1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
2UXBO 2VQFO 4DR1O 1FJGO 4JI7O 4DV3O 2FKXA 1XMQO 1N36O 1R1BA 1IBMO 4DV6O 4LF8O 3JAMN 2UUAO 1FKAO 4A5UB 2ZM6O 4OPHA 4LFAO 4GKKO 2LW7A 1XNQO 2DOSA 3M8AA 4JI2O 2E5LO 2HHHO 1KUQA 4B3SO 4JI0O 4DUZO 4JI3O 4X62O 1IBLO 4DUYO 1HNXO 1R6TA 1HNZO 4DR3O 4X65O 4LF7O 3T1YO 3T1HO 4DR2O 3SDLA 2Z0AA 4YY3O 1N33O 3J80N 4DR4O 3J7AU 3F5TA 4NXNO 4DR6O 1DK1A 5IWAO 2VQEO 4B3RO 5LMNO 1XEQA 4AQYO 4DV1O 4B3TO 1A32A 1HNWO 2UUCO 1YZBA 4LF5O 4LF4O 4K0KO 4DR5O 2UUBO 2UXCO 3RT3C 5A2QN 1J5EO 2N74A 4B3MO 4JYAO 1IBKO 5BR8O 1XMOO 3OTOO 4DV2O 1I94O 4DV4O 4LF9O 4LFCO 1X59A 2ZKOA 4KHPO 4DV0O 5LMUO 4X66O 2F4VO 3R66A 1AILA 1G1XB 4DV5O 4LFBO 5H5NA 4YHHO 5BXZA 1F7YA 4JI8O 4X64O 1N32O 2AGAA 3O65A 2UU9O 4OX9O 2UXDO 4LF6O 4GKJO 1NS1A 4JI1O 1D2DA 4JI5O 5BY1A 4JI4O 4DR7O 3J81N 1HR0O 4OPAA 1N34O 5LL6Y 5FLXN 1AB3A 4DV7O 4NXMO 5IT9N 1FYJA 4JV5O 2JRIA 4JI6O 2DJVA 1XNRO
chains in the Genus database with same CATH superfamily
2VWKA 3DXRA 1M90W 5JCOC 1JPXA 1GM9A 4TUYB 3KCYA 3AEIA 3DC6A 4IHJA 2IH3C 3EXAA 3OTOB 1OCRC 4WFHA 2R9AA 2Z3YA 4TUYA 5LMUB 4B3SO 1IBLO 1AJQA 3E8HA 1WB8A 4X8AA 1B06A 3E2EA 4TWKA 1IX9A 2RJZA 4J9ZB 3RYHB 4XBFA 3T1HO 1XL4A 5D5QA 1DGSA 2ZNJA 4GT1A 4IT5A 3PN1A 3K06A 2Q0OC 4NXNO 4DR6O 4HBNA 1XEQA 4AQYO 5CN0A 1NVPD 2UUCO 1H2LA 1YZBA 4X66B 5LXTB 3FYIB 1Y67A 1UJWB 3LSQA 3PJSK 3H1JH 1Q6IA 1AVMA 1OCOC 5LXTA 2IBZH 4BIOA 3CHXA 4DV4O 4O4JA 1DTOA 3OR7C 3RVZA 4DV0O 1ORQC 2RMKB 4ZOLB 5H5NA 4NXMB 4MS2A 1N8RW 1V54B 2ZT9B 4QJFB 3JCUZ 4WFGA 4U7NA 3CPWU 2GHYA 3CRAA 4JI4O 1HR0O 3Q4HA 1VQ8V 4W4KA 3D3QA 5DN6G 4H33A 3QO7A 4D7SA 1M93A 2H94A 5JVDB 5LGNA 5LYJA 2JRIA 4UCVA 4JAVA 4JI6O 4I4TA 3A2FA 5FNVB 1AI4A 4DR1O 4IYHA 5C93A 4KXRA 4DV3O 5JVDA 2ZIOA 2LGQA 1JVMA 3JAMN 5KMGB 3JATA 1EZVH 2CTQA 3OTFA 4D6TH 4J80A 2X0LA 1OV9A 3ASNB 5L3FA 2HEPA 2F4VB 1IZ3A 2X7RB 2W0FC 2ZXWB 1UFIA 3VQYA 3T1YO 3L75H 2GV9A 4Z1VA 3T4DA 3UKMA 1SQXH 4UV8A 4J7JA 1V55C 3TETA 4CC6A 1WAZA 1S5LZ 4K0KO 1B6QA 1Q86W 3DTUB 4CBCA 1BSMA 3AK3A 3ZEDA 1S5HC 3S3XA 1VP7A 4JI8B 4N23A 1EM1A 5EBMC 5IJ0B 4BW5A 5LBQA 1YITV 5H6QA 2Q7EA 1YHQV 3KZIZ 5EYPB 5B3SC 4FFBB 4NKGB 1I94O 2EZOA 4TT3G 2BTOA 1N36B 2EIJB 3QO8A 5IJ0A 5DM6V 1L8DA 3ABTA 3O9OA 5EYPA 2AXTZ 3BFRA 4UCTA 4JI2B 1Y76B 5J2TB 2HHHB 2A7WA 2UXDO 4LF6O 2JDIG 4RWUA 1X4TA 4G2KA 4F4LA 2JIZG 4LF7B 1SQVH 3FB6C 1XI1A 3BABA 1R73A 4RQEA 1AB3A 3B8NA 2IJKA 5JCOA 5KAIZ 2XT9A 1FFTB 3WB0A 2X6AA 2WWWA 1GAXA 1KYOF 5B1OA 3HKEB 1MSDA 4O4IA 3BA9A 4O2BB 1K4CC 5LP6C 3RYIB 2GSMB 4FVMA 4MSWC 2QWQB 3T1CA 3CCVV 4O2BA 3THOA 4XDLA 4JTCB 4JYYA 4WCEV 1R3JC 3CJHA 2PZSA 4JZ2A 1SQBH 4JI0O 3K57A 3OUFA 1R6TA 4PA9A 1TVKA 2ODMA 2Z0AA 1FXHA 2NN4A 3NR7A 1IBKB 1OCOB 2JS5A 3K04A 2C2AA 1SA0B 4KFMA 1K9MW 1A32A 2JJ2G 2KQXA 3E35A 3P3PA 3AG1B 2B1GA 2WA4A 2UXCO 4JV5B 3OT7A 1NT2B 3ETDA 4FFKA 5H6RA 5KHHA 5LOVB 2D2CB 1N32B 5CA0B 4X20B 1PD3A 1M5IA 1KECA 4X1YB 5IYCO 4JF3A 3N2KA 5CA0A 1QR8A 2UUAB 4EB6A 4DV5O 3ETGA 3OW2U 4X1YA 4DV7B 4JAUA 4BIZA 3CCQV 2NNUA 1KB9F 1R6NA 4P9PA 5D5PA 1VQ5V 3RN4A 1P84F 1XNRB 1I7FA 5BY1A 4JTDB 1SKVA 1YI2V 4FIPC 4YY3B 4LF8B 4XDJA 5TISZ 1GN4A 2ZM6B 4FLVA 1Z2GA 1B3QA 4K8ZA 3LDCA 2EINC 4RUFA 2V4DA 2XAQA 2WLNA 1TUBA 4DUYB 2Q8VA 3CCUV 5KX5B 2Q4PA 4QPKA 2WLIA 3VQWA 2EIKB 4PA3A 1Q81W 1AROP 1V55B 3E83A 2DOSA 4I7ZB 1K92A 4YJ2B 4BW9A 1JCHA 2VWJA 5K1PA 4DR3O 2QKAA 4IYIA 3FYEB 4YJ2A 1W0KG 1WJZA 3G80A 2XAJA 1J5EB 5B3SB 3HKDA 3FD9A 3G71V 2EJ7A 4NVPA 4DR7B 4AI8A 1FPOA 5LMNO 3C90A 4WFAV 3ZN1A 3FAVA 5IYBO 1HW7A 1WN7A 2FMLA 1XHZA 4L8JA 4JYAO 2RDCA 1R6KA 1VF5B 1DF4A 5CBFA 2VS0A 4CZZA 3SYPA 1GN2A 4JYCA 3CE2A 3CC4V 2P4KA 4LF9O 1Q6UA 1U96A 4JGSA 2ITCC 4DV6B 1VQKV 5CA3A 3CCJV 4GKKB 3CMAV 4CH5A 2E3CA 2YEVA 2YIAA 1BE3H 3B2EE 2QTOA 2UU9O 4OX9O 1K5SA 3BA8A 1BT8A 3FB5C 5LP6B 4TV8A 1R3KC 4CH6A 4OPAA 3A0RA 1XUQA 4ABMA 5LP6A 4J7ZA 3TXSA 5IT9N 1XDCA 4LH7A 2AW9A 3D3IA 3AG2B 4FLXA 5EIBD 2W6IG 3K08A 2LFRA 2NLJC 2Q9LA 4RAIA 4CS4A 4JAAA 1I5YA 3TXQA 4WFFA 5CBGA 1FFXB 1IBMO 4TV9B 5J9PC 1PNLA 3ZHSA 1EZJA 1XNQO 2CK3G 1XOUA 1ZL8A 2R70A 2EZPA 2BOBC 4J9YB 1KKDA 2VQEB 1PL0A 4YHHB 4X9QA 1HNZO 3QNEA 3CWBH 2HG5C 2ILMA 1H8HG 1Y66A 4LNUB 2OCHA 5GTIZ 1N33O 2QWRB 1TUEB 2DE0X 2YS8A 4FLYA 4IL6Z 4YJ3B 1M4UA 3ZCCA 2KB1A 2GDSA 