2QDOA

Nbla protein from t. vulcanus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
VDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords NblA protein
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Thermosynechococcus vulcanus
total genus 20
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2qdoA00
2QDOA 3CS5A 2Q8VA 1OJHA
chains in the Genus database with same CATH superfamily
4JGSA 2JS5A 4DV7B 4LF5O 4F4LA 3ASNB 2KSDA 1GO3F 3AK3A 2JIZG 4CS2A 4IHJA 1Q7YW 1FFXA 1AR1B 2W0FC 2C2AA 4BIUA 1I5YA 1JA8A 1AVMA 2F66C 2YEVA 1QVGU 3OFNG 2ZE7A 4DV3B 2BOBC 4MVRA 3FKSG 4RUFA 3SJCC 2FKXA 4AI8A 1D5AA 4ZOLB 1PM9A 3A0RA 1OHHG 4DW1A 1HDJA 2ZQMA 5LMUB 2QWQB 2ZD9A 2B1IA 2JGDA 1BQZA 1FD9A 2WA3A 3E8HA 4IIJB 2WSSG 3H1HH 2A06H 3JATB 3Q4HA 4WFBV 5IT9N 4Z2WA 2Q67A 3T1HB 1RSOA 2ZM6O 4XDLA 3CHXA 1SQPH 3LSUA 1AI6A 3B8NA 4J80A 3JAKA 4R6ZA 3JASB 1FKAO 1AILA 3A0HZ 4JI2O 1WPBA 2ZKOA 4B3SB 4B08A 1JQ0A 2XAJA 5KMGB 4X62O 1T5EA 5GONA 2IU3A 3WG7C 1PL0A 3ZIAG 1SKVA 3CX5F 2ZE6A 1S3JA 1WJZA 3JYCA 1OCCC 2F93B 4MTFA 1G4YB 1FJGB 1BT8A 2KG7B 4LF7B 3CCQV 1HR0B 3KKYA 2ZR3A 2F1MA 2P4VA 4JI7B 2JJ2G 1XMQB 1YTFB 2PI5A 2XASA 3JALA 2PYLA 4NB5A 5IE9A 1VQKV 3DTUB 4PA6A 3GVMA 5E1AC 5GW7A 4BW9A 5L3EA 5LMNO 1VQ7V 4DV5O 1H2SB 1XEQA 5JVDA 1RM1C 3ZRVA 2Q0OC 5CB4B 3CSXA 1IVSA 4Z1MG 4UV9A 3AG2B 3F7VC 1XNRB 3EVKA 3OW2U 3HB3B 5B5EZ 1XOUA 2H3OA 3OMAB 3IJ4A 3JD1A 1S72V 3U11A 4KFMA 2YC0A 3HPLC 5CA0B 3RYFB 2P67A 2HJFC 3H01A 3FD9A 1ZLZA 4NXNO 4NXMB 1ZUQA 4DR2B 2BE3A 2P5OA 2AHYA 1TUEB 4K35A 5IJ0A 4JV5B 1Q8IA 2XOKG 3ABKB 2QM4A 3ZMSA 4X9QA 4DV2B 2DWEC 5LHIA 4UUJC 2F23A 1N32B 3T4ZA 4H33A 1HP8A 4UCOA 3SPIA 1X59A 2LGQA 3E22B 3ETEA 1XMOO 2LGWA 4B3RO 2HP8A 4JYBA 1NS1A 4P2ZA 1HNXO 4B3SO 4FVMA 3OM3B 4PV1B 5EC2C 3SJAC 1F4MA 4H44B 3IGAC 3D36A 4JAUA 2A79B 4TUYB 3JD3A 2EILC 4UCVA 2JDIG 1Y76A 5D5PA 4DV6B 3VQYA 4G27B 1NH2D 2RMKB 2CTWA 1M90W 1K3EA 5ITZA 4JASA 4ASUG 3JARA 1VQ9V 2YSUB 1HR0O 4K3AA 2A9HA 5JCOC 3UM7A 1BMFG 1N34B 1XMQO 2UUAB 4LF6B 5B66Z 1N0JA 4NR1A 3RYHB 3VQXA 2DWDC 1AR5A 3P30A 3K3WA 2EZOA 5LYJA 3KZIZ 1DTOA 4KP4A 3SR2C 5H6RA 4Z1VA 1Y74A 2EIJC 5EC1C 3RYIB 1K5QA 1H2LA 3VQWA 3ZRWB 3LNMB 2P4KA 2UXCB 1HW7A 2F4VB 1FFTB 1E1QG 4OX9B 3APOA 1OCZB 2KKWA 3AK2A 4MTOA 1SQQH 1UFIA 1HNWO 2HLDG 1Q5OA 5B1AC 3RGBA 4DR6O 4HNAB 3VQVA 1J95A 5JQGA 2LQTA 3RVYA 4PELA 4X66B 5EZYB 1R73A 4WF9V 4IHJB 4Q6GA 1FFXB 2IJIA 3KG2A 2YEVB 4FLWA 4K0KO 5LGNA 4NXMO 4DR2O 2LFRA 2XAFA 2DYRC 3CC2V 1H38A 2YI9A 1R1BA 4J41A 3L75H 4RQFA 1Z2GA 3FYIB 3K9AA 4JV5O 1GN3A 1VF7A 2W6JG 2BTQA 1VQ6V 2ZT9B 1V55B 1R6KA 4QJFB 3CRQA 5CBFA 2ZNIA 4LF8O 2X6CA 1Y67A 2V4DA 2JGDB 4X89A 3L70H 3J7AU 2CAZC 2DW4A 4PA4A 2DN9A 2PY5A 4PJ0Z 2LP7A 1NU1H 2CGNA 3AEIA 3Q4HB 2OIGA 1PD3A 2ODMA 1S5LZ 3WB2A 1SESA 4XDJA 1H2KA 3JAKB 2E74B 2H8PC 3C3SA 2MK3A 5L3BA 3OEHG 2DYSB 3C90A 1KU9A 3L9DA 3JASA 4RWUA 1YZBA 5GONB 1GN6A 1QLNA 4DV6O 5IDJA 1JFFB 4JTAB 1NTZH 3BAAA 5A9GA 2OCCB 4NKGB 5KHHA 2K1EA 4X65O 3A8TA 2QTSA 2IM9A 4PA7A 2LO1A 2HEPA 2QGNA 4CH4A 2UUAO 4FLUA 4LF6O 1ZL8A 2ADPA 4UCSA 3ZMZA 1ORQC 2Q7EA 3ETDA 4U7OA 4H0LB 1KB9F 3H9VA 1N36B 3RN4A 1Q43A 2X6BA 3CC4V 2FMLA 3JALB 1XL4A 5BZBA 3K5OA 5IYBO 3LSSA 1P49A 2Q5ZA 4QE9A 3W7WA 4W4KA 2FTKA 3CJHA 1AJPA 2Q4PA 5JVDB 4GCZA 4FM0A 3J81N 3DSQA 4FJCC 3HKBB 1KP3A 3ABLB 3APQA 1W59A 2N04A 3FFQA 1YITV 4LP8A 2YDEA 3RWRD 1BSMA 4FLTA 4UV8A 1KBHA 1AI7A 4TOIA 4LH6A 3CWBH 1YF2A 4MW8A 1PPJH 2CTRA 2ADQB 3SDLA 2UXDO 4UCUA 5B1BB 4JZ2A 4B3MO 2IH1C 3K5MA 1YJ9V 2E3CA 1JJOA 3FAVA 3TJTA 4C7UA 5IJ0B 5H9CA 1E79G 1WN7A 1BCCH 3MHHC 2F95B 2QSAA 1RPOA 3BHPA 1YVWA 5KHGA 1B6QA 1IBKB 2IBZH 5CBHA 3X2QC 5B3SB 2GTAA 4OGQB 1Z5WA 4GKJB 3ZN1A 2IJJA 2YIBA 3DC6A 5F2VO 1NVPD 4F6RA 1H8EG 1P84F 1Z5VA 2N74A 1BS3A 4LBEC 