1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pollen allergen Ole e 6
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
source organism Olea europaea
molecule tags Allergen
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
3OGCC 1SC5B 4LF7B 2GTAA 4JV5B 1AJQA 1B3QA 2CTWA 4HYOA 5KUKA 1BMFG 2H8PC 4UCVA 4B3RB 1FJGO 3N2KB 4F4LA 2N74A 4DUZO 2ZCEA 5LBQA 3K04A 1TUEB 4JI1O 2Z0AA 5H2FZ 3ZIAG 5LOVA 3ZMZA 1FPOA 1IURA 4B7KA 4FM0A 1AJNA 4GX2A 1R3IC 3APQA 5KHHA 2IH3C 4UCTA 3X2QC 4NXNO 3K0DA 3GB7C 1QHTA 4X88A 4LFBO 2UU9O 4HBNA 4L87A 1ZWIC 3VQYA 3EVKA 1KC8W 3OTOB 5IYBO 2VRZA 3HKCB 2QTOA 1SQQH 1WPXA 4PELA 1G8MA 1GN3A 2E74B 3UQ8A 1XNRB 1XOUA 4O4IA 5IT9N 3E22A 1HR0O 2C2AA 1VQ7V 4MVMA 4HNAB 1NKDA 3BEHA 5KHJA 5LYJB 5BR8O 4K0KO 1H2KA 3L9DA 2Z5UA 4DR7O 1R6KA 2VQEB 4TQFA 1FS0G 2Q68A 3BFRA 3BRCA 3SJBC 1SZXA 3UCSC 5IE9A 2HJDA 4DR2O 1Q6UA 4DW1A 3CRRA 2F95B 2GV9A 2JEUA 3OT7A 2WPDG 4J41A 4ZI7A 4U7OA 1IBLO 2RN9A 1EN6A 3SPJA 5K1PA 3K9AA 4GKKB 3FD9A 1XNQB 1BHBA 1EZVH 1BQZA 4BWAA 5B66Z 1VMGA 3TGUH 4JYAO 3PN1A 4OX9B 2FKXA 3BVOA 3SPIA 1MNGA 2OT5A 3K57A 1O9HA 1OJHA 1I7FA 2P6JA 4FLYA 3LDDA 2UXNA 3AG4B 3ZX6A 1PNKA 1Q3EA 2WLIB 1GKFA 1I5XA 5EBLC 4LNUB 4UFZA 4EKWA 3J80N 2OIGA 3M8AA 2BCCH 2OCHA 3E8FA 1VQ9V 1PKXA 2KQXA 4OPHA 4Z1VA 4AQYB 2JGUA 1KMIZ 4LF6B 1I0HA 4NB5A 3JCUZ 1S72V 4X1KA 4CH6A 4X20B 2A3QA 2ILMA 4YY3O 3K06A 1YTFB 1G6UA 1XMQB 3CP1A 3JATA 4GKJO 3ZHUA 1H2MA 4ZOLB 2WLJA 4UCUA 1AP6A 4FIPC 2QM8A 3R66A 2UXDB 3UT5A 4JTAB 4G28B 2JVDA 1VQ8V 5EZYB 2H3OA 4X20A 4TUYA 4JYBA 1ZX3A 1YITV 2BTOA 5L3EA 2Q7GA 1NBMG 1XUQA 3E8BA 1XQ8A 2EIMC 4X1IA 3C90A 3MD0A 3CYOA 4DV1B 1V54C 4RWUA 3QF7A 2CTRA 4ASUG 5JJJB 2BE3A 1Y6XA 4JF3A 4W4LA 1PL4A 3S3WA 4GZRB 3J81N 1VF6A 2QKCA 3VOUA 2JJ1G 3NR7A 5C8YA 3FB7C 3SPCA 3B8NA 1DLBA 4TV8A 1DK1A 3QVNA 2OCCB 1VF6C 4MSWC 4DR5B 4X66B 2XT9A 2Q7EA 2YEVB 3ZBHA 4BIZA 1SF9A 2V4DA 2LW1A 5KLVH 5E1AC 4BW9A 4N23A 1BS3A 3K0GA 3AG1B 5CN0A 2WLKA 2PYJA 3Q4HA 4WCEV 4FK5C 4ZHQA 3THOA 1F4NA 2Q5ZA 1TA8A 2CUGA 1AI6A 1KP2A 1SS3A 4A5UB 2ETNA 1T5EA 3STLC 4DV5O 3CXHF 2YUAA 4J7JA 4F6RA 2L6LA 3ZHRA 2IJHA 1JCHA 1URFA 2OCCC 4WBNA 2ZIMA 1OCOB 4JZGA 4UUJC 4Q6GA 5CB4A 1IXMA 2F66C 3OR7C 2BTQA 4JI7B 5A2QN 3AG1C 3FAVA 2ZXWC 3B40A 4AHCA 1E1QG 2PYLA 3BA8A 1WA8A 4DR1O 1R1BA 1PM9A 4FLXA 1OCCB 3ZHVA 3HR0A 4LR3A 2Q69A 1HP8A 4LWSA 1G4YB 1GH6A 4YHHB 1YI2V 2X6AA 3CX5F 4O4LA 2XUMA 5F2VO 1S5HC 2N04A 1YSCA 2WLLB 2VWJA 2ZT9B 4MW8A 3ASOC 1ZTEA 1Q5OA 1AR4A 1RPOA 1Q7YW 3T4DA 3K08A 1QLEB 1AI4A 1VF5B 1NH2B 3CE2A 2P90A 1FKAO 3ML0A 4DRXA 5JQGA 2WLLA 2EIJC 2WSSG 1VQMV 2DYSC 4MVRA 4CS4A 3K5OA 3SYAA 2KKWA 2BOBC 3G80A 1S76D 4JI4O 4O4HA 5J9PC 2JGDA 3JSLA 3OGIB 4R50A 2EILB 5IYDO 1HNWB 2UUCO 4NYKA 1Y76B 1MG1A 1W0JG 2M6YA 5GW7A 4LF4O 1FYJA 4FLTA 1ORQC 3G71V 1M90W 1QR8A 4JI8O 3RW0A 3HKBB 2R70A 1QLEC 2PGGA 2GUZA 1W2BU 1NVPB 1VQ5V 1RPRA 4DV3O 1Z2GA 2ZE8A 1BQ0A 5LGNA 3APOA 3CMAV 1K4DC 2P22C 1XILA 2KB1A 4JTDB 3ABTA 4O4JB 4B3MO 4B3SO 4HAMA 4FLUA 3LDCA 2HHHO 3ZRWB 1N36B 4CS2A 3MHHC 3ZRXA 4BR6A 3CCVV 1R3JC 1WP8A 4IIJB 1M4UA 4GYCB 5J2UB 3OUFA 3OFNG 4XDLA 5LMNO 4X8AA 1ROPA 5BXZA 2UUBB 4FFBB 1SQXH 1QQCA 1JVMA 3T4ZA 3E2EA 4UV8A 2XHBA 3H9VA 4GX0A 2K1EA 3ZN1A 5KMGA 1IBMO 1A32A 1TAEA 5IJ0A 3JALA 1SZTA 3B4SA 1M56B 4EB6A 1GN6A 3A0HZ 2EX3A 1WN7A 1TVKB 1QR9A 2RDCA 3AK2A 4DW0A 3MHSC 2Q67A 3WFVA 5LA6A 3CXCU 4PHZA 1RSOB 1GN4A 3TXSA 5LMUO 5KAFZ 1VIBA 2G38A 4CC5A 1IBKO 3ASNC 4JPRA 3ZRVA 1JFFB 5ITZB 3CCMV 2OWOA 4LFCB 5IYCO 4X62B 1MSWD 2FTKA 3AG7A 1PL0A 2A0LA 4Z1MG 2LP7A 1BE3H 2VS0A 2QEXV 3CD6V 2P4KA 1M56C 2ITDC 5EC1C 4JAUA 3M7MX 3N27A 3G4SV 4ZKIA 3LDEA 1YVWA 4YXWG 2IU0A 2Q8VA 2B9ZA 1VARA 5GTIZ 1MZFA 2CH7B 2XAGA 1CEZA 2HFEC 