1M9NA 2YXLA 3KCXA 2CGNA 3E8GA 4YJ3A 4NTWA 3SYCA 4J41A 3CRMA 4K8XA 1GKFA 3IAYA 1AR1B 1GM8A 1FXVA 1YTFB 2WLLB 4ZHQB 1G4YB 1X59A 3MAQA 3ZMSA 4CH3A 4PJ0Z 3ZRSA 5KAFZ 1U97A 4B7KA 5IJ9B 1AILA 2WA3A 3CCMV 4MT8A 2XUMA 1PV0A 2ZXWC 1YEWA 1IBLB 1BS3A 2KG7B 3RW0A 4GKJO 2DYRB 3GWKC 2F95B 3CRCA 4K3AA 5LHIA 3T1HB 1Y74B 3K5NA 2CH7A 2JK5C 4O4LB 4PELA 2AHZA 4BAYA 3SYAA 1SESA 3BVOA 5B1NA 2IJJA 4DR6B 4UCRA 4J11A 1XREA 3L73H 2DW4A 3TJTA 2ETNA 4O4LA 5KUKA 3I55V 1Q5OA 2DJVA 2UUCB 1YCIA 1GMGA 2UXBO 3JYCA 5B5EZ 1AR4A 4HAMA 3OGCC 4JYBA 1JX9A 1TA8A 3JAWB 4E2LA 4GLXA 1ZUQA 1H38A 2EIJC 2QE7G 1O9GA 4DV4B 4UFZA 4PD4F 4ICGA 2GBOA 2Y48A 4DV0B 1XHXA 1F23A 1PL4A 2UUBB 2ADPA 4MVZA 1S77D 5AG2A 1Q90D 4PA4A 2IU3A 4JI4B 1US6A 1XMOB 1JR9A 4B3RO 2W6JG 4LP8A 1NZ6A 5DEDA 1SS3A 4P30A 4KUMA 3JCZA 2XAHA 4I0XB 2QA4V 5L3DA 4JI6B 4FLZA 3RGBA 3K79A 1THZA 5C8YB 4MVQA 3D36C 4H44B 2AHYA 2Y0PA 3CCEV 4DRXB 3RYHA 4KHPO 1G6UA 2OYQA 3G6EV 5C8YA 4LFBO 3WFVA 4GX2A 4CH4A 5BZBA 2K9PA 3FKSG 4UXNA 2ARHA 2OIEA 1IVSA 2E76B 1AP5A 5E1AC 3T1YB 3ZIAG 3CXHF 1SQPH 3P3NA 4J10A 2DQ3A 3B09A 3ZRVA 3ZHQA 3OAAG 3E22B 1K97A 4BIUA 1VQLV 3AG1C 2VQFO 4X1IB 4ZOLA 2AZ0A 3UQ8A 1XMQO 3M99B 2YI9A 5ITZB 2ZR3A 3TCUA 2LJ2A 2LW7A 2YSUB 2JGDB 1NH2B 2XTAA 2FTKA 3MDSA 5ITZA 2WLHA 3QF7A 4WF9V 1OZ0A 2H8PC 2RN9A 3APOA 2ZNIA 4DW1A 2UXDB 1CEZA 2B9ZA 5EK0A 5BR8B 1CP9A 3J80N 1N4CA 5FNVA 4NTYA 4FZ0A 5KHIA 4DV2B 2DQ0A 1OCZC 1NJIW 5KMGA 1K73W 1SZTA 1JJ2U 4B3MO 1BQ0A 4FM2A 2YDEA 1QLNA 3GB7C 1Q3EA 2PGGA 4MVSA 3AG3B 4UB6Z 3CD6V 5CBHA 2EIKC 4N21A 1BGYH 4X66O 2YXHA 2YC0A 4I9WA 2QKSA 1ZSPA 1GRJA 5BXZA 3A8TA 4JI0B 3OEEG 5B66Z 2ZDIC 3SR2C 2P67A 4IIJB 5HFMA 4NR1A 4H37A 4LC1A 2LQTA 4JI7B 4XDKA 3B4SA 4NXMO 3AG4C 3OUSA 2L6LA 2HVKC 4PDRA 3T4ZA 4GX5A 4FFBA 4DO2A 2JEUA 3TGUH 2ITDC 3I56V 1WP7A 3RBZA 4X62B 2WSSG 3AK2A 2UXCB 2M7WA 3CCRV 3ZMTA 1Y76A 5J2TA 1NTKH 3STLC 5F2VO 4LFAO 3WU2Z 2L35A 3BY6A 4NB5A 3DGEA 2N05A 1YSCA 2JEXA 4ZIBA 1KQSU 1MOFA 1K7DA 3ABKC 4CS3A 1HWYA 2F43G 5J2UB 2PTMA 4DV5B 3VBBA 3OM3B 1JFFB 3H1KH 4NYKA 4IGGA 3GVMA 4LBEC 1K8AW 1OHHG 1BZKA 3HKEA 1JFFA 2R9RB 1BQZA 4WFEA 3EVKA 3RYIA 5JQGB 3D36A 1LUVA 4LF5O 3SGIA 3AG2C 1CPYA 1NU1H 5CA1B 5A2QN 1ZTEA 4GYCB 4X64B 2IH1C 3JD2A 3ZRWB 1S0VA 3B8MA 3CC7V 5CA1A 1D5AA 2Y69C 3BRCA 4LFCO 3HR0A 1K33A 3ZRWA 1G1XB 3FFQA 1VF6C 4PV1B 4JI8O 3ML0A 4OGQB 2P22C 4MVUA 1M1KW 1SA0A 1MNGA 1M56C 2R9IA 4DR3B 3K9AA 3ZHRA 4BWAA 3RYCB 2H3OA 3DSQA 3I5DA 4ASUG 2A9HA 3LDDA 5LOVA 1VMGA 5H9CA 4X20A 1NBMG 2K1EA 4FMTA 3RYCA 5LMNB 5B1BB 2Q67A 1F4NA 4MW8A 1AJNA 3CMEV 1YF2A 4KL1A 1N0JA 1TGOA 1KP2A 3ASOB 2WLJA 3BPZA 3P32A 1H2NA 5IYDO 4JYAB 2LFSA 1W59A 2GTSA 2DN9A 4YXWG 2XOKG 3T2MA 2OIGA 3N2GB 5B1AC 5EC1C 4R6ZA 1OCZB 1YVWA 4EFBA 4MW3A 5BMVB 4JI3O 3E8BA 4Q6GA 1QR9A 3HB3B 5H2FZ 4C7UA 4LF4B 2DYRC 2UU9B 3JSLA 2MW2B 1I5XA 3JALB 2P90A 1XQ8A 1WPBA 1MA1A 5KX5A 2DWEC 5L3EA 2W0XA 2VRZA 2ZQMA 3G6BA 4FJCC 1RPRA 3E8FA 2PI5A 4MTOA 1IBKO 4PHZA 4BR6A 3FB8C 1P7BA 1ROPA 1FAFA 1G8MA 3X2QC 1ZWIC 4FK5C 1GN6A 2BSKB 5KHGA 2ZDIA 2FB5A 3TK1A 3ZN0A 3AG4B 1XNQB 5DECA 2CDYA 2BCCH 3ZMUA 1N32O 2QWPB 1KC8W 3SJQC 4R8CA 5GONB 4JASA 3CXCU 3QO5A 1HNZB 4JI1O 3CRRA 3ABUA 1GM7A 3W7UA 4JI5O 2EULA 1YXBA 1VQPV 1HDJA 1N34O 1PPJH 4DYLA 3FX7A 2EIMB 4UVBA 2P4VA 3LSUA 1N33B 3LNMB 4DV7O 1QVGU 2ADQB 2P7TC 1YIJV 1SERA 2CUGA 1H2GA 2HP8A 4CC5A 1Y4MA 2LW1A 3ABKB 1KBHA 1XBLA 4HNAB 2A0LA 1XNRO 3OEHG 3WB2A 1PNMA 4FM0A 1UPGA 5JH7B 4HNAA 2Q68A 4DR2B 2LP7A 3SJAC 4LF8O 4NTXA 3BAAA 2ZM6O 4FM1A 3MHSC 3M8AA 5JH7A 3LDEA 1QQCA 4UUJC 3RWRD 2Y4TA 4DUZO 4DV1B 4DUYO 1HNWB 1HNXO 1I08A 1NKDA 1XL6A 2EBOA 1OJHA 3WG7B 1E79G 1SC5B 1L0LH 2Y69B 3IGAC 3K5MA 4LWSB 4B3TO 1GK9A 4ZI7B 1WA8B 1QLEB 1FFXA 2IU0A 4TV9A 4DK0A 4DR5O 5L3BA 3OD4A 3ZJZA 1QVFU 5LGUA 1J5EO 2QTSA 1WA8A 4RO2A 1SF9A 1M56B 4UCOA 4PI0A 3ZRXA 2UXBB 1NTZH 1B04A 1OCCC 3K59A 3ETQA 1F51A 1JQ0A 3E86A 2D3OW 4LNUA 4K35A 1JMKC 4I5SA 1SQFA 3UCSC 1SZXA 1PKXA 1BHAA 3O65A 1MABG 2GUZB 4Q20A 3CB2A 2CTPA 4LCUC 4RUEA 4F6RB 3H1IH 3FB7C 5IY5C 2GUZA 3JASB 3B40A 3F7VC 5B1AB 1NVPB 4MTFA 4F6RA 3K3WA 4B3RB 1FYJA 4PDVA 1LR1A 3JASA 2WLLA 4ZHQA 1WPXA 2Q7GA 3HKCB 4AHCA 2ZIMA 5JJEB 1N0NA 2OCCB 5IJ9A 4B3SB 2BOCC 3NXSA 2RCVA 2PYJA 3K0GA 1K4DC 1YJWV 3M7MX 3AG3C 3LUTB 4WFBV 4DK1A 