1SS3A

Solution structure of ole e 6, an allergen from olive tree pollen
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
50
structure length
50
Chain Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Ole e 6, a Major Allergen from Olive Tree Pollen.
pubmed doi rcsb
source organism Olea europaea
molecule tags Allergen
molecule keywords Pollen allergen Ole e 6
total genus 14
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09253 Ole-e-6 Pollen allergen ole e 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.720 Mainly Alpha Orthogonal Bundle Helix Hairpins Pollen allergen ole e 6 1ss3A00
1SS3A
chains in the Genus database with same CATH superfamily
1IDSA 5D5QA 2QTSA 4O4IB 4X66O 2R70A 1Y6XA 1ZAUA 4JV5O 2ETNA 2A3QA 2EIMB 1H2GA 1VP7A 2GUZA 2WSSG 4AILC 1HW7A 4K8XA 5J9PC 4PA9A 1IBLB 4PA4A 2H8PC 2WPDG 5GONB 4W4KA 1KU9A 3TCUA 4RQEA 4KHPB 4FFBB 3FB7C 3TK1A 4FLWA 1VQPV 4K3AA 2QM7A 1SKVA 2H3OA 3K03A 3HKCB 3CC4V 3BEHA 2HHHO 3O9OA 4I55B 5IT9N 1EN6A 1H2LA 4LFBB 3N2KA 3G71V 4NXNO 4GKJB 5LHIA 2UU9O 1ZL8B 4B3TB 1PNKA 1SQXH 3A8TA 3SJAC 1R6TA 3K5MA 1ZSPA 1PL0A 4LH7A 3UKMA 4BW9A 4X9QA 3ETDA 3UT5B 4O4LA 4UXNA 4F6RB 5CMUA 1Y66A 1N0JA 1XREA 4X64O 3SYAA 3FKSG 5F2VO 1MMMA 3MHHC 1SA0B 3AG2B 4DR6O 3CC7V 3LDEA 2MW2B 2BSKA 2HVJC 2F93B 2YIDA 4JI8B 1WP7A 4ZKIA 2Y69B 5KAIZ 1SC5B 2E74B 2EINB 4CH5A 1N36O 2QM4A 1A32A 4HYOA 1NTKH 2ZQMA 3FAVA 4G2KA 2P90A 4OX9O 3MHSC 2OCHA 1BQZA 5L3FA 3SDLA 1AP5A 5LA6B 4B7EA 3WB2A 2YIBA 3THOA 3LSSA 4RUEA 1XDCA 4ZHQA 1EM1A 1EZJA 2RNBA 2JS3A 3KCYA 2HLDG 1VQKV 1OCRB 4X62B 5DECA 2PY5A 4JZGA 1AJNA 3BFRA 3RYHB 1MSDA 2XAHA 1SQFA 2N04A 4JZ2A 3SYQA 1R3IC 4X1IB 3ABTA 4YIOA 4LH6A 4JTCB 3BA8A 1IURA 3ABMB 3ZRWA 1FXKC 3E35A 4UVCA 3T1HO 4Q6GA 1I94B 1N0NA 2BTOA 3AG2C 4B3SO 2QSAA 4KFMA 4TOIA 4DV2O 4K0KO 2LFRA 5B1BB 3AG1B 4LNUA 4I0XA 4IHJB 1SZXA 4PD4F 1GRJA 2JS5A 3B8MA 4TSFG 1E79G 5AG2A 4TQDA 5JWPA 1N8RW 4TV9A 3W7WA 3E22B 2HP8A 4FMTA 4DR1B 5IY5C 3ASOC 2V4DA 4DV0O 5L3GA 4X8AA 1GN2A 5C8YB 4WFAV 3AG3B 1BCCH 4F4LA 4I9WA 2P22C 2EILB 1S76D 4GKJO 1X4TA 4CBCA 4DR3B 2ADPA 3ZMUA 3A0RA 1ZWIC 4X88A 3OMAB 3K57A 1XEQA 5DEDA 4X1YA 4JAVA 1GAXA 2B9ZA 4YJ3A 2VQFB 4LF4B 2DE0X 1EZVH 3HKCA 1SQQH 3JASA 4U3JB 1E1RG 3ZEDA 1YHQV 4I5SA 1NJIW 2XT9A 3J7AU 1JQ0A 4JI4O 3FYIB 4GX5A 4KXRA 4ZBMA 5CA3A 3ZHQA 3LUTB 1KECA 1NI8A 5H6QA 2IJHA 3SGIA 1IBMB 3CX5F 1GTOA 3ABKC 3APQA 2CTPA 2WA4A 3E8FA 1OZ0A 3G4SV 2RQ6A 1F4NA 5BR8O 5CA1A 2UXDB 2HR3A 1OV9A 2UXXA 4J7ZA 2EINC 1AP6A 4KL1A 5L3BA 3CRAA 5LMUO 4WFGA 2GV9A 1Q82W 2Q8VA 2Q0AA 5BMVB 3FYEB 5C93A 2L35A 2NN4A 5EC1C 4Z2WA 1HNZB 3RYCA 1OCOC 5H2FZ 1I5XA 5EZYA 2YXHA 4X1KB 3N2GA 4BIZA 2ITCC 1O9GA 2JK5C 1Q86W 5FLXN 3NR7A 4CH3A 1OCZB 3RN4A 5IYBO 5BZBA 1G4YB 1H8HG 1M90W 3OTFA 4I50B 5KX5A 4JF3A 3OD4A 4ZOLA 1J5EO 1JCHA 4UCOA 1VF6A 5A2QN 2EIMC 1MOFA 1XMOO 2HKOA 1K3EA 1I94O 4Z1MG 2V7QG 1P49A 4DUZO 4RQFA 3DXRA 4HNAB 3ZRWB 2O57A 1NTMH 4LF9O 1VQ9V 2OTLV 1OJHA 1NR1A 2JIZG 4X20B 4HBNA 4MVOA 1K5QA 3WFVA 3L9DA 4BIOA 2Q4PA 4FLZA 1QLNA 5JJJB 3ZHSA 4DR3O 5B66Z 2A06H 2X6BA 5D5PA 1BMFG 2UXBB 2Q7EA 1H8EG 3ZJZA 3D36A 2R72A 2P06A 1YEWA 1K9MW 1RFYA 5CA0B 2FYUH 2WAMA 1HDJA 5KHIA 3IC9A 2KKWA 5KHHA 1TVKA 2F4VO 1PL4A 3OR6C 2OTJV 2YEVA 3CCRV 1K33A 2JGUA 4FFKA 4PDRA 4DXWA 2QKAA 4DR6B 5CB4A 2YC0A 3H1HH 3HKDA 4QPJA 5JVDB 2ZT9B 4U3FH 3IC7A 1AILA 2HFEC 2W0FC 1R3KC 1D5AA 2FL4A 3E2EA 1HR0O 5CBGA 1M4UA 4NKGB 3OMNB 1IBMO 3L70H 4TT3G 2X6CA 4NXMB 1ZL8A 3A2FA 1BGYH 3SPJA 3SYCA 4NVPA 4WFBV 3CCUV 4PJ0Z 1G6UA 1SQGA 4TV8B 3ML0A 3K5LA 3JAKB 1COWG 3AG7A 3U10A 1DLBA 1V9PA 1N34O 1AVMA 3M8AA 1ZLZA 4O2AB 4UCUA 4J11A 4E4EA 4UV9A 1Z5VA 2ZCEA 5H9CA 4UVAA 2V1DA 4YIPA 3CMEV 4NTYA 1XOUA 3SYOA 5L3DA 1JX9A 1L0NH 4NR1A 4LP8A 3L75H 5J2TA 3T1YB 5EK0A 2UU9B 1WPBA 