2RDCA

Crystal structure of a putative lipid binding protein (gsu0061) from geobacter sulfurreducens pca at 1.80 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
133
structure length
133
Chain Sequence
ETTMGRYKKVIEITGHDEVAAKLLEGLIDAGTRYFSKVVEMEHRMASARFRLDGEELRELTETLDRSRRLAHESLISSLHVFNRYIVKEYGEELKEAGIEGGIFPKPEANRDRIAIADWAGELLTGIYENRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of protein of unknown function (NP_951123.1) from Geobacter sulfurreducens at 1.80 A resolution
rcsb
source organism Geobacter sulfurreducens pca
molecule tags Lipid binding protein
total genus 47
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11554 DUF3232 Protein of unknown function (DUF3232)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.800 Mainly Alpha Orthogonal Bundle Helix Hairpins protein ne1242 2rdcA00
2RDCA
chains in the Genus database with same CATH superfamily
2H8PC 1PKXA 4F6RB 5IJ9A 1P84F 3P3NA 3K0GA 1DLBA 3BA9A 4OGQB 4JI1O 3G67A 4LFBB 2PI5A 1K9MW 4J9ZB 3ABMC 3ABKC 1H2SB 4HBNA 3ZN1A 2PUSA 1AI5A 4OX9B 3SJAC 3K58A 5LP6C 2UXDO 3CP1A 2HJFC 3JALB 2P90A 1WLEA 3FB8C 1LUWA 1N8RW 2N74A 3BPZA 1WA8B 3OMAB 2X6CA 3DXRB 3LSQA 4DV5B 4K3AA 3W7XA 3FKSG 3TK1A 1A32A 4LC1A 3CS5A 3WB1A 3BAAA 1YITV 2IU0A 4CS4A 1NR1A 2JGUA 1AB3A 4I9QA 4MVRA 2LGWA 4B3TB 4DR3O 2GTAA 2XAGA 5CMUA 2OTJV 4EB6B 3AG3C 4TUYB 2VQEB 3CMEV 2Q9LA 3MHSC 4U3JA 4DR4B 4B08A 1N34B 5LYJA 2HG5C 4DXWA 4WCEV 3N2KA 4X1YA 4JI7B 1GTOA 1S5JA 3C3SA 3ZCCA 2XAQA 3K5OA 4JI3O 1VF6C 2X0LA 3J80N 4X20A 1CP9A 5JH7A 4O4HB 1Q6UA 1XOUA 5LXTB 3APQA 2ARHA 3DTUB 2EBOA 4LF9B 3JAMN 4B7EA 1FXKA 3LNNA 3ETDA 2Q7GA 4UUJC 2QJ1A 5JJNB 4QPJA 5JJJB 1HNZO 1R6KA 1F4MA 3K59A 5GONA 3T1HB 4B3MO 4LFAO 3LDDA 1NH2D 5ITZB 2UXNA 2HHHB 1M57B 3KKYA 4JTDB 5EIBC 2IJKA 2LW7A 4DR7B 2NNUA 3PN1A 4NXNB 1TAEA 2YDEA 4WFFA 1QLEB 4WBNA 4GX1A 1CXZB 1EN6A 4F6RA 2BTOA 5EZYA 3A0BZ 1YIJV 4DV3B 1HNXO 1S3JA 4UFZA 2YSUB 1BSMA 1JFFA 5FPOA 1RSOB 1AI7A 4JI1B 1N0NA 3JSLA 1AJQA 1V54B 4X64O 1E1QG 3JALA 3JD4A 5J2UB 3MAQA 1G1XB 5EIBD 1VQLV 2IU3A 1ORQC 4DW1A 1WA8A 4TWKA 1EFRG 2UXDB 1JR9A 1XL6A 2P7TC 2P5OA 2Q0AA 1MA1A 4JI4O 2P4VA 2C2AA 1I7FA 3T4DA 4JV5O 4O2AB 1XMOO 1E1RG 4AQYO 2WLJA 4XDJA 4GLXA 3OT7A 1Q8IA 1AI4A 3CB2A 4NB5A 3UO3A 4O4JA 1R6TA 2LP7A 2OTLV 2DYRB 3RVZA 2DWDC 2LJ2A 2QWPB 2UXCO 2D2CB 1AR1B 4BAYA 5IWAO 3CCJV 4MVQA 1YSCA 3HKDB 2VQFO 4EB6A 4DR3B 3IJ4A 4TUYA 2ZIMA 2Z0AA 4LFCO 1JCHA 1AVMA 4YIOA 4YIPA 4FLUA 1QVFU 1XREA 3JAWB 5B1BB 3ZHQA 1P49A 1EN5A 1ZTEA 4FMTA 3VQVA 3FD9A 4JI0B 3K5MA 2Y0PA 1GN6A 3FAVB 2JS3A 2GDSA 3OTOO 4HAMA 4IYHA 3NXSA 3KCXA 4UV9A 1V9PA 4JAVA 4AI8A 3THOA 1I94O 4JI5B 1B6QA 4O4HA 3W7SA 4H44B 2ZE7A 5LXTA 2UUBO 2HVJC 2ZDIA 4JI3B 1D2DA 2RQ6A 2Z3YA 2YIBA 3HR0A 1SERA 1OJHA 1KP2A 1T5EA 2WLKA 3KG2A 1K97A 4MVMA 2JJ2G 3HKBA 1VQ7V 2R72A 2WSSG 1F23A 4J10A 2F66C 3ZMZA 5ITZA 2PGGA 1IBLO 1HNZB 3H1HH 2AZ2A 1XI1A 4UXNA 4IT5A 2FTKA 1XDCA 3AG4B 4FIPC 4O4LB 2V4DA 1GMGA 5KA5A 1IBMO 1HP8A 4I50B 2AHZA 1TGOA 1FJGO 1RSOA 3W7TA 2AZ0A 1L8DA 3M99B 3ZRWB 1S5LZ 3K08A 4FZ0A 3E86A 5H6RA 4MVSA 5IYBO 5KLVH 3UT5A 4PV1B 1GAXA 3UCSC 5J2UA 2KG7A 1H2LA 1XUQA 3MD0A 2ZM6B 4MSWC 5B1OA 3TXSA 3TXQA 3SDLA 3NR7A 4Q20A 4O2AA 5C8YA 5KHGA 1ZSPA 2G38A 3CC2V 1NVPB 1E79G 1S5HC 1N36B 4FZ1A 1XMOB 4HNAB 4DV0O 3UO2A 3OUSA 2ADPA 2ZXWC 2H3OA 3D36A 1J95A 4IL6Z 1D5AA 1K73W 2A7WA 3TGUH 3STLC 2EJ7A 3HKDA 1OCZB 1Q81W 2M7WA 4P2ZA 2XHBA 1M90W 4IGGA 4DV4B 3RW0A 2Y48A 3H1LH 1QLEC 1JVMA 2YI8A 3JAWA 2VQFB 5LMUB 4XBFA 5C93A 5LMNO 3F5TA 2QGNA 4CC6A 1H2MA 2Y0IA 4X8AA 4LF6O 2YIBD 2CDYA 2Q4PA 3FAVA 3JD2A 3ZX6A 1RFYA 1ZLZA 1BGYH 3Q4HB 4GT1A 5JCOA 4GKJO 4IYIA 2QSAA 2PF4E 3RYHB 4FK5C 4UCVA 3CCQV 2IH1C 2ATKC 2MW2B 3AG2B 4QE7A 1FYJA 1N32B 1R3KC 1SQGA 2FMLA 2BOBC 1VQNV 4MVUA 2MK3A 2CGNA 5IJ9B 4QPKA 3OMIB 