2QDOA

Nbla protein from t. vulcanus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
VDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NblA protein
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
source organism Thermosynechococcus vulcanus
molecule tags Photosynthesis
total genus 20
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2qdoA00
3CS5A 2QDOA 1OJHA 2Q8VA
chains in the Genus database with same CATH superfamily
4O4JB 2AZ2A 4JI6B 2EIJB 2HKOA 4LF9B 3C90A 3I56V 2F43G 5EYPA 2VRZA 3RGBA 4KL1A 4MVRA 5LA6A 2H8PC 3UKMA 4KHPB 4LP8A 1NR1A 4I4TB 3WG7C 2F23A 1FXVA 3HKEB 4DR5B 1EZJA 1SQPH 2DYSB 3HKCA 2K9PA 2IJIA 4Z2WA 2CGNA 5BY1A 1V54B 5J2TB 1R3LC 4FLYA 3CJHB 1BE3H 1IDSA 3UCSC 4TT3G 5BMVA 2JGDB 5K1PA 3PJSK 4JTDB 1BHAA 4B7EA 3LNMB 3ABTA 5HFLA 2PZSA 2AZ0A 4PA7A 1M5IA 2QJ1A 1NTMH 1QLEB 4PDMA 2WLNA 4QGPA 1AVMA 4NXMO 3DC5A 3ML0A 4OX9O 1VMGA 1N34O 1Q6IA 2UUAB 4IYHA 3ASNB 4I55A 1SKVA 1RP3B 1OV9A 1W0KG 2R70A 3MDSA 4LFCO 1VEWA 4JAVA 2HP8A 2ZQMA 3BRCA 3A2FA 2YUAA 2LGQA 4HAMA 1V9PA 4DR6B 3OTFA 4DYLA 1Q86W 4NYKA 1BCCH 3CCLV 3AG2B 4D7TA 3CRAA 5CA0A 1X4TA 3ABUA 4DUYO 5J2UB 1WNSA 1Z5WA 1I5YA 1NTZH 4UVBA 1H38A 1AR5A 2N05A 2IM9A 3MHHC 3J7AU 3JCZA 4YIOA 1KBHA 3SPJA 4DV7O 1ZSPA 5LP6B 1M4UA 2B1GA 2P4KA 5CBGA 4JI2O 3HKBB 5EK0A 1GM7A 3RVZA 1Q82W 1HNXB 2H3OA 3G71V 3LNNA 4JI3O 5B3SB 2IJKA 4NTYA 2PY5A 4LF8O 3L9DA 2ATKC 3T1CA 1HNZB 4LR3A 1R6TA 3JAWA 4X1KB 2JJ1G 3HKDB 1BHBA 3MD0A 4XDLA 2YXHA 3SJCC 4DXWA 2L35A 4QE9A 4TV8A 2ILMA 1E1QG 2YXYA 3QTCA 4FLTA 1GRJA 2Y4TA 4JZGA 1SQQH 3L71H 5LHHA 1ZL8A 2HG5C 1Q8IA 4CS2A 5L3GA 3VBBA 1FXKA 1IVSA 3S3XA 1N33B 5DM6V 1B3QA 4FFKA 4FMTA 4ASUG 1VQPV 3JARA 3JAKA 2A0LA 2DWDC 2YEVB 2VQFB 2PF4E 1Y76A 1M93A 1NI8A 2ZCEA 3ETEA 3HB3B 2DW4A 5LHIA 5LGTA 3U10A 4JI0B 1H8EG 1AJPA 4JF3A 1EFRG 4CH4A 1SC5B 3JCUZ 4PA4A 2Q4PA 1SS3A 1FJGB 2EZOA 5KAIZ 4W4KA 3SR2C 2W0FC 3W7WA 3OTOO 1H2NA 3JYCA 5JVDA 1VQLV 1A32A 4DK1A 5LXTB 2HJFC 2WA4A 4N23A 1ZWIC 2YI9A 1NS1A 2BE3A 2ZM6O 1K73W 5GTHZ 4ZOLB 2QKSA 3ZHVA 2ZD9A 3AK3A 3QO5A 5D5QA 1ZAUA 3KG2A 4DV0B 2FYUH 5IYZB 1O9GA 1D2DA 1R6NA 5B1NA 3K08A 1BS3A 2QM8A 4JAUA 4K35A 4YJ2B 1S77D 2YXLA 2Z5UA 1K34A 1GN2A 1MZFA 5BZBA 1RSOA 4JGSA 1ROPA 5KHGA 4O4HB 4PA3A 1GKFA 4JI6O 3ABMB 4CS3A 5KMGB 4DK0A 2P5OA 1V55C 4R6ZA 1MZEA 3J80N 1EN6A 1XNRB 2RMKB 