1NKDA

Atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords ROP
publication title Structural parameters for proteins derived from the atomic resolution (1.09 A) structure of a designed variant of the ColE1 ROP protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nkdA00
1PD3A 1GTOA 2IJKA 2IJHA 2IJIA 2IJJA 1GMGA 1F4MA 1RPRA 1F4NA 1B6QA 1ROPA 3K79A 4DO2A 1NKDA 2GHYA 1RPOA
chains in the Genus database with same CATH superfamily
3JALB 1S0VA 2JIZG 4YXWG 3Q4HA 4UB6Z 5KHHA 4JV5O 1QNMA 3ZHVA 2KG7A 1HW7A 4X20A 1O9GA 4R6ZA 4GKKB 1NVPD 3WG7B 1RPRA 1HNXB 5KUMA 1XUQA 4HZ3A 2ZNIA 5EYPA 1XNRO 3IC9A 3A0RA 2BOCC 5DM6V 1Y67A 3IAYA 3RYCA 1FKAO 1K8AW 2CGNA 4PA9A 4I4TB 4IIJB 3AG3C 1SQXH 2YIBD 2EZOA 4O4IA 4J10A 4BR6A 3LDDA 3VQWA 1X4TA 3N2KA 1K73W 3LDCA 2QWQB 2AGAA 5J2TA 3QO7A 1H2KA 4JI7O 1IDSA 4ASUG 4K0KB 1U96A 1TUBA 4NTXA 1OCCC 2XTAA 3ZRSA 4JI4O 3BEHA 3JAWB 1N36B 2DWEC 1YTFD 3SJAC 3T1HB 3W7TA 1NVPB 2ZIMA 4LF5B 3DXRB 3C3SA 4X1KA 1N32B 3JATB 4BW9A 3N2GB 5IWAB 3F7YC 2ZE5A 2DOSA 4AI8A 3CRRA 2ADQB 1VF6A 4UCRA 2HLDG 4UVBA 1H38A 4D6TH 4LF6B 4QIWF 4NXNB 4XDKA 3OMAB 1BL8A 3DC6A 4WFBV 4DV5B 5C8YB 3CRQA 3EXAA 2B5UA 4YY3B 5EC2C 2P5OA 4LNUA 3BAAA 3UT5A 2BSKB 2ZR3A 1YDXA 2AXTZ 4DR1O 4PDLA 1VQ6V 1VQ7V 2CH7A 4GCZA 3SPHA 3BCCH 2YXLA 2QTSA 4MVOA 1SQGA 5LHHA 3ABUA 1KD1W 2P22C 1IBKB 3CX5F 1XNQO 1KKCA 2QWNB 2QA4V 2UXNA 5GTIZ 4YHHB 3E86A 5CA0A 3LNMB 2WLNA 4RQEA 1XBLA 1YJ9V 3RT3C 5JJNB 4I55A 2MW2B 4PA7A 5LOVA 1OCZC 3SJQC 1MA1A 3F7VC 1CPYA 3HKDB 4GX1A 5LMUB 2JEUA 1NT2B 1TAEA 5D5QA 3CD6V 1XL4A 1XMQO 1R3LC 3RYHB 2AZ2A 4LBEC 3SYCA 3JCUZ 2BTOA 2EZPA 5JCOC 1NBMG 4ZBMA 1KB9F 2XHBA 2CTWA 1THZA 5B1BC 5CA3A 4XBFA 3T1YO 1BSMA 4IL6Z 1JQ0A 3ZJZA 1IVSA 1CP9A 1JFFA 1VQ8V 1KU9A 3OGIB 1Y74A 5GONB 3TCUA 1QLNA 3CB2A 3I56V 1FYJA 3OT7A 4N23A 4X1IB 3IJ4A 1K34A 2YXHA 3AG4B 2JGDB 4YJ2A 3E8HA 3D8CA 5IYZB 2QM7A 3CC7V 3CPWU 1RSOA 3RGBA 3C3TA 5B3SC 3BPZA 4KHPB 4E2LA 3Q4HB 2UUCB 4B3TO 1H2NA 1H2MA 1R6KA 2IM9A 5L3EA 5EBMC 4H13B 3L75H 1UPGA 2KG7B 3M7MX 4DR5B 4X20B 4DV0O 1S76D 4LFCB 1HR0O 5B5EZ 5HFLA 3FX7A 1QLEC 1L1FA 3T4ZA 1M5IA 4D7SA 1RFYA 2JDIG 1PD3A 2IJHA 3RYCB 4GZRB 5LYJA 4IGGA 3ZMVA 1FJGO 2QE7G 4O4IB 2RN9A 1XMOB 3W7XA 1AJPA 3ETDA 2NR5A 3N2KB 4BIZA 1AI7A 2X0LA 5GTHZ 1M4UA 4X62O 4JASA 3JD3A 5KHIA 4H44B 2ATKC 1PKXA 4F4LA 2IH1C 4J9YB 5LGNA 5LP6A 5JH7A 1TUBB 3GWOA 5LMNO 3K9AA 1BGYH 4JV5B 3L71H 5LXTA 1VEWA 3FB6C 2Q69A 2Y4TA 3MDSA 2IJKA 1WLEA 3C90A 4PHZA 5E1AC 1N8RW 1XNRB 2Y48A 3CHXA 1HNZO 5EIBC 1PL0A 4O2BA 4CH4A 4EB6A 3RVZA 2WLMA 3ZN0A 3ETGA 5E79Z 4GKKO 1MNGA 1AR4A 4LNUB 3H1JH 3UT5B 1OV9A 3OFNG 4OPAA 3TXQA 2CH7B 2PYLA 4ZKIA 5JJJB 3ASOC 2YC0A 5IE9A 1ZL8B 2Q6AA 2DYRC 4OX9O 4JI7B 3K04A 2EJRA 3HKCA 2A9HA 4CZZA 2WLHA 3L74H 1I7FA 2ZM6B 3STZC 4DV6B 3BA9A 5CA0B 3P32A 2E74B 2YIAA 4NKGB 3ZRXA 4I55B 2PTMA 4MT8A 3AG2B 5LOVB 5IY5C 2KKWA 2YI9A 3JD1A 4TOIA 2IU0A 3OR7C 3S3WA 4DRXA 3UCSC 3G71V 4J7ZA 3K57A 1H2SB 3ABKB 4Z1VA 1IURA 4QE9A 3EHBB 4FIPC 2WAMA 4DR1B 1Q8IA 1SQVH 2OTJV 4E4EA 1ENVA 1QBZA 2K1EA 2Y69B 1PNMA 4LF6O 2DQ3A 4NXNO 1HWYA 1NH2D 2GDSA 2H94A 1VQOV 4YY3O 2EIKB 1JFFB 2Q7EA 2XAQA 4RO2A 4NYKA 4DR4O 5IYDO 4X65B 1Y74B 1EN5A 1RM1C 2QKCA 3T2MA 1AI6A 4TV9A 3ZHTA 3X2QB 5BZBA 1YXBA 4EFEA 1SQQH 1CXZB 1SZXA 2N74A 3TK1A 1G4YB 5EZYA 1OCOC 2XOKG 4YJ2B 3O65A 2QTOA 1N0JA 1TGOA 1RSOB 2ARHA 1YZBA 1Q43A 1XMQB 2NLJC 3JCZA 4MW8A 3ZRVA 4P9OA 5JJEB 4JTAB 1XI1A 1URFA 2Q9LA 3CCQV 2EINB 2UXCO 3TXSA 3E22A 4FLTA 1NH2B 4WBNA 1VQ5V 1GN4A 1D5AA 2M7WA 3T1YB 1FPOA 2YIBA 2Q7HA 2XUMA 5H2FZ 5L3CA 1DTOA 1LR1A 1SC5B 1WB8A 4LFAO 4PELA 1MSWD 4RUEA 5LYJB 3CE2A 2F23A 1FXKC 3OE7G 3OUSA 3G80A 2OWOA 5B1AC 1H2GA 1B3QA 4X1YA 1S72V 3OMNB 2ODMA 3CXCU 3RYFA 1KBHA 2WA4A 4ICGA 1YI2V 4LF7O 1YITV 2CUGA 1VQNV 1FFXA 1KUQA 2VWJA 1M90W 4JI5O 5LP6B 2Q0AA 5JH7B 1N34B 3ML0A 4B3TB 4OPHA 5LXTB 4HAMA 1GM9A 2M6YA 4DV0B 1HR0B 1VP7A 2YIDA 1Z5VA 1EZVH 4KHPO 4MVSA 2D3OW 2F95B 2UUCO 3JD0A 3ABMC 4AQYO 2ZDIA 4O2BB 2CGOA 3VBBA 4EB6B 1OHHG 4B3RO 3A2FA 4YJ3A 4LFCO 4KXRA 5TISZ 1SESA 4DK1A 1Z2GA 1JR9A 2R72A 3D36A 1LUVA 5JQGA 2K9PA 1QVGU 3WG7C 3FYIB 2Q8VA 4C7UA 2EIMC 4J7KA 4X62B 2X6BA 3JASA 1OCRB 3HKCB 1WAZA 2E76B 4FM2A 3AK1A 1XMOO 3OEEG 2W0FC 4WCEV 5LMNB 4MVUA 5KAFZ 4B3MO 3E2EA 1WN7A 4FK5C 1BQ0A 2RCVA 3ZBHA 1I94O 4ZOLA 1VF5B 1PL4A 4P30A 4DRXB 2CDYA 4JTDB 3AG1C 2QR4A 1M56B 1HNZB 2PI4A 3ICXA 2R9IA 3G67A 3LNNA 1M93A 4IYIA 3RVYA 4F6RA 3ASNB 2OYQA 4H37A 2CK3G 1JCHA 1Q3EA 3R65A 1AILA 2QGNA 2L6LA 1NKDA 1RPOA 1Y6XA 1VQ4V 4OGQB 1JJ2U 2H3OA 2ZE6A 4DV4B 4RWUA 2X6CA 1KMIZ 4I0XB 4OX9B 2WLIA 2YICA 4DW1A 1XL6A 2YSUB 1QR9A 1BCCH 2W6JG 3H01A 2Q73A 4TV9B 2GUZB 3S3XA 2QWRB 2ZCEA 3U0ZA 1R6TA 2DYSB 5IJ0B 3CEIA 4R50A 2LQTA 3PJSK 5EZYB 2ZM6O 2UXBO 3BFRA 4DV6O 3IFXA 1CEZA 3I5DA 1KP3A 5LGUA 3L70H 1SQBH 3BY6A 2JVDA 2IH3C 1SA0A 1MZFA 1AI4A 1SETA 4QNHB 4UCSA 4UUJC 1K9MW 2E5LO 1G1XB 2DQ0A 4FFBA 4O4LA 5GW7A 1ZSPA 2YEVA 3KZIZ 5KLVH 4DV7O 4JGSA 1TUEB 5AG2A 3CRCA 3E22B 2HP8A 4WBNB 1XEQA 1JA8A 3KKYA 1E1RG 2ZKOA 2R70A 1VQ9V 1HNWB 1EM1A 1OJHA 4DR4B 1EBOA 2LJ2A 4QPKA 4L8JA 4TQFA 3ZMSA 3MAQA 1XHZA 3L72H 3ZIAG 1IBLO 1ZL8A 3UM7A 3D3IA 3H1LH 3OR6C 1H8HG 4JPRA 4X1YB 2QM4A 2UXXA 3HR0A 4NTWA 1PNLA 4JI1O 4X65O 4FJCC 3SJBC 2GHYA 1JX9A 3RYFB 