1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
source organism Olea europaea
molecule tags Allergen
molecule keywords Pollen allergen Ole e 6
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
4LNUA 3GVMA 3JAMN 3TJTA 3S3XA 4PI0A 5IJ9A 3VOUA 5LOVB 1B04A 1SC5B 1ZTEA 2X6AA 1YDXA 3SJBC 5BMVB 2JVDA 4JI2O 4JASA 3N2GB 1ZUQA 4OX9B 1HNZB 1K9MW 3JD3A 3A0HZ 4DR1B 2ZDIA 3CX5F 4FLXA 1YHQV 4LF7O 3LSUA 2GUZB 1A32A 1SQBH 4DR5O 2KKWA 3J81N 2G38A 2WAMA 5CBGA 4JV5B 3JATB 2QE7G 1MZFA 3FX7A 5EBMC 1IBMB 2ITCC 1VQKV 2ZD9A 5LA6B 4RUEA 2DW4A 2D3OW 5B3SC 3O65A 3F7YC 3ABMB 5GONB 4D7SA 3CRRA 4WFEA 4YJ2B 3OE7G 3EXAA 5BR8O 3CC7V 2P90A 1N36O 1XNRO 1J5EO 1AILA 2OYQA 2WSSG 1H8HG 2ZNIA 2LO1A 3EHBB 2XAFA 4I4TB 4TQFA 3WB2A 2R70A 3RYFB 4MVMA 2QWQB 1IBKB 1QU7A 1BZKA 2CK3G 2Y0IA 4X66O 1JQ0A 1XEQA 2IJKA 4GKKB 3LDEA 2PYLA 2QWNB 3ZS8C 3RBZA 3ABTA 2ZE8A 3ZMZA 1TUBA 4O4HA 2YC0A 1F51A 4WFGA 4Z1MG 4IIJB 2P7TC 4B3MB 1AJQA 3BCCH 3FYIB 3BAAA 2DYSC 2VRZA 4GZRB 3CE2A 2BSKB 1L8DA 2CTQA 2GTSA 4JV5O 3ZRWB 5LHGA 5FNVB 2DYRC 1GM7A 3JD2A 4Q6GA 3SGIA 4DR1O 2W0XA 3APOA 5LYJA 3SYPA 4X64O 5LMUO 2WLHA 3K03A 1SKVA 5JCOC 1GH6A 2UXDB 2IJJA 2JJ2G 1E79G 3SJQC 5J2UA 3M7MX 4I5SA 4LF7B 2Y69B 3IJ4A 4WFHA 2X7RB 3B40A 2BSKA 4TV8A 3B8NA 1N32O 1LR1A 2Y4TA 2VQFO 1U97A 1N0JA 5EZYB 4NR1A 4L8JA 5LGTA 4UXNA 4N21A 4RQEA 3LDDA 3AG2B 5LYJB 1NZ6A 5CA3A 1P7GA 1YXBA 1RSOB 4J7ZA 1GN2A 4LFAB 1BHBA 2DE0X 4GX5A 1KC8W 2Q7GA 2P6JA 5J2UB 2YS8A 4QIWF 4YJ3A 5GTHZ 4KHPO 3ASNB 2P67A 4FFBB 4U3JB 4X89A 2EZPA 3FYEB 2QM4A 3QVNA 5B3SB 1B3QA 5EIBC 4UV9A 4PA4A 4WFAV 2Q68A 5H6QA 2ZNJA 2XASA 2OTJV 5IYZB 2JEXA 1Y6XA 1N33B 1P84F 2PI4A 4GLXA 4UVCA 3SJAC 2W6IG 4WBNB 4X62B 1D5NA 1SF9A 1VF6A 1Q43A 2NR5A 3P3PA 1SQGA 1JVMA 4DR3O 2QJ1A 5HFLA 2JGDB 3CRCA 2DQ0A 1YJWV 1N32B 4FM0A 2FTKA 2H8PC 1O9GA 2QWOB 1XL4A 1SQFA 5KA5A 3ZRSA 1E1QG 2GDSA 2JJ1G 3N2GA 4AQYB 4BIZA 3JALA 4MT8A 1EBOA 1FXKB 3U11A 4TWKA 5LP6C 5EIBD 2HVKC 4DV6O 2XT9A 3LSQA 3K08A 5LGNA 2BOCC 1AI6A 4O4LA 1WPXA 2D2CB 2Q7HA 2E74B 2ZIOA 2H94A 5FL7G 2V7QG 3DGEA 2F4VO 1AROP 3GWKC 4DR5B 4R7CA 4J7JA 4F6RB 4OXSA 3QNEA 3OGIB 3JYCA 3N27A 1K5SA 2YEVB 3JAKA 3VBBA 3OD4A 4LF5B 1JFFA 2E76B 1K34A 2Q0AA 1IXBA 3AG4B 1V54C 1JA8A 3HKEB 4YHHO 4ZI7A 1HNWB 3OTOO 4YIOA 2WLKA 3THOA 1Q90D 1VIBA 1HNZO 3ZRVA 4W4LA 5KUKA 4GCZA 2A06H 3AG3C 3JCZA 1FJGO 2PTMA 3FAVB 3QO5A 2O57A 4JI4O 3AG7A 2QM7A 4QPJA 2XNDG 4PDVA 4DUYB 2ZE7A 1IURA 4IYIA 3KCXA 3ABKC 4X1YB 5EYPA 1VQ7V 3ABMC 2EULA 4DYLA 3B09A 1IDSA 1R1BA 1NJIW 1TUBB 2HR3A 4O4HB 1SA0B 1ENVA 2Q6AA 1OCRB 1Q8IA 2P22C 3JSNA 4U7OA 4DR3B 3UQ8A 4R8CA 4JAUA 4FZ0A 3CSXA 4DV4B 4C7UA 5CN0A 4JI7O 3K79A 2UUAO 4O4LB 4TUYB 3JASA 4JZGA 3TK1A 1QBZA 1CEZA 2Z5UA 4FLTA 4F6RA 3CCRV 4EKWA 4X66B 2W0FC 4DRXB 2XAGA 1BHAA 3DC5A 3K59A 4FK5C 3MAQA 3G71V 4IHJA 4LF9B 2V1DA 1FS0G 1R3JC 2RDCA 4JTAB 3E2EA 4FLYA 2CE4A 3AK1A 1YIJV 1N34O 1JJOA 4CH4A 5CB4A 1FJGB 3SPGA 4O2AB 1QLEC 4MW8A 4TV9A 3X2QB 3OEEG 1UJWB 4P9OA 4IHJB 2YI9A 3JARB 1KKDA 2HHHB 4JAVA 1SQPH 3BPZA 4DRXA 4JI1O 4JI6O 3G80A 4GYCB 3CCSV 3L70H 1YITV 2ADQB 2JGDA 2CDYA 1XMOO 3WB0A 3L74H 3AK2A 5K1XA 1CP9A 2F66C 2DWEC 2QDOA 4PA9A 2KG7A 1NTMH 1BQZA 1AP6A 2IH3C 1JOYA 2QKSA 1XHXA 3CJHA 2HEPA 2ZM6B 2K1EA 3SYOA 3JARA 2R9AA 4PDLA 1WNSA 4WFBV 5KLVH 1KQSU 1RSOA 1OCZC 3IFXA 3K9SA 4B7KA 4H33A 3LSSA 3IGAC 4ABMA 1DGSA 3P30A 5E79Z 1OCOB 2YSUB 1V55C 5IE9A 1AVMA 3HKDA 4I55A 5BMVA 4FLZA 3H1HH 1VARA 5J2TB 4OGQB 3OMNB 4DV6B 1AR5A 2ZXWC 1GK9A 3J80N 4WFFA 1Q82W 4X1YA 4JI7B 2JS5A 4FFKA 3OUSA 1Q6IA 1IZ3A 4KL1A 4BIOA 4O4JB 3H1LH 1BGYH 1WB8A 1ZWIC 3H1KH 3EVKA 3ZIAG 4MTOA 3IC9A 5KX5A 1BT8A 5L3FA 1K8AW 3M8AA 1H38A 5IT9N 4X62O 1QVGU 4JYAO 3RWRD 3LNNA 3ZHUA 4DV7B 