1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Pollen allergen Ole e 6
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
source organism Olea europaea
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
1SRYA 1AROP 3ZHQA 1EN5A 4FLZA 3U10A 4LFCO 1OZ0A 4LF6O 4B3TB 3CJHB 5H6QA 1AI7A 1R6TA 1L1FA 2YIBD 1W0JG 1N36O 2EJRA 1GRJA 1XREA 1DF4A 4DV3B 1YJNV 2Z5UA 2DWDC 4DV1O 4X64B 3B2EE 1CXZB 2KSDA 5CB4A 4LFCB 2GDSA 2QJ1A 4LF6B 2FL4A 4LH7A 4PA3A 2Q7EA 3QVNA 4TQFA 4X20B 1N36B 2K9PA 3CCLV 3LNNA 3OM3B 2AXTZ 1QLEB 3DGEA 4WFFA 1I94O 2HLDG 4DV1B 3W7WA 1QR8A 2Q8VA 1TGOA 4FM1A 3L74H 3FB5C 1OCZC 2VS0A 3AG2B 3K59A 3P30A 1Q5OA 2DYRB 4LF9O 1WLEA 2CAZC 2Q4PA 4F6RA 4Q20A 1I94B 3CRRA 3E22A 2YUAA 3ETDA 2JDIG 1HNWO 4O2AB 4JGSA 1YDXA 1S5LZ 5IT9N 4R7CA 3ZMSA 1Q90D 3A2FA 2UU9O 4R50A 1K9MW 1YXBA 1M9NA 3J81N 1GN3A 4DK1A 4RAIA 3VQYA 2A0LA 4DR1O 5LOVB 3BHPA 1HNWB 1OCOC 3J7AU 3A0HZ 3R66A 3D3IA 2ZCEA 1JCHA 1V55B 3K0DA 4PDRA 4YJ3A 2LGQA 2UU9B 1AR4A 2AZ2A 1I5YA 4UVBA 4TV8A 3CWBH 3RYFA 3RYCB 1AP6A 1QHTA 4K35A 4DR1B 1WAZA 4BIZA 2EX3A 5KX5B 1NU1H 3VBBA 3DSQA 3UKMA 1AI6A 1XL4A 4JI6O 4HYOA 1LR1A 3LUTB 2HVJC 5L3EA 1VARA 4O4JA 1R3LC 1WP8A 1IURA 1M56B 3B4SA 1Q43A 2F93B 4K3AA 5CA0B 5IJ9B 4EB6A 3SJBC 3B40A 3DTUB 4LWSB 4P9OA 1VQPV 1K4DC 4JI6B 5J2UB 2RMKB 2ZM6O 3OW2U 1I7FA 2ZXWB 3H1JH 2DWEC 3ZX6A 2GSMB 4DW0A 5EBWC 4FLTA 1YJWV 1IBLO 1MOFA 1U96A 3ZHVA 4DRXA 1KMIZ 1OCOB 2E5LO 5FL7G 3JYCA 3ABLC 1XHXA 3ZHTA 1Y67A 2OTJV 3E8HA 3P3NA 4D7SA 2WLNA 5KHJA 3FFQA 2WPDG 5B1AC 1M90W 2ZM6B 4L8JA 1SQGA 4PDLA 2QM7A 4WF9V 3H1LH 1ZX3A 5C93A 2EIJC 1IBLB 3FYEB 4H13B 2P7TC 2DE0X 4X1YB 4LNUA 3RVYA 1N32O 2KG7A 2E5LB 3GB7C 1Q6UA 1AR5A 3OUFA 4UVCA 2FYUH 1VQKV 5KMGA 3OE7G 2VRZA 4UB6Z 1SZTA 5IYZA 1X4TA 4B3SO 1IXBA 3QF7A 1N32B 5E1AC 3F7YC 3K03A 3A0BZ 3E35A 3CB2A 3UO3A 1SERA 2PTMA 4UFZA 5CBGA 4NTXA 1Q3EA 2DOSA 1A32A 3JSLA 3RYHB 2GTSA 1SQVH 1MABG 3CE2A 4MVMA 5EIBC 1Z5WA 2Q9LA 4PHZA 4B3SB 1P49A 4WFAV 4DV2O 1EZVH 4FVMA 1H8EG 2ARHA 3TETA 5B1AB 3T1CA 3H9VA 3CRMA 2Q69A 1I08A 1X59A 3GWOA 4ZBMA 4MT8A 1QR9A 2YC0A 2LGWA 2QWOB 3OAAG 5KHHA 3ZRWB 3FAVA 1KP3A 3L9DA 1G8MA 3H1IH 4DV2B 4MSWC 1JQ0A 5LP6C 2WLMA 4FLVA 3BA9A 2LW1A 4JYCA 1K5QA 3LSQA 1OCRC 4UB8Z 1NH2D 2A3QA 3N2GB 3H1HH 4GYCB 4X1KA 1QBZA 2YXLA 4DV5O 4CBCA 1DF5A 4I4TA 1SZXA 3AG3C 1YITV 3QO8A 3WFVA 4HBNA 1TA8A 4FJCC 4QPKA 1Y74A 1PNKA 4X1IB 4LCUC 1XL6A 3NXSA 5B3SB 3L72H 2YICA 3JD2A 1WA8B 1XEQA 4UCVA 5EYPB 3G67A 3OGIB 3E2EA 4J9ZB 5LXTB 2ZE7A 3W7SA 5H2FZ 4ASUG 4ABMA 4DV5B 4LF4O 1IBKO 3J80N 2DW4A 3VOUA 1HP8A 4MW3A 1DGSA 5FPOA 5LYJA 2QWNB 1Q6IA 2OIGA 3D36A 2QGNA 3MAQA 4EEQA 1JX9A 1S3JA 5GONA 4LF4B 4NYKA 1IBKB 4BIUA 3P3PA 1BE3H 1TUBB 4QE9A 5FPRA 3WB1A 3Q4HA 5IYDO 5LHHA 4C7UA 1J5EO 2BCCH 5LL6Y 2IJHA 4X8AA 3X2QC 2JEUA 2JK5C 4CH6A 1Q6HA 1OCCC 2EIKB 4FLXA 1T5EA 2AW9A 3OEEG 1YSCA 3I5DA 3JARB 5IY5B 3STLC 4MTGA 1G6UA 4U7NA 3HKEA 3K9SA 2CGOA 4QIWF 1J5EB 3D3QA 4WFEA 4FM0A 1EZJA 4JI1O 3AEIA 3JCZA 4X62O 2VWKA 1Z2GA 4U3JB 1AJNA 5GTIZ 3JAWB 3RT3C 4NXMO 1H2NA 2YSUB 4ZOLA 4DW1A 3CC7V 2UUCO 3JCUZ 3K0GA 4FLYA 5B1BC 3AG4B 1M57C 3D8CA 2PUSA 4PA9A 2UUAO 1DK1A 1XDCA 2LFSA 4JI1B 3SYQA 3G80A 1NKDA 1WB7A 2QTSA 3K04A 5C8YB 4X62B 2HEPA 1VQ8V 1THZA 4JF3A 5IDJA 4R6ZA 4NXMB 2P06A 2ZD9A 3DC6A 1ORQC 3K08A 2UUCB 2GBOA 4P2ZA 4XDLA 1FS0G 2QTOA 1CEZA 3TCUA 3EHBB 1Q8IA 2UUAB 2W0FC 5CA1A 1FXKC 1OCCB 5LBQA 3H01A 4PDMA 5H9CA 1PKXA 3CCJV 1H2KA 3OT7A 3ABKB 5KHGA 3RBZA 1S0VA 4E2LA 3FX7A 1YVWA 4MS2A 3SPHA 1VQNV 5CB4B 2QKCA 5EZYA 4KFMA 1NVPD 5LHIA 4ZHQB 1IZ3A 2RN9A 4HAMA 3TK1A 3ZS8C 5DEDA 3VQXA 3IGAC 2LP7A 1YJ9V 1VP7A 3MHHC 4JAVA 1JOYA 4ICGA 4EFBA 4I0XB 1TVKA 2JGDA 5BMVA 5JJJB 3QNEA 4J11A 5CN0A 1N33O 