1NKDA

Atomic resolution (1.07 angstroms) structure of the rop mutant <2aa>
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
59
structure length
59
Chain Sequence
MTKQEKTALNMARFIRSQTLTLLEKLNELADAADEQADICESLHDHADELYRSCLARFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Structural parameters for proteins derived from the atomic resolution (1.09 A) structure of a designed variant of the ColE1 ROP protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 27
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1997-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01815 Rop Rop protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nkdA00
2IJKA 1F4NA 1F4MA 1PD3A 1ROPA 2GHYA 1GMGA 2IJIA 2IJJA 1B6QA 1RPOA 1NKDA 2IJHA 1RPRA 1GTOA 4DO2A 3K79A
chains in the Genus database with same CATH superfamily
1XI1A 4KP4A 4B7EA 2A7WA 5FPRA 1H2SB 2E3CA 3JAWA 5EIBC 4LF4B 3QVNA 2L35A 1OCZC 3AEIA 1YSCA 3MHSC 4CS2A 4RQFA 4DR4B 4UCRA 4DW1A 4H33A 1VMGA 4HNAA 3CJHB 2Q7EA 2OWOA 2GTAA 1YJWV 2F1MA 4LP8A 1FS0G 1M56B 3A0HZ 4LH7A 3G6EV 5ITZA 3THOA 4Z1MG 2GBOA 5JJEB 1XDCA 2UXNA 1DK1A 4R7CA 3TK1A 1GM8A 1B6QA 4JI3B 1XOUA 3F7VC 4WFEA 5B1AC 4B3TB 4DR3B 1IBLB 4LF7O 1XHXA 4WFGA 1XMQB 2UXBO 2DYRB 3EXAA 2LP7A 2QKAA 1YF2A 2YXYA 1XMOB 1KU9A 4LF6B 5IJ0A 1YITV 4NXNB 3FB5C 3OTFA 4EFBA 3LDDA 3CC7V 1THZA 4B3MO 2F43G 2UU9B 2CE4A 1OCOC 5IY5C 4BW9A 1TUBA 3X2QC 4JTAB 1WAZA 4NTWA 3K5MA 1SETA 2RNBA 2EINC 3SDLA 2EJRA 2HR3A 4MVSA 5KHKA 2PYLA 2CTRA 3K04A 2NLJC 1JMKC 4DXWA 4OGQB 2ZIOA 4FLTA 3UO3A 4E2LA 3D36A 3TETA 2YIBD 3W7SA 4DUYB 3HKEB 2ILMA 2VRZA 1H2KA 1Z2GA 1ZTEA 4J41A 3SYCA 4TV8B 3SR2C 4ZHQB 2Y4TA 4UFZA 3P3PA 4JI1O 1FD9A 5IYZA 3UQ8A 3ZRWB 5B3SC 1GN6A 1NH2B 2R9RB 1WA8A 1BQ0A 3SPHA 3ASNB 4CS3A 1G1XB 5K1XA 3CRCA 4DYLA 5A2QN 2RDCA 4F6RB 5B5EZ 2DYSC 2Y4UA 3N2GA 1FFXB 3CRAA 5LHIA 4DR2B 4FLZA 2XAFA 2WLHA 4DV7O 3JALA 1XL4A 2E5LO 3RYFB 1P7BA 2AZ0A 5CB4A 3BFRA 1F51A 4TQDA 1AR5A 2OT5A 3AK3A 4I7ZB 4L8JA 1AVMA 1N33O 2IBZH 4QIWF 2EZPA 5LHHA 3SYOA 5GONB 4I9WA 4LF5B 3RWRD 2RJZA 3D8CA 2QE7G 1Y74A 1E1QG 3F5WC 4ZOLA 3CC4V 5LMUO 1FPOA 5JWPA 2Q8VA 1N8RW 1W2BU 1Z5WA 5IYDO 4X64O 2CTQA 5DEDA 3K58A 1J5EO 2YS8A 4I9QA 5LBQA 2FL4A 3IFXA 3L75H 2CUGA 4MW3A 3UCSC 3OGIB 1GO3F 1AJNA 2CGOA 2MK3A 1M9NA 1Y66A 5B1OA 1XUQA 5JQGA 1U96A 3RYHB 1QBZA 2QTSA 3OUSA 2D2CB 4UVAA 4EFEA 3KZIZ 4B3SO 1CXZB 1VF7A 1HWYA 3WB0A 3RT3C 4NYKA 3HKDA 4X1IA 4LF9O 3K08A 4U3FH 2GHYA 1YVWA 1V54C 3I5DA 5KMGA 3ZHSA 1W0KG 2Q0OC 4FLVA 3JSLA 1EN5A 2W6IG 1GN4A 2QWRB 5DM6V 2WPDG 3Q4HA 4ZBMA 1IURA 1L0NH 1Q5OA 1BMFG 1AILA 3OTOO 3JASA 3SYAA 3UM7A 2X6AA 1BZKA 4K35A 3WG7B 1B04A 3T1HO 5CBHA 1F4MA 1SQGA 3T4ZA 3M7MX 4GKKO 2HVJC 2QR4A 4RO2A 1AR4A 4JYAB 1Q90D 2CTWA 2M6YA 1S5HC 1NTMH 2ITDC 2QA4V 2OTJV 5L3DA 3ZMVA 1IXBA 4JF3A 4FK5C 2CK3G 5LMNB 1Q3EA 3EHBB 4LFAO 3K9SA 4TOIA 4PA9A 3A0BZ 3L70H 3ZRSA 1YIJV 3B8NA 4HZ3A 1L0LH 5LYJB 4FFBB 5F2VO 4K0KO 4UB6Z 3CCLV 2YI9A 3RYCB 3VOUA 5IWAB 4JI6B 2CH7B 1FXKA 3K3WA 3PJSK 3FYEB 2NN4A 3ASOC 3RVZA 5J2UA 3T2MA 4NTYA 1RP3B 3IAYA 1P7GA 2XASA 3L73H 3ABLB 4KUMA 3F5TA 1S76D 1H2LA 4TSFG 4GLXA 4QJFB 4IGGA 4LWSA 3CCQV 1Y4MA 3HR0A 4FZ0A 5EBWC 1NTKH 3VQXA 1GTOA 2MW2B 3I56V 3CD6V 1WN7A 1R3KC 3APQA 4GCZA 2P90A 1PD3A 2YIAA 1X59A 4QE9A 3JAMN 4YXWG 4JI8O 3JD3A 2HHHO 4UCSA 4CS4A 4GKJB 1JFFA 2OCCC 3SJQC 2E76B 4KHPO 1AROP 1FJGO 1R3IC 3JSNA 2ZQMA 1Q86W 2DE0X 3HKCB 3SJCC 2Q9LA 5LXTB 4I50B 2HKOA 3OMNB 1NH2D 3RYIB 1V55B 4CC6A 1KKDA 4BIOA 1Q82W 1AJQA 4G27B 3D3IA 4DUZB 4JASA 4X1YA 3P3NA 1VQ8V 2V4DA 1SA0B 2EZOA 4B3RO 4I55B 1H2MA 4XDKA 2P5OA 1IX9A 1F23A 4RWUA 3OR7C 1R6TA 4GX0A 1SQPH 1W0JG 3C90A 1ROPA 2Y69B 4J7KA 4PD4F 1TUEB 4PDRA 3A0RA 5KX5A 1JPXA 1IZ3A 4DV4O 3ICXA 3H1IH 4UVBA 4H37A 2WLJA 3E8BA 2H94A 2WLLA 1Y76B 4PI0A 4WCEV 4LF7B 2UXBB 3VQWA 2UXDO 4G2KA 4JV5O 1SQXH 2ODMA 3CJHA 2QKCA 2Q7HA 2LQTA 2ZT9B 3JD2A 3FAVB 1KUQA 2WLMA 1HNWO 2RN9A 4R6ZA 4RUEA 2ITCC 4J42A 2AHYA 2LGQA 2A9HA 1ZLZA 3H1JH 1SRYA 2DQ3A 1O9HA 2RMKB 2YICA 4UCVA 3U0ZA 1S5JA 2KG7A 1K97A 2IJHA 4CBCA 2EIJC 1IBKO 1KECA 1NQTA 1VF6C 1N34O 2XAHA 4U3JB 1SF9A 2ATKC 2IJJA 1Q8IA 5H6RA 3GB7C 4WBNA 4YHHO 1EN4A 3HPLC 1H8HG 2WA4A 1ZL8B 5JH7A 1VP7A 3TXQA 1EFRG 5K1PA 4X9QA 4JI1B 1FFTB 4AI8A 3JAKB 1N0NA 4ZI7B 2DQ0A 5IYCO 4X65O 1SKVA 4PDLA 5LOVB 5J2TB 2BOBC 4YJ3A 4QGPA 5CA0A 3G80A 4QNHB 1K8AW 3JATA 2IU3A 5CA1B 2JK5C 1L8DA 5CBGA 4P30A 1L1FA 3ZEDA 3WU2Z 2Y0IA 4O2AB 2JGDB 3LDEA 4KL1A 1XBLA 4DV7B 3LSSA 1V9PA 3DXRB 4UB8Z 2E5LB 2ZCEA 1LNQA 1Y67A 1PNKA 2EIMB 4JYYA 4YIPA 2HJDA 4PDVA 4NXMO 2PUSA 1IXMA 2HVKC 1Y6XA 4WFAV 5C8YA 3IC9A 5EYPB 2O57A 2P7TC 3ZHUA 1Q81W 4JAAA 1BS3A 3ZMSA 3ZMTA 4H13B 2YEVB 1J5EB 3F7YC 1JCHA 4DRXB 3ABMB 1OCOB 5IY5B 3K03A 4LFBB 3ZN0A 2OYQA 4YIOA 3FKSG 4PHZA 4JYCA 3B09A 1XHZA 4P9OA 3ZHVA 4O4IB 2EINB 3K0DA 4DV2O 4B3SB 5LP6B 4I5SA 1CEZA 2WA3A 4FMTA 3SPJA 4J7ZA 4LF9B 2P6JA 3G71V 3ABKC 4X1KB 5BY1A 2HEPA 1ZAUA 5BXZA 2F66C 4I4TB 1BT8A 1G6UA 2DWDC 5JCOC 4XBFA 2WLIB 4I0XB 3QNEA 2BOCC 2LJ2A 2EILB 4OX9O 2DOSA 3WB1A 2WLKA 3UT5A 1MMMA 3OTOB 3CP1A 1RSOB 3DTUB 1EBOA 4H44B 2AGAA 1JOYA 5LGNA 3T1HB 1DF4A 2ZM6O 3S3WA 3RGBA 2FTKA 4UCUA 2F4VO 4GYCB 2PZSA 2UXCO 4JYBA 4QPKA 4TUYA 3ML0A 3CX5F 4TWKA 2X0LA 4IHJB 3CC2V 4J9YB 1US6A 1YTFD 4JI0O 1D5AA 4NB5A 1K33A 5IYBO 2UUBB 5IJ9A 