1IBMO

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ibmO00
1F7YA 5IWAO 1HNXO 1NS1A 5IT9N 2N74A 4X65O 4JYAO 4DV2O 4AQYO 1HR0O 4LFCO 3T1HO 2UUCO 1N34O 4DR2O 1D2DA 5H5NA 4X64O 1IBKO 4GKKO 1XMOO 4JI7O 2Z0AA 2VQEO 2DJVA 2LW7A 2E5LO 4JI3O 4JI5O 1X59A 4DUYO 4A5UB 4B3RO 2DOSA 4OPHA 1FJGO 1XMQO 4JV5O 2ZKOA 2UU9O 2UXCO 3OTOO 4LF7O 3J81N 1XEQA 4DR4O 1XNQO 1IBMO 4YY3O 4JI1O 4DUZO 5BXZA 1N33O 5BR8O 4LF5O 4LFAO 1AILA 4LF9O 1XNRO 4K0KO 1N32O 5A2QN 4JI2O 4X66O 1N36O 2UUAO 4OPAA 4JI6O 4B3SO 3T1YO 1FYJA 1I94O 4JI4O 4LF6O 2VQFO 2UXDO 4DV7O 2F4VO 4LFBO 1YZBA 4DR6O 1KUQA 4DV4O 3JAMN 4DV3O 4B3TO 3J7AU 3R66A 1IBLO 2JRIA 4DV1O 2UXBO 4DR1O 4DR7O 2ZM6O 1HNWO 4X62O 3F5TA 4KHPO 3O65A 4JI0O 4JI8O 4B3MO 4LF8O 1R6TA 4NXNO 4YHHO 4OX9O 2FKXA 4DV0O 4DR3O 5LMNO 1G1XB 4DR5O 5LL6Y 1HNZO 1J5EO 1FKAO 4LF4O 2AGAA 5FLXN 3RT3C 4DV6O 4NXMO 3M8AA 5BY1A 4GKJO 1R1BA 2HHHO 1DK1A 2UUBO 4DV5O 5LMUO 1A32A 3J80N 3SDLA 1AB3A
chains in the Genus database with same CATH superfamily
2CTRA 2ZR3A 4DRXB 4JF3A 2RN9A 4AQYO 2UUCO 1WP8A 4FM2A 3EXAA 1NR1A 4JI3O 1IURA 4PJ0Z 4BIZA 4A5UB 3B8MA 5FNVA 4JI7B 4W4KA 3RYFA 2QTOA 2VWKA 4JTAB 2JGDA 2KQXA 2WPDG 5KA5A 4JPRA 3K79A 2DYRB 2YS8A 1BGYH 4O4HB 4JASA 5BXZA 4FIPC 3UO2A 4LFAO 3HPLC 4JI1B 3BCCH 2UXXA 1VQKV 4TV8A 2FTKA 4DRXA 4C7UA 1T5EA 4PDRA 1P7GA 4P2ZA 2O57A 1AI5A 2ZT9B 4LF6O 1DTOA 1Q8IA 2OTLV 3JAKB 3VQXA 2CAZC 2H8PC 4MVUA 3TK1A 1MOFA 1RPRA 5L3GA 3K5OA 1BE3H 5B66Z 2YIDA 5IYBO 2B5UA 2L35A 3UM7A 3H1LH 3S3XA 1KQSU 1AJNA 5B1OA 4JI8O 3K03A 4LF8O 3OE7G 4O4HA 3H1KH 3ZMVA 3F7YC 4H37A 3HKEB 2A9HA 4TV9B 2D2CB 1J5EO 4O2AA 5EC1C 1Q6IA 4DR3B 2EILB 2WWWA 3CJHA 1BSMA 5B5EZ 2DYRC 3OEHG 2X6AA 3CRAA 4J10A 2B1IA 2F93B 4DV6B 4P9PA 2RNBA 3JD2A 4RUFA 1V54B 4GKJB 1EZJA 3CHXA 2G38A 1M9NA 3JAKA 3ICXA 1VP7A 2OIGA 5LMUB 3F5WC 4GUNA 2QSAA 2E76B 4WFFA 4F6EA 2QDOA 4NTWA 3CCSV 4UCUA 1GO3F 3FYIB 1IBKO 1ZLZA 3JSNA 1XMOO 2KB1A 1HR0B 4CZZA 1FPOA 4TSFG 4O4LB 3JD4A 1W0JG 1KBHA 1TGOA 2ZXWB 3HKEA 4D7SA 4TV9A 1FJGO 4QIWF 1GRJA 2ZKOA 5EBLC 1EM1A 5LP6B 2WLLB 3A0RA 1NTMH 5LOVB 3SJAC 3ZEDA 2XAQA 3AG2C 3LSQA 1YTFD 1QU7A 1Y66A 4JAVA 2K9PA 3AG1B 5IYZA 4B7EA 1FXKB 1H38A 3HKDB 3OMNB 5B1NA 4K8XA 1I94O 1M5IA 1AP5A 1V54C 4X1KA 3MHSC 4UV8A 5L3DA 2E74B 4D7TA 5KUKA 4JZGA 1WB8A 3H1HH 1EBOA 1QLEB 2M7WA 2QWOB 1R3JC 4LNUB 1N4CA 5CB4B 2YXLA 2Y4UA 4LFAB 5B1BB 3L73H 3FB8C 3K08A 2HP8A 4UVBA 1R3IC 5E79Z 4EFEA 1Z5WA 4X62B 1V55B 4KHPB 4UB8Z 2ZCEA 2HLDG 2KG7B 2XAHA 3H1JH 4LF6B 3QG5A 2RQ6A 3K0GA 3HKDA 1NVPD 1Y76B 3QVNA 2WA3A 2CGNA 1OV9A 3AG1C 4NTXA 4UXNA 5IWAO 4GT1A 1SZTA 5JJJB 2Q6AA 1GKFA 1ZAUA 3BPZA 1K92A 4LNUA 1D2DA 2DE0X 4R8CA 1LR1A 3AG4C 2DJVA 5LHGA 2R70A 1J5EB 1URFA 2Q68A 4FLUA 1B06A 1U97A 4KXRA 3H01A 4X64B 2XUMA 5EYPA 1XMQO 1VIBA 4PA6A 2QR4A 2IW5A 1Q82W 1US6A 4O2BA 2W0FC 4RO2A 3DXRB 4PV1B 3HB3B 2QWPB 4LF7B 1JOYA 3JAWA 4CH4A 1Q43A 2IM9A 1XNRO 2Q73A 5EBMC 1VMGA 4XDKA 4WFBV 2PI4A 1IBKB 1AI6A 1CP9A 1K73W 2ZD9A 4PA4A 1EN6A 3SPCA 3CRMA 2Q67A 1X4TA 4DXWA 4MSWC 3HKCB 3C90A 1I5XA 3N2KA 5H2FZ 3VQVA 4DV7B 1BHAA 1ZSPA 3A8TA 3K5NA 4DR1O 4LR3A 1GN2A 2ZR2A 3ZJZA 4JI0O 2ZINA 4OX9O 2ADPA 2FKXA 1MSWD 1YEWA 2JEXA 5CBFA 1HNZO 3SYQA 5KA6A 2V1DA 3CXHF 4YHHB 5EZYB 3P30A 2ITDC 1OCCB 3ZX6A 2HHHO 4MTXA 5LXTA 2H94A 1H2LA 4JAUA 3RYIA 3SJQC 3SPJA 3AK1A 5KHGA 4FLZA 4JYYA 2CDYA 5EBWC 3RVZA 1KKDA 2Z0AA 5LGUA 3ABMB 1NI8A 3GWKC 2YICA 2WLKA 4I0XB 2XASA 2LQTA 5LA6B 1IBMO 1VQLV 3SYOA 5IWAB 2V4DA 4YY3B 3LUTB 1I0HA 3WG7B 2JJ2G 1Q3EA 2QKSA 4MW8A 3SYCA 4IIJA 2ZNIA 5B1AB 3T1YB 1P7BA 1H2NA 2ETNA 3B8NA 3OT7A 4L87A 3OFNG 2D3OW 1TVKB 1THZA 1IBLO 4DV1O 3ZHRA 1IX9A 3E35A 3UCSC 1VQ7V 1XL4A 2EIJB 3SJCC 1AR4A 3DC6A 2ZE5A 1IXMA 5LMNO 2ZM6B 1BT8A 3FAVB 5IJ0A 1LNQA 3KCXA 4LF4O 1KKCA 1JPXA 2HKOA 4J9ZB 4CH3A 2OCHA 3K9SA 5CBHA 4ZI7B 2AHZA 3ZRVA 3NXSA 3RYHB 3KZIZ 2HG5C 1M90W 1F7YA 2UUBB 4B08A 2CH7B 1NKDA 2ARHA 4ASUG 3QO5A 3T1HO 4CBCA 1HNXB 3ZRWB 3AG3C 4X20B 5J2UA 3HKBB 4OX9B 4JI7O 2EJ7A 3LNNA 1N34B 2IU0A 4IGGA 1HNZB 1S3JA 2DWEC 2LW1A 3OMAB 2Q4PA 2E5LB 1VEWA 3FAVA 2YIAA 1Q90D 4JZ2A 3ABUA 3ASNB 4O4IA 1VQ8V 4G27B 4JI1O 2RDCA 2NNUA 1MG1A 4EKWA 5DEDA 5J9PC 4ZOLA 4JYBA 2CTQA 1SF9A 3K0DA 1KP2A 2F1MA 4OGQB 1EN5A 1YVWA 1FFXA 1N36O 4I7ZB 4JYCA 2ZDIC 1FYJA 1K5SA 2OYQA 4RQEA 