3CCRV 1M9NA 5DECA 2P22C 3CP1A 1OCZC 1W0JG 3K03A 4HZ3A 2CUGA 4O2BA 2P06A 2ZM6B 4FLYA 2RDCA 1SERA 1OCRB 3ZMTA 5FNVA 4JI2B 1L1FA 2EIMC 4KL1A 1P4RA 1Y76B 4DK0A 5H2FZ 4X62B 4JI1O 2EJRA 2RN9A 1M1KW 2BCCH 4DV0O 1DF4A 5ITZB 4J42A 4ZI7A 4P9PA 1M56C 1YDXA 4YXWG 4B7EA 2EBOA 5LXTA 3CMAV 4I9QA 4GUNA 3HKDB 2Q69A 1N36O 1JX9A 3CCUV 1KKDA 2AHZA 1AROP 4B7KA 4NTXA 5KUMA 4QNHB 5LYJB 4PDRA 1XUQA 2XNDG 3SJQC 1XHXA 1Y74B 1WP8A 4FFBB 5H6QA 4UVCA 2DMXA 4KXRA 4DK1A 3RYIA 2WLJA 4ZBMA 4N23A 3JD4A 2A0LA 4YIPA 5AG2A 3WFVA 4RO2A 1YIJV 1VARA 4TQDA 1I0HA 3IFXA 4UB6Z 4L87A 3CCMV 4GX1A 5LMNB 1VMGA 1Y4MA 4YJ3A 4DV5B 5EBLC 5JQGB 4J10A 1F23A 2QKCA 4G28B 4O4LA 2JJ1G 4F6EA 4HNAA 1M57C 2ARHA 3OUFA 1FXKC 2DYSC 4GZRB 5EZYA 4WFAV 3SYOA 4J7ZA 4MS2A 3E83A 4N21A 3F5TA 1YXBA 2ZXWC 4LFAB 1F4NA 2R9IA 4O2AA 2FL4A 2YI8A 3P32A 3FYEB 5CN0A 2BTQB 4NXNB 1IBKO 2QTOA 1S5JA 1X4TA 1XHZA 2EINC 4UVBA 1IDSA 1NR1A 4RQEA 3L71H 2R70A 4GKJO 2Y69B 3JAMN 3SPJA 1AJQA 5KHJA 3BRCA 2H94A 1AI5A 4HAMA 3ZHUA 2R9RB 1XMOB 4B3RB 3AG3B 4LR3A 1HNXB 1K4CC 1VF6A 3C3TA 3TCUA 3UKMA 3OE7G 3W7SA 4CC5A 1S77D 5GTHZ 3HR0A 3VOUA 1F51A 1JFFA 1GMGA 3LDEA 1K5SA 3S3XA 3SYQA 2UU9O 4OPAA 3SJBC 1ZL8B 4BIOA 4UB8Z 1V54C 1OZ0A 1R3IC 2OWOA 1OCOB 1CP9A 4X8AA 3THOA 5C8YA 3AG1C 4JF3A 3ZX6A 2CTPA 2EJ7A 3DC5A 3I55V 2QKSA 3CJHB 2L6LA 3B77A 1SF9A 3UQ8A 1P7GA 1QR8A 2D3OW 2ZIMA 5IY5B 3T1CA 3E2EA 5CA3A 3E8GA 4FIPC 4UFZA 1EN4A 3AG4C 1CPYA 3HKBA 2NLJC 2CE4A 3TXQA 2RQ6A 2ZINA 2Q8VA 4H37A 1EZVH 3K5NA 1HNWB 3CMEV 4DR6B 1AI4A 1M93A 1LUVA 4LFAO 2VQFB 4CH5A 1Q6HA 2DOSA 2P7TC 4WFHA 1SZXA 2HKOA 2EIKC 4LWSB 3FAVB 1M5IA 4K0KB 1WB7A 2UXBB 1OV9A 5L3GA 4CC6A 4HBNA 4DXWA 4D6TH 4JI0O 2B5UA 3CCJV 3W7TA 1N33O 5EYPB 4K8XA 4GT1A 1SQXH 2Q68A 3ABUA 1VQPV 4LF8B 3JAWB 4F6RB 1TAEA 2YXHA 1L0LH 2NNUA 5KUKA 3ASOB 3H1IH 5KA6A 2DE0X 5EIBC 1AB3A 4JPRA 1VQMV 2EULA 3E89A 2QKAA 2GHYA 4O2BB 1KECA 2AGAA 5IJ9A 1YI2V 3NXSA 4J7JA 1EFRG 5FNVB 4PA9A 4TV8A 4FK5C 4DO2A 1KQSU 3ASNC 1BE3H 1Y6XA 4MVUA 3ZMUA 3N27A 4CH3A 3S3WA 3ABMB 4ZI7B 1XDCA 4X1IB 3DGEA 5LXTB 1O9GA 3KCXA 3TXSA 3FB6C 1GM7A 4AQYO 4X65B 5LOVA 2BSKA 1Q6UA 3HKDA 2Y0IA 2O57A 2XAGA 1SZTA 4GLXA 1AP5A 1QR9A 3UO3A 1WP7A 4NYKA 2BTOA 1SQBH 2JS3A 2ITDC 1QU7A 1IURA 2QM7A 4DR4B 4GX2A 3K0DA 3E8BA 3ZMVA 3M8AA 4FFBA 3LNNA 4I55A 3K0GA 2WWWA 1A32A 3H1JH 3GB7C 3CE2A 1TGOA 4BR6A 1EZJA 2XT9A 3E8FA 2OTJV 1KKCA 4YJ3B 4NTYA 4FPPA 5TISZ 5LP6B 1JJ2U 4DRXB 2QA4V 2OIEA 4O4LB 1WAZA 3EXAA 4EFEA 4JI8O 4Q20A 5JWPA 2VQFO 1GTOA 3RT3C 3OGIB 4PA3A 1NJIW 4O2AB 1AP6A 2UXBO 2UXDB 3TETA 4B3MB 1KMIZ 1K4DC 5CA1B 2ZDIC 2OYQA 4I4TA 1UPGA 4FM2A 5LHGA 3UO2A 3ZHTA 4MVMA 1XNQO 4TV9B 1TA8A 1QLEB 1IBMB 4QPJA 3OMNB 2E5LO 5JCOA 1VQLV 1PV0A 4LFCB 1LR1A 1CXZB 1GK9A 1PKXA 2UXXA 1I94B 5KHKA 4WBNB 3SYAA 3BA8A 1L8DA 5BMVA 1H8HG 4UCRA 3N2GB 4LCUC 4E2LA 3LDDA 2KB1A 5IWAO 5LL6Y 4JI3O 2QE7G 2PYJA 1OJHA 2R9AA 1NH2B 4YY3B 4CBCA 3AG2C 4DUYO 1Q82W 3EHBB 1TUBA 1VQ8V 4XDKA 5D5QA 4OPHA 4QE7A 4MW3A 1B04A 5B1NA 4WCEV 2ZIOA 1BZKA 4JYAB 2HHHO 4JI1B 4R7CA 4EB6A 4DV0B 1WA8A 3CEIA 1JPXA 1XI1A 2VS0A 4AHCA 3H1KH 1ZTEA 3G80A 1HNZB 1U97A 1ZAUA 2P90A 5C8YB 5K1PA 3BA9A 3J80N 3A0BZ 5E79Z 5FPRA 4FZ0A 4P9OA 1EN6A 3CS5A 4FM1A 4DR4O 3AK1A 2AW9A 1NTKH 2RCVA 3ABKC 2XUMA 4BAYA 4ZIBA 2VQEB 4GKKO 1Q86W 5LHHA 3OTOB 4QIWF 5KAFZ 4MVSA 5KHIA 4AILC 2AXTZ 3BFRA 1THZA 5JH7A 4NVPA 1XBLA 2HG5C 3HKCB 5LGUA 1YJWV 2Q7GA 2Y4UA 2WLMA 1JOYA 4GX5A 4DV1O 1AR4A 2MW2B 3SGIA 5JJNB 5LGTA 3RBZA 1QBZA 1ZWIC 2V7QG 5EIBD 4DR7O 1MSDA 3LUTB 4IYHA 4LWSA 2ITCC 1R3JC 3WG7B 4LF4O 3FX7A 5IYZB 5B1OA 1W2BU 1I5XA 4XBFA 2QEXV 1K34A 2WAMA 1NT2B 1IBMO 1GM9A 1OCCB 1GRJA 2WLIB 1FYJA 2HVJC 4EKWA 5EYPA 4LFCO 4LF9B 3CXCU 2PTMA 1I94O 4GYCB 3JAWA 4I0XA 4RUEA 3ZBHA 1GAXA 4EEQA 1US6A 2CK3G 2WPDG 1GN4A 