2XUMA 1G4YB 4LFAB 1BCCH 1GAXA 2BTQB 3MDSA 3RN4A 3HKBA 4DV1B 3L74H 4FPPA 3BPZA 4DK1A 4N23A 1CP9A 4FZ1A 4PA3A 3FB6C 4O4LB 1CPYA 5D5PA 2EIKB 2DJVA 1PL0A 5IT9N 5CN0A 1TVKA 5KA5A 1UFIA 2A3QA 1PKXA 3M99B 3GVMA 4X66O 4FLUA 1E79G 1I5XA 4LR3A 1HNXO 3JAWB 3JD1A 2JEXA 3AG1B 3JD4A 4UXNA 1BHBA 3SYPA 2BE3A 3SJBC 2F95B 1WLEA 3R66A 1FYJA 4HNAB 4HAMA 5GW7A 3VBBA 3TCUA 5J9PC 1BL8A 2PTMA 2C2AA 2IH3C 4TQFA 5ITZB 3AK2A 3IC7A 2XT9A 4NTXA 4B08A 1M57B 5EBLC 4MVUA 4BIUA 2VS0A 5LYJA 4FFBA 3CCJV 1S77D 4NKGB 3ASNC 5KUMA 3GWOA 5EK0A 4K3AA 4MSWC 1R73A 1OV9A 2BTOA 3OUFA 1EZVH 5GTIZ 3P30A 5H9CA 1N36O 3J7AU 4D6TH 2HG5C 1HW7A 4CC5A 3A2FA 4JI8B 1NU1H 1UPGA 2ZXWB 2CAZC 4K8ZA 5IJ0B 2HHHB 3OGCC 5D5QA 1VQ9V 2JJ2G 3P32A 1G8MA 5LA6A 4KHPB 2V1DA 1FJGB 1FAFA 2P4VA 4BWAA 4O4JB 4DR5O 3OT7A 1S3JA 4X89A 4IT5A 4FLXA 2GSMB 3CXHF 2EJ7A 4GX2A 1GM7A 4L87A 1LUVA 5CMUA 3AG7A 1H38A 1OCCB 2JJ1G 1IBLO 1BHAA 1E1RG 3E35A 2LW7A 3RFRA 1XMQO 5FNVA 3LDCA 5EIBD 1XMOO 4B3RB 4LF6O 4LF8B 1VQKV 2V7QG 4LNUA 4UV8A 2VWJA 2QTOA 5EC1C 2RCVA 3ETQA 3AG4C 4JPRA 5DN6G 5IYZB 2ZD9A 1I5YA 4X20A 3ZMZA 4FVMA 1WA8B 2LO1A 3G6BA 1YZBA 2B5UA 5A9GA 3C3TA 2E74B 3AK1A 1I0HA 3BCCH 2VQEO 4DR1O 3N2GB 3H1HH 4EB6A 1URFA 3CRMA 3T1YO 3QO5A 1ENVA 3E86A 3E22B 3ZHTA 3N2KB 2UXDB 4X8AA 3W7WA 1LUWA 4JV5B 2ZNJA 2QM7A 3JALB 3CCRV 3ZRXA 2ADQB 3OMAB 2PF4E 2P4KA 4JAUA 3SPGA 2E75B 2AXTZ 2W0FC 1R6KA 1HNWB 5BZBA 4NVPA 5EZYA 1H8EG 3WG7C 4Q20A 3JARA 1VF6A 1KP3A 1VQNV 1PNLA 4TV9B 4YJ2A 2F93B 1Y74B 3MD0A 4ZOLB 2Q68A 2W6JG 3PN1A 4DR2O 4N21A 4RAIA 1IBKB 2QWQB 3DGEA 3ZHRA 1N34B 1IDSA 2JEUA 4UVCA 1RM1B 3G67A 1JQ0A 1GN3A 2WAMA 4MT8A 4D7TA 1QVGU 1BSMA 3BRCA 5JQGB 3IGAC 1NR1A 4X65B 2GDSA 4WFFA 2K9PA 3VQVA 4YY3B 3ABTA 4X1IB 1ZUQA 1UJWB 5JVDA 1NVPD 3TGUH 4DV3O 2Q4PA 5KMGB 3H9VA 3CCMV 3TXSA 3ABUA 1K3EA 2EX3A 3AG3B 2Y48A 2IM9A 3FD9A 2QGNA 3ABLC 5L3EA 4R50A 3BHPA 1HNZB 2VQFB 3B8MA 2ZDIC 3Q4HB 3RVYA 3O65A 5B1BC 4DR7O 4DV0O 1W59A 2Q0AA 1P4RA 2AZ2A 3JASB 3QO8A 4O4HA 5FL7G 4QE7A 4X62O 1GMGA 3E8FA 3LNMB 1SS3A 3JCZA 3K06A 1OJHA 1IBMO 4JI7O 3K0GA 4P2ZA 2Z0AA 4TT3G 4DW0A 1GRJA 1YTFB 5CA1A 2OCHA 4JI4O 2X6BA 1JVMA 4JZ2A 3I55V 3B40A 1BE3H 1AR1B 1MZFA 2GUZA 1AB3A 4UCTA 4Z2WA 1XNQO 2JS5A 2ZR3A 2R9AA 4GX5A 4ABMA 2YC0A 2ARHA 1FXHA 1KP2A 4EEQA 2ZNIA 2W0XA 4BW5A 4OXSA 1AP5A 3CHXA 3OM3B 5EYPA 2UXXA 1FXKB 5JCOA 1N32O 2EIJB 4LH6A 3B2EE 4CH6A 1KC8W 5J2UB 4IIJB 1Q7YW 2OTLV 2WLNA 1MNGA 5L3CA 4B3MB 1LR1A 2R70A 1QCEA 4MS2A 4J9ZB 3LSQA 3AG2B 2R72A 1GN2A 1R3LC 2Y69C 4LWSB 5KUKA 1K34A 4OX9B 2P67A 2XOKG 1SESA 2QKSA 3ZN1A 3U10A 2QJ1A 3WB2A 5LP6A 1QLNA 1HP8A 3BY6A 5KA6A 3H01A 4WFBV 1QNMA 2HLDG 3H1LH 3SJAC 3T4DA 1VQLV 2DN9A 4X1KA 2F4VB 4LFCO 1XL6A 2X6CA 1M4UA 4GX1A 1SQVH 2PI4A 4JI5O 2YUAA 3RBZA 3QO7A 3WFVA 2YXHA 4MVRA 1JFFB 3OD4A 1Q6IA 4JI0B 4PA6A 1QLEB 4LCUC 3K9AA 1JX9A 5LGUA 1QU7A 1BGYH 2GTSA 2DMXA 1SZTA 2WWWA 3BA9A 3STLC 4IL6Z 1M1KW 1I94O 1QVFU 4JTDB 1K5QA 1OCZB 3OEHG 2A06H 4Q6GA 1B06A 4X1YB 2L6LA 1QR9A 3BA8A 4X66B 2BSKB 1WB7A 3L71H 2EULA 3HKEA 2QSAA 3N27A 3SYQA 5KAFZ 1HNXB 4MTOA 2KKWA 4TV8A 4ZHQA 1AJPA 1NTZH 2FB5A 3CMAV 4O2BB 3ZRWA 3CYOA 2JIZG 2DW4A 1N33B 3CSXA 4PJ0Z 3S3XA 5KX5B 1SERA 3R65A 3OMIB 5B1AB 3K5NA 3FB8C 2LFSA 3LNNA 1I7FA 2YDEA 1MSWD 1MSDA 4O4LA 5JJNB 4F6RA 1R3JC 1AI6A 1FFXA 1ZSPA 2Q6AA 5LMUB 4MVQA 1DLBA 4CH4A 1OCRC 2WLLB 3CCEV 4J10A 3TJTA 1IVSA 2PGGA 1NS1A 4X64B 2PI5A 3E8HA 1N36B 2LW1A 2UUAO 4K8XA 3RYFA 1WPXA 4EKWA 1OHHG 2KB1A 3X2QB 1HDJA 1GM9A 3DSQA 4DV6O 1S0VA 5KHHA 2A0LA 3OEEG 4PA7A 2Q69A 1S72V 2KQXA 1DF5A 5GONA 2ZINA 3FB7C 3CCVV 1P49A 4DR5B 4U7OA 3K5OA 5B1NA 2AHZA 2EIMC 5TISZ 4MTGA 3DC6A 1ORQC 4UV9A 1N0JA 3K57A 1TGOA 4LC1A 4DV5O 4AQYO 1VQOV 2KG7B 1NT2B 2H8PC 3M8AA 2N74A 3UO2A 1TA8A 1R6NA 5LGTA 4W4KA 1F7YA 4BR6A 5B3SB 2Q5ZA 3STZC 3RYHA 1M56C 3D3QA 4JGSA 5L3BA 4WBNB 3ZHQA 3ABMC 4PELA 1YHQV 4PV1B 2UUCO 1GKFA 4O4JA 5JH7B 2H3OA 1Z5VA 1COWG 4LBEC 2QWPB 1AP6A 1HR0O 4FFKA 5BR8O 5H5NA 4GKKB 2WSSG 4UUJC 2DYSB 2VWKA 3W7UA 1NVPB 4YJ3B 2NNUA 1SZXA 2DYRC 1PV0A 4XDLA 3FFQA 5LP6C 5CA0B 5HFLA 1K4DC 3HB3B 4UCOA 4DR6O 3JATB 4MVMA 2VQEB 4DR1B 5JJJB 5E79Z 5IDJA 1WP8A 3T1YB 3B4SA 2XHBA 3BAAA 2JRIA 4FIPC 5FPOA 1XNRO 5DECA 4MTXA 3H1KH 1M90W 4A5UB 1RPRA 4WF9V 4J11A 3MHHC 1JJ2U 1N4CA 3CS5A 4K0KB 1D5NA 2EILC 2PYJA 1VQMV 5BMVB 3OFNG 4KXRA 2G38A 3G4SV 1QQCA 1KKCA 1SQBH 4PDMA 5C8YB 2ZR2A 3LUTB 1SC5B 3ZCCA 4QPJA 2IJIA 2OIGA 4JAVA 1EZJA 1YXBA 2P22C 2BCCH 4C7UA 3SPIA 4J80A 1H2GA 4D7SA 2HP8A 4JZGA 3KCYA 5FLXN 1AI4A 3E22A 4E4EA 3N2KA 4JI2O 2X7RB 1YJ9V 4AILC 2NR5A 4BIZA 1AI7A 2QM8A 3RYCA 1JA8A 2ZE6A 1GK9A 4CH3A 1PPJH 2CH7A 2B1GA 4GUNA 1YDXA 1V54B 1H2NA 2CGNA 4LF4O 2EIKC 4ASUG 3E89A 4TV9A 3JYCA 3BABA 1SQFA 1YCIA 4DR4O 3OW2U 2DWEC 3OR6C 2ZDIA 1XEQA 4DV3B 3B77A 3AG1C 1XILA 1TUBB 2Z3YA 2P06A 2B1IA 3CEIA 2Z5UA 4LFBO 3AG4B 4DR7B 3BEHA 4DV0B 5KHGA 4JI3O 1BQZA 3UT5B 1NBMG 1FKAO 4B3TO 1I08A 4DR3O 3KG2A 1KB9F 1M57C 2PY5A 2OIEA 2A79B 4X62B 2JDIG 1NI8A 1F4NA 1X4TA 2XAGA 4NXNO 5EC2C 1ZWIC 1Q43A 1IBMB 4JI7B 1YJNV 2UU9O 5CA3A 2QWOB 3CRQA 4TUYB 4RUFA 4JI4B 3CPWU 2ZXWC 1K73W 1PL4A 3HKCA 1D2DA 3FYIB 5LXTA 4I50A 2YI8A 3CCSV 4DV4B 5IJ9B 2YSUB 3VQYA 3RYIA 4F6EA 3O9OA 3W7XA 3ZBHA 1NR7A 1T5EA 1XNQB 2ZIMA 3HKBB 1VARA 2RQ6A 4GT1A 3ASOB 1SA0A 4FLYA 4FM2A 3A8TA 4I55A 2YIBA 1MG1A 4X88A 4P9PA 5CBFA 