3E22B 5H5NA 4LF8O 2UXNA 1N36B 3H9VA 5KAIZ 4N23A 1PKXA 3QO8A 1EN6A 4I0XA 5JQGA 5HFMA 2L35A 3E8FA 1VQNV 1NH2D 2A0LA 3K5NA 1P4RA 1FFXB 2Q0OC 1F4NA 2E5LB 1HWYA 1FPOA 4JI8O 2R72A 5B1OA 2B9ZA 5C93A 1G4YB 5IDJA 4LF6O 2CTRA 4LF5O 2Y48A 1W2BU 3VQWA 2FL4A 5C8YB 4DUZB 5KAFZ 3BABA 3OUFA 3BY6A 3SJCC 1GRJA 1YTFB 4PELA 1VQOV 4IGGA 4NB5A 3KG2A 4X88A 5TISZ 1WA8A 4YY3B 1J95A 3QF7A 2AXTZ 3BA9A 2CTPA 5DN6G 4O2AA 3ZX6A 2DQ3A 2X6BA 1Q86W 2B1GA 2ZCEA 3E35A 4ZOLA 2AZ2A 4RQFA 1IVSA 3W7SA 5JH7A 3RYIB 1M56B 2ADPA 5IYCO 1L0NH 3E8HA 3HKBA 3G67A 1GAXA 1NS1A 4DR2B 1GTOA 4RWUA 2NN4A 5EYPB 3T1YO 1VQMV 2AHZA 2JRIA 4BAYA 4ICGA 2QGNA 2GV9A 1WP8A 4D7TA 2OCCB 2WA4A 1SZTA 2YEVA 3G4SV 3MHSC 3CRMA 3F7VC 3H1IH 1ZX3A 4WCEV 4PA3A 1IBLB 5LL6Y 3R65A 3UKMA 1UFIA 4MVSA 3HKEA 3ASOB 1BE3H 4D6TH 1AI7A 5L3DA 1KP2A 1Z5VA 4DV1O 4DR6O 2RQ6A 1RP3B 1BQ0A 4QGPA 3L73H 4NXMO 4DV0B 3RN4A 4NVPA 1WP7A 1B06A 4JI5B 5LGUA 1NT2B 1VQ6V 1GN6A 3ZHTA 4FLVA 2Q69A 1NQTA 2EIKC 3ZJZA 4FPPA 2ODMA 3PJSK 1SS3A 4JI8B 2DYRB 2B5UA 4LR3A 2AW9A 5L3CA 2EJ7A 1YF2A 4JGSA 3CWBH 4ZBMA 3G6EV 4LH6A 3CCUV 1TAEA 4QE7A 2LW7A 5LXTA 4FMTA 3CMEV 3DC6A 1G1XB 2FB5A 3OMIB 2CAZC 4JAAA 5B1BB 4DV2B 1T5EA 1KKCA 3WG7B 2YIBA 2RNBA 1VQLV 1HDJA 3RVZA 2VQEO 3CPWU 1OHHG 2ZIMA 4IYHA 4XDKA 2P4VA 3GB7C 4J9YB 3HKBB 3W7UA 2ILMA 1YTFD 1K4CC 3STZC 4MTXA 4NXNB 1EN5A 2JIZG 3E86A 4U3FH 4UUJC 2B1IA 4CH6A 3SPIA 4LWSA 4YJ3B 5J2TA 2YXHA 2YIAA 2XAJA 4GX0A 1URFA 4DR4O 3QTCA 4H13B 2FMLA 4JYAB 1JCHA 1R73A 3CC4V 4UFZA 3ASNC 4J10A 2AHYA 1OCOC 3JAWB 2V4DA 2AGAA 4PI2A 4UCTA 5D5QA 1ZL8B 3IAYA 3CCLV 4NTWA 4TOIA 4HNAB 1KMIZ 1OV9A 5IYDO 3ASOC 3QG5A 4EFEA 2LP7A 1F4MA 5IJ0A 4CH5A 2PGGA 1M93A 2JGUA 3VQVA 3HR0A 2KSDA 4ASUG 1NVPB 1Y74B 1K4DC 3C90A 3FB5C 4PHZA 2HP8A 1W0KG 1VP7A 3SDLA 1KU9A 2FYUH 3NXSA 2PUSA 4JYCA 2E75B 4K8XA 4X64B 1S5LZ 4DXWA 3VQXA 3B4SA 2JK5C 4DK1A 3DXRA 5EC2C 1XL6A 3UO3A 3NR7A 1HW7A 2QM8A 4OX9O 3E83A 1THZA 1PL0A 3ABLC 4WBNA 3UO2A 1KBHA 2F95B 2LGQA 1MZEA 1Z5WA 5IWAO 1GO3F 4DW1A 1O9HA 1H2MA 3OEHG 5B1BC 4UB8Z 1Y67A 2ZR2A 5J9PC 2QWPB 4DR7B 4BW5A 2RCVA 1M90W 1PNKA 2DWDC 2ZE5A 4AHCA 1V54B 4X20B 2NLJC 2HG5C 1JX9A 1XREA 4QNHB 1CPYA 1BL8A 2CTWA 2UXBB 3SYAA 1JMKC 3RGBA 3AG4C 4I50A 3HKCA 4PDMA 5KMGA 3Q4HB 3FB7C 2BOBC 1TVKB 4Q20A 1XNRB 4JI3B 3HB3B 1EM1A 3ZMTA 1WLEA 1ZAUA 5B5EZ 4AQYO 4B3MO 4TSFG 1US6A 2ZKOA 1E1RG 2IM9A 4I50B 3ABKB 2LJ2A 4MSWC 3RFRA 3AG1C 5KHKA 1W0JG 1V9PA 3SYQA 4DR6B 3F5WC 1OCRC 4DV3O 1VQ8V 2N04A 1LUVA 1XNQO 2XUMA 1I5YA 2YICA 2CGOA 1BS3A 3BRCA 3ETEA 1QLNA 1JR9A 4O2BA 4EB6B 1HNXB 4X65O 4I9QA 4QPKA 2OIEA 2OT5A 2WLIA 2ZM6O 1N4CA 2A79B 3SPCA 4MVOA 1W59A 5FNVA 4LP8A 4DUYO 3BEHA 4ZHQB 3FD9A 1COWG 3E22A 3ZHVA 1AR1B 3ZN1A 2EIJC 3L72H 1XILA 2KG7B 1OCCB 3E8GA 2L6LA 1FXVA 1G8MA 3CRAA 4PV1B 1HR0B 2VQFB 4JI0B 4FM1A 5IJ9B 4NXNO 2X6CA 3OTOB 1NH2B 2Q73A 4NYKA 4H0LB 5IWAB 1OJHA 4JI5O 5IYBO 5KHJA 4P2ZA 4EB6A 4J11A 4ZIBA 1Y66A 5JJEB 2KB1A 1JPXA 4ZHQA 4A5UB 2VQEB 4UV8A 1EFRG 4O4IA 4BWAA 5BY1A 1GMGA 4JPRA 4UCSA 2QKCA 3B77A 2E5LO 5H2FZ 5DM6V 2LQTA 5CA1B 3UT5B 4DV2O 2W6JG 4LF6B 1DTOA 3A8TA 3L71H 3F5TA 1SZXA 4LF9O 3ZMUA 4LH7A 1NVPD 5JVDB 1R3IC 4CS3A 5EBLC 1Y4MA 1Q6HA 2Q4PA 4MVQA 5CA0A 2R9RB 3SPJA 3ZN0A 5JH7B 3DSQA 4DW0A 3A0BZ 1S72V 4CC6A 3OGCC 1R6KA 4B3RO 2UU9O 2A7WA 3FB6C 1Q5OA 3W7TA 3DXRB 4DV3B 2WLMA 4TV9B 3RYCB 2OWOA 1YJNV 4MTFA 1ZL8A 1JJ2U 2Q67A 3CS5A 1PL4A 1H2GA 4PA7A 2Q5ZA 1P49A 2XTAA 3KKYA 1V55B 4W4KA 2ZXWB 4B3TB 3ETQA 2GTAA 4WF9V 1Y74A 2UXXA 4X1KA 4EEQA 3LUTB 5C8YA 3T1HB 2H3OA 4K0KO 2BTOA 2P4KA 1IBLO 2BCCH 5F2VO 2EX3A 1KD1W 1QHTA 1DK1A 1XMOB 1S0VA 4O4IB 3D3IA 4O2BB 2CH7A 1NR1A 3T1CA 1K73W 3WB1A 1FXHA 1EN4A 3P32A 1PNMA 1PP9H 2ITDC 2QWRB 3OTFA 3FB8C 4B08A 