1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
b'DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pollen allergen Ole e 6
molecule tags Allergen
source organism Olea europaea
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
4WFEA 2NN4A 2EINC 1FKAO 2K9PA 3ZHRA 3OEHG 1NR7A 2HJDA 2HLDG 3X2QB 3K9AA 3KCYA 3CCEV 1R3LC 1VQ5V 2LFSA 1WA8A 3AK2A 2OIGA 5GONA 3SPIA 1OCOC 2CK3G 4K8ZA 2VQEO 1XREA 2XTAA 5IY5C 4JI0O 3CCQV 3K08A 3N2KA 5IYZB 3E83A 3DXRA 3L70H 1TVKA 3W7UA 5LMUO 4FLXA 1QCEA 3I56V 4LC1A 4NXNB 2CE4A 4LNUA 2WA3A 2P22C 2WPDG 1QLEB 4MTFA 4ZI7A 2DYRB 2B1IA 5CN0A 2C2AA 4CS3A 4DYLA 2CGNA 1N33O 4PDRA 4DR4O 3BY6A 4JAVA 1SETA 3UT5B 1OJHA 4LFAB 4DR1O 2EILB 3RYFA 1IVSA 2GDSA 1XEQA 1THZA 1I08A 1DF4A 4DW0A 1VQ7V 4D6TH 3L72H 3A0HZ 4HAMA 3M8AA 1M90W 1HNWB 2XAGA 2ODMA 4FMTA 3IC9A 3JAMN 1YITV 2ZNJA 3CRQA 4BIUA 4I0XB 2GBOA 2E3CA 3LDCA 3K5OA 2EILC 1DTOA 1Y74B 3D36C 1US6A 2Y4UA 4FLUA 5KUMA 3JSNA 4CS4A 4DR5O 2AHZA 3BEHA 5B1AC 4UCUA 1ZUQA 2P6JA 2WLNA 4JF3A 2MK3A 4GUNA 1JQ0A 4IHJA 3LNMB 3ZMUA 1SC5B 4QE9A 3ASOB 5FNVA 5EZYB 1K8AW 3IC7A 3OR6C 1Q43A 3B77A 4NXMB 2DN9A 1QNMA 2E5LO 3TXSA 1RPOA 2N04A 4WFFA 2Q73A 5CBHA 1FAFA 1JCHA 2BTQA 3ZRXA 4DV7B 4LF8O 1GN6A 1Q6HA 2B5UA 1R3JC 5C8YB 2L35A 2DWEC 1BCCH 4PA9A 3B09A 3ETGA 4DO2A 5J2TA 1AP6A 2AZ0A 3T1YB 1F7YA 2Q4PA 1IBMO 2BE3A 5IT9N 3EFFK 3D3IA 4TUYB 3SJQC 4G28B 1FXVA 2PF4E 1JFFB 1GH6A 1VQ6V 3M7MX 2HJFC 4U7NA 2XNDG 1BHBA 3FB5C 4PELA 1KKDA 1KKCA 3JALA 2PYJA 3OAAG 3SR2C 2LQTA 1SQQH 3VQWA 1D5NA 2LGQA 1UPGA 1DF5A 5D5QA 3E22A 2FTKA 3KKYA 2XAFA 2RMKB 4HBNA 3RGBA 2HR3A 1KQSU 2AHYA 2YSUB 1F4NA 4TOIA 1P84F 3SPGA 3CCVV 2QKCA 2QTOA 5DM6V 2W6JG 1RSOB 4CH6A 2H3OA 3RFRA 1AI5A 1GM9A 3OGCC 1GN4A 1M56C 1Y74A 3PJSK 3ZHSA 3LSUA 2ETNA 1NVPD 3E2EA 1WP8A 3DXRB 4D7SA 3FKSG 4YIPA 4BWAA 4H13B 2IH1C 4BW9A 2Q7HA 3N2GA 4AI8A 4LF4B 1NVPB 3E8GA 3E8BA 2QJ1A 4IL6Z 5CBFA 2YS8A 4KFMA 4PI2A 5A2QN 4YY3O 4YJ3A 3OFNG 5JJEB 4DV2O 4ZKIA 1OZ0A 2EIMC 4KL1A 1VQ9V 1W2BU 3JD2A 3UT5A 2RN9A 3S3XA 3VQXA 1K4CC 4J41A 3ZRSA 2UUCO 4LF5O 2WLLB 3C90A 3SJAC 1XMQB 2IBZH 1X59A 1VMGA 2FB5A 2Q67A 2Q69A 3AK3A 2FYUH 1FJGB 4OX9O 1DGSA 2Y69B 4FFKA 1XUQA 1H2LA 1S0VA 1PL4A 3UCSC 4I55A 4DV5B 4LFBO 3K57A 4OX9B 3ZIAG 5JQGB 4GYCB 1PNKA 4TQDA 1NKDA 4OPHA 3P3NA 1L0LH 2VRZA 2A06H 4A5UB 3C3TA 5GTIZ 2KKWA 1G4YB 4J9ZB 4PI0A 2QWOB 4TQFA 2XUMA 3FFQA 4I50B 2CTWA 4UCRA 2HEPA 1IBKO 1K4DC 5CA1A 4X20A 3SJCC 4B7KA 5TISZ 1CXZB 4K3AA 1HNXO 3OTOO 1SF9A 4DV6O 1XI1A 4W4KA 1L8DA 3WU2Z 1NTKH 2PTMA 4FLZA 1IBKB 4QPKA 2B9ZA 3B2EE 4W4LA 5EBMC 1P49A 1M57C 2OTLV 2GHYA 1FYJA 2XAJA 2ZIMA 2AXTZ 1YF2A 2BSKB 4LF6B 1VQ8V 1CP9A 2DQ3A 1Z5WA 4IYHA 2PI4A 2Q0AA 3THOA 4NKGB 1TUBA 4JZ2A 3E8HA 5BZBA 3ZHQA 5LP6A 4LFCO 3DC6A 3CB2A 2QTSA 1K5SA 4PDLA 3E89A 5KA6A 1M57B 1MMMA 3CCUV 2R9IA 2UXCB 4UB8Z 2LW7A 1XDCA 1SQBH 3P30A 4X88A 1SKVA 3BPZA 1E1RG 1XMOB 4HZ3A 1ZAUA 3JD0A 2P4KA 4JI5B 3LUTB 4HNAB 5LMNB 1GN3A 1Q81W 5L3BA 4I5SA 4R8CA 1JPXA 1XMOO 1S5JA 1OCCC 1FXHA 4ZBMA 4DR6B 1GO3F 4DUZB 3H1KH 3CJHA 1PV0A 4EFBA 2BOCC 1IURA 1H2MA 1JJ2U 2QR4A 3WG7B 3OEEG 4DUZO 4FVMA 4I7ZB 3W7XA 2Z5UA 3SYOA 1OCZB 4PA3A 1WNSA 3LSQA 3CCMV 5FNVB 1EM1A 3DSQA 3JALB 4MW3A 2IU0A 2RNBA 1K34A 1DLBA 2P67A 4UVAA 1B3QA 1TA8A 3VBBA 2EIKC 3MHHC 4RUEA 1COWG 1AR4A 3OGIB 4GX5A 4PA4A 4PHZA 5CB4B 1R1BA 5JJNB 1VP7A 4AHCA 3K5LA 2HKOA 4I4TA 5K1PA 3CP1A 4CZZA 3T1HB 4KP4A 2CH7B 3H1HH 2B1GA 4CH4A 5EBLC 4EB6A 1Q86W 4FM2A 3AG2C 3AG1C 1GKFA 1EN5A 1RM1C 2EBOA 3ASNC 2GTAA 2VQFB 4Q20A 1HR0B 2QKAA 4NTWA 1VQNV 1LUWA 2AZ2A 4JYAB 5EZYA 4UCSA 1WPBA 1Y4MA 1FXKC 1ZL8B 3CSXA 3D8CA 4UV9A 3K5MA 3AG2B 2ZQMA 1PD3A 4MTGA 1QVFU 1SS3A 4LWSB 4CBCA 5EYPB 2Q5ZA 1K9MW 3F7VC 4YIOA 1DK1A 