1QR9A 2PYLA 2P6JA 1GH6A 3OAAG 1SQGA 1K4DC 1YZBA 1OCOB 5JVDB 1NH2D 3JD3A 3ZMUA 1BCCH 1ZL8B 4UCTA 2WA4A 3CRCA 3D8CA 4X8AA 2BOBC 2AZ2A 1PKXA 4NTYA 1XOUA 2MW2B 1IVSA 3FB6C 4KP4A 2XAGA 2ZE7A 1QVGU 1Z5VA 4E2LA 5GTIZ 2HFEC 4DR3O 4MVQA 3THOA 3UKMA 4PA9A 1SETA 3BVOA 2PUSA 2F43G 1NR7A 3KG2A 1FKAO 1EZVH 4DV6O 3D36A 3M8AA 4DV0B 4GKJO 4DR5B 2BOCC 2EBOA 1H8HG 1L1FA 3H1IH 4EFBA 3OGCC 3QO7A 5DECA 5LMUO 2P90A 2M6YA 2OTJV 1AB3A 4JAAA 3CMEV 1R6NA 1R73A 5E1AC 3AEIA 1HR0O 3TXQA 1OCZC 2RMKB 1YIJV 1Y74A 3BA8A 3CCJV 4UCOA 2XOKG 4WFHA 1QQCA 2GHYA 3ML0A 2A06H 2W0XA 4ZHQA 3CCEV 5LMNB 3L70H 4LP8A 5D5QA 2Y4TA 4FPPA 1ROPA 2P4VA 5KMGA 2JJ1G 2YXYA 1SRYA 2IBZH 2IJJA 5LBQA 1IXBA 3U0ZA 4NVPA 4MVRA 2YC0A 4PA3A 1AR1B 3N2GA 4LC1A 5KX5A 1Y6XA 3T1HB 4O4JB 1I08A 3M7MX 1YJWV 3A0HZ 4MTFA 5BR8B 2RJZA 4I50B 3LDCA 1O9GA 1JJ2U 1AVMA 1KMIZ 3OM3B 2OWOA 1D5NA 4JI4B 5EIBD 1GTOA 3CEIA 2CK3G 2EX3A 1JX9A 2RCVA 1R3LC 4MTOA 1GAXA 3LNMB 1SQQH 5FL7G 3ZN0A 1AR5A 1G4YB 4X62O 1HNWO 4KHPO 3E8FA 3Q4HB 3NR7A 3E86A 2EIKC 3K59A 1N36B 1BHBA 1S5LZ 4FM0A 5HFMA 5LL6Y 1W59A 1UPGA 3B4SA 4UUJC 3T4DA 4TT3G 3SYPA 1K7DA 4MVMA 2QM7A 3VQYA 3P3PA 3ZS8C 3ABKC 2UXNA 4I50A 1L0NH 2F23A 3J80N 4X88A 3G71V 3CC4V 2FYUH 2A3QA 5IT9N 2XAFA 1K8AW 3AG2B 3BABA 5CA1B 3RBZA 4PDVA 4X65B 1RSOB 4X64O 1N8RW 1MZFA 1SA0B 4DR2B 1H2GA 3Q4HA 1GN4A 1YXBA 1HWYA 3SPHA 4W4LA 1DGSA 2V7QG 5H9CA 4LF7O 2LP7A 1BL8A 2YI9A 1JCHA 1SQVH 5KLVH 4HAMA 1VQ5V 4LH6A 3K9AA 3CCQV 5JJEB 1GK9A 1XNQB 2Y0PA 1JA8A 4U7OA 1SC5B 4HYOA 3IAYA 3F7VC 3UO3A 3SPIA 5A2QN 1AJQA 5DN6G 4QNHB 2QWRB 1VQPV 2Y48A 2MK3A 3BFRA 3ZMZA 3L74H 4DV7O 1R6KA 3MDSA 1K34A 5AG2A 1JVMA 2ADQB 1K3EA 2WLIB 1YF2A 5B3SC 2F4VB 4PD4F 3JAMN 3TETA 1NJIW 4LFBB 3J7AU 3B77A 5L3CA 1NZ6A 4GLXA 1LUWA 3BY6A 3K3WA 4FLXA 2JRIA 2BCCH 2QEXV 5ITZB 1NTZH 2IH3C 2GTSA 4YHHO 1KECA 4KFMA 3W7XA 1PP9H 4AILC 3JASB 4ZIBA 1IDSA 3ASOB 2XTAA 4WBNB 4O4LA 4G2KA 3AG4B 1XREA 1SESA 4QJFB 3WB1A 1WAZA 4YJ2B 3ZN1A 1EN4A 1DLBA 1PM9A 3MAQA 4NXMB 5LP6A 1K4CC 2IU3A 2WLLA 1QNMA 5LOVA 5H6RA 4R50A 2X7RB 1FAFA 3VOUA 4JYAO 2IJHA 3LSUA 3QTCA 4IYIA 1HNWB 3APQA 3RW0A 1FXKA 4LFCB 2GBOA 5ITZA 4I4TB 5K1PA 2DYSC 1AROP 3STLC 1WB7A 3EVKA 5LGTA 2IJIA 2ZIMA 4H44B 3JASA 2AZ0A 4YXWG 3WB2A 1XEQA 2EJRA 5C8YB 4YY3O 4YJ2A 5TISZ 3JSLA 3ASOC 5CB4A 4BIOA 1N32O 1M1KW 3P3NA 4MT8A 4LF5B 5JQGB 3T1YO 4JGSA 2Y69C 2LFRA 1FXHA 1O9HA 1KYOF 4GX5A 2KG7A 4ZKIA 1KUQA 3JATB 4DV4O 1Y76A 4F6RB 4CS3A 2Q5ZA 4BWAA 4HBNA 4IHJB 1JJOA 5CBGA 1CPYA 2ZM6O 3B09A 3FB7C 3RVYA 3O65A 2CGOA 1N0JA 3K04A 4XBFA 2DQ0A 3CB2A 1XHXA 4X1IB 3CMAV 1PL0A 1AI4A 1BMFG 1VF7A 3L75H 5JQGA 4CC5A 1E1RG 2UUBO 5H6QA 4HZ3A 1VQMV 3W7SA 3S3WA 2PF4E 1SQXH 3JATA 3E8HA 1Q86W 1HNXO 2PTMA 3E22B 3DXRA 4F6RA 5KHKA 1N34O 4IHJA 3CYOA 5H5NA 2FB5A 3G6EV 1KU9A 4NYKA 4P9OA 3ABTA 2E5LO 2QKAA 2YI8A 3FB5C 1QCEA 4DUYO 3VBBA 2N05A 1YI2V 4QGPA 4J42A 3HKCA 2YEVB 1GM7A 3TGUH 2A0LA 1WP7A 4PDMA 5BMVB 3HR0A 2QGNA 1GN6A 3CXCU 2XHBA 3P32A 2P67A 1TAEA 3SGIA 2JS5A 4JYAB 4LF9O 3IC7A 4K3AA 2YXHA 1MABG 1MNGA 1HP8A 2Q0OC 3JD0A 1OJHA 3ABLC 5EK0A 4JI6B 2JVDA 5EZYA 4LCUC 1G6UA 2P5OA 1VQNV 4CH6A 4PI2A 4B7KA 3UQ8A 4NKGB 1PNMA 3I56V 2VRZA 3CD6V 3R66A 3RYCB 3O9OA 4J7ZA 4J9YB 1M57C 3ETEA 4I55B 5FPRA 4EB6B 5KHIA 4TQFA 2ZIOA 1N32B 1YSCA 4DV0O 5JCOA 4DR7B 3TCUA 3ZRXA 4DR5O 3AG3B 4BR6A 3X2QC 2YSUB 5FLXN 1L8DA 2DQ3A 2GUZB 4DYLA 2JK5C 4I0XA 4DV4B 1AP6A 5LA6A 3JD1A 2R9AA 4CS2A 2A7WA 3G80A 2VWJA 3CRQA 2YDEA 4X89A 3BEHA 1Y4MA 3CC7V 5FPOA 3B40A 3LDEA 2YUAA 1RM1C 3A2FA 1F23A 3APOA 3OMIB 5IYCO 2E75B 5CA3A 3SJBC 4DR4O 4FVMA 2OCCC 5EC2C 1VF6A 4YJ3B 4J80A 2UU9B 2JGUA 2UXCB 2DW4A 4UV9A 3JALB 4I9WA 1TVKA 2E3CA 3CP1A 5BR8O 3IGAC 1YJNV 1H8EG 2ZE6A 1JFFB 1DF4A 2EINC 4DUZB 1N33B 3GVMA 1NU1H 5HFLA 4JI4O 4TOIA 5IY5C 1V9PA 4X66B 2VQFO 3LDDA 4DUYB 4B3SB 1PPJH 4DK1A 4ABMA 4RWUA 2ZDIA 5C93A 2GV9A 4DR6B 4ZI7A 1CXZB 3DSQA 1TUBB 3RYHA 3C3SA 2CH7A 3G6BA 1QHTA 2BE3A 4LF9B 1KP3A 3OGIB 4GCZA 4IT5A 2XT9A 1OCZB 3ETDA 4PI0A 3ZRWA 1VQ4V 5JH7B 4X20A 4GZRB 3HKBA 3A0BZ 2IH1C 1SQFA 4BW5A 2AGAA 3OTFA 1JFFA 4NXNB 1MMMA 2ODMA 1R1BA 1D5AA 4TUYB 2R9RB 1S72V 1DK1A 4U3JB 1JR9A 1SKVA 4D6TH 2EIMC 2XNDG 1YITV 1NS1A 4X65O 2QTSA 1PNKA 3M99B 4DW0A 4DR2O 1VARA 3K57A 2HVKC 1RPOA 1TUBA 5F2VO 1M56C 5L3EA 4BW9A 1K97A 