2QA4V 5JJJB 1VQPV 5LXTB 1K5QA 1FKAO 4X9QA 4IIJA 2UUBO 3TCUA 1MA1A 4YHHB 4YIPA 1HNWO 4PJ0Z 3D36A 2QSAA 3ZHSA 1D2DA 4HBNA 1I5XA 1MSWD 2Y69C 2C2AA 4K8ZA 3IC7A 1AJNA 3K5OA 1VQ9V 1AI4A 2DMXA 4FFBA 4DV4O 5A9GA 4ZOLB 4X65B 2Y0PA 4UVAA 1R3KC 2Z3YA 5B1AB 1SA0A 4I4TA 2PF4E 5LMUB 4UCOA 2RJZA 1XI1A 4G27B 2OCHA 1M56C 1WPBA 4LFCO 1S77D 1XNQB 1SRYA 3FFQA 3OR6C 3UCSC 5K1PA 5KHGA 5KUMA 5ITZB 1HNXO 4B3SB 3STLC 4LC1A 5L3BA 4HNAA 1NI8A 3E89A 3PN1A 4UCRA 3T1HO 5L3GA 4JI3O 1Q81W 4R6ZA 3B8MA 2UUAB 4KUMA 2JEUA 1S5HC 3RT3C 1M57C 2M7WA 4CH3A 2X0LA 4J41A 4DR4B 1IBKO 4JI2B 1L0LH 2F43G 1NTZH 2HHHO 2WLIB 4J9ZB 5KX5B 1RFYA 3CHXA 4MS2A 1WAZA 1GM8A 4R50A 3APQA 4G2KA 4H44B 3U10A 4X1KB 1IX9A 2ARHA 1QQCA 1YEWA 2JS3A 5LP6B 4O4JA 4LF4O 2IJIA 4UB6Z 1DF4A 3JASB 4CZZA 5JWPA 4L87A 2BTQA 1RM1C 1M4UA 1XDCA 4FLUA 3DTUB 1EZVH 1VF7A 2PYJA 1FXKC 2YIBD 5A2QN 1P7BA 3L9DA 4MVZA 3RW0A 2HFEC 5FLXN 2QTSA 3CYOA 5BXZA 4J7KA 4AILC 3RYFA 1Z2GA 1UPGA 2A9HA 2UXCB 3OAAG 4P30A 1XUQA 3RYHA 5CB4B 3D3QA 3CB2A 2P5OA 4DV0O 1ZLZA 1RPOA 4H37A 4MTGA 1YVWA 1SETA 3CD6V 1WB7A 5EC1C 1H2SB 1K97A 3AG3B 3RYCA 4XBFA 3C3SA 2WLLB 4LWSB 5B1AC 5LBQA 2GBOA 2YUAA 2MK3A 4PDRA 3JD0A 2HVJC 2Z0AA 2ETNA 2IU0A 1XOUA 2EILC 3K04A 3CXHF 4KXRA 3ZMSA 3CP1A 4K35A 2IW5A 2ZQMA 3OMAB 2KQXA 1Q6UA 2WWWA 3T4ZA 2EINB 5EK0A 2ATKC 3RYIA 1SQXH 3RVYA 3BA8A 2WLLA 5E1AC 3K0DA 4I7ZB 3TXQA 3UM7A 4QJFB 2ZR3A 2Q7EA 3ZHQA 2M6YA 1U96A 3OM3B 4EFBA 3OR7C 3MDSA 5CBFA 4IL6Z 1SQVH 4U7NA 1NBMG 1XQ8A 3I5DA 2YI8A 2XHBA 3W7XA 5LMNO 1FD9A 2VWJA 1PNLA 2ZDIC 4LFAO 5GW7A 3CCJV 1SESA 1QR8A 4FIPC 1M5IA 4E2LA 4DV5B 1H2KA 2XAHA 4HAMA 4TV8B 3CCQV 1M57B 5CA0B 4KHPB 1VQ4V 2IJHA 3CRQA 4X1IA 4P9PA 1GN4A 3CCEV 2YXYA 2XAQA 1GN3A 2F93B 3OFNG 4GKJB 3WFVA 1H2LA 2RMKB 1S3JA 5KHHA 3BHPA 4JTDB 2MW2B 1AB3A 3Q4HA 5GTIZ 1K92A 3HKCB 3JD4A 4RUFA 2XOKG 5FPRA 5DEDA 4CS4A 5BZBA 4YXWG 1R3LC 4J42A 4HYOA 5JCOA 3TXSA 3ZRWA 5GONA 2UUCO 3KCYA 2VWKA 3CJHB 3CMAV 1QLEB 4DUZO 2NNUA 1F7YA 2WLJA 1NTKH 3ML0A 2LGWA 3ABLB 1WJZA 1R6TA 4UCUA 3BFRA 1GM9A 1FFTB 5JQGB 4I0XB 3I56V 4LCUC 1HP8A 1KP3A 2F4VB 3ETGA 4JZ2A 3HPLC 5B1NA 1NR7A 3AG2C 2N74A 1G6UA 4FM2A 3ZEDA 4RAIA 2UUBB 4JI1B 4JI6B 4FZ1A 4DO2A 1QNMA 3N2KA 3H1JH 3HKDB 3JATA 3OT7A 3ETDA 1NKDA 5H9CA 4DV1B 5DECA 3BVOA 3E8BA 4GT1A 2EILB 2EJRA 1I7FA 1PPJH 1CXZB 5ITZA 1I08A 5LHHA 4IT5A 1KECA 1MNGA 2EBOA 5IYZA 3JCUZ 2PZSA 3S3WA 5LMNB 1TGOA 2E3CA 4TQDA 3RYHB 1B6QA 5IY5C 3J7AU 1VMGA 3ABUA 1EZJA 3AG1B 4UCVA 3SPHA 2OCCC 4K3AA 2UXDO 2YIDA 2A3QA 5CA1A 2WA3A 4RO2A 2IBZH 2WPDG 5L3EA 1GKFA 2GSMB 3LNMB 1XBLA 1SQQH 3H01A 1Y76B 4JYYA 1I0HA 3D8CA 4XDLA 4YJ2A 1Q3EA 4UVBA 5EBWC 4FLWA 1X59A 2EIMB 3JSLA 2EIJB 2WLNA 1X4TA 2LW1A 5LA6A 2YXLA 3C3TA 3A0RA 3FAVA 2UXCO 3ICXA 2UXBO 2QTOA 3ZRXA 1MMMA 4X8AA 5KA6A 3CEIA 2CH7B 4I9WA 4LF4B 3WG7C 1Y76A 4JYBA 4F4LA 1N0NA 1DLBA 2CUGA 4MVUA 3WU2Z 2BE3A 2GHYA 4PA6A 2JDIG 1AJPA 1D5AA 1ROPA 3LDCA 2QEXV 2AZ0A 1S5JA 2HJFC 2CGNA 4BW9A 2IH1C 4JI0O 1HR0O 2LFRA 2QKAA 4DV7O 3ZBHA 2F23A 1YSCA 1K3EA 5D5PA 5KHIA 1XMQB 3ZHRA 2ZINA 1RPRA 1N34B 3K58A 4NTYA 1FXKA 4KP4A 4BR6A 3AK3A 1F23A 2DOSA 2GUZA 3MD0A 2EINC 4GX1A 3K9AA 1OZ0A 3K0GA 4OPHA 3SR2C 2HKOA 1VEWA 2ZE6A 1WA8B 2PY5A 3TETA 3SYCA 4GKKO 2RN9A 3JD1A 3CXCU 1TA8A 1H8EG 4ZKIA 1BSMA 4DV5O 4X20A 5KMGB 4DR2O 4LFCB 4MVRA 5LOVA 3JAKB 3N2KB 1BCCH 1L1FA 2YDEA 1JFFB 4DK0A 2OTLV 1Q7YW 4LBEC 5BR8B 1R6NA 1PD3A 2VS0A 1AP5A 3K3WA 5CMUA 4JTCB 1MABG 2P06A 4HZ3A 1I94O 1K7DA 2UU9B 3K5LA 2EIKB 4NTXA 1YZBA 2F1MA 4Z1VA 4I55B 1FFXA 2HJDA 4JF3A 5LP6A 4LNUB 5IJ0B 3JALB 3W7WA 4Z2WA 1LNQA 5AG2A 4QE9A 1MOFA 2LFSA 4GX2A 3X2QC 1VQ5V 3TGUH 1S76D 1KYOF 4OPAA 2UUCB 4NKGB 1XMQO 4AI8A 4B3RB 2IU3A 4E4EA 4GKJO 2QR4A 3CCVV 4JI4B 