3TJTA 1TVKB 2HHHB 1ZL8A 5IJ0A 3EXAA 5B1BB 1TAEA 5L3DA 2EZPA 2WLJA 2Y0PA 2EZOA 3A0RA 3H1IH 2A3QA 4P2ZA 4JI0B 2HHHO 1QLEC 5LXTA 3CCJV 4X1YA 2F4VO 1QU7A 3CXCU 1HNZO 3BHPA 3ZS8C 1Q5OA 1NH2D 4H37A 2ZNIA 2DW4A 2AW9A 4TV9A 3JCUZ 1N36O 2IJIA 1RFYA 4I9WA 2F4VB 2GSMB 5IJ0B 1V54B 4O2BA 5C93A 2EIJC 3AEIA 5CMUA 2M7WA 4DV3O 3OW2U 3SPJA 1NZ6A 1N36B 3G4SV 3HKCA 3G71V 3CPWU 1Y76B 1GMGA 4HYOA 5JCOA 4DR1B 5CBGA 4NYKA 1K7DA 5EC2C 4DXWA 3RYHA 4PDMA 1TUEB 5LGNA 1KB9F 4B7EA 3K04A 1B04A 4MVQA 1ZSPA 5LGTA 5LYJB 5IJ9A 1QQCA 1B06A 2A7WA 2P06A 3ZMZA 1YJ9V 5LOVA 1P4RA 2DYRC 1JX9A 1E1QG 2ITCC 4JI2B 3CE2A 4JYYA 2BCCH 3CCRV 2CH7A 1WAZA 2GTSA 5LHHA 1FD9A 1QBZA 1LNQA 5L3GA 1H8HG 2PZSA 1K92A 3MAQA 3W7SA 2M6YA 4CH3A 3IJ4A 4K35A 1QVGU 2MW2B 2IJKA 1N0NA 5EIBC 2P4VA 2E5LB 1V54C 2JVDA 4PD4F 1NT2B 4O4IB 5HFLA 2CAZC 4EKWA 3K5NA 4LF8B 1G8MA 1R6KA 2QM4A 3ABLC 4X64B 2YUAA 3U0ZA 2JDIG 5B1AB 3O65A 1VQKV 3T1YO 1SQGA 2FKXA 1IXBA 1I94B 3CJHB 1QHTA 3ETEA 4JV5O 3ZMSA 2Z0AA 5KHGA 3GWKC 2YIBA 4KHPO 2QDOA 1GM7A 3UO2A 4F6RA 2OIEA 1VQLV 1K97A 4FFBA 3ZMVA 1NQTA 4PA7A 2JGDA 5FLXN 1PNMA 2DOSA 2ZDIC 3F7YC 1PKXA 1EFRG 1AJQA 4B3RB 3CHXA 1KC8W 3P3PA 1N4CA 3ZX6A 2IU3A 4MVRA 2X6BA 1K73W 5EC1C 1FS0G 1H38A 3QO8A 1NU1H 4X62B 3L74H 1YSCA 1P7GA 4DR7O 2JGUA 2CGOA 3JSLA 5J2UB 1IXMA 3A0BZ 5A9GA 1YIJV 2YXYA 1WA8B 2Q6AA 4FM0A 3JD4A 5KHHA 4OGQB 5E79Z 1N34O 3ZHVA 1AROP 2X7RB 3KCXA 3CXHF 4O4IA 4YHHO 3OTOB 1YTFD 4G2KA 3ABLB 3D3QA 1TGOA 3BRCA 5KMGB 4B3TB 1MG1A 4YJ2A 4AQYO 3FAVB 3OM3B 4FK5C 1MSDA 4YHHB 3B4SA 4PDVA 3HKDA 2VS0A 2EULA 5JVDB 4LF4O 2EJ7A 2H8PC 4JI6B 4CH5A 4LF6O 1OCZC 2OCCB 2GV9A 1XL6A 2ATKC 2K1EA 3AG4C 3ICXA 4BAYA 4B3SB 4MSWC 4RO2A 4DV2B 4FLWA 3CCSV 1IZ3A 1Q8IA 3ZN0A 1BSMA 4Z1MG 3BVOA 5IYBO 5ITZB 3J80N 5JH7B 1BMFG 3K06A 4LBEC 4I55B 2X6CA 4LF7O 2IM9A 4JI7B 1FXKA 1D5AA 2OCCC 2WA4A 3N2GB 3MHSC 4JI5O 5KAIZ 1GK9A 3AG4B 4JI3O 4QE7A 2R70A 4LF7B 4H33A 1FJGO 4TUYA 1T5EA 3QG5A 4JGSA 2Q7GA 1QR8A 4DR6O 4JTDB 2CUGA 2A79B 3OMAB 2YICA 4O4HB 3W7TA 5EBWC 4MVOA 5B1OA 2NLJC 1O9GA 2ZKOA 4GX0A 4F6EA 5DECA 1CPYA 3L9DA 2YEVA 3EVKA 1SA0A 1EZJA 4ABMA 1FFTB 5FL7G 4PA6A 3OMNB 2ZINA 2DYSB 5KHIA 3KG2A 4B3MB 1HP8A 2YI8A 5L3CA 2R72A 3RYIA 2PI5A 1SQPH 3SPCA 5IJ9B 5H2FZ 2X0LA 2R9RB 4O4JB 3FYEB 4TWKA 4O2AB 3TK1A 1NH2B 1YHQV 4GZRB 4MW8A 4WFAV 2R9AA 1W0KG 3M99B 3ZJZA 3T1HO 3DTUB 3E86A 4I0XA 3HKCB 4X9QA 1M9NA 2E75B 4O2AA 4DV0O 4X65O 3ML0A 2UU9B 2CDYA 2LW1A 4LFCB 2XOKG 1SQXH 4U3JB 4R50A 4DR3O 2VQFO 4ZHQB 1HR0O 1VQ4V 3I55V 3CX5F 3HKEB 4XBFA 3T2MA 2W6IG 5D5PA 3RYFB 4JI4O 4KUMA 3K9SA 4EB6B 4TSFG 4GKJB 4P30A 3TCUA 2XASA 5LXTB 3B8MA 1X4TA 3CEIA 1VARA 2WLKA 3JCZA 2KQXA 1AJNA 5KUKA 4X1KB 2ZT9B 3CRCA 3ABMC 2QWQB 5LA6B 1ROPA 4LNUB 3A8TA 5K1XA 1AI7A 5LP6C 3U10A 1BT8A 1MNGA 1BQZA 5CA3A 1K33A 2HVJC 2UXBO 2UXNA 1JVMA 5J2TB 2V4DA 3ZHTA 4NXNO 1W0JG 4UCVA 1IDSA 4MS2A 2VQEB 3RYIB 3FB8C 3NR7A 1R3IC 1WLEA 2Y0IA 4J9YB 2UXBB 3ZCCA 2BTQB 4U3FH 4QNHB 1I7FA 4GLXA 2ZXWC 3CRMA 2XT9A 4DUYO 2IJHA 3L75H 3BA8A 2UUBB 1IBLB 3SPHA 3HKEA 3HKBB 1M1KW 1IX9A 3W7WA 3JYCA 3LSSA 1WP7A 3IGAC 1M56B 4WBNA 1VEWA 1IBLO 1KP2A 1D2DA 1NJIW 1ZWIC 4HNAA 1KD1W 4CC5A 2GUZB 2ZXWB 4ZI7B 4QIWF 1E79G 5KX5B 3A2FA 2JRIA 4O4LB 5KMGA 1Y6XA 3B40A 4F4LA 2ZCEA 1EN4A 1R3KC 1LUVA 2OWOA 2HVKC 4U7OA 1FXKB 5IYDO 1MABG 2JS5A 3ZRWA 4H0LB 4MVZA 1FFXB 1YZBA 4UFZA 3F5TA 4QJFB 3CYOA 2QWRB 3STLC 4DV4O 4GX1A 1AI4A 5GONB 1SRYA 1KUQA 1AILA 3CD6V 5H6RA 5B5EZ 1AVMA 4NXMO 2XAQA 4DV4B 2JS3A 1KYOF 1FPOA 1YTFB 2YEVB 3MD0A 3JARA 4DR2O 3OUFA 1ZX3A 2RQ6A 4ASUG 3FAVA 4B08A 3RN4A 2ZE5A 5CA1B 3ZN1A 2L6LA 4DK1A 1KBHA 3JARB 1IBMB 1SQFA 1BE3H 2JEUA 4JI8B 1XNQO 3SYQA 2KG7A 4XDKA 2H94A 3GB7C 5LOVB 4EEQA 1Z2GA 1I94O 2F66C 5BY1A 