1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pollen allergen Ole e 6
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
source organism Olea europaea
molecule tags Allergen
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
3K5LA 5B3SC 4U7NA 5EBWC 1VQMV 4LH6A 3CMEV 1L0NH 2IW5A 4LF4O 3CSXA 1PKXA 4J7KA 1MNGA 2QM4A 3D3QA 3RGBA 3IC9A 1I5XA 4R7CA 3SJBC 1JR9A 2DYSB 2EINB 3RBZA 1S76D 2HEPA 4TQFA 1VQ7V 2OWOA 1Q81W 1FJGO 1K4CC 5DECA 1ZTEA 3OUSA 4X88A 1V54B 3QO8A 3ETGA 4PA3A 1W59A 2LO1A 4DV7O 4KP4A 1S0VA 1YZBA 4DV2O 3G67A 1FD9A 3JAMN 2N04A 3D8CA 3F7VC 4L8JA 1YJ9V 3W7TA 1BL8A 2ATKC 1ZL8A 3FD9A 2EIJC 2EBOA 4CH5A 1TUEB 5FPRA 3D3IA 2GDSA 2KG7A 1MG1A 1R1BA 3QG5A 4JGSA 1A32A 1JPXA 1I94B 2B9ZA 1HNZB 2DQ3A 5B1BC 4JI6B 4B3RO 2DWDC 3E8BA 4NXNB 4X64B 3CHXA 3OE7G 3AG3C 2JEXA 4AHCA 2RQ6A 4FZ1A 3JAKB 4LFAO 2EIKB 1XBLA 3RW0A 1VEWA 4DV1B 1AB3A 1SS3A 3A2FA 2QKSA 1EN4A 1WPBA 2D2CB 1IXBA 1YVWA 4LNUB 2NNUA 3LSUA 3EHBB 1SC5B 1S5LZ 1U97A 3ETQA 4LF6B 1JVMA 3KCXA 3F5TA 3SPHA 4DUZO 2WA4A 1K92A 1JJOA 4F6RA 2F66C 1YJWV 2ZM6B 2IH3C 4I0XB 3UT5B 1R3LC 3CCUV 3CRMA 3OGIB 3F5WC 4KL1A 4FFBB 3U10A 1XNQO 3GVMA 5EZYA 1LR1A 2ZD9A 2CTQA 4GT1A 1VQNV 4G27B 5LYJB 4QPKA 2CGNA 4IYIA 3KZIZ 5EYPA 1QBZA 4LCUC 4JI7O 3E8GA 4JTCB 4JI1O 3TETA 5BR8B 1H8HG 4FLYA 3IJ4A 4YJ3A 3DC5A 4JAUA 1SQVH 1ZWIC 1UFIA 3BRCA 1VQ5V 4OPHA 1YTFB 1FYJA 3E8FA 3ZRXA 3HR0A 3ZHRA 1OCZC 5EIBD 1D5AA 5JJEB 4DR2B 1ZAUA 2P90A 1CEZA 2YIBA 3ICXA 4DV3B 1K8AW 4LFBB 2WLKA 3AK1A 1K33A 1VIBA 2XHBA 1ZLZA 2ADPA 2PYLA 1NTMH 4I50B 1H2LA 4UVCA 1K4DC 3Q4HB 5C93A 1J5EB 4Z1MG 2AZ0A 1QHTA 1W2BU 4XDKA 4DV0B 1RSOB 4GX5A 4HYOA 4YIPA 4U3FH 3JD1A 3CXCU 1R3IC 2WSSG 3FAVA 3OEEG 4PJ0Z 1IZ3A 5KA6A 1SF9A 4LWSA 3N2GB 1JFFA 5LP6A 3OAAG 1RPOA 1I94O 2Y4UA 3K5MA 4ZKIA 2DQ0A 1YITV 4JI6O 4X1YA 4NXNO 5CB4B 4X64O 3M99B 3I56V 3K08A 1S77D 3CD6V 1F4NA 2N74A 3FB7C 5L3DA 4KXRA 1XREA 1NVPD 2DYSC 1NH2B 4BW5A 3MHHC 4QE7A 5H6RA 4DV1O 1BZKA 1ENVA 2WAMA 3K0DA 5CA0B 1M1KW 4LF6O 4RQFA 2IJIA 1V54C 3RFRA 1JA8A 4I55B 1XMQB 2Q6AA 1SERA 1XOUA 3J81N 2YUAA 2LQTA 3ZHVA 1MZFA 2ZM6O 1BGYH 4NTYA 4LF5B 2BSKB 3JCZA 1EN5A 4U7OA 1VQ8V 5B1NA 2OT5A 2QTSA 1IVSA 2DYRB 2X7RB 1H38A 3SPIA 2CDYA 4J80A 2Q7HA 4NR1A 1Z5WA 1AI5A 2W0FC 4X8AA 2IBZH 3CCLV 4J9YB 1S3JA 3JATB 3JALA 1GN4A 1DGSA 5JVDB 3CMAV 2EIKC 1XQ8A 1B04A 1OZ0A 3CRCA 1Q6HA 2WLJA 3G71V 4FFKA 5JQGA 2QSAA 2QKCA 2F1MA 2VQEB 5FLXN 4DR2O 1TVKA 2OYQA 2YI9A 4O2AB 2W0XA 5GTHZ 3MHSC 2ZR2A 5IT9N 3C3TA 4DV3O 4W4KA 2ZE8A 4LFBO 5FNVA 3B8NA 1T5EA 4FK5C 1RPRA 1HWYA 4PA6A 1I08A 1MABG 4JPRA 4UCTA 1TUBA 3D36C 1H2GA 2NN4A 4RO2A 2LGWA 1AILA 4DR7B 2RJZA 2F23A 4FFBA 2IJJA 4XDLA 1J5EO 3M8AA 2NR5A 4O4LB 4FM1A 3SYCA 4YIOA 1VQ4V 5BZBA 1WB8A 3N2KA 1KP2A 1FFXB 4P9PA 2AGAA 4I4TA 1S5HC 1MSWD 1BQZA 4K0KB 5EBMC 4PI0A 4RUFA 1Q3EA 2JS5A 3K03A 4UB8Z 5CA3A 3B09A 1R3JC 3SYPA 3OEHG 4DR3B 3B40A 1EBOA 3E2EA 5TISZ 1ZL8B 4CS3A 2F4VB 4K8ZA 3ZMZA 4B08A 5LMNB 4YJ2A 4X1IA 2C2AA 5K1XA 3ZRWA 2A06H 3ZHTA 2P4VA 4R50A 2OCHA 4JYYA 1XHXA 2YEVA 2O57A 1Q6UA 4UUJC 5GONA 1OCOB 1AI7A 1KP3A 2QWPB 1XMQO 3H1IH 2K9PA 3KKYA 4LH7A 4LF5O 5BMVA 5ITZA 4GLXA 2CTRA 4XBFA 3OUFA 1VP7A 2XNDG 4GX2A 2CH7B 1RSOA 2CK3G 3CC7V 4J7JA 2P06A 4F6RB 2QM8A 3AG7A 4E4EA 1MA1A 4XDJA 1HW7A 3CCSV 3P3PA 1PL4A 3SPJA 5EZYB 3IFXA 5JCOA 2VRZA 4DV2B 1K5QA 1AI6A 2BTQA 2ZDIA 3P32A 1VF6A 3APQA 5EYPB 3TGUH 2QWNB 1VQOV 3BHPA 2Q5ZA 3ASOB 1EZJA 4CC5A 1GN3A 5E1AC 4H13B 2VQEO 3FB8C 4IGGA 3KG2A 4YJ3B 4QE9A 2H8PC 3DSQA 5KA5A 3ZHUA 2ZT9B 2Q68A 4P2ZA 1D2DA 4I55A 4GUNA 2X6BA 5H9CA 4I7ZB 3CXHF 1Y66A 2DYRC 3SPGA 2QA4V 4DR7O 3VQWA 3OMAB 3CCQV 1NJIW 3A0HZ 2VWKA 2QEXV 4EB6B 2R70A 4NTWA 4PHZA 5KHHA 2PI4A 4FLVA 5D5QA 5B1AB 3VQYA 