4TQDA 2VS0A 1AJPA 4GKKB 2JEUA 2OIEA 2VQEB 3G67A 5JVDA 1L0LH 1M4UA 3OTOO 1XNQO 1ZL8A 3T4ZA 3ZHQA 2LGWA 4TUYA 2Q7HA 2OT5A 5A9GA 1RP3B 2P4KA 1VQOV 3ETGA 1SS3A 1XQ8A 2EIKB 4UCSA 4K0KB 1Q6UA 5FNVB 2QWQB 1KB9F 2NN4A 2F4VO 2CE4A 4LFBO 4H0LB 3E83A 2JGDB 5KUMA 2H3OA 5CA0B 1MZEA 2UXDB 4DR4B 2F95B 2ATKC 1B6QA 3ABKB 5IE9A 1PD3A 2QWNB 4DV3B 4B3TB 3E8BA 3WB0A 3L71H 1WPXA 4TV8B 3AG7A 4Z2WA 3K5MA 4FZ1A 4G28B 5KHHA 2UXBB 1RFYA 4IL6Z 4LBEC 4U7NA 5LGNA 3K58A 4NXMO 2JS3A 2P22C 2VQFB 5BY1A 3H9VA 1S76D 3ZHVA 4FZ0A 2W6JG 4PA7A 1G8MA 2CTWA 4FK5C 2BSKB 3RGBA 5CA0A 4WFAV 5IDJA 5LHIA 3ZHUA 4DV2O 4LFCO 4AI8A 4RAIA 1E1QG 3N27A 3DTUB 3FX7A 4YIOA 4FLYA 2B9ZA 5IYDO 4O4JA 1DF5A 1I7FA 1XILA 5CN0A 2LW7A 4O2AB 4H13B 4WFGA 3CJHB 3BRCA 5L3FA 3ZMTA 4JV5O 2HJFC 1ORQC 3QF7A 3DGEA 3G4SV 4B3RB 5GTHZ 1KC8W 5B3SB 4XDJA 3RWRD 4LF5O 1WNSA 1QR8A 3SPGA 1QBZA 1FS0G 2BSKA 4QPJA 1GM9A 2QE7G 3CX5F 5CMUA 4JTCB 4JI2B 2UUAB 2JIZG 1SQPH 2PI5A 3OR6C 3BAAA 5DM6V 1OZ0A 3OTOB 2IJKA 4DO2A 4L8JA 3TXSA 1P49A 3CCUV 3FFQA 1VQ9V 3ZIAG 3OD4A 3FD9A 2QM4A 4Z1VA 3QO8A 5KAFZ 5EIBC 4BIUA 2AHYA 2QA4V 4UB6Z 5IYZB 2C2AA 2HEPA 3E89A 5CA1A 5GONB 1RSOA 1K5QA 4X1KB 1SA0A 2BTOA 4B3MB 2WAMA 2Z3YA 2ITCC 1Q5OA 2DYSB 3STZC 1BZKA 2N04A 4NB5A 4PDLA 3ZMSA 4EEQA 2PGGA 2L6LA 4MW3A 2QKCA 2ZNJA 1QVFU 3WU2Z 3BHPA 4DV5B 4YIPA 1UJWB 2X6BA 4ZBMA 2PYJA 1J95A 2KSDA 3SR2C 2F66C 3R65A 1HW7A 1BQ0A 2GDSA 1Y67A 4KUMA 1GM8A 3JARB 4J11A 4MTGA 4Q6GA 4AQYB 1Z2GA 2UUCB 2DWDC 2EILC 4KL1A 2WLHA 1X59A 4N23A 1IZ3A 2Y69B 5GONA 1OHHG 4RQFA 3IJ4A 1QLNA 4OPHA 1YTFB 3TJTA 4JI3B 5GW7A 4F4LA 1SZXA 2WLIA 3BA9A 4GX2A 3J81N 1XI1A 4FLTA 1HDJA 1F51A 3D3QA 2FMLA 3K5LA 3EFFK 2JDIG 4FLWA 1S0VA 1AILA 4DV2B 1XUQA 3I5DA 4WFEA 2PZSA 1COWG 4AHCA 1NT2B 1W0KG 2Q8VA 2K1EA 4GX1A 4JI6O 3DC5A 2ZXWC 2CTPA 2LGQA 3JARA 4WBNA 5LP6C 5EYPB 1TUEB 1XL6A 2ZE8A 1GMGA 4JV5B 4R6ZA 4O2BB 2XAJA 2NLJC 3U10A 3I55V 5KAIZ 3JAWB 4PHZA 2WLNA 3U11A 4TWKA 4K8ZA 4DR7O 1FXKC 4I9QA 3F5TA 1NVPB 4DK0A 4FFKA 4X9QA 2Z5UA 1SERA 1GN3A 1S77D 1JMKC 4JI8B 3RT3C 4I4TA 4LF8B 2W6IG 3IFXA 1NQTA 4UCVA 3N2KB 1QLEC 2FL4A 3SDLA 3L9DA 3ZCCA 5C8YA 5JJNB 1YHQV 5B1BC 3JCUZ 2EZPA 3RFRA 4UVCA 3CCRV 4RUEA 4CH5A 1V55C 1M93A 4BAYA 4IYHA 4QE9A 2Q0AA 4UCRA 1K9MW 1XBLA 1PNLA 4QPKA 1XMOB 1WN7A 3ABLB 2WLMA 4UVAA 2UU9O 4NR1A 5LXTB 2UXCO 1NBMG 3IC9A 3PJSK 5D5PA 3RYIB 1FJGB 1WA8B 3GWOA 4DUZO 1N33O 4E4EA 2GSMB 3CE2A 2AXTZ 1TA8A 4MVSA 1F4MA 1M57B 1PL4A 4X66O 3B2EE 4B3SO 3JYCA 2Q7GA 4X1IA 3SYAA 2EZOA 1MSDA 3OW2U 4DR6O 3AK3A 3X2QB 2QM8A 1I94B 3CCLV 2BTQB 4X1YB 5IJ9B 1CEZA 4LWSB 1K33A 3VQWA 2ILMA 3CCMV 3E22A 2Q7EA 4U3FH 3AK2A 1WA8A 5BZBA 4HNAB 1R6TA 4NXNO 3UT5B 4IIJB 1SQBH 3OR7C 3MD0A 1RM1B 2LJ2A 4LH7A 1BQZA 3ZBHA 1A32A 2YEVA 5LHHA 4FFBB 4DW1A 3ZHSA 1XDCA 5BMVA 1LUVA 2BTQA 2OCCB 2N74A 2KKWA 5K1XA 2PY5A 4X1YA 2P7TC 5IJ9A 5JWPA 2Q69A 4LWSA 3E2EA 4GKKO 4CS4A 5IJ0B 2VQEO 2CUGA 2EINB 5J2TB 4ICGA 1Q6HA 2QJ1A 4JI5O 4HNAA 1OCCC 1H2KA 1VF5B 3UT5A 5IY5B 1YCIA 2P06A 4J7KA 2HR3A 5LYJB 4XDLA 2A79B 1XMQB 1I5YA 2WSSG 1ZX3A 3CRRA 3RYCA 5JCOC 4FFBA 3ETQA 4K0KO 4I55A 4EB6A 3ABMC 1EFRG 2YIBD 1WPBA 5J2UB 1JQ0A 4OPAA 3C3TA 3CC2V 1XNRB 3LSSA 4MVZA 2UXDO 1H2MA 2DN9A 1N0NA 2GUZA 5J2TA 3CCVV 4FM1A 4J7JA 4O4IB 4H33A 4DV3O 4B3TO 4N21A 4K35A 3CWBH 2EIMB 2LFSA 4ZOLB 5LYJA 3PN1A 2UXBO 1OCRB 1P84F 1UFIA 3WG7C 4FJCC 4OXSA 3OUFA 1WLEA 1FFXB 2EULA 2DMXA 1WJZA 4DR1B 4UFZA 1G1XB 1FXVA 4PELA 1S5JA 4JI0B 1M56B 1NTKH 5B1AC 5KHJA 4FMTA 4CC6A 2HVJC 3ZRSA 4GYCB 3W7UA 4WF9V 1VQ6V 3GB7C 1VF6C 2X6CA 2YIBA 3W7WA 3FYEB 3FKSG 1B04A 2HHHB 4Z1MG 4FLVA 4P30A 4YJ3A 2EIJC 3CS5A 2AW9A 3JALA 2X0LA 3D3IA 2LO1A 1F4NA 3E8GA 3ZHTA 3JCZA 1XHZA 1PV0A 1P4RA 5L3BA 4B3RO 2DOSA 4QE7A 3WFVA 1OCRC 3OUSA 2B1GA 3T2MA 1E79G 2Y0IA 2ZQMA 1Q81W 2GTAA 1W2BU 2Q9LA 3K06A 2R72A 3MHHC 1IBMB 4WCEV 4I5SA 1ZWIC 1Y74B 1R3KC 3KCYA 1NH2B 2NR5A 4JI2O 4ZHQB 2UUAO 3KKYA 4MVOA 2HJDA 1ZUQA 5JH7A 1Q7YW 1FD9A 4JI5B 4GX0A 5KMGB 3ASNC 3CSXA 1YDXA 1MA1A 4U3JA 3T1CA 1S5HC 1YJ9V 4MS2A 3N2GB 5KX5B 3RN4A 1H2SB 3D36C 1FFTB 4Q20A 4B3MO 1IBLB 3CPWU 1B3QA 4DV1B 4R7CA 1ENVA 3RYFB 2WLJA 1OCOC 1ZTEA 2R9IA 3L72H 1U96A 1AI7A 3OEEG 3EHBB 4JTDB 4LF4B 3W7TA 4J41A 4DV5O 1BS3A 1KD1W 3QNEA
chains in the Genus database with same CATH topology