1HR0B 1JJOA 5H5NA 2UXCB 2ITDC 1DF5A 3RYCB 1VIBA 5KHJA 1I0HA 2ADQB 1QU7A 3CCLV 4I9QA 3AG1C 1R6KA 3N2GB 1OHHG 2XAQA 5L3EA 2QKCA 2FB5A 4UB6Z 2ZKOA 2UXBO 1XBLA 4PHZA 3RYFA 4LF5B 5IJ0B 2L6LA 4AHCA 2P5OA 1N33O 5KLVH 2WLLA 4PV1B 5KX5B 1RP3B 5JJNB 4FZ1A 2LGWA 4H13B 3QTCA 4N21A 3EXAA 1G1XB 2F23A 3OEEG 3OUFA 2XASA 4O4HB 2OCCB 3P3NA 3ETQA 4LWSA 1BE3H 3AK2A 4BW5A 2UXCO 5LGTA 2IW5A 4GKKB 4R6ZA 5KMGB 2YDEA 2Q0OC 4HNAA 4J7KA 4PI0A 1M93A 1XHXA 4DV5B 1MNGA 1N36B 1OCZC 2DYSC 3B8NA 1YXBA 3GWKC 1OCRC 1M56B 2VRZA 1SQPH 3F7VC 5TISZ 4IHJA 1LNQA 2DMXA 3ICXA 3B09A 4B08A 2AGAA 1FFTB 3E22A 2CGNA 3CRRA 3D36C 4FLYA 2X7RB 3RVZA 3M99B 5C8YA 3BRCA 2XHBA 3CRMA 2YUAA 3CJHB 4U7OA 1GKFA 4LFAO 3K5NA 4X62O 5EYPA 4H37A 5KUKA 5B1AB 4JTAB 3W7UA 5GW7A 1ENVA 3ZRSA 4B7KA 4H0LB 4WF9V 3EVKA 3K08A 1VF5B 4EB6B 1NVPD 4MVUA 1XILA 4R8CA 2DQ3A 5J2UA 2A7WA 2UUBB 3JASB 4U3JA 1GM8A 1GO3F 2H94A 3AK1A 2RMKB 3I55V 2LO1A 2HEPA 1AJPA 4UV8A 2WLKA 4NXNB 1Y67A 2PI4A 4P30A 4JAUA 2PTMA 3K58A 2ATKC 2D3OW 2PGGA 1HNZO 1K4CC 3QF7A 3SJCC 3CXHF 4FZ0A 1PP9H 1EN4A 4CS2A 3E83A 1NU1H 1RM1B 5JH7A 4PI2A 1J95A 2ZE7A 2KG7A 1KKDA 3FB8C 5J2TB 3P3PA 4FM1A 5IJ9B 1S5LZ 4K35A 1I7FA 1YCIA 4FIPC 3AK3A 3OEHG 3EFFK 3S3WA 1GMGA 1PV0A 2QTOA 4IIJB 1VQ4V 2DW4A 3L74H 2ZINA 1VF6C 2ZXWB 1P84F 4P9OA 3RYIB 2XAFA 1YDXA 4TUYB 4JI4B 5KHKA 5KUMA 1VARA 4N23A 2WLLB 5JQGA 1WN7A 2ZXWC 2EILC 3HKEA 3SPHA 3QVNA 1WNSA 3WB1A 2GTAA 2CGOA 3CWBH 1UJWB 4LFCO 4GCZA 2HJDA 1FXHA 1N32O 1N4CA 1URFA 1SQBH 4J9YB 1DF4A 3U0ZA 1HNXO 4JYAO 3O65A 2W6JG 1Z5WA 5EBLC 1FD9A 4QJFB 5B5EZ 1WPXA 2X6AA 2ZM6B 1P7BA 1NBMG 1WB8A 3ZHVA 4UFZA 3BA9A 4NXMO 4EFBA 1QBZA 2YIAA 3R66A 1IBKB 3JALA 4XDLA 1SESA 4HZ3A 2OCCC 1IXBA 1FS0G 4CS3A 4MVSA 2P6JA 2IM9A 4DV6O 3W7SA 2A79B 2HJFC 5IYZB 4UUJC 4LF6O 5EYPB 5LYJA 1XHZA 4BR6A 1YJWV 5CBFA 3L72H 1KYOF 3VQWA 1K97A 4AQYO 1F4MA 1NS1A 1QHTA 2PYLA 4JI2B 1YTFB 4DR7B 4O2BA 3T2MA 2BCCH 3SPGA 3RW0A 4J10A 3CPWU 4YY3O 4GX0A 4NTXA 1IXMA 4KHPO 2R9RB 1Q6HA 4DR2B 3JD4A 4I7ZB 4C7UA 1LUVA 1VQLV 1K4DC 1NKDA 3CMAV 2WLMA 4MTFA 1Q6UA 1NZ6A 2EJRA 4LF8B 3JAKA 4LBEC 1QLEB 4IGGA 3FB5C 4MT8A 2ZE6A 3TGUH 4F6RA 2DWDC 2ZNJA 4WFHA 2JGDA 1R3LC 5HFLA 2EIJB 4JYBA 1Q6IA 2BSKB 3QO7A 2ZD9A 3FD9A 2QA4V 3FFQA 2XUMA 2KQXA 1RSOA 3CP1A 1SERA 3AG3C 1FXKA 1UFIA 4JYCA 2CTRA 3ZHTA 2DYRC 1N32B 1G8MA 2NNUA 1R6NA 5GTHZ 3RFRA 4IIJA 2EZOA 3ASNB 3RYFB 3RBZA 1IBKO 1K73W 4YXWG 3H1LH 3NXSA 1I5YA 3JATB 2IH1C 1JFFB 4TQFA 4J7JA 3OFNG 4PA6A 3T4ZA 1IVSA 3HKEB 2E5LB 4MVRA 3WU2Z 1V55B 1ORQC 4GZRB 3CXCU 3STLC 1P4RA 4B3MB 3BHPA 1YITV 2OYQA 4DV1B 3K3WA 1PM9A 1ZX3A 4PELA 3BPZA 3HPLC 3EHBB 1H38A 2P4VA 5BXZA 1CEZA 2XTAA 1Y76A 2QWNB 1FJGB 4J80A 3E8BA 2F43G 3JSNA 1VQMV 2AZ0A 4MTGA 4MVMA 2OWOA 4B3RB 5K1XA 1HNXB 4JYAB 2BE3A 4DV7O 1D2DA 4IYIA 4TV9B 1I08A 4FLUA 3F5WC 1XMOB 2CH7A 1QVGU 4AI8A 4L87A 3ZS8C 1FAFA 2P7TC 3CCMV 4GX1A 4CZZA 1W0JG 1PD3A 3SR2C 4WFEA 5IYZA 4X65B 2FTKA 2XAJA 2EJ7A 4UB8Z 3ZX6A 4DR4O 4FFBA 2Q67A 3ZHRA 2QM8A 1AI5A 1M57B 3CS5A 5LOVB 3JCUZ 4CC5A 4FPPA 1SS3A 4B3RO 1XQ8A 5FL7G 5EBMC 4DK0A 3M7MX 1MZFA 4LFCB 1WJZA 2P4KA 3HR0A 3Q4HA 3IFXA 4QNHB 4LFBO 3IGAC 3I56V 2B1IA 1SQVH 2QWPB 4G27B 2KSDA 1K8AW 3QO5A 5ITZA 2JJ2G 2Q7HA 5LP6B 2A0LA 5FPOA 1YSCA 3QNEA 2UUAO 2WLIB 1E1QG 1U96A 4DK1A 2NLJC 4LF7B 3A0HZ 2GUZB 4LF7O 3UO3A 4JI3B 2ZDIA 1PPJH 3ZRVA 3AG4B 4GX2A 1GN3A 1RPOA 3JD3A 4EKWA 1XNRO 2AW9A 5EZYB 3CCSV 1VQOV 2C2AA 1B6QA 1BZKA 1H2SB 3DC6A 2OIEA 2GTSA 5JCOC 4ZHQB 1VMGA 4I55A 1V54C 2DOSA 5KA6A 3OW2U 3T4DA 1V55C 2IH3C 4JGSA 4DRXB 4PA7A 3U11A 3N2KB 3G67A 3KG2A 1H2MA 1BHAA 4DUZB 3RYHA 3MD0A 4JI0O 2LQTA 1R1BA 5LGNA 1BS3A 1BT8A 3BCCH 4MSWC 3ASOB 4ABMA 3UO2A 3CC2V 1AROP 1AI7A 5LXTB 4AQYB 2CK3G 3X2QC 3B4SA 4P2ZA 3ZRXA 1VQ7V 5IYCO 4UCSA 3BVOA 4I0XB 2R9IA 3CE2A 4YY3B 1M5IA 3X2QB 1W0KG 