5IJ9B 2ZR2A 2DQ0A 1YHQV 4MVQA 3ZEDA 1R6TA 4TV8B 4YY3O 5LBQA 1M4UA 5BR8B 3L73H 4LNUA 5L3CA 1RM1B 3B40A 3G6BA 3WB1A 4BIZA 3ETGA 3K9SA 4JYAO 3STLC 3K5LA 1WPXA 1QCEA 4JI6O 1E1RG 3RW0A 4JI4O 4X1IA 3K79A 2XAHA 1HNZO 4KUMA 5LOVB 1ROPA 2BSKB 2UU9B 1VQ5V 1EBOA 3JD0A 3U0ZA 2VWJA 2IH3C 2E75B 2WA4A 2VQEO 1V55C 1J5EO 3UT5A 3E35A 4R8CA 3OTOO 4X20A 4KHPB 4WFGA 2HVKC 4I55B 5JJEB 2QDOA 4J9ZB 3CRCA 5K1XA 3K06A 3ZRXA 1DK1A 1ENVA 4QGPA 1BHBA 4FLXA 1NQTA 4X88A 5LP6A 1VQ4V 4DRXA 2A3QA 1YTFD 3B09A 1K73W 1NZ6A 4YJ2A 1PL4A 2QWNB 5BY1A 2Q0AA 3JD2A 2VWKA 3WB0A 3BY6A 4FFKA 3CRAA 3ETQA 2OCCC 3K04A 1PNMA 3N2KA 3IC7A 2YICA 2EILB 3ML0A 3HKEA 4I4TB 2V1DA 3QO5A 4UCTA 3OD4A 3H1LH 1COWG 5CA1A 2IU0A 4U3JA 3ZHSA 3SPHA 1NVPB 4JI0B 4YHHO 1SQVH 3BPZA 4LF9O 4TV9A 1N33B 4DUZB 5J2TB 1SA0A 3OAAG 4YIOA 5BMVB 3STZC 3ICXA 2QWRB 4X1YA 3RFRA 2EIJB 4WBNA 3BABA 4RAIA 4X64O 1IXBA 2IJHA 3N2GA 4H13B 5BR8O 5KLVH 3JSNA 5FLXN 3BEHA 1YEWA 3T1YO 2K9PA 3ABLC 1MSWD 2QM8A 3ZHVA 2DJVA 1IBLO 1URFA 1TUBB 4D7SA 3ZS8C 3OTFA 3CCSV 4DR5B 1N4CA 2YIBD 5B1AB 3CD6V 4A5UB 2YIAA 4O4JA 2OT5A 3R65A 4EB6B 1WA8B 3CPWU 2Z0AA 1K97A 1FXKA 2WLHA 5B1BC 4I7ZB 1EM1A 1IX9A 5A2QN 1FPOA 4B3TB 4AQYB 5EK0A 2M7WA 2DYRB 3P3PA 4KHPO 2X0LA 4JZGA 2YUAA 1IZ3A 1XREA 4J11A 5B3SC 2Y4TA 2YXYA 1K7DA 1R6NA 1QQCA 4MVZA 2RNBA 4MSWC 3BVOA 3GWOA 5JH7B 1GM8A 5KA5A 1I08A 2Y0PA 4G2KA 4ZKIA 1S5HC 2RJZA 1DF5A 2JVDA 3HKCA 4LFBO 2WLKA 2Z3YA 1Q90D 1F7YA 3D36C 1MOFA 2EZPA 1OCRC 4JI8B 3UCSC 3G6EV 3ABTA 4JYYA 1XL6A 5IYDO 4DV7O 4IL6Z 4FLVA 3OT7A 4FLZA 5FL7G 1RPRA 1GN2A 3CB2A 1SQFA 3G4SV 3T2MA 1XILA 1VP7A 5L3DA 1IXMA 5LA6A 4CS3A 5BXZA 2JK5C 1QNMA 5IYZA 4PI0A 2B9ZA 2B1GA 3QG5A 2OCHA 1WLEA 2UXNA 1KYOF 1K9MW 4DV3O 4DUZO 1BQ0A 2WLIA 2FYUH 2JEUA 1N0NA 2WLNA 2GUZA 1XNQB 4QPKA 1VEWA 2ETNA 1O9HA 4I0XB 1G8MA 1XQ8A 2CH7A 4TSFG 2GSMB 2VRZA 3OR7C 2E5LB 3CCVV 3L72H 5LMUO 4ZHQA 4DR3B 5J2UA 4PDVA 1MZFA 1RFYA 3W7UA 1QVFU 3P3NA 1JR9A 1GKFA 1FXVA 5IWAB 1TVKA 4LNUB 2QWPB 4DR5O 3F5WC 4JI3B 3T1HO 1KD1W 1UJWB 1B3QA 1FXHA 1MZEA 3D8CA 1AJNA 1BL8A 4O4IA 2WLLB 4DUYB 5DM6V 1JVMA 4X1KA 4FMTA 4IT5A 2PI4A 4JTCB 4B3TO 2HJDA 1R3KC 3K57A 2ATKC 3JCZA 4O4HA 4CZZA 2HHHB 2ZNJA 3ZCCA 2KQXA 4P30A 4DR1B 4I50A 5KAIZ 3O9OA 1ZSPA 1P7BA 4TQFA 3OMIB 3DXRB 3RVZA 1PP9H 2W6IG 3UT5B 1FJGO 2LFSA 4X20B 4PDLA 1ZX3A 4LF7O 5DEDA 3NR7A 2XHBA 1MABG 4JI7O 2IJKA 5EBMC 2Y69C 2YXLA 5KX5A 2ZCEA 4WFEA 4U7NA 4GKKB 2D2CB 3X2QB 2CTQA 5CMUA 3MHSC 3CRMA 2AZ0A 2CGOA 2OTLV 4HYOA 4J9YB 3RYCA 3K08A 3JSLA 3PN1A 2NN4A 2G38A 3ZJZA 4JI5B 3ZHQA 2M6YA 2P6JA 3AG3C 4IYIA 2QWOB 4YJ2B 4TWKA 1WNSA 3B4SA 1FS0G 1NKDA 1RP3B 2ZE5A 2ZE8A 4DYLA 4W4LA 3U10A 3K59A 4DV1B 3W7XA 2LJ2A 4WFFA 1XNRO 1Y66A 1K33A 3R66A 3M7MX 3N2KB 1G6UA 4JTDB 1WB8A 4DR7B 2EIMB 5IYCO 3HKEB 4U3FH 2Y48A 3F7YC 1N8RW 1K8AW 4U3JB 4LF4B 3G71V 2LW7A 2QJ1A 2PF4E 1M56B 2Q7HA 1OCOC 2XAQA 2R72A 3CYOA 3LDCA 3PJSK 3QNEA 5C93A 1L0NH 4EFBA 3SPGA 3FB7C 4DR3O 1SA0B 4JAVA 3T4DA 2X7RB 3I5DA 2F43G 3A2FA 3FB5C 4X1YB 1SC5B 3G67A 1MG1A 5J2TA 4DV2O 4ZOLA 1N32O 5IY5C 1VF5B 3QO7A 5EBWC 3CCEV 1D5NA 1K92A 3QO8A 5HFLA 4K8ZA 1U96A 1GH6A 4CH6A 1V9PA 3O65A 2XTAA 3MAQA 2UUCB 2EX3A 2E76B 5J9PC 4IIJA 2A7WA 1RSOB 2Q6AA 4O4JB 3JATA 3WU2Z 1B06A 4NTWA 3M99B 2NR5A 1SETA 4TT3G 1Q3EA 1M57B 1MA1A 1FXKB 4JI6B 4DR1O 2HR3A 1KC8W 2Q9LA 4JI4B 1KUQA 1BGYH 1JMKC 4J7KA 3JCUZ 5KMGA 2ZXWB 2DQ3A 3CXHF 1HWYA 4PDMA 1QHTA 1EN5A 3QVNA 3ZN0A 2YS8A 2JEXA 1N34O 2GV9A 4DV4B 3ZRSA 2ZDIA 2PUSA 3IC9A 1J5EB 4MT8A 2EINB 1MNGA 3TGUH 2KG7A 2PZSA 3OR6C 2FB5A 4IGGA 3ASOC 4JI5O 5GTIZ 1NTMH 2UXCO 2F4VO 3B8MA 4OX9O 3OUSA 2Q73A 3CCLV 1H2NA 4I5SA 1G1XB 2UUBB 1PNLA 1R3LC 5L3FA 1LUWA 3K58A 1SS3A 2JGUA 1YJNV 4X66O 1MMMA 5CB4A 3ABMC 2GBOA 4BW5A 5LA6B 1BHAA 4FZ1A 2L35A 1CEZA 3D3IA 3L74H 4LF5B 