4OPHA 1W0JG 2KG7A 2Z5UA 3IFXA 2A06H 3APQA 4KHPB 4NXNB 1Y74A 2AZ2A 3L74H 4AQYB 1BCCH 4LFBB 3KG2A 2QDOA 1JOYA 1GH6A 2QJ1A 3OR6C 5CMUA 3CEIA 3K58A 4YIPA 3X2QB 3J7AU 1VARA 1VQNV 2JGUA 5IWAO 2BTQB 2VQEO 2B5UA 1FXKB 2G38A 4Z2WA 3SJBC 3OMNB 2P5OA 3ABMB 3JAWA 4I9QA 3RYFB 1AI5A 1O9HA 3N27A 2FL4A 2BTQA 3RT3C 1F4MA 3QVNA 3AG7A 1QCEA 5L3GA 2QGNA 2VQFB 1RM1B 3RYFA 3CRQA 3VQXA 1HR0B 3CC2V 3HKBB 3STZC 2R72A 4G28B 1H2MA 5KA6A 5EBLC 2FYUH 4B08A 4IHJB 3HKBA 1VQOV 2CTRA 3SPJA 4DR1B 1AJPA 4DV3B 2UXNA 1GN3A 2ZINA 1IDSA 4I0XA 5FPOA 3SYQA 5LL6Y 1Q43A 1MZFA 1R3LC 4PI2A 4TQFA 2Q6AA 2Q73A 3JSNA 2EX3A 2E74B 1JA8A 4GCZA 4DRXA 2YXYA 3EFFK 1DF5A 2ZE6A 1FJGO 1IXBA 4DXWA 4B3MB 1YJ9V 1VQ9V 2WPDG 3MD0A 4ZKIA 1M57B 1YTFD 4FPPA 2ATKC 2IM9A 3W7SA 3RFRA 5KA5A 2E5LO 4H13B 5KHJA 1KUQA 2JJ1G 1RPOA 4YIOA 2E75B 5K1XA 3DC5A 2NR5A 3K9SA 4X65O 4O4JB 3E22A 4K0KB 1LUWA 1D5NA 3SDLA 3JD4A 1LNQA 1OCCB 1RFYA 4UVCA 4DR4O 1K5QA 1H8EG 4X89A 2IJIA 4X1IA 1I94B 2QM4A 3AK1A 3H01A 3VOUA 4R7CA 1Z5WA 2BE3A 5B1BC 1VQMV 1EN4A 3Q4HB 3OFNG 4O4HB 2UUBO 3OE7G 3UO3A 1QHTA 4P2ZA 2JGDA 3ZX6A 2HR3A 3ASOC 3ZMVA 2F1MA 3A0BZ 4PDLA 1XMOO 4LF6B 4O4HA 3E89A 5LYJB 3OTOO 5IY5B 3ZMZA 4I4TB 5LMUO 4LFAB 3WB1A 5EIBC 1YJNV 3JATB 4JZGA 3MHHC 2HJFC 2A79B 1HP8A 1NR7A 1IXMA 1BL8A 3D8CA 3CYOA 4I50B 2A3QA 3U0ZA 3SPGA 2WAMA 4GX1A 3JD1A 2EILB 1E1RG 1AI6A 4ZBMA 4QE9A 3CX5F 1EFRG 4I50A 1NTMH 1BMFG 1RP3B 5JJNB 4HZ3A 4LF5B 4WBNB 4J7KA 1K34A 1SRYA 1AR5A 3OMIB 5GTHZ 1GTOA 4FZ1A 1FKAO 2HLDG 4WBNA 4IIJA 2ZCEA 5CB4B 2CGOA 4LFCB 1PNKA 1VQ4V 2OTJV 3JARB 1Y6XA 3L72H 1KD1W 2IW5A 4QPJA 3R65A 4PA7A 5CB4A 3JARA 4H0LB 1S3JA 2DWDC 3U10A 4TOIA 2X6CA 4Z1MG 3LNNA 1T5EA 2EIMC 4QGPA 4JTAB 4OXSA 4MTXA 4X1KB 2YIBA 1SQGA 1KMIZ 4QIWF 2QKCA 1VEWA 4X1KA 3H1HH 5BR8O 1WLEA 4RQFA 3L71H 5J2UA 2OTLV 4DV2O 2Q0AA 1MG1A 2CE4A 3L70H 4O4IB 1OCRB 2F4VO 1NH2D 3K5LA 2F93B 1FD9A 1F7YA 2X6BA 1ZX3A 1RSOB 1CXZB 1NI8A 4JI3B 1JJOA 5JQGA 1MSWD 3W7TA 3IJ4A 5EZYB 3WG7C 3CJHB 4R50A 1RSOA 3F5WC 2WLKA 1YDXA 4X88A 5EZYA 1TVKB 1QLEC 3JD0A 3G67A 1FS0G 2ZE8A 4UCUA 2XAFA 1W2BU 1KKCA 2ZE5A 4JI7O 2M6YA 3ZHUA 2IJHA 1N36O 1R1BA 5A9GA 3HPLC 5FPRA 1E1QG 4UCSA 4TSFG 4JI2O 1WP8A 2HHHO 1URFA 2V7QG 4X62O 1Q7YW 1QNMA 3N2KB 4LF7O 2DYSC 3K5OA 4QNHB 5KLVH 3SJCC 3ZS8C 2PF4E 1KP3A 1ENVA 4EB6B 1WB7A 2UXXA 3SPHA 4UB8Z 2O57A 2QSAA 4JI1B 1S72V 4JI5B 4LH6A 3F5TA 2Q5ZA 1N34B 3S3WA 5LGTA 3W7XA 2OWOA 2LGWA 4LF9B 4U3JB 1VQ7V 4MVRA 4MVMA 1L0NH 3UM7A 3N2GA 4GX0A 4U3JA 2V1DA 2OCCC 1K3EA 1SQQH 2YIBD 4OX9B 3BCCH 4U7OA 5BMVA 2N04A 5IE9A 1PM9A 3UT5B 5IDJA 3ZHTA 3CSXA 3K03A 3JD3A 3ZHVA 2CAZC 2HFEC 2OT5A 3R66A 1TUBB 1EN5A 2EJRA 2XAGA 2XASA 5L3CA 3UT5A 1R3IC 4X64O 3JALA 2WLIB 3BHPA 4DUZB 5EC2C 4G27B 1HNXB 1H2SB 5EBWC 1D2DA 3J81N 4PDMA 1Q6HA 1QU7A 3P30A 1IBMB 1VIBA 1FXKC 5IYZB 1P7GA 5JWPA 4PA6A 4JV5O 3ABMC 4B3TB 2BSKA 3H9VA 3HKDB 1S76D 2QM7A 5IYZA 4DR5B 1EBOA 2FKXA 1QBZA 3FAVB 1RM1C 4EEQA 5GONA 2PUSA 1Q82W 4E4EA 1NR1A 5KUMA 2UUAO 4CS2A 1Z5VA 4KP4A 1XILA 3ABLC 1MZEA 2PYLA 5KHKA 3G4SV 1DLBA 3ZBHA 4AILC 4W4LA 1BHBA 4EKWA 1I0HA 2HJDA 1ZLZA 4YY3O 2YI8A 2HKOA 2YEVB 2KSDA 4UV9A 1J95A 1EN6A 3BEHA 4D7TA 2ZR2A 1DK1A 3ETEA 2JVDA 2F23A 3C3TA 1VF7A 4TV8B 4LF4O 1WNSA 2N74A 3ICXA 4TQDA 4GKJB 3OMAB 3A0HZ 3RVYA 3LSSA 1M57C 2RQ6A 2QWNB 2P6JA 3CP1A 4J42A 2B1IA 4HYOA 2ZKOA 4L87A 4U3FH 4MVOA 3UO2A 2YICA 2QEXV 4FLUA 4GUNA 2XNDG 2QM8A 2AGAA 1VQ6V 3L9DA 2PI4A 4LWSA 3B77A 3W7WA 4ZI7A 5E79Z 1ZL8B 4MTGA 1VF6A 4DR7O 3C3SA 2KKWA 1S5JA 3QG5A 3K0DA 1L1FA 5LA6B 5IWAB 1KU9A 2QR4A 5LHHA 5GW7A 1MMMA 2Y0IA 1V54C 1SETA 3SPIA 3CCSV 2LO1A 5LA6A 2DYSB 4GZRB 2YIDA 1H2KA 4DV6O 4EFEA 2PY5A 4A5UB 4GKKO 4JPRA 2F66C 2GTAA 2DMXA 2HVJC 2QWOB 2RNBA 3F7YC 4DW0A 1AI7A 3QTCA 4DR2O 2WLMA 4FLWA 3IC7A 1AP6A 4FLTA 1P4RA 3GWOA 3HKCA 5JJJB 2XHBA 5LHGA 4DV1O 1HNWO 2EILC 2Y4UA 2ZD9A 2P06A 3ASNC 5HFLA 2EINB 3H1LH 3IC9A 2CH7B 3SPCA 1GO3F 3CS5A 1P49A 3VQVA 1FJGB 4UVAA 4LR3A 4O2AB 1PP9H 3OGIB 4F6EA 4YHHO 4QE7A 4O2AA 3CCLV 2E5LB 3KKYA 4B7EA 1COWG 1FXKA 5FL7G 1NS1A 4P9OA 3EHBB 4X65B 2CTWA 3U11A 3JAKB 1TAEA 2ZE7A 2JS3A 1ZAUA 5FLXN 1XMQB 4I55B 3SYOA 4DR4B 3JAKA 3DXRB 1Q8IA 1NQTA 1IURA 3ABLB 2Q7HA 4I55A 2MK3A 2Q69A 2YUAA 1V9PA
chains in the Genus database with same CATH topology