1O9GA 1TVKB 2CDYA 1OCCC 2CTPA 1N32B 1VEWA 4DUYO 2EBOA 1WP7A 5HFMA 1VQ6V 4ZKIA 5H2FZ 5CB4B 3KKYA 4CH5A 4AHCA 1VIBA 3D36C 2UUBO 2IU0A 1PP9H 3E83A 3ZIAG 2LFRA 4DK0A 3CRRA 4DV1O 5GTHZ 3ZS8C 1MA1A 1Y76A 3BVOA 1RPOA 1FXVA 1VQ4V 1WPBA 1XQ8A 1YI2V 5C93A 4DO2A 3JD0A 2OCCB 2F23A 1K7DA 4MW8A 4IIJA 2FKXA 1P84F 5IE9A 4FM1A 3QG5A 4B7KA 4LFCB 4WFHA 4YHHB 1DTOA 1EM1A 3FAVA 4JI5B 4BAYA 4ICGA 3GWKC 5B1BB 5LL6Y 1A32A 1VQPV 5LA6B 1M93A 4LF5O 2XTAA 4ZIBA 1QHTA 5H6QA 4NR1A 3HKDB 4FJCC 5L3GA 3K59A 4CZZA 4H0LB 1I94B 2JS3A 3CWBH 3DC5A 4PI2A 1K4CC 3K5LA 2YXLA 4U3JA 1MZEA 5FNVB 3J80N 4KFMA 5B66Z 2QWNB 3JCUZ 2N04A 3T1CA 5LHGA 4JTCB 4MVOA 1KMIZ 3C3SA 1ZL8A 2ZE5A 4J7JA 4LNUB 4MVZA 3CXCU 1NJIW 1RM1C 3JAKA 3CMEV 2M7WA 4ZI7A 4NXMB 4IYIA 4G28B 5LOVA 5J2TA 1OZ0A 1VF5B 2QDOA 4W4LA 4IYHA 4U7NA 4X20B 2FYUH 3SPCA 2ETNA 2HFEC 4MTFA 1NZ6A 3CB2A 3KCXA 1U97A 5AG2A 1PM9A 1QR8A 2K1EA 3QTCA 1Q6UA 4O2AA 1K92A 2JGDA 3ZMUA 2BSKA 1GH6A 4XDJA 4LF8O 3CCUV 3ETGA 3NXSA 4EB6B 2UUAB 3DXRA 3APOA 1Q6HA 3AG3C 4O2BA 4DV6B 1KD1W 1SQQH 3J81N 1V55C 3ETEA 4DV2B 4JYAO 5EZYB 3NR7A 3EFFK 2IH1C 3RW0A 1XREA 2ZE8A 4OPAA 3JARB 3OAAG 5KAIZ 4YJ2B 4DV5B 4AQYB 5LMNO 5KHIA 2YEVA 2XAJA 3OE7G 2R9IA 3MAQA 3E2EA 3L72H 4DRXA 1WNSA 3W7TA 3ZX6A 1ZX3A 3ZJZA 2Q73A 3IJ4A 2D3OW 2QM4A 4O4IA 2ADPA 2Q67A 1J95A 2UUCB 1VQ7V 5IWAO 3K79A 4JI6O 1VQ5V 2ZM6B 2HJFC 1HR0B 5KHJA 1MABG 3CE2A 5BR8B 5E1AC 2LGWA 2B9ZA 1WB8A 2UXCB 2YIDA 4I4TA 1M5IA 2XNDG 1RFYA 1FXKC 2QEXV 5JVDB 1K9MW 1EN6A 2WLIA 4I0XA 4DR6B 2JGUA 1YEWA 1S5LZ 2XAQA 2Q7GA 4Z1VA 1XNRB 4PA4A 1RSOA 1PNMA 1KQSU 1B3QA 4RQEA 3AG2C 1NKDA 1KBHA 3ZRVA 2IJKA 2ZKOA 3E8GA 3FX7A 4O4HB 3SGIA 2FMLA 1JR9A 2KSDA 1TAEA 3QF7A 1WJZA 4FLWA 1DGSA 1OCRB 4YY3O 5EBMC 2ZE7A 4OPHA 5L3FA 4IHJA 4GKJO 2GV9A 3ETDA 3L9DA 1JJOA 4FM0A 2N05A 2BTQA 2Y0PA 4GZRB 4HBNA 3UKMA 1KYOF 1HNZO 2VQFO 4JI2B 3LSUA 4HYOA 2GUZB 4F4LA 4R8CA 2IW5A 1MOFA 1QLEC 1AI5A 5KLVH 2JVDA 4DUZO 1K5SA 5BMVA 3EVKA 3U11A 2AW9A 1R1BA 3ABKB
chains in the Genus database with same CATH topology
4UVBA 2QM7A 3CCRV 4H37A 2WLJA 4KP4A 3SPIA 1H2GA 3ZRXA 3OMAB 4JAUA 3SPGA 1AI4A 3E8BA 2H94A 2WLLA 1OCZC 2W0FC 3AEIA 1R6KA 1YSCA 3MHSC 4RQFA 2X7RB 5BZBA 1YJ9V 1H8EG 4H33A 3WG7C 4WCEV 4BIZA 4Q20A 1KP3A 1AI7A 2QM8A 1VQNV 1YJWV 1PNLA 1FS0G 1M56B 4LP8A 3G6EV 1GK9A 4Z1MG 3MD0A 2Q68A 2W6JG 4G2KA 2B1GA 4N21A 1V54B 4RAIA 2UXNA 3JD2A 4R7CA 2EIKC 3DGEA 1GM8A 3TK1A 3E89A 4ASUG 3JYCA 1B6QA 2WLMA 2JEUA 4UVCA 1RM1B 3OW2U 4R6ZA 3F7VC 4WFEA 5B1AC 4RUEA 2ITCC 1JQ0A 2DWEC 2AHYA 3OR6C 2ZDIA 2A9HA 4WFGA 2DYRB 2LP7A 2WAMA 4MT8A 1SRYA 2DQ3A 1QVGU 3B77A 3AG1C 1YITV 3FB5C 3IGAC 1K97A 2IJHA 2Z3YA 1NR1A 4CBCA 2EIJC 3LDDA 2B1IA 3CC7V 1KECA 2Z5UA 4WFFA 1NQTA 1THZA 3AG4B 3BEHA 2F43G 1OCOC 5IY5C 3ABTA 2XAHA 1NBMG 2ATKC 2IJJA 3X2QC 3KG2A 4JTAB 5H6RA 1UJWB 1M57C 3GB7C 1NVPD 3HPLC 1H8HG 2A79B 3CCMV 1SETA 3ABUA 1K3EA 2JDIG 1F4NA 2XAGA 2EINC 3AG3B 2Y48A 1EFRG 5EC2C 2EJRA 2HR3A 1ZWIC 3ABLC 5L3EA 1FFTB 4MVSA 4R50A 3B8MA 2DQ0A 1YJNV 5IYCO 2ZDIC 3RVYA 5B1BC 4PDLA 3K04A 2NLJC 5CA3A 4DXWA 4RUFA 2BOBC 3CPWU 2ZXWC 1P4RA 3QO8A 4E2LA 1K73W 3D36A 4QNHB 3TETA 3FYIB 5FL7G 4QE7A 3CCSV 1K8AW 3W7SA 2YSUB 2IU3A 2JK5C 3SYCA 5CBGA 3W7XA 4P30A 1GMGA 1NR7A 3E8FA 3LNMB 1L1FA 3JCZA 3K06A 3ZRWB 5B3SC 3LDEA 3K0GA 4P2ZA 4TT3G 4GT1A 3ASOB 1YTFB 1NH2B 2R9RB 3LSSA 3SPHA 3ASNB 1MG1A 4X88A 4P9PA 5CBFA 1LNQA 2X6BA 1JVMA 1OCCC 1PNKA 3I55V 2EIMB 1AR1B 4PDVA 2EBOA 1IXMA 2HVKC 2DYSC 5LHIA 4WFAV 5HFMA 1VQ6V 4ZKIA 2ZR3A 4GX5A 2XAFA 2P7TC 2WLHA 2IU0A 1FXHA 1KP2A 1Q81W 1XL4A 3E83A 3ZMSA 4BW5A 3ZMTA 3ZIAG 4OXSA 2LFRA 1P7BA 3OM3B 2UXXA 1FXKB 1F51A 2YEVB 2EIJB 3F7YC 2OT5A 1JCHA 1KC8W 1RPOA 3ABMB 4QIWF 1FXVA 1OCOB 1Q7YW 2EZPA 5IY5B 1VQ4V 2OTLV 2WLNA 1YI2V 5LHHA 3SYOA 4I9WA 3K03A 3ZN0A 5L3CA 5C93A 4DO2A 3JD0A 1QCEA 4MS2A 2OCCB 3FKSG 2QE7G 4JYCA 1E1QG 3F5WC 3CC4V 4J9ZB 3LSQA 1K7DA 3AG2B 4MW8A 4P9OA 4WFHA 1DTOA 2EINB 1R3LC 3K0DA 2Y69C 1N8RW 4I5SA 5KUKA 5IYDO 1W2BU 4BAYA 1K34A 1CEZA 2P67A 4FMTA 3SPJA 5LBQA 5B1BB 2XOKG 2P6JA 3G71V 3ABKC 3IFXA 1SESA 2QKSA 4MW3A 3ZN1A 1VQPV 1GO3F 1AJNA 2MK3A 1QLNA 1M9NA 1Y66A 3BY6A 5B1OA 5H6QA 5KA6A 3H01A 2DWDC 2HLDG 4WFBV 1QBZA 3T4DA 4FJCC 4XBFA 3OUSA 5L3GA 1VQLV 2WLIB 4UVAA 3QNEA 4CZZA 1XL6A 2X6CA 2BOCC 4GX1A 2PI4A 1HWYA 1K4CC 3RBZA 2EILB 3QO7A 2WLKA 3WFVA 4MVRA 3CP1A 3K08A 3DTUB 4KFMA 3T1CA 1EBOA 4PA6A 1JOYA 5LHGA 1QLEB 2GHYA 4JTCB 4MVOA 4LCUC 5LGNA 1V54C 3K9AA 1DF4A 1JX9A 5LGUA 1W0KG 2FTKA 4MVZA 3CXCU 1NJIW 1SZTA 2WWWA 1RM1C 2W6IG 3STLC 3CMEV 5DM6V 2M7WA 1QVFU 1M1KW 2WPDG 4ZBMA 4JTDB 4JYBA 4QPKA 4G28B 1K5QA 1BMFG 1OCZB 3ML0A 3OEHG 1OZ0A 4TWKA 2X0LA 3CC2V 4J9YB 4U7NA 3SYAA 3UM7A 1YTFD 2X6AA 3WG7B 3SPCA 1QR9A 1K33A 5IYBO 2HFEC 4MTFA 3SYQA 5CBHA 1F4MA 1G4YB 4MTOA 1AJPA 1QR8A 3T4ZA 2K1EA 3CMAV 2HVJC 4FPPA 4RO2A 3ZRWA 1K92A 3CYOA 2JIZG 3ZMUA 4N23A 1CP9A 4PA3A 1S5HC 3FB6C 4XDJA 2DW4A 3CCUV 3ETGA 3NXSA 1CPYA 2EIKB 2ITDC 1PL0A 2QA4V 2OTJV 5L3DA 5CN0A 1SERA 3R65A 3ZMVA 3OMIB 5B1AB 5KA5A 3AG3C 3FB8C 4JF3A 1PKXA 4FK5C 2LFSA 2CK3G 3M99B 1KD1W 1MSWD 1E79G 1I5XA 1R3JC 3EHBB 1AI6A 2Q6AA 3JD1A 1V55C 2JEXA 3AG1B 3ETEA 1DLBA 4MVQA 4X8AA 1OCRC 3JD4A 2WLLB 4UXNA 1BHBA 4PA9A 3CCEV 3SYPA 2PI5A 3E8HA 3ZRSA 3EFFK 1WLEA 2IH1C 1YIJV 3RW0A 3B8NA 4HAMA 4HZ3A 5GW7A 3VBBA 3TCUA 5J9PC 1BL8A 