1NKDA

Atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Structural parameters for proteins derived from the atomic resolution (1.09 A) structure of a designed variant of the ColE1 ROP protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nkdA00
4DO2A 1F4MA 1GMGA 1F4NA 1PD3A 1RPRA 2IJJA 3K79A 1ROPA 1NKDA 2IJHA 2IJIA 2IJKA 1RPOA 2GHYA 1B6QA 1GTOA
chains in the Genus database with same CATH superfamily
3JASA 1XILA 3ABMB 2WLLA 4UUJC 3SJCC 2ZXWC 3ZRXA 1VIBA 1QHTA 5LL6Y 4JI4O 1VQ7V 4NKGB 4O2BB 1Y4MA 4QPKA 4RUFA 2ILMA 3LDDA 2NN4A 4CS3A 1N4CA 4TQFA 3ASOB 4HBNA 1KUQA 2QEXV 3ABTA 1MNGA 4FLUA 4NVPA 5KHHA 4J7ZA 4LC1A 1QLEB 1VQPV 1P4RA 3G80A 4F6EA 3FB5C 3H1HH 4AQYB 1G6UA 1S5LZ 2YIDA 1Q6IA 5KUMA 3AG1C 2LQTA 1JVMA 2HLDG 1K5QA 2Y48A 3D3IA 2CTPA 1R6NA 3NXSA 4FFKA 2VRZA 3SPJA 4JAAA 3OE7G 5L3GA 4GX0A 4YJ3B 2HHHO 1L8DA 4DR3B 4WBNB 4JI8B 1AB3A 2YEVA 3N2KB 4DV1B 1G1XB 2CUGA 4ZI7A 2QGNA 3DC5A 1HDJA 5H6QA 1LUVA 2OIGA 4LF7B 3AG3B 2Q0AA 2UUAB 3APOA 1M90W 3JD2A 3JD1A 2IU3A 2E76B 4JAUA 3ABLC 5FNVB 4CS2A 4W4LA 4ZBMA 2HFEC 1OCRB 4DV7O 3D36C 5ITZB 1LUWA 5CBGA 1M57C 1FXKB 1Y67A 4X8AA 5CA0B 4FFBB 2NNUA 3AEIA 4MTXA 4XDLA 1TVKB 3HKEB 4NXMO 2V1DA 1YJ9V 3UKMA 4DO2A 5BR8B 1VQ9V 3L73H 1H8EG 4I9QA 1QVGU 3CXHF 2QSAA 1OCZC 3I5DA 3A0RA 3ZMUA 2CTQA 2UUCB 4UCUA 3WFVA 3IFXA 2A3QA 1K8AW 3H1JH 3C90A 4LFCB 3GWKC 2QM8A 2B1IA 2UXBB 2Q8VA 2Y69C 1KC8W 2JS5A 1AR5A 4LF4B 1KECA 2F43G 5D5PA 4DUZB 1Q6HA 2RQ6A 2EIMC 4TV9B 3CHXA 3HKCB 5B3SB 1BS3A 3L72H 4X1KB 1IBLO 4I55A 2IBZH 3E22A 4MW8A 1SS3A 3KCXA 3STLC 1SA0B 2R72A 1XHZA 4O4JA 5BMVB 2YXHA 3E8BA 4MTFA 1I0HA 1SERA 2EX3A 1KMIZ 3WG7B 2LP7A 2YI9A 3BABA 3SYQA 2XASA 4BIZA 3DC6A 5EZYA 1QR8A 4CC5A 5L3FA 4D7SA 2A9HA 2ZQMA 3E8FA 1F51A 2ZE5A 3T1YO 4QE9A 1IVSA 2A7WA 4GUNA 3CX5F 4LF6B 5DEDA 2GTSA 1FAFA 2KG7B 2YICA 4R7CA 2B9ZA 2A06H 4LWSB 5IWAO 5BY1A 1GH6A 3OGCC 4ZOLA 3D3QA 4WFAV 1V54B 2X6CA 1Q86W 1NBMG 1E1RG 3WB0A 1AJNA 2AZ0A 4KL1A 4ZHQB 4DXWA 1O9HA 4CH5A 4DR1B 4FLWA 3C3TA 4QE7A 2BCCH 2V7QG 1Y76A 4P9OA 1WA8B 1H2GA 2HEPA 2ZE6A 1VQ6V 4I9WA 3EHBB 4DR6B 2EIJB 4RUEA 4JI6O 1ORQC 1PM9A 1QQCA 1Z5VA 2UXCB 4KHPO 1KKDA 4LF9O 5J2UA 2G38A 4XDJA 4F6RB 2DWDC 4G28B 3BA9A 1ZUQA 3CS5A 1XHXA 3ABUA 4DV3O 2VQEO 1I08A 1K4DC 2JRIA 4JGSA 4IHJA 1HNWB 1XQ8A 1UFIA 2DE0X 3JAWB 1YTFB 4NXNB 4FMTA 1Q81W 1N36O 2P5OA 1KU9A 4NTXA 3CP1A 3D36A 3E89A 4JI5B 4QNHB 1HW7A 2KQXA 5K1XA 1MG1A 4J7KA 2XOKG 4WFBV 2Q5ZA 5E79Z 1JCHA 2CGNA 1TAEA 5CBFA 4HNAB 4H37A 3CCRV 3JATB 4FM2A 3CPWU 2IW5A 2QE7G 2ZD9A 3FB6C 3JYCA 3K79A 1WPXA 5LA6B 4AQYO 4MVSA 2OWOA 5FPRA 2XAHA 3R66A 2ODMA 4LR3A 4UCOA 2YIAA 2DMXA 4E2LA 3K58A 1RP3B 4RO2A 2UXDB 4JI2B 1I94B 5LBQA 1AJPA 4CBCA 4I4TA 2Y0PA 2JJ2G 3NR7A 2YXLA 2ADPA 4J42A 4MVMA 4G2KA 4JI8O 4FIPC 3CJHB 2OYQA 3ZS8C 1QNMA 2WLKA 4IYIA 3SDLA 4LF7O 2ITDC 2UUAO 4H0LB 3U0ZA 5H6RA 2HJFC 1DF5A 2ZR2A 1G4YB 3M8AA 3X2QB 2QR4A 1O9GA 1B3QA 3JAKA 1M9NA 2WLIA 4JI1B 1AI5A 3SPHA 4X20A 4KUMA 1RM1B 3BA8A 3JASB 5CB4B 3ZMTA 2WLLB 1Q82W 2QWPB 1R3LC 3K06A 2EILB 2H3OA 2W0XA 5BR8O 5L3DA 5B1BC 2Q0OC 2OIEA 3LSSA 3T1CA 2B5UA 3CCJV 3E86A 3FYIB 2DYRC 2UUCO 4Z2WA 1IBKB 4LFCO 5BXZA 4FM1A 1ZX3A 1XL6A 5C8YA 2M6YA 2UXBO 3L71H 1D5NA 3CCQV 1XDCA 2HP8A 3VOUA 1VF5B 3ABKC 4LF4O 4UVBA 3RYHA 3RT3C 3G6BA 4DUZO 2FL4A 2YDEA 1L0LH 3RFRA 2Y4UA 1UJWB 1VQLV 3CMEV 1FXVA 3B77A 4O4IA 1S5JA 4YJ2A 5JVDA 1KD1W 1NTZH 4LBEC 4AILC 3ZRWA 1PPJH 5KMGA 2Q7GA 4JTAB 3B8MA 3SPGA 3K08A 1PKXA 4FLYA 4BW5A 3E8GA 1OZ0A 3HB3B 1PL0A 4X1IA 5CMUA 2P06A 1NKDA 2P67A 3OUSA 3QVNA 4ASUG 2VQFB 1SF9A 4LNUA 2IH3C 2CTRA 4O4HA 1QVFU 4LF6O 3AG2C 3L70H 3G6EV 2X0LA 1EFRG 3MHHC 3K59A 1MA1A 4TV8A 1K7DA 1GM8A 4NTYA 2A0LA 5EYPA 1X4TA 2PGGA 1WN7A 2A79B 2P4KA 1M4UA 1R6KA 2W0FC 4OX9B 5IYZA 1WNSA 1GTOA 3VQVA 4BW9A 2GV9A 4DR1O 3ZN0A 4LH7A 5IE9A 3TK1A 4IIJA 1BZKA 1OCOC 2PI4A 4MVOA 3CCLV 2F4VB 4DR6O 4UCTA 4IYHA 4N21A 4FZ1A 4Z1MG 3H1IH 1GN2A 4UCRA 3OGIB 1ZL8A 2CDYA 2YIBD 2UXCO 4KFMA 4JYAB 2ITCC 4C7UA 2IJIA 3FKSG 1WJZA 4JI6B 3E22B 4FLTA 2BOBC 1IZ3A 3T2MA 4GX2A 1K97A 4DV6B 4ABMA 2JGDA 4NXNO 1XOUA 3Q4HA 3SJBC 5KAIZ 3JALB 1R3JC 5J9PC 3OW2U 4JI5O 4RQFA 3FYEB 3K9AA 3K5OA 3TXQA 3EXAA 1F7YA 1E1QG 1J5EB 1K3EA 1N0JA 2QKSA 5JJEB 2XAQA 2ZIMA 3IC7A 3W7SA 2Q4PA 5LP6C 5LMNB 1PD3A 5KHKA 2EBOA 5H5NA 1SZXA 4PV1B 1EBOA 5LMUB 4TUYB 3G4SV 4IGGA 4DRXA 1VQOV 1FJGB 3FB8C 4B7EA 2RDCA 3A8TA 4X66B 2O57A 4X62B 3JD0A 1M5IA 2F93B 2UXDO 2OCCB 4JI2O 4I5SA 1I94O 3RWRD 3ZHUA 1LR1A 1B06A 1QLNA 5BZBA 3SPCA 2Q67A 3ABMC 2NLJC 1AR1B 4U7OA 1ROPA 3PJSK 3QO7A 2QM7A 3DXRB 2BSKA 1NS1A 1R1BA 4MS2A 2EIKB 4JTDB 1NI8A 2Y4TA 3RBZA 2CH7A 1FKAO 4UVCA 2ZE8A 3ASOC 2RN9A 5IJ0B 1AP6A 2R9AA 3K04A 4RQEA 4O4LA 4JI1O 1QLEC 2JIZG 3N27A 2IU0A 3DTUB 2H94A 3JARB 4GKKB 2R9RB 1MMMA 3JCUZ 2F95B 3T4ZA 4U3JA 3W7XA 1K33A 3BCCH 1CEZA 3HR0A 4ICGA 3FAVB 5KUKA 3ZMZA 2IJJA 2ZNJA 2N74A 5LXTA 4ZIBA 2AGAA 1P49A 3I56V 2PF4E 3A0HZ 3B4SA 5LHGA 1IBMB 3W7WA 1NQTA 5FPOA 1MSDA 4PDRA 1K5SA 4JTCB 4LFAB 3GWOA 5B66Z 1IBKO 2DYSB 5EC2C 3OR7C 5JCOC 2WLJA 1BGYH 1SC5B 5JH7A 1BQ0A 1M93A 1N8RW 3PN1A 3BFRA 1US6A 5GONB 3LNNA 4PA4A 4PA6A 4K8ZA 2MK3A 2K9PA 3SJQC 2JJ1G 4I4TB 3JSLA 3CSXA 1SQFA 1K73W 4B7KA 4PELA 4JI3B 1OCRC 2UXNA 1H2LA 1FXKC 1TUBB 1KP3A 3K0GA 4L8JA 4FK5C 2XAFA 