1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
1HNZO 1IBKO 1HNWO 2UUBO 5A2QN 3F5TA 4DV6O 4DR3O 4DR5O 1YZBA 2UXBO 3R66A 4AQYO 4JI8O 4LFAO 4KHPO 1N33O 1X59A 4X66O 2UUCO 1F7YA 4OPAA 4DR1O 3O65A 4K0KO 3OTOO 1FKAO 4DV5O 5FLXN 4LF8O 1I94O 4A5UB 1J5EO 1DK1A 1IBMO 4NXNO 2LW7A 2HHHO 3M8AA 1IBLO 1N34O 4LFBO 4GKKO 2DOSA 2AGAA 1FJGO 4DR4O 4NXMO 5BR8O 5LMUO 4DV7O 1AILA 5H5NA 4LF5O 4B3RO 1XEQA 4LF7O 1NS1A 4B3SO 4X62O 2Z0AA 4OX9O 2VQFO 5LMNO 3J7AU 3SDLA 2N74A 2UUAO 4DV4O 1XMQO 4GKJO 4DV1O 1FYJA 4JI4O 4JI7O 4JI0O 4B3MO 2UU9O 4X64O 3T1HO 4JI2O 4YY3O 4JI1O 4JYAO 4JI5O 2VQEO 4LF6O 2UXDO 1HNXO 2ZKOA 5BXZA 3J81N 4LFCO 1XNRO 3T1YO 4LF9O 4LF4O 4DR6O 1R1BA 5IT9N 1KUQA 2UXCO 4X65O 1A32A 4B3TO 5BY1A 4DV3O 3RT3C 4YHHO 4DV2O 4DUZO 1XMOO 4DR2O 2DJVA 1N36O 1D2DA 2E5LO 1AB3A 1HR0O 2JRIA 3JAMN 2F4VO 4JI3O 2FKXA 1N32O 5LL6Y 1R6TA 4JV5O 1G1XB 4OPHA 3J80N 5IWAO 1XNQO 4JI6O 4DR7O 4DV0O 2ZM6O 4DUYO
chains in the Genus database with same CATH superfamily
1BHBA 3CCUV 3BEHA 5LP6B 1WA8B 1R6NA 2O57A 2ZNJA 4NR1A 1UFIA 2AXTZ 2WLMA 1H2SB 3ZJZA 3AK3A 4DR1O 3O65A 2KG7B 2BOCC 4G27B 1RFYA 4FPPA 3B8MA 3I5DA 4PDRA 5CN0A 4B08A 4U7NA 2AGAA 5E79Z 4EFEA 2GBOA 4DRXB 1M9NA 3G67A 2WLNA 2Y4TA 5GW7A 4EKWA 4PV1B 3A2FA 5LMNO 3H01A 4LF8B 4BIZA 1IDSA 1XHXA 4FK5C 3RFRA 3KZIZ 2QKAA 4JI0O 4UCUA 3W7SA 3LDEA 4DV2B 1S0VA 5BR8B 2DYRB 1OCZC 3K79A 4QPJA 4UCSA 4PDLA 5LOVA 2X7RB 3Q4HB 3ML0A 3RW0A 3T2MA 5IJ9B 2Q9LA 3E83A 3FB8C 3SJBC 1GMGA 3QO7A 4U3JA 1WPXA 1KKDA 5IT9N 4XDKA 2X6CA 1N8RW 1VF5B 3BHPA 5E1AC 1PL4A 1TUBA 1QNMA 3MAQA 4JTAB 1YVWA 1OV9A 1K92A 5B1OA 5LXTB 2B1IA 1HR0O 1QBZA 2JS3A 3SYOA 1G1XB 2YC0A 4O4JB 2BTOA 2LO1A 2XAJA 1YSCA 1SQFA 5EBWC 1KB9F 1HNWO 1Y67A 2QE7G 1US6A 5A2QN 3F5TA 1VQOV 1KYOF 3CC4V 3ABKC 1JCHA 5TISZ 2YXLA 1AI5A 3A0HZ 4ZHQA 3L73H 3U11A 1ZL8A 1O9GA 5IDJA 1KQSU 4QPKA 4NTWA 3EFFK 3ZHTA 1F23A 4A5UB 4MTOA 2HKOA 1KU9A 2ZR3A 1WA8A 1E1QG 2IJJA 4LFBO 4UCVA 2OCHA 2WAMA 4MVRA 5BR8O 3RVYA 1KMIZ 4JI1B 5H5NA 3ZHUA 4EFBA 5JCOA 1ZL8B 2QTSA 3U10A 3JSNA 4TQFA 1TUEB 3UM7A 4P9OA 3SPCA 1M56B 4JI7O 2QWNB 4TV9A 3W7XA 4X64O 4QE9A 2PTMA 2OTLV 4O4JA 2WLLA 3G80A 1SQQH 1HNWB 4Z1VA 4FM0A 3MD0A 3ETGA 4I5SA 5L3FA 4B7EA 3CCMV 2Q73A 3E35A 3B8NA 1Z2GA 4JI7B 2EINC 1FJGB 2IJHA 4MW8A 3RN4A 4X1YA 2UU9B 3JAWA 3JATB 3ETEA 3X2QC 4CBCA 4P9PA 2A9HA 4MTGA 5CA1B 1B6QA 3K08A 3Q4HA 1CPYA 4DR3B 4O4LB 3K3WA 3E8FA 3N27A 3J80N 5IWAO 4CZZA 4XDLA 1GO3F 1NH2B 1AP5A 1HWYA 1H2KA 1H2NA 1JFFA 2P6JA 1V54C 2C2AA 3FYIB 3K9AA 4GX1A 1K5SA 5CB4B 3OM3B 2QM4A 4ICGA 5LOVB 2FYUH 1BZKA 5FL7G 1KP3A 4DV5O 2ZR2A 4GLXA 2XOKG 2M6YA 5IYCO 2HVJC 2X6AA 3BVOA 1JPXA 1YXBA 1MZFA 2CTPA 1JX9A 3LNMB 3P30A 4IHJA 1XBLA 2DQ3A 4MS2A 2ZCEA 3OMAB 4TWKA 2UUBB 5GONA 3L72H 3UT5A 3N2GA 1L0NH 2HEPA 4LF9B 1I5XA 5DM6V 1P7BA 5EBLC 4AI8A 1KKCA 3CCEV 1XMQO 5L3CA 2Q7GA 1NH2D 1SESA 4L87A 4LWSB 1AJPA 1ZSPA 2A3QA 2UU9O 1SKVA 3E86A 2A79B 4JI1O 1BT8A 4YIOA 1Q81W 5EYPA 2GTSA 1OJHA 1OCRB 4MVZA 4LF4O 3VBBA 4AHCA 1XMQB 5BMVB 4WBNA 1EZJA 4LNUA 1RPRA 4JI3B 1MABG 4J7JA 2VRZA 4TUYA 4F6RB 1VF7A 4JZGA 3CSXA 2EIJC 3HKBA 1VIBA 1LNQA 4DUZO 4E2LA 4JI2B 2JJ2G 2JGUA 1AB3A 1R3IC 5D5PA 4DUZB 3ZN0A 1Q7YW 4YY3B 4CC6A 2EBOA 1NTMH 2IH3C 3K5LA 1TGOA 1PV0A 4JI4B 4U3JB 3HKCB 4QJFB 2UXBB 3RYHA 2YI9A 1UJWB 5HFMA 2KQXA 2WLLB 1H8EG 2QM7A 2Q7EA 1F7YA 3CCSV 1P49A 4H33A 3D3IA 5JWPA 1ZX3A 3KCYA 1Q8IA 3OTOO 2F1MA 1WNSA 2LFRA 3JSLA 2K1EA 1FJGO 3LDDA 2R9RB 5K1PA 4JAVA 3SYQA 1Q43A 4DK1A 1Q86W 3A0BZ 1N34B 3CC2V 4I0XB 2UXNA 1M90W 3J7AU 3SDLA 4DV5B 4TV9B 2WA4A 5C93A 3IC7A 1SC5B 1M56C 2AHZA 1UPGA 4NTYA 4QIWF 2XUMA 3T1HO 4JI2O 3LUTB 4NXNB 2CTQA 4PDVA 3FB7C 5KHKA 4LFCO 3J81N 4F4LA 2JVDA 3T1YO 2JGDB 4OX9B 4J10A 3CCQV 1OZ0A 1EN5A 1KECA 2QTOA 3D36A 4YIPA 2Q69A 2IBZH 1NKDA 4YHHO 4YJ3B 3GB7C 4H37A 3CYOA 4I4TB 1LUWA 1M57C 2JRIA 1K7DA 3ZMZA 4CH6A 2DYSC 1E1RG 2ZD9A 4ABMA 4GKKB 2XASA 3S3XA 1AVMA 4JF3A 1M5IA 1S5JA 3ABKB 1HNZO 3NR7A 3HKEB 1BQ0A 3CS5A 1GTOA 1FD9A 4JI8O 3ZX6A 1JVMA 1W59A 2QM8A 2GSMB 5LGTA 5FNVB 4FLWA 1NI8A 1MG1A 3ZRWA 2Q8VA 1G6UA 4UB8Z 3LSQA 4NVPA 2Q4PA 2QEXV 4JV5B 3TXQA 4DYLA 4FFBB 2Z5UA 5L3DA 1I94B 1SQVH 4O4LA 5LP6C 1K33A 3FAVA 2DOSA 3ZCCA 5L3EA 5CA0B 4DV7O 4I7ZB 2EIKC 1WPBA 2OIEA 3KKYA 4JZ2A 3EXAA 1BMFG 4LNUB 2QWQB 1NU1H 