1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
1NS1A 2HHHO 4JI3O 1X59A 4JI7O 4JYAO 4DV2O 1IBMO 4B3SO 4DR4O 5H5NA 2UXCO 4JI2O 3F5TA 2UXDO 4JI4O 1N32O 4JI0O 4DV1O 4DV7O 1KUQA 4JI8O 4X66O 4DUZO 4NXMO 5LMUO 1J5EO 1N36O 4LFAO 1AB3A 3OTOO 5LMNO 1D2DA 3J80N 2LW7A 2UUBO 4AQYO 1IBLO 4B3MO 4B3RO 1N33O 1HR0O 2VQEO 4LF5O 1R6TA 3JAMN 4LF9O 4YY3O 5FLXN 1XNQO 2UUCO 4LF6O 3J81N 4K0KO 2UUAO 3RT3C 4DV5O 3O65A 1F7YA 4KHPO 2UXBO 4JI6O 4A5UB 3J7AU 5LL6Y 4DR5O 4GKKO 4DR2O 4JI1O 5BY1A 3T1HO 2F4VO 2UU9O 4B3TO 4DV4O 2E5LO 3SDLA 4OPAA 5IWAO 4DUYO 4GKJO 1FJGO 1R1BA 1HNWO 2JRIA 4DR3O 2ZM6O 4X62O 1XNRO 2VQFO 4X64O 3R66A 1AILA 1XMOO 1DK1A 4OPHA 5BR8O 4LF7O 4DV6O 1XEQA 1FYJA 4LF4O 4X65O 4NXNO 4DR6O 5A2QN 1IBKO 4YHHO 2FKXA 1XMQO 4LFCO 1A32A 4DR7O 1G1XB 5IT9N 2DOSA 3M8AA 4DV3O 3T1YO 4LFBO 2Z0AA 2ZKOA 2AGAA 4DV0O 1YZBA 2N74A 1N34O 4JV5O 2DJVA 1HNXO 4OX9O 4LF8O 1FKAO 1HNZO 4JI5O 4DR1O 1I94O 5BXZA
chains in the Genus database with same CATH superfamily
1NR1A 5L3DA 1THZA 2F1MA 2V1DA 3K9AA 3L73H 1P4RA 2IJJA 3CRQA 2ZR2A 3FB5C 3H9VA 1QQCA 2JGDA 3F7VC 1YHQV 1W0KG 1XMOB 4PA7A 2QGNA 2RNBA 4JI6B 2CH7B 5KX5B 2FYUH 1JPXA 3RYCB 4MVZA 3CCEV 1J5EO 1O9GA 4LFAO 3BFRA 4ZI7B 1N33B 3CCRV 3ZN1A 2CK3G 2WLIA 3CCMV 3SYPA 5EZYA 1NJIW 1JR9A 4R7CA 3JD2A 2PI5A 2R9RB 2JS3A 3A0HZ 1EN4A 2PGGA 2C2AA 3T4DA 1IBMB 1K3EA 5EZYB 4CH4A 1VF5B 4DK1A 2XAQA 3N2GB 1HDJA 5K1PA 3FB7C 1XI1A 1OHHG 3H1KH 2KB1A 1S3JA 2JRIA 4DR3O 1JMKC 2CH7A 4MW3A 4X64O 1QLNA 5H9CA 4JGSA 2P5OA 1U97A 1TVKB 1OCZC 3RFRA 1B6QA 1Y4MA 5LYJB 1YTFD 1LUWA 4BR6A 3K5NA 2ZCEA 3CRRA 1WP7A 1IBKO 4PHZA 2N04A 3SPHA 1XMQO 4LFCO 1LR1A 1EZVH 4MTGA 4GX1A 2DOSA 1GM8A 1N32B 3JALB 2GBOA 2V4DA 1Q81W 4TQFA 3AK1A 1L8DA 4TV8B 3BABA 2JJ2G 1IXBA 3K0DA 5HFLA 2AZ2A 1GM7A 4RAIA 3L70H 3ABUA 3BA8A 2QWPB 4DR2B 4DW0A 3G71V 3W7SA 1DF4A 4O2BB 4FFKA 2XUMA 4DV7O 1KUQA 2Q73A 3E8GA 2QWQB 4KUMA 3A8TA 3KKYA 3MHHC 3E89A 3WB0A 1KBHA 1SERA 2W6IG 2QKAA 1DTOA 1M9NA 1SQBH 3ZHUA 1Y76A 1QNMA 3T1CA 2JGDB 4O4LB 4MVOA 3UT5A 3RYIB 5DECA 5EK0A 4K0KO 3RYCA 3MAQA 1M56C 3L74H 4W4LA 1KQSU 1JOYA 2QTOA 4DR2O 4I9QA 2DYRC 4ZOLA 1K9MW 5JCOC 2OTLV 5FPOA 1M56B 3SDLA 5IWAO 1H2LA 4P2ZA 1S77D 1VQMV 2HR3A 4IHJB 1H2KA 5B5EZ 4X20B 3SYQA 5ITZA 3UKMA 5CA0B 1E1QG 3S3XA 3OFNG 1YTFB 2YEVB 4DR6O 1NTMH 1BS3A 1Z5WA 2WPDG 1D5NA 4YHHO 4FMTA 3UCSC 5LXTA 4FFBB 3K3WA 3T1YO 1QR8A 4KHPB 4MVRA 1S5HC 1TUBA 3CB2A 2N05A 1HNXO 4OX9O 3G80A 3ASNC 4FJCC 4UB6Z 3ASOB 4DV5B 1H2MA 4H13B 4JI3O 1ROPA 2QKCA 4U3JB 2H8PC 2DWDC 1Q6IA 2IJHA 5KUMA 2JGUA 4K8XA 1OCCC 3P30A 3HKCA 4B3TB 4C7UA 2ADQB 4X8AA 4CS3A 1XBLA 5JCOA 3OTOB 4DUZO 4RQEA 2EBOA 3OAAG 2QKSA 2QA4V 3J80N 3U0ZA 2A0LA 2ITCC 5D5QA 1XQ8A 4IIJB 5KHKA 4DV2B 4MVQA 1QBZA 1KKDA 2AHZA 3DGEA 3RYHA 1VF6A 5KMGA 2ZIMA 2DW4A 3RVZA 3UO3A 3OW2U 3BHPA 1L0LH 2XASA 3OTFA 3J7AU 4DR5O 4HNAA 3AG1C 2WLKA 4WFHA 2Q67A 2ZD9A 4LBEC 5EBMC 5FL7G 2ZDIC 1Y76B 3FYEB 1GK9A 4DR1B 5B66Z 3W7WA 3BEHA 3SR2C 1N0JA 4MTFA 1XUQA 2Y69C 3N2KB 2UXDB 2Q4PA 1K7DA 1Q6HA 1GKFA 1XOUA 1VQNV 3JALA 1VQ5V 4O4LA 1FAFA 1JVMA 4I4TB 1UJWB 4X88A 2IJKA 4XDJA 4UVCA 2Q7HA 3SJAC 5LOVA 1VQ6V 4EB6B 1AI4A 1XILA 2ODMA 3K79A 1ZL8A 4N21A 3RW0A 1US6A 4JV5O 1P7BA 1CEZA 4B08A 1FKAO 2ZIOA 4DR1O 1JCHA 4X89A 3ZRWA 1XHZA 4NYKA 4O2BA 2ZE6A 2EZPA 3CC2V 2P6JA 1N4CA 5BR8B 3T1HB 1ZL8B 4FZ1A 1GMGA 3C90A 3HKBA 2W6JG 2NNUA 1WNSA 3DSQA 1R3IC 3OE7G 4O2AB 2XAFA 3UQ8A 2Y48A 1I0HA 1QLEB 3RYIA 4NB5A 4B3RO 1WA8A 2LO1A 1RFYA 1YVWA 1PL4A 2QWRB 3W7TA 1NTKH 2RJZA 1SQPH 3ZMTA 3CC7V 1S0VA 2EINB 3U11A 2YIDA 1XL4A 1HNXB 5CA3A 2LFRA 3SPJA 4UV8A 1Q90D 1F4NA 5KHIA 2UU9O 1YITV 5L3CA 2P22C 2ZNJA 2H3OA 3JD0A 4UCRA 3K57A 5JQGB 3G6EV 1FFXB 2PYJA 3CPWU 1AR5A 4MVSA 5KMGB 4JI7B 2EX3A 3ZRSA 1ZLZA 2WLLB 1I08A 3R66A 2ZNIA 1YJWV 2GDSA 3QO7A 1M90W 4BW5A 3FFQA 1KB9F 3FKSG 2M7WA 2Y0IA 1FJGB 3K5OA 1KECA 3CRAA 4BAYA 1HWYA 4NXMB 3VQYA 4DR7O 1PP9H 2JIZG 5LHGA 3JAKA 3TGUH 1S72V 4XDKA 2DJVA 1WP8A 4JI5O 1SC5B 2DYSC 1I94O 2EJ7A 2AW9A 3L75H 4NKGB 1YIJV 2A9HA 3RGBA 1PM9A 4BW9A 4GZRB 4JAAA 4AQYB 2YI8A 1V9PA 4FIPC 5LA6B 4PA3A 3ABLB 3AG3C 5EYPB 1VQOV 2HHHB 2YDEA 4PA4A 1I5YA 4JI4O 4HNAB 4GKKB 2X6CA 1OCZB 4JI1B 4NXMO 4Z1MG 1PNMA 3T2MA 2KKWA 3QO8A 1S5JA 2ZT9B 1ZSPA 1MZEA 4K3AA 1AROP 1SESA 3THOA 2IM9A 2XT9A 