3UKMA 3X2QC 1S76D 2DYRC 1VQKV 5IDJA 1MABG 3PJSK 4B3SB 3KZIZ 5BY1A 4I0XB 4NTYA 5DECA 2JVDA 2YXYA 4UCSA 4FLVA 2F4VB 3AG1B 1W59A 3S3XA 4I50A 5B1BC 1N33B 3JD3A 1I08A 5LA6A 2RJZA 3B8MA 1NJIW 4X62O 3IC7A 1J5EB 5FL7G 4WFHA 2ZINA 2LFSA 2FL4A 4UCOA 2EJRA 5KHJA 1PV0A 1AP6A 1JJ2U 2LW1A 2PTMA 5JCOC 1HNWB 1ZL8B 4X66B 2ODMA 1IBKO 1SQPH 5EBMC 3OR7C 4YXWG 4JYCA 3CJHA 3CCEV 1NZ6A 4J42A 5DEDA 4AHCA 5DN6G 2Q7EA 1QLNA 2EINB 5L3GA 4J7KA 4ZI7A 3ZHTA 3K0DA 4R6ZA 4QIWF 3STZC 5B3SB 4E2LA 2YUAA 2ZKOA 4HNAA 3JD0A 4JTCB 1SQBH 1SS3A 1X59A 4LF4O 5EBLC 4DYLA 2Q69A 2HEPA 1MG1A 3F5WC 4YHHB 4LF5B 2M6YA 1Q7YW 1K5SA 3AK1A 3H9VA 4X1YB 4JYBA 2K9PA 3SYQA 4UB6Z 3L74H 1JA8A 4KL1A 4RQEA 4JZ2A 3E8HA 1PL4A 2WAMA 2JJ1G 3SJQC 1SZXA 2L35A 3K3WA 1BHBA 1FXKB 1Z5VA 2QA4V 4MVZA 2JGDB 3FYEB 5LHIA 4YJ2B 2B9ZA 1QBZA 3DSQA 1SF9A 3Q4HA 2XAHA 3K9SA 2AGAA 4FFBA 3E8GA 4O2BB 4TQFA 1EN4A 3B2EE 2GTSA 3RYHA 4NKGB 3RGBA 3LUTB 2H94A 5J2TA 4GKJB 3RYIB 1K92A 2P67A 2QDOA 2Y69B 2NN4A 3H1IH 3CCRV 2ZNJA 2PY5A 1R73A 1N0JA 3M7MX 3DC5A 4FLTA 2CTRA 3CYOA 2QWRB 5EZYB 1K5QA 5JQGA 2HP8A 4D6TH 2LQTA 4FM1A 3FB7C 1JFFB 1AI6A 4TQDA 4KXRA 4LF8O 1K3EA 2HLDG 4I0XA 5HFMA 4JI6O 1MMMA 3UQ8A 2XASA 1CPYA 1H8EG 4BIUA 2KKWA 1PP9H 4QE9A 1XMQB 3B77A 4D7TA 3OW2U 4K8ZA 5KMGA 3DGEA 1Y66A 4P9PA 3CSXA 1EBOA 2EIKB 1NVPD 3VOUA 4TV9B 3JATB 3GVMA 3O65A 1VARA 4QGPA 4CH6A 3I55V 3M8AA 4DV7O 1K4DC 2YICA 3CCUV 2O57A 3N2GB 5JWPA 3B8NA 4LBEC 2EIJB 1DTOA 3FFQA 1ZL8A 3BRCA 4O4JB 4FLZA 2LGQA 1Q86W 2ZR3A 1YXBA 4X9QA 3JYCA 1K34A 3AK2A 2RN9A 3AG2C 5FNVA 4GKKB 3ZHSA 1JQ0A 3ASNB 1AROP 4MS2A 2N04A 2EILC 2VWJA 1LR1A 4UB8Z 3BEHA 2HJDA 4O4IB 1LUVA 3K06A 1FFXB 3CWBH 1OCOC 4MW8A 4DR1B 3JSNA 1XQ8A 2VS0A 4LF4B 4X65B 5LBQA 3WB0A 4A5UB 3KCYA 3FX7A 1XL4A 1LNQA 3AG1C 1KBHA 1Y67A 3P30A 3ZRXA 2PZSA 4JTAB 2GBOA 1Q5OA 1H2NA 4JYAO 2JGDA 2A9HA 4YJ2A 3J7AU 4GYCB 4I4TB 4RQFA 3HKBB 3SYPA 5IY5B 1RP3B 4O2BA 1WPBA 2QKSA 3ML0A 1NU1H 2OCCB 2OYQA 3RYIA 3T1YB 1BE3H 1JOYA 1PNMA 2FYUH 2R70A 2QTSA 2EINC 4JAAA 3QO7A 2WLIB 4NXMB 5EC1C 2B1IA 4UVAA 2P06A 1MSDA 4G2KA 2BE3A 1VQMV 2DWEC 2WPDG 4DV2O 4DW0A 1NI8A 4NVPA 3HPLC 3WFVA 2F23A 3G80A 1BL8A 1KB9F 2XNDG 5EYPA 3UT5B 2L6LA 4LF8B 4F4LA 4WFBV 1GN2A 3TCUA 4JI6B 2ZE5A 4HYOA 2KG7B 5IYZA 1QHTA 1WP7A 3ZRSA 2JDIG 3K79A 5IYCO 2QEXV 3FB5C 4TV9A 1FXKC 3JATA 5C8YB 5JVDB 3K04A 1VQ5V 3N2GA 2EIMB 5L3CA 3QTCA 4K35A 2UUAO 1P7BA 1P4RA 2IJJA 1PPJH 1VQ4V 2AXTZ 1Q6IA 3D8CA 3ZBHA 1WN7A 4WFAV 5E79Z 3CRQA 3CD6V 2QE7G 4U3FH 4RO2A 4DR5O 1IXBA 4UCTA 1OZ0A 1EZVH 3CCVV 5KA6A 1M5IA 3D3IA 3IAYA 1XNQO 3ZMVA 1UJWB 3RFRA 3I5DA 4TOIA 4PI0A 2AHYA 1AILA 4PA6A 1JPXA 3T2MA 2CTPA 1RM1B 2XTAA 1QR9A 3ZHRA 4O4IA 2W6IG 2BTQB 3G6BA 1FFXA 5CN0A 4LH7A 4UV8A 1OCCB 1KD1W 3L72H 4W4LA 2CTQA 2IM9A 2Q0OC 3IGAC 4JASA 2Q6AA 4DO2A 1GM8A 2A3QA 4DR6O 1EZJA 3OGCC 4CS2A 2UUCO 4BW5A 1H2KA 2IJHA 3F7YC 2OIGA 4J80A 3WU2Z 2EIKC 1I0HA 3R66A 2PI4A 4ZOLB 4I4TA 5H9CA 1YCIA 4PA9A 2WLMA 5EBWC 2Y4UA 1YJNV 1OV9A 2EIJC 2GHYA 4B3MB 4LFAB 3EVKA 3QF7A 3U10A 1GKFA 5FPRA 4B3RO 1FFTB 3OE7G 2BOCC 2WLLB 4CZZA 3OGIB 1JMKC 3QNEA 2V7QG 4NTWA 2WLIA 5IE9A 1GN4A 3ZMTA 2QR4A 2RMKB 4MVOA 3EFFK 3QO8A 1SZTA 3CRCA 5LA6B 5DM6V 1HNXB 2A79B 4L8JA 1S72V 3E2EA 1JJOA 2YC0A 1Z5WA 2CK3G 3SPIA 4YY3O 3RBZA 1AR5A 4GX0A 3RWRD 5LGNA 4PELA 1IX9A 3LNMB 3TJTA 1VQ9V 1WNSA 4X64B 5BR8O 4PD4F 4NTXA 3CCLV 2ZDIC 2DYSB 2QKCA 3EHBB 4Z1VA 1SQXH 3E8FA 1PNKA 3CJHB 5CBHA 5LGTA 5JVDA 1GH6A 3CPWU 2WLHA 1GM9A 1M4UA 1Q3EA 4ZI7B 4JI4B 2IBZH 1RPRA 3CRMA 2B1GA 5CA1A 4JV5B 1BT8A 3VQWA 3CHXA 4AQYB 4H37A 2WWWA 1M57C 2HFEC 5B1NA 3A0HZ 2QM8A 3SJCC 2UXCB 5IWAB 3ZEDA 5LHGA 2WA3A 3SYOA 1VIBA 3A2FA 4TT3G 4EFBA 1NKDA 5GTHZ 4LFCB 1NS1A 4EEQA 4DV1O 3W7WA 2BTQA 1SQVH 1L0NH 3BFRA 1EM1A 4TSFG 2ZT9B 4JPRA 1V54C 1P7GA 1B06A 3UM7A 1W2BU 1DK1A 1L1FA 4FFBB 1TUBA 3BA8A 