1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
4X64O 2DOSA 4X66O 3J81N 1R1BA 4AQYO 4KHPO 2F4VO 3T1YO 5BXZA 4YY3O 4LF9O 4LFCO 1X59A 4JI3O 4X62O 3J7AU 1XEQA 2FKXA 4JI2O 1FKAO 4B3TO 4GKKO 1XNRO 4DUYO 1N34O 4DR3O 4DV7O 2E5LO 2UXCO 2UUAO 4LF4O 4JI8O 4OPHA 4DV5O 2ZKOA 4JI0O 3F5TA 4LFAO 1HNZO 2UU9O 1XNQO 4NXNO 5LMUO 4DV1O 2UUBO 3J80N 2HHHO 5LMNO 1F7YA 1N33O 2UXDO 4DR5O 4DR7O 1DK1A 1IBMO 4GKJO 2VQFO 4OPAA 4JV5O 2AGAA 4DR4O 4X65O 4DV6O 1HNXO 3OTOO 4A5UB 5BR8O 4DV4O 5H5NA 4B3SO 1D2DA 4LF5O 4YHHO 5IT9N 4JI7O 4LF8O 1N32O 1J5EO 3M8AA 1FJGO 4DV3O 1N36O 3JAMN 2UXBO 1IBLO 2N74A 5BY1A 2ZM6O 2VQEO 4B3RO 4JI1O 4JI5O 1R6TA 3RT3C 5LL6Y 4B3MO 4JI6O 1XMOO 4JYAO 3T1HO 5IWAO 1FYJA 3R66A 4DV2O 1YZBA 1AILA 4DUZO 2JRIA 4DR6O 1AB3A 4K0KO 2UUCO 4DR1O 1HR0O 1G1XB 2DJVA 4DR2O 2LW7A 1A32A 2Z0AA 5FLXN 1IBKO 1NS1A 1HNWO 1KUQA 4LF7O 1I94O 4NXMO 3O65A 1XMQO 3SDLA 5A2QN 4DV0O 4LFBO 4JI4O 4LF6O 4OX9O
chains in the Genus database with same CATH superfamily
2IJKA 4ZHQB 4JGSA 4AQYO 3CX5F 1XL6A 4FZ0A 1S72V 1H38A 4KUMA 1Y4MA 1K92A 1SA0A 1XILA 1W0KG 4PA6A 4ZOLB 2IBZH 2CTWA 4TUYB 4JF3A 1AJPA 2KKWA 3AG1B 1V55B 4NYKA 1VQOV 4DR2B 1YEWA 2W0XA 5J9PC 1F7YA 1N33O 1YF2A 1QR8A 3VQVA 1IXMA 3TXQA 5ITZA 4WFFA 2PUSA 3ETDA 5LYJA 2WLJA 3E8BA 2XAFA 4TOIA 1S5JA 3ZHQA 1GN2A 4U7NA 3A8TA 1HR0B 3JAMN 1EZVH 2NLJC 1Y76A 1IBLO 3A0RA 4DO2A 1SC5B 4MTFA 3WB0A 1DF4A 4DUYB 4PHZA 5B5EZ 2X6AA 1SQPH 4NTYA 3LSUA 5KMGA 5IWAO 3P30A 3JSLA 5BMVA 4ZIBA 1Q90D 2QGNA 4DR7B 1VF6A 1KQSU 4CZZA 1Y76B 1BQ0A 1AP6A 1VP7A 1VQ6V 3JD3A 3ZS8C 2ODMA 1JVMA 2JVDA 2YI8A 2A9HA 3B77A 4QPKA 3O65A 5KMGB 4YHHB 2VS0A 3AG3B 5A2QN 4FLTA 3CCQV 1NTMH 4MTOA 2GBOA 3CCSV 2LQTA 1V54B 3RW0A 1JJOA 1Q81W 1T5EA 4HAMA 1SQVH 2R9IA 3H1KH 4FIPC 4LH6A 1FFXA 3IGAC 5C93A 4QGPA 3FFQA 5B1NA 3KKYA 2QKSA 1H2GA 2L6LA 4LNUA 2EIJB 3HKBB 3K5NA 2LW1A 1ZWIC 4LF4O 1JX9A 1EM1A 4BAYA 3AG1C 4J7KA 1K34A 2OCHA 2HJDA 4JPRA 1L0NH 1AR4A 3ASOB 5A9GA 1NVPB 1M90W 4PA9A 5B3SB 4FLYA 1DK1A 1IBMO 4RUFA 1FXVA 5GTIZ 1PV0A 2YC0A 1M4UA 4JV5O 1FXHA 4DV0B 4X1IA 4DV6O 1QLNA 2R72A 3OTOO 4PDLA 4N21A 4O4HA 2OIEA 4FK5C 2YDEA 5KHIA 2DYSB 3G6EV 1THZA 4R6ZA 3VQYA 4JI7O 4FLVA 1QBZA 2F4VB 3CP1A 4UUJC 2WLMA 1Q3EA 1QVGU 2Y0IA 1M9NA 4MVMA 4B7KA 1ZLZA 4JI5O 1H2NA 5EZYA 1JFFB 3K06A 4OGQB 5IYBO 1VQ9V 5EYPB 3N2GB 1IX9A 2FB5A 4EKWA 2GV9A 5LMNB 1KP3A 4PI0A 4G27B 3WU2Z 2CH7B 3E86A 3QVNA 1NT2B 2HEPA 1KMIZ 2DJVA 4X65B 2QTSA 3ASNB 2WLIB 3VOUA 2Z0AA 1BMFG 1VQ4V 1YIJV 1VQ7V 4JI4O 1VQKV 3JAWA 3NR7A 3CC2V 4X66O 2QM7A 5LGNA 3T4DA 5KAIZ 1PM9A 1V54C 1VF6C 1SS3A 2ZD9A 3RYHB 4YY3O 4TQFA 2BTOA 1XEQA 4CC5A 4NTXA 2RQ6A 4UVCA 1RSOB 2B9ZA 4LCUC 4EFEA 2ZR2A 4LWSB 3CMEV 5FL7G 3JAWB 3LNNA 1FJGB 2EIJC 3SPJA 4OPHA 4CS4A 4DV3B 2HLDG 1L8DA 1Q8IA 3GWKC 3GWOA 4UCTA 1BSMA 4DR5O 2QKAA 5IJ0A 1TUEB 5FNVB 3T4ZA 2H94A 2G38A 5B3SC 1PNKA 2P90A 3W7UA 3F7VC 3X2QB 3IJ4A 4CS2A 1U96A 4A5UB 3LUTB 4DV2B 1YVWA 3M7MX 2IM9A 1LUWA 4CH3A 3M8AA 4GX2A 5CA1A 1WPBA 2PGGA 1ENVA 2AZ2A 2ARHA 3D8CA 4ICGA 5IJ0B 4PV1B 5L3FA 2F43G 2PTMA 1N34B 1UFIA 1R3IC 4R7CA 2AZ0A 4DV1B 1OJHA 2HHHB 3RVZA 3ZJZA 5HFLA 4X1YA 4DR2O 2LJ2A 1LR1A 1S0VA 3CJHA 4MSWC 4LF5B 1G6UA 2HVKC 2L35A 4D6TH 1WP8A 3GVMA 4LF6O 4HZ3A 2Y0PA 5L3DA 4B3RB 1N33B 2FL4A 4KHPO 2IJIA 4X1YB 2WWWA 4JI6B 3EVKA 4CH6A 4U3JB 2XASA 3KG2A 1P84F 1OZ0A 2LFRA 2QM8A 5CBFA 2Q68A 5EIBC 4DUYO 2XAHA 1Q86W 2YSUB 3SJBC 3SYCA 1SQBH 4L87A 1SF9A 4WFGA 5B1BB 3CCEV 2HP8A 2JS5A 4WFAV 4DR7O 4I50B 3JAKA 1PD3A 2V1DA 3OR7C 4B7EA 1L1FA 4MVUA 2B1IA 3L74H 3L9DA 4X64B 4I4TA 4YHHO 2BOBC 3F5WC 3CWBH 2ZXWC 2N74A 2Q0OC 5LHIA 1I5YA 3U10A 5IDJA 1S5LZ 4BW5A 1GTOA 1NVPD 3FAVA 1EZJA 2DYRB 4WFEA 1XMOO 5GTHZ 1HDJA 1OCRC 1JR9A 3RFRA 4CC6A 2XNDG 2WA3A 3G71V 1MSWD 2Q67A 4I4TB 1QLEB 1JOYA 3E83A 4F6RB 4OXSA 2EBOA 4IYIA 2EZOA 1IDSA 5DEDA 3JCZA 1P7BA 4QIWF 1MSDA 4MW3A 4J7ZA 4UXNA 4WBNB 1WLEA 2UXXA 2Y69C 5GW7A 2YEVA 3SDLA 4DV0O 2E74B 4AI8A 3G67A 1FAFA 1JQ0A 3D3IA 1PKXA 1ZUQA 4NR1A 3U0ZA 5E79Z 2PI5A 2WLKA 2F4VO 3H1IH 3FD9A 4JV5B 1Y74B 4EB6B 1KC8W 3AG7A 3CYOA 4DV6B 3OTOB 2EZPA 5JVDA 4JZGA 2CE4A 2OTJV 5CN0A 3FKSG 1XHZA 4J10A 1R3JC 1XNRO 2IU3A 3AG4C 4EFBA 3RYCA 2BE3A 2P67A 1QU7A 2UUCB 1RP3B 1VQPV 2QWNB 3F5TA 3R65A 1VF7A 3L70H 5B66Z 2UUBO 2X6CA 5LMNO 1IBKB 5B1BC 