3JAWB 4LF9O 2ZXWB 1YSCA 2YICA 1CP9A 4ASUG 3C3TA 3O9OA 1V54B 4GKKO 2LJ2A 4JI1O 3B8MA 2P06A 4ZHQA 2WLHA 2YS8A 5IYZB 4OPAA 4RUEA 4JI4B 2GUZA 1K97A 3G67A 2F93B 3RWRD 2FL4A 4UUJC 3ZN0A 3SJQC 4UB8Z 1YXBA 4CH6A 5GONB 2AZ0A 3ZHTA 1JJOA 3B4SA 1BCCH 1AILA 4X65B 4J41A 2YXYA 4P30A 1PD3A 2JDIG 3OUSA 3G6BA 2F43G 3OEEG 1QCEA 4I55A 4UV9A 5H6RA 3JCZA 1V55B 2ZE8A 1IBLB 5IT9N 3QF7A 4LFBO 2XNDG 2Q7EA 3M99B 2AXTZ 3VBBA 1B04A 4O2AA 4WBNB 4FPPA 2XAJA 2WWWA 5IY5C 1NS1A 2KG7A 1DGSA 1X59A 2HLDG 2PI4A 4JI7O 4JV5B 2OCCC 3STZC 1IBMO 1BT8A 2B5UA 3ZJZA 1OCRB 2UUAB 3D3IA 1BE3H 4YJ3B 4NXNB 4DV3B 3ZRVA 2JS5A 5LBQA 3B2EE 2H94A 4BIUA 3H1IH 1N33O 3AG2C 1SKVA 4WCEV 1F4MA 1IDSA 3IJ4A 3Q4HB 1SETA 4FLYA 1H2GA 1KMIZ 3ZHVA 4FLZA 4NVPA 3BA9A 5ITZB 1MMMA 2Q0OC 1GN4A 1NTZH 3E8FA 3ZCCA 4B3SB 5JJJB 2Y0PA 3JSNA 4R50A 3AG1B 4H44B 3FAVB 3IAYA 4B3RB 3ZMZA 3LNNA 5KHGA 2ITDC 3APOA 3EVKA 5IYDO 4OGQB 4X62O 3JARA 1ENVA 4RUFA 3A0BZ 3GB7C 2BCCH 4TV8A 3B77A 2W0FC 2CTRA 2CUGA 2RMKB 4CS2A 5IJ9A 3W7UA 1GH6A 5IDJA 3IC7A 5TISZ 3D36C 3E22A 1YEWA 1KC8W 4JPRA 4FLUA 2Z0AA 3VQVA 1T5EA 4K8ZA 4X64B 4PI2A 1YZBA 5LHHA 1N34O 4EEQA 3MHSC 4FVMA 3LDDA 3E86A 1S5LZ 3N2KA 2A7WA 1PPJH 1M57B 3VQXA 2IU3A 5BXZA 1SRYA 2VQEB 4DO2A 3A2FA 1RM1B 4MS2A 3RBZA 5IYCO 2LW1A 1M57C 3DXRB 1W59A 2P67A 4IYHA 4JI2O 4BIOA 2UXDO 3ZS8C 2UXNA 3AG2B 3ETDA 4LF4B 2QSAA 5LGNA 4FLXA 4BIZA 4F6EA 1RPOA 3N27A 3ML0A 3CX5F 3ZHSA 3JAWA 3CXHF 4AQYO 4HAMA 1K8AW 5EC1C 3RYFB 1IBLO 4R6ZA 1FXHA 1CXZB 5LP6A 3QG5A 2BSKB 4O4JB 4DR4B 4TUYA 3SPCA 4DRXB 2WLIB 1B06A 3JCUZ 2HP8A 2QM4A 1WN7A 4FLTA 3SYCA 1R3JC 4CH5A 3ABTA 5LL6Y 3I5DA 1TUEB 5JQGA 4UCSA 2OWOA 2OIGA 3K0GA 1QU7A 1FJGO 1WPXA 5J2TA 1JA8A 1SF9A 4AILC 3JD1A 4UXNA 3CCQV 3FD9A 4ICGA 2VQFO 1EM1A 2CE4A 4OX9B 4K35A 1NBMG 4OPHA 3E35A 4LF7O 1TUBB 3P3NA 5J2TB 1KP2A 1NZ6A 3U10A 3TETA 5LA6A 5HFMA 3NR7A 1MA1A 4CBCA 2YI9A 5JWPA 4CC6A 3FB8C 1M5IA 4CS4A 2O57A 4J9YB 5LMUB 2LP7A 4J7KA 5KX5A 4PJ0Z 5KHJA 2QR4A 1UFIA 4JF3A 3P3PA 3E8HA 3WFVA 4F6RB 3ABMC 3RYFA 1BZKA 1WAZA 5CA1B 1YJNV 2OIEA 1NT2B 2HHHO 2IW5A 4TUYB 5E1AC 4JZGA 2X6BA 4J7ZA 2UXCO 3JASA 1KP3A 4KL1A 4JASA 1N32O 4UFZA 4DV1O 2ARHA 4I0XB 1WB7A 2JK5C 3JAKB 1XMQB 4EKWA 4GT1A 5IJ0B 1R3KC 3SJCC 2YXHA 1VF7A 2XAGA 2PUSA 1K4CC 5CA1A 4D7TA 2EIKC 4DXWA 3STLC 3KCYA 2VS0A 5FNVB 3CP1A 1P7GA 2UXBO 4LP8A 3TJTA 4YIOA 1Q7YW 1AI5A 4WFBV 4F4LA 5IJ9B 1N34B 1AP5A 3SPIA 1SQGA 1WA8B 2IJIA 4DRXA 1BGYH 1HNWO 1BL8A 1M1KW 4I50A 2UUCB 4MVMA 2WA3A 4DV7B 1FXKB 3EHBB 4BWAA 2A06H 1WLEA 4IYIA 2B9ZA 1MG1A 1QR9A 1Y6XA 4B7KA 4DYLA 1OCCB 4O4IB 1HR0B 4MW8A 1PNKA 2PY5A 3PJSK 5KAFZ 2DE0X 1V54C 2F66C 3ZHQA 5B1AB 1AR4A 4MTOA 2MW2B 1YDXA 2LQTA 3L72H 5BZBA 5LP6B 2ADPA 5H6QA 4U7NA 3WB1A 3OM3B 3BAAA 3OMNB 3BPZA 4QE7A 1KD1W 2OCHA 2BTQA 1SQVH 4TQDA 4X66O 4RWUA 3LSSA 5DN6G 1BMFG 2GTSA 1I7FA 3NXSA 1E1RG 3IFXA 3JASB 3JD3A 3ZHRA 3D36A 3OT7A 3UO2A 1MOFA 2CGNA 5EC2C 5LHIA 3B09A 3RVYA 5J9PC 1RM1C 2PF4E 4HBNA 4LFAB 5B3SC 1QVGU 4LF9B 4KHPO 4DV6B 4LH6A 2ZM6B 4JI6O 1SZTA 3T1YB 4NR1A 2F95B 4WFGA 4DV0B 5JJNB 3QNEA 2HJDA 2W0XA 4DV4O 2DYRB 4PDVA 1NH2B 2NN4A 4H33A 3LDCA 1AJPA 3APQA 3JATB 4TWKA 3AK2A 3CMAV 5J2UA 1NVPD 4LF6B 5BMVA 4X1IA 3HKCB 2ZE7A 5DM6V 1EBOA 4X65O 3X2QB 3JYCA 4ZIBA 4GUNA 3SYAA 1SQXH 5A2QN 1KKCA 2LFSA 1XNQB 4JTDB 3WG7C 1FFTB 1OCRC 5JVDB 2LGQA 3CRMA 2ZINA 4NTYA 2BTOA 2E75B 1F23A 4DV0O 4J11A 1L0NH 4LNUA 5B1BB 2Q69A 2NLJC 2IBZH 4J80A 3ETGA 4TV9B 1VQ7V 1FS0G 1K34A 4QPKA 2E5LB 3CJHB 3CSXA 3CCUV 4Q20A 1X4TA 2E74B 1CPYA 4JYAO 3JD4A 4ABMA 2ZDIA 1LUVA 5L3BA 4LF5B 3BRCA 1MSDA 1P84F 3DC6A 4UVAA 2UUBO 3QVNA 2Q0AA 4GYCB 1VQKV 3DXRA 1XNRB 2GUZB 4LF5O 3AG4C 1TVKA 4G2KA 2DQ0A 4YY3O 4JTCB 3B40A 1NKDA 3O65A 1F7YA 3DC5A 4O4IA 4LFBB 1JX9A 3HKDB 3LUTB 1Q86W 1Q43A 1NVPB 3T1HO 1AI7A 4CZZA 2EIMB 4ZBMA 1SA0A 4KP4A 4DR7B 3CE2A 1XNRO 5CBHA 2Q6AA 2P7TC 2JJ1G 1Q3EA 1DK1A 3WG7B 3ETEA 3OGIB 5BR8O 3ZEDA 3K9SA 4RO2A 1ZTEA 3CS5A 1HNZB 1VQLV 4NXNO 4PA9A 1G8MA 2FKXA 3ZRWB 1HNWB 3N2GA 2MK3A 4JI8B 5KUKA 4GLXA 2N74A 2OT5A 4ZKIA 2RCVA 4Q6GA 1SS3A 2Z3YA 2QEXV 4JYCA 1IZ3A 3LNMB 1SA0B 2XHBA 4LH7A 3AG7A 5IJ0A 4L8JA 2Q9LA 4JYYA 4FM2A 2ZXWC 2EINC 1XL6A 2RQ6A 2UXXA 4I5SA 4JI8O 2D2CB 4IL6Z 2ILMA 4FZ0A 2EIJC 2WLLA 1H8HG 5LMNO 1U96A 2WSSG 3KCXA 5B1OA 4QIWF 1GM9A 