1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
1FYJA 4DV0O 1XNRO 1R6TA 4AQYO 3R66A 5BR8O 2DOSA 1KUQA 3J81N 5IT9N 1IBMO 4DR5O 1HNWO 1J5EO 3RT3C 1N34O 5LMUO 4DUYO 3T1HO 4K0KO 2Z0AA 4LFAO 4B3SO 2LW7A 4DR1O 2UUBO 1X59A 1XNQO 4JI8O 1NS1A 1F7YA 4LF7O 4DV4O 4YHHO 2UUAO 2DJVA 4LFCO 4B3MO 3SDLA 1XMOO 4JI1O 1N32O 1N36O 3F5TA 4A5UB 2HHHO 4JI2O 1XMQO 4DV6O 4X65O 4X66O 4B3RO 2F4VO 2FKXA 4JYAO 1YZBA 4NXNO 1IBLO 1AILA 2UXBO 1XEQA 2ZM6O 1G1XB 2UXCO 5IWAO 3T1YO 4GKJO 1FJGO 2UU9O 4JI5O 4DV7O 3J7AU 5BXZA 4LFBO 4DR4O 4JI0O 5FLXN 1DK1A 1FKAO 4YY3O 4LF9O 2UXDO 4JV5O 4B3TO 4OX9O 4DR6O 1D2DA 4DV1O 4X64O 4DUZO 1A32A 3OTOO 4DV3O 4JI6O 3J80N 4JI7O 2JRIA 1HR0O 4LF8O 2AGAA 1IBKO 1HNZO 4JI4O 3O65A 5LL6Y 2ZKOA 5A2QN 4X62O 2VQFO 4DV5O 5H5NA 4DR3O 1AB3A 4LF4O 3M8AA 5BY1A 1R1BA 4GKKO 2VQEO 4DR2O 2E5LO 2N74A 3JAMN 4KHPO 4DR7O 1N33O 4JI3O 4NXMO 5LMNO 4OPAA 1I94O 4OPHA 2UUCO 4LF6O 1HNXO 4LF5O 4DV2O
chains in the Genus database with same CATH superfamily
1E1RG 4DV0O 2HJDA 4FK5C 5J2UB 4X62B 3LUTB 1HNWO 4DR3B 1J5EO 2V4DA 3WB1A 4FPPA 1H2MA 2Q0AA 2IM9A 3SYPA 3OEEG 2XAFA 1W59A 2XNDG 4MTFA 5EC1C 1P7BA 4UCSA 5IJ9B 2DYSC 2LP7A 3RYFA 2ZNJA 2QKAA 2XASA 3WFVA 3JATB 3WU2Z 4MS2A 4YIOA 3X2QB 3EVKA 4PA6A 1S5HC 5IDJA 1F51A 3UT5B 4PJ0Z 1T5EA 4H13B 5KA6A 1VEWA 5EBMC 2UXCO 3WB0A 4ICGA 3MD0A 5DEDA 3W7UA 4I4TA 4RUFA 3ZMVA 1I08A 4NYKA 4DR5B 3CRQA 2CDYA 2EINC 4LF9O 1L0NH 5LA6B 4JAAA 2OTJV 1D2DA 3APQA 4LFAB 1URFA 4DRXA 4PDVA 2Q68A 3L9DA 4CC5A 4LF8O 3CC7V 5B1BB 1S5JA 4B08A 3JD4A 4MVQA 1ZL8A 4O4JA 4MTGA 1Q90D 4TSFG 1BE3H 1XMOB 2IU3A 3MDSA 2FL4A 3OMAB 1VARA 3B77A 2JGUA 1GN4A 1QR9A 1XBLA 1Y67A 1AR1B 4JTCB 1VQ7V 4FLYA 5DM6V 3S3XA 1F4NA 1Y74B 4OPHA 4PI0A 4O4IA 5LOVB 1K33A 2JEUA 1MZEA 3K9AA 5H9CA 1H2LA 1KUQA 1M5IA 1ZUQA 3JALA 1VQ4V 3ABMB 1JPXA 2UXDB 1KBHA 3ZX6A 3OUSA 3MHSC 5KX5A 4DV4O 1NZ6A 1YXBA 4PV1B 5LMNB 1VQKV 5E79Z 3L71H 4HNAB 2RJZA 2ZDIC 4HBNA 1MOFA 1NTMH 3A0BZ 1KP3A 3I56V 2UUCB 2QTSA 3JARA 3KKYA 4L87A 5IY5C 2A7WA 1P7GA 1TAEA 3FB7C 4DUYB 4X66O 2KSDA 4WFBV 2E5LB 5C93A 3D36C 3MHHC 2HFEC 1RM1C 2JDIG 3QO7A 3ASNB 2H3OA 4DV2O 5LHGA 3SYOA 2GSMB 4IIJA 4DV2B 2UU9O 1IVSA 1RP3B 1G4YB 5LGNA 1SETA 2VWKA 2ILMA 4JI0O 3FFQA 5KHIA 1HNWB 4FM2A 1VMGA 3K59A 3P30A 5IYBO 1H2GA 3TXQA 4GX2A 4J7ZA 5JQGA 3ZMSA 4JI6O 3CCMV 3K57A 4IHJA 1HR0O 1JFFB 2YICA 4PELA 1F23A 2DYRB 4LNUB 1M9NA 4CS4A 2VQFO 2QWQB 1G8MA 3OT7A 4HAMA 4WFFA 1Q6HA 2QDOA 2XUMA 4DR4B 3K5MA 4E4EA 3K5LA 3AG2B 2MK3A 4UV8A 4ZOLA 4OX9B 2E3CA 1K7DA 2M6YA 2IU0A 3CCUV 1KKCA 3G6EV 3P3NA 2ZIMA 2UXCB 1KC8W 1R6TA 1WA8B 4ZHQB 2QEXV 1RFYA 2UXNA 5B1BC 4XDKA 2KB1A 3F5WC 4LC1A 4QE9A 4K0KO 2ZIOA 1SZTA 1XREA 2WLJA 3RYCB 4YHHO 3RYIA 4Z2WA 2Q0OC 4LF8B 4LF6B 2UXXA 1SQGA 2Q6AA 3ETGA 2Y0PA 1QLEC 1Q81W 2VRZA 4B7KA 1IZ3A 4X65O 2EX3A 5IYDO 3VQWA 1BCCH 3AG1B 3JSNA 4RAIA 3E22B 1V55C 1AILA 4UB8Z 1PKXA 1UFIA 1P4RA 3G4SV 3N2KA 5B1OA 5L3DA 3T1YO 1K4CC 4JZGA 2P06A 1AROP 2OT5A 1I5XA 5JJNB 2YIBA 4DV7O 1WP8A 4CH3A 1LUWA 4KFMA 3D3IA 4YY3O 3FB5C 3SJQC 1N4CA 2YC0A 4DR6O 3ZHQA 2A3QA 3GB7C 3JAWB 5B66Z 1YJNV 4LCUC 2ZT9B 1SQBH 3VQYA 1XHXA 1HWYA 5KUKA 2E76B 4TQDA 5EIBC 5IWAB 1BSMA 2DW4A 2R9IA 2KQXA 4UXNA 2Q7GA 1FS0G 4LF4O 2B9ZA 1Q8IA 4RO2A 1MSWD 1Q7YW 4X66B 4MVSA 1Q3EA 4JI3O 2LO1A 3ASOC 4BR6A 4DV3B 4WBNA 3T4ZA 1GM8A 3ABKB 3R66A 2DWEC 3AG7A 3ML0A 1YSCA 4JYBA 1R6NA 4K35A 3O9OA 2DE0X 2QWOB 1AR4A 3CXHF 2WWWA 1J95A 5J2TA 3Q4HB 3OW2U 2L6LA 2YXHA 3OUFA 3L72H 1VQPV 1F7YA 4R6ZA 2JS3A 2D3OW 3LSUA 4EFEA 4NXMB 1BT8A 4JI6B 3AG2C 1HR0B 1SQFA 4ABMA 3ZRWA 3AG4C 2VQFB 2FYUH 2GDSA 2XT9A 4AI8A 2P7TC 3CSXA 4ASUG 1QNMA 1NR1A 4XDLA 4F6EA 4JZ2A 3H9VA 4LF7B 3ZHUA 5KHKA 4UCOA 3FYEB 1JCHA 1GTOA 3JASB 3KCYA 2Y69C 3ABTA 3I5DA 1FFTB 2P4VA 2EZOA 4LH6A 5BMVB 5KMGA 3APOA 1ORQC 1SZXA 2QTOA 1PNMA 5FNVA 4K0KB 5ITZB 3IC9A 1DGSA 3C3SA 4YHHB 3AG1C 3JCUZ 1BS3A 1OV9A 4GYCB 3ETEA 5EZYA 1KB9F 1PL4A 1K4DC 1B3QA 2Z3YA 4R8CA 4X62O 4P9OA 4DR3O 4AHCA 5H2FZ 4LFBB 2XAHA 5BY1A 2KG7A 2GBOA 1OCZB 3HPLC 5KAIZ 2RNBA 2QKCA 2JJ1G 4DR7O 4PDMA 3BCCH 3E8BA 3OTOB 2FMLA 2FTKA 4PI2A 5EYPB 4RUEA 5CBGA 1TVKB 1FYJA 4MVRA 4JYYA 1XNRO 1JQ0A 4MVZA 3T1YB 3K3WA 3ZMZA 5GONB 2LFSA 2PI4A 1JX9A 3OR7C 4DV7B 3E2EA 1CXZB 5CBFA 3NXSA 2QGNA 5CN0A 5CA1A 4YY3B 1KQSU 1WPXA 2LJ2A 5E1AC 4KHPB 2YEVA 2WLNA 4YJ2A 2UUAO 3L74H 2HR3A 1YTFB 4LFCO 4F6RB 5IYZB 3N2GB 2YIDA 4UFZA 2CGNA 2YS8A 1OCCB 2Q7HA 5CMUA 3RWRD 4TOIA 2G38A 4LF4B 1PV0A 3BABA 3UT5A 3ABKC 3ZEDA 4JYAO 1WNSA 1N0JA 3RFRA 1GN2A 4JI3B 2GUZB 4X89A 1Q86W 1WB7A 2ZR2A 4B3MB 3HKCA 3R65A 3SJAC 3DXRA 3CC4V 5AG2A 1Y66A 1XMQB 1IX9A 3CYOA 2X6AA 3CCSV 5DECA 4JGSA 1AJNA 2JS5A 3OR6C 5CA3A 4O2BB 4JAVA 4K8XA 2XAQA 4K3AA 2JRIA 2LW1A 4MT8A 3W7WA 4I7ZB 4X1IA 1KKDA 1K3EA 2ZE6A 4QIWF 2ZKOA 1H8EG 3DGEA 2N04A 4G28B 2F23A 3HR0A 1KP2A 2R70A 3CC2V 4IYHA 2M7WA 2P67A 1VQ5V 3OGCC 5CA0A 1NKDA 4LWSA 2ZE7A 5CB4B 5LOVA 3HKBA 5LMNO 2AXTZ 2UUCO 4WFEA 2PF4E 2HJFC 5JVDB 2ZQMA 2Q5ZA 3BAAA 3N27A 1FFXB 2QWNB 2QM7A 2B5UA 1PD3A 4D6TH 2RQ6A 4QGPA 4DUYO 2WLIB 5GTIZ 3MAQA 1ENVA 4IL6Z 5LHHA 5IE9A 1BMFG 2RMKB 1I0HA 4QE7A 1ZAUA 3HKDB 3HKEB 3ZCCA 1NI8A 1N33B 1BQ0A 5IY5B 1I94B 1Q43A 4FFBA 4GZRB 1QCEA 2EJRA 2HKOA 1N32O 4A5UB 3JYCA 4PHZA 4DV6O 2BSKB 3RYHB 3P32A 2WAMA 1RM1B 3ZMUA 4X1YB 3FAVB 1W0KG 3BY6A 1S5LZ 3LDCA 2ITDC 4G27B 2CH7A 3STLC 2UXBO 5J9PC 1XEQA 2ZM6O 4DR7B 1W0JG 5EBLC 3ICXA 1RPOA 1M56B 3IGAC 4U3JA 4N23A 1XNRB 5KUMA 4DR4O 4K8ZA 4PA3A 1H8HG 2Q73A 4OX9O 4KP4A 4EFBA 2AHYA 1OCCC 5C8YA 2UUAB 4BWAA 3QG5A 2ZD9A 4FLUA 1E79G 4LFCB 4GKJB 1SA0B 3ZN1A 1AB3A 3JD0A 4LBEC 3W7SA 2X0LA 5JWPA 2WLLB 2N74A 1NQTA 1MA1A 2BTQB 4JYAB 1M57B 3F7VC 3OM3B 4DUZB 3G80A 1B6QA 4JI7B 4LF6O 4EB6A 4FLZA 4G2KA 4TV8B 3CRMA 3M99B 5BZBA 3SPHA 2Z5UA 4O4LB 5FPRA 4TV9B 1PNKA 1SF9A 3LSSA 4X20A 4F4LA 3CRCA 1N8RW 1SC5B 2WA4A 2LW7A 4I5SA 4JYCA 1WLEA 2HG5C 3H01A 4O4HA 1QLEB 3IC7A 5KHGA 1EBOA 2F95B 4MW3A 3CCJV 3BA9A 4XBFA 1V55B 4MTXA 1WPBA 3K5NA 2FB5A 3AG3B 2BTOA 4B3SB 2XHBA 1AR5A 4LP8A 2Y4UA 5IWAO 1KYOF 3CJHA 1DF4A 2QJ1A 3UQ8A 4JI1B 5HFLA 5EC2C 1FXKC 1PM9A 1TA8A 4P9PA 2CUGA 4TT3G 2F66C 4KL1A 3TXSA 1NH2B 3H1HH 3G67A 1MMMA 3G6BA 3CP1A 1Y6XA 4MVMA 5LP6A 1QR8A 4DV3O 2QR4A 2A9HA 3LNMB 3A0HZ 3ZMTA 1SQPH 4H0LB 4Z1MG 2WLMA 1QHTA 2EULA 4RQFA 4MVOA 1N32B 1JVMA 1M56C 4D7TA 4DV6B 3ASOB 1R1BA 3E35A 1L1FA 4NXMO 4X64B 2ZNIA 2UXBB 2GTAA 3SPJA 4CS3A 3U10A 2ZM6B 2CGOA 3UM7A 4GCZA 2YXLA 2DOSA 3CE2A 2Q8VA 1MNGA 2IJIA 1US6A 3L75H 5JH7A 3T1HO 1NTZH 1ZLZA 4IYIA 3ETDA 3RYFB 2DQ0A 2Q7EA 4IT5A 1OZ0A 4LF7O 3AG4B 3RVYA 2BCCH 2IH1C 1H2KA 4BAYA 1M57C 4MW8A 3LDEA 3PN1A 4I9QA 3TGUH 4J9ZB 4CH6A 4AQYB 4PA7A 2F1MA 5LMUB 4I4TB 1XI1A 3LSQA 4B3RO 3JD1A 4TWKA 4CZZA 3CCEV 4FVMA 1Q82W 4J10A 2Y69B 1ZX3A 5JCOC 1G1XB 4JASA 4DRXB 4KUMA 1IURA 5LBQA 1XL6A 2IW5A 2BE3A 1S72V 1ZL8B 3K9SA 4O4JB 4LFBO 4I55A 1EZJA 3A8TA 3CCRV 1O9GA 5FLXN 1YHQV 3CD6V 4JTDB 2QM8A 5ITZA 4ZBMA 4UCVA 5IJ0A 1HDJA 3OTOO 3AG3C 1Y76A 4L8JA 1IXBA 4DO2A 1SERA 1EN6A 3JAKA 4O4IB 4CBCA 1YI2V 2ZINA 1FAFA 1EFRG 2DMXA 2X7RB 3JAMN 3NR7A 3JALB 5EYPA 4KHPO 4X1KB 2ADPA 1M93A 4WFHA 3CXCU 5KX5B 1X4TA 1GMGA 5D5QA 3K79A 4FMTA 3GWOA 3PJSK 2BOCC 2OWOA 3RBZA 1GN3A 1ZTEA 1HW7A 3L70H 2OCCC 4HYOA 1QVFU 1WAZA 1AP5A 1EZVH 1JOYA 4QNHB 1VIBA 5LXTA 1OJHA 2WLHA 4WFGA 4PDLA 4B3MO 4GX1A 5B1AC 3E83A 1Z5WA 3H1JH 5JJJB 2HLDG 1XMQO 2PUSA 3SPIA 3FX7A 1Q5OA 4WF9V 1NBMG 1B04A 2AW9A 2AHZA 1CP9A 1NVPB 1VQMV 4O2AA 1DTOA 4LH7A 5IYCO 4IHJB 4HZ3A 1R73A 1ZSPA 2NNUA 3ZRXA 2R9RB 4QPJA 1N36B 2A0LA 3AK3A 1R3KC 3ABLB 2PI5A 2H8PC 3HB3B 3T1HB 2EIKB 1FD9A 4I50B 1XOUA 4RWUA 2GTSA 4ZOLB 1OHHG 4FJCC 4NR1A 3DTUB 1GN6A 3CRAA 4UCRA 2LFRA 1VQ6V 4DV5O 2PYJA 3BEHA 5H5NA 3B09A 4MTOA 2D2CB 1S77D 4U7OA 2AZ2A 1FXVA 2YIAA 3GVMA 2VQEO 3SPGA 4B3RB 3FB6C 1N33O 5B1NA 2JIZG 1I94O 1JA8A 1FPOA 2VWJA 3E8GA 4UB6Z 3RYIB 1AI5A 2YSUB 2HVKC 3FD9A 2ZE8A 3OE7G 4NTYA 5LYJA 2JGDA 2ZDIA 1KECA 2HVJC 3HKDA 3BHPA 2QSAA 2UUBO 3L73H 4GLXA 3U0ZA 2W0FC 1WN7A 1WP7A 1YJ9V 1NR7A 3LNNA 4OXSA 3WG7B 5J2UA 1VP7A 4ZI7B 1YEWA 3N2KB 3D36A 3JCZA 4J7JA 3QO5A 2K1EA 3CB2A 4H44B 2DWDC 2MW2B 5L3EA 3ZRSA 4DR1B 1W2BU 3OMIB 4NVPA 2Q69A 5IJ9A 1R3IC 4FZ0A 3VQVA 2YUAA 2PY5A 2W6IG 4GKJO 3JATA 4JI2B 1R6KA 3BPZA 5LGUA 2A06H 4WCEV 4UUJC 2F4VB 1S0VA 1UJWB 2NN4A 4DUZO 4JI7O 1SKVA 5K1PA 2AGAA 2K9PA 3JD2A 4BIOA 2ZXWB 3O65A 2HP8A 3STZC 4WBNB 3D8CA 3B4SA 2B1GA 5LA6A 1S76D 2BTQA 2EIJB 4PDRA 4DR2O 4JV5B 1WB8A 1OCRB 1WJZA 5EBWC 2F93B 3ABLC 4TV8A 2EZPA 4ZIBA 2EIKC 4JI4B 2RDCA 1VF6A 1VQLV 2ITCC 2IH3C 3K58A 1YITV 4B3SO 1SS3A 5JJEB 1PL0A 1Y74A 3QTCA 