1P7BA 2YI9A 4MTGA 1Y74B 3CRMA 3JAKB 4CBCA 4FLVA 1L0LH 4P9OA 4DV2O 3SPGA 4DV4O 4MVOA 1US6A 4I7ZB 4JI6B 1R3LC 1WNSA 3BA9A 2JDIG 3TXQA 5LOVB 2DWDC 4L8JA 1UJWB 2WA3A 5A9GA 2QGNA 4O2AA 1WPBA 4X64B 3D3IA 2IW5A 4DV5B 1AILA 1MZEA 5B1NA 4TV9A 1NH2D 1MOFA 3ZHTA 3VQVA 1EM1A 2OTLV 1KKDA 3ETEA 3CCRV 2DN9A 2LJ2A 3B09A 1JMKC 3RT3C 2ZQMA 5H5NA 4I9QA 3OUSA 1B04A 5IYZB 4R8CA 2A06H 3SJCC 1SQGA 4PI2A 4O4IB 2LGWA 3E22B 1H2NA 2UXBO 1N34O 4AI8A 1ZAUA 2IJKA 4I0XB 1NVPD 1P7GA 1JX9A 5B3SC 5JJEB 3KG2A 2RCVA 3RBZA 5IYZA 2EZOA 5KUMA 1VQNV 2ZR3A 2IBZH 4MTXA 2DE0X 1SQVH 3I55V 4KHPO 4RQFA 1YHQV 3QO7A 2XNDG 4TT3G 1IZ3A 1LUVA 4I0XA 2X6BA 1J95A 3GVMA 2PF4E 4ZBMA 4ZI7B 4CH4A 4UCOA 4RUFA 3ETGA 2Y48A 3RYCA 3PJSK 3ZCCA 4CH3A 3O9OA 1B6QA 4E4EA 3K58A 1R3KC 2AZ0A 2YI8A 3FFQA 2GTSA 3JD0A 3ZN0A 1GK9A 3G6EV 2R72A 1HNXB 4EEQA 3VQWA 2DW4A 2ZM6O 1NS1A 3ZMSA 3SYCA 1I08A 3OMAB 1EZJA 2E5LO 1OCRC 1KKCA 2AXTZ 2XAQA 2UXCB 1NTZH 4N21A 2ODMA 1GMGA 2QKSA 4ZIBA 3H01A 4WFEA 3VBBA 4WF9V 4FM1A 3QTCA 5LP6A 4MVQA 4LF5B 1ZL8B 2YS8A 2ZNJA 2FMLA 2QKAA 4H0LB 3OAAG 3RVZA 3SDLA 4RAIA 2MK3A 5LL6Y 4DUYO 4I9WA 4JYYA 3IAYA 5C93A 3F5TA 3W7UA 3T1HB 3CC2V 4JI5B 4JI3O 4LF8O 1BL8A 4MTOA 1YJWV 4NXMB 2X7RB 4X1KB 1Q81W 3T1YB 1H38A 4AILC 4DV6B 1K97A 2QWNB 2JS5A 2YIAA 3JATB 1R6TA 2FL4A 1ZL8A 4O2BB 1GN2A 2JJ2G 1Q86W 5IWAO 1S5JA 1QCEA 4FZ0A 3UT5B 3L74H 4DR3B 1I94B 2VQFB 2EIMB 3F7YC 2QWOB 4GX1A 5LXTA 1IBMB 4PI0A 1V54B 3CRAA 2ADPA 4TUYB 3EFFK 5AG2A 2GHYA 4DV7B 1B06A 3KCYA 1N33O 2EJRA 3JCZA 4O2BA 3N2GB 4X1IB 2P4VA 1FXKA 2DYRB 2LO1A 4PA4A 3D36A 4EFBA 1D5NA 3OTFA 3JASA 4J7KA 1SQFA 3DTUB 5HFLA 1QVFU 2UUAO 4J9ZB 4JYCA 1FXKC 3MAQA 3T2MA 1BGYH 2F93B 3D36C 5C8YB 5CA3A 1YJNV 5FNVA 4JI2O 3N2GA 2XAFA 1L1FA 5IY5B 3ABUA 1XMOB 1GM9A 1JA8A 4TV8B 4YJ2A 1YIJV 2ZE6A 4QPJA 4JI0B 1OZ0A 2YXLA 2QJ1A 1X4TA 2ZR2A 5LHIA 2B1IA 3QNEA 1QVGU 1LNQA 2VWKA 2XAHA 4UVAA 4CH5A 2W0XA 2DYRC 4MS2A 3LNMB 4J80A 4B3TO 4KP4A 3H1LH 2M7WA 1QNMA 3Q4HB 4LFAB 4ZHQB 5D5QA 3W7WA 1XI1A 1K73W 4LC1A 5JH7A 4XBFA 2QWRB 3AG3C 3RN4A 3OE7G 5CBGA 4DR4B 1P4RA 3JAWA 2D2CB 4WFFA 4F6RB 1IVSA 3RYHA 3RVYA 1QBZA 4I5SA 1VQ4V 5IY5C 2CE4A 2IM9A 5GONA 4PV1B 4D6TH 4I55A 4WBNB 2WAMA 2ZXWB 4DV0O 5CB4B 3HKEA 5B5EZ 1N32B 3TK1A 2PZSA 2BTQB 2Q6AA 2DQ0A 3WB1A 1XREA 5CMUA 4PJ0Z 3RYIB 3FAVB 4DR6O 3SYQA 4PD4F 3OEEG 4IL6Z 1WA8B 1GRJA 1J5EO 3CCUV 4XDJA 2F4VO 3E83A 1FJGB 4LWSB 3K59A 1K5QA 1N4CA 4GCZA 4DUZB 1XBLA 1Z5WA 4JI1B 3WG7B 3ASOB 4LF7O 4JASA 4O4LB 4JV5O 3RYIA 3L72H 4NXNB 4B3RO 4CZZA 4Q20A 2WLHA 4LFBB 2UU9B 4OPAA 1P49A 3AEIA 3TETA 1KP3A 1YJ9V 1AVMA 2EIJB 2ATKC 2QSAA 2DYSB 2AW9A 3A0BZ 2YIDA 1ZLZA 4RUEA 2YICA 3DSQA 2R9AA 2JRIA 5JQGB 4DRXB 3ABLC 4JAAA 3ETQA 3JYCA 4GUNA 3WG7C 1Q8IA 4FLZA 3SYOA 2P67A 1HR0B 3RFRA 3OTOO 2AZ2A 3CSXA 1K33A 4J10A 3T1CA 5BR8B 4J11A 4K0KB 4O4HB 2JGDB 4RO2A 1XNRO 1O9GA 4XDKA 3BHPA 4DR7B 3WB0A 2B5UA 1Y4MA 2GUZB 1UFIA 2QDOA 3MDSA 2F43G 2CTQA 2WLMA 4QGPA 5JVDB 1MA1A 1Q43A 5CA1A 3H1KH 4DR2B 5IJ9A 1JR9A 1XL4A 1GO3F 2HEPA 2Q4PA 4YJ3A 1KU9A 4FPPA 2ADQB 1IBLB 3FKSG 3IC7A 1SA0B 3LSUA 1TUBB 3U10A 1FFTB 4MVUA 5JVDA 1M9NA 4JYAB 2NN4A 2ZE7A 5L3GA 2IU3A 4TSFG 2KSDA 1YZBA 2EIKC 4MT8A 2JK5C 2R9IA 5HFMA 2ZNIA 4JZ2A 1F4MA 3A0RA 4DUYB 4GKKO 3JD4A 1XNQO 1WB7A 3HPLC 5KMGB 1LR1A 1SA0A 2A79B 5IJ0B 3JALB 5IDJA 1TUBA 4UVBA 3WB2A 4WFGA 4K3AA 2HVKC 3P3PA 4EB6B 1GAXA 5L3FA 1H2GA 1K34A 3ASNB 4JTCB 1SESA 4X89A 5LA6B 5IWAB 2R9RB 1BHAA 1RP3B 3ZJZA 4D7SA 2OIEA 3OMIB 4YY3B 3AG2B 3RYFB 1D5AA 2CTPA 1F7YA 2KG7A 4P9PA 4GKJB 1OV9A 1CXZB 2F1MA 3E89A 3CCLV 5DN6G 1KD1W 2ZKOA 1PD3A 1I5YA 2GSMB 2YC0A 4LF6O 3H1IH 1GM8A 3L71H 2H94A 2CAZC 4X1YA 4UXNA 4DYLA 1XMQO 4IYIA 5EYPA 3KCXA 4K8XA 1JJ2U 2NLJC 3G67A 4MW3A 