3SYCA 2GHYA 1SRYA 1BE3H 1YIJV 5IDJA 3STZC 5KA5A 1WB7A 1YDXA 2DW4A 4B3RB 1PP9H 1S5HC 1XMOO 5KX5B 5IJ9A 2HKOA 4BIUA 4PJ0Z 2RNBA 3O65A 3ZX6A 3BEHA 3J7AU 4WF9V 1YI2V 1TUEB 1V9PA 2VQFO 1WP7A 3IAYA 3ETEA 4TQDA 4JZ2A 5LP6A 1KYOF 1QU7A 1I5YA 3HPLC 2LJ2A 4HYOA 3W7TA 1ZTEA 3CCEV 2P6JA 3H1LH 5B1OA 2PI5A 2QKCA 2PYJA 1JJ2U 1MZFA 1HR0B 4CH3A 3UCSC 4PA3A 2EINB 3P30A 4I50A 5D5QA 4K0KB 1JFFA 1F4NA 1I7FA 5B3SC 2GUZB 2IJKA 4OX9O 2ZDIC 3LNMB 4A5UB 4QJFB 5K1PA 2XUMA 5CA3A 1IX9A 2ZT9B 3HKBA 4Q20A 2BTQB 1OV9A 1GN6A 2FYUH 3HKDA 3CRAA 4LP8A 2F4VO 5C8YB 3N2GB 3WG7C 1F4MA 3RYCB 2Q7HA 2PUSA 2EULA 3MAQA 4DR7B 4JYAO 5B1AB 4O2BA 3RYIA 4B3TB 1FFXA 4O4IB 1GK9A 3ETGA 2UXXA 1VQ5V 3K3WA 1KP2A 2LGQA 4JF3A 3UT5B 2XT9A 2QWNB 1XREA 4DV6O 5KMGB 4X64B 1SETA 2D3OW 1HNZB 1PV0A 4MW3A 1VEWA 4J10A 3CWBH 2EZOA 1V54C 1GMGA 4UXNA 3THOA 2QJ1A 4X1IB 1WPBA 1JA8A 3P3NA 5CA1B 4WFFA 1J5EO 4E4EA 4JAVA 4DV0B 5LMNO 3CC4V 5LGTA 2VS0A 2N05A 1WB8A 5LOVA 3ZHTA 1GO3F 2EJ7A 4YJ3A 1K9MW 2OTLV 4DW0A 4O2AA 2EIJC 3OTFA 2DJVA 4WBNA 5LMUO 4TV8B 4H44B 4MVQA 4UV9A 3N2KA 1FJGO 4PHZA 2PZSA 1M1KW 1IURA 5JCOA 1EN5A 5F2VO 4X66O 4L87A 2DOSA 2DQ3A 2JDIG 4X62O 5J2TB 4KXRA 3TETA 1VQ4V 3B09A 3AG4B 4I0XB 4B3SB 1JMKC 2ADQB 4YHHB 1GN4A 2WLNA 4FZ0A 5FNVA 1K34A 1XL4A 1H2MA 1KQSU 2WA3A 5ITZA 4J9ZB 1AVMA 1YZBA 5FL7G 1TVKA 1BL8A 5LGNA 3RGBA 4D6TH 3H1KH 3QF7A 5JJJB 3HKEA 1XI1A 1Y66A 1U96A 3SYPA 4WCEV 1RSOA 4CH6A 2R9IA 1UPGA 2FKXA 5IY5B 5L3CA 2XAJA 4GKJB 3CC7V 3SYOA 1YCIA 1BHBA 1RPOA 3UO3A 1MSWD 4GKKO 1K92A 1Q90D 3KZIZ 3S3WA 5IYDO 3CRRA 1Y74A 4PI2A 1JQ0A 5DM6V 3QTCA 3ZCCA 1AILA 2YXYA 4CS4A 4PDVA 1OHHG 5JQGA 1GKFA 2HG5C 2P90A 3VQWA 1YVWA 3R65A 1IBMO 3HKCA 3F7VC 1N34B 3TCUA 3ZN1A 2ZM6B 2ZDIA 2ETNA 4LFAO 1YEWA 4W4KA 4X88A 4DRXB 1JJOA 3S3XA 2R70A 1F23A 5BMVA 1LNQA 3BY6A 4QIWF 3RVZA 2H8PC 4UB6Z 3UO2A 4EFEA 1Q3EA 3X2QC 2QWOB 1OCCC 3TGUH 2FTKA 1RFYA 1CXZB 2ZIOA 3GB7C 3U11A 3A2FA 4DUYB 1DK1A 1RM1C 1S72V 4JI3O 5LYJA 3W7UA 4CZZA 1MABG 4DV4B 4IL6Z 2KG7A 2LFRA 3ZMVA 3LSUA 2Y0IA 3EVKA 2EILC 4OXSA 3K03A 4LWSA 1NVPB 4K3AA 4B3RO 1M56B 1MZEA 3CRMA 1GAXA 1FPOA 2CH7B 1H38A 4PDMA 3ZRVA 4YY3B 2BTOA 1SQPH 1KBHA 3OT7A 2B1GA 3CMAV 3FX7A 5DECA 2YEVB 4ZI7B 1MOFA 1B04A 1OJHA 1XMOB 2LO1A 1WA8A 1T5EA 4NB5A 1HR0O 2EZPA 2HVJC 2XTAA 1NH2B 1AI4A 3P32A 4K0KO 2GSMB 1GM9A 1XUQA 1BT8A 1AROP 2FB5A 3K5LA 1SESA 1DGSA 2AXTZ 3KKYA 1W0JG 1X59A 2OT5A 5EIBD 3JAWA 1AI6A 1Q43A 2ARHA 1OCOB 3VBBA 5JH7B 4JPRA 1V55B 5EK0A 5IYBO 4NTWA 1YHQV 4DV2B 4DR7O 1FS0G 1GRJA 1AI7A 1THZA 1NU1H 3ZJZA 2QTOA 3OM3B 4PDLA 1FXHA 3OFNG 4B3TO 4HNAA 2P4VA 2W6IG 2UUBB 1NZ6A 4G27B 1L0NH 4GZRB 3JATA 3C3SA 3ASNB 4U3FH 4X64O 1HNZO 5KAFZ 3F5WC 4JYBA 5KHGA 3JSNA 4QGPA 4TT3G 3OEEG 1QCEA 2LFSA 4J41A 1N32B 1PNMA 2XAGA 2V4DA 4I55B 4UCSA 4JV5B 4PD4F 4DV0O 4WFGA 4HZ3A 4O4JB 1D2DA 1KKCA 4P30A 4DK1A 2VWKA 4OGQB 3WB2A 3K5MA 3O9OA 4P9PA 2EJRA 1NR1A 4H13B 2ZXWB 5CN0A 3CJHA 5EZYB 4FM0A 4DV5B 3T1HB 1ZAUA 2AW9A 4I50B 1SQVH 1H2KA 1HNXB 1GM7A 2F66C 2WLHA 5EBWC 4XBFA 2PY5A 1NVPD 4B3SO 4LCUC 5EBMC 1SQXH 4DR5B 3LDCA 4YHHO 3HKBB 4JZGA 1Q7YW 4ZOLB 3HKDB 4UCVA 4BAYA 1ENVA 2IJHA 2YIBA 5CB4A 1ZSPA 3A0BZ 3OUFA 4F4LA 1NR7A 3AG1B 5IYCO 5JJNB 2QWRB 1SQQH 1E79G 4FJCC 2K1EA 1U97A 3TXSA 3RYIB 1Y76B 2Q73A 1FFXB 1R73A 2CGOA 1NH2D 4NR1A 4JI7B 3DGEA 5JWPA 1J95A 2YI8A 1VF7A 4GKJO 3B8NA 3DSQA 4U7NA 3OMIB 5J2UB 3IGAC 4X65B 1QBZA 3KG2A 2RMKB 3SGIA 4BIOA 3L74H 2OCCC 4IHJB 1EM1A 2WWWA 4DYLA 1ZLZA 3ABLB 5L3BA 2BOCC 1CPYA 4AI8A 5LOVB 1N34O 2ZM6O 3BVOA 2E5LB 4O2AB 1M57B 4DW1A 2IM9A 5EBLC 3OMAB 1XNQB 2EIKC 1FFTB 3RYFA 3CRCA 1TGOA 1L1FA 3LDEA 3AK1A 3I55V 3OR6C 2P7TC 5B1NA 1S76D 1OCZB 3L9DA 1XMQB 3T4DA 3ICXA 4DUYO 4LF5B 4MSWC 3AG3C 3APQA 5KA6A 4DV4O 3LSQA 4GYCB 4X1YA 5C93A 5LHHA 3UM7A 2Q7EA 2W6JG 1VQ8V 2Y69B 3OTOB 2LW7A 5H2FZ 2Q6AA 4P2ZA 4FLVA 5TISZ 1CP9A 3L75H 2RJZA 3GVMA 3MHSC 2EIMB 3CYOA 4LF8B 4YY3O 1SQBH 1RSOB 2VWJA 2P22C 1EN4A 3ZMSA 4EB6A 2DYSC 2OCHA 2GDSA 2RCVA 4HAMA 3WU2Z 1EZVH 1XNRB 1IXMA 1R6TA 1Y74B 3ZEDA 3G67A 3JAKB 1PNLA 2HR3A 3J80N 2QA4V 2WLIB 5JQGB 2WPDG 4TWKA 2ZINA 4X20B 1PL4A 2UU9B 2YC0A 3B40A 1K4CC 4X9QA 3ZIAG 3QO5A 3JCZA 4TOIA 4R50A 4JYYA 4YXWG 2YUAA 3QG5A 3CCUV 4Q6GA 4J9YB 3CCSV 3BPZA 3K9SA 5LGUA 3EFFK 5KHJA 1YJWV 2YSUB 3JALA 4J11A 1GN3A 4DV2O 1A32A 3CCVV 4GLXA 2F23A 3E2EA 4YIPA 5IT9N 2MW2B 3QO8A 5LYJB 5GTIZ 2UUBO 4K8XA 5KHIA 1P84F 1Y6XA 5EC1C 4DR4B 3RYHB 4FVMA 4TUYA 1HP8A 2EINC 4N23A 1IDSA 1N32O 4PA9A 1S77D 4I7ZB 4YJ2B 2HJDA 5JVDB 5B5EZ 2Q69A 4JV5O 1YITV 2CTWA 2QM4A 3IC9A 3ZRWB 2CE4A 1VMGA 3OAAG 4FPPA 4GX5A 1P7BA 2KKWA 4KP4A 1YJNV 1EZJA 1JX9A 3CD6V 2JVDA 2ZR3A 1SQGA 3QNEA 1R3IC 4DR2B 4DV5O 1NT2B 1W59A 3T1HO 1DTOA 1BSMA 1RPRA 4LNUB 5B1AC 4LFBB 1VF6C 1AP5A 3DXRA 4J80A 4JI0B 1HNXO 3OMNB 3LUTB 2QKAA 2Q9LA 4O4HB 2N04A 5IJ0A 1N33B 4DR5O 3M7MX 4FLZA 3MDSA 2ZCEA 2PTMA 1YF2A 2WAMA 5EYPB 4OPAA 3ZHSA 2JS3A 3JARA 1NJIW 3AK3A 1N0NA 1TA8A 1JOYA 5IYZB 3FFQA 1SKVA 4GX1A 1JR9A 4YIOA 3H9VA 3FAVA 4IT5A 4IIJB 4B3MB 2Z0AA 3IJ4A 3SYAA 4BWAA 2QTSA 4MVZA 4UVAA 4JI7O 4B08A 1FXKA 5CA0A 2FMLA 4FFBA 1ZL8B 4LH6A 4JI4B 1COWG 2IH1C 4X65O 2XNDG 1YSCA 2LW1A 1BCCH 1H2SB 5HFMA 3AG4C 3P3PA 5H9CA 3JD4A 1G8MA 2AHZA 5LHIA 3JD3A 3F7YC 2JGDB 5GONA 3Q4HB 3CC2V 4XDKA 2LGWA 1R3KC 4RWUA 