2UXBO 2VQFO 4DR1O 1FJGO 4JI7O 4DV3O 2FKXA 1XMQO 1N36O 1R1BA 1IBMO 4DV6O 4LF8O 3JAMN 2UUAO 1FKAO 4A5UB 2ZM6O 4OPHA 4LFAO 4GKKO 2LW7A 1XNQO 2DOSA 3M8AA 4JI2O 2E5LO 2HHHO 1KUQA 4B3SO 4JI0O 4DUZO 4JI3O 4X62O 1IBLO 4DUYO 1HNXO 1R6TA 1HNZO 4DR3O 4X65O 4LF7O 3T1YO 3T1HO 4DR2O 3SDLA 2Z0AA 4YY3O 1N33O 3J80N 4DR4O 3J7AU 3F5TA 4NXNO 4DR6O 1DK1A 5IWAO 2VQEO 4B3RO 5LMNO 1XEQA 4AQYO 4DV1O 4B3TO 1A32A 1HNWO 2UUCO 1YZBA 4LF5O 4LF4O 4K0KO 4DR5O 2UUBO 2UXCO 3RT3C 5A2QN 1J5EO 2N74A 4B3MO 4JYAO 1IBKO 5BR8O 1XMOO 3OTOO 4DV2O 1I94O 4DV4O 4LF9O 4LFCO 1X59A 2ZKOA 4KHPO 4DV0O 5LMUO 4X66O 2F4VO 3R66A 1AILA 1G1XB 4DV5O 4LFBO 5H5NA 4YHHO 5BXZA 1F7YA 4JI8O 4X64O 1N32O 2AGAA 3O65A 2UU9O 4OX9O 2UXDO 4LF6O 4GKJO 1NS1A 4JI1O 1D2DA 4JI5O 5BY1A 4JI4O 4DR7O 3J81N 1HR0O 4OPAA 1N34O 5LL6Y 5FLXN 1AB3A 4DV7O 4NXMO 5IT9N 1FYJA 4JV5O 2JRIA 4JI6O 2DJVA 1XNRO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  2VQF O;  4DR1 O;  1FJG O;  4JI7 O;  4DV3 O;  2FKX A;  1XMQ O;  1N36 O;  1R1B A;  1IBM O;  4DV6 O;  4LF8 O;  3JAM N;  2UUA O;  1FKA O;  4A5U B;  2ZM6 O;  4OPH A;  4LFA O;  4GKK O;  2LW7 A;  1XNQ O;  2DOS A;  3M8A A;  4JI2 O;  2E5L O;  2HHH O;  1KUQ A;  4B3S O;  4JI0 O;  4DUZ O;  4JI3 O;  4X62 O;  1IBL O;  4DUY O;  1HNX O;  1R6T A;  1HNZ O;  4DR3 O;  4X65 O;  4LF7 O;  3T1Y O;  3T1H O;  4DR2 O;  3SDL A;  2Z0A A;  4YY3 O;  1N33 O;  3J80 N;  4DR4 O;  3J7A U;  3F5T A;  4NXN O;  4DR6 O;  1DK1 A;  5IWA O;  2VQE O;  4B3R O;  5LMN O;  1XEQ A;  4AQY O;  4DV1 O;  4B3T O;  1A32 A;  1HNW O;  2UUC O;  1YZB A;  4LF5 O;  4LF4 O;  4K0K O;  4DR5 O;  2UUB O;  2UXC O;  3RT3 C;  5A2Q N;  1J5E O;  2N74 A;  4B3M O;  4JYA O;  1IBK O;  5BR8 O;  1XMO O;  3OTO O;  4DV2 O;  1I94 O;  4DV4 O;  4LF9 O;  4LFC O;  1X59 A;  2ZKO A;  4KHP O;  4DV0 O;  5LMU O;  4X66 O;  2F4V O;  3R66 A;  1AIL A;  1G1X B;  4DV5 O;  4LFB O;  5H5N A;  4YHH O;  5BXZ A;  1F7Y A;  4JI8 O;  4X64 O;  1N32 O;  2AGA A;  3O65 A;  2UU9 O;  4OX9 O;  2UXD O;  4LF6 O;  4GKJ O;  1NS1 A;  4JI1 O;  1D2D A;  4JI5 O;  5BY1 A;  4JI4 O;  4DR7 O;  3J81 N;  1HR0 O;  4OPA A;  1N34 O;  5LL6 Y;  5FLX N;  1AB3 A;  4DV7 O;  4NXM O;  5IT9 N;  1FYJ A;  4JV5 O;  2JRI A;  4JI6 O;  2DJV A;  1XNR O; 
#chains in the Genus database with same CATH topology
 2VWK A;  3DXR A;  1M90 W;  5JCO C;  1JPX A;  1GM9 A;  4TUY B;  3KCY A;  3AEI A;  3DC6 A;  4IHJ A;  2IH3 C;  3EXA A;  3OTO B;  1OCR C;  4WFH A;  2R9A A;  2Z3Y A;  4TUY A;  5LMU B;  4B3S O;  1IBL O;  1AJQ A;  3E8H A;  1WB8 A;  4X8A A;  1B06 A;  3E2E A;  4TWK A;  1IX9 A;  2RJZ A;  4J9Z B;  3RYH B;  4XBF A;  3T1H O;  1XL4 A;  5D5Q A;  1DGS A;  2ZNJ A;  4GT1 A;  4IT5 A;  3PN1 A;  3K06 A;  2Q0O C;  4NXN O;  4DR6 O;  4HBN A;  1XEQ A;  4AQY O;  5CN0 A;  1NVP D;  2UUC O;  1H2L A;  1YZB A;  4X66 B;  5LXT B;  3FYI B;  1Y67 A;  1UJW B;  3LSQ A;  3PJS K;  3H1J H;  1Q6I A;  1AVM A;  1OCO C;  5LXT A;  2IBZ H;  4BIO A;  3CHX A;  4DV4 O;  4O4J A;  1DTO A;  3OR7 C;  3RVZ A;  4DV0 O;  1ORQ C;  2RMK B;  4ZOL B;  5H5N A;  4NXM B;  4MS2 A;  1N8R W;  1V54 B;  2ZT9 B;  4QJF B;  3JCU Z;  4WFG A;  4U7N A;  3CPW U;  2GHY A;  3CRA A;  4JI4 O;  1HR0 O;  3Q4H A;  1VQ8 V;  4W4K A;  3D3Q A;  5DN6 G;  4H33 A;  3QO7 A;  4D7S A;  1M93 A;  2H94 A;  5JVD B;  5LGN A;  5LYJ A;  2JRI A;  4UCV A;  4JAV A;  4JI6 O;  4I4T A;  3A2F A;  5FNV B;  1AI4 A;  4DR1 O;  4IYH A;  5C93 A;  4KXR A;  4DV3 O;  5JVD A;  2ZIO A;  2LGQ A;  1JVM A;  3JAM N;  5KMG B;  3JAT A;  1EZV H;  2CTQ A;  3OTF A;  4D6T H;  4J80 A;  2X0L A;  1OV9 A;  3ASN B;  5L3F A;  2HEP A;  2F4V B;  1IZ3 A;  2X7R B;  2W0F C;  2ZXW B;  1UFI A;  3VQY A;  3T1Y O;  3L75 H;  2GV9 A;  4Z1V A;  3T4D A;  3UKM A;  1SQX H;  4UV8 A;  4J7J A;  1V55 C;  3TET A;  4CC6 A;  1WAZ A;  1S5L Z;  4K0K O;  1B6Q A;  1Q86 W;  3DTU B;  4CBC A;  1BSM A;  3AK3 A;  3ZED A;  1S5H C;  3S3X A;  1VP7 A;  4JI8 B;  4N23 A;  1EM1 A;  5EBM C;  5IJ0 B;  4BW5 A;  5LBQ A;  1YIT V;  5H6Q A;  2Q7E A;  1YHQ V;  3KZI Z;  5EYP B;  5B3S C;  4FFB B;  4NKG B;  1I94 O;  2EZO A;  4TT3 G;  2BTO A;  1N36 B;  2EIJ B;  3QO8 A;  5IJ0 A;  5DM6 V;  1L8D A;  3ABT A;  3O9O A;  5EYP A;  2AXT Z;  3BFR A;  4UCT A;  4JI2 B;  1Y76 B;  5J2T B;  2HHH B;  2A7W A;  2UXD