2RMKB

Rac1/prk1 complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
81
structure length
81
Chain Sequence
GIPATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDIIRMQLRRALQADQLENQAAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein/transferase
molecule keywords Ras-related C3 botulinum toxin substrate 1
publication title The Rac1 Polybasic Region Is Required for Interaction with Its Effector PRK1
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 81
sequence length 81
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02185 HR1 Hr1 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2rmkB00
2Q0OC 4IGGA 1CXZB 1UPGA 1US6A 1URFA 4NB5A 4DYLA 2RMKB 4NKGB 1RFYA 2HJDA
chains in the Genus database with same CATH superfamily
4BW9A 3TGUH 1YJNV 2OTJV 3STZC 4LR3A 4K8XA 1QCEA 2F23A 4E4EA 5IYBO 1VQ8V 3ZCCA 4DK0A 1NZ6A 4DUZB 1YTFB 4DV1O 4JI4B 1G8MA 2ZE8A 2JEUA 1PL0A 3QO5A 1PKXA 4GKKO 2YXYA 4CS3A 4HYOA 1IXMA 4OX9O 2Y48A 3UT5B 2DQ0A 4X66B 2GHYA 4ZOLA 3QVNA 1XOUA 2ILMA 4DR2B 4PI0A 4DR6B 1FKAO 4JI6O 2FMLA 1N36O 1QVFU 2UUBO 4W4KA 5F2VO 1FAFA 1M57B 4R8CA 2JVDA 1PL4A 3STLC 1SRYA 3H1LH 3OFNG 2QJ1A 4JI3B 3BRCA 3CCRV 1KECA 4LF7O 2XAQA 5BR8B 4WFAV 1GN4A 1NJIW 3AK3A 2PI5A 5LYJB 3OR6C 5CA1A 4GX0A 1XEQA 4UV8A 3UCSC 4QIWF 1H2KA 2W0XA 3ZMSA 2QM4A 1QLEB 3K04A 4OGQB 4C7UA 3UT5A 3ZHTA 2VWKA 2OTLV 2WSSG 2NN4A 1M57C 5IY5B 1F7YA 4HZ3A 4JI2O 3G67A 2IM9A 2MW2B 4RWUA 4LNUA 1RP3B 2IU3A 4IYIA 4D7SA 1KP3A 2A79B 3UO2A 5FL7G 2YS8A 1ZL8B 2ADQB 3H1JH 4BWAA 2GTSA 1S0VA 5B3SB 1FXHA 5KA6A 3FB5C 1Y67A 3QO7A 3CJHB 4CH4A 3K59A 2X6BA 1GN3A 2UXDB 1BE3H 1AVMA 5D5PA 5KUKA 1QLEC 3ZHUA 1FXVA 3SYAA 1DF5A 2QWRB 1YI2V 5EIBC 4JI7B 1YJ9V 2ZDIC 4EB6B 5IY5C 2ZDIA 4UUJC 1XNRO 2AW9A 1TUBA 1HNWO 1SQFA 1N8RW 1MG1A 4UVBA 4JTCB 3K0DA 2IJKA 1MA1A 2WA4A 1NTMH 3L72H 3BHPA 2PF4E 1ZL8A 5B3SC 2QGNA 3SJCC 4X1KB 3JAKB 4JZGA 4PDMA 1WP8A 2JJ1G 5IE9A 1AJPA 1V54B 2YC0A 2H8PC 3CJHA 3JARB 3G71V 1AI5A 5H6RA 4ZKIA 4DK1A 1H2GA 4DV5O 5H6QA 2CAZC 2FKXA 5LA6B 2ZM6B 3ZN0A 4G27B 2C2AA 2QM7A 1R3LC 4EB6A 2N05A 3SJBC 3M7MX 1JQ0A 1VF7A 3CC2V 1HR0B 1Q43A 1BQZA 4J42A 4FMTA 1U96A 2Q68A 4O4HB 4TV8A 4FLUA 1Y76A 3TXQA 2XTAA 2A0LA 1BSMA 4X62B 4UCTA 2D2CB 4J9YB 1G6UA 1J5EB 2UXBB 2ZE7A 1AJQA 4JGSA 1WB7A 1XI1A 3CCSV 2AZ0A 4X1KA 2Q8VA 3JAKA 4IYHA 4P2ZA 2FTKA 1V54C 5BMVB 2ZCEA 4FIPC 1OV9A 3WB0A 5EK0A 2GV9A 2WA3A 3JD4A 3JARA 3CCEV 1B06A 4EKWA 5FPRA 3D3IA 3C90A 5LA6A 5IDJA 2ODMA 3AG1C 4H33A 2XASA 4LC1A 3P3NA 3NR7A 4LFCO 3FD9A 3H01A 3KCXA 4QGPA 1XQ8A 4NXNO 2WLNA 2HR3A 1ROPA 3JCZA 4JAVA 3L75H 1L0LH 2G38A 3M99B 3F7VC 5KHIA 3M8AA 4DXWA 4H0LB 3JD2A 5BMVA 1N0JA 1WPBA 3SJAC 4F6RB 4KHPO 2BTOA 4FM0A 3DXRB 4FZ0A 3VQXA 2RDCA 1E79G 3AG2B 2DQ3A 2F93B 5KX5B 2QEXV 2UXNA 2MK3A 3SDLA 4LCUC 1NT2B 1MSDA 3ABMB 4AQYO 3VOUA 1I7FA 3J7AU 2WLIB 3IC7A 3DSQA 2LQTA 3HKCB 3NXSA 1SESA 1YDXA 3B4SA 5DECA 4LFBB 3RYHB 3OT7A 1KYOF 1K7DA 1MABG 4Q20A 3ZRVA 1VP7A 2YIAA 3ZRWA 4RAIA 4MSWC 4PHZA 3BEHA 3GWKC 1I5XA 3GB7C 1PPJH 3BCCH 2UUAO 3AG2C 4DV3B 1K9MW 1OZ0A 1Q6UA 3R65A 1KQSU 1UPGA 3JAMN 2OT5A 3DXRA 2FYUH 4LF9O 5KX5A 4DR1B 1Q3EA 3O9OA 4CC5A 3ABMC 3W7TA 3CXCU 2GTAA 2CDYA 5IJ0B 3LUTB 3FB6C 2ZINA 5KUMA 4FLYA 2PI4A 2WLIA 3CCMV 4NXMO 3OUSA 5DM6V 3HKCA 4JYAB 5CA0B 2UUCO 4I4TB 1VARA 3AG3B 4FFBB 4IIJB 1RPOA 5LMUB 4Z1MG 4DR3B 1PNMA 1DTOA 4LF6O 4DV0B 4I0XB 1SQPH 4O2BB 3RYIB 2HHHO 3G80A 3ZIAG 1NTZH 1DLBA 3KZIZ 2VRZA 4DV7O 3CEIA 4X8AA 3CMEV 4KP4A 3JYCA 5IJ0A 4I50A 1GRJA 3SJQC 1BQ0A 1D5AA 3ZHRA 1YEWA 2Q7GA 3JAWB 4QE7A 5CA0A 3ZJZA 4ZHQB 1IZ3A 3CP1A 2Y4TA 3AG3C 4I4TA 2WLKA 4O4JB 2ZIOA 4LF8O 3MHSC 1Q6IA 4IIJA 5JQGB 4RUEA 3THOA 4J41A 2XAJA 4DR7B 3N2GB 3RYFB 2RQ6A 2Y4UA 1NH2B 4O2BA 4MT8A 3RYIA 1W59A 3CCJV 5KHJA 4Z1VA 3SYCA 3K3WA 4WF9V 2P90A 4PA6A 5LXTB 3RT3C 1NKDA 2YEVB 4B3MO 3K5LA 