3E35A 2E5LO 4DR3O 1TUBA 4DV1O 1XNQO 2QDOA 5AG2A 2F1MA 3AK2A 5B1BB 4TV9A 5KX5A 1KB9F 3CE2A 5EIBC 2HHHB 5L3EA 3K5NA 4X1KA 3CXCU 2X6BA 5IY5C 2XHBA 2DYRB 1XMQO 4FLXA 1OCCB 1SA0A 1YXBA 3M99B 4GT1A 2YS8A 2Q68A 4LF5O 3ETQA 3CRQA 4K35A 4JASA 2ZKOA 3OD4A 1NTKH 2JEUA 2CAZC 4WFHA 3OTOO 4ZKIA 3CEIA 3ABKB 5KLVH 3ZBHA 2DQ0A 1VQNV 1Q6UA 1S3JA 4H33A 2JEXA 2JK5C 3ZHRA 4PI0A 3BAAA 4DK0A 4LF8O 2KB1A 1Q5OA 4D7TA 1VP7A 2GUZA 4CC6A 4DV7B 3ZHVA 4Z1VA 2WSSG 3K57A 2WA4A 2BSKB 2L6LA 3SJAC 2BTQA 1JPXA 1P7GA 2KSDA 4TSFG 2QWQB 4NXMB 4R6ZA 1IXBA 1XNRO 4NYKA 4AHCA 1VQKV 3CB2A 4QPJA 3N2GA 3WB1A 3CCMV 4PA7A 1EN6A 1YTFD 4X89A 3RYCA 4O4LB 3MD0A 1VQMV 2WLMA 4ZHQA 3J81N 4UFZA 1VF6A 2UU9O 1H8HG 5DN6G 1AJQA 5GTHZ 4U3JB 2C2AA 3AG2B 2GBOA 3ZHQA 4EKWA 1I5XA 3UT5A 3ETDA 5CBHA 1W2BU 3K0DA 2M7WA 1M56C 3RYFB 5LXTB 5A2QN 2X7RB 1S0VA 4F6RA 1FD9A 1XBLA 4MT8A 2Z5UA 1IBLB 5CA1A 1BMFG 2JGUA 4RAIA 5FLXN 3FB7C 5HFLA 1BQZA 4J7JA 1DLBA 2L35A 5A9GA 1WLEA 3E8HA 1Z5WA 1VARA 4X1YB 2AZ2A 4MVUA 4WFEA 3RW0A 4DR4O 4OPHA 3AG7A 4GCZA 1PNKA 2PYLA 3SPIA 1Z2GA 2ZE7A 1WAZA 3T1YB 3ML0A 1D5AA 4EFBA 2CK3G 3RN4A 4UV8A 1FYJA 1HWYA 5J2TA 1ZWIC 4R8CA 3FD9A 4EEQA 2AHYA 4I0XA 4EB6B 5LA6A 4MTOA 5IWAB 1B6QA 1WP8A 5IJ9B 4JYCA 4BR6A 1Q8IA 2DN9A 2Z3YA 1V55C 3VQXA 3BRCA 4DR2O 3G71V 1SZTA 1NTMH 3UQ8A 4LFBO 3KCYA 2E75B 4JI0O 2NR5A 5LP6B 4CH4A 1URFA 2D2CB 3BHPA 5E1AC 3ZRSA 3D8CA 1N33O 2ZNIA 3TJTA 3F5TA 3H01A 1AR4A 3ASNC 1HNWO 2X6AA 2OTJV 3OEHG 2ATKC 2GTAA 4KHPB 4LF9B 1JFFB 3B2EE 1XEQA 1H2NA 1DF4A 1W0KG 4MTGA 5GW7A 2HVKC 3JAMN 2VQEB 2BE3A 4DV3B 2E3CA 3VQYA 3E83A 4UB8Z 2DWEC 1BHAA 3RVYA 4B3MO 4MVRA 1QR9A 3SR2C 3U10A 1N36B 2E74B
chains in the Genus database with same CATH topology
1FXVA 3B77A 4HAMA 4L87A 2DQ3A 2JDIG 1IXMA 3TETA 3ABMB 2WLLA 4UUJC 1KD1W 2ZXWC 3ZRXA 1VQ4V 3AG4B 4LBEC 1VQ7V 1PNLA 2HR3A 3ZRWA 2QA4V 2WLIB 1Y4MA 2WLNA 2WPDG 4QPKA 4TWKA 4RUFA 4JTAB 3B8MA 3LDDA 3K08A 3SPGA 1PKXA 1K34A 4BW5A 1XL4A 3E8GA 1OZ0A 3HB3B 1K4CC 1PL0A 3ZIAG 1KQSU 3QO5A 3JCZA 3ASOB 2QEXV 3ABTA 4J9ZB 4R50A 5CMUA 4YXWG 5FL7G 1NKDA 1BL8A 2P67A 3CCUV 4LC1A 5LGNA 1QLEB 3OUSA 4ASUG 1VQPV 4J9YB 3CCSV 1P4RA 2IH3C 5LGUA 1Y66A 3EFFK 3FB5C 1YJWV 2YSUB 3SYPA 4WCEV 1QVFU 3AG2C 3G6EV 5KUMA 3AG1C 2X0LA 1EFRG 1JVMA 2HLDG 1K5QA 2Y48A 3D3IA 3MHHC 2R9IA 5IY5B 3CCVV 1R6NA 1K7DA 5L3CA 2XAJA 3CC7V 3NXSA 3SYOA 1BHBA 1RPOA 3E2EA 1GM8A 2A0LA 3SPJA 3QO8A 1MSWD 2A79B 1K92A 3OE7G 5L3GA 4GX0A 1R6KA 2W0FC 5IYDO 1JQ0A 5DM6V 5EC1C 3ZCCA 1GTOA 2YEVA 4PDVA 1OHHG 2EINC 3ZN0A 3TK1A 1GKFA 2HG5C 2P90A 4N23A 1OCOC 5H6QA 3R65A 2PI4A 4PA9A 1S77D 3AG3B 3F7VC 4MVOA 3TCUA 3ZN1A 3CCLV 1M90W 3JD2A 2Q69A 4N21A 2ZDIA 3JD1A 1YITV 2IU3A 4Z1MG 4X88A 3ZRWB 4JAUA 4KFMA 3ABLC 3OAAG 2ITCC 4FPPA 1F23A 2IJIA 4GX5A 1P7BA 4KP4A 1YJNV 1LNQA 3BY6A 1EZJA 4ZBMA 3FKSG 1JX9A 3CD6V 2HFEC 1OCRB 4QIWF 3RVZA 2H8PC 2ZR3A 5CBGA 1M57C 3QNEA 1R3IC 1FXKB 4X8AA 2NNUA 2BOBC 3AEIA 4MTXA 4XDLA 3X2QC 3T2MA 4GX2A 1K97A 1OCCC 1DTOA 1RPRA 2FTKA 5B1AC 3GB7C 2V1DA 1YJ9V 3UKMA 4DO2A 1RM1C 1S72V 3OMNB 3LUTB 3W7UA 1VQ9V 1R3JC 4CZZA 1H8EG 1MABG 5J9PC 3OW2U 1QVGU 4RQFA 3FYEB 3K9AA 1OCZC 2LFRA 3ZMVA 1E1QG 1K3EA 2QKSA 3A0RA 3ZMUA 2WAMA 2XAQA 2EILC 3IC7A 4OXSA 3K03A 3WFVA 1NVPB 3IFXA 3W7SA 1M56B 1K8AW 1PD3A 2QM8A 1H38A 1NJIW 4PDMA 3ZRVA 2EBOA 1JOYA 4GX1A 2B1IA 2B1GA 3CMAV 2Y69C 1KC8W 2YEVB 1EBOA 3G4SV 1MOFA 1KECA 1VQOV 2F43G 3FB8C 3SYAA 2EIMC 5B3SB 4MVZA 4UVAA 3JD0A 1FXKA 2OCCB 4I5SA 2EZPA 4MW8A 2HVJC 3STLC 1NH2B 1AI4A 1COWG 3P32A 2IH1C 1QLNA 2XNDG 1YSCA 2GSMB 3E8BA 4MTFA 1GM9A 1SERA 1AROP 5BZBA 3SPCA 2Q67A 3ABMC 1SESA 3WG7B 2LP7A 2NLJC 3SYQA 4U7OA 5HFMA 1AR1B 2XASA 3AG4C 4BIZA 5H9CA 3JD4A 1G8MA 1ROPA 3PJSK 1QR8A 1W0JG 2AHZA 3JD3A 3QO7A 5LHIA 2QM7A 3F7YC 5L3FA 2OT5A 2A9HA 2ZQMA 2EIKB 3E8FA 4MS2A 3CC2V 1AI6A 1F51A 4JTDB 4XDKA 3RBZA 4QE9A 1R3KC 1OCOB 3E35A 3VBBA 4UVCA 4JPRA 1V55B 3ASOC 5EK0A 5IYBO 4R7CA 3K04A 1YHQV 4RQEA 1FS0G 1AI7A 1QLEC 2JIZG 2IU0A 1THZA 3DTUB 3ZJZA 2QTOA 3OM3B 4PDLA 1FXHA 3OFNG 2H94A 3OGCC 5B1BB 4WFAV 2R9RB 1V54B 2X6CA 1Q86W 1NBMG 3T4ZA 3W7XA 2W6IG 1E1RG 5L3EA 4G27B 1K33A 1CEZA 3CXCU 2X6BA 3ASNB 5IY5C 2DYRB 1AJNA 1OCCB 3M99B 4GT1A 3ZMZA 4DXWA 5KUKA 2IJJA 2Q68A 3F5WC 4QE7A 4JYBA 2V7QG 4TT3G 3OEEG 1QCEA 2LFSA 3I56V 4P9OA 1PNMA 1H2GA 2XAGA 5LHGA 3W7WA 1VQ6V 1NQTA 4I9WA 3EHBB 4JASA 4PDRA 2EIJB 1K5SA 4RUEA 2JEUA 4WFHA 1ORQC 4ZKIA 3ABKB 4WFGA 4JTCB 4HZ3A 2DQ0A 3GWOA 1VQNV 1S3JA 2DYSB 2JEXA 2JK5C 4H33A 5EC2C 1KKDA 4P30A 3OR7C 2WLJA 4XDJA 2DWDC 4G28B 2KB1A 4P9PA 2EJRA 1NR1A 3ABUA 1N8RW 1K4DC 2ZXWB 2WSSG 5CN0A 4JGSA 4PA4A 4PA6A 2MK3A 3SJQC 2JJ1G 1YTFB 1JPXA 4FMTA 1K73W 1Q81W 4TSFG 1GM7A 4R6ZA 4PELA 1VQKV 1OCRC 2WLHA 5EBWC 2UXNA 3CP1A 4XBFA 3D36A 3E89A 1FXKC 4QPJA 3CCMV 4PA7A 1NVPD 1KP3A 3K0GA 4QNHB 4FK5C 2XAFA 4X89A 2GHYA 4LCUC 5EBMC 3SYCA 1YTFD 1SRYA 3LDCA 1MG1A 1YIJV 3MD0A 1VQMV 2WLMA 5IDJA 2XOKG 4WFBV 1JCHA 3STZC 5KA5A 2DW4A 1Q7YW 1H8HG 5DN6G 1S5HC 5CBFA 4BAYA 1AJQA 1ENVA 2IJHA 2HKOA 2C2AA 4H37A 4BIUA 3CCRV 3AG2B 3OUFA 4F4LA 1NR7A 3AG1B 4EKWA 1I5XA 3CPWU 2IW5A 3ETDA 3BEHA 5CBHA 5IYCO 1W2BU 3K0DA 4WF9V 2QE7G 1YI2V 1TUEB 2M7WA 2ZD9A 3FB6C 3JYCA 1E79G 3K79A 4FJCC 1WPXA 1M56C 2K1EA 3ETEA 2X7RB 4MVSA 1S0VA 1I5YA 3HPLC 4HYOA 3W7TA 2XAHA 