2PUSA 1R1BA 3DGEA 5KMGA 1YTFB 2VWKA 2CE4A 3SYQA 2EBOA 3H1HH 2ZT9B 1FFXB 4X66B 3J81N 1ZLZA 1DLBA 4PI0A 1U97A 3E8GA 1KP2A 3P30A 4U7OA 1VARA 2JS3A 1WP7A 4IHJA 1L0LH 4CS2A 1FXVA 2UXCB 4G27B 4D7TA 1COWG 3AK3A 2Q68A 3QNEA 3AG4C 1NTZH 4UVCA 3ZHQA 3B4SA 2DE0X 3CCRV 4TQDA 2WLKA 3OMIB 4JI6O 1F4NA 1VQLV 4LFAB 4YJ3B 3SPIA 1SERA 2LW7A 3UKMA 5KA5A 3K5NA 2WPDG 5KA6A 3SYPA 2WSSG 4WFAV 3K59A 2G38A 4DYLA 4CC6A 5JQGB 1TA8A 3ZRWA 1H2LA 4JAVA 4UCTA 3JASB 4MTGA 1VMGA 4LF7B 2GV9A 3SPJA 3K5LA 2AHZA 5LGTA 3RYIA 1MMMA 3U10A 1G8MA 3BA8A 3ZHUA 4JI5B 3SYOA 1J5EO 1AI5A 1JOYA 5FPRA 2CTQA 1QU7A 4X89A 4BIUA 5K1PA 1MOFA 2BOBC 1WJZA 5KHKA 4NTYA 4ZOLB 2HJDA 3K3WA 2IU3A 4B3SO 2NN4A 1N34O 2RDCA 4AQYB 4DUZO 2O57A 4BWAA 2XAJA 4DR2O 1R3KC 4B3RB 1GRJA 4F6RB 1P84F 2EIJB 3P3PA 1SQFA 4MTFA 4LH6A 1FS0G 1B04A 4J9ZB 1W2BU 2QM8A 4FLXA 1VF6C 1NR7A 2H8PC 3N27A 2WLIB 2WLLB 5KAIZ 2B9ZA 2P90A 1MSDA 4BAYA 3DSQA 4B3MB 2XASA 1WPBA 4DR6O 4F6EA 4MVMA 4LFBB 4FVMA 3O9OA 3ZN1A 2PF4E 1I94B 2KQXA 5LBQA 5FLXN 3E35A 4DUYO 4FZ1A 4O4HA 1SA0B 1GM8A 2V7QG 3STLC 1EN6A 4DV2B 4B08A 4FFBB 4O4LB 4DK0A 2VQEB 2YEVB 5B66Z 4FZ0A 1P7GA 2BTQA 1KKDA 4JYBA 4CBCA 2QJ1A 2OCCB 3WU2Z 2DWDC 4QGPA 4PD4F 1BMFG 3K5OA 1XDCA 1N4CA 3K79A 4O4JA 3ABKC 3JD4A 1UJWB 1BQZA 4K8XA 5EIBD 5HFMA 1BZKA 3A0BZ 1Q90D 4G2KA 4W4KA 4CH6A 2X7RB 3D3QA 4DV4O 5LHGA 2HKOA 5B1NA 3ABLB 2ETNA 2JJ2G 2UXBB 1NI8A 2PI5A 1Q6HA 2EIKC 5KMGB 2LGQA 2OTLV 3ETQA 2E5LB 2HG5C 2HR3A 3X2QC 3QF7A 3KCYA 4H0LB 2VQFB 4PI2A 1P7BA 5C93A 4DV7B 3CP1A 4IHJB 2A0LA 3ZMUA 1FXHA 3UO3A 2FL4A 3OEHG 1Y4MA 4I9WA 1KC8W 1HP8A 1S5HC 2Q4PA 1IXBA 4P9PA 3CSXA 3RW0A 3H1KH 4PJ0Z 2DMXA 1XREA 2Y4UA 2GTAA 2B1IA 2QWPB 1JVMA 5H6RA 1IBLB 1I5YA 4UXNA 1YVWA 1ZWIC 2GTSA 4I0XA 1WB7A 1NR1A 1DGSA 1HNWO 2Z0AA 4YIPA 3VOUA 3ZRWB 1K5SA 2XT9A 3ZEDA 3W7WA 4JI1B 1S5JA 1JMKC 5L3FA 4XDJA 2GUZA 3DC5A 4JYYA 3BVOA 5ITZA 4DR7O 3RYIB 1AP6A 3CCSV 2D2CB 1GN6A 5IJ0A 4TT3G 1PNKA 4U3JA 1WA8A 2V4DA 2ZE8A 2ZNJA 1AR5A 3GB7C 5L3DA 3FB7C 4MS2A 3CC4V 4X66O 4QPJA 3CJHA 3FFQA 5BR8B 1V9PA 4W4LA 4JI0O 4Z1MG 1GN3A 4X8AA 1X59A 4JI6B 3J7AU 2UXDO 3FB8C 1VIBA 4X64B 5F2VO 2P4KA 4DV3B 5LP6C 4LF4B 5CA1A 1K3EA 3K06A 4DW0A 3U11A 4LP8A 3AEIA 2R9AA 4ZIBA 4DXWA 2LP7A 2WA3A 1V55B 2OCHA 2F43G 2PYJA 4I50B 1L8DA 3OAAG 2A79B 1NJIW 3LSUA 1P49A 1GM7A 1J5EB 5CMUA 2JGUA 5FNVA 1QVFU 4BIOA 3QG5A 1K7DA 2F66C 3K08A 4HNAA 1Q6IA 2ZXWB 3CWBH 3M99B 5CBHA 4B3SB 4EFBA 2ZIOA 3RBZA 2Q0OC 4J80A 3TGUH 1OCRC 1V54B 3K9SA 4O4HB 5JWPA 5IYCO 4DUZB 3P3NA 1M57B 4JF3A 1YHQV 4K35A 4WF9V 4DR2B 5J9PC 2XNDG 4A5UB 4WFHA 4DV1O 1K4DC 3M8AA 2JS5A 2BTQB 3CC2V 4JTCB 1W0JG 4FM1A 2EILC 4ABMA 3E8FA 2P6JA 4NVPA 5A2QN 3APQA 4LCUC 1M56C 4O4JB 4Q6GA 2P7TC 1GKFA 3K58A 4QJFB 1XHXA 1AJQA 3ASNC 2VS0A 4PDVA 2OIGA 3T1CA 4DR6B 2HVJC 2W6IG 1GK9A 4B7EA 2PGGA 4BW5A 4Z2WA 4I7ZB 3SDLA 3ZMTA 2YDEA 4UFZA 4JYCA 1WP8A 4N21A 4UCUA 1TVKA 4X88A 1K4CC 2XAFA 4R7CA 3FAVA 1IBMB 4DUYB 5EC1C 4LF9B 4LFBO 5KHJA 5KX5A 1YCIA 1YIJV 4U7NA 1W59A 1Y76A 5DN6G 3FB5C 2ITCC 2RNBA 4JI8B 2DYSC 2ZE7A 5CBFA 1PP9H 5L3GA 1BS3A 3DTUB 3BHPA 4UCOA 4AILC 4DV2O 4FFKA 3EFFK 3ABMB 2VQEO 5JCOA 1E1QG 1UFIA 4PV1B 1Q81W 2E3CA 1ORQC 2LO1A 2OT5A 2IBZH 5IYBO 4FLYA 1QCEA 2UUAB 5IDJA 2WLJA 2PZSA 2EIMB 5EBWC 2WLLA 1NU1H 1YJNV 1KECA 2WWWA 5FPOA 1NS1A 4NB5A 5ITZB 4UV8A 4MTOA 4GX5A 4FLVA 4MSWC 3T4DA 4PDRA 1M9NA 4RQFA 1G6UA 3THOA 4U3FH 5D5PA 4ZHQA 2EJ7A 3CMEV 4U3JB 1WA8B 4RUFA 5CB4A 5LHIA 4GKJB 4MVRA 1XILA 5DECA 3TETA 1GH6A 3JAKA 1VQMV 4JI2B 3JARA 3CJHB 3AG1B 2BCCH 2VQFO 4GT1A 4KFMA 2AZ0A 3HKEA 2F4VO 1A32A 2QKSA 2LFSA 5LA6A 3A0HZ 4IT5A 2A3QA 5CA1B 1KQSU 4WFEA 3CYOA 3IC7A 2YI8A 3QO8A 4KUMA 1AB3A 2ZR2A 2ZQMA 2IW5A 3AG3B 4JAAA 4DR7B 5H5NA 3JAMN 1YSCA 2ZDIC 3A8TA 1US6A 3NR7A 3ABTA 1N0NA 1QQCA 3PN1A 1DF5A 2FTKA 5FNVB 3JD2A 3R66A 2XAGA 2Z3YA 3D36C 4HNAB 4ZI7A 3F5WC 3HKBA 3B8NA 2AHYA 3OTOB 1GO3F 1NTMH 3G6BA 3HB3B 1OCCB 1DK1A 4JI0B 1EFRG 1SS3A 5EK0A 2UXDB 2Z5UA 4CS3A 1VQPV 1GN2A 2CAZC 5BR8O 4UVAA 2EX3A 1ZTEA 4TWKA 4WFFA 4H33A 2X6AA 4X64O 4OXSA 4DV3O 1AR1B 4LF4O 1D5NA 2N04A 3WB2A 2ITDC 4CH5A 3OD4A 3RN4A 1WPXA 1S3JA 3SYAA 4GX0A 3E8BA 4EEQA 4J11A 3B09A 2F93B 3ETEA 2KB1A 2EIJC 2UUBO 4JI3O 3SPGA 1B06A 2P4VA 1PM9A 3CMAV 2B1GA 3HPLC 1R6NA 1TVKB 3CS5A 3G4SV 1FD9A 4DO2A 2Q5ZA 3EVKA 3ZX6A 3FAVB 4J41A 5A9GA 4PA4A 4NXMB 5JVDA 1SF9A 5KX5B 1R3IC 4FLWA 1OCZB 1DF4A 2CTRA 1S77D 4LC1A 1Y76B 3RFRA 4DV1B 2ADPA 1P4RA 2RQ6A 2P06A 1B6QA 3CXHF 4LF8B 1JPXA 3JSLA 4JYAO 4AHCA 2JEXA 3FYEB 1F4MA 4KL1A 5IJ9A 2GBOA 1KYOF 1GAXA 5BMVA 3B2EE 4HYOA 1K5QA 4EKWA 1L0NH 3W7SA 3CCMV 4GLXA 3AG7A 3B40A 5B1BB 2RJZA 1BT8A 4I50A 3OTFA 3E89A 2OCCC 2HEPA 2ILMA 4DR3B 2LFRA 4J42A 3ZCCA 3H9VA 5EYPB 2UU9B 1FFTB 3SJCC 1D2DA 1R3JC 3JSNA 1WNSA 4GYCB 1GMGA 3FKSG 5BXZA 2FYUH 4RAIA 5KUKA 4ZHQB 3UQ8A 1SQPH 5CB4B 1ZUQA 1IBMO 1GTOA 3QTCA 1S5LZ 2HVKC 3K0GA 3ABLC 2HHHB 4LF9O 3W7UA 3L73H 1IX9A 3JAKB 3KG2A 5B3SB 3JARB 5J2TB 4L87A 2E75B 4HBNA 1IXMA 2LW1A 3L9DA 2LGWA 3AG2C 3HKEB 2DN9A 5K1XA 1LUWA 2N05A 1MG1A 2XAHA 4JI8O 3WFVA 4TV8A 5LA6B 2DW4A 1QLEB 2JJ1G 1N33O 3GWKC 4LWSA 4X1KB 3FD9A 1HDJA 4MW3A 4FLZA 1M1KW 1FXKA 3LSQA 1SRYA 3OGCC 4WFGA 3WB0A 3MHSC 1BHBA 4O2AA 1J95A 1PV0A 2AW9A 2Y69C 3RWRD 2UUAO 4IYHA 1HNXO 3QVNA 1Y66A 4G28B 5DEDA 3QO5A 