4YHHB 2EJRA 2Z0AA 3PJSK 3RYFB 3C3SA 4WFBV 4DR4B 5IJ0A 3DC5A 4QNHB 2W0XA 3JAKA 2LJ2A 3LDCA 4LF5B 2JDIG 2Y48A 3WG7B 4BIOA 3T1YB 4TSFG 1OCCC 4PA6A 1FS0G 1L8DA 1AI6A 3UCSC 4IT5A 3SPHA 4FZ1A 4FLTA 4U7OA 1XNRO 4B3SB 2HR3A 2CGNA 2JGDA 3QVNA 1VF6C 4GKJB 2CE4A 5H6QA 2XTAA 2UXCO 1FFTB 1Z5WA 4B3TO 3H1KH 2LP7A 4NKGB 4P30A 4WCEV 1K3EA 5IY5B 2KSDA 2FB5A 2OCCB 3IFXA 1FXKC 3CP1A 2LGWA 2VQFB 2YI8A 5CBGA 1XMOB 2RQ6A 1GH6A 2Q7HA 5B1BB 3JARA 5IWAB 5JH7B 5CMUA 2F66C 1IBKO 2R9AA 2Q68A 2CH7A 4LFAB 1D5NA 1G4YB 4FIPC 4FJCC 5KHIA 1ZLZA 3W7UA 2OYQA 1AI7A 4UVCA 3RYFA 1Y66A 2QJ1A 4FFKA 4ZOLA 4GZRB 1DF4A 1NBMG 1D5AA 2DYRC 4BR6A 2PGGA 4RQEA 5AG2A 1SA0B 3H9VA 2R9IA 4NXNO 4X89A 1IBLO 4Z2WA 3ABLC 1YCIA 1S72V 1SQBH 3SYPA 5IYZB 2QWOB 2ZIOA 5B1AB 1XOUA 1QLNA 4ZOLB 1MMMA 3VQWA 2BSKB 3AG3B 1GK9A 5JQGB 4J9ZB 2ITDC 2YEVA 3T4ZA 1MSWD 4TUYB 4F6RA 1BCCH 4PHZA 2Y69C 3B2EE 3HKCA 1TA8A 4DR2B 2CUGA 3DXRB 1MSDA 1Q90D 1RP3B 2VQEO 4JI5O 2YSUB 2DMXA 3L70H 1SZTA 3OEHG 3SJQC 3ZMTA 1GM9A 1AROP 3X2QB 1EZVH 5DEDA 5LHGA 1NVPB 3I55V 5KMGB 1YJ9V 3AG2C 1IBKB 3D36C 3H1JH 3RYIA 3CD6V 3QNEA 4QGPA 3SPIA 2WLHA 4DR2O 2ZE6A 5CA3A 2CAZC 4HNAB 1F4MA 3E22A 3E22B 3JASA 1W0JG 4MW3A 2NNUA 1IVSA 5KHHA 4J41A 4KL1A 1HW7A 1VARA 2WLJA 3TK1A 2RNBA 2UXCB 4CH3A 4DV6O 1SQGA 1R3KC 3APOA 1AR5A 3OMNB 1S77D 1ORQC 5EC1C 4K0KO 1OCOC 3G4SV 5D5QA 1M93A 2QR4A 3MHHC 5KHJA 3ABLB 4X8AA 3CRQA 1VQNV 4NYKA 4TOIA 2BTQA 4FVMA 1JFFB 3QTCA 3BA8A 1GN4A 1CXZB 3CWBH 3K5OA 3BFRA 2HLDG 3LNNA 3HR0A 4D7SA 4O2BA 2N74A 1TVKB 2RDCA 3BAAA 3JAWB 4PA7A 2YEVB 3EHBB 1NR1A 3DSQA 1THZA 1XQ8A 2JK5C 2AZ2A 4CH5A 4ZBMA 2QDOA 1XNQB 3K9SA 1COWG 2F93B 1HNXO 4JASA 3CHXA 5EYPB 3D3QA 5GTHZ 2OCCC 2IJIA 4PA4A 5GTIZ 1EM1A 1SQPH 4RUFA 4EB6A 4BW9A 3RYCB 3HKEA 2YIBA 2ZE7A 2GTAA 1Y74B 5C8YB 4J42A 2ZIMA 3SJAC 3OR6C 1N36O 3TXSA 2WPDG 1BHAA 4LH6A 3STLC 3CC7V 1N32O 4D6TH 2GV9A 1AR1B 4FM1A 3FB5C 5KUKA 4JAUA 3N2KB 1BSMA 4LWSA 4YXWG 2V4DA 4X20B 2G38A 1NJIW 1N33O 5DN6G 4WFFA 3CRMA 2UUCO 3LSUA 4DUYB 1XL4A 2P4VA 1VEWA 2XNDG 2ADQB 1OHHG 2B9ZA 5ITZA 5KMGA 1SF9A 1BE3H 2EINB 2QWRB 1Y4MA 1SQXH 2H8PC 3P3NA 1N33B 5B1BC 3DXRA 5LMUO 3T4DA 3APQA 4LP8A 2AW9A 4N21A 2GUZB 1S76D 2HVKC 5A9GA 2LGQA 1ZTEA 2MK3A 2P06A 2BE3A 4LF7O 3CMAV 4DR7B 5IY5C 4PELA 2ZQMA 4O2BB 4UFZA 4DV4O 4BW5A 5LGUA 1P84F 4JI4O 2EZOA 4LFCB 1PPJH 1RM1B 4GX5A 4JYAO 3U0ZA 4HYOA 2ETNA 1P4RA 4JYCA 1K4DC 3AEIA 3BPZA 1KBHA 5FNVA 3ETDA 1OCZB 2VS0A 1NVPD 3ZIAG 2EULA 5L3BA 1K4CC 3AG1B 1A32A 4DO2A 1VQ4V 3AG1C 2ZDIA 4PDMA 2Q0AA 3C90A 3JCZA 3K58A 5FPRA 2XAFA 4I50A 2E5LO 1QU7A 5HFLA 5LYJB 1VF6A 3CRCA 4JI3O 4J7ZA 1R6TA 1EFRG 2ZDIC 5IJ9A 1AI4A 4GT1A 5JH7A 3ABTA 2ZM6O 3ASOB 3HKDA 2Z3YA 3M7MX 4DR3O 2ZT9B 3AG2B 4X1IB 2X0LA 4LFAO 1QVFU 1X59A 4WFAV 1AJQA 4J7KA 4X66O 5IYBO 4IIJB 3JCUZ 3TGUH 3N2GB 5B5EZ 5GONB 3JALA 4J80A 5KHGA 2RJZA 2X6BA 4DW1A 3ABUA 1RPOA 2KG7A 3WFVA 2M7WA 1QVGU 1IBMO 2HHHO 3KCXA 4DRXA 3H1IH 1FFXA 1ENVA 1AR4A 1VQKV 4IYIA 5EBMC 1NTKH 3CXHF 5LP6A 1K5QA 1HNZB 2UXDB 3UT5B 1GN2A 2DW4A 4FM2A 3G71V 4GYCB 5B1AC 2PYJA 4B3SO 4JI6B 4EB6B 4KFMA 5H9CA 2EILB 5KLVH 4GKJO 3UO2A 3OGIB 1Q6IA 1H2MA 4I0XA 3R65A 1PP9H 4FLVA 5EZYA 3A8TA 4DXWA 1BQZA 4O4HA 1WN7A 1W0KG 2PYLA 4RUEA 4LF7B 4NTXA 5KAFZ 4KHPB 3VQVA 3AK2A 4I55B 4UCOA 4F6EA 3ZBHA 2R72A 2IM9A 1XMOO 4MVOA 3K0GA 2OT5A 5FPOA 5LMUB 3I56V 3IC9A 3E8BA 5CA1A 4OGQB 3CJHA 4JV5O 2Q5ZA 5KX5B 3OR7C 3IAYA 3ZN1A 3IGAC 2NN4A 3UQ8A 2EJ7A 2UUBO 3IJ4A 3R66A 3HPLC 2IU0A 3P3PA 5JJJB 4CS4A 4JGSA 2EIMC 2YUAA 1IX9A 1S5HC 5JCOC 2PI5A 3K59A 1Y6XA 3L71H 4IIJA 3JARB 3ZS8C 2LFSA 1F51A 2ZXWC 2PI4A 1OCCB 2LW7A 4OXSA 3WG7C 5F2VO 4QE7A 3H1HH 1RSOA 1N32B 4HNAA 5LBQA 2LQTA 4NXMO 3BA9A 4LF5O 5EC2C 3RGBA 4TV8B 4TV8A 3UO3A 1HDJA 2V7QG 2Q6AA 1SERA 3T1HB 2R70A 1KD1W 2QGNA 2Q67A 1Z5VA 2E3CA 2E5LB 4KUMA 1FYJA 4EEQA 3SPJA 1V9PA 4GUNA 3P32A 2GDSA 1Q82W 5LA6A 2Y4UA 1YIJV 2MW2B 4HAMA 4UXNA 2UXDO 4GX2A 3RBZA 4WFGA 3CEIA 4HBNA 5BXZA 1E79G 1GN6A 2CDYA 5JQGA 3K5NA 3T1CA 1JA8A 2WLIA 3FX7A 2HHHB 1T5EA 3G6EV 1H2GA 4DV3O 3ASOC 1JR9A 4BWAA 1PNKA 2F43G 2DJVA 2HJFC 4IYHA 5J2UB 4WFHA 1D2DA 5LHHA 3FAVB 3E2EA 3ZRXA 4MVMA 1M57B 2ZE5A 2FKXA 1N0NA 5LL6Y 3OFNG 3BCCH 2GUZA 4UCRA 2XAGA 2ATKC 5BMVA 1QHTA 1VQPV 4NB5A 2W6IG 2DE0X 1YZBA 2UXBO 2DQ0A 2UXXA 1MNGA 