1R73A 3CCEV 1NH2D 2P6JA 2PI5A 4MT8A 5B1OA 3DGEA 1J95A 4E2LA 1JJ2U 4RO2A 2Z5UA 3B8NA 1BMFG 5LBQA 1AJPA 4U7NA 4PA3A 4RAIA 2EINB 3OMIB 3P30A 3FB7C 4CBCA 5HFLA 1DLBA 2JJ2G 3IGAC 1QBZA 1F4NA 5B3SC 3KG2A 1WLEA 3E8HA 4MVMA 4G2KA 2IJKA 2ZDIC 4MVUA 4WFEA 3LNMB 3RW0A 4FIPC 4QJFB 2OCCC 5CA3A 2WLKA 2WWWA 4GCZA 1PNKA 4Q20A 3ABLB 5L3BA 2BOCC 1CPYA 3SPIA 2ITDC 3ML0A 4LP8A 2CK3G 5H6RA 4UV8A 2HJFC 1HWYA 1DF5A 3WG7C 1M57B 1F4MA 1ZWIC 1G4YB 2ZR2A 4R8CA 5EBLC 3X2QB 3OMAB 2AHYA 1M9NA 5B1AB 2WLIA 2EIKC 1AI5A 4MTOA 1FFTB 3SPHA 1B6QA 4KUMA 1RM1B 1L1FA 3LDEA 4JYCA 1GK9A 3ETGA 2Z3YA 2UXXA 3ZMTA 1V55C 3I55V 3K3WA 3OR6C 1VQ5V 2P7TC 5B1NA 2WLLB 3G71V 1SZTA 1KP2A 4JF3A 1S76D 1OCZB 1Q82W 1R3LC 1SETA 3K06A 2D3OW 2EILB 3T4DA 4MW3A 5L3DA 4MSWC 5B1BC 2EZOA 5E1AC 3ZRSA 1V54C 3AG3C 1GMGA 4UXNA 5KA6A 3LSSA 3LSQA 3T1CA 5C93A 5LHHA 3UM7A 2B5UA 3H01A 3CCJV 2W6JG 3E86A 1VQ8V 2Y69B 3ASNC 4WFFA 3FYIB 2X6AA 2DYRC 2OTJV 3OEHG 4JAVA 2ATKC 2Q6AA 4P2ZA 1CP9A 3CC4V 5LGTA 3MHSC 2EIMB 1DF4A 1W0KG 3CYOA 1GO3F 4MTGA 1XL6A 5GW7A 2HVKC 1K9MW 2OTLV 2EIJC 3CCQV 3VOUA 3E83A 3ABKC 4MVQA 4UV9A 4UVBA 3ZMSA 2DWEC 1BHAA 2DYSC 3RVYA 1M1KW 4MVRA 1UJWB 1QR9A 1VQLV 3CMEV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO2 A;  1F4M A;  1GMG A;  1F4N A;  1PD3 A;  1RPR A;  2IJJ A;  3K79 A;  1ROP A;  1NKD A;  2IJH A;  2IJI A;  2IJK A;  1RPO A;  2GHY A;  1B6Q A;  1GTO A; 
#chains in the Genus database with same CATH topology
 3JAS A;  1XIL A;  3ABM B;  2WLL A;  4UUJ C;  3SJC C;  2ZXW C;  3ZRX A;  1VIB A;  1QHT A;  5LL6 Y;  4JI4 O;  1VQ7 V;  4NKG B;  4O2B B;  1Y4M A;  4QPK A;  4RUF A;  2ILM A;  3LDD A;  2NN4 A;  4CS3 A;  1N4C A;  4TQF A;  3ASO B;  4HBN A;  1KUQ A;  2QEX V;  3ABT A;  1MNG A;  4FLU A;  4NVP A;  5KHH A;  4J7Z A;  4LC1 A;  1QLE B;  1VQP V;  1P4R A;  3G80 A;  4F6E A;  3FB5 C;  3H1H H;  4AQY B;  1G6U A;  1S5L Z;  2YID A;  1Q6I A;  5KUM A;  3AG1 C;  2LQT A;  1JVM A;  2HLD G;  1K5Q A;  2Y48 A;  3D3I A;  2CTP A;  1R6N A;  3NXS A;  4FFK A;  2VRZ A;  3SPJ A;  4JAA A;  3OE7 G;  5L3G A;  4GX0 A;  4YJ3 B;  2HHH O;  1L8D A;  4DR3 B;  4WBN B;  4JI8 B;  1AB3 A;  2YEV A;  3N2K B;  4DV1 B;  1G1X B;  2CUG A;  4ZI7 A;  2QGN A;  3DC5 A;  1HDJ A;  5H6Q A;  1LUV A;  2OIG A;  4LF7 B;  3AG3 B;  2Q0A A;  2UUA B;  3APO A;  1M90 W;  3JD2 A;  3JD1 A;  2IU3 A;  2E76 B;  4JAU A;  3ABL C;  5FNV B;  4CS2 A;  4W4L A;  4ZBM A;  2HFE C;  1OCR B;  4DV7 O;  3D36 C;  5ITZ B;  1LUW A;  5CBG A;  1M57 C;  1FXK B;  1Y67 A;  4X8A A;  5CA0 B;  4FFB B;  2NNU A;  3AEI A;  4MTX A;  4XDL A;  1TVK B;  3HKE B;  4NXM O;  2V1D A;  1YJ9 V;  3UKM A;  4DO2 A;  5BR8 B;  1VQ9 V;  3L73 H;  1H8E G;  4I9Q A;  1QVG U;  3CXH F;  2QSA A;  1OCZ C;  3I5D A;  3A0R A;  3ZMU A;  2CTQ A;  2UUC B;  4UCU A;  3WFV A;  3IFX A;  2A3Q A;  1K8A W;  3H1J H;  3C90 A;  4LFC B;  3GWK C;  2QM8 A;  2B1I A;  2UXB B;  2Q8V A;  2Y69 C;  1KC8 W;  2JS5 A;  1AR5 A;  4LF4 B;  1KEC A;  2F43 G;  5D5P A;  4DUZ B;  1Q6H A;  2RQ6 A;  2EIM C;  4TV9 B;  3CHX A;  3HKC B;  5B3S B;  1BS3 A;  3L72 H;  4X1K B;  1IBL O;  4I55 A;  2IBZ H;  3E22 A;  4MW8 A;  1SS3 A;  3KCX A;  3STL C;  1SA0 B;  2R72 A;  1XHZ A;  4O4J A;  5BMV B;  2YXH A;  3E8B A;  4MTF A;  1I0H A;  1SER A;  2EX3 A;  1KMI Z;  3WG7 B;  2LP7 A;  2YI9 A;  3BAB A;  3SYQ A;  2XAS A;  4BIZ A;  3DC6 A;  5EZY A;  1QR8 A;  4CC5 A;  5L3F A;  4D7S A;  2A9H A;  2ZQM A;  3E8F A;  1F51 A;  2ZE5 A;  3T1Y O;  4QE9 A;  1IVS A;  2A7W A;  4GUN A;  3CX5 F;  4LF6 B;  5DED A;  2GTS A;  1FAF A;  2KG7 B;  2YIC A;  4R7C A;  2B9Z A;  2A06 H;  4LWS B;  5IWA O;  5BY1 A;  1GH6 A;  3OGC C;  4ZOL A;  3D3Q A;  4WFA V;  1V54 B;  2X6C A;  1Q86 W;  1NBM G;  1E1R G;  3WB0 A;  1AJN A;  2AZ0 A;  4KL1 A;  4ZHQ B;  4DXW A;  1O9H A;  4CH5 A;  4DR1 B;  4FLW A;  3C3T A;  4QE7 A;  2BCC H;  2V7Q G;  1Y76 A;  4P9O A;  1WA8 B;  1H2G A;  2HEP A;  2ZE6 A;  1VQ6 V;  4I9W A;  3EHB B;  4DR6 B;  2EIJ B;  4RUE A;  4JI6 O;  1ORQ C;  1PM9 A;  1QQC A;  1Z5V A;  2UXC B;  4KHP O;  1KKD A;  4LF9 O;  5J2U A;  2G38 A;  4XDJ A;  4F6R B;  2DWD C;  4G28 B;  3BA9 A;  1ZUQ A;  3CS5 A;  1XHX A;  3ABU A;  4DV3 O;  2VQE O;  1I08 A;  1K4D C;  2JRI A;  4JGS A;  4IHJ A;  1HNW B;  1XQ8 A;  1UFI A;  2DE0 X;  3JAW B;  1YTF B;  4NXN B;  4FMT A;  1Q81 W;  1N36 O;  2P5O A;  1KU9 A;  4NTX A;  3CP1 A;  3D36 A;  3E89 A;  4JI5 B;  4QNH B;  1HW7 A;  2KQX A;  5K1X A;  1MG1 A;  4J7K A;  2XOK G;  4WFB V;  2Q5Z A;  5E79 Z;  1JCH A;  2CGN A;  1TAE A;  5CBF A;  4HNA B;  4H37 A;  3CCR V;  3JAT B;  4FM2 A;  3CPW U;  2IW5 A;  2QE7 G;  2ZD9 A;  3FB6 C;  3JYC A;  3K79 A;  1WPX A;  5LA6 B;  4AQY O;  4MVS A;  2OWO A;  5FPR A;  2XAH A;  3R66 A;  2ODM A;  4LR3 A;  4UCO A;  2YIA A;  2DMX A;  4E2L A;  3K58 A;  1RP3 B;  4RO2 A;  2UXD B;  4JI2 B;  1I94 B;  5LBQ A;  1AJP A;  4CBC A;  4I4T A;  2Y0P A;  2JJ2 G;  3NR7 A;  2YXL A;  2ADP A;  4J42 A;  4MVM A;  4G2K A;  4JI8 O;  4FIP C;  3CJH B;  2OYQ A;  3ZS8 C;  1QNM A;  2WLK A;  4IYI A;  3SDL A;  4LF7 O;  2ITD C;  2UUA O;  4H0L B;  3U0Z A;  5H6R A;  2HJF C;  1DF5 A;  2ZR2 A;  1G4Y B;  3M8A A;  3X2Q B;  2QR4 A;  1O9G A;  1B3Q A;  3JAK A;  1M9N A;  2WLI A;  4JI1 B;  1AI5 A;  3SPH A;  4X20 A;  4KUM