2EZPA 1KKCA 3OTOB 1GO3F 3GWKC 3QO5A 1MNGA 2ZIOA 4FLXA 1I94B 4DR6B 2DOSA 1MOFA 5J2TB 5L3BA 4DUZO 2IH3C 1M56B 1PD3A 2UUBB 1NBMG 4ZOLA 1AJNA 4R50A 4ZIBA 3CX5F 3OEEG 1QR8A 2EIMC 1F7YA 2Q68A 1ZWIC 4LCUC 3JCZA 2CH7B 5JQGB 1K8AW 1KYOF 3WB2A 4ZBMA 2XUMA 4DR2O 3D36C 1I5XA 1XNRO 4GZRB 1IBLB 3HKEB 2WLLA 4BWAA 4LWSB 4DV6O 2PYJA 1M93A 4B3RB 5KAIZ 1YEWA 1FKAO 1RM1C 2GUZB 1NH2B 5KMGB 4DK1A 1R3LC 1IBMB 1B3QA 1HWYA 3JAKB 1US6A 1FJGB 4ZKIA 1H38A 3QG5A 1O9GA 3VBBA 3K03A 4UCRA 5KHKA 5IYDO 2CGOA 5B1AB 1QU7A 3JARB 1ENVA 3B4SA 4YY3B 2BSKB 3U11A 1N4CA 4FM2A 5JJEB 2DMXA 1IDSA 3E83A 1QVGU 5KHIA 5FNVB 2LFRA 5B66Z 1THZA 4IIJB 3ETQA 3ZS8C 3WG7B 4QJFB 1WAZA 4MTFA 4PI2A 5K1XA 4K0KO 3ASOB 1K7DA 2HR3A 1Z2GA 1H2GA 4D7SA 4DV0B 2WLNA 4DR4O 4H33A 3AG4C 4PDMA 4PA4A 1N34O 4KUMA 3S3WA 4PHZA 5IT9N 4X89A 3VQYA 4JI7O 1R3JC 3SR2C 1ZAUA 4WF9V 1FXVA 1I5YA 2DQ0A 5LMNB 3JD1A 3B40A 4PDRA 1FAFA 4LF6B 3ICXA 2R9RB 4LF9O 1FPOA 1QQCA 2HKOA 2DJVA 5L3EA 1NR7A 3T1HO 4TV8B 4JI2O 2QWQB 4C7UA 5E1AC 1ZX3A 3BCCH 2F1MA 4ICGA 4J41A 4PDLA 2P22C 4DUZB 2ZQMA 3GB7C 4WFEA 4DR7O 1SQFA 2R9IA 2CH7A 4NXNO 2RNBA 1SRYA 4IHJB 5H5NA 3DC6A 1KU9A 3ABTA 5KAFZ 3HKEA 4DV3O 2AW9A 2YXHA 1OCZC 3L70H 3SGIA 4LWSA 2ZD9A 4ABMA 4DR2B 4I55B 5EYPB 4F6EA 1XNRB 3E22B 5KX5B 4LNUB 4X1KB 3LDEA 1Q43A 1KKDA 2GUZA 4UVCA 1MZFA 2A06H 5IYZB 4DV6B 1VQ8V 4RUFA 3F7VC 3MHHC 3CMAV 4OXSA 5CA3A 3JCUZ 3EXAA 2OIEA 3JAKA 2QKAA 2VRZA 3RYFA 4X62B 2Q8VA 1VF6A 2UXBO 3G71V 4UVBA 1VP7A 3IC9A 4MTOA 3JARA 1Q90D 1Y4MA 1F4NA 2BSKA 3OEHG 2Z5UA 1KQSU 2N05A 3ZJZA 1HR0O 4Q6GA 2A0LA 2DW4A 1M56C 1UPGA 3RYCB 1YDXA 4LP8A 1IBKB 1HW7A 4G28B 3ZHUA 4IIJA 2IJIA 1XHXA 3VQXA 1G8MA 2JS5A 2LO1A 4MTGA 2DE0X 2PYLA 2EZOA 3ABLB 2FKXA 2W6JG 1DGSA 4FPPA 1W0KG 4DRXA 3TETA 1SESA 4JI0O 4K0KB 4KHPO 4JZGA 2YXLA 3L75H 2YEVA 1SA0B 4OPHA 2Q73A 2Q5ZA 4PA3A 1JX9A 2KSDA 4EFEA 1MSWD 3W7UA 1VMGA 2QM4A 3CE2A 4JI5O 1BQZA 1DF5A 3FB6C 4I7ZB 3SPCA 2IW5A 2V1DA 2ITCC 2VWKA 1VF5B 4W4KA 2OT5A 3H1KH 3CEIA 1BS3A 5KHHA 1URFA 5B1AC 1HDJA 1Y6XA 2EX3A 5F2VO 1OHHG 5LL6Y 4TV8A 4N21A 1YI2V 1S77D 5CBGA 3SJBC 1M1KW 4Z2WA 4JI2B 1UFIA 4JAUA 5B3SC 3H01A 4PJ0Z 1R1BA 2JIZG 2ZXWB 2UU9O 4CH4A 4IHJA 3WG7C 1M9NA 5L3FA 1AP5A 2KQXA 3CCMV 4XDLA 3A0RA 2W0XA 4P9OA 4NYKA 3ASOC 4CH5A 2RDCA 4PA7A 2CAZC 1Q82W 2YIDA 4I55A 4JI8O 1H8HG 3E22A 5KX5A 4LNUA 4X1KA 1IXMA 4FJCC 1D5NA 4QNHB 1K4CC 3E89A 3H1JH 2JRIA 1O9HA 4KP4A 5CA0B 4J11A 5TISZ 2ZE6A 3OTFA 3ETEA 2CE4A 4BW9A 2ZM6O 2CTWA 4E4EA 5LOVB 5CA1B 1NTZH 4FVMA 1KC8W 3K5LA 4DV7B 2UXBB 3DXRA 5H6QA 2JEXA 1BHAA 1YZBA 1SETA 1OCRB 1N36O 1Y76B 3JASB 5KUMA 4HZ3A 4LR3A 3RYCA 3L73H 2Y69C 1NTMH 3J81N 3ZHVA 4Z1MG 3RT3C 1BMFG 2NLJC 2YIAA 1HR0B 3CXHF 3I56V 5BXZA 5J9PC 3X2QB 5GTIZ 3ZN0A 4DV4O 3SPGA 2F43G 2P6JA 2X6AA 2KB1A 1MZEA 3K57A 3P3PA 5CB4B 1PL0A 5LMUO 5BZBA 1KUQA 1PNLA 3C3TA 4DK0A 4J9YB 3ZRVA 4U7OA 1GRJA 1V55B 3N27A 1SA0A 3OUFA 1TUBB 1VEWA 3OM3B 1U96A 1XILA 4GX2A 4KHPB 1GN3A 3ZIAG 4DUYO 2E5LO 3FYIB 4B7KA 1B04A 3CRRA 3OD4A 4GUNA 1YTFB 2QWOB 4WFGA 3B09A 2ZCEA 1GM7A 4I5SA 4ASUG 3E8BA 4JYAB 1WJZA 2P4KA 5BMVB 5IJ0B 2Q67A 1XEQA 1N32O 4H13B 4ZHQB 3OR6C 3AK3A 2UXXA 3HKCB 4JYYA 4JGSA 2CUGA 3LSUA 4RAIA 3APOA 5KUKA 4G27B 3ASNC 4OPAA 1WPXA 4B3SO 1ZUQA 4J7JA 1TVKB 1FD9A 2X6BA 4P30A 4NR1A 2F4VO 3ABLC 2W0FC 1N33O 2UU9B 1YJWV 4DV2B 3ABUA 1Y74B 1YVWA 1J5EO 1F51A 5AG2A 3BY6A 2D3OW 4AILC 3BVOA 5CA0A 4JI8B 1WB7A 3MDSA 1HNWO 4J7ZA 4XDKA 1VQOV 1YF2A 5K1PA 1IVSA 4UCUA 1BZKA 4X66O 1Q6HA 4GCZA 5LOVA 3LSSA 5IY5C 3IFXA 1S0VA 4I9WA 1X4TA 1ROPA 4LF7O 1WP8A 2UUAB 3CRAA 1KP3A 1Y76A 2OCCC 3JASA 1NTKH 2XAFA 5D5QA 4DR5B 3RN4A 3CC4V 3SPHA 3ZMSA 2ADQB 4EKWA 4YHHO 4LF5O 1XNQB 3A8TA 2QM7A 5H2FZ 4U7NA 4CC5A 4R8CA 3ABMB 3ABKB 3O9OA 2DQ3A 5CB4A 1COWG 3G6EV 2K1EA 4YJ3B 5LP6B 3QVNA 3K5NA 4FM0A 3AG7A 1KMIZ 2B5UA 2ITDC 1WB8A 2F95B 