4J42A 1KKCA 2VS0A 5LL6Y 3FB5C 2JK5C 4YXWG 3CJHA 3JSNA 2IU3A 5LGUA 2OIEA 3K5NA 4E2LA 5IYDO 2QR4A 4DR3O 1BSMA 4DUYB 3ZJZA 2F4VO 4K3AA 3FAVB 5LMNO 4F4LA 1WN7A 2PI5A 4GKJB 4LWSB 1JFFB 5LP6B 2EZPA 1JMKC 2EIMB 1Q82W 4X1YB 4KUMA 3ZMTA 1GH6A 1I0HA 2OTJV 2GTSA 1HNXB 2OTLV 3ZN0A 2FL4A 2YXHA 1FXVA 5KUMA 2QWRB 3IAYA 3P30A 4O4LA 1IDSA 3G80A 2QM7A 4TQDA 1N33B 3JD0A 1Y76A 3LUTB 2B1IA 1N8RW 2KQXA 1M93A 1FFXA 5AG2A 5DN6G 2RMKB 3HPLC 5E79Z 2QE7G 1Q86W 3UCSC 3DC6A 1IBMO 1B6QA 3BCCH 4ZHQB 1M5IA 1RFYA 4EEQA 3EVKA 4TT3G 1EN6A 1M4UA 3ZX6A 4DW0A 2DOSA 3K9SA 3OT7A 2BE3A 2JJ2G 3E89A 4O4HA 3E8HA 1OCOC 3M7MX 3JALB 1GN6A 1KU9A 2Q4PA 4PI2A 4LF9B 3EXAA 3AEIA 2AW9A 2EX3A 3JD3A 4FM2A 1YF2A 5J2TA 3BY6A 2HFEC 3AK3A 3SPCA 4LF8B 4DR4B 5JQGB 3L74H 5D5PA 2WLLA 3ZRVA 4WFFA 1TVKB 1UJWB 2DMXA 1XUQA 2A0LA 2ARHA 5FNVB 1H8EG 4HAMA 3QVNA 2CH7A 1PNKA 2B1GA 5L3EA 1VQKV 2Q0OC 2M6YA 1CXZB 2FMLA 4TV9A 2Q73A 3QF7A 1TUBB 4JTAB 4FIPC 3ETEA 4X20A 2QJ1A 3O65A 1M57B 2K1EA 3ASOC 1NKDA 1F51A 3N2KB 4PDLA 3HKDA 5CMUA 4DUYO 3RYCA 1P4RA 3H1LH 4I4TB 3E35A 2YDEA 4PDRA 4BIZA 4IHJA 2Y69B 1YCIA 3VBBA 4EFBA 4GKJO 2P6JA 3HKCA 3S3XA 5IDJA 1M90W 5IJ0B 3RYFA 4YHHB 1ORQC 4B3MB 3F7YC 2HR3A 1WP7A 5L3CA 3CC4V 5CN0A 2OIGA 5KX5A 2X6CA 2D3OW 3APOA 5B1AC 4YJ2B 4X1IB 4J41A 1GMGA 3ZRWB 2PGGA 1HNXO 2XOKG 4I5SA 1PNMA 3A0BZ 2VWJA 1K5SA 2QWOB 2YEVB 4EB6A 3W7UA 3NR7A 4QJFB 1WB7A 1N33O 5GONB 1KKDA 1V9PA 3H1JH 5CBHA 4DV6O 2KSDA 2CTPA 3TXSA 5BMVB 2JJ1G 5ITZB 1URFA 1TAEA 4AI8A 2UXBB 1X59A 1P7BA 1PD3A 2A3QA 3OMNB 3ZBHA 3FX7A 4JYAB 1AP5A 4WFAV 2XAHA 1SQGA 1QR8A 4EKWA 1K73W 3DXRB 4JZGA 5LP6C 4PA7A 4X62B 2EIMC 1IBKB 2UUCO 1E1QG 4H37A 4CC6A 4Z1VA 3NXSA 1B3QA 3SR2C 4K8XA 2P22C 4J7ZA 4LF9O 4ZBMA 4FLZA 4OPAA 3ASNB 1MMMA 2BTQB 5JH7A 1O9HA 1XILA 4F6EA 1NZ6A 4LF8O 4DR4O 4IL6Z 2LFRA 4NTXA 2EINC 4YY3B 4EFEA 3CX5F 3ABLB 1RM1B 1YDXA 1RP3B 4JV5B 3BVOA 2B5UA 2N05A 4UCVA 4HZ3A 3W7WA 1JCHA 2VQFB 3TJTA 4PELA 1IXMA 1XDCA 3T1HB 2UXXA 3H01A 4B7KA 4JI2B 1VQ9V 3T4DA 1FXHA 1XNRO 4MVQA 1BS3A 3RYHA 1LUWA 3VOUA 5KMGA 1WP8A 2CE4A 2QGNA 5L3GA 4UCRA 2JEUA 3C3SA 4ZHQA 4RQEA 5C8YA 1S5JA 4WBNA 2PTMA 4B7EA 3B77A 4IIJA 2CUGA 3CJHB 3CC2V 3JARA 1WLEA 4DK1A 3QO5A 2MW2B 4NXMB 4MW8A 4ASUG 1VQ6V 2BOBC 4YHHO 1SQFA 4B3MO 1Y4MA 5IJ9B 4G2KA 5A2QN 2R9RB 1YXBA 5LGNA 1W0KG 2Q7GA 1R73A 4LC1A 5DM6V 1I5YA 2EJRA 1XHZA 2YXYA 3BEHA 3ZRSA 3K0GA 1KB9F 4NB5A 3G6EV 4DR5B 3CCRV 3G6BA 2GTAA 3QNEA 4LFCB 3RN4A 1G8MA 4JZ2A 3LSSA 1BHBA 2RNBA 1TGOA 1NTKH 2Q0AA 5IE9A 2GBOA 2F95B 1M57C 2UU9B 5B1OA 3SDLA 3WG7B 1W0JG 5EC2C 2UXBO 2Y0PA 2BTOA 2ZNJA 3ZIAG 2ZIOA 1FXKA 4JYAO 1Y76B 2ZKOA 3FB6C 3STLC 2Y69C 1N4CA 4FLWA 1R6NA 1SQPH 4X62O 4NYKA 4JAVA 3LNMB 4WFHA 1IBKO 1FFTB 3R65A 4MVSA 2LW1A 3E22A 1Q8IA 3RWRD 4H44B 5B3SB 5IJ0A 2HHHB 1IBLB 3CS5A 3MAQA 2PUSA 3SYQA 2ITDC 1DK1A 2ZR3A 1XMOB 4D7SA 4O4HB 3JYCA 3QO7A 1B06A 1MOFA 1KMIZ 2GSMB 3STZC 1V55B 4YY3O 4MW3A 1AP6A 3CRAA 2JVDA 3ABUA 4JV5O 2R9AA 4UV8A 3B4SA 4MVZA 5J2TB 2FYUH 2HVKC 3UO2A 3LDDA 1YHQV 1O9GA 2VQFO 1AROP 4AQYB 2IU0A 1PL0A 4BW9A 3T1HO 3WB2A 1THZA 2QWQB 4JI2O 2WLLB 3K3WA 3ZMVA 4FMTA 1VQLV 2MK3A 3OFNG 2QDOA 5JJNB 5EK0A 3QTCA 3L73H 3CB2A 4JASA 1PP9H 4N21A 3JASA 3FKSG 2V7QG 3ZN1A 2EULA 1AR5A 3HKBB 1VF5B 2LW7A 3CCVV 5JCOC 3DXRA 4TV9B 3ASNC 2ZDIC 2DWEC 1YI2V 1VF6C 4X20B 4PA9A 1L1FA 2BOCC 3X2QB 1IBMB 1GAXA 4NXMO 5H5NA 3AG1B 5J2UA 4MTOA 1FPOA 3A8TA 1Q43A 2ZCEA 3K04A 3HKDB 2EILB 3ABLC 1RM1C 3RYCB 4I9QA 2ODMA 3OTFA 1ZX3A 2LJ2A 3RVYA 4X65O 3P3NA 1G1XB 2G38A 4IHJB 1QVGU 2PZSA 3BPZA 3TXQA 3HKCB 3ABTA 2UXNA 4GYCB 4DR5O 2P7TC 3RYFB 4LFCO 3FFQA 4DR6B 1AVMA 5HFMA 3OR6C 1MSDA 1US6A 4UCUA 3K06A 4OXSA 5KX5B 1M56B 4GCZA 4JI5B 4Q6GA 1WAZA 2UU9O 3H9VA 3JSLA 