5KA6A 1MNGA 1FJGO 2LQTA 2HKOA 2JS5A 1EFRG 2OCCC 3FKSG 5KLVH 3SYAA 3E22B 3SJCC 1GMGA 2X0LA 4DXWA 2Y4UA 1GAXA 5LA6A 3P32A 4I55B 1W59A 4NTYA 4KHPO 1VQ7V 1XBLA 1H2LA 1N33B 2B9ZA 3BA8A 1FXKB 1FJGB 4HNAB 5JJNB 1SS3A 3FB7C 1BHAA 1FYJA 3STZC 2FKXA 4IIJB 1NT2B 4H0LB 1KECA 3E89A 2ZE5A 1NR1A 5B1NA 4KHPB 2YXHA 1XILA 4O4HA 1KC8W 1GKFA 2CTPA 4EKWA 1G1XB 4I7ZB 2ZINA 4FPPA 4KL1A 3RYFB 3LSSA 3CD6V 3ZJZA 2AGAA 1PM9A 2A7WA 1QLEC 4KUMA 1V9PA 3WB2A 2WAMA 4AILC 3O9OA 4JI7O 3DC5A 3KG2A 5DN6G 4QE7A 2BSKA 2GUZB 3MD0A 1H2GA 2B1GA 2DYRC 2IU3A 4JASA 2C2AA 1ZLZA 3IJ4A 1QCEA 4EB6B 1K33A 2ZQMA 3ABTA 4OX9O 3UT5A 1I0HA 1VQ6V 2CTWA 3C3SA 4RQEA 3FD9A 4JI7B 4DV4O 3K9AA 1XMQO 4J7ZA 3UM7A 2LW7A 1VF6A 3LSUA 2EINC 1E1QG 2CH7B 3JATA 2IJIA 4DR2O 4OX9B 4TUYB 2QWQB 4DR4O 1US6A 1NBMG 4DV4B 4FFKA 1XMQB 1JJOA 1YF2A 2LO1A 1GN2A 1URFA 3FB8C 5L3BA 1J95A 2F66C 2YS8A 4IT5A 1V55C 4FFBB 4LNUB 2UXBO 4DR2B 3OR7C 4CS3A 5L3FA 2WLIA 4DR4B 3G6BA 1UJWB 3E86A 2PI5A 3ZMZA 1N8RW 2NR5A 2Y4TA 1ZL8A 1Q7YW 2YEVA 3N2KB 5KUKA 2N05A 1S5HC 2QSAA 4JTDB 4WBNB 2RQ6A 1K5SA 4JZ2A 1UPGA 3M99B 2UXBB 3HKDB 3HKCB 4NVPA 1GM9A 4I5SA 5GTHZ 1D5AA 4UCRA 2XHBA 1F51A 1AI4A 4FZ0A 1M56C 2ZR3A 5BY1A 1L8DA 1WN7A 3ETGA 1JFFA 1SA0A 1BQZA 3JD1A 3IFXA 1KBHA 1R6KA 2NLJC 2P5OA 2EINB 1Y4MA 1GN6A 1WP7A 2IW5A 2ZXWC 2EIMB 3CYOA 1AILA 1AP5A 1VIBA 1HR0O 3AK3A 4PJ0Z 4RO2A 1BMFG 2K1EA 4IL6Z 1NTZH 3HR0A 3ICXA 4O4LA 2EZOA 3ZBHA 3F7VC 3FAVB 5EBMC 4MVRA 5LGTA 1K34A 2JVDA 3RYIA 2JS3A 1HR0B 2OYQA 1JR9A 4D6TH 1RM1B 4A5UB 1RSOA 2WLHA 3S3XA 2ADQB 4TWKA 1PD3A 1B6QA 2EZPA 3JD0A 1QU7A 1WPXA 3T1YO 1BHBA 3WG7B 4IHJA 3APQA 4ZI7B 1Y74B 1JA8A 1Y66A 2JIZG 1EN6A 1CPYA 3JASA 5H6RA 2DQ3A 2KKWA 1FD9A 5CBHA 1VQ9V 3T1YB 4WFBV 4XDKA 5HFMA 3SPIA 4QNHB 4ZIBA 4IGGA 2ZR2A 2UXXA 2WSSG 2Y0IA 1VQLV 4LC1A 1AB3A 3CJHA 1ZSPA 1NVPB 2IJJA 1V54B 4JAUA 5GONB 3ZN0A 1P7GA 1EM1A 3OGCC 4FZ1A 2HJFC 1MSWD 1MA1A 1JJ2U 4YY3O 4LF8O 2ETNA 3CCUV 2JJ2G 2Y48A 3CX5F 4JYAO 3FYIB 3PJSK 1O9HA 1EN4A 3HKEB 3CP1A 1IDSA 1SF9A 3OFNG 5AG2A 4UV9A 4YY3B 1BT8A 4LF8B 4F4LA 3HB3B 3CS5A 2D3OW 4KP4A 1NQTA 1W2BU 1AVMA 1XMOO 1SQBH 1WJZA 2ZNJA 4JYAB 5B3SC 4N23A 3GWKC 4NTWA 4YHHO 3CXCU 3U11A 2EULA 4MVQA 4TQDA 2P90A 4DR7O 3JSNA 4PA4A 2F4VO 1DTOA 1JMKC 5KAFZ 4UV8A 3ASOB 1XMOB 1VQOV 3JAKB 3OMAB 1IX9A 3UQ8A 5BZBA 1YTFD 4YHHB 1NTKH 4K0KO 5EC1C 3B8NA 4RUEA 1VF7A 4YJ2A 1LNQA 3ZHUA 4CZZA 5CA1B 3F5WC 1WPBA 1XI1A 4DR7B 5ITZB 2CUGA 4B7KA 1SQPH 1SQQH 3HKBA 2F4VB 2LFRA 1VQ5V 1IXMA 1R3KC 3L70H 3ML0A 4EFEA 4K0KB 4UXNA 2XAGA 2EIKC 2OT5A 4BWAA 3BPZA 3K5LA 1N4CA 2E3CA 1KYOF 4QPJA 5IY5C 1Y6XA 1XOUA 4U3FH 4GLXA 1PL4A 3T1HO 3LNMB 5KX5A 2ZDIC 2A06H 3A0RA 3N27A 1Y76A 4X88A 4J7JA 4LBEC 5JQGB 1R3IC 3MHSC 5JVDA 1SQXH 4K8ZA 5CA0A 4XBFA 4OXSA 3AG4C 3CC2V 3ASNB 5FLXN 3T1HB 3BFRA 2IJKA 4PDVA 2QKSA 4O4IA 5IE9A 1IVSA 2OIEA 5IYBO 1ZUQA 3KZIZ 4B7EA 3ZRVA 1PP9H 3CRCA 4GCZA 4NB5A 1M1KW 3L71H 4X9QA 2R9AA 1K4CC 4R8CA 3G6EV 4DR6O 2XAQA 3CRQA 1KP2A 3BCCH 1D2DA 3SPJA 2N04A 3FB6C 2BOBC 3RVZA 4O4HB 5D5PA 3ABKC 2VWJA 2FTKA 4X1YA 3CCVV 3CC4V 4O2BB 2QDOA 1FPOA 2EBOA 5FNVB 4DR6B 1R1BA 3SJQC 3DXRB 2P67A 4OGQB 2WLKA 3MDSA 4N21A 4FMTA 2PGGA 4DV0O 1SC5B 1FXVA 2GHYA 2HJDA 4GX5A 1MMMA 3ABMB 1XNQO 2MW2B 4LFBO 5JH7A 3R65A 1P4RA 2ZE6A 4DR3O 1NZ6A 2L35A 4MTXA 2V4DA 5D5QA 3I55V 3K5NA 4G28B 1N0NA 4BW9A 2BSKB 4DYLA 3JALB 3CHXA 4XDJA 4DV0B 4PA6A 2X7RB 2P6JA 1XNQB 4KXRA 4LFBB 2DYSB 4PV1B 4DR3B 3K58A 4WFHA 3SPGA 5CMUA 5KHIA 1S72V 4J41A 2Y69C 2IH3C 2RCVA 4IYIA 1K7DA 3CEIA 3CXHF 4JPRA 1KKDA 5CA3A 4J42A 4JZGA 4GUNA 2HP8A 3B09A 1O9GA 3I56V 2Q0AA 2PYLA 4NR1A 3SR2C 3ZRWA 4PI2A 1IBMO 3ETEA 1S77D 3QO7A 2QWPB 4P30A 1MZEA 3T4ZA 3B77A 5DM6V 2HR3A 4W4LA 5KUMA 3TJTA 3OMIB 