1AR4A 4X88A 1CEZA 1RPOA 5D5PA 2ZNIA 4BR6A 1YJ9V 4L87A 1AJPA 4X1IB 2UUCB 4GX5A 3T1CA 4FFKA 2Y4TA 1QNMA 3CXCU 5A2QN 2OCHA 4DUYB 2E5LB 2FB5A 5BMVA 2XT9A 5IJ0A 3HB3B 2E74B 2XOKG 4ZHQA 3HKCA 1IZ3A 1OCRC 3AG3B 4MW3A 1TUEB 4LFBO 2X7RB 4CS3A 4JF3A 2EILB 3D3QA 2QWNB 5LHHA 1G4YB 1TVKA 3CC7V 4FLYA 4FLWA 4OX9O 1OCOB 3OAAG 2E76B 4RWUA 1VF7A 4O4LA 2GSMB 3T4ZA 1OCCC 1XMQO 1XHZA 3RYFB 1Y74A 2HVKC 2RCVA 2YI9A 3ZMUA 1FS0G 1V55C 5GW7A 5LGUA 4DV5O 1DF4A 1NT2B 3LDCA 5EC2C 1L0LH 2YS8A 3ZRWA 3L71H 3SYCA 1NQTA 1R3IC 3P32A 2GV9A 4PDVA 2JEUA 5BR8B 1XBLA 4N23A 4B3TO 3AEIA 1K33A 3R65A 1TA8A 4R7CA 3GWOA 5B5EZ 4MT8A 1KECA 4K8XA 3OMNB 2VQEO 4H0LB 4GKKO 3U0ZA 5HFLA 5L3DA 3SYAA 4BIZA 2QTOA 1VQ6V 4LF7B 1SC5B 5EK0A 4KFMA 3ETGA 4DRXB 3OFNG 1BQ0A 1G6UA 2BCCH 2ILMA 2YEVB 2XAJA 4DR1O 4CH3A 4U3JB 2Q7HA 2F93B 3CCSV 4X65O 1YTFD 5LYJB 3E35A 3N2KB 3C90A 1FXHA 2E3CA 4YJ3A 2E75B 2WA4A 5LP6A 4DV1B 1PM9A 2OWOA 2ZR2A 4CBCA 1IURA 4X20B 2R9AA 5JH7B 2ETNA 1VQPV 3BABA 3BHPA 3SPJA 1W0JG 3L9DA 2DYSC 3G4SV 4X1IA 5A9GA 3K9AA 5FLXN 5CBFA 4MTXA 1SQQH 5GONB 2HHHO 2NR5A 1GK9A 4RUEA 1SKVA 4LH6A 3T1YO 1YHQV 1QCEA 1BCCH 2ZE8A 2EULA 3RVYA 4NXMO 4BIOA 1R6NA 2DN9A 1U97A 4WBNB 2JK5C
chains in the Genus database with same CATH topology
2RDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDC A; 
#chains in the Genus database with same CATH topology
 2H8P C;  1PKX A;  4F6R B;  5IJ9 A;  1P84 F;  3P3N A;  3K0G A;  1DLB A;  3BA9 A;  4OGQ B;  4JI1 O;  3G67 A;  4LFB B;  2PI5 A;  1K9M W;  4J9Z B;  3ABM C;  3ABK C;  1H2S B;  4HBN A;  3ZN1 A;  2PUS A;  1AI5 A;  4OX9 B;  3SJA C;  3K58 A;  5LP6 C;  2UXD O;  3CP1 A;  2HJF C;  3JAL B;  2P90 A;  1WLE A;  3FB8 C;  1LUW A;  1N8R W;  2N74 A;  3BPZ A;  1WA8 B;  3OMA B;  2X6C A;  3DXR B;  3LSQ A;  4DV5 B;  4K3A A;  3W7X A;  3FKS G;  3TK1 A;  1A32 A;  4LC1 A;  3CS5 A;  3WB1 A;  3BAA A;  1YIT V;  2IU0 A;  4CS4 A;  1NR1 A;  2JGU A;  1AB3 A;  4I9Q A;  4MVR A;  2LGW A;  4B3T B;  4DR3 O;  2GTA A;  2XAG A;  5CMU A;  2OTJ V;  4EB6 B;  3AG3 C;  4TUY B;  2VQE B;  3CME V;  2Q9L A;  3MHS C;  4U3J A;  4DR4 B;  4B08 A;  1N34 B;  5LYJ A;  2HG5 C;  4DXW A;  4WCE V;  3N2K A;  4X1Y A;  4JI7 B;  1GTO A;  1S5J A;  3C3S A;  3ZCC A;  2XAQ A;  3K5O A;  4JI3 O;  1VF6 C;  2X0L A;  3J80 N;  4X20 A;  1CP9 A;  5JH7 A;  4O4H B;  1Q6U A;  1XOU A;  5LXT B;  3APQ A;  2ARH A;  3DTU B;  2EBO A;  4LF9 B;  3JAM N;  4B7E A;  1FXK A;  3LNN A;  3ETD A;  2Q7G A;  4UUJ C;  2QJ1 A;  5JJN B;  4QPJ A;  5JJJ B;  1HNZ O;  1R6K A;  1F4M A;  3K59 A;  5GON A;  3T1H B;  4B3M O;  4LFA O;  3LDD A;  1NH2 D;  5ITZ B;  2UXN A;  2HHH B;  1M57 B;  3KKY A;  4JTD B;  5EIB C;  2IJK A;  2LW7 A;  4DR7 B;  2NNU A;  3PN1 A;  4NXN B;  1TAE A;  2YDE A;  4WFF A;  1QLE B;  4WBN A;  4GX1 A;  1CXZ B;  1EN6 A;  4F6R A;  2BTO A;  5EZY A;  3A0B Z;  1YIJ V;  4DV3 B;  1HNX O;  1S3J A;  4UFZ A;  2YSU B;  1BSM A;  1JFF A;  5FPO A;  1RSO B;  1AI7 A;  4JI1 B;  1N0N A;  3JSL A;  1AJQ A;  1V54 B;  4X64 O;  1E1Q G;  3JAL A;  3JD4 A;  5J2U B;  3MAQ A;  1G1X B;  5EIB D;  1VQL V;  2IU3 A;  1ORQ C;  4DW1 A;  1WA8 A;  4TWK A;  1EFR G;  2UXD B;  1JR9 A;  1XL6 A;  2P7T C;  2P5O A;  2Q0A A;  1MA1 A;  4JI4 O;  2P4V A;  2C2A A;  1I7F A;  3T4D A;  4JV5 O;  4O2A B;  1XMO O;  1E1R G;  4AQY O;  2WLJ A;  4XDJ A;  4GLX A;  3OT7 A;  1Q8I A;  1AI4 A;  3CB2 A;  4NB5 A;  3UO3 A;  4O4J A;  1R6T A;  2LP7 A;  2OTL V;  2DYR B;  3RVZ A;  2DWD C;  2LJ2 A;  2QWP B;  2UXC O;  2D2C B;  1AR1 B;  4BAY A;  5IWA O;  3CCJ V;  4MVQ A;  1YSC A;  3HKD B;  2VQF O;  4EB6 A;  4DR3 B;  3IJ4 A;  4TUY A;  2ZIM A;  2Z0A A;  4LFC O;  1JCH A;  1AVM A;  4YIO A;  4YIP A;  4FLU A;  1QVF U;  1XRE A;  3JAW B;  5B1B B;  3ZHQ A;  1P49 A;  1EN5 A;  1ZTE A;  4FMT A;  3VQV A;  3FD9 A;  4JI0 B;  