1COWG 2KB1A 2GUZA 2IH1C 5KHGA 1KQSU 2Q7EA 2JGDA 2W6IG 4X89A 5FL7G 3T1YB 2EZOA 2JS3A 3OW2U 1YIJV 1DF4A 3G4SV 4N23A 2Q67A 4KHPB 2FB5A 2Q8VA 1E1RG 2EJ7A 5HFLA 1M9NA 1Z5VA 3OR7C 3ML0A 1K34A 2HHHO 3JCUZ 5GTIZ 2WLHA 4FZ0A 4O4IA 1IBLO 5IJ9A 4R8CA 5H6QA 1QLNA 4TV8A 3L72H 1XMOO 2V1DA 4UCSA 2WLMA 2X6AA 1BCCH 2W6JG 2ZE5A 4MSWC 2XUMA 3TCUA 4ZOLA 3WB1A 3K58A 5JH7B 3WG7C 4DXWA 2LGQA 4NKGB 4ZI7A 4H33A 4AQYO 5KHIA 4JI4B 4FVMA 2HP8A 2WLIB 4MTFA 1IX9A 2H3OA 1DLBA 4JTDB 4CH4A 2YXLA 2R9IA 5BXZA 3THOA 3LSQA 2IJHA 4BWAA 2E75B 1QLEB 2UUAO 4DV6B 5LOVA 2JDIG 4H0LB 3CP1A 3AG2B 5L3FA 4WFEA 3RYHB 4U3JA 5KMGB 1U96A 4Q20A 3ZHQA 3H1HH 4GX0A 1JJ2U 2E5LB 1N32B 1SQXH 3PN1A 5C8YB 4A5UB 1S72V 1V55C 4WBNB 4FM0A 1XEQA 2GV9A 5B66Z 2UUCB 4B3SB 4IIJB 2JRIA 2WWWA 1HDJA 3JARB 5KUKA 5K1PA 2L35A 4DV4B 4LP8A 2RN9A 1XL6A 2NLJC 3BA8A 3SYOA 1BMFG 4DR6O 2OCCB 1OCRB 3W7SA 3R66A 3AG4B 1VF7A 4JI5O 2YS8A 2ETNA 4OGQB 1VQPV 4D7TA 3GB7C 1GM9A 1ZUQA 3OGCC 1GO3F 4WCEV 2XAQA 1KECA 5LMUB 1G4YB 2P67A 3ABKB 4JYBA 3VQVA 3X2QC 3HKBA 4PDVA 1SESA 1X4TA 3AG1C 3B2EE 1QU7A 1Z2GA 3T1YO 1N34B 4O4JB 1YTFD 1XNRB 3N27A 1F4MA 2EILC 4PV1B 4KHPO 2ZNIA 2BCCH 2A7WA 1I7FA 5LBQA 3BA9A 1FXKB 2Y48A 2YIDA 1BQ0A 4B3TB 2ZXWB 3OM3B 4PD4F 4JI0B 2XAJA 1QVFU 1D5NA 3JD4A 3ETDA 1TA8A 3JAWA 5LA6A 1M56C 3E22B 1QR9A 3FYEB 2XT9A 5IWAB 4DYLA 5EC1C 1ROPA 1MZEA 3T1CA 5GW7A 3OD4A 3HKEA 5IY5B 3CRQA 3J7AU 2LP7A 1K3EA 2E3CA 3LDCA 4DRXB 2YICA 4JI4O 2ZQMA 1VMGA 4MVMA 2ITCC 3U0ZA 1N0NA 4DO2A 1OV9A 4WFBV 4UV9A 4J9ZB 1FAFA 5LHGA 3UKMA 1NI8A 3OTOO 1NR7A 3L71H 3UO3A 2FTKA 1AJPA 4HNAA 1Q90D 3I5DA 3ZS8C 1R6KA 3JD2A 4W4LA 4RWUA 2UXDB 1IURA 1SQBH 2PF4E 2YIAA 1EM1A 2JGUA 1R6TA 2CTWA 1NBMG 3CRRA 4G28B 4DV5B 2E74B 1NS1A 2E5LO 3JASB 3RYIA 5KLVH 1NH2D 1N32O 2YI8A 4TUYA 2ZIMA 1JX9A 1GRJA 1BT8A 1L0LH 2RDCA 4B3SO 1QQCA 5LXTA 4C7UA 1N36B 4L87A 4NVPA 4MTGA 3L9DA 1PV0A 4DV4O 5J2UB 5EBLC 3BABA 1HNWB 5IYZB 2X0LA 4P9OA 4FJCC 5CA1A 3IC7A 4GZRB 1VARA 1Q7YW 3LNNA 1Q6IA 3SJCC 1AR1B 4FLTA 4O2BA 2WLIA 1OCCB 1PNLA 1QLEC 4FLUA 1UPGA 1HNZO 1Y74A 2F43G 2DN9A 1KYOF 3AG2C 3ZHSA 4X66B 5LMUO 1N0JA 2HG5C 2XASA 4GKKB 1WA8A 2YC0A 5KAIZ 1PPJH 2ADQB 3PJSK 2H94A 2KKWA 4QGPA 4ICGA 1N34O 2PYJA 4MTXA 1KBHA 4JI8B 1Y6XA 1XI1A 1CP9A 4BR6A 2GUZB 5LGTA 2Q69A 3SJAC 1BHAA 1GTOA 3WB0A 4CH6A 1XL4A 3DGEA 4D6TH 4B3TO 1H2KA 4JI0O 3ZEDA 3W7XA 4RAIA 1YJNV 2JGDB 1HP8A 3SJQC 1G6UA 1P84F 4GX1A 3LDEA 2OCCC 4CBCA 3S3WA 4OX9B 1OCRC 5DEDA 2HVJC 1WNSA 3AG4C 4TSFG 4TOIA 4LBEC 1NQTA 4AILC 1NT2B 5IWAO 4O4IB 4KFMA 1NVPB 2Z0AA 5IYCO 4X1KB 2IJKA 4QPJA 4TWKA 5BY1A 4X65B 4TV8B 3C90A 5L3BA 4Z2WA 2UUBB 1YSCA 2Y4TA 4I9WA 3ABKC 3CPWU 1KD1W 1NTZH 1JOYA 5BR8O 3FYIB 4ZIBA 4ZOLB 1F7YA 2DJVA 3H1KH 4JYCA 1DTOA 1HR0B 4BAYA 1SA0B 4ZI7B 4LF7B 3K57A 3ABMB 4UVBA 3K9AA 4UCOA 4JF3A 1FXKC 2R72A 5J9PC 2Q9LA 2ZXWC 3JAKA 2UXDO 3TK1A 4O4JA 2A9HA 3CE2A 4R6ZA 1SZTA 3U11A 4LNUA 4DV5O 1OHHG 2HJFC 4DR1B 4FPPA 5CBFA 2ILMA 4LR3A 1R3KC 3GWKC 5LOVB 3SYAA 3VQXA 1K7DA 4UVAA 1K9MW 1LUVA 4I0XA 1CPYA 3UT5A 1P49A 2WA3A 5KAFZ 4U3JB 1N36O 1AR4A 5IY5C 2XAGA 3T2MA 4BIUA 1AJQA 2IM9A 3CWBH 2ZE6A 3WFVA 4DV0O 4MVOA 3L75H 4CH3A 3D36A 4MVRA 5LYJA 1GM8A 1FS0G 4MVUA 1HNWO 1Q5OA 1QCEA 2QTOA 4K35A 4DRXA 3RVZA 2HLDG 2XAFA 2UXCB 1WJZA 1QNMA 1KUQA 2Y0IA 2Z5UA 5B5EZ 1AJNA 3BAAA 1OJHA 4X66O 2XTAA 1WPXA 4WF9V 4GKKO 4MS2A 4JI3B 2V4DA 2P5OA 2KG7B 3CYOA 2HKOA 4CS2A 4JI8O 3ZCCA 3O9OA 2M7WA 2EIJB 2P4KA 4P30A 2LFSA 1H2SB 5LHHA 2UUAB 4J11A 5JJJB 1GKFA 3J80N 3E83A 5B1BB 4I50A 5EIBC 4LF4B 4QIWF 2WPDG 1J95A 2AZ2A 4OX9O 4DK0A 3Q4HA 3AG3B 2PY5A 4J10A 2Z3YA 2AHZA 1JQ0A 3CCEV 2QKAA 2YIBD 3BFRA 1OCCC 5IYZA 1LNQA 3K59A 5KHKA 2CGOA 4WFGA 1SKVA 4X9QA 2JIZG 5JWPA 1SQQH 2E76B 1FJGB 