3W7XA 5B5EZ 4MTFA 3ZRXA 3CMEV 2WLIB 3CCEV 4GKKO 1NS1A 1IBMB 3ETQA 5EK0A 1QQCA 1SETA 2XUMA 3CCQV 3N2GA 5KAIZ 2JJ1G 1N34O 3L75H 4X65O 2BTQA 1ZAUA 1NI8A 2A79B 4F6RB 1VMGA 1PL0A 4QJFB 3BABA 3HPLC 4X1IA 2YDEA 3IAYA 4GKKB 1WA8A 1K97A 1H2MA 5EYPA 2Y69B 4E4EA 3LDCA 2YIAA 1N34B 1L0LH 2ADPA 2EJ7A 4MVSA 4BAYA 4X65B 1K73W 3SDLA 1QVFU 5JJEB 3SJAC 4GKJO 4FLWA 2F1MA 2KB1A 2EILC 4PA7A 1H2SB 3ZMTA 3SPCA 1JPXA 1ROPA 3EFFK 2O57A 5LP6A 3THOA 1WB8A 4YJ3B 2FB5A 1TUBA 5A2QN 1R6NA 1FXHA 2E74B 2X6BA 1LUVA 4TV8B 4GKJB 1XHZA 4LF7O 2Q7HA 4RUFA 2CE4A 2DQ0A 2GTAA 1K92A 4DV7O 3H1KH 1F4MA 3O65A 1RSOB 4I50A 3IC9A 4CS2A 3KKYA 1BCCH 4LF7B 4O4JB 4U3JA 1D5NA 2Z3YA 4DV7B 3S3WA 4J80A 3JAWA 1S76D 2X6CA 3CCRV 4JAAA 1YTFB 5LGNA 1NR7A 2CGNA 2VQFO 3SYPA 2RNBA 3JASB 1XNRO 2H3OA 2HVKC 2R72A 4U7OA 1KQSU 2EILB 2OTLV 3CCSV 4Q6GA 4CS4A 4TV9A 4DRXB 3KCXA 5KHKA 1YI2V 2P4KA 2W0XA 3ABUA 4JI3O 5EIBD 2EIMC 1E79G 3QO5A 1NH2B 4LP8A 3E8BA 2PI4A 2VQFB 4G27B 1XNRB 1GK9A 3IC7A 1Q81W 4J9YB 4B08A 3APOA 2AZ0A 4JI8O 2BTOA 2KG7B 4DUYO 4JI3B 2OCHA 2B1IA 4LR3A 3AK1A 5KMGB 2DJVA 2YI8A 3ZMVA 2QKAA 2Q73A 1RM1C 4ZHQA 5F2VO 2Y0PA 2Q67A 5IYZB 4P9PA 4JI8B 3ZMUA 4CC6A 5GW7A 4DUYB 3RWRD 4LF5O 2WWWA 2WLLA 3UCSC 4YIOA 2UXNA 4I0XA 1GM7A 2M6YA 5L3GA 2F43G 3WG7C 1NJIW 4CC5A 4DO2A 4JI4O 3NR7A 1HW7A 3TXQA 1OV9A 5DECA 4GX0A 1GN4A 5K1PA 2P22C 4LF5B 1H38A 1MG1A 2ZKOA 3TXSA 4UVAA 1GTOA 4I55A 5IJ0A 5L3CA 4JI4B 1KD1W 4G2KA 1M4UA 5H5NA 2WA4A 3CPWU 4LF9B 1FXKA 2XAFA 4HNAA 1LUWA 3B8MA 3D36C 3OUSA 1P7BA 4YJ2B 3U0ZA 4IIJA 5J2TA 2AHZA 1V54C 3HKBB 1L0NH 4OPHA 1B06A 1GH6A 4GZRB 3JD3A 1AR1B 1ZTEA 2XT9A 4DK0A 2F23A 3E8FA 3OEHG 1GM8A 3RN4A 4X1KB 1YCIA 2BOCC 5TISZ 3UO2A 1OCZB 4NKGB 4I4TB 1KU9A 2E75B 1R73A 4MW8A 4B3MO 2IBZH 1HNZO 3SYCA 1Y76B 3EVKA 1FFXA 2GUZA 3K57A 5JVDB 1OJHA 1TAEA 2PYJA 3EXAA 4OPAA 3OTFA 1RFYA 1BZKA 2B5UA 5LYJB 4B3MB 1OHHG 1PV0A 4JTAB 4O4IB 4TSFG 5K1XA 5JWPA 1HNZB 5HFLA 3RGBA 1QNMA 3LDEA 2ZIOA 1BSMA 4NXNO 3ASOC 1P84F 3CRAA 2V1DA 3JAMN 2ITDC 1VEWA 3TGUH 4FK5C 4AQYO 1M93A 2CH7A 1WNSA 1AI5A 1ZWIC 4LH6A 1Q82W 3Q4HB 3G71V 1BGYH 4TUYA 4MTOA 1B04A 1HDJA 2WLJA 4GX1A 2XAHA 4NXNB 2HFEC 3M7MX 2NN4A 4X20A 4X89A 4AQYB 4FFBA 2AHYA 2A9HA 2DN9A 3OTOO 2BE3A 5BR8O 5LGUA 3GVMA 1KB9F 3N2KA 4ZOLB 5JH7B 4WBNA 1R3JC 3K5MA 3HKCA 3HKDA 4YIPA 2IH1C 3OMNB 1DLBA 3W7UA 1PNLA 3OTOB 3CMAV 5BR8B 3ASNC 4O2AA 2DMXA 4FLUA 1M5IA 4W4KA 2CDYA 4PI0A 1AJQA 3WB0A 2ILMA 1GO3F 1YHQV 3ABLB 4UCSA 4DV6O 2XOKG 3G4SV 5EC2C 4H37A 4JI5O 1QVGU 1FFTB 2H94A 5LOVA 2YXYA 3CSXA 2EIJB 2XASA 3ZHSA 2R9RB 3AK2A 1YIJV 4WCEV 2MK3A 4PELA 1SESA 4UUJC 1U97A 1COWG 5EZYB 4DV6B 2NNUA 2JGUA 4MVUA 4JI5B 4GT1A 2L6LA 1BS3A 3RYCA 4BW5A 2M7WA 1YZBA 2PY5A 4JYYA 2ZNIA 3VQWA 2CK3G 2XAJA 1EBOA 3ZRSA 4B3RO 3ZHRA 1TVKB 2JGDB 5BMVB 2ZIMA 1XQ8A 1RP3B 3ABMC 2BTQB 2QWRB 1SKVA 4AI8A 5IJ9A 4ZI7A 3ZN1A 3BEHA 4LWSA 2LJ2A 4B3RB 3LDDA 5J2UA 1Z5VA 5LA6B 2HHHO 4Z1MG 5CBFA 5JCOC 2Q0OC 3BRCA 3K5OA 5B1OA 2R9IA 1RPOA 2DYSC 2X6AA 4JV5O 2D2CB 1FKAO 2WA3A 3RFRA 4PD4F 2ZE8A 4RQFA 3A8TA 1VF6C 2QM4A 2HHHB 4TOIA 2Q6AA 3ZCCA 2Q7GA 5LP6B 2FMLA 3CCMV 2JEXA 2JRIA 4I9WA 4JV5B 4WFGA 2XTAA 1JVMA 2UXCO 3C90A 4DR5O 3BY6A 1OCRB 5LHGA 3K06A 1TUEB 3OD4A 2CTQA 4DUZO 2PZSA 2PF4E 4ZKIA 5BXZA 4X66O 1HNXO 3AG3B 4I50B 2UXDO 5E79Z 3AG1C 2ODMA 2UXCB 4DR5B 3AG7A 1VF5B 2Q5ZA 1F7YA 4LFAO 4DUZB 2YIDA 1B3QA 3RYHA 4JI0O 4JI2O 1BQ0A 2QR4A 2N74A 3E83A 3UT5B 1MSDA 4X66B 1K8AW 2KQXA 4CH3A 2ZT9B 3T4DA 1HNXB 3OR6C 2UXDB 1S5JA 4MVZA 3QG5A 3K79A 4JYBA 4TV9B 4LFAB 2E76B 4JI0B 3JATB 4JI2B 2ITCC 3JAKA 1G4YB 4GX2A 1KUQA 2HG5C 4UCUA 2IM9A 5J9PC 2RDCA 5IWAO 2GV9A 4TT3G 5ITZA 3X2QB 1N0JA 5LMUO 4JTCB 4UCOA 4FM2A 2CTRA 1E1RG 2F95B 1Q86W 3AG1B 1ZL8B 