5KUMA 2A0LA 3AG3C 3JD0A 1YEWA 2Y0IA 4KP4A 4C7UA 1IXMA 1XREA 4MVQA 4CS2A 1FKAO 5J2TA 2W6JG 4LF8O 3C3TA 3ASNC 1J95A 2EIJB 5JVDA 3THOA 4WBNB 1N34O 3WB0A 1ZUQA 2CTWA 3KG2A 2QA4V 5LMNB 2PY5A 2JEXA 3TETA 2D2CB 4L8JA 1U96A 4KXRA 5ITZB 5IE9A 3TJTA 4JTDB 4I9WA 2VWKA 3SJCC 5LGNA 2A7WA 5CBHA 3F5WC 4R7CA 3JD2A 1R73A 1M1KW 4B3MO 3GWKC 1R6KA 5EK0A 2B1GA 3SR2C 4DV1B 5B1NA 1V55B 1YHQV 3SYAA 1B04A 4IHJB 1G8MA 4W4LA 2HFEC 3ICXA 3VOUA 5IJ0B 5B66Z 1MOFA 3OD4A 2QWPB 4UV8A 1XDCA 3FYEB 4X65O 4DW0A 3HKDB 2GHYA 4MT8A 1XNRB 3PN1A 4K8ZA 1QLEC 1VQLV 3CJHB 4UVAA 4XDJA 1OCOB 3UKMA 2N05A 2PF4E 2P90A 3STZC 5LXTA 1P7GA 1PNMA 4IL6Z 4R6ZA 3O9OA 1YJNV 1ZWIC 4ZKIA 1QLEB 1Y76B 1J5EB 1NQTA 1NZ6A 1I0HA 3B09A 2EILC 4PA3A 3JD3A 2P22C 4O4IA 1JJ2U 1KP2A 3HB3B 4O4IB 4UVBA 5J2UA 3CRAA 2QKCA 1I7FA 4FZ0A 4LH7A 2L35A 1ZAUA 4G28B 4LR3A 4LF4B 1YITV 1R3LC 2LW1A 1I94O 3RVZA 4PI0A 4ZI7A 1DTOA 3ZHVA 2E75B 1F4NA 1QR9A 4PI2A 4I4TA 2Q0OC 1VQ8V 2ILMA 3HKBB 2ZNIA 2DWEC 2F4VB 1GAXA 2ZE8A 1W2BU 3GWOA 4LCUC 4PA9A 2UUAO 1DGSA 2Y69B 1IZ3A 1PKXA 2ADPA 5KA6A 1CEZA 3CRRA 3WB2A 4JYBA 4AILC 4X88A 3RYIB 4J9YB 5JJEB 1SZXA 3L74H 3TCUA 1L0LH 3SYCA 2H94A 3JASB 3ZRVA 2YXYA 4TQDA 1N4CA 1O9HA 4O2AB 4NXMB 1H8HG 1NTZH 3WB1A 3FB6C 1S3JA 1YJWV 3CXCU 1WB7A 1HP8A 4DV2O 2YICA 2ZINA 4X66B 3B40A 4H0LB 4DV7B 3E89A 3OT7A 2E76B 3JAMN 2AZ0A 4DV6B 3QF7A 4FLYA 4OPHA 5K1XA 3OUSA 1VQ7V 3G6BA 1XNQO 4UV9A 4N23A 5C8YA 4D7TA 5KX5A 3S3WA 4CC5A 4CH4A 5CA0A 4B7KA 1HNXB 2CGOA 4DR5O 4UUJC 5EIBD 4AQYO 2QSAA 2WLKA 4PD4F 2ODMA 1WB8A 2XHBA 1Q5OA 1FAFA 1R3JC 3FKSG 4OPAA 1NT2B 4I50B 1HR0B 3OUFA 4Z1MG 3K57A 4I55A 2D3OW 1IXBA 1Y76A 3FFQA 3K03A 1XUQA 4I9QA 3W7TA 3M8AA 1BS3A 2CH7B 5DECA 4DR5B 4GKKO 3OTOB 4O4HB 3B77A 1XI1A 1JQ0A 2K9PA 1AILA 1N36B 2DYSB 4RAIA 1BL8A 1QCEA 4X62O 3CMEV 2VQFO 1Q6HA 2XAHA 3CCVV 5BZBA 2BTQB 3CB2A 2ZXWB 1PL0A 1WLEA 3L75H 5LA6B 3CX5F 1DLBA 1EN6A 2XAQA 1FXKA 2ZKOA 4K3AA 3JD4A 2EIKB 1EBOA 1VMGA 1JOYA 3FD9A 1M4UA 1K73W 3AK1A 1KUQA 1SETA 1IURA 4AQYB 1GM8A 2YDEA 2YIDA 3MHSC 4FLXA 1V55C 1FXKB 2IU3A 4O2AA 2YS8A 5KA5A 2KKWA 4DV4B 4TT3G 3CCLV 3ZHQA 4JTCB 1B06A 3B4SA 3RWRD 3JAKB 1YF2A 4KHPO 3ZEDA 3CCJV 4R8CA 1VQMV 1JJOA 1MA1A 3ZHRA 3AG4B 4DV3B 5LHIA 3EVKA 5FLXN 2P7TC 4J11A 2WSSG 1KC8W 1J5EO 2ZM6B 2IW5A 4LBEC 2EZPA 1TVKA 4DR6B 3CPWU 2HP8A 4DV0B 2E74B 2WA3A 2UUCB 4FFBA 5B3SB 4B3RO 1PNLA 4BAYA 1I5YA 3A0RA 2PUSA 3BY6A 3K04A 2FMLA 2WLIB 3NXSA 5JJNB 1NS1A 5IYZA 2F95B 1BGYH 1I08A 2JJ1G 2BOBC 4ASUG 1V54B 2ARHA 1EN4A 3E8HA 1S5LZ 3QG5A 4P2ZA 1CP9A 4YJ2B 3RYHB 1SA0A 3JATA 4GCZA 4X1YB 2OTJV 3K0DA 1OCRC 2DN9A 3WU2Z 4MVUA 2KB1A 1VQ6V 2CK3G 3H1LH 3M99B 4LF9O 2QKSA 4X62B 3OE7G 2AHYA 3OGCC 3OEEG 4ZIBA 1WAZA 1R1BA 4DK0A 4K0KB 4K8XA 1GM7A 3ABMB 4WFEA 3W7WA 2Y0PA 4Q20A 4RO2A 2NLJC 2DWDC 3SGIA 1WJZA 4IGGA 3JD1A 1QR8A 4JAAA 3ZMSA 4JI6O 4DV0O 4WF9V 4DUYO 2RCVA 4K35A 1Q6UA 1QQCA 1DF5A 5LYJA 2EX3A 4JPRA 4E4EA 3ASNB 2RMKB 1SS3A 5JVDB 5IYDO 1ROPA 2IH1C 1YDXA 5KAIZ 1TAEA 1WP7A 1RM1C 4FLUA 4YJ2A 1L1FA 1N0JA 3JYCA 3RYCA 4JYAB 4LFBB 5CB4A 3MDSA 1Q3EA 4ZI7B 4PJ0Z 3F7VC 4B3MB 2NR5A 4DR4O 3F7YC 1JMKC 3QO5A 1VP7A 1GKFA 2HG5C 4H44B 3ZMUA 3QO8A 5CBFA 3ZRSA 1FXHA 2OWOA 1XILA 2HJDA 4W4KA 1LR1A 4OX9O 4H13B 3K06A 2FTKA 3DGEA 2B5UA 4U3FH 1YTFD 4FMTA 1XHZA 3GVMA 1NR7A 2H3OA 5EZYB 2CTRA 4X64B 1U97A 2P67A 3BRCA 4Q6GA 2BSKA 2F23A 4GX0A 3VQYA 4B3TB 5J9PC 4LC1A 4JI8B 1MZEA 1AP6A 4JI5B 4LF6B 5BY1A 2FL4A 3RT3C 4JYYA 5H6RA 3DTUB 4G2KA 4BIUA 1FFXB 4R50A 2YXHA 3E8GA 1YTFB 5B3SC 3N2KA 3ETQA 3DC6A 4DR7O 4X9QA 4B3RB 1H2LA 4JI0B 2ITCC 3D8CA 1RSOB 3OMIB 5EIBC 4MTFA 3L9DA 1X4TA 1URFA 2JS5A 2IJKA 4X1IA 1IBLB 4X20A 5L3GA 1Y74A 3K5MA 1H38A 1GRJA 1FXVA 3SPGA 1XL6A 4XBFA 2P5OA 3ZMVA 1K8AW 3ABMC 1IBMB 3JALB 1DK1A 3OAAG 1VQ9V 5H2FZ 3CE2A 2A06H 1YI2V 2XT9A 1FPOA 3CCRV 4MTXA 5J2TB 3OW2U 1XEQA 3OTFA 1K97A 4UB6Z 1B3QA 4ZHQB 2VQEB 4DV1O 1LUVA 1TUBB 2P4KA 2VWJA 2PZSA 2BCCH 4RWUA 3BABA 4YY3O 1GN3A 4X1KA 4MVSA 4LF6O 3ZRWB 1VQ5V 4DR6O 2WWWA 2N04A 3LSSA 2W0FC 4CS3A 4UCTA 3ZHSA 2JEUA 4X1KB 4FLZA 2YIBD 2RN9A 3VQXA 1PD3A 1PM9A 1WP8A 4MSWC 1K34A 2YIAA 4HZ3A 4RQFA 2F4VO 3AG4C 4X65B 2EIMB 2V1DA 1SRYA 1K9MW 2L6LA 2UUAB 3AG7A 1AJNA 4YJ3A 4DR1B 2OIGA 2JIZG
chains in the Genus database with same CATH topology