3CSXA 1F4NA 3ZHSA 5H6RA 2XHBA 2Y48A 3EFFK 5JVDB 4IL6Z 4X65O 2NN4A 3W7TA 3STLC 4ZI7A 2ZE6A 1JA8A 2M6YA 2QWRB 1Q7YW 4OX9B 5LHGA 5KX5A 3AG2C 3BHPA 4MVRA 4IT5A 3H1HH 1NKDA 3IFXA 2V4DA 2B1GA 2QJ1A 1MZFA 1WN7A 1RPOA 4JTAB 3ZBHA 4HNAA 3QNEA 4BIZA 1AR1B 3H1JH 1MZEA 2FYUH 4GKKB 3ETEA 5L3EA 4JAVA 1LNQA 4KXRA 1M56C 1B04A 4KP4A 4YIPA 3HKEA 5KLVH 3VQWA 2EX3A 3RWRD 3QF7A 5LMUB 1JJ2U 2JDIG 3E35A 4TV8B 1QLEC 4JYYA 4MVOA 2ZNJA 4K0KO 2VQFB 2KSDA 1GH6A 4HNAB 3JASA 4DV4B 3TCUA 4UB8Z 4UCVA 2CGOA 4B08A 3HKEB 1F4MA 4RWUA 3OEEG 4PJ0Z 4JI1B 3MHSC 4JZ2A 1R1BA 4Z2WA 4DR5B 2OIGA 3P3PA 2ILMA 3ZN1A 3OUSA 3A0HZ 1X59A 5E1AC 2R9RB 4PA7A 2K9PA 1GK9A 3OFNG 1K5SA 2WLHA 3JYCA 2ZT9B 4ZOLA 3K58A 4FM0A 1N34O 2F1MA 1K97A 2PZSA 2ZKOA 1WPXA 4Q6GA 4MS2A 3K03A 4DV1O 3B40A 2XUMA 2HHHO 5LXTB 1HNWB 1MMMA 1AVMA 3IC7A 1GO3F 1K5QA 2CGNA 3OGCC 2OTLV 4FMTA 4O4LB 1TVKA 1DGSA 4LF5O 1Y6XA 1FPOA 1H2MA 4K3AA 4PI2A 5TISZ 1RPRA 5L3GA 1YTFB 2VWJA 1KU9A 2OYQA 5EC2C 2WLLB 5BY1A 4BW9A 3H01A 3T2MA 2GTAA 2OCCB 4B3RO 1DLBA 4FFKA 3OM3B 3KZIZ 4JI6O 4G28B 1SQGA 1PL4A 2QWQB 3T1CA 1TVKB 2VRZA 1H2KA 3SYAA 4JI8B 4LF6B 1WJZA 2AW9A 3UQ8A 2ZCEA 1ROPA 1JMKC 5KA6A 2GDSA 4KHPB 2UXDB 1O9GA 4Z1MG 3SGIA 4NB5A 5EBLC 3AK3A 1MNGA 1P7GA 1A32A 2CAZC 3K59A 1PL0A 3N2KB 2BCCH 4BWAA 2E76B 2OWOA 1SESA 4X64O 4H0LB 4ABMA 3UT5A 2KG7B 1K4CC 4LF9O 1Q82W 3ZRWA 2AHZA 5F2VO 3L72H 2ZDIA 1UPGA 1Y67A 4UCOA 3E22B 5K1XA 2N05A 3HKBA 3OW2U 4DR6B 2LGQA 1QVFU 3JSNA 3UT5B 4W4LA 1AJNA 4QE7A 3JALA 3CRRA 4GUNA 3RBZA 3SJCC 3ZRWB 1XMOB 4O4JB 3W7WA 3ZIAG 4F6EA 3K9SA 2XAJA 1BE3H 3LSSA 4UCRA 5H5NA 5JJNB 4NTWA 2JJ2G 3SYPA 2YXYA 1W0JG 5EBMC 1V55C 1AROP 1PP9H 2GSMB 3JALB 5CB4A 4MTGA 2OCCC 2JGDB 1P49A 2ETNA 2FTKA 5IYCO 1JFFA 4TT3G 3AK1A 5EYPA 2BTQA 4P2ZA 3N2GA 2Q5ZA 3B8NA 1AILA 2EJRA 2EJ7A 4TV9B 2UUCO 2CH7A 4PELA 1F23A 2Z3YA 5CB4B 4QPJA 3ZRSA 2LW7A 3ABMB 3QO5A 2WLIA 1QHTA 5J2TB 1IBKO 1KUQA 4FZ1A 1XNRB 2CDYA 2BTQB 2EULA 2Q8VA 1NI8A 3K79A 1NR7A 3L73H 3CCVV 4OX9O 3E2EA 4ASUG 4WCEV 2UUBB 2ZM6B 3G6BA 3JATB 4GLXA 4ZKIA 2YICA 2QM4A 5IJ9B 1BCCH 3RYHA 3FYEB 4J11A 4LFCO 4QJFB 4GKKO 1RSOA 2HVJC 3OE7G 4LWSA 5H2FZ 4I9WA 1R6NA 3AG3C 5CBGA 4DUZB 1RM1B 1MABG 2K1EA 4DV5O 3C3SA 2RMKB 1I0HA 1XNQO 5LMUO 2O57A 5KUMA 1KBHA 4JYBA 2VQFO 5FNVA 1K7DA 4JTDB 1KD1W 4DRXB 2ZDIC 3K5LA 3HKCA 2A06H 4DV4O 4D7TA 1UJWB 3ZMTA 2CTPA 1SETA 4PDVA 1ORQC 1OCOB 4WFHA 3CRCA 2JIZG 3SR2C 4K0KB 4JYCA 4BIUA 2UXBO 4JI3B 4X62B 4F4LA 3CCMV 4I55B 5LHHA 4JI1O 3WFVA 3S3XA 3ASOC 5HFMA 4JI2B 1R6TA 1J95A 1YJ9V 1OCCB 1AI6A 1R3LC 4GX0A 3HKCB 1X4TA 3BY6A 1VARA 1D5NA 4H37A 2F95B 4JI0B 2DYSC 1S5HC 2QR4A 3LDEA 5FPRA 3JD0A 1OHHG 1YTFD 2CUGA 1QQCA 1HNWO 5JCOA 4B3SB 1YSCA 3WG7B 4NXMO 3RYIA 1ZX3A 3IC9A 1I7FA 3K5MA 3UKMA 3OD4A 3SJQC 3TK1A 3A2FA 4G2KA 3ZN0A 3JARB 4MVQA 3CXCU 4U3JA 3ASNC 3K0DA 1I08A 2FKXA 2LGWA 1FKAO 4DW0A 3RYIB 4Z1VA 3ICXA 2DW4A 1L0LH 1OCZB 2WPDG 4JI8O 3VBBA 2RN9A 1KB9F 4P9OA 1SQXH 2DMXA 1KECA 3FB7C 5EC1C 2F66C 2UXDO 3WB2A 4FLZA 4I50A 1XOUA 1SERA 3RYFB 2AGAA 4J42A 4MVZA 2IU0A 1HNXO 1VMGA 2BOCC 1Z2GA 1EBOA 5KUKA 5K1PA 2ATKC 5CMUA 1OV9A 5IT9N 1N32O 2IJJA 4E4EA 3OAAG 3G4SV 2PY5A 1KKDA 4WFBV 1M57B 5KHKA 3BA9A 1NZ6A 2XAGA 3CC4V 1R3KC 1XQ8A 1OCCC 4IIJB 3X2QC 3F7YC 4TWKA 5JQGA 2YI9A 4DK0A 1N0NA 4IGGA 1YZBA 4DR6O 3LNMB 4LF9B 4F6RA 4LH7A 2JGUA 5B1AB 3ZHVA 1AR5A 4TSFG 5BR8B 2EIKB 2H3OA 3DXRB 4WBNA 5JJJB 5BZBA 3ABUA 3WG7C 2DWEC 4YJ2A 1GM9A 5JQGB 2Q4PA 3BFRA 2Q0AA 1N36B 2P06A 1IXBA 2DOSA 2ZQMA 4HBNA 2DE0X 1HWYA 3UCSC 1B06A 2Z5UA 1IVSA 2W6JG 5J2UB 1E1RG 1Y74A 4EB6A 3OMIB 3J7AU 3EXAA 1GAXA 4FLXA 4BIOA 5JCOC 2RCVA 3GB7C 3TETA 1CXZB 4YJ2B 5L3CA 1S3JA 3L75H 3DGEA 1SZTA 1OCZC 4FPPA 4CH4A 4N23A 3ABTA 3W7XA 3J80N 1S76D 1TAEA 2YIDA 5IYZA 3CCRV 3NXSA 2PI4A 1H2LA 1CP9A 1U97A 1GN6A 3EHBB 4PA4A 2ITDC 2CTQA 3A0BZ 4DR4O 3JD2A 1GN4A 2DN9A 1XUQA 2LP7A 1FXKB 1YITV 4MVSA 3BAAA 3BVOA 5IYZB 4R50A 3M99B 4UFZA 2ZM6O 2VQEO 1M57C 5LL6Y 4B3MO 1V9PA 1HP8A 1NTKH 2EIMB 4CBCA 3ZHRA 4UCUA 4O4IB 2F23A 3K3WA 4DUZO 1YJWV 4TV8A 2GTSA 3ZMZA 3CC7V 4LFCB 1XDCA 1VQNV 1H8EG 3DSQA 4P9PA 4C7UA 2BSKB 2PF4E 1NS1A 2NNUA 2WLNA 1YJNV 2ADPA 2DYRC 4PDRA 4WF9V 3LSQA 4DV5B 2Y4TA 3ZMUA 3P32A 1NR1A 3UO2A 1XNQB 2IH3C 2X6BA 1PNMA 2P4KA 2CTRA 5CA0A 3TJTA 1K73W 4U7OA 2RNBA 