1F7YA 5IWAO 1HNXO 1NS1A 5IT9N 2N74A 4X65O 4JYAO 4DV2O 4AQYO 1HR0O 4LFCO 3T1HO 2UUCO 1N34O 4DR2O 1D2DA 5H5NA 4X64O 1IBKO 4GKKO 1XMOO 4JI7O 2Z0AA 2VQEO 2DJVA 2LW7A 2E5LO 4JI3O 4JI5O 1X59A 4DUYO 4A5UB 4B3RO 2DOSA 4OPHA 1FJGO 1XMQO 4JV5O 2ZKOA 2UU9O 2UXCO 3OTOO 4LF7O 3J81N 1XEQA 4DR4O 1XNQO 1IBMO 4YY3O 4JI1O 4DUZO 5BXZA 1N33O 5BR8O 4LF5O 4LFAO 1AILA 4LF9O 1XNRO 4K0KO 1N32O 5A2QN 4JI2O 4X66O 1N36O 2UUAO 4OPAA 4JI6O 4B3SO 3T1YO 1FYJA 1I94O 4JI4O 4LF6O 2VQFO 2UXDO 4DV7O 2F4VO 4LFBO 1YZBA 4DR6O 1KUQA 4DV4O 3JAMN 4DV3O 4B3TO 3J7AU 3R66A 1IBLO 2JRIA 4DV1O 2UXBO 4DR1O 4DR7O 2ZM6O 1HNWO 4X62O 3F5TA 4KHPO 3O65A 4JI0O 4JI8O 4B3MO 4LF8O 1R6TA 4NXNO 4YHHO 4OX9O 2FKXA 4DV0O 4DR3O 5LMNO 1G1XB 4DR5O 5LL6Y 1HNZO 1J5EO 1FKAO 4LF4O 2AGAA 5FLXN 3RT3C 4DV6O 4NXMO 3M8AA 5BY1A 4GKJO 1R1BA 2HHHO 1DK1A 2UUBO 4DV5O 5LMUO 1A32A 3J80N 3SDLA 1AB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7Y A;  5IWA O;  1HNX O;  1NS1 A;  5IT9 N;  2N74 A;  4X65 O;  4JYA O;  4DV2 O;  4AQY O;  1HR0 O;  4LFC O;  3T1H O;  2UUC O;  1N34 O;  4DR2 O;  1D2D A;  5H5N A;  4X64 O;  1IBK O;  4GKK O;  1XMO O;  4JI7 O;  2Z0A A;  2VQE O;  2DJV A;  2LW7 A;  2E5L O;  4JI3 O;  4JI5 O;  1X59 A;  4DUY O;  4A5U B;  4B3R O;  2DOS A;  4OPH A;  1FJG O;  1XMQ O;  4JV5 O;  2ZKO A;  2UU9 O;  2UXC O;  3OTO O;  4LF7 O;  3J81 N;  1XEQ A;  4DR4 O;  1XNQ O;  1IBM O;  4YY3 O;  4JI1 O;  4DUZ O;  5BXZ A;  1N33 O;  5BR8 O;  4LF5 O;  4LFA O;  1AIL A;  4LF9 O;  1XNR O;  4K0K O;  1N32 O;  5A2Q N;  4JI2 O;  4X66 O;  1N36 O;  2UUA O;  4OPA A;  4JI6 O;  4B3S O;  3T1Y O;  1FYJ A;  1I94 O;  4JI4 O;  4LF6 O;  2VQF O;  2UXD O;  4DV7 O;  2F4V O;  4LFB O;  1YZB A;  4DR6 O;  1KUQ A;  4DV4 O;  3JAM N;  4DV3 O;  4B3T O;  3J7A U;  3R66 A;  1IBL O;  2JRI A;  4DV1 O;  2UXB O;  4DR1 O;  4DR7 O;  2ZM6 O;  1HNW O;  4X62 O;  3F5T A;  4KHP O;  3O65 A;  4JI0 O;  4JI8 O;  4B3M O;  4LF8 O;  1R6T A;  4NXN O;  4YHH O;  4OX9 O;  2FKX A;  4DV0 O;  4DR3 O;  5LMN O;  1G1X B;  4DR5 O;  5LL6 Y;  1HNZ O;  1J5E O;  1FKA O;  4LF4 O;  2AGA A;  5FLX N;  3RT3 C;  4DV6 O;  4NXM O;  3M8A A;  5BY1 A;  4GKJ O;  1R1B A;  2HHH O;  1DK1 A;  2UUB O;  4DV5 O;  5LMU O;  1A32 A;  3J80 N;  3SDL A;  1AB3 A; 
#chains in the Genus database with same CATH topology
 2CTR A;  2ZR3 A;  4DRX B;  4JF3 A;  2RN9 A;  4AQY O;  2UUC O;  1WP8 A;  4FM2 A;  3EXA A;  1NR1 A;  4JI3 O;  1IUR A;  4PJ0 Z;  4BIZ A;  4A5U B;  3B8M A;  5FNV A;  4JI7 B;  4W4K A;  3RYF A;  2QTO A;  2VWK A;  4JTA B;  2JGD A;  2KQX A;  2WPD G;  5KA5 A;  4JPR A;  3K79 A;  2DYR B;  2YS8 A;  1BGY H;  4O4H B;  4JAS A;  5BXZ A;  4FIP C;  3UO2 A;  4LFA O;  3HPL C;  4JI1 B;  3BCC H;  2UXX A;  1VQK V;  4TV8 A;  2FTK A;  4DRX A;  4C7U A;  1T5E A;  4PDR A;  1P7G A;  4P2Z A;  2O57 A;  1AI5 A;  2ZT9 B;  4LF6 O;  1DTO A;  1Q8I A;  2OTL V;  3JAK B;  3VQX A;  2CAZ C;  2H8P C;  4MVU A;  3TK1 A;  1MOF A;  1RPR A;  5L3G A;  3K5O A;  1BE3 H;  5B66 Z;  2YID A;  5IYB O;  2B5U A;  2L35 A;  3UM7 A;  3H1L H;  3S3X A;  1KQS U;  1AJN A;  5B1O A;  4JI8 O;  3K03 A;  4LF8 O;  3OE7 G;  4O4H A;  3H1K H;  3ZMV A;  3F7Y C;  4H37 A;  3HKE B;  2A9H A;  4TV9 B;  2D2C B;  1J5E O;  4O2A A;  5EC1 C;  1Q6I A;  4DR3 B;  2EIL B;  2WWW A;  3CJH A;  1BSM A;  5B5E Z;  2DYR C;  3OEH G;  2X6A A;  3CRA A;  4J10 A;  2B1I A;  2F93 B;  4DV6 B;  4P9P A;  2RNB A;  3JD2 A;  4RUF A;  1V54 B;  4GKJ B;  1EZJ A;  3CHX A;  2G38 A;  1M9N A;  3JAK A;  3ICX A;  1VP7 A;  2OIG A;  5LMU B;  3F5W C;  4GUN A;  2QSA A;  2E76 B;  4WFF A;  4F6E A;  2QDO A;  4NTW A;  3CCS V;  4UCU A;  1GO3 F;  3FYI B;  1IBK O;  1ZLZ A;  3JSN A;  1XMO O;  2KB1 A;  1HR0 B;  4CZZ A;  1FPO A;  4TSF G;  4O4L B;  3JD4 A;  1W0J G;  1KBH A;  1TGO A;  2ZXW B;  3HKE A;  4D7S A;  4TV9 A;  1FJG O;  4QIW F;  1GRJ A;  2ZKO A;  5EBL C;  1EM1 A;  5LP6 B;  2WLL B;  3A0R A;  1NTM H;  5LOV B;  3SJA C;  3ZED A;  2XAQ A;  3AG2 C;  3LSQ A;  1YTF D;  1QU7 A;  1Y66 A;  4JAV A;  2K9P A;  3AG1 B;  5IYZ A;  4B7E A;  1FXK B;  1H38 A;  3HKD B;  3OMN B;  5B1N A;  4K8X A;  1I94 O;  1M5I A;  1AP5 A;  1V54 C;  4X1K A;  3MHS C;  4UV8 A;  5L3D A;  2E74 B;  4D7T A;  5KUK A;  4JZG A;  1WB8 A;  3H1H H;  1EBO A;  1QLE B;  2M7W A;  2QWO