3K5M A;  2Y0P A;  1GN6 A;  3FAV B;  2JS3 A;  2GDS A;  3OTO O;  4HAM A;  4IYH A;  3NXS A;  3KCX A;  4UV9 A;  1V9P A;  4JAV A;  4AI8 A;  3THO A;  1I94 O;  4JI5 B;  1B6Q A;  4O4H A;  3W7S A;  4H44 B;  2ZE7 A;  5LXT A;  2UUB O;  2HVJ C;  2ZDI A;  4JI3 B;  1D2D A;  2RQ6 A;  2Z3Y A;  2YIB A;  3HR0 A;  1SER A;  1OJH A;  1KP2 A;  1T5E A;  2WLK A;  3KG2 A;  1K97 A;  4MVM A;  2JJ2 G;  3HKB A;  1VQ7 V;  2R72 A;  2WSS G;  1F23 A;  4J10 A;  2F66 C;  3ZMZ A;  5ITZ A;  2PGG A;  1IBL O;  1HNZ B;  3H1H H;  2AZ2 A;  1XI1 A;  4UXN A;  4IT5 A;  2FTK A;  1XDC A;  3AG4 B;  4FIP C;  4O4L B;  2V4D A;  1GMG A;  5KA5 A;  1IBM O;  1HP8 A;  4I50 B;  2AHZ A;  1TGO A;  1FJG O;  1RSO A;  3W7T A;  2AZ0 A;  1L8D A;  3M99 B;  3ZRW B;  1S5L Z;  3K08 A;  4FZ0 A;  3E86 A;  5H6R A;  4MVS A;  5IYB O;  5KLV H;  3UT5 A;  4PV1 B;  1GAX A;  3UCS C;  5J2U A;  2KG7 A;  1H2L A;  1XUQ A;  3MD0 A;  2ZM6 B;  4MSW C;  5B1O A;  3TXS A;  3TXQ A;  3SDL A;  3NR7 A;  4Q20 A;  4O2A A;  5C8Y A;  5KHG A;  1ZSP A;  2G38 A;  3CC2 V;  1NVP B;  1E79 G;  1S5H C;  1N36 B;  4FZ1 A;  1XMO B;  4HNA B;  4DV0 O;  3UO2 A;  3OUS A;  2ADP A;  2ZXW C;  2H3O A;  3D36 A;  1J95 A;  4IL6 Z;  1D5A A;  1K73 W;  2A7W A;  3TGU H;  3STL C;  2EJ7 A;  3HKD A;  1OCZ B;  1Q81 W;  2M7W A;  4P2Z A;  2XHB A;  1M90 W;  4IGG A;  4DV4 B;  3RW0 A;  2Y48 A;  3H1L H;  1QLE C;  1JVM A;  2YI8 A;  3JAW A;  2VQF B;  5LMU B;  4XBF A;  5C93 A;  5LMN O;  3F5T A;  2QGN A;  4CC6 A;  1H2M A;  2Y0I A;  4X8A A;  4LF6 O;  2YIB D;  2CDY A;  2Q4P A;  3FAV A;  3JD2 A;  3ZX6 A;  1RFY A;  1ZLZ A;  1BGY H;  3Q4H B;  4GT1 A;  5JCO A;  4GKJ O;  4IYI A;  2QSA A;  2PF4 E;  3RYH B;  4FK5 C;  4UCV A;  3CCQ V;  2IH1 C;  2ATK C;  2MW2 B;  3AG2 B;  4QE7 A;  1FYJ A;  1N32 B;  1R3K C;  1SQG A;  2FML A;  2BOB C;  1VQN V;  4MVU A;  2MK3 A;  2CGN A;  5IJ9 B;  4QPK A;  3OMI B;  3UKM A;  3X2Q C;  1S76 D;  2DYR C;  1VQK V;  5IDJ A;  1MAB G;  3PJS K;  4B3S B;  3KZI Z;  5BY1 A;  4I0X B;  4NTY A;  5DEC A;  2JVD A;  2YXY A;  4UCS A;  4FLV A;  2F4V B;  3AG1 B;  1W59 A;  3S3X A;  4I50 A;  5B1B C;  1N33 B;  3JD3 A;  1I08 A;  5LA6 A;  2RJZ A;  3B8M A;  1NJI W;  4X62 O;  3IC7 A;  1J5E B;  5FL7 G;  4WFH A;  2ZIN A;  2LFS A;  2FL4 A;  4UCO A;  2EJR A;  5KHJ A;  1PV0 A;  1AP6 A;  1JJ2 U;  2LW1 A;  2PTM A;  5JCO C;  1HNW B;  1ZL8 B;  4X66 B;  2ODM A;  1IBK O;  1SQP H;  5EBM C;  3OR7 C;  4YXW G;  4JYC A;  3CJH A;  3CCE V;  1NZ6 A;  4J42 A;  5DED A;  4AHC A;  5DN6 G;  2Q7E A;  1QLN A;  2EIN B;  5L3G A;  4J7K A;  4ZI7 A;  3ZHT A;  3K0D A;  4R6Z A;  4QIW F;  3STZ C;  5B3S B;  4E2L A;  2YUA A;  2ZKO A;  4HNA A;  3JD0 A;  4JTC B;  1SQB H;  1SS3 A;  1X59 A;  4LF4 O;  5EBL C;  4DYL A;  2Q69 A;  2HEP A;  1MG1 A;  3F5W C;  4YHH B;  4LF5 B;  2M6Y A;  1Q7Y W;  1K5S A;  3AK1 A;  3H9V A;  4X1Y B;  4JYB A;  2K9P A;  3SYQ A;  4UB6 Z;  3L74 H;  1JA8 A;  4KL1 A;  4RQE A;  4JZ2 A;  3E8H A;  1PL4 A;  2WAM A;  2JJ1 G;  3SJQ C;  1SZX A;  2L35 A;  3K3W A;  1BHB A;  1FXK B;  1Z5V A;  2QA4 V;  4MVZ A;  2JGD B;  3FYE B;  5LHI A;  4YJ2 B;  2B9Z A;  1QBZ A;  3DSQ A;  1SF9 A;  3Q4H A;  2XAH A;  3K9S A;  2AGA A;  4FFB A;  3E8G A;  4O2B B;  4TQF A;  1EN4 A;  3B2E E;  2GTS A;  3RYH A;  4NKG B;  3RGB A;  3LUT B;  2H94 A;  5J2T A;  4GKJ B;  3RYI B;  1K92 A;  2P67 A;  2QDO A;  2Y69 B;  2NN4 A;  3H1I H;  3CCR V;  2ZNJ A;  2PY5 A;  1R73 A;  1N0J A;  3M7M X;  3DC5 A;  4FLT A;  2CTR A;  3CYO A;  2QWR B;  5EZY B;  1K5Q A;  5JQG A;  2HP8 A;  4D6T H;  2LQT A;  4FM1 A;  3FB7 C;  1JFF B;  1AI6 A;  4TQD A;  4KXR A;  4LF8 O;  1K3E A;  2HLD G;  4I0X A;  5HFM A;  4JI6 O;  1MMM A;  3UQ8 A;  2XAS A;  1CPY A;  1H8E G;  4BIU A;  2KKW A;  1PP9 H;  4QE9 A;  1XMQ B;  3B77 A;  4D7T A;  3OW2 U;  4K8Z A;  5KMG A;  3DGE A;  1Y66 