1NKDA

Atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural parameters for proteins derived from the atomic resolution (1.09 A) structure of a designed variant of the ColE1 ROP protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords ROP
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nkdA00
2IJKA 1F4NA 1NKDA 1GMGA 2IJHA 2IJJA 1PD3A 2IJIA 1F4MA 1RPRA 1ROPA 1B6QA 1RPOA 4DO2A 1GTOA 3K79A 2GHYA
chains in the Genus database with same CATH superfamily
4NXNB 2VQEO 2EZOA 4AQYB 4JV5B 3ZRVA 1H8EG 1VF6A 4NR1A 2OWOA 4MVSA 3K0GA 1SKVA 1PM9A 1VQ4V 2DYRC 3CC2V 4DR6B 1WN7A 2DOSA 4G27B 3ZHSA 1Q86W 4J41A 4NB5A 4U3JB 4ZIBA 3H01A 3TK1A 2WPDG 4RQEA 4FLXA 5EBLC 1FS0G 2OIGA 4JZ2A 5B1AC 1MZEA 4NTXA 1KKCA 4PD4F 5B1BC 2VQFO 4OGQB 4IHJA 4D7SA 4OXSA 3TXSA 5IT9N 3BHPA 2PI5A 1VF6C 2LQTA 1IXBA 2AW9A 1OCOB 2YSUB 4O4IB 4JF3A 4I5SA 4YHHO 1XQ8A 3JCUZ 3HKDA 1QBZA 4MTOA 2P90A 3ZRXA 1S5HC 3B2EE 3E8GA 2UXDO 3UCSC 3K58A 2WLIA 5E1AC 1V55B 1BHAA 3ZHRA 1KECA 3QG5A 4CC5A 1N32O 2CTQA 4FK5C 1SESA 4JI5O 1PV0A 1Q43A 1TUEB 1X4TA 3BABA 2N74A 3ICXA 1R3IC 3T1CA 2HFEC 4W4KA 5D5QA 3WB2A 4KXRA 4P2ZA 4DV5B 1R3JC 1M56B 1Y74B 2A06H 2DJVA 1GM7A 1AJQA 5DEDA 1L0NH 4O2AB 1H2MA 1GN2A 4JI1O 5A9GA 1N32B 3ML0A 3ABKB 3O65A 2ZE5A 4JYAO 2Y4UA 4RWUA 2JRIA 4B08A 3E8FA 2UXDB 3VQWA 4ZI7A 3D8CA 1I7FA 2RNBA 1Y6XA 3UO2A 4DV3O 1VQ8V 1GRJA 3S3XA 3FD9A 3Q4HB 1AI4A 2DMXA 5ITZA 2QE7G 4WFHA 1YHQV 3ETDA 5H2FZ 1VP7A 1PNMA 4NXMO 4F6RB 1XMOO 3L75H 1BE3H 3QVNA 4JAUA 2LGWA 1FAFA 1H2SB 4F6RA 1FFTB 3NR7A 3IC9A 3L73H 4DK0A 1CEZA 5IY5B 2P06A 4BAYA 3FB8C 4JYAB 3FB5C 4JYYA 4J7KA 4FPPA 3AG4B 2QM8A 2CTWA 2FKXA 3P32A 4DV2B 1VQ5V 5LMNB 3E83A 4AQYO 1AJPA 2Q0AA 2YIAA 2OCCB 3RYHA 3RYFA 2VWJA 2PYJA 2CGNA 2WLLB 1U96A 1HNZO 3T1YB 4H44B 5B1OA 4ABMA 5LMUB 1CXZB 1LNQA 5B1BB 1FKAO 5DECA 2GTSA 2JEXA 3E86A 2X0LA 4L8JA 5JCOA 2ZINA 4MTXA 2X6AA 1XREA 5IJ0B 5IYDO 4DV2O 4LWSA 2ODMA 4UB8Z 4BIZA 2CTRA 4DXWA 3ZHVA 4DUYO 2P5OA 1EZVH 4IIJB 3L70H 4O4HA 4DR1B 1GN3A 4Z1MG 4JTCB 2ZIOA 1JCHA 3JAMN 4LC1A 1AI6A 3BA9A 2WAMA 4ZKIA 3NXSA 1IURA 2EIJC 2KG7A 2PGGA 3SPHA 4CS3A 5IWAO 1KC8W 1N4CA 2RMKB 3QO5A 4CS4A 4CS2A 3QTCA 4LF6B 4CC6A 1XMOB 3SPJA 1YTFD 4ZI7B 4MS2A 4CH3A 4EEQA 2EIMC 1DK1A 2VS0A 2Y4TA 3K5OA 2LO1A 3OD4A 3I55V 4EFEA 4J80A 4DRXA 4MSWC 2WLMA 3L72H 4DV4B 1IBLB 5CB4A 1FXHA 2EIJB 2HR3A 3WG7B 3SR2C 4JI3B 3AG7A 2Z5UA 2YC0A 4B7EA 4FLWA 4JZGA 4B3TB 1RM1C 5KUKA 4WFGA 1ZL8B 4FLZA 2Y0IA 2P22C 3L71H 2YEVB 2Z3YA 3CMEV 1SERA 4DR4B 5J2TA 3J81N 4BWAA 3ABKC 4JPRA 5LP6A 4TV9A 4H13B 1UJWB 2JVDA 4PA6A 4UVAA 4X9QA 3BCCH 1M90W 2FMLA 1UFIA 5LP6B 4JGSA 4JTAB 1AILA 1WJZA 1V54B 1EN5A 4QGPA 2F1MA 1TUBB 1GO3F 3L9DA 2W0FC 4E4EA 1K9MW 4X64O 5IJ0A 2Q73A 2Q5ZA 3SJQC 4YJ2B 3BEHA 1B3QA 1MABG 2YIBA 1I5YA 5JQGA 2BTOA 3HPLC 4O4HB 4JI6O 1URFA 5IYZB 2KB1A 3CJHB 4HYOA 1S5LZ 1NVPB 4GKKB 4DR5B 5L3EA 3VQYA 2F43G 5CA0A 4X62O 3RFRA 1PNLA 2ZKOA 4DR2B 1IBLO 4DV1O 2KQXA 1M57C 4KFMA 4CH5A 4PHZA 3ZN1A 2P67A 2XNDG 5F2VO 2WLNA 2Q0OC 4DK1A 1KBHA 4X1YA 4JI0B 4R6ZA 2V1DA 2X6BA 1WA8A 2ZDIA 4DV3B 1R6KA 2XT9A 2OTLV 2UUAB 3OTOO 3K3WA 4LFAO 1PNKA 4DR3O 2PY5A 1ZUQA 3E8HA 5EBWC 4K8XA 5LHIA 2LFSA 3FAVA 1GH6A 2AHZA 4DV7B 2YEVA 3FAVB 2BSKB 1PPJH 4NKGB 2EJ7A 2Q67A 3H1JH 1VF7A 5JH7A 1MOFA 2ATKC 5H9CA 4Q6GA 4GX1A 2RDCA 3K08A 3K5NA 3IGAC 1KKDA 3T1HO 3LSSA 1AR5A 3UT5B 5HFLA 3ZJZA 4FVMA 3K5MA 1KD1W 4QPJA 5C8YB 3H1HH 1G8MA 3ETQA 4LF8B 1QCEA 4BW9A 2ZXWB 5LXTA 2ZT9B 3M7MX 3B40A 4IGGA 4J42A 4PDVA 1MA1A 1N34O 4JI1B 2PI4A 2UU9O 3ZRWB 3OAAG 3G67A 3AK3A 2UUBB 3RBZA 5CMUA 2ZNJA 1QLEB 3CXCU 3ETGA 1XBLA 4RQFA 2QJ1A 1RSOB 2E75B 2ADQB 4HNAA 3BRCA 3SJAC 3FYEB 2LJ2A 5EYPA 4I7ZB 3CSXA 5CA0B 3K0DA 1EN6A 2XUMA 2Y69B 4K0KO 1Q6UA 2RQ6A 1XL4A 2CH7A 3L74H 4D7TA 5GONA 5KMGA 2OT5A 2YXYA 5H6RA 3RT3C 4X64B 1BQ0A 5LP6C 4X1YB 4QE9A 3X2QB 1ENVA 1S3JA 3JARA 3CC7V 2UUCB 5GONB 4NXNO 1XMQO 1K73W 3CMAV 1XUQA 4GX0A 1NQTA 2QA4V 5CBFA 4IYIA 1VQ9V 3UM7A 3CB2A 1VQNV 2E5LO 1KMIZ 4ZOLB 2Q4PA 3JATB 1QVFU 1WAZA 1GK9A 4J9ZB 3DSQA 4MVUA 5DM6V 3ZMSA 4H0LB 4UFZA 4UB6Z 1XMQB 3OE7G 4UVCA 2AZ2A 3LNMB 3JAKA 1Z5VA 5KX5A 1BMFG 5KHGA 3WB0A 2CTPA 1WB7A 2HP8A 3WFVA 1NJIW 2IM9A 1S0VA 1HR0B 1GM9A 4H33A 3PJSK 3RW0A 3VQXA 5E79Z 2WLIB 4GZRB 2PZSA 4LFCB 1JA8A 2F23A 4G2KA 3GVMA 3RYFB 2FTKA 1QVGU 1N0NA 2F93B 2WLLA 1D2DA 1Q6HA 4X1IA 3UO3A 5TISZ 2ZQMA 3APOA 1GAXA 1H2NA 4LBEC 1YIJV 1W2BU 3JAWB 4ZHQA 4X65O 4I50B 3CS5A 5EK0A 5JQGB 4DR6O 3JYCA 3KCYA 5KUMA 4UCOA 4EKWA 1TVKA 4MVRA 1G4YB 3ABTA 5LA6A 1K5SA 3RGBA 3B4SA 5KHHA 1Q8IA 1XOUA 1V55C 1P7GA 4FFBB 3MHHC 3MAQA 1H8HG 1SQGA 4LFBO 5BY1A 2EILC 2HJDA 1YI2V 3BVOA 2XTAA 2XHBA 4FLVA 4FLTA 1LUVA 4MT8A 4X65B 5KHJA 3QO8A 2CGOA 5BXZA 4K8ZA 1NR1A 4P9OA 3K9AA 5ITZB 2OTJV 1WB8A 2UUBO 4DUZB 4YJ3A 1Q6IA 4DV6B 4YXWG 4TQDA 3B77A 2DQ0A 1HNZB 2XAQA 2EJRA 2X7RB 5B66Z 1VQ6V 2BOCC 4DR2O 4GYCB 4JI6B 3EFFK 4FLUA 3ZX6A 5LYJB 1XDCA 4DO2A 3K06A 4H37A 1E1RG 1S5JA 1NR7A 4U3JA 4UV9A 2DQ3A 3JAKB 1NI8A 4JV5O 4RAIA 4LF7B 2XAHA 4X89A 2DYRB 4DV4O 4PI0A 5KHKA 2NR5A 3WB1A 1YF2A 3STLC 3CX5F 2HG5C 4AILC 3CCRV 5GTHZ 4DR5O 2R9RB 3MD0A 3MHSC 4DV1B 2WLJA 1OJHA 1R3LC 1GN6A 1RFYA 4DV0O 1EFRG 1OCZB 2JK5C 3SYCA 4JI4B 2QKAA 2WLHA 3G6BA 4B3RO 4CH6A 5J2UA 1I0HA 1GMGA 2RCVA 4CH4A 4PDMA 1US6A 