2RMKB

Rac1/prk1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
GIPATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQADQLENQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/transferase
total genus 29
structure length 81
sequence length 81
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2rmkB00
1UPGA 1RFYA 2Q0OC 4NKGB 1URFA 4IGGA 2HJDA 4NB5A 1CXZB 1US6A 2RMKB 4DYLA
chains in the Genus database with same CATH superfamily
2ZR2A 2JJ1G 3T1CA 1YJWV 3K5LA 2PUSA 2XNDG 3JCUZ 4JI1B 2P7TC 3IGAC 2UXBO 3ABUA 3QTCA 2Q0AA 5KHJA 4Z1VA 2H94A 4L8JA 2UUAB 4MVMA 3UM7A 4GLXA 4OPAA 1JFFB 4LCUC 4PDVA 1PL4A 2PF4E 4I4TA 1XDCA 1DK1A 2HJFC 1ZUQA 4FK5C 5K1PA 4B7KA 4DUZB 4DV6O 4FLXA 4KP4A 2AHYA 4AILC 3BA8A 3WB0A 4LH6A 2IH3C 3SPJA 2IJHA 1XHXA 1PPJH 3OGIB 2HEPA 2CTPA 1US6A 1VQ7V 3JARA 3AK2A 1AR1B 4QPJA 2D3OW 4FVMA 1VF6A 3OM3B 4DV7B 4J9YB 4JTAB 2Q7HA 4WFFA 4JF3A 2DJVA 4IYIA 5IJ9A 1S3JA 2VWKA 5H5NA 3CRMA 2FL4A 2Z5UA 2DOSA 4PELA 1SA0B 1OV9A 5FLXN 3FB7C 2BOCC 3QO7A 3DC6A 5FPOA 2WLNA 3SYQA 1P84F 5H6QA 5JJJB 3HR0A 1WPBA 4X9QA 2ZDIC 3JALA 2IM9A 3VQWA 1WB7A 5H9CA 4ZOLB 1VQLV 3K0GA 5L3FA 2ZKOA 2YC0A 4JI7O 4QE9A 2RCVA 1AJNA 1SQXH 4R50A 4QGPA 2Q7GA 2JGDB 1NZ6A 4JI2B 4JZ2A 4AQYO 3ZN0A 3RYIA 1GN3A 4LFBB 3KKYA 5C8YA 5JVDA 4JI4O 4J10A 5J2UA 3AK1A 1J5EO 4PI0A 2ZNJA 4X1IA 1MSDA 1JMKC 3F7VC 1OZ0A 1GM7A 5IY5B 1AI4A 5LMUO 4WBNB 5LHGA 1SZXA 4HNAA 4LWSA 2ZT9B 1XOUA 3H1HH 2EINB 5D5PA 5K1XA 5GTHZ 4DV5O 1S5HC 3QO5A 4TT3G 2OCCB 5EZYB 4DR3O 2DYRB 1RSOA 3UT5A 2RN9A 1KB9F 2Q69A 5JQGA 1U96A 3X2QC 3JATB 4MW8A 2ZIMA 4U3JB 4PA7A 1VARA 3B8NA 1XILA 2QWQB 4BW9A 4YJ2A 2AZ0A 1QQCA 2NLJC 3T1YO 3J7AU 5BZBA 2P4KA 2OCHA 2LW1A 1COWG 3OGCC 4BR6A 2P4VA 1K3EA 5JCOA 1HR0B 1MA1A 2GHYA 1Z5WA 1HNWB 3H1IH 1D5AA 3FD9A 2JEXA 3E22B 4YJ3B 3LSUA 1K7DA 4LF4B 2OT5A 4JASA 1X4TA 5KMGB 4DR4O 1QBZA 4DUYO 4X62O 2DW4A 4O4HB 1AP5A 1BT8A 4X66O 4B08A 4FZ0A 4F6RA 2UXDB 3VQVA 2XASA 3OE7G 1N36O 3E83A 4FMTA 4FLYA 4JYBA 3HKCB 4XDKA 4JTCB 3WB2A 1B04A 3C3SA 2W0FC 2WLJA 2WA4A 2Z3YA 5KHGA 4PI2A 1KECA 5B3SC 4LFCO 1R3IC 1M4UA 1JCHA 4G27B 4R6ZA 4YY3O 4AHCA 5L3BA 1Q6UA 4FFBA 1Y76B 5CBHA 3U11A 3JASB 1N32B 2RQ6A 3TXSA 2IJKA 1S72V 1CXZB 2QSAA 2H3OA 2YEVA 2X6CA 1EM1A 4P30A 3H9VA 1R3KC 5IWAO 1H2SB 4TV8A 3UCSC 4DW0A 1QR9A 4UXNA 2ZIOA 1N33O 1AROP 4RO2A 1TUBB 2HJDA 1AJQA 1WP8A 2A3QA 3ETEA 2P22C 1NJIW 3VOUA 2FB5A 3MHHC 1PNMA 3ETDA 5LMNO 1IBKB 2UXCB 1JQ0A 5CA1A 2DMXA 2OTJV 4JI8O 3JD1A 1BGYH 2KKWA 2F4VO 4KHPB 1DF5A 1M93A 1Y74B 2WLIB 4O2BB 3A0RA 4MTFA 1KYOF 4HZ3A 4JAUA 1SF9A 1JJ2U 1ZTEA 2KG7A 5LOVA 2OIEA 4IHJA 2ZE7A 3K3WA 2AZ2A 3AEIA 3FX7A 4BIZA 5JJEB 4UVBA 2EJ7A 1LUWA 4ASUG 4D7SA 1AI7A 2BTQA 4CH4A 3FYEB 4DR5O 2F66C 5CBGA 3THOA 3K9SA 1B06A 3CC4V 1S5LZ 1K4CC 4DYLA 4IIJA 1PL0A 4DV2O 2YIAA 4QE7A 4B3MO 4FLTA 3BAAA 1YZBA 1VQ4V 1LNQA 2A06H 1NS1A 2VQEO 4ZHQA 1F23A 1GRJA 3OTOO 4UCSA 2YIBD 4PA4A 3CMEV 1S5JA 3FB6C 1G1XB 3ZMZA 2WLLB 4PDRA 3D8CA 4YIPA 2FKXA 4MT8A 2VS0A 4MS2A 4LF7B 2QEXV 3EVKA 2WLHA 3MHSC 2IU0A 2DWEC 2YI9A 3RYCB 4Q6GA 1AVMA 1PP9H 2FMLA 4CH5A 2QA4V 3R65A 2M6YA 5EYPA 4K0KO 3LSQA 2HLDG 3K79A 5IYZB 1NBMG 3I5DA 1N0NA 5B1OA 2A7WA 5DN6G 3OTFA 3SJBC 4JV5B 3VQXA 4LC1A 3ZHUA 3N2KB 2EIJC 5IT9N 4JI0O 4UVAA 1AR5A 1ZL8A 1JFFA 5HFMA 1W59A 4DV3B 5IYCO 2NNUA 1K73W 2QWRB 4JGSA 4ZKIA 2IJIA 5L3EA 1VF7A 4TQFA 4JI5O 1MG1A 2F95B 4U7NA 2B1GA 3X2QB 4B3RO 3D36C 1HP8A 4GT1A 2JJ2G 1PD3A 5IDJA 4PA9A 2P67A 3NXSA 3CD6V 1IBMO 5LXTB 2UUCO 1K33A 3K5NA 4LF9O 1FXKC 3QF7A 1I94O 2N74A 4LNUB 3TXQA 4YXWG 2R9IA 1SA0A 3W7SA 4LFAB 3RYFB 3T4DA 1PNLA 2YXLA 2K9PA 4IYHA 3JD3A 4P2ZA 3ZHTA 4CS4A 3CXCU 1RM1C 4LBEC 3LNMB 4NVPA 4WCEV 2QM4A 2AW9A 4ABMA 1VQ5V 1HNXO 4FLZA 4OX9B 4JI1O 1KMIZ 1L0NH 1NU1H 5HFLA 1JA8A 3BHPA 2JGDA 3JCZA 2VRZA 4ZIBA 2UUAO 2QM7A 