2DWEC 4X66O 1BL8A 4DRXA 3E8GA 2BOCC 5B5EZ 2YIBD 1Z5VA 1R1BA 1UJWB 4ZHQA 1S3JA 1A32A 1F4NA 1YF2A 4KL1A 5JQGA 3OTOO 4J7KA 4MVZA 1YXBA 2V1DA 4AHCA 3N2GA 3RYFA 3K9SA 5LGTA 1DGSA 1S72V 1AI6A 2JK5C 3BVOA 4YIOA 1NI8A 3LSSA 1CEZA 2YEVA 3L9DA 1WJZA 1KMIZ 4DV2O 2Q9LA 2XHBA 2EJRA 4HNAB 4HBNA 2K1EA 2Q0AA 1MNGA 1I5YA 3RYCB 3SYPA 1GH6A 3MDSA 3P30A 2ARHA 3B8MA 3K06A 3B8NA 3G6BA 4B3RB 2EULA 2WWWA 3OMIB 5LMNB 1P7BA 1AI4A 1Z2GA 2KQXA 4WFGA 2HJFC 3H1IH 3D36C 3ZHQA 4BR6A 1B6QA 2AHZA 4TOIA 5FLXN 2IBZH 2YSUB 2KSDA 4UXNA 1I08A 4B3TB 3BA8A 2EBOA 3APOA 4WFBV 4JI0B 1JJOA 2WLHA 3AEIA 4UB6Z 4UB8Z 3HB3B 1GM7A 3BA9A 3ABKB 2A9HA 2K9PA 3WU2Z 5L3GA 1TVKB 3CXHF 3JSLA 2ZR2A 5CN0A 3CX5F 1I0HA 2CK3G 1JPXA 5H9CA 3RYCA 1QLNA 2QWNB 3FAVB 3CSXA 2QWQB 1N0NA 2LGWA 1J95A 3PN1A 3JCUZ 4ZBMA 2P22C 4MTOA 3H1HH 2AXTZ 1AR1B 1VQLV 1Q8IA 2B1GA 2QWOB 4J7JA 2Y0PA 5JCOC 1O9GA 2V4DA 4XDKA 1SKVA 5JCOA 5L3EA 3CMAV 4KFMA 1XMOB 3ABKC 1VQMV 1NVPD 1ZTEA 2ZM6O 4FLXA 3F7YC 2IJHA 4RO2A 1YHQV 1HR0O 1FYJA 4WCEV 4ICGA 2BTQB 2RN9A 3E89A 3SPGA 5JH7A 5KAIZ 3FAVA 2UU9B 1VQKV 2WLMA 4JI1B 1NR1A 2P6JA 5E1AC 2Q7HA 5CBGA 1OHHG 3TK1A 1M90W 3JD1A 3ETDA 5J2UB 3ZMZA 1JCHA 2QM8A 2Z5UA 2F66C 1CP9A 2VQFB 1SQBH 3GWOA 2LW7A 5JJNB 1P49A 1BZKA 5C8YB 1Q86W 1KBHA 2XAGA 4XBFA 2HFEC 4GKJO 2H94A 4DYLA 1IBKB 1ZSPA 2HEPA 4PJ0Z 1W0JG 4CC6A 1VQ4V 2UXCB 1G1XB 4X9QA 1K5SA 3ZN1A 2M7WA 3SR2C 3ETGA 4CH3A 3IAYA 1RPRA 5A9GA 5FNVB 1FJGB 3ZBHA 4O4LB 5J2UA 3MD0A 1HDJA 1FS0G 1KKCA 2R9IA 3ZHSA 4IL6Z 2PYLA 2CH7B 4EFEA 5FPOA 1GN2A 5LYJA 5IWAB 3K79A 4TT3G 2B5UA 5C8YA 1IX9A 2BE3A 1IBLO 2R9AA 4EEQA 3H9VA 1W2BU 5B1NA 4PDRA 2ZNIA 1QNMA 1URFA 4YIPA 2Z3YA 4UFZA 3LDCA 4YHHB 3CCVV 1Y74B 4X64O 1PM9A 4HAMA 4GUNA 3MAQA 2QA4V 4JV5B 1FFXB 1V9PA 2X6CA 1NBMG 5FNVA 2YXLA 4DUYB 1RSOB 4O4LA 1AP5A 1VQOV 1NU1H 3K0GA 3CCUV 2RJZA 2KKWA 1YTFD 2OCCB 3E35A 2LJ2A 1X4TA 3FKSG 1M56B 3ZHVA 3J80N 3E22B 1VQ7V 2E75B 4WFHA 4U3JB 2LP7A 2W0FC 1F23A 4K0KO 1FXKB 3JALB 3OTFA 2Q67A 5IT9N 2N74A 1Y74A 2ZT9B 3LNMB 1S5JA 4DV1B 3J81N 1VQ9V 5HFLA 3A8TA 4JAUA 1AB3A 1FFXA 4GKKB 1XHXA 3CRMA 1SQGA 4YJ3B 2YI8A 4OX9B 1H2LA 2EJ7A 1YJWV 3SYOA 1AI7A 3B09A 5L3BA 2QTOA 3HKDB 4DV0O 2OCCC 4PA4A 1N36B 2PTMA 2F4VO 1M56C 2W6JG 2EZOA 3O65A 3Q4HB 3AK2A 5EBWC 3E22A 5H5NA 4U3JA 3HR0A 3E83A 1FXKC 2IJIA 1M1KW 2JS3A 2CTQA 1ZWIC 4LH6A 3OAAG 3JALA 4LF7B 2Y0IA 4O2AB 1VMGA 1R3IC 2RNBA 3RWRD 1SA0B 2OYQA 5H2FZ 1I94O 3FYEB 2IH3C 2QTSA 4E2LA 4O4HA 1E1QG 2A7WA 1O9HA 1XHZA 3D3QA 1VF6C 5LHHA 4FLTA 1VF6A 4YJ2B 1U97A 3CRCA 4DR7O 5GONB 4K35A 5KLVH 3HKDA 2RCVA 1WA8B 4JI2B 3OD4A 1B04A 2GUZB 2IJJA 1N34B 5IJ9B 4PDVA 1PNKA 2CTWA 4LP8A 3K58A 2OIEA 4FFKA 3SGIA 2HP8A 1IBMO 4NKGB 4I5SA 1KD1W 4O2AA 3DC5A 4WFEA 2XOKG 1EBOA 1SA0A 4K8ZA 1S76D 4NTYA 4MW3A 3IFXA 4UCSA 4J9ZB 4XDJA 2BCCH 2HVKC 4MVOA 2VQEB 1E1RG 3FFQA 3BAAA 3ZS8C 3JATB 3CRAA 4DV4B 4YJ2A 4JYCA 1K4CC 2F43G 5ITZB 1FPOA 1P7GA 2QWPB 1WA8A 3CCQV 4F6RA 3ML0A 3K5MA 1HNWB 3L73H 3A2FA 1EN6A 5JJEB 5D5QA 5IJ9A 4CBCA 3HKEB 1S77D 4NVPA 3E8BA 3UM7A 3T1YO 4X65O 1ZAUA 2F1MA 4UCOA 2QKAA 2XNDG 5EC1C 1R6NA 4TV9B 1GTOA 2E5LB 1TAEA 1IXBA 3AK1A 4N23A 2DW4A 3E8HA 5B1AB 1H8HG 2OIGA 4B3RO 2A3QA 3IJ4A 4FM2A 2QR4A 3BFRA 1QVGU 5LMNO 2PYJA 4YY3O 1XNQB 2R9RB 3RYHA 4J80A 1KUQA 4JI5O 2Q4PA 1N33O 4QE9A 1VIBA 4B3SB 1EN4A 2WLLB 5LGUA 4LFAO 4I7ZB 4KUMA 2V7QG 3E86A 4JI0O 2IU0A 4BAYA 3K9AA 3HKEA 3N2KB 1H2NA 4BIOA 4GT1A 2X6AA 1WB8A 2ZKOA 1SZXA 2AGAA 3OMAB 4IGGA 4TV9A 4H37A 4NB5A 1N32B 1GM8A 5B1AC 5JVDB 1K8AW 1H2SB 2ETNA 4J11A 1JR9A 4LBEC 5CBFA 3TETA 2VWJA 4FFBA 1R6KA 2P7TC 4K3AA 1JFFB 4DUZO 1XL6A 2JRIA 4AI8A 2WLLA 1T5EA 2YUAA 3S3XA 4JI4O 1PD3A 4PA9A 4BIZA 4I0XA 2FL4A 4LFCB 3C3SA 3QF7A 2P06A 5KAFZ 4NXNB 3N2KA 1X59A 2OWOA 1XBLA 3LSUA 5GTHZ 1EFRG 2QKSA 3UO3A 4PI2A 3RVYA 1YCIA 1AR5A 4B08A 1L1FA 3UQ8A 4X20B 2LFSA 1EN5A 1MZFA 1BT8A 