1VQOV 5J2UA 2ZR2A 4JI8O 4GCZA 1SQVH 1LR1A 4KHPB 1TUBB 5IE9A 4CC6A 4CS2A 1KMIZ 5B1BC 2WWWA 3X2QC 2LP7A 5AG2A 4X1IA 5BMVB 1VQMV 4NTXA 3QF7A 4O4LA 2FMLA 3HPLC 3G67A 1AP5A 1HDJA 5CA0A 2JEXA 3VOUA 1J5EO 4XDLA 3RBZA 2WLLA 2YXLA 1XBLA 4NB5A 2UUAB 3E8FA 4MVSA 1BS3A 2HG5C 1NBMG 1AR1B 1J5EB 3OMIB 3JD3A 3HKBA 4LH7A 5IWAB 2UUAO 2OTJV 4MT8A 3FB7C 4ZOLB 2ZDIA 3WFVA 5B3SB 1VF6C 2UXXA 1L1FA 1NTZH 1R6TA 5BXZA 3N27A 5LYJA 2ZD9A 4YXWG 2ILMA 1QR9A 3RT3C 3ZRWB 3WB2A 3QO5A 3JAKA 3ZMTA 4NVPA 3SDLA 4JTCB 1YI2V 4UV8A 2QGNA 4EFEA 3BA9A 3RW0A 3SYCA 2E76B 3JAWB 3GWOA 5LHGA 2NR5A 3ZHUA 5DN6G 2Q68A 3CS5A 5L3FA 3I5DA 5IDJA 4IT5A 4FJCC 5KLVH 4WFBV 1Y67A 4X64O 3QVNA 2CTPA 4MVUA 4P9OA 2DE0X 1URFA 4JZGA 4F6RB 5JJJB 4FZ1A 2A0LA 3G6BA 2WLHA 3G80A 2OT5A 3K0DA 3CCLV 4JI7O 1BL8A 4PJ0Z 2FL4A 1SESA 1G6UA 1Q6IA 3D36A 1R6NA 3H01A 1H2SB 3UQ8A 3H1JH 2UUCB 4LF5B 4DV5O 4LFBB 3K58A 1AJPA 4JAAA 5L3EA 1VIBA 4JPRA 2QM8A 4J42A 5FPRA 5KHJA 3RYCB 1NI8A 1XQ8A 1MZEA 1XHXA 1Q82W 1YEWA 1MZFA 1M93A 3AG1B 3UKMA 4X62O 3U11A 3ASNB 4Z1VA 4O2BB 5LL6Y 4TV8B 2EJRA 3CWBH 4FZ0A 2WLIB 4RAIA 3SYPA 3UM7A 3E35A 3E22B 5JCOC 4DRXA 2PUSA 1MA1A 3ETQA 3MDSA 4K8XA 3UO3A 4MVMA 4X8AA 1RPRA 1AB3A 2Q7EA 4U3JA 4X89A 3RVYA 1JR9A 1OCRB 1S77D 3BCCH 3JATA 3JASA 2P7TC 4RQFA 4E4EA 2NNUA 1VF7A 3OD4A 4B3SO 2HP8A 1VF6A 5IYCO 2WAMA 4X1IB 5BMVA 1OCOB 4XDJA 4ICGA 3FX7A 1WB8A 3JATB 5F2VO 2F23A 5J9PC 4JI4B 4IIJA 1OCRC 1ZLZA 3BFRA 4GKJO 4FPPA 4RUFA 2ZE8A 1U96A 2N74A 1NR1A 4BW5A 2EIKB 3AK1A 4FIPC 3JD1A 4JI1O 1H2KA 3APQA 3QNEA 4P9PA 1YXBA 4UVBA 4LCUC 2AGAA 2JJ2G 2YC0A 5H9CA 3CC4V 2BSKA 2QSAA 1KP3A 4X1YB 3CMAV 3QTCA 2YXHA 2YDEA 5GTHZ 2QWPB 3ZRVA 2XAHA 3GVMA 3FD9A 4TV8A 1JMKC 3BAAA 4X20B 1F4MA 3WB1A 4I50A 2N05A 4LF9O 2ARHA 5EYPA 5LMUB 1I0HA 4UB6Z 3CMEV 1H2NA 4WFGA 2RJZA 3JAKB 1Q3EA 3N2KB 2A9HA 1PM9A 2LJ2A 4LF9B 4DUYB 1H8EG 4UVCA 2EX3A 1JOYA 3OT7A 1V9PA 4OXSA 3K79A 3T4ZA 5JQGA 1SERA 4UUJC 1UJWB 2YIAA 1B6QA 5EK0A 4ZOLA 2F93B 2Y48A 5ITZA 4LFAO 4BR6A 2EINB 1W59A 4X66O 2ZM6B 4MTOA 4J7JA 3LDEA 2ADQB 1H2GA 3STZC 1J95A 2QA4V 1V55C 2JGDB 2F43G 4DV0B 4I4TB 1F23A 3SGIA 2WLMA 2UU9O 3FYIB 3RWRD 4DW1A 2JJ1G 3HKDB 4YJ2B 1YCIA 1P7BA 3LDDA 4I9QA 2F95B 4LR3A 4D7TA 5H6QA 1S72V 4KXRA 4FM1A 1BGYH 3P32A 3H1LH 1SZXA 2QE7G 3Q4HB 2EIJB 1S5HC 3WB0A 5LGUA 2IJJA 2KSDA 3PN1A 2KG7B 3L73H 4L87A 1FFXA 3K59A 3AG7A 4WF9V 3TXQA 4E2LA 1HNZB 1RSOA 4DV7O 2QM7A 3OTFA 1EN6A 3LNNA 4J7KA 1Q90D 2GUZA 4X1KA 1XNQB 1M5IA 3ZBHA 2QKSA 4IYIA 2W0FC 3CRAA 4PV1B 1JJOA 1V55B 2ADPA 2UUBO 3K0GA 5BR8O 5HFMA 4FLYA 1VQPV 1EBOA 1N33B 2RCVA 4DR4B 1MOFA 3TGUH 4GT1A 2Q9LA 1K3EA 4ZHQA 1I5XA 1YJNV 5BR8B 1OCCB 3Q4HA 1OHHG 4DV3B 4IIJB 3RVZA 1L0NH 3QO7A 4J80A 2BTOA 3ABKC 2O57A 3J81N 1GTOA 4JI2O 3H9VA 2UXDB 1WPXA 3VQYA 1U97A 2DWDC 1Y76A 3SJBC 1HNWO 1YDXA 4RQEA 2YI9A 2X6AA 4R6ZA 3IAYA 3BABA 4JYCA 4J10A 5IY5B 2PYLA 2UXDO 2DQ0A 1KU9A 4NTYA 4O4JA 1WJZA 4WBNB 3CRRA 1QLNA 4FLVA 4DR5B 4LP8A 2WSSG 1XNRO 1M4UA 5B1NA 4R7CA 2PGGA 2LFRA 1BHAA 1WB7A 1YJWV 4BIZA 1XHZA 4DR2B 1XNRB 1SA0B 2JIZG 4OPAA 2W0XA 4GKKO 2ZIOA 1UFIA 2Z3YA 3HB3B 1NS1A 2PY5A 4WFHA 3RYHB 3OE7G 1PP9H 1Y66A 4LWSA 4GKKB 1OV9A 1PPJH 3NXSA 5FPOA 1NTMH 5LA6A 1XOUA 3AG3B 4DV1B 1KECA 3ABKB 4L8JA 1S76D 1G1XB 4N21A 3JASB 2LGWA 2V1DA 5E1AC 5KAFZ 4DV1O 4TV9B 5JH7A 4B3RO 4NR1A 3R66A 4JV5B 4YJ3B 3AG3C 3KZIZ 3ASOC 5JWPA 1GAXA 4RWUA 3T1CA 2WLIA 1ORQC 4IHJB 5GW7A 2ITDC 5B3SC 4FLTA 2VWJA 1N34B 1HWYA 3ETDA 4IGGA 1GM8A 1I5YA 3K3WA 5IWAO 4UCOA 1VF5B 5DEDA 4QGPA 1CEZA 1N8RW 2QEXV 1RP3B 4DR7B 4J11A 2YIDA 5LHIA 4DV6B 1ZTEA 3FB6C 1GRJA 4Z2WA 1XL4A 2YIBD 1HW7A 4J7ZA 2G38A 3R65A 2IW5A 2HFEC 4AILC 2RDCA 3ABMB 4TT3G 2ZR3A 3S3WA 4DRXB 4B3TO 4AQYB 2Y69C 1JA8A 4YY3B 4JI6O 