3ASNC 1WP7A 3OAAG 3ZBHA 4MVOA 4UCVA 4MVUA 3TGUH 4J80A 1JVMA 2QM8A 4H33A 3CS5A 5LGTA 4DUZO 5FNVB 2PTMA 3WU2Z 1KKCA 3CJHA 4TV9B 2F93B 3DTUB 3STLC 1FFXB 1BQ0A 1BCCH 2JRIA 1H2GA 2EJRA 3DXRA 1U97A 2BCCH 5EZYA 1Q90D 3E8BA 4IT5A 1NTMH 3E2EA 3GVMA 4FZ1A 1BS3A 2E75B 4Q20A 1NI8A 5TISZ 3B40A 1H2NA 3JATA 5KHIA 3DC5A 4U3JA 2QR4A 2JGUA 4O4IB 5CA0B 3SJQC 4RQFA 4JZGA 2CH7B 4JAVA 3BEHA 3TJTA 1K9MW 4JYYA 1FYJA 1OCCB 5FL7G 3ZN1A 3RYHB 1VF6C 1FAFA 2UXXA 5J2TA 1QLNA 2NN4A 2VQFB 5IJ0A 1FXHA 2P5OA 3CMAV 5LGNA 3GB7C 4FM0A 3AK3A 1TA8A 3ZMSA 3OR7C 3FAVB 3E22A 4YJ3A 3TK1A 5CN0A 1SETA 2V7QG 1IURA 1H38A 5KMGA 4JI2O 2WWWA 1RP3B 2KQXA 3LSSA 2K1EA 4L87A 2ILMA 4I55A 4O4HA 4LFBO 4FLWA 4X8AA 4UUJC 3SJAC 2IJJA 2ZM6B 3CHXA 5KUMA 3AG1C 4FLUA 3HKCA 2QWPB 4E4EA 1NQTA 4IL6Z 1QVFU 3K0DA 1QLEB 4WF9V 4K35A 3H01A 4DV4B 2CE4A 1Y76A 3P3NA 2EBOA 3JASA 1IBLB 1AILA 2HVJC 1H2LA 1A32A 1SERA 4JYAB 5IYDO 4NTYA 1SKVA 3G67A 5JH7B 3PN1A 1N0JA 3IC7A 3QO8A 3APOA 4LF6B 5EBLC 2LGQA 4B7EA 2CGNA 2QGNA 4G2KA 1EFRG 1WJZA 3IC9A 1L1FA 3ZMTA 1HR0O 2YIBA 1HNWO 4NYKA 4TUYB 1YTFB 3CYOA 4BAYA 3ZHVA 4LF4O 4EFEA 2EX3A 5LYJB 4JPRA 1PV0A 3A0HZ 3CWBH 4YHHO 1Q6IA 1Y74A 4O2BA 1BHBA 1BL8A 5EC2C 1YF2A 1Q7YW 2UXDO 3WG7C 3T1HB 3JD2A 3FFQA 4UCOA 1IXBA 5JCOC 1B6QA 1D5NA 2DYSC 1PM9A 3CRQA 3HKBB 3L74H 1GAXA 1N8RW 4X64B 2EIMC 4X89A 1M57C 2Y4TA 4X65O 4I0XA 3RN4A 3JD0A 4I7ZB 4AI8A 1F7YA 4RQEA 1YEWA 1KP2A 4FPPA 2E5LB 1R1BA 3ABLC 4E2LA 2OIGA 1EZJA 4JYCA 2IW5A 4MVZA 1FXKB 1GO3F 3ZS8C 1YIJV 4JTDB 1N32O 2YUAA 2Q9LA 3L75H 1GK9A 4NXMB 1R3JC 1SQFA 1XNQB 3Q4HB 3WB1A 2Q7EA 3L9DA 2M7WA 2CGOA 2ZDIA 4X20B 2YXYA 3S3WA 1VQKV 5LP6A 1K4DC 1VP7A 1NKDA 2N05A 1K92A 1N34O 1Q6HA 3R66A 2YDEA 3HKDB 1KUQA 1YTFD 2OTLV 2WLLA 1KQSU 2CUGA 3G6BA 1RPOA 4LR3A 1ORQC 2EULA 4DR6O 4UVCA 3MAQA 2QTSA 2X6AA 3RYCA 3ASNB 1IBKO 2ATKC 3WFVA 1XMQB 3E35A 4FIPC 3KCYA 5IYZA 2XT9A 4WFHA 4LF5O 4J9ZB 2RDCA 3CEIA 2XAGA 1K5SA 2HG5C 5CB4B 5C93A 1ZSPA 1LUVA 5IE9A 3B4SA 3CCSV 4J11A 1QNMA 4NTXA 2QTOA 4JI4B 1P7GA 4DV1B 4JAAA 3UO2A 1P49A 1J5EB 3GWKC 1Q43A 3SPGA 4IGGA 1WNSA 2BE3A 2QDOA 2GTAA 5A2QN 5LMUB 3LDDA 1XMOB 2ADQB 3SJCC 2EILB 2Y69C 5DECA 3SYOA 1HDJA 1GM8A 3E8HA 4OPHA 1WA8B 4JI6B 1WPXA 2HKOA 4RUEA 2YIDA 3ML0A 5H6RA 4MVQA 3HPLC 4NXNB 3IAYA 4LNUA 3K06A 1LR1A 2BTOA 4DR3B 2XHBA 4DV0B 4N23A 1XL6A 4DW1A 3RYFA 3OD4A 2KSDA 1YSCA 3JAWA 2BSKB 4UV9A 4QJFB 2IU3A 4PV1B 3MD0A 4RWUA 4K8ZA 1FJGB 3BFRA 1FKAO 4PHZA 3OW2U 3C90A 2Z0AA 2RNBA 2B5UA 3QG5A 3B09A 2PGGA 3BPZA 3ZHSA 4WFBV 2X6BA 3LUTB 4DK0A 4CC5A 3CRAA 4X88A 4JV5O 1AJPA 3CCLV 1XUQA 1YCIA 4R8CA 2H8PC 4F4LA 1NTZH 1DLBA 3ZX6A 4DV3O 1W0KG 1QCEA 1H8EG 5IYBO 1WB8A 4WFGA 5J2UB 4OXSA 2UU9B 5FNVA 1AP6A 4MTOA 4BIOA 2PY5A 3E8GA 4EEQA 2Q5ZA 2W0XA 1K34A 4XDJA 3RVYA 2ITCC 4TV9A 1MMMA 2QWOB 4PDLA 2ARHA 3VQYA 5EIBD 2UXNA 1FFXA 4CBCA 4UCRA 2E3CA 1L0LH 4BWAA 2YSUB 1Y67A 2XAJA 3KZIZ 1XNRB 4Z1MG 1KC8W 4X1KB 3UT5B 2ZE6A 4LFAO 2A9HA 2F23A 4X1YB 4CH6A 4LP8A 4C7UA 4WFEA 2CH7A 4GX1A 5KLVH 2PYLA 2GSMB 4NR1A 1YJ9V 5BR8B 3H1KH 3RYHA 3M7MX 1M9NA 4YJ2B 3BY6A 1NVPB 4QPKA 4MVSA 3KG2A 4JI3B 2OYQA 1OHHG 1VQ6V 2LO1A 4OX9O 5D5QA 4XBFA 3WG7B 3FAVA 3JAKB 2CDYA 2AXTZ 2DYSB 4DO2A 2OWOA 1G8MA 1D2DA 2CK3G 1KU9A 3ZRSA 2CTQA 4NB5A 4O2AB 1QHTA 1M57B 1H2KA 1HNZO 1YHQV 5H2FZ 3FYIB 2CAZC 4DR1B 4B3SB 4JI8B 4J41A 1I7FA 2EIKC 2DE0X 5B66Z 3ABLB 2RMKB 4F6RB 1VEWA 5CA3A 1SQQH 3JYCA 4HBNA 5LBQA 3P32A 2UUBB 2ZNIA 1SESA 2E76B 2QKSA 2Y0IA 5JJNB 3W7UA 3P3PA 1NR7A 3P30A 1OCRC 1ENVA 1T5EA 4O4LB 5GTIZ 1R6NA 1TAEA 3CCQV 2N04A 2BOBC 3U0ZA 2CTWA 5KX5B 2A0LA 4ZBMA 3NR7A 3QNEA 1VF5B 3HB3B 1SS3A 4ZI7B 2HHHB 1X59A 2P06A 3FB5C 5KHKA 1Y6XA 3OMNB 1NT2B 3CCJV 3W7TA 2QKAA 2R70A 4NTWA 1NVPD 5JH7A 5EK0A 2YEVB 1AR4A 2EINC 1S77D 1MZEA 4ZOLA 3MDSA 4TOIA 5KAFZ 2VQFO 4GKKO 4J7ZA 1S76D 