3R66A 2R9IA 1AR4A 4DR7O 3A2FA 2PI5A 1KB9F 4NXMB 1VF5B 1VF6C 3GWOA 5H6RA 1QCEA 1NU1H 4XDJA 4TT3G 4J80A 1H2NA 3L75H 3ZCCA 3O9OA 5CBHA 3JAWA 3MHHC 3K5MA 1PM9A 3G6BA 3K57A 1XHZA 4LFBO 3M99B 4F6EA 4B3TO 3CC2V 2DJVA 4ZI7B 1WN7A 2K9PA 4K0KB 4BIUA 1OCZB 1BMFG 3D36C 3FKSG 2FKXA 4G28B 5EZYA 1N33O 1YCIA 1TUEB 1K33A 5JVDA 5JJNB 4MW3A 5LHIA 4LF8B 1FAFA 1LUWA 1MG1A 3UT5A 1ORQC 3VQYA 3OW2U 3ZMVA 2Y4UA 1TVKA 1SERA 5FPOA 3B2EE 3K06A 1YI2V 3T1YB 1M9NA 1I94B 4U3JA 4TUYA 4CS2A 5IY5B 4B7EA 1DF5A 1J5EB 2HLDG 1ZSPA 2ZT9B 3I55V 1PV0A 5B66Z 3AEIA 4PD4F 3T2MA 2DN9A 1IBMO 3T4DA 4CC5A 1QVFU 2DYSB 1IXMA 4FVMA 1YJ9V 2Q8VA 2Q9LA 3P3NA 4LFBB 1QR9A 3U0ZA 1FYJA 4B3SO 4GUNA 1N8RW 4X1IB 4YY3O 1M1KW 2EZOA 3EFFK 3KZIZ 2EIMC 1KUQA 1OCCC 1MSDA 4CBCA 3CCMV 1AI5A 3QO7A 1RM1B 2N05A 4FJCC 2BTQB 2OIGA 4KFMA
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 4LNU A;  3GVM A;  3JAM N;  3TJT A;  3S3X A;  4PI0 A;  5IJ9 A;  3VOU A;  5LOV B;  1B04 A;  1SC5 B;  1ZTE A;  2X6A A;  1YDX A;  3SJB C;  5BMV B;  2JVD A;  4JI2 O;  4JAS A;  3N2G B;  1ZUQ A;  4OX9 B;  1HNZ B;  1K9M W;  3JD3 A;  3A0H Z;  4DR1 B;  2ZDI A;  3CX5 F;  4FLX A;  1YHQ V;  4LF7 O;  3LSU A;  2GUZ B;  1A32 A;  1SQB H;  4DR5 O;  2KKW A;  3J81 N;  2G38 A;  2WAM A;  5CBG A;  4JV5 B;  3JAT B;  2QE7 G;  1MZF A;  3FX7 A;  5EBM C;  1IBM B;  2ITC C;  1VQK V;  2ZD9 A;  5LA6 B;  4RUE A;  2DW4 A;  2D3O W;  5B3S C;  3O65 A;  3F7Y C;  3ABM B;  5GON B;  4D7S A;  3CRR A;  4WFE A;  4YJ2 B;  3OE7 G;  3EXA A;  5BR8 O;  3CC7 V;  2P90 A;  1N36 O;  1XNR O;  1J5E O;  1AIL A;  2OYQ A;  2WSS G;  1H8H G;  2ZNI A;  2LO1 A;  3EHB B;  2XAF A;  4I4T B;  4TQF A;  3WB2 A;  2R70 A;  3RYF B;  4MVM A;  2QWQ B;  1IBK B;  1QU7 A;  1BZK A;  2CK3 G;  2Y0I A;  4X66 O;  1JQ0 A;  1XEQ A;  2IJK A;  4GKK B;  3LDE A;  2PYL A;  2QWN B;  3ZS8 C;  3RBZ A;  3ABT A;  2ZE8 A;  3ZMZ A;  1TUB A;  4O4H A;  2YC0 A;  1F51 A;  4WFG A;  4Z1M G;  4IIJ B;  2P7T C;  4B3M B;  1AJQ A;  3BCC H;  3FYI B;  3BAA A;  2DYS C;  2VRZ A;  4GZR B;  3CE2 A;  2BSK B;  1L8D A;  2CTQ A;  2GTS A;  4JV5 O;  3ZRW B;  5LHG A;  5FNV B;  2DYR C;  1GM7 A;  3JD2 A;  4Q6G A;  3SGI A;  4DR1 O;  2W0X A;  3APO A;  5LYJ A;  3SYP A;  4X64 O;  5LMU O;  2WLH A;  3K03 A;  1SKV A;  5JCO C;  1GH6 A;  2UXD B;  2IJJ A;  2JJ2 G;  1E79 G;  3SJQ C;  5J2U A;  3M7M X;  4I5S A;  4LF7 B;  2Y69 B;  3IJ4 A;  4WFH A;  2X7R B;  3B40 A;  2BSK A;  4TV8 A;  3B8N A;  1N32 O;  1LR1 A;  2Y4T A;  2VQF O;  1U97 A;  1N0J A;  5EZY B;  4NR1 A;  4L8J A;  5LGT A;  4UXN A;  4N21 A;  4RQE A;  3LDD A;  3AG2 B;  5LYJ B;  1NZ6 A;  5CA3 A;  1P7G A;  1YXB A;  1RSO B;  4J7Z A;  1GN2 A;  4LFA B;  1BHB A;  2DE0 X;  4GX5 A;  1KC8 W;  2Q7G A;  2P6J A;  5J2U B;  2YS8 A;  4QIW F;  4YJ3 A;  5GTH Z;  4KHP O;  3ASN B;  2P67 A;  4FFB B;  4U3J B;  4X89 A;  2EZP A;  3FYE B;  2QM4 A;  3QVN A;  5B3S B;  1B3Q A;  5EIB C;  4UV9 A;  4PA4 A;  4WFA V;  2Q68 A;  5H6Q A;  2ZNJ A;  2XAS A;  2OTJ V;  5IYZ B;  2JEX A;  1Y6X A;  1N33 B;  1P84 F;  2PI4 A;  4GLX A;  4UVC A;  3SJA C;  2W6I G;  4WBN B;  4X62 B;  1D5N A;  1SF9 A;  1VF6 A;  1Q43 A;  2NR5 A;  3P3P A;  1SQG A;  1JVM A;  4DR3 O;  2QJ1 A;  5HFL A;  2JGD B;  3CRC A;  2DQ0 A;  1YJW V;  1N32 B;  4FM0 A;  2FTK A;  2H8P C;  1O9G A;  2QWO B;  1XL4 A;  1SQF A;  5KA5 A;  3ZRS A;  1E1Q G;  2GDS A;  2JJ1 G;  3N2G A;  4AQY B;  4BIZ A;  3JAL A;  4MT8 A;  1EBO A;  1FXK B;  3U11 A;  4TWK A;  5LP6 C;  5EIB D;  2HVK C;  4DV6 O;  2XT9 A;  3LSQ A;  3K08 A;  5LGN A;  2BOC C;  1AI6 A;  4O4L A;  1WPX A;  2D2C B;  2Q7H A;  2E74 B;  2ZIO A;  2H94 A;  5FL7 G;  2V7Q G;  3DGE A;  2F4V O;  1ARO P;  3GWK C;  4DR5 B;  4R7C A;  