A;  1RM1 B;  3BA8 A;  3JAS B;  5CB4 B;  3ZMT A;  2WLL B;  1Q82 W;  2QWP B;  1R3L C;  3K06 A;  2EIL B;  2H3O A;  2W0X A;  5BR8 O;  5L3D A;  5B1B C;  2Q0O C;  2OIE A;  3LSS A;  3T1C A;  2B5U A;  3CCJ V;  3E86 A;  3FYI B;  2DYR C;  2UUC O;  4Z2W A;  1IBK B;  4LFC O;  5BXZ A;  4FM1 A;  1ZX3 A;  1XL6 A;  5C8Y A;  2M6Y A;  2UXB O;  3L71 H;  1D5N A;  3CCQ V;  1XDC A;  2HP8 A;  3VOU A;  1VF5 B;  3ABK C;  4LF4 O;  4UVB A;  3RYH A;  3RT3 C;  3G6B A;  4DUZ O;  2FL4 A;  2YDE A;  1L0L H;  3RFR A;  2Y4U A;  1UJW B;  1VQL V;  3CME V;  1FXV A;  3B77 A;  4O4I A;  1S5J A;  4YJ2 A;  5JVD A;  1KD1 W;  1NTZ H;  4LBE C;  4AIL C;  3ZRW A;  1PPJ H;  5KMG A;  2Q7G A;  4JTA B;  3B8M A;  3SPG A;  3K08 A;  1PKX A;  4FLY A;  4BW5 A;  3E8G A;  1OZ0 A;  3HB3 B;  1PL0 A;  4X1I A;  5CMU A;  2P06 A;  1NKD A;  2P67 A;  3OUS A;  3QVN A;  4ASU G;  2VQF B;  1SF9 A;  4LNU A;  2IH3 C;  2CTR A;  4O4H A;  1QVF U;  4LF6 O;  3AG2 C;  3L70 H;  3G6E V;  2X0L A;  1EFR G;  3MHH C;  3K59 A;  1MA1 A;  4TV8 A;  1K7D A;  1GM8 A;  4NTY A;  2A0L A;  5EYP A;  1X4T A;  2PGG A;  1WN7 A;  2A79 B;  2P4K A;  1M4U A;  1R6K A;  2W0F C;  4OX9 B;  5IYZ A;  1WNS A;  1GTO A;  3VQV A;  4BW9 A;  2GV9 A;  4DR1 O;  3ZN0 A;  4LH7 A;  5IE9 A;  3TK1 A;  4IIJ A;  1BZK A;  1OCO C;  2PI4 A;  4MVO A;  3CCL V;  2F4V B;  4DR6 O;  4UCT A;  4IYH A;  4N21 A;  4FZ1 A;  4Z1M G;  3H1I H;  1GN2 A;  4UCR A;  3OGI B;  1ZL8 A;  2CDY A;  2YIB D;  2UXC O;  4KFM A;  4JYA B;  2ITC C;  4C7U A;  2IJI A;  3FKS G;  1WJZ A;  4JI6 B;  3E22 B;  4FLT A;  2BOB C;  1IZ3 A;  3T2M A;  4GX2 A;  1K97 A;  4DV6 B;  4ABM A;  2JGD A;  4NXN O;  1XOU A;  3Q4H A;  3SJB C;  5KAI Z;  3JAL B;  1R3J C;  5J9P C;  3OW2 U;  4JI5 O;  4RQF A;  3FYE B;  3K9A A;  3K5O A;  3TXQ A;  3EXA A;  1F7Y A;  1E1Q G;  1J5E B;  1K3E A;  1N0J A;  2QKS A;  5JJE B;  2XAQ A;  2ZIM A;  3IC7 A;  3W7S A;  2Q4P A;  5LP6 C;  5LMN B;  1PD3 A;  5KHK A;  2EBO A;  5H5N A;  1SZX A;  4PV1 B;  1EBO A;  5LMU B;  4TUY B;  3G4S V;  4IGG A;  4DRX A;  1VQO V;  1FJG B;  3FB8 C;  4B7E A;  2RDC A;  3A8T A;  4X66 B;  2O57 A;  4X62 B;  3JD0 A;  1M5I A;  2F93 B;  2UXD O;  2OCC B;  4JI2 O;  4I5S A;  1I94 O;  3RWR D;  3ZHU A;  1LR1 A;  1B06 A;  1QLN A;  5BZB A;  3SPC A;  2Q67 A;  3ABM C;  2NLJ C;  1AR1 B;  4U7O A;  1ROP A;  3PJS K;  3QO7 A;  2QM7 A;  3DXR B;  2BSK A;  1NS1 A;  1R1B A;  4MS2 A;  2EIK B;  4JTD B;  1NI8 A;  2Y4T A;  3RBZ A;  2CH7 A;  1FKA O;  4UVC A;  2ZE8 A;  3ASO C;  2RN9 A;  5IJ0 B;  1AP6 A;  2R9A A;  3K04 A;  4RQE A;  4O4L A;  4JI1 O;  1QLE C;  2JIZ G;  3N27 A;  2IU0 A;  3DTU B;  2H94 A;  3JAR B;  4GKK B;  2R9R B;  1MMM A;  3JCU Z;  2F95 B;  3T4Z A;  4U3J A;  3W7X A;  1K33 A;  3BCC H;  1CEZ A;  3HR0 A;  4ICG A;  3FAV B;  5KUK A;  3ZMZ A;  2IJJ A;  2ZNJ A;  2N74 A;  5LXT A;  4ZIB A;  2AGA A;  1P49 A;  3I56 V;  2PF4 E;  3A0H Z;  3B4S A;  5LHG A;  1IBM B;  3W7W A;  1NQT A;  5FPO A;  1MSD A;  4PDR A;  1K5S A;  4JTC B;  4LFA B;  3GWO A;  5B66 Z;  1IBK O;  2DYS B;  5EC2 C;  3OR7 C;  5JCO C;  2WLJ A;  1BGY H;  1SC5 B;  5JH7 A;  1BQ0 A;  1M93 A;  1N8R W;  3PN1 A;  3BFR A;  1US6 A;  5GON B;  3LNN A;  4PA4 A;  4PA6 A;  4K8Z A;  2MK3 A;  2K9P A;  3SJQ C;  2JJ1 G;  4I4T B;  3JSL A;  3CSX A;  1SQF A;  1K73 W;  4B7K A;  4PEL A;  4JI3 B;  1OCR C;  2UXN A;  1H2L A;  1FXK C;  1TUB B;  1KP3 A;  3K0G A;  4L8J A;  4FK5 C;  2XAF A;  3SYC A;  2GHY A;  1SRY A;  1BE3 H;  1YIJ V;  5IDJ A;  3STZ C;  5KA5 A;  1WB7 A;  1YDX A;  2DW4 A;  4B3R B;  1PP9 H;  1S5H C;  1XMO O;  5KX5 B;  5IJ9 A;  2HKO A;  4BIU A;  4PJ0 Z;  2RNB A;  3O65 A;  3ZX6 A;  3BEH A;  3J7A U;  4WF9 V;  1YI2 V;  1TUE B;  1V9P A;  2VQF O;  1WP7 A;  3IAY A;  3ETE A;  4TQD A;  4JZ2 A;  5LP6 A;  1KYO F;  1QU7 A;  1I5Y A;  3HPL C;  2LJ2 A;  4HYO A;  3W7T A;  1ZTE A;  3CCE V;  2P6J A;  3H1L H;  5B1O A;  2PI5 A;  2QKC A;  2PYJ A;  1JJ2 U;  1MZF A;  1HR0 B;  4CH3 A;  3UCS C;  4PA3 A;  2EIN B;  3P30 A;  4I50 A;  5D5Q A;  4K0K B;  1JFF A;  1F4N A;  1I7F A;  5B3S C;  2GUZ B;  2IJK A;  4OX9 O;  2ZDI C;  3LNM B;  4A5U B;  4QJF B;  5K1P A;  2XUM A;  5CA3 A;  1IX9 A;  2ZT9 B;  3HKB A;  4Q20 A;  2BTQ B;  1OV9 A;  1GN6 A;  2FYU H;  3HKD A;  3CRA A;  4LP8 A;  2F4V O;  5C8Y B;  3N2G B;  3WG7 C;  1F4M A;  3RYC B;  2Q7H A;  2PUS A;  2EUL A;  3MAQ A;  4DR7 B;  4JYA O;  5B1A B;  4O2B A;  3RYI A;  4B3T B;  1FFX A;  4O4I B;  1GK9 A;  3ETG A;  2UXX A;  1VQ5 V;  3K3W A;  1KP2 A;  2LGQ A;  4JF3 A;  3UT5 B;  2XT9 A;  2QWN B;  1XRE A;  4DV6 O;  5KMG B;  4X64 B;  1SET A;  2D3O W;  1HNZ B;  1PV0 A;  4MW3 A;  1VEW A;  4J10 A;  3CWB H;  2EZO A;  1V54 C;  1GMG A;  4UXN A;  3THO A;  2QJ1 A;  4X1I B;  1WPB A;  1JA8 A;  3P3N A;  5CA1 B;  4WFF A;  1J5E O;  4E4E A;  4JAV A;  4DV0 B;  5LMN O;  3CC4 V;  5LGT A;  2VS0 A;  2N05 A;  1WB8 A;  5LOV A;  3ZHT A;  1GO3 F;  2EJ7 A;  4YJ3 A;  1K9M W;  2OTL V;  4DW0 A;  4O2A A;  2EIJ C;  3OTF A;  2DJV A;  4WBN A;  5LMU O;  4TV8 B;  4H44 B;  4MVQ A;  4UV9 A;  3N2K A;  1FJG O;  4PHZ A;  2PZS A;  1M1K W;  1IUR A;  5JCO A;  1EN5 A;  5F2V O;  4X66 O;  4L87 A;  2DOS A;  2DQ3 A;  2JDI G;  4X62 O;  5J2T B;  4KXR A;  3TET A;  1VQ4 V;  3B09 A;  3AG4 B;  4I0X B;  