3B77A 4PD4F 3ZRVA 1VQ9V 2AHZA 1ROPA 3BABA 4TUYA 1YXBA 3JD4A 4NKGB 5LA6B 5BXZA 5KAIZ 5LYJA 3SYAA 4MW3A 4UCTA 5CA1B 1XREA 2WSSG 2MK3A 4B3TB 1SZTA 1BE3H 5B3SB 2JK5C 4DR7B 2XTAA 5A9GA 2ZM6O 3SPCA 3HKBA 3D36A 1IXMA 2DN9A 1WLEA 1OCZC 3IJ4A 4U3FH 4WBNA 1R6TA 2Q68A 4DXWA 3ZEDA 3BA9A 1V54C 4DV4O 2WLKA 3G4SV 5BY1A 4TQDA 3HKEB 5CMUA 4DV7O 1FXKA 2A79B 4EB6B 3K08A 2GBOA 1NH2B 1Z5VA 1IBLO 4R7CA 3D3IA 2V4DA 4YIOA 4DR2B 2HFEC 4JYAO 1P7BA 2E74B 3K03A 4B3RB 5GONB 3Q4HA 2EZPA 4H44B 2HVKC 1I0HA 1SC5B 4X20A 3LDEA 4CS2A 3G80A 3EXAA 4LF8B 1O9GA 4J7JA 4KL1A 3U10A 3CXHF 4LF6O 3UO3A 1EZVH 4ZHQB 1SQVH 3AG2C 5B5EZ 2PZSA 2EZOA 2YS8A 3T4ZA 2JIZG 1TVKB 3T2MA 1G6UA 1G4YB 1QU7A 1VQPV 5GW7A 1L8DA 2HP8A 5DM6V 1HNXB 3ZRXA 4TSFG 2ZE5A 3ABKC 1GM9A 4G28B 3T1HO 4DRXB 5CB4A 2QJ1A 1OCOC 5EBWC 1AB3A 1MNGA 3CX5F 4GKJB 3AG7A 4X64O 1H8HG 4CC6A 1ZL8B 5BMVB 3ASOC 4GUNA 3SDLA 2QE7G 1M90W 1NH2D 1I5YA 4CH3A 2E5LO 2X7RB 3K5OA 1Q82W 2P90A 3ZCCA 4MTXA 3BRCA 5KHHA 3M99B 2IBZH 2ZQMA 3EFFK 3JSLA 3F5WC 4NXMO 4GX0A 3AG3C 3RFRA 1XNQO 2RJZA 3IFXA 3JSNA 3J81N 1WA8A 2QWNB 3OMIB 2YXHA 2PI5A 4MTGA 3L71H 1XHZA 1Q81W 2Q4PA 3CB2A 1EN6A 2IH1C 1TUBA 2B9ZA 2R72A 2C2AA 1M56C 2WLMA 1JX9A 5EC1C 4FLVA 2BSKA 3N2GB 3G6EV 4UB8Z 2EIJB 4H13B 2DQ0A 2LJ2A 5B1NA 5LP6C 1XEQA 3W7WA 2EIKB 2QKCA 1EN5A 1XMQO 4O4JB 3ZRWB 2WLIA 3L73H 1F4NA 5DEDA 1J95A 2JS3A 3ZIAG 3LDCA 4GYCB 1GKFA 1SQBH 2UXBB 2JEUA 1E1QG 1SQGA 3KCXA 1OCRB 4RAIA 1P4RA 4KUMA 5B1AC 4W4LA 3AG4C 2W6JG 3BVOA 2PI4A 5LL6Y 3N27A 4DV1O 5ITZB 3K59A 4UV8A 2L35A 4DV6B 3CCMV 1O9HA 3D3QA 1UPGA 2GV9A 1XMOO 2GUZB 4H37A 3CCRV 3ZHRA 3CJHB 4QIWF 4TWKA 2ZCEA 4J7KA 1H2MA 1RM1B 2JS5A 4MSWC 4JI6O 3SGIA 3K57A 1CEZA 4I50B 4NXNO 3CRRA 3DXRB 4X1KA 4N21A 4DV0O 3L70H 4KFMA 2VWJA 1QR8A 4X1YA 1XL4A 2JVDA 2XAFA 3FB8C 3SYPA 1BSMA 3A8TA 1VQMV 3SR2C 4GZRB 4GX2A 1FJGO 2UXCO 3I55V 1SRYA 3ABMC 4A5UB 5J2TB 1KP3A 2XAHA 5IJ0B 2LGWA 4GCZA 4JI7B 4KHPO 3JAKA 3CC7V 1W2BU 1GTOA 3F5TA 2L6LA 1YVWA 4H0LB 4FM2A 1I08A 2B1IA 3K5MA 2GTSA 1FPOA 3N2KA 3ICXA 3CCUV 1ZX3A 4O2AA 1OCZB 1FFTB 1PKXA 4AQYB 1V54B 3DGEA 4HAMA 4I55B 4YHHB 1N4CA 1EBOA 4I4TB 2UU9O 1K8AW 3CRCA 2WAMA 3OEEG 3O65A 1V9PA 2Q67A 4O4LA 1Q8IA 4MVRA 1TUEB 4ICGA 4X65B 2F43G 1K97A 5F2VO 2ETNA 3JARB 4PJ0Z 1Q3EA 2LFRA 1RPRA 5KX5A 3OMAB 3K58A 1KD1W 5LXTA 2DQ3A 3M8AA 3AG2B 4ZI7A 4DV5B 2XUMA 1XNRO 5KA5A 3ETQA 5IJ9B 3RWRD 3CCEV 2ZD9A 1F4MA 2ZXWC 5LGUA 3ZMUA 4LF7O 3L72H 5BR8O 1IDSA 3I56V 1DGSA 1N34B 1V55C 3JALB 4JI3O 3T1YB 3TCUA 3ABKB 5B1BC 2G38A 1FS0G 4LH7A 1DTOA 3ABTA 3RT3C 5LA6A 4DR6B 1Z2GA 3OR6C 1S0VA 1OCOB 3J80N 3H1LH 3OEHG 3AG1B 1AI6A 4DK1A 1WAZA 1PNKA 1OCCC 4DR1O 3ASOB 4DR4B 4B3SO 4DUYB 4KXRA 1HW7A 5L3GA 3S3XA 4X62B 3RYIB 1XBLA 2KB1A 4X66B 5JVDB 5C8YB 4LF5B 3OT7A 2ZINA 1GN2A 3E89A 1N36B 4P9OA 4UB6Z 4X1IB 4W4KA 2UUBO 1ZLZA 1B3QA 3AG3B 1JJOA 1YI2V 1GN6A 2ITDC 4I0XB 2WA3A 3HKEA 4LFCB 4HNAB 4LWSB 3APQA 3SYCA 5L3DA 4EB6A 3JAMN 4YY3B 1WN7A 2DWDC 3EHBB 4K8XA 2ODMA 2HHHO 1M56B 2F1MA 5GONA 1RSOB 1XI1A 1M1KW 4O4IA 2X0LA 5CA0A 5JQGB 4FM1A 1QLEC 1VIBA 2V1DA 3C3TA 4GX5A 5LP6B 3BCCH 2FTKA 2O57A 5IWAB 3K04A 4FFKA 2ZE8A 1VQOV 2NR5A 3A0BZ 5L3CA 1N33B 5AG2A 3CP1A 1TVKA 3CE2A 5LHIA 2HR3A 3CPWU 3RW0A 1QVGU 1CPYA 4K3AA 3LNNA 4F6EA 5LMNB 3OFNG 5B1AB 3E86A 2EIMB 3AG4B 2Y4UA 1THZA 1NTKH 4PA6A 4B3TO 4DR7O 1R73A 2Q73A 2F4VB 4DRXA 2GDSA 3K9AA 1KKDA 2MW2B 1IZ3A 1ZWIC 3B2EE 4QNHB 4XDLA 5BMVA 1Y4MA 3F7YC 5E1AC 2YICA 1VMGA 1E1RG 3SPHA 2Q0OC 4P9PA 3SPIA 3OUFA 1HWYA 4DR5B 5CBFA 1BMFG 2Q6AA 4PA3A 1FD9A 4FFBB 4DR2O 1F51A 1IVSA 4I9QA 5EBMC 3CSXA 5FPRA 4DV2B 1W0JG 5IY5C 4B3MB 1ZAUA 3W7XA 3RBZA 1CP9A 3QVNA 2XAQA 3PJSK 4LF8O 2R9AA 2XOKG 3ABMB 2R9RB 3DSQA 2VQEB 1MABG 2Y48A 4PDMA 4TV8B 4CS3A 5JWPA 1DF4A 3UKMA 3OTOB 2OCCC 2DYRC 3N2GA 3E8FA 1RFYA 3JAWB 1YDXA 4CZZA 