2CTQA 3L71H 1S5LZ 4G27B 1Q7YW 5CB4A 5JVDA 1JFFA 1AI6A 3WG7C 2UXCO 3K03A 3OUSA 3RYCA 4DK0A 4Q6GA 1N0JA 3CC7V 3JAWA 1XMQO 3CC2V 1AR5A 2OYQA 1S3JA 4UCTA 4JI1B 2D2CB 3APOA 4ZIBA 5LMNO 2Y4TA 4JAUA 1WN7A 2IH3C 5C8YA 4C7UA 3O9OA 1K5QA 4LH6A 3J7AU 4JASA 3G6EV 4GX2A 2CTRA 4BIOA 4JI3B 4MTXA 5KHKA 4N23A 3T4DA 2V7QG 3TETA 1ENVA 2KB1A 3HR0A 3ABUA 4UXNA 1EZVH 3C3SA 4JTAB 3DC5A 5B66Z 1SZTA 1Z5VA 4O4HA 3DGEA 1BQ0A 4QPJA 2LO1A 1RM1B 2EIMB 2F1MA 2Q0OC 5CA0B 5H5NA 1HNXB 4K0KB 5LBQA 2XHBA 3ZEDA 2ZE6A 3F5WC 5IYZA 1BZKA 4B3MO 1MSWD 5EIBD 2JK5C 1A32A 4K0KO 3SYAA 2QWNB 4X66B 2Q8VA 3EHBB 2ZM6O 3OR7C 5LP6B 1N32B 1Q6UA 4H44B 1XILA 4DR3B 3VQVA 1PL0A 4JYBA 3IFXA 2D3OW 2VWKA 1YVWA 1N32O 1PNLA 3B8NA 5KX5A 2BOBC 2P5OA 5KA5A 1F51A 4WCEV 4X65B 2DYSC 1R73A 1O9HA 2OCHA 1GN2A 4JYAO 2ZE7A 2E74B 4FFBB 2DMXA 2P90A 3ABTA 2DJVA
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 4WFE A;  2NN4 A;  2EIN C;  1FKA O;  2K9P A;  3ZHR A;  3OEH G;  1NR7 A;  2HJD A;  2HLD G;  3X2Q B;  3K9A A;  3KCY A;  3CCE V;  1R3L C;  1VQ5 V;  2LFS A;  1WA8 A;  3AK2 A;  2OIG A;  5GON A;  3SPI A;  1OCO C;  2CK3 G;  4K8Z A;  2VQE O;  1XRE A;  2XTA A;  5IY5 C;  4JI0 O;  3CCQ V;  3K08 A;  3N2K A;  5IYZ B;  3E83 A;  3DXR A;  3L70 H;  1TVK A;  3W7U A;  5LMU O;  4FLX A;  1QCE A;  3I56 V;  4LC1 A;  4NXN B;  2CE4 A;  4LNU A;  2WA3 A;  2P22 C;  2WPD G;  1QLE B;  4MTF A;  4ZI7 A;  2DYR B;  2B1I A;  5CN0 A;  2C2A A;  4CS3 A;  4DYL A;  2CGN A;  1N33 O;  4PDR A;  4DR4 O;  3BY6 A;  4JAV A;  1SET A;  3UT5 B;  1OJH A;  4LFA B;  4DR1 O;  2EIL B;  3RYF A;  1IVS A;  2GDS A;  1XEQ A;  1THZ A;  1I08 A;  1DF4 A;  4DW0 A;  1VQ7 V;  4D6T H;  3L72 H;  3A0H Z;  4HAM A;  3M8A A;  1M90 W;  1HNW B;  2XAG A;  2ODM A;  4FMT A;  3IC9 A;  3JAM N;  1YIT V;  2ZNJ A;  3CRQ A;  4BIU A;  4I0X B;  2GBO A;  2E3C A;  3LDC A;  3K5O A;  2EIL C;  1DTO A;  1Y74 B;  3D36 C;  1US6 A;  2Y4U A;  4FLU A;  5KUM A;  3JSN A;  4CS4 A;  4DR5 O;  2AHZ A;  3BEH A;  5B1A C;  4UCU A;  1ZUQ A;  2P6J A;  2WLN A;  4JF3 A;  2MK3 A;  4GUN A;  1JQ0 A;  4IHJ A;  3LNM B;  3ZMU A;  1SC5 B;  4QE9 A;  3ASO B;  5FNV A;  5EZY B;  1K8A W;  3IC7 A;  3OR6 C;  1Q43 A;  3B77 A;  4NXM B;  2DN9 A;  1QNM A;  2E5L O;  3TXS A;  1RPO A;  2N04 A;  4WFF A;  2Q73 A;  5CBH A;  1FAF A;  1JCH A;  2BTQ A;  3ZRX A;  4DV7 B;  4LF8 O;  1GN6 A;  1Q6H A;  2B5U A;  1R3J C;  5C8Y B;  2L35 A;  2DWE C;  1BCC H;  4PA9 A;  3B09 A;  3ETG A;  4DO2 A;  5J2T A;  1AP6 A;  2AZ0 A;  3T1Y B;  1F7Y A;  2Q4P A;  1IBM O;  2BE3 A;  5IT9 N;  3EFF K;  3D3I A;  4TUY B;  3SJQ C;  4G28 B;  1FXV A;  2PF4 E;  1JFF B;  1GH6 A;  1VQ6 V;  3M7M X;  2HJF C;  4U7N A;  2XND G;  1BHB A;  3FB5 C;  4PEL A;  1KKD A;  1KKC A;  3JAL A;  2PYJ A;  3OAA G;  3SR2 C;  2LQT A;  1SQQ H;  3VQW A;  1D5N A;  2LGQ A;  1UPG A;  1DF5 A;  5D5Q A;  3E22 A;  2FTK A;  3KKY A;  2XAF A;  2RMK B;  4HBN A;  3RGB A;  2HR3 A;  1KQS U;  2AHY A;  2YSU B;  1F4N A;  4TOI A;  1P84 F;  3SPG A;  3CCV V;  2QKC A;  2QTO A;  5DM6 V;  2W6J G;  1RSO B;  4CH6 A;  2H3O A;  3RFR A;  1AI5 A;  1GM9 A;  3OGC C;  1GN4 A;  1M56 C;  1Y74 A;  3PJS K;  3ZHS A;  3LSU A;  2ETN A;  1NVP D;  3E2E A;  1WP8 A;  3DXR B;  4D7S A;  3FKS G;  4YIP A;  4BWA A;  4H13 B;  2IH1 C;  4BW9 A;  2Q7H A;  3N2G A;  4AI8 A;  4LF4 B;  1NVP B;  3E8G A;  3E8B A;  2QJ1 A;  4IL6 Z;  5CBF A;  2YS8 A;  4KFM A;  4PI2 A;  5A2Q N;  4YY3 O;  4YJ3 A;  3OFN G;  5JJE B;  4DV2 O;  4ZKI A;  1OZ0 A;  2EIM C;  4KL1 A;  1VQ9 V;  1W2B U;  3JD2 A;  3UT5 A;  2RN9 A;  3S3X A;  3VQX A;  1K4C C;  4J41 A;  3ZRS A;  2UUC O;  4LF5 O;  2WLL B;  3C90 A;  3SJA C;  1XMQ B;  2IBZ H;  1X59 A;  1VMG A;  2FB5 A;  2Q67 A;  