3H1LH 4WBNA 4JAAA 2PTMA 3EVKA 1J5EB 4DR1O 4PV1B 1MNGA 1JVMA 4DV5O 4LF4O 2W6IG 2IJKA 3UQ8A 4QPKA 3T1YO 2ZD9A 2IBZH 2ZXWC 3U10A 2F4VB 2DW4A 4JI2O 4X62B 1S77D 4UCVA 3JALA 2FL4A 3ABMC 1B06A 1PD3A 1RPOA 2R9IA 4TQFA 1IXMA 4NTWA 4YJ3B 2E3CA 2GTAA 2LGQA 3CRAA 1VQOV 3AG3C 3I56V 3OR7C 2A79B 3IAYA 1I94O 1NVPD 3CE2A 2A0LA 3CCQV 4PA3A 3T2MA 2EILB 3DXRB 2D3OW 2V4DA 3QF7A 3K5LA 5FLXN 2Q9LA 3CRQA 4AI8A 3HKCB 5LYJA 2QSAA 3JCZA 1XILA 2WLKA 4XDJA 1K33A 5J2TB 5EIBC 3LDEA 4FLYA 1Y4MA 1ROPA 2C2AA 3DC5A 3ZRSA 3JD2A 3AG3B 2JGDA 2Q7EA 1BZKA 2GDSA 2XAJA 2VWKA 1ZAUA 1O9GA 4LF5O 2M7WA 4I0XA 1BGYH 3SYAA 4U3FH 4LP8A 5JH7B 4PJ0Z 2L35A 5IE9A 5HFMA 1SC5B 4J7ZA 3OTOB 2QR4A 4BR6A 4QIWF 3AG2B 2DYSB 3FX7A 4PDLA 1SQQH 1TAEA 2BTQA 3N2GB 2BE3A 5LL6Y 5AG2A 2IJJA 5EIBD 3BFRA 5CA1B 2UXXA 4A5UB 1MSDA 4IT5A 1VARA 2GV9A 4JI2B 4U7NA 5LGTA 2QDOA 2UUCO 1XNQB 4F4LA 1YCIA 5DN6G 4LF7O 5B5EZ 1M4UA 4HBNA 2DYSC 1DGSA 3ZHUA 1NZ6A 5FPRA 1YDXA 2V7QG 1HNWO 3APQA 3CXHF 5CN0A 5L3BA 4X1KA 4PA4A 5KLVH 1P4RA 4XDLA 4WFFA 1SQXH 2PUSA 4MW8A 1HNXO 1SQFA 1HR0O 4ASUG 4FZ0A 3CCVV 4FFBA 1Q7YW 1JOYA 2UU9B 3OR6C 1Q90D 1GN4A 3W7TA 3OEEG 1YZBA 4NVPA 3FYIB 1P49A 4QNHB 3FB7C 4B3MO 4X66B 3CWBH 2CH7B 3CCSV 3EHBB 3TGUH 4WFBV 3A0HZ 3RN4A 3SPGA 4K3AA 3BPZA 1S72V 4TT3G 1AR4A 1R1BA 3CYOA 3FFQA 3HKCA 3P30A 2DE0X 1SETA 1KP3A 2GUZA 3SDLA 5KA6A 2OYQA 3R65A 2YXLA 2JIZG 1Y76B 4NTYA 1ZL8A 3CRCA 2H3OA 3OT7A 1S76D 1NTZH 4FFKA 4UCSA 1VQLV 1YEWA 1IX9A 4I0XB 4YHHB 3SJBC 3K9SA 1VIBA 3A2FA 2BSKA 3TETA 1L8DA 1IVSA 1JFFA 4OX9B 1NH2B 1EM1A 1W59A 2Q8VA 1T5EA 3SGIA 1XNRB 3AEIA 2JJ1G 2DN9A 4NXMB 5IJ9A 3ZBHA 1SA0A 5CA1A 1YSCA 2QWQB 5LHGA 4PI2A 3E22A 3OW2U 3W7XA 4UVBA 3RYHB 1XI1A 4I4TA 4DYLA 4I55A 1M56C 5BR8O 2ZM6B 4X20B 4JAVA 3CPWU 3JD4A 1FFXB 5FNVA 4I4TB 2A9HA 1QLNA 2HKOA 2YI9A 1I5XA 4KHPB 5IYZA 1P7BA 1H2KA 1TGOA 2P6JA 1TA8A 1SQVH 1NT2B 4DV7O 2F95B 1XEQA 5KA5A 4GKJB 2W6JG 2ETNA 4CBCA 5K1PA 4K0KB 2HEPA 3K57A 1FD9A 1Y67A 4JI4O 5EYPB 1N36O 2QM7A 4FIPC 4O2BB 3SPCA 1JJ2U 4P9PA 4MVQA 3JSLA 4J10A 5L3CA 2W0XA 4QE7A 1SQBH 1VQKV 4W4LA 4Q20A 3SJCC 4JI8B 4BW5A 3OTFA 4PDRA 3LDDA 4C7UA 2WA3A 4DR3B 1FJGO 1Y66A 3M8AA 1PL4A 2EZPA 1JX9A 5LOVA 4JYCA 1JPXA 1MZFA 3JARB 1DLBA 4TV8A 1M93A 3ASOB 2QKCA 1JMKC 2UXNA 4J9YB 2QTSA 3OUFA 4UCUA 1M57B 2UXCB 1ZWIC 2QWOB 3D36C 2XAGA 2LW1A 3CRRA 4MVMA 2E5LB 4DW1A 1RM1B 4B3SO 1RPRA 1J95A 3AK2A 4J7JA 4TV9B 4HAMA 3CCJV 5LMNO 4FMTA 5C8YA 1KP2A 5D5PA 4D6TH 5KX5B 2XAFA 2OCHA 1BCCH 2N04A 1SA0B 1Z2GA 2HJFC 4OPAA 2RN9A 1KQSU 2EULA 1YXBA 4DR7O 1THZA 3C3TA 3G71V 5FL7G 4I55B 4X1IB 1OV9A 1K92A 3ZHQA 4DUZO 4X20A 4WFEA 1YVWA 1B04A 2K9PA 4I50A 3HB3B 4R50A 1JQ0A 1RSOA 1K7DA 3LNNA 1OCRB 4FJCC 1QQCA 2FB5A 5LA6B 4YJ2A 5JVDB 2Q68A 2HHHO 3EXAA 2CUGA 1HNWB 2ARHA 1QLEC 1FXKA 3A8TA 1K34A 3F5TA 2Q7GA 1M5IA 1NTMH 3K03A 3B8MA 3T4ZA 1TVKB 1ZTEA 1IBMB 4ZBMA 3F7VC 4BIUA 1KU9A 2YS8A 1IDSA 5EC2C 4GUNA 1PL0A 2QWRB 1KYOF 1Y74A 2Y69C 1N8RW 3RYIA 1F23A 3OMNB 1MMMA 4LR3A 3D36A 5KHIA 1J5EO 4FM1A 2JDIG 5BMVA 2P4KA 4O4LA 1YJNV 4MVOA 4YY3O 3H1KH 2UXBO 2YIDA 1FYJA 3G6EV 4TUYA 1OZ0A 2BOBC 3D3IA 3X2QC 4JI7B 3JATA 2ZR2A 1BQZA 4BIOA 1CPYA 4UUJC 5JWPA 3ZHTA 1X59A 3Q4HA 1ZLZA 1OCCB 3ABLC 2KKWA 3JD1A 5LHHA 1D5NA 4JTDB 5J9PC 3VQVA 4LNUB 3QO7A 2E76B 3HR0A 1IZ3A 1I94B 3HKEB 3AG4C 3U0ZA 2L6LA 2HLDG 2GBOA 2GHYA 3TXQA 4FM2A 3P3PA 4DV0B 2YUAA 2F66C 5IDJA 3JD3A 4UCTA 4JI3O 3PN1A 1Q3EA 1H38A 2IJIA 5J2UB 1NU1H 3LSQA 1SZXA 3GWOA 1N0JA 3C3SA 4XDKA 2H8PC 3ZMUA 4IHJB 1LUWA 2B1IA 4DV6O 4EFBA 1K3EA 1HP8A 1F51A 4QJFB 2IJHA 3KCXA 1OCZC 2MW2B 1N33O 4IL6Z 2Q7HA 3OGCC 4WFAV 1FXKB 4GKJO 2JEUA 1VQ7V 4EB6A 2EIMB 1ZX3A 2WSSG 2IH1C 3C90A 1EBOA 5IYCO 2UXCO 5LBQA 3AG1B 3M99B 4GT1A 1G1XB 2AHYA 5EC1C 1R6NA 4DUYB 2JGUA 1OCRC 1BL8A 2G38A 2ZE6A 5BR8B 2ZM6O 3K59A 1K8AW 4IYHA 1L1FA 1GKFA 2H94A 1N33B 3RYCA 4JI8O 2R72A 2LW7A 1K4CC 2KG7B 2OIEA 3ZMZA 3E2EA 4LFBB 3THOA 5K1XA 3RYCB 3CP1A 1XNRO 2R9AA 5B3SC 3RWRD 3RVYA 3WG7C 5LOVB 3STZC 2YIBD 2ITDC 1WA8B 1Q81W 3UKMA 5A2QN 1N36B 1FXKC 4DRXB 1ORQC 4MTGA 1QNMA 1WPXA 4K35A 4PELA 4DR4O 3O9OA 4LCUC 4R7CA 1OCOC 4LNUA 3VBBA 4B3MB 3GWKC 1YJ9V 1YTFB 2AXTZ 2ZE7A 1LR1A 4UV8A 4WCEV 3ZMVA 1SS3A 2EINB 2DWDC 1NKDA 4GX5A 1DF5A 3IFXA 2Y48A 3KG2A 2OCCC 3VOUA 3OUSA 3MDSA 3SYOA 3N2GA 2M6YA 4I9QA 2X6CA 3D3QA 4GX2A 3TJTA 5JJNB 4RUFA 3LDCA 4LF6O 3ZCCA 4O4IA 3H1IH 2VQEB 4LF9O 1EN4A 3W7WA 2GSMB 2AZ0A 5L3DA 3GB7C 3BAAA 5L3GA 4HZ3A 3S3WA 3HKDB 1R6TA 2UUAO 2ZDIC 1TUBA 4OPHA 1WNSA 5L3FA 3HKBB 4FM0A 3JAWA 4ZHQB 1H2GA 3ABUA 1E79G 2Q69A 4B3TO 2N05A 1FXVA 4LF8O 2B5UA 3E89A 3HKBA 1O9HA 3CD6V 2MK3A 4TWKA 4LWSB 1NS1A 2RJZA 4B7KA 1IBMO 3DTUB 5B1NA 4LF5B 3BY6A 1XNQO 1CP9A 4JI5B 1HWYA 3CCLV 3JALB 4LF4B 4MVZA 1L0LH 1NTKH 1VF5B 3ABMB 2ZNIA 4B3SB 2LP7A 4U7OA 3N2KA 2PF4E 3TCUA 3K04A 2DWEC 1ZSPA 3ETEA 3OFNG 1XHZA 4GCZA 2ZE8A 1K4DC 1P84F 4O4LB 3N2KB 1QR8A 2IU0A 2Z0AA 1AJNA 1R3KC 3E35A 1VQPV 2NNUA 5KAIZ 4MTFA 3B8NA 3CCEV 1B6QA 5GW7A 3WU2Z 2FYUH 3IJ4A 3JSNA 4TV8B 2B9ZA 2EBOA 4X8AA 1AP5A 2AGAA 2D2CB 5CA3A 1KUQA 3AG1C 3CCMV 5CB4B 3ASNC 4XBFA 4F6EA 2CDYA 1NH2D 1RP3B 1M9NA 1Y76A 4I9WA 1YJWV 3OMAB 5EZYB 3G4SV 1JFFB 4JYBA 3OGIB 3JASB 1SZTA 3ASOC 1IBKB 5LGUA 1WP8A 4O4JB 2XASA 2XOKG 3JASA 5IJ9B 4P30A 1JJOA 4DR7B 3KKYA 3LUTB 1YITV 4UCRA 5BZBA 2QWPB 2BTQB 2UXBB 1BT8A 2QM4A 4X66O 3DGEA 4X88A 3KZIZ 3T1HB 2CE4A 5C93A 1I08A 1Z5WA 2A7WA 5CBHA 3E8BA 1FFXA 3FB6C 3U11A 1XHXA 1FJGB 3BA8A 2A3QA 2EX3A 2QWNB 3OM3B 4ICGA 1GTOA 2LFRA 1H2LA 2WWWA 3ZN0A 1HDJA 3G80A 1N34B 1AI5A 2JS3A 5IWAB 1IBKO 3IC7A 1SRYA 4JASA 4X1KB 2NN4A 2P7TC 3OEHG 3AG2C 1VMGA 4O2BA 3ZEDA 1PKXA 2R70A 4HNAB 2CAZC 2QTOA 1M1KW 5IY5C 4NYKA 4RUEA 2IW5A 4KP4A 2YXHA 5H5NA 1D5AA 5JJJB 1DF4A 2HVJC 2JS5A 4GKKO 3CJHA 3F7YC 1K97A 4PA9A 1Q82W 4GLXA 2Q6AA 5IYBO 2YI8A 1WLEA 4LH6A 4Z1VA 3SYQA 2P4VA 3P3NA 1AP6A 3SPIA 2GUZB 1NBMG 2ADPA 1EZJA 3CC4V 1PP9H 3DXRA 2IU3A 1SQPH 3R66A 4JI7O 1VEWA 4TUYB 1VQMV 1K5QA 1BSMA 3J80N 1V54C 5B1AB 2QGNA 3ZS8C 3SYPA 1SF9A 1MSWD 3W7SA 2WA4A 1HW7A 5EZYA 4KHPO 1QU7A 2ILMA 4ZOLA 1AR1B 3CEIA 3K79A 2JGDB 1G6UA 1GM8A 1OHHG 4TOIA 3AK1A 4O4JA 3QNEA 5FPOA 2CK3G 5KAFZ 4B3RB 3HKEA 1OCCC 3ABLB 1DTOA 5B3SB 4PA7A 2O57A 1A32A 1COWG 5LXTB 3ASNB 2KSDA 4TSFG 4JI0O 3FKSG 2VQFB 1KB9F 3E22B 3I5DA 3F5WC 4N21A 2IH3C 1F4MA 1WPBA 4J11A 3UT5A 5CBGA 1U97A 1BHBA 1MG1A 2Y0PA 2ZIMA 4FZ1A 1AROP 1Q5OA 5FNVB 3W7UA 1W0JG 3ZMTA 1QR9A 5JJEB 5JVDA 5LMUO 4Z2WA 4DW0A 1BS3A 2JJ2G 3H9VA 1AVMA 2YICA 1W0KG 4YY3B 1XL6A 2EINC 2ZCEA 1R73A 3CCUV 1AB3A 4WBNB 1F7YA 1F4NA 4LFCO 4AHCA 4CZZA 1JR9A 4RO2A 2K1EA 3LSUA 4KUMA 3ZRWA 3N27A 5GTIZ 2EIKB 2E74B 3A0RA 4G28B 1UPGA 3ZIAG 4MW3A 4KL1A 2ZR3A 4R8CA 4EB6B 3J7AU 4IIJA 4YIPA 5H6QA 2BCCH 3T4DA 3RYIB 4LFAB 4L87A 4UXNA 5KMGB 5LGNA 3A0BZ 4YIOA 4E2LA 4LF9B 2VRZA 2YDEA 3OMIB 2B1GA 2EIKC 3DC6A 2HHHB 4O2AA 3RVZA 1FPOA 3B09A 2QEXV 4LH7A 1V9PA 2PYLA 2NLJC 1WP7A 2QKSA 3CRMA 1QHTA 5EBMC 5JCOC 3JD0A 1AI7A 4WF9V 1E1QG 2HVKC 2ITCC 4N23A 3CHXA 1HNXB 5BMVB 2F4VO 4OX9O
chains in the Genus database with same CATH topology
2EZOA 3K08A 3IGAC 4F4LA 1K8AW 1KKDA 3LSSA 3ZRVA 5DN6G 1L1FA 1H8EG 1GKFA 2H94A 4MVSA 3K0GA 5HFLA 3ZJZA 1KD1W 4QPJA 2DYSC 1VQ4V 1G8MA 2DYRC 1K4CC 3CC2V 1QCEA 2ZXWB 2V7QG 3ZMZA 3E2EA 4G27B 4PDVA 5CN0A 5L3BA 1Q86W 3CP1A 5B3SC 4PA4A 1P4RA 3RVYA 4XDLA 4WFFA 3H01A 3WG7C 4MW8A 2WPDG 3TK1A 2PI4A 3STZC 4RQEA 4ASUG 2ITDC 3CCVV 3ZRWB 3OAAG 5EBLC 1Q7YW 1FS0G 3UKMA 1Q81W 1JOYA 3OR6C 5B1AC 3W7TA 1FXKC 3OEEG 5B1BC 3RBZA 1ORQC 4MTGA 3FYIB 5CMUA 1QLEB 1WPXA 4PELA 3CXCU 3ETGA 4QNHB 4RQFA 4LCUC 4R7CA 3FB7C 1OCOC 3VBBA 3CCSV 3EHBB 1YJ9V 4OXSA 1YTFB 3FYEB 4WFBV 2PI5A 1OCOB 2YSUB 4UV8A 3SPGA 4JF3A 3K0DA 4WCEV 3ZMVA 2EINB 4I5SA 1S72V 4TT3G 2DWDC 2Y69B 3P30A 3CYOA 1NKDA 4GX5A 1DF5A 1SETA 3IFXA 1KP3A 2Y48A 1QBZA 5KA6A 4MTOA 2P90A 3ZRXA 3KG2A 1S5HC 1XL4A 3E8GA 2OCCC 3R65A 3VOUA 3OUSA 3SYOA 2JIZG 2WLIA 2X6CA 5E1AC 1V55B 4GX2A 1BHAA 1KECA 2OT5A 4RUFA 5H6RA 1S76D 3LDCA 4FK5C 1VQLV 3ZCCA 1SESA 4QE9A 3X2QB 1TUEB 1ENVA 1S3JA 3W7WA 3CC7V 2GSMB 5L3DA 3GB7C 1R3IC 5L3GA 3T1CA 4HZ3A 2HFEC 1K73W 2ZDIC 3CMAV 4P2ZA 1R3JC 3TETA 4GX0A 1M56B 1NQTA 2QA4V 1GM7A 1AJQA 5CBFA 1NH2B 1VQ9V 3UM7A 1VQNV 5L3FA 1H2GA 3AEIA 1QVFU 3ABUA 1E79G 3ML0A 1GK9A 4J9ZB 3ABKB 2Q69A 2JJ1G 1FXVA 4MVUA 5DM6V 2B5UA 3ZMSA 1YSCA 3E89A 3E8FA 5LHGA 3CD6V 3OW2U 3W7XA 4UVBA 2MK3A 3OE7G 4TWKA 4UVCA 3LNMB 1M56C 1BMFG 1VQ8V 3DTUB 5B1NA 3BY6A 1CP9A 4JAVA 3CPWU 1HWYA 3JD4A 1AI4A 3CCLV 4MVZA 2QE7G 4WFHA 2A9HA 3WFVA 1YHQV 1QLNA 2HKOA 1NJIW 3ETDA 1S0VA 3ABMB 1I5XA 2LP7A 4U7OA 1GM9A 4H33A 3TCUA 3K04A 1PNMA 2DWEC 1P7BA 3PJSK 3RW0A 2P6JA 3ETEA 3OFNG 5KA5A 2W6JG 4GCZA 1K4DC 4CBCA 4JAUA 1QR8A 2IU0A 1FFTB 2WLIB 1AJNA 1R3KC 3E35A 1CEZA 4G2KA 5IY5B 1VQPV 2NNUA 4MTFA 2QM7A 4FIPC 2FTKA 3B8NA 3CCEV 4BAYA 1B6QA 2WLLA 3FB8C 5GW7A 3FB5C 1QVGU 3SPCA 1JJ2U 4FPPA 3AG4B 4P9PA 2ZQMA 2EBOA 4MVQA 5L3CA 4X8AA 4LBEC 4QE7A 5CA3A 1YIJV 2QM8A 1W2BU 3AG1C 1VQKV 3CCMV 4Q20A 3ASNC 4XBFA 3P32A 1NH2D 1VQ5V 5EK0A 1M9NA 4BW5A 3E83A 4I9WA 1YJWV 3OMAB 3JYCA 4PDRA 3G4SV 3LDDA 5KUMA 4EKWA 4JYBA 1AJPA 4MVRA 1G4YB 3ABTA 1SZTA 1K5SA 1Y66A 2OCCB 3ASOC 2EZPA 1JX9A 5LGUA 4JYCA 1V55C 2WLLB 1JPXA 3MHHC 5B1OA 1DLBA 2XASA 1LNQA 5B1BB 1H8HG 2XOKG 2JEXA 2EILC 4P30A 3ASOB 2UXNA 1YI2V 4J9YB 3LUTB 1YITV 3E86A 4MT8A 2X0LA 3OUFA 1M57B 5BZBA 1ZWIC 3QO8A 4MTXA 2X6AA 5IYDO 3DGEA 4X88A 4BIZA 1NR1A 5C93A 4DXWA 2XAGA 4P9OA 5CBHA 3E8BA 4MVMA 3K9AA 2OTJV 3FB6C 4Z1MG 4JTCB 1RM1B 3OM3B 1RPRA 1JCHA 4YXWG 1J95A 3B77A 2DQ0A 1GTOA 4LC1A 1AI6A 2XAQA 2EJRA 2LFRA 2WWWA 2X7RB 4HAMA 3CCJV 2WAMA 1VQ6V 4FMTA 3ZN0A 1KP2A 2BOCC 4ZKIA 3NXSA 2XAFA 1AI5A 3EFFK 2EIJC 3SPHA 2HJFC 3IC7A 4DO2A 3K06A 4H37A 1KC8W 1E1RG 3QO5A 1NR7A 1SRYA 4JASA 1KQSU 3SPJA 2P7TC 4UV9A 1YTFD 3OEHG 2DQ3A 3AG2C 4MS2A 1THZA 3G71V 5FL7G 2EIMC 4RAIA 1PKXA 2XAHA 1K92A 4X89A 2DYRB 2QTOA 1M1KW 5IY5C 4RUEA 2IW5A 4KP4A 4WFEA 3I55V 4MSWC 2WLMA 3STLC 3HB3B 2HG5C 4R50A 1DF4A 1JQ0A 2HVJC 1K7DA 1FXHA 2EIJB 3F7YC 1K97A 3CCRV 2HR3A 4PA9A 1OCRB 3WG7B 4FJCC 1Q82W 2Q68A 2R9RB 2Z5UA 3MD0A 2Q6AA 5IYBO 3MHSC 1RM1C 5KUKA 4WFGA 1WLEA 1R3LC 2WLJA 1EFRG 1QLEC 1OCZB 3SYQA 1FXKA 2JK5C 2YEVB 2Z3YA 3CMEV 1SERA 3SYCA 1K34A 3SPIA 1NBMG 1EZJA 3CC4V 2WLHA 3K03A 3B8MA 2IU3A 3T4ZA 3ABKC 4JPRA 1GMGA 4ZBMA 3F7VC 1VQMV 1K5QA 4PDMA 4BIUA 1V54C 5EC2C 1UJWB 5B1AB 4PA6A 1PL0A 4UVAA 2Y69C 3SYPA 1N8RW 1MSWD 1M90W 1F23A 3W7SA 3OMNB 3D36A 4JGSA 4JTAB 1V54B 2JDIG 1AR1B 1JVMA 3K79A 2W6IG 1GM8A 2IJKA 1OHHG 1YJNV 4MVOA 1GO3F 3QNEA 4QPKA 2CK3G 2ZD9A 2ZXWC 3G6EV 