3OAAG 2C2AA 3CCLV 1WPXA 4EKWA 1OHHG 2KB1A 2IH3C 3VOUA 3X2QB 3IC7A 1GM9A 1FXKA 3K3WA 1S0VA 2YEVA 3PJSK 1M57B 5EBLC 2XAJA 3OE7G 2R9IA 3FYEB 4MVUA 4BIUA 3E2EA 2A0LA 3ASOC 3OEEG 2Q69A 4PA7A 3RVZA 3CCJV 1S72V 1S77D 3T2MA 1DF5A 3ASNC 3W7TA 5KUMA 3GWOA 5EK0A 4MSWC 2XASA 3FB7C 3CCVV 3ABLB 1R73A 3OUFA 3P30A 4U7OA 5H9CA 4KUMA 3ZJZA 5B1NA 2AHZA 2EIMC 2HG5C 2D3OW 1S76D 4MTGA 1ORQC 4UV9A 2Q67A 1J95A 4TSFG 4LC1A 2ZXWB 4QJFB 3CCQV 1VQ7V 1Y4MA 1VQOV 5EBWC 3K79A 1VQ5V 2HJFC 2H8PC 3OGCC 1VQ9V 2JJ2G 3P32A 1MABG 1G8MA 1GTOA 3I56V 1R6NA 3CD6V 5E1AC 5LGTA 2V1DA 1R3KC 4GCZA 2P90A 2XNDG 1PD3A 1S3JA 5B3SB 3STZC 1FXKC 1M56C 4JGSA 4QE9A 4X89A 5L3BA 2QEXV 1K9MW 2GSMB 2WLIA 4YXWG 3ABMC 4PELA 4GX2A 1GM7A 1YHQV 3JD3A 1GKFA 4L87A 5CMUA 4LBEC 1H38A 1COWG 2XAQA 1OCCB 2JJ1G 1BHAA 1E1RG 3E35A 2OCCC 3LDCA 4PA4A 1KQSU 1PNMA 2WSSG 4RQEA 4UUJC 2DYSB 3AG2C 3SJQC 1AROP 1NKDA 1R3IC 3W7UA 1NVPB 3ZRVA 2IJKA 1VQKV 2NNUA 2DYRC 2V7QG 3E8GA 4XDLA 2ZQMA 4UV8A 1Q86W 5HFLA 1K4DC 3HB3B 2HKOA 3OMNB 2QTOA 4MVMA 1NH2D 1V55B 1OCRB 5EC1C 5EBMC 5IDJA 1KKDA 5L3FA 1Q82W 1AJQA 3AG4C 4G27B 3D3IA 4JPRA 5DN6G 4FIPC 2ZD9A 1I5YA 4JASA 4MTXA 3ETDA 3ZMZA 1M90W 1VQ8V 2EZOA 1RPRA 4WF9V 4XDKA 2B5UA 3MHHC 1JJ2U 1F23A 2EILC 3UKMA 1VQMV 3OR7C 3OFNG 4HYOA 3G4SV 4F4LA 4R8CA 2IW5A 1MOFA 4GX0A 1QLEC 1W0JG 1ROPA 2Y69B 4PDMA 1AI5A 1TUEB 2ZR2A 3LUTB 3QO5A 3A0RA 4PDRA 1K5SA 1ENVA 3ZCCA 3E86A 1JPXA 4QPJA 2IJIA 4JAVA 1EZJA 3W7WA 3ABKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJK A;  1F4N A;  1F4M A;  1PD3 A;  1ROP A;  2GHY A;  1GMG A;  2IJI A;  2IJJ A;  1B6Q A;  1RPO A;  1NKD A;  2IJH A;  1RPR A;  1GTO A;  4DO2 A;  3K79 A; 
#chains in the Genus database with same CATH topology
 1XI1 A;  4KP4 A;  4B7E A;  2A7W A;  5FPR A;  1H2S B;  2E3C A;  3JAW A;  5EIB C;  4LF4 B;  3QVN A;  2L35 A;  1OCZ C;  3AEI A;  1YSC A;  3MHS C;  4CS2 A;  4RQF A;  4DR4 B;  4UCR A;  4DW1 A;  4H33 A;  1VMG A;  4HNA A;  3CJH B;  2Q7E A;  2OWO A;  2GTA A;  1YJW V;  2F1M A;  4LP8 A;  1FS0 G;  1M56 B;  3A0H Z;  4LH7 A;  3G6E V;  5ITZ A;  3THO A;  4Z1M G;  2GBO A;  5JJE B;  1XDC A;  2UXN A;  1DK1 A;  4R7C A;  3TK1 A;  1GM8 A;  1B6Q A;  4JI3 B;  1XOU A;  3F7V C;  4WFE A;  5B1A C;  4B3T B;  4DR3 B;  1IBL B;  4LF7 O;  1XHX A;  4WFG A;  1XMQ B;  2UXB O;  2DYR B;  3EXA A;  2LP7 A;  2QKA A;  1YF2 A;  2YXY A;  1XMO B;  1KU9 A;  4LF6 B;  5IJ0 A;  1YIT V;  4NXN B;  3FB5 C;  3OTF A;  4EFB A;  3LDD A;  3CC7 V;  1THZ A;  4B3M O;  2F43 G;  2UU9 B;  2CE4 A;  1OCO C;  5IY5 C;  4BW9 A;  1TUB A;  3X2Q C;  4JTA B;  1WAZ A;  4NTW A;  3K5M A;  1SET A;  2RNB A;  2EIN C;  3SDL A;  2EJR A;  2HR3 A;  4MVS A;  5KHK A;  2PYL A;  2CTR A;  3K04 A;  2NLJ C;  1JMK C;  4DXW A;  4OGQ B;  2ZIO A;  4FLT A;  3UO3 A;  4E2L A;  3D36 A;  3TET A;  2YIB D;  3W7S A;  4DUY B;  3HKE B;  2ILM A;  2VRZ A;  1H2K A;  1Z2G A;  1ZTE A;  4J41 A;  3SYC A;  4TV8 B;  3SR2 C;  4ZHQ B;  2Y4T A;  4UFZ A;  3P3P A;  4JI1 O;  1FD9 A;  5IYZ A;  3UQ8 A;  3ZRW B;  5B3S C;  1GN6 A;  1NH2 B;  2R9R B;  1WA8 A;  1BQ0 A;  3SPH A;  3ASN B;  4CS3 A;  1G1X B;  5K1X A;  3CRC A;  4DYL A;  5A2Q N;  2RDC A;  4F6R B;  5B5E Z;  2DYS C;  2Y4U A;  3N2G A;  1FFX B;  3CRA A;  5LHI A;  4DR2 B;  4FLZ A;  2XAF A;  2WLH A;  4DV7 O;  3JAL A;  1XL4 A;  2E5L O;  3RYF B;  1P7B A;  2AZ0 A;  5CB4 A;  3BFR A;  1F51 A;  4TQD A;  1AR5 A;  2OT5 A;  3AK3 A;  4I7Z B;  4L8J A;  1AVM A;  1N33 O;  2IBZ H;  4QIW F;  2EZP A;  5LHH A;  3SYO A;  5GON B;  4I9W A;  4LF5 B;  3RWR D;  2RJZ A;  3D8C A;  2QE7 G;  1Y74 A;  1E1Q G;  3F5W C;  4ZOL A;  3CC4 V;  5LMU O;  1FPO A;  5JWP A;  2Q8V A;  1N8R W;  1W2B U;  1Z5W A;  5IYD O;  4X64 O;  2CTQ A;  5DED A;  3K58 A;  1J5E O;  2YS8 A;  4I9Q A;  5LBQ A;  2FL4 A;  3IFX A;  3L75 H;  2CUG A;  4MW3 A;  3UCS C;  3OGI B;  1GO3 F;  1AJN A;  2CGO A;  2MK3 A;  1M9N A;  1Y66 A;  5B1O A;  1XUQ A;  5JQG A;  1U96 A;  3RYH B;  1QBZ A;  2QTS A;  3OUS A;  2D2C B;  4UVA A;  4EFE A;  3KZI Z;  4B3S O;  1CXZ B;  1VF7 A;  1HWY A;  3WB0 A;  3RT3 C;  4NYK A;  3HKD A;  4X1I A;  4LF9 O;  3K08 A;  4U3F H;  2GHY A;  1YVW A;  1V54 C;  3I5D A;  5KMG A;  3ZHS A;  1W0K G;  2Q0O C;  4FLV A;  3JSL A;  1EN5 A;  2W6I G;  1GN4 A;  2QWR B;  5DM6 V;  2WPD G;  3Q4H A;  4ZBM A;  1IUR A;  1L0N H;  1Q5O A;  1BMF G;  1AIL A;  3OTO O;  3JAS A;  3SYA A;  3UM7 A;  2X6A A;  1BZK A;  4K35 A;  3WG7 B;  1B04 A;  3T1H O;  5CBH A;  1F4M A;  1SQG A;  3T4Z A;  3M7M X;  4GKK O;  2HVJ C;  2QR4 A;  4RO2 A;  1AR4 A;  4JYA B;  1Q90 D;  2CTW A;  2M6Y A;  1S5H C;  1NTM H;  2ITD C;  2QA4 V;  2OTJ V;  5L3D A;  3ZMV A;  1IXB A;  4JF3 A;  4FK5 C;  2CK3 G;  5LMN B;  1Q3E A;  3EHB B;  4LFA O;  3K9S A;  4TOI A;  4PA9 A;  3A0B Z;  3L70 H;  3ZRS A;  1YIJ V;  3B8N A;  4HZ3 A;  1L0L H;  5LYJ B;  4FFB B;  5F2V O;  4K0K O;  4UB6 Z;  3CCL V;  2YI9 A;  3RYC B;  3VOU A;  5IWA B;  4JI6 B;  2CH7 B;  1FXK A;  3K3W A;  3PJS K;  3FYE B;  2NN4 A;  3ASO C;  3RVZ A;  5J2U A;  3T2M A;  4NTY A;  1RP3 B;  3IAY A;  1P7G A;  2XAS A;  3L73 H;  3ABL B;  4KUM A;  3F5T A;  1S76 D;  1H2L A;  4TSF G;  4GLX A;  4QJF B;  4IGG A;  4LWS A;  3CCQ V;  1Y4M A;  3HR0 A;  4FZ0 A;  5EBW C;  1NTK H;  3VQX A;  1GTO A;  2MW2 B;  3I56 V;  3CD6 V;  1WN7 A;  1R3K C;  3APQ A;  