2W0XA 4GX0A 1I7FA 2BOCC 4UVAA 4I9WA 2GTSA 4UXNA 4MTXA 3E86A 2GDSA 4L8JA 1VQNV 1V54B 2GUZB 2YIDA 5CA0A 3RYFA 1NI8A 5JJJB 1DGSA 2CH7B 4YHHB 1D2DA 3ZHRA 1YSCA 3BCCH 3LSQA 2JRIA 3AG1B 4PHZA 4LC1A 4ZHQB 1DLBA 2ILMA 3QTCA 5J2UB 3VBBA 1H2MA 1S76D 1LNQA 4R50A 4MTGA 2UUCO 1PNKA 1TVKB 4X64B 4CS4A 5LP6C 1S0VA 2PGGA 3MDSA 4JAAA 3CC7V 2N05A 2IW5A 1H2GA 3T1YB 3E22A 3AG4B 3OEEG 1FAFA 1SQGA 2Z5UA 4O4IB 1VQOV 1IBLB 4X1KB 2LW1A 3GWKC 3SYPA 4OXSA 3QF7A 2WLLA 4ABMA 4D7TA 4O4HB 3CRRA 4ICGA 4E4EA 4I50B 1Q6IA 4DW0A 4MVOA 4TUYA 2EIKB 5DN6G 2HFEC 1VIBA 1W0KG 3DXRA 4DV4O 2QR4A 3IAYA 3I56V 3JARB 1KP2A 1QLEC 5KX5B 4PI2A 2X6AA 1NR7A 5H5NA 4LH7A 3OGCC 3RYCB 1SRYA 3RYHA 5FPOA 3EFFK 1JCHA 5HFMA 3MD0A 3TK1A 3KCYA 3SPCA 3B2EE 3AG7A 2UUBO 2CDYA 3FB8C 3SYCA 1NBMG 5CBGA 1YCIA 4PD4F 3ZRWA 1VF6C 1Q81W 2AZ2A 4LFBB 4BWAA 4JYCA 3D3QA
chains in the Genus database with same CATH topology
2QDOA 3CS5A 2Q8VA 1OJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDO A;  3CS5 A;  2Q8V A;  1OJH A; 
#chains in the Genus database with same CATH topology
 4JGS A;  2JS5 A;  4DV7 B;  4LF5 O;  4F4L A;  3ASN B;  2KSD A;  1GO3 F;  3AK3 A;  2JIZ G;  4CS2 A;  4IHJ A;  1Q7Y W;  1FFX A;  1AR1 B;  2W0F C;  2C2A A;  4BIU A;  1I5Y A;  1JA8 A;  1AVM A;  2F66 C;  2YEV A;  1QVG U;  3OFN G;  2ZE7 A;  4DV3 B;  2BOB C;  4MVR A;  3FKS G;  4RUF A;  3SJC C;  2FKX A;  4AI8 A;  1D5A A;  4ZOL B;  1PM9 A;  3A0R A;  1OHH G;  4DW1 A;  1HDJ A;  2ZQM A;  5LMU B;  2QWQ B;  2ZD9 A;  2B1I A;  2JGD A;  1BQZ A;  1FD9 A;  2WA3 A;  3E8H A;  4IIJ B;  2WSS G;  3H1H H;  2A06 H;  3JAT B;  3Q4H A;  4WFB V;  5IT9 N;  4Z2W A;  2Q67 A;  3T1H B;  1RSO A;  2ZM6 O;  4XDL A;  3CHX A;  1SQP H;  3LSU A;  1AI6 A;  3B8N A;  4J80 A;  3JAK A;  4R6Z A;  3JAS B;  1FKA O;  1AIL A;  3A0H Z;  4JI2 O;  1WPB A;  2ZKO A;  4B3S B;  4B08 A;  1JQ0 A;  2XAJ A;  5KMG B;  4X62 O;  1T5E A;  5GON A;  2IU3 A;  3WG7 C;  1PL0 A;  3ZIA G;  1SKV A;  3CX5 F;  2ZE6 A;  1S3J A;  1WJZ A;  3JYC A;  1OCC C;  2F93 B;  4MTF A;  1G4Y B;  1FJG B;  1BT8 A;  2KG7 B;  4LF7 B;  3CCQ V;  1HR0 B;  3KKY A;  2ZR3 A;  2F1M A;  2P4V A;  4JI7 B;  2JJ2 G;  1XMQ B;  1YTF B;  2PI5 A;  2XAS A;  3JAL A;  2PYL A;  4NB5 A;  5IE9 A;  1VQK V;  3DTU B;  4PA6 A;  3GVM A;  5E1A C;  5GW7 A;  4BW9 A;  5L3E A;  5LMN O;  1VQ7 V;  4DV5 O;  1H2S B;  1XEQ A;  5JVD A;  1RM1 C;  3ZRV A;  2Q0O C;  5CB4 B;  3CSX A;  1IVS A;  4Z1M G;  4UV9 A;  3AG2 B;  3F7V C;  1XNR B;  3EVK A;  3OW2 U;  3HB3 B;  5B5E Z;  1XOU A;  2H3O A;  3OMA B;  3IJ4 A;  3JD1 A;  1S72 V;  3U11 A;  4KFM A;  2YC0 A;  3HPL C;  5CA0 B;  3RYF B;  2P67 A;  2HJF C;  3H01 A;  3FD9 A;  1ZLZ A;  4NXN O;  4NXM B;  1ZUQ A;  4DR2 B;  2BE3 A;  2P5O A;  2AHY A;  1TUE B;  4K35 A;  5IJ0 A;  4JV5 B;  1Q8I A;  2XOK G;  3ABK B;  2QM4 A;  3ZMS A;  4X9Q A;  4DV2 B;  2DWE C;  5LHI A;  4UUJ C;  2F23 A;  1N32 B;  3T4Z A;  4H33 A;  1HP8 A;  4UCO A;  3SPI A;  1X59 A;  2LGQ A;  3E22 B;  3ETE A;  1XMO O;  2LGW A;  4B3R O;  2HP8 A;  4JYB A;  1NS1 A;  4P2Z A;  1HNX O;  4B3S O;  4FVM A;  3OM3 B;  4PV1 B;  5EC2 C;  3SJA C;  1F4M A;  4H44 B;  3IGA C;  3D36 A;  4JAU A;  2A79 B;  4TUY B;  3JD3 A;  2EIL C;  4UCV A;  2JDI G;  1Y76 A;  5D5P A;  4DV6 B;  3VQY A;  4G27 B;  1NH2 D;  2RMK B;  2CTW A;  1M90 W;  1K3E A;  5ITZ A;  4JAS A;  4ASU G;  3JAR A;  1VQ9 V;  2YSU B;  1HR0 O;  4K3A A;  2A9H A;  5JCO C;  3UM7 A;  1BMF G;  1N34 B;  1XMQ O;  2UUA B;  4LF6 B;  5B66 Z;  1N0J A;  4NR1 A;  3RYH B;  3VQX A;  2DWD C;  1AR5 A;  3P30 A;  3K3W A;  2EZO A;  5LYJ A;  3KZI Z;  1DTO A;  4KP4 A;  3SR2 C;  5H6R A;  4Z1V A;  1Y74 A;  2EIJ C;  5EC1 C;  3RYI B;  1K5Q A;  1H2L A;  3VQW A;  3ZRW B;  3LNM B;  2P4K A;  2UXC B;  1HW7 A;  