2W0FC 2DW4A 1OZ0A 2BOBC 3D3IA 3X2QC 1K9MW 1OCCC 3ABLB 1S77D 1DTOA 2ZR2A 5B3SB 4PA7A 1CPYA 4UUJC 1COWG 3ASNB 4TSFG 1OCCB 3ABLC 3FKSG 3SJQC 3ABMC 3F5WC 3BEHA 2IH3C 3JD1A 4N21A 5LHHA 1PD3A 4JTDB 1F4MA 5J9PC 1MABG 1I5YA 3HPLC 1RPOA 5CBGA 2R9IA 3QO7A 1IXMA 1BHBA 1MG1A 2KB1A 4HYOA 1NVPB 1AROP 1VQOV 3AG3C 3I56V 3AG4C 2A79B 3OR7C 5L3EA 2F43G 3W7UA 1W0JG 1NVPD 2A0LA 1QR9A 3ZMTA 3CCQV 4PA3A 1PNLA 2EILB 3T2MA 2D3OW 2HLDG 2JJ2G 2GHYA 1W0KG 1XL6A 2EINC 1M57C 3JCZA 1R73A 4KFMA 3CCUV 2WLKA 4XDJA 5IDJA 3JD3A 1F4NA 4CZZA 3ZN1A 1K33A 4RO2A 2K1EA 3LDEA 4KUMA 3ZRWA 1Y4MA 2P67A 2XNDG 2EIKB 3A0RA 4G28B 1H38A 2IJIA 1ROPA 2C2AA 3ZIAG 4MW3A 2ZR3A 4R8CA 3ZRSA 3JD2A 2WLNA 3AG3B 3LSQA 5H6QA 3GWOA 4R6ZA 2V1DA 2X6BA 2XAJA 4XDKA 2H8PC 3T4DA 3ZMUA 2ZDIA 2OTLV 1R6KA 2M7WA 3SYAA 2B1IA 4LP8A 4L87A 4UXNA 3K3WA 5HFMA 1PNKA 1K3EA 3E8HA 5LGNA 5EBWC 1F51A 4QJFB 2LFSA 5LHIA 4E2LA 2IJHA 3OMIB 1OCZC 2B1GA 2EIKC 2AHZA 3OGCC 3RVZA 4WFAV 4QIWF 3AG2B 2DYSB 1FXKB 2YEVA 4PDLA 2JEUA 1VQ7V 2EIMB 2QEXV 2WSSG 2IH1C 1EBOA 2NLJC 5IYCO 2QKSA 2IJJA 2Q67A 5LBQA 3AG1B 2UXXA 3M99B 4GT1A 5EBMC 1MOFA 1AI7A 3JD0A 2AHYA 5EC1C 4WF9V 1E1QG 1R6NA 2ATKC 2HVKC 2ITCC 4N23A 5H9CA 4GX1A 4U7NA 5LGTA 1OCRC 1BL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJK A;  1F4N A;  1NKD A;  1GMG A;  2IJH A;  2IJJ A;  1PD3 A;  2IJI A;  1F4M A;  1RPR A;  1ROP A;  1B6Q A;  1RPO A;  4DO2 A;  1GTO A;  3K79 A;  2GHY A; 
#chains in the Genus database with same CATH topology
 4NXN B;  2VQE O;  2EZO A;  4AQY B;  4JV5 B;  3ZRV A;  1H8E G;  1VF6 A;  4NR1 A;  2OWO A;  4MVS A;  3K0G A;  1SKV A;  1PM9 A;  1VQ4 V;  2DYR C;  3CC2 V;  4DR6 B;  1WN7 A;  2DOS A;  4G27 B;  3ZHS A;  1Q86 W;  4J41 A;  4NB5 A;  4U3J B;  4ZIB A;  3H01 A;  3TK1 A;  2WPD G;  4RQE A;  4FLX A;  5EBL C;  1FS0 G;  2OIG A;  4JZ2 A;  5B1A C;  1MZE A;  4NTX A;  1KKC A;  4PD4 F;  5B1B C;  2VQF O;  4OGQ B;  4IHJ A;  4D7S A;  4OXS A;  3TXS A;  5IT9 N;  3BHP A;  2PI5 A;  1VF6 C;  2LQT A;  1IXB A;  2AW9 A;  1OCO B;  2YSU B;  4O4I B;  4JF3 A;  4I5S A;  4YHH O;  1XQ8 A;  3JCU Z;  3HKD A;  1QBZ A;  4MTO A;  2P90 A;  3ZRX A;  1S5H C;  3B2E E;  3E8G A;  2UXD O;  3UCS C;  3K58 A;  2WLI A;  5E1A C;  1V55 B;  1BHA A;  3ZHR A;  1KEC A;  3QG5 A;  4CC5 A;  1N32 O;  2CTQ A;  4FK5 C;  1SES A;  4JI5 O;  1PV0 A;  1Q43 A;  1TUE B;  1X4T A;  3BAB A;  2N74 A;  3ICX A;  1R3I C;  3T1C A;  2HFE C;  4W4K A;  5D5Q A;  3WB2 A;  4KXR A;  4P2Z A;  4DV5 B;  1R3J C;  1M56 B;  1Y74 B;  2A06 H;  2DJV A;  1GM7 A;  1AJQ A;  5DED A;  1L0N H;  4O2A B;  1H2M A;  1GN2 A;  4JI1 O;  5A9G A;  1N32 B;  3ML0 A;  3ABK B;  3O65 A;  2ZE5 A;  4JYA O;  2Y4U A;  4RWU A;  2JRI A;  4B08 A;  3E8F A;  2UXD B;  3VQW A;  4ZI7 A;  3D8C A;  1I7F A;  2RNB A;  1Y6X A;  3UO2 A;  4DV3 O;  1VQ8 V;  1GRJ A;  3S3X A;  3FD9 A;  3Q4H B;  1AI4 A;  2DMX A;  5ITZ A;  2QE7 G;  4WFH A;  1YHQ V;  3ETD A;  5H2F Z;  1VP7 A;  1PNM A;  4NXM O;  4F6R B;  1XMO O;  3L75 H;  1BE3 H;  3QVN A;  4JAU A;  2LGW A;  1FAF A;  1H2S B;  4F6R A;  1FFT B;  3NR7 A;  3IC9 A;  3L73 H;  4DK0 A;  1CEZ A;  5IY5 B;  2P06 A;  4BAY A;  3FB8 C;  4JYA B;  3FB5 C;  4JYY A;  4J7K A;  4FPP A;  3AG4 B;  2QM8 A;  2CTW A;  2FKX A;  3P32 A;  4DV2 B;  1VQ5 V;  5LMN B;  3E83 A;  4AQY O;  1AJP A;  2Q0A A;  2YIA A;  2OCC B;  3RYH A;  3RYF A;  2VWJ A;  2PYJ A;  2CGN A;  2WLL B;  1U96 A;  1HNZ O;  3T1Y B;  4H44 B;  5B1O A;  4ABM A;  5LMU B;  1CXZ B;  1LNQ A;  5B1B B;  1FKA O;  5DEC A;  2GTS A;  2JEX A;  3E86 A;  2X0L A;  4L8J A;  5JCO A;  2ZIN A;  4MTX A;  2X6A A;  1XRE A;  5IJ0 B;  5IYD O;  4DV2 O;  4LWS A;  2ODM A;  4UB8 Z;  4BIZ A;  2CTR A;  4DXW A;  3ZHV A;  4DUY O;  2P5O A;  1EZV H;  4IIJ B;  3L70 H;  4O4H A;  4DR1 B;  1GN3 A;  4Z1M G;  4JTC B;  2ZIO A;  1JCH A;  3JAM N;  4LC1 A;  1AI6 A;  3BA9 A;  2WAM A;  4ZKI A;  3NXS A;  1IUR A;  2EIJ C;  2KG7 A;  2PGG A;  3SPH A;  4CS3 A;  5IWA O;  1KC8 W;  1N4C A;  2RMK B;  3QO5 A;  4CS4 A;  4CS2 A;  3QTC A;  4LF6 B;  4CC6 A;  1XMO B;  3SPJ A;  1YTF D;  4ZI7 B;  4MS2 A;  4CH3 A;  4EEQ A;  2EIM C;  1DK1 A;  2VS0 A;  2Y4T A;  3K5O A;  2LO1 A;  3OD4 A;  3I55 V;  4EFE A;  4J80 A;  4DRX A;  4MSW C;  2WLM A;  3L72 H;  4DV4 B;  1IBL B;  5CB4 A;  1FXH A;  2EIJ B;  2HR3 A;  3WG7 B;  3SR2 C;  4JI3 B;  3AG7 A;  2Z5U A;  2YC0 A;  4B7E A;  4FLW A;  4JZG A;  4B3T B;  1RM1 C;  5KUK A;  4WFG A;  1ZL8 B;  4FLZ A;  2Y0I A;  2P22 C;  3L71 H;  2YEV B;  2Z3Y A;  3CME V;  1SER A;  4DR4 B;  5J2T A;  3J81 N;  4BWA A;  3ABK C;  4JPR A;  5LP6 A;  4TV9 A;  4H13 B;  1UJW B;  2JVD A;  4PA6 A;  4UVA A;  4X9Q A;  3BCC H;  1M90 W;  2FML A;  1UFI A;  5LP6 B;  4JGS A;  4JTA B;  1AIL A;  1WJZ A;  1V54 B;  1EN5 A;  4QGP A;  2F1M A;  1TUB B;  1GO3 F;  3L9D A;  2W0F C;  4E4E A;  1K9M W;  4X64 O;  5IJ0 A;  2Q73 A;  2Q5Z A;  3SJQ C;  4YJ2 B;  3BEH A;  1B3Q A;  1MAB G;  2YIB A;  1I5Y A;  5JQG A;  2BTO A;  3HPL C;  4O4H B;  4JI6 O;  1URF A;  5IYZ B;  2KB1 A;  3CJH B;  4HYO A;  1S5L Z;  1NVP B;  4GKK B;  4DR5 B;  5L3E A;  3VQY A;  2F43 G;  5CA0 A;  4X62 O;  3RFR A;  1PNL A;  2ZKO A;  4DR2 B;  1IBL O;  4DV1 O;  2KQX A;  1M57 C;  4KFM A;  4CH5 A;  4PHZ A;  3ZN1 A;  2P67 A;  2XND G;  5F2V O;  2WLN