B;  1R3J C;  4LNU B;  1N4C A;  5CB4 B;  2YXL A;  2Y4U A;  4LFA B;  5B1B B;  3L73 H;  3FB8 C;  3K08 A;  2HP8 A;  4UVB A;  1R3I C;  5E79 Z;  4EFE A;  1Z5W A;  4X62 B;  1V55 B;  4KHP B;  4UB8 Z;  2ZCE A;  2HLD G;  2KG7 B;  2XAH A;  3H1J H;  4LF6 B;  3QG5 A;  2RQ6 A;  3K0G A;  3HKD A;  1NVP D;  1Y76 B;  3QVN A;  2WA3 A;  2CGN A;  1OV9 A;  3AG1 C;  4NTX A;  4UXN A;  5IWA O;  4GT1 A;  1SZT A;  5JJJ B;  2Q6A A;  1GKF A;  1ZAU A;  3BPZ A;  1K92 A;  4LNU A;  1D2D A;  2DE0 X;  4R8C A;  1LR1 A;  3AG4 C;  2DJV A;  5LHG A;  2R70 A;  1J5E B;  1URF A;  2Q68 A;  4FLU A;  1B06 A;  1U97 A;  4KXR A;  3H01 A;  4X64 B;  2XUM A;  5EYP A;  1XMQ O;  1VIB A;  4PA6 A;  2QR4 A;  2IW5 A;  1Q82 W;  1US6 A;  4O2B A;  2W0F C;  4RO2 A;  3DXR B;  4PV1 B;  3HB3 B;  2QWP B;  4LF7 B;  1JOY A;  3JAW A;  4CH4 A;  1Q43 A;  2IM9 A;  1XNR O;  2Q73 A;  5EBM C;  1VMG A;  4XDK A;  4WFB V;  2PI4 A;  1IBK B;  1AI6 A;  1CP9 A;  1K73 W;  2ZD9 A;  4PA4 A;  1EN6 A;  3SPC A;  3CRM A;  2Q67 A;  1X4T A;  4DXW A;  4MSW C;  3HKC B;  3C90 A;  1I5X A;  3N2K A;  5H2F Z;  3VQV A;  4DV7 B;  1BHA A;  1ZSP A;  3A8T A;  3K5N A;  4DR1 O;  4LR3 A;  1GN2 A;  2ZR2 A;  3ZJZ A;  4JI0 O;  2ZIN A;  4OX9 O;  2ADP A;  2FKX A;  1MSW D;  1YEW A;  2JEX A;  5CBF A;  1HNZ O;  3SYQ A;  5KA6 A;  2V1D A;  3CXH F;  4YHH B;  5EZY B;  3P30 A;  2ITD C;  1OCC B;  3ZX6 A;  2HHH O;  4MTX A;  5LXT A;  2H94 A;  1H2L A;  4JAU A;  3RYI A;  3SJQ C;  3SPJ A;  3AK1 A;  5KHG A;  4FLZ A;  4JYY A;  2CDY A;  5EBW C;  3RVZ A;  1KKD A;  2Z0A A;  5LGU A;  3ABM B;  1NI8 A;  3GWK C;  2YIC A;  2WLK A;  4I0X B;  2XAS A;  2LQT A;  5LA6 B;  1IBM O;  1VQL V;  3SYO A;  5IWA B;  2V4D A;  4YY3 B;  3LUT B;  1I0H A;  3WG7 B;  2JJ2 G;  1Q3E A;  2QKS A;  4MW8 A;  3SYC A;  4IIJ A;  2ZNI A;  5B1A B;  3T1Y B;  1P7B A;  1H2N A;  2ETN A;  3B8N A;  3OT7 A;  4L87 A;  3OFN G;  2D3O W;  1TVK B;  1THZ A;  1IBL O;  4DV1 O;  3ZHR A;  1IX9 A;  3E35 A;  3UCS C;  1VQ7 V;  1XL4 A;  2EIJ B;  3SJC C;  1AR4 A;  3DC6 A;  2ZE5 A;  1IXM A;  5LMN O;  2ZM6 B;  1BT8 A;  3FAV B;  5IJ0 A;  1LNQ A;  3KCX A;  4LF4 O;  1KKC A;  1JPX A;  2HKO A;  4J9Z B;  4CH3 A;  2OCH A;  3K9S A;  5CBH A;  4ZI7 B;  2AHZ A;  3ZRV A;  3NXS A;  3RYH B;  3KZI Z;  2HG5 C;  1M90 W;  1F7Y A;  2UUB B;  4B08 A;  2CH7 B;  1NKD A;  2ARH A;  4ASU G;  3QO5 A;  3T1H O;  4CBC A;  1HNX B;  3ZRW B;  3AG3 C;  4X20 B;  5J2U A;  3HKB B;  4OX9 B;  4JI7 O;  2EJ7 A;  3LNN A;  1N34 B;  2IU0 A;  4IGG A;  1HNZ B;  1S3J A;  2DWE C;  2LW1 A;  3OMA B;  2Q4P A;  2E5L B;  1VEW A;  3FAV A;  2YIA A;  1Q90 D;  4JZ2 A;  3ABU A;  3ASN B;  4O4I A;  1VQ8 V;  4G27 B;  4JI1 O;  2RDC A;  2NNU A;  1MG1 A;  4EKW A;  5DED A;  5J9P C;  4ZOL A;  4JYB A;  2CTQ A;  1SF9 A;  3K0D A;  1KP2 A;  2F1M A;  4OGQ B;  1EN5 A;  1YVW A;  1FFX A;  1N36 O;  4I7Z B;  4JYC A;  2ZDI C;  1FYJ A;  1K5S A;  2OYQ A;  4RQE A;  1QR9 A;  2PYL A;  2P6J A;  1GH6 A;  3OAA G;  1SQG A;  1K4D C;  1YZB A;  1OCO B;  5JVD B;  1NH2 D;  3JD3 A;  3ZMU A;  1BCC H;  1ZL8 B;  4UCT A;  2WA4 A;  3CRC A;  3D8C A;  4X8A A;  2BOB C;  2AZ2 A;  1PKX A;  4NTY A;  1XOU A;  2MW2 B;  1IVS A;  3FB6 C;  4KP4 A;  2XAG A;  2ZE7 A;  1QVG U;  1Z5V A;  4E2L A;  5GTI Z;  2HFE C;  4DR3 O;  4MVQ A;  3THO A;  3UKM A;  4PA9 A;  1SET A;  3BVO A;  2PUS A;  2F43 G;  1NR7 A;  3KG2 A;  1FKA O;  1EZV H;  4DV6 O;  3D36 A;  3M8A A;  4DV0 B;  4GKJ O;  4DR5 B;  2BOC C;  2EBO A;  1H8H G;  1L1F A;  3H1I H;  4EFB A;  3OGC C;  3QO7 A;  5DEC A;  5LMU O;  2P90 A;  2M6Y A;  2OTJ V;  1AB3 A;  4JAA A;  3CME V;  1R6N A;  1R73 A;  5E1A C;  3AEI A;  1HR0 O;  3TXQ A;  1OCZ C;  2RMK B;  1YIJ V;  1Y74 A;  3BA8 A;  3CCJ V;  4UCO A;  2XOK G;  4WFH A;  1QQC A;  2GHY A;  3ML0 A;  2A06 H;  2W0X A;  4ZHQ A;  3CCE V;  5LMN B;  3L70 H;  4LP8 A;  5D5Q A;  2Y4T A;  4FPP A;  1ROP A;  2P4V A;  5KMG A;  2JJ1 G;  2YXY A;  1SRY A;  2IBZ H;  2IJJ A;  5LBQ A;  1IXB A;  3U0Z A;  4NVP A;  4MVR A;  2YC0 A;  4PA3 A;  1AR1 B;  3N2G A;  4LC1 A;  5KX5 A;  1Y6X A;  3T1H B;  4O4J B;  1I08 A;  3M7M X;  1YJW V;  3A0H Z;  4MTF A;  5BR8 B;  2RJZ A;  4I50 B;  3LDC A;  1O9G A;  1JJ2 U;  1AVM A;  1KMI Z;  3OM3 B;  2OWO A;  1D5N A;  4JI4 B;  5EIB D;  1GTO A;  3CEI