4IYHA 2AXTZ 1GK9A 1SZXA 2UUBO 1H2MA 3JAWB 5A9GA 1AI4A 4CS4A 5KHJA 5LA6B 1GM7A 4DV7B 3N2GA 5H2FZ 1ZSPA 5LHIA 1HR0O 3HKEB 1F23A 1GN2A 5CB4A 4LF7O 3UM7A 4HBNA 1P7GA 4ABMA 1EZVH 3K5OA 1Y67A 1YEWA 1EFRG 3K79A 1DF5A 3AK2A 4UFZA 2HJDA 5CA0A 4B3RB 4DR1O 2YSUB 4HNAB 4FLXA 3E86A 1K97A 4PDMA 2RCVA 4LFAB 4DW1A 3UQ8A 2F93B 2BSKA 3T4ZA 3RT3C 3A0RA 3EFFK 3B8MA 5CBGA 3RYIB 1OCZB 4QNHB 4DUZB 1H2NA 2L6LA 4TUYB 4X1KA 3IGAC 1E79G 4BIOA 1L8DA 2DW4A 5LXTB 1PM9A 2ZE7A 1FKAO 4PA4A 4K0KO 1SRYA 1XNQB 3WU2Z 2UXCO 3L70H 5FPOA 2CAZC 4UXNA 3CCMV 3JATA 3ABMC 1NU1H 3GWOA 4RUEA 2FKXA 2ZINA 3DTUB 3CCJV 5JVDA 3OMIB 3SGIA 2DE0X 5CA1B 1SA0A 3MD0A 3CEIA 1KC8W 4JI3O 3KCYA 1NR1A 2WLNA 4JAAA 4JI7B 4O2BB 3ZMUA 4CZZA 4UB6Z 4JI1B 5F2VO 2A79B 4O2AA 1Y74B 3HB3B 1SETA 3MDSA 3OTOB 5IYBO 2GHYA 1BE3H 3I55V 4MT8A 2AHYA 3ZMSA 1WA8B 4IT5A
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 3K5L A;  5B3S C;  4U7N A;  5EBW C;  1VQM V;  4LH6 A;  3CME V;  1L0N H;  2IW5 A;  4LF4 O;  3CSX A;  1PKX A;  4J7K A;  1MNG A;  2QM4 A;  3D3Q A;  3RGB A;  3IC9 A;  1I5X A;  4R7C A;  3SJB C;  1JR9 A;  2DYS B;  2EIN B;  3RBZ A;  1S76 D;  2HEP A;  4TQF A;  1VQ7 V;  2OWO A;  1Q81 W;  1FJG O;  1K4C C;  5DEC A;  1ZTE A;  3OUS A;  4X88 A;  1V54 B;  3QO8 A;  3ETG A;  4PA3 A;  1W59 A;  2LO1 A;  4DV7 O;  4KP4 A;  1S0V A;  1YZB A;  4DV2 O;  3G67 A;  1FD9 A;  3JAM N;  2N04 A;  3D8C A;  3F7V C;  4L8J A;  1YJ9 V;  3W7T A;  1BL8 A;  2ATK C;  1ZL8 A;  3FD9 A;  2EIJ C;  2EBO A;  4CH5 A;  1TUE B;  5FPR A;  3D3I A;  2GDS A;  2KG7 A;  1MG1 A;  1R1B A;  3QG5 A;  4JGS A;  1A32 A;  1JPX A;  1I94 B;  2B9Z A;  1HNZ B;  2DQ3 A;  5B1B C;  4JI6 B;  4B3R O;  2DWD C;  3E8B A;  4NXN B;  4X64 B;  3CHX A;  3OE7 G;  3AG3 C;  2JEX A;  4AHC A;  2RQ6 A;  4FZ1 A;  3JAK B;  4LFA O;  2EIK B;  1XBL A;  3RW0 A;  1VEW A;  4DV1 B;  1AB3 A;  1SS3 A;  3A2F A;  2QKS A;  1EN4 A;  1WPB A;  2D2C B;  1IXB A;  1YVW A;  4LNU B;  2NNU A;  3LSU A;  3EHB B;  1SC5 B;  1S5L Z;  1U97 A;  3ETQ A;  4LF6 B;  1JVM A;  3KCX A;  3F5T A;  3SPH A;  4DUZ O;  2WA4 A;  1K92 A;  1JJO A;  4F6R A;  2F66 C;  1YJW V;  2ZM6 B;  2IH3 C;  4I0X B;  3UT5 B;  1R3L C;  3CCU V;  3CRM A;  3OGI B;  3F5W C;  4KL1 A;  4FFB B;  3U10 A;  1XNQ O;  3GVM A;  5EZY A;  1LR1 A;  2ZD9 A;  2CTQ A;  4GT1 A;  1VQN V;  4G27 B;  5LYJ B;  4QPK A;  2CGN A;  4IYI A;  3KZI Z;  5EYP A;  1QBZ A;  4LCU C;  4JI7 O;  3E8G A;  4JTC B;  4JI1 O;  3TET A;  5BR8 B;  1H8H G;  4FLY A;  3IJ4 A;  4YJ3 A;  3DC5 A;  4JAU A;  1SQV H;  1ZWI C;  1UFI A;  3BRC A;  1VQ5 V;  4OPH A;  1YTF B;  1FYJ A;  3E8F A;  3ZRX A;  3HR0 A;  3ZHR A;  1OCZ C;  5EIB D;  1D5A A;  5JJE B;  4DR2 B;  1ZAU A;  2P90 A;  1CEZ A;  2YIB A;  3ICX A;  4DV3 B;  1K8A W;  4LFB B;  2WLK A;  3AK1 A;  1K33 A;  1VIB A;  2XHB A;  1ZLZ A;  2ADP A;  2PYL A;  1NTM H;  4I50 B;  1H2L A;  4UVC A;  1K4D C;  3Q4H B;  5C93 A;  1J5E B;  4Z1M G;  2AZ0 A;  1QHT A;  1W2B U;  4XDK A;  4DV0 B;  1RSO B;  4GX5 A;  4HYO A;  4YIP A;  4U3F H;  3JD1 A;  3CXC U;  1R3I C;  2WSS G;  3FAV A;  3OEE G;  4PJ0 Z;  1IZ3 A;  5KA6 A;  1SF9 A;  4LWS A;  3N2G B;  1JFF A;  5LP6 A;  3OAA G;  1RPO A;  1I94 O;  2Y4U A;  3K5M A;  4ZKI A;  2DQ0 A;  1YIT V;  4JI6 O;  4X1Y A;  4NXN O;  5CB4 B;  4X64 O;  3M99 B;  3I56 V;  3K08 A;  1S77 D;  3CD6 V;  1F4N A;  2N74 A;  3FB7 C;  5L3D A;  4KXR A;  1XRE A;  1NVP D;  2DYS C;  1NH2 B;  4BW5 A;  3MHH C;  4QE7 A;  5H6R A;  4DV1 O;  1BZK A;  1ENV A;  2WAM A;  3K0D A;  5CA0 B;  1M1K W;  4LF6 O;  4RQF A;  2IJI A;  1V54 C;  3RFR A;  1JA8 A;  4I55 B;  1XMQ B;  2Q6A A;  1SER A;  1XOU A;  3J81 N;  2YUA A;  2LQT A;  3ZHV A;  1MZF A;  2ZM6 O;  1BGY H;  4NTY A;  