O;  4LF6 O;  2JDI G;  4RWU A;  1X4T A;  4G2K A;  4F4L A;  2JIZ G;  4LF7 B;  1SQV H;  3FB6 C;  1XI1 A;  3BAB A;  1R73 A;  4RQE A;  1AB3 A;  3B8N A;  2IJK A;  5JCO A;  5KAI Z;  2XT9 A;  1FFT B;  3WB0 A;  2X6A A;  2WWW A;  1GAX A;  1KYO F;  5B1O A;  3HKE B;  1MSD A;  4O4I A;  3BA9 A;  4O2B B;  1K4C C;  5LP6 C;  3RYI B;  2GSM B;  4FVM A;  4MSW C;  2QWQ B;  3T1C A;  3CCV V;  4O2B A;  3THO A;  4XDL A;  4JTC B;  4JYY A;  4WCE V;  1R3J C;  3CJH A;  2PZS A;  4JZ2 A;  1SQB H;  4JI0 O;  3K57 A;  3OUF A;  1R6T A;  4PA9 A;  1TVK A;  2ODM A;  2Z0A A;  1FXH A;  2NN4 A;  3NR7 A;  1IBK B;  1OCO B;  2JS5 A;  3K04 A;  2C2A A;  1SA0 B;  4KFM A;  1K9M W;  1A32 A;  2JJ2 G;  2KQX A;  3E35 A;  3P3P A;  3AG1 B;  2B1G A;  2WA4 A;  2UXC O;  4JV5 B;  3OT7 A;  1NT2 B;  3ETD A;  4FFK A;  5H6R A;  5KHH A;  5LOV B;  2D2C B;  1N32 B;  5CA0 B;  4X20 B;  1PD3 A;  1M5I A;  1KEC A;  4X1Y B;  5IYC O;  4JF3 A;  3N2K A;  5CA0 A;  1QR8 A;  2UUA B;  4EB6 A;  4DV5 O;  3ETG A;  3OW2 U;  4X1Y A;  4DV7 B;  4JAU A;  4BIZ A;  3CCQ V;  2NNU A;  1KB9 F;  1R6N A;  4P9P A;  5D5P A;  1VQ5 V;  3RN4 A;  1P84 F;  1XNR B;  1I7F A;  5BY1 A;  4JTD B;  1SKV A;  1YI2 V;  4FIP C;  4YY3 B;  4LF8 B;  4XDJ A;  5TIS Z;  1GN4 A;  2ZM6 B;  4FLV A;  1Z2G A;  1B3Q A;  4K8Z A;  3LDC A;  2EIN C;  4RUF A;  2V4D A;  2XAQ A;  2WLN A;  1TUB A;  4DUY B;  2Q8V A;  3CCU V;  5KX5 B;  2Q4P A;  4QPK A;  2WLI A;  3VQW A;  2EIK B;  4PA3 A;  1Q81 W;  1ARO P;  1V55 B;  3E83 A;  2DOS A;  4I7Z B;  1K92 A;  4YJ2 B;  4BW9 A;  1JCH A;  2VWJ A;  5K1P A;  4DR3 O;  2QKA A;  4IYI A;  3FYE B;  4YJ2 A;  1W0K G;  1WJZ A;  3G80 A;  2XAJ A;  1J5E B;  5B3S B;  3HKD A;  3FD9 A;  3G71 V;  2EJ7 A;  4NVP A;  4DR7 B;  4AI8 A;  1FPO A;  5LMN O;  3C90 A;  4WFA V;  3ZN1 A;  3FAV A;  5IYB O;  1HW7 A;  1WN7 A;  2FML A;  1XHZ A;  4L8J A;  4JYA O;  2RDC A;  1R6K A;  1VF5 B;  1DF4 A;  5CBF A;  2VS0 A;  4CZZ A;  3SYP A;  1GN2 A;  4JYC A;  3CE2 A;  3CC4 V;  2P4K A;  4LF9 O;  1Q6U A;  1U96 A;  4JGS A;  2ITC C;  4DV6 B;  1VQK V;  5CA3 A;  3CCJ V;  4GKK B;  3CMA V;  4CH5 A;  2E3C A;  2YEV A;  2YIA A;  1BE3 H;  3B2E E;  2QTO A;  2UU9 O;  4OX9 O;  1K5S A;  3BA8 A;  1BT8 A;  3FB5 C;  5LP6 B;  4TV8 A;  1R3K C;  4CH6 A;  4OPA A;  3A0R A;  1XUQ A;  4ABM A;  5LP6 A;  4J7Z A;  3TXS A;  5IT9 N;  1XDC A;  4LH7 A;  2AW9 A;  3D3I A;  3AG2 B;  4FLX A;  5EIB D;  2W6I G;  3K08 A;  2LFR A;  2NLJ C;  2Q9L A;  4RAI A;  4CS4 A;  4JAA A;  1I5Y A;  3TXQ A;  4WFF A;  5CBG A;  1FFX B;  1IBM O;  4TV9 B;  5J9P C;  1PNL A;  3ZHS A;  1EZJ A;  1XNQ O;  2CK3 G;  1XOU A;  1ZL8 A;  2R70 A;  2EZP A;  2BOB C;  4J9Y B;  1KKD A;  2VQE B;  1PL0 A;  4YHH B;  4X9Q A;  1HNZ O;  3QNE A;  3CWB H;  2HG5 C;  2ILM A;  1H8H G;  1Y66 A;  4LNU B;  2OCH A;  5GTI Z;  1N33 O;  2QWR B;  1TUE B;  2DE0 X;  2YS8 A;  4FLY A;  4IL6 Z;  4YJ3 B;  1M4U A;  3ZCC A;  2KB1 A;  2GDS A;  1M9N A;  2YXL A;  3KCX A;  2CGN A;  3E8G A;  4YJ3 A;  4NTW A;  3SYC A;  4J41 A;  3CRM A;  4K8X A;  1GKF A;  3IAY A;  1AR1 B;  1GM8 A;  1FXV A;  1YTF B;  2WLL B;  4ZHQ B;  1G4Y B;  1X59 A;  3MAQ A;  3ZMS A;  4CH3 A;  4PJ0 Z;  3ZRS A;  5KAF Z;  1U97 A;  4B7K A;  5IJ9 B;  1AIL A;  2WA3 A;  3CCM V;  4MT8 A;  2XUM A;  1PV0 A;  2ZXW C;  1YEW A;  1IBL B;  1BS3 A;  2KG7 B;  3RW0 A;  4GKJ O;  2DYR B;  3GWK C;  2F95 B;  3CRC A;  4K3A A;  5LHI A;  3T1H B;  1Y74 B;  3K5N A;  2CH7 A;  2JK5 C;  4O4L B;  4PEL A;  2AHZ A;  4BAY A;  3SYA A;  1SES A;  3BVO A;  5B1N A;  2IJJ A;  4DR6 B;  4UCR A;  4J11 A;  1XRE A;  3L73 H;  2DW4 A;  3TJT A;  2ETN A;  4O4L A;  5KUK A;  3I55 V;  1Q5O A;  2DJV A;  2UUC B;  1YCI A;  1GMG A;  2UXB O;  3JYC A;  5B5E Z;  1AR4 A;  4HAM A;  3OGC C;  4JYB A;  1JX9 A;  1TA8 A;  3JAW B;  4E2L A;  4GLX A;  1ZUQ A;  1H38 A;  2EIJ C;  2QE7 G;  1O9G A;  4DV4 B;  4UFZ A;  4PD4 F;  4ICG A;  2GBO A;  2Y48 A;  4DV0 B;  1XHX A;  1F23 A;  1PL4 A;  2UUB B;  2ADP A;  4MVZ A;  1S77 D;  5AG2 A;  1Q90 D;  4PA4 A;  2IU3 A;  4JI4 B;  1US6 A;  1XMO B;  1JR9 A;  4B3R O;  2W6J G;  4LP8 A;  1NZ6 A;  5DED A;  1SS3 A;  4P30 A;  4KUM A;  3JCZ A;  2XAH A;  4I0X B;  2QA4 V;  5L3D A;  4JI6 B;  4FLZ A;  3RGB A;  3K79 A;  1THZ A;  5C8Y B;  4MVQ A;  3D36 C;  