5LP6A 3OEHG 3SJAC 1US6A 4JI3O 4X62O 3OT7A 3ABKB 2C2AA 4I0XA 5KHGA 4JI2O 3B2EE 2HKOA 4K8XA 4DR3O 1XI1A 2UUAO 4BR6A 2XT9A 1WNSA 2UXBB 3CHXA 4JI0O 4KL1A 5GONA 4X9QA 5CA0B 4NXNO 2V7QG 1WAZA 5LP6B 5LXTA 3SYOA 2XTAA 3CD6V 1I94B 1ZL8A 2A3QA 1DTOA 4PDMA 4I0XB 1N8RW 3DC5A 4PA3A 4O4LA 5C8YA 1BGYH 4B3SO 4UVAA 4KFMA 2ITCC 1B6QA 3T1YB 5GONB 3CRQA 3SPHA 2YXHA 3FB8C 1GMGA 2WLLA 3QTCA 2Q7GA 1EN4A 1ZL8B 4I5SA 4NXMB 4K8ZA 3L71H 3SPIA 1MOFA 1VQ5V 1B3QA 5C8YB 1Q43A 1D5AA 2EIMC 4GX5A 4DK1A 3VQXA 4H13B 1FS0G 3B4SA 3OMAB 2A7WA 1H2SB 1FFTB 5LA6B 1MG1A 1ZSPA 1SRYA 3D3QA 5FLXN 2F93B 4LF7O 2ADQB 1XMQO 1CEZA 3N2KA 3FB6C 1YHQV 1Z5WA 3PN1A 5JH7A 4FVMA 4LBEC 2ZNIA 2FMLA 4MT8A 2KG7A 4FFBA 5EBWC 1COWG 1HNXB 4AILC 5DECA 1SA0B 4H33A 4YIOA 3ABKC 3OGIB 1URFA 5B1OA 5IYDO 3E22A 1N32B 2X7RB 2XAQA 3KCXA 5JH7B 2HG5C 4LP8A 2Y4UA 1HW7A 1KYOF 3UM7A 3K0GA 3TXSA 3BABA 1AP5A 4FFBB 5LP6C 5KHHA 3QO8A 3DC6A 2HJFC 1Y66A 5ITZB 5LGUA 3E8HA 4LFBB 5LYJB 4O4JA 2WA4A 5BR8O 1M1KW 3KCYA 1VQ8V 1D2DA 3BA8A 2EINB 2PYLA 4LF8O 1JPXA 1J5EO 3K9AA 1QNMA 1PNLA 1VIBA 1N36O 1N4CA 4UB6Z 3CRMA 4Q20A 3BCCH 3ZRXA 1QR9A 4NVPA 2E3CA 4B3TB 2JGDA 2UXNA 4JYAO 2YS8A 1RFYA 1KP2A 5BMVB 4LFAB 1Q5OA 5DM6V 1Q6UA 1TGOA 4TV9A 4J9YB 1AB3A 3ZEDA 4DR1O 2JJ1G 2Q6AA 4DW1A 3S3WA 4U3FH 4FJCC 2GUZA 1R73A 5J2TA 5IY5B 2ZR3A 4O2BA 1JCHA 5AG2A 3E89A 3JD1A 1GM7A 3D36A 2EILB 2MW2B 1ZAUA 2D2CB 2AXTZ 1WA8A 1G8MA 3O9OA 2YIBD 1EN6A 2DQ0A 1IZ3A 4XBFA 3JATA 4CS3A 2QWOB 2YXLA 3W7SA 1FFXB 5IJ9A 3DTUB 4DR4B 1WB7A 4H44B 4FLWA 3T1HB 2GUZB 1AJQA 1W59A 4O2BB 1H8HG 3WB1A 3OR6C 4LNUB 2E5LO 2QKCA 3E8GA 4J9ZB 4DV7O 3H1LH 2Q7HA 4YJ3A 4L8JA 1WA8B 3ETQA 5CBHA 1K8AW 1YCIA 4W4KA 2UU9O 2VQEB 4B3MB 3BRCA 3TGUH 1XHXA 4X1IB 5JJEB 1FD9A 4DRXA 4O4HB 1AI7A 3FYIB 1BL8A 2P6JA 1BQZA 2HFEC 3CS5A 1K33A 3LDCA 1M93A 5FPOA 2R70A 4YJ3B 2EINC 4I9QA 1EFRG 2ZE8A 2WAMA 3JCUZ 1NJIW 3CEIA 3FB5C 3CMAV 1LUVA 4I55A 1GM8A 2WSSG 3APQA 4RAIA 5EZYB 2B5UA 2UXCB 2E75B 4D7SA 3G80A 4UCSA 1VQLV 1S77D 3R66A 3K5OA 1ZTEA 1E1QG 1YI2V 3H9VA 4X20A 4GKJB 4PD4F 1NH2B 1EN5A 1K9MW 2Q9LA 2LFSA 3BEHA 4X8AA 3MAQA 5D5QA 4XDLA 4JAAA 4DR3B 1YDXA 1I94O 4FLUA 2UUAB 2JS3A 3MHHC 5IY5C 1I5XA 5EK0A 1BT8A 4NXNB 2EILC 4GYCB 3ZMVA 2QEXV 4JTCB 4X20B 3THOA 3T1YO 3JARA 4I7ZB 1BZKA 2Q73A 2QDOA 5LBQA 3ABMC 2A0LA 2R9AA 5KA5A 1GN3A 3CCLV 2W6IG 4EEQA 3CB2A 1TA8A 3D36C 2RDCA 3SPCA 2ZXWB 3B8MA 1F51A 1HNZO 5CA3A 2VWKA 1N0JA 3RGBA 1AI4A 4XDJA 4JASA 1NBMG 4XDKA 4MTXA 1OCRB 3RYFA 4X1KA 1VEWA 4UVBA 4UV9A 1W2BU 2ZINA 1NQTA 5H9CA 3RN4A 4AQYB 3SYQA 1RM1C 5CA1B 2LO1A 2X0LA 1R6KA 4MW8A 3C3TA 1BHAA 4DYLA 4IHJA 3RT3C 4LF7B 3AK2A 1XMQB 2Y69B 4J41A 4X1KB 2XOKG 2P22C 4IIJA 2HR3A 3B09A 3PJSK 1NU1H 1OCOC 5IE9A 3MD0A 1HR0O 2W0FC 3E8FA 2RJZA 4IHJB 1GRJA 4P30A 3CJHB 2H8PC 3K04A 3DXRA 3AG4B 4LFBO 1DF5A 1P4RA 1IBLB 3ZX6A 1BHBA 2D3OW 3CRAA 1XL4A 2A79B 3I5DA 2CK3G 2QE7G 2GHYA 5J2UA 5LOVA 5IWAB 3CXHF 1SQFA 2ZE7A 4RUEA 3CCUV 2IH1C 2QWPB 3P3NA 2DQ3A 4B3TO 3AG2B 4FM2A 3ZCCA 3JD4A 4LF8B 1Q6IA 3I56V 1J5EB 2Q69A 4HYOA 4LFAO 3ABLB 3QG5A 1NTZH 3AEIA 3HR0A 1M5IA 2DWDC 3JAKB 2KQXA 2QTOA 4JYAB 5LOVB 4OPAA 1M56B 1SQQH 1YXBA 4LR3A 4J80A 4J7JA 3OUFA 5KAFZ 1FXKA 1O9HA 4UV8A 4DR1B 5JWPA 4R8CA 2QSAA 3K57A 2IW5A 2QA4V 3STZC 3FAVB 3MDSA 4NKGB 1TUBA 3HKDA 4TQDA 3T1HO 4LF4B 3FX7A 3ZRVA 2YIBA 1IURA 1FYJA 4O4IA 1Z5VA 1VF5B 5DN6G 1Q6HA 2JRIA 1GKFA 1IBMB 2MK3A 4ZBMA 5H6QA 3Q4HA 2N04A 1WP7A 4AHCA 4JAUA 2BSKA 2P5OA 5KHJA 4GZRB 4QE9A 1TUBB 2YEVB 4DV7B 2E5LB 3QO7A 3HKDB 4K35A 2PYJA 4FM1A 4JI7B 2M7WA 2ZE5A 4RQEA 2UU9B 5L3BA 3J81N 2ZIMA 2Q7EA 4JI5B 3RVYA 1K4DC 5BXZA 3SPGA 3ZHTA 3Q4HB 1WB8A 1NH2D 1KKCA 5B1AC 5D5PA 3ZMSA 2YUAA 3OTFA 1XREA 2EIKC 1CPYA 2JEUA 3RYCB 2UXCO 4GCZA 3ML0A 5EIBD 3U11A 2ZIOA 4O2AA 3CCJV 2YIAA 1MA1A 4RO2A 2NR5A 3ABLC 2JK5C 4CH5A 4DXWA 5LGTA 4GKJO 4E2LA 1BS3A 3HPLC 1K3EA 4ZI7B 4JI4B 4X88A 2OT5A 3I55V 3LDDA 5KX5B 4X66B 1PPJH 4QNHB 2P7TC 4LC1A 1FJGO 4DV3O 4YY3B 4O2AB 2P4VA 1G4YB 2JEXA 4GT1A 3OMNB 4GX1A 3BPZA 2AHYA 3K08A 3ZHUA 4YXWG 1E79G 3UO3A 4IYHA 3CE2A 1FXKC 4DV2O 3CPWU 4X89A 1QCEA 2IJHA 3HB3B 1AI5A 3APOA 4ZHQA 5LA6A 1XBLA 1G1XB 3ETGA 3JASB 1SZXA 3C90A 1VQMV 2KB1A 4RQFA 4TUYA 3IAYA 3N27A 1HNZB 1SKVA
chains in the Genus database with same CATH topology