2F4V B;  1FFT B;  1E1Q G;  4OX9 B;  3APO A;  1OCZ B;  2KKW A;  3AK2 A;  4MTO A;  1SQQ H;  1UFI A;  1HNW O;  2HLD G;  1Q5O A;  5B1A C;  3RGB A;  4DR6 O;  4HNA B;  3VQV A;  1J95 A;  5JQG A;  2LQT A;  3RVY A;  4PEL A;  4X66 B;  5EZY B;  1R73 A;  4WF9 V;  4IHJ B;  4Q6G A;  1FFX B;  2IJI A;  3KG2 A;  2YEV B;  4FLW A;  4K0K O;  5LGN A;  4NXM O;  4DR2 O;  2LFR A;  2XAF A;  2DYR C;  3CC2 V;  1H38 A;  2YI9 A;  1R1B A;  4J41 A;  3L75 H;  4RQF A;  1Z2G A;  3FYI B;  3K9A A;  4JV5 O;  1GN3 A;  1VF7 A;  2W6J G;  2BTQ A;  1VQ6 V;  2ZT9 B;  1V55 B;  1R6K A;  4QJF B;  3CRQ A;  5CBF A;  2ZNI A;  4LF8 O;  2X6C A;  1Y67 A;  2V4D A;  2JGD B;  4X89 A;  3L70 H;  3J7A U;  2CAZ C;  2DW4 A;  4PA4 A;  2DN9 A;  2PY5 A;  4PJ0 Z;  2LP7 A;  1NU1 H;  2CGN A;  3AEI A;  3Q4H B;  2OIG A;  1PD3 A;  2ODM A;  1S5L Z;  3WB2 A;  1SES A;  4XDJ A;  1H2K A;  3JAK B;  2E74 B;  2H8P C;  3C3S A;  2MK3 A;  5L3B A;  3OEH G;  2DYS B;  3C90 A;  1KU9 A;  3L9D A;  3JAS A;  4RWU A;  1YZB A;  5GON B;  1GN6 A;  1QLN A;  4DV6 O;  5IDJ A;  1JFF B;  4JTA B;  1NTZ H;  3BAA A;  5A9G A;  2OCC B;  4NKG B;  5KHH A;  2K1E A;  4X65 O;  3A8T A;  2QTS A;  2IM9 A;  4PA7 A;  2LO1 A;  2HEP A;  2QGN A;  4CH4 A;  2UUA O;  4FLU A;  4LF6 O;  1ZL8 A;  2ADP A;  4UCS A;  3ZMZ A;  1ORQ C;  2Q7E A;  3ETD A;  4U7O A;  4H0L B;  1KB9 F;  3H9V A;  1N36 B;  3RN4 A;  1Q43 A;  2X6B A;  3CC4 V;  2FML A;  3JAL B;  1XL4 A;  5BZB A;  3K5O A;  5IYB O;  3LSS A;  1P49 A;  2Q5Z A;  4QE9 A;  3W7W A;  4W4K A;  2FTK A;  3CJH A;  1AJP A;  2Q4P A;  5JVD B;  4GCZ A;  4FM0 A;  3J81 N;  3DSQ A;  4FJC C;  3HKB B;  1KP3 A;  3ABL B;  3APQ A;  1W59 A;  2N04 A;  3FFQ A;  1YIT V;  4LP8 A;  2YDE A;  3RWR D;  1BSM A;  4FLT A;  4UV8 A;  1KBH A;  1AI7 A;  4TOI A;  4LH6 A;  3CWB H;  1YF2 A;  4MW8 A;  1PPJ H;  2CTR A;  2ADQ B;  3SDL A;  2UXD O;  4UCU A;  5B1B B;  4JZ2 A;  4B3M O;  2IH1 C;  3K5M A;  1YJ9 V;  2E3C A;  1JJO A;  3FAV A;  3TJT A;  4C7U A;  5IJ0 B;  5H9C A;  1E79 G;  1WN7 A;  1BCC H;  3MHH C;  2F95 B;  2QSA A;  1RPO A;  3BHP A;  1YVW A;  5KHG A;  1B6Q A;  1IBK B;  2IBZ H;  5CBH A;  3X2Q C;  5B3S B;  2GTA A;  4OGQ B;  1Z5W A;  4GKJ B;  3ZN1 A;  2IJJ A;  2YIB A;  3DC6 A;  5F2V O;  1NVP D;  4F6R A;  1H8E G;  1P84 F;  1Z5V A;  2N74 A;  1BS3 A;  4LBE C;  3CCR V;  1M9N A;  5DEC A;  2P22 C;  3CP1 A;  1OCZ C;  1W0J G;  3K03 A;  4HZ3 A;  2CUG A;  4O2B A;  2P06 A;  2ZM6 B;  4FLY A;  2RDC A;  1SER A;  1OCR B;  3ZMT A;  5FNV A;  4JI2 B;  1L1F A;  2EIM C;  4KL1 A;  1P4R A;  1Y76 B;  4DK0 A;  5H2F Z;  4X62 B;  4JI1 O;  2EJR A;  2RN9 A;  1M1K W;  2BCC H;  4DV0 O;  1DF4 A;  5ITZ B;  4J42 A;  4ZI7 A;  4P9P A;  1M56 C;  1YDX A;  4YXW G;  4B7E A;  2EBO A;  5LXT A;  3CMA V;  4I9Q A;  4GUN A;  3HKD B;  2Q69 A;  1N36 O;  1JX9 A;  3CCU V;  1KKD A;  2AHZ A;  1ARO P;  4B7K A;  4NTX A;  5KUM A;  4QNH B;  5LYJ B;  4PDR A;  1XUQ A;  2XND G;  3SJQ C;  1XHX A;  1Y74 B;  1WP8 A;  4FFB B;  5H6Q A;  4UVC A;  2DMX A;  4KXR A;  4DK1 A;  3RYI A;  2WLJ A;  4ZBM A;  4N23 A;  3JD4 A;  2A0L A;  4YIP A;  5AG2 A;  3WFV A;  4RO2 A;  1YIJ V;  1VAR A;  4TQD A;  1I0H A;  3IFX A;  4UB6 Z;  4L87 A;  3CCM V;  4GX1 A;  5LMN B;  1VMG A;  1Y4M A;  4YJ3 A;  4DV5 B;  5EBL C;  5JQG B;  4J10 A;  1F23 A;  2QKC A;  4G28 B;  4O4L A;  2JJ1 G;  4F6E A;  4HNA A;  1M57 C;  2ARH A;  3OUF A;  1FXK C;  2DYS C;  4GZR B;  5EZY A;  4WFA V;  3SYO A;  4J7Z A;  4MS2 A;  3E83 A;  4N21 A;  3F5T A;  1YXB A;  2ZXW C;  4LFA B;  1F4N A;  2R9I A;  4O2A A;  2FL4 A;  2YI8 A;  3P32 A;  3FYE B;  5CN0 A;  2BTQ B;  4NXN B;  1IBK O;  2QTO A;  1S5J A;  1X4T A;  1XHZ A;  2EIN C;  4UVB A;  1IDS A;  1NR1 A;  4RQE A;  3L71 H;  2R70 A;  4GKJ O;  2Y69 B;  3JAM N;  3SPJ A;  1AJQ A;  5KHJ A;  3BRC A;  2H94 A;  1AI5 A;  4HAM A;  3ZHU A;  2R9R B;  1XMO B;  4B3R B;  3AG3 B;  4LR3 A;  1HNX B;  1K4C C;  1VF6 A;  3C3T A;  3TCU A;  3UKM A;  3OE7 G;  3W7S A;  4CC5 A;  1S77 D;  5GTH Z;  3HR0 A;  3VOU A;  1F51 A;  1JFF A;  1GMG A;  3LDE A;  1K5S A;  3S3X A;  3SYQ A;  2UU9 O;  4OPA A;  3SJB C;  1ZL8 B;  4BIO A;  4UB8 Z;  1V54 C;  1OZ0 A;  1R3I C;  2OWO A;  1OCO B;  1CP9 A;  4X8A A;  3THO A;  5C8Y A;  3AG1 C;  4JF3 A;  3ZX6 A;  2CTP A;  2EJ7 A;  3DC5 A;  3I55 V;  2QKS A;  3CJH B;  2L6L A;  3B77 A;  1SF9 A;  3UQ8 A;  1P7G A;  1QR8 A;  2D3O W;  2ZIM A;  5IY5 B;  3T1C A;  3E2E A;  5CA3 A;  3E8G A;  4FIP C;  4UFZ A;  1EN4 A;  3AG4 C;  1CPY A;  3HKB A;  2NLJ C;  2CE4 A;  3TXQ A;  2RQ6 A;  2ZIN A;  2Q8V A;  4H37 A;  1EZV H;  3K5N A;  1HNW B;  3CME V;  4DR6 B;  1AI4 A;  1M93 A;  1LUV A;  4LFA O;  2VQF B;  4CH5 A;  1Q6H A;  2DOS A;  2P7T C;  4WFH A;  1SZX A;  2HKO A;  2EIK C;  4LWS B;  3FAV B;  1M5I A;  4K0K B;  1WB7 A;  2UXB B;  1OV9 A;  5L3G A;  4CC6 A;  4HBN A;  4DXW A;  4D6T H;  4JI0 O;  2B5U A;  3CCJ V;  3W7T A;  1N33 O;  5EYP B;  4K8X A;  4GT1 A;  1SQX H;  2Q68 A;  3ABU A;  1VQP V;  4LF8 B;  3JAW B;  4F6R B;  1TAE A;  2YXH A;  1L0L H;  2NNU A;  5KUK A;  3ASO B;  3H1I H;  5KA6 A;  2DE0 X;  5EIB C;  1AB3 A;  4JPR A;  1VQM V;  2EUL A;  3E89 A;  2QKA A;  2GHY A;  4O2B B;  1KEC A;  2AGA A;  5IJ9 A;  1YI2 V;  3NXS A;  4J7J A;  1EFR G;  5FNV B;  4PA9 A;  4TV8 A;  4FK5 C;  4DO2 A;  1KQS U;  3ASN C;  1BE3 H;  1Y6X A;  4MVU A;  3ZMU A;  3N27 A;  4CH3 A;  3S3W A;  3ABM B;  4ZI7 B;  1XDC A;  4X1I B;  3DGE A;  5LXT B;  1O9G A;  3KCX A;  3TXS A;  3FB6 C;  1GM7 A;  4AQY O;  4X65 B;  5LOV A;  2BSK A;  1Q6U A;  3HKD A;  2Y0I A;  2O57 A;  2XAG A;  1SZT A;  4GLX A;  1AP5 A;  1QR9 A;  3UO3 A;  1WP7 A;  4NYK A;  2BTO A;  1SQB H;  2JS3 A;  2ITD C;  1QU7 A;  1IUR A;  2QM7 A;  4DR4 B;  4GX2 A;  3K0D A;  3E8B A;  3ZMV A;  3M8A A;  4FFB A;  3LNN A;  4I55 A;  3K0G A;  2WWW A;  1A32 A;  3H1J H;  3GB7 C;  3CE2 A;  1TGO A;  4BR6 A;  1EZJ A;  2XT9 A;  3E8F A;  2OTJ V;  1KKC A;  4YJ3 B;  4NTY A;  4FPP A;  5TIS Z;  5LP6 B;  1JJ2 U;  4DRX B;  2QA4 V;  2OIE A;  4O4L B;  1WAZ A;  3EXA A;  4EFE A;  4JI8 O;  4Q20 A;  5JWP A;  2VQF O;  1GTO A;  3RT3 C;  3OGI B;  4PA3 A;  1NJI W;  4O2A B;  1AP6 A;  2UXB O;  2UXD B;  3TET A;  4B3M B;  1KMI Z;  1K4D C;  5CA1 B;  2ZDI C;  2OYQ A;  4I4T A;  1UPG A;  4FM2 A;  5LHG A;  3UO2 A;  3ZHT A;  4MVM A;  1XNQ O;  4TV9 B;  1TA8 A;  1QLE B;  1IBM B;  4QPJ A;  3OMN B;  2E5L O;  5JCO A;  1VQL V;  1PV0 A;  4LFC B;  1LR1 A;  1CXZ B;  1GK9 A;  1PKX A;  2UXX A;  1I94 B;  5KHK A;  4WBN B;  3SYA A;  3BA8 A;  1L8D A;  5BMV A;  1H8H G;  4UCR A;  3N2G B;  4LCU C;  4E2L A;  3LDD A;  2KB1 A;  5IWA O;  5LL6 Y;  4JI3 O;  2QE7 G;  2PYJ A;  1OJH A;  2R9A A;  1NH2 B;  4YY3 B;  4CBC A;  3AG2 C;  4DUY O;  1Q82 W;  3EHB B;  1TUB A;  1VQ8 V;  4XDK A;  5D5Q A;  4OPH A;  4QE7 A;  4MW3 A;  1B04 A;  5B1N A;  4WCE V;  2ZIO A;  1BZK A;  4JYA B;  2HHH O;  4JI1 B;  4R7C A;  4EB6 A;  4DV0 B;  1WA8 A;  3CEI A;  1JPX A;  1XI1 A;  2VS0 A;  4AHC A;  3H1K H;  1ZTE A;  3G80 A;  1HNZ B;  1U97 A;  1ZAU A;  2P90 A;  5C8Y B;  5K1P A;  3BA9 A;  3J80 N;  3A0B Z;  5E79 Z;  5FPR A;  4FZ0 A;  4P9O A;  1EN6 A;  3CS5 A;  4FM1 A;  4DR4 O;  3AK1 A;  2AW9 A;  1NTK H;  2RCV A;  3ABK C;  2XUM A;  4BAY A;  4ZIB A;  2VQE B;  4GKK O;  1Q86 W;  5LHH A;  3OTO B;  4QIW F;  5KAF Z;  4MVS A;  5KHI A;  4AIL C;  2AXT Z;  3BFR A;  1THZ A;  5JH7 A;  4NVP A;  1XBL A;  2HG5 C;  3HKC B;  5LGU A;  1YJW V;  2Q7G A;  2Y4U A;  2WLM A;  1JOY A;  4GX5 A;  4DV1 O;  1AR4 A;  2MW2 B;  3SGI A;  5JJN B;  5LGT A;  3RBZ A;  1QBZ A;  1ZWI