2RDCA

Crystal structure of a putative lipid binding protein (gsu0061) from geobacter sulfurreducens pca at 1.80 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
133
structure length
133
Chain Sequence
ETTMGRYKKVIEITGHDEVAAKLLEGLIDAGTRYFSKVVEMEHRMASARFRLDGEELRELTETLDRSRRLAHESLISSLHVFNRYIVKEYGEELKEAGIEGGIFPKPEANRDRIAIADWAGELLTGIYENRHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords Uncharacterized protein
publication title Crystal structure of protein of unknown function (NP_951123.1) from Geobacter sulfurreducens at 1.80 A resolution
rcsb
source organism Geobacter sulfurreducens pca
total genus 47
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11554 DUF3232 Protein of unknown function (DUF3232)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.800 Mainly Alpha Orthogonal Bundle Helix Hairpins protein ne1242 2rdcA00
2RDCA
chains in the Genus database with same CATH superfamily
4QGPA 4X20B 1NQTA 3PN1A 2P06A 4LC1A 4DO2A 5JJNB 3STLC 2A0LA 3CWBH 4BR6A 4B3RB 1E1QG 3QG5A 4RAIA 2WLNA 4JI8O 4LF8B 5JQGA 4B3RO 2GTAA 1EM1A 3N2KA 4P9OA 1M5IA 4FFKA 2IBZH 3MAQA 4MVQA 1H2SB 2LFSA 3AG1B 4O4LA 1R3KC 2LFRA 3JAWA 4AI8A 1GM7A 1W0JG 3CE2A 5IDJA 3ABKC 4BW9A 2VQFO 4IL6Z 1XHXA 2CDYA 2AHZA 3UT5B 3CCSV 5CB4B 2G38A 2ATKC 5CBFA 3WG7C 3VQWA 3ZCCA 1YIJV 1SA0A 4PD4F 4DV2O 2Q0AA 4XDJA 3VQYA 1EN6A 4CBCA 4MVOA 2UU9O 4X65O 4J41A 1MMMA 3IAYA 4UFZA 2Y69B 5A2QN 1PKXA 3KZIZ 5LHIA 2BTOA 2YDEA 2WWWA 4R50A 3ASNB 1PL0A 4DV7O 5LXTA 1NZ6A 5LHGA 4DUZO 5KA5A 3ABTA 1COWG 4QPJA 1AI5A 4GKKO 1YXBA 4ZOLB 4DV0O 5IYCO 4XDKA 3CS5A 4DR2B 2V1DA 5C93A 4FM1A 1YITV 2ZNJA 2QKAA 1KECA 4FMTA 5BZBA 4LFAB 2P67A 2YXHA 5GTHZ 5BMVA 4GLXA 3L71H 2EIMB 1XUQA 2F93B 2RJZA 4DV3O 2AXTZ 1IURA 1N32B 5KHKA 4QJFB 4ZI7A 2EIJC 3OUSA 4FIPC 5EZYB 1JPXA 4RWUA 4MTGA 4WCEV 1Y4MA 3JYCA 3D3IA 4LF5B 4G28B 3BEHA 2WLJA 3OMAB 3SYOA 3F7YC 4LF5O 4TV8B 1RM1C 1YTFB 1V9PA 2AHYA 3SJCC 4PA4A 5IJ9B 1GN2A 3ABMB 4X9QA 3HKDB 1TUBA 4MTXA 3B09A 4BWAA 3VOUA 1B6QA 1T5EA 1B06A 2PYJA 4HNAB 2KG7A 4DV1B 2NN4A 2E5LB 1IBMB 1QU7A 3JD4A 1CXZB 5EBLC 3P30A 3BHPA 3WB0A 4Q6GA 4A5UB 1R6NA 4DR1O 1KUQA 2Q5ZA 3LSSA 1S5HC 4YIPA 2F23A 1BHBA 1US6A 2GSMB 4LF6O 4JYYA 4FPPA 1HNZO 1ORQC 3WB1A 3E2EA 2LW7A 1SRYA 4PJ0Z 3KG2A 1QHTA 4WFFA 3RVYA 4DR5B 1AJNA 4UXNA 1VQ6V 3RYHB 4YJ3B 4UB8Z 1CEZA 4LFCB 5EYPA 4FVMA 2H94A 3JD3A 1SZTA 3IGAC 3ZS8C 3JAMN 1VEWA 2UUCB 3WB2A 1IZ3A 2P90A 5CA3A 1K3EA 2L6LA 1NH2B 3CD6V 4RUFA 1DF5A 1QVGU 3RFRA 2V7QG 4KL1A 4X1KA 4X8AA 3SR2C 1XL6A 3E86A 2EIJB 3UO3A 2HVKC 1L8DA 1Q90D 4JTAB 1XNQO 2OTJV 2ZIMA 5GONA 1SA0B 5CA0B 1H8EG 3CPWU 4JV5B 3K57A 1SS3A 2HHHO 2JEUA 4ZHQA 3HKCB 4JI5B 3ZRVA 1ENVA 1NJIW 5HFLA 3SPJA 2VWJA 4JV5O 2ZXWB 1P49A 4H33A 2WLKA 4CH4A 5JCOC 3AG3C 5CA1B 1DK1A 1WA8A 2RQ6A 1FFXA 3UCSC 1YJWV 4TT3G 5LXTB 3S3XA 1NR7A 5LP6A 1S72V 4JTCB 3G6EV 2A79B 2XAQA 2KQXA 1JCHA 2W0FC 4LP8A 3LNNA 3WFVA 3H01A 1BE3H 4RUEA 1ZX3A 3L75H 1IXMA 2P7TC 4ZI7B 1HP8A 4I0XA 4E4EA 3EVKA 2X6AA 3CX5F 4DR7B 2IU3A 1TVKA 2EULA 5LOVB 4PDRA 2ZCEA 4B3SB 4JZ2A 2QEXV 3H1HH 3E8BA 2Q0OC 1H38A 3T1HO 1MNGA 2ETNA 3CJHA 4X1IB 1GM9A 2EZPA 1NTZH 3K5MA 2X0LA 1RPOA 5L3FA 5FL7G 3ML0A 5KUKA 2ITCC 3CCMV 2YXYA 3WU2Z 4PV1B 5EC2C 4LH6A 5LMNO 4JASA 3NR7A 5IJ0A 5KHJA 1M93A 1S77D 1TUBB 1WNSA 2CE4A 3K9SA 3OEEG 3T1CA 1F4NA 3OUFA 4O4IA 2HG5C 4MW8A 4O4JA 3CP1A 3CRAA 3QO7A 4CS4A 5L3EA 3RN4A 5DEDA 4W4LA 2OIGA 4FLYA 1AR5A 1JFFA 4ZIBA 4JAVA 4JYCA 4QIWF 1N4CA 5KX5A 1NVPD 3JCUZ 5L3DA 3MD0A 3F7VC 1MZEA 3OD4A 2QWOB 3P32A 3K06A 2Y4UA 3QF7A 3D8CA 4LFBO 4BIOA 2CH7A 4GKJB 3ETEA 1KQSU 3VQXA 4I50A 4YXWG 2Q9LA 2DWEC 2Z5UA 4PELA 4KUMA 2LP7A 3ZMUA 5JJEB 1X59A 4RO2A 1K97A 1SESA 4PHZA 3JAKB 5JVDA 3RW0A 1GN3A 2ZDIA 4JI4B 3B8NA 1Y76B 4WFGA 4AQYB 3JARB 1KYOF 4I9WA 2QGNA 3W7XA 1BQ0A 4PDLA 4MVRA 