4X64O 2DOSA 4X66O 3J81N 1R1BA 4AQYO 4KHPO 2F4VO 3T1YO 5BXZA 4YY3O 4LF9O 4LFCO 1X59A 4JI3O 4X62O 3J7AU 1XEQA 2FKXA 4JI2O 1FKAO 4B3TO 4GKKO 1XNRO 4DUYO 1N34O 4DR3O 4DV7O 2E5LO 2UXCO 2UUAO 4LF4O 4JI8O 4OPHA 4DV5O 2ZKOA 4JI0O 3F5TA 4LFAO 1HNZO 2UU9O 1XNQO 4NXNO 5LMUO 4DV1O 2UUBO 3J80N 2HHHO 5LMNO 1F7YA 1N33O 2UXDO 4DR5O 4DR7O 1DK1A 1IBMO 4GKJO 2VQFO 4OPAA 4JV5O 2AGAA 4DR4O 4X65O 4DV6O 1HNXO 3OTOO 4A5UB 5BR8O 4DV4O 5H5NA 4B3SO 1D2DA 4LF5O 4YHHO 5IT9N 4JI7O 4LF8O 1N32O 1J5EO 3M8AA 1FJGO 4DV3O 1N36O 3JAMN 2UXBO 1IBLO 2N74A 5BY1A 2ZM6O 2VQEO 4B3RO 4JI1O 4JI5O 1R6TA 3RT3C 5LL6Y 4B3MO 4JI6O 1XMOO 4JYAO 3T1HO 5IWAO 1FYJA 3R66A 4DV2O 1YZBA 1AILA 4DUZO 2JRIA 4DR6O 1AB3A 4K0KO 2UUCO 4DR1O 1HR0O 1G1XB 2DJVA 4DR2O 2LW7A 1A32A 2Z0AA 5FLXN 1IBKO 1NS1A 1HNWO 1KUQA 4LF7O 1I94O 4NXMO 3O65A 1XMQO 3SDLA 5A2QN 4DV0O 4LFBO 4JI4O 4LF6O 4OX9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 O;  2DOS A;  4X66 O;  3J81 N;  1R1B A;  4AQY O;  4KHP O;  2F4V O;  3T1Y O;  5BXZ A;  4YY3 O;  4LF9 O;  4LFC O;  1X59 A;  4JI3 O;  4X62 O;  3J7A U;  1XEQ A;  2FKX A;  4JI2 O;  1FKA O;  4B3T O;  4GKK O;  1XNR O;  4DUY O;  1N34 O;  4DR3 O;  4DV7 O;  2E5L O;  2UXC O;  2UUA O;  4LF4 O;  4JI8 O;  4OPH A;  4DV5 O;  2ZKO A;  4JI0 O;  3F5T A;  4LFA O;  1HNZ O;  2UU9 O;  1XNQ O;  4NXN O;  5LMU O;  4DV1 O;  2UUB O;  3J80 N;  2HHH O;  5LMN O;  1F7Y A;  1N33 O;  2UXD O;  4DR5 O;  4DR7 O;  1DK1 A;  1IBM O;  4GKJ O;  2VQF O;  4OPA A;  4JV5 O;  2AGA A;  4DR4 O;  4X65 O;  4DV6 O;  1HNX O;  3OTO O;  4A5U B;  5BR8 O;  4DV4 O;  5H5N A;  4B3S O;  1D2D A;  4LF5 O;  4YHH O;  5IT9 N;  4JI7 O;  4LF8 O;  1N32 O;  1J5E O;  3M8A A;  1FJG O;  4DV3 O;  1N36 O;  3JAM N;  2UXB O;  1IBL O;  2N74 A;  5BY1 A;  2ZM6 O;  2VQE O;  4B3R O;  4JI1 O;  4JI5 O;  1R6T A;  3RT3 C;  5LL6 Y;  4B3M O;  4JI6 O;  1XMO O;  4JYA O;  3T1H O;  5IWA O;  1FYJ A;  3R66 A;  4DV2 O;  1YZB A;  1AIL A;  4DUZ O;  2JRI A;  4DR6 O;  1AB3 A;  4K0K O;  2UUC O;  4DR1 O;  1HR0 O;  1G1X B;  2DJV A;  4DR2 O;  2LW7 A;  1A32 A;  2Z0A A;  5FLX N;  1IBK O;  1NS1 A;  1HNW O;  1KUQ A;  4LF7 O;  1I94 O;  4NXM O;  3O65 A;  1XMQ O;  3SDL A;  5A2Q N;  4DV0 O;  4LFB O;  4JI4 O;  4LF6 O;  4OX9 O; 
#chains in the Genus database with same CATH topology
 2IJK A;  4ZHQ B;  4JGS A;  4AQY O;  3CX5 F;  1XL6 A;  4FZ0 A;  1S72 V;  1H38 A;  4KUM A;  1Y4M A;  1K92 A;  1SA0 A;  1XIL A;  1W0K G;  4PA6 A;  4ZOL B;  2IBZ H;  2CTW A;  4TUY B;  4JF3 A;  1AJP A;  2KKW A;  3AG1 B;  1V55 B;  4NYK A;  1VQO V;  4DR2 B;  1YEW A;  2W0X A;  5J9P C;  1F7Y A;  1N33 O;  1YF2 A;  1QR8 A;  3VQV A;  1IXM A;  3TXQ A;  5ITZ A;  4WFF A;  2PUS A;  3ETD A;  5LYJ A;  2WLJ A;  3E8B A;  2XAF A;  4TOI A;  1S5J A;  3ZHQ A;  1GN2 A;  4U7N A;  3A8T A;  1HR0 B;  3JAM N;  1EZV H;  2NLJ C;  1Y76 A;  1IBL O;  3A0R A;  4DO2 A;  1SC5 B;  4MTF A;  3WB0 A;  1DF4 A;  4DUY B;  4PHZ A;  5B5E Z;  2X6A A;  1SQP H;  4NTY A;  3LSU A;  5KMG A;  5IWA O;  3P30 A;  3JSL A;  5BMV A;  4ZIB A;  1Q90 D;  2QGN A;  4DR7 B;  1VF6 A;  1KQS U;  4CZZ A;  1Y76 B;  1BQ0 A;  1AP6 A;  1VP7 A;  1VQ6 V;  3JD3 A;  3ZS8 C;  2ODM A;  1JVM A;  2JVD A;  2YI8 A;  2A9H A;  3B77 A;  4QPK A;  3O65 A;  5KMG B;  4YHH B;  2VS0 A;  3AG3 B;  5A2Q N;  4FLT A;  3CCQ V;  1NTM H;  4MTO A;  2GBO A;  3CCS V;  2LQT A;  1V54 B;  3RW0 A;  1JJO A;  1Q81 W;  1T5E A;  4HAM A;  1SQV H;  2R9I A;  3H1K H;  4FIP C;  4LH6 A;  1FFX A;  3IGA C;  5C93 A;  4QGP A;  3FFQ A;  5B1N A;  3KKY A;  2QKS A;  1H2G A;  2L6L A;  4LNU A;  2EIJ B;  3HKB B;  3K5N A;  2LW1 A;  1ZWI C;  4LF4 O;  1JX9 A;  1EM1 A;  4BAY A;  3AG1 C;  4J7K A;  1K34 A;  2OCH A;  2HJD A;  4JPR A;  1L0N H;  1AR4 A;  3ASO B;  5A9G A;  1NVP B;  1M90 W;  4PA9 A;  5B3S B;  4FLY A;  1DK1 A;  1IBM O;  4RUF A;  1FXV A;  5GTI Z;  1PV0 A;  2YC0 A;  1M4U A;  4JV5 O;  1FXH A;  4DV0 B;  4X1I A;  4DV6 O;  1QLN A;  2R72 A;  3OTO O;  4PDL A;  4N21 A;  4O4H A;  2OIE A;  4FK5 C;  2YDE A;  5KHI A;  2DYS B;  3G6E V;  1THZ A;  4R6Z A;  3VQY A;  4JI7 O;  4FLV A;  1QBZ A;  2F4V B;  3CP1 A;  4UUJ C;  2WLM A;  1Q3E A;  1QVG U;  2Y0I A;  1M9N A;  4MVM A;  4B7K A;  1ZLZ A;  4JI5 O;  1H2N A;  5EZY A;  1JFF B;  3K06 A;  4OGQ B;  5IYB O;  1VQ9 