A;  2Q0O C;  4DK1 A;  1KBH A;  4X1Y A;  4JI0 B;  4R6Z A;  2V1D A;  2X6B A;  1WA8 A;  2ZDI A;  4DV3 B;  1R6K A;  2XT9 A;  2OTL V;  2UUA B;  3OTO O;  3K3W A;  4LFA O;  1PNK A;  4DR3 O;  2PY5 A;  1ZUQ A;  3E8H A;  5EBW C;  4K8X A;  5LHI A;  2LFS A;  3FAV A;  1GH6 A;  2AHZ A;  4DV7 B;  2YEV A;  3FAV B;  2BSK B;  1PPJ H;  4NKG B;  2EJ7 A;  2Q67 A;  3H1J H;  1VF7 A;  5JH7 A;  1MOF A;  2ATK C;  5H9C A;  4Q6G A;  4GX1 A;  2RDC A;  3K08 A;  3K5N A;  3IGA C;  1KKD A;  3T1H O;  3LSS A;  1AR5 A;  3UT5 B;  5HFL A;  3ZJZ A;  4FVM A;  3K5M A;  1KD1 W;  4QPJ A;  5C8Y B;  3H1H H;  1G8M A;  3ETQ A;  4LF8 B;  1QCE A;  4BW9 A;  2ZXW B;  5LXT A;  2ZT9 B;  3M7M X;  3B40 A;  4IGG A;  4J42 A;  4PDV A;  1MA1 A;  1N34 O;  4JI1 B;  2PI4 A;  2UU9 O;  3ZRW B;  3OAA G;  3G67 A;  3AK3 A;  2UUB B;  3RBZ A;  5CMU A;  2ZNJ A;  1QLE B;  3CXC U;  3ETG A;  1XBL A;  4RQF A;  2QJ1 A;  1RSO B;  2E75 B;  2ADQ B;  4HNA A;  3BRC A;  3SJA C;  3FYE B;  2LJ2 A;  5EYP A;  4I7Z B;  3CSX A;  5CA0 B;  3K0D A;  1EN6 A;  2XUM A;  2Y69 B;  4K0K O;  1Q6U A;  2RQ6 A;  1XL4 A;  2CH7 A;  3L74 H;  4D7T A;  5GON A;  5KMG A;  2OT5 A;  2YXY A;  5H6R A;  3RT3 C;  4X64 B;  1BQ0 A;  5LP6 C;  4X1Y B;  4QE9 A;  3X2Q B;  1ENV A;  1S3J A;  3JAR A;  3CC7 V;  2UUC B;  5GON B;  4NXN O;  1XMQ O;  1K73 W;  3CMA V;  1XUQ A;  4GX0 A;  1NQT A;  2QA4 V;  5CBF A;  4IYI A;  1VQ9 V;  3UM7 A;  3CB2 A;  1VQN V;  2E5L O;  1KMI Z;  4ZOL B;  2Q4P A;  3JAT B;  1QVF U;  1WAZ A;  1GK9 A;  4J9Z B;  3DSQ A;  4MVU A;  5DM6 V;  3ZMS A;  4H0L B;  4UFZ A;  4UB6 Z;  1XMQ B;  3OE7 G;  4UVC A;  2AZ2 A;  3LNM B;  3JAK A;  1Z5V A;  5KX5 A;  1BMF G;  5KHG A;  3WB0 A;  2CTP A;  1WB7 A;  2HP8 A;  3WFV A;  1NJI W;  2IM9 A;  1S0V A;  1HR0 B;  1GM9 A;  4H33 A;  3PJS K;  3RW0 A;  3VQX A;  5E79 Z;  2WLI B;  4GZR B;  2PZS A;  4LFC B;  1JA8 A;  2F23 A;  4G2K A;  3GVM A;  3RYF B;  2FTK A;  1QVG U;  1N0N A;  2F93 B;  2WLL A;  1D2D A;  1Q6H A;  4X1I A;  3UO3 A;  5TIS Z;  2ZQM A;  3APO A;  1GAX A;  1H2N A;  4LBE C;  1YIJ V;  1W2B U;  3JAW B;  4ZHQ A;  4X65 O;  4I50 B;  3CS5 A;  5EK0 A;  5JQG B;  4DR6 O;  3JYC A;  3KCY A;  5KUM A;  4UCO A;  4EKW A;  1TVK A;  4MVR A;  1G4Y B;  3ABT A;  5LA6 A;  1K5S A;  3RGB A;  3B4S A;  5KHH A;  1Q8I A;  1XOU A;  1V55 C;  1P7G A;  4FFB B;  3MHH C;  3MAQ A;  1H8H G;  1SQG A;  4LFB O;  5BY1 A;  2EIL C;  2HJD A;  1YI2 V;  3BVO A;  2XTA A;  2XHB A;  4FLV A;  4FLT A;  1LUV A;  4MT8 A;  4X65 B;  5KHJ A;  3QO8 A;  2CGO A;  5BXZ A;  4K8Z A;  1NR1 A;  4P9O A;  3K9A A;  5ITZ B;  2OTJ V;  1WB8 A;  2UUB O;  4DUZ B;  4YJ3 A;  1Q6I A;  4DV6 B;  4YXW G;  4TQD A;  3B77 A;  2DQ0 A;  1HNZ B;  2XAQ A;  2EJR A;  2X7R B;  5B66 Z;  1VQ6 V;  2BOC C;  4DR2 O;  4GYC B;  4JI6 B;  3EFF K;  4FLU A;  3ZX6 A;  5LYJ B;  1XDC A;  4DO2 A;  3K06 A;  4H37 A;  1E1R G;  1S5J A;  1NR7 A;  4U3J A;  4UV9 A;  2DQ3 A;  3JAK B;  1NI8 A;  4JV5 O;  4RAI A;  4LF7 B;  2XAH A;  4X89 A;  2DYR B;  4DV4 O;  4PI0 A;  5KHK A;  2NR5 A;  3WB1 A;  1YF2 A;  3STL C;  3CX5 F;  2HG5 C;  4AIL C;  3CCR V;  5GTH Z;  4DR5 O;  2R9R B;  3MD0 A;  3MHS C;  4DV1 B;  2WLJ A;  1OJH A;  1R3L C;  1GN6 A;  1RFY A;  4DV0 O;  1EFR G;  1OCZ B;  2JK5 C;  3SYC A;  4JI4 B;  2QKA A;  2WLH A;  3G6B A;  4B3R O;  4CH6 A;  5J2U A;  1I0H A;  1GMG A;  2RCV A;  4CH4 A;  4PDM A;  1US6 A;  3H1L H;  4WBN A;  4JAA A;  2PTM A;  3EVK A;  1J5E B;  4DR1 O;  4PV1 B;  1MNG A;  1JVM A;  4DV5 O;  4LF4 O;  2W6I G;  2IJK A;  3UQ8 A;  4QPK A;  3T1Y O;  2ZD9 A;  2IBZ H;  2ZXW C;  3U10 A;  2F4V B;  2DW4 A;  4JI2 O;  4X62 B;  1S77 D;  4UCV A;  3JAL A;  2FL4 A;  3ABM C;  1B06 A;  1PD3 A;  1RPO A;  2R9I A;  4TQF A;  1IXM A;  4NTW A;  4YJ3 B;  2E3C A;  2GTA A;  2LGQ A;  3CRA A;  1VQO V;  3AG3 C;  3I56 V;  3OR7 C;  2A79 B;  3IAY A;  1I94 O;  1NVP D;  3CE2 A;  2A0L A;  3CCQ V;  4PA3 A;  3T2M A;  2EIL B;  3DXR B;  2D3O W;  2V4D A;  3QF7 A;  3K5L A;  5FLX N;  2Q9L A;  3CRQ A;  4AI8 A;  3HKC B;  5LYJ A;  2QSA A;  3JCZ A;  1XIL A;  2WLK A;  4XDJ A;  1K33 A;  5J2T B;  5EIB C;  3LDE A;  4FLY A;  1Y4M A;  1ROP A;  2C2A A;  3DC5 A;  3ZRS A;  3JD2 A;  3AG3 B;  2JGD A;  2Q7E A;  1BZK A;  2GDS A;  2XAJ A;  2VWK A;  1ZAU A;  1O9G A;  4LF5 O;  2M7W A;  4I0X A;  1BGY H;  3SYA A;  4U3F H;  4LP8 A;  5JH7 B;  4PJ0 Z;  2L35 A;  5IE9 A;  5HFM A;  1SC5 B;  4J7Z A;  3OTO B;  2QR4 A;  4BR6 A;  4QIW F;  3AG2 B;  2DYS B;  3FX7 A;  4PDL A;  1SQQ H;  1TAE A;  2BTQ A;  3N2G B;  2BE3 A;  5LL6 Y;  5AG2 A;  2IJJ A;  5EIB D;  3BFR A;  5CA1 B;  2UXX A;  4A5U B;  1MSD A;  4IT5 A;  1VAR A;  2GV9 A;  4JI2 B;  4U7N A;  5LGT A;  2QDO A;  2UUC O;  1XNQ B;  4F4L A;  1YCI A;  5DN6 G;  4LF7 O;  5B5E Z;  1M4U A;  4HBN A;  2DYS C;  1DGS A;  3ZHU A;  1NZ6 A;  5FPR A;  1YDX A;  2V7Q G;  1HNW O;  3APQ A;  3CXH F;  5CN0 A;  5L3B A;  4X1K A;  4PA4 A;  5KLV H;  1P4R A;  4XDL A;  4WFF A;  1SQX H;  2PUS A;  4MW8 A;  1HNX O;  1SQF A;  1HR0 O;  4ASU G;  4FZ0 A;  3CCV V;  4FFB A;  1Q7Y W;  1JOY A;  2UU9 B;  3OR6 C;  1Q90 D;  1GN4 A;  3W7T A;  3OEE G;  1YZB A;  4NVP A;  3FYI B;  1P49 A;  4QNH B;  3FB7 C;  4B3M O;  4X66 B;  3CWB H;  2CH7 B;  3CCS V;  3EHB B;  3TGU H;  4WFB V;  3A0H Z;  3RN4 