4KXRA 3L70H 3RYFA 3CB2A 1GTOA 3DXRA 1VF7A 4PA3A 5BMVA 1D2DA 3ZHQA 1YEWA 4I50B 1SKVA 4X9QA 4JI2B 3TJTA 3AG2C 2OYQA 3TCUA 4PDVA 4ABMA 5EC2C 3GWKC 1P84F 1TGOA 4GT1A 3JD2A 2Q0AA 4LF9O 3ZMUA 2NNUA 3IJ4A 4MTFA 4QIWF 4DV1O 1VP7A 1BCCH 1WP7A 4I50A 1WB8A 2JS3A 2WWWA 4IHJB 2YSUB 4OXSA 4O2AB 3STZC 1KYOF 5B1AB 1HNZO 2XAJA 1THZA 2YXHA 4GX5A 3W7SA 3ZEDA 4TV9B 4MVSA 4U3JA 4PA7A 4I4TA 5CA0A 3EXAA 3HB3B 5EBWC 1FFXA 1HWYA 1AROP 4IHJA 4X66O 4DR5O 1XDCA 2ARHA 3W7TA 2YIBA 3ZMTA 1GM7A 4H13B 5EBMC 1FAFA 4PDRA 4FLWA 3CJHA 2DWEC 1M1KW 1F51A 2QA4V 4G27B 5KAIZ 5B3SB 5H9CA 2Y0IA 3NXSA 5GTHZ 4DXWA 1DGSA 1Q82W 4FVMA 5B1AC 1DTOA 2BOCC 2NR5A 2AGAA 3D3QA 3H1JH 5FPRA 1Q90D 2HKOA 1BZKA 4YIOA 5TISZ 5J2TA 5LHHA 3CC7V 5KHIA 4QJFB 4DR1B 4C7UA 3CCJV 2XOKG 4E2LA 1OCZB 1VQOV 3I5DA 4W4KA 4JI7O 2LFSA 5JCOA 3SJAC 1M57B 3B77A 4QPKA 4U3FH 2LGQA 4IT5A 3RYCB 1N8RW 3JD1A 4PDLA 3N2KA 1Y66A 5JCOC 2EINB 4YHHO 2CGNA 5CBFA 1NU1H 1PNLA 3AK1A 3FX7A 1OCRB 3B8MA 3P3NA 4GLXA 4CS3A 2A7WA 1KB9F 2AHZA 3KZIZ 4H37A 4K35A 3QO8A 4NKGB 1DF5A 1OCZC 1S3JA 1M57C 5B1OA 1FXVA 4J9YB 3E8HA 3C3TA 5LP6B 3HKCA 3ZHSA 2QTSA 4ICGA 3DC5A 4BIUA 4JI4B 1LUWA 1ENVA 4TOIA 2E76B 2EINC 3UO2A 4UCSA 2UUCB 2LQTA 4LF4B 1MMMA 2BSKB 4JI8B 4JAVA 4HNAA 3EHBB 5LYJA 4PA9A 4PA6A 4DV3B 1KBHA 1HNWO 3C3SA 1PPJH 2P06A 1EN4A 2HJFC 1L8DA 4B3MB 4B3SB 1KUQA 5LGUA 2W6JG 1M93A 1NI8A 2GDSA 2HHHB 1NQTA 3CEIA 1AI7A 5LP6C 4QNHB 3U0ZA 2BSKA 2HG5C 5B1BB 4EFEA 2Z3YA 5LXTB 2P5OA 4JGSA 5LMNB 1JOYA 4F6EA 1CP9A 4BIOA 5BZBA 1N36O 1H8EG 3IGAC 4HZ3A 3SGIA 3UO3A 1FXKB 3G6BA 5KA6A 2YXYA 4X65O 3ZRSA 3LSQA 2Q9LA 4LBEC 1SRYA 2UUBO 1PNMA 3JASB 2QM7A 1WJZA 2YIBD 3SYPA 3OD4A 2DMXA 4IGGA 4FMTA 3FYIB 1N0NA 3BAAA 3JSNA 1E1RG 5FNVB 5B1BC 1COWG 1AJPA 1KECA 3OR6C 5DM6V 2Q0OC 1JQ0A 4YJ2B 3HKDB 3BCCH 3OEHG 3QG5A 1W59A 4H33A 4DK1A 5LMUB 1K3EA 2WLIA 1IBKB 1RM1B 4LNUA 4TQDA 4P2ZA 3AG3B 1K8AW 3CHXA 5EK0A 2DJVA 3GWOA 3OM3B 3AG4C 3ETDA 2N05A 3I56V 1H2LA 5JH7B 3HKDA 2V1DA 1HDJA 1K4CC 1VQLV 5EIBC 2EULA 3JAWB 4P30A 1BSMA 3RGBA 4LFCO 4X62O 3AK3A 3RYHB 3BPZA 1AP5A 2ZD9A 3ZMVA 1R73A 5GONB 2EJ7A 4LF9B 2RQ6A 4I55B 1S5LZ 2B1GA 3ABMB 5KHGA 4ZOLA 2RMKB 3HKEB 5FL7G 2PY5A 1UPGA 1RM1C 3CC4V 1Q6IA 3SR2C 3B2EE 2L35A 2Q73A 5EZYA 1HNZB 1F23A 2GBOA 4DV2B 2FB5A 4DV4B 1L0NH 1FD9A 1XHXA 1IDSA 3FB8C 4J7ZA 1XL6A 3CWBH 5H6RA 3J7AU 2YDEA 4R7CA 3H1HH 2V7QG 3ZS8C 4DO2A 1VQPV 2AHYA 4KFMA 3CCQV 2CK3G 2XASA 3SPHA 3ABMC 1H2SB 4JI6O 2DOSA 3OMNB 2WLNA 4YIPA 2JIZG 5DEDA 1YCIA 2MW2B 2W0FC 4IYHA 3ABLB 3CPWU 1WAZA 4X64O 1JPXA 1QLNA 1NR1A 1IXBA 2YEVA 2QM4A 2ZIOA 3BABA 2X6CA 3K79A 1OHHG 2HP8A 4U7NA 4FFKA 2IH1C 2QR4A 2UXBB 1N34B 4R6ZA 2K9PA 5KX5B 2OTJV 2EBOA 2E3CA 5JWPA 3UKMA 2LW7A 1SERA 3ABKB 2Y0PA 3JARB 3RWRD 3M99B 5KA5A 2WA4A 4KHPB 5KX5A 1JJOA 1YDXA 5CA1B 2CDYA 4FJCC 2HR3A 3K5MA 1U96A 1U97A 4CC6A 3SJQC 3FB5C 5IJ9B 1OCOC 4BAYA 1ZSPA 4RQEA 5E79Z 4D7TA 4NTXA 4YJ3B 5D5PA 2QWPB 5LHGA 3JARA 3U11A 4FM2A 1K92A 4LH7A 1PP9H 2EIKB 4UB6Z 2DQ3A 1EN5A 1N0JA 2A9HA 2PUSA 2X0LA 3ABKC 2Y4TA 4B08A 5DECA 1OCCC 2D3OW 3L75H 1AB3A 2VQEO 2Y4UA 2QWQB 2ZM6B 5EIBD 4UCRA 1M5IA 4B7EA 4NR1A 3O65A 2E5LB 1NT2B 1K7DA 2RJZA 1K9MW 5L3BA 4LCUC 5JJNB 1HNXO 1YTFD 3QO5A 5BY1A 2XTAA 1YF2A 3L73H 3CMEV 1K5SA 2QE7G 2PTMA 1VEWA 3D8CA 2IJIA 2RNBA 3JD3A 3A8TA 5L3DA 1HW7A 1DF4A 2ZE5A 2UXCO 4OGQB 4JI3B 4LF8B 2P7TC 3DGEA 4OX9O 1YXBA 2HLDG 4LF5O 1S77D 5FLXN 4Z2WA 3P32A 2KG7B 1IX9A 3K5NA 1WLEA 1S0VA 2Q7HA 4MVZA 3T1HO 3FB6C 1Y76A 4J42A 1CPYA 4JI5O 5CBHA 3S3XA 3WU2Z 4NVPA 1AI5A 4NXMO 1XHZA 3HKBA 2W6IG 4BW5A 5L3CA 4X65B 3T1YO 4X1YB 4DV6O 4KL1A 2PI4A 5EYPB 2EILC 1V55B 4G2KA 4FZ1A 4LH6A 3CCEV 3DXRB 1SQPH 5K1XA 5BMVB 4O4JA 1N33B 1NTMH 1G1XB 3ZRWA 4AQYO 4TWKA 4DR3O 