5E79Z 1LUWA 2DYRB 4JI7B 4H44B 3STZC 3E86A 1THZA 4LCUC 3J81N 3ETGA 4FVMA 3ETEA 2N74A 3WB0A 1WB7A 3UM7A 4LR3A 2LJ2A 1AR5A 3JSLA 3ABLC 3G6BA 1NTZH 2IJIA 2ZR2A 2PF4E 1FXVA 2QEXV 2LW7A 2YEVB 3ABLB 1VQ5V 1YVWA 1WA8A 4O2BB 5CB4B 3GWOA 1VQNV 1FFXA 2VQFO 2E76B 1XL6A 5IYDO 2X0LA 3HB3B 2Q9LA 3ZN0A 1AR4A 4WFFA 5CN0A 1QVFU 3T1CA 3OUSA 1ZUQA 4DV6B 3H9VA 3D3IA 5EC2C 3MAQA 1QR8A 4LNUB 2ZNIA 2EBOA 2UUAB 1F7YA 3ASNC 3E8HA 2IU3A 4OGQB 1MSWD 5LGUA 5LP6A 4R50A 4YJ2A 5CA1B 2UXDO 1KBHA 4LF8O 4JI3O 2WLIA 2YXLA 3K5OA 4KUMA 3H1IH 1US6A 1Q5OA 3P30A 1M1KW 1HP8A 2K9PA 3CSXA 4D7TA 3JAWA 3DGEA 1NH2D 1W59A 4LF9B 1NH2B 2F1MA 4X66B 3HKBA 2ILMA 5E1AC 4JI6B 1K5SA 3VQXA 4DR7O 1DGSA 1Q43A 1K7DA 3B2EE 2YI9A 4DR4B 1NQTA 3LNMB 3CCJV 4JI7O 3SJBC 3F5TA 1BSMA 4WBNA 2LGQA 4JI0B 1F23A 3RT3C 1B04A 2M6YA 1EBOA 4DRXA 2IJKA 1KQSU 4BIUA 1JFFA 5B1NA 2XOKG 4ZI7B 4P9PA 1GM9A 2QKSA 2YS8A 4OPHA 4BAYA 2CDYA 4EEQA 2FMLA 2ZIOA 3DC5A 2BTQB 1HWYA 2GHYA 1PKXA 3JAMN 4O4LB 2HVKC 2VS0A 4DV7B 5DN6G 3OTOB 4JPRA 3CCEV 3QG5A 3B77A 1MA1A 1Y4MA 3D3QA 3UCSC 4JI5O 1AI6A 3LDCA 5BMVA 1EN5A 2M7WA 2D2CB 3VBBA 1GN6A 2P67A 3F7YC 3FAVB 3PN1A 1TGOA 4YHHO 2CH7B 3KCXA 4DW0A 1VF7A 1SRYA 2JEXA 4QGPA 5LA6A 1MZEA 2AHZA 5CA0A 4JI8O 3H1KH 5HFMA 3OM3B 1WLEA 1IZ3A 5KHGA 2Q73A 5KA5A 4KP4A 3J80N 3JD2A 2LP7A 3TJTA 4A5UB 4DV1O 3LNNA 2PYJA 2QJ1A 3S3XA 1AR1B 2Q5ZA 1K92A 3K06A 2GSMB 5KAFZ 4Q20A 1NR7A 4ASUG 4G28B 2ZM6O 3TXSA 1XUQA 1YF2A 3BAAA 5H6RA 3SPIA 4B3TO 2W6IG 4YHHB 2XAGA 4D6TH 3OMIB 4PDVA 1S5JA 3JD1A 2DQ0A 5FNVB 2HG5C 3K9AA 4IT5A 1T5EA 2QDOA 2DJVA 3T1HB 4JI2O 5FPRA 4FM2A 4YJ2B 3WG7C 1XMQO 4LF4O 2VWJA 5IE9A 2Y69C 1HNWO 2CTWA 3CD6V 2EIJC 4DR2O 3OGCC 1FJGO 3JAWB 5IJ9A 1TUEB 2EZPA 5CBHA 2R9AA 3BABA 2N05A 4X1YB 4MVZA 5IY5B 4YJ3B 2Y4TA 2RN9A 3ZCCA 4QPKA 4MS2A 3H01A 2MK3A 2VQEO 4DR5O 2YI8A 4UCTA 5B3SC 3OE7G 4DV3B 5JJEB 5IJ0A 3JD0A 3I5DA 1TAEA 4NYKA 4JI5B 4WBNB 4JI1B 5LMUB 3TXQA 4OXSA 4ZI7A 3ZMVA 3ZN1A 2YSUB 3QO8A 2BOBC 3K0GA 4DUYB 4O4JA 4O4HA 4JYYA 3LDDA 1FYJA 2DN9A 2OT5A 1N34B 4LWSB 2XNDG 5GTIZ 4O2AA 3SYPA 4DV4O 4GT1A 5BY1A 3CRQA 1QLEC 2E75B 1M9NA 4DV5O 5LP6C 2DWEC 2UUCB 1Q90D 2A9HA 4ZIBA 4HAMA 2JVDA 1NT2B 1UPGA 4XDKA 1DTOA 1K34A 2E5LO 1RPRA 2RJZA 2PZSA 2Q6AA 4QIWF 5LL6Y 2OIGA 3K9SA 2B1GA 4RWUA 4BWAA 1Q8IA 5EIBD 1KB9F 1JVMA 2AXTZ 2EULA 1S3JA 3CCQV 4MVQA 1BHBA 4LFAB 4R7CA 4I50A 2KB1A 1N33B 2ZR3A 2PUSA 2WLJA 2CTQA 3APOA 2G38A 1GH6A 4EB6A 4LC1A 3CYOA 1WA8B 4GYCB 1XI1A 1X59A 2Y48A 2ODMA 2W0XA 3OR7C 5L3CA 4FLXA 4CC6A 3JARB 4EFEA 1AJQA 2UUBO 5LBQA 1H2NA 1VQ6V 1CXZB 4NB5A 2WLHA 4JTDB 4PDLA 5KMGA 3ABKB 1J5EB 1F51A 1SF9A 3KKYA 3ZMTA 3P32A 1B3QA 1S0VA 4LF5O 1NVPB 2GDSA 4X65O 4I4TB 1HNWB 3LSQA 2AHYA 4UVBA 3SJQC 2ARHA 1TUBB 1Q81W 1PNMA 2CUGA 4DO2A 4DR1O 4FLTA 1XNQB 1JR9A 1KP2A 4GUNA 1KUQA 2ZDIC 4O4IA 2ZE8A 3VQVA 4FJCC 2WWWA 2JGDB 4TWKA 4RUFA 4QE7A 3R65A 1YIJV 1R3JC 1TVKB 4DV4B 5GONA 3A0BZ 5B3SB 1VQ8V 3HKBB 1OCCB 1RSOB 1YI2V 2QWOB 3HKDB 5JVDA 4UCVA 4J9ZB 1KKCA 4OX9B 3DSQA 3FB6C 3ZMZA 2IBZH 3L73H 3JCZA 3PJSK 1YJNV 3RYIA 4MTOA 1S5HC 2JDIG 3CHXA 2Q7GA 1GK9A 1S72V 4UCRA 1WAZA 1KC8W 2LFSA 5JQGB 2WA3A 3DTUB 4TV8A 3CB2A 4DR5B 3OT7A 1RM1C 2BTQA 2QWQB 3GVMA 5EIBC 4O4JB 4DV0B 4JI6O 2IU0A 3UT5A 2YIBD 1GN4A 1AB3A 3RVYA 1W2BU 3K04A 2QE7G 1MABG 1SA0A 2EIKB 3L71H 4B3SB 2KG7B 4DV2B 4K0KB 1XMQB 1DK1A 4MW8A 3OGIB 3UQ8A 1R73A 1YTFD 1XL4A 1M57C 2WLNA 5EBWC 1Q3EA 3RWRD 2UUCO 1AI4A 1BQ0A 1IX9A 1WP8A 2JRIA 1U97A 2K1EA 1MG1A 3K0DA 2LW1A 3OAAG 4TUYA 5LYJB 4CS4A 1BL8A 4X89A 3OTOO 3E8GA 2BOCC 1Y74B 1KMIZ 1O9HA 5LMNO 1YJ9V 1B06A 1H2KA 1SETA 2ZIMA 1QR9A 4X1IA 1S77D 2Z3YA 1KD1W 3JARA 1L1FA 2E3CA 4FK5C 3N27A 2CAZC 3K79A 1YZBA 5FNVA 4D7SA 4JI1O 2PI5A 4E2LA 2NR5A 4IYHA 2F66C 1M56C 4OPAA 3AEIA 3ZMSA 4JV5B 4X64B 5ITZB 1TUBA 5IWAB 2CE4A 4GLXA 