2EBOA 2Z3YA 5GONB 3RYFA 3CCQV 4P2ZA 2PTMA 1R3JC 4TWKA 2D3OW 1LNQA 1DTOA 5IYDO 3HKBA 1IBLO 1VQMV 1Q82W 5JH7A 5KHGA 1M4UA 4B3MB 4J7KA 1WA8B 2YI9A 1PP9H 1N34B 4BIZA 2IJKA 3HKEB 1N34O 2UXBB 4AHCA 2BE3A 1AJQA 1XL4A 4GX5A 4JAUA 1L0NH 4UCSA 2HVJC 2HEPA 2DQ0A 3K79A 5J2UB 2IH3C 4NR1A 3FKSG 4IT5A 1RFYA 4DR4B 2HLDG 1ZL8A 3FB7C 4DR6O 1YJNV 2BTQB 4JTDB 3LDDA 4L87A 2R72A 3K0GA 4H13B 4TQDA 1WPXA 1XILA 1DLBA 2AZ2A 2WA3A 1FJGO 1Y67A 2Y48A 1Q7YW 3JD1A 4J9YB 4DV4O 4IHJB 3RYIB 4MT8A 3N2GA 4FLZA 1J5EB 3O9OA 4TSFG 4DRXB 2QTSA 1KC8W 2Y69C 4JI6B 1NT2B 3ZRSA 4DW0A 3CXHF 2QM7A 4UV9A 1R73A 2KSDA 1VQ7V 4DR3B 1FS0G 4EB6A 1YEWA 4FFBA 4EFEA 1Y74B 1D5AA 4DK1A 2EJ7A 1QCEA 1N36B 4NVPA 2VQEB 1SKVA 1QNMA 4KP4A 3SJAC 1PPJH 4J9ZB 4JYBA 1HR0B 2VQEO 5LA6B 4OX9B 4JYAB 4J7ZA 2ITDC 3OMNB 5KHIA 1KU9A 1R6TA 4OX9O 1H2NA 4CC5A 2EINC 3A0RA 1S0VA 3T4DA 3CMEV 1B04A 2DW4A 1WAZA 3FB5C 2Q6AA 5KHHA 2WLLA 3H1LH 1XMOB 4JI0B 3B77A 4UVBA 1JMKC 3JCZA 4J42A 1ZSPA 2YIBD 4LF8O 4NXNB 3K5OA 3ETQA 4I4TA 5IYZA 4NXNO 3E22A 5H9CA 2Y0IA 3ABMC 4YJ2B 3JASA 5JVDB 3AG4C 5LMUB 2A9HA 3J80N 1VQPV 1H8HG 1HW7A 1K34A 1UJWB 2JJ1G 2W0XA 1YVWA 4TV9B 1VMGA 2K1EA 1M9NA 4X62B 4LF4B 4CS2A 1G6UA 3RYFB 5J2TB 2UUBB 4U3JA 4PDMA 4MVMA 1I94B 1FXHA 4CC6A 3K0DA 3W7UA 4E2LA 1YTFD 1PNLA 4J10A 1SC5B 2O57A 1OV9A 3CCRV 2UUAB 1OJHA 3A0BZ 2MK3A 5FNVA 3G71V 3LSUA 1WP7A 2QWRB 1V54C 3O65A 2RDCA 5BXZA 4CS3A 2W6JG 4MSWC 1YZBA 3L73H 2RCVA 5B3SB 2Q7EA 3T4ZA 2F66C 4GYCB 3K9AA 3ZEDA 3A0HZ 1V55C 3SPCA 3U11A 4JI7B 1SQBH 4I55B 3Q4HA 3ZRWB 2A7WA 4DR2O 3T1YB 2EINB 2IJHA 4P9PA 2OIEA 3BY6A 5LYJB 1BS3A 1SERA 1NI8A 3CCVV 4LFAO 1XQ8A 3M7MX 4JPRA 2B1GA 3K03A 2XHBA 2XUMA 4DYLA 1OHHG 2QKCA 2BSKA 3BABA 2BOBC 4B7EA 1N32O 3OW2U 4I5SA 2AZ0A 1M57B 4IIJB 2JGDA 2QA4V 5FPOA 2CTRA 4FLUA 3BRCA 1NH2D 2F95B 2ZXWC 2PUSA 4LNUB 3DXRB 1S3JA 3IC7A 4Z1VA 1OCZB 2ADPA 3OAAG 3AEIA 1S5LZ 3AG4B 3APQA 2UXXA 5HFMA 2GTSA 3NXSA 2UXDB 2ODMA 2ZNIA 5IY5B 2UXDO 2H3OA 3IJ4A 2A3QA 2F1MA 2NLJC 3QVNA 4F6EA 5J9PC 2HJFC 4DV1O 1K73W 2JS3A 2E5LO 4PA3A 3JSNA 3ZBHA 1IBMO 4YY3B 4UCOA 4NTWA 5ITZA 2H8PC 2CK3G 2HR3A 1V54B 1ZAUA 1G1XB 2ZQMA 1J95A 4JI1B 3A8TA 3M8AA 3B4SA 1E79G 4FK5C 1I08A 5JQGB 2OWOA 4WBNA 1MG1A 1XREA 3SYCA 3N2KB 2DMXA 2DYRC 4DR5O 3ZN1A 1V55B 2ZT9B 3OEHG 1VQ9V 5C8YA 4F4LA 5JCOA 5IYZB 4UB6Z 4LFCO 3SPIA 4F6RA 4O4LB 1XNRB 1FXKA 4O2BA 3KCYA 1M56B 2UUCO 2QSAA 3JAWB 2Q8VA 1GH6A 3ZMTA 4WFHA 2HFEC 4KFMA 3LDCA 4X1YA 2R9IA 4DV5B 2QKSA 3ZHTA 3SJBC 3K5NA 1D2DA 3ZHSA 2A06H 4O4HA 4K8ZA 3R65A 1IBKB 1EZVH 3AG2B 3LDEA 2B9ZA 5GW7A 1KD1W 5CBGA 2CTQA 1XMQB 4Z1MG 4GCZA 3FAVA 1VF6C 4R7CA 2GUZA 1GMGA 1MOFA 2F43G 3ZHRA 1HNWB 2JRIA 5DN6G 1PL4A 2Q67A 4UCTA 1L1FA 1SQPH 3SPGA 4K35A 2E75B 3ZN0A 1KBHA 4U7NA 4JI5O 3GB7C 4WFBV 3A2FA 4UCVA 3APOA 4X64B 4DK0A 1GN6A 3ASOC 3UKMA 2JVDA 4EEQA 2L35A 2YUAA 1Q6UA 1QLEB 3CCJV 1NS1A 4G2KA 1RSOA 2E76B 3OGCC 1BHAA 2JK5C 2WLHA 2ZM6B 3G67A 2Q69A 2YXLA 3RWRD 4GX2A 5BMVB 4O2AA 1YCIA 3B8MA 3TCUA 2DYSB 2EZOA 3M99B 1UPGA 1L0LH 2ZE5A 1GO3F 3I5DA 4AILC 1Z5VA 4HZ3A 4DR7O 3SYAA 2XASA 4FLWA 2WAMA 3CCLV 5B1OA 4B3SO 2JDIG 5KLVH 3H1JH 3RYCA 2XAJA 2PZSA 1OCOB 1HNXB 2DYRB 3JALA 1R3IC 1N8RW 4LF9B 4GZRB 1MA1A 1KB9F 3ZHVA 1KP3A 2YICA 4DV6B 3KCXA 1QBZA 3X2QB 3W7TA 4ASUG 2KG7B 3MDSA 4XDLA 3SYPA 1SQFA 1QR8A 3K58A 2IJIA 2YEVA 1XHZA 2ARHA 3JATA 1ZTEA 1I5XA 3H1KH 4J11A 4LWSA 2CAZC 1LR1A 2R9AA 4UVAA 4JI3B 2W6IG 2WLMA 2Y0PA 5KAFZ 1I5YA 2GBOA 1F4MA 4NXMB 2QR4A 3FD9A 3LSQA 3ASOB 4EFBA 1NTKH 3OTOB 4TUYA 2NNUA 1VQKV 3UM7A 4WFEA 5EYPB 3OFNG 1VQ4V 3OGIB 5LHHA 4B3TB 4FLVA 1I7FA 4TQFA 4GKJO 1MZFA 1G4YB 4L8JA 4X20A 3OE7G 4FM0A 1FXKB 4O2BB 5LBQA 2P4KA 1X4TA 4FZ1A 4JI2B 3BPZA 2GHYA 1PM9A 1KKCA 1K5SA 1G8MA 1VQNV 4FZ0A 4X1KB 3E8HA 4YIOA 5TISZ 2M6YA 3E8FA 1Q86W 1QLNA 4O4HB 2DWDC 4JI4O 1QVFU 1JX9A 2ZE8A 4AQYO 3IFXA 1QR9A 