A;  4P9P A;  3CSX A;  1EBO A;  2EIK B;  1NVP D;  3VOU A;  4TV9 B;  3JAT B;  3GVM A;  3O65 A;  1VAR A;  4QGP A;  4CH6 A;  3I55 V;  3M8A A;  4DV7 O;  1K4D C;  2YIC A;  3CCU V;  2O57 A;  3N2G B;  5JWP A;  3B8N A;  4LBE C;  2EIJ B;  1DTO A;  3FFQ A;  1ZL8 A;  3BRC A;  4O4J B;  4FLZ A;  2LGQ A;  1Q86 W;  2ZR3 A;  1YXB A;  4X9Q A;  3JYC A;  1K34 A;  3AK2 A;  2RN9 A;  3AG2 C;  5FNV A;  4GKK B;  3ZHS A;  1JQ0 A;  3ASN B;  1ARO P;  4MS2 A;  2N04 A;  2EIL C;  2VWJ A;  1LR1 A;  4UB8 Z;  3BEH A;  2HJD A;  4O4I B;  1LUV A;  3K06 A;  1FFX B;  3CWB H;  1OCO C;  4MW8 A;  4DR1 B;  3JSN A;  1XQ8 A;  2VS0 A;  4LF4 B;  4X65 B;  5LBQ A;  3WB0 A;  4A5U B;  3KCY A;  3FX7 A;  1XL4 A;  1LNQ A;  3AG1 C;  1KBH A;  1Y67 A;  3P30 A;  3ZRX A;  2PZS A;  4JTA B;  2GBO A;  1Q5O A;  1H2N A;  4JYA O;  2JGD A;  2A9H A;  4YJ2 A;  3J7A U;  4GYC B;  4I4T B;  4RQF A;  3HKB B;  3SYP A;  5IY5 B;  1RP3 B;  4O2B A;  1WPB A;  2QKS A;  3ML0 A;  1NU1 H;  2OCC B;  2OYQ A;  3RYI A;  3T1Y B;  1BE3 H;  1JOY A;  1PNM A;  2FYU H;  2R70 A;  2QTS A;  2EIN C;  4JAA A;  3QO7 A;  2WLI B;  4NXM B;  5EC1 C;  2B1I A;  4UVA A;  2P06 A;  1MSD A;  4G2K A;  2BE3 A;  1VQM V;  2DWE C;  2WPD G;  4DV2 O;  4DW0 A;  1NI8 A;  4NVP A;  3HPL C;  3WFV A;  2F23 A;  3G80 A;  1BL8 A;  1KB9 F;  2XND G;  5EYP A;  3UT5 B;  2L6L A;  4LF8 B;  4F4L A;  4WFB V;  1GN2 A;  3TCU A;  4JI6 B;  2ZE5 A;  4HYO A;  2KG7 B;  5IYZ A;  1QHT A;  1WP7 A;  3ZRS A;  2JDI G;  3K79 A;  5IYC O;  2QEX V;  3FB5 C;  4TV9 A;  1FXK C;  3JAT A;  5C8Y B;  5JVD B;  3K04 A;  1VQ5 V;  3N2G A;  2EIM B;  5L3C A;  3QTC A;  4K35 A;  2UUA O;  1P7B A;  1P4R A;  2IJJ A;  1PPJ H;  1VQ4 V;  2AXT Z;  1Q6I A;  3D8C A;  3ZBH A;  1WN7 A;  4WFA V;  5E79 Z;  3CRQ A;  3CD6 V;  2QE7 G;  4U3F H;  4RO2 A;  4DR5 O;  1IXB A;  4UCT A;  1OZ0 A;  1EZV H;  3CCV V;  5KA6 A;  1M5I A;  3D3I A;  3IAY A;  1XNQ O;  3ZMV A;  1UJW B;  3RFR A;  3I5D A;  4TOI A;  4PI0 A;  2AHY A;  1AIL A;  4PA6 A;  1JPX A;  3T2M A;  2CTP A;  1RM1 B;  2XTA A;  1QR9 A;  3ZHR A;  4O4I A;  2W6I G;  2BTQ B;  3G6B A;  1FFX A;  5CN0 A;  4LH7 A;  4UV8 A;  1OCC B;  1KD1 W;  3L72 H;  4W4L A;  2CTQ A;  2IM9 A;  2Q0O C;  3IGA C;  4JAS A;  2Q6A A;  4DO2 A;  1GM8 A;  2A3Q A;  4DR6 O;  1EZJ A;  3OGC C;  4CS2 A;  2UUC O;  4BW5 A;  1H2K A;  2IJH A;  3F7Y C;  2OIG A;  4J80 A;  3WU2 Z;  2EIK C;  1I0H A;  3R66 A;  2PI4 A;  4ZOL B;  4I4T A;  5H9C A;  1YCI A;  4PA9 A;  2WLM A;  5EBW C;  2Y4U A;  1YJN V;  1OV9 A;  2EIJ C;  2GHY A;  4B3M B;  4LFA B;  3EVK A;  3QF7 A;  3U10 A;  1GKF A;  5FPR A;  4B3R O;  1FFT B;  3OE7 G;  2BOC C;  2WLL B;  4CZZ A;  3OGI B;  1JMK C;  3QNE A;  2V7Q G;  4NTW A;  2WLI A;  5IE9 A;  1GN4 A;  3ZMT A;  2QR4 A;  2RMK B;  4MVO A;  3EFF K;  3QO8 A;  1SZT A;  3CRC A;  5LA6 B;  5DM6 V;  1HNX B;  2A79 B;  4L8J A;  1S72 V;  3E2E A;  1JJO A;  2YC0 A;  1Z5W A;  2CK3 G;  3SPI A;  4YY3 O;  3RBZ A;  1AR5 A;  4GX0 A;  3RWR D;  5LGN A;  4PEL A;  1IX9 A;  3LNM B;  3TJT A;  1VQ9 V;  1WNS A;  4X64 B;  5BR8 O;  4PD4 F;  4NTX A;  3CCL V;  2ZDI C;  2DYS B;  2QKC A;  3EHB B;  4Z1V A;  1SQX H;  3E8F A;  1PNK A;  3CJH B;  5CBH A;  5LGT A;  5JVD A;  1GH6 A;  3CPW U;  2WLH A;  1GM9 A;  1M4U A;  1Q3E A;  4ZI7 B;  4JI4 B;  2IBZ H;  1RPR A;  3CRM A;  2B1G A;  5CA1 A;  4JV5 B;  1BT8 A;  3VQW A;  3CHX A;  4AQY B;  4H37 A;  2WWW A;  1M57 C;  2HFE C;  5B1N A;  3A0H Z;  2QM8 A;  3SJC C;  2UXC B;  5IWA B;  3ZED A;  5LHG A;  2WA3 A;  3SYO A;  1VIB A;  3A2F A;  4TT3 G;  4EFB A;  1NKD A;  5GTH Z;  4LFC B;  1NS1 A;  4EEQ A;  4DV1 O;  3W7W A;  2BTQ A;  1SQV H;  1L0N H;  3BFR A;  1EM1 A;  4TSF G;  2ZT9 B;  4JPR A;  1V54 C;  1P7G A;  1B06 A;  3UM7 A;  1W2B U;  1DK1 A;  1L1F A;  4FFB B;  1TUB A;  3BA8 A;  2EZP A;  1KKC A;  3OTO