5IWAB 3E8GA 2YEVB 4UCTA 3M8AA 3PN1A 3RW0A 4H33A 5LMUB 5L3DA 2R70A 3BVOA 4J10A 4FIPC 2WLLB 3K3WA 3QTCA 5B1BB 2QEXV 4IYHA 1M57B 3VQVA 3W7TA 2QA4V 3SGIA 1NTMH 2OWOA 3ZEDA 5JQGA 5LXTA 1JFFB 2P4VA 1SA0B 2ATKC 2YIBA 3KCYA 2QE7G 4AHCA 5EBLC 3L73H 5LMNO 4CH4A 1PPJH 1XUQA 2W6JG 2QM8A 1VQ4V 1RPRA 2VQEO 4CH5A 4H44B 5IJ0B 4O4LB 3BAAA 1MZFA 2IU0A 1SQFA 2YI9A 2Z0AA 4QGPA 5LMNB 4YXWG 1QLNA 3RYIB 1W0KG 5J2TB 2Q68A 1H8HG 1PNMA 3T2MA 2VQEB 1VQMV 4Z1VA 3JD4A 3ZIAG 4D7TA 4Z2WA 1HWYA 4I9QA 1F23A 1K3EA 2H8PC 3JARA 4J7KA 2UUBO 2XNDG 4BR6A 1UFIA 4O2BA 1I5XA 5B66Z 5FNVA 3C3TA 3SYOA 2ZDIA 1ENVA 2RJZA 3DXRA 4L87A 1BL8A 4K8XA 3WU2Z 4RWUA 1FAFA 1F4NA 4IHJB 1YEWA 1AJPA 4HZ3A 2W6IG 4F6EA 2OCCB 2V7QG 2UUBB 1FFXB 4BIOA 2G38A 4B3TO 3AG2C 5C8YA 1CP9A 3JALA 5KA5A 5A9GA 1KKCA 5JCOA 4DV3O 4MVOA 5IYCO 3F5TA 4X64O
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 1SRY A;  1ARO P;  3ZHQ A;  1EN5 A;  4FLZ A;  3U10 A;  4LFC O;  1OZ0 A;  4LF6 O;  4B3T B;  3CJH B;  5H6Q A;  1AI7 A;  1R6T A;  1L1F A;  2YIB D;  1W0J G;  1N36 O;  2EJR A;  1GRJ A;  1XRE A;  1DF4 A;  4DV3 B;  1YJN V;  2Z5U A;  2DWD C;  4DV1 O;  4X64 B;  3B2E E;  1CXZ B;  2KSD A;  5CB4 A;  4LFC B;  2GDS A;  2QJ1 A;  4LF6 B;  2FL4 A;  4LH7 A;  4PA3 A;  2Q7E A;  3QVN A;  4TQF A;  4X20 B;  1N36 B;  2K9P A;  3CCL V;  3LNN A;  3OM3 B;  2AXT Z;  1QLE B;  3DGE A;  4WFF A;  1I94 O;  2HLD G;  4DV1 B;  3W7W A;  1QR8 A;  2Q8V A;  1TGO A;  4FM1 A;  3L74 H;  3FB5 C;  1OCZ C;  2VS0 A;  3AG2 B;  3K59 A;  3P30 A;  1Q5O A;  2DYR B;  4LF9 O;  1WLE A;  2CAZ C;  2Q4P A;  4F6R A;  4Q20 A;  1I94 B;  3CRR A;  3E22 A;  2YUA A;  3ETD A;  2JDI G;  1HNW O;  4O2A B;  4JGS A;  1YDX A;  1S5L Z;  5IT9 N;  4R7C A;  3ZMS A;  1Q90 D;  3A2F A;  2UU9 O;  4R50 A;  1K9M W;  1YXB A;  1M9N A;  3J81 N;  1GN3 A;  4DK1 A;  4RAI A;  3VQY A;  2A0L A;  4DR1 O;  5LOV B;  3BHP A;  1HNW B;  1OCO C;  3J7A U;  3A0H Z;  3R66 A;  3D3I A;  2ZCE A;  1JCH A;  1V55 B;  3K0D A;  4PDR A;  4YJ3 A;  2LGQ A;  2UU9 B;  1AR4 A;  2AZ2 A;  1I5Y A;  4UVB A;  4TV8 A;  3CWB H;  3RYF A;  3RYC B;  1AP6 A;  1QHT A;  4K35 A;  4DR1 B;  1WAZ A;  4BIZ A;  2EX3 A;  5KX5 B;  1NU1 H;  3VBB A;  3DSQ A;  3UKM A;  1AI6 A;  1XL4 A;  4JI6 O;  4HYO A;  1LR1 A;  3LUT B;  2HVJ C;  5L3E A;  1VAR A;  4O4J A;  1R3L C;  1WP8 A;  1IUR A;  1M56 B;  3B4S A;  1Q43 A;  2F93 B;  4K3A A;  5CA0 B;  5IJ9 B;  4EB6 A;  3SJB C;  3B40 A;  3DTU B;  4LWS B;  4P9O A;  1VQP V;  1K4D C;  4JI6 B;  5J2U B;  2RMK B;  2ZM6 O;  3OW2 U;  1I7F A;  2ZXW B;  3H1J H;  2DWE C;  3ZX6 A;  2GSM B;  4DW0 A;  5EBW C;  4FLT A;  1YJW V;  1IBL O;  1MOF A;  1U96 A;  3ZHV A;  4DRX A;  1KMI Z;  1OCO B;  2E5L O;  5FL7 G;  3JYC A;  3ABL C;  1XHX A;  3ZHT A;  1Y67 A;  2OTJ V;  3E8H A;  3P3N A;  4D7S A;  2WLN A;  5KHJ A;  3FFQ A;  2WPD G;  5B1A C;  1M90 W;  2ZM6 B;  4L8J A;  1SQG A;  4PDL A;  2QM7 A;  4WF9 V;  3H1L H;  1ZX3 A;  5C93 A;  2EIJ C;  1IBL B;  3FYE B;  4H13 B;  2P7T C;  2DE0 X;  4X1Y B;  4LNU A;  3RVY A;  1N32 O;  2KG7 A;  2E5L B;  3GB7 C;  1Q6U A;  1AR5 A;  3OUF A;  4UVC A;  2FYU H;  1VQK V;  5KMG A;  3OE7 G;  2VRZ A;  4UB6 Z;  1SZT A;  5IYZ A;  1X4T A;  4B3S O;  1IXB A;  3QF7 A;  1N32 B;  5E1A C;  3F7Y C;  3K03 A;  3A0B Z;  3E35 A;  3CB2 A;  3UO3 A;  1SER A;  2PTM A;  4UFZ A;  5CBG A;  4NTX A;  1Q3E A;  2DOS A;  1A32 A;  3JSL A;  3RYH B;  2GTS A;  1SQV H;  1MAB G;  3CE2 A;  4MVM A;  5EIB C;  1Z5W A;  2Q9L A;  4PHZ A;  4B3S B;  1P49 A;  4WFA V;  4DV2 O;  1EZV H;  4FVM A;  1H8E G;  2ARH A;  3TET A;  5B1A B;  3T1C A;  3H9V A;  3CRM A;  2Q69 A;  1I08 A;  1X59 A;  3GWO A;  4ZBM A;  4MT8 A;  1QR9 A;  2YC0 A;  2LGW A;  2QWO B;  3OAA