C;  2V7Q G;  5EIB D;  4DR7 O;  1MSD A;  3LUT B;  4IYH A;  4LWS A;  2ITC C;  1R3J C;  3WG7 B;  4LF4 O;  3FX7 A;  5IYZ B;  5B1O A;  1W2B U;  1I5X A;  4XBF A;  2QEX V;  1K34 A;  2WAM A;  1NT2 B;  1IBM O;  1GM9 A;  1OCC B;  1GRJ A;  2WLI B;  1FYJ A;  2HVJ C;  4EKW A;  5EYP A;  4LFC O;  4LF9 B;  3CXC U;  2PTM A;  1I94 O;  4GYC B;  3JAW A;  4I0X A;  4RUE A;  3ZBH A;  1GAX A;  4EEQ A;  1US6 A;  2CK3 G;  2WPD G;  1GN4 A;  5IJ9 B;  2ZR2 A;  2DQ0 A;  1YHQ V;  4MVQ A;  3ZED A;  1R6T A;  4TV8 B;  4YY3 O;  5LBQ A;  1M4U A;  5BR8 B;  3L73 H;  4LNU A;  5L3C A;  1RM1 B;  3B40 A;  3G6B A;  3WB1 A;  4BIZ A;  3ETG A;  3K9S A;  4JYA O;  3STL C;  3K5L A;  1WPX A;  1QCE A;  4JI6 O;  1E1R G;  3RW0 A;  4JI4 O;  4X1I A;  3K79 A;  2XAH A;  1HNZ O;  4KUM A;  5LOV B;  1ROP A;  2BSK B;  2UU9 B;  1VQ5 V;  1EBO A;  3JD0 A;  3U0Z A;  2VWJ A;  2IH3 C;  2E75 B;  2WA4 A;  2VQE O;  1V55 C;  1J5E O;  3UT5 A;  3E35 A;  4R8C A;  3OTO O;  4X20 A;  4KHP B;  4WFG A;  2HVK C;  4I55 B;  5JJE B;  2QDO A;  4J9Z B;  3CRC A;  5K1X A;  3K06 A;  3ZRX A;  1DK1 A;  1ENV A;  4QGP A;  1BHB A;  4FLX A;  1NQT A;  4X88 A;  5LP6 A;  1VQ4 V;  4DRX A;  2A3Q A;  1YTF D;  3B09 A;  1K73 W;  1NZ6 A;  4YJ2 A;  1PL4 A;  2QWN B;  5BY1 A;  2Q0A A;  3JD2 A;  2VWK A;  3WB0 A;  3BY6 A;  4FFK A;  3CRA A;  3ETQ A;  2OCC C;  3K04 A;  1PNM A;  3N2K A;  3IC7 A;  2YIC A;  2EIL B;  3ML0 A;  3HKE A;  4I4T B;  2V1D A;  3QO5 A;  4UCT A;  3OD4 A;  3H1L H;  1COW G;  5CA1 A;  2IU0 A;  4U3J A;  3ZHS A;  3SPH A;  1NVP B;  4JI0 B;  4YHH O;  1SQV H;  3BPZ A;  4LF9 O;  4TV9 A;  1N33 B;  4DUZ B;  5J2T B;  1SA0 A;  3OAA G;  4YIO A;  5BMV B;  3STZ C;  3ICX A;  2QWR B;  4X1Y A;  3RFR A;  2EIJ B;  4WBN A;  3BAB A;  4RAI A;  4X64 O;  1IXB A;  2IJH A;  3N2G A;  4H13 B;  5BR8 O;  5KLV H;  3JSN A;  5FLX N;  3BEH A;  1YEW A;  3T1Y O;  2K9P A;  3ABL C;  1MSW D;  2QM8 A;  3ZHV A;  2DJV A;  1IBL O;  1URF A;  1TUB B;  4D7S A;  3ZS8 C;  3OTF A;  3CCS V;  4DR5 B;  1N4C A;  2YIB D;  5B1A B;  3CD6 V;  4A5U B;  2YIA A;  4O4J A;  2OT5 A;  3R65 A;  4EB6 B;  1WA8 B;  3CPW U;  2Z0A A;  1K97 A;  1FXK A;  2WLH A;  5B1B C;  4I7Z B;  1EM1 A;  1IX9 A;  5A2Q N;  1FPO A;  4B3T B;  4AQY B;  5EK0 A;  2M7W A;  2DYR B;  3P3P A;  4KHP O;  2X0L A;  4JZG A;  2YUA A;  1IZ3 A;  1XRE A;  4J11 A;  5B3S C;  2Y4T A;  2YXY A;  1K7D A;  1R6N A;  1QQC A;  4MVZ A;  2RNB A;  4MSW C;  3BVO A;  3GWO A;  5JH7 B;  1GM8 A;  5KA5 A;  1I08 A;  2Y0P A;  4G2K A;  4ZKI A;  1S5H C;  2RJZ A;  1DF5 A;  2JVD A;  3HKC A;  4LFB O;  2WLK A;  2Z3Y A;  1Q90 D;  1F7Y A;  3D36 C;  1MOF A;  2EZP A;  1OCR C;  4JI8 B;  3UCS C;  3G6E V;  3ABT A;  4JYY A;  1XL6 A;  5IYD O;  4DV7 O;  4IL6 Z;  4FLV A;  3OT7 A;  4FLZ A;  5FL7 G;  1RPR A;  1GN2 A;  3CB2 A;  1SQF A;  3G4S V;  3T2M A;  1XIL A;  1VP7 A;  5L3D A;  1IXM A;  5LA6 A;  4CS3 A;  5BXZ A;  2JK5 C;  1QNM A;  5IYZ A;  4PI0 A;  2B9Z A;  2B1G A;  3QG5 A;  2OCH A;  1WLE A;  2UXN A;  1KYO F;  1K9M W;  4DV3 O;  4DUZ O;  1BQ0 A;  2WLI A;  2FYU H;  2JEU A;  1N0N A;  2WLN A;  2GUZ A;  1XNQ B;  4QPK A;  1VEW A;  2ETN A;  1O9H A;  4I0X B;  1G8M A;  1XQ8 A;  2CH7 A;  4TSF G;  2GSM B;  2VRZ A;  3OR7 C;  2E5L B;  3CCV V;  3L72 H;  5LMU O;  4ZHQ A;  4DR3 B;  5J2U A;  4PDV A;  1MZF A;  1RFY A;  3W7U A;  1QVF U;  3P3N A;  1JR9 A;  1GKF A;  1FXV A;  5IWA B;  1TVK A;  4LNU B;  2QWP B;  4DR5 O;  3F5W C;  4JI3 B;  3T1H O;  1KD1 W;  1UJW B;  1B3Q A;  1FXH A;  1MZE A;  3D8C A;  1AJN A;  1BL8 A;  4O4I A;  2WLL B;  4DUY B;  5DM6 V;  1JVM A;  4X1K A;  4FMT A;  4IT5 A;  2PI4 A;  4JTC B;  4B3T O;  2HJD A;  1R3K C;  3K57 A;  2ATK C;  3JCZ A;  4O4H A;  4CZZ A;  2HHH B;  2ZNJ A;  3ZCC A;  2KQX A;  4P30 A;  4DR1 B;  