1HNZO 1IBKO 1HNWO 2UUBO 5A2QN 3F5TA 4DV6O 4DR3O 4DR5O 1YZBA 2UXBO 3R66A 4AQYO 4JI8O 4LFAO 4KHPO 1N33O 1X59A 4X66O 2UUCO 1F7YA 4OPAA 4DR1O 3O65A 4K0KO 3OTOO 1FKAO 4DV5O 5FLXN 4LF8O 1I94O 4A5UB 1J5EO 1DK1A 1IBMO 4NXNO 2LW7A 2HHHO 3M8AA 1IBLO 1N34O 4LFBO 4GKKO 2DOSA 2AGAA 1FJGO 4DR4O 4NXMO 5BR8O 5LMUO 4DV7O 1AILA 5H5NA 4LF5O 4B3RO 1XEQA 4LF7O 1NS1A 4B3SO 4X62O 2Z0AA 4OX9O 2VQFO 5LMNO 3J7AU 3SDLA 2N74A 2UUAO 4DV4O 1XMQO 4GKJO 4DV1O 1FYJA 4JI4O 4JI7O 4JI0O 4B3MO 2UU9O 4X64O 3T1HO 4JI2O 4YY3O 4JI1O 4JYAO 4JI5O 2VQEO 4LF6O 2UXDO 1HNXO 2ZKOA 5BXZA 3J81N 4LFCO 1XNRO 3T1YO 4LF9O 4LF4O 4DR6O 1R1BA 5IT9N 1KUQA 2UXCO 4X65O 1A32A 4B3TO 5BY1A 4DV3O 3RT3C 4YHHO 4DV2O 4DUZO 1XMOO 4DR2O 2DJVA 1N36O 1D2DA 2E5LO 1AB3A 1HR0O 2JRIA 3JAMN 2F4VO 4JI3O 2FKXA 1N32O 5LL6Y 1R6TA 4JV5O 1G1XB 4OPHA 3J80N 5IWAO 1XNQO 4JI6O 4DR7O 4DV0O 2ZM6O 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ O;  1IBK O;  1HNW O;  2UUB O;  5A2Q N;  3F5T A;  4DV6 O;  4DR3 O;  4DR5 O;  1YZB A;  2UXB O;  3R66 A;  4AQY O;  4JI8 O;  4LFA O;  4KHP O;  1N33 O;  1X59 A;  4X66 O;  2UUC O;  1F7Y A;  4OPA A;  4DR1 O;  3O65 A;  4K0K O;  3OTO O;  1FKA O;  4DV5 O;  5FLX N;  4LF8 O;  1I94 O;  4A5U B;  1J5E O;  1DK1 A;  1IBM O;  4NXN O;  2LW7 A;  2HHH O;  3M8A A;  1IBL O;  1N34 O;  4LFB O;  4GKK O;  2DOS A;  2AGA A;  1FJG O;  4DR4 O;  4NXM O;  5BR8 O;  5LMU O;  4DV7 O;  1AIL A;  5H5N A;  4LF5 O;  4B3R O;  1XEQ A;  4LF7 O;  1NS1 A;  4B3S O;  4X62 O;  2Z0A A;  4OX9 O;  2VQF O;  5LMN O;  3J7A U;  3SDL A;  2N74 A;  2UUA O;  4DV4 O;  1XMQ O;  4GKJ O;  4DV1 O;  1FYJ A;  4JI4 O;  4JI7 O;  4JI0 O;  4B3M O;  2UU9 O;  4X64 O;  3T1H O;  4JI2 O;  4YY3 O;  4JI1 O;  4JYA O;  4JI5 O;  2VQE O;  4LF6 O;  2UXD O;  1HNX O;  2ZKO A;  5BXZ A;  3J81 N;  4LFC O;  1XNR O;  3T1Y O;  4LF9 O;  4LF4 O;  4DR6 O;  1R1B A;  5IT9 N;  1KUQ A;  2UXC O;  4X65 O;  1A32 A;  4B3T O;  5BY1 A;  4DV3 O;  3RT3 C;  4YHH O;  4DV2 O;  4DUZ O;  1XMO O;  4DR2 O;  2DJV A;  1N36 O;  1D2D A;  2E5L O;  1AB3 A;  1HR0 O;  2JRI A;  3JAM N;  2F4V O;  4JI3 O;  2FKX A;  1N32 O;  5LL6 Y;  1R6T A;  4JV5 O;  1G1X B;  4OPH A;  3J80 N;  5IWA O;  1XNQ O;  4JI6 O;  4DR7 O;  4DV0 O;  2ZM6 O;  4DUY O; 
#chains in the Genus database with same CATH topology
 1BHB A;  3CCU V;  3BEH A;  5LP6 B;  1WA8 B;  1R6N A;  2O57 A;  2ZNJ A;  4NR1 A;  1UFI A;  2AXT Z;  2WLM A;  1H2S B;  3ZJZ A;  3AK3 A;  4DR1 O;  3O65 A;  2KG7 B;  2BOC C;  4G27 B;  1RFY A;  4FPP A;  3B8M A;  3I5D A;  4PDR A;  5CN0 A;  4B08 A;  4U7N A;  2AGA A;  5E79 Z;  4EFE A;  2GBO A;  4DRX B;  1M9N A;  3G67 A;  2WLN A;  2Y4T A;  5GW7 A;  4EKW A;  4PV1 B;  3A2F A;  5LMN O;  3H01 A;  4LF8 B;  4BIZ A;  1IDS A;  1XHX A;  4FK5 C;  3RFR A;  3KZI Z;  2QKA A;  4JI0 O;  4UCU A;  3W7S A;  3LDE A;  4DV2 B;  1S0V A;  5BR8 B;  2DYR B;  1OCZ C;  3K79 A;  4QPJ A;  4UCS A;  4PDL A;  5LOV A;  2X7R B;  3Q4H B;  3ML0 A;  3RW0 A;  3T2M A;  5IJ9 B;  2Q9L A;  3E83 A;  3FB8 C;  3SJB C;  1GMG A;  3QO7 A;  4U3J A;  1WPX A;  1KKD A;  5IT9 N;  4XDK A;  2X6C A;  1N8R W;  1VF5 B;  3BHP A;  5E1A C;  1PL4 A;  1TUB A;  1QNM A;  3MAQ A;  4JTA B;  1YVW A;  1OV9 A;  1K92 A;  5B1O A;  5LXT B;  2B1I A;  1HR0 O;  1QBZ A;  2JS3 A;  3SYO A;  1G1X B;  2YC0 A;  4O4J B;  2BTO A;  2LO1 A;  2XAJ A;  1YSC A;  1SQF A;  5EBW C;  1KB9 F;  1HNW O;  1Y67 A;  2QE7 G;  1US6 A;  5A2Q N;  3F5T A;  1VQO V;  1KYO F;  3CC4 V;  3ABK C;  1JCH A;  5TIS Z;  2YXL A;  1AI5 A;  3A0H Z;  4ZHQ A;  3L73 H;  3U11 A;  1ZL8 A;  1O9G A;  5IDJ A;  1KQS U;  4QPK A;  4NTW A;  3EFF K;  3ZHT A;  1F23 A;  4A5U B;  4MTO A;  2HKO A;  1KU9 A;  2ZR3 A;  1WA8 A;  1E1Q G;  2IJJ A;  4LFB O;  4UCV A;  2OCH A;  2WAM A;  4MVR A;  5BR8 O;  3RVY A;  1KMI Z;  4JI1 B;  5H5N A;  3ZHU A;  4EFB A;  5JCO A;  1ZL8 B;  2QTS A;  3U10 A;  3JSN A;  4TQF A;  1TUE B;  3UM7 A;  4P9O A;  3SPC A;  1M56 B;  4JI7 O;  2QWN B;  4TV9 A;  3W7X A;  4X64 O;  4QE9 A;  2PTM A;  2OTL V;  4O4J A;  2WLL A;  3G80 A;  1SQQ H;  1HNW B;  4Z1V A;  4FM0 A;  3MD0 A;  3ETG A;  4I5S A;  5L3F A;  4B7E A;  3CCM V;  2Q73 A;  3E35 A;  3B8N A;  1Z2G A;  4JI7 B;  2EIN C;  1FJG B;  2IJH A;  4MW8 A;  3RN4 A;  4X1Y A;  2UU9 B;  3JAW A;  3JAT B;  3ETE