G;  5KHH A;  3ZRW B;  3FAV A;  1KP3 A;  3L9D A;  1G8M A;  3H1I H;  4DV2 B;  4MSW C;  1JQ0 A;  5LP6 C;  2WLM A;  4FLV A;  3BA9 A;  2LW1 A;  4JYC A;  1K5Q A;  3LSQ A;  1OCR C;  4UB8 Z;  1NH2 D;  2A3Q A;  3N2G B;  3H1H H;  4GYC B;  4X1K A;  1QBZ A;  2YXL A;  4DV5 O;  4CBC A;  1DF5 A;  4I4T A;  1SZX A;  3AG3 C;  1YIT V;  3QO8 A;  3WFV A;  4HBN A;  1TA8 A;  4FJC C;  4QPK A;  1Y74 A;  1PNK A;  4X1I B;  4LCU C;  1XL6 A;  3NXS A;  5B3S B;  3L72 H;  2YIC A;  3JD2 A;  1WA8 B;  1XEQ A;  4UCV A;  5EYP B;  3G67 A;  3OGI B;  3E2E A;  4J9Z B;  5LXT B;  2ZE7 A;  3W7S A;  5H2F Z;  4ASU G;  4ABM A;  4DV5 B;  4LF4 O;  1IBK O;  3J80 N;  2DW4 A;  3VOU A;  1HP8 A;  4MW3 A;  1DGS A;  5FPO A;  5LYJ A;  2QWN B;  1Q6I A;  2OIG A;  3D36 A;  2QGN A;  3MAQ A;  4EEQ A;  1JX9 A;  1S3J A;  5GON A;  4LF4 B;  4NYK A;  1IBK B;  4BIU A;  3P3P A;  1BE3 H;  1TUB B;  4QE9 A;  5FPR A;  3WB1 A;  3Q4H A;  5IYD O;  5LHH A;  4C7U A;  1J5E O;  2BCC H;  5LL6 Y;  2IJH A;  4X8A A;  3X2Q C;  2JEU A;  2JK5 C;  4CH6 A;  1Q6H A;  1OCC C;  2EIK B;  4FLX A;  1T5E A;  2AW9 A;  3OEE G;  1YSC A;  3I5D A;  3JAR B;  5IY5 B;  3STL C;  4MTG A;  1G6U A;  4U7N A;  3HKE A;  3K9S A;  2CGO A;  4QIW F;  1J5E B;  3D3Q A;  4WFE A;  4FM0 A;  1EZJ A;  4JI1 O;  3AEI A;  3JCZ A;  4X62 O;  2VWK A;  1Z2G A;  4U3J B;  1AJN A;  5GTI Z;  3JAW B;  3RT3 C;  4NXM O;  1H2N A;  2YSU B;  4ZOL A;  4DW1 A;  3CC7 V;  2UUC O;  3JCU Z;  3K0G A;  4FLY A;  5B1B C;  3AG4 B;  1M57 C;  3D8C A;  2PUS A;  4PA9 A;  2UUA O;  1DK1 A;  1XDC A;  2LFS A;  4JI1 B;  3SYQ A;  3G80 A;  1NKD A;  1WB7 A;  2QTS A;  3K04 A;  5C8Y B;  4X62 B;  2HEP A;  1VQ8 V;  1THZ A;  4JF3 A;  5IDJ A;  4R6Z A;  4NXM B;  2P06 A;  2ZD9 A;  3DC6 A;  1ORQ C;  3K08 A;  2UUC B;  2GBO A;  4P2Z A;  4XDL A;  1FS0 G;  2QTO A;  1CEZ A;  3TCU A;  3EHB B;  1Q8I A;  2UUA B;  2W0F C;  5CA1 A;  1FXK C;  1OCC B;  5LBQ A;  3H01 A;  4PDM A;  5H9C A;  1PKX A;  3CCJ V;  1H2K A;  3OT7 A;  3ABK B;  5KHG A;  3RBZ A;  1S0V A;  4E2L A;  3FX7 A;  1YVW A;  4MS2 A;  3SPH A;  1VQN V;  5CB4 B;  2QKC A;  5EZY A;  4KFM A;  1NVP D;  5LHI A;  4ZHQ B;  1IZ3 A;  2RN9 A;  4HAM A;  3TK1 A;  3ZS8 C;  5DED A;  3VQX A;  3IGA C;  2LP7 A;  1YJ9 V;  1VP7 A;  3MHH C;  4JAV A;  1JOY A;  4ICG A;  4EFB A;  4I0X B;  1TVK A;  2JGD A;  5BMV A;  5JJJ B;  3QNE A;  4J11 A;  5CN0 A;  1N33 O;  5KA6 A;  1MNG A;  1FJG O;  2LQT A;  2HKO A;  2JS5 A;  1EFR G;  2OCC C;  3FKS G;  5KLV H;  3SYA A;  3E22 B;  3SJC C;  1GMG A;  2X0L A;  4DXW A;  2Y4U A;  1GAX A;  5LA6 A;  3P32 A;  4I55 B;  1W59 A;  4NTY A;  4KHP O;  1VQ7 V;  1XBL A;  1H2L A;  1N33 B;  2B9Z A;  3BA8 A;  1FXK B;  1FJG B;  4HNA B;  5JJN B;  1SS3 A;  3FB7 C;  1BHA A;  1FYJ A;  3STZ C;  2FKX A;  4IIJ B;  1NT2 B;  4H0L B;  1KEC A;  3E89 A;  2ZE5 A;  1NR1 A;  5B1N A;  4KHP B;  2YXH A;  1XIL A;  4O4H A;  1KC8 W;  1GKF A;  2CTP A;  4EKW A;  1G1X B;  4I7Z B;  2ZIN A;  4FPP A;  4KL1 A;  3RYF B;  3LSS A;  3CD6 V;  3ZJZ A;  2AGA A;  1PM9 A;  2A7W A;  1QLE C;  4KUM A;  1V9P A;  3WB2 A;  2WAM A;  4AIL C;  3O9O A;  4JI7 O;  3DC5 A;  3KG2 A;  5DN6 G;  4QE7 A;  2BSK A;  2GUZ B;  3MD0 A;  1H2G A;  2B1G A;  2DYR C;  2IU3 A;  4JAS A;  2C2A A;  1ZLZ A;  3IJ4 A;  1QCE A;  4EB6 B;  1K33 A;  2ZQM A;  3ABT A;  4OX9 O;  3UT5 A;  1I0H A;  1VQ6 V;  2CTW A;  3C3S A;  4RQE A;  3FD9 A;  4JI7 B;  4DV4 O;  3K9A A;  1XMQ O;  4J7Z A;  3UM7 A;  2LW7 A;  1VF6 A;  3LSU A;  2EIN C;  1E1Q G;  2CH7 B;  3JAT A;  2IJI A;  4DR2 O;  4OX9 B;  4TUY B;  2QWQ B;  4DR4 O;  1US6 A;  1NBM G;  4DV4 B;  4FFK A;  1XMQ B;  1JJO A;  1YF2 A;  2LO1 A;  1GN2 A;  1URF A;  3FB8 C;  5L3B A;  1J95 A;  2F66 