1TA8A 1JOYA 2RDCA 1L0LH 4FLVA 3ZHUA 3CJHA 4JAAA 4K8ZA 1Z2GA 3T1YO 4DYLA 4FM0A 2UXNA 4NTWA 1V54B 4W4LA 4XBFA 2Y0PA 1VEWA 4QE9A 1FXKB 3W7XA 3VOUA 4Z1VA 1L8DA 1CPYA 1Q7YW 3G80A 4JASA 5J2UB 2AZ2A 1ROPA 2Z0AA 3CCVV 4CH6A 4MW3A 1JJ2U 3IJ4A 3C90A 3SPCA 2QGNA 4J41A 4F6EA 3FX7A 4U7NA 2YICA 5B1AC 2QR4A 3IAYA 3H1JH 1IBLO 4MTXA 3JYCA 4LF6B 4XDJA 2EX3A 4ICGA 1FKAO 2HHHB 1XNRB 3D8CA 1SZTA 2VWKA 1OCOB 5B1OA 5DM6V 1D5NA 3RGBA 2QWRB 5LXTA 1LR1A 1QNMA 2B5UA 2Y0IA 3AG4C 5JH7B 4J42A 1Y76B 1JA8A 2Q69A 2JEUA 3K59A 1JPXA 4L8JA 4DW1A 5A9GA 3VQYA 3WG7B 1EFRG 3LSUA 5IDJA 5LHHA 4PDMA 2ZE5A 2VQEB 3BY6A 4X1KA 2Q68A 1P7GA 1FPOA 2F95B 1QQCA 5LMNB 1ZTEA 3GB7C 2Y4UA 4PA3A 3B40A 4DUYO 3E89A 4RO2A 1GM7A 5B1BC 3C3TA 3C3SA 2EIKC 3JATA 2F4VB 1JMKC 4ZOLB 2YXYA 5BR8B 4RAIA 5JCOA 3W7TA 3CRCA 1Y74A 2IJJA 1CP9A 5LOVA 3ZIAG 2JJ1G 4B3MO 1PNLA 2FKXA 4GKKO 1XNQO 3TETA 1FFXB 1KP3A 3MDSA 5IWAO 3ZBHA 4CH4A 2RCVA 3DXRB 1OCCC 3Q4HB 1QCEA 2DYSB 3KZIZ 4DV3O 4X20A 2GBOA 4I4TA 4IL6Z 2Z5UA 5K1PA 5LHGA 3ABUA 4H33A 4WCEV 3ABMC 3G6EV 3CEIA 3JALB
chains in the Genus database with same CATH topology
1SS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS3 A; 
#chains in the Genus database with same CATH topology
 1IDS A;  5D5Q A;  2QTS A;  4O4I B;  4X66 O;  2R70 A;  1Y6X A;  1ZAU A;  4JV5 O;  2ETN A;  2A3Q A;  2EIM B;  1H2G A;  1VP7 A;  2GUZ A;  2WSS G;  4AIL C;  1HW7 A;  4K8X A;  5J9P C;  4PA9 A;  1IBL B;  4PA4 A;  2H8P C;  2WPD G;  5GON B;  4W4K A;  1KU9 A;  3TCU A;  4RQE A;  4KHP B;  4FFB B;  3FB7 C;  3TK1 A;  4FLW A;  1VQP V;  4K3A A;  2QM7 A;  1SKV A;  2H3O A;  3K03 A;  3HKC B;  3CC4 V;  3BEH A;  2HHH O;  3O9O A;  4I55 B;  5IT9 N;  1EN6 A;  1H2L A;  4LFB B;  3N2K A;  3G71 V;  4NXN O;  4GKJ B;  5LHI A;  2UU9 O;  1ZL8 B;  4B3T B;  1PNK A;  1SQX H;  3A8T A;  3SJA C;  1R6T A;  3K5M A;  1ZSP A;  1PL0 A;  4LH7 A;  3UKM A;  4BW9 A;  4X9Q A;  3ETD A;  3UT5 B;  4O4L A;  4UXN A;  4F6R B;  5CMU A;  1Y66 A;  1N0J A;  1XRE A;  4X64 O;  3SYA A;  3FKS G;  5F2V O;  1MMM A;  3MHH C;  1SA0 B;  3AG2 B;  4DR6 O;  3CC7 V;  3LDE A;  2MW2 B;  2BSK A;  2HVJ C;  2F93 B;  2YID A;  4JI8 B;  1WP7 A;  4ZKI A;  2Y69 B;  5KAI Z;  1SC5 B;  2E74 B;  2EIN B;  4CH5 A;  1N36 O;  2QM4 A;  1A32 A;  4HYO A;  1NTK H;  2ZQM A;  3FAV A;  4G2K A;  2P90 A;  4OX9 O;  3MHS C;  2OCH A;  1BQZ A;  5L3F A;  3SDL A;  1AP5 A;  5LA6 B;  4B7E A;  3WB2 A;  2YIB A;  3THO A;  3LSS A;  4RUE A;  1XDC A;  4ZHQ A;  1EM1 A;  1EZJ A;  2RNB A;  2JS3 A;  3KCY A;  2HLD G;  1VQK V;  1OCR B;  4X62 B;  5DEC A;  2PY5 A;  4JZG A;  1AJN A;  3BFR A;  3RYH B;  1MSD A;  2XAH A;  1SQF A;  2N04 A;  4JZ2 A;  3SYQ A;  1R3I C;  4X1I B;  3ABT A;  4YIO A;  4LH6 A;  4JTC B;  3BA8 A;  1IUR A;  3ABM B;  3ZRW A;  1FXK C;  3E35 A;  4UVC A;  3T1H O;  4Q6G A;  1I94 B;  1N0N A;  2BTO A;  3AG2 C;  4B3S O;  2QSA A;  4KFM A;  4TOI A;  4DV2 O;  4K0K O;  2LFR A;  5B1B B;  3AG1 B;  4LNU A;  4I0X A;  4IHJ B;  1SZX A;  4PD4 F;  1GRJ A;  2JS5 A;  3B8M A;  4TSF G;  1E79 G;  5AG2 A;  4TQD A;  5JWP A;  1N8R W;  4TV9 A;  3W7W A;  3E22 B;  2HP8 A;  4FMT A;  4DR1 B;  5IY5 C;  3ASO C;  2V4D A;  4DV0 O;  5L3G A;  4X8A A;  1GN2 A;  5C8Y B;  4WFA V;  3AG3 B;  1BCC H;  4F4L A;  4I9W A;  2P22 C;  2EIL B;  1S76 D;  4GKJ O;  1X4T A;  4CBC A;  4DR3 B;  2ADP A;  3ZMU A;  3A0R A;  1ZWI C;  4X88 A;  3OMA B;  3K57 A;  1XEQ A;  5DED A;  4X1Y A;  4JAV A;  1GAX A;  2B9Z A;  4YJ3 A;  2VQF B;  4LF4 B;  2DE0 X;  1EZV H;  3HKC A;  1SQQ H;  3JAS A;  4U3J B;  1E1R G;  3ZED A;  1YHQ V;  4I5S A;  1NJI W;  2XT9 A;  3J7A U;  1JQ0 A;  4JI4 O;  3FYI B;  4GX5 A;  4KXR A;  4ZBM A;  5CA3 A;  3ZHQ A;  3LUT B;  1KEC A;  1NI8 A;  5H6Q A;  2IJH A;  3SGI A;  1IBM B;  3CX5 F;  1GTO A;  3ABK C;  