V;  5EYP B;  3N2G B;  1IX9 A;  2FB5 A;  4EKW A;  2GV9 A;  5LMN B;  1KP3 A;  4PI0 A;  4G27 B;  3WU2 Z;  2CH7 B;  3E86 A;  3QVN A;  1NT2 B;  2HEP A;  1KMI Z;  2DJV A;  4X65 B;  2QTS A;  3ASN B;  2WLI B;  3VOU A;  2Z0A A;  1BMF G;  1VQ4 V;  1YIJ V;  1VQ7 V;  4JI4 O;  1VQK V;  3JAW A;  3NR7 A;  3CC2 V;  4X66 O;  2QM7 A;  5LGN A;  3T4D A;  5KAI Z;  1PM9 A;  1V54 C;  1VF6 C;  1SS3 A;  2ZD9 A;  3RYH B;  4YY3 O;  4TQF A;  2BTO A;  1XEQ A;  4CC5 A;  4NTX A;  2RQ6 A;  4UVC A;  1RSO B;  2B9Z A;  4LCU C;  4EFE A;  2ZR2 A;  4LWS B;  3CME V;  5FL7 G;  3JAW B;  3LNN A;  1FJG B;  2EIJ C;  3SPJ A;  4OPH A;  4CS4 A;  4DV3 B;  2HLD G;  1L8D A;  1Q8I A;  3GWK C;  3GWO A;  4UCT A;  1BSM A;  4DR5 O;  2QKA A;  5IJ0 A;  1TUE B;  5FNV B;  3T4Z A;  2H94 A;  2G38 A;  5B3S C;  1PNK A;  2P90 A;  3W7U A;  3F7V C;  3X2Q B;  3IJ4 A;  4CS2 A;  1U96 A;  4A5U B;  3LUT B;  4DV2 B;  1YVW A;  3M7M X;  2IM9 A;  1LUW A;  4CH3 A;  3M8A A;  4GX2 A;  5CA1 A;  1WPB A;  2PGG A;  1ENV A;  2AZ2 A;  2ARH A;  3D8C A;  4ICG A;  5IJ0 B;  4PV1 B;  5L3F A;  2F43 G;  2PTM A;  1N34 B;  1UFI A;  1R3I C;  4R7C A;  2AZ0 A;  4DV1 B;  1OJH A;  2HHH B;  3RVZ A;  3ZJZ A;  5HFL A;  4X1Y A;  4DR2 O;  2LJ2 A;  1LR1 A;  1S0V A;  3CJH A;  4MSW C;  4LF5 B;  1G6U A;  2HVK C;  2L35 A;  4D6T H;  1WP8 A;  3GVM A;  4LF6 O;  4HZ3 A;  2Y0P A;  5L3D A;  4B3R B;  1N33 B;  2FL4 A;  4KHP O;  2IJI A;  4X1Y B;  2WWW A;  4JI6 B;  3EVK A;  4CH6 A;  4U3J B;  2XAS A;  3KG2 A;  1P84 F;  1OZ0 A;  2LFR A;  2QM8 A;  5CBF A;  2Q68 A;  5EIB C;  4DUY O;  2XAH A;  1Q86 W;  2YSU B;  3SJB C;  3SYC A;  1SQB H;  4L87 A;  1SF9 A;  4WFG A;  5B1B B;  3CCE V;  2HP8 A;  2JS5 A;  4WFA V;  4DR7 O;  4I50 B;  3JAK A;  1PD3 A;  2V1D A;  3OR7 C;  4B7E A;  1L1F A;  4MVU A;  2B1I A;  3L74 H;  3L9D A;  4X64 B;  4I4T A;  4YHH O;  2BOB C;  3F5W C;  3CWB H;  2ZXW C;  2N74 A;  2Q0O C;  5LHI A;  1I5Y A;  3U10 A;  5IDJ A;  1S5L Z;  4BW5 A;  1GTO A;  1NVP D;  3FAV A;  1EZJ A;  2DYR B;  4WFE A;  1XMO O;  5GTH Z;  1HDJ A;  1OCR C;  1JR9 A;  3RFR A;  4CC6 A;  2XND G;  2WA3 A;  3G71 V;  1MSW D;  2Q67 A;  4I4T B;  1QLE B;  1JOY A;  3E83 A;  4F6R B;  4OXS A;  2EBO A;  4IYI A;  2EZO A;  1IDS A;  5DED A;  3JCZ A;  1P7B A;  4QIW F;  1MSD A;  4MW3 A;  4J7Z A;  4UXN A;  4WBN B;  1WLE A;  2UXX A;  2Y69 C;  5GW7 A;  2YEV A;  3SDL A;  4DV0 O;  2E74 B;  4AI8 A;  3G67 A;  1FAF A;  1JQ0 A;  3D3I A;  1PKX A;  1ZUQ A;  4NR1 A;  3U0Z A;  5E79 Z;  2PI5 A;  2WLK A;  2F4V O;  3H1I H;  3FD9 A;  4JV5 B;  1Y74 B;  4EB6 B;  1KC8 W;  3AG7 A;  3CYO A;  4DV6 B;  3OTO B;  2EZP A;  5JVD A;  4JZG A;  2CE4 A;  2OTJ V;  5CN0 A;  3FKS G;  1XHZ A;  4J10 A;  1R3J C;  1XNR O;  2IU3 A;  3AG4 C;  4EFB A;  3RYC A;  2BE3 A;  2P67 A;  1QU7 A;  2UUC B;  1RP3 B;  1VQP V;  2QWN B;  3F5T A;  3R65 A;  1VF7 A;  3L70 H;  5B66 Z;  2UUB O;  2X6C A;  5LMN O;  1IBK B;  5B1B C;  3CSX A;  1F4N A;  3ZHS A;  5H6R A;  2XHB A;  2Y48 A;  3EFF K;  5JVD B;  4IL6 Z;  4X65 O;  2NN4 A;  3W7T A;  3STL C;  4ZI7 A;  2ZE6 A;  1JA8 A;  2M6Y A;  2QWR B;  1Q7Y W;  4OX9 B;  5LHG A;  5KX5 A;  3AG2 C;  3BHP A;  4MVR A;  4IT5 A;  3H1H H;  1NKD A;  3IFX A;  2V4D A;  2B1G A;  2QJ1 A;  1MZF A;  1WN7 A;  1RPO A;  4JTA B;  3ZBH A;  4HNA A;  3QNE A;  4BIZ A;  1AR1 B;  3H1J H;  1MZE A;  2FYU H;  4GKK B;  3ETE A;  5L3E A;  4JAV A;  1LNQ A;  4KXR A;  1M56 C;  1B04 A;  4KP4 A;  4YIP A;  3HKE A;  5KLV H;  3VQW A;  2EX3 A;  3RWR D;  3QF7 A;  5LMU B;  1JJ2 U;  2JDI G;  3E35 A;  4TV8 B;  1QLE C;  4JYY A;  4MVO A;  2ZNJ A;  4K0K O;  2VQF B;  2KSD A;  1GH6 A;  4HNA B;  3JAS A;  4DV4 B;  3TCU A;  4UB8 Z;  4UCV A;  2CGO A;  4B08 A;  3HKE B;  1F4M A;  4RWU A;  3OEE G;  4PJ0 Z;  4JI1 B;  3MHS C;  4JZ2 A;  1R1B A;  4Z2W A;  4DR5 B;  2OIG A;  3P3P A;  2ILM A;  3ZN1 A;  3OUS A;  3A0H Z;  1X59 A;  5E1A C;  2R9R B;  4PA7 A;  2K9P A;  1GK9 A;  3OFN G;  1K5S A;  2WLH A;  3JYC A;  2ZT9 B;  4ZOL A;  3K58 A;  4FM0 A;  1N34 O;  2F1M A;  1K97 A;  2PZS A;  2ZKO A;  1WPX A;  4Q6G A;  4MS2 A;  3K03 A;  4DV1 O;  3B40 A;  2XUM A;  2HHH O;  5LXT B;  1HNW B;  1MMM A;  1AVM A;  3IC7 A;  1GO3 F;  1K5Q A;  2CGN A;  3OGC C;  2OTL V;  4FMT A;  4O4L B;  1TVK A;  1DGS A;  