3SGIA 1QU7A 1D5NA 1RSOB 5HFMA 1U96A 3U11A 1YF2A 4LR3A 3G71V 2IJHA 3OAAG 4JI1O 3KG2A 1SQQH 3FB8C 1LUVA 4CH4A 4DV5B 1JR9A 1UPGA 3H1LH 5KMGB 1MSDA 3F7YC 4MVUA 2VQEB 4HNAA 1I5YA 5FPOA 3SR2C 5FNVB 1YCIA 2GV9A 1BHAA 1FXKB 3DC5A 4IGGA 1QVGU 3CHXA 3K0DA 4R7CA 1OCOC 4FLTA 3WG7C 4EKWA 2HHHB 2JEXA 5EZYB 1H38A 4C7UA 1FXHA 1FKAO 1P84F 4B3TO 5KAFZ 2KG7B 4X64O 4QPKA 5KHHA 2PTMA 2UUBB 1K97A 3K08A 3CMAV 2QA4V 1JJOA 1AI6A 1KMIZ 2XOKG 3TK1A 5LL6Y 4R50A 3SYAA 3ZJZA 2W0XA 3K04A 4D7SA 2R72A 3CS5A 3DSQA 2CTQA 3ZRVA 2YDEA 3VBBA 2Y48A 3DC6A 1PNLA 1JFFA 2CTRA 5CA1B 4U3FH 3C90A 1XDCA 1L8DA 1V54B 2JVDA 1HNXO 2ADQB 4LNUA 2YEVB 4YJ2B 5TISZ 4AQYO 3J81N 1GH6A 2F43G 2ZXWC 3S3WA 3SJCC 2DN9A 5LMUO 3IJ4A 3CMEV 1S3JA 3B40A 3I55V 1M1KW 4I0XB 2XTAA 1XNQO 2WSSG 5KA5A 3W7TA 4JAUA 2EIJC 1WA8A 4ZHQA 5EK0A 1OCRC 4FM0A 2V1DA 3VQXA 1VQ8V 3E8FA 1EN4A 3HKCB 2X6CA 1N34B 1M4UA 3DXRB 1EM1A 3RYCA 5L3CA 4NXNO 2A79B 4DR2B 4AILC 1IBLO 1CPYA 4W4KA 2EIMB 2B1IA 4JPRA 1BHBA 4TUYB 3OFNG 3T4DA 1M90W 1TGOA 1GM7A 4X1IB 4XDJA 3OD4A 4FM1A 3RVZA 1K73W 3CRRA 3K06A 2AZ0A 4J11A 4P30A 3E22A 1TUBB 2JK5C 2LQTA 2Y4TA 5CA0B 3K0GA 4LWSB 3EHBB 1HNZO 4J80A 3HKBB 1SRYA 3RN4A 4YJ3B 4ZKIA 1F4MA 2OIEA 4P2ZA 3AEIA 4BIZA 5A2QN 3BA8A 1FJGB 2ARHA 2P22C 4JI5B 2RCVA 5KLVH 4CC6A 3JAWA 4X1KA 1XQ8A 3RW0A 5CBHA 4DV1B 2C2AA 1R3LC 2BOBC 2NR5A 2ZE5A 1NH2D 4LF5O 2Q9LA 5B3SC 3EFFK 4FFBB 1Z2GA 2QWPB 5EIBD 3BFRA 4J41A 2OCCB 1GO3F 2X6BA 4I9WA 1VF7A 1YDXA 4UVBA 1X59A 4B3TB 4JI8O 1VQNV 1AJPA 3H1KH 5B1AB 5LHIA 1GAXA 5L3FA 2CH7B 4DV0B 1N36O 4DXWA 3F5TA 1V54C 3Q4HA 3ZHSA 4U3JB 3TETA 2IJJA 1J5EB 3K03A 5GW7A 4X88A 1LR1A 2Y0IA 1CEZA 2Q67A 4CH5A 3X2QC 3E89A 3C3TA 3T2MA 1HNXB 5C8YB 1I7FA 4UV9A 3OGIB 5LGTA 1YIJV 4W4LA 4I50A 2WPDG 2P4KA 3JD3A 3UO2A 3JASA 1XNQB 2LGWA 3BRCA 1BZKA 1IBKO 2P6JA 4FIPC 1MABG 5BMVA 2EIMC 2LGQA 2QWRB 1TUEB 4YXWG 1HP8A 5KHJA 4EB6B 2XAJA 4GT1A 1BGYH 3FKSG 4LF9B 1VF6C 3TCUA 4X20B 4B7EA 2O57A 4NXNB 1IBLB 3FYIB 1DLBA 4NB5A 4O4HB 3ZS8C 4J42A 1K5SA 1AVMA 4U7NA 1K9MW 3RT3C 1XHZA 2HEPA 3E86A 2Z0AA 3W7XA 1PPJH 2P90A 4DR1O 3ZHRA 1B06A 2CTWA 4Q6GA 1K8AW 1TVKA 4ZI7A 3ABMC 1QQCA 1HNZB 5GONA 4DYLA 2EILB 5GTHZ 1Q6IA 1THZA 1ZWIC 3TJTA 3JSLA 4JI2O 2CE4A 1VF5B 3CJHB 1N0NA 4EEQA 3ZIAG 3JARB 3QO8A 5FL7G 1LNQA 2F4VO 2FKXA 1YZBA 2CTPA 1U97A 4FLVA 3THOA 1Q6UA 4F6RA 4DV4B 5LP6B 5IYZA 3N2GA 3B8NA 4LF5B 1NU1H 3P3PA 3LDDA 3ASNC 2N05A 5BXZA 4IIJB 1E1QG 4JV5O 1KU9A 1H2NA 3CPWU 2KKWA 3SPCA 3E8HA 2GUZA 3OTFA 3UKMA 3J80N 4JI8B 4DK1A 4JI4O 2ODMA 2Q4PA 5JQGB 1K5QA 1V9PA 2UU9B 4JF3A 4YIPA 4MSWC 1NVPD 2DYRC 4DK0A 4DW0A 2H94A 2ATKC 4O2BA 4JI0B 2OIGA 4GKKO 5JH7B 2ETNA 4GX5A 4UVCA 4OPAA 4BW9A 4X8AA 4X9QA 2ZR3A 1AP6A 3ABUA 3ETQA 4BW5A 5BR8O 4WFAV 1MZFA 3T1CA 5DN6G 1IBMO 4E2LA 3KCXA 4BIUA 5CB4A 1RSOA 4UCTA 4TQFA 4GX0A 1NS1A 1SESA 3IAYA 3M7MX 1MG1A 5JVDA 5L3GA 1BQZA 3A2FA 1KD1W 2QE7G 1SQXH 1FFXA 4JTAB 2DJVA 1IBKB 3SDLA 1K92A 1NTKH 3SYQA 1D5AA 3RGBA 2WLIA 5B5EZ 2HHHO 2PGGA 4NTWA 2ZCEA 3A0RA 3OMNB 3QNEA 3VOUA 4I55B 5H6QA 3HKEA 3B2EE 2QKSA 4H33A 2CAZC 1FXKA 1AI7A 1VQ9V 2W6JG 4QJFB 1NT2B 5IJ0B 1OCOB 4FFKA 4OGQB 1H2SB 1Y76B 2BSKA 3RYHA 1NJIW 2EJ7A 4FLXA 1DF5A 3FAVA 4X1YA 4Z1VA 2OYQA 3JAKB 4CS2A 5D5PA 1DK1A 4J7KA 2EILC 3D3QA 4X65B 2R9AA 2YI9A 3ZHTA 4DW1A 1A32A 4FZ1A 5H6RA 2YIBD 1JMKC 1YVWA 2YI8A 2DQ3A 3QF7A 4J9YB 2OCHA 2VS0A 3QVNA 5LP6C 1ROPA 1IDSA 3CCVV 1AJQA 3CWBH 5A9GA 5F2VO 1YTFD 2PZSA 2JJ2G 1O9HA 4DR6B 2WA3A 3ZHVA 3K5OA 2E75B 2DYSB 2YXYA 3CCLV 3CX5F 1SA0A 1GRJA 3UCSC 3AK2A 2P5OA 3ZN0A 5LXTB 1R3JC 5IT9N 3ZBHA 4DR5O 1Z5VA 2WLLA 4I0XA 1N34O 1Y4MA 4KXRA 4N21A 3KZIZ 4LFAO 1XL4A 2V7QG 3B8MA 1JJ2U 4UVAA 1EN5A 5J2TB 3SYCA 2WLKA 2XAGA 1GM9A 3AK1A 1XMOO 2EINB 4NKGB 4O4LA 4FLWA 1XILA 4TV9A 2EBOA 4O2AB 5JCOA 3ZRWB 3H1IH 2RN9A 4GUNA 1QLNA 1XUQA 4Q20A 4TUYA 4GKKB 2OTLV 4PA4A 2L35A 2NLJC 2IBZH 3CCQV 3OEHG 2IJKA 1K34A 1BL8A 3CEIA 1FJGO 2CK3G 1TUBA 4JI5O 3J7AU 2PYLA 4PA9A 5BR8B 1IBMB 5L3BA 1YJWV 1RPRA 2UXDO 3BVOA 3IFXA 1GK9A 4DV1O 3WB2A 1PP9H 2QM4A 3UO3A 4YJ3A 1P49A 2GHYA 4UCUA 3EXAA 4RQEA 5K1XA 1IXMA 4NTXA 1GKFA 4H37A 3M8AA 1G6UA 5LYJB 1VQOV 1L0LH 1QBZA 2JGDB 2E5LO 1SQVH 1AI4A 4PD4F 5B3SB 1OCZC 1COWG 3SJBC 2E74B 3GWKC
chains in the Genus database with same CATH topology