4NR1A 4GX2A 5L3BA 4ZI7B 3HKBB 3E83A 3CCLV 3K0DA 2Q7GA 3SR2C 1ZX3A 1K92A 3B8MA 1ROPA 3NXSA 1AVMA 3CRAA 2QDOA 3VQVA 3UO2A 5J2UA 2FB5A 4FM0A 2F4VB 4GKJO 4JI4B 3F5TA 4JI2O 1NQTA 1W0KG 4CC5A 3ZS8C 3J80N 1H8EG 4K8ZA 1BE3H 2RMKB 4TUYA 1SZTA 4K0KO 2NNUA 4R8CA 3JALA 2FMLA 1Q86W 3CRMA 4CS4A 5LL6Y 1LNQA 1OZ0A 1Z5WA 5FL7G 1N36O 3ZHRA 3T1HO 4LF5O 1N32O 4PDMA 2EINC 5IWAO 2ZD9A 3CCEV 3APOA 3ASOB 2VRZA 4CH3A 1EZJA 3BABA 2DJVA 2DYRB 4FPPA 1SKVA 4UCVA 1XNQB 4P2ZA 1V55C 2QWOB 4JZ2A 4DV5O 4I4TA 2YUAA 4IIJA 2R9RB 3VQYA 5H9CA 2HFEC 4K3AA 5JVDB 5IY5B 4KP4A 1IBKO 4QE7A 4I5SA 3OTOO 3I55V 2GSMB 1PPJH 2Y0IA 1XQ8A 2FKXA 5B1OA 3CCUV 1EN4A 4YHHO 3LDEA 3OW2U 2ZXWC 1XOUA 2JRIA 3AK2A 4FLUA 2QEXV 3G6EV 2QSAA 3JAWA 5IJ9B 1V54C 5BMVB 3CCVV 3CCJV 1NZ6A 2IJIA 1I0HA 1M57C 2OIEA 2EULA 3DXRA 4LR3A 4UV9A 3JATA 3N2GA 5H6QA 2PY5A 3B77A 3K5MA 2UUBB 4TSFG 3KCXA 2MK3A 4JI3B 5LMUO 2BE3A 1NTKH 1F23A 4Q20A 4PA3A 1RM1B 5C8YA 3H1IH 1F7YA 2BSKA 4JAUA 3K03A 1QHTA 1T5EA 1F51A 5KHGA 2A06H 1OCOB 4FMTA 4X9QA 2HJFC 1JJOA 2JK5C 2Q67A 5BY1A 3TJTA 5CBGA 5EBLC 4NXMO 1MABG 3SPCA 4JYAB 3WB1A 3OUFA 2CTPA 1IZ3A 3JYCA 2KSDA 4UB8Z 2QKAA 1MZEA 4TV8B 3MD0A 4LF8O 1YJWV 3LUTB 4YIOA 2A7WA 3HKDA 1K33A 2IJJA 4LWSB 1ZAUA 3OM3B 4JZGA 1AP5A 4PA6A 2P67A 5IT9N 3RYHA 1Q82W 1FXKB 2ZINA 1O9HA 2F1MA 2YS8A 1R73A 3BRCA 5B1AB 4DR5O 4O2AB 4MVQA 1RP3B 1FAFA 1E79G 1FJGB 1QR8A 4DR3O 2W0XA 4I9QA 4J7JA 3SGIA 2UU9O 1I08A 3MHHC 5GONA 1Q5OA 1Q6UA 5CN0A 3ZHSA 1Q7YW 1AROP 3LSSA 2YXYA 4MVZA 1I5XA 2C2AA 1VF7A 4GUNA 2Y0PA 4X1IA 5J2UB 3ZMZA 1AJNA 2HHHO 4B7KA 2JGDA 2V1DA 2L35A 1BHAA 3VQXA 3IGAC 1N33B 5IYZA 1K97A 4LH7A 4XDLA 1YF2A 1VQKV 4MTXA 3GVMA 1YEWA 4TUYB 2EILB
chains in the Genus database with same CATH topology
3JCZA 4TWKA 4MW8A 3ZRVA 4P9OA 1S0VA 4WFFA 2JIZG 1KKDA 4YXWG 4JYBA 4H33A 4CBCA 4JTAB 2OCCB 2X6AA 4OXSA 2DWDC 1AR1B 3CCQV 2EINB 2ITDC 1BMFG 1NH2B 1VQ5V 4R6ZA 1WPXA 1S3JA 1NVPD 3WG7B 2M7WA 1RPRA 3SYAA 4GX0A 3E8BA 3K79A 5KUMA 3ABKC 3JD4A 1UJWB 4HZ3A 5HFMA 3ETEA 2KB1A 2EIJC 5L3CA 4G2KA 1DTOA 1MSWD 4PELA 4RUEA 3A0RA 2X7RB 2BOCC 3SPGA 5DM6V 5LHGA 1FXKC 3OE7G 3OUSA 3CMAV 2HKOA 1K8AW 4PA9A 2B1GA 3HPLC 5B1NA 1R6NA 3ABLB 3AG3C 5B1AC 1H2GA 3G4SV 2JJ2G 4DO2A 2EZOA 3LDDA 2PI5A 4PA4A 1S72V 3OMNB 2EIKC 1K73W 3CXCU 1R3IC 3LDCA 1OCZB 1DF4A 1S77D 4LC1A 1YI2V 3QO7A 1YITV 2OTLV 2HG5C 1VQNV 2HR3A 3X2QC 1P4RA 1M90W 1P7BA 4ASUG 3ML0A 5C93A 3CP1A 1B6QA 2A0LA 3ZMUA 1OCCC 1JPXA 3ZRSA 1FXHA 4HAMA 3BEHA 3OEHG 1Y4MA 2JEXA 3FYEB 1GM9A 1F4MA 4I9WA 2DWEC 1YTFD 1KC8W 3W7TA 1NVPB 1S5HC 4HYOA 1K5QA 4EKWA 3F7YC 4P9PA 4MVSA 3RW0A 3W7SA 2D3OW 3CCMV 3JD0A 3ABMC 5B1BB 2ZDIA 2HLDG 4UVBA 1H38A 3VBBA 1OHHG 2B1IA 4QIWF 1JVMA 5H6RA 1I5YA 4UXNA 4XDKA 3OMAB 1BL8A 3E89A 4WFBV 1ZWIC 1SESA 2OCCC 1NR1A 2B5UA 5EC2C 2LFRA 3D36A 2ZR3A 3ZCCA 3VOUA 4PDLA 1K5SA 3ZRWB 3W7WA 1VQ7V 1VQ6V 1QVGU 4GCZA 3WG7C 3SPHA 3FYIB 5L3FA 1FFTB 4XDJA 1R3JC 2EIMC 4MVOA 5LHHA 1KD1W 3ABUA 2X6BA 1GMGA 3FKSG 1OCRB 4RAIA 2QA4V 5KUKA 2UXNA 3CCSV 4TT3G 3OEEG 2W0FC 4WCEV 1PNKA 3E86A 1GTOA 4MVUA 2HVKC 3GB7C 3K0GA 3ABLC 3LNMB 3W7UA 2WLNA 4RQEA 1YJ9V 5L3DA 3E2EA 3FB7C 3KG2A 4MS2A 5B3SB 4FK5C 3CC4V 4QPJA 4L87A 4PA7A 1IXMA 1OCZC 3SJQC 4P30A 4Z1MG 3AG2C 3F7VC 4X8AA 1MG1A 2XAHA 4JTDB 3AG1C 1CPYA 3WFVA 1M56B 4GX1A 3FB8C 2PI4A 2R9IA 2DW4A 2JEUA 1QLEB 2JJ1G 3RVYA 1K3EA 3K06A 3ASNB 4H37A 3CD6V 2CK3G 1JCHA 1R3LC 4LP8A 3AEIA 3R65A 4LBEC 4MW3A 3SYCA 1M1KW 4DXWA 2EZPA 1NKDA 2LP7A 1FXKA 1RPOA 3LSQA 1VQ4V 1SRYA 3OGCC 1NBMG 4ZBMA 1V55B 1JJ2U 2F43G 4WFGA 3MHSC 1BHBA 1J95A 1THZA 2X6CA 3OAAG 2A79B 5B1BC 2Y69C 5CA3A 1NJIW 4XBFA 1Y66A 2WLIA 4G28B 1JQ0A 1GM7A 5CMUA 3ZJZA 1CP9A 3QO5A 1QVFU 1VQ8V 1XL6A 2YSUB 4GX2A 1QR9A 2W6JG 3H01A 5L3BA 1K7DA 3E83A 3CCLV 3K08A 3K0DA 3TCUA 1QLNA 2ZXWB 3M99B 3I56V 1K92A 3B8MA 1ROPA 3NXSA 5CBHA 2DYSB 4N23A 4R50A 1CEZA 3PJSK 1K34A 3IFXA 3RBZA 1KP3A 1OCRC 5LGUA 3BY6A 1V54B 3AG4B 5IYCO 2IH3C 1M57B 3E8HA 4JF3A 1YHQV 4WF9V 1AI4A 1SETA 2QM7A 4QNHB 5J9PC 1NQTA 2XNDG 1W0KG 3CC7V 3CPWU 4UUJC 4WFHA 1K4DC 1K9MW 1H8EG 2DQ0A 5GW7A 5B3SC 3CC2V 4JTCB 1W0JG 2YEVA 1SZTA 4E2LA 2NNUA 4R8CA 4JGSA 1R6KA 1TUEB 5L3EA 1Q86W 5EBMC 2EILC 1LNQA 1OZ0A 5FL7G 3E8FA 2P6JA 1S76D 4LCUC 1E1RG 1M56C 4PDMA 5HFLA 2EINC 1VQ9V 2ZD9A 3CCEV 1QLEC 3ASOB 1EZJA 1GKFA 2P7TC 1L1FA 3T4ZA 4QJFB 1EBOA 1AJQA 4QPKA 3ASNC 2DYRB 4PDVA 4FPPA 2JDIG 3ZMSA 3T1CA 1PD3A 2IJHA 2HVJC 2W6IG 1GK9A 4BW5A 3ZIAG 3UM7A 3ZMVA 2QE7G 3ZMTA 3D3IA 4P2ZA 1V55C 4JYCA 3OR6C 1H8HG 4N21A 4JPRA 2R9RB 4X88A 1K4CC 2XAFA 1AJPA 2UXXA 3ETDA 4R7CA 2HFEC 5H9CA 1PNLA 3W7XA 4FJCC 5EC1C 2GHYA 5IY5B 4BIZA 1AI7A 1JX9A 2X0LA 4KP4A 3DGEA 1YTFB 4QE7A 1YIJV 4I5SA 4U7NA 4JASA 3JD3A 3SYQA 2EBOA 3I55V 2GSMB 2ATKC 1DLBA 1PKXA 5B1OA 4F4LA 3CCUV 2IH1C 5DN6G 3FB5C 3LDEA 2ITCC 3E8GA 4J9YB 5LGNA 3OW2U 2ZXWC 1KP2A 3P30A 4U7OA 3GWOA 3K9AA 2QEXV 2DYSC 3G6EV 5CBFA 5L3GA 1FXVA 3FB6C 3DTUB 4G27B 2Q69A 1COWG 2Q68A 1V54C 3AG4C 3QNEA 4UVCA 3CCJV 3CCVV 2IJIA 3EFFK 1M57C 3ABMB 4UV9A 3CCRV 2WLKA 3OMIB 5H6QA 1E1QG 2IJKA 1WLEA 5E1AC 1Q81W 1F4NA 3B77A 1N8RW 2Y48A 1VQLV 1ORQC 2OT5A 1PL0A 4TSFG 2MK3A 3SPIA 5IYBO 3RVZA 1F23A 1SERA 2WLMA 3ZN0A 4Q20A 3ETGA 3UKMA 5KA5A 1QCEA 2WPDG 5KA6A 4PA3A 5IDJA 3SYPA 2WLJA 1RM1B 3OFNG 2WSSG 2EIMB 4WFAV 