1WNSA 3SYQA 4CS4A 4DR2O 1XL4A 4DR6O 1S5HC 3CE2A 1JMKC 1US6A 1NS1A 4KHPB 1OCOB 4I9WA 2UU9O 4JI1O 3JAWA 2DE0X 1OJHA 1YSCA 2KG7B 4FM1A 4O4JA 1EZJA 4JI3O 2DMXA 1JFFA 4JYBA 4LF4B 5BR8O 3FB7C 2HG5C 2VQFO 4P9PA 1GAXA 2P4KA 2EX3A 4QNHB 3IGAC 5KHKA 4YXWG 3DGEA 2RMKB 4FLZA 3CPWU 4P9OA 2GSMB 2WLJA 4QPJA 1LUWA 5LXTA 1BCCH 3ETQA 5CMUA 4PV1B 5EC2C 1OCOC 1JX9A 3C3TA 4LF5B 3I55V 1F51A 2UUAB 1SC5B 2Q73A 2CE4A 3JSNA 4TUYB 5A2QN 5B1BB 2ZXWB 5LOVB 3F5TA 4ABMA 4FPPA 1HNZB 1SETA 3BY6A 1KC8W 2H3OA 4JI8B 1Y66A 3D36A 1M4UA 5EBLC 4CS2A 1LR1A 3RN4A 4WFFA 4MVQA 3FYIB 2UXDO 5HFMA 3TJTA 4KXRA 1GN6A 2UUCB 2CUGA 2EIJB 2F95B 2QE7G 3K5NA 1VQPV 4JI7O 1AP6A 5DN6G 1LUVA 4HNAA 2NR5A 4YHHO 3QNEA 3A0RA 1DF4A 1SERA 4LF6B 1H8EG 1UFIA 4ZIBA 5LHGA 4OXSA 2LFRA 1K97A 4AILC 3LSQA 2HHHB 2ZXWC 3TCUA 5KA5A 4U7OA 4DV7B 1AJNA 4B7EA 3VQYA 2R72A 3VBBA 4ZOLB 4F6EA 1KU9A 5EYPB 2N04A 4JZ2A 4FLWA 3CWBH 3K57A 2EIJC 1ORQC 1W0KG 2ZNJA 1EZVH 2PUSA 3G4SV 5GW7A 1NH2D 2WAMA 4BIUA 4IHJB 4UCUA 1TVKA 2DYSB 1JJ2U 4LF8B 4PELA 4L87A 1XDCA 1COWG 4H13B 5L3FA 3G6EV 1JVMA 4NYKA 3N27A 1XMQB 1GMGA 3FB8C 4B7KA 3ASNB 3CD6V 4JAAA 5B1OA 5LP6B 5CA1B 4GYCB 3W7XA 2IW5A 3CCLV 5E79Z 4GZRB 4X62O 1G4YB 1NR7A 3K08A 1F4MA 4PDLA 1J5EO 2UXBO 4GLXA 2XT9A 4B3MB 4JPRA 2YXHA 3CS5A 5C93A 3ZMVA 5EYPA 3SPJA 2JGDB 3OMNB 2HJDA 4GX1A 4LNUB 4RUFA 1N4CA 2B9ZA 1HNXB 3WB1A 1MOFA 3L71H 4IHJA 2DYSC 3OUFA 5BXZA 1BMFG 5B66Z 5KMGB 4MS2A 2ADPA 1CXZB 4DR4B 3OTOB 2W6IG 4X1YB 4A5UB 1BGYH 2YICA 3ASNC 5LP6C 2QSAA 2BTQA 3DC6A 4ZI7B 1QBZA 5LP6A 1V55B 1THZA 3R66A 2ITCC 5BY1A 2HVJC 4MTGA 5J2TB 2BOBC 3W7WA 1Q90D 3EFFK 2Y69B 4MTFA 4IT5A 4D6TH 1RFYA 3WB2A 2JDIG 4UVAA 2HLDG 4DV2B 3ZRSA 3T1HB 4TQFA 2JGDA 4DV6B 2JIZG 4L8JA 3CRQA 1R3JC 1TUBB 2CGNA 1K4DC 1Y4MA 3LNNA 3CC7V 1N34O 4GX2A 5IYCO 3OM3B 4UV9A 2QDOA 3KCYA 2EILB 1WLEA 3DTUB 5KMGA 4X1IB 2X7RB 4DR5B 2ZD9A 4FLVA 3RVZA 4MTXA 3P32A 1TGOA 2CTPA 4X1YA 4PA3A 4MVRA 3CC4V 1V55C 3AG7A 2E76B 4J7ZA 1K73W 4ZI7A 4MVUA 1MSWD 4BW5A 4WBNB 4I55B 3BPZA 1S5LZ 3U0ZA 4ASUG 2Y69C 2VQEO 1VQ6V 3RFRA 5J2TA 4LFBO 1PNLA 2OCHA 4DV4O 1GM9A 5LL6Y 2LGQA 3U10A 2R70A 3BABA 2CH7A 2A06H 4TV8B 4PD4F 2DN9A 2B1IA 4DV3O 2EILC 2Q0OC 1Y76B 1Q7YW 2PY5A 1K3EA 2JS5A 4DR1O 4X1IA 1M93A 2EIMB 5BZBA 5TISZ 4G28B 2E5LO 1AR4A 4JTDB 3W7SA 2EZPA 1SS3A 5CBHA 4WBNA 4I55A 4JYAO 2YDEA 1VF5B 4Z2WA 3T4DA 3QTCA 1XNQO 2KB1A 5DEDA 3CYOA 4B3SO 4R50A 1RSOA 5LGNA 2CGOA 1D5NA 1GK9A 3HKBB 1XILA 3AG1B 5LHIA 1RM1B 5LMUO 4DR3O 1QR9A 1QU7A 2L35A 5IYZB 4JI6B 1Q82W 2UUBB 3T4ZA 1VQ5V 3HPLC 2P4VA 5EBMC 2QKCA 4W4LA 1GKFA 2EIMC 3SPCA 1R6TA 3CHXA 2AHYA 2Q5ZA 3ABLB 5AG2A 3LDEA 2DJVA 1D2DA 5EZYB 3LDDA 3RGBA 1FXKA 1TUEB 4DW1A 1Q5OA 3ZEDA 1Q81W 3I5DA 3QO8A 2VS0A 3WG7B 2WPDG 3SPIA 1N32O 3B2EE 2ATKC 1IURA 1WP7A 2NLJC 5EIBD 1ZUQA 2EIKB 2ZIMA 4YJ3A 2DYRB 2Z0AA 1RM1C 2YIDA 1IVSA 4LH7A 4GKJB 1AROP 3HKBA 2Q6AA 3ASOB 2JJ2G 5JWPA 4I9QA 3AG4B 4QPKA 5IYZA 2XUMA 3OR7C 2UXXA 2AZ2A 3P3PA 3Q4HA 3VQVA 3H1KH 3ABLC 4RQEA 2HKOA 3K03A 1GO3F 5EZYA 3WG7C 1YVWA 3QG5A 3ZRWB 5CA3A 2EIKC 1XUQA 3S3WA 2DYRC 1IBLB 3ASOC 4LF4O 1MMMA 3AG4C 3TXSA 4TQDA 5GONA 2CTRA 1LNQA 1IDSA 1M5IA 4X64B 4U3FH 3EVKA 3B77A 2JGUA 1XNRB 4CZZA 2GUZA 5JJJB 3OEHG 1PV0A 5GTIZ 2GDSA 3E2EA 4GCZA 1B3QA 3D8CA 3MHHC 1OCZB 3OGCC 1NTKH 4NR1A 4MVMA 1QQCA 3KG2A 4X89A 2P67A 4RQFA 4NTXA 3RBZA 2YI9A 1KP2A 4LF5O 4F4LA 3OW2U 4FK5C 3F5WC 2NNUA 4TWKA 3EHBB 4CH6A 2O57A 1Y6XA 4DV5B 4LWSB 1K34A 1K5QA 1HNZO 3GVMA 4K0KB 1KKDA 3ABTA 3A0BZ 3JATA 2YIBA 3W7UA 4UCRA 4JI8O 4FZ1A 1L8DA 4I50B 5ITZA 4B3TO 1EM1A 2BSKB 3RW0A 4MW8A 2GBOA 4U7NA 1SF9A 4XDLA 3ZRXA 2LW1A 1ENVA 3OEEG 4PA7A 4J10A 1OCZC 1SQXH 1FFTB 1P84F 3EXAA 5KHGA 1BHBA 3IC9A 2F4VB 4JYYA 4H44B 4O4IB 3JD3A 4LWSA 4OPHA 4TSFG 1YZBA 3A0HZ 4DRXB 1VEWA 1MZEA 5IYDO 2EINB 3VQWA 1KB9F 5K1XA 2BSKA 3UKMA 1I94B 1XMOO 3FX7A 2IH1C 