4GCZ A;  2P90 A;  1PD3 A;  2YIA A;  1X59 A;  4QE9 A;  3JAM N;  4YXW G;  4JI8 O;  3JD3 A;  2HHH O;  4UCS A;  4CS4 A;  4GKJ B;  1JFF A;  2OCC C;  3SJQ C;  2E76 B;  4KHP O;  1ARO P;  1FJG O;  1R3I C;  3JSN A;  2ZQM A;  1Q86 W;  2DE0 X;  3HKC B;  3SJC C;  2Q9L A;  5LXT B;  4I50 B;  2HKO A;  3OMN B;  1NH2 D;  3RYI B;  1V55 B;  4CC6 A;  1KKD A;  4BIO A;  1Q82 W;  1AJQ A;  4G27 B;  3D3I A;  4DUZ B;  4JAS A;  4X1Y A;  3P3N A;  1VQ8 V;  2V4D A;  1SA0 B;  2EZO A;  4B3R O;  4I55 B;  1H2M A;  4XDK A;  2P5O A;  1IX9 A;  1F23 A;  4RWU A;  3OR7 C;  1R6T A;  4GX0 A;  1SQP H;  1W0J G;  3C90 A;  1ROP A;  2Y69 B;  4J7K A;  4PD4 F;  1TUE B;  4PDR A;  3A0R A;  5KX5 A;  1JPX A;  1IZ3 A;  4DV4 O;  3ICX A;  3H1I H;  4UVB A;  4H37 A;  2WLJ A;  3E8B A;  2H94 A;  2WLL A;  1Y76 B;  4PI0 A;  4WCE V;  4LF7 B;  2UXB B;  3VQW A;  2UXD O;  4G2K A;  4JV5 O;  1SQX H;  2ODM A;  3CJH A;  2QKC A;  2Q7H A;  2LQT A;  2ZT9 B;  3JD2 A;  3FAV B;  1KUQ A;  2WLM A;  1HNW O;  2RN9 A;  4R6Z A;  4RUE A;  2ITC C;  4J42 A;  2AHY A;  2LGQ A;  2A9H A;  1ZLZ A;  3H1J H;  1SRY A;  2DQ3 A;  1O9H A;  2RMK B;  2YIC A;  4UCV A;  3U0Z A;  1S5J A;  2KG7 A;  1K97 A;  2IJH A;  4CBC A;  2EIJ C;  1IBK O;  1KEC A;  1NQT A;  1VF6 C;  1N34 O;  2XAH A;  4U3J B;  1SF9 A;  2ATK C;  2IJJ A;  1Q8I A;  5H6R A;  3GB7 C;  4WBN A;  4YHH O;  1EN4 A;  3HPL C;  1H8H G;  2WA4 A;  1ZL8 B;  5JH7 A;  1VP7 A;  3TXQ A;  1EFR G;  5K1P A;  4X9Q A;  4JI1 B;  1FFT B;  4AI8 A;  3JAK B;  1N0N A;  4ZI7 B;  2DQ0 A;  5IYC O;  4X65 O;  1SKV A;  4PDL A;  5LOV B;  5J2T B;  2BOB C;  4YJ3 A;  4QGP A;  5CA0 A;  3G80 A;  4QNH B;  1K8A W;  3JAT A;  2IU3 A;  5CA1 B;  2JK5 C;  1L8D A;  5CBG A;  4P30 A;  1L1F A;  3ZED A;  3WU2 Z;  2Y0I A;  4O2A B;  2JGD B;  3LDE A;  4KL1 A;  1XBL A;  4DV7 B;  3LSS A;  1V9P A;  3DXR B;  4UB8 Z;  2E5L B;  2ZCE A;  1LNQ A;  1Y67 A;  1PNK A;  2EIM B;  4JYY A;  4YIP A;  2HJD A;  4PDV A;  4NXM O;  2PUS A;  1IXM A;  2HVK C;  1Y6X A;  4WFA V;  5C8Y A;  3IC9 A;  5EYP B;  2O57 A;  2P7T C;  3ZHU A;  1Q81 W;  4JAA A;  1BS3 A;  3ZMS A;  3ZMT A;  4H13 B;  2YEV B;  1J5E B;  3F7Y C;  1JCH A;  4DRX B;  3ABM B;  1OCO B;  5IY5 B;  3K03 A;  4LFB B;  3ZN0 A;  2OYQ A;  4YIO A;  3FKS G;  4PHZ A;  4JYC A;  3B09 A;  1XHZ A;  4P9O A;  3ZHV A;  4O4I B;  2EIN B;  3K0D A;  4DV2 O;  4B3S B;  5LP6 B;  4I5S A;  1CEZ A;  2WA3 A;  4FMT A;  3SPJ A;  4J7Z A;  4LF9 B;  2P6J A;  3G71 V;  3ABK C;  4X1K B;  5BY1 A;  2HEP A;  1ZAU A;  5BXZ A;  2F66 C;  4I4T B;  1BT8 A;  1G6U A;  2DWD C;  5JCO C;  4XBF A;  2WLI B;  4I0X B;  3QNE A;  2BOC C;  2LJ2 A;  2EIL B;  4OX9 O;  2DOS A;  3WB1 A;  2WLK A;  3UT5 A;  1MMM A;  3OTO B;  3CP1 A;  1RSO B;  3DTU B;  1EBO A;  4H44 B;  2AGA A;  1JOY A;  5LGN A;  3T1H B;  1DF4 A;  2ZM6 O;  3S3W A;  3RGB A;  2FTK A;  4UCU A;  2F4V O;  4GYC B;  2PZS A;  2UXC O;  4JYB A;  4QPK A;  4TUY A;  3ML0 A;  3CX5 F;  4TWK A;  2X0L A;  4IHJ B;  3CC2 V;  4J9Y B;  1US6 A;  1YTF D;  4JI0 O;  1D5A A;  4NB5 A;  1K33 A;  5IYB O;  2UUB B;  5IJ9 A;  2XUM A;  1G4Y B;  4LFA B;  1BCC H;  1GAX A;  2BTQ B;  3MDS A;  3RN4 A;  3HKB A;  4DV1 B;  3L74 H;  4FPP A;  3BPZ A;  4DK1 A;  4N23 A;  1CP9 A;  4FZ1 A;  4PA3 A;  3FB6 C;  4O4L B;  1CPY A;  5D5P A;  2EIK B;  2DJV A;  1PL0 A;  5IT9 N;  5CN0 A;  1TVK A;  5KA5 A;  1UFI A;  2A3Q A;  1PKX A;  3M99 B;  3GVM A;  4X66 O;  4FLU A;  1E79 G;  1I5X A;  4LR3 A;  1HNX O;  3JAW B;  3JD1 A;  2JEX A;  3AG1 B;  3JD4 A;  4UXN A;  1BHB A;  3SYP A;  2BE3 A;  3SJB C;  2F95 B;  1WLE A;  3R66 A;  1FYJ A;  4HNA B;  4HAM A;  5GW7 A;  3VBB A;  3TCU A;  5J9P C;  1BL8 A;  2PTM A;  2C2A A;  2IH3 C;  4TQF A;  5ITZ B;  3AK2 A;  3IC7 A;  2XT9 A;  4NTX A;  4B08 A;  1M57 B;  5EBL C;  4MVU A;  4BIU A;  2VS0 A;  5LYJ A;  4FFB A;  3CCJ V;  1S77 D;  4NKG B;  3ASN C;  5KUM A;  3GWO A;  5EK0 A;  4K3A A;  4MSW C;  1R73 A;  1OV9 A;  2BTO A;  3OUF A;  1EZV H;  5GTI Z;  3P30 A;  5H9C A;  1N36 O;  3J7A U;  4D6T H;  2HG5 C;  1HW7 A;  4CC5 A;  3A2F A;  4JI8 B;  1NU1 H;  1UPG A;  2ZXW B;  2CAZ C;  4K8Z A;  5IJ0 B;  2HHH B;  3OGC C;  5D5Q A;  1VQ9 V;  2JJ2 G;  3P32 A;  1G8M A;  5LA6 A;  4KHP B;  2V1D A;  1FJG B;  1FAF A;  2P4V A;  4BWA A;  4O4J B;  4DR5 O;  3OT7 A;  1S3J A;  4X89 A;  4IT5 A;  4FLX A;  2GSM B;  3CXH F;  2EJ7 A;  4GX2 A;  1GM7 A;  4L87 A;  1LUV A;  5CMU A;  3AG7 A;  1H38 A;  1OCC B;  2JJ1 G;  1IBL O;  1BHA A;  1E1R G;  3E35 A;  2LW7 A;  3RFR A;  1XMQ O;  5FNV A;  3LDC A;  5EIB D;  1XMO O;  4B3R B;  4LF6 O;  4LF8 B;  1VQK V;  2V7Q G;  4LNU A;  4UV8 A;  2VWJ A;  2QTO A;  5EC1 C;  2RCV A;  3ETQ A;  3AG4 C;  4JPR A;  5DN6 G;  5IYZ B;  2ZD9 A;  1I5Y A;  4X20 A;  3ZMZ A;  4FVM A;  1WA8 B;  2LO1 A;  3G6B A;  1YZB A;  2B5U A;  5A9G A;  3C3T A;  2E74 B;  3AK1 A;  1I0H A;  3BCC H;  2VQE O;  4DR1 O;  3N2G B;  3H1H H;  4EB6 A;  1URF A;  3CRM A;  3T1Y O;  3QO5 A;  1ENV A;  3E86 A;  3E22 B;  3ZHT A;  3N2K B;  2UXD B;  4X8A A;  3W7W A;  1LUW A;  4JV5 B;  2ZNJ A;  2QM7 A;  3JAL B;  3CCR V;  3ZRX A;  2ADQ B;  3OMA B;  2PF4 E;  2P4K A;  4JAU A;  3SPG A;  2E75 B;  2AXT Z;  2W0F C;  1R6K A;  1HNW B;  5BZB A;  4NVP A;  5EZY A;  1H8E G;  3WG7 C;  4Q20 A;  3JAR A;  1VF6 A;  1KP3 A;  1VQN V;  1PNL A;  4TV9 B;  