A;  3SPG A;  4K3A A;  3BPZ A;  1S72 V;  4TT3 G;  1AR4 A;  1R1B A;  3CYO A;  3FFQ A;  3HKC A;  3P30 A;  2DE0 X;  1SET A;  1KP3 A;  2GUZ A;  3SDL A;  5KA6 A;  2OYQ A;  3R65 A;  2YXL A;  2JIZ G;  1Y76 B;  4NTY A;  1ZL8 A;  3CRC A;  2H3O A;  3OT7 A;  1S76 D;  1NTZ H;  4FFK A;  4UCS A;  1VQL V;  1YEW A;  1IX9 A;  4I0X B;  4YHH B;  3SJB C;  3K9S A;  1VIB A;  3A2F A;  2BSK A;  3TET A;  1L8D A;  1IVS A;  1JFF A;  4OX9 B;  1NH2 B;  1EM1 A;  1W59 A;  2Q8V A;  1T5E A;  3SGI A;  1XNR B;  3AEI A;  2JJ1 G;  2DN9 A;  4NXM B;  5IJ9 A;  3ZBH A;  1SA0 A;  5CA1 A;  1YSC A;  2QWQ B;  5LHG A;  4PI2 A;  3E22 A;  3OW2 U;  3W7X A;  4UVB A;  3RYH B;  1XI1 A;  4I4T A;  4DYL A;  4I55 A;  1M56 C;  5BR8 O;  2ZM6 B;  4X20 B;  4JAV A;  3CPW U;  3JD4 A;  1FFX B;  5FNV A;  4I4T B;  2A9H A;  1QLN A;  2HKO A;  2YI9 A;  1I5X A;  4KHP B;  5IYZ A;  1P7B A;  1H2K A;  1TGO A;  2P6J A;  1TA8 A;  1SQV H;  1NT2 B;  4DV7 O;  2F95 B;  1XEQ A;  5KA5 A;  4GKJ B;  2W6J G;  2ETN A;  4CBC A;  5K1P A;  4K0K B;  2HEP A;  3K57 A;  1FD9 A;  1Y67 A;  4JI4 O;  5EYP B;  1N36 O;  2QM7 A;  4FIP C;  4O2B B;  3SPC A;  1JJ2 U;  4P9P A;  4MVQ A;  3JSL A;  4J10 A;  5L3C A;  2W0X A;  4QE7 A;  1SQB H;  1VQK V;  4W4L A;  4Q20 A;  3SJC C;  4JI8 B;  4BW5 A;  3OTF A;  4PDR A;  3LDD A;  4C7U A;  2WA3 A;  4DR3 B;  1FJG O;  1Y66 A;  3M8A A;  1PL4 A;  2EZP A;  1JX9 A;  5LOV A;  4JYC A;  1JPX A;  1MZF A;  3JAR B;  1DLB A;  4TV8 A;  1M93 A;  3ASO B;  2QKC A;  1JMK C;  2UXN A;  4J9Y B;  2QTS A;  3OUF A;  4UCU A;  1M57 B;  2UXC B;  1ZWI C;  2QWO B;  3D36 C;  2XAG A;  2LW1 A;  3CRR A;  4MVM A;  2E5L B;  4DW1 A;  1RM1 B;  4B3S O;  1RPR A;  1J95 A;  3AK2 A;  4J7J A;  4TV9 B;  4HAM A;  3CCJ V;  5LMN O;  4FMT A;  5C8Y A;  1KP2 A;  5D5P A;  4D6T H;  5KX5 B;  2XAF A;  2OCH A;  1BCC H;  2N04 A;  1SA0 B;  1Z2G A;  2HJF C;  4OPA A;  2RN9 A;  1KQS U;  2EUL A;  1YXB A;  4DR7 O;  1THZ A;  3C3T A;  3G71 V;  5FL7 G;  4I55 B;  4X1I B;  1OV9 A;  1K92 A;  3ZHQ A;  4DUZ O;  4X20 A;  4WFE A;  1YVW A;  1B04 A;  2K9P A;  4I50 A;  3HB3 B;  4R50 A;  1JQ0 A;  1RSO A;  1K7D A;  3LNN A;  1OCR B;  4FJC C;  1QQC A;  2FB5 A;  5LA6 B;  4YJ2 A;  5JVD B;  2Q68 A;  2HHH O;  3EXA A;  2CUG A;  1HNW B;  2ARH A;  1QLE C;  1FXK A;  3A8T A;  1K34 A;  3F5T A;  2Q7G A;  1M5I A;  1NTM H;  3K03 A;  3B8M A;  3T4Z A;  1TVK B;  1ZTE A;  1IBM B;  4ZBM A;  3F7V C;  4BIU A;  1KU9 A;  2YS8 A;  1IDS A;  5EC2 C;  4GUN A;  1PL0 A;  2QWR B;  1KYO F;  1Y74 A;  2Y69 C;  1N8R W;  3RYI A;  1F23 A;  3OMN B;  1MMM A;  4LR3 A;  3D36 A;  5KHI A;  1J5E O;  4FM1 A;  2JDI G;  5BMV A;  2P4K A;  4O4L A;  1YJN V;  4MVO A;  4YY3 O;  3H1K H;  2UXB O;  2YID A;  1FYJ A;  3G6E V;  4TUY A;  1OZ0 A;  2BOB C;  3D3I A;  3X2Q C;  4JI7 B;  3JAT A;  2ZR2 A;  1BQZ A;  4BIO A;  1CPY A;  4UUJ C;  5JWP A;  3ZHT A;  1X59 A;  3Q4H A;  1ZLZ A;  1OCC B;  3ABL C;  2KKW A;  3JD1 A;  5LHH A;  1D5N A;  4JTD B;  5J9P C;  3VQV A;  4LNU B;  3QO7 A;  2E76 B;  3HR0 A;  1IZ3 A;  1I94 B;  3HKE B;  3AG4 C;  3U0Z A;  2L6L A;  2HLD G;  2GBO A;  2GHY A;  3TXQ A;  4FM2 A;  3P3P A;  4DV0 B;  2YUA A;  2F66 C;  5IDJ A;  3JD3 A;  4UCT A;  4JI3 O;  3PN1 A;  1Q3E A;  1H38 A;  2IJI A;  5J2U B;  1NU1 H;  3LSQ A;  1SZX A;  3GWO A;  1N0J A;  3C3S A;  4XDK A;  2H8P C;  3ZMU A;  4IHJ B;  1LUW A;  2B1I A;  4DV6 O;  4EFB A;  1K3E A;  1HP8 A;  1F51 A;  4QJF B;  2IJH A;  3KCX A;  1OCZ C;  2MW2 B;  1N33 O;  4IL6 Z;  2Q7H A;  3OGC C;  4WFA V;  1FXK B;  4GKJ O;  2JEU A;  1VQ7 V;  4EB6 A;  2EIM B;  1ZX3 A;  2WSS G;  2IH1 C;  3C90 A;  1EBO A;  5IYC O;  2UXC O;  5LBQ A;  3AG1 B;  3M99 B;  4GT1 A;  1G1X B;  2AHY A;  5EC1 C;  1R6N A;  4DUY B;  2JGU A;  1OCR C;  1BL8 A;  2G38 A;  2ZE6 A;  5BR8 B;  2ZM6 O;  3K59 A;  1K8A W;  4IYH A;  1L1F A;  1GKF A;  2H94 A;  1N33 B;  3RYC A;  4JI8 O;  2R72 A;  2LW7 A;  1K4C C;  2KG7 B;  2OIE A;  3ZMZ A;  3E2E A;  4LFB B;  3THO A;  5K1X A;  3RYC B;  3CP1 A;  1XNR O;  2R9A A;  5B3S C;  3RWR D;  3RVY A;  3WG7 C;  5LOV B;  3STZ C;  2YIB D;  2ITD C;  1WA8 B;  1Q81 W;  3UKM A;  5A2Q N;  1N36 B;  1FXK C;  4DRX B;  1ORQ C;  4MTG A;  1QNM A;  1WPX A;  4K35 A;  4PEL A;  4DR4 O;  3O9O A;  4LCU C;  4R7C A;  1OCO C;  4LNU A;  3VBB A;  4B3M B;  3GWK C;  1YJ9 V;  1YTF B;  2AXT Z;  2ZE7 A;  1LR1 A;  4UV8 A;  4WCE V;  3ZMV A;  1SS3 A;  2EIN B;  2DWD C;  1NKD A;  4GX5 A;  1DF5 A;  3IFX A;  2Y48 A;  3KG2 A;  2OCC C;  3VOU A;  3OUS A;  3MDS A;  3SYO A;  3N2G A;  2M6Y A;  4I9Q A;  2X6C A;  3D3Q A;  4GX2 A;  3TJT A;  5JJN B;  4RUF A;  3LDC A;  4LF6 O;  3ZCC A;  4O4I A;  3H1I H;  2VQE B;  4LF9 O;  1EN4 A;  3W7W A;  2GSM B;  2AZ0 A;  5L3D A;  3GB7 C;  3BAA A;  5L3G A;  4HZ3 A;  3S3W A;  3HKD B;  1R6T A;  2UUA O;  2ZDI C;  1TUB A;  4OPH A;  1WNS A;  5L3F A;  3HKB B;  4FM0 A;  3JAW A;  4ZHQ B;  1H2G A;  3ABU A;  1E79 G;  2Q69 A;  4B3T O;  2N05 A;  1FXV A;  4LF8 O;  2B5U A;  3E89 A;  3HKB A;  1O9H A;  3CD6 V;  2MK3 A;  4TWK A;  4LWS B;  1NS1 A;  2RJZ A;  4B7K A;  1IBM O;  3DTU B;  5B1N A;  4LF5 B;  3BY6 A;  1XNQ O;  1CP9 A;  4JI5 B;  1HWY A;  3CCL V;  3JAL B;  4LF4 B;  4MVZ A;  1L0L H;  1NTK H;  1VF5 B;  3ABM B;  2ZNI A;  4B3S B;  2LP7 A;  4U7O A;  