1I94O 2EZPA 2VQFO 4PDMA 2JEXA 4IIJA 1FXHA 2IJJA 5J2UA 4UVCA 1X59A 2PI5A 4DV7O 1AR5A 3K9SA 4WFAV 4FFBA 4DK0A 3OW2U 3LUTB 2UUAB 4UV9A 1RFYA 3K03A 2Y69B 1ZUQA 1Q6HA 1R6NA 1QU7A 3P30A 1AR1B 3W7XA 2UXDO 4H44B 4WFHA 1SETA 1V55C 3IFXA 2HVJC 1E79G 1Z5VA 2O57A 1EBOA 1NR7A 1NZ6A 1EFRG 5FPOA 1PV0A 1Y67A 4U3JB 4UB8Z 3UM7A 1VQ6V 1TVKA 3R65A 4I4TB 5CA0B 3K5LA 3DC6A 4K8ZA 4B3TB 1XMOO 1FFXB 4QE7A 4JI0O 1H8HG 1RSOA 2UXXA 2FYUH 3FYEB 1W0KG 3CCSV 2ITCC 2Y69C 2ZDIA 2E75B 3CJHB 3LSSA 1NJIW 4NTWA 4NTYA 1JFFA 5ITZA 3K3WA 1MABG 4LFAO 5H6QA 1SQBH 2ZDIC 3CS5A 3CRQA 2CGOA 3KKYA 2F23A 4QE9A 4DV0B 4WFBV 3A2FA 4DR4O 4KUMA 3E86A 3BY6A 5LGTA 1NTKH 1XEQA 3LNNA 2ZINA 3F5WC 1V9PA 1MSDA 3ICXA 4DR6B 2LFRA 5J2TB 4LP8A 1BT8A 3IC9A 5KHKA 3E8GA 3X2QB 1KQSU 3JAMN 3F7VC 3VQXA 1J5EB 2CH7A 1N32O 3CRCA 2F4VB 1VQKV 1Y74A 3E35A 3JAKA
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 3OGC C;  1SC5 B;  4LF7 B;  2GTA A;  4JV5 B;  1AJQ A;  1B3Q A;  2CTW A;  4HYO A;  5KUK A;  1BMF G;  2H8P C;  4UCV A;  4B3R B;  1FJG O;  3N2K B;  4F4L A;  2N74 A;  4DUZ O;  2ZCE A;  5LBQ A;  3K04 A;  1TUE B;  4JI1 O;  2Z0A A;  5H2F Z;  3ZIA G;  5LOV A;  3ZMZ A;  1FPO A;  1IUR A;  4B7K A;  4FM0 A;  1AJN A;  4GX2 A;  1R3I C;  3APQ A;  5KHH A;  2IH3 C;  4UCT A;  3X2Q C;  4NXN O;  3K0D A;  3GB7 C;  1QHT A;  4X88 A;  4LFB O;  2UU9 O;  4HBN A;  4L87 A;  1ZWI C;  3VQY A;  3EVK A;  1KC8 W;  3OTO B;  5IYB O;  2VRZ A;  3HKC B;  2QTO A;  1SQQ H;  1WPX A;  4PEL A;  1G8M A;  1GN3 A;  2E74 B;  3UQ8 A;  1XNR B;  1XOU A;  4O4I A;  5IT9 N;  3E22 A;  1HR0 O;  2C2A A;  1VQ7 V;  4MVM A;  4HNA B;  1NKD A;  3BEH A;  5KHJ A;  5LYJ B;  5BR8 O;  4K0K O;  1H2K A;  3L9D A;  2Z5U A;  4DR7 O;  1R6K A;  2VQE B;  4TQF A;  1FS0 G;  2Q68 A;  3BFR A;  3BRC A;  3SJB C;  1SZX A;  3UCS C;  5IE9 A;  2HJD A;  4DR2 O;  1Q6U A;  4DW1 A;  3CRR A;  2F95 B;  2GV9 A;  2JEU A;  3OT7 A;  2WPD G;  4J41 A;  4ZI7 A;  4U7O A;  1IBL O;  2RN9 A;  1EN6 A;  3SPJ A;  5K1P A;  3K9A A;  4GKK B;  3FD9 A;  1XNQ B;  1BHB A;  1EZV H;  1BQZ A;  4BWA A;  5B66 Z;  1VMG A;  3TGU H;  4JYA O;  3PN1 A;  4OX9 B;  2FKX A;  3BVO A;  3SPI A;  1MNG A;  2OT5 A;  3K57 A;  1O9H A;  1OJH A;  1I7F A;  2P6J A;  4FLY A;  3LDD A;  2UXN A;  3AG4 B;  3ZX6 A;  1PNK A;  1Q3E A;  2WLI B;  1GKF A;  1I5X A;  5EBL C;  4LNU B;  4UFZ A;  4EKW A;  3J80 N;  2OIG A;  3M8A A;  2BCC H;  2OCH A;  3E8F A;  1VQ9 V;  1PKX A;  2KQX A;  4OPH A;  4Z1V A;  4AQY B;  2JGU A;  1KMI Z;  4LF6 B;  1I0H A;  4NB5 A;  3JCU Z;  1S72 V;  4X1K A;  4CH6 A;  4X20 B;  2A3Q A;  2ILM A;  4YY3 O;  3K06 A;  1YTF B;  1G6U A;  1XMQ B;  3CP1 A;  3JAT A;  4GKJ O;  3ZHU A;  1H2M A;  4ZOL B;  2WLJ A;  4UCU A;  1AP6 A;  4FIP C;  2QM8 A;  3R66 A;  2UXD B;  3UT5 A;  4JTA B;  4G28 B;  2JVD A;  1VQ8 V;  5EZY B;  2H3O A;  4X20 A;  4TUY A;  4JYB A;  1ZX3 A;  1YIT V;  2BTO A;  5L3E A;  2Q7G A;  1NBM G;  1XUQ A;  3E8B A;  1XQ8 A;  2EIM C;  4X1I A;  3C90 A;  3MD0 A;  3CYO A;  4DV1 B;  1V54 C;  4RWU A;  3QF7 A;  2CTR A;  4ASU G;  5JJJ B;  2BE3 A;  1Y6X A;  4JF3 A;  4W4L A;  1PL4 A;  3S3W A;  4GZR B;  3J81 N;  1VF6 A;  2QKC A;  3VOU A;  2JJ1 G;  3NR7 A;  5C8Y A;  3FB7 C;  3SPC A;  3B8N A;  1DLB A;  4TV8 A;  1DK1 A;  3QVN A;  2OCC B;  1VF6 C;  4MSW C;  4DR5 B;  4X66 B;  2XT9 A;  2Q7E A;  2YEV B;  3ZBH A;  4BIZ A;  1SF9 A;  2V4D A;  2LW1 A;  5KLV H;  5E1A C;  4BW9 A;  4N23 A;  1BS3 A;  3K0G A;  3AG1 B;  5CN0 A;  2WLK A;  2PYJ A;  3Q4H A;  4WCE V;  4FK5 C;  4ZHQ A;  3THO A;  1F4N A;  2Q5Z A;  1TA8 A;  2CUG A;  1AI6 A;  1KP2 A;  1SS3 A;  4A5U B;  2ETN A;  1T5E A;  3STL C;  4DV5 O;  3CXH F;  2YUA A;  4J7J A;  4F6R A;  2L6L A;  3ZHR A;  