4YJ2 A;  2F93 B;  1Y74 B;  3MD0 A;  4ZOL B;  2Q68 A;  2W6J G;  3PN1 A;  4DR2 O;  4N21 A;  4RAI A;  1IBK B;  2QWQ B;  3DGE A;  3ZHR A;  1N34 B;  1IDS A;  2JEU A;  4UVC A;  1RM1 B;  3G67 A;  1JQ0 A;  1GN3 A;  2WAM A;  4MT8 A;  4D7T A;  1QVG U;  1BSM A;  3BRC A;  5JQG B;  3IGA C;  1NR1 A;  4X65 B;  2GDS A;  4WFF A;  2K9P A;  3VQV A;  4YY3 B;  3ABT A;  4X1I B;  1ZUQ A;  1UJW B;  5JVD A;  1NVP D;  3TGU H;  4DV3 O;  2Q4P A;  5KMG B;  3H9V A;  3CCM V;  3TXS A;  3ABU A;  1K3E A;  2EX3 A;  3AG3 B;  2Y48 A;  2IM9 A;  3FD9 A;  2QGN A;  3ABL C;  5L3E A;  4R50 A;  3BHP A;  1HNZ B;  2VQF B;  3B8M A;  2ZDI C;  3Q4H B;  3RVY A;  3O65 A;  5B1B C;  4DR7 O;  4DV0 O;  1W59 A;  2Q0A A;  1P4R A;  2AZ2 A;  3JAS B;  3QO8 A;  4O4H A;  5FL7 G;  4QE7 A;  4X62 O;  1GMG A;  3E8F A;  3LNM B;  1SS3 A;  3JCZ A;  3K06 A;  1OJH A;  1IBM O;  4JI7 O;  3K0G A;  4P2Z A;  2Z0A A;  4TT3 G;  4DW0 A;  1GRJ A;  1YTF B;  5CA1 A;  2OCH A;  4JI4 O;  2X6B A;  1JVM A;  4JZ2 A;  3I55 V;  3B40 A;  1BE3 H;  1AR1 B;  1MZF A;  2GUZ A;  1AB3 A;  4UCT A;  4Z2W A;  1XNQ O;  2JS5 A;  2ZR3 A;  2R9A A;  4GX5 A;  4ABM A;  2YC0 A;  2ARH A;  1FXH A;  1KP2 A;  4EEQ A;  2ZNI A;  2W0X A;  4BW5 A;  4OXS A;  1AP5 A;  3CHX A;  3OM3 B;  5EYP A;  2UXX A;  1FXK B;  5JCO A;  1N32 O;  2EIJ B;  4LH6 A;  3B2E E;  4CH6 A;  1KC8 W;  5J2U B;  4IIJ B;  1Q7Y W;  2OTL V;  2WLN A;  1MNG A;  5L3C A;  4B3M B;  1LR1 A;  2R70 A;  1QCE A;  4MS2 A;  4J9Z B;  3LSQ A;  3AG2 B;  2R72 A;  1GN2 A;  1R3L C;  2Y69 C;  4LWS B;  5KUK A;  1K34 A;  4OX9 B;  2P67 A;  2XOK G;  1SES A;  2QKS A;  3ZN1 A;  3U10 A;  2QJ1 A;  3WB2 A;  5LP6 A;  1QLN A;  1HP8 A;  3BY6 A;  5KA6 A;  3H01 A;  4WFB V;  1QNM A;  2HLD G;  3H1L H;  3SJA C;  3T4D A;  1VQL V;  2DN9 A;  4X1K A;  2F4V B;  4LFC O;  1XL6 A;  2X6C A;  1M4U A;  4GX1 A;  1SQV H;  2PI4 A;  4JI5 O;  2YUA A;  3RBZ A;  3QO7 A;  3WFV A;  2YXH A;  4MVR A;  1JFF B;  3OD4 A;  1Q6I A;  4JI0 B;  4PA6 A;  1QLE B;  4LCU C;  3K9A A;  1JX9 A;  5LGU A;  1QU7 A;  1BGY H;  2GTS A;  2DMX A;  1SZT A;  2WWW A;  3BA9 A;  3STL C;  4IL6 Z;  1M1K W;  1I94 O;  1QVF U;  4JTD B;  1K5Q A;  1OCZ B;  3OEH G;  2A06 H;  4Q6G A;  1B06 A;  4X1Y B;  2L6L A;  1QR9 A;  3BA8 A;  4X66 B;  2BSK B;  1WB7 A;  3L71 H;  2EUL A;  3HKE A;  2QSA A;  3N27 A;  3SYQ A;  5KAF Z;  1HNX B;  4MTO A;  2KKW A;  4TV8 A;  4ZHQ A;  1AJP A;  1NTZ H;  2FB5 A;  3CMA V;  4O2B B;  3ZRW A;  3CYO A;  2JIZ G;  2DW4 A;  1N33 B;  3CSX A;  4PJ0 Z;  3S3X A;  5KX5 B;  1SER A;  3R65 A;  3OMI B;  5B1A B;  3K5N A;  3FB8 C;  2LFS A;  3LNN A;  1I7F A;  2YDE A;  1MSW D;  1MSD A;  4O4L A;  5JJN B;  4F6R A;  1R3J C;  1AI6 A;  1FFX A;  1ZSP A;  2Q6A A;  5LMU B;  4MVQ A;  1DLB A;  4CH4 A;  1OCR C;  2WLL B;  3CCE V;  4J10 A;  3TJT A;  1IVS A;  2PGG A;  1NS1 A;  4X64 B;  2PI5 A;  3E8H A;  1N36 B;  2LW1 A;  2UUA O;  4K8X A;  3RYF A;  1WPX A;  4EKW A;  1OHH G;  2KB1 A;  3X2Q B;  1HDJ A;  1GM9 A;  3DSQ A;  4DV6 O;  1S0V A;  5KHH A;  2A0L A;  3OEE G;  4PA7 A;  2Q69 A;  1S72 V;  2KQX A;  1DF5 A;  5GON A;  2ZIN A;  3FB7 C;  3CCV V;  1P49 A;  4DR5 B;  4U7O A;  3K5O A;  5B1N A;  2AHZ A;  2EIM C;  5TIS Z;  4MTG A;  3DC6 A;  1ORQ C;  4UV9 A;  1N0J A;  3K57 A;  1TGO A;  4LC1 A;  4DV5 O;  4AQY O;  1VQO V;  2KG7 B;  1NT2 B;  2H8P C;  3M8A A;  2N74 A;  3UO2 A;  1TA8 A;  1R6N A;  5LGT A;  4W4K A;  1F7Y A;  4BR6 A;  5B3S B;  2Q5Z A;  3STZ C;  3RYH A;  1M56 C;  3D3Q A;  4JGS A;  5L3B A;  4WBN B;  3ZHQ A;  3ABM C;  4PEL A;  1YHQ V;  4PV1 B;  2UUC O;  1GKF A;  4O4J A;  5JH7 B;  2H3O A;  1Z5V A;  1COW G;  4LBE C;  2QWP B;  1AP6 A;  1HR0 O;  4FFK A;  5BR8 O;  5H5N A;  4GKK B;  2WSS G;  4UUJ C;  2DYS B;  2VWK A;  3W7U A;  1NVP B;  4YJ3 B;  2NNU A;  1SZX A;  2DYR C;  1PV0 A;  4XDL A;  3FFQ A;  5LP6 C;  5CA0 B;  5HFL A;  1K4D C;  3HB3 B;  4UCO A;  4DR6 O;  3JAT B;  4MVM A;  2VQE B;  4DR1 B;  5JJJ B;  5E79 Z;  5IDJ A;  1WP8 A;  3T1Y B;  3B4S A;  2XHB A;  3BAA A;  2JRI A;  4FIP C;  5FPO A;  1XNR O;  5DEC A;  4MTX A;  3H1K H;  1M90 W;  4A5U B;  1RPR A;  4WF9 V;  4J11 A;  3MHH C;  1JJ2 U;  1N4C A;  3CS5 A;  4K0K B;  1D5N A;  2EIL C;  2PYJ A;  1VQM V;  5BMV B;  3OFN G;  4KXR A;  2G38 A;  3G4S V;  1QQC A;  1KKC A;  1SQB H;  4PDM A;  5C8Y B;  2ZR2 A;  3LUT B;  1SC5 B;  3ZCC A;  4QPJ A;  2IJI A;  2OIG A;  4JAV A;  1EZJ A;  1YXB A;  2P22 C;  2BCC H;  4C7U A;  3SPI A;  4J80 A;  1H2G A;  4D7S A;  2HP8 A;  4JZG A;  3KCY A;  5FLX N;  1AI4 A;  3E22 A;  4E4E A;  3N2K A;  4JI2 O;  2X7R B;  1YJ9 V;  4AIL C;  2NR5 A;  4BIZ A;  1AI7 A;  2QM8 A;  3RYC A;  1JA8 A;  2ZE6 A;  1GK9 A;  4CH3 A;  1PPJ H;  2CH7 A;  2B1G A;  4GUN A;  1YDX A;  1V54 B;  1H2N A;  2CGN A;  4LF4 O;  2EIK C;  4ASU G;  3E89 A;  4TV9 A;  3JYC A;  3BAB A;  1SQF A;  1YCI A;  4DR4 O;  3OW2 U;  2DWE C;  3OR6 C;  2ZDI A;  1XEQ A;  4DV3 B;  3B77 A;  3AG1 C;  1XIL A;  1TUB B;  2Z3Y A;  2P06 A;  2B1I A;  3CEI A;  2Z5U A;  4LFB O;  3AG4 B;  4DR7 B;  3BEH A;  4DV0 B;  5KHG A;  4JI3 O;  1BQZ A;  3UT5 B;  1NBM G;  1FKA O;  4B3T O;  1I08 A;  4DR3 O;  3KG2 A;  1KB9 F;  1M57 C;  2PY5 A;  2OIE A;  2A79 B;  4X62 B;  2JDI G;  1NI8 A;  1F4N A;  1X4T A;  2XAG A;  4NXN O;  5EC2 C;  1ZWI C;  1Q43 A;  1IBM B;  4JI7 B;  1YJN V;  2UU9 