C;  2YS8 A;  4IT5 A;  1V55 C;  4FFB B;  4LNU B;  2UXB O;  4DR2 B;  3OR7 C;  4CS3 A;  5L3F A;  2WLI A;  4DR4 B;  3G6B A;  1UJW B;  3E86 A;  2PI5 A;  3ZMZ A;  1N8R W;  2NR5 A;  2Y4T A;  1ZL8 A;  1Q7Y W;  2YEV A;  3N2K B;  5KUK A;  2N05 A;  1S5H C;  2QSA A;  4JTD B;  4WBN B;  2RQ6 A;  1K5S A;  4JZ2 A;  1UPG A;  3M99 B;  2UXB B;  3HKD B;  3HKC B;  4NVP A;  1GM9 A;  4I5S A;  5GTH Z;  1D5A A;  4UCR A;  2XHB A;  1F51 A;  1AI4 A;  4FZ0 A;  1M56 C;  2ZR3 A;  5BY1 A;  1L8D A;  1WN7 A;  3ETG A;  1JFF A;  1SA0 A;  1BQZ A;  3JD1 A;  3IFX A;  1KBH A;  1R6K A;  2NLJ C;  2P5O A;  2EIN B;  1Y4M A;  1GN6 A;  1WP7 A;  2IW5 A;  2ZXW C;  2EIM B;  3CYO A;  1AIL A;  1AP5 A;  1VIB A;  1HR0 O;  3AK3 A;  4PJ0 Z;  4RO2 A;  1BMF G;  2K1E A;  4IL6 Z;  1NTZ H;  3HR0 A;  3ICX A;  4O4L A;  2EZO A;  3ZBH A;  3F7V C;  3FAV B;  5EBM C;  4MVR A;  5LGT A;  1K34 A;  2JVD A;  3RYI A;  2JS3 A;  1HR0 B;  2OYQ A;  1JR9 A;  4D6T H;  1RM1 B;  4A5U B;  1RSO A;  2WLH A;  3S3X A;  2ADQ B;  4TWK A;  1PD3 A;  1B6Q A;  2EZP A;  3JD0 A;  1QU7 A;  1WPX A;  3T1Y O;  1BHB A;  3WG7 B;  4IHJ A;  3APQ A;  4ZI7 B;  1Y74 B;  1JA8 A;  1Y66 A;  2JIZ G;  1EN6 A;  1CPY A;  3JAS A;  5H6R A;  2DQ3 A;  2KKW A;  1FD9 A;  5CBH A;  1VQ9 V;  3T1Y B;  4WFB V;  4XDK A;  5HFM A;  3SPI A;  4QNH B;  4ZIB A;  4IGG A;  2ZR2 A;  2UXX A;  2WSS G;  2Y0I A;  1VQL V;  4LC1 A;  1AB3 A;  3CJH A;  1ZSP A;  1NVP B;  2IJJ A;  1V54 B;  4JAU A;  5GON B;  3ZN0 A;  1P7G A;  1EM1 A;  3OGC C;  4FZ1 A;  2HJF C;  1MSW D;  1MA1 A;  1JJ2 U;  4YY3 O;  4LF8 O;  2ETN A;  3CCU V;  2JJ2 G;  2Y48 A;  3CX5 F;  4JYA O;  3FYI B;  3PJS K;  1O9H A;  1EN4 A;  3HKE B;  3CP1 A;  1IDS A;  1SF9 A;  3OFN G;  5AG2 A;  4UV9 A;  4YY3 B;  1BT8 A;  4LF8 B;  4F4L A;  3HB3 B;  3CS5 A;  2D3O W;  4KP4 A;  1NQT A;  1W2B U;  1AVM A;  1XMO O;  1SQB H;  1WJZ A;  2ZNJ A;  4JYA B;  5B3S C;  4N23 A;  3GWK C;  4NTW A;  4YHH O;  3CXC U;  3U11 A;  2EUL A;  4MVQ A;  4TQD A;  2P90 A;  4DR7 O;  3JSN A;  4PA4 A;  2F4V O;  1DTO A;  1JMK C;  5KAF Z;  4UV8 A;  3ASO B;  1XMO B;  1VQO V;  3JAK B;  3OMA B;  1IX9 A;  3UQ8 A;  5BZB A;  1YTF D;  4YHH B;  1NTK H;  4K0K O;  5EC1 C;  3B8N A;  4RUE A;  1VF7 A;  4YJ2 A;  1LNQ A;  3ZHU A;  4CZZ A;  5CA1 B;  3F5W C;  1WPB A;  1XI1 A;  4DR7 B;  5ITZ B;  2CUG A;  4B7K A;  1SQP H;  1SQQ H;  3HKB A;  2F4V B;  2LFR A;  1VQ5 V;  1IXM A;  1R3K C;  3L70 H;  3ML0 A;  4EFE A;  4K0K B;  4UXN A;  2XAG A;  2EIK C;  2OT5 A;  4BWA A;  3BPZ A;  3K5L A;  1N4C A;  2E3C A;  1KYO F;  4QPJ A;  5IY5 C;  1Y6X A;  1XOU A;  4U3F H;  4GLX A;  1PL4 A;  3T1H O;  3LNM B;  5KX5 A;  2ZDI C;  2A06 H;  3A0R A;  3N27 A;  1Y76 A;  4X88 A;  4J7J A;  4LBE C;  5JQG B;  1R3I C;  3MHS C;  5JVD A;  1SQX H;  4K8Z A;  5CA0 A;  4XBF A;  4OXS A;  3AG4 C;  3CC2 V;  3ASN B;  5FLX N;  3T1H B;  3BFR A;  2IJK A;  4PDV A;  2QKS A;  4O4I A;  5IE9 A;  1IVS A;  2OIE A;  5IYB O;  1ZUQ A;  3KZI Z;  4B7E A;  3ZRV A;  1PP9 H;  3CRC A;  4GCZ A;  4NB5 A;  1M1K W;  3L71 H;  4X9Q A;  2R9A A;  1K4C C;  4R8C A;  3G6E V;  4DR6 O;  2XAQ A;  3CRQ A;  1KP2 A;  3BCC H;  1D2D A;  3SPJ A;  2N04 A;  3FB6 C;  2BOB C;  3RVZ A;  4O4H B;  5D5P A;  3ABK C;  2VWJ A;  2FTK A;  4X1Y A;  3CCV V;  3CC4 V;  4O2B B;  2QDO A;  1FPO A;  2EBO A;  5FNV B;  4DR6 B;  1R1B A;  3SJQ C;  3DXR B;  2P67 A;  4OGQ B;  2WLK A;  3MDS A;  4N21 A;  4FMT A;  2PGG A;  4DV0 O;  1SC5 B;  1FXV A;  2GHY A;  2HJD A;  4GX5 A;  1MMM A;  3ABM B;  1XNQ O;  2MW2 B;  4LFB O;  5JH7 A;  3R65 A;  1P4R A;  2ZE6 A;  4DR3 O;  1NZ6 A;  2L35 A;  4MTX A;  2V4D A;  5D5Q A;  3I55 V;  3K5N A;  4G28 B;  1N0N A;  4BW9 A;  2BSK B;  4DYL A;  3JAL B;  