2EIKB 3MHSC 1AP5A 3W7WA 1TUEB 2FKXA 1NU1H 1RPRA 2WSSG 3K08A 4ZHQB 5B1AB 3SGIA 3OTFA 2IM9A 1K4CC 1MSDA 2YI8A 4BW5A 2B5UA 1EFRG 1FFXB 5DM6V 4B3MO 4CH6A 3UT5A 5CB4A 5LP6B 5EIBC 4H0LB 3RT3C 3SJQC 3JD0A 1GRJA 2RN9A 3BAAA 3SPHA 2X7RB 1YF2A 5JWPA 2UXBO 4QE7A 4YHHB 3CCEV 1E1RG 1VIBA 2UXCB 2AGAA 2F4VB 3CC4V 1FD9A 2GDSA 1W0KG 2F4VO 3EFFK 4I0XB 5EIBD 1TVKB 3J7AU 4DR4O 1AR4A 1BT8A 2ZINA 5B1BC 1H2MA 4ZOLA 3CJHB 4MS2A 3J81N 2Q7HA 4K3AA 3BA8A 2ZR3A 1OCRB 2Y4TA 3T2MA 2YIBA 1PNMA 4R6ZA 2DQ3A 1QQCA 2C2AA 5IJ0B 1J5EO 2RMKB 3RVZA 3C3TA 4GUNA 3CC7V 3FB6C 4JI6O 5B3SC 1VQLV 1P7BA 5B1NA 5EZYA 3OR7C 1SETA 3DTUB 4O4IB 1N0NA 2LO1A 2HP8A 1XI1A 4O4JB 1R3LC 4DR3O 4H44B 1EBOA 2YEVB 2WLIA 3JATB 4TV8A 1Y66A 1N36O 1AR1B 5IJ9A 4LWSB 2CGNA 4OGQB 1JJOA 5EBWC 1HR0O 1DGSA 2P6JA 2LQTA 4JYAO 1JFFB 1OZ0A 5BY1A 2XTAA 1RP3B 5KX5B 5KMGA 2GV9A 4RQEA 4HNAA 3VQVA 1BMFG 4CH5A 1JQ0A 1AP6A 2HKOA 2IW5A 5AG2A 2ZE6A 1M57C 1NKDA 2CH7B 4J7JA 1WB8A 4I50B 3AG7A 2YC0A 1Q3EA 1M1KW 1XMOO 4JI0O 2HJDA 3CRCA 2OCCC 3G4SV 3QTCA 1WB7A 2PGGA 1OCCC 1OCZC 2OCHA 2QDOA 3ZJZA 3D36C 4JI8B 2QE7G 4IYHA 1Q6HA 4JAAA 5LMUO 4GT1A 1GAXA 4CZZA 3RYHA 4YJ3A 1AILA 3BA9A 3ABLB 4FJCC 5B1BB 3TGUH 5IY5C 4G27B 3JD2A 4X62O 4LF4O 4DXWA 2UUBO 1IDSA 3HKBB 1U96A 2IU0A 2N05A 1I94O 5JH7B 2CUGA 2Z0AA 3VBBA 5B66Z 5LGTA 2VQFB 5H6RA 1FFTB 1Y6XA 3MHHC 2B1IA 2UUAO 5IT9N 2FMLA 1IVSA 4DV2B 4QE9A 3SYQA 4K0KB 2UU9B 4X65B 2XAFA 5CA0A 2MW2B 1MABG 4XBFA 4K0KO 4JZGA 2K9PA 3UO2A 2QWQB 3HKCA 5L3CA 1F7YA 4UUJC 1XEQA 1P4RA 1K4DC 1NTMH 5CA1A 2EJRA 1A32A 4JI7O 4B08A 4DV7B 1WJZA 5K1PA 3EHBB 4DUZB 5D5QA 2QWNB 4QPKA 3HR0A 2XNDG 3H9VA 1M56C 2QM4A 1ZL8B 4GKKB 3C3SA 4DV0B 1H2KA 3T1YO 4WFAV 2QM8A 1K9MW 2YIDA 3TXQA 3AG2C 1P84F 5FLXN 2YS8A 2JGUA 3E89A 3N2GB 4DV3B 4FLXA 4NTXA 5E79Z 1SQVH 3ZRXA 4CH3A 1R6KA 2JS5A 2OCCB 2VS0A 4NB5A 3TJTA 1EN5A 2KKWA 1TA8A 1OCCB 4NKGB 5LOVA 2DN9A 3STZC 2QWPB 4BIUA 4EB6B 4X1IA 4FFBB 3FYEB 2DE0X 3HB3B 3N27A 5CMUA 3F5TA 1QLEC 2WLIB 5IWAB 4D7SA 3CHXA 5D5PA 4U7OA 5IWAO 1M90W 1AI7A 1K5QA 2NR5A 5K1XA 1K92A 3L72H 4KHPB 1VARA 1S5JA 3FX7A 4FM2A 3ABKB 3DC6A 5KMGB 2DYSC 4KHPO 1SF9A 5KAIZ 1JJ2U 4YY3O 3E83A 4OPAA 4TOIA 2IJJA 2LGQA 2WLLB 1O9HA 3WG7B 3B40A 1VF6A 4JI1O 1JR9A 3CB2A 4GX0A 1AI6A 4DR1B 1IX9A 2ZR2A 1VQ8V 2X6BA 1YSCA 4ABMA 5EBMC 4HYOA 1OCOC 1WP8A 4LF6B 2WA4A 1HNZB 1S76D 5A9GA 4I4TB 3E22B 2RNBA 3JASB 3TETA 4W4KA 1THZA 4ICGA 1H2GA 2FTKA 2PY5A 1XNRO 3OM3B 5JJJB 1UFIA 3ZX6A 4MVZA 3X2QC 2P22C 3ZMVA 4U3JB 5FPRA 5H5NA 1BGYH 1EN4A 4DV5O 3HPLC 2IH1C 2D2CB 3K04A 3BVOA 4C7UA 1IBKO 1FKAO 2Q68A 1FXVA 5CBHA 4D6TH 1XMQO 5FNVB 3JAKA 4MW3A 4X89A 2PI4A 1HNWO 1PV0A 1Y76A 3JARA 1XNQB 5LL6Y 4JF3A 1B3QA 1VF5B 1GK9A 2P5OA 4N23A 2ADQB 2ZE7A 1AJPA 1GKFA 4Z2WA 2HHHB 2XOKG 2BCCH 3CEIA 4X64O 3I55V 3AK1A 3AK3A 4PA6A 4K8XA 1URFA 1YJ9V 3L9DA 1RM1B 3H1IH 2OYQA 1O9GA 2AW9A 3Q4HB 1FXKC 1W59A 3CRRA 1CPYA 1FAFA 1AB3A 3F5WC 3QNEA 5B5EZ 5EC1C 3K59A 4LF7B 1R1BA 2ZM6O 3HKEA 4JGSA 4FLTA 5GTIZ 3ZHQA 3C90A 4LF7O 1JVMA 2BSKB 4P30A 1IXBA 4UV8A 1VF7A 2EIKC 5IE9A 3DSQA 3CMAV 3KKYA 5DECA 5J2UA 3W7SA 2JGDB 5B1AC 1PNKA 3CSXA 3FYIB 1KP2A 3FFQA 2VRZA 2BTQA 1HNXO 1GN4A 3LNMB 1K7DA 4UCUA 4EKWA 3T1HB 4LF9O 3GWOA 4PDVA 3E8GA 1TAEA 3CRMA 2CGOA 5LP6C 3BCCH 4MTFA 2EILC 5LGNA 4DV6O 4IHJA 3RYIA 4RQFA 5LMNB 1FPOA 4IGGA 1CP9A 3OT7A 3ZHUA 3CC2V 1H2LA 3IC9A 4DRXA 3S3WA 3GWKC 4NYKA 3ABUA 1MSWD 4KXRA 5ITZB 1Z5WA 2LGWA 3OR6C 4H37A 2E3CA 1PD3A 2DJVA 3QO5A 1Y74A 1U97A 1Q81W 3UQ8A 4JI3O 2OTLV 4LH7A 2QJ1A 3OMIB 2YIAA 1AVMA 3P3PA 3K5LA 4UVCA 5LA6A 4NXMO 1XOUA 4WBNB 2ZD9A 1F23A 1OCRC 1P7GA 3FB8C 2FL4A 3LUTB 4D7TA 3OTOO 3I56V 5C8YB 2R70A 1VQOV 1N0JA 3CRQA 3AG3B 5L3BA 3B2EE 4I9QA 1SQXH 2KB1A 1LUVA 2N04A 4N21A 4F6RB 5EK0A 2CTPA 4GX1A 5KA6A 4B3TO 1KMIZ 2JIZG 1HWYA 4LFBB 2V4DA 4X1YB 1LUWA 4JI2O 3L70H 1AI4A 