2IJH A;  1JCH A;  1URF A;  2OCC C;  4WBN A;  2ZIM A;  1OCO B;  4JZG A;  4UUJ C;  4Q6G A;  5CB4 A;  1IXM A;  2F66 C;  3OR7 C;  2BTQ A;  4JI7 B;  5A2Q N;  3AG1 C;  3FAV A;  2ZXW C;  3B40 A;  4AHC A;  1E1Q G;  2PYL A;  3BA8 A;  1WA8 A;  4DR1 O;  1R1B A;  1PM9 A;  4FLX A;  1OCC B;  3ZHV A;  3HR0 A;  4LR3 A;  2Q69 A;  1HP8 A;  4LWS A;  1G4Y B;  1GH6 A;  4YHH B;  1YI2 V;  2X6A A;  3CX5 F;  4O4L A;  2XUM A;  5F2V O;  1S5H C;  2N04 A;  1YSC A;  2WLL B;  2VWJ A;  2ZT9 B;  4MW8 A;  3ASO C;  1ZTE A;  1Q5O A;  1AR4 A;  1RPO A;  1Q7Y W;  3T4D A;  3K08 A;  1QLE B;  1AI4 A;  1VF5 B;  1NH2 B;  3CE2 A;  2P90 A;  1FKA O;  3ML0 A;  4DRX A;  5JQG A;  2WLL A;  2EIJ C;  2WSS G;  1VQM V;  2DYS C;  4MVR A;  4CS4 A;  3K5O A;  3SYA A;  2KKW A;  2BOB C;  3G80 A;  1S76 D;  4JI4 O;  4O4H A;  5J9P C;  2JGD A;  3JSL A;  3OGI B;  4R50 A;  2EIL B;  5IYD O;  1HNW B;  2UUC O;  4NYK A;  1Y76 B;  1MG1 A;  1W0J G;  2M6Y A;  5GW7 A;  4LF4 O;  1FYJ A;  4FLT A;  1ORQ C;  3G71 V;  1M90 W;  1QR8 A;  4JI8 O;  3RW0 A;  3HKB B;  2R70 A;  1QLE C;  2PGG A;  2GUZ A;  1W2B U;  1NVP B;  1VQ5 V;  1RPR A;  4DV3 O;  1Z2G A;  2ZE8 A;  1BQ0 A;  5LGN A;  3APO A;  3CMA V;  1K4D C;  2P22 C;  1XIL A;  2KB1 A;  4JTD B;  3ABT A;  4O4J B;  4B3M O;  4B3S O;  4HAM A;  4FLU A;  3LDC A;  2HHH O;  3ZRW B;  1N36 B;  4CS2 A;  3MHH C;  3ZRX A;  4BR6 A;  3CCV V;  1R3J C;  1WP8 A;  4IIJ B;  1M4U A;  4GYC B;  5J2U B;  3OUF A;  3OFN G;  4XDL A;  5LMN O;  4X8A A;  1ROP A;  5BXZ A;  2UUB B;  4FFB B;  1SQX H;  1QQC A;  1JVM A;  3T4Z A;  3E2E A;  4UV8 A;  2XHB A;  3H9V A;  4GX0 A;  2K1E A;  3ZN1 A;  5KMG A;  1IBM O;  1A32 A;  1TAE A;  5IJ0 A;  3JAL A;  1SZT A;  3B4S A;  1M56 B;  4EB6 A;  1GN6 A;  3A0H Z;  2EX3 A;  1WN7 A;  1TVK B;  1QR9 A;  2RDC A;  3AK2 A;  4DW0 A;  3MHS C;  2Q67 A;  3WFV A;  5LA6 A;  3CXC U;  4PHZ A;  1RSO B;  1GN4 A;  3TXS A;  5LMU O;  5KAF Z;  1VIB A;  2G38 A;  4CC5 A;  1IBK O;  3ASN C;  4JPR A;  3ZRV A;  1JFF B;  5ITZ B;  3CCM V;  2OWO A;  4LFC B;  5IYC O;  4X62 B;  1MSW D;  2FTK A;  3AG7 A;  1PL0 A;  2A0L A;  4Z1M G;  2LP7 A;  1BE3 H;  2VS0 A;  2QEX V;  3CD6 V;  2P4K A;  1M56 C;  2ITD C;  5EC1 C;  4JAU A;  3M7M X;  3N27 A;  3G4S V;  4ZKI A;  3LDE A;  1YVW A;  4YXW G;  2IU0 A;  2Q8V A;  2B9Z A;  1VAR A;  5GTI Z;  1MZF A;  2CH7 B;  2XAG A;  1CEZ A;  2HFE C;  1P7B A;  2YI9 A;  4MTG A;  1Y74 B;  3CRM A;  3JAK B;  4CBC A;  4FLV A;  1L0L H;  4P9O A;  4DV2 O;  3SPG A;  4DV4 O;  4MVO A;  1US6 A;  4I7Z B;  4JI6 B;  1R3L C;  1WNS A;  3BA9 A;  2JDI G;  3TXQ A;  5LOV B;  2DWD C;  4L8J A;  1UJW B;  2WA3 A;  5A9G A;  2QGN A;  4O2A A;  1WPB A;  4X64 B;  3D3I A;  2IW5 A;  4DV5 B;  1AIL A;  1MZE A;  5B1N A;  4TV9 A;  1NH2 D;  1MOF A;  3ZHT A;  3VQV A;  1EM1 A;  2OTL V;  1KKD A;  3ETE A;  3CCR V;  2DN9 A;  2LJ2 A;  3B09 A;  1JMK C;  3RT3 C;  2ZQM A;  5H5N A;  4I9Q A;  3OUS A;  1B04 A;  5IYZ B;  4R8C A;  2A06 H;  3SJC C;  1SQG A;  4PI2 A;  4O4I B;  2LGW A;  3E22 B;  1H2N A;  2UXB O;  1N34 O;  4AI8 A;  1ZAU A;  2IJK A;  4I0X B;  1NVP D;  1P7G A;  1JX9 A;  5B3S C;  5JJE B;  3KG2 A;  2RCV A;  3RBZ A;  5IYZ A;  2EZO A;  5KUM A;  1VQN V;  2ZR3 A;  2IBZ H;  4MTX A;  2DE0 X;  1SQV H;  3I55 V;  4KHP O;  4RQF A;  1YHQ V;  3QO7 A;  2XND G;  4TT3 G;  1IZ3 A;  1LUV A;  4I0X A;  2X6B A;  1J95 A;  3GVM A;  2PF4 E;  4ZBM A;  4ZI7 B;  4CH4 A;  4UCO A;  4RUF A;  3ETG A;  2Y48 A;  3RYC A;  3PJS K;  3ZCC A;  4CH3 A;  3O9O A;  1B6Q A;  4E4E A;  3K58 A;  1R3K C;  2AZ0 A;  2YI8 A;  3FFQ A;  2GTS A;  3JD0 A;  3ZN0 A;  1GK9 A;  3G6E V;  2R72 A;  1HNX B;  4EEQ A;  3VQW A;  2DW4 A;  2ZM6 O;  1NS1 A;  3ZMS A;  3SYC A;  1I08 A;  