O;  5CA3 A;  2QWO B;  3CRQ A;  4TUY B;  4RUF A;  4JI4 B;  3CPW U;  2ZXW C;  1K73 W;  1PL4 A;  3HKC A;  1D2D A;  3FYI B;  5LXT A;  4I50 A;  2YI8 A;  3CCS V;  4DV4 B;  5IJ9 B;  2YSU B;  3VQY A;  3RYI A;  4F6E A;  3O9O A;  3W7X A;  3ZBH A;  1NR7 A;  1T5E A;  1XNQ B;  2ZIM A;  3HKB B;  1VAR A;  2RQ6 A;  4GT1 A;  3ASO B;  1SA0 A;  4FLY A;  4FM2 A;  3A8T A;  4I55 A;  2YIB A;  1MG1 A;  4X88 A;  4P9P A;  5CBF A;  1O9G A;  1TVK B;  2CDY A;  1OCC C;  2CTP A;  1N32 B;  1VEW A;  4DUY O;  2EBO A;  1WP7 A;  5HFM A;  1VQ6 V;  4ZKI A;  5H2F Z;  5CB4 B;  3KKY A;  4CH5 A;  4AHC A;  1VIB A;  3D36 C;  2UUB O;  2IU0 A;  1PP9 H;  3E83 A;  3ZIA G;  2LFR A;  4DK0 A;  3CRR A;  4DV1 O;  5GTH Z;  3ZS8 C;  1MA1 A;  1Y76 A;  3BVO A;  1RPO A;  1FXV A;  1VQ4 V;  1WPB A;  1XQ8 A;  1YI2 V;  5C93 A;  4DO2 A;  3JD0 A;  2OCC B;  2F23 A;  1K7D A;  4MW8 A;  4IIJ A;  2FKX A;  1P84 F;  5IE9 A;  4FM1 A;  3QG5 A;  4B7K A;  4LFC B;  4WFH A;  4YHH B;  1DTO A;  1EM1 A;  3FAV A;  4JI5 B;  4BAY A;  4ICG A;  3GWK C;  5B1B B;  5LL6 Y;  1A32 A;  1VQP V;  5LA6 B;  1M93 A;  4LF5 O;  2XTA A;  4ZIB A;  1QHT A;  5H6Q A;  4NR1 A;  3HKD B;  4FJC C;  5L3G A;  3K59 A;  4CZZ A;  4H0L B;  1I94 B;  2JS3 A;  3CWB H;  3DC5 A;  4PI2 A;  1K4C C;  3K5L A;  2YXL A;  4U3J A;  1MZE A;  5FNV B;  3J80 N;  4KFM A;  5B66 Z;  2QWN B;  3JCU Z;  2N04 A;  3T1C A;  5LHG A;  4JTC B;  4MVO A;  1KMI Z;  3C3S A;  1ZL8 A;  2ZE5 A;  4J7J A;  4LNU B;  4MVZ A;  3CXC U;  1NJI W;  1RM1 C;  3JAK A;  3CME V;  2M7W A;  4ZI7 A;  4NXM B;  4IYI A;  4G28 B;  5LOV A;  5J2T A;  1OZ0 A;  1VF5 B;  2QDO A;  4W4L A;  4IYH A;  4U7N A;  4X20 B;  2FYU H;  3SPC A;  2ETN A;  2HFE C;  4MTF A;  1NZ6 A;  3CB2 A;  3KCX A;  1U97 A;  5AG2 A;  1PM9 A;  1QR8 A;  2K1E A;  3QTC A;  1Q6U A;  4O2A A;  1K92 A;  2JGD A;  3ZMU A;  2BSK A;  1GH6 A;  4XDJ A;  4LF8 O;  3CCU V;  3ETG A;  3NXS A;  4EB6 B;  2UUA B;  3DXR A;  3APO A;  1Q6H A;  3AG3 C;  4O2B A;  4DV6 B;  1KD1 W;  1SQQ H;  3J81 N;  1V55 C;  3ETE A;  4DV2 B;  4JYA O;  5EZY B;  3NR7 A;  3EFF K;  2IH1 C;  3RW0 A;  1XRE A;  2ZE8 A;  4OPA A;  3JAR B;  3OAA G;  5KAI Z;  4YJ2 B;  4DV5 B;  4AQY B;  5LMN O;  5KHI A;  2YEV A;  2XAJ A;  3OE7 G;  2R9I A;  3MAQ A;  3E2E A;  3L72 H;  4DRX A;  1WNS A;  3W7T A;  3ZX6 A;  1ZX3 A;  3ZJZ A;  2Q73 A;  3IJ4 A;  2D3O W;  2QM4 A;  4O4I A;  2ADP A;  2Q67 A;  1J95 A;  2UUC B;  1VQ7 V;  5IWA O;  3K79 A;  4JI6 O;  1VQ5 V;  2ZM6 B;  2HJF C;  1HR0 B;  5KHJ A;  1MAB G;  3CE2 A;  5BR8 B;  5E1A C;  2LGW A;  2B9Z A;  1WB8 A;  2UXC B;  2YID A;  4I4T A;  1M5I A;  2XND G;  1RFY A;  1FXK C;  2QEX V;  5JVD B;  1K9M W;  1EN6 A;  2WLI A;  4I0X A;  4DR6 B;  2JGU A;  1YEW A;  1S5L Z;  2XAQ A;  2Q7G A;  4Z1V A;  1XNR B;  4PA4 A;  1RSO A;  1PNM A;  1KQS U;  1B3Q A;  4RQE A;  3AG2 C;  1NKD A;  1KBH A;  3ZRV A;  2IJK A;  2ZKO A;  3E8G A;  3FX7 A;  4O4H B;  3SGI A;  2FML A;  1JR9 A;  2KSD A;  1TAE A;  3QF7 A;  1WJZ A;  4FLW A;  1DGS A;  1OCR B;  4YY3 O;  5EBM C;  2ZE7 A;  4OPH A;  5L3F A;  4IHJ A;  4GKJ O;  2GV9 A;  3ETD A;  3L9D A;  1JJO A;  4FM0 A;  2N05 A;  2BTQ A;  2Y0P A;  4GZR B;  4HBN A;  3UKM A;  1KYO F;  1HNZ O;  2VQF O;  4JI2 B;  3LSU A;  4HYO A;  2GUZ B;  4F4L A;  4R8C A;  2IW5 A;  1MOF A;  1QLE C;  1AI5 A;  5KLV H;  2JVD A;  4DUZ O;  1K5S A;  5BMV A;  3EVK A;  3U11 A;  2AW9 A;  1R1B A;  3ABK B; 
#chains in the Genus database with same CATH homology
 4UVB A;  2QM7 A;  3CCR V;  4H37 A;  2WLJ A;  4KP4 A;  3SPI A;  1H2G A;  3ZRX A;  3OMA B;  4JAU A;  3SPG A;  1AI4 A;  3E8B A;  2H94 A;  2WLL A;  1OCZ C;  2W0F C;  3AEI A;  1R6K A;  1YSC A;  3MHS C;  4RQF A;  2X7R B;  5BZB A;  1YJ9 V;  1H8E G;  4H33 A;  3WG7 C;  4WCE V;  4BIZ A;  4Q20 A;  1KP3 A;  1AI7 A;  2QM8 A;  1VQN V;  1YJW V;  1PNL A;  1FS0 G;  1M56 B;  4LP8 A;  3G6E V;  1GK9 A;  4Z1M G;  3MD0 A;  2Q68 A;  2W6J G;  4G2K A;  2B1G A;  4N21 A;  1V54 B;  4RAI A;  2UXN A;  3JD2 A;  4R7C A;  2EIK C;  3DGE A;  1GM8 A;  3TK1 A;  3E89 A;  4ASU G;  3JYC A;  1B6Q A;  2WLM A;  2JEU A;  4UVC A;  1RM1 B;  3OW2 U;  4R6Z A;  3F7V C;  4WFE A;  5B1A C;  4RUE A;  2ITC C;  1JQ0 A;  2DWE C;  2AHY A;  3OR6 C;  2ZDI A;  2A9H A;  4WFG A;  2DYR B;  2LP7 A;  2WAM A;  4MT8 A;  1SRY A;  2DQ3 A;  1QVG U;  3B77 A;  3AG1 C;  1YIT V;  3FB5 C;  3IGA C;  1K97 A;  2IJH A;  2Z3Y A;  1NR1 A;  4CBC A;  2EIJ C;  3LDD A;  2B1I A;  3CC7 V;  1KEC A;  2Z5U A;  4WFF A;  1NQT A;  1THZ A;  3AG4 B;  3BEH A;  2F43 G;  1OCO C;  5IY5 C;  3ABT A;  2XAH A;  1NBM G;  2ATK C;  2IJJ A;  3X2Q C;  3KG2 A;  4JTA B;  5H6R A;  1UJW B;  1M57 C;  3GB7 C;  1NVP D;  3HPL C;  1H8H G;  2A79 B;  3CCM V;  1SET A;  3ABU A;  1K3E A;  2JDI G;  1F4N A;  2XAG A;  2EIN C;  3AG3 B;  2Y48 A;  1EFR G;  5EC2 C;  2EJR A;  2HR3 A;  1ZWI C;  3ABL C;  5L3E A;  1FFT B;  4MVS A;  4R50 A;  3B8M A;  2DQ0 A;  1YJN V;  5IYC O;  2ZDI C;  3RVY A;  5B1B C;  4PDL A;  3K04 A;  2NLJ C;  5CA3 A;  4DXW A;  4RUF A;  2BOB C;  3CPW U;  2ZXW C;  1P4R A;  3QO8 A;  4E2L A;  1K73 W;  3D36 A;  4QNH B;  3TET A;  3FYI B;  5FL7 G;  4QE7 A;  3CCS V;  1K8A W;  3W7S A;  2YSU B;  2IU3 A;  2JK5 C;  3SYC A;  5CBG A;  3W7X A;  4P30 A;  1GMG A;  1NR7 A;  3E8F A;  3LNM B;  1L1F A;  3JCZ A;  3K06 A;  3ZRW