1DF4A 2JJ2G 1SQQH 1ZWIC 4ZKIA 1ZLZA 1N33B 3ETGA 4PI2A 3FAVB 3CCUV 1XBLA 3G80A 3TK1A 2GUZB 1N33O 3AK2A 2ZKOA 3RBZA 1BL8A 4YJ2A 2VWKA 4OXSA 3BFRA 4TV9A 1JOYA 1VP7A 1WN7A 2ILMA 4MTOA 1K33A 3TXSA 1Q8IA 4I7ZB 1GTOA 5J2TA 4DUYB 1IBLB 2EX3A 4R8CA 4LR3A 1HDJA 2PYLA 1YI2V 1FYJA 4DUYO 1YHQV 1NR1A 2LW1A 2LJ2A 2XAHA 2EILB 5IYBO 1BCCH 2Q4PA 3CXCU 5CN0A 1ROPA 3ZMSA 1RSOB 1K8AW 1F51A 3P3NA 1BSMA 3ZMZA 4YHHO 4PI0A 2Q7GA 3DC5A 2BOCC 3RGBA 3U10A 4O2AB 5E1AC 2ZDIC 2UXCO 3U0ZA 1NVPB 3ETDA 4LCUC 3G6BA 4NTYA 1KKDA 3GVMA 2FB5A 3EXAA 3ABLC 4IYIA 2DOSA 4PA9A 2R9RB 4X88A 4I55A 1YDXA 2PI5A 4X66B 1NBMG 3AG1C 3R66A 3ZRWA 4B7KA 3JSLA 4DR6B 5F2VO 3RYCB 3DGEA 4X66O 1D5NA 3JALB 2XT9A 1WPBA 3CYOA 5LYJA 3E35A 2N74A 5H6QA 1FJGB 1I0HA 1SZXA 1BQZA 3K3WA 5LGUA 4DV4B 1Q43A 1JA8A 4DW1A 5BR8B 2FYUH 5KUMA 5BR8O 2Q73A 2QTOA 4HAMA 2ZIOA 2XAGA 2E74B 2P4VA 1XDCA 4IIJA 1Z2GA 4U3FH 4ZBMA 1Q6IA 2YSUB 4BAYA 2CTWA 3D3QA 4LNUA 4PA7A 3DXRA 4WF9V 4OPHA 3ASNC 3THOA 4Q20A 5H2FZ 2OT5A 3D36A 3L74H 4UCRA 1ZUQA 3HKDA 1EZJA 2X6CA 2M7WA 2JEXA 3SDLA 4LBEC 2PF4E 2WPDG 1GM8A 1SQGA 1TGOA 1W2BU 1Q5OA 3PJSK 4J80A 5L3GA 4QNHB 4MVSA 4TUYB 1VQ5V 4HBNA 2UXNA 1WLEA 4MVUA 3ZIAG 1BZKA 3ICXA 2EIMC 3QO8A 1AROP
chains in the Genus database with same CATH topology
2RDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDC A; 
#chains in the Genus database with same CATH topology
 4QGP A;  4X20 B;  1NQT A;  3PN1 A;  2P06 A;  4LC1 A;  4DO2 A;  5JJN B;  3STL C;  2A0L A;  3CWB H;  4BR6 A;  4B3R B;  1E1Q G;  3QG5 A;  4RAI A;  2WLN A;  4JI8 O;  4LF8 B;  5JQG A;  4B3R O;  2GTA A;  1EM1 A;  3N2K A;  4P9O A;  1M5I A;  4FFK A;  2IBZ H;  3MAQ A;  4MVQ A;  1H2S B;  2LFS A;  3AG1 B;  4O4L A;  1R3K C;  2LFR A;  3JAW A;  4AI8 A;  1GM7 A;  1W0J G;  3CE2 A;  5IDJ A;  3ABK C;  4BW9 A;  2VQF O;  4IL6 Z;  1XHX A;  2CDY A;  2AHZ A;  3UT5 B;  3CCS V;  5CB4 B;  2G38 A;  2ATK C;  5CBF A;  3WG7 C;  3VQW A;  3ZCC A;  1YIJ V;  1SA0 A;  4PD4 F;  4DV2 O;  2Q0A A;  4XDJ A;  3VQY A;  1EN6 A;  4CBC A;  4MVO A;  2UU9 O;  4X65 O;  4J41 A;  1MMM A;  3IAY A;  4UFZ A;  2Y69 B;  5A2Q N;  1PKX A;  3KZI Z;  5LHI A;  2BTO A;  2YDE A;  2WWW A;  4R50 A;  3ASN B;  1PL0 A;  4DV7 O;  5LXT A;  1NZ6 A;  5LHG A;  4DUZ O;  5KA5 A;  3ABT A;  1COW G;  4QPJ A;  1AI5 A;  4GKK O;  1YXB A;  4ZOL B;  4DV0 O;  5IYC O;  4XDK A;  3CS5 A;  4DR2 B;  2V1D A;  5C93 A;  4FM1 A;  1YIT V;  2ZNJ A;  2QKA A;  1KEC A;  4FMT A;  5BZB A;  4LFA B;  2P67 A;  2YXH A;  5GTH Z;  5BMV A;  4GLX A;  3L71 H;  2EIM B;  1XUQ A;  2F93 B;  2RJZ A;  4DV3 O;  2AXT Z;  1IUR A;  1N32 B;  5KHK A;  4QJF B;  4ZI7 A;  2EIJ C;  3OUS A;  4FIP C;  5EZY B;  1JPX A;  4RWU A;  4MTG A;  4WCE V;  1Y4M A;  3JYC A;  3D3I A;  4LF5 B;  4G28 B;  3BEH A;  2WLJ A;  3OMA B;  3SYO A;  3F7Y C;  4LF5 O;  4TV8 B;  1RM1 C;  1YTF B;  1V9P A;  2AHY A;  3SJC C;  4PA4 A;  5IJ9 B;  1GN2 A;  3ABM B;  4X9Q A;  3HKD B;  1TUB A;  4MTX A;  3B09 A;  4BWA A;  3VOU A;  1B6Q A;  1T5E A;  1B06 A;  2PYJ A;  4HNA B;  2KG7 A;  4DV1 B;  2NN4 A;  2E5L B;  1IBM B;  1QU7 A;  3JD4 A;  1CXZ B;  5EBL C;  3P30 A;  3BHP A;  3WB0 A;  4Q6G A;  4A5U B;  1R6N A;  4DR1 O;  1KUQ A;  2Q5Z A;  3LSS A;  1S5H C;  4YIP A;  2F23 A;  1BHB A;  1US6 A;  2GSM B;  4LF6 O;  4JYY A;  4FPP A;  1HNZ O;  1ORQ C;  3WB1 A;  3E2E A;  2LW7 A;  1SRY A;  4PJ0 Z;  3KG2 A;  1QHT A;  4WFF A;  3RVY A;  4DR5 B;  1AJN A;  4UXN A;  1VQ6 V;  3RYH B;  4YJ3 B;  4UB8 Z;  1CEZ A;  4LFC B;  5EYP A;  4FVM A;  2H94 A;  3JD3 A;  1SZT A;  3IGA C;  3ZS8 C;  3JAM N;  1VEW A;  2UUC B;  3WB2 A;  1IZ3 A;  2P90 A;  5CA3 A;  1K3E A;  2L6L A;  1NH2 B;  3CD6 V;  4RUF A;  1DF5 A;  1QVG U;  3RFR A;  2V7Q G;  4KL1 A;  4X1K A;  4X8A A;  3SR2 C;  1XL6 A;  3E86 A;  2EIJ B;  3UO3 A;  2HVK C;  1L8D A;  1Q90 