2NR5A 2QTSA 5GTHZ 3CYOA 2R72A 2EIJB 4X66B 1MSWD 4JAUA 4JI5B 1IBKB 1QHTA 2KG7B 3K58A 5LYJA 3J81N 1VQ9V 4OXSA 4XDLA 4O4HB 5EIBD 2Q7GA 4J42A 2UXCB 4NTXA 3UM7A 4U7OA 3K03A 2EIKB 4B3TO 3MD0A 4DUYO 2Y4TA 1MZFA 3KG2A 4I4TA 3TXQA 1KU9A 2F23A 1YCIA 4W4KA 2HEPA 2L35A 4DK0A 2Q68A 4LNUB 5K1XA 2VWJA 1P49A 5C8YB 1H2NA 1K73W 5CB4A 1PKXA 2JEXA 4P9OA 4KXRA 1JFFB 5KAIZ 3CJHA 2IH1C 2A3QA 1A32A 1G1XB 3D8CA 2K1EA 3H01A 3M8AA 4EFEA 4DW1A 3CWBH 1XREA 5L3FA 4IGGA 3OEHG 4JZ2A 3E8BA 5IYZA 4GX0A 4YJ2B 1MABG 2DYSB 1K5QA 1GN3A 1J5EB 2EULA 1R3LC 3OMAB 4G27B 4RQFA 4DR4O 2Q8VA 4IT5A 5H5NA 3ETQA 2EZOA 3MDSA 1TA8A 2ZE5A 3QTCA 2IU0A 3TK1A 2WLMA 4YXWG 1YF2A 4X20A 2DWEC 1H8EG 4KFMA 1K92A 1JFFA 1QVFU 1KYOF 1D2DA 3KZIZ 4ZOLB 2RN9A 2AHYA 2VQEO 2E3CA 3CCLV 1GAXA 1BSMA 1IX9A 2GSMB 2X0LA 5BMVB 1PL0A 5FLXN 4LF6O 1FXKC 4PDMA 4DV5O 4FLWA 2Q5ZA 1TAEA 4GCZA 1EN5A 2F4VO 2VRZA 2YUAA 4EB6A 2BSKA 4O4JA 4GKJO 4FFBA 1B3QA 2QWNB 1Q5OA 1HW7A 4D6TH 3EFFK 1XDCA 3HPLC 4D7SA 3EXAA 2F4VB 2YEVA 4WFFA 1XEQA 1VF6C 3CXCU 1BHAA 2UU9B 3JARB 3LSQA 2JVDA 3ZX6A 1VEWA 2YSUB 1TGOA 3PN1A 2EIMC 5EBLC 3ZBHA 1XHXA 3VQWA 1N36B 2AGAA 4GX2A 2DN9A 1AJQA 5KA5A 2XTAA 1N8RW 4IIJA 3E22B 1SQFA 1RPRA 4DR3B 4J9ZB 2FTKA 1AP6A 2JEUA 4MT8A 4B3SO 3T4ZA 2UUBB 1EFRG 1RSOB 1QLEC 2Y4UA 5IE9A 1M93A 4E4EA 2R9IA 5D5PA 1NR7A 1Q8IA 4X1KB 2CTWA 4CH3A 3GWOA 1AJNA 2BOBC 3E2EA 4JYBA 1BQZA 4ZHQB 4PV1B 5C93A 4GX5A 3ZMUA 3FAVA 1Q82W 1JJ2U 1Y74B 1Y67A 3RN4A 2UUCO 5C8YA 1YJ9V 3HKEB 4X1KA 2ATKC 4I50B 4A5UB 4R8CA 2BOCC 5B1BC 4GKJB 3C3SA 4WFEA 2YIBA 1K4DC 3I56V 2PYLA 3F5WC 3SPGA 3K04A 2WLNA 5CN0A 3SJBC 2ZQMA 2HG5C 3L71H 3B8NA 1WB8A 4PA6A 3HR0A 5IYBO 2GTAA 1AR1B 1XMOO 3TXSA 3AK3A 1O9HA 2P4KA 5H2FZ 3I55V 2DQ3A 2X6AA 4LF4O 2FMLA 3K06A 1J95A 3ABKC 4IHJA 5IWAB 2K9PA 5F2VO 3F7YC 4YY3B 2D3OW 5JH7B 3K59A 3FYIB 2ZKOA 5CMUA 4X1IB 4MTXA 3ABLC 3AG3B 4LWSB 1VQ4V 1NI8A 3CRCA 5GONA 4LF8O 1L1FA 4I0XA 2ZR3A 3DTUB 1GN2A 4TSFG 2VWKA 3GVMA 4MSWC 1BHBA 3ZMSA 3JSLA 4PI0A 5IY5B 2HVKC 4QNHB 4YHHB 1VARA 5JJEB 4QPJA 4X1YB 1ZX3A 3VOUA 4DR6B 1G6UA 1HP8A 3HB3B 5FPRA 5LMUO 4PDRA 3ABKB 4PELA 4MVUA 2KSDA 1VQ8V 4B3MO 1V55C 1AVMA 2B1GA 4LF7B 2PTMA 4AI8A 3W7XA 5LP6C 1XNQO 1VP7A 2IH3C 2UUAO 2QWOB 4TT3G 1W2BU 4UVBA 2R9AA 4X1YA 1AI6A 4I7ZB 4LFCB 5CBGA 2A79B 3K08A 5EYPA 4DV1B 1IXMA 2E5LO 5KA6A 4UCOA 2YIAA 3R65A 3BCCH 1I94B 1D5AA 2R70A 4X9QA 4O4HA 3CD6V 2FB5A 3OUFA 3K5MA 4DV4B 4YJ2A 4F6RA 1GO3F 3CCJV 3X2QC 4CC5A 1SZXA 4LR3A 3BY6A 4JI2B 3TCUA 3D3QA 5JVDA 3GWKC 5LMNB 1IURA 4U3JA 2L6LA 2HJFC 2LGWA 1FFXA 4N23A 1FPOA 1K33A 4Z2WA 1I5XA 2EILB 4K0KB 3OR7C 2ETNA 1DF5A 2E76B 5B1NA 2X7RB 5EIBC 2M6YA 2CDYA 1VQPV 1VIBA 1N0NA 2QDOA 1Z5VA 4Z1VA 5LOVB 3FX7A 5LXTB 4YIPA 5LGUA 2BE3A 3ZMVA 3HKBB 2YIBD 2QM7A 3H1JH 1S76D 2EILC 3HKDA 1R6KA 1COWG 4LWSA 1FD9A 1Y66A 4LC1A 4JI0O 3CEIA 5E79Z 2EJRA 3AG4B 3HKEA 1AB3A 4FM1A 3OR6C 4QGPA 5GTIZ 3CCSV 1HR0O 2OTJV 4U3FH 5KLVH 1R6TA 1FXKA 4E2LA 1H2SB 3RT3C 4HZ3A 1OCOB 1ZAUA 1DLBA 1ZUQA 2GHYA 4LCUC 3SGIA 2V7QG 3BVOA 5J2UB 3ZRXA 1Q6UA 1WJZA 4L87A 2QE7G 5L3EA 4PD4F 1NQTA 5BY1A 2XAHA 1RP3B 2HVJC 2CTPA 1OCOC 4TOIA 3H1LH 4WFAV 4HYOA 4J7JA 4ZI7A 2RDCA 1ORQC 4JI0B 1PV0A 1JQ0A 4JTAB 3A0RA 1OZ0A 3P32A 4WBNA 4J10A 5LGTA 3FB6C 3SYOA 3Q4HA 4FM0A 1K5SA 3G4SV 4DV6O 4JI3B 1FYJA 3K5LA 1VMGA 1FXVA 2GV9A 2VQFB 1G4YB 2Y69B 5CBFA 3M7MX 5GW7A 2G38A 2HFEC 2YC0A 4DV3O 1MNGA 4JAVA 3ASOC 1GRJA 1EN6A 1WPBA 4WF9V 5KHHA 4P9PA 3ASNB 3AEIA 3CHXA 4JYAB 3JATA 1HNZO 4DR5B 5EBWC 4YJ3A 1NU1H 2P90A 2QJ1A 5L3GA 1M4UA 5B1AC 3CC4V 1OJHA 4UCUA 1Y74A 3E83A 3ZIAG 4X62B 5DEDA 2UXBB 4DV2O 3LSUA 4XBFA 1UPGA 3CCVV 3H1HH 3F5TA 1SQQH 1GTOA 2YXLA 3OMIB 2QM8A 4QJFB 3RYHB 3QO5A 2B1IA 1N36O 2P4VA 3OTOO 4DUZB 1EZJA 4AHCA 2LW7A 1W0JG 3CMEV 1RSOA 4B7EA 3IC9A 1IVSA 1GN6A 3WB2A 3JAMN 1NH2D 4FLVA 2CGOA 1BQ0A 3S3WA 5B3SB 3ICXA 3ABMB 1R73A 3OD4A 1E79G 4B3MB 4I9WA 3WU2Z 1R1BA 5A9GA 1F51A 2WLJA 2ZM6O 1Z2GA 4H37A 3OGCC 4UCVA 4UCTA 2XOKG 5CB4B 4EFBA 4G28B 1H38A 1YI2V 2KQXA 4TV9A 1URFA 1R6NA 4QE9A 5FNVA 2Z5UA 2OCCB 4H0LB 4DUYB 2PZSA 3IGAC 4LF8B 4NTWA 4PDLA 4I55B 2WAMA 2BTQB 3LDEA 2CTQA 1OV9A 2DMXA 2OYQA 1ZWIC 2WA4A 3UT5B 5AG2A 5CA0A 1PNLA 2CAZC 2HKOA 4FK5C 3L9DA 1LNQA 5JH7A
chains in the Genus database with same CATH topology