3APQ A;  2CTP A;  2WA4 A;  3E8F A;  1OZ0 A;  3G4S V;  2RQ6 A;  1F4N A;  5BR8 O;  5CA1 A;  2UXD B;  2HR3 A;  1OV9 A;  2UXX A;  4J7Z A;  2EIN C;  1AP6 A;  4KL1 A;  5L3B A;  3CRA A;  5LMU O;  4WFG A;  2GV9 A;  1Q82 W;  2Q8V A;  2Q0A A;  5BMV B;  3FYE B;  5C93 A;  2L35 A;  2NN4 A;  5EC1 C;  4Z2W A;  1HNZ B;  3RYC A;  1OCO C;  5H2F Z;  1I5X A;  5EZY A;  2YXH A;  4X1K B;  3N2G A;  4BIZ A;  2ITC C;  1O9G A;  2JK5 C;  1Q86 W;  5FLX N;  3NR7 A;  4CH3 A;  1OCZ B;  3RN4 A;  5IYB O;  5BZB A;  1G4Y B;  1H8H G;  1M90 W;  3OTF A;  4I50 B;  5KX5 A;  4JF3 A;  3OD4 A;  4ZOL A;  1J5E O;  1JCH A;  4UCO A;  1VF6 A;  5A2Q N;  2EIM C;  1MOF A;  1XMO O;  2HKO A;  1K3E A;  1I94 O;  4Z1M G;  2V7Q G;  1P49 A;  4DUZ O;  4RQF A;  3DXR A;  4HNA B;  3ZRW B;  2O57 A;  1NTM H;  4LF9 O;  1VQ9 V;  2OTL V;  1OJH A;  1NR1 A;  2JIZ G;  4X20 B;  4HBN A;  4MVO A;  1K5Q A;  3WFV A;  3L9D A;  4BIO A;  2Q4P A;  4FLZ A;  1QLN A;  5JJJ B;  3ZHS A;  4DR3 O;  5B66 Z;  2A06 H;  2X6B A;  5D5P A;  1BMF G;  2UXB B;  2Q7E A;  1H8E G;  3ZJZ A;  3D36 A;  2R72 A;  2P06 A;  1YEW A;  1K9M W;  1RFY A;  5CA0 B;  2FYU H;  2WAM A;  1HDJ A;  5KHI A;  3IC9 A;  2KKW A;  5KHH A;  1TVK A;  2F4V O;  1PL4 A;  3OR6 C;  2OTJ V;  2YEV A;  3CCR V;  1K33 A;  2JGU A;  4FFK A;  4PDR A;  4DXW A;  2QKA A;  4DR6 B;  5CB4 A;  2YC0 A;  3H1H H;  3HKD A;  4QPJ A;  5JVD B;  2ZT9 B;  4U3F H;  3IC7 A;  1AIL A;  2HFE C;  2W0F C;  1R3K C;  1D5A A;  2FL4 A;  3E2E A;  1HR0 O;  5CBG A;  1M4U A;  4NKG B;  3OMN B;  1IBM O;  3L70 H;  4TT3 G;  2X6C A;  4NXM B;  1ZL8 A;  3A2F A;  1BGY H;  3SPJ A;  3SYC A;  4NVP A;  4WFB V;  3CCU V;  4PJ0 Z;  1G6U A;  1SQG A;  4TV8 B;  3ML0 A;  3K5L A;  3JAK B;  1COW G;  3AG7 A;  3U10 A;  1DLB A;  1V9P A;  1N34 O;  1AVM A;  3M8A A;  1ZLZ A;  4O2A B;  4UCU A;  4J11 A;  4E4E A;  4UV9 A;  1Z5V A;  2ZCE A;  5H9C A;  4UVA A;  2V1D A;  4YIP A;  3CME V;  4NTY A;  1XOU A;  3SYO A;  5L3D A;  1JX9 A;  1L0N H;  4NR1 A;  4LP8 A;  3L75 H;  5J2T A;  3T1Y B;  5EK0 A;  2UU9 B;  1WPB A;  1HR0 B;  1JJO A;  5H5N A;  2UXC B;  2ITD C;  1DF5 A;  3RYC B;  1VIB A;  5KHJ A;  1I0H A;  2ADQ B;  1QU7 A;  3CCL V;  4I9Q A;  3AG1 C;  1R6K A;  3N2G B;  1OHH G;  2XAQ A;  5L3E A;  2QKC A;  2FB5 A;  4UB6 Z;  2ZKO A;  2UXB O;  1XBL A;  4PHZ A;  3RYF A;  4LF5 B;  5IJ0 B;  2L6L A;  4AHC A;  2P5O A;  1N33 O;  5KLV H;  2WLL A;  4PV1 B;  5KX5 B;  1RP3 B;  5JJN B;  4FZ1 A;  2LGW A;  4H13 B;  3QTC A;  4N21 A;  3EXA A;  1G1X B;  2F23 A;  3OEE G;  3OUF A;  2XAS A;  4O4H B;  2OCC B;  3P3N A;  3ETQ A;  4LWS A;  1BE3 H;  3AK2 A;  4BW5 A;  2UXC O;  5LGT A;  2IW5 A;  4GKK B;  4R6Z A;  5KMG B;  2YDE A;  2Q0O C;  4HNA A;  4J7K A;  4PI0 A;  1M93 A;  1XHX A;  4DV5 B;  1MNG A;  1N36 B;  1OCZ C;  2DYS C;  3B8N A;  1YXB A;  3GWK C;  1OCR C;  1M56 B;  2VRZ A;  1SQP H;  3F7V C;  5TIS Z;  4IHJ A;  1LNQ A;  2DMX A;  3ICX A;  3B09 A;  4B08 A;  2AGA A;  1FFT B;  3E22 A;  2CGN A;  3CRR A;  3D36 C;  4FLY A;  2X7R B;  3RVZ A;  3M99 B;  5C8Y A;  3BRC A;  2XHB A;  3CRM A;  2YUA A;  3CJH B;  4U7O A;  1GKF A;  4LFA O;  3K5N A;  4X62 O;  5EYP A;  4H37 A;  5KUK A;  5B1A B;  4JTA B;  3W7U A;  5GW7 A;  1ENV A;  3ZRS A;  4B7K A;  4H0L B;  4WF9 V;  3EVK A;  3K08 A;  1VF5 B;  4EB6 B;  1NVP D;  4MVU A;  1XIL A;  4R8C A;  2DQ3 A;  5J2U A;  2A7W A;  2UUB B;  3JAS B;  4U3J A;  1GM8 A;  1GO3 F;  2H94 A;  3AK1 A;  2RMK B;  3I55 V;  2LO1 A;  2HEP A;  1AJP A;  4UV8 A;  2WLK A;  4NXN B;  1Y67 A;  2PI4 A;  4P30 A;  4JAU A;  2PTM A;  3K58 A;  2ATK C;  2D3O W;  2PGG A;  1HNZ O;  1K4C C;  3QF7 A;  3SJC C;  3CXH F;  4FZ0 A;  1PP9 H;  1EN4 A;  4CS2 A;  3E83 A;  1NU1 H;  1RM1 B;  5JH7 A;  4PI2 A;  1J95 A;  2ZE7 A;  2KG7 A;  1KKD A;  3FB8 C;  5J2T B;  