3OMA B;  1EZJ A;  2E5L O;  1OCR C;  1KKC A;  2AXT Z;  2XAQ A;  2UXC B;  1NTZ H;  4N21 A;  2ODM A;  1GMG A;  2QKS A;  4ZIB A;  3H01 A;  4WFE A;  3VBB A;  4WF9 V;  4FM1 A;  3QTC A;  5LP6 A;  4MVQ A;  4LF5 B;  1ZL8 B;  2YS8 A;  2ZNJ A;  2FML A;  2QKA A;  4H0L B;  3OAA G;  3RVZ A;  3SDL A;  4RAI A;  2MK3 A;  5LL6 Y;  4DUY O;  4I9W A;  4JYY A;  3IAY A;  5C93 A;  3F5T A;  3W7U A;  3T1H B;  3CC2 V;  4JI5 B;  4JI3 O;  4LF8 O;  1BL8 A;  4MTO A;  1YJW V;  4NXM B;  2X7R B;  4X1K B;  1Q81 W;  3T1Y B;  1H38 A;  4AIL C;  4DV6 B;  1K97 A;  2QWN B;  2JS5 A;  2YIA A;  3JAT B;  1R6T A;  2FL4 A;  1ZL8 A;  4O2B B;  1GN2 A;  2JJ2 G;  1Q86 W;  5IWA O;  1S5J A;  1QCE A;  4FZ0 A;  3UT5 B;  3L74 H;  4DR3 B;  1I94 B;  2VQF B;  2EIM B;  3F7Y C;  2QWO B;  4GX1 A;  5LXT A;  1IBM B;  4PI0 A;  1V54 B;  3CRA A;  2ADP A;  4TUY B;  3EFF K;  5AG2 A;  2GHY A;  4DV7 B;  1B06 A;  3KCY A;  1N33 O;  2EJR A;  3JCZ A;  4O2B A;  3N2G B;  4X1I B;  2P4V A;  1FXK A;  2DYR B;  2LO1 A;  4PA4 A;  3D36 A;  4EFB A;  1D5N A;  3OTF A;  3JAS A;  4J7K A;  1SQF A;  3DTU B;  5HFL A;  1QVF U;  2UUA O;  4J9Z B;  4JYC A;  1FXK C;  3MAQ A;  3T2M A;  1BGY H;  2F93 B;  3D36 C;  5C8Y B;  5CA3 A;  1YJN V;  5FNV A;  4JI2 O;  3N2G A;  2XAF A;  1L1F A;  5IY5 B;  3ABU A;  1XMO B;  1GM9 A;  1JA8 A;  4TV8 B;  4YJ2 A;  1YIJ V;  2ZE6 A;  4QPJ A;  4JI0 B;  1OZ0 A;  2YXL A;  2QJ1 A;  1X4T A;  2ZR2 A;  5LHI A;  2B1I A;  3QNE A;  1QVG U;  1LNQ A;  2VWK A;  2XAH A;  4UVA A;  4CH5 A;  2W0X A;  2DYR C;  4MS2 A;  3LNM B;  4J80 A;  4B3T O;  4KP4 A;  3H1L H;  2M7W A;  1QNM A;  3Q4H B;  4LFA B;  4ZHQ B;  5D5Q A;  3W7W A;  1XI1 A;  1K73 W;  4LC1 A;  5JH7 A;  4XBF A;  2QWR B;  3AG3 C;  3RN4 A;  3OE7 G;  5CBG A;  4DR4 B;  1P4R A;  3JAW A;  2D2C B;  4WFF A;  4F6R B;  1IVS A;  3RYH A;  3RVY A;  1QBZ A;  4I5S A;  1VQ4 V;  5IY5 C;  2CE4 A;  2IM9 A;  5GON A;  4PV1 B;  4D6T H;  4I55 A;  4WBN B;  2WAM A;  2ZXW B;  4DV0 O;  5CB4 B;  3HKE A;  5B5E Z;  1N32 B;  3TK1 A;  2PZS A;  2BTQ B;  2Q6A A;  2DQ0 A;  3WB1 A;  1XRE A;  5CMU A;  4PJ0 Z;  3RYI B;  3FAV B;  4DR6 O;  3SYQ A;  4PD4 F;  3OEE G;  4IL6 Z;  1WA8 B;  1GRJ A;  1J5E O;  3CCU V;  4XDJ A;  2F4V O;  3E83 A;  1FJG B;  4LWS B;  3K59 A;  1K5Q A;  1N4C A;  4GCZ A;  4DUZ B;  1XBL A;  1Z5W A;  4JI1 B;  3WG7 B;  3ASO B;  4LF7 O;  4JAS A;  4O4L B;  4JV5 O;  3RYI A;  3L72 H;  4NXN B;  4B3R O;  4CZZ A;  4Q20 A;  2WLH A;  4LFB B;  2UU9 B;  4OPA A;  1P49 A;  3AEI A;  3TET A;  1KP3 A;  1YJ9 V;  1AVM A;  2EIJ B;  2ATK C;  2QSA A;  2DYS B;  2AW9 A;  3A0B Z;  2YID A;  1ZLZ A;  4RUE A;  2YIC A;  3DSQ A;  2R9A A;  2JRI A;  5JQG B;  4DRX B;  3ABL C;  4JAA A;  3ETQ A;  3JYC A;  4GUN A;  3WG7 C;  1Q8I A;  4FLZ A;  3SYO A;  2P67 A;  1HR0 B;  3RFR A;  3OTO O;  2AZ2 A;  3CSX A;  1K33 A;  4J10 A;  3T1C A;  5BR8 B;  4J11 A;  4K0K B;  4O4H B;  2JGD B;  4RO2 A;  1XNR O;  1O9G A;  4XDK A;  3BHP A;  4DR7 B;  3WB0 A;  2B5U A;  1Y4M A;  2GUZ B;  1UFI A;  2QDO A;  3MDS A;  2F43 G;  2CTQ A;  2WLM A;  4QGP A;  5JVD B;  1MA1 A;  1Q43 A;  5CA1 A;  3H1K H;  4DR2 B;  5IJ9 A;  1JR9 A;  1XL4 A;  1GO3 F;  2HEP A;  2Q4P A;  4YJ3 A;  1KU9 A;  4FPP A;  2ADQ B;  1IBL B;  3FKS G;  3IC7 A;  1SA0 B;  3LSU A;  1TUB B;  3U10 A;  1FFT B;  4MVU A;  5JVD A;  1M9N A;  4JYA B;  2NN4 A;  2ZE7 A;  5L3G A;  2IU3 A;  4TSF G;  2KSD A;  1YZB A;  2EIK C;  4MT8 A;  2JK5 C;  2R9I A;  5HFM A;  2ZNI A;  4JZ2 A;  1F4M A;  3A0R A;  4DUY B;  4GKK O;  3JD4 A;  1XNQ O;  1WB7 A;  3HPL C;  5KMG B;  1LR1 A;  1SA0 A;  2A79 B;  5IJ0 B;  3JAL B;  5IDJ A;  1TUB A;  4UVB A;  3WB2 A;  4WFG A;  4K3A A;  2HVK C;  3P3P A;  4EB6 B;  1GAX A;  5L3F