D;  4JTA B;  1XNQ O;  2OTJ V;  2ZIM A;  5GON A;  1SA0 B;  5CA0 B;  1H8E G;  3CPW U;  4JV5 B;  3K57 A;  1SS3 A;  2HHH O;  2JEU A;  4ZHQ A;  3HKC B;  4JI5 B;  3ZRV A;  1ENV A;  1NJI W;  5HFL A;  3SPJ A;  2VWJ A;  4JV5 O;  2ZXW B;  1P49 A;  4H33 A;  2WLK A;  4CH4 A;  5JCO C;  3AG3 C;  5CA1 B;  1DK1 A;  1WA8 A;  2RQ6 A;  1FFX A;  3UCS C;  1YJW V;  4TT3 G;  5LXT B;  3S3X A;  1NR7 A;  5LP6 A;  1S72 V;  4JTC B;  3G6E V;  2A79 B;  2XAQ A;  2KQX A;  1JCH A;  2W0F C;  4LP8 A;  3LNN A;  3WFV A;  3H01 A;  1BE3 H;  4RUE A;  1ZX3 A;  3L75 H;  1IXM A;  2P7T C;  4ZI7 B;  1HP8 A;  4I0X A;  4E4E A;  3EVK A;  2X6A A;  3CX5 F;  4DR7 B;  2IU3 A;  1TVK A;  2EUL A;  5LOV B;  4PDR A;  2ZCE A;  4B3S B;  4JZ2 A;  2QEX V;  3H1H H;  3E8B A;  2Q0O C;  1H38 A;  3T1H O;  1MNG A;  2ETN A;  3CJH A;  4X1I B;  1GM9 A;  2EZP A;  1NTZ H;  3K5M A;  2X0L A;  1RPO A;  5L3F A;  5FL7 G;  3ML0 A;  5KUK A;  2ITC C;  3CCM V;  2YXY A;  3WU2 Z;  4PV1 B;  5EC2 C;  4LH6 A;  5LMN O;  4JAS A;  3NR7 A;  5IJ0 A;  5KHJ A;  1M93 A;  1S77 D;  1TUB B;  1WNS A;  2CE4 A;  3K9S A;  3OEE G;  3T1C A;  1F4N A;  3OUF A;  4O4I A;  2HG5 C;  4MW8 A;  4O4J A;  3CP1 A;  3CRA A;  3QO7 A;  4CS4 A;  5L3E A;  3RN4 A;  5DED A;  4W4L A;  2OIG A;  4FLY A;  1AR5 A;  1JFF A;  4ZIB A;  4JAV A;  4JYC A;  4QIW F;  1N4C A;  5KX5 A;  1NVP D;  3JCU Z;  5L3D A;  3MD0 A;  3F7V C;  1MZE A;  3OD4 A;  2QWO B;  3P32 A;  3K06 A;  2Y4U A;  3QF7 A;  3D8C A;  4LFB O;  4BIO A;  2CH7 A;  4GKJ B;  3ETE A;  1KQS U;  3VQX A;  4I50 A;  4YXW G;  2Q9L A;  2DWE C;  2Z5U A;  4PEL A;  4KUM A;  2LP7 A;  3ZMU A;  5JJE B;  1X59 A;  4RO2 A;  1K97 A;  1SES A;  4PHZ A;  3JAK B;  5JVD A;  3RW0 A;  1GN3 A;  2ZDI A;  4JI4 B;  3B8N A;  1Y76 B;  4WFG A;  4AQY B;  3JAR B;  1KYO F;  4I9W A;  2QGN A;  3W7X A;  1BQ0 A;  4PDL A;  4MVR A;  2EBO A;  2Z3Y A;  5GON B;  3RYF A;  3CCQ V;  4P2Z A;  2PTM A;  1R3J C;  4TWK A;  2D3O W;  1LNQ A;  1DTO A;  5IYD O;  3HKB A;  1IBL O;  1VQM V;  1Q82 W;  5JH7 A;  5KHG A;  1M4U A;  4B3M B;  4J7K A;  1WA8 B;  2YI9 A;  1PP9 H;  1N34 B;  4BIZ A;  2IJK A;  3HKE B;  1N34 O;  2UXB B;  4AHC A;  2BE3 A;  1AJQ A;  1XL4 A;  4GX5 A;  4JAU A;  1L0N H;  4UCS A;  2HVJ C;  2HEP A;  2DQ0 A;  3K79 A;  5J2U B;  2IH3 C;  4NR1 A;  3FKS G;  4IT5 A;  1RFY A;  4DR4 B;  2HLD G;  1ZL8 A;  3FB7 C;  4DR6 O;  1YJN V;  2BTQ B;  4JTD B;  3LDD A;  4L87 A;  2R72 A;  3K0G A;  4H13 B;  4TQD A;  1WPX A;  1XIL A;  1DLB A;  2AZ2 A;  2WA3 A;  1FJG O;  1Y67 A;  2Y48 A;  1Q7Y W;  3JD1 A;  4J9Y B;  4DV4 O;  4IHJ B;  3RYI B;  4MT8 A;  3N2G A;  4FLZ A;  1J5E B;  3O9O A;  4TSF G;  4DRX B;  2QTS A;  1KC8 W;  2Y69 C;  4JI6 B;  1NT2 B;  3ZRS A;  4DW0 A;  3CXH F;  2QM7 A;  4UV9 A;  1R73 A;  2KSD A;  1VQ7 V;  4DR3 B;  1FS0 G;  4EB6 A;  1YEW A;  4FFB A;  4EFE A;  1Y74 B;  1D5A A;  4DK1 A;  2EJ7 A;  1QCE A;  1N36 B;  4NVP A;  2VQE B;  1SKV A;  1QNM A;  4KP4 A;  3SJA C;  1PPJ H;  4J9Z B;  4JYB A;  1HR0 B;  2VQE O;  5LA6 B;  4OX9 B;  4JYA B;  4J7Z A;  2ITD C;  3OMN B;  5KHI A;  1KU9 A;  1R6T A;  4OX9 O;  1H2N A;  4CC5 A;  2EIN C;  3A0R A;  1S0V A;  3T4D A;  3CME V;  1B04 A;  2DW4 A;  1WAZ A;  3FB5 C;  2Q6A A;  5KHH A;  2WLL A;  3H1L H;  1XMO B;  4JI0 B;  3B77 A;  4UVB A;  1JMK C;  3JCZ A;  4J42 A;  1ZSP A;  2YIB D;  4LF8 O;  4NXN B;  3K5O A;  3ETQ A;  4I4T A;  5IYZ A;  4NXN O;  3E22 A;  5H9C A;  2Y0I A;  3ABM C;  4YJ2 B;  3JAS A;  5JVD B;  3AG4 C;  5LMU B;  2A9H A;  3J80 N;  1VQP V;  1H8H G;  1HW7 A;  1K34 A;  1UJW B;  2JJ1 G;  2W0X A;  1YVW A;  4TV9 B;  1VMG A;  2K1E A;  1M9N A;  4X62 B;  4LF4 B;  4CS2 A;  1G6U A;  3RYF B;  5J2T B;  2UUB B;  4U3J A;  4PDM A;  4MVM A;  1I94 B;  1FXH A;  4CC6 A;  3K0D A;  3W7U A;  4E2L A;  1YTF D;  1PNL A;  4J10 A;  1SC5 B;  2O57 A;  