2Q69 A;  3AK3 A;  2FYU H;  1FJG B;  4OX9 O;  1DGS A;  2Y69 B;  4FFK A;  1XUQ A;  1H2L A;  1S0V A;  1PL4 A;  3UCS C;  4I55 A;  4DV5 B;  4LFB O;  3K57 A;  4OX9 B;  3ZIA G;  5JQG B;  4GYC B;  1PNK A;  4TQD A;  1NKD A;  4OPH A;  3P3N A;  1L0L H;  2VRZ A;  2A06 H;  4A5U B;  3C3T A;  5GTI Z;  2KKW A;  1G4Y B;  4J9Z B;  4PI0 A;  2QWO B;  4TQF A;  2XUM A;  3FFQ A;  4I50 B;  2CTW A;  4UCR A;  2HEP A;  1IBK O;  1K4D C;  5CA1 A;  4X20 A;  3SJC C;  4B7K A;  5TIS Z;  1CXZ B;  4K3A A;  1HNX O;  3OTO O;  1SF9 A;  4DV6 O;  1XI1 A;  4W4K A;  1L8D A;  3WU2 Z;  1NTK H;  2PTM A;  4FLZ A;  1IBK B;  4QPK A;  2B9Z A;  3B2E E;  4W4L A;  5EBM C;  1P49 A;  1M57 C;  2OTL V;  2GHY A;  1FYJ A;  2XAJ A;  2ZIM A;  2AXT Z;  1YF2 A;  2BSK B;  4LF6 B;  1VQ8 V;  1CP9 A;  2DQ3 A;  1Z5W A;  4IYH A;  2PI4 A;  2Q0A A;  3THO A;  4NKG B;  1TUB A;  4JZ2 A;  3E8H A;  5BZB A;  3ZHQ A;  5LP6 A;  4LFC O;  3DC6 A;  3CB2 A;  2QTS A;  1K5S A;  4PDL A;  3E89 A;  5KA6 A;  1M57 B;  1MMM A;  3CCU V;  2R9I A;  2UXC B;  4UB8 Z;  2LW7 A;  1XDC A;  1SQB H;  3P30 A;  4X88 A;  1SKV A;  3BPZ A;  1E1R G;  1XMO B;  4HZ3 A;  1ZAU A;  3JD0 A;  2P4K A;  4JI5 B;  3LUT B;  4HNA B;  5LMN B;  1GN3 A;  1Q81 W;  5L3B A;  4I5S A;  4R8C A;  1JPX A;  1XMO O;  1S5J A;  1OCC C;  1FXH A;  4ZBM A;  4DR6 B;  1GO3 F;  4DUZ B;  3H1K H;  3CJH A;  1PV0 A;  4EFB A;  2BOC C;  1IUR A;  1H2M A;  1JJ2 U;  2QR4 A;  3WG7 B;  3OEE G;  4DUZ O;  4FVM A;  4I7Z B;  3W7X A;  2Z5U A;  3SYO A;  1OCZ B;  4PA3 A;  1WNS A;  3LSQ A;  3CCM V;  5FNV B;  1EM1 A;  3DSQ A;  3JAL B;  4MW3 A;  2IU0 A;  2RNB A;  1K34 A;  1DLB A;  2P67 A;  4UVA A;  1B3Q A;  1TA8 A;  3VBB A;  2EIK C;  3MHH C;  4RUE A;  1COW G;  1AR4 A;  3OGI B;  4GX5 A;  4PA4 A;  4PHZ A;  5CB4 B;  1R1B A;  5JJN B;  1VP7 A;  4AHC A;  3K5L A;  2HKO A;  4I4T A;  5K1P A;  3CP1 A;  4CZZ A;  3T1H B;  4KP4 A;  2CH7 B;  3H1H H;  2B1G A;  4CH4 A;  5EBL C;  4EB6 A;  1Q86 W;  4FM2 A;  3AG2 C;  3AG1 C;  1GKF A;  1EN5 A;  1RM1 C;  2EBO A;  3ASN C;  2GTA A;  2VQF B;  4Q20 A;  1HR0 B;  2QKA A;  4NTW A;  1VQN V;  1LUW A;  2AZ2 A;  4JYA B;  5EZY A;  4UCS A;  1WPB A;  1Y4M A;  1FXK C;  1ZL8 B;  3CSX A;  3D8C A;  4UV9 A;  3K5M A;  3AG2 B;  2ZQM A;  1PD3 A;  4MTG A;  1QVF U;  1SS3 A;  4LWS B;  4CBC A;  5EYP B;  2Q5Z A;  1K9M W;  3F7V C;  4YIO A;  1DK1 A;  3TJT A;  1TVK B;  2HHH B;  1ZL8 A;  5IJ0 A;  3EXA A;  5B1B B;  1TAE A;  5L3D A;  2EZP A;  2WLJ A;  2Y0P A;  2EZO A;  3A0R A;  3H1I H;  2A3Q A;  4P2Z A;  4JI0 B;  2HHH O;  1QLE C;  5LXT A;  3CCJ V;  4X1Y A;  2F4V O;  1QU7 A;  3CXC U;  1HNZ O;  3BHP A;  3ZS8 C;  1Q5O A;  1NH2 D;  4H37 A;  2ZNI A;  2DW4 A;  2AW9 A;  4TV9 A;  3JCU Z;  1N36 O;  2IJI A;  1RFY A;  4I9W A;  2F4V B;  2GSM B;  5IJ0 B;  1V54 B;  4O2B A;  5C93 A;  2EIJ C;  3AEI A;  5CMU A;  2M7W A;  4DV3 O;  3OW2 U;  3SPJ A;  1NZ6 A;  1N36 B;  3G4S V;  3HKC A;  3G71 V;  3CPW U;  1Y76 B;  1GMG A;  4HYO A;  5JCO A;  4DR1 B;  5CBG A;  4NYK A;  1K7D A;  5EC2 C;  4DXW A;  3RYH A;  4PDM A;  1TUE B;  5LGN A;  1KB9 F;  4B7E A;  3K04 A;  1B04 A;  4MVQ A;  1ZSP A;  5LGT A;  5LYJ B;  5IJ9 A;  1QQC A;  1B06 A;  2A7W A;  2P06 A;  3ZMZ A;  1YJ9 V;  5LOV A;  1P4R A;  2DYR C;  1JX9 A;  1E1Q G;  2ITC C;  4JI2 B;  3CE2 A;  4JYY A;  2BCC H;  3CCR V;  2CH7 A;  1WAZ A;  2GTS A;  5LHH A;  1FD9 A;  1QBZ A;  1LNQ A;  5L3G A;  1H8H G;  2PZS A;  1K92 A;  3MAQ A;  3W7S A;  2M6Y A;  4CH3 A;  3IJ4 A;  4K35 A;  1QVG U;  2MW2 B;  2IJK A;  1N0N A;  5EIB C;  2P4V A;  2E5L B;  1V54 C;  2JVD A;  4PD4 F;  1NT2 B;  4O4I B;  5HFL A;  2CAZ C;  4EKW A;  3K5N A;  4LF8 B;  1G8M A;  1R6K A;  2QM4 A;  3ABL C;  4X64 B;  2YUA