3P3P A;  4FM1 A;  5IJ9 B;  1S5L Z;  4K35 A;  1I7F A;  1YCI A;  4FIP C;  3AK3 A;  3OEH G;  3EFF K;  3S3W A;  1GMG A;  1PV0 A;  2QTO A;  4IIJ B;  1VQ4 V;  2DW4 A;  3L74 H;  2ZIN A;  1VF6 C;  2ZXW B;  1P84 F;  4P9O A;  3RYI B;  2XAF A;  1YDX A;  4TUY B;  4JI4 B;  5KHK A;  5KUM A;  1VAR A;  4N23 A;  2WLL B;  5JQG A;  1WN7 A;  2ZXW C;  2EIL C;  3HKE A;  3SPH A;  3QVN A;  1WNS A;  3WB1 A;  2GTA A;  2CGO A;  3CWB H;  1UJW B;  4LFC O;  4GCZ A;  2HJD A;  1FXH A;  1N32 O;  1N4C A;  1URF A;  1SQB H;  4J9Y B;  1DF4 A;  3U0Z A;  1HNX O;  4JYA O;  3O65 A;  2W6J G;  1Z5W A;  5EBL C;  1FD9 A;  4QJF B;  5B5E Z;  1WPX A;  2X6A A;  2ZM6 B;  1P7B A;  1NBM G;  1WB8 A;  3ZHV A;  4UFZ A;  3BA9 A;  4NXM O;  4EFB A;  1QBZ A;  2YIA A;  3R66 A;  1IBK B;  3JAL A;  4XDL A;  1SES A;  4HZ3 A;  2OCC C;  1IXB A;  1FS0 G;  4CS3 A;  4MVS A;  2P6J A;  2IM9 A;  4DV6 O;  3W7S A;  2A79 B;  2HJF C;  5IYZ B;  4UUJ C;  4LF6 O;  5EYP B;  5LYJ A;  1XHZ A;  4BR6 A;  1YJW V;  5CBF A;  3L72 H;  1KYO F;  3VQW A;  1K97 A;  4AQY O;  1F4M A;  1NS1 A;  1QHT A;  2PYL A;  4JI2 B;  1YTF B;  4DR7 B;  4O2B A;  3T2M A;  2BCC H;  3SPG A;  3RW0 A;  4J10 A;  3CPW U;  4YY3 O;  4GX0 A;  4NTX A;  1IXM A;  4KHP O;  2R9R B;  1Q6H A;  4DR2 B;  3JD4 A;  4I7Z B;  4C7U A;  1LUV A;  1VQL V;  1K4D C;  1NKD A;  3CMA V;  2WLM A;  4MTF A;  1Q6U A;  1NZ6 A;  2EJR A;  4LF8 B;  3JAK A;  4LBE C;  1QLE B;  4IGG A;  3FB5 C;  4MT8 A;  2ZE6 A;  3TGU H;  4F6R A;  2DWD C;  2ZNJ A;  4WFH A;  2JGD A;  1R3L C;  5HFL A;  2EIJ B;  4JYB A;  1Q6I A;  2BSK B;  3QO7 A;  2ZD9 A;  3FD9 A;  2QA4 V;  3FFQ A;  2XUM A;  2KQX A;  1RSO A;  3CP1 A;  1SER A;  3AG3 C;  1FXK A;  1UFI A;  4JYC A;  2CTR A;  3ZHT A;  2DYR C;  1N32 B;  1G8M A;  2NNU A;  1R6N A;  5GTH Z;  3RFR A;  4IIJ A;  2EZO A;  3ASN B;  3RYF B;  3RBZ A;  1IBK O;  1K73 W;  4YXW G;  3H1L H;  3NXS A;  1I5Y A;  3JAT B;  2IH1 C;  1JFF B;  4TQF A;  4J7J A;  3OFN G;  4PA6 A;  3T4Z A;  1IVS A;  3HKE B;  2E5L B;  4MVR A;  3WU2 Z;  1V55 B;  1ORQ C;  4GZR B;  3CXC U;  3STL C;  1P4R A;  4B3M B;  3BHP A;  1YIT V;  2OYQ A;  4DV1 B;  3K3W A;  1PM9 A;  1ZX3 A;  4PEL A;  3BPZ A;  3HPL C;  3EHB B;  1H38 A;  2P4V A;  5BXZ A;  1CEZ A;  2XTA A;  1Y76 A;  2QWN B;  1FJG B;  4J80 A;  3E8B A;  2F43 G;  3JSN A;  1VQM V;  2AZ0 A;  4MTG A;  4MVM A;  2OWO A;  4B3R B;  5K1X A;  1HNX B;  4JYA B;  2BE3 A;  4DV7 O;  1D2D A;  4IYI A;  4TV9 B;  1I08 A;  4FLU A;  3F5W C;  1XMO B;  2CH7 A;  1QVG U;  4AI8 A;  4L87 A;  3ZS8 C;  1FAF A;  2P7T C;  3CCM V;  4GX1 A;  4CZZ A;  1W0J G;  1PD3 A;  3SR2 C;  4WFE A;  5IYZ A;  4X65 B;  2FTK A;  2XAJ A;  2EJ7 A;  4UB8 Z;  3ZX6 A;  4DR4 O;  4FFB A;  2Q67 A;  3ZHR A;  2QM8 A;  1AI5 A;  1M57 B;  3CS5 A;  5LOV B;  3JCU Z;  4CC5 A;  4FPP A;  1SS3 A;  4B3R O;  1XQ8 A;  5FL7 G;  5EBM C;  4DK0 A;  3M7M X;  1MZF A;  4LFC B;  1WJZ A;  2P4K A;  3HR0 A;  3Q4H A;  3IFX A;  4QNH B;  4LFB O;  3IGA C;  3I56 V;  2B1I A;  1SQV H;  2QWP B;  4G27 B;  2KSD A;  1K8A W;  3QO5 A;  5ITZ A;  2JJ2 G;  2Q7H A;  5LP6 B;  2A0L A;  5FPO A;  1YSC A;  3QNE A;  2UUA O;  2WLI B;  1E1Q G;  1U96 A;  4DK1 A;  2NLJ C;  4LF7 B;  3A0H Z;  2GUZ B;  4LF7 O;  3UO3 A;  4JI3 B;  2ZDI A;  1PPJ H;  3ZRV A;  3AG4 B;  4GX2 A;  1GN3 A;  1RPO A;  3JD3 A;  4EKW A;  1XNR O;  2AW9 A;  5EZY B;  3CCS V;  1VQO V;  2C2A A;  1B6Q A;  1BZK A;  1H2S B;  3DC6 A;  2OIE A;  2GTS A;  5JCO C;  4ZHQ B;  1VMG A;  4I55 A;  1V54 C;  2DOS A;  5KA6 A;  3OW2 U;  3T4D A;  1V55 C;  2IH3 C;  4JGS A;  4DRX B;  4PA7 A;  3U11 A;  3N2K B;  3G67 A;  3KG2 A;  1H2M A;  1BHA A;  4DUZ B;  3RYH A;  3MD0 A;  4JI0 O;  2LQT A;  1R1B A;  5LGN A;  1BS3 A;  1BT8 A;  3BCC H;  4MSW C;  3ASO B;  4ABM A;  3UO2 A;  3CC2 V;  1ARO P;  