A;  3X2Q C;  4CBC A;  4P9P A;  2A9H A;  4MTG A;  5CA1 B;  1B6Q A;  3K08 A;  3Q4H A;  1CPY A;  4DR3 B;  4O4L B;  3K3W A;  3E8F A;  3N27 A;  3J80 N;  5IWA O;  4CZZ A;  4XDL A;  1GO3 F;  1NH2 B;  1AP5 A;  1HWY A;  1H2K A;  1H2N A;  1JFF A;  2P6J A;  1V54 C;  2C2A A;  3FYI B;  3K9A A;  4GX1 A;  1K5S A;  5CB4 B;  3OM3 B;  2QM4 A;  4ICG A;  5LOV B;  2FYU H;  1BZK A;  5FL7 G;  1KP3 A;  4DV5 O;  2ZR2 A;  4GLX A;  2XOK G;  2M6Y A;  5IYC O;  2HVJ C;  2X6A A;  3BVO A;  1JPX A;  1YXB A;  1MZF A;  2CTP A;  1JX9 A;  3LNM B;  3P30 A;  4IHJ A;  1XBL A;  2DQ3 A;  4MS2 A;  2ZCE A;  3OMA B;  4TWK A;  2UUB B;  5GON A;  3L72 H;  3UT5 A;  3N2G A;  1L0N H;  2HEP A;  4LF9 B;  1I5X A;  5DM6 V;  1P7B A;  5EBL C;  4AI8 A;  1KKC A;  3CCE V;  1XMQ O;  5L3C A;  2Q7G A;  1NH2 D;  1SES A;  4L87 A;  4LWS B;  1AJP A;  1ZSP A;  2A3Q A;  2UU9 O;  1SKV A;  3E86 A;  2A79 B;  4JI1 O;  1BT8 A;  4YIO A;  1Q81 W;  5EYP A;  2GTS A;  1OJH A;  1OCR B;  4MVZ A;  4LF4 O;  3VBB A;  4AHC A;  1XMQ B;  5BMV B;  4WBN A;  1EZJ A;  4LNU A;  1RPR A;  4JI3 B;  1MAB G;  4J7J A;  2VRZ A;  4TUY A;  4F6R B;  1VF7 A;  4JZG A;  3CSX A;  2EIJ C;  3HKB A;  1VIB A;  1LNQ A;  4DUZ O;  4E2L A;  4JI2 B;  2JJ2 G;  2JGU A;  1AB3 A;  1R3I C;  5D5P A;  4DUZ B;  3ZN0 A;  1Q7Y W;  4YY3 B;  4CC6 A;  2EBO A;  1NTM H;  2IH3 C;  3K5L A;  1TGO A;  1PV0 A;  4JI4 B;  4U3J B;  3HKC B;  4QJF B;  2UXB B;  3RYH A;  2YI9 A;  1UJW B;  5HFM A;  2KQX A;  2WLL B;  1H8E G;  2QM7 A;  2Q7E A;  1F7Y A;  3CCS V;  1P49 A;  4H33 A;  3D3I A;  5JWP A;  1ZX3 A;  3KCY A;  1Q8I A;  3OTO O;  2F1M A;  1WNS A;  2LFR A;  3JSL A;  2K1E A;  1FJG O;  3LDD A;  2R9R B;  5K1P A;  4JAV A;  3SYQ A;  1Q43 A;  4DK1 A;  1Q86 W;  3A0B Z;  1N34 B;  3CC2 V;  4I0X B;  2UXN A;  1M90 W;  3J7A U;  3SDL A;  4DV5 B;  4TV9 B;  2WA4 A;  5C93 A;  3IC7 A;  1SC5 B;  1M56 C;  2AHZ A;  1UPG A;  4NTY A;  4QIW F;  2XUM A;  3T1H O;  4JI2 O;  3LUT B;  4NXN B;  2CTQ A;  4PDV A;  3FB7 C;  5KHK A;  4LFC O;  3J81 N;  4F4L A;  2JVD A;  3T1Y O;  2JGD B;  4OX9 B;  4J10 A;  3CCQ V;  1OZ0 A;  1EN5 A;  1KEC A;  2QTO A;  3D36 A;  4YIP A;  2Q69 A;  2IBZ H;  1NKD A;  4YHH O;  4YJ3 B;  3GB7 C;  4H37 A;  3CYO A;  4I4T B;  1LUW A;  1M57 C;  2JRI A;  1K7D A;  3ZMZ A;  4CH6 A;  2DYS C;  1E1R G;  2ZD9 A;  4ABM A;  4GKK B;  2XAS A;  3S3X A;  1AVM A;  4JF3 A;  1M5I A;  1S5J A;  3ABK B;  1HNZ O;  3NR7 A;  3HKE B;  1BQ0 A;  3CS5 A;  1GTO A;  1FD9 A;  4JI8 O;  3ZX6 A;  1JVM A;  1W59 A;  2QM8 A;  2GSM B;  5LGT A;  5FNV B;  4FLW A;  1NI8 A;  1MG1 A;  3ZRW A;  2Q8V A;  1G6U A;  4UB8 Z;  3LSQ A;  4NVP A;  2Q4P A;  2QEX V;  4JV5 B;  3TXQ A;  4DYL A;  4FFB B;  2Z5U A;  5L3D A;  1I94 B;  1SQV H;  4O4L A;  5LP6 C;  1K33 A;  3FAV A;  2DOS A;  3ZCC A;  5L3E A;  5CA0 B;  4DV7 O;  4I7Z B;  2EIK C;  1WPB A;  2OIE A;  3KKY A;  4JZ2 A;  3EXA A;  1BMF G;  4LNU B;  2QWQ B;  1NU1 H;  4YHH B;  2EJR A;  2Z0A A;  3PJS K;  3RYF B;  3C3S A;  4WFB V;  4DR4 B;  5IJ0 A;  3DC5 A;  4QNH B;  2W0X A;  3JAK A;  2LJ2 A;  3LDC A;  4LF5 B;  2JDI G;  2Y48 A;  3WG7 B;  4BIO A;  3T1Y B;  4TSF G;  1OCC C;  4PA6 A;  1FS0 G;  1L8D A;  1AI6 A;  3UCS C;  4IT5 A;  3SPH A;  4FZ1 A;  4FLT A;  4U7O A;  1XNR O;  4B3S B;  2HR3 A;  2CGN A;  2JGD A;  3QVN A;  1VF6 C;  4GKJ B;  2CE4 A;  5H6Q A;  2XTA A;  2UXC O;  1FFT B;  1Z5W A;  4B3T O;  3H1K H;  2LP7 A;  4NKG B;  4P30 A;  4WCE V;  1K3E A;  5IY5 B;  2KSD A;  2FB5 A;  2OCC B;  3IFX A;  1FXK C;  3CP1 A;  2LGW A;  2VQF B;  2YI8 A;  5CBG A;  1XMO B;  2RQ6 A;  1GH6 A;  2Q7H A;  5B1B B;  3JAR A;  5IWA B;  5JH7 B;  5CMU A;  2F66 C;  1IBK O;  2R9A A;  2Q68 A;  2CH7 A;  4LFA B;  1D5N A;  1G4Y B;  4FIP C;  4FJC C;  5KHI A;  1ZLZ A;  3W7U A;  2OYQ A;  1AI7 A;  4UVC A;  3RYF A;  1Y66 A;  2QJ1 A;  4FFK A;  4ZOL A;  4GZR B;  1DF4 A;  1NBM G;  1D5A A;  2DYR C;  4BR6 A;  2PGG A;  4RQE A;  5AG2 A;  1SA0 B;  3H9V A;  2R9I A;  4NXN O;  4X89 A;  1IBL O;  4Z2W A;  3ABL C;  1YCI A;  1S72 V;  1SQB H;  3SYP A;  5IYZ B;  2QWO B;  2ZIO A;  5B1A B;  1XOU A;  1QLN A;  4ZOL B;  1MMM A;  3VQW A;  2BSK B;  3AG3 B;  1GK9 A;  5JQG B;  4J9Z B;  2ITD C;  2YEV A;  3T4Z A;  1MSW D;  4TUY B;  4F6R A;  1BCC H;  4PHZ A;  2Y69 