B;  5B3S C;  3LDE A;  3K0G A;  4P2Z A;  4TT3 G;  4GT1 A;  3ASO B;  1YTF B;  1NH2 B;  2R9R B;  3LSS A;  3SPH A;  3ASN B;  1MG1 A;  4X88 A;  4P9P A;  5CBF A;  1LNQ A;  2X6B A;  1JVM A;  1OCC C;  1PNK A;  3I55 V;  2EIM B;  1AR1 B;  4PDV A;  2EBO A;  1IXM A;  2HVK C;  2DYS C;  5LHI A;  4WFA V;  5HFM A;  1VQ6 V;  4ZKI A;  2ZR3 A;  4GX5 A;  2XAF A;  2P7T C;  2WLH A;  2IU0 A;  1FXH A;  1KP2 A;  1Q81 W;  1XL4 A;  3E83 A;  3ZMS A;  4BW5 A;  3ZMT A;  3ZIA G;  4OXS A;  2LFR A;  1P7B A;  3OM3 B;  2UXX A;  1FXK B;  1F51 A;  2YEV B;  2EIJ B;  3F7Y C;  2OT5 A;  1JCH A;  1KC8 W;  1RPO A;  3ABM B;  4QIW F;  1FXV A;  1OCO B;  1Q7Y W;  2EZP A;  5IY5 B;  1VQ4 V;  2OTL V;  2WLN A;  1YI2 V;  5LHH A;  3SYO A;  4I9W A;  3K03 A;  3ZN0 A;  5L3C A;  5C93 A;  4DO2 A;  3JD0 A;  1QCE A;  4MS2 A;  2OCC B;  3FKS G;  2QE7 G;  4JYC A;  1E1Q G;  3F5W C;  3CC4 V;  4J9Z B;  3LSQ A;  1K7D A;  3AG2 B;  4MW8 A;  4P9O A;  4WFH A;  1DTO A;  2EIN B;  1R3L C;  3K0D A;  2Y69 C;  1N8R W;  4I5S A;  5KUK A;  5IYD O;  1W2B U;  4BAY A;  1K34 A;  1CEZ A;  2P67 A;  4FMT A;  3SPJ A;  5LBQ A;  5B1B B;  2XOK G;  2P6J A;  3G71 V;  3ABK C;  3IFX A;  1SES A;  2QKS A;  4MW3 A;  3ZN1 A;  1VQP V;  1GO3 F;  1AJN A;  2MK3 A;  1QLN A;  1M9N A;  1Y66 A;  3BY6 A;  5B1O A;  5H6Q A;  5KA6 A;  3H01 A;  2DWD C;  2HLD G;  4WFB V;  1QBZ A;  3T4D A;  4FJC C;  4XBF A;  3OUS A;  5L3G A;  1VQL V;  2WLI B;  4UVA A;  3QNE A;  4CZZ A;  1XL6 A;  2X6C A;  2BOC C;  4GX1 A;  2PI4 A;  1HWY A;  1K4C C;  3RBZ A;  2EIL B;  3QO7 A;  2WLK A;  3WFV A;  4MVR A;  3CP1 A;  3K08 A;  3DTU B;  4KFM A;  3T1C A;  1EBO A;  4PA6 A;  1JOY A;  5LHG A;  1QLE B;  2GHY A;  4JTC B;  4MVO A;  4LCU C;  5LGN A;  1V54 C;  3K9A A;  1DF4 A;  1JX9 A;  5LGU A;  1W0K G;  2FTK A;  4MVZ A;  3CXC U;  1NJI W;  1SZT A;  2WWW A;  1RM1 C;  2W6I G;  3STL C;  3CME V;  5DM6 V;  2M7W A;  1QVF U;  1M1K W;  2WPD G;  4ZBM A;  4JTD B;  4JYB A;  4QPK A;  4G28 B;  1K5Q A;  1BMF G;  1OCZ B;  3ML0 A;  3OEH G;  1OZ0 A;  4TWK A;  2X0L A;  3CC2 V;  4J9Y B;  4U7N A;  3SYA A;  3UM7 A;  1YTF D;  2X6A A;  3WG7 B;  3SPC A;  1QR9 A;  1K33 A;  5IYB O;  2HFE C;  4MTF A;  3SYQ A;  5CBH A;  1F4M A;  1G4Y B;  4MTO A;  1AJP A;  1QR8 A;  3T4Z A;  2K1E A;  3CMA V;  2HVJ C;  4FPP A;  4RO2 A;  3ZRW A;  1K92 A;  3CYO A;  2JIZ G;  3ZMU A;  4N23 A;  1CP9 A;  4PA3 A;  1S5H C;  3FB6 C;  4XDJ A;  2DW4 A;  3CCU V;  3ETG A;  3NXS A;  1CPY A;  2EIK B;  2ITD C;  1PL0 A;  2QA4 V;  2OTJ V;  5L3D A;  5CN0 A;  1SER A;  3R65 A;  3ZMV A;  3OMI B;  5B1A B;  5KA5 A;  3AG3 C;  3FB8 C;  4JF3 A;  1PKX A;  4FK5 C;  2LFS A;  2CK3 G;  3M99 B;  1KD1 W;  1MSW D;  1E79 G;  1I5X A;  1R3J C;  3EHB B;  1AI6 A;  2Q6A A;  3JD1 A;  1V55 C;  2JEX A;  3AG1 B;  3ETE A;  1DLB A;  4MVQ A;  4X8A A;  1OCR C;  3JD4 A;  2WLL B;  4UXN A;  1BHB A;  4PA9 A;  3CCE V;  3SYP A;  2PI5 A;  3E8H A;  3ZRS A;  3EFF K;  1WLE A;  2IH1 C;  1YIJ V;  3RW0 A;  3B8N A;  4HAM A;  4HZ3 A;  5GW7 A;  3VBB A;  3TCU A;  5J9P C;  1BL8 A;  3OAA G;  2C2A A;  3CCL V;  1WPX A;  4EKW A;  1OHH G;  2KB1 A;  2IH3 C;  3VOU A;  3X2Q B;  3IC7 A;  1GM9 A;  1FXK A;  3K3W A;  1S0V A;  2YEV A;  3PJS K;  1M57 B;  5EBL C;  2XAJ A;  3OE7 G;  2R9I A;  3FYE B;  4MVU A;  4BIU A;  3E2E A;  2A0L A;  3ASO C;  3OEE G;  2Q69 A;  4PA7 A;  3RVZ A;  3CCJ V;  1S72 V;  1S77 D;  3T2M A;  1DF5 A;  3ASN C;  3W7T A;  5KUM A;  3GWO A;  5EK0 A;  4MSW C;  2XAS A;  3FB7 C;  3CCV V;  3ABL B;  1R73 A;  3OUF A;  3P30 A;  4U7O A;  5H9C A;  4KUM A;  3ZJZ A;  5B1N A;  2AHZ A;  2EIM C;  2HG5 C;  2D3O W;  1S76 D;  4MTG A;  1ORQ C;  4UV9 A;  2Q67 A;  1J95 A;  4TSF G;  4LC1 A;  2ZXW B;  4QJF B;  3CCQ V;  1VQ7 V;  1Y4M A;  1VQO V;  5EBW C;  3K79 A;  1VQ5 V;  2HJF C;  2H8P C;  3OGC C;  1VQ9 V;  2JJ2 G;  3P32 A;  1MAB G;  1G8M A;  1GTO A;  3I56 V;  1R6N A;  3CD6 V;  5E1A C;  5LGT A;  2V1D A;  1R3K C;  4GCZ A;  2P90 A;  2XND G;  1PD3 A;  1S3J A;  5B3S B;  3STZ C;  1FXK C;  1M56 C;  4JGS A;  4QE9 A;  4X89 A;  5L3B A;  2QEX V;  1K9M W;  2GSM B;  2WLI A;  4YXW G;  3ABM C;  4PEL A;  4GX2 A;  1GM7 A;  1YHQ V;  3JD3 A;  1GKF A;  4L87 A;  5CMU A;  4LBE C;  1H38 A;  1COW G;  2XAQ A;  1OCC B;  2JJ1 G;  1BHA A;  1E1R G;  3E35 A;  2OCC C;  3LDC A;  4PA4 A;  1KQS U;  1PNM A;  2WSS G;  4RQE A;  4UUJ C;  2DYS B;  3AG2 C;  3SJQ C;  1ARO P;  1NKD A;  1R3I C;  3W7U A;  1NVP B;  3ZRV A;  2IJK A;  1VQK V;  2NNU A;  2DYR C;  2V7Q G;  3E8G A;  4XDL A;  2ZQM A;  4UV8 A;  1Q86 W;  5HFL A;  1K4D C;  3HB3 B;  2HKO A;  3OMN B;  2QTO A;  4MVM A;  1NH2 D;  1V55 B;  1OCR B;  5EC1 C;  5EBM C;  5IDJ A;  1KKD A;  5L3F A;  1Q82 W;  1AJQ A;  3AG4 C;  4G27 B;  3D3I A;  4JPR A;  5DN6 G;  4FIP C;  2ZD9 A;  1I5Y A;  4JAS A;  4MTX A;  3ETD A;  3ZMZ A;  1M90 W;  1VQ8 V;  2EZO A;  1RPR A;  4WF9 V;  4XDK A;  2B5U A;  3MHH C;  1JJ2 U;  1F23 A;  2EIL C;  3UKM A;  1VQM V;  3OR7 C;  3OFN G;  4HYO A;  3G4S V;  4F4L A;  4R8C A;  2IW5 A;  1MOF A;  4GX0 A;  1QLE C;  1W0J G;  1ROP A;  2Y69 B;  4PDM A;  1AI5 A;  1TUE B;  2ZR2 A;  3LUT B;  3QO5 A;  3A0R A;  4PDR A;  1K5S A;  1ENV A;  3ZCC A;  3E86 A;  1JPX A;  4QPJ A;  2IJI A;  4JAV A;  1EZJ A;  3W7W A;  3ABK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...