5EBWC 2WLLA 3ZRWA 4JAUA 3K03A 4ZKIA 1YJNV 1KECA 4JAVA 1F51A 2WWWA 3ASOC 4MTGA 4UV8A 4MTOA 4GX5A 2Q6AA 1OCOB 2DYRC 4MSWC 4FMTA 3SPJA 3T4DA 3K04A 2AHZA 2EJRA 4PDRA 2HJFC 5LGTA 1G8MA 1M9NA 2A9HA 4CZZA 4RQFA 2WLHA 2JK5C 3SYOA 2Q67A 1AI5A 5CBGA 3STZC 3CMEV 1JOYA 4RUFA 3P32A 5EBLC 4X89A 4BIUA 5LHIA 1MABG 3SPCA 4MVRA 1MOFA 3ZRXA 2BOBC 3TETA 3OUFA 1VQMV 4MT8A 3AG2B 5IY5C 3AG1B 3K3WA 3JD1A 2IU3A 2IU0A 3JYCA 4GT1A 4KFMA 3OR7C 3MD0A 3G71V 2QKSA 2LFSA 1YJWV 3LUTB 2XAJA 3ABKB 1K33A 1R3KC 4QE9A 1KQSU 2IJJA 4WFEA 3EHBB 3CYOA 3IC7A 2EIJB 4FIPC 3OM3B 4PA6A 2WAMA 2P67A 4MTFA 3QO8A 1Q82W 1FXKB 4KUMA 2OTJV 1FS0G 2ZR2A 1ENVA 1QBZA 2K1EA 1R73A 2Y69B 1PNMA 2IW5A 2ZQMA 4J9ZB 3AG3B 5B1AB 1W2BU 2DQ3A 2QM8A 4MVQA 1HWYA 1E79G 1YSCA 2ZDIC 1NR7A 2H8PC 1NH2D 3ABTA 2H94A 2WLIB 1QR8A 1VQOV 2EIKB 1DF5A 2FTKA 2XAQA 3JD2A 4RO2A 2WLLB 2P90A 5IYDO 1RM1C 4BAYA 3T2MA 2XAGA 2Z3YA 1AI6A 2XASA 3MHHC 3X2QB 4MVMA 3F5WC 5BZBA 3B8NA 5CN0A 2AHYA 1Q7YW 1GO3F 3HB3B 3ZN1A 1AROP 3LSSA 1OCCB 3TK1A 4MVZA 1I5XA 5LBQA 1G4YB 1EFRG 2C2AA 1OCOC 3E35A 5EK0A 2XOKG 3ZMZA 1AJNA 2V1DA 1BHAA 1GM8A 3IGAC 2QTOA 2V7QG 2Z5UA 3STLC 1K97A 4XDLA 1VQKV 1VQPV 4MTXA 2NLJC 1XL4A 2YEVB 4UVAA 2EILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1GTO A;  2IJK A;  2IJH A;  2IJI A;  2IJJ A;  1GMG A;  1F4M A;  1RPR A;  1F4N A;  1B6Q A;  1ROP A;  3K79 A;  4DO2 A;  1NKD A;  2GHY A;  1RPO A; 
#chains in the Genus database with same CATH topology
 3JAL B;  1S0V A;  2JIZ G;  4YXW G;  3Q4H A;  4UB6 Z;  5KHH A;  4JV5 O;  1QNM A;  3ZHV A;  2KG7 A;  1HW7 A;  4X20 A;  1O9G A;  4R6Z A;  4GKK B;  1NVP D;  3WG7 B;  1RPR A;  1HNX B;  5KUM A;  1XUQ A;  4HZ3 A;  2ZNI A;  5EYP A;  1XNR O;  3IC9 A;  3A0R A;  2BOC C;  5DM6 V;  1Y67 A;  3IAY A;  3RYC A;  1FKA O;  1K8A W;  2CGN A;  4PA9 A;  4I4T B;  4IIJ B;  3AG3 C;  1SQX H;  2YIB D;  2EZO A;  4O4I A;  4J10 A;  4BR6 A;  3LDD A;  3VQW A;  1X4T A;  3N2K A;  1K73 W;  3LDC A;  2QWQ B;  2AGA A;  5J2T A;  3QO7 A;  1H2K A;  4JI7 O;  1IDS A;  4ASU G;  4K0K B;  1U96 A;  1TUB A;  4NTX A;  1OCC C;  2XTA A;  3ZRS A;  4JI4 O;  3BEH A;  3JAW B;  1N36 B;  2DWE C;  1YTF D;  3SJA C;  3T1H B;  3W7T A;  1NVP B;  2ZIM A;  4LF5 B;  3DXR B;  3C3S A;  4X1K A;  1N32 B;  3JAT B;  4BW9 A;  3N2G B;  5IWA B;  3F7Y C;  2ZE5 A;  2DOS A;  4AI8 A;  3CRR A;  2ADQ B;  1VF6 A;  4UCR A;  2HLD G;  4UVB A;  1H38 A;  4D6T H;  4LF6 B;  4QIW F;  4NXN B;  4XDK A;  3OMA B;  1BL8 A;  3DC6 A;  4WFB V;  4DV5 B;  5C8Y B;  3CRQ A;  3EXA A;  2B5U A;  4YY3 B;  5EC2 C;  2P5O A;  4LNU A;  3BAA A;  3UT5 A;  2BSK B;  2ZR3 A;  1YDX A;  2AXT Z;  4DR1 O;  4PDL A;  1VQ6 V;  1VQ7 V;  2CH7 A;  4GCZ A;  3SPH A;  3BCC H;  2YXL A;  2QTS A;  4MVO A;  1SQG A;  5LHH A;  3ABU A;  1KD1 W;  2P22 C;  1IBK B;  3CX5 F;  1XNQ O;  1KKC A;  2QWN B;  2QA4 V;  2UXN A;  5GTI Z;  4YHH B;  3E86 A;  5CA0 A;  3LNM B;  2WLN A;  4RQE A;  1XBL A;  1YJ9 V;  3RT3 C;  5JJN B;  4I55 A;  2MW2 B;  4PA7 A;  5LOV A;  1OCZ C;  3SJQ C;  1MA1 A;  3F7V C;  1CPY A;  3HKD B;  4GX1 A;  5LMU B;  2JEU A;  1NT2 B;  1TAE A;  5D5Q A;  3CD6 V;  1XL4 A;  1XMQ O;  1R3L C;  3RYH B;  2AZ2 A;  4LBE C;  3SYC A;  3JCU Z;  2BTO A;  2EZP A;  5JCO C;  1NBM G;  4ZBM A;  1KB9 F;  2XHB A;  2CTW A;  1THZ A;  5B1B C;  5CA3 A;  4XBF A;  3T1Y O;  1BSM A;  4IL6 Z;  1JQ0 A;  3ZJZ A;  1IVS A;  1CP9 A;  1JFF A;  1VQ8 V;  1KU9 A;  3OGI B;  1Y74 A;  5GON B;  3TCU A;  1QLN A;  3CB2 A;  3I56 V;  1FYJ A;  3OT7 A;  4N23 A;  4X1I B;  3IJ4 A;  1K34 A;  2YXH A;  3AG4 B;  2JGD B;  4YJ2 A;  3E8H A;  3D8C A;  5IYZ B;  2QM7 A;  3CC7 V;  3CPW U;  1RSO A;  3RGB A;  3C3T A;  5B3S C;  3BPZ A;  4KHP B;  4E2L A;  3Q4H B;  2UUC B;  4B3T O;  1H2N A;  1H2M A;  1R6K A;  2IM9 A;  5L3E A;  5EBM C;  4H13 B;  3L75 H;  1UPG A;  2KG7 B;  3M7M X;  4DR5 B;  4X20 B;  4DV0 O;  1S76 D;  4LFC B;  1HR0 O;  5B5E Z;  5HFL A;  3FX7 A;  1QLE C;  1L1F A;  3T4Z A;  1M5I A;  4D7S A;  1RFY A;  2JDI G;  1PD3 A;  2IJH A;  3RYC B;  4GZR B;  5LYJ A;  4IGG A;  3ZMV A;  1FJG O;  2QE7 G;  4O4I B;  2RN9 A;  1XMO B;  3W7X A;  1AJP A;  3ETD A;  2NR5 A;  3N2K B;  4BIZ A;  1AI7 A;  2X0L A;  5GTH Z;  1M4U A;  4X62 O;  4JAS A;  3JD3 A;  5KHI A;  4H44 B;  2ATK C;  1PKX A;  4F4L A;  2IH1 C;  4J9Y B;  5LGN A;  5LP6 A;  5JH7 A;  1TUB B;  3GWO A;  5LMN O;  3K9A A;  1BGY H;  4JV5 B;  3L71 H;  5LXT A;  1VEW A;  3FB6 C;  2Q69 A;  2Y4T A;  3MDS A;  2IJK A;  1WLE A;  3C90 A;  4PHZ A;  5E1A C;  1N8R W;  1XNR B;  2Y48 A;  3CHX A;  1HNZ O;  5EIB C;  1PL0 A;  4O2B A;  4CH4 A;  4EB6 A;  3RVZ A;  2WLM A;  3ZN0 A;  3ETG A;  5E79 Z;  4GKK O;  1MNG A;  1AR4 A;  4LNU B;  3H1J H;  3UT5 B;  1OV9 A;  3OFN G;  4OPA A;  3TXQ A;  2CH7 B;  2PYL A;  4ZKI A;  5JJJ B;  3ASO C;  2YC0 A;  5IE9 A;  1ZL8 B;  2Q6A A;  2DYR C;  4OX9 O;  4JI7 B;  3K04 A;  2EJR A;  3HKC A;  2A9H A;  4CZZ A;  2WLH A;  3L74 H;  1I7F A;  2ZM6 B;  3STZ C;  4DV6 B;  3BA9 A;  5CA0 B;  3P32 A;  2E74 B;  2YIA A;  4NKG B;  3ZRX A;  4I55 B;  2PTM A;  4MT8 A;  3AG2 B;  5LOV B;  5IY5 C;  2KKW A;  2YI9 A;  3JD1 A;  4TOI A;  2IU0 A;  3OR7 C;  3S3W A;  4DRX A;  3UCS C;  3G71 V;  4J7Z A;  3K57 A;  1H2S B;  3ABK B;  4Z1V A;  1IUR A;  4QE9 A;  