C;  3B2E E;  3HKC A;  1TA8 A;  4DR2 B;  2CUG A;  3DXR B;  1MSD A;  1Q90 D;  1RP3 B;  2VQE O;  4JI5 O;  2YSU B;  2DMX A;  3L70 H;  1SZT A;  3OEH G;  3SJQ C;  3ZMT A;  1GM9 A;  1ARO P;  3X2Q B;  1EZV H;  5DED A;  5LHG A;  1NVP B;  3I55 V;  5KMG B;  1YJ9 V;  3AG2 C;  1IBK B;  3D36 C;  3H1J H;  3RYI A;  3CD6 V;  3QNE A;  4QGP A;  3SPI A;  2WLH A;  4DR2 O;  2ZE6 A;  5CA3 A;  2CAZ C;  4HNA B;  1F4M A;  3E22 A;  3E22 B;  3JAS A;  1W0J G;  4MW3 A;  2NNU A;  1IVS A;  5KHH A;  4J41 A;  4KL1 A;  1HW7 A;  1VAR A;  2WLJ A;  3TK1 A;  2RNB A;  2UXC B;  4CH3 A;  4DV6 O;  1SQG A;  1R3K C;  3APO A;  1AR5 A;  3OMN B;  1S77 D;  1ORQ C;  5EC1 C;  4K0K O;  1OCO C;  3G4S V;  5D5Q A;  1M93 A;  2QR4 A;  3MHH C;  5KHJ A;  3ABL B;  4X8A A;  3CRQ A;  1VQN V;  4NYK A;  4TOI A;  2BTQ A;  4FVM A;  1JFF B;  3QTC A;  3BA8 A;  1GN4 A;  1CXZ B;  3CWB H;  3K5O A;  3BFR A;  2HLD G;  3LNN A;  3HR0 A;  4D7S A;  4O2B A;  2N74 A;  1TVK B;  2RDC A;  3BAA A;  3JAW B;  4PA7 A;  2YEV B;  3EHB B;  1NR1 A;  3DSQ A;  1THZ A;  1XQ8 A;  2JK5 C;  2AZ2 A;  4CH5 A;  4ZBM A;  2QDO A;  1XNQ B;  3K9S A;  1COW G;  2F93 B;  1HNX O;  4JAS A;  3CHX A;  5EYP B;  3D3Q A;  5GTH Z;  2OCC C;  2IJI A;  4PA4 A;  5GTI Z;  1EM1 A;  1SQP H;  4RUF A;  4EB6 A;  4BW9 A;  3RYC B;  3HKE A;  2YIB A;  2ZE7 A;  2GTA A;  1Y74 B;  5C8Y B;  4J42 A;  2ZIM A;  3SJA C;  3OR6 C;  1N36 O;  3TXS A;  2WPD G;  1BHA A;  4LH6 A;  3STL C;  3CC7 V;  1N32 O;  4D6T H;  2GV9 A;  1AR1 B;  4FM1 A;  3FB5 C;  5KUK A;  4JAU A;  3N2K B;  1BSM A;  4LWS A;  4YXW G;  2V4D A;  4X20 B;  2G38 A;  1NJI W;  1N33 O;  5DN6 G;  4WFF A;  3CRM A;  2UUC O;  3LSU A;  4DUY B;  1XL4 A;  2P4V A;  1VEW A;  2XND G;  2ADQ B;  1OHH G;  2B9Z A;  5ITZ A;  5KMG A;  1SF9 A;  1BE3 H;  2EIN B;  2QWR B;  1Y4M A;  1SQX H;  2H8P C;  3P3N A;  1N33 B;  5B1B C;  3DXR A;  5LMU O;  3T4D A;  3APQ A;  4LP8 A;  2AW9 A;  4N21 A;  2GUZ B;  1S76 D;  2HVK C;  5A9G A;  2LGQ A;  1ZTE A;  2MK3 A;  2P06 A;  2BE3 A;  4LF7 O;  3CMA V;  4DR7 B;  5IY5 C;  4PEL A;  2ZQM A;  4O2B B;  4UFZ A;  4DV4 O;  4BW5 A;  5LGU A;  1P84 F;  4JI4 O;  2EZO A;  4LFC B;  1PPJ H;  1RM1 B;  4GX5 A;  4JYA O;  3U0Z A;  4HYO A;  2ETN A;  1P4R A;  4JYC A;  1K4D C;  3AEI A;  3BPZ A;  1KBH A;  5FNV A;  3ETD A;  1OCZ B;  2VS0 A;  1NVP D;  3ZIA G;  2EUL A;  5L3B A;  1K4C C;  3AG1 B;  1A32 A;  4DO2 A;  1VQ4 V;  3AG1 C;  2ZDI A;  4PDM A;  2Q0A A;  3C90 A;  3JCZ A;  3K58 A;  5FPR A;  2XAF A;  4I50 A;  2E5L O;  1QU7 A;  5HFL A;  5LYJ B;  1VF6 A;  3CRC A;  4JI3 O;  4J7Z A;  1R6T A;  1EFR G;  2ZDI C;  5IJ9 A;  1AI4 A;  4GT1 A;  5JH7 A;  3ABT A;  2ZM6 O;  3ASO B;  3HKD A;  2Z3Y A;  3M7M X;  4DR3 O;  2ZT9 B;  3AG2 B;  4X1I B;  2X0L A;  4LFA O;  1QVF U;  1X59 A;  4WFA V;  1AJQ A;  4J7K A;  4X66 O;  5IYB O;  4IIJ B;  3JCU Z;  3TGU H;  3N2G B;  5B5E Z;  5GON B;  3JAL A;  4J80 A;  5KHG A;  2RJZ A;  2X6B A;  4DW1 A;  3ABU A;  1RPO A;  2KG7 A;  3WFV A;  2M7W A;  1QVG U;  1IBM O;  2HHH O;  3KCX A;  4DRX A;  3H1I H;  1FFX A;  1ENV A;  1AR4 A;  1VQK V;  4IYI A;  5EBM C;  1NTK H;  3CXH F;  5LP6 A;  1K5Q A;  1HNZ B;  2UXD B;  3UT5 B;  1GN2 A;  2DW4 A;  4FM2 A;  3G71 V;  4GYC B;  5B1A C;  2PYJ A;  4B3S O;  4JI6 B;  4EB6 B;  4KFM A;  5H9C A;  2EIL B;  5KLV H;  4GKJ O;  3UO2 A;  3OGI B;  1Q6I A;  1H2M A;  4I0X A;  3R65 A;  1PP9 H;  4FLV A;  5EZY A;  3A8T A;  4DXW A;  1BQZ A;  4O4H A;  1WN7 A;  1W0K G;  2PYL A;  4RUE A;  4LF7 B;  4NTX A;  5KAF Z;  4KHP B;  3VQV A;  3AK2 A;  4I55 B;  4UCO A;  4F6E A;  3ZBH A;  2R72 A;  2IM9 A;  1XMO O;  4MVO A;  3K0G A;  2OT5 A;  5FPO A;  5LMU B;  3I56 V;  3IC9 A;  3E8B A;  5CA1 A;  4OGQ B;  3CJH A;  4JV5 O;  2Q5Z A;  5KX5 B;  3OR7 C;  3IAY A;  3ZN1 A;  3IGA C;  2NN4 A;  3UQ8 A;  2EJ7 A;  2UUB O;  3IJ4 A;  3R66 A;  3HPL C;  2IU0 A;  3P3P A;  5JJJ B;  4CS4 A;  4JGS A;  2EIM C;  2YUA A;  1IX9 A;  1S5H C;  5JCO C;  2PI5 A;  3K59 A;  1Y6X A;  3L71 H;  4IIJ A;  3JAR B;  3ZS8 C;  2LFS A;  1F51 A;  2ZXW C;  2PI4 A;  1OCC B;  2LW7 A;  4OXS A;  3WG7 C;  5F2V O;  4QE7 A;  3H1H H;  1RSO A;  1N32 B;  4HNA A;  5LBQ A;  2LQT A;  4NXM O;  3BA9 A;  4LF5 O;  5EC2 C;  3RGB A;  4TV8 B;  4TV8 A;  3UO3 A;  1HDJ A;  2V7Q G;  