4LF5 B;  2BSK B;  3JCZ A;  1EN5 A;  4U7O A;  1VQ8 V;  5B1N A;  2OT5 A;  2QTS A;  1IVS A;  2DYR B;  2X7R B;  1H38 A;  3SPI A;  2CDY A;  4J80 A;  2Q7H A;  4NR1 A;  1Z5W A;  1AI5 A;  2W0F C;  4X8A A;  2IBZ H;  3CCL V;  4J9Y B;  1S3J A;  3JAT B;  3JAL A;  1GN4 A;  1DGS A;  5JVD B;  3CMA V;  2EIK C;  1XQ8 A;  1B04 A;  1OZ0 A;  3CRC A;  1Q6H A;  2WLJ A;  3G71 V;  4FFK A;  5JQG A;  2QSA A;  2QKC A;  2F1M A;  2VQE B;  5FLX N;  4DR2 O;  1TVK A;  2OYQ A;  2YI9 A;  4O2A B;  2W0X A;  5GTH Z;  3MHS C;  2ZR2 A;  5IT9 N;  3C3T A;  4DV3 O;  4W4K A;  2ZE8 A;  4LFB O;  5FNV A;  3B8N A;  1T5E A;  4FK5 C;  1RPR A;  1HWY A;  4PA6 A;  1I08 A;  1MAB G;  4JPR A;  4UCT A;  1TUB A;  3D36 C;  1H2G A;  2NN4 A;  4RO2 A;  2LGW A;  1AIL A;  4DR7 B;  2RJZ A;  2F23 A;  4FFB A;  2IJJ A;  4XDL A;  1J5E O;  3M8A A;  2NR5 A;  4O4L B;  4FM1 A;  3SYC A;  4YIO A;  1VQ4 V;  5BZB A;  1WB8 A;  3N2K A;  1KP2 A;  1FFX B;  4P9P A;  2AGA A;  4I4T A;  1S5H C;  1MSW D;  1BQZ A;  4K0K B;  5EBM C;  4PI0 A;  4RUF A;  1Q3E A;  2JS5 A;  3K03 A;  4UB8 Z;  5CA3 A;  3B09 A;  1R3J C;  3SYP A;  3OEH G;  4DR3 B;  3B40 A;  1EBO A;  3E2E A;  5TIS Z;  1ZL8 B;  4CS3 A;  2F4V B;  4K8Z A;  3ZMZ A;  4B08 A;  5LMN B;  4YJ2 A;  4X1I A;  2C2A A;  5K1X A;  3ZRW A;  2A06 H;  3ZHT A;  2P4V A;  4R50 A;  2OCH A;  4JYY A;  1XHX A;  2YEV A;  2O57 A;  1Q6U A;  4UUJ C;  5GON A;  1OCO B;  1AI7 A;  1KP3 A;  2QWP B;  1XMQ O;  3H1I H;  2K9P A;  3KKY A;  4LH7 A;  4LF5 O;  5BMV A;  5ITZ A;  4GLX A;  2CTR A;  4XBF A;  3OUF A;  1VP7 A;  2XND G;  4GX2 A;  2CH7 B;  1RSO A;  2CK3 G;  3CC7 V;  4J7J A;  2P06 A;  4F6R B;  2QM8 A;  3AG7 A;  4E4E A;  1MA1 A;  4XDJ A;  1HW7 A;  3CCS V;  3P3P A;  1PL4 A;  3SPJ A;  5EZY B;  3IFX A;  5JCO A;  2VRZ A;  4DV2 B;  1K5Q A;  1AI6 A;  2BTQ A;  2ZDI A;  3P32 A;  1VF6 A;  3APQ A;  5EYP B;  3TGU H;  2QWN B;  1VQO V;  3BHP A;  2Q5Z A;  3ASO B;  1EZJ A;  4CC5 A;  1GN3 A;  5E1A C;  4H13 B;  2VQE O;  3FB8 C;  4IGG A;  3KG2 A;  4YJ3 B;  4QE9 A;  2H8P C;  3DSQ A;  5KA5 A;  3ZHU A;  2ZT9 B;  2Q68 A;  4P2Z A;  1D2D A;  4I55 A;  4GUN A;  2X6B A;  5H9C A;  4I7Z B;  3CXH F;  1Y66 A;  2DYR C;  3SPG A;  2QA4 V;  4DR7 O;  3VQW A;  3OMA B;  3CCQ V;  1NJI W;  3A0H Z;  2VWK A;  2QEX V;  4EB6 B;  2R70 A;  4NTW A;  4PHZ A;  5KHH A;  2PI4 A;  4FLV A;  5D5Q A;  5B1A B;  3VQY A;  4J42 A;  1KKC A;  2VS0 A;  5LL6 Y;  3FB5 C;  2JK5 C;  4YXW G;  3CJH A;  3JSN A;  2IU3 A;  5LGU A;  2OIE A;  3K5N A;  4E2L A;  5IYD O;  2QR4 A;  4DR3 O;  1BSM A;  4DUY B;  3ZJZ A;  2F4V O;  4K3A A;  3FAV B;  5LMN O;  4F4L A;  1WN7 A;  2PI5 A;  4GKJ B;  4LWS B;  1JFF B;  5LP6 B;  2EZP A;  1JMK C;  2EIM B;  1Q82 W;  4X1Y B;  4KUM A;  3ZMT A;  1GH6 A;  1I0H A;  2OTJ V;  2GTS A;  1HNX B;  2OTL V;  3ZN0 A;  2FL4 A;  2YXH A;  1FXV A;  5KUM A;  2QWR B;  3IAY A;  3P30 A;  4O4L A;  1IDS A;  3G80 A;  2QM7 A;  4TQD A;  1N33 B;  3JD0 A;  1Y76 A;  3LUT B;  2B1I A;  1N8R W;  2KQX A;  1M93 A;  1FFX A;  5AG2 A;  5DN6 G;  2RMK B;  3HPL C;  5E79 Z;  2QE7 G;  1Q86 W;  3UCS C;  3DC6 A;  1IBM O;  1B6Q A;  3BCC H;  4ZHQ B;  1M5I A;  1RFY A;  4EEQ A;  3EVK A;  4TT3 G;  1EN6 A;  1M4U A;  3ZX6 A;  4DW0 A;  2DOS A;  3K9S A;  3OT7 A;  2BE3 A;  2JJ2 G;  3E89 A;  4O4H A;  3E8H A;  1OCO C;  3M7M X;  3JAL B;  1GN6 A;  1KU9 A;  2Q4P A;  4PI2 A;  4LF9 B;  3EXA A;  3AEI A;  2AW9 A;  2EX3 A;  3JD3 A;  4FM2 A;  1YF2 A;  5J2T A;  3BY6 A;  2HFE C;  3AK3 A;  3SPC A;  4LF8 B;  4DR4 B;  5JQG B;  3L74 H;  5D5P A;  2WLL A;  3ZRV A;  4WFF A;  1TVK B;  1UJW B;  2DMX A;  1XUQ A;  2A0L A;  2ARH A;  5FNV B;  1H8E G;  4HAM A;  3QVN A;  2CH7 A;  1PNK A;  2B1G A;  5L3E A;  1VQK V;  