3B40A 1JA8A 3ZMTA 5CB4B 3E8FA 4UCVA 3JASB 5K1PA 1DK1A 3WFVA 3PJSK 1WAZA 4P30A 1JOYA 1CPYA 4Q6GA 3ABUA 4JTAB 3K5OA 1XMQO 1VQNV 4OPAA 3U11A 1Z5WA 1SQQH 1NVPB 3OE7G 4G2KA 5JVDA 5L3CA 4O4IA 1TA8A 1NQTA 3CRRA 2X0LA 4GX5A 1R3KC 1R73A 3ETEA 2E3CA 5L3DA 1IBMB 2EINC 1M9NA 2FB5A 4N21A 2ZE5A 4JASA 4UVCA 4AQYB 3ZMUA 4QJFB 2LO1A 2E74B 1K92A 2XAHA 1HNXO 1ZX3A 3APQA 5CB4A 4CH5A 3JASA 4DR4O 3CB2A 4X20A 1OCRB 2M6YA 1IBKO 1ZLZA 3X2QB 1FD9A 1HW7A 4EFBA 4X88A 2PGGA 2UXCO 3KKYA 2KG7A 1PP9H 3T2MA 4LF9B 1L0NH 3SPHA 3T1YB 4X65B 4FJCC 1FJGO 1P4RA 1BHAA 2XAFA 2D3OW 5LBQA 3T1HO 2ITDC 2ZQMA 1H38A 4DV6O 1OCCB 5KHHA 1AILA 4NXMB 1SQVH 5IWAO 2JEXA 3L74H 1XREA 2DWDC 3OGIB 4DR5O 3ZX6A 4YY3B 1OCRC 4JI5B 1N33B 3X2QC 4FVMA 3T1CA 1HP8A 4MVSA 2ZR3A 4LFAB 2L6LA 3ICXA 3L70H 4JF3A 2PZSA 4JV5O 5B1BC 1Q6HA 4R7CA 4DO2A 4TUYA 4D7TA 2P5OA 5LOVA 2DOSA 1HWYA 1QHTA 4R6ZA 4DUYO 4DW0A 1OCCC 1QR8A 1WN7A 1BS3A 1WPXA 2Q69A 1YIJV 3JD0A 1SZTA 5JH7B 3I56V 1YITV 2Q7EA 1H2MA 5J9PC 1K33A 2ZE6A 4NTWA
chains in the Genus database with same CATH topology
2Q0OC 4IGGA 1CXZB 1UPGA 1US6A 1URFA 4NB5A 4DYLA 2RMKB 4NKGB 1RFYA 2HJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0O C;  4IGG A;  1CXZ B;  1UPG A;  1US6 A;  1URF A;  4NB5 A;  4DYL A;  2RMK B;  4NKG B;  1RFY A;  2HJD A; 
#chains in the Genus database with same CATH topology
 4BW9 A;  3TGU H;  1YJN V;  2OTJ V;  3STZ C;  4LR3 A;  4K8X A;  1QCE A;  2F23 A;  4E4E A;  5IYB O;  1VQ8 V;  3ZCC A;  4DK0 A;  1NZ6 A;  4DUZ B;  1YTF B;  4DV1 O;  4JI4 B;  1G8M A;  2ZE8 A;  2JEU A;  1PL0 A;  3QO5 A;  1PKX A;  4GKK O;  2YXY A;  4CS3 A;  4HYO A;  1IXM A;  4OX9 O;  2Y48 A;  3UT5 B;  2DQ0 A;  4X66 B;  2GHY A;  4ZOL A;  3QVN A;  1XOU A;  2ILM A;  4DR2 B;  4PI0 A;  4DR6 B;  1FKA O;  4JI6 O;  2FML A;  1N36 O;  1QVF U;  2UUB O;  4W4K A;  5F2V O;  1FAF A;  1M57 B;  4R8C A;  2JVD A;  1PL4 A;  3STL C;  1SRY A;  3H1L H;  3OFN G;  2QJ1 A;  4JI3 B;  3BRC A;  3CCR V;  1KEC A;  4LF7 O;  2XAQ A;  5BR8 B;  4WFA V;  1GN4 A;  1NJI W;  3AK3 A;  2PI5 A;  5LYJ B;  3OR6 C;  5CA1 A;  4GX0 A;  1XEQ A;  4UV8 A;  3UCS C;  4QIW F;  1H2K A;  2W0X A;  3ZMS A;  2QM4 A;  1QLE B;  3K04 A;  4OGQ B;  4C7U A;  3UT5 A;  3ZHT A;  2VWK A;  2OTL V;  2WSS G;  2NN4 A;  1M57 C;  5IY5 B;  1F7Y A;  4HZ3 A;  4JI2 O;  3G67 A;  2IM9 A;  2MW2 B;  4RWU A;  4LNU A;  1RP3 B;  2IU3 A;  4IYI A;  4D7S A;  1KP3 A;  2A79 B;  3UO2 A;  5FL7 G;  2YS8 A;  1ZL8 B;  2ADQ B;  3H1J H;  4BWA A;  2GTS A;  1S0V A;  5B3S B;  1FXH A;  5KA6 A;  3FB5 C;  1Y67 A;  3QO7 A;  3CJH B;  4CH4 A;  3K59 A;  2X6B A;  1GN3 A;  2UXD B;  1BE3 H;  1AVM A;  5D5P A;  5KUK A;  1QLE C;  3ZHU A;  1FXV A;  3SYA A;  1DF5 A;  2QWR B;  1YI2 V;  5EIB C;  4JI7 B;  1YJ9 V;  2ZDI C;  4EB6 B;  5IY5 C;  2ZDI A;  4UUJ C;  1XNR O;  2AW9 A;  1TUB A;  1HNW O;  1SQF A;  1N8R W;  1MG1 A;  4UVB A;  4JTC B;  3K0D A;  2IJK A;  1MA1 A;  2WA4 A;  1NTM H;  3L72 H;  3BHP A;  2PF4 E;  1ZL8 A;  5B3S C;  2QGN A;  3SJC C;  4X1K B;  3JAK B;  4JZG A;  4PDM A;  1WP8 A;  2JJ1 G;  5IE9 A;  1AJP A;  1V54 B;  2YC0 A;  2H8P C;  3CJH A;  3JAR B;  3G71 V;  1AI5 A;  5H6R A;  4ZKI A;  4DK1 A;  1H2G A;  4DV5 O;  5H6Q A;  2CAZ C;  2FKX A;  5LA6 B;  2ZM6 B;  3ZN0 A;  4G27 B;  2C2A A;  2QM7 A;  1R3L C;  4EB6 A;  2N05 A;  3SJB C;  3M7M X;  1JQ0 A;  1VF7 A;  3CC2 V;  1HR0 B;  1Q43 A;  1BQZ A;  4J42 A;  4FMT A;  1U96 A;  2Q68 A;  4O4H B;  4TV8 A;  4FLU A;  1Y76 A;  3TXQ A;  2XTA A;  2A0L A;  1BSM A;  4X62 B;  4UCT A;  2D2C B;  4J9Y B;  1G6U A;  1J5E B;  2UXB B;  2ZE7 A;  1AJQ A;  4JGS A;  1WB7 A;  1XI1 A;  3CCS V;  2AZ0 A;  4X1K A;  2Q8V A;  3JAK A;  4IYH A;  4P2Z A;  2FTK A;  1V54 C;  5BMV B;  2ZCE A;  4FIP C;  1OV9 A;  3WB0 A;  5EK0 A;  2GV9 A;  2WA3 A;  3JD4 A;  3JAR A;  3CCE V;  1B06 A;  4EKW A;  