4J7J A;  4F6R B;  4OXS A;  3QNE A;  3OGI B;  3JYC A;  3N27 A;  1K5S A;  2YEV B;  3JAK A;  3VBB A;  3OD4 A;  4LF5 B;  1JFF A;  2E76 B;  1K34 A;  2Q0A A;  1IXB A;  3AG4 B;  1V54 C;  1JA8 A;  3HKE B;  4YHH O;  4ZI7 A;  1HNW B;  3OTO O;  4YIO A;  2WLK A;  3THO A;  1Q90 D;  1VIB A;  1HNZ O;  3ZRV A;  4W4L A;  5KUK A;  4GCZ A;  2A06 H;  3AG3 C;  3JCZ A;  1FJG O;  2PTM A;  3FAV B;  3QO5 A;  2O57 A;  4JI4 O;  3AG7 A;  2QM7 A;  4QPJ A;  2XND G;  4PDV A;  4DUY B;  2ZE7 A;  1IUR A;  4IYI A;  3KCX A;  3ABK C;  4X1Y B;  5EYP A;  1VQ7 V;  3ABM C;  2EUL A;  4DYL A;  3B09 A;  1IDS A;  1R1B A;  1NJI W;  1TUB B;  2HR3 A;  4O4H B;  1SA0 B;  1ENV A;  2Q6A A;  1OCR B;  1Q8I A;  2P22 C;  3JSN A;  4U7O A;  4DR3 B;  3UQ8 A;  4R8C A;  4JAU A;  4FZ0 A;  3CSX A;  4DV4 B;  4C7U A;  5CN0 A;  4JI7 O;  3K79 A;  2UUA O;  4O4L B;  4TUY B;  3JAS A;  4JZG A;  3TK1 A;  1QBZ A;  1CEZ A;  2Z5U A;  4FLT A;  4F6R A;  3CCR V;  4EKW A;  4X66 B;  2W0F C;  4DRX B;  2XAG A;  1BHA A;  3DC5 A;  3K59 A;  4FK5 C;  3MAQ A;  3G71 V;  4IHJ A;  4LF9 B;  2V1D A;  1FS0 G;  1R3J C;  2RDC A;  4JTA B;  3E2E A;  4FLY A;  2CE4 A;  3AK1 A;  1YIJ V;  1N34 O;  1JJO A;  4CH4 A;  5CB4 A;  1FJG B;  3SPG A;  4O2A B;  1QLE C;  4MW8 A;  4TV9 A;  3X2Q B;  3OEE G;  1UJW B;  4P9O A;  4IHJ B;  2YI9 A;  3JAR B;  1KKD A;  2HHH B;  4JAV A;  1SQP H;  3BPZ A;  4DRX A;  4JI1 O;  4JI6 O;  3G80 A;  4GYC B;  3CCS V;  3L70 H;  1YIT V;  2ADQ B;  2JGD A;  2CDY A;  1XMO O;  3WB0 A;  3L74 H;  3AK2 A;  5K1X A;  1CP9 A;  2F66 C;  2DWE C;  2QDO A;  4PA9 A;  2KG7 A;  1NTM H;  1BQZ A;  1AP6 A;  2IH3 C;  1JOY A;  2QKS A;  1XHX A;  3CJH A;  2HEP A;  2ZM6 B;  2K1E A;  3SYO A;  3JAR A;  2R9A A;  4PDL A;  1WNS A;  4WFB V;  5KLV H;  1KQS U;  1RSO A;  1OCZ C;  3IFX A;  3K9S A;  4B7K A;  4H33 A;  3LSS A;  3IGA C;  4ABM A;  1DGS A;  3P30 A;  5E79 Z;  1OCO B;  2YSU B;  1V55 C;  5IE9 A;  1AVM A;  3HKD A;  4I55 A;  5BMV A;  4FLZ A;  3H1H H;  1VAR A;  5J2T B;  4OGQ B;  3OMN B;  4DV6 B;  1AR5 A;  2ZXW C;  1GK9 A;  3J80 N;  4WFF A;  1Q82 W;  4X1Y A;  4JI7 B;  2JS5 A;  4FFK A;  3OUS A;  1Q6I A;  1IZ3 A;  4KL1 A;  4BIO A;  4O4J B;  3H1L H;  1BGY H;  1WB8 A;  1ZWI C;  3H1K H;  3EVK A;  3ZIA G;  4MTO A;  3IC9 A;  5KX5 A;  1BT8 A;  5L3F A;  1K8A W;  3M8A A;  1H38 A;  5IT9 N;  4X62 O;  1QVG U;  4JYA O;  3RWR D;  3LNN A;  3ZHU A;  4DV7 B;  3E22 B;  5H5N A;  4LF8 O;  2UXN A;  1N36 B;  3H9V A;  5KAI Z;  4N23 A;  1PKX A;  3QO8 A;  1EN6 A;  4I0X A;  5JQG A;  5HFM A;  2L35 A;  3E8F A;  1VQN V;  1NH2 D;  2A0L A;  3K5N A;  1P4R A;  1FFX B;  2Q0O C;  1F4N A;  2E5L B;  1HWY A;  1FPO A;  4JI8 O;  2R72 A;  5B1O A;  2B9Z A;  5C93 A;  1G4Y B;  5IDJ A;  4LF6 O;  2CTR A;  4LF5 O;  2Y48 A;  1W2B U;  3VQW A;  2FL4 A;  5C8Y B;  4DUZ B;  5KAF Z;  3BAB A;  3OUF A;  3BY6 A;  3SJC C;  1GRJ A;  1YTF B;  4PEL A;  1VQO V;  4IGG A;  4NB5 A;  3KG2 A;  4X88 A;  5TIS Z;  1WA8 A;  4YY3 B;  1J95 A;  3QF7 A;  2AXT Z;  3BA9 A;  2CTP A;  5DN6 G;  4O2A A;  3ZX6 A;  2DQ3 A;  2X6B A;  1Q86 W;  2B1G A;  2ZCE A;  3E35 A;  4ZOL A;  2AZ2 A;  4RQF A;  1IVS A;  3W7S A;  5JH7 A;  3RYI B;  1M56 B;  2ADP A;  5IYC O;  1L0N H;  3E8H A;  3HKB A;  3G67 A;  1GAX A;  1NS1 A;  4DR2 B;  1GTO A;  4RWU A;  2NN4 A;  5EYP B;  3T1Y O;  1VQM V;  2AHZ A;  2JRI A;  4BAY A;  4ICG A;  2QGN A;  2GV9 A;  1WP8 A;  4D7T A;  2OCC B;  2WA4 A;  1SZT A;  2YEV A;  3G4S V;  3MHS C;  3CRM A;  3F7V C;  3H1I H;  1ZX3 A;  4WCE V;  4PA3 A;  1IBL B;  5LL6 Y;  3R65 A;  3UKM A;  1UFI A;  4MVS A;  3HKE A;  3ASO B;  1BE3 H;  4D6T H;  1AI7 A;  5L3D A;  1KP2 A;  1Z5V A;  4DV1 O;  4DR6 O;  2RQ6 A;  1RP3 B;  1BQ0 A;  