1OV9 A;  3CCR V;  2UUA B;  1OJH A;  3A0B Z;  2MK3 A;  5FNV A;  3G71 V;  3LSU A;  1WP7 A;  2QWR B;  1V54 C;  3O65 A;  2RDC A;  5BXZ A;  4CS3 A;  2W6J G;  4MSW C;  1YZB A;  3L73 H;  2RCV A;  5B3S B;  2Q7E A;  3T4Z A;  2F66 C;  4GYC B;  3K9A A;  3ZED A;  3A0H Z;  1V55 C;  3SPC A;  3U11 A;  4JI7 B;  1SQB H;  4I55 B;  3Q4H A;  3ZRW B;  2A7W A;  4DR2 O;  3T1Y B;  2EIN B;  2IJH A;  4P9P A;  2OIE A;  3BY6 A;  5LYJ B;  1BS3 A;  1SER A;  1NI8 A;  3CCV V;  4LFA O;  1XQ8 A;  3M7M X;  4JPR A;  2B1G A;  3K03 A;  2XHB A;  2XUM A;  4DYL A;  1OHH G;  2QKC A;  2BSK A;  3BAB A;  2BOB C;  4B7E A;  1N32 O;  3OW2 U;  4I5S A;  2AZ0 A;  1M57 B;  4IIJ B;  2JGD A;  2QA4 V;  5FPO A;  2CTR A;  4FLU A;  3BRC A;  1NH2 D;  2F95 B;  2ZXW C;  2PUS A;  4LNU B;  3DXR B;  1S3J A;  3IC7 A;  4Z1V A;  1OCZ B;  2ADP A;  3OAA G;  3AEI A;  1S5L Z;  3AG4 B;  3APQ A;  2UXX A;  5HFM A;  2GTS A;  3NXS A;  2UXD B;  2ODM A;  2ZNI A;  5IY5 B;  2UXD O;  2H3O A;  3IJ4 A;  2A3Q A;  2F1M A;  2NLJ C;  3QVN A;  4F6E A;  5J9P C;  2HJF C;  4DV1 O;  1K73 W;  2JS3 A;  2E5L O;  4PA3 A;  3JSN A;  3ZBH A;  1IBM O;  4YY3 B;  4UCO A;  4NTW A;  5ITZ A;  2H8P C;  2CK3 G;  2HR3 A;  1V54 B;  1ZAU A;  1G1X B;  2ZQM A;  1J95 A;  4JI1 B;  3A8T A;  3M8A A;  3B4S A;  1E79 G;  4FK5 C;  1I08 A;  5JQG B;  2OWO A;  4WBN A;  1MG1 A;  1XRE A;  3SYC A;  3N2K B;  2DMX A;  2DYR C;  4DR5 O;  3ZN1 A;  1V55 B;  2ZT9 B;  3OEH G;  1VQ9 V;  5C8Y A;  4F4L A;  5JCO A;  5IYZ B;  4UB6 Z;  4LFC O;  3SPI A;  4F6R A;  4O4L B;  1XNR B;  1FXK A;  4O2B A;  3KCY A;  1M56 B;  2UUC O;  2QSA A;  3JAW B;  2Q8V A;  1GH6 A;  3ZMT A;  4WFH A;  2HFE C;  4KFM A;  3LDC A;  4X1Y A;  2R9I A;  4DV5 B;  2QKS A;  3ZHT A;  3SJB C;  3K5N A;  1D2D A;  3ZHS A;  2A06 H;  4O4H A;  4K8Z A;  3R65 A;  1IBK B;  1EZV H;  3AG2 B;  3LDE A;  2B9Z A;  5GW7 A;  1KD1 W;  5CBG A;  2CTQ A;  1XMQ B;  4Z1M G;  4GCZ A;  3FAV A;  1VF6 C;  4R7C A;  2GUZ A;  1GMG A;  1MOF A;  2F43 G;  3ZHR A;  1HNW B;  2JRI A;  5DN6 G;  1PL4 A;  2Q67 A;  4UCT A;  1L1F A;  1SQP H;  3SPG A;  4K35 A;  2E75 B;  3ZN0 A;  1KBH A;  4U7N A;  4JI5 O;  3GB7 C;  4WFB V;  3A2F A;  4UCV A;  3APO A;  4X64 B;  4DK0 A;  1GN6 A;  3ASO C;  3UKM A;  2JVD A;  4EEQ A;  2L35 A;  2YUA A;  1Q6U A;  1QLE B;  3CCJ V;  1NS1 A;  4G2K A;  1RSO A;  2E76 B;  3OGC C;  1BHA A;  2JK5 C;  2WLH A;  2ZM6 B;  3G67 A;  2Q69 A;  2YXL A;  3RWR D;  4GX2 A;  5BMV B;  4O2A A;  1YCI A;  3B8M A;  3TCU A;  2DYS B;  2EZO A;  3M99 B;  1UPG A;  1L0L H;  2ZE5 A;  1GO3 F;  3I5D A;  4AIL C;  1Z5V A;  4HZ3 A;  4DR7 O;  3SYA A;  2XAS A;  4FLW A;  2WAM A;  3CCL V;  5B1O A;  4B3S O;  2JDI G;  5KLV H;  3H1J H;  3RYC A;  2XAJ A;  2PZS A;  1OCO B;  1HNX B;  2DYR B;  3JAL A;  1R3I C;  1N8R W;  4LF9 B;  4GZR B;  1MA1 A;  1KB9 F;  3ZHV A;  1KP3 A;  2YIC A;  4DV6 B;  3KCX A;  1QBZ A;  3X2Q B;  3W7T A;  4ASU G;  2KG7 B;  3MDS A;  4XDL A;  3SYP A;  1SQF A;  1QR8 A;  3K58 A;  2IJI A;  2YEV A;  1XHZ A;  2ARH A;  3JAT A;  1ZTE A;  1I5X A;  3H1K H;  4J11 A;  4LWS A;  2CAZ C;  1LR1 A;  2R9A A;  4UVA A;  4JI3 B;  2W6I G;  2WLM A;  2Y0P A;  5KAF Z;  1I5Y A;  2GBO A;  1F4M A;  4NXM B;  2QR4 A;  3FD9 A;  3LSQ A;  3ASO B;  4EFB A;  1NTK H;  3OTO B;  4TUY A;  2NNU A;  1VQK V;  3UM7 A;  4WFE A;  5EYP B;  3OFN G;  1VQ4 V;  3OGI B;  5LHH A;  4B3T B;  4FLV A;  1I7F A;  4TQF A;  4GKJ O;  1MZF A;  1G4Y B;  4L8J A;  4X20 A;  3OE7 G;  4FM0 A;  1FXK B;  4O2B B;  5LBQ A;  2P4K A;  1X4T A;  4FZ1 A;  4JI2 B;  3BPZ A;  2GHY A;  1PM9 A;  1KKC A;  1K5S A;  1G8M A;  1VQN V;  4FZ0 A;  4X1K B;  3E8H A;  4YIO A;  5TIS Z;  2M6Y A;  3E8F A;  1Q86 W;  1QLN A;  4O4H B;  2DWD C;  4JI4 O;  1QVF U;  1JX9 A;  2ZE8 A;  4AQY O;  3IFX A;  1QR9 A;  2EIK B;  3MHS C;  1AP5 A;  3W7W A;  1TUE