5FPR A;  3D3I A;  3C90 A;  5LA6 A;  5IDJ A;  2ODM A;  3AG1 C;  4H33 A;  2XAS A;  4LC1 A;  3P3N A;  3NR7 A;  4LFC O;  3FD9 A;  3H01 A;  3KCX A;  4QGP A;  1XQ8 A;  4NXN O;  2WLN A;  2HR3 A;  1ROP A;  3JCZ A;  4JAV A;  3L75 H;  1L0L H;  2G38 A;  3M99 B;  3F7V C;  5KHI A;  3M8A A;  4DXW A;  4H0L B;  3JD2 A;  5BMV A;  1N0J A;  1WPB A;  3SJA C;  4F6R B;  4KHP O;  2BTO A;  4FM0 A;  3DXR B;  4FZ0 A;  3VQX A;  2RDC A;  1E79 G;  3AG2 B;  2DQ3 A;  2F93 B;  5KX5 B;  2QEX V;  2UXN A;  2MK3 A;  3SDL A;  4LCU C;  1NT2 B;  1MSD A;  3ABM B;  4AQY O;  3VOU A;  1I7F A;  3J7A U;  2WLI B;  3IC7 A;  3DSQ A;  2LQT A;  3HKC B;  3NXS A;  1SES A;  1YDX A;  3B4S A;  5DEC A;  4LFB B;  3RYH B;  3OT7 A;  1KYO F;  1K7D A;  1MAB G;  4Q20 A;  3ZRV A;  1VP7 A;  2YIA A;  3ZRW A;  4RAI A;  4MSW C;  4PHZ A;  3BEH A;  3GWK C;  1I5X A;  3GB7 C;  1PPJ H;  3BCC H;  2UUA O;  3AG2 C;  4DV3 B;  1K9M W;  1OZ0 A;  1Q6U A;  3R65 A;  1KQS U;  1UPG A;  3JAM N;  2OT5 A;  3DXR A;  2FYU H;  4LF9 O;  5KX5 A;  4DR1 B;  1Q3E A;  3O9O A;  4CC5 A;  3ABM C;  3W7T A;  3CXC U;  2GTA A;  2CDY A;  5IJ0 B;  3LUT B;  3FB6 C;  2ZIN A;  5KUM A;  4FLY A;  2PI4 A;  2WLI A;  3CCM V;  4NXM O;  3OUS A;  5DM6 V;  3HKC A;  4JYA B;  5CA0 B;  2UUC O;  4I4T B;  1VAR A;  3AG3 B;  4FFB B;  4IIJ B;  1RPO A;  5LMU B;  4Z1M G;  4DR3 B;  1PNM A;  1DTO A;  4LF6 O;  4DV0 B;  4I0X B;  1SQP H;  4O2B B;  3RYI B;  2HHH O;  3G80 A;  3ZIA G;  1NTZ H;  1DLB A;  3KZI Z;  2VRZ A;  4DV7 O;  3CEI A;  4X8A A;  3CME V;  4KP4 A;  3JYC A;  5IJ0 A;  4I50 A;  1GRJ A;  3SJQ C;  1BQ0 A;  1D5A A;  3ZHR A;  1YEW A;  2Q7G A;  3JAW B;  4QE7 A;  5CA0 A;  3ZJZ A;  4ZHQ B;  1IZ3 A;  3CP1 A;  2Y4T A;  3AG3 C;  4I4T A;  2WLK A;  4O4J B;  2ZIO A;  4LF8 O;  3MHS C;  1Q6I A;  4IIJ A;  5JQG B;  4RUE A;  3THO A;  4J41 A;  2XAJ A;  4DR7 B;  3N2G B;  3RYF B;  2RQ6 A;  2Y4U A;  1NH2 B;  4O2B A;  4MT8 A;  3RYI A;  1W59 A;  3CCJ V;  5KHJ A;  4Z1V A;  3SYC A;  3K3W A;  4WF9 V;  2P90 A;  4PA6 A;  5LXT B;  3RT3 C;  1NKD A;  2YEV B;  4B3M O;  3K5L A;  2DWE C;  4X66 O;  1BL8 A;  4DRX A;  3E8G A;  2BOC C;  5B5E Z;  2YIB D;  1Z5V A;  1R1B A;  1UJW B;  4ZHQ A;  1S3J A;  1A32 A;  1F4N A;  1YF2 A;  4KL1 A;  5JQG A;  3OTO O;  4J7K A;  4MVZ A;  1YXB A;  2V1D A;  4AHC A;  3N2G A;  3RYF A;  3K9S A;  5LGT A;  1DGS A;  1S72 V;  1AI6 A;  2JK5 C;  3BVO A;  4YIO A;  1NI8 A;  3LSS A;  1CEZ A;  2YEV A;  3L9D A;  1WJZ A;  1KMI Z;  4DV2 O;  2Q9L A;  2XHB A;  2EJR A;  4HNA B;  4HBN A;  2K1E A;  2Q0A A;  1MNG A;  1I5Y A;  3RYC B;  3SYP A;  1GH6 A;  3MDS A;  3P30 A;  2ARH A;  3B8M A;  3K06 A;  3B8N A;  3G6B A;  4B3R B;  2EUL A;  2WWW A;  3OMI B;  5LMN B;  1P7B A;  1AI4 A;  1Z2G A;  2KQX A;  4WFG A;  2HJF C;  3H1I H;  3D36 C;  3ZHQ A;  4BR6 A;  1B6Q A;  2AHZ A;  4TOI A;  5FLX N;  2IBZ H;  2YSU B;  2KSD A;  4UXN A;  1I08 A;  4B3T B;  3BA8 A;  2EBO A;  3APO A;  4WFB V;  4JI0 B;  1JJO A;  2WLH A;  3AEI A;  4UB6 Z;  4UB8 Z;  3HB3 B;  1GM7 A;  3BA9 A;  3ABK B;  2A9H A;  2K9P A;  3WU2 Z;  5L3G A;  1TVK B;  3CXH F;  3JSL A;  2ZR2 A;  5CN0 A;  3CX5 F;  1I0H A;  2CK3 G;  1JPX A;  5H9C A;  3RYC A;  1QLN A;  2QWN B;  3FAV B;  3CSX A;  2QWQ B;  1N0N A;  2LGW A;  1J95 A;  3PN1 A;  3JCU Z;  4ZBM A;  2P22 C;  4MTO A;  3H1H H;  2AXT Z;  1AR1 B;  1VQL V;  1Q8I A;  2B1G A;  2QWO B;  4J7J A;  2Y0P A;  5JCO C;  1O9G A;  2V4D A;  4XDK A;  1SKV A;  5JCO A;  5L3E A;  3CMA V;  4KFM A;  1XMO B;  3ABK C;  1VQM V;  1NVP D;  1ZTE A;  2ZM6 O;  4FLX A;  3F7Y C;  2IJH A;  4RO2 A;  1YHQ V;  1HR0 O;  1FYJ A;  4WCE V;  4ICG A;  2BTQ B;  2RN9 A;  3E89 A;  3SPG A;  5JH7 A;  5KAI Z;  3FAV A;  2UU9 B;  1VQK V;  2WLM A;  4JI1 B;  1NR1 A;  2P6J A;  5E1A C;  2Q7H A;  5CBG A;  1OHH G;  3TK1 A;  1M90 W;  3JD1 A;  3ETD A;  5J2U B;  