1NS1A 2HHHO 4JI3O 1X59A 4JI7O 4JYAO 4DV2O 1IBMO 4B3SO 4DR4O 5H5NA 2UXCO 4JI2O 3F5TA 2UXDO 4JI4O 1N32O 4JI0O 4DV1O 4DV7O 1KUQA 4JI8O 4X66O 4DUZO 4NXMO 5LMUO 1J5EO 1N36O 4LFAO 1AB3A 3OTOO 5LMNO 1D2DA 3J80N 2LW7A 2UUBO 4AQYO 1IBLO 4B3MO 4B3RO 1N33O 1HR0O 2VQEO 4LF5O 1R6TA 3JAMN 4LF9O 4YY3O 5FLXN 1XNQO 2UUCO 4LF6O 3J81N 4K0KO 2UUAO 3RT3C 4DV5O 3O65A 1F7YA 4KHPO 2UXBO 4JI6O 4A5UB 3J7AU 5LL6Y 4DR5O 4GKKO 4DR2O 4JI1O 5BY1A 3T1HO 2F4VO 2UU9O 4B3TO 4DV4O 2E5LO 3SDLA 4OPAA 5IWAO 4DUYO 4GKJO 1FJGO 1R1BA 1HNWO 2JRIA 4DR3O 2ZM6O 4X62O 1XNRO 2VQFO 4X64O 3R66A 1AILA 1XMOO 1DK1A 4OPHA 5BR8O 4LF7O 4DV6O 1XEQA 1FYJA 4LF4O 4X65O 4NXNO 4DR6O 5A2QN 1IBKO 4YHHO 2FKXA 1XMQO 4LFCO 1A32A 4DR7O 1G1XB 5IT9N 2DOSA 3M8AA 4DV3O 3T1YO 4LFBO 2Z0AA 2ZKOA 2AGAA 4DV0O 1YZBA 2N74A 1N34O 4JV5O 2DJVA 1HNXO 4OX9O 4LF8O 1FKAO 1HNZO 4JI5O 4DR1O 1I94O 5BXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NS1 A;  2HHH O;  4JI3 O;  1X59 A;  4JI7 O;  4JYA O;  4DV2 O;  1IBM O;  4B3S O;  4DR4 O;  5H5N A;  2UXC O;  4JI2 O;  3F5T A;  2UXD O;  4JI4 O;  1N32 O;  4JI0 O;  4DV1 O;  4DV7 O;  1KUQ A;  4JI8 O;  4X66 O;  4DUZ O;  4NXM O;  5LMU O;  1J5E O;  1N36 O;  4LFA O;  1AB3 A;  3OTO O;  5LMN O;  1D2D A;  3J80 N;  2LW7 A;  2UUB O;  4AQY O;  1IBL O;  4B3M O;  4B3R O;  1N33 O;  1HR0 O;  2VQE O;  4LF5 O;  1R6T A;  3JAM N;  4LF9 O;  4YY3 O;  5FLX N;  1XNQ O;  2UUC O;  4LF6 O;  3J81 N;  4K0K O;  2UUA O;  3RT3 C;  4DV5 O;  3O65 A;  1F7Y A;  4KHP O;  2UXB O;  4JI6 O;  4A5U B;  3J7A U;  5LL6 Y;  4DR5 O;  4GKK O;  4DR2 O;  4JI1 O;  5BY1 A;  3T1H O;  2F4V O;  2UU9 O;  4B3T O;  4DV4 O;  2E5L O;  3SDL A;  4OPA A;  5IWA O;  4DUY O;  4GKJ O;  1FJG O;  1R1B A;  1HNW O;  2JRI A;  4DR3 O;  2ZM6 O;  4X62 O;  1XNR O;  2VQF O;  4X64 O;  3R66 A;  1AIL A;  1XMO O;  1DK1 A;  4OPH A;  5BR8 O;  4LF7 O;  4DV6 O;  1XEQ A;  1FYJ A;  4LF4 O;  4X65 O;  4NXN O;  4DR6 O;  5A2Q N;  1IBK O;  4YHH O;  2FKX A;  1XMQ O;  4LFC O;  1A32 A;  4DR7 O;  1G1X B;  5IT9 N;  2DOS A;  3M8A A;  4DV3 O;  3T1Y O;  4LFB O;  2Z0A A;  2ZKO A;  2AGA A;  4DV0 O;  1YZB A;  2N74 A;  1N34 O;  4JV5 O;  2DJV A;  1HNX O;  4OX9 O;  4LF8 O;  1FKA O;  1HNZ O;  4JI5 O;  4DR1 O;  1I94 O;  5BXZ A; 
#chains in the Genus database with same CATH topology
 1NR1 A;  5L3D A;  1THZ A;  2F1M A;  2V1D A;  3K9A A;  3L73 H;  1P4R A;  2IJJ A;  3CRQ A;  2ZR2 A;  3FB5 C;  3H9V A;  1QQC A;  2JGD A;  3F7V C;  1YHQ V;  1W0K G;  1XMO B;  4PA7 A;  2QGN A;  2RNB A;  4JI6 B;  2CH7 B;  5KX5 B;  2FYU H;  1JPX A;  3RYC B;  4MVZ A;  3CCE V;  1J5E O;  1O9G A;  4LFA O;  3BFR A;  4ZI7 B;  1N33 B;  3CCR V;  3ZN1 A;  2CK3 G;  2WLI A;  3CCM V;  3SYP A;  5EZY A;  1NJI W;  1JR9 A;  4R7C A;  3JD2 A;  2PI5 A;  2R9R B;  2JS3 A;  3A0H Z;  1EN4 A;  2PGG A;  2C2A A;  3T4D A;  1IBM B;  1K3E A;  5EZY B;  4CH4 A;  1VF5 B;  4DK1 A;  2XAQ A;  3N2G B;  1HDJ A;  5K1P A;  3FB7 C;  1XI1 A;  1OHH G;  3H1K H;  2KB1 A;  1S3J A;  2JRI A;  4DR3 O;  1JMK C;  2CH7 A;  4MW3 A;  4X64 O;  1QLN A;  5H9C A;  4JGS A;  2P5O A;  1U97 A;  1TVK B;  1OCZ C;  3RFR A;  1B6Q A;  1Y4M A;  5LYJ B;  1YTF D;  1LUW A;  4BR6 A;  3K5N A;  2ZCE A;  3CRR A;  1WP7 A;  1IBK O;  4PHZ A;  2N04 A;  3SPH A;  1XMQ O;  4LFC O;  1LR1 A;  1EZV H;  4MTG A;  4GX1 A;  2DOS A;  1GM8 A;  1N32 B;  3JAL B;  2GBO A;  2V4D A;  1Q81 W;  4TQF A;  3AK1 A;  1L8D A;  4TV8 B;  3BAB A;  2JJ2 G;  1IXB A;  3K0D A;  5HFL A;  2AZ2 A;  1GM7 A;  4RAI A;  3L70 H;  3ABU A;  3BA8 A;  2QWP B;  4DR2 B;  4DW0 A;  3G71 V;  3W7S A;  1DF4 A;  4O2B B;  4FFK A;  2XUM A;  4DV7 O;  1KUQ A;  2Q73 A;  3E8G A;  2QWQ B;  4KUM A;  3A8T A;  3KKY A;  3MHH C;  3E89 A;  3WB0 A;  1KBH A;  1SER A;  2W6I G;  2QKA A;  1DTO A;  1M9N A;  1SQB H;  3ZHU A;  1Y76 A;  1QNM A;  3T1C A;  2JGD B;  4O4L B;  4MVO A;  3UT5 A;  3RYI B;  5DEC A;  5EK0 A;  4K0K O;  3RYC A;  3MAQ A;  1M56 C;  3L74 H;  4W4L A;  1KQS U;  1JOY A;  2QTO A;  4DR2 O;  4I9Q A;  2DYR C;  4ZOL A;  1K9M W;  5JCO C;  2OTL V;  5FPO A;  1M56 B;  3SDL A;  5IWA O;  1H2L A;  4P2Z A;  1S77 D;  1VQM V;  2HR3 A;  4IHJ B;  1H2K A;  5B5E Z;  4X20 B;  3SYQ A;  5ITZ A;  3UKM A;  5CA0 B;  1E1Q G;  3S3X A;  3OFN G;  1YTF B;  2YEV B;  4DR6 O;  1NTM H;  