1AI7 A;  5LXT B;  4AQY B;  2CK3 G;  3X2Q C;  3B4S A;  4P2Z A;  3ZRX A;  1VQ7 V;  5IYC O;  4UCS A;  3BVO A;  4I0X B;  2R9I A;  3CE2 A;  4YY3 B;  1M5I A;  3X2Q B;  1W0K G;  5E79 Z;  1LUW A;  2DYR B;  4JI7 B;  4H44 B;  3STZ C;  3E86 A;  1THZ A;  4LCU C;  3J81 N;  3ETG A;  4FVM A;  3ETE A;  2N74 A;  3WB0 A;  1WB7 A;  3UM7 A;  4LR3 A;  2LJ2 A;  1AR5 A;  3JSL A;  3ABL C;  3G6B A;  1NTZ H;  2IJI A;  2ZR2 A;  2PF4 E;  1FXV A;  2QEX V;  2LW7 A;  2YEV B;  3ABL B;  1VQ5 V;  1YVW A;  1WA8 A;  4O2B B;  5CB4 B;  3GWO A;  1VQN V;  1FFX A;  2VQF O;  2E76 B;  1XL6 A;  5IYD O;  2X0L A;  3HB3 B;  2Q9L A;  3ZN0 A;  1AR4 A;  4WFF A;  5CN0 A;  1QVF U;  3T1C A;  3OUS A;  1ZUQ A;  4DV6 B;  3H9V A;  3D3I A;  5EC2 C;  3MAQ A;  1QR8 A;  4LNU B;  2ZNI A;  2EBO A;  2UUA B;  1F7Y A;  3ASN C;  3E8H A;  2IU3 A;  4OGQ B;  1MSW D;  5LGU A;  5LP6 A;  4R50 A;  4YJ2 A;  5CA1 B;  2UXD O;  1KBH A;  4LF8 O;  4JI3 O;  2WLI A;  2YXL A;  3K5O A;  4KUM A;  3H1I H;  1US6 A;  1Q5O A;  3P30 A;  1M1K W;  1HP8 A;  2K9P A;  3CSX A;  4D7T A;  3JAW A;  3DGE A;  1NH2 D;  1W59 A;  4LF9 B;  1NH2 B;  2F1M A;  4X66 B;  3HKB A;  2ILM A;  5E1A C;  4JI6 B;  1K5S A;  3VQX A;  4DR7 O;  1DGS A;  1Q43 A;  1K7D A;  3B2E E;  2YI9 A;  4DR4 B;  1NQT A;  3LNM B;  3CCJ V;  4JI7 O;  3SJB C;  3F5T A;  1BSM A;  4WBN A;  2LGQ A;  4JI0 B;  1F23 A;  3RT3 C;  1B04 A;  2M6Y A;  1EBO A;  4DRX A;  2IJK A;  1KQS U;  4BIU A;  1JFF A;  5B1N A;  2XOK G;  4ZI7 B;  4P9P A;  1GM9 A;  2QKS A;  2YS8 A;  4OPH A;  4BAY A;  2CDY A;  4EEQ A;  2FML A;  2ZIO A;  3DC5 A;  2BTQ B;  1HWY A;  2GHY A;  1PKX A;  3JAM N;  4O4L B;  2HVK C;  2VS0 A;  4DV7 B;  5DN6 G;  3OTO B;  4JPR A;  3CCE V;  3QG5 A;  3B77 A;  1MA1 A;  1Y4M A;  3D3Q A;  3UCS C;  4JI5 O;  1AI6 A;  3LDC A;  5BMV A;  1EN5 A;  2M7W A;  2D2C B;  3VBB A;  1GN6 A;  2P67 A;  3F7Y C;  3FAV B;  3PN1 A;  1TGO A;  4YHH O;  2CH7 B;  3KCX A;  4DW0 A;  1VF7 A;  1SRY A;  2JEX A;  4QGP A;  5LA6 A;  1MZE A;  2AHZ A;  5CA0 A;  4JI8 O;  3H1K H;  5HFM A;  3OM3 B;  1WLE A;  1IZ3 A;  5KHG A;  2Q73 A;  5KA5 A;  4KP4 A;  3J80 N;  3JD2 A;  2LP7 A;  3TJT A;  4A5U B;  4DV1 O;  3LNN A;  2PYJ A;  2QJ1 A;  3S3X A;  1AR1 B;  2Q5Z A;  1K92 A;  3K06 A;  2GSM B;  5KAF Z;  4Q20 A;  1NR7 A;  4ASU G;  4G28 B;  2ZM6 O;  3TXS A;  1XUQ A;  1YF2 A;  3BAA A;  5H6R A;  3SPI A;  4B3T O;  2W6I G;  4YHH B;  2XAG A;  4D6T H;  3OMI B;  4PDV A;  1S5J A;  3JD1 A;  2DQ0 A;  5FNV B;  2HG5 C;  3K9A A;  4IT5 A;  1T5E A;  2QDO A;  2DJV A;  3T1H B;  4JI2 O;  5FPR A;  4FM2 A;  4YJ2 B;  3WG7 C;  1XMQ O;  4LF4 O;  2VWJ A;  5IE9 A;  2Y69 C;  1HNW O;  2CTW A;  3CD6 V;  2EIJ C;  4DR2 O;  3OGC C;  1FJG O;  3JAW B;  5IJ9 A;  1TUE B;  2EZP A;  5CBH A;  2R9A A;  3BAB A;  2N05 A;  4X1Y B;  4MVZ A;  5IY5 B;  4YJ3 B;  2Y4T A;  2RN9 A;  3ZCC A;  4QPK A;  4MS2 A;  3H01 A;  2MK3 A;  2VQE O;  4DR5 O;  2YI8 A;  4UCT A;  5B3S C;  3OE7 G;  4DV3 B;  5JJE B;  5IJ0 A;  3JD0 A;  3I5D A;  1TAE A;  4NYK A;  4JI5 B;  4WBN B;  4JI1 B;  5LMU B;  3TXQ A;  4OXS A;  4ZI7 A;  3ZMV A;  3ZN1 A;  2YSU B;  3QO8 A;  2BOB C;  3K0G A;  4DUY B;  4O4J A;  4O4H A;  4JYY A;  3LDD A;  1FYJ A;  2DN9 A;  2OT5 A;  1N34 B;  4LWS B;  2XND G;  5GTI Z;  4O2A A;  3SYP A;  4DV4 O;  4GT1 A;  5BY1 A;  3CRQ A;  1QLE C;  2E75 B;  1M9N A;  4DV5 O;  5LP6 C;  2DWE C;  2UUC B;  1Q90 D;  2A9H A;  4ZIB A;  4HAM A;  2JVD A;  1NT2 B;  1UPG A;  4XDK A;  1DTO A;  1K34 A;  2E5L O;  1RPR A;  2RJZ A;  2PZS A;  2Q6A A;  4QIW F;  5LL6 Y;  2OIG A;  3K9S A;  2B1G A;  4RWU A;  4BWA A;  1Q8I A;  5EIB D;  1KB9 F;  1JVM A;  2AXT Z;  2EUL A;  1S3J A;  3CCQ V;  4MVQ A;  1BHB A;  4LFA B;  4R7C A;  4I50 A;  2KB1 A;  1N33 B;  2ZR3 A;  2PUS A;  2WLJ A;  2CTQ A;  3APO A;  2G38 