2Q0O C;  2M6Y A;  1CXZ B;  2FML A;  4TV9 A;  2Q73 A;  3QF7 A;  1TUB B;  4JTA B;  4FIP C;  3ETE A;  4X20 A;  2QJ1 A;  3O65 A;  1M57 B;  2K1E A;  3ASO C;  1NKD A;  1F51 A;  3N2K B;  4PDL A;  3HKD A;  5CMU A;  4DUY O;  3RYC A;  1P4R A;  3H1L H;  4I4T B;  3E35 A;  2YDE A;  4PDR A;  4BIZ A;  4IHJ A;  2Y69 B;  1YCI A;  3VBB A;  4EFB A;  4GKJ O;  2P6J A;  3HKC A;  3S3X A;  5IDJ A;  1M90 W;  5IJ0 B;  3RYF A;  4YHH B;  1ORQ C;  4B3M B;  3F7Y C;  2HR3 A;  1WP7 A;  5L3C A;  3CC4 V;  5CN0 A;  2OIG A;  5KX5 A;  2X6C A;  2D3O W;  3APO A;  5B1A C;  4YJ2 B;  4X1I B;  4J41 A;  1GMG A;  3ZRW B;  2PGG A;  1HNX O;  2XOK G;  4I5S A;  1PNM A;  3A0B Z;  2VWJ A;  1K5S A;  2QWO B;  2YEV B;  4EB6 A;  3W7U A;  3NR7 A;  4QJF B;  1WB7 A;  1N33 O;  5GON B;  1KKD A;  1V9P A;  3H1J H;  5CBH A;  4DV6 O;  2KSD A;  2CTP A;  3TXS A;  5BMV B;  2JJ1 G;  5ITZ B;  1URF A;  1TAE A;  4AI8 A;  2UXB B;  1X59 A;  1P7B A;  1PD3 A;  2A3Q A;  3OMN B;  3ZBH A;  3FX7 A;  4JYA B;  1AP5 A;  4WFA V;  2XAH A;  1SQG A;  1QR8 A;  4EKW A;  1K73 W;  3DXR B;  4JZG A;  5LP6 C;  4PA7 A;  4X62 B;  2EIM C;  1IBK B;  2UUC O;  1E1Q G;  4H37 A;  4CC6 A;  4Z1V A;  3NXS A;  1B3Q A;  3SR2 C;  4K8X A;  2P22 C;  4J7Z A;  4LF9 O;  4ZBM A;  4FLZ A;  4OPA A;  3ASN B;  1MMM A;  2BTQ B;  5JH7 A;  1O9H A;  1XIL A;  4F6E A;  1NZ6 A;  4LF8 O;  4DR4 O;  4IL6 Z;  2LFR A;  4NTX A;  2EIN C;  4YY3 B;  4EFE A;  3CX5 F;  3ABL B;  1RM1 B;  1YDX A;  1RP3 B;  4JV5 B;  3BVO A;  2B5U A;  2N05 A;  4UCV A;  4HZ3 A;  3W7W A;  1JCH A;  2VQF B;  3TJT A;  4PEL A;  1IXM A;  1XDC A;  3T1H B;  2UXX A;  3H01 A;  4B7K A;  4JI2 B;  1VQ9 V;  3T4D A;  1FXH A;  1XNR O;  4MVQ A;  1BS3 A;  3RYH A;  1LUW A;  3VOU A;  5KMG A;  1WP8 A;  2CE4 A;  2QGN A;  5L3G A;  4UCR A;  2JEU A;  3C3S A;  4ZHQ A;  4RQE A;  5C8Y A;  1S5J A;  4WBN A;  2PTM A;  4B7E A;  3B77 A;  4IIJ A;  2CUG A;  3CJH B;  3CC2 V;  3JAR A;  1WLE A;  4DK1 A;  3QO5 A;  2MW2 B;  4NXM B;  4MW8 A;  4ASU G;  1VQ6 V;  2BOB C;  4YHH O;  1SQF A;  4B3M O;  1Y4M A;  5IJ9 B;  4G2K A;  5A2Q N;  2R9R B;  1YXB A;  5LGN A;  1W0K G;  2Q7G A;  1R73 A;  4LC1 A;  5DM6 V;  1I5Y A;  2EJR A;  1XHZ A;  2YXY A;  3BEH A;  3ZRS A;  3K0G A;  1KB9 F;  4NB5 A;  3G6E V;  4DR5 B;  3CCR V;  3G6B A;  2GTA A;  3QNE A;  4LFC B;  3RN4 A;  1G8M A;  4JZ2 A;  3LSS A;  1BHB A;  2RNB A;  1TGO A;  1NTK H;  2Q0A A;  5IE9 A;  2GBO A;  2F95 B;  1M57 C;  2UU9 B;  5B1O A;  3SDL A;  3WG7 B;  1W0J G;  5EC2 C;  2UXB O;  2Y0P A;  2BTO A;  2ZNJ A;  3ZIA G;  2ZIO A;  1FXK A;  4JYA O;  1Y76 B;  2ZKO A;  3FB6 C;  3STL C;  2Y69 C;  1N4C A;  4FLW A;  1R6N A;  1SQP H;  4X62 O;  4NYK A;  4JAV A;  3LNM B;  4WFH A;  1IBK O;  1FFT B;  3R65 A;  4MVS A;  2LW1 A;  3E22 A;  1Q8I A;  3RWR D;  4H44 B;  5B3S B;  5IJ0 A;  2HHH B;  1IBL B;  3CS5 A;  3MAQ A;  2PUS A;  3SYQ A;  2ITD C;  1DK1 A;  2ZR3 A;  1XMO B;  4D7S A;  4O4H B;  3JYC A;  3QO7 A;  1B06 A;  1MOF A;  1KMI Z;  2GSM B;  3STZ C;  1V55 B;  4YY3 O;  4MW3 A;  1AP6 A;  3CRA A;  2JVD A;  3ABU A;  4JV5 O;  2R9A A;  4UV8 A;  3B4S A;  4MVZ A;  5J2T B;  2FYU H;  2HVK C;  3UO2 A;  3LDD A;  1YHQ V;  1O9G A;  2VQF O;  1ARO P;  4AQY B;  2IU0 A;  1PL0 A;  4BW9 A;  3T1H O;  3WB2 A;  1THZ A;  2QWQ B;  4JI2 O;  2WLL B;  3K3W A;  3ZMV A;  4FMT A;  1VQL V;  2MK3 A;  3OFN G;  2QDO A;  5JJN B;  5EK0 A;  3QTC A;  3L73 H;  3CB2 A;  4JAS A;  1PP9 H;  4N21 A;  3JAS A;  3FKS G;  2V7Q G;  3ZN1 A;  2EUL A;  1AR5 A;  3HKB B;  1VF5 B;  2LW7 A;  3CCV V;  5JCO C;  3DXR A;  4TV9 B;  3ASN C;  2ZDI C;  2DWE C;  1YI2 V;  1VF6 C;  4X20 B;  4PA9 A;  1L1F A;  2BOC C;  3X2Q B;  1IBM B;  1GAX A;  4NXM O;  5H5N A;  3AG1 