1BS3 A;  1Z5W A;  2WPD G;  1D5N A;  4YHH O;  4FMT A;  3UCS C;  5LXT A;  4FFB B;  3K3W A;  3T1Y O;  1QR8 A;  4KHP B;  4MVR A;  1S5H C;  1TUB A;  3CB2 A;  2N05 A;  1HNX O;  4OX9 O;  3G80 A;  3ASN C;  4FJC C;  4UB6 Z;  3ASO B;  4DV5 B;  1H2M A;  4H13 B;  4JI3 O;  1ROP A;  2QKC A;  4U3J B;  2H8P C;  2DWD C;  1Q6I A;  2IJH A;  5KUM A;  2JGU A;  4K8X A;  1OCC C;  3P30 A;  3HKC A;  4B3T B;  4C7U A;  2ADQ B;  4X8A A;  4CS3 A;  1XBL A;  5JCO A;  3OTO B;  4DUZ O;  4RQE A;  2EBO A;  3OAA G;  2QKS A;  2QA4 V;  3J80 N;  3U0Z A;  2A0L A;  2ITC C;  5D5Q A;  1XQ8 A;  4IIJ B;  5KHK A;  4DV2 B;  4MVQ A;  1QBZ A;  1KKD A;  2AHZ A;  3DGE A;  3RYH A;  1VF6 A;  5KMG A;  2ZIM A;  2DW4 A;  3RVZ A;  3UO3 A;  3OW2 U;  3BHP A;  1L0L H;  2XAS A;  3OTF A;  3J7A U;  4DR5 O;  4HNA A;  3AG1 C;  2WLK A;  4WFH A;  2Q67 A;  2ZD9 A;  4LBE C;  5EBM C;  5FL7 G;  2ZDI C;  1Y76 B;  3FYE B;  1GK9 A;  4DR1 B;  5B66 Z;  3W7W A;  3BEH A;  3SR2 C;  1N0J A;  4MTF A;  1XUQ A;  2Y69 C;  3N2K B;  2UXD B;  2Q4P A;  1K7D A;  1Q6H A;  1GKF A;  1XOU A;  1VQN V;  3JAL A;  1VQ5 V;  4O4L A;  1FAF A;  1JVM A;  4I4T B;  1UJW B;  4X88 A;  2IJK A;  4XDJ A;  4UVC A;  2Q7H A;  3SJA C;  5LOV A;  1VQ6 V;  4EB6 B;  1AI4 A;  1XIL A;  2ODM A;  3K79 A;  1ZL8 A;  4N21 A;  3RW0 A;  1US6 A;  4JV5 O;  1P7B A;  1CEZ A;  4B08 A;  1FKA O;  2ZIO A;  4DR1 O;  1JCH A;  4X89 A;  3ZRW A;  1XHZ A;  4NYK A;  4O2B A;  2ZE6 A;  2EZP A;  3CC2 V;  2P6J A;  1N4C A;  5BR8 B;  3T1H B;  1ZL8 B;  4FZ1 A;  1GMG A;  3C90 A;  3HKB A;  2W6J G;  2NNU A;  1WNS A;  3DSQ A;  1R3I C;  3OE7 G;  4O2A B;  2XAF A;  3UQ8 A;  2Y48 A;  1I0H A;  1QLE B;  3RYI A;  4NB5 A;  4B3R O;  1WA8 A;  2LO1 A;  1RFY A;  1YVW A;  1PL4 A;  2QWR B;  3W7T A;  1NTK H;  2RJZ A;  1SQP H;  3ZMT A;  3CC7 V;  1S0V A;  2EIN B;  3U11 A;  2YID A;  1XL4 A;  1HNX B;  5CA3 A;  2LFR A;  3SPJ A;  4UV8 A;  1Q90 D;  1F4N A;  5KHI A;  2UU9 O;  1YIT V;  5L3C A;  2P22 C;  2ZNJ A;  2H3O A;  3JD0 A;  4UCR A;  3K57 A;  5JQG B;  3G6E V;  1FFX B;  2PYJ A;  3CPW U;  1AR5 A;  4MVS A;  5KMG B;  4JI7 B;  2EX3 A;  3ZRS A;  1ZLZ A;  2WLL B;  1I08 A;  3R66 A;  2ZNI A;  1YJW V;  2GDS A;  3QO7 A;  1M90 W;  4BW5 A;  3FFQ A;  1KB9 F;  3FKS G;  2M7W A;  2Y0I A;  1FJG B;  3K5O A;  1KEC A;  3CRA A;  4BAY A;  1HWY A;  4NXM B;  3VQY A;  4DR7 O;  1PP9 H;  2JIZ G;  5LHG A;  3JAK A;  3TGU H;  1S72 V;  4XDK A;  2DJV A;  1WP8 A;  4JI5 O;  1SC5 B;  2DYS C;  1I94 O;  2EJ7 A;  2AW9 A;  3L75 H;  4NKG B;  1YIJ V;  2A9H A;  3RGB A;  1PM9 A;  4BW9 A;  4GZR B;  4JAA A;  4AQY B;  2YI8 A;  1V9P A;  4FIP C;  5LA6 B;  4PA3 A;  3ABL B;  3AG3 C;  5EYP B;  1VQO V;  2HHH B;  2YDE A;  4PA4 A;  1I5Y A;  4JI4 O;  4HNA B;  4GKK B;  2X6C A;  1OCZ B;  4JI1 B;  4NXM O;  4Z1M G;  1PNM A;  3T2M A;  2KKW A;  3QO8 A;  1S5J A;  2ZT9 B;  1ZSP A;  1MZE A;  4K3A A;  1ARO P;  1SES A;  3THO A;  2IM9 A;  2XT9 A;  3JAW B;  4LF9 O;  2ZXW B;  1YSC A;  2YIC A;  1CP9 A;  4ASU G;  3C3T A;  3O9O A;  1V54 B;  4GKK O;  2LJ2 A;  4JI1 O;  3B8M A;  2P06 A;  4ZHQ A;  2WLH A;  2YS8 A;  5IYZ B;  4OPA A;  4RUE A;  4JI4 B;  2GUZ A;  1K97 A;  3G67 A;  2F93 B;  3RWR D;  2FL4 A;  4UUJ C;  3ZN0 A;  3SJQ C;  4UB8 Z;  1YXB A;  4CH6 A;  5GON B;  2AZ0 A;  3ZHT A;  1JJO A;  3B4S A;  1BCC H;  1AIL A;  4X65 B;  4J41 A;  2YXY A;  4P30 A;  1PD3 A;  2JDI G;  3OUS A;  3G6B A;  2F43 G;  3OEE G;  1QCE A;  4I55 A;  4UV9 A;  5H6R A;  3JCZ A;  1V55 B;  2ZE8 A;  1IBL B;  5IT9 N;  3QF7 A;  4LFB O;  2XND G;  2Q7E A;  3M99 B;  2AXT Z;  3VBB A;  1B04 A;  4O2A A;  4WBN B;  4FPP A;  2XAJ A;  2WWW A;  5IY5 C;  1NS1 A;  2KG7 A;  1DGS A;  1X59 A;  2HLD G;  2PI4 A;  4JI7 O;  4JV5 B;  2OCC C;  3STZ C;  1IBM O;  1BT8 A;  2B5U A;  3ZJZ A;  1OCR B;  2UUA B;  3D3I A;  1BE3 H;  4YJ3 B;  4NXN B;  4DV3 B;  3ZRV A;  2JS5 A;  5LBQ A;  3B2E E;  2H94 A;  4BIU A;  3H1I H;  1N33 O;  3AG2 C;  1SKV A;  4WCE V;  1F4M A;  1IDS A;  3IJ4 A;  3Q4H B;  1SET A;  4FLY A;  1H2G A;  1KMI Z;  3ZHV A;  4FLZ A;  4NVP A;  3BA9 A;  5ITZ B;  1MMM A;  2Q0O C;  1GN4 A;  1NTZ H;  3E8F A;  3ZCC A;  4B3S B;  5JJJ B;  2Y0P A;  3JSN A;  4R50 A;  3AG1 B;  4H44 B;  3FAV B;  3IAY A;  4B3R B;  3ZMZ A;  3LNN A;  5KHG A;  2ITD C;  