3CHX A;  4XDJ A;  4DV0 B;  4PA6 A;  2X7R B;  2P6J A;  1XNQ B;  4KXR A;  4LFB B;  2DYS B;  4PV1 B;  4DR3 B;  3K58 A;  4WFH A;  3SPG A;  5CMU A;  5KHI A;  1S72 V;  4J41 A;  2Y69 C;  2IH3 C;  2RCV A;  4IYI A;  1K7D A;  3CEI A;  3CXH F;  4JPR A;  1KKD A;  5CA3 A;  4J42 A;  4JZG A;  4GUN A;  2HP8 A;  3B09 A;  1O9G A;  3I56 V;  2Q0A A;  2PYL A;  4NR1 A;  3SR2 C;  3ZRW A;  4PI2 A;  1IBM O;  3ETE A;  1S77 D;  3QO7 A;  2QWP B;  4P30 A;  1MZE A;  3T4Z A;  3B77 A;  5DM6 V;  2HR3 A;  4W4L A;  5KUM A;  3TJT A;  3OMI B;  3W7X A;  5B5E Z;  4MTF A;  3ZRX A;  3CME V;  2WLI B;  3CCE V;  4GKK O;  1NS1 A;  1IBM B;  3ETQ A;  5EK0 A;  1QQC A;  1SET A;  2XUM A;  3CCQ V;  3N2G A;  5KAI Z;  2JJ1 G;  1N34 O;  3L75 H;  4X65 O;  2BTQ A;  1ZAU A;  1NI8 A;  2A79 B;  4F6R B;  1VMG A;  1PL0 A;  4QJF B;  3BAB A;  3HPL C;  4X1I A;  2YDE A;  3IAY A;  4GKK B;  1WA8 A;  1K97 A;  1H2M A;  5EYP A;  2Y69 B;  4E4E A;  3LDC A;  2YIA A;  1N34 B;  1L0L H;  2ADP A;  2EJ7 A;  4MVS A;  4BAY A;  4X65 B;  1K73 W;  3SDL A;  1QVF U;  5JJE B;  3SJA C;  4GKJ O;  4FLW A;  2F1M A;  2KB1 A;  2EIL C;  4PA7 A;  1H2S B;  3ZMT A;  3SPC A;  1JPX A;  1ROP A;  3EFF K;  2O57 A;  5LP6 A;  3THO A;  1WB8 A;  4YJ3 B;  2FB5 A;  1TUB A;  5A2Q N;  1R6N A;  1FXH A;  2E74 B;  2X6B A;  1LUV A;  4TV8 B;  4GKJ B;  1XHZ A;  4LF7 O;  2Q7H A;  4RUF A;  2CE4 A;  2DQ0 A;  2GTA A;  1K92 A;  4DV7 O;  3H1K H;  1F4M A;  3O65 A;  1RSO B;  4I50 A;  3IC9 A;  4CS2 A;  3KKY A;  1BCC H;  4LF7 B;  4O4J B;  4U3J A;  1D5N A;  2Z3Y A;  4DV7 B;  3S3W A;  4J80 A;  3JAW A;  1S76 D;  2X6C A;  3CCR V;  4JAA A;  1YTF B;  5LGN A;  1NR7 A;  2CGN A;  2VQF O;  3SYP A;  2RNB A;  3JAS B;  1XNR O;  2H3O A;  2HVK C;  2R72 A;  4U7O A;  1KQS U;  2EIL B;  2OTL V;  3CCS V;  4Q6G A;  4CS4 A;  4TV9 A;  4DRX B;  3KCX A;  5KHK A;  1YI2 V;  2P4K A;  2W0X A;  3ABU A;  4JI3 O;  5EIB D;  2EIM C;  1E79 G;  3QO5 A;  1NH2 B;  4LP8 A;  3E8B A;  2PI4 A;  2VQF B;  4G27 B;  1XNR B;  1GK9 A;  3IC7 A;  1Q81 W;  4J9Y B;  4B08 A;  3APO A;  2AZ0 A;  4JI8 O;  2BTO A;  2KG7 B;  4DUY O;  4JI3 B;  2OCH A;  2B1I A;  4LR3 A;  3AK1 A;  5KMG B;  2DJV A;  2YI8 A;  3ZMV A;  2QKA A;  2Q73 A;  1RM1 C;  4ZHQ A;  5F2V O;  2Y0P A;  2Q67 A;  5IYZ B;  4P9P A;  4JI8 B;  3ZMU A;  4CC6 A;  5GW7 A;  4DUY B;  3RWR D;  4LF5 O;  2WWW A;  2WLL A;  3UCS C;  4YIO A;  2UXN A;  4I0X A;  1GM7 A;  2M6Y A;  5L3G A;  2F43 G;  3WG7 C;  1NJI W;  4CC5 A;  4DO2 A;  4JI4 O;  3NR7 A;  1HW7 A;  3TXQ A;  1OV9 A;  5DEC A;  4GX0 A;  1GN4 A;  5K1P A;  2P22 C;  4LF5 B;  1H38 A;  1MG1 A;  2ZKO A;  3TXS A;  4UVA A;  1GTO A;  4I55 A;  5IJ0 A;  5L3C A;  4JI4 B;  1KD1 W;  4G2K A;  1M4U A;  5H5N A;  2WA4 A;  3CPW U;  4LF9 B;  1FXK A;  2XAF A;  4HNA A;  1LUW A;  3B8M A;  3D36 C;  3OUS A;  1P7B A;  4YJ2 B;  3U0Z A;  4IIJ A;  5J2T A;  2AHZ A;  1V54 C;  3HKB B;  1L0N H;  4OPH A;  1B06 A;  1GH6 A;  4GZR B;  3JD3 A;  1AR1 B;  1ZTE A;  2XT9 A;  4DK0 A;  2F23 A;  3E8F A;  3OEH G;  1GM8 A;  3RN4 A;  4X1K B;  1YCI A;  2BOC C;  5TIS Z;  3UO2 A;  1OCZ B;  4NKG B;  4I4T B;  1KU9 A;  2E75 B;  1R73 A;  4MW8 A;  4B3M O;  2IBZ H;  1HNZ O;  3SYC A;  1Y76 B;  3EVK A;  1FFX A;  2GUZ A;  3K57 A;  5JVD B;  1OJH A;  1TAE A;  2PYJ A;  3EXA A;  4OPA A;  3OTF A;  1RFY A;  1BZK A;  2B5U A;  5LYJ B;  4B3M B;  1OHH G;  1PV0 A;  4JTA B;  4O4I B;  4TSF G;  5K1X A;  5JWP A;  1HNZ B;  5HFL A;  3RGB A;  1QNM A;  3LDE A;  2ZIO A;  1BSM A;  4NXN O;  3ASO C;  1P84 F;  3CRA A;  2V1D A;  3JAM N;  2ITD C;  1VEW A;  3TGU H;  4FK5 C;  4AQY O;  1M93 A;  2CH7 A;  1WNS A;  1AI5 A;  1ZWI C;  4LH6 A;  1Q82 W;  3Q4H B;  3G71 V;  1BGY H;  4TUY A;  4MTO