1GMGA 1I5XA 4BIUA 1MZFA 4UFZA 2LFSA 2ZR3A 2ADPA 3STZC 4D6TH 1JPXA 4O4JA 4UCUA 1BQZA 1YITV 4I9WA 1VQ8V 3ZRWA 4K0KB 1MSWD 1Y66A 4FJCC 1UJWB 3GWOA 1IX9A 2Y0PA 4OGQB 5E79Z 2D2CB 1OJHA 3OUSA 1AI5A 1R3LC 1XQ8A 1M5IA 4RUFA 1HNZB 4GKJO 2KG7B 5LOVB 4JI0B 4IHJB 4EFBA 2Y69B 2WPDG 3RGBA 1EN4A 2LP7A 5ITZA 4Z2WA 1URFA 1KBHA 1YJNV 2CTRA 2BTQB 3ZJZA 4I5SA 3CCVV 1JOYA 4JI5B 3UQ8A 3A2FA 3G71V 3RVZA 1K5QA 5KA6A 1FXVA 2GUZA 2LW7A 2FYUH 2ZXWB 4IIJB 1Q5OA 1JR9A 2PYJA 1BHAA 3ZMVA 1UFIA 4EKWA 1Q86W 2Q8VA 4I50A 2JDIG 1IBMB 1V55B 2UUCB 3O9OA 3HKDA 4LF9B 2P6JA 5B1BB 5LHHA 1I94B 3CC2V 3ZHQA 2AGAA 4J42A 4BW5A 5KUKA 1SQPH 4D7TA 1GH6A 1NR1A 1MOFA 3ETGA 2EILC 3VBBA 1BZKA 1E79G 3FKSG 1GN4A 5J9PC 3B8MA 3H1JH 4U7OA 1VQNV 1R6KA 4HYOA 2W6IG 2LQTA 4WFAV 2YI8A 1TGOA 3TETA 4GKKB 5EIBC 5EYPB
chains in the Genus database with same CATH topology
1UPGA 1RFYA 2Q0OC 4NKGB 1URFA 4IGGA 2HJDA 4NB5A 1CXZB 1US6A 2RMKB 4DYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPG A;  1RFY A;  2Q0O C;  4NKG B;  1URF A;  4IGG A;  2HJD A;  4NB5 A;  1CXZ B;  1US6 A;  2RMK B;  4DYL A; 
#chains in the Genus database with same CATH topology
 2ZR2 A;  2JJ1 G;  3T1C A;  1YJW V;  3K5L A;  2PUS A;  2XND G;  3JCU Z;  4JI1 B;  2P7T C;  3IGA C;  2UXB O;  3ABU A;  3QTC A;  2Q0A A;  5KHJ A;  4Z1V A;  2H94 A;  4L8J A;  2UUA B;  4MVM A;  3UM7 A;  4GLX A;  4OPA A;  1JFF B;  4LCU C;  4PDV A;  1PL4 A;  2PF4 E;  4I4T A;  1XDC A;  1DK1 A;  2HJF C;  1ZUQ A;  4FK5 C;  5K1P A;  4B7K A;  4DUZ B;  4DV6 O;  4FLX A;  4KP4 A;  2AHY A;  4AIL C;  3BA8 A;  3WB0 A;  4LH6 A;  2IH3 C;  3SPJ A;  2IJH A;  1XHX A;  1PPJ H;  3OGI B;  2HEP A;  2CTP A;  1US6 A;  1VQ7 V;  3JAR A;  3AK2 A;  1AR1 B;  4QPJ A;  2D3O W;  4FVM A;  1VF6 A;  3OM3 B;  4DV7 B;  4J9Y B;  4JTA B;  2Q7H A;  4WFF A;  4JF3 A;  2DJV A;  4IYI A;  5IJ9 A;  1S3J A;  2VWK A;  5H5N A;  3CRM A;  2FL4 A;  2Z5U A;  2DOS A;  4PEL A;  1SA0 B;  1OV9 A;  5FLX N;  3FB7 C;  2BOC C;  3QO7 A;  3DC6 A;  5FPO A;  2WLN A;  3SYQ A;  1P84 F;  5H6Q A;  5JJJ B;  3HR0 A;  1WPB A;  4X9Q A;  2ZDI C;  3JAL A;  2IM9 A;  3VQW A;  1WB7 A;  5H9C A;  4ZOL B;  1VQL V;  3K0G A;  5L3F A;  2ZKO A;  2YC0 A;  4JI7 O;  4QE9 A;  2RCV A;  1AJN A;  1SQX H;  4R50 A;  4QGP A;  2Q7G A;  2JGD B;  1NZ6 A;  4JI2 B;  4JZ2 A;  4AQY O;  3ZN0 A;  3RYI A;  1GN3 A;  4LFB B;  3KKY A;  5C8Y A;  5JVD A;  4JI4 O;  4J10 A;  5J2U A;  3AK1 A;  1J5E O;  4PI0 A;  2ZNJ A;  4X1I A;  1MSD A;  1JMK C;  3F7V C;  1OZ0 A;  1GM7 A;  5IY5 B;  1AI4 A;  5LMU O;  4WBN B;  5LHG A;  1SZX A;  4HNA A;  4LWS A;  2ZT9 B;  1XOU A;  3H1H H;  2EIN B;  5D5P A;  5K1X A;  5GTH Z;  4DV5 O;  1S5H C;  3QO5 A;  4TT3 G;  2OCC B;  5EZY B;  4DR3 O;  2DYR B;  1RSO A;  3UT5 A;  2RN9 A;  1KB9 F;  2Q69 A;  5JQG A;  1U96 A;  3X2Q C;  3JAT B;  4MW8 A;  2ZIM A;  4U3J B;  4PA7 A;  1VAR A;  3B8N A;  1XIL A;  2QWQ B;  4BW9 A;  4YJ2 A;  2AZ0 A;  1QQC A;  2NLJ C;  3T1Y O;  3J7A U;  5BZB A;  2P4K A;  2OCH A;  2LW1 A;  1COW G;  3OGC C;  4BR6 A;  2P4V A;  1K3E A;  5JCO A;  1HR0 B;  1MA1 A;  2GHY A;  1Z5W A;  1HNW B;  3H1I H;  1D5A A;  3FD9 A;  2JEX A;  3E22 B;  4YJ3 B;  3LSU A;  1K7D A;  4LF4 B;  2OT5 A;  4JAS A;  1X4T A;  5KMG B;  4DR4 O;  1QBZ A;  4DUY O;  4X62 O;  2DW4 A;  4O4H B;  1AP5 A;  1BT8 A;  4X66 O;  4B08 A;  4FZ0 A;  4F6R A;  2UXD B;  3VQV A;  2XAS A;  3OE7 G;  1N36 O;  3E83 A;  4FMT A;  4FLY A;  4JYB A;  3HKC B;  4XDK A;  4JTC B;  3WB2 A;  1B04 A;  3C3S A;  2W0F C;  2WLJ A;  2WA4 A;  2Z3Y A;  5KHG A;  4PI2 A;  1KEC A;  5B3S C;  4LFC O;  1R3I C;  1M4U A;  1JCH A;  4G27 B;  4R6Z A;  4YY3 O;  4AHC A;  5L3B A;  1Q6U A;  4FFB A;  1Y76 B;  5CBH A;  3U11 A;  3JAS B;  1N32 B;  2RQ6 A;  3TXS A;  2IJK A;  1S72 V;  1CXZ B;  2QSA A;  2H3O