4QGP A;  3L73 H;  4NXM O;  4DV0 B;  3RN4 A;  4NVP A;  1WP7 A;  1B06 A;  4JI5 B;  5LGU A;  1NT2 B;  1VQ6 V;  1GN6 A;  3ZHT A;  4FLV A;  2Q69 A;  1NQT A;  2EIK C;  3ZJZ A;  4FPP A;  2ODM A;  3PJS K;  1SS3 A;  4JI8 B;  2DYR B;  2B5U A;  4LR3 A;  2AW9 A;  5L3C A;  2EJ7 A;  1YF2 A;  4JGS A;  3CWB H;  4ZBM A;  3G6E V;  4LH6 A;  3CCU V;  1TAE A;  4QE7 A;  2LW7 A;  5LXT A;  4FMT A;  3CME V;  3DC6 A;  1G1X B;  2FB5 A;  3OMI B;  2CAZ C;  4JAA A;  5B1B B;  4DV2 B;  1T5E A;  1KKC A;  3WG7 B;  2YIB A;  2RNB A;  1VQL V;  1HDJ A;  3RVZ A;  2VQE O;  3CPW U;  1OHH G;  2ZIM A;  4IYH A;  4XDK A;  2P4V A;  3GB7 C;  4J9Y B;  3HKB B;  3W7U A;  2ILM A;  1YTF D;  1K4C C;  3STZ C;  4MTX A;  4NXN B;  1EN5 A;  2JIZ G;  3E86 A;  4U3F H;  4UUJ C;  2B1I A;  4CH6 A;  3SPI A;  4LWS A;  4YJ3 B;  5J2T A;  2YXH A;  2YIA A;  2XAJ A;  4GX0 A;  1URF A;  4DR4 O;  3QTC A;  4H13 B;  2FML A;  4JYA B;  1JCH A;  1R73 A;  3CC4 V;  4UFZ A;  3ASN C;  4J10 A;  2AHY A;  1OCO C;  3JAW B;  2V4D A;  2AGA A;  4PI2 A;  4UCT A;  5D5Q A;  1ZL8 B;  3IAY A;  3CCL V;  4NTW A;  4TOI A;  4HNA B;  1KMI Z;  1OV9 A;  5IYD O;  3ASO C;  3QG5 A;  4EFE A;  2LP7 A;  1F4M A;  5IJ0 A;  4CH5 A;  2PGG A;  1M93 A;  2JGU A;  3VQV A;  3HR0 A;  2KSD A;  4ASU G;  1NVP B;  1Y74 B;  1K4D C;  3C90 A;  3FB5 C;  4PHZ A;  2HP8 A;  1W0K G;  1VP7 A;  3SDL A;  1KU9 A;  2FYU H;  3NXS A;  2PUS A;  4JYC A;  2E75 B;  4K8X A;  4X64 B;  1S5L Z;  4DXW A;  3VQX A;  3B4S A;  2JK5 C;  4DK1 A;  3DXR A;  5EC2 C;  1XL6 A;  3UO3 A;  3NR7 A;  1HW7 A;  2QM8 A;  4OX9 O;  3E83 A;  1THZ A;  1PL0 A;  3ABL C;  4WBN A;  3UO2 A;  1KBH A;  2F95 B;  2LGQ A;  1MZE A;  1Z5W A;  5IWA O;  1GO3 F;  4DW1 A;  1O9H A;  1H2M A;  3OEH G;  5B1B C;  4UB8 Z;  1Y67 A;  2ZR2 A;  5J9P C;  2QWP B;  4DR7 B;  4BW5 A;  2RCV A;  1M90 W;  1PNK A;  2DWD C;  2ZE5 A;  4AHC A;  1V54 B;  4X20 B;  2NLJ C;  2HG5 C;  1JX9 A;  1XRE A;  4QNH B;  1CPY A;  1BL8 A;  2CTW A;  2UXB B;  3SYA A;  1JMK C;  3RGB A;  3AG4 C;  4I50 A;  3HKC A;  4PDM A;  5KMG A;  3Q4H B;  3FB7 C;  2BOB C;  1TVK B;  4Q20 A;  1XNR B;  4JI3 B;  3HB3 B;  1EM1 A;  3ZMT A;  1WLE A;  1ZAU A;  5B5E Z;  4AQY O;  4B3M O;  4TSF G;  1US6 A;  2ZKO A;  1E1R G;  2IM9 A;  4I50 B;  3ABK B;  2LJ2 A;  4MSW C;  3RFR A;  3AG1 C;  5KHK A;  1W0J G;  1V9P A;  3SYQ A;  4DR6 B;  3F5W C;  1OCR C;  4DV3 O;  1VQ8 V;  2N04 A;  1LUV A;  1XNQ O;  2XUM A;  1I5Y A;  2YIC A;  2CGO A;  1BS3 A;  3BRC A;  3ETE A;  1QLN A;  1JR9 A;  4O2B A;  4EB6 B;  1HNX B;  4X65 O;  4I9Q A;  4QPK A;  2OIE A;  2OT5 A;  2WLI A;  2ZM6 O;  1N4C A;  2A79 B;  3SPC A;  4MVO A;  1W59 A;  5FNV A;  4LP8 A;  4DUY O;  3BEH A;  4ZHQ B;  3FD9 A;  1COW G;  3E22 A;  3ZHV A;  1AR1 B;  3ZN1 A;  2EIJ C;  3L72 H;  1XIL A;  2KG7 B;  1OCC B;  3E8G A;  2L6L A;  1FXV A;  1G8M A;  3CRA A;  4PV1 B;  1HR0 B;  2VQF B;  4JI0 B;  4FM1 A;  5IJ9 B;  4NXN O;  2X6C A;  3OTO B;  1NH2 B;  2Q73 A;  4NYK A;  4H0L B;  5IWA B;  1OJH A;  4JI5 O;  5IYB O;  5KHJ A;  4P2Z A;  4EB6 A;  4J11 A;  4ZIB A;  1Y66 A;  5JJE B;  2KB1 A;  1JPX A;  4ZHQ A;  4A5U B;  2VQE B;  4UV8 A;  1EFR G;  4O4I A;  4BWA A;  5BY1 A;  1GMG A;  4JPR A;  4UCS A;  2QKC A;  3B77 A;  2E5L O;  5H2F Z;  5DM6 V;  2LQT A;  5CA1 B;  3UT5 B;  4DV2 O;  2W6J G;  4LF6 B;  1DTO A;  3A8T A;  3L71 H;  3F5T A;  1SZX A;  4LF9 O;  3ZMU A;  4LH7 A;  1NVP D;  5JVD B;  1R3I C;  4CS3 A;  5EBL C;  1Y4M A;  1Q6H A;  2Q4P A;  4MVQ A;  5CA0 A;  2R9R B;  3SPJ A;  3ZN0 A;  5JH7 B;  3DSQ A;  4DW0 A;  3A0B Z;  1S72 V;  4CC6 A;  3OGC C;  1R6K A;  4B3R O;  2UU9 O;  2A7W A;  3FB6 C;  1Q5O A;  3W7T A;  3DXR B;  4DV3 B;  2WLM A;  4TV9 B;  3RYC B;  2OWO