4LF5 O;  1Y6X A;  1FPO A;  1H2M A;  4K3A A;  4PI2 A;  5TIS Z;  1RPR A;  5L3G A;  1YTF B;  2VWJ A;  1KU9 A;  2OYQ A;  5EC2 C;  2WLL B;  5BY1 A;  4BW9 A;  3H01 A;  3T2M A;  2GTA A;  2OCC B;  4B3R O;  1DLB A;  4FFK A;  3OM3 B;  3KZI Z;  4JI6 O;  4G28 B;  1SQG A;  1PL4 A;  2QWQ B;  3T1C A;  1TVK B;  2VRZ A;  1H2K A;  3SYA A;  4JI8 B;  4LF6 B;  1WJZ A;  2AW9 A;  3UQ8 A;  2ZCE A;  1ROP A;  1JMK C;  5KA6 A;  2GDS A;  4KHP B;  2UXD B;  1O9G A;  4Z1M G;  3SGI A;  4NB5 A;  5EBL C;  3AK3 A;  1MNG A;  1P7G A;  1A32 A;  2CAZ C;  3K59 A;  1PL0 A;  3N2K B;  2BCC H;  4BWA A;  2E76 B;  2OWO A;  1SES A;  4X64 O;  4H0L B;  4ABM A;  3UT5 A;  2KG7 B;  1K4C C;  4LF9 O;  1Q82 W;  3ZRW A;  2AHZ A;  5F2V O;  3L72 H;  2ZDI A;  1UPG A;  1Y67 A;  4UCO A;  3E22 B;  5K1X A;  2N05 A;  3HKB A;  3OW2 U;  4DR6 B;  2LGQ A;  1QVF U;  3JSN A;  3UT5 B;  4W4L A;  1AJN A;  4QE7 A;  3JAL A;  3CRR A;  4GUN A;  3RBZ A;  3SJC C;  3ZRW B;  1XMO B;  4O4J B;  3W7W A;  3ZIA G;  4F6E A;  3K9S A;  2XAJ A;  1BE3 H;  3LSS A;  4UCR A;  5H5N A;  5JJN B;  4NTW A;  2JJ2 G;  3SYP A;  2YXY A;  1W0J G;  5EBM C;  1V55 C;  1ARO P;  1PP9 H;  2GSM B;  3JAL B;  5CB4 A;  4MTG A;  2OCC C;  2JGD B;  1P49 A;  2ETN A;  2FTK A;  5IYC O;  1JFF A;  4TT3 G;  3AK1 A;  5EYP A;  2BTQ A;  4P2Z A;  3N2G A;  2Q5Z A;  3B8N A;  1AIL A;  2EJR A;  2EJ7 A;  4TV9 B;  2UUC O;  2CH7 A;  4PEL A;  1F23 A;  2Z3Y A;  5CB4 B;  4QPJ A;  3ZRS A;  2LW7 A;  3ABM B;  3QO5 A;  2WLI A;  1QHT A;  5J2T B;  1IBK O;  1KUQ A;  4FZ1 A;  1XNR B;  2CDY A;  2BTQ B;  2EUL A;  2Q8V A;  1NI8 A;  3K79 A;  1NR7 A;  3L73 H;  3CCV V;  4OX9 O;  3E2E A;  4ASU G;  4WCE V;  2UUB B;  2ZM6 B;  3G6B A;  3JAT B;  4GLX A;  4ZKI A;  2YIC A;  2QM4 A;  5IJ9 B;  1BCC H;  3RYH A;  3FYE B;  4J11 A;  4LFC O;  4QJF B;  4GKK O;  1RSO A;  2HVJ C;  3OE7 G;  4LWS A;  5H2F Z;  4I9W A;  1R6N A;  3AG3 C;  5CBG A;  4DUZ B;  1RM1 B;  1MAB G;  2K1E A;  4DV5 O;  3C3S A;  2RMK B;  1I0H A;  1XNQ O;  5LMU O;  2O57 A;  5KUM A;  1KBH A;  4JYB A;  2VQF O;  5FNV A;  1K7D A;  4JTD B;  1KD1 W;  4DRX B;  2ZDI C;  3K5L A;  3HKC A;  2A06 H;  4DV4 O;  4D7T A;  1UJW B;  3ZMT A;  2CTP A;  1SET A;  4PDV A;  1ORQ C;  1OCO B;  4WFH A;  3CRC A;  2JIZ G;  3SR2 C;  4K0K B;  4JYC A;  4BIU A;  2UXB O;  4JI3 B;  4X62 B;  4F4L A;  3CCM V;  4I55 B;  5LHH A;  4JI1 O;  3WFV A;  3S3X A;  3ASO C;  5HFM A;  4JI2 B;  1R6T A;  1J95 A;  1YJ9 V;  1OCC B;  1AI6 A;  1R3L C;  4GX0 A;  3HKC B;  1X4T A;  3BY6 A;  1VAR A;  1D5N A;  4H37 A;  2F95 B;  4JI0 B;  2DYS C;  1S5H C;  2QR4 A;  3LDE A;  5FPR A;  3JD0 A;  1OHH G;  1YTF D;  2CUG A;  1QQC A;  1HNW O;  5JCO A;  4B3S B;  1YSC A;  3WG7 B;  4NXM O;  3RYI A;  1ZX3 A;  3IC9 A;  1I7F A;  3K5M A;  3UKM A;  3OD4 A;  3SJQ C;  3TK1 A;  3A2F A;  4G2K A;  3ZN0 A;  3JAR B;  4MVQ A;  3CXC U;  4U3J A;  3ASN C;  3K0D A;  1I08 A;  2FKX A;  2LGW A;  1FKA O;  4DW0 A;  3RYI B;  4Z1V A;  3ICX A;  2DW4 A;  1L0L H;  1OCZ B;  2WPD G;  4JI8 O;  3VBB A;  2RN9 A;  1KB9 F;  4P9O A;  1SQX H;  2DMX A;  1KEC A;  3FB7 C;  5EC1 C;  2F66 C;  2UXD O;  3WB2 A;  4FLZ A;  4I50 A;  1XOU A;  1SER A;  3RYF B;  2AGA A;  4J42 A;  4MVZ A;  2IU0 A;  1HNX O;  1VMG A;  2BOC C;  1Z2G A;  1EBO A;  5KUK A;  5K1P A;  2ATK C;  5CMU A;  1OV9 A;  5IT9 N;  1N32 O;  2IJJ A;  4E4E A;  3OAA G;  3G4S V;  2PY5 A;  1KKD A;  4WFB V;  1M57 B;  5KHK A;  3BA9 A;  1NZ6 A;  2XAG A;  3CC4 V;  1R3K C;  1XQ8 A;  1OCC C;  4IIJ B;  3X2Q C;  3F7Y C;  4TWK A;  5JQG A;  2YI9 A;  4DK0 A;  1N0N A;  4IGG A;  1YZB A;  4DR6 O;  3LNM B;  4LF9 B;  4F6R A;  4LH7 A;  2JGU A;  5B1A B;  3ZHV A;  1AR5 A;  4TSF G;  5BR8 B;  2EIK B;  2H3O A;  3DXR B;  4WBN A;  5JJJ B;  5BZB A;  3ABU A;  3WG7 C;  2DWE C;  4YJ2 A;  1GM9 A;  5JQG B;  2Q4P A;  3BFR A;  2Q0A A;  1N36 B;  2P06 A;  1IXB A;  2DOS A;  2ZQM A;  4HBN A;  2DE0 X;  1HWY A;  3UCS C;  1B06 A;  2Z5U A;  1IVS A;  2W6J G;  5J2U B;  1E1R G;  1Y74 A;  4EB6 A;  3OMI B;  3J7A U;  3EXA A;  1GAX A;  4FLX A;  4BIO A;  5JCO C;  2RCV A;  3GB7 C;  3TET A;  1CXZ B;  4YJ2 B;  5L3C A;  1S3J A;  3L75 H;  3DGE A;  1SZT A;  1OCZ C;  4FPP A;  4CH4 A;  4N23 A;  3ABT A;  3W7X A;  3J80 N;  1S76 D;  1TAE A;  2YID A;  5IYZ A;  3CCR V;  3NXS A;  2PI4 A;  1H2L A;  1CP9 A;  1U97 A;  1GN6 A;  3EHB B;  4PA4 A;  2ITD C;  2CTQ A;  3A0B Z;  4DR4 O;  3JD2 A;  1GN4 A;  2DN9 A;  1XUQ A;  2LP7 A;  1FXK B;  1YIT V;  4MVS A;  3BAA A;  3BVO A;  5IYZ B;  4R50 A;  3M99 B;  4UFZ A;  2ZM6 O;  2VQE O;  1M57 C;  5LL6 Y;  4B3M O;  1V9P A;  1HP8 A;  1NTK H;  2EIM B;  4CBC A;  3ZHR A;  4UCU A;  4O4I B;  2F23 A;  3K3W A;  4DUZ O;  1YJW V;  4TV8 A;  2GTS A;  3ZMZ A;  3CC7 V;  4LFC B;  1XDC A;  1VQN V;  1H8E G;  3DSQ A;  4P9P A;  4C7U A;  2BSK B;  2PF4 E;  1NS1 A;  2NNU A;  2WLN A;  1YJN V;  2ADP A;  2DYR C;  4PDR A;  4WF9 V;  3LSQ A;  4DV5 B;  2Y4T A;  3ZMU A;  3P32 A;  1NR1 A;  3UO2 A;  1XNQ B;  2IH3 C;  2X6B A;  1PNM A;  2P4K A;  2CTR A;  5CA0 A;  3TJT A;  1K73 W;  4U7O A;  2RNB A;  5LP6 A;  3OEH G;  3SJA C;  1US6 A;  4JI3 O;  4X62 O;  3OT7 A;  3ABK B;  2C2A A;  4I0X A;  5KHG A;  4JI2 O;  3B2E E;  2HKO A;  4K8X A;  4DR3 O;  1XI1 A;  2UUA O;  4BR6 A;  2XT9 A;  1WNS A;  2UXB B;  3CHX A;  4JI0 O;  4KL1 A;  5GON A;  4X9Q A;  5CA0 B;  4NXN O;  2V7Q G;  1WAZ A;  5LP6 B;  5LXT A;  3SYO A;  2XTA A;  3CD6 V;  1I94 B;  1ZL8 A;  2A3Q A;  1DTO A;  4PDM A;  4I0X B;  1N8R W;  3DC5 A;  4PA3 A;  4O4L A;  5C8Y A;  1BGY H;  4B3S O;  4UVA A;  4KFM A;  2ITC C;  1B6Q A;  3T1Y B;  5GON B;  3CRQ A;  3SPH A;  2YXH A;  3FB8 C;  1GMG A;  2WLL A;  3QTC A;  2Q7G A;  1EN4 A;  1ZL8 B;  4I5S A;  4NXM B;  4K8Z A;  3L71 H;  3SPI A;  1MOF A;  1VQ5 V;  1B3Q A;  5C8Y B;  1Q43 A;  1D5A A;  2EIM C;  4GX5 A;  4DK1 A;  3VQX A;  4H13 B;  1FS0 G;  3B4S A;  3OMA B;  2A7W A;  1H2S B;  1FFT B;  5LA6 B;  1MG1 A;  1ZSP A;  1SRY A;  3D3Q A;  5FLX N;  2F93 B;  4LF7 O;  2ADQ B;  1XMQ O;  1CEZ A;  3N2K A;  3FB6 C;  1YHQ V;  1Z5W A;  3PN1 A;  5JH7 A;  4FVM A;  4LBE C;  2ZNI A;  2FML A;  4MT8 A;  2KG7 A;  4FFB A;  5EBW C;  1COW G;  1HNX B;  4AIL C;  5DEC A;  1SA0 B;  4H33 A;  4YIO A;  3ABK C;  3OGI B;  1URF A;  5B1O A;  5IYD O;  3E22 A;  1N32 B;  2X7R B;  2XAQ A;  3KCX A;  5JH7 B;  2HG5 C;  4LP8 A;  2Y4U A;  1HW7 A;  1KYO F;  3UM7 A;  3K0G A;  3TXS A;  3BAB A;  1AP5 A;  4FFB B;  5LP6 C;  5KHH A;  3QO8 A;  3DC6 A;  2HJF C;  1Y66 A;  5ITZ B;  5LGU A;  3E8H A;  4LFB B;  5LYJ B;  4O4J A;  2WA4 A;  5BR8 O;  1M1K W;  3KCY A;  1VQ8 V;  1D2D A;  3BA8 A;  2EIN B;  2PYL A;  4LF8 O;  1JPX A;  1J5E O;  3K9A A;  1QNM A;  1PNL A;  1VIB A;  1N36 O;  1N4C A;  4UB6 Z;  3CRM A;  4Q20 A;  3BCC H;  3ZRX A;  1QR9 A;  4NVP A;  2E3C A;  4B3T B;  2JGD A;  2UXN A;  4JYA O;  2YS8 A;  1RFY A;  1KP2 A;  5BMV B;  4LFA B;  1Q5O A;  5DM6 V;  1Q6U A;  1TGO A;  4TV9 A;  4J9Y B;  1AB3 A;  3ZED A;  4DR1 O;  2JJ1 G;  2Q6A A;  4DW1 A;  3S3W A;  4U3F H;  4FJC C;  2GUZ A;  1R73 A;  5J2T A;  5IY5 B;  2ZR3 A;  4O2B A;  1JCH A;  5AG2 A;  3E89 A;  3JD1 A;  1GM7 A;  3D36 A;  2EIL B;  2MW2 B;  1ZAU A;  2D2C B;  2AXT Z;  1WA8 A;  1G8M A;  3O9O A;  2YIB D;  1EN6 A;  2DQ0 A;  1IZ3 A;  4XBF A;  3JAT A;  4CS3 A;  2QWO B;  2YXL A;  3W7S A;  1FFX B;  5IJ9 A;  3DTU B;  4DR4 B;  1WB7 A;  4H44 B;  4FLW A;  3T1H B;  2GUZ B;  1AJQ A;  1W59 A;  4O2B B;  1H8H G;  3WB1 A;  3OR6 C;  4LNU B;  2E5L O;  2QKC A;  3E8G A;  4J9Z B;  4DV7 O;  3H1L H;  2Q7H A;  4YJ3 A;  4L8J A;  1WA8 B;  3ETQ A;  5CBH A;  1K8A W;  1YCI A;  4W4K A;  2UU9 O;  2VQE B;  4B3M B;  3BRC A;  3TGU H;  1XHX A;  4X1I B;  5JJE B;  1FD9 A;  4DRX A;  4O4H B;  1AI7 A;  3FYI B;  1BL8 A;  2P6J A;  1BQZ A;  2HFE C;  3CS5 A;  1K33 A;  3LDC A;  1M93 A;  5FPO A;  2R70 A;  4YJ3 B;  2EIN C;  4I9Q A;  1EFR G;  2ZE8 A;  2WAM A;  3JCU Z;  1NJI W;  3CEI A;  3FB5 C;  3CMA V;  1LUV A;  4I55 A;  1GM8 A;  2WSS G;  3APQ A;  4RAI A;  5EZY B;  2B5U A;  2UXC B;  2E75 B;  4D7S A;  3G80 A;  4UCS A;  1VQL V;  1S77 D;  3R66 A;  3K5O A;  1ZTE A;  1E1Q G;  1YI2 V;  3H9V A;  4X20 A;  4GKJ B;  4PD4 F;  1NH2 B;  1EN5 A;  1K9M W;  2Q9L A;  2LFS A;  3BEH A;  4X8A A;  3MAQ A;  5D5Q A;  4XDL A;  4JAA A;  4DR3 B;  1YDX A;  1I94 O;  4FLU A;  2UUA B;  2JS3 A;  3MHH C;  5IY5 C;  1I5X A;  5EK0 A;  1BT8 A;  4NXN B;  2EIL C;  4GYC B;  3ZMV A;  2QEX V;  4JTC B;  4X20 B;  3THO A;  3T1Y O;  3JAR A;  4I7Z B;  1BZK A;  2Q73 A;  2QDO A;  5LBQ A;  3ABM C;  2A0L A;  2R9A A;  