3N2K A;  2PF4 E;  3TCU A;  3K04 A;  2DWE C;  1ZSP A;  3ETE A;  3OFN G;  1XHZ A;  4GCZ A;  2ZE8 A;  1K4D C;  1P84 F;  4O4L B;  3N2K B;  1QR8 A;  2IU0 A;  2Z0A A;  1AJN A;  1R3K C;  3E35 A;  1VQP V;  2NNU A;  5KAI Z;  4MTF A;  3B8N A;  3CCE V;  1B6Q A;  5GW7 A;  3WU2 Z;  2FYU H;  3IJ4 A;  3JSN A;  4TV8 B;  2B9Z A;  2EBO A;  4X8A A;  1AP5 A;  2AGA A;  2D2C B;  5CA3 A;  1KUQ A;  3AG1 C;  3CCM V;  5CB4 B;  3ASN C;  4XBF A;  4F6E A;  2CDY A;  1NH2 D;  1RP3 B;  1M9N A;  1Y76 A;  4I9W A;  1YJW V;  3OMA B;  5EZY B;  3G4S V;  1JFF B;  4JYB A;  3OGI B;  3JAS B;  1SZT A;  3ASO C;  1IBK B;  5LGU A;  1WP8 A;  4O4J B;  2XAS A;  2XOK G;  3JAS A;  5IJ9 B;  4P30 A;  1JJO A;  4DR7 B;  3KKY A;  3LUT B;  1YIT V;  4UCR A;  5BZB A;  2QWP B;  2BTQ B;  2UXB B;  1BT8 A;  2QM4 A;  4X66 O;  3DGE A;  4X88 A;  3KZI Z;  3T1H B;  2CE4 A;  5C93 A;  1I08 A;  1Z5W A;  2A7W A;  5CBH A;  3E8B A;  1FFX A;  3FB6 C;  3U11 A;  1XHX A;  1FJG B;  3BA8 A;  2A3Q A;  2EX3 A;  2QWN B;  3OM3 B;  4ICG A;  1GTO A;  2LFR A;  1H2L A;  2WWW A;  3ZN0 A;  1HDJ A;  3G80 A;  1N34 B;  1AI5 A;  2JS3 A;  5IWA B;  1IBK O;  3IC7 A;  1SRY A;  4JAS A;  4X1K B;  2NN4 A;  2P7T C;  3OEH G;  3AG2 C;  1VMG A;  4O2B A;  3ZED A;  1PKX A;  2R70 A;  4HNA B;  2CAZ C;  2QTO A;  1M1K W;  5IY5 C;  4NYK A;  4RUE A;  2IW5 A;  4KP4 A;  2YXH A;  5H5N A;  1D5A A;  5JJJ B;  1DF4 A;  2HVJ C;  2JS5 A;  4GKK O;  3CJH A;  3F7Y C;  1K97 A;  4PA9 A;  1Q82 W;  4GLX A;  2Q6A A;  5IYB O;  2YI8 A;  1WLE A;  4LH6 A;  4Z1V A;  3SYQ A;  2P4V A;  3P3N A;  1AP6 A;  3SPI A;  2GUZ B;  1NBM G;  2ADP A;  1EZJ A;  3CC4 V;  1PP9 H;  3DXR A;  2IU3 A;  1SQP H;  3R66 A;  4JI7 O;  1VEW A;  4TUY B;  1VQM V;  1K5Q A;  1BSM A;  3J80 N;  1V54 C;  5B1A B;  2QGN A;  3ZS8 C;  3SYP A;  1SF9 A;  1MSW D;  3W7S A;  2WA4 A;  1HW7 A;  5EZY A;  4KHP O;  1QU7 A;  2ILM A;  4ZOL A;  1AR1 B;  3CEI A;  3K79 A;  2JGD B;  1G6U A;  1GM8 A;  1OHH G;  4TOI A;  3AK1 A;  4O4J A;  3QNE A;  5FPO A;  2CK3 G;  5KAF Z;  4B3R B;  3HKE A;  1OCC C;  3ABL B;  1DTO A;  5B3S B;  4PA7 A;  2O57 A;  1A32 A;  1COW G;  5LXT B;  3ASN B;  2KSD A;  4TSF G;  4JI0 O;  3FKS G;  2VQF B;  1KB9 F;  3E22 B;  3I5D A;  3F5W C;  4N21 A;  2IH3 C;  1F4M A;  1WPB A;  4J11 A;  3UT5 A;  5CBG A;  1U97 A;  1BHB A;  1MG1 A;  2Y0P A;  2ZIM A;  4FZ1 A;  1ARO P;  1Q5O A;  5FNV B;  3W7U A;  1W0J G;  3ZMT A;  1QR9 A;  5JJE B;  5JVD A;  5LMU O;  4Z2W A;  4DW0 A;  1BS3 A;  2JJ2 G;  3H9V A;  1AVM A;  2YIC A;  1W0K G;  4YY3 B;  1XL6 A;  2EIN C;  2ZCE A;  1R73 A;  3CCU V;  1AB3 A;  4WBN B;  1F7Y A;  1F4N A;  4LFC O;  4AHC A;  4CZZ A;  1JR9 A;  4RO2 A;  2K1E A;  3LSU A;  4KUM A;  3ZRW A;  3N27 A;  5GTI Z;  2EIK B;  2E74 B;  3A0R A;  4G28 B;  1UPG A;  3ZIA G;  4MW3 A;  4KL1 A;  2ZR3 A;  4R8C A;  4EB6 B;  3J7A U;  4IIJ A;  4YIP A;  5H6Q A;  2BCC H;  3T4D A;  3RYI B;  4LFA B;  4L87 A;  4UXN A;  5KMG B;  5LGN A;  3A0B Z;  4YIO A;  4E2L A;  4LF9 B;  2VRZ A;  2YDE A;  3OMI B;  2B1G A;  2EIK C;  3DC6 A;  2HHH B;  4O2A A;  3RVZ A;  1FPO A;  3B09 A;  2QEX V;  4LH7 A;  1V9P A;  2PYL A;  2NLJ C;  1WP7 A;  2QKS A;  3CRM A;  1QHT A;  5EBM C;  5JCO C;  3JD0 A;  1AI7 A;  4WF9 V;  1E1Q G;  2HVK C;  2ITC C;  4N23 A;  3CHX A;  1HNX B;  5BMV B;  2F4V O;  4OX9 O; 
#chains in the Genus database with same CATH homology
 2EZO A;  3K08 A;  3IGA C;  4F4L A;  1K8A W;  1KKD A;  3LSS A;  3ZRV A;  5DN6 G;  1L1F A;  1H8E G;  1GKF A;  2H94 A;  4MVS A;  3K0G A;  5HFL A;  3ZJZ A;  1KD1 W;  4QPJ A;  2DYS C;  1VQ4 V;  1G8M A;  2DYR C;  1K4C C;  3CC2 V;  1QCE A;  2ZXW B;  2V7Q G;  3ZMZ A;  3E2E A;  4G27 B;  4PDV A;  5CN0 A;  5L3B A;  1Q86 W;  3CP1 A;  5B3S C;  4PA4 A;  1P4R A;  3RVY A;  4XDL A;  4WFF A;  3H01 A;  3WG7 C;  4MW8 A;  2WPD G;  3TK1 A;  2PI4 A;  3STZ C;  4RQE A;  4ASU G;  2ITD C;  3CCV V;  3ZRW B;  3OAA G;  5EBL C;  1Q7Y W;  1FS0 G;  3UKM A;  1Q81 W;  1JOY A;  3OR6 C;  5B1A C;  3W7T A;  1FXK C;  3OEE G;  5B1B C;  3RBZ A;  1ORQ C;  4MTG A;  3FYI B;  5CMU A;  1QLE B;  1WPX A;  4PEL A;  3CXC U;  3ETG A;  4QNH B;  4RQF A;  4LCU C;  4R7C A;  3FB7 C;  1OCO C;  3VBB A;  3CCS V;  3EHB B;  1YJ9 V;  4OXS A;  1YTF B;  3FYE B;  4WFB V;  2PI5 A;  1OCO B;  2YSU B;  4UV8 A;  3SPG A;  4JF3 A;  3K0D A;  4WCE V;  3ZMV A;  2EIN B;  4I5S A;  1S72 V;  4TT3 G;  2DWD C;  2Y69 B;  3P30 A;  3CYO A;  1NKD A;  4GX5 A;  1DF5 A;  1SET A;  3IFX A;  1KP3 A;  2Y48 A;  1QBZ A;  5KA6 A;  4MTO A;  2P90 A;  3ZRX A;  3KG2 A;  1S5H C;  1XL4 A;  3E8G A;  2OCC C;  3R65 A;  3VOU A;  3OUS A;  3SYO A;  2JIZ G;  2WLI A;  2X6C A;  5E1A C;  1V55 B;  4GX2 A;  1BHA A;  1KEC A;  2OT5 A;  4RUF A;  5H6R A;  1S76 D;  3LDC A;  4FK5 C;  1VQL V;  3ZCC A;  1SES A;  4QE9 A;  3X2Q B;  1TUE B;  1ENV A;  1S3J A;  3W7W A;  3CC7 V;  2GSM B;  5L3D A;  3GB7 C;  1R3I C;  5L3G A;  3T1C A;  4HZ3 A;  2HFE C;  1K73 W;  2ZDI C;  3CMA V;  4P2Z A;  1R3J C;  3TET A;  4GX0 A;  1M56 B;  1NQT A;  2QA4 V;  1GM7 A;  1AJQ A;  5CBF A;  1NH2 B;  1VQ9 V;  3UM7 A;  1VQN V;  5L3F A;  1H2G A;  3AEI A;  1QVF U;  3ABU A;  1E79 G;  3ML0 A;  1GK9 A;  4J9Z B;  3ABK B;  2Q69 A;  2JJ1 G;  1FXV A;  4MVU A;  5DM6 V;  2B5U A;  3ZMS A;  1YSC A;  