A;  2CK3 G;  2EX3 A;  1JX9 A;  2RCV A;  1R3L C;  4MTO A;  1GAX A;  3LNM B;  1SQQ H;  5FL7 G;  3ZN0 A;  1AR5 A;  1G4Y B;  4X62 O;  1HNW O;  4KHP O;  3E8F A;  3Q4H B;  3NR7 A;  3E86 A;  2EIK C;  3K59 A;  1N36 B;  1BHB A;  1S5L Z;  4FM0 A;  5HFM A;  5LL6 Y;  1W59 A;  1UPG A;  3B4S A;  4UUJ C;  3T4D A;  4TT3 G;  3SYP A;  1K7D A;  4MVM A;  2QM7 A;  3VQY A;  3P3P A;  3ZS8 C;  3ABK C;  2UXN A;  4I50 A;  1L0N H;  2F23 A;  3J80 N;  4X88 A;  3G71 V;  3CC4 V;  2FYU H;  2A3Q A;  5IT9 N;  2XAF A;  1K8A W;  3AG2 B;  3BAB A;  5CA1 B;  3RBZ A;  4PDV A;  4X65 B;  1RSO B;  4X64 O;  1N8R W;  1MZF A;  1SA0 B;  4DR2 B;  1H2G A;  3Q4H A;  1GN4 A;  1YXB A;  1HWY A;  3SPH A;  4W4L A;  1DGS A;  2V7Q G;  5H9C A;  4LF7 O;  2LP7 A;  1BL8 A;  2YI9 A;  1JCH A;  1SQV H;  5KLV H;  4HAM A;  1VQ5 V;  4LH6 A;  3K9A A;  3CCQ V;  5JJE B;  1GK9 A;  1XNQ B;  2Y0P A;  1JA8 A;  4U7O A;  1SC5 B;  4HYO A;  3IAY A;  3F7V C;  3UO3 A;  3SPI A;  5A2Q N;  1AJQ A;  5DN6 G;  4QNH B;  2QWR B;  1VQP V;  2Y48 A;  2MK3 A;  3BFR A;  3ZMZ A;  3L74 H;  4DV7 O;  1R6K A;  3MDS A;  1K34 A;  5AG2 A;  1JVM A;  2ADQ B;  1K3E A;  2WLI B;  1YF2 A;  5B3S C;  2F4V B;  4PD4 F;  3JAM N;  3TET A;  1NJI W;  4LFB B;  3J7A U;  3B77 A;  5L3C A;  1NZ6 A;  4GLX A;  1LUW A;  3BY6 A;  3K3W A;  4FLX A;  2JRI A;  2BCC H;  2QEX V;  5ITZ B;  1NTZ H;  2IH3 C;  2GTS A;  4YHH O;  1KEC A;  4KFM A;  3W7X A;  1PP9 H;  4AIL C;  3JAS B;  4ZIB A;  1IDS A;  3ASO B;  2XTA A;  4WBN B;  4O4L A;  4G2K A;  3AG4 B;  1XRE A;  1SES A;  4QJF B;  3WB1 A;  1WAZ A;  4YJ2 B;  3ZN1 A;  1EN4 A;  1DLB A;  1PM9 A;  3MAQ A;  4NXM B;  5LP6 A;  1K4C C;  2IU3 A;  2WLL A;  1QNM A;  5LOV A;  5H6R A;  4R50 A;  2X7R B;  1FAF A;  3VOU A;  4JYA O;  2IJH A;  3LSU A;  3QTC A;  4IYI A;  1HNW B;  3APQ A;  3RW0 A;  1FXK A;  4LFC B;  2GBO A;  5ITZ A;  4I4T B;  5K1P A;  2DYS C;  1ARO P;  3STL C;  1WB7 A;  3EVK A;  5LGT A;  2IJI A;  2ZIM A;  4H44 B;  3JAS A;  2AZ0 A;  4YXW G;  3WB2 A;  1XEQ A;  2EJR A;  5C8Y B;  4YY3 O;  4YJ2 A;  5TIS Z;  3JSL A;  3ASO C;  5CB4 A;  4BIO A;  1N32 O;  1M1K W;  3P3N A;  4MT8 A;  4LF5 B;  5JQG B;  3T1Y O;  4JGS A;  2Y69 C;  2LFR A;  1FXH A;  1O9H A;  1KYO F;  4GX5 A;  2KG7 A;  4ZKI A;  1KUQ A;  3JAT B;  4DV4 O;  1Y76 A;  4F6R B;  4CS3 A;  2Q5Z A;  4BWA A;  4HBN A;  4IHJ B;  1JJO A;  5CBG A;  1CPY A;  2ZM6 O;  3B09 A;  3FB7 C;  3RVY A;  3O65 A;  2CGO A;  1N0J A;  3K04 A;  4XBF A;  2DQ0 A;  3CB2 A;  1XHX A;  4X1I B;  3CMA V;  1PL0 A;  1AI4 A;  1BMF G;  1VF7 A;  3L75 H;  5JQG A;  4CC5 A;  1E1R G;  2UUB O;  5H6Q A;  4HZ3 A;  1VQM V;  3W7S A;  3S3W A;  2PF4 E;  1SQX H;  3JAT A;  3E8H A;  1Q86 W;  1HNX O;  2PTM A;  3E22 B;  3DXR A;  4F6R A;  5KHK A;  1N34 O;  4IHJ A;  3CYO A;  5H5N A;  2FB5 A;  3G6E V;  1KU9 A;  4NYK A;  4P9O A;  3ABT A;  2E5L O;  2QKA A;  2YI8 A;  3FB5 C;  1QCE A;  4DUY O;  3VBB A;  2N05 A;  1YI2 V;  4QGP A;  4J42 A;  3HKC A;  2YEV B;  1GM7 A;  3TGU H;  2A0L A;  1WP7 A;  4PDM A;  5BMV B;  3HR0 A;  2QGN A;  1GN6 A;  3CXC U;  2XHB A;  3P32 A;  2P67 A;  1TAE A;  3SGI A;  2JS5 A;  4JYA B;  4LF9 O;  3IC7 A;  4K3A A;  2YXH A;  1MAB G;  1MNG A;  1HP8 A;  2Q0O C;  3JD0 A;  1OJH A;  3ABL C;  5EK0 A;  4JI6 B;  2JVD A;  5EZY A;  4LCU C;  1G6U A;  2P5O A;  1VQN V;  4CH6 A;  4PI2 A;  4B7K A;  3UQ8 A;  4NKG B;  1PNM A;  3I56 V;  2VRZ A;  3CD6 V;  3R66 A;  3RYC B;  3O9O A;  4J7Z A;  4J9Y B;  1M57 C;  3ETE A;  4I55 B;  5FPR A;  4EB6 B;  5KHI A;  4TQF A;  2ZIO A;  1N32 B;  1YSC A;  4DV0 O;  5JCO A;  4DR7 B;  3TCU A;  3ZRX A;  4DR5 O;  3AG3 B;  4BR6 A;  3X2Q C;  2YSU B;  5FLX N;  1L8D A;  2DQ3 A;  2GUZ B;  4DYL A;  2JK5 C;  4I0X A;  4DV4 B;  1AP6 A;  5LA6 A;  3JD1 A;  2R9A A;  4CS2 A;  2A7W A;  3G80 A;  2VWJ A;  3CRQ A;  2YDE A;  4X89 A;  3BEH A;  1Y4M A;  3CC7 V;  5FPO A;  3B40 A;  3LDE A;  2YUA A;  1RM1 C;  3A2F A;  1F23 A;  3APO A;  3OMI B;  5IYC O;  2E75 B;  5CA3 A;  3SJB C;  4DR4 O;  4FVM A;  2OCC C;  5EC2 C;  1VF6 A;  4YJ3 B;  4J80 A;  2UU9 B;  2JGU A;  2UXC B;  2DW4 A;  4UV9 A;  3JAL B;  4I9W A;  1TVK A;  2E3C A;  3CP1 A;  5BR8 O;  3IGA C;  1YJN V;  1H8E G;  2ZE6 A;  1JFF B;  1DF4 A;  2EIN C;  4DUZ B;  1N33 B;  3GVM A;  1NU1 H;  