3APO A;  3EVK A;  5IYD O;  4OGQ B;  4X62 O;  3JAR A;  1ENV A;  4RUF A;  3A0B Z;  3GB7 C;  2BCC H;  4TV8 A;  3B77 A;  2W0F C;  2CTR A;  2CUG A;  2RMK B;  4CS2 A;  5IJ9 A;  3W7U A;  1GH6 A;  5IDJ A;  3IC7 A;  5TIS Z;  3D36 C;  3E22 A;  1YEW A;  1KC8 W;  4JPR A;  4FLU A;  2Z0A A;  3VQV A;  1T5E A;  4K8Z A;  4X64 B;  4PI2 A;  1YZB A;  5LHH A;  1N34 O;  4EEQ A;  3MHS C;  4FVM A;  3LDD A;  3E86 A;  1S5L Z;  3N2K A;  2A7W A;  1PPJ H;  1M57 B;  3VQX A;  2IU3 A;  5BXZ A;  1SRY A;  2VQE B;  4DO2 A;  3A2F A;  1RM1 B;  4MS2 A;  3RBZ A;  5IYC O;  2LW1 A;  1M57 C;  3DXR B;  1W59 A;  2P67 A;  4IYH A;  4JI2 O;  4BIO A;  2UXD O;  3ZS8 C;  2UXN A;  3AG2 B;  3ETD A;  4LF4 B;  2QSA A;  5LGN A;  4FLX A;  4BIZ A;  4F6E A;  1RPO A;  3N27 A;  3ML0 A;  3CX5 F;  3ZHS A;  3JAW A;  3CXH F;  4AQY O;  4HAM A;  1K8A W;  5EC1 C;  3RYF B;  1IBL O;  4R6Z A;  1FXH A;  1CXZ B;  5LP6 A;  3QG5 A;  2BSK B;  4O4J B;  4DR4 B;  4TUY A;  3SPC A;  4DRX B;  2WLI B;  1B06 A;  3JCU Z;  2HP8 A;  2QM4 A;  1WN7 A;  4FLT A;  3SYC A;  1R3J C;  4CH5 A;  3ABT A;  5LL6 Y;  3I5D A;  1TUE B;  5JQG A;  4UCS A;  2OWO A;  2OIG A;  3K0G A;  1QU7 A;  1FJG O;  1WPX A;  5J2T A;  1JA8 A;  1SF9 A;  4AIL C;  3JD1 A;  4UXN A;  3CCQ V;  3FD9 A;  4ICG A;  2VQF O;  1EM1 A;  2CE4 A;  4OX9 B;  4K35 A;  1NBM G;  4OPH A;  3E35 A;  4LF7 O;  1TUB B;  3P3N A;  5J2T B;  1KP2 A;  1NZ6 A;  3U10 A;  3TET A;  5LA6 A;  5HFM A;  3NR7 A;  1MA1 A;  4CBC A;  2YI9 A;  5JWP A;  4CC6 A;  3FB8 C;  1M5I A;  4CS4 A;  2O57 A;  4J9Y B;  5LMU B;  2LP7 A;  4J7K A;  5KX5 A;  4PJ0 Z;  5KHJ A;  2QR4 A;  1UFI A;  4JF3 A;  3P3P A;  3E8H A;  3WFV A;  4F6R B;  3ABM C;  3RYF A;  1BZK A;  1WAZ A;  5CA1 B;  1YJN V;  2OIE A;  1NT2 B;  2HHH O;  2IW5 A;  4TUY B;  5E1A C;  4JZG A;  2X6B A;  4J7Z A;  2UXC O;  3JAS A;  1KP3 A;  4KL1 A;  4JAS A;  1N32 O;  4UFZ A;  4DV1 O;  2ARH A;  4I0X B;  1WB7 A;  2JK5 C;  3JAK B;  1XMQ B;  4EKW A;  4GT1 A;  5IJ0 B;  1R3K C;  3SJC C;  2YXH A;  1VF7 A;  2XAG A;  2PUS A;  1K4C C;  5CA1 A;  4D7T A;  2EIK C;  4DXW A;  3STL C;  3KCY A;  2VS0 A;  5FNV B;  3CP1 A;  1P7G A;  2UXB O;  4LP8 A;  3TJT A;  4YIO A;  1Q7Y W;  1AI5 A;  4WFB V;  4F4L A;  5IJ9 B;  1N34 B;  1AP5 A;  3SPI A;  1SQG A;  1WA8 B;  2IJI A;  4DRX A;  1BGY H;  1HNW O;  1BL8 A;  1M1K W;  4I50 A;  2UUC B;  4MVM A;  2WA3 A;  4DV7 B;  1FXK B;  3EHB B;  4BWA A;  2A06 H;  1WLE A;  4IYI A;  2B9Z A;  1MG1 A;  1QR9 A;  1Y6X A;  4B7K A;  4DYL A;  1OCC B;  4O4I B;  1HR0 B;  4MW8 A;  1PNK A;  2PY5 A;  3PJS K;  5KAF Z;  2DE0 X;  1V54 C;  2F66 C;  3ZHQ A;  5B1A B;  1AR4 A;  4MTO A;  2MW2 B;  1YDX A;  2LQT A;  3L72 H;  5BZB A;  5LP6 B;  2ADP A;  5H6Q A;  4U7N A;  3WB1 A;  3OM3 B;  3BAA A;  3OMN B;  3BPZ A;  4QE7 A;  1KD1 W;  2OCH A;  2BTQ A;  1SQV H;  4TQD A;  4X66 O;  4RWU A;  3LSS A;  5DN6 G;  1BMF G;  2GTS A;  1I7F A;  3NXS A;  1E1R G;  3IFX A;  3JAS B;  3JD3 A;  3ZHR A;  3D36 A;  3OT7 A;  3UO2 A;  1MOF A;  2CGN A;  5EC2 C;  5LHI A;  3B09 A;  3RVY A;  5J9P C;  1RM1 C;  2PF4 E;  4HBN A;  4LFA B;  5B3S C;  1QVG U;  4LF9 B;  4KHP O;  4DV6 B;  4LH6 A;  2ZM6 B;  4JI6 O;  1SZT A;  3T1Y B;  4NR1 A;  2F95 B;  4WFG A;  4DV0 B;  5JJN B;  3QNE A;  2HJD A;  2W0X A;  4DV4 O;  2DYR B;  4PDV A;  1NH2 B;  2NN4 A;  4H33 A;  3LDC A;  1AJP A;  3APQ A;  3JAT B;  4TWK A;  3AK2 A;  3CMA V;  5J2U A;  1NVP D;  4LF6 B;  5BMV A;  4X1I A;  3HKC B;  2ZE7 A;  5DM6 V;  1EBO A;  4X65 O;  3X2Q B;  3JYC A;  4ZIB A;  4GUN A;  3SYA A;  1SQX H;  5A2Q N;  1KKC A;  2LFS A;  1XNQ B;  4JTD B;  3WG7 C;  1FFT B;  1OCR C;  5JVD B;  2LGQ A;  3CRM A;  2ZIN A;  4NTY A;  2BTO A;  2E75 B;  1F23 A;  4DV0 O;  4J11 A;  1L0N H;  4LNU A;  5B1B B;  2Q69 A;  2NLJ C;  2IBZ H;  4J80 A;  3ETG A;  4TV9 B;  1VQ7 V;  1FS0 G;  1K34 A;  4QPK A;  2E5L B;  3CJH B;  3CSX A;  3CCU V;  4Q20 A;  1X4T A;  2E74 B;  1CPY A;  4JYA O;  3JD4 A;  4ABM A;  2ZDI A;  1LUV A;  5L3B A;  4LF5 B;  3BRC A;  1MSD A;  1P84 F;  3DC6 A;  4UVA A;  2UUB O;  3QVN A;  2Q0A A;  4GYC B;  1VQK V;  3DXR A;  1XNR B;  2GUZ B;  4LF5 O;  3AG4 C;  1TVK A;  4G2K A;  2DQ0 A;  4YY3 O;  4JTC B;  3B40 A;  1NKD A;  3O65 A;  1F7Y A;  3DC5 A;  4O4I A;  4LFB B;  1JX9 A;  3HKD