4H44 B;  2AHY A;  2Y0P A;  3CCE V;  4DRX B;  3RYH A;  4KHP O;  1G6U A;  2OYQ A;  3G6E V;  5C8Y A;  4LFB O;  3WFV A;  4GX2 A;  4CH4 A;  5BZB A;  2K9P A;  3FKS G;  4UXN A;  2ARH A;  2OIE A;  1IVS A;  2E76 B;  1AP5 A;  5E1A C;  3T1Y B;  3ZIA G;  3CXH F;  1SQP H;  3P3N A;  4J10 A;  2DQ3 A;  3B09 A;  3ZRV A;  3ZHQ A;  3OAA G;  3E22 B;  1K97 A;  4BIU A;  1VQL V;  3AG1 C;  2VQF O;  4X1I B;  4ZOL A;  2AZ0 A;  3UQ8 A;  1XMQ O;  3M99 B;  2YI9 A;  5ITZ B;  2ZR3 A;  3TCU A;  2LJ2 A;  2LW7 A;  2YSU B;  2JGD B;  1NH2 B;  2XTA A;  2FTK A;  3MDS A;  5ITZ A;  2WLH A;  3QF7 A;  4WF9 V;  1OZ0 A;  2H8P C;  2RN9 A;  3APO A;  2ZNI A;  4DW1 A;  2UXD B;  1CEZ A;  2B9Z A;  5EK0 A;  5BR8 B;  1CP9 A;  3J80 N;  1N4C A;  5FNV A;  4NTY A;  4FZ0 A;  5KHI A;  4DV2 B;  2DQ0 A;  1OCZ C;  1NJI W;  5KMG A;  1K73 W;  1SZT A;  1JJ2 U;  4B3M O;  1BQ0 A;  4FM2 A;  2YDE A;  1QLN A;  3GB7 C;  1Q3E A;  2PGG A;  4MVS A;  3AG3 B;  4UB6 Z;  3CD6 V;  5CBH A;  2EIK C;  4N21 A;  1BGY H;  4X66 O;  2YXH A;  2YC0 A;  4I9W A;  2QKS A;  1ZSP A;  1GRJ A;  5BXZ A;  3A8T A;  4JI0 B;  3OEE G;  5B66 Z;  2ZDI C;  3SR2 C;  2P67 A;  4IIJ B;  5HFM A;  4NR1 A;  4H37 A;  4LC1 A;  2LQT A;  4JI7 B;  4XDK A;  3B4S A;  4NXM O;  3AG4 C;  3OUS A;  2L6L A;  2HVK C;  4PDR A;  3T4Z A;  4GX5 A;  4FFB A;  4DO2 A;  2JEU A;  3TGU H;  2ITD C;  3I56 V;  1WP7 A;  3RBZ A;  4X62 B;  2WSS G;  3AK2 A;  2UXC B;  2M7W A;  3CCR V;  3ZMT A;  1Y76 A;  5J2T A;  1NTK H;  3STL C;  5F2V O;  4LFA O;  3WU2 Z;  2L35 A;  3BY6 A;  4NB5 A;  3DGE A;  2N05 A;  1YSC A;  2JEX A;  4ZIB A;  1KQS U;  1MOF A;  1K7D A;  3ABK C;  4CS3 A;  1HWY A;  2F43 G;  5J2U B;  2PTM A;  4DV5 B;  3VBB A;  3OM3 B;  1JFF B;  3H1K H;  4NYK A;  4IGG A;  3GVM A;  4LBE C;  1K8A W;  1OHH G;  1BZK A;  3HKE A;  1JFF A;  2R9R B;  1BQZ A;  4WFE A;  3EVK A;  3RYI A;  5JQG B;  3D36 A;  1LUV A;  4LF5 O;  3SGI A;  3AG2 C;  1CPY A;  1NU1 H;  5CA1 B;  5A2Q N;  1ZTE A;  4GYC B;  4X64 B;  2IH1 C;  3JD2 A;  3ZRW B;  1S0V A;  3B8M A;  3CC7 V;  5CA1 A;  1D5A A;  2Y69 C;  3BRC A;  4LFC O;  3HR0 A;  1K33 A;  3ZRW A;  1G1X B;  3FFQ A;  1VF6 C;  4PV1 B;  4JI8 O;  3ML0 A;  4OGQ B;  2P22 C;  4MVU A;  1M1K W;  1SA0 A;  1MNG A;  1M56 C;  2R9I A;  4DR3 B;  3K9A A;  3ZHR A;  4BWA A;  3RYC B;  2H3O A;  3DSQ A;  3I5D A;  4ASU G;  2A9H A;  3LDD A;  5LOV A;  1VMG A;  5H9C A;  4X20 A;  1NBM G;  2K1E A;  4FMT A;  3RYC A;  5LMN B;  5B1B B;  2Q67 A;  1F4N A;  4MW8 A;  1AJN A;  3CME V;  1YF2 A;  4KL1 A;  1N0J A;  1TGO A;  1KP2 A;  3ASO B;  2WLJ A;  3BPZ A;  3P32 A;  1H2N A;  5IYD O;  4JYA B;  2LFS A;  1W59 A;  2GTS A;  2DN9 A;  4YXW G;  2XOK G;  3T2M A;  2OIG A;  3N2G B;  5B1A C;  5EC1 C;  4R6Z A;  1OCZ B;  1YVW A;  4EFB A;  4MW3 A;  5BMV B;  4JI3 O;  3E8B A;  4Q6G A;  1QR9 A;  3HB3 B;  5H2F Z;  4C7U A;  4LF4 B;  2DYR C;  2UU9 B;  3JSL A;  2MW2 B;  1I5X A;  3JAL B;  2P90 A;  1XQ8 A;  1WPB A;  1MA1 A;  5KX5 A;  2DWE C;  5L3E A;  2W0X A;  2VRZ A;  2ZQM A;  3G6B A;  4FJC C;  1RPR A;  3E8F A;  2PI5 A;  4MTO A;  1IBK O;  4PHZ A;  4BR6 A;  3FB8 C;  1P7B A;  1ROP A;  1FAF A;  1G8M A;  3X2Q C;  1ZWI C;  4FK5 C;  1GN6 A;  2BSK B;  5KHG A;  2ZDI A;  2FB5 A;  3TK1 A;  3ZN0 A;  3AG4 B;  1XNQ B;  5DEC A;  2CDY A;  2BCC H;  3ZMU A;  1N32 O;  2QWP B;  1KC8 W;  3SJQ C;  4R8C A;  5GON B;  4JAS A;  3CXC U;  3QO5 A;  1HNZ B;  4JI1 O;  3CRR A;  3ABU A;  1GM7 A;  3W7U A;  4JI5 O;  2EUL A;  1YXB A;  1VQP V;  1HDJ A;  1N34 O;  1PPJ H;  4DYL A;  3FX7 A;  2EIM B;  4UVB A;  2P4V A;  3LSU A;  1N33 B;  3LNM B;  4DV7 O;  1QVG U;  2ADQ B;  2P7T C;  1YIJ V;  1SER A;  2CUG A;  1H2G A;  2HP8 A;  4CC5 A;  1Y4M A;  2LW1 A;  3ABK B;  1KBH A;  1XBL A;  4HNA B;  2A0L A;  1XNR O;  3OEH G;  3WB2 A;  1PNM A;  4FM0 A;  1UPG A;  5JH7 B;  4HNA A;  2Q68 A;  4DR2 B;  2LP7 A;  3SJA C;  4LF8 O;  4NTX A;  3BAA A;  2ZM6 O;  4FM1 A;  3MHS C;  3M8A A;  5JH7 A;  3LDE A;  1QQC A;  4UUJ C;  3RWR D;  2Y4T A;  4DUZ O;  4DV1 B;  4DUY O;  1HNW B;  1HNX O;  1I08 A;  1NKD A;  1XL6 A;  2EBO A;  1OJH A;  3WG7 B;  1E79 G;  1SC5 B;  1L0L H;  2Y69 B;  3IGA C;  3K5M A;  4LWS B;  4B3T O;  1GK9 A;  4ZI7 B;  1WA8 B;  1QLE B;  1FFX A;  2IU0 A;  4TV9 A;  4DK0 A;  4DR5 