5HFL A;  4JI4 O;  4TOI A;  5IY5 C;  1V9P A;  4X66 B;  2VQF O;  3LDD A;  4DUY B;  4B3S B;  1PPJ H;  4DK1 A;  4ABM A;  4RWU A;  2ZDI A;  5C93 A;  2GV9 A;  4DR6 B;  4ZI7 A;  1CXZ B;  3DSQ A;  1TUB B;  3RYH A;  3C3S A;  2CH7 A;  3G6B A;  1QHT A;  2BE3 A;  4LF9 B;  1KP3 A;  3OGI B;  4GCZ A;  4IT5 A;  2XT9 A;  1OCZ B;  3ETD A;  4PI0 A;  3ZRW A;  1VQ4 V;  5JH7 B;  4X20 A;  4GZR B;  3HKB A;  3A0B Z;  2IH1 C;  1SQF A;  4BW5 A;  2AGA A;  3OTF A;  1JFF A;  4NXN B;  1MMM A;  2ODM A;  1R1B A;  1D5A A;  4TUY B;  2R9R B;  1S72 V;  1DK1 A;  4U3J B;  1JR9 A;  1SKV A;  4D6T H;  2EIM C;  2XND G;  1YIT V;  1NS1 A;  4X65 O;  2QTS A;  1PNK A;  3M99 B;  4DW0 A;  4DR2 O;  1VAR A;  3K57 A;  2HVK C;  1RPO A;  1TUB A;  5F2V O;  1M56 C;  5L3E A;  4BW9 A;  1K97 A;  4TQD A;  2VS0 A;  1AJP A;  4GKK B;  2JEU A;  2OIE A;  2VQE B;  3G67 A;  5JVD A;  1L0L H;  1M4U A;  3OTO O;  1XNQ O;  1ZL8 A;  3T4Z A;  3ZHQ A;  2LGW A;  4TUY A;  2Q7H A;  2OT5 A;  5A9G A;  1RP3 B;  2P4K A;  1VQO V;  3ETG A;  1SS3 A;  1XQ8 A;  2EIK B;  4UCS A;  4K0K B;  1Q6U A;  5FNV B;  2QWQ B;  1KB9 F;  2NN4 A;  2F4V O;  2CE4 A;  4LFB O;  4H0L B;  3E83 A;  2JGD B;  5KUM A;  2H3O A;  5CA0 B;  1MZE A;  2UXD B;  4DR4 B;  2F95 B;  2ATK C;  1B6Q A;  3ABK B;  5IE9 A;  1PD3 A;  2QWN B;  4DV3 B;  4B3T B;  3E8B A;  3WB0 A;  3L71 H;  1WPX A;  4TV8 B;  3AG7 A;  4Z2W A;  3K5M A;  4FZ1 A;  4G28 B;  5KHH A;  2UXB B;  1RFY A;  4IL6 Z;  4LBE C;  4U7N A;  5LGN A;  3K58 A;  4NXM O;  2JS3 A;  2P22 C;  2VQF B;  5BY1 A;  3H9V A;  1S76 D;  3ZHV A;  4FZ0 A;  2W6J G;  4PA7 A;  1G8M A;  2CTW A;  4FK5 C;  2BSK B;  3RGB A;  5CA0 A;  4WFA V;  5IDJ A;  5LHI A;  3ZHU A;  4DV2 O;  4LFC O;  4AI8 A;  4RAI A;  1E1Q G;  3N27 A;  3DTU B;  3FX7 A;  4YIO A;  4FLY A;  2B9Z A;  5IYD O;  4O4J A;  1DF5 A;  1I7F A;  1XIL A;  5CN0 A;  2LW7 A;  4O2A B;  4H13 B;  4WFG A;  3CJH B;  3BRC A;  5L3F A;  3ZMT A;  4JV5 O;  2HJF C;  1ORQ C;  3QF7 A;  3DGE A;  3G4S V;  4B3R B;  5GTH Z;  1KC8 W;  5B3S B;  4XDJ A;  3RWR D;  4LF5 O;  1WNS A;  1QR8 A;  3SPG A;  1QBZ A;  1FS0 G;  2BSK A;  4QPJ A;  1GM9 A;  2QE7 G;  3CX5 F;  5CMU A;  4JTC B;  4JI2 B;  2UUA B;  2JIZ G;  1SQP H;  2PI5 A;  3OR6 C;  3BAA A;  5DM6 V;  1OZ0 A;  3OTO B;  2IJK A;  4DO2 A;  4L8J A;  3TXS A;  1P49 A;  3CCU V;  3FFQ A;  1VQ9 V;  3ZIA G;  3OD4 A;  3FD9 A;  2QM4 A;  4Z1V A;  3QO8 A;  5KAF Z;  5EIB C;  4BIU A;  2AHY A;  2QA4 V;  4UB6 Z;  5IYZ B;  2C2A A;  2HEP A;  3E89 A;  5CA1 A;  5GON B;  1RSO A;  1K5Q A;  4X1K B;  1SA0 A;  2BTO A;  4B3M B;  2WAM A;  2Z3Y A;  2ITC C;  1Q5O A;  2DYS B;  3STZ C;  1BZK A;  2N04 A;  4NB5 A;  4PDL A;  3ZMS A;  4EEQ A;  2PGG A;  2L6L A;  4MW3 A;  2QKC A;  2ZNJ A;  1QVF U;  3WU2 Z;  3BHP A;  4DV5 B;  4YIP A;  1UJW B;  2X6B A;  4ZBM A;  2PYJ A;  1J95 A;  2KSD A;  3SR2 C;  2F66 C;  3R65 A;  1HW7 A;  1BQ0 A;  2GDS A;  1Y67 A;  4KUM A;  1GM8 A;  3JAR B;  4J11 A;  4MTG A;  4Q6G A;  4AQY B;  1Z2G A;  2UUC B;  2DWD C;  2EIL C;  4KL1 A;  2WLH A;  1X59 A;  4N23 A;  1IZ3 A;  2Y69 B;  5GON A;  1OHH G;  4RQF A;  3IJ4 A;  1QLN A;  4OPH A;  1YTF B;  3TJT A;  4JI3 B;  5GW7 A;  4F4L A;  1SZX A;  2WLI A;  3BA9 A;  4GX2 A;  3J81 N;  1XI1 A;  4FLT A;  1HDJ A;  1F51 A;  3D3Q A;  2FML A;  3K5L A;  3EFF K;  2JDI G;  4FLW A;  1S0V A;  1AIL A;  4DV2 B;  1XUQ A;  3I5D A;  4WFE A;  2PZS A;  1COW G;  4AHC A;  1NT2 B;  1W0K G;  2Q8V A;  2K1E A;  4GX1 A;  4JI6 O;  3DC5 A;  2ZXW C;  2CTP A;  2LGQ A;  3JAR A;  4WBN A;  5LP6 C;  5EYP B;  1TUE B;  1XL6 A;  2ZE8 A;  1GMG A;  4JV5 B;  4R6Z A;  4O2B B;  2XAJ A;  2NLJ C;  3U10 A;  3I55 V;  5KAI Z;  3JAW B;  4PHZ A;  2WLN A;  3U11 A;  4TWK A;  4K8Z A;  4DR7 O;  1FXK C;  4I9Q A;  3F5T A;  1NVP B;  4DK0 A;  4FFK A;  4X9Q A;  2Z5U A;  1SER A;  1GN3 A;  1S77 D;  1JMK C;  4JI8 B;  3RT3 C;  4I4T A;  4LF8 B;  2W6I G;  3IFX A;  1NQT A;  4UCV A;  3N2K B;  1QLE C;  2FL4 A;  3SDL A;  3L9D A;  3ZCC A;  5C8Y A;  5JJN B;  1YHQ V;  5B1B C;  3JCU Z;  2EZP A;  3RFR A;  4UVC A;  3CCR V;  4RUE A;  4CH5 A;  1V55 C;  1M93 A;  4BAY A;  4IYH A;  4QE9 A;  2Q0A A;  4UCR A;  1K9M W;  1XBL A;  1PNL A;  4QPK A;  1XMO B;  1WN7 A;  3ABL B;  2WLM A;  4UVA A;  2UU9 O;  4NR1 A;  5LXT B;  