A;  3U0Z A;  2JDI G;  5B1A B;  3O65 A;  1VQK V;  3T1Y O;  1SQG A;  2FKX A;  1IXB A;  1I94 B;  3CJH B;  1QHT A;  3ETE A;  4JV5 O;  3ZMS A;  2Z0A A;  5KHG A;  3GWK C;  2YIB A;  4KHP O;  2QDO A;  1GM7 A;  3UO2 A;  4F6R A;  2OIE A;  1VQL V;  1K97 A;  4FFB A;  3ZMV A;  1NQT A;  4PA7 A;  2JGD A;  5FLX N;  1PNM A;  2DOS A;  2ZDI C;  3F7Y C;  1PKX A;  1EFR G;  1AJQ A;  4B3R B;  3CHX A;  1KC8 W;  3P3P A;  1N4C A;  3ZX6 A;  2IU3 A;  4MVR A;  2X6B A;  1K73 W;  5EC1 C;  1FS0 G;  1H38 A;  3QO8 A;  1NU1 H;  4X62 B;  3L74 H;  1YSC A;  1P7G A;  4DR7 O;  2JGU A;  2CGO A;  3JSL A;  5J2U B;  1IXM A;  3A0B Z;  5A9G A;  1YIJ V;  2YXY A;  1WA8 B;  2Q6A A;  4FM0 A;  3JD4 A;  5KHH A;  4OGQ B;  5E79 Z;  1N34 O;  3ZHV A;  1ARO P;  2X7R B;  3KCX A;  3CXH F;  4O4I A;  4YHH O;  3OTO B;  1YTF D;  4G2K A;  3ABL B;  3D3Q A;  1TGO A;  3BRC A;  5KMG B;  4B3T B;  1MG1 A;  4YJ2 A;  4AQY O;  3FAV B;  3OM3 B;  4FK5 C;  1MSD A;  4YHH B;  3B4S A;  4PDV A;  3HKD A;  2VS0 A;  2EUL A;  5JVD B;  4LF4 O;  2EJ7 A;  2H8P C;  4JI6 B;  4CH5 A;  4LF6 O;  1OCZ C;  2OCC B;  2GV9 A;  1XL6 A;  2ATK C;  2K1E A;  3AG4 C;  3ICX A;  4BAY A;  4B3S B;  4MSW C;  4RO2 A;  4DV2 B;  4FLW A;  3CCS V;  1IZ3 A;  1Q8I A;  3ZN0 A;  1BSM A;  4Z1M G;  3BVO A;  5IYB O;  5ITZ B;  3J80 N;  5JH7 B;  1BMF G;  3K06 A;  4LBE C;  4I55 B;  2X6C A;  4LF7 O;  2IM9 A;  4JI7 B;  1FXK A;  1D5A A;  2OCC C;  2WA4 A;  3N2G B;  3MHS C;  4JI5 O;  5KAI Z;  1GK9 A;  3AG4 B;  4JI3 O;  4QE7 A;  2R70 A;  4LF7 B;  4H33 A;  1FJG O;  4TUY A;  1T5E A;  3QG5 A;  4JGS A;  2Q7G A;  1QR8 A;  4DR6 O;  4JTD B;  2CUG A;  2A79 B;  3OMA B;  2YIC A;  4O4H B;  3W7T A;  5EBW C;  4MVO A;  5B1O A;  2NLJ C;  1O9G A;  2ZKO A;  4GX0 A;  4F6E A;  5DEC A;  1CPY A;  3L9D A;  2YEV A;  3EVK A;  1SA0 A;  1EZJ A;  4ABM A;  1FFT B;  5FL7 G;  4PA6 A;  3OMN B;  2ZIN A;  2DYS B;  5KHI A;  3KG2 A;  4B3M B;  1HP8 A;  2YI8 A;  5L3C A;  2R72 A;  3RYI A;  2PI5 A;  1SQP H;  3SPC A;  5IJ9 B;  5H2F Z;  2X0L A;  2R9R B;  4O4J B;  3FYE B;  4TWK A;  4O2A B;  3TK1 A;  1NH2 B;  1YHQ V;  4GZR B;  4MW8 A;  4WFA V;  2R9A A;  1W0K G;  3M99 B;  3ZJZ A;  3T1H O;  3DTU B;  3E86 A;  4I0X A;  3HKC B;  4X9Q A;  1M9N A;  2E75 B;  4O2A A;  4DV0 O;  4X65 O;  3ML0 A;  2UU9 B;  2CDY A;  2LW1 A;  4LFC B;  2XOK G;  1SQX H;  4U3J B;  4R50 A;  4DR3 O;  2VQF O;  4ZHQ B;  1HR0 O;  1VQ4 V;  3I55 V;  3CX5 F;  3HKE B;  4XBF A;  3T2M A;  2W6I G;  5D5P A;  3RYF B;  4JI4 O;  4KUM A;  3K9S A;  4EB6 B;  4TSF G;  4GKJ B;  4P30 A;  3TCU A;  2XAS A;  5LXT B;  3B8M A;  1X4T A;  3CEI A;  1VAR A;  2WLK A;  3JCZ A;  2KQX A;  1AJN A;  5KUK A;  4X1K B;  2ZT9 B;  3CRC A;  3ABM C;  2QWQ B;  5LA6 B;  1ROP A;  4LNU B;  3A8T A;  5K1X A;  1AI7 A;  5LP6 C;  3U10 A;  1BT8 A;  1MNG A;  1BQZ A;  5CA3 A;  1K33 A;  2HVJ C;  2UXB O;  2UXN A;  1JVM A;  5J2T B;  2V4D A;  3ZHT A;  4NXN O;  1W0J G;  4UCV A;  1IDS A;  4MS2 A;  2VQE B;  3RYI B;  3FB8 C;  3NR7 A;  1R3I C;  1WLE A;  2Y0I A;  4J9Y B;  2UXB B;  3ZCC A;  2BTQ B;  4U3F H;  4QNH B;  1I7F A;  4GLX A;  2ZXW C;  3CRM A;  2XT9 A;  4DUY O;  2IJH A;  3L75 H;  3BA8 A;  2UUB B;  1IBL B;  3SPH A;  3HKE A;  3HKB B;  1M1K W;  1IX9 A;  3W7W A;  3JYC A;  3LSS A;  1WP7 A;  3IGA C;  1M56 B;  4WBN A;  1VEW A;  1IBL O;  1KP2 A;  1D2D A;  1NJI W;  1ZWI C;  4HNA A;  1KD1 W;  4CC5 A;  2GUZ B;  2ZXW B;  4ZI7 B;  4QIW F;  1E79 G;  5KX5 B;  3A2F A;  2JRI A;  4O4L B;  5KMG A;  1Y6X A;  3B40 A;  4F4L A;  2ZCE A;  1EN4 A;  1R3K C;  1LUV A;  2OWO A;  2HVK C;  4U7O A;  1FXK B;  5IYD O;  1MAB G;  2JS5 A;  3ZRW A;  4H0L B;  4MVZ A;  1FFX B;  1YZB A;  4UFZ A;  3F5T A;  4QJF B;  3CYO A;  2QWR