O;  5L3B A;  3OD4 A;  3ZJZ A;  1QVF U;  5LGU A;  1J5E O;  2QTS A;  1WA8 A;  4RO2 A;  1SF9 A;  1M56 B;  4UCO A;  4PI0 A;  3ZRX A;  2UXB B;  1NTZ H;  1B04 A;  1OCC C;  3K59 A;  3ETQ A;  1F51 A;  1JQ0 A;  3E86 A;  2D3O W;  4LNU A;  4K35 A;  1JMK C;  4I5S A;  1SQF A;  3UCS C;  1SZX A;  1PKX A;  1BHA A;  3O65 A;  1MAB G;  2GUZ B;  4Q20 A;  3CB2 A;  2CTP A;  4LCU C;  4RUE A;  4F6R B;  3H1I H;  3FB7 C;  5IY5 C;  2GUZ A;  3JAS B;  3B40 A;  3F7V C;  5B1A B;  1NVP B;  4MTF A;  4F6R A;  3K3W A;  4B3R B;  1FYJ A;  4PDV A;  1LR1 A;  3JAS A;  2WLL A;  4ZHQ A;  1WPX A;  2Q7G A;  3HKC B;  4AHC A;  2ZIM A;  5JJE B;  1N0N A;  2OCC B;  5IJ9 A;  4B3S B;  2BOC C;  3NXS A;  2RCV A;  2PYJ A;  3K0G A;  1K4D C;  1YJW V;  3M7M X;  3AG3 C;  3LUT B;  4WFB V;  4DK1 A;  4OPH A;  1W0J G;  2KG7 A;  2Z5U A;  3IFX A;  2A06 H;  3APQ A;  4KHP B;  4NXN B;  1Y74 A;  2AZ2 A;  3L74 H;  4AQY B;  1BCC H;  4LFB B;  3KG2 A;  2QDO A;  1JOY A;  1GH6 A;  2QJ1 A;  3OR6 C;  5CMU A;  3CEI A;  3K58 A;  4YIP A;  3X2Q B;  3J7A U;  1VAR A;  1VQN V;  2JGU A;  5IWA O;  2BTQ B;  2VQE O;  2B5U A;  1FXK B;  2G38 A;  4Z2W A;  3SJB C;  3OMN B;  2P5O A;  3ABM B;  3JAW A;  4I9Q A;  3RYF B;  1AI5 A;  1O9H A;  3N27 A;  2FL4 A;  2BTQ A;  3RT3 C;  1F4M A;  3QVN A;  3AG7 A;  1QCE A;  5L3G A;  2QGN A;  2VQF B;  1RM1 B;  3RYF A;  3CRQ A;  3VQX A;  1HR0 B;  3CC2 V;  3HKB B;  3STZ C;  2R72 A;  4G28 B;  1H2M A;  5KA6 A;  5EBL C;  2FYU H;  4B08 A;  4IHJ B;  3HKB A;  1VQO V;  2CTR A;  3SPJ A;  4DR1 B;  1AJP A;  4DV3 B;  2UXN A;  1GN3 A;  2ZIN A;  1IDS A;  4I0X A;  5FPO A;  3SYQ A;  5LL6 Y;  1Q43 A;  1MZF A;  1R3L C;  4PI2 A;  4TQF A;  2Q6A A;  2Q73 A;  3JSN A;  2EX3 A;  2E74 B;  1JA8 A;  4GCZ A;  4DRX A;  2YXY A;  3EFF K;  1DF5 A;  2ZE6 A;  1FJG O;  1IXB A;  4DXW A;  4B3M B;  1YJ9 V;  1VQ9 V;  2WPD G;  3MD0 A;  4ZKI A;  1M57 B;  1YTF D;  4FPP A;  2ATK C;  2IM9 A;  3W7S A;  3RFR A;  5KA5 A;  2E5L O;  4H13 B;  5KHJ A;  1KUQ A;  2JJ1 G;  1RPO A;  4YIO A;  2E75 B;  5K1X A;  3DC5 A;  2NR5 A;  3K9S A;  4X65 O;  4O4J B;  3E22 A;  4K0K B;  1LUW A;  1D5N A;  3SDL A;  3JD4 A;  1LNQ A;  1OCC B;  1RFY A;  4UVC A;  4DR4 O;  1K5Q A;  1H8E G;  4X89 A;  2IJI A;  4X1I A;  1I94 B;  2QM4 A;  3AK1 A;  3H01 A;  3VOU A;  4R7C A;  1Z5W A;  2BE3 A;  5B1B C;  1VQM V;  1EN4 A;  3Q4H B;  3OFN G;  4O4H B;  2UUB O;  3OE7 G;  3UO3 A;  1QHT A;  4P2Z A;  2JGD A;  3ZX6 A;  2HR3 A;  3ASO C;  3ZMV A;  2F1M A;  3A0B Z;  4PDL A;  1XMO O;  4LF6 B;  4O4H A;  3E89 A;  5LYJ B;  3OTO O;  5IY5 B;  3ZMZ A;  4I4T B;  5LMU O;  4LFA B;  3WB1 A;  5EIB C;  1YJN V;  3JAT B;  4JZG A;  3MHH C;  2HJF C;  2A79 B;  1HP8 A;  1NR7 A;  1IXM A;  1BL8 A;  3D8C A;  3CYO A;  4I50 B;  2A3Q A;  3U0Z A;  3SPG A;  2WAM A;  4GX1 A;  3JD1 A;  2EIL B;  1E1R G;  1AI6 A;  4ZBM A;  4QE9 A;  3CX5 F;  1EFR G;  4I50 A;  1NTM H;  1BMF G;  1RP3 B;  5JJN B;  4HZ3 A;  4LF5 B;  4WBN B;  4J7K A;  1K34 A;  1SRY A;  1AR5 A;  3OMI B;  5GTH Z;  1GTO A;  4FZ1 A;  1FKA O;  2HLD G;  4WBN A;  4IIJ A;  2ZCE A;  5CB4 B;  2CGO A;  4LFC B;  1PNK A;  1VQ4 V;  2OTJ V;  3JAR B;  1Y6X A;  3L72 H;  1KD1 W;  2IW5 A;  4QPJ A;  3R65 A;  4PA7 A;  5CB4 A;  3JAR A;  4H0L B;  1S3J A;  2DWD C;  3U10 A;  4TOI A;  2X6C A;  4Z1M G;  3LNN A;  1T5E A;  2EIM C;  4QGP A;  4JTA B;  4OXS A;  4MTX A;  4X1K B;  2YIB A;  1SQG A;  1KMI Z;  4QIW F;  2QKC A;  1VEW A;  4X1K A;  3H1H H;  5BR8 O;  1WLE A;  4RQF A;  3L71 H;  5J2U A;  2OTL V;  4DV2 O;  2Q0A A;  1MG1 A;  2CE4 A;  3L70 H;  4O4I B;  1OCR B;  2F4V O;  1NH2 D;  3K5L A;  2F93 B;  1FD9 A;  1F7Y A;  2X6B A;  1ZX3 A;  1RSO B;  1CXZ B;  1NI8 A;  4JI3 B;  1JJO A;  5JQG A;  1MSW D;  3W7T A;  3IJ4 A;  5EZY B;  3WG7 C;  3CJH B;  4R50 A;  1RSO A;  3F5W C;  2WLK A;  1YDX A;  4X88 A;  5EZY A;  1TVK B;  1QLE C;  3JD0 A;  3G67 A;  1FS0 G;  2ZE8 A;  4UCU A;  2XAF A;  1W2B U;  1KKC A;  2ZE5 A;  4JI7 O;  2M6Y A;  3ZHU A;  2IJH A;  1N36 O;  1R1B A;  5A9G A;  3HPL C;  5FPR A;  1E1Q G;  4UCS A;  4TSF G;  4JI2 O;  1WP8 A;  2HHH O;  1URF A;  2V7Q G;  4X62 O;  1Q7Y W;  1QNM A;  3N2K B;  4LF7 O;  2DYS C;  3K5O A;  4QNH B;  5KLV H;  3SJC C;  3ZS8 C;  2PF4 E;  1KP3 A;  1ENV A;  4EB6 B;  1WB7 A;  