B;  1GO3 F;  3GWK C;  3QO5 A;  1MNG A;  2ZIO A;  4FLX A;  1I94 B;  4DR6 B;  2DOS A;  1MOF A;  5J2T B;  5L3B A;  4DUZ O;  2IH3 C;  1M56 B;  1PD3 A;  2UUB B;  1NBM G;  4ZOL A;  1AJN A;  4R50 A;  4ZIB A;  3CX5 F;  3OEE G;  1QR8 A;  2EIM C;  1F7Y A;  2Q68 A;  1ZWI C;  4LCU C;  3JCZ A;  2CH7 B;  5JQG B;  1K8A W;  1KYO F;  3WB2 A;  4ZBM A;  2XUM A;  4DR2 O;  3D36 C;  1I5X A;  1XNR O;  4GZR B;  1IBL B;  3HKE B;  2WLL A;  4BWA A;  4LWS B;  4DV6 O;  2PYJ A;  1M93 A;  4B3R B;  5KAI Z;  1YEW A;  1FKA O;  1RM1 C;  2GUZ B;  1NH2 B;  5KMG B;  4DK1 A;  1R3L C;  1IBM B;  1B3Q A;  1HWY A;  3JAK B;  1US6 A;  1FJG B;  4ZKI A;  1H38 A;  3QG5 A;  1O9G A;  3VBB A;  3K03 A;  4UCR A;  5KHK A;  5IYD O;  2CGO A;  5B1A B;  1QU7 A;  3JAR B;  1ENV A;  3B4S A;  4YY3 B;  2BSK B;  3U11 A;  1N4C A;  4FM2 A;  5JJE B;  2DMX A;  1IDS A;  3E83 A;  1QVG U;  5KHI A;  5FNV B;  2LFR A;  5B66 Z;  1THZ A;  4IIJ B;  3ETQ A;  3ZS8 C;  3WG7 B;  4QJF B;  1WAZ A;  4MTF A;  4PI2 A;  5K1X A;  4K0K O;  3ASO B;  1K7D A;  2HR3 A;  1Z2G A;  1H2G A;  4D7S A;  4DV0 B;  2WLN A;  4DR4 O;  4H33 A;  3AG4 C;  4PDM A;  4PA4 A;  1N34 O;  4KUM A;  3S3W A;  4PHZ A;  5IT9 N;  4X89 A;  3VQY A;  4JI7 O;  1R3J C;  3SR2 C;  1ZAU A;  4WF9 V;  1FXV A;  1I5Y A;  2DQ0 A;  5LMN B;  3JD1 A;  3B40 A;  4PDR A;  1FAF A;  4LF6 B;  3ICX A;  2R9R B;  4LF9 O;  1FPO A;  1QQC A;  2HKO A;  2DJV A;  5L3E A;  1NR7 A;  3T1H O;  4TV8 B;  4JI2 O;  2QWQ B;  4C7U A;  5E1A C;  1ZX3 A;  3BCC H;  2F1M A;  4ICG A;  4J41 A;  4PDL A;  2P22 C;  4DUZ B;  2ZQM A;  3GB7 C;  4WFE A;  4DR7 O;  1SQF A;  2R9I A;  2CH7 A;  4NXN O;  2RNB A;  1SRY A;  4IHJ B;  5H5N A;  3DC6 A;  1KU9 A;  3ABT A;  5KAF Z;  3HKE A;  4DV3 O;  2AW9 A;  2YXH A;  1OCZ C;  3L70 H;  3SGI A;  4LWS A;  2ZD9 A;  4ABM A;  4DR2 B;  4I55 B;  5EYP B;  4F6E A;  1XNR B;  3E22 B;  5KX5 B;  4LNU B;  4X1K B;  3LDE A;  1Q43 A;  1KKD A;  2GUZ A;  4UVC A;  1MZF A;  2A06 H;  5IYZ B;  4DV6 B;  1VQ8 V;  4RUF A;  3F7V C;  3MHH C;  3CMA V;  4OXS A;  5CA3 A;  3JCU Z;  3EXA A;  2OIE A;  3JAK A;  2QKA A;  2VRZ A;  3RYF A;  4X62 B;  2Q8V A;  1VF6 A;  2UXB O;  3G71 V;  4UVB A;  1VP7 A;  3IC9 A;  4MTO A;  3JAR A;  1Q90 D;  1Y4M A;  1F4N A;  2BSK A;  3OEH G;  2Z5U A;  1KQS U;  2N05 A;  3ZJZ A;  1HR0 O;  4Q6G A;  2A0L A;  2DW4 A;  1M56 C;  1UPG A;  3RYC B;  1YDX A;  4LP8 A;  1IBK B;  1HW7 A;  4G28 B;  3ZHU A;  4IIJ A;  2IJI A;  1XHX A;  3VQX A;  1G8M A;  2JS5 A;  2LO1 A;  4MTG A;  2DE0 X;  2PYL A;  2EZO A;  3ABL B;  2FKX A;  2W6J G;  1DGS A;  4FPP A;  1W0K G;  4DRX A;  3TET A;  1SES A;  4JI0 O;  4K0K B;  4KHP O;  4JZG A;  2YXL A;  3L75 H;  2YEV A;  1SA0 B;  4OPH A;  2Q73 A;  2Q5Z A;  4PA3 A;  1JX9 A;  2KSD A;  4EFE A;  1MSW D;  3W7U A;  1VMG A;  2QM4 A;  3CE2 A;  4JI5 O;  1BQZ A;  1DF5 A;  3FB6 C;  4I7Z B;  3SPC A;  2IW5 A;  2V1D A;  2ITC C;  2VWK A;  1VF5 B;  4W4K A;  2OT5 A;  3H1K H;  3CEI A;  1BS3 A;  5KHH A;  1URF A;  5B1A C;  1HDJ A;  1Y6X A;  2EX3 A;  5F2V O;  1OHH G;  5LL6 Y;  4TV8 A;  4N21 A;  1YI2 V;  1S77 D;  5CBG A;  3SJB C;  1M1K W;  4Z2W A;  4JI2 B;  1UFI A;  4JAU A;  5B3S C;  3H01 A;  4PJ0 Z;  1R1B A;  2JIZ G;  2ZXW B;  2UU9 O;  4CH4 A;  4IHJ A;  3WG7 C;  1M9N A;  5L3F A;  1AP5 A;  2KQX A;  3CCM V;  4XDL A;  3A0R A;  2W0X A;  4P9O A;  4NYK A;  3ASO C;  4CH5 A;  2RDC A;  4PA7 A;  2CAZ C;  1Q82 W;  2YID A;  4I55 A;  4JI8 O;  1H8H G;  3E22 A;  5KX5 A;  4LNU A;  4X1K A;  1IXM A;  4FJC C;  1D5N A;  4QNH B;  1K4C C;  3E89 A;  3H1J H;  2JRI A;  1O9H A;  4KP4 A;  5CA0 B;  4J11 A;  5TIS Z;  2ZE6 A;  3OTF A;  3ETE A;  2CE4 A;  4BW9 A;  2ZM6 O;  2CTW A;  4E4E A;  5LOV B;  5CA1 B;  1NTZ H;  4FVM A;  1KC8 W;  3K5L A;  4DV7 B;  2UXB B;  3DXR A;  5H6Q A;  2JEX A;  1BHA A;  1YZB A;  1SET