A;  1GH6 A;  4EB6 A;  4LC1 A;  3CYO A;  1WA8 B;  4GYC B;  1XI1 A;  1X59 A;  2Y48 A;  2ODM A;  2W0X A;  3OR7 C;  5L3C A;  4FLX A;  4CC6 A;  3JAR B;  4EFE A;  1AJQ A;  2UUB O;  5LBQ A;  1H2N A;  1VQ6 V;  1CXZ B;  4NB5 A;  2WLH A;  4JTD B;  4PDL A;  5KMG A;  3ABK B;  1J5E B;  1F51 A;  1SF9 A;  3KKY A;  3ZMT A;  3P32 A;  1B3Q A;  1S0V A;  4LF5 O;  1NVP B;  2GDS A;  4X65 O;  4I4T B;  1HNW B;  3LSQ A;  2AHY A;  4UVB A;  3SJQ C;  2ARH A;  1TUB B;  1Q81 W;  1PNM A;  2CUG A;  4DO2 A;  4DR1 O;  4FLT A;  1XNQ B;  1JR9 A;  1KP2 A;  4GUN A;  1KUQ A;  2ZDI C;  4O4I A;  2ZE8 A;  3VQV A;  4FJC C;  2WWW A;  2JGD B;  4TWK A;  4RUF A;  4QE7 A;  3R65 A;  1YIJ V;  1R3J C;  1TVK B;  4DV4 B;  5GON A;  3A0B Z;  5B3S B;  1VQ8 V;  3HKB B;  1OCC B;  1RSO B;  1YI2 V;  2QWO B;  3HKD B;  5JVD A;  4UCV A;  4J9Z B;  1KKC A;  4OX9 B;  3DSQ A;  3FB6 C;  3ZMZ A;  2IBZ H;  3L73 H;  3JCZ A;  3PJS K;  1YJN V;  3RYI A;  4MTO A;  1S5H C;  2JDI G;  3CHX A;  2Q7G A;  1GK9 A;  1S72 V;  4UCR A;  1WAZ A;  1KC8 W;  2LFS A;  5JQG B;  2WA3 A;  3DTU B;  4TV8 A;  3CB2 A;  4DR5 B;  3OT7 A;  1RM1 C;  2BTQ A;  2QWQ B;  3GVM A;  5EIB C;  4O4J B;  4DV0 B;  4JI6 O;  2IU0 A;  3UT5 A;  2YIB D;  1GN4 A;  1AB3 A;  3RVY A;  1W2B U;  3K04 A;  2QE7 G;  1MAB G;  1SA0 A;  2EIK B;  3L71 H;  4B3S B;  2KG7 B;  4DV2 B;  4K0K B;  1XMQ B;  1DK1 A;  4MW8 A;  3OGI B;  3UQ8 A;  1R73 A;  1YTF D;  1XL4 A;  1M57 C;  2WLN A;  5EBW C;  1Q3E A;  3RWR D;  2UUC O;  1AI4 A;  1BQ0 A;  1IX9 A;  1WP8 A;  2JRI A;  1U97 A;  2K1E A;  1MG1 A;  3K0D A;  2LW1 A;  3OAA G;  4TUY A;  5LYJ B;  4CS4 A;  1BL8 A;  4X89 A;  3OTO O;  3E8G A;  2BOC C;  1Y74 B;  1KMI Z;  1O9H A;  5LMN O;  1YJ9 V;  1B06 A;  1H2K A;  1SET A;  2ZIM A;  1QR9 A;  4X1I A;  1S77 D;  2Z3Y A;  1KD1 W;  3JAR A;  1L1F A;  2E3C A;  4FK5 C;  3N27 A;  2CAZ C;  3K79 A;  1YZB A;  5FNV A;  4D7S A;  4JI1 O;  2PI5 A;  4E2L A;  2NR5 A;  4IYH A;  2F66 C;  1M56 C;  4OPA A;  3AEI A;  3ZMS A;  4JV5 B;  4X64 B;  5ITZ B;  1TUB A;  5IWA B;  2CE4 A;  4GLX A;  1TA8 A;  1JOY A;  2RDC A;  1L0L H;  4FLV A;  3ZHU A;  3CJH A;  4JAA A;  4K8Z A;  1Z2G A;  3T1Y O;  4DYL A;  4FM0 A;  2UXN A;  4NTW A;  1V54 B;  4W4L A;  4XBF A;  2Y0P A;  1VEW A;  4QE9 A;  1FXK B;  3W7X A;  3VOU A;  4Z1V A;  1L8D A;  1CPY A;  1Q7Y W;  3G80 A;  4JAS A;  5J2U B;  2AZ2 A;  1ROP A;  2Z0A A;  3CCV V;  4CH6 A;  4MW3 A;  1JJ2 U;  3IJ4 A;  3C90 A;  3SPC A;  2QGN A;  4J41 A;  4F6E A;  3FX7 A;  4U7N A;  2YIC A;  5B1A C;  2QR4 A;  3IAY A;  3H1J H;  1IBL O;  4MTX A;  3JYC A;  4LF6 B;  4XDJ A;  2EX3 A;  4ICG A;  1FKA O;  2HHH B;  1XNR B;  3D8C A;  1SZT A;  2VWK A;  1OCO B;  5B1O A;  5DM6 V;  1D5N A;  3RGB A;  2QWR B;  5LXT A;  1LR1 A;  1QNM A;  2B5U A;  2Y0I A;  3AG4 C;  5JH7 B;  4J42 A;  1Y76 B;  1JA8 A;  2Q69 A;  2JEU A;  3K59 A;  1JPX A;  4L8J A;  4DW1 A;  5A9G A;  3VQY A;  3WG7 B;  1EFR G;  3LSU A;  5IDJ A;  5LHH A;  4PDM A;  2ZE5 A;  2VQE B;  3BY6 A;  4X1K A;  2Q68 A;  1P7G A;  1FPO A;  2F95 B;  1QQC A;  5LMN B;  1ZTE A;  3GB7 C;  2Y4U A;  4PA3 A;  3B40 A;  4DUY O;  3E89 A;  4RO2 A;  1GM7 A;  5B1B C;  3C3T A;  3C3S A;  2EIK C;  3JAT A;  2F4V B;  1JMK C;  4ZOL B;  2YXY A;  5BR8 B;  4RAI A;  5JCO A;  3W7T A;  3CRC A;  1Y74 A;  2IJJ A;  1CP9 A;  5LOV A;  3ZIA G;  2JJ1 G;  4B3M O;  1PNL A;  2FKX A;  4GKK O;  1XNQ O;  3TET A;  1FFX B;  1KP3 A;  3MDS A;  5IWA O;  3ZBH A;  4CH4 A;  2RCV A;  3DXR B;  1OCC C;  3Q4H B;  1QCE A;  2DYS B;  3KZI Z;  4DV3 O;  4X20 A;  2GBO A;  4I4T A;  4IL6 Z;  2Z5U A;  5K1P A;  5LHG A;  3ABU A;  4H33 A;  4WCE V;  3ABM C;  3G6E V;  3CEI A;  3JAL B; 
#chains in the Genus database with same CATH homology
 1SS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...