B;  5J2U A;  4MTO A;  1FPO A;  3A8T A;  1Q43 A;  2ZCE A;  3K04 A;  3HKD B;  2EIL B;  3ABL C;  1RM1 C;  3RYC B;  4I9Q A;  2ODM A;  3OTF A;  1ZX3 A;  2LJ2 A;  3RVY A;  4X65 O;  3P3N A;  1G1X B;  2G38 A;  4IHJ B;  1QVG U;  2PZS A;  3BPZ A;  3TXQ A;  3HKC B;  3ABT A;  2UXN A;  4GYC B;  4DR5 O;  2P7T C;  3RYF B;  4LFC O;  3FFQ A;  4DR6 B;  1AVM A;  5HFM A;  3OR6 C;  1MSD A;  1US6 A;  4UCU A;  3K06 A;  4OXS A;  5KX5 B;  1M56 B;  4GCZ A;  4JI5 B;  4Q6G A;  1WAZ A;  2UU9 O;  3H9V A;  3JSL A;  1COW G;  2KB1 A;  2GUZ A;  2IH1 C;  5KHG A;  1KQS U;  2Q7E A;  2JGD A;  2W6I G;  4X89 A;  5FL7 G;  3T1Y B;  2EZO A;  2JS3 A;  3OW2 U;  1YIJ V;  1DF4 A;  3G4S V;  4N23 A;  2Q67 A;  4KHP B;  2FB5 A;  2Q8V A;  1E1R G;  2EJ7 A;  5HFL A;  1M9N A;  1Z5V A;  3OR7 C;  3ML0 A;  1K34 A;  2HHH O;  3JCU Z;  5GTI Z;  2WLH A;  4FZ0 A;  4O4I A;  1IBL O;  5IJ9 A;  4R8C A;  5H6Q A;  1QLN A;  4TV8 A;  3L72 H;  1XMO O;  2V1D A;  4UCS A;  2WLM A;  2X6A A;  1BCC H;  2W6J G;  2ZE5 A;  4MSW C;  2XUM A;  3TCU A;  4ZOL A;  3WB1 A;  3K58 A;  5JH7 B;  3WG7 C;  4DXW A;  2LGQ A;  4NKG B;  4ZI7 A;  4H33 A;  4AQY O;  5KHI A;  4JI4 B;  4FVM A;  2HP8 A;  2WLI B;  4MTF A;  1IX9 A;  2H3O A;  1DLB A;  4JTD B;  4CH4 A;  2YXL A;  2R9I A;  5BXZ A;  3THO A;  3LSQ A;  2IJH A;  4BWA A;  2E75 B;  1QLE B;  2UUA O;  4DV6 B;  5LOV A;  2JDI G;  4H0L B;  3CP1 A;  3AG2 B;  5L3F A;  4WFE A;  3RYH B;  4U3J A;  5KMG B;  1U96 A;  4Q20 A;  3ZHQ A;  3H1H H;  4GX0 A;  1JJ2 U;  2E5L B;  1N32 B;  1SQX H;  3PN1 A;  5C8Y B;  4A5U B;  1S72 V;  1V55 C;  4WBN B;  4FM0 A;  1XEQ A;  2GV9 A;  5B66 Z;  2UUC B;  4B3S B;  4IIJ B;  2JRI A;  2WWW A;  1HDJ A;  3JAR B;  5KUK A;  5K1P A;  2L35 A;  4DV4 B;  4LP8 A;  2RN9 A;  1XL6 A;  2NLJ C;  3BA8 A;  3SYO A;  1BMF G;  4DR6 O;  2OCC B;  1OCR B;  3W7S A;  3R66 A;  3AG4 B;  1VF7 A;  4JI5 O;  2YS8 A;  2ETN A;  4OGQ B;  1VQP V;  4D7T A;  3GB7 C;  1GM9 A;  1ZUQ A;  3OGC C;  1GO3 F;  4WCE V;  2XAQ A;  1KEC A;  5LMU B;  1G4Y B;  2P67 A;  3ABK B;  4JYB A;  3VQV A;  3X2Q C;  3HKB A;  4PDV A;  1SES A;  1X4T A;  3AG1 C;  3B2E E;  1QU7 A;  1Z2G A;  3T1Y O;  1N34 B;  4O4J B;  1YTF D;  1XNR B;  3N27 A;  1F4M A;  2EIL C;  4PV1 B;  4KHP O;  2ZNI A;  2BCC H;  2A7W A;  1I7F A;  5LBQ A;  3BA9 A;  1FXK B;  2Y48 A;  2YID A;  1BQ0 A;  4B3T B;  2ZXW B;  3OM3 B;  4PD4 F;  4JI0 B;  2XAJ A;  1QVF U;  1D5N A;  3JD4 A;  3ETD A;  1TA8 A;  3JAW A;  5LA6 A;  1M56 C;  3E22 B;  1QR9 A;  3FYE B;  2XT9 A;  5IWA B;  4DYL A;  5EC1 C;  1ROP A;  1MZE A;  3T1C A;  5GW7 A;  3OD4 A;  3HKE A;  5IY5 B;  3CRQ A;  3J7A U;  2LP7 A;  1K3E A;  2E3C A;  3LDC A;  4DRX B;  2YIC A;  4JI4 O;  2ZQM A;  1VMG A;  4MVM A;  2ITC C;  3U0Z A;  1N0N A;  4DO2 A;  1OV9 A;  4WFB V;  4UV9 A;  4J9Z B;  1FAF A;  5LHG A;  3UKM A;  1NI8 A;  3OTO O;  1NR7 A;  3L71 H;  3UO3 A;  2FTK A;  1AJP A;  4HNA A;  1Q90 D;  3I5D A;  3ZS8 C;  1R6K A;  3JD2 A;  4W4L A;  4RWU A;  2UXD B;  1IUR A;  1SQB H;  2PF4 E;  2YIA A;  1EM1 A;  2JGU A;  1R6T A;  2CTW A;  1NBM G;  3CRR A;  4G28 B;  4DV5 B;  2E74 B;  1NS1 A;  2E5L O;  3JAS B;  3RYI A;  5KLV H;  1NH2 D;  1N32 O;  2YI8 A;  4TUY A;  2ZIM A;  1JX9 A;  1GRJ A;  1BT8 A;  1L0L H;  2RDC A;  4B3S O;  1QQC A;  5LXT A;  4C7U A;  1N36 B;  4L87 A;  4NVP A;  4MTG A;  3L9D A;  1PV0 A;  4DV4 O;  5J2U B;  5EBL C;  3BAB A;  1HNW B;  5IYZ B;  2X0L A;  4P9O A;  4FJC C;  5CA1 A;  3IC7 A;  4GZR B;  1VAR A;  1Q7Y W;  3LNN A;  1Q6I A;  3SJC C;  1AR1 B;  4FLT A;  4O2B A;  2WLI A;  1OCC B;  1PNL A;  1QLE C;  4FLU A;  1UPG A;  1HNZ O;  1Y74 A;  2F43 G;  2DN9 A;  1KYO F;  3AG2 C;  3ZHS A;  4X66 B;  5LMU O;  1N0J A;  2HG5 C;  