3EHB B;  4FIP C;  2WAM A;  4DR1 B;  1Q8I A;  1SQV H;  2OTJ V;  4E4E A;  1ENV A;  1QBZ A;  2K1E A;  2Y69 B;  1PNM A;  4LF6 O;  2DQ3 A;  4NXN O;  1HWY A;  1NH2 D;  2GDS A;  2H94 A;  1VQO V;  4YY3 O;  2EIK B;  1JFF B;  2Q7E A;  2XAQ A;  4RO2 A;  4NYK A;  4DR4 O;  5IYD O;  4X65 B;  1Y74 B;  1EN5 A;  1RM1 C;  2QKC A;  3T2M A;  1AI6 A;  4TV9 A;  3ZHT A;  3X2Q B;  5BZB A;  1YXB A;  4EFE A;  1SQQ H;  1CXZ B;  1SZX A;  2N74 A;  3TK1 A;  1G4Y B;  5EZY A;  1OCO C;  2XOK G;  4YJ2 B;  3O65 A;  2QTO A;  1N0J A;  1TGO A;  1RSO B;  2ARH A;  1YZB A;  1Q43 A;  1XMQ B;  2NLJ C;  3JCZ A;  4MW8 A;  3ZRV A;  4P9O A;  5JJE B;  4JTA B;  1XI1 A;  1URF A;  2Q9L A;  3CCQ V;  2EIN B;  2UXC O;  3TXS A;  3E22 A;  4FLT A;  1NH2 B;  4WBN A;  1VQ5 V;  1GN4 A;  1D5A A;  2M7W A;  3T1Y B;  1FPO A;  2YIB A;  2Q7H A;  2XUM A;  5H2F Z;  5L3C A;  1DTO A;  1LR1 A;  1SC5 B;  1WB8 A;  4LFA O;  4PEL A;  1MSW D;  4RUE A;  5LYJ B;  3CE2 A;  2F23 A;  1FXK C;  3OE7 G;  3OUS A;  3G80 A;  2OWO A;  5B1A C;  1H2G A;  1B3Q A;  4X1Y A;  1S72 V;  3OMN B;  2ODM A;  3CXC U;  3RYF A;  1KBH A;  2WA4 A;  4ICG A;  1YI2 V;  4LF7 O;  1YIT V;  2CUG A;  1VQN V;  1FFX A;  1KUQ A;  2VWJ A;  1M90 W;  4JI5 O;  5LP6 B;  2Q0A A;  5JH7 B;  1N34 B;  3ML0 A;  4B3T B;  4OPH A;  5LXT B;  4HAM A;  1GM9 A;  2M6Y A;  4DV0 B;  1HR0 B;  1VP7 A;  2YID A;  1Z5V A;  1EZV H;  4KHP O;  4MVS A;  2D3O W;  2F95 B;  2UUC O;  3JD0 A;  3ABM C;  4AQY O;  2ZDI A;  4O2B B;  2CGO A;  3VBB A;  4EB6 B;  1OHH G;  4B3R O;  3A2F A;  4YJ3 A;  4LFC O;  4KXR A;  5TIS Z;  1SES A;  4DK1 A;  1Z2G A;  1JR9 A;  2R72 A;  3D36 A;  1LUV A;  5JQG A;  2K9P A;  1QVG U;  3WG7 C;  3FYI B;  2Q8V A;  4C7U A;  2EIM C;  4J7K A;  4X62 B;  2X6B A;  3JAS A;  1OCR B;  3HKC B;  1WAZ A;  2E76 B;  4FM2 A;  3AK1 A;  1XMO O;  3OEE G;  2W0F C;  4WCE V;  5LMN B;  4MVU A;  5KAF Z;  4B3M O;  3E2E A;  1WN7 A;  4FK5 C;  1BQ0 A;  2RCV A;  3ZBH A;  1I94 O;  4ZOL A;  1VF5 B;  1PL4 A;  4P30 A;  4DRX B;  2CDY A;  4JTD B;  3AG1 C;  2QR4 A;  1M56 B;  1HNZ B;  2PI4 A;  3ICX A;  2R9I A;  3G67 A;  3LNN A;  1M93 A;  4IYI A;  3RVY A;  4F6R A;  3ASN B;  2OYQ A;  4H37 A;  2CK3 G;  1JCH A;  1Q3E A;  3R65 A;  1AIL A;  2QGN A;  2L6L A;  1NKD A;  1RPO A;  1Y6X A;  1VQ4 V;  4OGQ B;  1JJ2 U;  2H3O A;  2ZE6 A;  4DV4 B;  4RWU A;  2X6C A;  1KMI Z;  4I0X B;  4OX9 B;  2WLI A;  2YIC A;  4DW1 A;  1XL6 A;  2YSU B;  1QR9 A;  1BCC H;  2W6J G;  3H01 A;  2Q73 A;  4TV9 B;  2GUZ B;  3S3X A;  2QWR B;  2ZCE A;  3U0Z A;  1R6T A;  2DYS B;  5IJ0 B;  3CEI A;  4R50 A;  2LQT A;  3PJS K;  5EZY B;  2ZM6 O;  2UXB O;  3BFR A;  4DV6 O;  3IFX A;  1CEZ A;  3I5D A;  1KP3 A;  5LGU A;  3L70 H;  1SQB H;  3BY6 A;  2JVD A;  2IH3 C;  1SA0 A;  1MZF A;  1AI4 A;  1SET A;  4QNH B;  4UCS A;  4UUJ C;  1K9M W;  2E5L O;  1G1X B;  2DQ0 A;  4FFB A;  4O4L A;  5GW7 A;  1ZSP A;  2YEV A;  3KZI Z;  5KLV H;  4DV7 O;  4JGS A;  1TUE B;  5AG2 A;  3CRC A;  3E22 B;  2HP8 A;  4WBN B;  1XEQ A;  1JA8 A;  3KKY A;  1E1R G;  2ZKO A;  2R70 A;  1VQ9 V;  1HNW B;  1EM1 A;  1OJH A;  4DR4 B;  1EBO A;  2LJ2 A;  4QPK A;  4L8J A;  4TQF A;  3ZMS A;  3MAQ A;  1XHZ A;  3L72 H;  3ZIA G;  1IBL O;  1ZL8 A;  3UM7 A;  3D3I A;  3H1L H;  3OR6 C;  1H8H G;  4JPR A;  4X1Y B;  2QM4 A;  2UXX A;  3HR0 A;  4NTW A;  1PNL A;  4JI1 O;  4X65 O;  4FJC C;  3SJB C;  2GHY A;  1JX9 A;  3RYF B;  2PUS A;  1R1B A;  3DGE A;  5KMG A;  1YTF B;  2VWK A;  2CE4 A;  3SYQ A;  2EBO A;  3H1H H;  2ZT9 B;  1FFX B;  4X66 B;  3J81 N;  1ZLZ A;  1DLB A;  4PI0 A;  1U97 A;  3E8G A;  1KP2 A;  3P30 A;  4U7O A;  1VAR A;  2JS3 A;  1WP7 A;  4IHJ A;  1L0L H;  4CS2 A;  1FXV A;  2UXC B;  4G27 B;  4D7T A;  1COW G;  3AK3 A;  2Q68 A;  3QNE A;  3AG4 C;  1NTZ H;  4UVC A;  3ZHQ A;  3B4S A;  2DE0 X;  3CCR V;  4TQD A;  2WLK A;  3OMI B;  4JI6 O;  1F4N A;  1VQL V;  4LFA B;  4YJ3 B;  3SPI A;  1SER A;  2LW7 A;  3UKM A;  5KA5 A;  3K5N A;  2WPD G;  5KA6 A;  3SYP A;  2WSS G;  4WFA V;  3K59 A;  2G38 A;  4DYL A;  4CC6 A;  5JQG B;  1TA8 A;  3ZRW A;  1H2L A;  4JAV A;  4UCT A;  3JAS B;  4MTG A;  1VMG A;  4LF7 B;  2GV9 A;  3SPJ A;  3K5L A;  2AHZ A;  5LGT A;  3RYI A;  1MMM A;  3U10 A;  1G8M A;  3BA8 A;  3ZHU A;  4JI5 B;  3SYO A;  1J5E O;  1AI5 A;  1JOY A;  5FPR A;  2CTQ A;  1QU7 A;  4X89 A;  4BIU A;  5K1P A;  1MOF A;  2BOB C;  1WJZ A;  5KHK A;  4NTY A;  4ZOL B;  2HJD A;  3K3W A;  2IU3 A;  4B3S O;  2NN4 A;  1N34 O;  2RDC A;  4AQY B;  4DUZ O;  2O57 A;  4BWA A;  2XAJ A;  4DR2 O;  1R3K C;  4B3R B;  1GRJ A;  4F6R B;  1P84 F;  2EIJ B;  3P3P A;  1SQF A;  4MTF A;  4LH6 A;  1FS0 G;  1B04 A;  4J9Z B;  1W2B U;  2QM8 A;  4FLX A;  1VF6 C;  1NR7 A;  2H8P C;  3N27 A;  2WLI B;  2WLL B;  5KAI Z;  2B9Z A;  2P90 A;  1MSD A;  4BAY A;  3DSQ A;  4B3M B;  2XAS A;  1WPB A;  4DR6 O;  4F6E A;  4MVM A;  4LFB B;  4FVM A;  3O9O A;  3ZN1 A;  2PF4 E;  1I94 B;  2KQX A;  5LBQ A;  5FLX N;  3E35 A;  4DUY O;  4FZ1 A;  4O4H A;  1SA0 B;  1GM8 A;  2V7Q G;  3STL C;  1EN6 A;  4DV2 B;  4B08 A;  4FFB B;  4O4L B;  4DK0 A;  2VQE B;  2YEV B;  5B66 Z;  4FZ0 A;  1P7G A;  2BTQ A;  1KKD A;  4JYB A;  4CBC A;  2QJ1 A;  2OCC B;  3WU2 Z;  2DWD C;  4QGP A;  4PD4 F;  1BMF G;  3K5O A;  1XDC A;  1N4C A;  