1FYJA 4DV0O 1XNRO 1R6TA 4AQYO 3R66A 5BR8O 2DOSA 1KUQA 3J81N 5IT9N 1IBMO 4DR5O 1HNWO 1J5EO 3RT3C 1N34O 5LMUO 4DUYO 3T1HO 4K0KO 2Z0AA 4LFAO 4B3SO 2LW7A 4DR1O 2UUBO 1X59A 1XNQO 4JI8O 1NS1A 1F7YA 4LF7O 4DV4O 4YHHO 2UUAO 2DJVA 4LFCO 4B3MO 3SDLA 1XMOO 4JI1O 1N32O 1N36O 3F5TA 4A5UB 2HHHO 4JI2O 1XMQO 4DV6O 4X65O 4X66O 4B3RO 2F4VO 2FKXA 4JYAO 1YZBA 4NXNO 1IBLO 1AILA 2UXBO 1XEQA 2ZM6O 1G1XB 2UXCO 5IWAO 3T1YO 4GKJO 1FJGO 2UU9O 4JI5O 4DV7O 3J7AU 5BXZA 4LFBO 4DR4O 4JI0O 5FLXN 1DK1A 1FKAO 4YY3O 4LF9O 2UXDO 4JV5O 4B3TO 4OX9O 4DR6O 1D2DA 4DV1O 4X64O 4DUZO 1A32A 3OTOO 4DV3O 4JI6O 3J80N 4JI7O 2JRIA 1HR0O 4LF8O 2AGAA 1IBKO 1HNZO 4JI4O 3O65A 5LL6Y 2ZKOA 5A2QN 4X62O 2VQFO 4DV5O 5H5NA 4DR3O 1AB3A 4LF4O 3M8AA 5BY1A 1R1BA 4GKKO 2VQEO 4DR2O 2E5LO 2N74A 3JAMN 4KHPO 4DR7O 1N33O 4JI3O 4NXMO 5LMNO 4OPAA 1I94O 4OPHA 2UUCO 4LF6O 1HNXO 4LF5O 4DV2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYJ A;  4DV0 O;  1XNR O;  1R6T A;  4AQY O;  3R66 A;  5BR8 O;  2DOS A;  1KUQ A;  3J81 N;  5IT9 N;  1IBM O;  4DR5 O;  1HNW O;  1J5E O;  3RT3 C;  1N34 O;  5LMU O;  4DUY O;  3T1H O;  4K0K O;  2Z0A A;  4LFA O;  4B3S O;  2LW7 A;  4DR1 O;  2UUB O;  1X59 A;  1XNQ O;  4JI8 O;  1NS1 A;  1F7Y A;  4LF7 O;  4DV4 O;  4YHH O;  2UUA O;  2DJV A;  4LFC O;  4B3M O;  3SDL A;  1XMO O;  4JI1 O;  1N32 O;  1N36 O;  3F5T A;  4A5U B;  2HHH O;  4JI2 O;  1XMQ O;  4DV6 O;  4X65 O;  4X66 O;  4B3R O;  2F4V O;  2FKX A;  4JYA O;  1YZB A;  4NXN O;  1IBL O;  1AIL A;  2UXB O;  1XEQ A;  2ZM6 O;  1G1X B;  2UXC O;  5IWA O;  3T1Y O;  4GKJ O;  1FJG O;  2UU9 O;  4JI5 O;  4DV7 O;  3J7A U;  5BXZ A;  4LFB O;  4DR4 O;  4JI0 O;  5FLX N;  1DK1 A;  1FKA O;  4YY3 O;  4LF9 O;  2UXD O;  4JV5 O;  4B3T O;  4OX9 O;  4DR6 O;  1D2D A;  4DV1 O;  4X64 O;  4DUZ O;  1A32 A;  3OTO O;  4DV3 O;  4JI6 O;  3J80 N;  4JI7 O;  2JRI A;  1HR0 O;  4LF8 O;  2AGA A;  1IBK O;  1HNZ O;  4JI4 O;  3O65 A;  5LL6 Y;  2ZKO A;  5A2Q N;  4X62 O;  2VQF O;  4DV5 O;  5H5N A;  4DR3 O;  1AB3 A;  4LF4 O;  3M8A A;  5BY1 A;  1R1B A;  4GKK O;  2VQE O;  4DR2 O;  2E5L O;  2N74 A;  3JAM N;  4KHP O;  4DR7 O;  1N33 O;  4JI3 O;  4NXM O;  5LMN O;  4OPA A;  1I94 O;  4OPH A;  2UUC O;  4LF6 O;  1HNX O;  4LF5 O;  4DV2 O; 
#chains in the Genus database with same CATH topology
 1E1R G;  4DV0 O;  2HJD A;  4FK5 C;  5J2U B;  4X62 B;  3LUT B;  1HNW O;  4DR3 B;  1J5E O;  2V4D A;  3WB1 A;  4FPP A;  1H2M A;  2Q0A A;  2IM9 A;  3SYP A;  3OEE G;  2XAF A;  1W59 A;  2XND G;  4MTF A;  5EC1 C;  1P7B A;  4UCS A;  5IJ9 B;  2DYS C;  2LP7 A;  3RYF A;  2ZNJ A;  2QKA A;  2XAS A;  3WFV A;  3JAT B;  3WU2 Z;  4MS2 A;  4YIO A;  3X2Q B;  3EVK A;  4PA6 A;  1S5H C;  5IDJ A;  1F51 A;  3UT5 B;  4PJ0 Z;  1T5E A;  4H13 B;  5KA6 A;  1VEW A;  5EBM C;  2UXC O;  3WB0 A;  4ICG A;  3MD0 A;  5DED A;  3W7U A;  4I4T A;  4RUF A;  3ZMV A;  1I08 A;  4NYK A;  4DR5 B;  3CRQ A;  2CDY A;  2EIN C;  4LF9 O;  1L0N H;  5LA6 B;  4JAA A;  2OTJ V;  1D2D A;  3APQ A;  4LFA B;  1URF A;  4DRX A;  4PDV A;  2Q68 A;  3L9D A;  4CC5 A;  4LF8 O;  3CC7 V;  5B1B B;  1S5J A;  4B08 A;  3JD4 A;  4MVQ A;  1ZL8 A;  4O4J A;  4MTG A;  1Q90 D;  4TSF G;  1BE3 H;  1XMO B;  2IU3 A;  3MDS A;  2FL4 A;  3OMA B;  1VAR A;  3B77 A;  2JGU A;  1GN4 A;  1QR9 A;  1XBL A;  1Y67 A;  1AR1 B;  4JTC B;  1VQ7 V;  4FLY A;  5DM6 V;  3S3X A;  1F4N A;  1Y74 B;  4OPH A;  4PI0 A;  4O4I A;  5LOV B;  1K33 A;  2JEU A;  1MZE A;  3K9A A;  5H9C A;  1H2L A;  1KUQ A;  1M5I A;  1ZUQ A;  3JAL A;  1VQ4 V;  3ABM B;  1JPX A;  2UXD B;  1KBH A;  3ZX6 A;  3OUS A;  3MHS C;  5KX5 A;  4DV4 O;  1NZ6 A;  1YXB A;  4PV1 B;  5LMN B;  1VQK V;  5E79 Z;  3L71 H;  4HNA B;  2RJZ A;  2ZDI C;  4HBN A;  1MOF A;  1NTM H;  3A0B Z;  1KP3 A;  3I56 V;  2UUC B;  2QTS A;  3JAR A;  3KKY A;  4L87 A;  5IY5 C;  2A7W A;  1P7G A;  1TAE A;  3FB7 C;  4DUY B;  4X66 O;  2KSD A;  4WFB V;  2E5L B;  5C93 A;  3D36 C;  3MHH C;  2HFE C;  1RM1 C;  2JDI G;  3QO7 A;  3ASN B;  2H3O A;  4DV2 O;  5LHG A;  3SYO A;  2GSM B;  4IIJ A;  4DV2 B;  2UU9 O;  1IVS A;  1RP3 B;  1G4Y B;  5LGN A;  1SET A;  2VWK A;  2ILM A;  4JI0 O;  3FFQ A;  5KHI A;  1HNW B;  4FM2 A;  1VMG A;  3K59 A;  3P30 A;  5IYB O;  1H2G A;  3TXQ A;  4GX2 A;  4J7Z A;  5JQG A;  3ZMS A;  4JI6 