4I50 A;  5KAI Z;  3O9O A;  1ZSP A;  1P7B A;  4TQF A;  3OMI B;  3DXR B;  3RVZ A;  1PP9 H;  2W6I G;  3UT5 B;  1FJG O;  2LFS A;  4X20 B;  4PDL A;  1ZX3 A;  4LF7 O;  5DED A;  3NR7 A;  2XHB A;  1MAB G;  4JI7 O;  2IJK A;  5EBM C;  2Y69 C;  2YXL A;  5KX5 A;  2ZCE A;  4WFE A;  4U7N A;  4GKK B;  2D2C B;  3X2Q B;  2CTQ A;  5CMU A;  3MHS C;  3CRM A;  2AZ0 A;  2CGO A;  2OTL V;  4HYO A;  4J9Y B;  3RYC A;  3K08 A;  3JSL A;  3PN1 A;  2NN4 A;  2G38 A;  3ZJZ A;  4JI5 B;  3ZHQ A;  2M6Y A;  2P6J A;  3AG3 C;  4IYI A;  2QWO B;  4YJ2 B;  4TWK A;  1WNS A;  3B4S A;  1FS0 G;  1NKD A;  1RP3 B;  2ZE5 A;  2ZE8 A;  4DYL A;  4W4L A;  3U10 A;  3K59 A;  4DV1 B;  3W7X A;  2LJ2 A;  4WFF A;  1XNR O;  1Y66 A;  1K33 A;  3R66 A;  3M7M X;  3N2K B;  1G6U A;  4JTD B;  1WB8 A;  4DR7 B;  2EIM B;  5IYC O;  3HKE B;  4U3F H;  2Y48 A;  3F7Y C;  1N8R W;  1K8A W;  4U3J B;  4LF4 B;  3G71 V;  2LW7 A;  2QJ1 A;  2PF4 E;  1M56 B;  2Q7H A;  1OCO C;  2XAQ A;  2R72 A;  3CYO A;  3LDC A;  3PJS K;  3QNE A;  5C93 A;  1L0N H;  4EFB A;  3SPG A;  3FB7 C;  4DR3 O;  1SA0 B;  4JAV A;  3T4D A;  2X7R B;  3I5D A;  2F43 G;  3A2F A;  3FB5 C;  4X1Y B;  1SC5 B;  3G67 A;  1MG1 A;  5J2T A;  4DV2 O;  4ZOL A;  1N32 O;  5IY5 C;  1VF5 B;  3QO7 A;  5EBW C;  3CCE V;  1D5N A;  1K92 A;  3QO8 A;  5HFL A;  4K8Z A;  1U96 A;  1GH6 A;  4CH6 A;  1V9P A;  3O65 A;  2XTA A;  3MAQ A;  2UUC B;  2EX3 A;  2E76 B;  5J9P C;  4IIJ A;  2A7W A;  1RSO B;  2Q6A A;  4O4J B;  3JAT A;  3WU2 Z;  1B06 A;  4NTW A;  3M99 B;  2NR5 A;  1SET A;  4TT3 G;  1Q3E A;  1M57 B;  1MA1 A;  1FXK B;  4JI6 B;  4DR1 O;  2HR3 A;  1KC8 W;  2Q9L A;  4JI4 B;  1KUQ A;  1BGY H;  1JMK C;  4J7K A;  3JCU Z;  5KMG A;  2ZXW B;  2DQ3 A;  3CXH F;  1HWY A;  4PDM A;  1QHT A;  1EN5 A;  3QVN A;  3ZN0 A;  2YS8 A;  2JEX A;  1N34 O;  2GV9 A;  4DV4 B;  3ZRS A;  2ZDI A;  2PUS A;  3IC9 A;  1J5E B;  4MT8 A;  2EIN B;  1MNG A;  3TGU H;  2KG7 A;  2PZS A;  3OR6 C;  2FB5 A;  4IGG A;  3ASO C;  4JI5 O;  5GTI Z;  1NTM H;  2UXC O;  2F4V O;  3B8M A;  4OX9 O;  3OUS A;  2Q73 A;  3CCL V;  1H2N A;  4I5S A;  1G1X B;  2UUB B;  1PNL A;  1R3L C;  5L3F A;  1LUW A;  3K58 A;  1SS3 A;  2JGU A;  1YJN V;  4X66 O;  1MMM A;  5CB4 A;  3ABM C;  2GBO A;  4BW5 A;  5LA6 B;  1BHA A;  4FZ1 A;  2L35 A;  1CEZ A;  3D3I A;  3L74 H;  4LF5 B;  2W0X A;  4GX0 A;  1I7F A;  2BOC C;  4UVA A;  4I9W A;  2GTS A;  4UXN A;  4MTX A;  3E86 A;  2GDS A;  4L8J A;  1VQN V;  1V54 B;  2GUZ B;  2YID A;  5CA0 A;  3RYF A;  1NI8 A;  5JJJ B;  1DGS A;  2CH7 B;  4YHH B;  1D2D A;  3ZHR A;  1YSC A;  3BCC H;  3LSQ A;  2JRI A;  3AG1 B;  4PHZ A;  4LC1 A;  4ZHQ B;  1DLB A;  2ILM A;  3QTC A;  5J2U B;  3VBB A;  1H2M A;  1S76 D;  1LNQ A;  4R50 A;  4MTG A;  2UUC O;  1PNK A;  1TVK B;  4X64 B;  4CS4 A;  5LP6 C;  1S0V A;  2PGG A;  3MDS A;  4JAA A;  3CC7 V;  2N05 A;  2IW5 A;  1H2G A;  3T1Y B;  3E22 A;  3AG4 B;  3OEE G;  1FAF A;  1SQG A;  2Z5U A;  4O4I B;  1VQO V;  1IBL B;  4X1K B;  2LW1 A;  3GWK C;  3SYP A;  4OXS A;  3QF7 A;  2WLL A;  4ABM A;  4D7T A;  4O4H B;  3CRR A;  4ICG A;  4E4E A;  4I50 B;  1Q6I A;  4DW0 A;  4MVO A;  4TUY A;  2EIK B;  5DN6 G;  2HFE C;  1VIB A;  1W0K G;  3DXR A;  4DV4 O;  2QR4 A;  3IAY A;  3I56 V;  3JAR B;  1KP2 A;  1QLE C;  5KX5 B;  4PI2 A;  2X6A A;  1NR7 A;  5H5N A;  4LH7 A;  3OGC C;  3RYC B;  1SRY A;  3RYH A;  5FPO A;  3EFF K;  1JCH A;  5HFM A;  3MD0 A;  3TK1 A;  3KCY A;  3SPC A;  3B2E E;  3AG7 A;  2UUB O;  2CDY A;  3FB8 C;  3SYC A;  1NBM G;  5CBG A;  1YCI A;  4PD4 F;  3ZRW A;  1VF6 C;  1Q81 W;  2AZ2 A;  4LFB B;  4BWA A;  4JYC A;  3D3Q A; 
#chains in the Genus database with same CATH homology
 2QDO A;  3CS5 A;  2Q8V A;  1OJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...