A;  1H2G A;  1K34 A;  3ASN B;  4JTC B;  1SES A;  4X89 A;  5LA6 B;  5IWA B;  2R9R B;  1BHA A;  1RP3 B;  3ZJZ A;  4D7S A;  2OIE A;  3OMI B;  4YY3 B;  3AG2 B;  3RYF B;  1D5A A;  2CTP A;  1F7Y A;  2KG7 A;  4P9P A;  4GKJ B;  1OV9 A;  1CXZ B;  2F1M A;  3E89 A;  3CCL V;  5DN6 G;  1KD1 W;  2ZKO A;  1PD3 A;  1I5Y A;  2GSM B;  2YC0 A;  4LF6 O;  3H1I H;  1GM8 A;  3L71 H;  2H94 A;  2CAZ C;  4X1Y A;  4UXN A;  4DYL A;  1XMQ O;  4IYI A;  5EYP A;  3KCX A;  4K8X A;  1JJ2 U;  2NLJ C;  3G67 A;  4MW3 A;  4KXR A;  3L70 H;  3RYF A;  3CB2 A;  1GTO A;  3DXR A;  1VF7 A;  4PA3 A;  5BMV A;  1D2D A;  3ZHQ A;  1YEW A;  4I50 B;  1SKV A;  4X9Q A;  4JI2 B;  3TJT A;  3AG2 C;  2OYQ A;  3TCU A;  4PDV A;  4ABM A;  5EC2 C;  3GWK C;  1P84 F;  1TGO A;  4GT1 A;  3JD2 A;  2Q0A A;  4LF9 O;  3ZMU A;  2NNU A;  3IJ4 A;  4MTF A;  4QIW F;  4DV1 O;  1VP7 A;  1BCC H;  1WP7 A;  4I50 A;  1WB8 A;  2JS3 A;  2WWW A;  4IHJ B;  2YSU B;  4OXS A;  4O2A B;  3STZ C;  1KYO F;  5B1A B;  1HNZ O;  2XAJ A;  1THZ A;  2YXH A;  4GX5 A;  3W7S A;  3ZED A;  4TV9 B;  4MVS A;  4U3J A;  4PA7 A;  4I4T A;  5CA0 A;  3EXA A;  3HB3 B;  5EBW C;  1FFX A;  1HWY A;  1ARO P;  4IHJ A;  4X66 O;  4DR5 O;  1XDC A;  2ARH A;  3W7T A;  2YIB A;  3ZMT A;  1GM7 A;  4H13 B;  5EBM C;  1FAF A;  4PDR A;  4FLW A;  3CJH A;  2DWE C;  1M1K W;  1F51 A;  2QA4 V;  4G27 B;  5KAI Z;  5B3S B;  5H9C A;  2Y0I A;  3NXS A;  5GTH Z;  4DXW A;  1DGS A;  1Q82 W;  4FVM A;  5B1A C;  1DTO A;  2BOC C;  2NR5 A;  2AGA A;  3D3Q A;  3H1J H;  5FPR A;  1Q90 D;  2HKO A;  1BZK A;  4YIO A;  5TIS Z;  5J2T A;  5LHH A;  3CC7 V;  5KHI A;  4QJF B;  4DR1 B;  4C7U A;  3CCJ V;  2XOK G;  4E2L A;  1OCZ B;  1VQO V;  3I5D A;  4W4K A;  4JI7 O;  2LFS A;  5JCO A;  3SJA C;  1M57 B;  3B77 A;  4QPK A;  4U3F H;  2LGQ A;  4IT5 A;  3RYC B;  1N8R W;  3JD1 A;  4PDL A;  3N2K A;  1Y66 A;  5JCO C;  2EIN B;  4YHH O;  2CGN A;  5CBF A;  1NU1 H;  1PNL A;  3AK1 A;  3FX7 A;  1OCR B;  3B8M A;  3P3N A;  4GLX A;  4CS3 A;  2A7W A;  1KB9 F;  2AHZ A;  3KZI Z;  4H37 A;  4K35 A;  3QO8 A;  4NKG B;  1DF5 A;  1OCZ C;  1S3J A;  1M57 C;  5B1O A;  1FXV A;  4J9Y B;  3E8H A;  3C3T A;  5LP6 B;  3HKC A;  3ZHS A;  2QTS A;  4ICG A;  3DC5 A;  4BIU A;  4JI4 B;  1LUW A;  1ENV A;  4TOI A;  2E76 B;  2EIN C;  3UO2 A;  4UCS A;  2UUC B;  2LQT A;  4LF4 B;  1MMM A;  2BSK B;  4JI8 B;  4JAV A;  4HNA A;  3EHB B;  5LYJ A;  4PA9 A;  4PA6 A;  4DV3 B;  1KBH A;  1HNW O;  3C3S A;  1PPJ H;  2P06 A;  1EN4 A;  2HJF C;  1L8D A;  4B3M B;  4B3S B;  1KUQ A;  5LGU A;  2W6J G;  1M93 A;  1NI8 A;  2GDS A;  2HHH B;  1NQT A;  3CEI A;  1AI7 A;  5LP6 C;  4QNH B;  3U0Z A;  2BSK A;  2HG5 C;  5B1B B;  4EFE A;  2Z3Y A;  5LXT B;  2P5O A;  4JGS A;  5LMN B;  1JOY A;  4F6E A;  1CP9 A;  4BIO A;  5BZB A;  1N36 O;  1H8E G;  3IGA C;  4HZ3 A;  3SGI A;  3UO3 A;  1FXK B;  3G6B A;  5KA6 A;  2YXY A;  4X65 O;  3ZRS A;  3LSQ A;  2Q9L A;  4LBE C;  1SRY A;  2UUB O;  1PNM A;  3JAS B;  2QM7 A;  1WJZ A;  2YIB D;  3SYP A;  3OD4 A;  2DMX A;  4IGG A;  4FMT A;  3FYI B;  1N0N A;  3BAA A;  3JSN A;  1E1R G;  5FNV B;  5B1B C;  1COW G;  1AJP A;  1KEC A;  3OR6 C;  5DM6 V;  2Q0O C;  1JQ0 A;  4YJ2 B;  3HKD B;  3BCC H;  3OEH G;  3QG5 A;  1W59 A;  4H33 A;  4DK1 A;  5LMU B;  1K3E A;  2WLI A;  1IBK B;  1RM1 B;  4LNU A;  4TQD A;  4P2Z A;  3AG3 B;  1K8A W;  3CHX A;  5EK0 A;  2DJV A;  3GWO A;  3OM3 B;  3AG4 C;  3ETD A;  2N05 A;  3I56 V;  1H2L A;  5JH7 B;  3HKD A;  2V1D A;  1HDJ A;  1K4C C;  1VQL V;  5EIB C;  2EUL A;  3JAW B;  4P30 A;  1BSM A;  3RGB A;  4LFC O;  4X62 O;  3AK3 A;  3RYH B;  3BPZ A;  1AP5 A;  2ZD9 A;  3ZMV A;  1R73 A;  5GON B;  2EJ7 A;  4LF9 B;  2RQ6 A;  4I55 B;  