2XAS A;  4GKK B;  1WA8 A;  2YC0 A;  5KAI Z;  1PPJ H;  2ADQ B;  3PJS K;  2H94 A;  2KKW A;  4QGP A;  4ICG A;  1N34 O;  2PYJ A;  4MTX A;  1KBH A;  4JI8 B;  1Y6X A;  1XI1 A;  1CP9 A;  4BR6 A;  2GUZ B;  5LGT A;  2Q69 A;  3SJA C;  1BHA A;  1GTO A;  3WB0 A;  4CH6 A;  1XL4 A;  3DGE A;  4D6T H;  4B3T O;  1H2K A;  4JI0 O;  3ZED A;  3W7X A;  4RAI A;  1YJN V;  2JGD B;  1HP8 A;  3SJQ C;  1G6U A;  1P84 F;  4GX1 A;  3LDE A;  2OCC C;  4CBC A;  3S3W A;  4OX9 B;  1OCR C;  5DED A;  2HVJ C;  1WNS A;  3AG4 C;  4TSF G;  4TOI A;  4LBE C;  1NQT A;  4AIL C;  1NT2 B;  5IWA O;  4O4I B;  4KFM A;  1NVP B;  2Z0A A;  5IYC O;  4X1K B;  2IJK A;  4QPJ A;  4TWK A;  5BY1 A;  4X65 B;  4TV8 B;  3C90 A;  5L3B A;  4Z2W A;  2UUB B;  1YSC A;  2Y4T A;  4I9W A;  3ABK C;  3CPW U;  1KD1 W;  1NTZ H;  1JOY A;  5BR8 O;  3FYI B;  4ZIB A;  4ZOL B;  1F7Y A;  2DJV A;  3H1K H;  4JYC A;  1DTO A;  1HR0 B;  4BAY A;  1SA0 B;  4ZI7 B;  4LF7 B;  3K57 A;  3ABM B;  4UVB A;  3K9A A;  4UCO A;  4JF3 A;  1FXK C;  2R72 A;  5J9P C;  2Q9L A;  2ZXW C;  3JAK A;  2UXD O;  3TK1 A;  4O4J A;  2A9H A;  3CE2 A;  4R6Z A;  1SZT A;  3U11 A;  4LNU A;  4DV5 O;  1OHH G;  2HJF C;  4DR1 B;  4FPP A;  5CBF A;  2ILM A;  4LR3 A;  1R3K C;  3GWK C;  5LOV B;  3SYA A;  3VQX A;  1K7D A;  4UVA A;  1K9M W;  1LUV A;  4I0X A;  1CPY A;  3UT5 A;  1P49 A;  2WA3 A;  5KAF Z;  4U3J B;  1N36 O;  1AR4 A;  5IY5 C;  2XAG A;  3T2M A;  4BIU A;  1AJQ A;  2IM9 A;  3CWB H;  2ZE6 A;  3WFV A;  4DV0 O;  4MVO A;  3L75 H;  4CH3 A;  3D36 A;  4MVR A;  5LYJ A;  1GM8 A;  1FS0 G;  4MVU A;  1HNW O;  1Q5O A;  1QCE A;  2QTO A;  4K35 A;  4DRX A;  3RVZ A;  2HLD G;  2XAF A;  2UXC B;  1WJZ A;  1QNM A;  1KUQ A;  2Y0I A;  2Z5U A;  5B5E Z;  1AJN A;  3BAA A;  1OJH A;  4X66 O;  2XTA A;  1WPX A;  4WF9 V;  4GKK O;  4MS2 A;  4JI3 B;  2V4D A;  2P5O A;  2KG7 B;  3CYO A;  2HKO A;  4CS2 A;  4JI8 O;  3ZCC A;  3O9O A;  2M7W A;  2EIJ B;  2P4K A;  4P30 A;  2LFS A;  1H2S B;  5LHH A;  2UUA B;  4J11 A;  5JJJ B;  1GKF A;  3J80 N;  3E83 A;  5B1B B;  4I50 A;  5EIB C;  4LF4 B;  4QIW F;  2WPD G;  1J95 A;  2AZ2 A;  4OX9 O;  4DK0 A;  3Q4H A;  3AG3 B;  2PY5 A;  4J10 A;  2Z3Y A;  2AHZ A;  1JQ0 A;  3CCE V;  2QKA A;  2YIB D;  3BFR A;  1OCC C;  5IYZ A;  1LNQ A;  3K59 A;  5KHK A;  2CGO A;  4WFG A;  1SKV A;  4X9Q A;  2JIZ G;  5JWP A;  1SQQ H;  2E76 B;  1FJG B;  4IYH A;  2AXT Z;  1GK9 A;  1SZX A;  2UUB O;  1H2M A;  3JAW B;  5A9G A;  1AI4 A;  4CS4 A;  5KHJ A;  5LA6 B;  1GM7 A;  4DV7 B;  3N2G A;  5H2F Z;  1ZSP A;  5LHI A;  1HR0 O;  3HKE B;  1F23 A;  1GN2 A;  5CB4 A;  4LF7 O;  3UM7 A;  4HBN A;  1P7G A;  4ABM A;  1EZV H;  3K5O A;  1Y67 A;  1YEW A;  1EFR G;  3K79 A;  1DF5 A;  3AK2 A;  4UFZ A;  2HJD A;  5CA0 A;  4B3R B;  4DR1 O;  2YSU B;  4HNA B;  4FLX A;  3E86 A;  1K97 A;  4PDM A;  2RCV A;  4LFA B;  4DW1 A;  3UQ8 A;  2F93 B;  2BSK A;  3T4Z A;  3RT3 C;  3A0R A;  3EFF K;  3B8M A;  5CBG A;  3RYI B;  1OCZ B;  4QNH B;  4DUZ B;  1H2N A;  2L6L A;  4TUY B;  4X1K A;  3IGA C;  1E79 G;  4BIO A;  1L8D A;  2DW4 A;  5LXT B;  1PM9 A;  2ZE7 A;  1FKA O;  4PA4 A;  4K0K O;  1SRY A;  1XNQ B;  3WU2 Z;  2UXC O;  3L70 H;  5FPO A;  2CAZ C;  4UXN A;  3CCM V;  3JAT A;  3ABM C;  1NU1 H;  3GWO A;  4RUE A;  2FKX A;  2ZIN A;  3DTU B;  3CCJ V;  5JVD A;  3OMI B;  3SGI A;  2DE0 X;  5CA1 B;  1SA0 A;  3MD0 A;  3CEI A;  1KC8 W;  4JI3 O;  3KCY A;  1NR1 A;  2WLN A;  4JAA A;  4JI7 B;  4O2B B;  3ZMU A;  4CZZ A;  4UB6 Z;  4JI1 B;  5F2V O;  2A79 B;  4O2A A;  1Y74 B;  3HB3 B;  1SET A;  3MDS A;  3OTO B;  5IYB O;  2GHY A;  1BE3 H;  3I55 V;  4MT8 A;  2AHY A;  3ZMS A;  1WA8 B;  4IT5 A; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...