O;  3CCM V;  3K57 A;  4IHJ A;  1HR0 O;  1JFF B;  2YIC A;  4PEL A;  1F23 A;  2DYR B;  4LNU B;  1M9N A;  4CS4 A;  2VQF O;  2QWQ B;  1G8M A;  3OT7 A;  4HAM A;  4WFF A;  1Q6H A;  2QDO A;  2XUM A;  4DR4 B;  3K5M A;  4E4E A;  3K5L A;  3AG2 B;  2MK3 A;  4UV8 A;  4ZOL A;  4OX9 B;  2E3C A;  1K7D A;  2M6Y A;  2IU0 A;  3CCU V;  1KKC A;  3G6E V;  3P3N A;  2ZIM A;  2UXC B;  1KC8 W;  1R6T A;  1WA8 B;  4ZHQ B;  2QEX V;  1RFY A;  2UXN A;  5B1B C;  4XDK A;  2KB1 A;  3F5W C;  4LC1 A;  4QE9 A;  4K0K O;  2ZIO A;  1SZT A;  1XRE A;  2WLJ A;  3RYC B;  4YHH O;  3RYI A;  4Z2W A;  2Q0O C;  4LF8 B;  4LF6 B;  2UXX A;  1SQG A;  2Q6A A;  3ETG A;  2Y0P A;  1QLE C;  1Q81 W;  2VRZ A;  4B7K A;  1IZ3 A;  4X65 O;  2EX3 A;  5IYD O;  3VQW A;  1BCC H;  3AG1 B;  3JSN A;  4RAI A;  3E22 B;  1V55 C;  1AIL A;  4UB8 Z;  1PKX A;  1UFI A;  1P4R A;  3G4S V;  3N2K A;  5B1O A;  5L3D A;  3T1Y O;  1K4C C;  4JZG A;  2P06 A;  1ARO P;  2OT5 A;  1I5X A;  5JJN B;  2YIB A;  4DV7 O;  1WP8 A;  4CH3 A;  1LUW A;  4KFM A;  3D3I A;  4YY3 O;  3FB5 C;  3SJQ C;  1N4C A;  2YC0 A;  4DR6 O;  3ZHQ A;  2A3Q A;  3GB7 C;  3JAW B;  5B66 Z;  1YJN V;  4LCU C;  2ZT9 B;  1SQB H;  3VQY A;  1XHX A;  1HWY A;  5KUK A;  2E76 B;  4TQD A;  5EIB C;  5IWA B;  1BSM A;  2DW4 A;  2R9I A;  2KQX A;  4UXN A;  2Q7G A;  1FS0 G;  4LF4 O;  2B9Z A;  1Q8I A;  4RO2 A;  1MSW D;  1Q7Y W;  4X66 B;  4MVS A;  1Q3E A;  4JI3 O;  2LO1 A;  3ASO C;  4BR6 A;  4DV3 B;  4WBN A;  3T4Z A;  1GM8 A;  3ABK B;  3R66 A;  2DWE C;  3AG7 A;  3ML0 A;  1YSC A;  4JYB A;  1R6N A;  4K35 A;  3O9O A;  2DE0 X;  2QWO B;  1AR4 A;  3CXH F;  2WWW A;  1J95 A;  5J2T A;  3Q4H B;  3OW2 U;  2L6L A;  2YXH A;  3OUF A;  3L72 H;  1VQP V;  1F7Y A;  4R6Z A;  2JS3 A;  2D3O W;  3LSU A;  4EFE A;  4NXM B;  1BT8 A;  4JI6 B;  3AG2 C;  1HR0 B;  1SQF A;  4ABM A;  3ZRW A;  3AG4 C;  2VQF B;  2FYU H;  2GDS A;  2XT9 A;  4AI8 A;  2P7T C;  3CSX A;  4ASU G;  1QNM A;  1NR1 A;  4XDL A;  4F6E A;  4JZ2 A;  3H9V A;  4LF7 B;  3ZHU A;  5KHK A;  4UCO A;  3FYE B;  1JCH A;  1GTO A;  3JAS B;  3KCY A;  2Y69 C;  3ABT A;  3I5D A;  1FFT B;  2P4V A;  2EZO A;  4LH6 A;  5BMV B;  5KMG A;  3APO A;  1ORQ C;  1SZX A;  2QTO A;  1PNM A;  5FNV A;  4K0K B;  5ITZ B;  3IC9 A;  1DGS A;  3C3S A;  4YHH B;  3AG1 C;  3JCU Z;  1BS3 A;  1OV9 A;  4GYC B;  3ETE A;  5EZY A;  1KB9 F;  1PL4 A;  1K4D C;  1B3Q A;  2Z3Y A;  4R8C A;  4X62 O;  4P9O A;  4DR3 O;  4AHC A;  5H2F Z;  4LFB B;  2XAH A;  5BY1 A;  2KG7 A;  2GBO A;  1OCZ B;  3HPL C;  5KAI Z;  2RNB A;  2QKC A;  2JJ1 G;  4DR7 O;  4PDM A;  3BCC H;  3E8B A;  3OTO B;  2FML A;  2FTK A;  4PI2 A;  5EYP B;  4RUE A;  5CBG A;  1TVK B;  1FYJ A;  4MVR A;  4JYY A;  1XNR O;  1JQ0 A;  4MVZ A;  3T1Y B;  3K3W A;  3ZMZ A;  5GON B;  2LFS A;  2PI4 A;  1JX9 A;  3OR7 C;  4DV7 B;  3E2E A;  1CXZ B;  5CBF A;  3NXS A;  2QGN A;  5CN0 A;  5CA1 A;  4YY3 B;  1KQS U;  1WPX A;  2LJ2 A;  5E1A C;  4KHP B;  2YEV A;  2WLN A;  4YJ2 A;  2UUA O;  3L74 H;  2HR3 A;  1YTF B;  4LFC O;  4F6R B;  5IYZ B;  3N2G B;  2YID A;  4UFZ A;  2CGN A;  2YS8 A;  1OCC B;  2Q7H A;  5CMU A;  3RWR D;  4TOI A;  2G38 A;  4LF4 B;  1PV0 A;  3BAB A;  3UT5 A;  3ABK C;  3ZED A;  4JYA O;  1WNS A;  1N0J A;  3RFR A;  1GN2 A;  4JI3 B;  2GUZ B;  4X89 A;  1Q86 W;  1WB7 A;  2ZR2 A;  4B3M B;  3HKC A;  3R65 A;  3SJA C;  3DXR A;  3CC4 V;  5AG2 A;  1Y66 A;  1XMQ B;  1IX9 A;  3CYO A;  2X6A A;  3CCS V;  5DEC A;  4JGS A;  1AJN A;  2JS5 A;  3OR6 C;  5CA3 A;  4O2B B;  4JAV A;  4K8X A;  2XAQ A;  4K3A A;  2JRI A;  2LW1 A;  4MT8 A;  3W7W A;  4I7Z B;  4X1I A;  1KKD A;  1K3E A;  2ZE6 A;  4QIW F;  2ZKO A;  1H8E G;  3DGE A;  2N04 A;  4G28 B;  2F23 A;  3HR0 A;  1KP2 A;  2R70 A;  3CC2 V;  4IYH A;  2M7W A;  2P67 A;  1VQ5 V;  3OGC C;  5CA0 A;  1NKD A;  4LWS A;  2ZE7 A;  5CB4 B;  5LOV A;  3HKB A;  5LMN O;  2AXT Z;  2UUC O;  4WFE A;  2PF4 E;  2HJF C;  5JVD B;  2ZQM A;  2Q5Z A;  3BAA A;  3N27 A;  1FFX B;  2QWN B;  2QM7 A;  2B5U A;  1PD3 A;  4D6T H;  2RQ6 A;  4QGP A;  4DUY O;  2WLI B;  5GTI Z;  3MAQ A;  1ENV A;  4IL6 Z;  5LHH A;  5IE9 A;  1BMF G;  2RMK B;  1I0H A;  4QE7 A;  1ZAU A;  3HKD B;  3HKE B;  3ZCC A;  1NI8 A;  1N33 B;  1BQ0 A;  5IY5 B;  1I94 B;  1Q43 A;  4FFB A;  4GZR B;  