2UXC O;  1NBM G;  3IC9 A;  3PJS K;  5D5P A;  3RYI B;  1FJG B;  1WA8 B;  3GWO A;  4DUZ O;  1N33 O;  4E4E A;  2GSM B;  3CE2 A;  2AXT Z;  1TA8 A;  4MVS A;  1F4M A;  1M57 B;  1PL4 A;  4X66 O;  3B2E E;  4B3S O;  3JYC A;  2Q7G A;  4X1I A;  3SYA A;  2EZO A;  1MSD A;  3OW2 U;  4DR6 O;  3AK3 A;  3X2Q B;  2QM8 A;  1I94 B;  3CCL V;  2BTQ B;  4X1Y B;  5IJ9 B;  1CEZ A;  4LWS B;  1K33 A;  3VQW A;  2ILM A;  3CCM V;  3E22 A;  2Q7E A;  4U3F H;  3AK2 A;  1WA8 A;  5BZB A;  4HNA B;  1R6T A;  4NXN O;  3UT5 B;  4IIJ B;  1SQB H;  3OR7 C;  3MD0 A;  1RM1 B;  2LJ2 A;  4LH7 A;  1BQZ A;  3ZBH A;  1A32 A;  2YEV A;  5LHH A;  4FFB B;  4DW1 A;  3ZHS A;  1XDC A;  5BMV A;  1LUV A;  2BTQ A;  2OCC B;  2N74 A;  2KKW A;  5K1X A;  2PY5 A;  4X1Y A;  2P7T C;  5IJ9 A;  5JWP A;  2Q69 A;  4LWS A;  3E2E A;  4GKK O;  4CS4 A;  5IJ0 B;  2VQE O;  2CUG A;  2EIN B;  5J2T B;  4ICG A;  1Q6H A;  2QJ1 A;  4JI5 O;  4HNA A;  1OCC C;  1H2K A;  1VF5 B;  3UT5 A;  5IY5 B;  1YCI A;  2P06 A;  4J7K A;  2HR3 A;  5LYJ B;  4XDL A;  2A79 B;  1XMQ B;  1I5Y A;  2WSS G;  1ZX3 A;  3CRR A;  3RYC A;  5JCO C;  4FFB A;  3ETQ A;  4K0K O;  4I55 A;  4EB6 A;  3ABM C;  1EFR G;  2YIB D;  1WPB A;  5J2U B;  1JQ0 A;  4OPA A;  3C3T A;  3CC2 V;  1XNR B;  3LSS A;  4MVZ A;  2UXD O;  1H2M A;  2DN9 A;  1N0N A;  2GUZ A;  5J2T A;  3CCV V;  4FM1 A;  4J7J A;  4O4I B;  4H33 A;  4DV3 O;  4B3T O;  4N21 A;  4K35 A;  3CWB H;  2EIM B;  2LFS A;  4ZOL B;  5LYJ A;  3PN1 A;  2UXB O;  1OCR B;  1P84 F;  1UFI A;  3WG7 C;  4FJC C;  4OXS A;  3OUF A;  1WLE A;  1FFX B;  2EUL A;  2DMX A;  1WJZ A;  4DR1 B;  4UFZ A;  1G1X B;  1FXV A;  4PEL A;  1S5J A;  4JI0 B;  1M56 B;  1NTK H;  5B1A C;  5KHJ A;  4FMT A;  4CC6 A;  2HVJ C;  3ZRS A;  4GYC B;  3W7U A;  4WF9 V;  1VQ6 V;  3GB7 C;  1VF6 C;  2X6C A;  2YIB A;  3W7W A;  3FYE B;  3FKS G;  1B04 A;  2HHH B;  4Z1M G;  4FLV A;  4P30 A;  4YJ3 A;  2EIJ C;  3CS5 A;  2AW9 A;  3JAL A;  2X0L A;  3D3I A;  2LO1 A;  1F4N A;  3E8G A;  3ZHT A;  3JCZ A;  1XHZ A;  1PV0 A;  1P4R A;  5L3B A;  4B3R O;  2DOS A;  4QE7 A;  3WFV A;  1OCR C;  3OUS A;  2B1G A;  3T2M A;  1E79 G;  2Y0I A;  2ZQM A;  1Q81 W;  2GTA A;  1W2B U;  2Q9L A;  3K06 A;  2R72 A;  3MHH C;  1IBM B;  4WCE V;  4I5S A;  1ZWI C;  1Y74 B;  1R3K C;  3KCY A;  1NH2 B;  2NR5 A;  4JI2 O;  4ZHQ B;  2UUA O;  3KKY A;  4MVO A;  2HJD A;  1ZUQ A;  5JH7 A;  1Q7Y W;  1FD9 A;  4JI5 B;  4GX0 A;  5KMG B;  3ASN C;  3CSX A;  1YDX A;  1MA1 A;  4U3J A;  3T1C A;  1S5H C;  1YJ9 V;  4MS2 A;  3N2G B;  5KX5 B;  3RN4 A;  1H2S B;  3D36 C;  1FFT B;  4Q20 A;  4B3M O;  1IBL B;  3CPW U;  1B3Q A;  4DV1 B;  4R7C A;  1ENV A;  3RYF B;  2WLJ A;  1OCO C;  1ZTE A;  2R9I A;  3L72 H;  1U96 A;  1AI7 A;  3OEE G;  3EHB B;  4JTD B;  4LF4 B;  3W7T A;  4J41 A;  4DV5 O;  1BS3 A;  1KD1 W;  3QNE A; 
#chains in the Genus database with same CATH homology
 1F7Y A;  5IWA O;  1HNX O;  1NS1 A;  5IT9 N;  2N74 A;  4X65 O;  4JYA O;  4DV2 O;  4AQY O;  1HR0 O;  4LFC O;  3T1H O;  2UUC O;  1N34 O;  4DR2 O;  1D2D A;  5H5N A;  4X64 O;  1IBK O;  4GKK O;  1XMO O;  4JI7 O;  2Z0A A;  2VQE O;  2DJV A;  2LW7 A;  2E5L O;  4JI3 O;  4JI5 O;  1X59 A;  4DUY O;  4A5U B;  4B3R O;  2DOS A;  4OPH A;  1FJG O;  1XMQ O;  4JV5 O;  2ZKO A;  2UU9 O;  2UXC O;  3OTO O;  4LF7 O;  3J81 N;  1XEQ A;  4DR4 O;  1XNQ O;  1IBM O;  4YY3 O;  4JI1 O;  4DUZ O;  5BXZ A;  1N33 O;  5BR8 O;  4LF5 O;  4LFA O;  1AIL A;  4LF9 O;  1XNR O;  4K0K O;  1N32 O;  5A2Q N;  4JI2 O;  4X66 O;  1N36 O;  2UUA O;  4OPA A;  4JI6 O;  4B3S O;  3T1Y O;  1FYJ A;  1I94 O;  4JI4 O;  4LF6 O;  2VQF O;  2UXD O;  4DV7 O;  2F4V O;  4LFB O;  1YZB A;  4DR6 O;  1KUQ A;  4DV4 O;  3JAM N;  4DV3 O;  4B3T O;  3J7A U;  3R66 A;  1IBL O;  2JRI A;  4DV1 O;  2UXB O;  4DR1 O;  4DR7 O;  2ZM6 O;  1HNW O;  4X62 O;  3F5T A;  4KHP O;  3O65 A;  4JI0 O;  4JI8 O;  4B3M O;  4LF8 O;  1R6T A;  4NXN O;  4YHH O;  4OX9 O;  2FKX A;  4DV0 O;  4DR3 O;  5LMN O;  1G1X B;  4DR5 O;  5LL6 Y;  1HNZ O;  1J5E O;  1FKA O;  4LF4 O;  2AGA A;  5FLX N;  3RT3 C;  4DV6 O;  4NXM O;  3M8A A;  5BY1 A;  4GKJ O;  1R1B A;  2HHH O;  1DK1 A;  2UUB O;  4DV5 O;  5LMU O;  1A32 A;  3J80 N;  3SDL A;  1AB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...