3E89 A;  3E8F A;  5LHG A;  3CD6 V;  3OW2 U;  3W7X A;  4UVB A;  2MK3 A;  3OE7 G;  4TWK A;  4UVC A;  3LNM B;  1M56 C;  1BMF G;  1VQ8 V;  3DTU B;  5B1N A;  3BY6 A;  1CP9 A;  4JAV A;  3CPW U;  1HWY A;  3JD4 A;  1AI4 A;  3CCL V;  4MVZ A;  2QE7 G;  4WFH A;  2A9H A;  3WFV A;  1YHQ V;  1QLN A;  2HKO A;  1NJI W;  3ETD A;  1S0V A;  3ABM B;  1I5X A;  2LP7 A;  4U7O A;  1GM9 A;  4H33 A;  3TCU A;  3K04 A;  1PNM A;  2DWE C;  1P7B A;  3PJS K;  3RW0 A;  2P6J A;  3ETE A;  3OFN G;  5KA5 A;  2W6J G;  4GCZ A;  1K4D C;  4CBC A;  4JAU A;  1QR8 A;  2IU0 A;  1FFT B;  2WLI B;  1AJN A;  1R3K C;  3E35 A;  1CEZ A;  4G2K A;  5IY5 B;  1VQP V;  2NNU A;  4MTF A;  2QM7 A;  4FIP C;  2FTK A;  3B8N A;  3CCE V;  4BAY A;  1B6Q A;  2WLL A;  3FB8 C;  5GW7 A;  3FB5 C;  1QVG U;  3SPC A;  1JJ2 U;  4FPP A;  3AG4 B;  4P9P A;  2ZQM A;  2EBO A;  4MVQ A;  5L3C A;  4X8A A;  4LBE C;  4QE7 A;  5CA3 A;  1YIJ V;  2QM8 A;  1W2B U;  3AG1 C;  1VQK V;  3CCM V;  4Q20 A;  3ASN C;  4XBF A;  3P32 A;  1NH2 D;  1VQ5 V;  5EK0 A;  1M9N A;  4BW5 A;  3E83 A;  4I9W A;  1YJW V;  3OMA B;  3JYC A;  4PDR A;  3G4S V;  3LDD A;  5KUM A;  4EKW A;  4JYB A;  1AJP A;  4MVR A;  1G4Y B;  3ABT A;  1SZT A;  1K5S A;  1Y66 A;  2OCC B;  3ASO C;  2EZP A;  1JX9 A;  5LGU A;  4JYC A;  1V55 C;  2WLL B;  1JPX A;  3MHH C;  5B1O A;  1DLB A;  2XAS A;  1LNQ A;  5B1B B;  1H8H G;  2XOK G;  2JEX A;  2EIL C;  4P30 A;  3ASO B;  2UXN A;  1YI2 V;  4J9Y B;  3LUT B;  1YIT V;  3E86 A;  4MT8 A;  2X0L A;  3OUF A;  1M57 B;  5BZB A;  1ZWI C;  3QO8 A;  4MTX A;  2X6A A;  5IYD O;  3DGE A;  4X88 A;  4BIZ A;  1NR1 A;  5C93 A;  4DXW A;  2XAG A;  4P9O A;  5CBH A;  3E8B A;  4MVM A;  3K9A A;  2OTJ V;  3FB6 C;  4Z1M G;  4JTC B;  1RM1 B;  3OM3 B;  1RPR A;  1JCH A;  4YXW G;  1J95 A;  3B77 A;  2DQ0 A;  1GTO A;  4LC1 A;  1AI6 A;  2XAQ A;  2EJR A;  2LFR A;  2WWW A;  2X7R B;  4HAM A;  3CCJ V;  2WAM A;  1VQ6 V;  4FMT A;  3ZN0 A;  1KP2 A;  2BOC C;  4ZKI A;  3NXS A;  2XAF A;  1AI5 A;  3EFF K;  2EIJ C;  3SPH A;  2HJF C;  3IC7 A;  4DO2 A;  3K06 A;  4H37 A;  1KC8 W;  1E1R G;  3QO5 A;  1NR7 A;  1SRY A;  4JAS A;  1KQS U;  3SPJ A;  2P7T C;  4UV9 A;  1YTF D;  3OEH G;  2DQ3 A;  3AG2 C;  4MS2 A;  1THZ A;  3G71 V;  5FL7 G;  2EIM C;  4RAI A;  1PKX A;  2XAH A;  1K92 A;  4X89 A;  2DYR B;  2QTO A;  1M1K W;  5IY5 C;  4RUE A;  2IW5 A;  4KP4 A;  4WFE A;  3I55 V;  4MSW C;  2WLM A;  3STL C;  3HB3 B;  2HG5 C;  4R50 A;  1DF4 A;  1JQ0 A;  2HVJ C;  1K7D A;  1FXH A;  2EIJ B;  3F7Y C;  1K97 A;  3CCR V;  2HR3 A;  4PA9 A;  1OCR B;  3WG7 B;  4FJC C;  1Q82 W;  2Q68 A;  2R9R B;  2Z5U A;  3MD0 A;  2Q6A A;  5IYB O;  3MHS C;  1RM1 C;  5KUK A;  4WFG A;  1WLE A;  1R3L C;  2WLJ A;  1EFR G;  1QLE C;  1OCZ B;  3SYQ A;  1FXK A;  2JK5 C;  2YEV B;  2Z3Y A;  3CME V;  1SER A;  3SYC A;  1K34 A;  3SPI A;  1NBM G;  1EZJ A;  3CC4 V;  2WLH A;  3K03 A;  3B8M A;  2IU3 A;  3T4Z A;  3ABK C;  4JPR A;  1GMG A;  4ZBM A;  3F7V C;  1VQM V;  1K5Q A;  4PDM A;  4BIU A;  1V54 C;  5EC2 C;  1UJW B;  5B1A B;  4PA6 A;  1PL0 A;  4UVA A;  2Y69 C;  3SYP A;  1N8R W;  1MSW D;  1M90 W;  1F23 A;  3W7S A;  3OMN B;  3D36 A;  4JGS A;  4JTA B;  1V54 B;  2JDI G;  1AR1 B;  1JVM A;  3K79 A;  2W6I G;  1GM8 A;  2IJK A;  1OHH G;  1YJN V;  4MVO A;  1GO3 F;  3QNE A;  4QPK A;  2CK3 G;  2ZD9 A;  2ZXW C;  3G6E V;  2W0F C;  2DW4 A;  1OZ0 A;  2BOB C;  3D3I A;  3X2Q C;  1K9M W;  1OCC C;  3ABL B;  1S77 D;  1DTO A;  2ZR2 A;  5B3S B;  4PA7 A;  1CPY A;  4UUJ C;  1COW G;  3ASN B;  4TSF G;  1OCC B;  3ABL C;  3FKS G;  3SJQ C;  3ABM C;  3F5W C;  3BEH A;  2IH3 C;  3JD1 A;  4N21 A;  5LHH A;  1PD3 A;  4JTD B;  1F4M A;  5J9P C;  1MAB G;  1I5Y A;  3HPL C;  1RPO A;  5CBG A;  2R9I A;  3QO7 A;  1IXM A;  1BHB A;  1MG1 A;  2KB1 A;  4HYO A;  1NVP B;  1ARO P;  1VQO V;  3AG3 C;  3I56 V;  3AG4 C;  2A79 B;  3OR7 C;  5L3E A;  2F43 G;  3W7U A;  1W0J G;  1NVP D;  2A0L A;  1QR9 A;  3ZMT A;  3CCQ V;  4PA3 A;  1PNL A;  2EIL B;  3T2M A;  2D3O W;  2HLD G;  2JJ2 G;  2GHY A;  1W0K G;  1XL6 A;  2EIN C;  1M57 C;  3JCZ A;  1R73 A;  4KFM A;  3CCU V;  2WLK A;  4XDJ A;  5IDJ A;  3JD3 A;  1F4N A;  4CZZ A;  3ZN1 A;  1K33 A;  4RO2 A;  2K1E A;  3LDE A;  4KUM A;  3ZRW A;  1Y4M A;  2P67 A;  2XND G;  2EIK B;  3A0R A;  4G28 B;  1H38 A;  2IJI A;  1ROP A;  2C2A A;  3ZIA G;  4MW3 A;  2ZR3 A;  4R8C A;  3ZRS A;  3JD2 A;  2WLN A;  3AG3 B;  3LSQ A;  5H6Q A;  3GWO A;  4R6Z A;  2V1D A;  2X6B A;  2XAJ A;  4XDK A;  2H8P C;  3T4D A;  3ZMU A;  2ZDI A;  2OTL V;  1R6K A;  2M7W A;  3SYA A;  2B1I A;  4LP8 A;  4L87 A;  4UXN A;  3K3W A;  5HFM A;  1PNK A;  1K3E A;  3E8H A;  5LGN A;  5EBW C;  1F51 A;  4QJF B;  2LFS A;  5LHI A;  4E2L A;  2IJH A;  3OMI B;  1OCZ C;  2B1G A;  2EIK C;  2AHZ A;  3OGC C;  3RVZ A;  4WFA V;  4QIW F;  3AG2 B;  2DYS B;  1FXK B;  2YEV A;  4PDL A;  2JEU A;  1VQ7 V;  2EIM B;  2QEX V;  2WSS G;  2IH1 C;  1EBO A;  2NLJ C;  5IYC O;  2QKS A;  2IJJ A;  2Q67 A;  5LBQ A;  3AG1 B;  2UXX A;  3M99 B;  4GT1 A;  5EBM C;  1MOF A;  1AI7 A;  3JD0 A;  2AHY A;  5EC1 C;  4WF9 V;  1E1Q G;  1R6N A;  2ATK C;  2HVK C;  2ITC C;  4N23 A;  5H9C A;  4GX1 A;  4U7N A;  5LGT A;  1OCR C;  1BL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...