1QCE A;  2EJR A;  2HKO A;  1N32 O;  4A5U B;  3JYC A;  4PHZ A;  4DV6 O;  2BSK B;  3RYH B;  3P32 A;  2WAM A;  1RM1 B;  3ZMU A;  4X1Y B;  3FAV B;  1W0K G;  3BY6 A;  1S5L Z;  3LDC A;  2ITD C;  4G27 B;  2CH7 A;  3STL C;  2UXB O;  5J9P C;  1XEQ A;  2ZM6 O;  4DR7 B;  1W0J G;  5EBL C;  3ICX A;  1RPO A;  1M56 B;  3IGA C;  4U3J A;  4N23 A;  1XNR B;  5KUM A;  4DR4 O;  4K8Z A;  4PA3 A;  1H8H G;  2Q73 A;  4OX9 O;  4KP4 A;  4EFB A;  2AHY A;  1OCC C;  5C8Y A;  2UUA B;  4BWA A;  3QG5 A;  2ZD9 A;  4FLU A;  1E79 G;  4LFC B;  4GKJ B;  1SA0 B;  3ZN1 A;  1AB3 A;  3JD0 A;  4LBE C;  3W7S A;  2X0L A;  5JWP A;  2WLL B;  2N74 A;  1NQT A;  1MA1 A;  2BTQ B;  4JYA B;  1M57 B;  3F7V C;  3OM3 B;  4DUZ B;  3G80 A;  1B6Q A;  4JI7 B;  4LF6 O;  4EB6 A;  4FLZ A;  4G2K A;  4TV8 B;  3CRM A;  3M99 B;  5BZB A;  3SPH A;  2Z5U A;  4O4L B;  5FPR A;  4TV9 B;  1PNK A;  1SF9 A;  3LSS A;  4X20 A;  4F4L A;  3CRC A;  1N8R W;  1SC5 B;  2WA4 A;  2LW7 A;  4I5S A;  4JYC A;  1WLE A;  2HG5 C;  3H01 A;  4O4H A;  1QLE B;  3IC7 A;  5KHG A;  1EBO A;  2F95 B;  4MW3 A;  3CCJ V;  3BA9 A;  4XBF A;  1V55 B;  4MTX A;  1WPB A;  3K5N A;  2FB5 A;  3AG3 B;  2BTO A;  4B3S B;  2XHB A;  1AR5 A;  4LP8 A;  2Y4U A;  5IWA O;  1KYO F;  3CJH A;  1DF4 A;  2QJ1 A;  3UQ8 A;  4JI1 B;  5HFL A;  5EC2 C;  1FXK C;  1PM9 A;  1TA8 A;  4P9P A;  2CUG A;  4TT3 G;  2F66 C;  4KL1 A;  3TXS A;  1NH2 B;  3H1H H;  3G67 A;  1MMM A;  3G6B A;  3CP1 A;  1Y6X A;  4MVM A;  5LP6 A;  1QR8 A;  4DV3 O;  2QR4 A;  2A9H A;  3LNM B;  3A0H Z;  3ZMT A;  1SQP H;  4H0L B;  4Z1M G;  2WLM A;  1QHT A;  2EUL A;  4RQF A;  4MVO A;  1N32 B;  1JVM A;  1M56 C;  4D7T A;  4DV6 B;  3ASO B;  1R1B A;  3E35 A;  1L1F A;  4NXM O;  4X64 B;  2ZNI A;  2UXB B;  2GTA A;  3SPJ A;  4CS3 A;  3U10 A;  2ZM6 B;  2CGO A;  3UM7 A;  4GCZ A;  2YXL A;  2DOS A;  3CE2 A;  2Q8V A;  1MNG A;  2IJI A;  1US6 A;  3L75 H;  5JH7 A;  3T1H O;  1NTZ H;  1ZLZ A;  4IYI A;  3ETD A;  3RYF B;  2DQ0 A;  2Q7E A;  4IT5 A;  1OZ0 A;  4LF7 O;  3AG4 B;  3RVY A;  2BCC H;  2IH1 C;  1H2K A;  4BAY A;  1M57 C;  4MW8 A;  3LDE A;  3PN1 A;  4I9Q A;  3TGU H;  4J9Z B;  4CH6 A;  4AQY B;  4PA7 A;  2F1M A;  5LMU B;  4I4T B;  1XI1 A;  3LSQ A;  4B3R O;  3JD1 A;  4TWK A;  4CZZ A;  3CCE V;  4FVM A;  1Q82 W;  4J10 A;  2Y69 B;  1ZX3 A;  5JCO C;  1G1X B;  4JAS A;  4DRX B;  4KUM A;  1IUR A;  5LBQ A;  1XL6 A;  2IW5 A;  2BE3 A;  1S72 V;  1ZL8 B;  3K9S A;  4O4J B;  4LFB O;  4I55 A;  1EZJ A;  3A8T A;  3CCR V;  1O9G A;  5FLX N;  1YHQ V;  3CD6 V;  4JTD B;  2QM8 A;  5ITZ A;  4ZBM A;  4UCV A;  5IJ0 A;  1HDJ A;  3OTO O;  3AG3 C;  1Y76 A;  4L8J A;  1IXB A;  4DO2 A;  1SER A;  1EN6 A;  3JAK A;  4O4I B;  4CBC A;  1YI2 V;  2ZIN A;  1FAF A;  1EFR G;  2DMX A;  2X7R B;  3JAM N;  3NR7 A;  3JAL B;  5EYP A;  4KHP O;  4X1K B;  2ADP A;  1M93 A;  4WFH A;  3CXC U;  5KX5 B;  1X4T A;  1GMG A;  5D5Q A;  3K79 A;  4FMT A;  3GWO A;  3PJS K;  2BOC C;  2OWO A;  3RBZ A;  1GN3 A;  1ZTE A;  1HW7 A;  3L70 H;  2OCC C;  4HYO A;  1QVF U;  1WAZ A;  1AP5 A;  1EZV H;  1JOY A;  4QNH B;  1VIB A;  5LXT A;  1OJH A;  2WLH A;  4WFG A;  4PDL A;  4B3M O;  4GX1 A;  5B1A C;  3E83 A;  1Z5W A;  3H1J H;  5JJJ B;  2HLD G;  1XMQ O;  2PUS A;  3SPI A;  3FX7 A;  1Q5O A;  4WF9 V;  1NBM G;  1B04 A;  2AW9 A;  2AHZ A;  1CP9 A;  1NVP B;  1VQM V;  4O2A A;  1DTO A;  4LH7 A;  5IYC O;  4IHJ B;  4HZ3 A;  1R73 A;  1ZSP A;  2NNU A;  3ZRX A;  2R9R B;  4QPJ A;  1N36 B;  2A0L A;  3AK3 A;  1R3K C;  3ABL B;  2PI5 A;  2H8P C;  3HB3 B;  3T1H B;  2EIK B;  1FD9 A;  4I50 B;  1XOU A;  4RWU A;  2GTS A;  4ZOL B;  1OHH G;  4FJC C;  4NR1 A;  3DTU B;  1GN6 A;  3CRA A;  4UCR A;  2LFR A;  1VQ6 V;  4DV5 O;  2PYJ A;  3BEH A;  5H5N A;  3B09 A;  4MTO A;  2D2C B;  1S77 D;  4U7O A;  2AZ2 A;  1FXV A;  2YIA A;  3GVM A;  2VQE O;  3SPG A;  4B3R B;  3FB6 C;  1N33 O;  5B1N A;  2JIZ G;  1I94 O;  1JA8 A;  1FPO A;  2VWJ A;  3E8G A;  4UB6 Z;  3RYI B;  1AI5 A;  2YSU B;  2HVK C;  3FD9 A;  2ZE8 A;  3OE7 G;  4NTY A;  5LYJ A;  2JGD A;  2ZDI A;  1KEC A;  2HVJ C;  3HKD A;  3BHP A;  2QSA A;  2UUB O;  3L73 H;  4GLX A;  3U0Z A;  2W0F C;  1WN7 A;  1WP7 A;  1YJ9 V;  1NR7 A;  3LNN A;  4OXS A;  3WG7 B;  5J2U A;  1VP7 A;  4ZI7 B;  1YEW A;  3N2K