A;  1YJN V;  4MTF A;  1ZL8 A;  1JJ2 U;  2Q67 A;  3CS5 A;  1PL4 A;  1H2G A;  4PA7 A;  2Q5Z A;  1P49 A;  2XTA A;  3KKY A;  1V55 B;  4W4K A;  2ZXW B;  4B3T B;  3ETQ A;  2GTA A;  4WF9 V;  1Y74 A;  2UXX A;  4X1K A;  4EEQ A;  3LUT B;  5C8Y A;  3T1H B;  2H3O A;  4K0K O;  2BTO A;  2P4K A;  1IBL O;  2BCC H;  5F2V O;  2EX3 A;  1KD1 W;  1QHT A;  1DK1 A;  1XMO B;  1S0V A;  4O4I B;  3D3I A;  4O2B B;  2CH7 A;  1NR1 A;  3T1C A;  1K73 W;  3WB1 A;  1FXH A;  1EN4 A;  3P32 A;  1PNM A;  1PP9 H;  2ITD C;  2QWR B;  3OTF A;  3FB8 C;  4B08 A;  2QA4 V;  5JJJ B;  1VQP V;  5LXT B;  1K5Q A;  1FKA O;  4X9Q A;  4IIJ A;  2UUB O;  3TCU A;  1MA1 A;  4YHH B;  4YIP A;  1HNW O;  4PJ0 Z;  3D36 A;  2QSA A;  3ZHS A;  1D2D A;  4HBN A;  1I5X A;  1MSW D;  2Y69 C;  2C2A A;  4K8Z A;  3IC7 A;  1AJN A;  3K5O A;  1VQ9 V;  1AI4 A;  2DMX A;  4FFB A;  4DV4 O;  5A9G A;  4ZOL B;  4X65 B;  2Y0P A;  4UVA A;  1R3K C;  2Z3Y A;  5B1A B;  1SA0 A;  4I4T A;  2PF4 E;  5LMU B;  4UCO A;  2RJZ A;  1XI1 A;  4G27 B;  2OCH A;  1M56 C;  1WPB A;  4LFC O;  1S77 D;  1XNQ B;  1SRY A;  3FFQ A;  3OR6 C;  3UCS C;  5K1P A;  5KHG A;  5KUM A;  5ITZ B;  1HNX O;  4B3S B;  3STL C;  4LC1 A;  5L3B A;  4HNA A;  1NI8 A;  3E89 A;  3PN1 A;  4UCR A;  3T1H O;  5L3G A;  4JI3 O;  1Q81 W;  4R6Z A;  3B8M A;  2UUA B;  4KUM A;  2JEU A;  1S5H C;  3RT3 C;  1M57 C;  2M7W A;  4CH3 A;  2X0L A;  4J41 A;  4DR4 B;  1IBK O;  4JI2 B;  1L0L H;  2F43 G;  1NTZ H;  2HHH O;  2WLI B;  4J9Z B;  5KX5 B;  1RFY A;  3CHX A;  4MS2 A;  1WAZ A;  1GM8 A;  4R50 A;  3APQ A;  4G2K A;  4H44 B;  3U10 A;  4X1K B;  1IX9 A;  2ARH A;  1QQC A;  1YEW A;  2JS3 A;  5LP6 B;  4O4J A;  4LF4 O;  2IJI A;  4UB6 Z;  1DF4 A;  3JAS B;  4CZZ A;  5JWP A;  4L87 A;  2BTQ A;  1RM1 C;  1M4U A;  1XDC A;  4FLU A;  3DTU B;  1EZV H;  1VF7 A;  2PYJ A;  1FXK C;  2YIB D;  5A2Q N;  1P7B A;  3L9D A;  4MVZ A;  3RW0 A;  2HFE C;  5FLX N;  2QTS A;  3CYO A;  5BXZ A;  4J7K A;  4AIL C;  3RYF A;  1Z2G A;  1UPG A;  2A9H A;  2UXC B;  3OAA G;  4P30 A;  1XUQ A;  3RYH A;  5CB4 B;  3D3Q A;  3CB2 A;  2P5O A;  4DV0 O;  1ZLZ A;  1RPO A;  4H37 A;  4MTG A;  1YVW A;  1SET A;  3CD6 V;  1WB7 A;  5EC1 C;  1H2S B;  1K97 A;  3AG3 B;  3RYC A;  4XBF A;  3C3S A;  2WLL B;  4LWS B;  5B1A C;  5LBQ A;  2GBO A;  2YUA A;  2MK3 A;  4PDR A;  3JD0 A;  2HVJ C;  2Z0A A;  2ETN A;  2IU0 A;  1XOU A;  2EIL C;  3K04 A;  3CXH F;  4KXR A;  3ZMS A;  3CP1 A;  4K35 A;  2IW5 A;  2ZQM A;  3OMA B;  2KQX A;  1Q6U A;  2WWW A;  3T4Z A;  2EIN B;  5EK0 A;  2ATK C;  3RYI A;  1SQX H;  3RVY A;  3BA8 A;  2WLL A;  5E1A C;  3K0D A;  4I7Z B;  3TXQ A;  3UM7 A;  4QJF B;  2ZR3 A;  2Q7E A;  3ZHQ A;  2M6Y A;  1U96 A;  3OM3 B;  4EFB A;  3OR7 C;  3MDS A;  5CBF A;  4IL6 Z;  1SQV H;  4U7N A;  1NBM G;  1XQ8 A;  3I5D A;  2YI8 A;  2XHB A;  3W7X A;  5LMN O;  1FD9 A;  2VWJ A;  1PNL A;  2ZDI C;  4LFA O;  5GW7 A;  3CCJ V;  1SES A;  1QR8 A;  4FIP C;  1M5I A;  4E2L A;  4DV5 B;  1H2K A;  2XAH A;  4HAM A;  4TV8 B;  3CCQ V;  1M57 B;  5CA0 B;  4KHP B;  1VQ4 V;  2IJH A;  3CRQ A;  4X1I A;  4P9P A;  1GN4 A;  3CCE V;  2YXY A;  2XAQ A;  1GN3 A;  2F93 B;  3OFN G;  4GKJ B;  3WFV A;  1H2L A;  2RMK B;  1S3J A;  5KHH A;  3BHP A;  4JTD B;  2MW2 B;  1AB3 A;  3Q4H A;  5GTI Z;  1K92 A;  3HKC B;  3JD4 A;  4RUF A;  2XOK G;  5FPR A;  5DED A;  4CS4 A;  5BZB A;  4YXW G;  1R3L C;  4J42 A;  4HYO A;  5JCO A;  3TXS A;  3ZRW A;  5GON A;  2UUC O;  3KCY A;  2VWK A;  3CJH B;  3CMA V;  1QLE B;  4DUZ O;  2NNU A;  1F7Y A;  2WLJ A;  1NTK H;  3ML0 A;  2LGW A;  3ABL B;  1WJZ A;  1R6T A;  4UCU A;  3BFR A;  1GM9 A;  1FFT B;  5JQG B;  4I0X B;  3I56 V;  4LCU C;  1HP8 A;  1KP3 A;  2F4V B;  3ETG