5KA5 A;  1GN3 A;  3CCL V;  2W6I G;  4EEQ A;  3CB2 A;  1TA8 A;  3D36 C;  2RDC A;  3SPC A;  2ZXW B;  3B8M A;  1F51 A;  1HNZ O;  5CA3 A;  2VWK A;  1N0J A;  3RGB A;  1AI4 A;  4XDJ A;  4JAS A;  1NBM G;  4XDK A;  4MTX A;  1OCR B;  3RYF A;  4X1K A;  1VEW A;  4UVB A;  4UV9 A;  1W2B U;  2ZIN A;  1NQT A;  5H9C A;  3RN4 A;  4AQY B;  3SYQ A;  1RM1 C;  5CA1 B;  2LO1 A;  2X0L A;  1R6K A;  4MW8 A;  3C3T A;  1BHA A;  4DYL A;  4IHJ A;  3RT3 C;  4LF7 B;  3AK2 A;  1XMQ B;  2Y69 B;  4J41 A;  4X1K B;  2XOK G;  2P22 C;  4IIJ A;  2HR3 A;  3B09 A;  3PJS K;  1NU1 H;  1OCO C;  5IE9 A;  3MD0 A;  1HR0 O;  2W0F C;  3E8F A;  2RJZ A;  4IHJ B;  1GRJ A;  4P30 A;  3CJH B;  2H8P C;  3K04 A;  3DXR A;  3AG4 B;  4LFB O;  1DF5 A;  1P4R A;  1IBL B;  3ZX6 A;  1BHB A;  2D3O W;  3CRA A;  1XL4 A;  2A79 B;  3I5D A;  2CK3 G;  2QE7 G;  2GHY A;  5J2U A;  5LOV A;  5IWA B;  3CXH F;  1SQF A;  2ZE7 A;  4RUE A;  3CCU V;  2IH1 C;  2QWP B;  3P3N A;  2DQ3 A;  4B3T O;  3AG2 B;  4FM2 A;  3ZCC A;  3JD4 A;  4LF8 B;  1Q6I A;  3I56 V;  1J5E B;  2Q69 A;  4HYO A;  4LFA O;  3ABL B;  3QG5 A;  1NTZ H;  3AEI A;  3HR0 A;  1M5I A;  2DWD C;  3JAK B;  2KQX A;  2QTO A;  4JYA B;  5LOV B;  4OPA A;  1M56 B;  1SQQ H;  1YXB A;  4LR3 A;  4J80 A;  4J7J A;  3OUF A;  5KAF Z;  1FXK A;  1O9H A;  4UV8 A;  4DR1 B;  5JWP A;  4R8C A;  2QSA A;  3K57 A;  2IW5 A;  2QA4 V;  3STZ C;  3FAV B;  3MDS A;  4NKG B;  1TUB A;  3HKD A;  4TQD A;  3T1H O;  4LF4 B;  3FX7 A;  3ZRV A;  2YIB A;  1IUR A;  1FYJ A;  4O4I A;  1Z5V A;  1VF5 B;  5DN6 G;  1Q6H A;  2JRI A;  1GKF A;  1IBM B;  2MK3 A;  4ZBM A;  5H6Q A;  3Q4H A;  2N04 A;  1WP7 A;  4AHC A;  4JAU A;  2BSK A;  2P5O A;  5KHJ A;  4GZR B;  4QE9 A;  1TUB B;  2YEV B;  4DV7 B;  2E5L B;  3QO7 A;  3HKD B;  4K35 A;  2PYJ A;  4FM1 A;  4JI7 B;  2M7W A;  2ZE5 A;  4RQE A;  2UU9 B;  5L3B A;  3J81 N;  2ZIM A;  2Q7E A;  4JI5 B;  3RVY A;  1K4D C;  5BXZ A;  3SPG A;  3ZHT A;  3Q4H B;  1WB8 A;  1NH2 D;  1KKC A;  5B1A C;  5D5P A;  3ZMS A;  2YUA A;  3OTF A;  1XRE A;  2EIK C;  1CPY A;  2JEU A;  3RYC B;  2UXC O;  4GCZ A;  3ML0 A;  5EIB D;  3U11 A;  2ZIO A;  4O2A A;  3CCJ V;  2YIA A;  1MA1 A;  4RO2 A;  2NR5 A;  3ABL C;  2JK5 C;  4CH5 A;  4DXW A;  5LGT A;  4GKJ O;  4E2L A;  1BS3 A;  3HPL C;  1K3E A;  4ZI7 B;  4JI4 B;  4X88 A;  2OT5 A;  3I55 V;  3LDD A;  5KX5 B;  4X66 B;  1PPJ H;  4QNH B;  2P7T C;  4LC1 A;  1FJG O;  4DV3 O;  4YY3 B;  4O2A B;  2P4V A;  1G4Y B;  2JEX A;  4GT1 A;  3OMN B;  4GX1 A;  3BPZ A;  2AHY A;  3K08 A;  3ZHU A;  4YXW G;  1E79 G;  3UO3 A;  4IYH A;  3CE2 A;  1FXK C;  4DV2 O;  3CPW U;  4X89 A;  1QCE A;  2IJH A;  3HB3 B;  1AI5 A;  3APO A;  4ZHQ A;  5LA6 A;  1XBL A;  1G1X B;  3ETG A;  3JAS B;  1SZX A;  3C90 A;  1VQM V;  2KB1 A;  4RQF A;  4TUY A;  3IAY A;  3N27 A;  1HNZ B;  1SKV A; 
#chains in the Genus database with same CATH homology
 4X64 O;  2DOS A;  4X66 O;  3J81 N;  1R1B A;  4AQY O;  4KHP O;  2F4V O;  3T1Y O;  5BXZ A;  4YY3 O;  4LF9 O;  4LFC O;  1X59 A;  4JI3 O;  4X62 O;  3J7A U;  1XEQ A;  2FKX A;  4JI2 O;  1FKA O;  4B3T O;  4GKK O;  1XNR O;  4DUY O;  1N34 O;  4DR3 O;  4DV7 O;  2E5L O;  2UXC O;  2UUA O;  4LF4 O;  4JI8 O;  4OPH A;  4DV5 O;  2ZKO A;  4JI0 O;  3F5T A;  4LFA O;  1HNZ O;  2UU9 O;  1XNQ O;  4NXN O;  5LMU O;  4DV1 O;  2UUB O;  3J80 N;  2HHH O;  5LMN O;  1F7Y A;  1N33 O;  2UXD O;  4DR5 O;  4DR7 O;  1DK1 A;  1IBM O;  4GKJ O;  2VQF O;  4OPA A;  4JV5 O;  2AGA A;  4DR4 O;  4X65 O;  4DV6 O;  1HNX O;  3OTO O;  4A5U B;  5BR8 O;  4DV4 O;  5H5N A;  4B3S O;  1D2D A;  4LF5 O;  4YHH O;  5IT9 N;  4JI7 O;  4LF8 O;  1N32 O;  1J5E O;  3M8A A;  1FJG O;  4DV3 O;  1N36 O;  3JAM N;  2UXB O;  1IBL O;  2N74 A;  5BY1 A;  2ZM6 O;  2VQE O;  4B3R O;  4JI1 O;  4JI5 O;  1R6T A;  3RT3 C;  5LL6 Y;  4B3M O;  4JI6 O;  1XMO O;  4JYA O;  3T1H O;  5IWA O;  1FYJ A;  3R66 A;  4DV2 O;  1YZB A;  1AIL A;  4DUZ O;  2JRI A;  4DR6 O;  1AB3 A;  4K0K O;  2UUC O;  4DR1 O;  1HR0 O;  1G1X B;  2DJV A;  4DR2 O;  2LW7 A;  1A32 A;  2Z0A A;  5FLX N;  1IBK O;  1NS1 A;  1HNW O;  1KUQ A;  4LF7 O;  1I94 O;  4NXM O;  3O65 A;  1XMQ O;  3SDL A;  5A2Q N;  4DV0 O;  4LFB O;  4JI4 O;  4LF6 O;  4OX9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...