3ZMZ A;  1JCH A;  2QM8 A;  2Z5U A;  2F66 C;  1CP9 A;  2VQF B;  1SQB H;  3GWO A;  2LW7 A;  5JJN B;  1P49 A;  1BZK A;  5C8Y B;  1Q86 W;  1KBH A;  2XAG A;  4XBF A;  2HFE C;  4GKJ O;  2H94 A;  4DYL A;  1IBK B;  1ZSP A;  2HEP A;  4PJ0 Z;  1W0J G;  4CC6 A;  1VQ4 V;  2UXC B;  1G1X B;  4X9Q A;  1K5S A;  3ZN1 A;  2M7W A;  3SR2 C;  3ETG A;  4CH3 A;  3IAY A;  1RPR A;  5A9G A;  5FNV B;  1FJG B;  3ZBH A;  4O4L B;  5J2U A;  3MD0 A;  1HDJ A;  1FS0 G;  1KKC A;  2R9I A;  3ZHS A;  4IL6 Z;  2PYL A;  2CH7 B;  4EFE A;  5FPO A;  1GN2 A;  5LYJ A;  5IWA B;  3K79 A;  4TT3 G;  2B5U A;  5C8Y A;  1IX9 A;  2BE3 A;  1IBL O;  2R9A A;  4EEQ A;  3H9V A;  1W2B U;  5B1N A;  4PDR A;  2ZNI A;  1QNM A;  1URF A;  4YIP A;  2Z3Y A;  4UFZ A;  3LDC A;  4YHH B;  3CCV V;  1Y74 B;  4X64 O;  1PM9 A;  4HAM A;  4GUN A;  3MAQ A;  2QA4 V;  4JV5 B;  1FFX B;  1V9P A;  2X6C A;  1NBM G;  5FNV A;  2YXL A;  4DUY B;  1RSO B;  4O4L A;  1AP5 A;  1VQO V;  1NU1 H;  3K0G A;  3CCU V;  2RJZ A;  2KKW A;  1YTF D;  2OCC B;  3E35 A;  2LJ2 A;  1X4T A;  3FKS G;  1M56 B;  3ZHV A;  3J80 N;  3E22 B;  1VQ7 V;  2E75 B;  4WFH A;  4U3J B;  2LP7 A;  2W0F C;  1F23 A;  4K0K O;  1FXK B;  3JAL B;  3OTF A;  2Q67 A;  5IT9 N;  2N74 A;  1Y74 A;  2ZT9 B;  3LNM B;  1S5J A;  4DV1 B;  3J81 N;  1VQ9 V;  5HFL A;  3A8T A;  4JAU A;  1AB3 A;  1FFX A;  4GKK B;  1XHX A;  3CRM A;  1SQG A;  4YJ3 B;  2YI8 A;  4OX9 B;  1H2L A;  2EJ7 A;  1YJW V;  3SYO A;  1AI7 A;  3B09 A;  5L3B A;  2QTO A;  3HKD B;  4DV0 O;  2OCC C;  4PA4 A;  1N36 B;  2PTM A;  2F4V O;  1M56 C;  2W6J G;  2EZO A;  3O65 A;  3Q4H B;  3AK2 A;  5EBW C;  3E22 A;  5H5N A;  4U3J A;  3HR0 A;  3E83 A;  1FXK C;  2IJI A;  1M1K W;  2JS3 A;  2CTQ A;  1ZWI C;  4LH6 A;  3OAA G;  3JAL A;  4LF7 B;  2Y0I A;  4O2A B;  1VMG A;  1R3I C;  2RNB A;  3RWR D;  1SA0 B;  2OYQ A;  5H2F Z;  1I94 O;  3FYE B;  2IH3 C;  2QTS A;  4E2L A;  4O4H A;  1E1Q G;  2A7W A;  1O9H A;  1XHZ A;  3D3Q A;  1VF6 C;  5LHH A;  4FLT A;  1VF6 A;  4YJ2 B;  1U97 A;  3CRC A;  4DR7 O;  5GON B;  4K35 A;  5KLV H;  3HKD A;  2RCV A;  1WA8 B;  4JI2 B;  3OD4 A;  1B04 A;  2GUZ B;  2IJJ A;  1N34 B;  5IJ9 B;  4PDV A;  1PNK A;  2CTW A;  4LP8 A;  3K58 A;  2OIE A;  4FFK A;  3SGI A;  2HP8 A;  1IBM O;  4NKG B;  4I5S A;  1KD1 W;  4O2A A;  3DC5 A;  4WFE A;  2XOK G;  1EBO A;  1SA0 A;  4K8Z A;  1S76 D;  4NTY A;  4MW3 A;  3IFX A;  4UCS A;  4J9Z B;  4XDJ A;  2BCC H;  2HVK C;  4MVO A;  2VQE B;  1E1R G;  3FFQ A;  3BAA A;  3ZS8 C;  3JAT B;  3CRA A;  4DV4 B;  4YJ2 A;  4JYC A;  1K4C C;  2F43 G;  5ITZ B;  1FPO A;  1P7G A;  2QWP B;  1WA8 A;  3CCQ V;  4F6R A;  3ML0 A;  3K5M A;  1HNW B;  3L73 H;  3A2F A;  1EN6 A;  5JJE B;  5D5Q A;  5IJ9 A;  4CBC A;  3HKE B;  1S77 D;  4NVP A;  3E8B A;  3UM7 A;  3T1Y O;  4X65 O;  1ZAU A;  2F1M A;  4UCO A;  2QKA A;  2XND G;  5EC1 C;  1R6N A;  4TV9 B;  1GTO A;  2E5L B;  1TAE A;  1IXB A;  3AK1 A;  4N23 A;  2DW4 A;  3E8H A;  5B1A B;  1H8H G;  2OIG A;  4B3R O;  2A3Q A;  3IJ4 A;  4FM2 A;  2QR4 A;  3BFR A;  1QVG U;  5LMN O;  2PYJ A;  4YY3 O;  1XNQ B;  2R9R B;  3RYH A;  4J80 A;  1KUQ A;  4JI5 O;  2Q4P A;  1N33 O;  4QE9 A;  1VIB A;  4B3S B;  1EN4 A;  2WLL B;  5LGU A;  4LFA O;  4I7Z B;  4KUM A;  2V7Q G;  3E86 A;  4JI0 O;  2IU0 A;  4BAY A;  3K9A A;  3HKE A;  3N2K B;  1H2N A;  4BIO A;  4GT1 A;  2X6A A;  1WB8 A;  2ZKO A;  1SZX A;  2AGA A;  3OMA B;  4IGG A;  4TV9 A;  4H37 A;  4NB5 A;  1N32 B;  1GM8 A;  5B1A C;  5JVD B;  1K8A W;  1H2S B;  2ETN A;  4J11 A;  1JR9 A;  4LBE C;  5CBF A;  3TET A;  2VWJ A;  4FFB A;  1R6K A;  2P7T C;  4K3A A;  1JFF B;  4DUZ O;  1XL6 A;  2JRI A;  4AI8 A;  2WLL A;  1T5E A;  2YUA A;  3S3X A;  4JI4 O;  1PD3 A;  4PA9 A;  4BIZ A;  4I0X A;  2FL4 A;  4LFC B;  3C3S A;  3QF7 A;  2P06 A;  5KAF Z;  4NXN B;  3N2K A;  1X59 A;  2OWO