2Q6A A;  1SER A;  3T1H B;  2R70 A;  1KD1 W;  2QGN A;  2Q67 A;  1Z5V A;  2E3C A;  2E5L B;  4KUM A;  1FYJ A;  4EEQ A;  3SPJ A;  1V9P A;  4GUN A;  3P32 A;  2GDS A;  1Q82 W;  5LA6 A;  2Y4U A;  1YIJ V;  2MW2 B;  4HAM A;  4UXN A;  2UXD O;  4GX2 A;  3RBZ A;  4WFG A;  3CEI A;  4HBN A;  5BXZ A;  1E79 G;  1GN6 A;  2CDY A;  5JQG A;  3K5N A;  3T1C A;  1JA8 A;  2WLI A;  3FX7 A;  2HHH B;  1T5E A;  3G6E V;  1H2G A;  4DV3 O;  3ASO C;  1JR9 A;  4BWA A;  1PNK A;  2F43 G;  2DJV A;  2HJF C;  4IYH A;  5J2U B;  4WFH A;  1D2D A;  5LHH A;  3FAV B;  3E2E A;  3ZRX A;  4MVM A;  1M57 B;  2ZE5 A;  2FKX A;  1N0N A;  5LL6 Y;  3OFN G;  3BCC H;  2GUZ A;  4UCR A;  2XAG A;  2ATK C;  5BMV A;  1QHT A;  1VQP V;  4NB5 A;  2W6I G;  2DE0 X;  1YZB A;  2UXB O;  2DQ0 A;  2UXX A;  1MNG A;  5KUM A;  2A0L A;  3AG3 C;  3JD0 A;  1YEW A;  2Y0I A;  4KP4 A;  4C7U A;  1IXM A;  1XRE A;  4MVQ A;  4CS2 A;  1FKA O;  5J2T A;  2W6J G;  4LF8 O;  3C3T A;  3ASN C;  1J95 A;  2EIJ B;  5JVD A;  3THO A;  4WBN B;  1N34 O;  3WB0 A;  1ZUQ A;  2CTW A;  3KG2 A;  2QA4 V;  5LMN B;  2PY5 A;  2JEX A;  3TET A;  2D2C B;  4L8J A;  1U96 A;  4KXR A;  5ITZ B;  5IE9 A;  3TJT A;  4JTD B;  4I9W A;  2VWK A;  3SJC C;  5LGN A;  2A7W A;  5CBH A;  3F5W C;  4R7C A;  3JD2 A;  1R73 A;  1M1K W;  4B3M O;  3GWK C;  1R6K A;  5EK0 A;  2B1G A;  3SR2 C;  4DV1 B;  5B1N A;  1V55 B;  1YHQ V;  3SYA A;  1B04 A;  4IHJ B;  1G8M A;  4W4L A;  2HFE C;  3ICX A;  3VOU A;  5IJ0 B;  5B66 Z;  1MOF A;  3OD4 A;  2QWP B;  4UV8 A;  1XDC A;  3FYE B;  4X65 O;  4DW0 A;  3HKD B;  2GHY A;  4MT8 A;  1XNR B;  3PN1 A;  4K8Z A;  1QLE C;  1VQL V;  3CJH B;  4UVA A;  4XDJ A;  1OCO B;  3UKM A;  2N05 A;  2PF4 E;  2P90 A;  3STZ C;  5LXT A;  1P7G A;  1PNM A;  4IL6 Z;  4R6Z A;  3O9O A;  1YJN V;  1ZWI C;  4ZKI A;  1QLE B;  1Y76 B;  1J5E B;  1NQT A;  1NZ6 A;  1I0H A;  3B09 A;  2EIL C;  4PA3 A;  3JD3 A;  2P22 C;  4O4I A;  1JJ2 U;  1KP2 A;  3HB3 B;  4O4I B;  4UVB A;  5J2U A;  3CRA A;  2QKC A;  1I7F A;  4FZ0 A;  4LH7 A;  2L35 A;  1ZAU A;  4G28 B;  4LR3 A;  4LF4 B;  1YIT V;  1R3L C;  2LW1 A;  1I94 O;  3RVZ A;  4PI0 A;  4ZI7 A;  1DTO A;  3ZHV A;  2E75 B;  1F4N A;  1QR9 A;  4PI2 A;  4I4T A;  2Q0O C;  1VQ8 V;  2ILM A;  3HKB B;  2ZNI A;  2DWE C;  2F4V B;  1GAX A;  2ZE8 A;  1W2B U;  3GWO A;  4LCU C;  4PA9 A;  2UUA O;  1DGS A;  2Y69 B;  1IZ3 A;  1PKX A;  2ADP A;  5KA6 A;  1CEZ A;  3CRR A;  3WB2 A;  4JYB A;  4AIL C;  4X88 A;  3RYI B;  4J9Y B;  5JJE B;  1SZX A;  3L74 H;  3TCU A;  1L0L H;  3SYC A;  2H94 A;  3JAS B;  3ZRV A;  2YXY A;  4TQD A;  1N4C A;  1O9H A;  4O2A B;  4NXM B;  1H8H G;  1NTZ H;  3WB1 A;  3FB6 C;  1S3J A;  1YJW V;  3CXC U;  1WB7 A;  1HP8 A;  4DV2 O;  2YIC A;  2ZIN A;  4X66 B;  3B40 A;  4H0L B;  4DV7 B;  3E89 A;  3OT7 A;  2E76 B;  3JAM N;  2AZ0 A;  4DV6 B;  3QF7 A;  4FLY A;  4OPH A;  5K1X A;  3OUS A;  1VQ7 V;  3G6B A;  1XNQ O;  4UV9 A;  4N23 A;  5C8Y A;  4D7T A;  5KX5 A;  3S3W A;  4CC5 A;  4CH4 A;  5CA0 A;  4B7K A;  1HNX B;  2CGO A;  4DR5 O;  4UUJ C;  5EIB D;  4AQY O;  2QSA A;  2WLK A;  4PD4 F;  2ODM A;  1WB8 A;  2XHB A;  1Q5O A;  1FAF A;  1R3J C;  3FKS G;  4OPA A;  1NT2 B;  4I50 B;  1HR0 B;  3OUF A;  4Z1M G;  3K57 A;  4I55 A;  2D3O W;  1IXB A;  1Y76 A;  3FFQ A;  3K03 A;  1XUQ A;  4I9Q A;  3W7T A;  3M8A A;  1BS3 A;  2CH7 B;  5DEC A;  4DR5 B;  4GKK O;  3OTO B;  4O4H B;  3B77 A;  1XI1 A;  1JQ0 A;  2K9P A;  1AIL A;  1N36 B;  2DYS B;  4RAI A;  1BL8 A;  1QCE A;  4X62 O;  3CME V;  2VQF O;  1Q6H A;  2XAH A;  3CCV V;  5BZB A;  2BTQ B;  3CB2 A;  2ZXW B;  1PL0 A;  1WLE A;  3L75 H;  5LA6 B;  3CX5 F;  1DLB A;  1EN6 A;  2XAQ A;  1FXK A;  2ZKO A;  4K3A A;  3JD4 A;  2EIK B;  1EBO A;  1VMG A;  1JOY A;  3FD9 A;  1M4U A;  1K73 W;  3AK1 A;  1KUQ A;  1SET A;  1IUR A;  4AQY B;  1GM8 A;  2YDE A;  2YID A;  3MHS C;  4FLX A;  1V55 C;  1FXK B;  2IU3 A;  4O2A A;  2YS8 A;  5KA5 A;  2KKW A;  4DV4 B;  4TT3 G;  3CCL V;  3ZHQ A;  4JTC B;  1B06 A;  3B4S A;  3RWR D;  3JAK B;  1YF2 A;  4KHP O;  3ZED A;  3CCJ V;  4R8C A;  1VQM V;  1JJO A;  1MA1 A;  3ZHR A;  3AG4 B;  4DV3 B;  5LHI A;  3EVK A;  5FLX N;  2P7T C;  4J11 A;  2WSS G;  1KC8 W;  1J5E O;  2ZM6 B;  2IW5 A;  4LBE C;  2EZP A;  1TVK A;  4DR6 B;  3CPW