B;  2FKX A;  1NU1 H;  1RPR A;  2WSS G;  3K08 A;  4ZHQ B;  5B1A B;  3SGI A;  3OTF A;  2IM9 A;  1K4C C;  1MSD A;  2YI8 A;  4BW5 A;  2B5U A;  1EFR G;  1FFX B;  5DM6 V;  4B3M O;  4CH6 A;  3UT5 A;  5CB4 A;  5LP6 B;  5EIB C;  4H0L B;  3RT3 C;  3SJQ C;  3JD0 A;  1GRJ A;  2RN9 A;  3BAA A;  3SPH A;  2X7R B;  1YF2 A;  5JWP A;  2UXB O;  4QE7 A;  4YHH B;  3CCE V;  1E1R G;  1VIB A;  2UXC B;  2AGA A;  2F4V B;  3CC4 V;  1FD9 A;  2GDS A;  1W0K G;  2F4V O;  3EFF K;  4I0X B;  5EIB D;  1TVK B;  3J7A U;  4DR4 O;  1AR4 A;  1BT8 A;  2ZIN A;  5B1B C;  1H2M A;  4ZOL A;  3CJH B;  4MS2 A;  3J81 N;  2Q7H A;  4K3A A;  3BA8 A;  2ZR3 A;  1OCR B;  2Y4T A;  3T2M A;  2YIB A;  1PNM A;  4R6Z A;  2DQ3 A;  1QQC A;  2C2A A;  5IJ0 B;  1J5E O;  2RMK B;  3RVZ A;  3C3T A;  4GUN A;  3CC7 V;  3FB6 C;  4JI6 O;  5B3S C;  1VQL V;  1P7B A;  5B1N A;  5EZY A;  3OR7 C;  1SET A;  3DTU B;  4O4I B;  1N0N A;  2LO1 A;  2HP8 A;  1XI1 A;  4O4J B;  1R3L C;  4DR3 O;  4H44 B;  1EBO A;  2YEV B;  2WLI A;  3JAT B;  4TV8 A;  1Y66 A;  1N36 O;  1AR1 B;  5IJ9 A;  4LWS B;  2CGN A;  4OGQ B;  1JJO A;  5EBW C;  1HR0 O;  1DGS A;  2P6J A;  2LQT A;  4JYA O;  1JFF B;  1OZ0 A;  5BY1 A;  2XTA A;  1RP3 B;  5KX5 B;  5KMG A;  2GV9 A;  4RQE A;  4HNA A;  3VQV A;  1BMF G;  4CH5 A;  1JQ0 A;  1AP6 A;  2HKO A;  2IW5 A;  5AG2 A;  2ZE6 A;  1M57 C;  1NKD A;  2CH7 B;  4J7J A;  1WB8 A;  4I50 B;  3AG7 A;  2YC0 A;  1Q3E A;  1M1K W;  1XMO O;  4JI0 O;  2HJD A;  3CRC A;  2OCC C;  3G4S V;  3QTC A;  1WB7 A;  2PGG A;  1OCC C;  1OCZ C;  2OCH A;  2QDO A;  3ZJZ A;  3D36 C;  4JI8 B;  2QE7 G;  4IYH A;  1Q6H A;  4JAA A;  5LMU O;  4GT1 A;  1GAX A;  4CZZ A;  3RYH A;  4YJ3 A;  1AIL A;  3BA9 A;  3ABL B;  4FJC C;  5B1B B;  3TGU H;  5IY5 C;  4G27 B;  3JD2 A;  4X62 O;  4LF4 O;  4DXW A;  2UUB O;  1IDS A;  3HKB B;  1U96 A;  2IU0 A;  2N05 A;  1I94 O;  5JH7 B;  2CUG A;  2Z0A A;  3VBB A;  5B66 Z;  5LGT A;  2VQF B;  5H6R A;  1FFT B;  1Y6X A;  3MHH C;  2B1I A;  2UUA O;  5IT9 N;  2FML A;  1IVS A;  4DV2 B;  4QE9 A;  3SYQ A;  4K0K B;  2UU9 B;  4X65 B;  2XAF A;  5CA0 A;  2MW2 B;  1MAB G;  4XBF A;  4K0K O;  4JZG A;  2K9P A;  3UO2 A;  2QWQ B;  3HKC A;  5L3C A;  1F7Y A;  4UUJ C;  1XEQ A;  1P4R A;  1K4D C;  1NTM H;  5CA1 A;  2EJR A;  1A32 A;  4JI7 O;  4B08 A;  4DV7 B;  1WJZ A;  5K1P A;  3EHB B;  4DUZ B;  5D5Q A;  2QWN B;  4QPK A;  3HR0 A;  2XND G;  3H9V A;  1M56 C;  2QM4 A;  1ZL8 B;  4GKK B;  3C3S A;  4DV0 B;  1H2K A;  3T1Y O;  4WFA V;  2QM8 A;  1K9M W;  2YID A;  3TXQ A;  3AG2 C;  1P84 F;  5FLX N;  2YS8 A;  2JGU A;  3E89 A;  3N2G B;  4DV3 B;  4FLX A;  4NTX A;  5E79 Z;  1SQV H;  3ZRX A;  4CH3 A;  1R6K A;  2JS5 A;  2OCC B;  2VS0 A;  4NB5 A;  3TJT A;  1EN5 A;  2KKW A;  1TA8 A;  1OCC B;  4NKG B;  5LOV A;  2DN9 A;  3STZ C;  2QWP B;  4BIU A;  4EB6 B;  4X1I A;  4FFB B;  3FYE B;  2DE0 X;  3HB3 B;  3N27 A;  5CMU A;  3F5T A;  1QLE C;  2WLI B;  5IWA B;  4D7S A;  3CHX A;  5D5P A;  4U7O A;  5IWA O;  1M90 W;  1AI7 A;  1K5Q A;  2NR5 A;  5K1X A;  1K92 A;  3L72 H;  4KHP B;  1VAR A;  1S5J A;  3FX7 A;  4FM2 A;  3ABK B;  3DC6 A;  5KMG B;  2DYS C;  4KHP O;  1SF9 A;  5KAI Z;  1JJ2 U;  4YY3 O;  3E83 A;  4OPA A;  4TOI A;  2IJJ A;  2LGQ A;  2WLL B;  1O9H A;  3WG7 B;  3B40 A;  1VF6 A;  4JI1 O;  1JR9 A;  3CB2 A;  4GX0 A;  1AI6 A;  4DR1 B;  1IX9 A;  2ZR2 A;  1VQ8 V;  2X6B A;  1YSC A;  4ABM A;  5EBM C;  4HYO A;  1OCO C;  1WP8 A;  4LF6 B;  2WA4 A;  1HNZ B;  1S76 D;  5A9G A;  4I4T B;  3E22 B;  2RNB A;  3JAS B;  3TET A;  4W4K A;  1THZ A;  4ICG A;  1H2G A;  2FTK A;  2PY5 A;  1XNR O;  3OM3 B;  5JJJ B;  1UFI A;  3ZX6 A;  4MVZ A;  3X2Q C;  2P22 C;  3ZMV A;  4U3J B;  5FPR A;  5H5N A;  1BGY H;  1EN4 A;  4DV5 O;  3HPL C;  2IH1 C;  2D2C B;  3K04 A;  3BVO A;  4C7U A;  1IBK O;  1FKA O;  2Q68 A;  