B;  3D36 A;  3JCZ A;  4J7J A;  3QO5 A;  2K1E A;  3CB2 A;  4H44 B;  2DWD C;  2MW2 B;  5L3E A;  3ZRS A;  4DR1 B;  1W2B U;  3OMI B;  4NVP A;  2Q69 A;  5IJ9 A;  1R3I C;  4FZ0 A;  3VQV A;  2YUA A;  2PY5 A;  2W6I G;  4GKJ O;  3JAT A;  4JI2 B;  1R6K A;  3BPZ A;  5LGU A;  2A06 H;  4WCE V;  4UUJ C;  2F4V B;  1S0V A;  1UJW B;  2NN4 A;  4DUZ O;  4JI7 O;  1SKV A;  5K1P A;  2AGA A;  2K9P A;  3JD2 A;  4BIO A;  2ZXW B;  3O65 A;  2HP8 A;  3STZ C;  4WBN B;  3D8C A;  3B4S A;  2B1G A;  5LA6 A;  1S76 D;  2BTQ A;  2EIJ B;  4PDR A;  4DR2 O;  4JV5 B;  1WB8 A;  1OCR B;  1WJZ A;  5EBW C;  2F93 B;  3ABL C;  4TV8 A;  2EZP A;  4ZIB A;  2EIK C;  4JI4 B;  2RDC A;  1VF6 A;  1VQL V;  2ITC C;  2IH3 C;  3K58 A;  1YIT V;  4B3S O;  1SS3 A;  5JJE B;  1PL0 A;  1Y74 A;  3QTC A;  3SGI A;  1QU7 A;  1D5N A;  1RSO B;  5HFM A;  1U96 A;  3U11 A;  1YF2 A;  4LR3 A;  3G71 V;  2IJH A;  3OAA G;  4JI1 O;  3KG2 A;  1SQQ H;  3FB8 C;  1LUV A;  4CH4 A;  4DV5 B;  1JR9 A;  1UPG A;  3H1L H;  5KMG B;  1MSD A;  3F7Y C;  4MVU A;  2VQE B;  4HNA A;  1I5Y A;  5FPO A;  3SR2 C;  5FNV B;  1YCI A;  2GV9 A;  1BHA A;  1FXK B;  3DC5 A;  4IGG A;  1QVG U;  3CHX A;  3K0D A;  4R7C A;  1OCO C;  4FLT A;  3WG7 C;  4EKW A;  2HHH B;  2JEX A;  5EZY B;  1H38 A;  4C7U A;  1FXH A;  1FKA O;  1P84 F;  4B3T O;  5KAF Z;  2KG7 B;  4X64 O;  4QPK A;  5KHH A;  2PTM A;  2UUB B;  1K97 A;  3K08 A;  3CMA V;  2QA4 V;  1JJO A;  1AI6 A;  1KMI Z;  2XOK G;  3TK1 A;  5LL6 Y;  4R50 A;  3SYA A;  3ZJZ A;  2W0X A;  3K04 A;  4D7S A;  2R72 A;  3CS5 A;  3DSQ A;  2CTQ A;  3ZRV A;  2YDE A;  3VBB A;  2Y48 A;  3DC6 A;  1PNL A;  1JFF A;  2CTR A;  5CA1 B;  4U3F H;  3C90 A;  1XDC A;  1L8D A;  1V54 B;  2JVD A;  1HNX O;  2ADQ B;  4LNU A;  2YEV B;  4YJ2 B;  5TIS Z;  4AQY O;  3J81 N;  1GH6 A;  2F43 G;  2ZXW C;  3S3W A;  3SJC C;  2DN9 A;  5LMU O;  3IJ4 A;  3CME V;  1S3J A;  3B40 A;  3I55 V;  1M1K W;  4I0X B;  2XTA A;  1XNQ O;  2WSS G;  5KA5 A;  3W7T A;  4JAU A;  2EIJ C;  1WA8 A;  4ZHQ A;  5EK0 A;  1OCR C;  4FM0 A;  2V1D A;  3VQX A;  1VQ8 V;  3E8F A;  1EN4 A;  3HKC B;  2X6C A;  1N34 B;  1M4U A;  3DXR B;  1EM1 A;  3RYC A;  5L3C A;  4NXN O;  2A79 B;  4DR2 B;  4AIL C;  1IBL O;  1CPY A;  4W4K A;  2EIM B;  2B1I A;  4JPR A;  1BHB A;  4TUY B;  3OFN G;  3T4D A;  1M90 W;  1TGO A;  1GM7 A;  4X1I B;  4XDJ A;  3OD4 A;  4FM1 A;  3RVZ A;  1K73 W;  3CRR A;  3K06 A;  2AZ0 A;  4J11 A;  4P30 A;  3E22 A;  1TUB B;  2JK5 C;  2LQT A;  2Y4T A;  5CA0 B;  3K0G A;  4LWS B;  3EHB B;  1HNZ O;  4J80 A;  3HKB B;  1SRY A;  3RN4 A;  4YJ3 B;  4ZKI A;  1F4M A;  2OIE A;  4P2Z A;  3AEI A;  4BIZ A;  5A2Q N;  3BA8 A;  1FJG B;  2ARH A;  2P22 C;  4JI5 B;  2RCV A;  5KLV H;  4CC6 A;  3JAW A;  4X1K A;  1XQ8 A;  3RW0 A;  5CBH A;  4DV1 B;  2C2A A;  1R3L C;  2BOB C;  2NR5 A;  2ZE5 A;  1NH2 D;  4LF5 O;  2Q9L A;  5B3S C;  3EFF K;  4FFB B;  1Z2G A;  2QWP B;  5EIB D;  3BFR A;  4J41 A;  2OCC B;  1GO3 F;  2X6B A;  4I9W A;  1VF7 A;  1YDX A;  4UVB A;  1X59 A;  4B3T B;  4JI8 O;  1VQN V;  1AJP A;  3H1K H;  5B1A B;  5LHI A;  1GAX A;  5L3F A;  2CH7 B;  4DV0 B;  1N36 O;  4DXW A;  3F5T A;  1V54 C;  3Q4H A;  3ZHS A;  4U3J B;  3TET A;  2IJJ A;  1J5E B;  3K03 A;  5GW7 A;  4X88 A;  1LR1 A;  2Y0I A;  1CEZ A;  2Q67 A;  4CH5 A;  3X2Q C;  3E89 A;  3C3T A;  3T2M A;  1HNX B;  5C8Y B;  1I7F A;  4UV9 A;  3OGI B;  5LGT A;  1YIJ V;  4W4L A;  4I50 A;  2WPD G;  2P4K A;  3JD3 A;  3UO2 A;  3JAS A;  1XNQ B;  2LGW A;  3BRC A;  1BZK A;  1IBK O;  2P6J A;  4FIP C;  1MAB G;  5BMV A;  2EIM C;  2LGQ A;  2QWR B;  1TUE B;  4YXW G;  1HP8 A;  5KHJ A;  4EB6 B;  2XAJ A;  4GT1 A;  1BGY H;  3FKS G;  4LF9 B;  1VF6 C;  3TCU A;  4X20 B;  4B7E A;  2O57 A;  4NXN B;  1IBL B;  3FYI B;  1DLB A;  4NB5 A;  4O4H B;  3ZS8 C;  4J42 A;  1K5S A;  1AVM A;  4U7N A;  1K9M W;  3RT3 C;  1XHZ A;  2HEP A;  3E86 A;  2Z0A A;  3W7X A;  1PPJ H;  2P90 A;  4DR1 O;  3ZHR A;  1B06 A;  2CTW A;  4Q6G A;  1K8A W;  1TVK A;  4ZI7 A;  3ABM C;  1QQC A;  1HNZ B;  5GON A;  4DYL A;  2EIL B;  5GTH Z;  1Q6I A;  1THZ A;  1ZWI C;  3TJT A;  3JSL A;  4JI2 O;  2CE4 A;  1VF5 B;  3CJH B;  1N0N A;  4EEQ A;  3ZIA G;  3JAR B;  3QO8 A;  5FL7 G;  1LNQ A;  2F4V O;  2FKX A;  1YZB A;  2CTP A;  1U97 A;  