A;  2YEV A;  2X6C A;  1EM1 A;  4P30 A;  3H9V A;  1R3K C;  5IWA O;  1H2S B;  4TV8 A;  3UCS C;  4DW0 A;  1QR9 A;  4UXN A;  2ZIO A;  1N33 O;  1ARO P;  4RO2 A;  1TUB B;  2HJD A;  1AJQ A;  1WP8 A;  2A3Q A;  3ETE A;  2P22 C;  1NJI W;  3VOU A;  2FB5 A;  3MHH C;  1PNM A;  3ETD A;  5LMN O;  1IBK B;  2UXC B;  1JQ0 A;  5CA1 A;  2DMX A;  2OTJ V;  4JI8 O;  3JD1 A;  1BGY H;  2KKW A;  2F4V O;  4KHP B;  1DF5 A;  1M93 A;  1Y74 B;  2WLI B;  4O2B B;  3A0R A;  4MTF A;  1KYO F;  4HZ3 A;  4JAU A;  1SF9 A;  1JJ2 U;  1ZTE A;  2KG7 A;  5LOV A;  2OIE A;  4IHJ A;  2ZE7 A;  3K3W A;  2AZ2 A;  3AEI A;  3FX7 A;  4BIZ A;  5JJE B;  4UVB A;  2EJ7 A;  1LUW A;  4ASU G;  4D7S A;  1AI7 A;  2BTQ A;  4CH4 A;  3FYE B;  4DR5 O;  2F66 C;  5CBG A;  3THO A;  3K9S A;  1B06 A;  3CC4 V;  1S5L Z;  1K4C C;  4DYL A;  4IIJ A;  1PL0 A;  4DV2 O;  2YIA A;  4QE7 A;  4B3M O;  4FLT A;  3BAA A;  1YZB A;  1VQ4 V;  1LNQ A;  2A06 H;  1NS1 A;  2VQE O;  4ZHQ A;  1F23 A;  1GRJ A;  3OTO O;  4UCS A;  2YIB D;  4PA4 A;  3CME V;  1S5J A;  3FB6 C;  1G1X B;  3ZMZ A;  2WLL B;  4PDR A;  3D8C A;  4YIP A;  2FKX A;  4MT8 A;  2VS0 A;  4MS2 A;  4LF7 B;  2QEX V;  3EVK A;  2WLH A;  3MHS C;  2IU0 A;  2DWE C;  2YI9 A;  3RYC B;  4Q6G A;  1AVM A;  1PP9 H;  2FML A;  4CH5 A;  2QA4 V;  3R65 A;  2M6Y A;  5EYP A;  4K0K O;  3LSQ A;  2HLD G;  3K79 A;  5IYZ B;  1NBM G;  3I5D A;  1N0N A;  5B1O A;  2A7W A;  5DN6 G;  3OTF A;  3SJB C;  4JV5 B;  3VQX A;  4LC1 A;  3ZHU A;  3N2K B;  2EIJ C;  5IT9 N;  4JI0 O;  4UVA A;  1AR5 A;  1ZL8 A;  1JFF A;  5HFM A;  1W59 A;  4DV3 B;  5IYC O;  2NNU A;  1K73 W;  2QWR B;  4JGS A;  4ZKI A;  2IJI A;  5L3E A;  1VF7 A;  4TQF A;  4JI5 O;  1MG1 A;  2F95 B;  4U7N A;  2B1G A;  3X2Q B;  4B3R O;  3D36 C;  1HP8 A;  4GT1 A;  2JJ2 G;  1PD3 A;  5IDJ A;  4PA9 A;  2P67 A;  3NXS A;  3CD6 V;  1IBM O;  5LXT B;  2UUC O;  1K33 A;  3K5N A;  4LF9 O;  1FXK C;  3QF7 A;  1I94 O;  2N74 A;  4LNU B;  3TXQ A;  4YXW G;  2R9I A;  1SA0 A;  3W7S A;  4LFA B;  3RYF B;  3T4D A;  1PNL A;  2YXL A;  2K9P A;  4IYH A;  3JD3 A;  4P2Z A;  3ZHT A;  4CS4 A;  3CXC U;  1RM1 C;  4LBE C;  3LNM B;  4NVP A;  4WCE V;  2QM4 A;  2AW9 A;  4ABM A;  1VQ5 V;  1HNX O;  4FLZ A;  4OX9 B;  4JI1 O;  1KMI Z;  1L0N H;  1NU1 H;  5HFL A;  1JA8 A;  3BHP A;  2JGD A;  3JCZ A;  2VRZ A;  4ZIB A;  2UUA O;  2QM7 A;  3ASN C;  1WP7 A;  3OAA G;  3ZBH A;  4MVO A;  4UCV A;  4MVU A;  3TGU H;  4J80 A;  1JVM A;  2QM8 A;  4H33 A;  3CS5 A;  5LGT A;  4DUZ O;  5FNV B;  2PTM A;  3WU2 Z;  1KKC A;  3CJH A;  4TV9 B;  2F93 B;  3DTU B;  3STL C;  1FFX B;  1BQ0 A;  1BCC H;  2JRI A;  1H2G A;  2EJR A;  3DXR A;  1U97 A;  2BCC H;  5EZY A;  1Q90 D;  3E8B A;  4IT5 A;  1NTM H;  3E2E A;  3GVM A;  4FZ1 A;  1BS3 A;  2E75 B;  4Q20 A;  1NI8 A;  5TIS Z;  3B40 A;  1H2N A;  3JAT A;  5KHI A;  3DC5 A;  4U3J A;  2QR4 A;  2JGU A;  4O4I B;  5CA0 B;  3SJQ C;  4RQF A;  4JZG A;  2CH7 B;  4JAV A;  3BEH A;  3TJT A;  1K9M W;  4JYY A;  1FYJ A;  1OCC B;  5FL7 G;  3ZN1 A;  3RYH B;  1VF6 C;  1FAF A;  2UXX A;  5J2T A;  1QLN A;  2NN4 A;  2VQF B;  5IJ0 A;  1FXH A;  2P5O A;  3CMA V;  5LGN A;  3GB7 C;  4FM0 A;  3AK3 A;  1TA8 A;  3ZMS A;  3OR7 C;  3FAV B;  3E22 A;  4YJ3 A;  3TK1 A;  5CN0 A;  1SET A;  2V7Q G;  1IUR A;  1H38 A;  5KMG A;  4JI2 O;  2WWW A;  1RP3 B;  2KQX A;  3LSS A;  2K1E A;  4L87 A;  2ILM A;  4I55 A;  4O4H A;  4LFB O;  4FLW A;  4X8A A;  4UUJ C;  3SJA C;  2IJJ A;  2ZM6 B;  3CHX A;  5KUM A;  3AG1 C;  4FLU A;  3HKC A;  2QWP B;  4E4E A;  1NQT A;  4IL6 Z;  1QVF U;  3K0D A;  1QLE B;  4WF9 V;  4K35 A;  3H01 A;  4DV4 B;  2CE4 A;  1Y76 A;  3P3N A;  2EBO A;  3JAS A;  1IBL B;  1AIL A;  2HVJ C;  1H2L A;  1A32 A;  1SER A;  4JYA B;  5IYD O;  4NTY A;  1SKV A;  3G67 A;  5JH7 B;  3PN1 A;  1N0J A;  3IC7 