A;  1OCR B;  1N36 O;  1Y76 B;  3JAS B;  5KUM A;  4HZ3 A;  4LR3 A;  3RYC A;  3L73 H;  2Y69 C;  1NTM H;  3J81 N;  3ZHV A;  4Z1M G;  3RT3 C;  1BMF G;  2NLJ C;  2YIA A;  1HR0 B;  3CXH F;  3I56 V;  5BXZ A;  5J9P C;  3X2Q B;  5GTI Z;  3ZN0 A;  4DV4 O;  3SPG A;  2F43 G;  2P6J A;  2X6A A;  2KB1 A;  1MZE A;  3K57 A;  3P3P A;  5CB4 B;  1PL0 A;  5LMU O;  5BZB A;  1KUQ A;  1PNL A;  3C3T A;  4DK0 A;  4J9Y B;  3ZRV A;  4U7O A;  1GRJ A;  1V55 B;  3N27 A;  1SA0 A;  3OUF A;  1TUB B;  1VEW A;  3OM3 B;  1U96 A;  1XIL A;  4GX2 A;  4KHP B;  1GN3 A;  3ZIA G;  4DUY O;  2E5L O;  3FYI B;  4B7K A;  1B04 A;  3CRR A;  3OD4 A;  4GUN A;  1YTF B;  2QWO B;  4WFG A;  3B09 A;  2ZCE A;  1GM7 A;  4I5S A;  4ASU G;  3E8B A;  4JYA B;  1WJZ A;  2P4K A;  5BMV B;  5IJ0 B;  2Q67 A;  1XEQ A;  1N32 O;  4H13 B;  4ZHQ B;  3OR6 C;  3AK3 A;  2UXX A;  3HKC B;  4JYY A;  4JGS A;  2CUG A;  3LSU A;  4RAI A;  3APO A;  5KUK A;  4G27 B;  3ASN C;  4OPA A;  1WPX A;  4B3S O;  1ZUQ A;  4J7J A;  1TVK B;  1FD9 A;  2X6B A;  4P30 A;  4NR1 A;  2F4V O;  3ABL C;  2W0F C;  1N33 O;  2UU9 B;  1YJW V;  4DV2 B;  3ABU A;  1Y74 B;  1YVW A;  1J5E O;  1F51 A;  5AG2 A;  3BY6 A;  2D3O W;  4AIL C;  3BVO A;  5CA0 A;  4JI8 B;  1WB7 A;  3MDS A;  1HNW O;  4J7Z A;  4XDK A;  1VQO V;  1YF2 A;  5K1P A;  1IVS A;  4UCU A;  1BZK A;  4X66 O;  1Q6H A;  4GCZ A;  5LOV A;  3LSS A;  5IY5 C;  3IFX A;  1S0V A;  4I9W A;  1X4T A;  1ROP A;  4LF7 O;  1WP8 A;  2UUA B;  3CRA A;  1KP3 A;  1Y76 A;  2OCC C;  3JAS A;  1NTK H;  2XAF A;  5D5Q A;  4DR5 B;  3RN4 A;  3CC4 V;  3SPH A;  3ZMS A;  2ADQ B;  4EKW A;  4YHH O;  4LF5 O;  1XNQ B;  3A8T A;  2QM7 A;  5H2F Z;  4U7N A;  4CC5 A;  4R8C A;  3ABM B;  3ABK B;  3O9O A;  2DQ3 A;  5CB4 A;  1COW G;  3G6E V;  2K1E A;  4YJ3 B;  5LP6 B;  3QVN A;  3K5N A;  4FM0 A;  3AG7 A;  1KMI Z;  2B5U A;  2ITD C;  1WB8 A;  2F95 B;  1AR4 A;  4X88 A;  1CEZ A;  1RPO A;  5D5P A;  2ZNI A;  4BR6 A;  1YJ9 V;  4L87 A;  1AJP A;  4X1I B;  2UUC B;  4GX5 A;  3T1C A;  4FFK A;  2Y4T A;  1QNM A;  3CXC U;  5A2Q N;  2OCH A;  4DUY B;  2E5L B;  2FB5 A;  5BMV A;  2XT9 A;  5IJ0 A;  3HB3 B;  2E74 B;  2XOK G;  4ZHQ A;  3HKC A;  1IZ3 A;  1OCR C;  3AG3 B;  4MW3 A;  1TUE B;  4LFB O;  2X7R B;  4CS3 A;  4JF3 A;  2EIL B;  3D3Q A;  2QWN B;  5LHH A;  1G4Y B;  1TVK A;  3CC7 V;  4FLY A;  4FLW A;  4OX9 O;  1OCO B;  3OAA G;  2E76 B;  4RWU A;  1VF7 A;  4O4L A;  2GSM B;  3T4Z A;  1OCC C;  1XMQ O;  1XHZ A;  3RYF B;  1Y74 A;  2HVK C;  2RCV A;  2YI9 A;  3ZMU A;  1FS0 G;  1V55 C;  5GW7 A;  5LGU A;  4DV5 O;  1DF4 A;  1NT2 B;  3LDC A;  5EC2 C;  1L0L H;  2YS8 A;  3ZRW A;  3L71 H;  3SYC A;  1NQT A;  1R3I C;  3P32 A;  2GV9 A;  4PDV A;  2JEU A;  5BR8 B;  1XBL A;  4N23 A;  4B3T O;  3AEI A;  1K33 A;  3R65 A;  1TA8 A;  4R7C A;  3GWO A;  5B5E Z;  4MT8 A;  1KEC A;  4K8X A;  3OMN B;  2VQE O;  4H0L B;  4GKK O;  3U0Z A;  5HFL A;  5L3D A;  3SYA A;  4BIZ A;  2QTO A;  1VQ6 V;  4LF7 B;  1SC5 B;  5EK0 A;  4KFM A;  3ETG A;  4DRX B;  3OFN G;  1BQ0 A;  1G6U A;  2BCC H;  2ILM A;  2YEV B;  2XAJ A;  4DR1 O;  4CH3 A;  4U3J B;  2Q7H A;  2F93 B;  3CCS V;  4X65 O;  1YTF D;  5LYJ B;  3E35 A;  3N2K B;  3C90 A;  1FXH A;  2E3C A;  4YJ3 A;  2E75 B;  2WA4 A;  5LP6 A;  4DV1 B;  1PM9 A;  2OWO A;  2ZR2 A;  4CBC A;  1IUR A;  4X20 B;  2R9A A;  5JH7 B;  2ETN A;  1VQP V;  3BAB A;  3BHP A;  3SPJ A;  1W0J G;  3L9D A;  2DYS C;  3G4S V;  4X1I A;  5A9G A;  3K9A A;  5FLX N;  5CBF A;  4MTX A;  1SQQ H;  5GON B;  2HHH O;  2NR5 A;  1GK9 A;  4RUE A;  1SKV A;  4LH6 A;  3T1Y O;  1YHQ V;  1QCE A;  1BCC H;  2ZE8 A;  2EUL A;  3RVY A;  4NXM O;  4BIO A;  1R6N A;  2DN9 A;  1U97 A;  4WBN B;  2JK5 C; 
#chains in the Genus database with same CATH homology
 2RDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...