3K79 A;  4O4J A;  3ABK C;  3JD4 A;  1UJW B;  1BQZ A;  4K8X A;  5EIB D;  5HFM A;  1BZK A;  3A0B Z;  1Q90 D;  4G2K A;  4W4K A;  4CH6 A;  2X7R B;  3D3Q A;  4DV4 O;  5LHG A;  2HKO A;  5B1N A;  3ABL B;  2ETN A;  2JJ2 G;  2UXB B;  1NI8 A;  2PI5 A;  1Q6H A;  2EIK C;  5KMG B;  2LGQ A;  2OTL V;  3ETQ A;  2E5L B;  2HG5 C;  2HR3 A;  3X2Q C;  3QF7 A;  3KCY A;  4H0L B;  2VQF B;  4PI2 A;  1P7B A;  5C93 A;  4DV7 B;  3CP1 A;  4IHJ B;  2A0L A;  3ZMU A;  1FXH A;  3UO3 A;  2FL4 A;  3OEH G;  1Y4M A;  4I9W A;  1KC8 W;  1HP8 A;  1S5H C;  2Q4P A;  1IXB A;  4P9P A;  3CSX A;  3RW0 A;  3H1K H;  4PJ0 Z;  2DMX A;  1XRE A;  2Y4U A;  2GTA A;  2B1I A;  2QWP B;  1JVM A;  5H6R A;  1IBL B;  1I5Y A;  4UXN A;  1YVW A;  1ZWI C;  2GTS A;  4I0X A;  1WB7 A;  1NR1 A;  1DGS A;  1HNW O;  2Z0A A;  4YIP A;  3VOU A;  3ZRW B;  1K5S A;  2XT9 A;  3ZED A;  3W7W A;  4JI1 B;  1S5J A;  1JMK C;  5L3F A;  4XDJ A;  2GUZ A;  3DC5 A;  4JYY A;  3BVO A;  5ITZ A;  4DR7 O;  3RYI B;  1AP6 A;  3CCS V;  2D2C B;  1GN6 A;  5IJ0 A;  4TT3 G;  1PNK A;  4U3J A;  1WA8 A;  2V4D A;  2ZE8 A;  2ZNJ A;  1AR5 A;  3GB7 C;  5L3D A;  3FB7 C;  4MS2 A;  3CC4 V;  4X66 O;  4QPJ A;  3CJH A;  3FFQ A;  5BR8 B;  1V9P A;  4W4L A;  4JI0 O;  4Z1M G;  1GN3 A;  4X8A A;  1X59 A;  4JI6 B;  3J7A U;  2UXD O;  3FB8 C;  1VIB A;  4X64 B;  5F2V O;  2P4K A;  4DV3 B;  5LP6 C;  4LF4 B;  5CA1 A;  1K3E A;  3K06 A;  4DW0 A;  3U11 A;  4LP8 A;  3AEI A;  2R9A A;  4ZIB A;  4DXW A;  2LP7 A;  2WA3 A;  1V55 B;  2OCH A;  2F43 G;  2PYJ A;  4I50 B;  1L8D A;  3OAA G;  2A79 B;  1NJI W;  3LSU A;  1P49 A;  1GM7 A;  1J5E B;  5CMU A;  2JGU A;  5FNV A;  1QVF U;  4BIO A;  3QG5 A;  1K7D A;  2F66 C;  3K08 A;  4HNA A;  1Q6I A;  2ZXW B;  3CWB H;  3M99 B;  5CBH A;  4B3S B;  4EFB A;  2ZIO A;  3RBZ A;  2Q0O C;  4J80 A;  3TGU H;  1OCR C;  1V54 B;  3K9S A;  4O4H B;  5JWP A;  5IYC O;  4DUZ B;  3P3N A;  1M57 B;  4JF3 A;  1YHQ V;  4K35 A;  4WF9 V;  4DR2 B;  5J9P C;  2XND G;  4A5U B;  4WFH A;  4DV1 O;  1K4D C;  3M8A A;  2JS5 A;  2BTQ B;  3CC2 V;  4JTC B;  1W0J G;  4FM1 A;  2EIL C;  4ABM A;  3E8F A;  2P6J A;  4NVP A;  5A2Q N;  3APQ A;  4LCU C;  1M56 C;  4O4J B;  4Q6G A;  2P7T C;  1GKF A;  3K58 A;  4QJF B;  1XHX A;  1AJQ A;  3ASN C;  2VS0 A;  4PDV A;  2OIG A;  3T1C A;  4DR6 B;  2HVJ C;  2W6I G;  1GK9 A;  4B7E A;  2PGG A;  4BW5 A;  4Z2W A;  4I7Z B;  3SDL A;  3ZMT A;  2YDE A;  4UFZ A;  4JYC A;  1WP8 A;  4N21 A;  4UCU A;  1TVK A;  4X88 A;  1K4C C;  2XAF A;  4R7C A;  3FAV A;  1IBM B;  4DUY B;  5EC1 C;  4LF9 B;  4LFB O;  5KHJ A;  5KX5 A;  1YCI A;  1YIJ V;  4U7N A;  1W59 A;  1Y76 A;  5DN6 G;  3FB5 C;  2ITC C;  2RNB A;  4JI8 B;  2DYS C;  2ZE7 A;  5CBF A;  1PP9 H;  5L3G A;  1BS3 A;  3DTU B;  3BHP A;  4UCO A;  4AIL C;  4DV2 O;  4FFK A;  3EFF K;  3ABM B;  2VQE O;  5JCO A;  1E1Q G;  1UFI A;  4PV1 B;  1Q81 W;  2E3C A;  1ORQ C;  2LO1 A;  2OT5 A;  2IBZ H;  5IYB O;  4FLY A;  1QCE A;  2UUA B;  5IDJ A;  2WLJ A;  2PZS A;  2EIM B;  5EBW C;  2WLL A;  1NU1 H;  1YJN V;  1KEC A;  2WWW A;  5FPO A;  1NS1 A;  4NB5 A;  5ITZ B;  4UV8 A;  4MTO A;  4GX5 A;  4FLV A;  4MSW C;  3T4D A;  4PDR A;  1M9N A;  4RQF A;  1G6U A;  3THO A;  4U3F H;  5D5P A;  4ZHQ A;  2EJ7 A;  3CME V;  4U3J B;  1WA8 B;  4RUF A;  5CB4 A;  5LHI A;  4GKJ B;  4MVR A;  1XIL A;  5DEC A;  3TET A;  1GH6 A;  3JAK A;  1VQM V;  4JI2 B;  3JAR A;  3CJH B;  3AG1 B;  2BCC H;  2VQF O;  4GT1 A;  4KFM A;  2AZ0 A;  3HKE A;  2F4V O;  1A32 A;  2QKS A;  2LFS A;  5LA6 A;  3A0H Z;  4IT5 A;  2A3Q A;  5CA1 B;  1KQS U;  4WFE A;  3CYO A;  3IC7 A;  2YI8 A;  3QO8 A;  4KUM A;  1AB3 A;  2ZR2 A;  2ZQM A;  2IW5 A;  3AG3 B;  4JAA A;  4DR7 B;  5H5N A;  3JAM N;  1YSC A;  2ZDI C;  3A8T A;  1US6 A;  3NR7 A;  3ABT A;  1N0N A;  1QQC A;  3PN1 A;  1DF5 A;  2FTK A;  5FNV B;  3JD2 A;  3R66 A;  2XAG A;  2Z3Y A;  3D36 C;  4HNA B;  4ZI7 A;  3F5W C;  3HKB A;  3B8N A;  2AHY A;  3OTO B;  1GO3 F;  1NTM H;  3G6B A;  3HB3 B;  1OCC B;  1DK1 A;  4JI0 B;  1EFR G;  1SS3 A;  5EK0 A;  2UXD B;  2Z5U A;  4CS3 A;  1VQP V;  1GN2 A;  2CAZ C;  5BR8 O;  4UVA A;  2EX3 A;  1ZTE A;  4TWK A;  4WFF A;  4H33 A;  2X6A A;  4X64 O;  4OXS A;  4DV3 O;  1AR1 B;  4LF4 O;  1D5N A;  2N04 A;  3WB2 A;  2ITD C;  4CH5 A;  3OD4 A;  3RN4 A;  1WPX A;  1S3J A;  3SYA A;  4GX0 A;  3E8B A;  4EEQ A;  4J11 A;  3B09 A;  2F93 B;  3ETE A;  2KB1 A;  2EIJ C;  2UUB O;  4JI3 O;  3SPG A;  1B06 A;  2P4V A;  1PM9 A;  3CMA V;  2B1G A;  3HPL C;  1R6N A;  1TVK B;  3CS5 A;  3G4S V;  1FD9 A;  4DO2 A;  2Q5Z A;  3EVK A;  3ZX6 A;  3FAV B;  4J41 A;  5A9G A;  4PA4 A;  4NXM B;  5JVD A;  1SF9 A;  5KX5 B;  1R3I C;  4FLW A;  1OCZ B;  1DF4 A;  2CTR A;  1S77 D;  4LC1 A;  1Y76 B;  3RFR A;  4DV1 B;  2ADP A;  1P4R A;  2RQ6 A;  2P06 A;  1B6Q A;  3CXH F;  4LF8 B;  1JPX A;  3JSL A;  4JYA O;  4AHC A;  2JEX A;  3FYE B;  1F4M A;  4KL1 A;  5IJ9 A;  2GBO A;  1KYO F;  1GAX A;  5BMV A;  3B2E E;  4HYO A;  1K5Q A;  4EKW A;  1L0N H;  3W7S A;  3CCM V;  4GLX A;  3AG7 A;  3B40 A;  5B1B B;  2RJZ A;  1BT8 A;  4I50 A;  3OTF A;  3E89 A;  2OCC C;  2HEP A;  2ILM A;  4DR3 B;  2LFR A;  4J42 A;  3ZCC A;  3H9V A;  5EYP B;  2UU9 B;  1FFT B;  3SJC C;  1D2D A;  1R3J C;  3JSN A;  1WNS A;  4GYC B;  