A;  1B04 A;  1HDJ A;  2WLJ A;  4GX1 A;  2XAH A;  4NXN B;  2HFE C;  3M7M X;  2NN4 A;  4X20 A;  4X89 A;  4AQY B;  4FFB A;  2AHY A;  2A9H A;  2DN9 A;  3OTO O;  2BE3 A;  5BR8 O;  5LGU A;  3GVM A;  1KB9 F;  3N2K A;  4ZOL B;  5JH7 B;  4WBN A;  1R3J C;  3K5M A;  3HKC A;  3HKD A;  4YIP A;  2IH1 C;  3OMN B;  1DLB A;  3W7U A;  1PNL A;  3OTO B;  3CMA V;  5BR8 B;  3ASN C;  4O2A A;  2DMX A;  4FLU A;  1M5I A;  4W4K A;  2CDY A;  4PI0 A;  1AJQ A;  3WB0 A;  2ILM A;  1GO3 F;  1YHQ V;  3ABL B;  4UCS A;  4DV6 O;  2XOK G;  3G4S V;  5EC2 C;  4H37 A;  4JI5 O;  1QVG U;  1FFT B;  2H94 A;  5LOV A;  2YXY A;  3CSX A;  2EIJ B;  2XAS A;  3ZHS A;  2R9R B;  3AK2 A;  1YIJ V;  4WCE V;  2MK3 A;  4PEL A;  1SES A;  4UUJ C;  1U97 A;  1COW G;  5EZY B;  4DV6 B;  2NNU A;  2JGU A;  4MVU A;  4JI5 B;  4GT1 A;  2L6L A;  1BS3 A;  3RYC A;  4BW5 A;  2M7W A;  1YZB A;  2PY5 A;  4JYY A;  2ZNI A;  3VQW A;  2CK3 G;  2XAJ A;  1EBO A;  3ZRS A;  4B3R O;  3ZHR A;  1TVK B;  2JGD B;  5BMV B;  2ZIM A;  1XQ8 A;  1RP3 B;  3ABM C;  2BTQ B;  2QWR B;  1SKV A;  4AI8 A;  5IJ9 A;  4ZI7 A;  3ZN1 A;  3BEH A;  4LWS A;  2LJ2 A;  4B3R B;  3LDD A;  5J2U A;  1Z5V A;  5LA6 B;  2HHH O;  4Z1M G;  5CBF A;  5JCO C;  2Q0O C;  3BRC A;  3K5O A;  5B1O A;  2R9I A;  1RPO A;  2DYS C;  2X6A A;  4JV5 O;  2D2C B;  1FKA O;  2WA3 A;  3RFR A;  4PD4 F;  2ZE8 A;  4RQF A;  3A8T A;  1VF6 C;  2QM4 A;  2HHH B;  4TOI A;  2Q6A A;  3ZCC A;  2Q7G A;  5LP6 B;  2FML A;  3CCM V;  2JEX A;  2JRI A;  4I9W A;  4JV5 B;  4WFG A;  2XTA A;  1JVM A;  2UXC O;  3C90 A;  4DR5 O;  3BY6 A;  1OCR B;  5LHG A;  3K06 A;  1TUE B;  3OD4 A;  2CTQ A;  4DUZ O;  2PZS A;  2PF4 E;  4ZKI A;  5BXZ A;  4X66 O;  1HNX O;  3AG3 B;  4I50 B;  2UXD O;  5E79 Z;  3AG1 C;  2ODM A;  2UXC B;  4DR5 B;  3AG7 A;  1VF5 B;  2Q5Z A;  1F7Y A;  4LFA O;  4DUZ B;  2YID A;  1B3Q A;  3RYH A;  4JI0 O;  4JI2 O;  1BQ0 A;  2QR4 A;  2N74 A;  3E83 A;  3UT5 B;  1MSD A;  4X66 B;  1K8A W;  2KQX A;  4CH3 A;  2ZT9 B;  3T4D A;  1HNX B;  3OR6 C;  2UXD B;  1S5J A;  4MVZ A;  3QG5 A;  3K79 A;  4JYB A;  4TV9 B;  4LFA B;  2E76 B;  4JI0 B;  3JAT B;  4JI2 B;  2ITC C;  3JAK A;  1G4Y B;  4GX2 A;  1KUQ A;  2HG5 C;  4UCU A;  2IM9 A;  5J9P C;  2RDC A;  5IWA O;  2GV9 A;  4TT3 G;  5ITZ A;  3X2Q B;  1N0J A;  5LMU O;  4JTC B;  4UCO A;  4FM2 A;  2CTR A;  1E1R G;  2F95 B;  1Q86 W;  3AG1 B;  1ZL8 B;  5IWA B;  3E8G A;  2YEV B;  4UCT A;  3M8A A;  3PN1 A;  3RW0 A;  4H33 A;  5LMU B;  5L3D A;  2R70 A;  3BVO A;  4J10 A;  4FIP C;  2WLL B;  3K3W A;  3QTC A;  5B1B B;  2QEX V;  4IYH A;  1M57 B;  3VQV A;  3W7T A;  2QA4 V;  3SGI A;  1NTM H;  2OWO A;  3ZED A;  5JQG A;  5LXT A;  1JFF B;  2P4V A;  1SA0 B;  2ATK C;  2YIB A;  3KCY A;  2QE7 G;  4AHC A;  5EBL C;  3L73 H;  5LMN O;  4CH4 A;  1PPJ H;  1XUQ A;  2W6J G;  2QM8 A;  1VQ4 V;  1RPR A;  2VQE O;  4CH5 A;  4H44 B;  5IJ0 B;  4O4L B;  3BAA A;  1MZF A;  2IU0 A;  1SQF A;  2YI9 A;  2Z0A A;  4QGP A;  5LMN B;  4YXW G;  1QLN A;  3RYI B;  1W0K G;  5J2T B;  2Q68 A;  1H8H G;  1PNM A;  3T2M A;  2VQE B;  1VQM V;  4Z1V A;  3JD4 A;  3ZIA G;  4D7T A;  4Z2W A;  1HWY A;  4I9Q A;  1F23 A;  1K3E A;  2H8P C;  3JAR A;  4J7K A;  2UUB O;  2XND G;  4BR6 A;  1UFI A;  4O2B A;  1I5X A;  5B66 Z;  5FNV A;  3C3T A;  3SYO A;  2ZDI A;  1ENV A;  2RJZ A;  3DXR A;  4L87 A;  1BL8 A;  4K8X A;  3WU2 Z;  4RWU A;  1FAF A;  1F4N A;  4IHJ B;  1YEW A;  1AJP A;  4HZ3 A;  2W6I G;  4F6E A;  2OCC B;  2V7Q G;  2UUB B;  1FFX B;  4BIO A;  2G38 A;  4B3T O;  3AG2 C;  5C8Y A;  1CP9 A;  3JAL A;  5KA5 A;  5A9G A;  1KKC A;  5JCO A;  4DV3 O;  4MVO A;  5IYC O;  3F5T A;  4X64 O; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...