A;  1XBL A;  3LSU A;  5GTH Z;  1EFR G;  2QKS A;  3UO3 A;  4PI2 A;  3RVY A;  1YCI A;  1AR5 A;  4B08 A;  1L1F A;  3UQ8 A;  4X20 B;  2LFS A;  1EN5 A;  1MZF A;  1BT8 A;  1WNS A;  3SYQ A;  4CS4 A;  4DR2 O;  1XL4 A;  4DR6 O;  1S5H C;  3CE2 A;  1JMK C;  1US6 A;  1NS1 A;  4KHP B;  1OCO B;  4I9W A;  2UU9 O;  4JI1 O;  3JAW A;  2DE0 X;  1OJH A;  1YSC A;  2KG7 B;  4FM1 A;  4O4J A;  1EZJ A;  4JI3 O;  2DMX A;  1JFF A;  4JYB A;  4LF4 B;  5BR8 O;  3FB7 C;  2HG5 C;  2VQF O;  4P9P A;  1GAX A;  2P4K A;  2EX3 A;  4QNH B;  3IGA C;  5KHK A;  4YXW G;  3DGE A;  2RMK B;  4FLZ A;  3CPW U;  4P9O A;  2GSM B;  2WLJ A;  4QPJ A;  1LUW A;  5LXT A;  1BCC H;  3ETQ A;  5CMU A;  4PV1 B;  5EC2 C;  1OCO C;  1JX9 A;  3C3T A;  4LF5 B;  3I55 V;  1F51 A;  2UUA B;  1SC5 B;  2Q73 A;  2CE4 A;  3JSN A;  4TUY B;  5A2Q N;  5B1B B;  2ZXW B;  5LOV B;  3F5T A;  4ABM A;  4FPP A;  1HNZ B;  1SET A;  3BY6 A;  1KC8 W;  2H3O A;  4JI8 B;  1Y66 A;  3D36 A;  1M4U A;  5EBL C;  4CS2 A;  1LR1 A;  3RN4 A;  4WFF A;  4MVQ A;  3FYI B;  2UXD O;  5HFM A;  3TJT A;  4KXR A;  1GN6 A;  2UUC B;  2CUG A;  2EIJ B;  2F95 B;  2QE7 G;  3K5N A;  1VQP V;  4JI7 O;  1AP6 A;  5DN6 G;  1LUV A;  4HNA A;  2NR5 A;  4YHH O;  3QNE A;  3A0R A;  1DF4 A;  1SER A;  4LF6 B;  1H8E G;  1UFI A;  4ZIB A;  5LHG A;  4OXS A;  2LFR A;  1K97 A;  4AIL C;  3LSQ A;  2HHH B;  2ZXW C;  3TCU A;  5KA5 A;  4U7O A;  4DV7 B;  1AJN A;  4B7E A;  3VQY A;  2R72 A;  3VBB A;  4ZOL B;  4F6E A;  1KU9 A;  5EYP B;  2N04 A;  4JZ2 A;  4FLW A;  3CWB H;  3K57 A;  2EIJ C;  1ORQ C;  1W0K G;  2ZNJ A;  1EZV H;  2PUS A;  3G4S V;  5GW7 A;  1NH2 D;  2WAM A;  4BIU A;  4IHJ B;  4UCU A;  1TVK A;  2DYS B;  1JJ2 U;  4LF8 B;  4PEL A;  4L87 A;  1XDC A;  1COW G;  4H13 B;  5L3F A;  3G6E V;  1JVM A;  4NYK A;  3N27 A;  1XMQ B;  1GMG A;  3FB8 C;  4B7K A;  3ASN B;  3CD6 V;  4JAA A;  5B1O A;  5LP6 B;  5CA1 B;  4GYC B;  3W7X A;  2IW5 A;  3CCL V;  5E79 Z;  4GZR B;  4X62 O;  1G4Y B;  1NR7 A;  3K08 A;  1F4M A;  4PDL A;  1J5E O;  2UXB O;  4GLX A;  2XT9 A;  4B3M B;  4JPR A;  2YXH A;  3CS5 A;  5C93 A;  3ZMV A;  5EYP A;  3SPJ A;  2JGD B;  3OMN B;  2HJD A;  4GX1 A;  4LNU B;  4RUF A;  1N4C A;  2B9Z A;  1HNX B;  3WB1 A;  1MOF A;  3L71 H;  4IHJ A;  2DYS C;  3OUF A;  5BXZ A;  1BMF G;  5B66 Z;  5KMG B;  4MS2 A;  2ADP A;  1CXZ B;  4DR4 B;  3OTO B;  2W6I G;  4X1Y B;  4A5U B;  1BGY H;  2YIC A;  3ASN C;  5LP6 C;  2QSA A;  2BTQ A;  3DC6 A;  4ZI7 B;  1QBZ A;  5LP6 A;  1V55 B;  1THZ A;  3R66 A;  2ITC C;  5BY1 A;  2HVJ C;  4MTG A;  5J2T B;  2BOB C;  3W7W A;  1Q90 D;  3EFF K;  2Y69 B;  4MTF A;  4IT5 A;  4D6T H;  1RFY A;  3WB2 A;  2JDI G;  4UVA A;  2HLD G;  4DV2 B;  3ZRS A;  3T1H B;  4TQF A;  2JGD A;  4DV6 B;  2JIZ G;  4L8J A;  3CRQ A;  1R3J C;  1TUB B;  2CGN A;  1K4D C;  1Y4M A;  3LNN A;  3CC7 V;  1N34 O;  4GX2 A;  5IYC O;  3OM3 B;  4UV9 A;  2QDO A;  3KCY A;  2EIL B;  1WLE A;  3DTU B;  5KMG A;  4X1I B;  2X7R B;  4DR5 B;  2ZD9 A;  4FLV A;  3RVZ A;  4MTX A;  3P32 A;  1TGO A;  2CTP A;  4X1Y A;  4PA3 A;  4MVR A;  3CC4 V;  1V55 C;  3AG7 A;  2E76 B;  4J7Z A;  1K73 W;  4ZI7 A;  4MVU A;  1MSW D;  4BW5 A;  4WBN B;  4I55 B;  3BPZ A;  1S5L Z;  3U0Z A;  4ASU G;  2Y69 C;  2VQE O;  1VQ6 V;  3RFR A;  5J2T A;  4LFB O;  1PNL A;  2OCH A;  4DV4 O;  1GM9 A;  5LL6 Y;  2LGQ A;  3U10 A;  2R70 A;  3BAB A;  2CH7 A;  2A06 H;  4TV8 B;  4PD4 F;  2DN9 A;  2B1I A;  4DV3 O;  2EIL C;  2Q0O C;  1Y76 B;  1Q7Y W;  2PY5 A;  1K3E A;  2JS5 A;  4DR1 O;  4X1I A;  1M93 A;  2EIM B;  5BZB A;  5TIS Z;  4G28 B;  2E5L O;  1AR4 A;  4JTD B;  3W7S A;  2EZP A;  1SS3 A;  5CBH A;  4WBN A;  4I55 A;  4JYA O;  2YDE A;  1VF5 B;  4Z2W A;  3T4D A;  3QTC A;  1XNQ O;  2KB1 A;  5DED A;  3CYO A;  4B3S O;  4R50 A;  1RSO A;  5LGN A;  2CGO A;  1D5N A;  1GK9 A;  3HKB B;  1XIL