1GMG A;  3FKS G;  5BXZ A;  2FYU H;  4RAI A;  5KUK A;  4ZHQ B;  3UQ8 A;  1SQP H;  5CB4 B;  1ZUQ A;  1IBM O;  1GTO A;  3QTC A;  1S5L Z;  2HVK C;  3K0G A;  3ABL C;  2HHH B;  4LF9 O;  3W7U A;  3L73 H;  1IX9 A;  3JAK B;  3KG2 A;  5B3S B;  3JAR B;  5J2T B;  4L87 A;  2E75 B;  4HBN A;  1IXM A;  2LW1 A;  3L9D A;  2LGW A;  3AG2 C;  3HKE B;  2DN9 A;  5K1X A;  1LUW A;  2N05 A;  1MG1 A;  2XAH A;  4JI8 O;  3WFV A;  4TV8 A;  5LA6 B;  2DW4 A;  1QLE B;  2JJ1 G;  1N33 O;  3GWK C;  4LWS A;  4X1K B;  3FD9 A;  1HDJ A;  4MW3 A;  4FLZ A;  1M1K W;  1FXK A;  3LSQ A;  1SRY A;  3OGC C;  4WFG A;  3WB0 A;  3MHS C;  1BHB A;  4O2A A;  1J95 A;  1PV0 A;  2AW9 A;  2Y69 C;  3RWR D;  2UUA O;  4IYH A;  1HNX O;  3QVN A;  1Y66 A;  4G28 B;  5DED A;  3QO5 A;  4NR1 A;  4GX2 A;  5L3B A;  4ZI7 B;  3HKB B;  3E83 A;  3CCL V;  3K0D A;  2Q7G A;  3SR2 C;  1ZX3 A;  1K92 A;  3B8M A;  1ROP A;  3NXS A;  1AVM A;  3CRA A;  2QDO A;  3VQV A;  3UO2 A;  5J2U A;  2FB5 A;  4FM0 A;  2F4V B;  4GKJ O;  4JI4 B;  3F5T A;  4JI2 O;  1NQT A;  1W0K G;  4CC5 A;  3ZS8 C;  3J80 N;  1H8E G;  4K8Z A;  1BE3 H;  2RMK B;  4TUY A;  1SZT A;  4K0K O;  2NNU A;  4R8C A;  3JAL A;  2FML A;  1Q86 W;  3CRM A;  4CS4 A;  5LL6 Y;  1LNQ A;  1OZ0 A;  1Z5W A;  5FL7 G;  1N36 O;  3ZHR A;  3T1H O;  4LF5 O;  1N32 O;  4PDM A;  2EIN C;  5IWA O;  2ZD9 A;  3CCE V;  3APO A;  3ASO B;  2VRZ A;  4CH3 A;  1EZJ A;  3BAB A;  2DJV A;  2DYR B;  4FPP A;  1SKV A;  4UCV A;  1XNQ B;  4P2Z A;  1V55 C;  2QWO B;  4JZ2 A;  4DV5 O;  4I4T A;  2YUA A;  4IIJ A;  2R9R B;  3VQY A;  5H9C A;  2HFE C;  4K3A A;  5JVD B;  5IY5 B;  4KP4 A;  1IBK O;  4QE7 A;  4I5S A;  3OTO O;  3I55 V;  2GSM B;  1PPJ H;  2Y0I A;  1XQ8 A;  2FKX A;  5B1O A;  3CCU V;  1EN4 A;  4YHH O;  3LDE A;  3OW2 U;  2ZXW C;  1XOU A;  2JRI A;  3AK2 A;  4FLU A;  2QEX V;  3G6E V;  2QSA A;  3JAW A;  5IJ9 B;  1V54 C;  5BMV B;  3CCV V;  3CCJ V;  1NZ6 A;  2IJI A;  1I0H A;  1M57 C;  2OIE A;  2EUL A;  3DXR A;  4LR3 A;  4UV9 A;  3JAT A;  3N2G A;  5H6Q A;  2PY5 A;  3B77 A;  3K5M A;  2UUB B;  4TSF G;  3KCX A;  2MK3 A;  4JI3 B;  5LMU O;  2BE3 A;  1NTK H;  1F23 A;  4Q20 A;  4PA3 A;  1RM1 B;  5C8Y A;  3H1I H;  1F7Y A;  2BSK A;  4JAU A;  3K03 A;  1QHT A;  1T5E A;  1F51 A;  5KHG A;  2A06 H;  1OCO B;  4FMT A;  4X9Q A;  2HJF C;  1JJO A;  2JK5 C;  2Q67 A;  5BY1 A;  3TJT A;  5CBG A;  5EBL C;  4NXM O;  1MAB G;  3SPC A;  4JYA B;  3WB1 A;  3OUF A;  2CTP A;  1IZ3 A;  3JYC A;  2KSD A;  4UB8 Z;  2QKA A;  1MZE A;  4TV8 B;  3MD0 A;  4LF8 O;  1YJW V;  3LUT B;  4YIO A;  2A7W A;  3HKD A;  1K33 A;  2IJJ A;  4LWS B;  1ZAU A;  3OM3 B;  4JZG A;  1AP5 A;  4PA6 A;  2P67 A;  5IT9 N;  3RYH A;  1Q82 W;  1FXK B;  2ZIN A;  1O9H A;  2F1M A;  2YS8 A;  1R73 A;  3BRC A;  5B1A B;  4DR5 O;  4O2A B;  4MVQ A;  1RP3 B;  1FAF A;  1E79 G;  1FJG B;  1QR8 A;  4DR3 O;  2W0X A;  4I9Q A;  4J7J A;  3SGI A;  2UU9 O;  1I08 A;  3MHH C;  5GON A;  1Q5O A;  1Q6U A;  5CN0 A;  3ZHS A;  1Q7Y W;  1ARO P;  3LSS A;  2YXY A;  4MVZ A;  1I5X A;  2C2A A;  1VF7 A;  4GUN A;  2Y0P A;  4X1I A;  5J2U B;  3ZMZ A;  1AJN A;  2HHH O;  4B7K A;  2JGD A;  2V1D A;  2L35 A;  1BHA A;  3VQX A;  3IGA C;  1N33 B;  5IYZ A;  1K97 A;  4LH7 A;  4XDL A;  1YF2 A;  1VQK V;  4MTX A;  3GVM A;  1YEW A;  4TUY B;  2EIL B; 
#chains in the Genus database with same CATH homology
 3JCZ A;  4TWK A;  4MW8 A;  3ZRV A;  4P9O A;  1S0V A;  4WFF A;  2JIZ G;  1KKD A;  4YXW G;  4JYB A;  4H33 A;  4CBC A;  4JTA B;  2OCC B;  2X6A A;  4OXS A;  2DWD C;  1AR1 B;  3CCQ V;  2EIN B;  2ITD C;  1BMF G;  1NH2 B;  1VQ5 V;  4R6Z A;  1WPX A;  1S3J A;  1NVP D;  3WG7 B;  2M7W A;  1RPR A;  3SYA A;  4GX0 A;  3E8B A;  3K79 A;  5KUM A;  3ABK C;  3JD4 A;  1UJW B;  4HZ3 A;  5HFM A;  3ETE A;  2KB1 A;  2EIJ C;  5L3C A;  4G2K A;  1DTO A;  1MSW D;  4PEL A;  4RUE A;  3A0R A;  2X7R B;  2BOC C;  3SPG A;  5DM6 V;  5LHG A;  1FXK C;  3OE7 G;  3OUS A;  3CMA V;  2HKO A;  1K8A W;  4PA9 A;  2B1G A;  3HPL C;  5B1N A;  1R6N A;  3ABL B;  3AG3 C;  5B1A C;  1H2G A;  3G4S V;  2JJ2 G;  4DO2 A;  2EZO A;  3LDD A;  2PI5 A;  4PA4 A;  1S72 V;  3OMN B;  2EIK C;  1K73 W;  3CXC U;  1R3I C;  3LDC A;  1OCZ B;  1DF4 A;  1S77 D;  4LC1 A;  1YI2 V;  3QO7 A;  1YIT V;  2OTL V;  2HG5 C;  1VQN V;  2HR3 A;  3X2Q C;  1P4R A;  1M90 W;  1P7B A;  4ASU G;  3ML0 A;  5C93 A;  3CP1 A;  1B6Q A;  2A0L A;  3ZMU A;  1OCC C;  1JPX A;  3ZRS A;  1FXH A;  4HAM A;  3BEH A;  3OEH G;  1Y4M A;  2JEX A;  3FYE B;  1GM9 A;  1F4M A;  4I9W A;  2DWE C;  1YTF D;  1KC8 W;  3W7T A;  1NVP B;  1S5H C;  4HYO A;  1K5Q A;  4EKW A;  3F7Y C;  4P9P A;  4MVS A;  3RW0 A;  3W7S A;  2D3O W;  3CCM V;  3JD0 A;  3ABM C;  5B1B B;  2ZDI A;  2HLD G;  4UVB A;  1H38 A;  3VBB A;  1OHH G;  2B1I A;  4QIW F;  1JVM A;  5H6R A;  1I5Y A;  4UXN A;  4XDK A;  3OMA B;  1BL8 A;  3E89 A;  4WFB V;  1ZWI C;  1SES A;  2OCC C;  1NR1 A;  2B5U A;  5EC2 C;  2LFR A;  3D36 A;  2ZR3 A;  3ZCC A;  3VOU A;  4PDL A;  1K5S A;  3ZRW B;  3W7W A;  1VQ7 V;  1VQ6 V;  1QVG U;  4GCZ A;  3WG7 C;  3SPH A;  3FYI B;  5L3F A;  1FFT B;  4XDJ A;  1R3J C;  2EIM C;  4MVO A;  5LHH A;  1KD1 W;  3ABU A;  2X6B A;  1GMG A;  3FKS G;  1OCR B;  4RAI A;  2QA4 V;  5KUK A;  2UXN A;  3CCS