B;  3LUT B;  1Q86 W;  1Q43 A;  1NVP B;  3T1H O;  1AI7 A;  4CZZ A;  2EIM B;  4ZBM A;  1SA0 A;  4KP4 A;  4DR7 B;  3CE2 A;  1XNR O;  5CBH A;  2Q6A A;  2P7T C;  2JJ1 G;  1Q3E A;  1DK1 A;  3WG7 B;  3ETE A;  3OGI B;  5BR8 O;  3ZED A;  3K9S A;  4RO2 A;  1ZTE A;  3CS5 A;  1HNZ B;  1VQL V;  4NXN O;  4PA9 A;  1G8M A;  2FKX A;  3ZRW B;  1HNW B;  3N2G A;  2MK3 A;  4JI8 B;  5KUK A;  4GLX A;  2N74 A;  2OT5 A;  4ZKI A;  2RCV A;  4Q6G A;  1SS3 A;  2Z3Y A;  2QEX V;  4JYC A;  1IZ3 A;  3LNM B;  1SA0 B;  2XHB A;  4LH7 A;  3AG7 A;  5IJ0 A;  4L8J A;  2Q9L A;  4JYY A;  4FM2 A;  2ZXW C;  2EIN C;  1XL6 A;  2RQ6 A;  2UXX A;  4I5S A;  4JI8 O;  2D2C B;  4IL6 Z;  2ILM A;  4FZ0 A;  2EIJ C;  2WLL A;  1H8H G;  5LMN O;  1U96 A;  2WSS G;  3KCX A;  5B1O A;  4QIW F;  1GM9 A;  2NR5 A;  2QTS A;  5GTH Z;  3CYO A;  2R72 A;  2EIJ B;  4X66 B;  1MSW D;  4JAU A;  4JI5 B;  1IBK B;  1QHT A;  2KG7 B;  3K58 A;  5LYJ A;  3J81 N;  1VQ9 V;  4OXS A;  4XDL A;  4O4H B;  5EIB D;  2Q7G A;  4J42 A;  2UXC B;  4NTX A;  3UM7 A;  4U7O A;  3K03 A;  2EIK B;  4B3T O;  3MD0 A;  4DUY O;  2Y4T A;  1MZF A;  3KG2 A;  4I4T A;  3TXQ A;  1KU9 A;  2F23 A;  1YCI A;  4W4K A;  2HEP A;  2L35 A;  4DK0 A;  2Q68 A;  4LNU B;  5K1X A;  2VWJ A;  1P49 A;  5C8Y B;  1H2N A;  1K73 W;  5CB4 A;  1PKX A;  2JEX A;  4P9O A;  4KXR A;  1JFF B;  5KAI Z;  3CJH A;  2IH1 C;  2A3Q A;  1A32 A;  1G1X B;  3D8C A;  2K1E A;  3H01 A;  3M8A A;  4EFE A;  4DW1 A;  3CWB H;  1XRE A;  5L3F A;  4IGG A;  3OEH G;  4JZ2 A;  3E8B A;  5IYZ A;  4GX0 A;  4YJ2 B;  1MAB G;  2DYS B;  1K5Q A;  1GN3 A;  1J5E B;  2EUL A;  1R3L C;  3OMA B;  4G27 B;  4RQF A;  4DR4 O;  2Q8V A;  4IT5 A;  5H5N A;  3ETQ A;  2EZO A;  3MDS A;  1TA8 A;  2ZE5 A;  3QTC A;  2IU0 A;  3TK1 A;  2WLM A;  4YXW G;  1YF2 A;  4X20 A;  2DWE C;  1H8E G;  4KFM A;  1K92 A;  1JFF A;  1QVF U;  1KYO F;  1D2D A;  3KZI Z;  4ZOL B;  2RN9 A;  2AHY A;  2VQE O;  2E3C A;  3CCL V;  1GAX A;  1BSM A;  1IX9 A;  2GSM B;  2X0L A;  5BMV B;  1PL0 A;  5FLX N;  4LF6 O;  1FXK C;  4PDM A;  4DV5 O;  4FLW A;  2Q5Z A;  1TAE A;  4GCZ A;  1EN5 A;  2F4V O;  2VRZ A;  2YUA A;  4EB6 A;  2BSK A;  4O4J A;  4GKJ O;  4FFB A;  1B3Q A;  2QWN B;  1Q5O A;  1HW7 A;  4D6T H;  3EFF K;  1XDC A;  3HPL C;  4D7S A;  3EXA A;  2F4V B;  2YEV A;  4WFF A;  1XEQ A;  1VF6 C;  3CXC U;  1BHA A;  2UU9 B;  3JAR B;  3LSQ A;  2JVD A;  3ZX6 A;  1VEW A;  2YSU B;  1TGO A;  3PN1 A;  2EIM C;  5EBL C;  3ZBH A;  1XHX A;  3VQW A;  1N36 B;  2AGA A;  4GX2 A;  2DN9 A;  1AJQ A;  5KA5 A;  2XTA A;  1N8R W;  4IIJ A;  3E22 B;  1SQF A;  1RPR A;  4DR3 B;  4J9Z B;  2FTK A;  1AP6 A;  2JEU A;  4MT8 A;  4B3S O;  3T4Z A;  2UUB B;  1EFR G;  1RSO B;  1QLE C;  2Y4U A;  5IE9 A;  1M93 A;  4E4E A;  2R9I A;  5D5P A;  1NR7 A;  1Q8I A;  4X1K B;  2CTW A;  4CH3 A;  3GWO A;  1AJN A;  2BOB C;  3E2E A;  4JYB A;  1BQZ A;  4ZHQ B;  4PV1 B;  5C93 A;  4GX5 A;  3ZMU A;  3FAV A;  1Q82 W;  1JJ2 U;  1Y74 B;  1Y67 A;  3RN4 A;  2UUC O;  5C8Y A;  1YJ9 V;  3HKE B;  4X1K A;  2ATK C;  4I50 B;  4A5U B;  4R8C A;  2BOC C;  5B1B C;  4GKJ B;  3C3S A;  4WFE A;  2YIB A;  1K4D C;  3I56 V;  2PYL A;  3F5W C;  3SPG A;  3K04 A;  2WLN A;  5CN0 A;  3SJB C;  2ZQM A;  2HG5 C;  3L71 H;  3B8N A;  1WB8 A;  4PA6 A;  3HR0 A;  5IYB O;  2GTA A;  1AR1 B;  1XMO O;  3TXS A;  3AK3 A;  1O9H A;  2P4K A;  5H2F Z;  3I55 V;  2DQ3 A;  2X6A A;  4LF4 O;  2FML A;  3K06 A;  1J95 A;  3ABK C;  4IHJ A;  5IWA B;  2K9P A;  5F2V O;  3F7Y C;  4YY3 B;  2D3O W;  5JH7 B;  3K59 A;  3FYI B;  2ZKO A;  5CMU A;  4X1I B;  4MTX A;  3ABL C;  3AG3 B;  4LWS B;  1VQ4 V;  1NI8 A;  3CRC A;  5GON A;  4LF8 O;  1L1F A;  4I0X A;  2ZR3 A;  3DTU B;  1GN2 A;  4TSF G;  2VWK A;  3GVM A;  4MSW C;  1BHB A;  3ZMS A;  3JSL A;  4PI0 A;  5IY5 B;  2HVK C;  4QNH B;  4YHH B;  1VAR A;  5JJE B;  4QPJ A;  4X1Y B;  1ZX3 A;  3VOU A;  4DR6 B;  1G6U A;  1HP8 A;  3HB3 B;  5FPR A;  5LMU O;  4PDR A;  3ABK B;  4PEL A;  4MVU A;  2KSD A;  1VQ8 V;  4B3M O;  1V55 C;  1AVM A;  2B1G A;  4LF7 B;  2PTM A;  4AI8 A;  3W7X A;  5LP6 C;  1XNQ O;  1VP7 A;  2IH3 C;  2UUA O;  2QWO B;  4TT3 G;  1W2B U;  4UVB A;  2R9A A;  4X1Y A;  1AI6 A;  4I7Z B;  4LFC B;  5CBG A;  2A79 B;  3K08 A;  5EYP A;  4DV1 B;  1IXM A;  