B;  3STL C;  4DV4 O;  4GX1 A;  1AI4 A;  5GON B;  1SRY A;  1KUQ A;  1AIL A;  3CD6 V;  5H6R A;  5B5E Z;  1AVM A;  4NXM O;  2XAQ A;  4DV4 B;  2JS3 A;  1KYO F;  1FPO A;  1YTF B;  2YEV B;  3MD0 A;  3JAR A;  4DR2 O;  3OUF A;  1ZX3 A;  2RQ6 A;  4ASU G;  3FAV A;  4B08 A;  3RN4 A;  2ZE5 A;  5CA1 B;  3ZN1 A;  2L6L A;  4DK1 A;  1KBH A;  3JAR B;  1IBM B;  1SQF A;  1BE3 H;  2JEU A;  4JI8 B;  1XNQ O;  3SYQ A;  2KG7 A;  4XDK A;  2H94 A;  3GB7 C;  5LOV B;  4EEQ A;  1Z2G A;  1I94 O;  2F66 C;  5BY1 A;  1VQO V;  5J2U A;  2ZR2 A;  4JI8 O;  4GCZ A;  1SQV H;  1LR1 A;  4KHP B;  1TUB B;  5IE9 A;  4CC6 A;  4CS2 A;  1KMI Z;  5B1B C;  2WWW A;  3X2Q C;  2LP7 A;  5AG2 A;  4X1I A;  5BMV B;  1VQM V;  4NTX A;  3QF7 A;  4O4L A;  2FML A;  3HPL C;  3G67 A;  1AP5 A;  1HDJ A;  5CA0 A;  2JEX A;  3VOU A;  1J5E O;  4XDL A;  3RBZ A;  2WLL A;  2YXL A;  1XBL A;  4NB5 A;  2UUA B;  3E8F A;  4MVS A;  1BS3 A;  2HG5 C;  1NBM G;  1AR1 B;  1J5E B;  3OMI B;  3JD3 A;  3HKB A;  4LH7 A;  5IWA B;  2UUA O;  2OTJ V;  4MT8 A;  3FB7 C;  4ZOL B;  2ZDI A;  3WFV A;  5B3S B;  1VF6 C;  2UXX A;  1L1F A;  1NTZ H;  1R6T A;  5BXZ A;  3N27 A;  5LYJ A;  2ZD9 A;  4YXW G;  2ILM A;  1QR9 A;  3RT3 C;  3ZRW B;  3WB2 A;  3QO5 A;  3JAK A;  3ZMT A;  4NVP A;  3SDL A;  4JTC B;  1YI2 V;  4UV8 A;  2QGN A;  4EFE A;  3BA9 A;  3RW0 A;  3SYC A;  2E76 B;  3JAW B;  3GWO A;  5LHG A;  2NR5 A;  3ZHU A;  5DN6 G;  2Q68 A;  3CS5 A;  5L3F A;  3I5D A;  5IDJ A;  4IT5 A;  4FJC C;  5KLV H;  4WFB V;  1Y67 A;  4X64 O;  3QVN A;  2CTP A;  4MVU A;  4P9O A;  2DE0 X;  1URF A;  4JZG A;  4F6R B;  5JJJ B;  4FZ1 A;  2A0L A;  3G6B A;  2WLH A;  3G80 A;  2OT5 A;  3K0D A;  3CCL V;  4JI7 O;  1BL8 A;  4PJ0 Z;  2FL4 A;  1SES A;  1G6U A;  1Q6I A;  3D36 A;  1R6N A;  3H01 A;  1H2S B;  3UQ8 A;  3H1J H;  2UUC B;  4LF5 B;  4DV5 O;  4LFB B;  3K58 A;  1AJP A;  4JAA A;  5L3E A;  1VIB A;  4JPR A;  2QM8 A;  4J42 A;  5FPR A;  5KHJ A;  3RYC B;  1NI8 A;  1XQ8 A;  1MZE A;  1XHX A;  1Q82 W;  1YEW A;  1MZF A;  1M93 A;  3AG1 B;  3UKM A;  4X62 O;  3U11 A;  3ASN B;  4Z1V A;  4O2B B;  5LL6 Y;  4TV8 B;  2EJR A;  3CWB H;  4FZ0 A;  2WLI B;  4RAI A;  3SYP A;  3UM7 A;  3E35 A;  3E22 B;  5JCO C;  4DRX A;  2PUS A;  1MA1 A;  3ETQ A;  3MDS A;  4K8X A;  3UO3 A;  4MVM A;  4X8A A;  1RPR A;  1AB3 A;  2Q7E A;  4U3J A;  4X89 A;  3RVY A;  1JR9 A;  1OCR B;  1S77 D;  3BCC H;  3JAT A;  3JAS A;  2P7T C;  4RQF A;  4E4E A;  2NNU A;  1VF7 A;  3OD4 A;  4B3S O;  2HP8 A;  1VF6 A;  5IYC O;  2WAM A;  4X1I B;  5BMV A;  1OCO B;  4XDJ A;  4ICG A;  3FX7 A;  1WB8 A;  3JAT B;  5F2V O;  2F23 A;  5J9P C;  4JI4 B;  4IIJ A;  1OCR C;  1ZLZ A;  3BFR A;  4GKJ O;  4FPP A;  4RUF A;  2ZE8 A;  1U96 A;  2N74 A;  1NR1 A;  4BW5 A;  2EIK B;  3AK1 A;  4FIP C;  3JD1 A;  4JI1 O;  1H2K A;  3APQ A;  3QNE A;  4P9P A;  1YXB A;  4UVB A;  4LCU C;  2AGA A;  2JJ2 G;  2YC0 A;  5H9C A;  3CC4 V;  2BSK A;  2QSA A;  1KP3 A;  4X1Y B;  3CMA V;  3QTC A;  2YXH A;  2YDE A;  5GTH Z;  2QWP B;  3ZRV A;  2XAH A;  3GVM A;  3FD9 A;  4TV8 A;  1JMK C;  3BAA A;  4X20 B;  1F4M A;  3WB1 A;  4I50 A;  2N05 A;  4LF9 O;  2ARH A;  5EYP A;  5LMU B;  1I0H A;  4UB6 Z;  3CME V;  1H2N A;  4WFG A;  2RJZ A;  3JAK B;  1Q3E A;  3N2K B;  2A9H A;  1PM9 A;  2LJ2 A;  4LF9 B;  4DUY B;  1H8E G;  4UVC A;  2EX3 A;  1JOY A;  3OT7 A;  1V9P A;  4OXS A;  3K79 A;  3T4Z A;  5JQG A;  1SER A;  4UUJ C;  1UJW B;  2YIA A;  1B6Q A;  5EK0 A;  4ZOL A;  2F93 B;  2Y48 A;  5ITZ A;  4LFA O;  4BR6 A;  2EIN B;  1W59 A;  4X66 O;  2ZM6 B;  4MTO A;  4J7J A;  3LDE A;  2ADQ B;  1H2G A;  3STZ C;  1J95 A;  2QA4 V;  1V55 C;  2JGD B;  2F43 G;  4DV0 B;  4I4T B;  1F23 A;  3SGI A;  2WLM A;  