A;  3QO8 A;  3APO A;  4LF6 B;  5EBL C;  2LGQ A;  4B7E A;  2CGN A;  2QGN A;  4G2K A;  1EFR G;  1WJZ A;  3IC9 A;  1L1F A;  3ZMT A;  1HR0 O;  2YIB A;  1HNW O;  4NYK A;  4TUY B;  1YTF B;  3CYO A;  4BAY A;  3ZHV A;  4LF4 O;  4EFE A;  2EX3 A;  5LYJ B;  4JPR A;  1PV0 A;  3A0H Z;  3CWB H;  4YHH O;  1Q6I A;  1Y74 A;  4O2B A;  1BHB A;  1BL8 A;  5EC2 C;  1YF2 A;  1Q7Y W;  2UXD O;  3WG7 C;  3T1H B;  3JD2 A;  3FFQ A;  4UCO A;  1IXB A;  5JCO C;  1B6Q A;  1D5N A;  2DYS C;  1PM9 A;  3CRQ A;  3HKB B;  3L74 H;  1GAX A;  1N8R W;  4X64 B;  2EIM C;  4X89 A;  1M57 C;  2Y4T A;  4X65 O;  4I0X A;  3RN4 A;  3JD0 A;  4I7Z B;  4AI8 A;  1F7Y A;  4RQE A;  1YEW A;  1KP2 A;  4FPP A;  2E5L B;  1R1B A;  3ABL C;  4E2L A;  2OIG A;  1EZJ A;  4JYC A;  2IW5 A;  4MVZ A;  1FXK B;  1GO3 F;  3ZS8 C;  1YIJ V;  4JTD B;  1N32 O;  2YUA A;  2Q9L A;  3L75 H;  1GK9 A;  4NXM B;  1R3J C;  1SQF A;  1XNQ B;  3Q4H B;  3WB1 A;  2Q7E A;  3L9D A;  2M7W A;  2CGO A;  2ZDI A;  4X20 B;  2YXY A;  3S3W A;  1VQK V;  5LP6 A;  1K4D C;  1VP7 A;  1NKD A;  2N05 A;  1K92 A;  1N34 O;  1Q6H A;  3R66 A;  2YDE A;  3HKD B;  1KUQ A;  1YTF D;  2OTL V;  2WLL A;  1KQS U;  2CUG A;  3G6B A;  1RPO A;  4LR3 A;  1ORQ C;  2EUL A;  4DR6 O;  4UVC A;  3MAQ A;  2QTS A;  2X6A A;  3RYC A;  3ASN B;  1IBK O;  2ATK C;  3WFV A;  1XMQ B;  3E35 A;  4FIP C;  3KCY A;  5IYZ A;  2XT9 A;  4WFH A;  4LF5 O;  4J9Z B;  2RDC A;  3CEI A;  2XAG A;  1K5S A;  2HG5 C;  5CB4 B;  5C93 A;  1ZSP A;  1LUV A;  5IE9 A;  3B4S A;  3CCS V;  4J11 A;  1QNM A;  4NTX A;  2QTO A;  4JI4 B;  1P7G A;  4DV1 B;  4JAA A;  3UO2 A;  1P49 A;  1J5E B;  3GWK C;  1Q43 A;  3SPG A;  4IGG A;  1WNS A;  2BE3 A;  2QDO A;  2GTA A;  5A2Q N;  5LMU B;  3LDD A;  1XMO B;  2ADQ B;  3SJC C;  2EIL B;  2Y69 C;  5DEC A;  3SYO A;  1HDJ A;  1GM8 A;  3E8H A;  4OPH A;  1WA8 B;  4JI6 B;  1WPX A;  2HKO A;  4RUE A;  2YID A;  3ML0 A;  5H6R A;  4MVQ A;  3HPL C;  4NXN B;  3IAY A;  4LNU A;  3K06 A;  1LR1 A;  2BTO A;  4DR3 B;  2XHB A;  4DV0 B;  4N23 A;  1XL6 A;  4DW1 A;  3RYF A;  3OD4 A;  2KSD A;  1YSC A;  3JAW A;  2BSK B;  4UV9 A;  4QJF B;  2IU3 A;  4PV1 B;  3MD0 A;  4RWU A;  4K8Z A;  1FJG B;  3BFR A;  1FKA O;  4PHZ A;  3OW2 U;  3C90 A;  2Z0A A;  2RNB A;  2B5U A;  3QG5 A;  3B09 A;  2PGG A;  3BPZ A;  3ZHS A;  4WFB V;  2X6B A;  3LUT B;  4DK0 A;  4CC5 A;  3CRA A;  4X88 A;  4JV5 O;  1AJP A;  3CCL V;  1XUQ A;  1YCI A;  4R8C A;  2H8P C;  4F4L A;  1NTZ H;  1DLB A;  3ZX6 A;  4DV3 O;  1W0K G;  1QCE A;  1H8E G;  5IYB O;  1WB8 A;  4WFG A;  5J2U B;  4OXS A;  2UU9 B;  5FNV A;  1AP6 A;  4MTO A;  4BIO A;  2PY5 A;  3E8G A;  4EEQ A;  2Q5Z A;  2W0X A;  1K34 A;  4XDJ A;  3RVY A;  2ITC C;  4TV9 A;  1MMM A;  2QWO B;  4PDL A;  2ARH A;  3VQY A;  5EIB D;  2UXN A;  1FFX A;  4CBC A;  4UCR A;  2E3C A;  1L0L H;  4BWA A;  2YSU B;  1Y67 A;  2XAJ A;  3KZI Z;  1XNR B;  4Z1M G;  1KC8 W;  4X1K B;  3UT5 B;  2ZE6 A;  4LFA O;  2A9H A;  2F23 A;  4X1Y B;  4CH6 A;  4LP8 A;  4C7U A;  4WFE A;  2CH7 A;  4GX1 A;  5KLV H;  2PYL A;  2GSM B;  4NR1 A;  1YJ9 V;  5BR8 B;  3H1K H;  3RYH A;  3M7M X;  1M9N A;  4YJ2 B;  3BY6 A;  1NVP B;  4QPK A;  4MVS A;  3KG2 A;  4JI3 B;  2OYQ A;  1OHH G;  1VQ6 V;  2LO1 A;  4OX9 O;  5D5Q A;  4XBF A;  3WG7 B;  3FAV A;  3JAK B;  2CDY A;  2AXT Z;  2DYS B;  4DO2 A;  2OWO A;  1G8M A;  1D2D A;  2CK3 G;  1KU9 A;  3ZRS A;  2CTQ A;  4NB5 A;  4O2A B;  1QHT A;  1M57 B;  1H2K A;  1HNZ O;  1YHQ V;  5H2F Z;  3FYI B;  2CAZ C;  4DR1 B;  4B3S B;  4JI8 B;  4J41 A;  1I7F A;  2EIK C;  2DE0 X;  5B66 Z;  3ABL B;  2RMK B;  4F6R B;  1VEW A;  5CA3 A;  1SQQ H;  3JYC A;  4HBN A;  5LBQ A;  3P32 A;  2UUB B;  2ZNI A;  1SES A;  2E76 B;  2QKS A;  2Y0I A;  5JJN B;  3W7U A;  3P3P A;  1NR7 A;  3P30 A;  1OCR C;  1ENV A;  