4FLV A;  3THO A;  1Q6U A;  4F6R A;  4DV4 B;  5LP6 B;  5IYZ A;  3N2G A;  3B8N A;  4LF5 B;  1NU1 H;  3P3P A;  3LDD A;  3ASN C;  2N05 A;  5BXZ A;  4IIJ B;  1E1Q G;  4JV5 O;  1KU9 A;  1H2N A;  3CPW U;  2KKW A;  3SPC A;  3E8H A;  2GUZ A;  3OTF A;  3UKM A;  3J80 N;  4JI8 B;  4DK1 A;  4JI4 O;  2ODM A;  2Q4P A;  5JQG B;  1K5Q A;  1V9P A;  2UU9 B;  4JF3 A;  4YIP A;  4MSW C;  1NVP D;  2DYR C;  4DK0 A;  4DW0 A;  2H94 A;  2ATK C;  4O2B A;  4JI0 B;  2OIG A;  4GKK O;  5JH7 B;  2ETN A;  4GX5 A;  4UVC A;  4OPA A;  4BW9 A;  4X8A A;  4X9Q A;  2ZR3 A;  1AP6 A;  3ABU A;  3ETQ A;  4BW5 A;  5BR8 O;  4WFA V;  1MZF A;  3T1C A;  5DN6 G;  1IBM O;  4E2L A;  3KCX A;  4BIU A;  5CB4 A;  1RSO A;  4UCT A;  4TQF A;  4GX0 A;  1NS1 A;  1SES A;  3IAY A;  3M7M X;  1MG1 A;  5JVD A;  5L3G A;  1BQZ A;  3A2F A;  1KD1 W;  2QE7 G;  1SQX H;  1FFX A;  4JTA B;  2DJV A;  1IBK B;  3SDL A;  1K92 A;  1NTK H;  3SYQ A;  1D5A A;  3RGB A;  2WLI A;  5B5E Z;  2HHH O;  2PGG A;  4NTW A;  2ZCE A;  3A0R A;  3OMN B;  3QNE A;  3VOU A;  4I55 B;  5H6Q A;  3HKE A;  3B2E E;  2QKS A;  4H33 A;  2CAZ C;  1FXK A;  1AI7 A;  1VQ9 V;  2W6J G;  4QJF B;  1NT2 B;  5IJ0 B;  1OCO B;  4FFK A;  4OGQ B;  1H2S B;  1Y76 B;  2BSK A;  3RYH A;  1NJI W;  2EJ7 A;  4FLX A;  1DF5 A;  3FAV A;  4X1Y A;  4Z1V A;  2OYQ A;  3JAK B;  4CS2 A;  5D5P A;  1DK1 A;  4J7K A;  2EIL C;  3D3Q A;  4X65 B;  2R9A A;  2YI9 A;  3ZHT A;  4DW1 A;  1A32 A;  4FZ1 A;  5H6R A;  2YIB D;  1JMK C;  1YVW A;  2YI8 A;  2DQ3 A;  3QF7 A;  4J9Y B;  2OCH A;  2VS0 A;  3QVN A;  5LP6 C;  1ROP A;  1IDS A;  3CCV V;  1AJQ A;  3CWB H;  5A9G A;  5F2V O;  1YTF D;  2PZS A;  2JJ2 G;  1O9H A;  4DR6 B;  2WA3 A;  3ZHV A;  3K5O A;  2E75 B;  2DYS B;  2YXY A;  3CCL V;  3CX5 F;  1SA0 A;  1GRJ A;  3UCS C;  3AK2 A;  2P5O A;  3ZN0 A;  5LXT B;  1R3J C;  5IT9 N;  3ZBH A;  4DR5 O;  1Z5V A;  2WLL A;  4I0X A;  1N34 O;  1Y4M A;  4KXR A;  4N21 A;  3KZI Z;  4LFA O;  1XL4 A;  2V7Q G;  3B8M A;  1JJ2 U;  4UVA A;  1EN5 A;  5J2T B;  3SYC A;  2WLK A;  2XAG A;  1GM9 A;  3AK1 A;  1XMO O;  2EIN B;  4NKG B;  4O4L A;  4FLW A;  1XIL A;  4TV9 A;  2EBO A;  4O2A B;  5JCO A;  3ZRW B;  3H1I H;  2RN9 A;  4GUN A;  1QLN A;  1XUQ A;  4Q20 A;  4TUY A;  4GKK B;  2OTL V;  4PA4 A;  2L35 A;  2NLJ C;  2IBZ H;  3CCQ V;  3OEH G;  2IJK A;  1K34 A;  1BL8 A;  3CEI A;  1FJG O;  2CK3 G;  1TUB A;  4JI5 O;  3J7A U;  2PYL A;  4PA9 A;  5BR8 B;  1IBM B;  5L3B A;  1YJW V;  1RPR A;  2UXD O;  3BVO A;  3IFX A;  1GK9 A;  4DV1 O;  3WB2 A;  1PP9 H;  2QM4 A;  3UO3 A;  4YJ3 A;  1P49 A;  2GHY A;  4UCU A;  3EXA A;  4RQE A;  5K1X A;  1IXM A;  4NTX A;  1GKF A;  4H37 A;  3M8A A;  1G6U A;  5LYJ B;  1VQO V;  1L0L H;  1QBZ A;  2JGD B;  2E5L O;  1SQV H;  1AI4 A;  4PD4 F;  5B3S B;  1OCZ C;  1COW G;  3SJB C;  2E74 B;  3GWK C; 
#chains in the Genus database with same CATH homology
 1FYJ A;  4DV0 O;  1XNR O;  1R6T A;  4AQY O;  3R66 A;  5BR8 O;  2DOS A;  1KUQ A;  3J81 N;  5IT9 N;  1IBM O;  4DR5 O;  1HNW O;  1J5E O;  3RT3 C;  1N34 O;  5LMU O;  4DUY O;  3T1H O;  4K0K O;  2Z0A A;  4LFA O;  4B3S O;  2LW7 A;  4DR1 O;  2UUB O;  1X59 A;  1XNQ O;  4JI8 O;  1NS1 A;  1F7Y A;  4LF7 O;  4DV4 O;  4YHH O;  2UUA O;  2DJV A;  4LFC O;  4B3M O;  3SDL A;  1XMO O;  4JI1 O;  1N32 O;  1N36 O;  3F5T A;  4A5U B;  2HHH O;  4JI2 O;  1XMQ O;  4DV6 O;  4X65 O;  4X66 O;  4B3R O;  2F4V O;  2FKX A;  4JYA O;  1YZB A;  4NXN O;  1IBL O;  1AIL A;  2UXB O;  1XEQ A;  2ZM6 O;  1G1X B;  2UXC O;  5IWA O;  3T1Y O;  4GKJ O;  1FJG O;  2UU9 O;  4JI5 O;  4DV7 O;  3J7A U;  5BXZ A;  4LFB O;  4DR4 O;  4JI0 O;  5FLX N;  1DK1 A;  1FKA O;  4YY3 O;  4LF9 O;  2UXD O;  4JV5 O;  4B3T O;  4OX9 O;  4DR6 O;  1D2D A;  4DV1 O;  4X64 O;  4DUZ O;  1A32 A;  3OTO O;  4DV3 O;  4JI6 O;  3J80 N;  4JI7 O;  2JRI A;  1HR0 O;  4LF8 O;  2AGA A;  1IBK O;  1HNZ O;  4JI4 O;  3O65 A;  5LL6 Y;  2ZKO A;  5A2Q N;  4X62 O;  2VQF O;  4DV5 O;  5H5N A;  4DR3 O;  1AB3 A;  4LF4 O;  3M8A A;  5BY1 A;  1R1B A;  4GKK O;  2VQE O;  4DR2 O;  2E5L O;  2N74 A;  3JAM N;  4KHP O;  4DR7 O;  1N33 O;  4JI3 O;  4NXM O;  5LMN O;  4OPA A;  1I94 O;  4OPH A;  2UUC O;  4LF6 O;  1HNX O;  4LF5 O;  4DV2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...