2UU9 O;  3FYI B;  3RWR D;  4DW1 A;  2JJ1 G;  3HKD B;  4YJ2 B;  1YCI A;  1P7B A;  3LDD A;  4I9Q A;  2F95 B;  4LR3 A;  4D7T A;  5H6Q A;  1S72 V;  4KXR A;  4FM1 A;  1BGY H;  3P32 A;  3H1L H;  1SZX A;  2QE7 G;  3Q4H B;  2EIJ B;  1S5H C;  3WB0 A;  5LGU A;  2IJJ A;  2KSD A;  3PN1 A;  2KG7 B;  3L73 H;  4L87 A;  1FFX A;  3K59 A;  3AG7 A;  4WF9 V;  3TXQ A;  4E2L A;  1HNZ B;  1RSO A;  4DV7 O;  2QM7 A;  3OTF A;  1EN6 A;  3LNN A;  4J7K A;  1Q90 D;  2GUZ A;  4X1K A;  1XNQ B;  1M5I A;  3ZBH A;  2QKS A;  4IYI A;  2W0F C;  3CRA A;  4PV1 B;  1JJO A;  1V55 B;  2ADP A;  2UUB O;  3K0G A;  5BR8 O;  5HFM A;  4FLY A;  1VQP V;  1EBO A;  1N33 B;  2RCV A;  4DR4 B;  1MOF A;  3TGU H;  4GT1 A;  2Q9L A;  1K3E A;  4ZHQ A;  1I5X A;  1YJN V;  5BR8 B;  1OCC B;  3Q4H A;  1OHH G;  4DV3 B;  4IIJ B;  3RVZ A;  1L0N H;  3QO7 A;  4J80 A;  2BTO A;  3ABK C;  2O57 A;  3J81 N;  1GTO A;  4JI2 O;  3H9V A;  2UXD B;  1WPX A;  3VQY A;  1U97 A;  2DWD C;  1Y76 A;  3SJB C;  1HNW O;  1YDX A;  4RQE A;  2YI9 A;  2X6A A;  4R6Z A;  3IAY A;  3BAB A;  4JYC A;  4J10 A;  5IY5 B;  2PYL A;  2UXD O;  2DQ0 A;  1KU9 A;  4NTY A;  4O4J A;  1WJZ A;  4WBN B;  3CRR A;  1QLN A;  4FLV A;  4DR5 B;  4LP8 A;  2WSS G;  1XNR O;  1M4U A;  5B1N A;  4R7C A;  2PGG A;  2LFR A;  1BHA A;  1WB7 A;  1YJW V;  4BIZ A;  1XHZ A;  4DR2 B;  1XNR B;  1SA0 B;  2JIZ G;  4OPA A;  2W0X A;  4GKK O;  2ZIO A;  1UFI A;  2Z3Y A;  3HB3 B;  1NS1 A;  2PY5 A;  4WFH A;  3RYH B;  3OE7 G;  1PP9 H;  1Y66 A;  4LWS A;  4GKK B;  1OV9 A;  1PPJ H;  3NXS A;  5FPO A;  1NTM H;  5LA6 A;  1XOU A;  3AG3 B;  4DV1 B;  1KEC A;  3ABK B;  4L8J A;  1S76 D;  1G1X B;  4N21 A;  3JAS B;  2LGW A;  2V1D A;  5E1A C;  5KAF Z;  4DV1 O;  4TV9 B;  5JH7 A;  4B3R O;  4NR1 A;  3R66 A;  4JV5 B;  4YJ3 B;  3AG3 C;  3KZI Z;  3ASO C;  5JWP A;  1GAX A;  4RWU A;  3T1C A;  2WLI A;  1ORQ C;  4IHJ B;  5GW7 A;  2ITD C;  5B3S C;  4FLT A;  2VWJ A;  1N34 B;  1HWY A;  3ETD A;  4IGG A;  1GM8 A;  1I5Y A;  3K3W A;  5IWA O;  4UCO A;  1VF5 B;  5DED A;  4QGP A;  1CEZ A;  1N8R W;  2QEX V;  1RP3 B;  4DR7 B;  4J11 A;  2YID A;  5LHI A;  4DV6 B;  1ZTE A;  3FB6 C;  1GRJ A;  4Z2W A;  1XL4 A;  2YIB D;  1HW7 A;  4J7Z A;  2G38 A;  3R65 A;  2IW5 A;  2HFE C;  4AIL C;  2RDC A;  3ABM B;  4TT3 G;  2ZR3 A;  3S3W A;  4DRX B;  4B3T O;  4AQY B;  2Y69 C;  1JA8 A;  4YY3 B;  4JI6 O;  2CTQ A;  3L71 H;  1S5L Z;  4G27 B;  1Q7Y W;  5CB4 A;  5JVD A;  1JFF A;  1AI6 A;  3WG7 C;  2UXC O;  3K03 A;  3OUS A;  3RYC A;  4DK0 A;  4Q6G A;  1N0J A;  3CC7 V;  3JAW A;  1XMQ O;  3CC2 V;  1AR5 A;  2OYQ A;  1S3J A;  4UCT A;  4JI1 B;  2D2C B;  3APO A;  4ZIB A;  5LMN O;  2Y4T A;  4JAU A;  1WN7 A;  2IH3 C;  5C8Y A;  4C7U A;  3O9O A;  1K5Q A;  4LH6 A;  3J7A U;  4JAS A;  3G6E V;  4GX2 A;  2CTR A;  4BIO A;  4JI3 B;  4MTX A;  5KHK A;  4N23 A;  3T4D A;  2V7Q G;  3TET A;  1ENV A;  2KB1 A;  3HR0 A;  3ABU A;  4UXN A;  1EZV H;  3C3S A;  4JTA B;  3DC5 A;  5B66 Z;  1SZT A;  1Z5V A;  4O4H A;  3DGE A;  1BQ0 A;  4QPJ A;  2LO1 A;  1RM1 B;  2EIM B;  2F1M A;  2Q0O C;  5CA0 B;  5H5N A;  1HNX B;  4K0K B;  5LBQ A;  2XHB A;  3ZED A;  2ZE6 A;  3F5W C;  5IYZ A;  1BZK A;  4B3M O;  1MSW D;  5EIB D;  2JK5 C;  1A32 A;  4K0K O;  3SYA A;  2QWN B;  4X66 B;  2Q8V A;  3EHB B;  2ZM6 O;  3OR7 C;  5LP6 B;  1N32 B;  1Q6U A;  4H44 B;  1XIL A;  4DR3 B;  3VQV A;  1PL0 A;  4JYB A;  3IFX A;  2D3O W;  2VWK A;  1YVW A;  1N32 O;  1PNL A;  3B8N A;  5KX5 A;  2BOB C;  2P5O A;  5KA5 A;  1F51 A;  4WCE V;  4X65 B;  2DYS C;  1R73 A;  1O9H A;  2OCH A;  1GN2 A;  4JYA O;  2ZE7 A;  2E74 B;  4FFB B;  2DMX A;  2P90 A;  3ABT A;  2DJV A; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...