V;  4TT3 G;  3OEE G;  2W0F C;  4WCE V;  1PNK A;  3E86 A;  1GTO A;  4MVU A;  2HVK C;  3GB7 C;  3K0G A;  3ABL C;  3LNM B;  3W7U A;  2WLN A;  4RQE A;  1YJ9 V;  5L3D A;  3E2E A;  3FB7 C;  3KG2 A;  4MS2 A;  5B3S B;  4FK5 C;  3CC4 V;  4QPJ A;  4L87 A;  4PA7 A;  1IXM A;  1OCZ C;  3SJQ C;  4P30 A;  4Z1M G;  3AG2 C;  3F7V C;  4X8A A;  1MG1 A;  2XAH A;  4JTD B;  3AG1 C;  1CPY A;  3WFV A;  1M56 B;  4GX1 A;  3FB8 C;  2PI4 A;  2R9I A;  2DW4 A;  2JEU A;  1QLE B;  2JJ1 G;  3RVY A;  1K3E A;  3K06 A;  3ASN B;  4H37 A;  3CD6 V;  2CK3 G;  1JCH A;  1R3L C;  4LP8 A;  3AEI A;  3R65 A;  4LBE C;  4MW3 A;  3SYC A;  1M1K W;  4DXW A;  2EZP A;  1NKD A;  2LP7 A;  1FXK A;  1RPO A;  3LSQ A;  1VQ4 V;  1SRY A;  3OGC C;  1NBM G;  4ZBM A;  1V55 B;  1JJ2 U;  2F43 G;  4WFG A;  3MHS C;  1BHB A;  1J95 A;  1THZ A;  2X6C A;  3OAA G;  2A79 B;  5B1B C;  2Y69 C;  5CA3 A;  1NJI W;  4XBF A;  1Y66 A;  2WLI A;  4G28 B;  1JQ0 A;  1GM7 A;  5CMU A;  3ZJZ A;  1CP9 A;  3QO5 A;  1QVF U;  1VQ8 V;  1XL6 A;  2YSU B;  4GX2 A;  1QR9 A;  2W6J G;  3H01 A;  5L3B A;  1K7D A;  3E83 A;  3CCL V;  3K08 A;  3K0D A;  3TCU A;  1QLN A;  2ZXW B;  3M99 B;  3I56 V;  1K92 A;  3B8M A;  1ROP A;  3NXS A;  5CBH A;  2DYS B;  4N23 A;  4R50 A;  1CEZ A;  3PJS K;  1K34 A;  3IFX A;  3RBZ A;  1KP3 A;  1OCR C;  5LGU A;  3BY6 A;  1V54 B;  3AG4 B;  5IYC O;  2IH3 C;  1M57 B;  3E8H A;  4JF3 A;  1YHQ V;  4WF9 V;  1AI4 A;  1SET A;  2QM7 A;  4QNH B;  5J9P C;  1NQT A;  2XND G;  1W0K G;  3CC7 V;  3CPW U;  4UUJ C;  4WFH A;  1K4D C;  1K9M W;  1H8E G;  2DQ0 A;  5GW7 A;  5B3S C;  3CC2 V;  4JTC B;  1W0J G;  2YEV A;  1SZT A;  4E2L A;  2NNU A;  4R8C A;  4JGS A;  1R6K A;  1TUE B;  5L3E A;  1Q86 W;  5EBM C;  2EIL C;  1LNQ A;  1OZ0 A;  5FL7 G;  3E8F A;  2P6J A;  1S76 D;  4LCU C;  1E1R G;  1M56 C;  4PDM A;  5HFL A;  2EIN C;  1VQ9 V;  2ZD9 A;  3CCE V;  1QLE C;  3ASO B;  1EZJ A;  1GKF A;  2P7T C;  1L1F A;  3T4Z A;  4QJF B;  1EBO A;  1AJQ A;  4QPK A;  3ASN C;  2DYR B;  4PDV A;  4FPP A;  2JDI G;  3ZMS A;  3T1C A;  1PD3 A;  2IJH A;  2HVJ C;  2W6I G;  1GK9 A;  4BW5 A;  3ZIA G;  3UM7 A;  3ZMV A;  2QE7 G;  3ZMT A;  3D3I A;  4P2Z A;  1V55 C;  4JYC A;  3OR6 C;  1H8H G;  4N21 A;  4JPR A;  2R9R B;  4X88 A;  1K4C C;  2XAF A;  1AJP A;  2UXX A;  3ETD A;  4R7C A;  2HFE C;  5H9C A;  1PNL A;  3W7X A;  4FJC C;  5EC1 C;  2GHY A;  5IY5 B;  4BIZ A;  1AI7 A;  1JX9 A;  2X0L A;  4KP4 A;  3DGE A;  1YTF B;  4QE7 A;  1YIJ V;  4I5S A;  4U7N A;  4JAS A;  3JD3 A;  3SYQ A;  2EBO A;  3I55 V;  2GSM B;  2ATK C;  1DLB A;  1PKX A;  5B1O A;  4F4L A;  3CCU V;  2IH1 C;  5DN6 G;  3FB5 C;  3LDE A;  2ITC C;  3E8G A;  4J9Y B;  5LGN A;  3OW2 U;  2ZXW C;  1KP2 A;  3P30 A;  4U7O A;  3GWO A;  3K9A A;  2QEX V;  2DYS C;  3G6E V;  5CBF A;  5L3G A;  1FXV A;  3FB6 C;  3DTU B;  4G27 B;  2Q69 A;  1COW G;  2Q68 A;  1V54 C;  3AG4 C;  3QNE A;  4UVC A;  3CCJ V;  3CCV V;  2IJI A;  3EFF K;  1M57 C;  3ABM B;  4UV9 A;  3CCR V;  2WLK A;  3OMI B;  5H6Q A;  1E1Q G;  2IJK A;  1WLE A;  5E1A C;  1Q81 W;  1F4N A;  3B77 A;  1N8R W;  2Y48 A;  1VQL V;  1ORQ C;  2OT5 A;  1PL0 A;  4TSF G;  2MK3 A;  3SPI A;  5IYB O;  3RVZ A;  1F23 A;  1SER A;  2WLM A;  3ZN0 A;  4Q20 A;  3ETG A;  3UKM A;  5KA5 A;  1QCE A;  2WPD G;  5KA6 A;  4PA3 A;  5IDJ A;  3SYP A;  2WLJ A;  1RM1 B;  3OFN G;  2WSS G;  2EIM B;  4WFA V;  5EBW C;  2WLL A;  3ZRW A;  4JAU A;  3K03 A;  4ZKI A;  1YJN V;  1KEC A;  4JAV A;  1F51 A;  2WWW A;  3ASO C;  4MTG A;  4UV8 A;  4MTO A;  4GX5 A;  2Q6A A;  1OCO B;  2DYR C;  4MSW C;  4FMT A;  3SPJ A;  3T4D A;  3K04 A;  2AHZ A;  2EJR A;  4PDR A;  2HJF C;  5LGT A;  1G8M A;  1M9N A;  2A9H A;  4CZZ A;  4RQF A;  2WLH A;  2JK5 C;  3SYO A;  2Q67 A;  1AI5 A;  5CBG A;  3STZ C;  3CME V;  1JOY A;  4RUF A;  3P32 A;  5EBL C;  4X89 A;  4BIU A;  5LHI A;  1MAB G;  3SPC A;  4MVR A;  1MOF A;  3ZRX A;  2BOB C;  3TET A;  3OUF A;  1VQM V;  4MT8 A;  3AG2 B;  5IY5 C;  3AG1 B;  3K3W A;  3JD1 A;  2IU3 A;  2IU0 A;  3JYC A;  4GT1 A;  4KFM A;  3OR7 C;  3MD0 A;  3G71 V;  2QKS A;  2LFS A;  1YJW V;  3LUT B;  2XAJ A;  3ABK B;  1K33 A;  1R3K C;  4QE9 A;  1KQS U;  2IJJ A;  4WFE A;  3EHB B;  3CYO A;  3IC7 A;  2EIJ B;  4FIP C;  3OM3 B;  4PA6 A;  2WAM A;  2P67 A;  4MTF A;  3QO8 A;  1Q82 W;  1FXK B;  4KUM A;  2OTJ V;  1FS0 G;  2ZR2 A;  1ENV A;  1QBZ A;  2K1E A;  1R73 A;  2Y69 B;  1PNM A;  2IW5 A;  2ZQM A;  4J9Z B;  3AG3 B;  5B1A B;  1W2B U;  2DQ3 A;  2QM8 A;  4MVQ A;  1HWY A;  1E79 G;  1YSC A;  2ZDI C;  1NR7 A;  2H8P C;  1NH2 D;  3ABT A;  2H94 A;  2WLI B;  1QR8 A;  1VQO V;  2EIK B;  1DF5 A;  2FTK A;  2XAQ A;  3JD2 A;  4RO2 A;  2WLL B;  2P90 A;  5IYD O;  1RM1 C;  4BAY A;  3T2M A;  2XAG A;  2Z3Y A;  1AI6 A;  2XAS A;  3MHH C;  3X2Q B;  4MVM A;  3F5W C;  5BZB A;  3B8N A;  5CN0 A;  2AHY A;  1Q7Y W;  1GO3 F;  3HB3 B;  3ZN1 A;  1ARO P;  3LSS A;  1OCC B;  3TK1 A;  4MVZ A;  1I5X A;  5LBQ A;  1G4Y B;  1EFR G;  2C2A A;  1OCO C;  3E35 A;  5EK0 A;  2XOK G;  3ZMZ A;  1AJN A;  2V1D A;  1BHA A;  1GM8 A;  3IGA C;  2QTO A;  2V7Q G;  2Z5U A;  3STL C;  1K97 A;  4XDL A;  1VQK V;  1VQP V;  4MTX A;  2NLJ C;  1XL4 A;  2YEV B;  4UVA A;  2EIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...