4B3S B;  1JMK C;  2ADQ B;  4YHH B;  1GN4 A;  2WLN A;  4FZ0 A;  5FNV A;  1K34 A;  1XL4 A;  1H2M A;  1KQS U;  2WA3 A;  5ITZ A;  4J9Z B;  1AVM A;  1YZB A;  5FL7 G;  1TVK A;  1BL8 A;  5LGN A;  3RGB A;  4D6T H;  3H1K H;  3QF7 A;  5JJJ B;  3HKE A;  1XI1 A;  1Y66 A;  1U96 A;  3SYP A;  4WCE V;  1RSO A;  4CH6 A;  2R9I A;  1UPG A;  2FKX A;  5IY5 B;  5L3C A;  2XAJ A;  4GKJ B;  3CC7 V;  3SYO A;  1YCI A;  1BHB A;  1RPO A;  3UO3 A;  1MSW D;  4GKK O;  1K92 A;  1Q90 D;  3KZI Z;  3S3W A;  5IYD O;  3CRR A;  1Y74 A;  4PI2 A;  1JQ0 A;  5DM6 V;  3QTC A;  3ZCC A;  1AIL A;  2YXY A;  4CS4 A;  4PDV A;  1OHH G;  5JQG A;  1GKF A;  2HG5 C;  2P90 A;  3VQW A;  1YVW A;  3R65 A;  1IBM O;  3HKC A;  3F7V C;  1N34 B;  3TCU A;  3ZN1 A;  2ZM6 B;  2ZDI A;  2ETN A;  4LFA O;  1YEW A;  4W4K A;  4X88 A;  4DRX B;  1JJO A;  3S3X A;  2R70 A;  1F23 A;  5BMV A;  1LNQ A;  3BY6 A;  4QIW F;  3RVZ A;  2H8P C;  4UB6 Z;  3UO2 A;  4EFE A;  1Q3E A;  3X2Q C;  2QWO B;  1OCC C;  3TGU H;  2FTK A;  1RFY A;  1CXZ B;  2ZIO A;  3GB7 C;  3U11 A;  3A2F A;  4DUY B;  1DK1 A;  1RM1 C;  1S72 V;  4JI3 O;  5LYJ A;  3W7U A;  4CZZ A;  1MAB G;  4DV4 B;  4IL6 Z;  2KG7 A;  2LFR A;  3ZMV A;  3LSU A;  2Y0I A;  3EVK A;  2EIL C;  4OXS A;  3K03 A;  4LWS A;  1NVP B;  4K3A A;  4B3R O;  1M56 B;  1MZE A;  3CRM A;  1GAX A;  1FPO A;  2CH7 B;  1H38 A;  4PDM A;  3ZRV A;  4YY3 B;  2BTO A;  1SQP H;  1KBH A;  3OT7 A;  2B1G A;  3CMA V;  3FX7 A;  5DEC A;  2YEV B;  4ZI7 B;  1MOF A;  1B04 A;  1OJH A;  1XMO B;  2LO1 A;  1WA8 A;  1T5E A;  4NB5 A;  1HR0 O;  2EZP A;  2HVJ C;  2XTA A;  1NH2 B;  1AI4 A;  3P32 A;  4K0K O;  2GSM B;  1GM9 A;  1XUQ A;  1BT8 A;  1ARO P;  2FB5 A;  3K5L A;  1SES A;  1DGS A;  2AXT Z;  3KKY A;  1W0J G;  1X59 A;  2OT5 A;  5EIB D;  3JAW A;  1AI6 A;  1Q43 A;  2ARH A;  1OCO B;  3VBB A;  5JH7 B;  4JPR A;  1V55 B;  5EK0 A;  5IYB O;  4NTW A;  1YHQ V;  4DV2 B;  4DR7 O;  1FS0 G;  1GRJ A;  1AI7 A;  1THZ A;  1NU1 H;  3ZJZ A;  2QTO A;  3OM3 B;  4PDL A;  1FXH A;  3OFN G;  4B3T O;  4HNA A;  2P4V A;  2W6I G;  2UUB B;  1NZ6 A;  4G27 B;  1L0N H;  4GZR B;  3JAT A;  3C3S A;  3ASN B;  4U3F H;  4X64 O;  1HNZ O;  5KAF Z;  3F5W C;  4JYB A;  5KHG A;  3JSN A;  4QGP A;  4TT3 G;  3OEE G;  1QCE A;  2LFS A;  4J41 A;  1N32 B;  1PNM A;  2XAG A;  2V4D A;  4I55 B;  4UCS A;  4JV5 B;  4PD4 F;  4DV0 O;  4WFG A;  4HZ3 A;  4O4J B;  1D2D A;  1KKC A;  4P30 A;  4DK1 A;  2VWK A;  4OGQ B;  3WB2 A;  3K5M A;  3O9O A;  4P9P A;  2EJR A;  1NR1 A;  4H13 B;  2ZXW B;  5CN0 A;  3CJH A;  5EZY B;  4FM0 A;  4DV5 B;  3T1H B;  1ZAU A;  2AW9 A;  4I50 B;  1SQV H;  1H2K A;  1HNX B;  1GM7 A;  2F66 C;  2WLH A;  5EBW C;  4XBF A;  2PY5 A;  1NVP D;  4B3S O;  4LCU C;  5EBM C;  1SQX H;  4DR5 B;  3LDC A;  4YHH O;  3HKB B;  4JZG A;  1Q7Y W;  4ZOL B;  3HKD B;  4UCV A;  4BAY A;  1ENV A;  2IJH A;  2YIB A;  5CB4 A;  1ZSP A;  3A0B Z;  3OUF A;  4F4L A;  1NR7 A;  3AG1 B;  5IYC O;  5JJN B;  2QWR B;  1SQQ H;  1E79 G;  4FJC C;  2K1E A;  1U97 A;  3TXS A;  3RYI B;  1Y76 B;  2Q73 A;  1FFX B;  1R73 A;  2CGO A;  1NH2 D;  4NR1 A;  4JI7 B;  3DGE A;  5JWP A;  1J95 A;  2YI8 A;  1VF7 A;  4GKJ O;  3B8N A;  3DSQ A;  4U7N A;  3OMI B;  5J2U B;  3IGA C;  4X65 B;  1QBZ A;  3KG2 A;  2RMK B;  3SGI A;  4BIO A;  3L74 H;  2OCC C;  4IHJ B;  1EM1 A;  2WWW A;  4DYL A;  1ZLZ A;  3ABL B;  5L3B A;  2BOC C;  1CPY A;  4AI8 A;  5LOV B;  1N34 O;  2ZM6 O;  3BVO A;  2E5L B;  4O2A B;  1M57 B;  4DW1 A;  2IM9 A;  5EBL C;  3OMA B;  1XNQ B;  2EIK C;  1FFT B;  3RYF A;  3CRC A;  1TGO A;  1L1F A;  3LDE A;  3AK1 A;  3I55 V;  3OR6 C;  2P7T C;  5B1N A;  1S76 D;  1OCZ B;  3L9D A;  1XMQ B;  3T4D A;  3ICX A;  4DUY O;  4LF5 B;  4MSW C;  3AG3 C;  3APQ A;  5KA6 A;  4DV4 O;  3LSQ A;  4GYC B;  4X1Y A;  5C93 A;  5LHH A;  3UM7 A;  2Q7E A;  2W6J G;  1VQ8 V;  2Y69 B;  3OTO B;  2LW7 A;  5H2F Z;  2Q6A A;  4P2Z A;  4FLV A;  5TIS Z;  1CP9 A;  3L75 H;  2RJZ A;  3GVM A;  3MHS C;  2EIM B;  3CYO A;  4LF8 B;  4YY3 O;  1SQB H;  1RSO B;  2VWJ A;  2P22 C;  1EN4 A;  3ZMS A;  4EB6 A;  2DYS C;  2OCH A;  2GDS A;  2RCV A;  4HAM A;  3WU2 Z;  1EZV H;  1XNR B;  1IXM A;  1R6T A;  1Y74 B;  3ZED A;  3G67 A;  3JAK B;  1PNL A;  2HR3 A;  3J80 N;  2QA4 V;  2WLI B;  5JQG B;  2WPD G;  4TWK A;  2ZIN A;  4X20 B;  1PL4 A;  2UU9 B;  2YC0 A;  3B40 A;  1K4C C;  4X9Q A;  3ZIA G;  3QO5 A;  3JCZ A;  4TOI A;  4R50 A;  4JYY A;  4YXW G;  2YUA A;  3QG5 A;  3CCU V;  4Q6G A;  4J9Y B;  3CCS V;  3BPZ A;  3K9S A;  5LGU A;  3EFF K;  5KHJ A;  1YJW V;  2YSU B;  3JAL A;  4J11 A;  1GN3 A;  4DV2 O;  1A32 A;  3CCV V;  4GLX A;  2F23 A;  3E2E A;  4YIP A;  5IT9 N;  2MW2 B;  3QO8 A;  5LYJ B;  5GTI Z;  2UUB O;  4K8X A;  5KHI A;  1P84 F;  1Y6X A;  5EC1 C;  4DR4 B;  3RYH B;  4FVM A;  4TUY A;  1HP8 A;  2EIN C;  4N23 A;  1IDS A;  1N32 O;  4PA9 A;  1S77 D;  4I7Z B;  4YJ2 B;  2HJD A;  5JVD B;  5B5E Z;  2Q69 A;  4JV5 O;  1YIT V;  2CTW A;  2QM4 A;  3IC9 A;  3ZRW B;  2CE4 A;  1VMG A;  3OAA G;  4FPP A;  4GX5 A;  1P7B A;  2KKW A;  4KP4 A;  1YJN V;  1EZJ A;  1JX9 A;  3CD6 V;  2JVD A;  2ZR3 A;  1SQG A;  3QNE A;  1R3I C;  4DR2 B;  4DV5 O;  1NT2 B;  1W59 A;  3T1H O;  1DTO A;  1BSM A;  1RPR A;  4LNU B;  5B1A C;  4LFB B;  1VF6 