A;  3AG1 B;  5LHI A;  1RM1 B;  5LMU O;  4DR3 O;  1QR9 A;  1QU7 A;  2L35 A;  5IYZ B;  4JI6 B;  1Q82 W;  2UUB B;  3T4Z A;  1VQ5 V;  3HPL C;  2P4V A;  5EBM C;  2QKC A;  4W4L A;  1GKF A;  2EIM C;  3SPC A;  1R6T A;  3CHX A;  2AHY A;  2Q5Z A;  3ABL B;  5AG2 A;  3LDE A;  2DJV A;  1D2D A;  5EZY B;  3LDD A;  3RGB A;  1FXK A;  1TUE B;  4DW1 A;  1Q5O A;  3ZED A;  1Q81 W;  3I5D A;  3QO8 A;  2VS0 A;  3WG7 B;  2WPD G;  3SPI A;  1N32 O;  3B2E E;  2ATK C;  1IUR A;  1WP7 A;  2NLJ C;  5EIB D;  1ZUQ A;  2EIK B;  2ZIM A;  4YJ3 A;  2DYR B;  2Z0A A;  1RM1 C;  2YID A;  1IVS A;  4LH7 A;  4GKJ B;  1ARO P;  3HKB A;  2Q6A A;  3ASO B;  2JJ2 G;  5JWP A;  4I9Q A;  3AG4 B;  4QPK A;  5IYZ A;  2XUM A;  3OR7 C;  2UXX A;  2AZ2 A;  3P3P A;  3Q4H A;  3VQV A;  3H1K H;  3ABL C;  4RQE A;  2HKO A;  3K03 A;  1GO3 F;  5EZY A;  3WG7 C;  1YVW A;  3QG5 A;  3ZRW B;  5CA3 A;  2EIK C;  1XUQ A;  3S3W A;  2DYR C;  1IBL B;  3ASO C;  4LF4 O;  1MMM A;  3AG4 C;  3TXS A;  4TQD A;  5GON A;  2CTR A;  1LNQ A;  1IDS A;  1M5I A;  4X64 B;  4U3F H;  3EVK A;  3B77 A;  2JGU A;  1XNR B;  4CZZ A;  2GUZ A;  5JJJ B;  3OEH G;  1PV0 A;  5GTI Z;  2GDS A;  3E2E A;  4GCZ A;  1B3Q A;  3D8C A;  3MHH C;  1OCZ B;  3OGC C;  1NTK H;  4NR1 A;  4MVM A;  1QQC A;  3KG2 A;  4X89 A;  2P67 A;  4RQF A;  4NTX A;  3RBZ A;  2YI9 A;  1KP2 A;  4LF5 O;  4F4L A;  3OW2 U;  4FK5 C;  3F5W C;  2NNU A;  4TWK A;  3EHB B;  4CH6 A;  2O57 A;  1Y6X A;  4DV5 B;  4LWS B;  1K34 A;  1K5Q A;  1HNZ O;  3GVM A;  4K0K B;  1KKD A;  3ABT A;  3A0B Z;  3JAT A;  2YIB A;  3W7U A;  4UCR A;  4JI8 O;  4FZ1 A;  1L8D A;  4I50 B;  5ITZ A;  4B3T O;  1EM1 A;  2BSK B;  3RW0 A;  4MW8 A;  2GBO A;  4U7N A;  1SF9 A;  4XDL A;  3ZRX A;  2LW1 A;  1ENV A;  3OEE G;  4PA7 A;  4J10 A;  1OCZ C;  1SQX H;  1FFT B;  1P84 F;  3EXA A;  5KHG A;  1BHB A;  3IC9 A;  2F4V B;  4JYY A;  4H44 B;  4O4I B;  3JD3 A;  4LWS A;  4OPH A;  4TSF G;  1YZB A;  3A0H Z;  4DRX B;  1VEW A;  1MZE A;  5IYD O;  2EIN B;  3VQW A;  1KB9 F;  5K1X A;  2BSK A;  3UKM A;  1I94 B;  1XMO O;  3FX7 A;  2IH1 C;  3B40 A;  1JA8 A;  3ZMT A;  5CB4 B;  3E8F A;  4UCV A;  3JAS B;  5K1P A;  1DK1 A;  3WFV A;  3PJS K;  1WAZ A;  4P30 A;  1JOY A;  1CPY A;  4Q6G A;  3ABU A;  4JTA B;  3K5O A;  1XMQ O;  1VQN V;  4OPA A;  3U11 A;  1Z5W A;  1SQQ H;  1NVP B;  3OE7 G;  4G2K A;  5JVD A;  5L3C A;  4O4I A;  1TA8 A;  1NQT A;  3CRR A;  2X0L A;  4GX5 A;  1R3K C;  1R73 A;  3ETE A;  2E3C A;  5L3D A;  1IBM B;  2EIN C;  1M9N A;  2FB5 A;  4N21 A;  2ZE5 A;  4JAS A;  4UVC A;  4AQY B;  3ZMU A;  4QJF B;  2LO1 A;  2E74 B;  1K92 A;  2XAH A;  1HNX O;  1ZX3 A;  3APQ A;  5CB4 A;  4CH5 A;  3JAS A;  4DR4 O;  3CB2 A;  4X20 A;  1OCR B;  2M6Y A;  1IBK O;  1ZLZ A;  3X2Q B;  1FD9 A;  1HW7 A;  4EFB A;  4X88 A;  2PGG A;  2UXC O;  3KKY A;  2KG7 A;  1PP9 H;  3T2M A;  4LF9 B;  1L0N H;  3SPH A;  3T1Y B;  4X65 B;  4FJC C;  1FJG O;  1P4R A;  1BHA A;  2XAF A;  2D3O W;  5LBQ A;  3T1H O;  2ITD C;  2ZQM A;  1H38 A;  4DV6 O;  1OCC B;  5KHH A;  1AIL A;  4NXM B;  1SQV H;  5IWA O;  2JEX A;  3L74 H;  1XRE A;  2DWD C;  3OGI B;  4DR5 O;  3ZX6 A;  4YY3 B;  1OCR C;  4JI5 B;  1N33 B;  3X2Q C;  4FVM A;  3T1C A;  1HP8 A;  4MVS A;  2ZR3 A;  4LFA B;  2L6L A;  3ICX A;  3L70 H;  4JF3 A;  2PZS A;  4JV5 O;  5B1B C;  1Q6H A;  4R7C A;  4DO2 A;  4TUY A;  4D7T A;  2P5O A;  5LOV A;  2DOS A;  1HWY A;  1QHT A;  4R6Z A;  4DUY O;  4DW0 A;  1OCC C;  1QR8 A;  1WN7 A;  1BS3 A;  1WPX A;  2Q69 A;  1YIJ V;  3JD0 A;  1SZT A;  5JH7 B;  3I56 V;  1YIT V;  2Q7E A;  1H2M A;  5J9P C;  1K33 A;  2ZE6 A;  4NTW A; 
#chains in the Genus database with same CATH homology
 2Q0O C;  4IGG A;  1CXZ B;  1UPG A;  1US6 A;  1URF A;  4NB5 A;  4DYL A;  2RMK B;  4NKG B;  1RFY A;  2HJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...