1S5L Z;  2B1G A;  3ABM B;  5KHG A;  4ZOL A;  2RMK B;  3HKE B;  5FL7 G;  2PY5 A;  1UPG A;  1RM1 C;  3CC4 V;  1Q6I A;  3SR2 C;  3B2E E;  2L35 A;  2Q73 A;  5EZY A;  1HNZ B;  1F23 A;  2GBO A;  4DV2 B;  2FB5 A;  4DV4 B;  1L0N H;  1FD9 A;  1XHX A;  1IDS A;  3FB8 C;  4J7Z A;  1XL6 A;  3CWB H;  5H6R A;  3J7A U;  2YDE A;  4R7C A;  3H1H H;  2V7Q G;  3ZS8 C;  4DO2 A;  1VQP V;  2AHY A;  4KFM A;  3CCQ V;  2CK3 G;  2XAS A;  3SPH A;  3ABM C;  1H2S B;  4JI6 O;  2DOS A;  3OMN B;  2WLN A;  4YIP A;  2JIZ G;  5DED A;  1YCI A;  2MW2 B;  2W0F C;  4IYH A;  3ABL B;  3CPW U;  1WAZ A;  4X64 O;  1JPX A;  1QLN A;  1NR1 A;  1IXB A;  2YEV A;  2QM4 A;  2ZIO A;  3BAB A;  2X6C A;  3K79 A;  1OHH G;  2HP8 A;  4U7N A;  4FFK A;  2IH1 C;  2QR4 A;  2UXB B;  1N34 B;  4R6Z A;  2K9P A;  5KX5 B;  2OTJ V;  2EBO A;  2E3C A;  5JWP A;  3UKM A;  2LW7 A;  1SER A;  3ABK B;  2Y0P A;  3JAR B;  3RWR D;  3M99 B;  5KA5 A;  2WA4 A;  4KHP B;  5KX5 A;  1JJO A;  1YDX A;  5CA1 B;  2CDY A;  4FJC C;  2HR3 A;  3K5M A;  1U96 A;  1U97 A;  4CC6 A;  3SJQ C;  3FB5 C;  5IJ9 B;  1OCO C;  4BAY A;  1ZSP A;  4RQE A;  5E79 Z;  4D7T A;  4NTX A;  4YJ3 B;  5D5P A;  2QWP B;  5LHG A;  3JAR A;  3U11 A;  4FM2 A;  1K92 A;  4LH7 A;  1PP9 H;  2EIK B;  4UB6 Z;  2DQ3 A;  1EN5 A;  1N0J A;  2A9H A;  2PUS A;  2X0L A;  3ABK C;  2Y4T A;  4B08 A;  5DEC A;  1OCC C;  2D3O W;  3L75 H;  1AB3 A;  2VQE O;  2Y4U A;  2QWQ B;  2ZM6 B;  5EIB D;  4UCR A;  1M5I A;  4B7E A;  4NR1 A;  3O65 A;  2E5L B;  1NT2 B;  1K7D A;  2RJZ A;  1K9M W;  5L3B A;  4LCU C;  5JJN B;  1HNX O;  1YTF D;  3QO5 A;  5BY1 A;  2XTA A;  1YF2 A;  3L73 H;  3CME V;  1K5S A;  2QE7 G;  2PTM A;  1VEW A;  3D8C A;  2IJI A;  2RNB A;  3JD3 A;  3A8T A;  5L3D A;  1HW7 A;  1DF4 A;  2ZE5 A;  2UXC O;  4OGQ B;  4JI3 B;  4LF8 B;  2P7T C;  3DGE A;  4OX9 O;  1YXB A;  2HLD G;  4LF5 O;  1S77 D;  5FLX N;  4Z2W A;  3P32 A;  2KG7 B;  1IX9 A;  3K5N A;  1WLE A;  1S0V A;  2Q7H A;  4MVZ A;  3T1H O;  3FB6 C;  1Y76 A;  4J42 A;  1CPY A;  4JI5 O;  5CBH A;  3S3X A;  3WU2 Z;  4NVP A;  1AI5 A;  4NXM O;  1XHZ A;  3HKB A;  2W6I G;  4BW5 A;  5L3C A;  4X65 B;  3T1Y O;  4X1Y B;  4DV6 O;  4KL1 A;  2PI4 A;  5EYP B;  2EIL C;  1V55 B;  4G2K A;  4FZ1 A;  4LH6 A;  3CCE V;  3DXR B;  1SQP H;  5K1X A;  5BMV B;  4O4J A;  1N33 B;  1NTM H;  1G1X B;  3ZRW A;  4AQY O;  4TWK A;  4DR3 O;  1I94 O;  2EZP A;  2VQF O;  4PDM A;  2JEX A;  4IIJ A;  1FXH A;  2IJJ A;  5J2U A;  4UVC A;  1X59 A;  2PI5 A;  4DV7 O;  1AR5 A;  3K9S A;  4WFA V;  4FFB A;  4DK0 A;  3OW2 U;  3LUT B;  2UUA B;  4UV9 A;  1RFY A;  3K03 A;  2Y69 B;  1ZUQ A;  1Q6H A;  1R6N A;  1QU7 A;  3P30 A;  1AR1 B;  3W7X A;  2UXD O;  4H44 B;  4WFH A;  1SET A;  1V55 C;  3IFX A;  2HVJ C;  1E79 G;  1Z5V A;  2O57 A;  1EBO A;  1NR7 A;  1NZ6 A;  1EFR G;  5FPO A;  1PV0 A;  1Y67 A;  4U3J B;  4UB8 Z;  3UM7 A;  1VQ6 V;  1TVK A;  3R65 A;  4I4T B;  5CA0 B;  3K5L A;  3DC6 A;  4K8Z A;  4B3T B;  1XMO O;  1FFX B;  4QE7 A;  4JI0 O;  1H8H G;  1RSO A;  2UXX A;  2FYU H;  3FYE B;  1W0K G;  3CCS V;  2ITC C;  2Y69 C;  2ZDI A;  2E75 B;  3CJH B;  3LSS A;  1NJI W;  4NTW A;  4NTY A;  1JFF A;  5ITZ A;  3K3W A;  1MAB G;  4LFA O;  5H6Q A;  1SQB H;  2ZDI C;  3CS5 A;  3CRQ A;  2CGO A;  3KKY A;  2F23 A;  4QE9 A;  4DV0 B;  4WFB V;  3A2F A;  4DR4 O;  4KUM A;  3E86 A;  3BY6 A;  5LGT A;  1NTK H;  1XEQ A;  3LNN A;  2ZIN A;  3F5W C;  1V9P A;  1MSD A;  3ICX A;  4DR6 B;  2LFR A;  5J2T B;  4LP8 A;  1BT8 A;  3IC9 A;  5KHK A;  3E8G A;  3X2Q B;  1KQS U;  3JAM N;  3F7V C;  3VQX A;  1J5E B;  2CH7 A;  1N32 O;  3CRC A;  2F4V B;  1VQK V;  1Y74 A;  3E35 A;  3JAK A; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...