C;  1AP5 A;  3DXR A;  4J80 A;  4JI0 B;  1HNX O;  3OMN B;  3LUT B;  2QKA A;  2Q9L A;  4O4H B;  2N04 A;  5IJ0 A;  1N33 B;  4DR5 O;  3M7M X;  4FLZ A;  3MDS A;  2ZCE A;  2PTM A;  1YF2 A;  2WAM A;  5EYP B;  4OPA A;  3ZHS A;  2JS3 A;  3JAR A;  1NJI W;  3AK3 A;  1N0N A;  1TA8 A;  1JOY A;  5IYZ B;  3FFQ A;  1SKV A;  4GX1 A;  1JR9 A;  4YIO A;  3H9V A;  3FAV A;  4IT5 A;  4IIJ B;  4B3M B;  2Z0A A;  3IJ4 A;  3SYA A;  4BWA A;  2QTS A;  4MVZ A;  4UVA A;  4JI7 O;  4B08 A;  1FXK A;  5CA0 A;  2FML A;  4FFB A;  1ZL8 B;  4LH6 A;  4JI4 B;  1COW G;  2IH1 C;  4X65 O;  2XND G;  1YSC A;  2LW1 A;  1BCC H;  1H2S B;  5HFM A;  3AG4 C;  3P3P A;  5H9C A;  3JD4 A;  1G8M A;  2AHZ A;  5LHI A;  3JD3 A;  3F7Y C;  2JGD B;  5GON A;  3Q4H B;  3CC2 V;  4XDK A;  2LGW A;  1R3K C;  4RWU A;  3E35 A;  2E5L O;  4DR3 O;  1TUB A;  4DV1 O;  1XNQ O;  2QDO A;  5AG2 A;  2F1M A;  3AK2 A;  5B1B B;  4TV9 A;  5KX5 A;  1KB9 F;  3CE2 A;  5EIB C;  2HHH B;  5L3E A;  3K5N A;  4X1K A;  3CXC U;  2X6B A;  5IY5 C;  2XHB A;  2DYR B;  1XMQ O;  4FLX A;  1OCC B;  1SA0 A;  1YXB A;  3M99 B;  4GT1 A;  2YS8 A;  2Q68 A;  4LF5 O;  3ETQ A;  3CRQ A;  4K35 A;  4JAS A;  2ZKO A;  3OD4 A;  1NTK H;  2JEU A;  2CAZ C;  4WFH A;  3OTO O;  4ZKI A;  3CEI A;  3ABK B;  5KLV H;  3ZBH A;  2DQ0 A;  1VQN V;  1Q6U A;  1S3J A;  4H33 A;  2JEX A;  2JK5 C;  3ZHR A;  4PI0 A;  3BAA A;  4DK0 A;  4LF8 O;  2KB1 A;  1Q5O A;  4D7T A;  1VP7 A;  2GUZ A;  4CC6 A;  4DV7 B;  3ZHV A;  4Z1V A;  2WSS G;  3K57 A;  2WA4 A;  2BSK B;  2L6L A;  3SJA C;  2BTQ A;  1JPX A;  1P7G A;  2KSD A;  4TSF G;  2QWQ B;  4NXM B;  4R6Z A;  1IXB A;  1XNR O;  4NYK A;  4AHC A;  1VQK V;  3CB2 A;  4QPJ A;  3N2G A;  3WB1 A;  3CCM V;  4PA7 A;  1EN6 A;  1YTF D;  4X89 A;  3RYC A;  4O4L B;  3MD0 A;  1VQM V;  2WLM A;  4ZHQ A;  3J81 N;  4UFZ A;  1VF6 A;  2UU9 O;  1H8H G;  5DN6 G;  1AJQ A;  5GTH Z;  4U3J B;  2C2A A;  3AG2 B;  2GBO A;  3ZHQ A;  4EKW A;  1I5X A;  3UT5 A;  3ETD A;  5CBH A;  1W2B U;  3K0D A;  2M7W A;  1M56 C;  3RYF B;  5LXT B;  5A2Q N;  2X7R B;  1S0V A;  4F6R A;  1FD9 A;  1XBL A;  4MT8 A;  2Z5U A;  1IBL B;  5CA1 A;  1BMF G;  2JGU A;  4RAI A;  5FLX N;  3FB7 C;  5HFL A;  1BQZ A;  4J7J A;  1DLB A;  2L35 A;  5A9G A;  1WLE A;  3E8H A;  1Z5W A;  1VAR A;  4X1Y B;  2AZ2 A;  4MVU A;  4WFE A;  3RW0 A;  4DR4 O;  4OPH A;  3AG7 A;  4GCZ A;  1PNK A;  2PYL A;  3SPI A;  1Z2G A;  2ZE7 A;  1WAZ A;  3T1Y B;  3ML0 A;  1D5A A;  4EFB A;  2CK3 G;  3RN4 A;  4UV8 A;  1FYJ A;  1HWY A;  5J2T A;  1ZWI C;  4R8C A;  3FD9 A;  4EEQ A;  2AHY A;  4I0X A;  4EB6 B;  5LA6 A;  4MTO A;  5IWA B;  1B6Q A;  1WP8 A;  5IJ9 B;  4JYC A;  4BR6 A;  1Q8I A;  2DN9 A;  2Z3Y A;  1V55 C;  3VQX A;  3BRC A;  4DR2 O;  3G71 V;  1SZT A;  1NTM H;  3UQ8 A;  4LFB O;  3KCY A;  2E75 B;  4JI0 O;  2NR5 A;  5LP6 B;  4CH4 A;  1URF A;  2D2C B;  3BHP A;  5E1A C;  3ZRS A;  3D8C A;  1N33 O;  2ZNI A;  3TJT A;  3F5T A;  3H01 A;  1AR4 A;  3ASN C;  1HNW O;  2X6A A;  2OTJ V;  3OEH G;  2ATK C;  2GTA A;  4KHP B;  4LF9 B;  1JFF B;  3B2E E;  1XEQ A;  1H2N A;  1DF4 A;  1W0K G;  4MTG A;  5GW7 A;  2HVK C;  3JAM N;  2VQE B;  2BE3 A;  4DV3 B;  2E3C A;  3VQY A;  3E83 A;  4UB8 Z;  2DWE C;  1BHA A;  3RVY A;  4B3M O;  4MVR A;  1QR9 A;  3SR2 C;  3U10 A;  1N36 B;  2E74 B; 
#chains in the Genus database with same CATH homology
 1FXV A;  3B77 A;  4HAM A;  4L87 A;  2DQ3 A;  2JDI G;  1IXM A;  3TET A;  3ABM B;  2WLL A;  4UUJ C;  1KD1 W;  2ZXW C;  3ZRX A;  1VQ4 V;  3AG4 B;  4LBE C;  1VQ7 V;  1PNL A;  2HR3 A;  3ZRW A;  2QA4 V;  2WLI B;  1Y4M A;  2WLN A;  2WPD G;  4QPK A;  4TWK A;  4RUF A;  4JTA B;  3B8M A;  3LDD A;  3K08 A;  3SPG A;  1PKX A;  1K34 A;  4BW5 A;  1XL4 A;  3E8G A;  1OZ0 A;  3HB3 B;  1K4C C;  1PL0 A;  3ZIA G;  1KQS U;  3QO5 A;  3JCZ A;  3ASO B;  2QEX V;  3ABT A;  4J9Z B;  4R50 A;  5CMU A;  4YXW G;  5FL7 G;  1NKD A;  1BL8 A;  2P67 A;  3CCU V;  4LC1 A;  5LGN A;  1QLE B;  3OUS A;  4ASU G;  1VQP V;  4J9Y B;  3CCS V;  1P4R A;  2IH3 C;  5LGU A;  1Y66 A;  3EFF K;  3FB5 C;  1YJW V;  2YSU B;  3SYP A;  4WCE V;  1QVF U;  3AG2 C;  3G6E V;  5KUM A;  3AG1 C;  2X0L A;  1EFR G;  1JVM A;  2HLD G;  1K5Q A;  2Y48 A;  3D3I A;  3MHH C;  2R9I A;  5IY5 B;  3CCV V;  1R6N A;  1K7D A;  5L3C A;  2XAJ A;  3CC7 V;  3NXS A;  3SYO A;  1BHB A;  1RPO A;  3E2E A;  1GM8 A;  2A0L A;  3SPJ A;  3QO8 A;  1MSW D;  2A79 B;  1K92 A;  3OE7 G;  5L3G A;  4GX0 A;  1R6K A;  2W0F C;  5IYD O;  1JQ0 A;  5DM6 V;  5EC1 C;  3ZCC A;  1GTO A;  2YEV A;  4PDV A;  1OHH G;  2EIN C;  3ZN0 A;  3TK1 A;  1GKF A;  2HG5 C;  2P90 A;  4N23 A;  1OCO C;  5H6Q A;  3R65 A;  2PI4 A;  4PA9 A;  1S77 D;  3AG3 B;  3F7V C;  4MVO A;  3TCU A;  3ZN1 A;  3CCL V;  1M90 W;  3JD2 A;  2Q69 A;  4N21 A;  2ZDI A;  3JD1 A;  1YIT V;  2IU3 A;  4Z1M G;  4X88 A;  3ZRW B;  4JAU A;  4KFM A;  3ABL C;  3OAA G;  2ITC C;  4FPP A;  1F23 A;  2IJI A;  4GX5 A;  1P7B A;  4KP4 A;  1YJN V;  1LNQ A;  3BY6 A;  1EZJ A;  4ZBM A;  3FKS G;  1JX9 A;  3CD6 V;  2HFE C;  1OCR B;  4QIW F;  3RVZ A;  2H8P C;  2ZR3 A;  5CBG A;  1M57 C;  3QNE A;  1R3I C;  1FXK B;  4X8A A;  2NNU A;  2BOB C;  3AEI A;  4MTX A;  4XDL A;  3X2Q C;  3T2M A;  4GX2 A;  1K97 A;  1OCC C;  1DTO A;  1RPR A;  