1FXV A;  5CBH A;  4D6T H;  1XMQ O;  5FNV B;  3JAK A;  4MW3 A;  4X89 A;  2PI4 A;  1HNW O;  1PV0 A;  1Y76 A;  3JAR A;  1XNQ B;  5LL6 Y;  4JF3 A;  1B3Q A;  1VF5 B;  1GK9 A;  2P5O A;  4N23 A;  2ADQ B;  2ZE7 A;  1AJP A;  1GKF A;  4Z2W A;  2HHH B;  2XOK G;  2BCC H;  3CEI A;  4X64 O;  3I55 V;  3AK1 A;  3AK3 A;  4PA6 A;  4K8X A;  1URF A;  1YJ9 V;  3L9D A;  1RM1 B;  3H1I H;  2OYQ A;  1O9G A;  2AW9 A;  3Q4H B;  1FXK C;  1W59 A;  3CRR A;  1CPY A;  1FAF A;  1AB3 A;  3F5W C;  3QNE A;  5B5E Z;  5EC1 C;  3K59 A;  4LF7 B;  1R1B A;  2ZM6 O;  3HKE A;  4JGS A;  4FLT A;  5GTI Z;  3ZHQ A;  3C90 A;  4LF7 O;  1JVM A;  2BSK B;  4P30 A;  1IXB A;  4UV8 A;  1VF7 A;  2EIK C;  5IE9 A;  3DSQ A;  3CMA V;  3KKY A;  5DEC A;  5J2U A;  3W7S A;  2JGD B;  5B1A C;  1PNK A;  3CSX A;  3FYI B;  1KP2 A;  3FFQ A;  2VRZ A;  2BTQ A;  1HNX O;  1GN4 A;  3LNM B;  1K7D A;  4UCU A;  4EKW A;  3T1H B;  4LF9 O;  3GWO A;  4PDV A;  3E8G A;  1TAE A;  3CRM A;  2CGO A;  5LP6 C;  3BCC H;  4MTF A;  2EIL C;  5LGN A;  4DV6 O;  4IHJ A;  3RYI A;  4RQF A;  5LMN B;  1FPO A;  4IGG A;  1CP9 A;  3OT7 A;  3ZHU A;  3CC2 V;  1H2L A;  3IC9 A;  4DRX A;  3S3W A;  3GWK C;  4NYK A;  3ABU A;  1MSW D;  4KXR A;  5ITZ B;  1Z5W A;  2LGW A;  3OR6 C;  4H37 A;  2E3C A;  1PD3 A;  2DJV A;  3QO5 A;  1Y74 A;  1U97 A;  1Q81 W;  3UQ8 A;  4JI3 O;  2OTL V;  4LH7 A;  2QJ1 A;  3OMI B;  2YIA A;  1AVM A;  3P3P A;  3K5L A;  4UVC A;  5LA6 A;  4NXM O;  1XOU A;  4WBN B;  2ZD9 A;  1F23 A;  1OCR C;  1P7G A;  3FB8 C;  2FL4 A;  3LUT B;  4D7T A;  3OTO O;  3I56 V;  5C8Y B;  2R70 A;  1VQO V;  1N0J A;  3CRQ A;  3AG3 B;  5L3B A;  3B2E E;  4I9Q A;  1SQX H;  2KB1 A;  1LUV A;  2N04 A;  4N21 A;  4F6R B;  5EK0 A;  2CTP A;  4GX1 A;  5KA6 A;  4B3T O;  1KMI Z;  2JIZ G;  1HWY A;  4LFB B;  2V4D A;  4X1Y B;  1LUW A;  4JI2 O;  3L70 H;  1AI4 A;  1DF4 A;  2JJ2 G;  1SQQ H;  1ZWI C;  4ZKI A;  1ZLZ A;  1N33 B;  3ETG A;  4PI2 A;  3FAV B;  3CCU V;  1XBL A;  3G80 A;  3TK1 A;  2GUZ B;  1N33 O;  3AK2 A;  2ZKO A;  3RBZ A;  1BL8 A;  4YJ2 A;  2VWK A;  4OXS A;  3BFR A;  4TV9 A;  1JOY A;  1VP7 A;  1WN7 A;  2ILM A;  4MTO A;  1K33 A;  3TXS A;  1Q8I A;  4I7Z B;  1GTO A;  5J2T A;  4DUY B;  1IBL B;  2EX3 A;  4R8C A;  4LR3 A;  1HDJ A;  2PYL A;  1YI2 V;  1FYJ A;  4DUY O;  1YHQ V;  1NR1 A;  2LW1 A;  2LJ2 A;  2XAH A;  2EIL B;  5IYB O;  1BCC H;  2Q4P A;  3CXC U;  5CN0 A;  1ROP A;  3ZMS A;  1RSO B;  1K8A W;  1F51 A;  3P3N A;  1BSM A;  3ZMZ A;  4YHH O;  4PI0 A;  2Q7G A;  3DC5 A;  2BOC C;  3RGB A;  3U10 A;  4O2A B;  5E1A C;  2ZDI C;  2UXC O;  3U0Z A;  1NVP B;  3ETD A;  4LCU C;  3G6B A;  4NTY A;  1KKD A;  3GVM A;  2FB5 A;  3EXA A;  3ABL C;  4IYI A;  2DOS A;  4PA9 A;  2R9R B;  4X88 A;  4I55 A;  1YDX A;  2PI5 A;  4X66 B;  1NBM G;  3AG1 C;  3R66 A;  3ZRW A;  4B7K A;  3JSL A;  4DR6 B;  5F2V O;  3RYC B;  3DGE A;  4X66 O;  1D5N A;  3JAL B;  2XT9 A;  1WPB A;  3CYO A;  5LYJ A;  3E35 A;  2N74 A;  5H6Q A;  1FJG B;  1I0H A;  1SZX A;  1BQZ A;  3K3W A;  5LGU A;  4DV4 B;  1Q43 A;  1JA8 A;  4DW1 A;  5BR8 B;  2FYU H;  5KUM A;  5BR8 O;  2Q73 A;  2QTO A;  4HAM A;  2ZIO A;  2XAG A;  2E74 B;  2P4V A;  1XDC A;  4IIJ A;  1Z2G A;  4U3F H;  4ZBM A;  1Q6I A;  2YSU B;  4BAY A;  2CTW A;  3D3Q A;  4LNU A;  4PA7 A;  3DXR A;  4WF9 V;  4OPH A;  3ASN C;  3THO A;  4Q20 A;  5H2F Z;  2OT5 A;  3D36 A;  3L74 H;  4UCR A;  1ZUQ A;  3HKD A;  1EZJ A;  2X6C A;  2M7W A;  2JEX A;  3SDL A;  4LBE C;  2PF4 E;  2WPD G;  1GM8 A;  1SQG A;  1TGO A;  1W2B U;  1Q5O A;  3PJS K;  4J80 A;  5L3G A;  4QNH B;  4MVS A;  4TUY B;  1VQ5 V;  4HBN A;  2UXN A;  1WLE A;  4MVU A;  3ZIA G;  1BZK A;  3ICX A;  2EIM C;  3QO8 A;  1ARO P; 
#chains in the Genus database with same CATH homology
 2RDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...