1T5E A;  4O4L B;  5GTI Z;  1R6N A;  1TAE A;  3CCQ V;  2N04 A;  2BOB C;  3U0Z A;  2CTW A;  5KX5 B;  2A0L A;  4ZBM A;  3NR7 A;  3QNE A;  1VF5 B;  3HB3 B;  1SS3 A;  4ZI7 B;  2HHH B;  1X59 A;  2P06 A;  3FB5 C;  5KHK A;  1Y6X A;  3OMN B;  1NT2 B;  3CCJ V;  3W7T A;  2QKA A;  2R70 A;  4NTW A;  1NVP D;  5JH7 A;  5EK0 A;  2YEV B;  1AR4 A;  2EIN C;  1S77 D;  1MZE A;  4ZOL A;  3MDS A;  4TOI A;  5KAF Z;  2VQF O;  4GKK O;  4J7Z A;  1S76 D;  3B77 A;  4PD4 F;  3ZRV A;  1VQ9 V;  2AHZ A;  1ROP A;  3BAB A;  4TUY A;  1YXB A;  3JD4 A;  4NKG B;  5LA6 B;  5BXZ A;  5KAI Z;  5LYJ A;  3SYA A;  4MW3 A;  4UCT A;  5CA1 B;  1XRE A;  2WSS G;  2MK3 A;  4B3T B;  1SZT A;  1BE3 H;  5B3S B;  2JK5 C;  4DR7 B;  2XTA A;  5A9G A;  2ZM6 O;  3SPC A;  3HKB A;  3D36 A;  1IXM A;  2DN9 A;  1WLE A;  1OCZ C;  3IJ4 A;  4U3F H;  4WBN A;  1R6T A;  2Q68 A;  4DXW A;  3ZED A;  3BA9 A;  1V54 C;  4DV4 O;  2WLK A;  3G4S V;  5BY1 A;  4TQD A;  3HKE B;  5CMU A;  4DV7 O;  1FXK A;  2A79 B;  4EB6 B;  3K08 A;  2GBO A;  1NH2 B;  1Z5V A;  1IBL O;  4R7C A;  3D3I A;  2V4D A;  4YIO A;  4DR2 B;  2HFE C;  4JYA O;  1P7B A;  2E74 B;  3K03 A;  4B3R B;  5GON B;  3Q4H A;  2EZP A;  4H44 B;  2HVK C;  1I0H A;  1SC5 B;  4X20 A;  3LDE A;  4CS2 A;  3G80 A;  3EXA A;  4LF8 B;  1O9G A;  4J7J A;  4KL1 A;  3U10 A;  3CXH F;  4LF6 O;  3UO3 A;  1EZV H;  4ZHQ B;  1SQV H;  3AG2 C;  5B5E Z;  2PZS A;  2EZO A;  2YS8 A;  3T4Z A;  2JIZ G;  1TVK B;  3T2M A;  1G6U A;  1G4Y B;  1QU7 A;  1VQP V;  5GW7 A;  1L8D A;  2HP8 A;  5DM6 V;  1HNX B;  3ZRX A;  4TSF G;  2ZE5 A;  3ABK C;  1GM9 A;  4G28 B;  3T1H O;  4DRX B;  5CB4 A;  2QJ1 A;  1OCO C;  5EBW C;  1AB3 A;  1MNG A;  3CX5 F;  4GKJ B;  3AG7 A;  4X64 O;  1H8H G;  4CC6 A;  1ZL8 B;  5BMV B;  3ASO C;  4GUN A;  3SDL A;  2QE7 G;  1M90 W;  1NH2 D;  1I5Y A;  4CH3 A;  2E5L O;  2X7R B;  3K5O A;  1Q82 W;  2P90 A;  3ZCC A;  4MTX A;  3BRC A;  5KHH A;  3M99 B;  2IBZ H;  2ZQM A;  3EFF K;  3JSL A;  3F5W C;  4NXM O;  4GX0 A;  3AG3 C;  3RFR A;  1XNQ O;  2RJZ A;  3IFX A;  3JSN A;  3J81 N;  1WA8 A;  2QWN B;  3OMI B;  2YXH A;  2PI5 A;  4MTG A;  3L71 H;  1XHZ A;  1Q81 W;  2Q4P A;  3CB2 A;  1EN6 A;  2IH1 C;  1TUB A;  2B9Z A;  2R72 A;  2C2A A;  1M56 C;  2WLM A;  1JX9 A;  5EC1 C;  4FLV A;  2BSK A;  3N2G B;  3G6E V;  4UB8 Z;  2EIJ B;  4H13 B;  2DQ0 A;  2LJ2 A;  5B1N A;  5LP6 C;  1XEQ A;  3W7W A;  2EIK B;  2QKC A;  1EN5 A;  1XMQ O;  4O4J B;  3ZRW B;  2WLI A;  3L73 H;  1F4N A;  5DED A;  1J95 A;  2JS3 A;  3ZIA G;  3LDC A;  4GYC B;  1GKF A;  1SQB H;  2UXB B;  2JEU A;  1E1Q G;  1SQG A;  3KCX A;  1OCR B;  4RAI A;  1P4R A;  4KUM A;  5B1A C;  4W4L A;  3AG4 C;  2W6J G;  3BVO A;  2PI4 A;  5LL6 Y;  3N27 A;  4DV1 O;  5ITZ B;  3K59 A;  4UV8 A;  2L35 A;  4DV6 B;  3CCM V;  1O9H A;  3D3Q A;  1UPG A;  2GV9 A;  1XMO O;  2GUZ B;  4H37 A;  3CCR V;  3ZHR A;  3CJH B;  4QIW F;  4TWK A;  2ZCE A;  4J7K A;  1H2M A;  1RM1 B;  2JS5 A;  4MSW C;  4JI6 O;  3SGI A;  3K57 A;  1CEZ A;  4I50 B;  4NXN O;  3CRR A;  3DXR B;  4X1K A;  4N21 A;  4DV0 O;  3L70 H;  4KFM A;  2VWJ A;  1QR8 A;  4X1Y A;  1XL4 A;  2JVD A;  2XAF A;  3FB8 C;  3SYP A;  1BSM A;  3A8T A;  1VQM V;  3SR2 C;  4GZR B;  4GX2 A;  1FJG O;  2UXC O;  3I55 V;  1SRY A;  3ABM C;  4A5U B;  5J2T B;  1KP3 A;  2XAH A;  5IJ0 B;  2LGW A;  4GCZ A;  4JI7 B;  4KHP O;  3JAK A;  3CC7 V;  1W2B U;  1GTO A;  3F5T A;  2L6L A;  1YVW A;  4H0L B;  4FM2 A;  1I08 A;  2B1I A;  3K5M A;  2GTS A;  1FPO A;  3N2K A;  3ICX A;  3CCU V;  1ZX3 A;  4O2A A;  1OCZ B;  1FFT B;  1PKX A;  4AQY B;  1V54 B;  3DGE A;  4HAM A;  4I55 B;  4YHH B;  1N4C A;  1EBO A;  4I4T B;  2UU9 O;  1K8A W;  3CRC A;  2WAM A;  3OEE G;  3O65 A;  1V9P A;  2Q67 A;  4O4L A;  1Q8I A;  4MVR A;  1TUE B;  4ICG A;  4X65 B;  2F43 G;  