2E5L O;  5KA6 A;  4UCO A;  2YIA A;  3R65 A;  3BCC H;  1I94 B;  1D5A A;  2R70 A;  4X9Q A;  4O4H A;  3CD6 V;  2FB5 A;  3OUF A;  3K5M A;  4DV4 B;  4YJ2 A;  4F6R A;  1GO3 F;  3CCJ V;  3X2Q C;  4CC5 A;  1SZX A;  4LR3 A;  3BY6 A;  4JI2 B;  3TCU A;  3D3Q A;  5JVD A;  3GWK C;  5LMN B;  1IUR A;  4U3J A;  2L6L A;  2HJF C;  2LGW A;  1FFX A;  4N23 A;  1FPO A;  1K33 A;  4Z2W A;  1I5X A;  2EIL B;  4K0K B;  3OR7 C;  2ETN A;  1DF5 A;  2E76 B;  5B1N A;  2X7R B;  5EIB C;  2M6Y A;  2CDY A;  1VQP V;  1VIB A;  1N0N A;  2QDO A;  1Z5V A;  4Z1V A;  5LOV B;  3FX7 A;  5LXT B;  4YIP A;  5LGU A;  2BE3 A;  3ZMV A;  3HKB B;  2YIB D;  2QM7 A;  3H1J H;  1S76 D;  2EIL C;  3HKD A;  1R6K A;  1COW G;  4LWS A;  1FD9 A;  1Y66 A;  4LC1 A;  4JI0 O;  3CEI A;  5E79 Z;  2EJR A;  3AG4 B;  3HKE A;  1AB3 A;  4FM1 A;  3OR6 C;  4QGP A;  5GTI Z;  3CCS V;  1HR0 O;  2OTJ V;  4U3F H;  5KLV H;  1R6T A;  1FXK A;  4E2L A;  1H2S B;  3RT3 C;  4HZ3 A;  1OCO B;  1ZAU A;  1DLB A;  1ZUQ A;  2GHY A;  4LCU C;  3SGI A;  2V7Q G;  3BVO A;  5J2U B;  3ZRX A;  1Q6U A;  1WJZ A;  4L87 A;  2QE7 G;  5L3E A;  4PD4 F;  1NQT A;  5BY1 A;  2XAH A;  1RP3 B;  2HVJ C;  2CTP A;  1OCO C;  4TOI A;  3H1L H;  4WFA V;  4HYO A;  4J7J A;  4ZI7 A;  2RDC A;  1ORQ C;  4JI0 B;  1PV0 A;  1JQ0 A;  4JTA B;  3A0R A;  1OZ0 A;  3P32 A;  4WBN A;  4J10 A;  5LGT A;  3FB6 C;  3SYO A;  3Q4H A;  4FM0 A;  1K5S A;  3G4S V;  4DV6 O;  4JI3 B;  1FYJ A;  3K5L A;  1VMG A;  1FXV A;  2GV9 A;  2VQF B;  1G4Y B;  2Y69 B;  5CBF A;  3M7M X;  5GW7 A;  2G38 A;  2HFE C;  2YC0 A;  4DV3 O;  1MNG A;  4JAV A;  3ASO C;  1GRJ A;  1EN6 A;  1WPB A;  4WF9 V;  5KHH A;  4P9P A;  3ASN B;  3AEI A;  3CHX A;  4JYA B;  3JAT A;  1HNZ O;  4DR5 B;  5EBW C;  4YJ3 A;  1NU1 H;  2P90 A;  2QJ1 A;  5L3G A;  1M4U A;  5B1A C;  3CC4 V;  1OJH A;  4UCU A;  1Y74 A;  3E83 A;  3ZIA G;  4X62 B;  5DED A;  2UXB B;  4DV2 O;  3LSU A;  4XBF A;  1UPG A;  3CCV V;  3H1H H;  3F5T A;  1SQQ H;  1GTO A;  2YXL A;  3OMI B;  2QM8 A;  4QJF B;  3RYH B;  3QO5 A;  2B1I A;  1N36 O;  2P4V A;  3OTO O;  4DUZ B;  1EZJ A;  4AHC A;  2LW7 A;  1W0J G;  3CME V;  1RSO A;  4B7E A;  3IC9 A;  1IVS A;  1GN6 A;  3WB2 A;  3JAM N;  1NH2 D;  4FLV A;  2CGO A;  1BQ0 A;  3S3W A;  5B3S B;  3ICX A;  3ABM B;  1R73 A;  3OD4 A;  1E79 G;  4B3M B;  4I9W A;  3WU2 Z;  1R1B A;  5A9G A;  1F51 A;  2WLJ A;  2ZM6 O;  1Z2G A;  4H37 A;  3OGC C;  4UCV A;  4UCT A;  2XOK G;  5CB4 B;  4EFB A;  4G28 B;  1H38 A;  1YI2 V;  2KQX A;  4TV9 A;  1URF A;  1R6N A;  4QE9 A;  5FNV A;  2Z5U A;  2OCC B;  4H0L B;  4DUY B;  2PZS A;  3IGA C;  4LF8 B;  4NTW A;  4PDL A;  4I55 B;  2WAM A;  2BTQ B;  3LDE A;  2CTQ A;  1OV9 A;  2DMX A;  2OYQ A;  1ZWI C;  2WA4 A;  3UT5 B;  5AG2 A;  5CA0 A;  1PNL A;  2CAZ C;  2HKO A;  4FK5 C;  3L9D A;  1LNQ A;  5JH7 A; 
#chains in the Genus database with same CATH homology
 1NS1 A;  2HHH O;  4JI3 O;  1X59 A;  4JI7 O;  4JYA O;  4DV2 O;  1IBM O;  4B3S O;  4DR4 O;  5H5N A;  2UXC O;  4JI2 O;  3F5T A;  2UXD O;  4JI4 O;  1N32 O;  4JI0 O;  4DV1 O;  4DV7 O;  1KUQ A;  4JI8 O;  4X66 O;  4DUZ O;  4NXM O;  5LMU O;  1J5E O;  1N36 O;  4LFA O;  1AB3 A;  3OTO O;  5LMN O;  1D2D A;  3J80 N;  2LW7 A;  2UUB O;  4AQY O;  1IBL O;  4B3M O;  4B3R O;  1N33 O;  1HR0 O;  2VQE O;  4LF5 O;  1R6T A;  3JAM N;  4LF9 O;  4YY3 O;  5FLX N;  1XNQ O;  2UUC O;  4LF6 O;  3J81 N;  4K0K O;  2UUA O;  3RT3 C;  4DV5 O;  3O65 A;  1F7Y A;  4KHP O;  2UXB O;  4JI6 O;  4A5U B;  3J7A U;  5LL6 Y;  4DR5 O;  4GKK O;  4DR2 O;  4JI1 O;  5BY1 A;  3T1H O;  2F4V O;  2UU9 O;  4B3T O;  4DV4 O;  2E5L O;  3SDL A;  4OPA A;  5IWA O;  4DUY O;  4GKJ O;  1FJG O;  1R1B A;  1HNW O;  2JRI A;  4DR3 O;  2ZM6 O;  4X62 O;  1XNR O;  2VQF O;  4X64 O;  3R66 A;  1AIL A;  1XMO O;  1DK1 A;  4OPH A;  5BR8 O;  4LF7 O;  4DV6 O;  1XEQ A;  1FYJ A;  4LF4 O;  4X65 O;  4NXN O;  4DR6 O;  5A2Q N;  1IBK O;  4YHH O;  2FKX A;  1XMQ O;  4LFC O;  1A32 A;  4DR7 O;  1G1X B;  5IT9 N;  2DOS A;  3M8A A;  4DV3 O;  3T1Y O;  4LFB O;  2Z0A A;  2ZKO A;  2AGA A;  4DV0 O;  1YZB A;  2N74 A;  1N34 O;  4JV5 O;  2DJV A;  1HNX O;  4OX9 O;  4LF8 O;  1FKA O;  1HNZ O;  4JI5 O;  4DR1 O;  1I94 O;  5BXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...