U;  2HP8 A;  4DV0 B;  2E74 B;  2WA3 A;  2UUC B;  4FFB A;  5B3S B;  4B3R O;  1PNL A;  4BAY A;  1I5Y A;  3A0R A;  2PUS A;  3BY6 A;  3K04 A;  2FML A;  2WLI B;  3NXS A;  5JJN B;  1NS1 A;  5IYZ A;  2F95 B;  1BGY H;  1I08 A;  2JJ1 G;  2BOB C;  4ASU G;  1V54 B;  2ARH A;  1EN4 A;  3E8H A;  1S5L Z;  3QG5 A;  4P2Z A;  1CP9 A;  4YJ2 B;  3RYH B;  1SA0 A;  3JAT A;  4GCZ A;  4X1Y B;  2OTJ V;  3K0D A;  1OCR C;  2DN9 A;  3WU2 Z;  4MVU A;  2KB1 A;  1VQ6 V;  2CK3 G;  3H1L H;  3M99 B;  4LF9 O;  2QKS A;  4X62 B;  3OE7 G;  2AHY A;  3OGC C;  3OEE G;  4ZIB A;  1WAZ A;  1R1B A;  4DK0 A;  4K0K B;  4K8X A;  1GM7 A;  3ABM B;  4WFE A;  3W7W A;  2Y0P A;  4Q20 A;  4RO2 A;  2NLJ C;  2DWD C;  3SGI A;  1WJZ A;  4IGG A;  3JD1 A;  1QR8 A;  4JAA A;  3ZMS A;  4JI6 O;  4DV0 O;  4WF9 V;  4DUY O;  2RCV A;  4K35 A;  1Q6U A;  1QQC A;  1DF5 A;  5LYJ A;  2EX3 A;  4JPR A;  4E4E A;  3ASN B;  2RMK B;  1SS3 A;  5JVD B;  5IYD O;  1ROP A;  2IH1 C;  1YDX A;  5KAI Z;  1TAE A;  1WP7 A;  1RM1 C;  4FLU A;  4YJ2 A;  1L1F A;  1N0J A;  3JYC A;  3RYC A;  4JYA B;  4LFB B;  5CB4 A;  3MDS A;  1Q3E A;  4ZI7 B;  4PJ0 Z;  3F7V C;  4B3M B;  2NR5 A;  4DR4 O;  3F7Y C;  1JMK C;  3QO5 A;  1VP7 A;  1GKF A;  2HG5 C;  4H44 B;  3ZMU A;  3QO8 A;  5CBF A;  3ZRS A;  1FXH A;  2OWO A;  1XIL A;  2HJD A;  4W4K A;  1LR1 A;  4OX9 O;  4H13 B;  3K06 A;  2FTK A;  3DGE A;  2B5U A;  4U3F H;  1YTF D;  4FMT A;  1XHZ A;  3GVM A;  1NR7 A;  2H3O A;  5EZY B;  2CTR A;  4X64 B;  1U97 A;  2P67 A;  3BRC A;  4Q6G A;  2BSK A;  2F23 A;  4GX0 A;  3VQY A;  4B3T B;  5J9P C;  4LC1 A;  4JI8 B;  1MZE A;  1AP6 A;  4JI5 B;  4LF6 B;  5BY1 A;  2FL4 A;  3RT3 C;  4JYY A;  5H6R A;  3DTU B;  4G2K A;  4BIU A;  1FFX B;  4R50 A;  2YXH A;  3E8G A;  1YTF B;  5B3S C;  3N2K A;  3ETQ A;  3DC6 A;  4DR7 O;  4X9Q A;  4B3R B;  1H2L A;  4JI0 B;  2ITC C;  3D8C A;  1RSO B;  3OMI B;  5EIB C;  4MTF A;  3L9D A;  1X4T A;  1URF A;  2JS5 A;  2IJK A;  4X1I A;  1IBL B;  4X20 A;  5L3G A;  1Y74 A;  3K5M A;  1H38 A;  1GRJ A;  1FXV A;  3SPG A;  1XL6 A;  4XBF A;  2P5O A;  3ZMV A;  1K8A W;  3ABM C;  1IBM B;  3JAL B;  1DK1 A;  3OAA G;  1VQ9 V;  5H2F Z;  3CE2 A;  2A06 H;  1YI2 V;  2XT9 A;  1FPO A;  3CCR V;  4MTX A;  5J2T B;  3OW2 U;  1XEQ A;  3OTF A;  1K97 A;  4UB6 Z;  1B3Q A;  4ZHQ B;  2VQE B;  4DV1 O;  1LUV A;  1TUB B;  2P4K A;  2VWJ A;  2PZS A;  2BCC H;  4RWU A;  3BAB A;  4YY3 O;  1GN3 A;  4X1K A;  4MVS A;  4LF6 O;  3ZRW B;  1VQ5 V;  4DR6 O;  2WWW A;  2N04 A;  3LSS A;  2W0F C;  4CS3 A;  4UCT A;  3ZHS A;  2JEU A;  4X1K B;  4FLZ A;  2YIB D;  2RN9 A;  3VQX A;  1PD3 A;  1PM9 A;  1WP8 A;  4MSW C;  1K34 A;  2YIA A;  4HZ3 A;  4RQF A;  2F4V O;  3AG4 C;  4X65 B;  2EIM B;  2V1D A;  1SRY A;  1K9M W;  2L6L A;  2UUA B;  3AG7 A;  1AJN A;  4YJ3 A;  4DR1 B;  2OIG A;  2JIZ G; 
#chains in the Genus database with same CATH homology
 1HNZ O;  1IBK O;  1HNW O;  2UUB O;  5A2Q N;  3F5T A;  4DV6 O;  4DR3 O;  4DR5 O;  1YZB A;  2UXB O;  3R66 A;  4AQY O;  4JI8 O;  4LFA O;  4KHP O;  1N33 O;  1X59 A;  4X66 O;  2UUC O;  1F7Y A;  4OPA A;  4DR1 O;  3O65 A;  4K0K O;  3OTO O;  1FKA O;  4DV5 O;  5FLX N;  4LF8 O;  1I94 O;  4A5U B;  1J5E O;  1DK1 A;  1IBM O;  4NXN O;  2LW7 A;  2HHH O;  3M8A A;  1IBL O;  1N34 O;  4LFB O;  4GKK O;  2DOS A;  2AGA A;  1FJG O;  4DR4 O;  4NXM O;  5BR8 O;  5LMU O;  4DV7 O;  1AIL A;  5H5N A;  4LF5 O;  4B3R O;  1XEQ A;  4LF7 O;  1NS1 A;  4B3S O;  4X62 O;  2Z0A A;  4OX9 O;  2VQF O;  5LMN O;  3J7A U;  3SDL A;  2N74 A;  2UUA O;  4DV4 O;  1XMQ O;  4GKJ O;  4DV1 O;  1FYJ A;  4JI4 O;  4JI7 O;  4JI0 O;  4B3M O;  2UU9 O;  4X64 O;  3T1H O;  4JI2 O;  4YY3 O;  4JI1 O;  4JYA O;  4JI5 O;  2VQE O;  4LF6 O;  2UXD O;  1HNX O;  2ZKO A;  5BXZ A;  3J81 N;  4LFC O;  1XNR O;  3T1Y O;  4LF9 O;  4LF4 O;  4DR6 O;  1R1B A;  5IT9 N;  1KUQ A;  2UXC O;  4X65 O;  1A32 A;  4B3T O;  5BY1 A;  4DV3 O;  3RT3 C;  4YHH O;  4DV2 O;  4DUZ O;  1XMO O;  4DR2 O;  2DJV A;  1N36 O;  1D2D A;  2E5L O;  1AB3 A;  1HR0 O;  2JRI A;  3JAM N;  2F4V O;  4JI3 O;  2FKX A;  1N32 O;  5LL6 Y;  1R6T A;  4JV5 O;  1G1X B;  4OPH A;  3J80 N;  5IWA O;  1XNQ O;  4JI6 O;  4DR7 O;  4DV0 O;  2ZM6 O;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...