2FTK A;  5B1A C;  3GB7 C;  2V1D A;  1YJ9 V;  3UKM A;  4DO2 A;  1RM1 C;  1S72 V;  3OMN B;  3LUT B;  3W7U A;  1VQ9 V;  1R3J C;  4CZZ A;  1H8E G;  1MAB G;  5J9P C;  3OW2 U;  1QVG U;  4RQF A;  3FYE B;  3K9A A;  1OCZ C;  2LFR A;  3ZMV A;  1E1Q G;  1K3E A;  2QKS A;  3A0R A;  3ZMU A;  2WAM A;  2XAQ A;  2EIL C;  3IC7 A;  4OXS A;  3K03 A;  3WFV A;  1NVP B;  3IFX A;  3W7S A;  1M56 B;  1K8A W;  1PD3 A;  2QM8 A;  1H38 A;  1NJI W;  4PDM A;  3ZRV A;  2EBO A;  1JOY A;  4GX1 A;  2B1I A;  2B1G A;  3CMA V;  2Y69 C;  1KC8 W;  2YEV B;  1EBO A;  3G4S V;  1MOF A;  1KEC A;  1VQO V;  2F43 G;  3FB8 C;  3SYA A;  2EIM C;  5B3S B;  4MVZ A;  4UVA A;  3JD0 A;  1FXK A;  2OCC B;  4I5S A;  2EZP A;  4MW8 A;  2HVJ C;  3STL C;  1NH2 B;  1AI4 A;  1COW G;  3P32 A;  2IH1 C;  1QLN A;  2XND G;  1YSC A;  2GSM B;  3E8B A;  4MTF A;  1GM9 A;  1SER A;  1ARO P;  5BZB A;  3SPC A;  2Q67 A;  3ABM C;  1SES A;  3WG7 B;  2LP7 A;  2NLJ C;  3SYQ A;  4U7O A;  5HFM A;  1AR1 B;  2XAS A;  3AG4 C;  4BIZ A;  5H9C A;  3JD4 A;  1G8M A;  1ROP A;  3PJS K;  1QR8 A;  1W0J G;  2AHZ A;  3JD3 A;  3QO7 A;  5LHI A;  2QM7 A;  3F7Y C;  5L3F A;  2OT5 A;  2A9H A;  2ZQM A;  2EIK B;  3E8F A;  4MS2 A;  3CC2 V;  1AI6 A;  1F51 A;  4JTD B;  4XDK A;  3RBZ A;  4QE9 A;  1R3K C;  1OCO B;  3E35 A;  3VBB A;  4UVC A;  4JPR A;  1V55 B;  3ASO C;  5EK0 A;  5IYB O;  4R7C A;  3K04 A;  1YHQ V;  4RQE A;  1FS0 G;  1AI7 A;  1QLE C;  2JIZ G;  2IU0 A;  1THZ A;  3DTU B;  3ZJZ A;  2QTO A;  3OM3 B;  4PDL A;  1FXH A;  3OFN G;  2H94 A;  3OGC C;  5B1B B;  4WFA V;  2R9R B;  1V54 B;  2X6C A;  1Q86 W;  1NBM G;  3T4Z A;  3W7X A;  2W6I G;  1E1R G;  5L3E A;  4G27 B;  1K33 A;  1CEZ A;  3CXC U;  2X6B A;  3ASN B;  5IY5 C;  2DYR B;  1AJN A;  1OCC B;  3M99 B;  4GT1 A;  3ZMZ A;  4DXW A;  5KUK A;  2IJJ A;  2Q68 A;  3F5W C;  4QE7 A;  4JYB A;  2V7Q G;  4TT3 G;  3OEE G;  1QCE A;  2LFS A;  3I56 V;  4P9O A;  1PNM A;  1H2G A;  2XAG A;  5LHG A;  3W7W A;  1VQ6 V;  1NQT A;  4I9W A;  3EHB B;  4JAS A;  4PDR A;  2EIJ B;  1K5S A;  4RUE A;  2JEU A;  4WFH A;  1ORQ C;  4ZKI A;  3ABK B;  4WFG A;  4JTC B;  4HZ3 A;  2DQ0 A;  3GWO A;  1VQN V;  1S3J A;  2DYS B;  2JEX A;  2JK5 C;  4H33 A;  5EC2 C;  1KKD A;  4P30 A;  3OR7 C;  2WLJ A;  4XDJ A;  2DWD C;  4G28 B;  2KB1 A;  4P9P A;  2EJR A;  1NR1 A;  3ABU A;  1N8R W;  1K4D C;  2ZXW B;  2WSS G;  5CN0 A;  4JGS A;  4PA4 A;  4PA6 A;  2MK3 A;  3SJQ C;  2JJ1 G;  1YTF B;  1JPX A;  4FMT A;  1K73 W;  1Q81 W;  4TSF G;  1GM7 A;  4R6Z A;  4PEL A;  1VQK V;  1OCR C;  2WLH A;  5EBW C;  2UXN A;  3CP1 A;  4XBF A;  3D36 A;  3E89 A;  1FXK C;  4QPJ A;  3CCM V;  4PA7 A;  1NVP D;  1KP3 A;  3K0G A;  4QNH B;  4FK5 C;  2XAF A;  4X89 A;  2GHY A;  4LCU C;  5EBM C;  3SYC A;  1YTF D;  1SRY A;  3LDC A;  1MG1 A;  1YIJ V;  3MD0 A;  1VQM V;  2WLM A;  5IDJ A;  2XOK G;  4WFB V;  1JCH A;  3STZ C;  5KA5 A;  2DW4 A;  1Q7Y W;  1H8H G;  5DN6 G;  1S5H C;  5CBF A;  4BAY A;  1AJQ A;  1ENV A;  2IJH A;  2HKO A;  2C2A A;  4H37 A;  4BIU A;  3CCR V;  3AG2 B;  3OUF A;  4F4L A;  1NR7 A;  3AG1 B;  4EKW A;  1I5X A;  3CPW U;  2IW5 A;  3ETD A;  3BEH A;  5CBH A;  5IYC O;  1W2B U;  3K0D A;  4WF9 V;  2QE7 G;  1YI2 V;  1TUE B;  2M7W A;  2ZD9 A;  3FB6 C;  3JYC A;  1E79 G;  3K79 A;  4FJC C;  1WPX A;  1M56 C;  2K1E A;  3ETE A;  2X7R B;  4MVS A;  1S0V A;  1I5Y A;  3HPL C;  4HYO A;  3W7T A;  2XAH A;  1R73 A;  3CCE V;  1NH2 D;  2P6J A;  2PI5 A;  4MT8 A;  5B1O A;  3DGE A;  1J95 A;  4E2L A;  1JJ2 U;  4RO2 A;  2Z5U A;  3B8N A;  1BMF G;  5LBQ A;  1AJP A;  4U7N A;  4PA3 A;  4RAI A;  2EIN B;  3OMI B;  3P30 A;  3FB7 C;  4CBC A;  5HFL A;  1DLB A;  2JJ2 G;  3IGA C;  1QBZ A;  1F4N A;  5B3S C;  3KG2 A;  1WLE A;  3E8H A;  4MVM A;  4G2K A;  2IJK A;  2ZDI C;  4MVU A;  4WFE A;  3LNM B;  3RW0 A;  4FIP C;  4QJF B;  2OCC C;  5CA3 A;  2WLK A;  2WWW A;  4GCZ A;  1PNK A;  4Q20 A;  3ABL B;  5L3B A;  2BOC C;  1CPY A;  3SPI A;  2ITD C;  3ML0 A;  4LP8 A;  2CK3 G;  5H6R A;  4UV8 A;  2HJF C;  1HWY A;  1DF5 A;  3WG7 C;  1M57 B;  1F4M A;  1ZWI C;  1G4Y B;  2ZR2 A;  4R8C A;  5EBL C;  3X2Q B;  3OMA B;  2AHY A;  1M9N A;  5B1A B;  2WLI A;  2EIK C;  1AI5 A;  4MTO A;  1FFT B;  3SPH A;  1B6Q A;  4KUM A;  1RM1 B;  1L1F A;  3LDE A;  4JYC A;  1GK9 A;  3ETG A;  2Z3Y A;  2UXX A;  3ZMT A;  1V55 C;  3I55 V;  3K3W A;  3OR6 C;  1VQ5 V;  2P7T C;  5B1N A;  2WLL B;  3G71 V;  1SZT A;  1KP2 A;  4JF3 A;  1S76 D;  1OCZ B;  1Q82 W;  1R3L C;  1SET A;  3K06 A;  2D3O W;  2EIL B;  3T4D A;  4MW3 A;  5L3D A;  4MSW C;  5B1B C;  2EZO A;  5E1A C;  3ZRS A;  1V54 C;  3AG3 C;  1GMG A;  4UXN A;  5KA6 A;  3LSS A;  3LSQ A;  3T1C A;  5C93 A;  5LHH A;  3UM7 A;  2B5U A;  3H01 A;  3CCJ V;  2W6J G;  3E86 A;  1VQ8 V;  2Y69 B;  3ASN C;  4WFF A;  3FYI B;  2X6A A;  2DYR C;  2OTJ V;  3OEH G;  4JAV A;  2ATK C;  2Q6A A;  4P2Z A;  1CP9 A;  3CC4 V;  5LGT A;  3MHS C;  2EIM B;  1DF4 A;  1W0K G;  3CYO A;  1GO3 F;  4MTG A;  1XL6 A;  5GW7 A;  2HVK C;  1K9M W;  2OTL V;  2EIJ C;  3CCQ V;  3VOU A;  3E83 A;  3ABK C;  4MVQ A;  4UV9 A;  4UVB A;  3ZMS A;  2DWE C;  1BHA A;  2DYS C;  3RVY A;  1M1K W;  4MVR A;  1UJW B;  1QR9 A;  1VQL V;  3CME V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...