1K97 A;  5F2V O;  2ETN A;  3JAR B;  4PJ0 Z;  1Q3E A;  2LFR A;  1RPR A;  5KX5 A;  3OMA B;  3K58 A;  1KD1 W;  5LXT A;  2DQ3 A;  3M8A A;  3AG2 B;  4ZI7 A;  4DV5 B;  2XUM A;  1XNR O;  5KA5 A;  3ETQ A;  5IJ9 B;  3RWR D;  3CCE V;  2ZD9 A;  1F4M A;  2ZXW C;  5LGU A;  3ZMU A;  4LF7 O;  3L72 H;  5BR8 O;  1IDS A;  3I56 V;  1DGS A;  1N34 B;  1V55 C;  3JAL B;  4JI3 O;  3T1Y B;  3TCU A;  3ABK B;  5B1B C;  2G38 A;  1FS0 G;  4LH7 A;  1DTO A;  3ABT A;  3RT3 C;  5LA6 A;  4DR6 B;  1Z2G A;  3OR6 C;  1S0V A;  1OCO B;  3J80 N;  3H1L H;  3OEH G;  3AG1 B;  1AI6 A;  4DK1 A;  1WAZ A;  1PNK A;  1OCC C;  4DR1 O;  3ASO B;  4DR4 B;  4B3S O;  4DUY B;  4KXR A;  1HW7 A;  5L3G A;  3S3X A;  4X62 B;  3RYI B;  1XBL A;  2KB1 A;  4X66 B;  5JVD B;  5C8Y B;  4LF5 B;  3OT7 A;  2ZIN A;  1GN2 A;  3E89 A;  1N36 B;  4P9O A;  4UB6 Z;  4X1I B;  4W4K A;  2UUB O;  1ZLZ A;  1B3Q A;  3AG3 B;  1JJO A;  1YI2 V;  1GN6 A;  2ITD C;  4I0X B;  2WA3 A;  3HKE A;  4LFC B;  4HNA B;  4LWS B;  3APQ A;  3SYC A;  5L3D A;  4EB6 A;  3JAM N;  4YY3 B;  1WN7 A;  2DWD C;  3EHB B;  4K8X A;  2ODM A;  2HHH O;  1M56 B;  2F1M A;  5GON A;  1RSO B;  1XI1 A;  1M1K W;  4O4I A;  2X0L A;  5CA0 A;  5JQG B;  4FM1 A;  1QLE C;  1VIB A;  2V1D A;  3C3T A;  4GX5 A;  5LP6 B;  3BCC H;  2FTK A;  2O57 A;  5IWA B;  3K04 A;  4FFK A;  2ZE8 A;  1VQO V;  2NR5 A;  3A0B Z;  5L3C A;  1N33 B;  5AG2 A;  3CP1 A;  1TVK A;  3CE2 A;  5LHI A;  2HR3 A;  3CPW U;  3RW0 A;  1QVG U;  1CPY A;  4K3A A;  3LNN A;  4F6E A;  5LMN B;  3OFN G;  5B1A B;  3E86 A;  2EIM B;  3AG4 B;  2Y4U A;  1THZ A;  1NTK H;  4PA6 A;  4B3T O;  4DR7 O;  1R73 A;  2Q73 A;  2F4V B;  4DRX A;  2GDS A;  3K9A A;  1KKD A;  2MW2 B;  1IZ3 A;  1ZWI C;  3B2E E;  4QNH B;  4XDL A;  5BMV A;  1Y4M A;  3F7Y C;  5E1A C;  2YIC A;  1VMG A;  1E1R G;  3SPH A;  2Q0O C;  4P9P A;  3SPI A;  3OUF A;  1HWY A;  4DR5 B;  5CBF A;  1BMF G;  2Q6A A;  4PA3 A;  1FD9 A;  4FFB B;  4DR2 O;  1F51 A;  1IVS A;  4I9Q A;  5EBM C;  3CSX A;  5FPR A;  4DV2 B;  1W0J G;  5IY5 C;  4B3M B;  1ZAU A;  3W7X A;  3RBZ A;  1CP9 A;  3QVN A;  2XAQ A;  3PJS K;  4LF8 O;  2R9A A;  2XOK G;  3ABM B;  2R9R B;  3DSQ A;  2VQE B;  1MAB G;  2Y48 A;  4PDM A;  4TV8 B;  4CS3 A;  5JWP A;  1DF4 A;  3UKM A;  3OTO B;  2OCC C;  2DYR C;  3N2G A;  3E8F A;  1RFY A;  3JAW B;  1YDX A;  4CZZ A;  1GMG A;  1I5X A;  4BIU A;  1MZF A;  4UFZ A;  2LFS A;  2ZR3 A;  2ADP A;  3STZ C;  4D6T H;  1JPX A;  4O4J A;  4UCU A;  1BQZ A;  1YIT V;  4I9W A;  1VQ8 V;  3ZRW A;  4K0K B;  1MSW D;  1Y66 A;  4FJC C;  1UJW B;  3GWO A;  1IX9 A;  2Y0P A;  4OGQ B;  5E79 Z;  2D2C B;  1OJH A;  3OUS A;  1AI5 A;  1R3L C;  1XQ8 A;  1M5I A;  4RUF A;  1HNZ B;  4GKJ O;  2KG7 B;  5LOV B;  4JI0 B;  4IHJ B;  4EFB A;  2Y69 B;  2WPD G;  3RGB A;  1EN4 A;  2LP7 A;  5ITZ A;  4Z2W A;  1URF A;  1KBH A;  1YJN V;  2CTR A;  2BTQ B;  3ZJZ A;  4I5S A;  3CCV V;  1JOY A;  4JI5 B;  3UQ8 A;  3A2F A;  3G71 V;  3RVZ A;  1K5Q A;  5KA6 A;  1FXV A;  2GUZ A;  2LW7 A;  2FYU H;  2ZXW B;  4IIJ B;  1Q5O A;  1JR9 A;  2PYJ A;  1BHA A;  3ZMV A;  1UFI A;  4EKW A;  1Q86 W;  2Q8V A;  4I50 A;  2JDI G;  1IBM B;  1V55 B;  2UUC B;  3O9O A;  3HKD A;  4LF9 B;  2P6J A;  5B1B B;  5LHH A;  1I94 B;  3CC2 V;  3ZHQ A;  2AGA A;  4J42 A;  4BW5 A;  5KUK A;  1SQP H;  4D7T A;  1GH6 A;  1NR1 A;  1MOF A;  3ETG A;  2EIL C;  3VBB A;  1BZK A;  1E79 G;  3FKS G;  1GN4 A;  5J9P C;  3B8M A;  3H1J H;  4U7O A;  1VQN V;  1R6K A;  4HYO A;  2W6I G;  2LQT A;  4WFA V;  2YI8 A;  1TGO A;  3TET A;  4GKK B;  5EIB C;  5EYP B; 
#chains in the Genus database with same CATH homology
 1UPG A;  1RFY A;  2Q0O C;  4NKG B;  1URF A;  4IGG A;  2HJD A;  4NB5 A;  1CXZ B;  1US6 A;  2RMK B;  4DYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...