2UXX A;  3SPH A;  4UB8 Z;  2O57 A;  2QSA A;  4JI1 B;  1S72 V;  4JI5 B;  4LH6 A;  3F5T A;  2Q5Z A;  1N34 B;  3S3W A;  5LGT A;  3W7X A;  2OWO A;  2LGW A;  4LF9 B;  4U3J B;  1VQ7 V;  4MVR A;  4MVM A;  1L0N H;  3UM7 A;  3N2G A;  4GX0 A;  4U3J A;  2V1D A;  2OCC C;  1K3E A;  1SQQ H;  2YIB D;  4OX9 B;  3BCC H;  4U7O A;  5BMV A;  2N04 A;  5IE9 A;  1PM9 A;  3UT5 B;  5IDJ A;  3ZHT A;  3CSX A;  3K03 A;  3JD3 A;  3ZHV A;  2CAZ C;  2HFE C;  2OT5 A;  3R66 A;  1TUB B;  1EN5 A;  2EJR A;  2XAG A;  2XAS A;  5L3C A;  3UT5 A;  1R3I C;  4X64 O;  3JAL A;  2WLI B;  3BHP A;  4DUZ B;  5EC2 C;  4G27 B;  1HNX B;  1H2S B;  5EBW C;  1D2D A;  3J81 N;  4PDM A;  1Q6H A;  1QU7 A;  3P30 A;  1IBM B;  1VIB A;  1FXK C;  5IYZ B;  1P7G A;  5JWP A;  4PA6 A;  4JV5 O;  3ABM C;  4B3T B;  2BSK A;  3H9V A;  3HKD B;  1S76 D;  2QM7 A;  5IYZ A;  4DR5 B;  1EBO A;  2FKX A;  1QBZ A;  3FAV B;  1RM1 C;  4EEQ A;  5GON A;  2PUS A;  1Q82 W;  4E4E A;  1NR1 A;  5KUM A;  2UUA O;  4CS2 A;  1Z5V A;  4KP4 A;  1XIL A;  3ABL C;  1MZE A;  2PYL A;  5KHK A;  3G4S V;  1DLB A;  3ZBH A;  4AIL C;  4W4L A;  1BHB A;  4EKW A;  1I0H A;  2HJD A;  1ZLZ A;  4YY3 O;  2YI8 A;  2HKO A;  2YEV B;  2KSD A;  4UV9 A;  1J95 A;  1EN6 A;  3BEH A;  4D7T A;  2ZR2 A;  1DK1 A;  3ETE A;  2JVD A;  2F23 A;  3C3T A;  1VF7 A;  4TV8 B;  4LF4 O;  1WNS A;  2N74 A;  3ICX A;  4TQD A;  4GKJ B;  3OMA B;  3A0H Z;  3RVY A;  3LSS A;  1M57 C;  2RQ6 A;  2QWN B;  2P6J A;  3CP1 A;  4J42 A;  2B1I A;  4HYO A;  2ZKO A;  4L87 A;  4U3F H;  4MVO A;  3UO2 A;  2YIC A;  2QEX V;  4FLU A;  4GUN A;  2XND G;  2QM8 A;  2AGA A;  1VQ6 V;  3L9D A;  2PI4 A;  4LWS A;  3B77 A;  3W7W A;  4ZI7 A;  5E79 Z;  1ZL8 B;  4MTG A;  1VF6 A;  4DR7 O;  3C3S A;  2KKW A;  1S5J A;  3QG5 A;  3K0D A;  1L1F A;  5LA6 B;  5IWA B;  1KU9 A;  2QR4 A;  5LHH A;  5GW7 A;  1MMM A;  2Y0I A;  1V54 C;  1SET A;  3SPI A;  3CCS V;  2LO1 A;  5LA6 A;  2DYS B;  4GZR B;  2YID A;  1H2K A;  4DV6 O;  4EFE A;  2PY5 A;  4A5U B;  4GKK O;  4JPR A;  2F66 C;  2GTA A;  2DMX A;  2HVJ C;  2QWO B;  2RNB A;  3F7Y C;  4DW0 A;  1AI7 A;  3QTC A;  4DR2 O;  2WLM A;  4FLW A;  3IC7 A;  1AP6 A;  4FLT A;  1P4R A;  3GWO A;  3HKC A;  5JJJ B;  2XHB A;  5LHG A;  4DV1 O;  1HNW O;  2EIL C;  2Y4U A;  2ZD9 A;  2P06 A;  3ASN C;  5HFL A;  2EIN B;  3H1L H;  3IC9 A;  2CH7 B;  3SPC A;  1GO3 F;  3CS5 A;  1P49 A;  3VQV A;  1FJG B;  4UVA A;  4LR3 A;  4O2A B;  1PP9 H;  3OGI B;  4F6E A;  4YHH O;  4QE7 A;  4O2A A;  3CCL V;  2E5L B;  3KKY A;  4B7E A;  1COW G;  1FXK A;  5FL7 G;  1NS1 A;  4P9O A;  3EHB B;  4X65 B;  2CTW A;  3U11 A;  3JAK B;  1TAE A;  2ZE7 A;  2JS3 A;  1ZAU A;  5FLX N;  1XMQ B;  4I55 B;  3SYO A;  4DR4 B;  3JAK A;  3DXR B;  1Q8I A;  1NQT A;  1IUR A;  3ABL B;  2Q7H A;  4I55 A;  2MK3 A;  2Q69 A;  2YUA A;  1V9P A; 
#chains in the Genus database with same CATH homology
 2UXB O;  2VQF O;  4DR1 O;  1FJG O;  4JI7 O;  4DV3 O;  2FKX A;  1XMQ O;  1N36 O;  1R1B A;  1IBM O;  4DV6 O;  4LF8 O;  3JAM N;  2UUA O;  1FKA O;  4A5U B;  2ZM6 O;  4OPH A;  4LFA O;  4GKK O;  2LW7 A;  1XNQ O;  2DOS A;  3M8A A;  4JI2 O;  2E5L O;  2HHH O;  1KUQ A;  4B3S O;  4JI0 O;  4DUZ O;  4JI3 O;  4X62 O;  1IBL O;  4DUY O;  1HNX O;  1R6T A;  1HNZ O;  4DR3 O;  4X65 O;  4LF7 O;  3T1Y O;  3T1H O;  4DR2 O;  3SDL A;  2Z0A A;  4YY3 O;  1N33 O;  3J80 N;  4DR4 O;  3J7A U;  3F5T A;  4NXN O;  4DR6 O;  1DK1 A;  5IWA O;  2VQE O;  4B3R O;  5LMN O;  1XEQ A;  4AQY O;  4DV1 O;  4B3T O;  1A32 A;  1HNW O;  2UUC O;  1YZB A;  4LF5 O;  4LF4 O;  4K0K O;  4DR5 O;  2UUB O;  2UXC O;  3RT3 C;  5A2Q N;  1J5E O;  2N74 A;  4B3M O;  4JYA O;  1IBK O;  5BR8 O;  1XMO O;  3OTO O;  4DV2 O;  1I94 O;  4DV4 O;  4LF9 O;  4LFC O;  1X59 A;  2ZKO A;  4KHP O;  4DV0 O;  5LMU O;  4X66 O;  2F4V O;  3R66 A;  1AIL A;  1G1X B;  4DV5 O;  4LFB O;  5H5N A;  4YHH O;  5BXZ A;  1F7Y A;  4JI8 O;  4X64 O;  1N32 O;  2AGA A;  3O65 A;  2UU9 O;  4OX9 O;  2UXD O;  4LF6 O;  4GKJ O;  1NS1 A;  4JI1 O;  1D2D A;  4JI5 O;  5BY1 A;  4JI4 O;  4DR7 O;  3J81 N;  1HR0 O;  4OPA A;  1N34 O;  5LL6 Y;  5FLX N;  1AB3 A;  4DV7 O;  4NXM O;  5IT9 N;  1FYJ A;  4JV5 O;  2JRI A;  4JI6 O;  2DJV A;  1XNR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...