A;  4JZ2 A;  3HPL C;  5B1N A;  1NR7 A;  3AG2 C;  2N74 A;  1G6U A;  4FM2 A;  3ZED A;  4RAI A;  2UUB B;  4JI1 B;  4JI6 B;  4FZ1 A;  4DO2 A;  1QNM A;  3N2K A;  3H1J H;  3HKD B;  3JAT A;  3OT7 A;  3ETD A;  1NKD A;  5H9C A;  4DV1 B;  5DEC A;  3BVO A;  3E8B A;  4GT1 A;  2EIL B;  2EJR A;  1I7F A;  1PPJ H;  1CXZ B;  5ITZ A;  1I08 A;  5LHH A;  4IT5 A;  1KEC A;  1MNG A;  2EBO A;  5IYZ A;  3JCU Z;  2PZS A;  3S3W A;  5LMN B;  1TGO A;  2E3C A;  4TQD A;  3RYH B;  1B6Q A;  5IY5 C;  3J7A U;  1VMG A;  3ABU A;  1EZJ A;  3AG1 B;  4UCV A;  3SPH A;  2OCC C;  4K3A A;  2UXD O;  2YID A;  2A3Q A;  5CA1 A;  2WA3 A;  4RO2 A;  2IBZ H;  2WPD G;  5L3E A;  1GKF A;  2GSM B;  3LNM B;  1XBL A;  1SQQ H;  3H01 A;  1Y76 B;  4JYY A;  1I0H A;  3D8C A;  4XDL A;  4YJ2 A;  1Q3E A;  4UVB A;  5EBW C;  4FLW A;  1X59 A;  2EIM B;  3JSL A;  2EIJ B;  2WLN A;  1X4T A;  2LW1 A;  5LA6 A;  2YXL A;  3C3T A;  3A0R A;  3FAV A;  2UXC O;  3ICX A;  2UXB O;  2QTO A;  3ZRX A;  1MMM A;  4X8A A;  5KA6 A;  3CEI A;  2CH7 B;  4I9W A;  4LF4 B;  3WG7 C;  1Y76 A;  4JYB A;  4F4L A;  1N0N A;  1DLB A;  2CUG A;  4MVU A;  3WU2 Z;  2BE3 A;  2GHY A;  4PA6 A;  2JDI G;  1AJP A;  1D5A A;  1ROP A;  3LDC A;  2QEX V;  2AZ0 A;  1S5J A;  2HJF C;  2CGN A;  4BW9 A;  2IH1 C;  4JI0 O;  1HR0 O;  2LFR A;  2QKA A;  4DV7 O;  3ZBH A;  2F23 A;  1YSC A;  1K3E A;  5D5P A;  5KHI A;  1XMQ B;  3ZHR A;  2ZIN A;  1RPR A;  1N34 B;  3K58 A;  4NTY A;  1FXK A;  4KP4 A;  4BR6 A;  3AK3 A;  1F23 A;  2DOS A;  2GUZ A;  3MD0 A;  2EIN C;  4GX1 A;  3K9A A;  1OZ0 A;  3K0G A;  4OPH A;  3SR2 C;  2HKO A;  1VEW A;  2ZE6 A;  1WA8 B;  2PY5 A;  3TET A;  3SYC A;  4GKK O;  2RN9 A;  3JD1 A;  3CXC U;  1TA8 A;  1H8E G;  4ZKI A;  1BSM A;  4DV5 O;  4X20 A;  5KMG B;  4DR2 O;  4LFC B;  4MVR A;  5LOV A;  3JAK B;  3N2K B;  1BCC H;  1L1F A;  2YDE A;  1JFF B;  4DK0 A;  2OTL V;  1Q7Y W;  4LBE C;  5BR8 B;  1R6N A;  1PD3 A;  2VS0 A;  1AP5 A;  3K3W A;  5CMU A;  4JTC B;  1MAB G;  2P06 A;  4HZ3 A;  1I94 O;  1K7D A;  2UU9 B;  3K5L A;  2EIK B;  4NTX A;  1YZB A;  2F1M A;  4Z1V A;  4I55 B;  1FFX A;  2HJD A;  4JF3 A;  5LP6 A;  4LNU B;  5IJ0 B;  3JAL B;  3W7W A;  4Z2W A;  1LNQ A;  5AG2 A;  4QE9 A;  1MOF A;  2LFS A;  4GX2 A;  3X2Q C;  1VQ5 V;  3TGU H;  1S76 D;  1KYO F;  4OPA A;  2UUC B;  4NKG B;  1XMQ O;  4AI8 A;  4B3R B;  2IU3 A;  4E4E A;  4GKJ O;  2QR4 A;  3CCV V;  4JI4 B;  3R66 A;  2R9I A;  1AR4 A;  4DR7 O;  3A2F A;  2PI5 A;  1KB9 F;  4NXM B;  1VF5 B;  1VF6 C;  3GWO A;  5H6R A;  1QCE A;  1NU1 H;  4XDJ A;  4TT3 G;  4J80 A;  1H2N A;  3L75 H;  3ZCC A;  3O9O A;  5CBH A;  3JAW A;  3MHH C;  3K5M A;  1PM9 A;  3G6B A;  3K57 A;  1XHZ A;  4LFB O;  3M99 B;  4F6E A;  4B3T O;  3CC2 V;  2DJV A;  4ZI7 B;  1WN7 A;  2K9P A;  4K0K B;  4BIU A;  1OCZ B;  1BMF G;  3D36 C;  3FKS G;  2FKX A;  4G28 B;  5EZY A;  1N33 O;  1YCI A;  1TUE B;  1K33 A;  5JVD A;  5JJN B;  4MW3 A;  5LHI A;  4LF8 B;  1FAF A;  1LUW A;  1MG1 A;  3UT5 A;  1ORQ C;  3VQY A;  3OW2 U;  3ZMV A;  2Y4U A;  1TVK A;  1SER A;  5FPO A;  3B2E E;  3K06 A;  1YI2 V;  3T1Y B;  1M9N A;  1I94 B;  4U3J A;  4TUY A;  4CS2 A;  5IY5 B;  4B7E A;  1DF5 A;  1J5E B;  2HLD G;  1ZSP A;  2ZT9 B;  3I55 V;  1PV0 A;  5B66 Z;  3AEI A;  4PD4 F;  3T2M A;  2DN9 A;  1IBM O;  3T4D A;  4CC5 A;  1QVF U;  2DYS B;  1IXM A;  4FVM A;  1YJ9 V;  2Q8V A;  2Q9L A;  3P3N A;  4LFB B;  1QR9 A;  3U0Z A;  1FYJ A;  4B3S O;  4GUN A;  1N8R W;  4X1I B;  4YY3 O;  1M1K W;  2EZO A;  3EFF K;  3KZI Z;  2EIM C;  1KUQ A;  1OCC C;  1MSD A;  4CBC A;  3CCM V;  1AI5 A;  3QO7 A;  1RM1 B;  2N05 A;  4FJC C;  2BTQ B;  2OIG A;  4KFM A; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...