2CGOA 2BSKB 2EIMC 4RWUA 1WPBA 1R73A 4ZKIA 2K1EA 4KHPO 5L3FA 3AK2A 1IXMA 2JS3A 1WP8A 2CTQA 2UXNA 3CSXA 1KKCA 4DR5O 1F23A 1VF6C 4AILC 2KSDA 1HP8A 4FLXA 1X59A 3BVOA 4B08A 4X1IA 1VF6A 2B5UA 1QR8A 1VQNV 1VQ6V 2CH7A 1EM1A 3ZX6A 1ZTEA 4FZ1A 3K79A 2DMXA 2DN9A 4FJCC 3IJ4A 4I0XB 2ITDC 2JEUA 2HFEC 2P90A 1M57C 4HNAB 1G6UA 3BABA 4X20A 1JA8A 5KUMA 3ZHRA 2DQ3A 3G6BA 1I94O 3LDCA 2QKCA 3Q4HA 1PKXA 4N21A 4ZI7A 4UCSA 3LSUA 2LFSA 4FLUA 3LSQA 1JCHA 2HR3A 1W0JG 3H1IH 4YJ3A 3FB8C 3GWOA 5IJ0A 1WAZA 5EIBC 3CHXA 4X62O 4UXNA 4DR6O 4JI4B 1SESA 1FFXA 1KB9F 1SQXH 3DTUB 4J9YB 1L0LH 3T4ZA 5KX5B 3VQYA 2FB5A 4LF7B 1YEWA 2LFRA 4KFMA 1PM9A 2P06A 4CH3A 2WLLA 3JALB 1AI5A 1VQ7V 1DF5A 4MVUA 3RW0A 2ITCC 2LW7A 4D7SA 3JD3A 2HVKC 5AG2A 1VQOV 1KC8W 4O4IA 1HNXO 1DF4A 4MT8A 1AI6A 1YITV 1Y66A 3E22B 4PELA 1VF5B 2E5LB 1BQ0A 3ZN0A 3T1HB 1JJ2U 2EIJC 4DR4B 1KP2A 4O4JA 1K3EA 5H2FZ 2VS0A 3L73H 2QR4A 3CCUV 1YTFB 3KKYA 5EBLC 2ZE5A 1Y74B 2QA4V 5DEDA 3CC7V 4LF6O 2ZE7A 1CP9A 4U3JB 2P4VA 1N33O 2XAQA 3K3WA 1K92A 1B04A 3ZEDA 2ZIOA 1HW7A 5CBHA 3CYOA 1S3JA 4JTAB 2DYSC 4I4TA 4X66B 1EBOA 4DV1B 1TVKA 1ORQC 3OEHG 5C8YB 3HKEA 1U97A 4KUMA 1SQGA 4TSFG 1V54C 1K4DC 1F7YA 1BZKA 2VQFO 3A0BZ 4Q6GA 1I5XA 5J2TA 3SYOA 3IGAC 4MVZA 2UXDB 3UT5B 4JI0O 4LWSB 3CJHA 2OCHA 5H6RA 1NU1H 2E74B 1XNQO 1JPXA 5KA5A 2PYJA 1YI2V 1GH6A 2JGDA 5B1BB 1FJGO 3CCMV 4BIUA 1QLEC 3K9AA 4X65B 4CH6A 3L75H 2N74A 4UCTA 2NR5A 1LUVA 3NR7A 3ASNC 4FM1A 2YI8A 4MVOA 3G4SV 4CC5A 1XOUA 4J42A 3U0ZA 4X89A 3W7SA 3RYFB 3I5DA 3OEEG 3OD4A 4EFEA 3T1YB 1VQKV 4DV0O 5JJJB 1KQSU 1NKDA 2F4VO 3UQ8A 3AG2C 5JJNB 1AI4A 2M6YA 1YDXA 1F4MA 2OCCB 4P9OA 4YIPA 4K3AA 4F6EA 2JS5A 2JEXA 5J2UA 2AHYA 2V7QG 1NH2B 3B8NA 4LF5O 1XNRO 1URFA 1NTKH 5LP6C 2CTPA 5D5PA 5LP6A 3K5OA 2EULA 2F66C 4X1YB 5B3SC 2F95B 3D3IA 3RWRD 3HKBA 5B1OA 4A5UB 4J80A 3IFXA 4AHCA 1FPOA 4X1KA 2WA3A 3HKDA 5KA6A 4J7ZA 4B3MB 2GBOA 1J5EO 1IURA 2XAGA 4UUJC 1SRYA 3FX7A 3TXSA 1GN6A 1SF9A 1RM1B 3STLC 2ZR2A 1OCRB 2ODMA 2RN9A 5B66Z 3CCRV 4DR1B 1NR7A 3CCSV 3K57A 1Y4MA 3TXQA 4P2ZA 2QDOA 2YEVA 4TQDA 3A0HZ 3BY6A 1AR4A 4JI4O 3ABLB 3DXRA 2Z3YA 3JD4A 2RJZA 2KG7B 3C3TA 3N2KA 3P3NA 5IDJA 4LC1A 4GCZA 2RQ6A 2P7TC 2BOCC 1K5SA 3GWKC 3L70H 1YJ9V 2MW2B 3SPCA 5LXTA 4DO2A 4FZ0A 1Q81W 3E89A 1N32B 4DR3B 4ZOLA 3ETGA 1KYOF 1EZVH 2QM7A 3A8TA 3DC6A 4CC6A 3W7UA 5IYZA 3FYEB 3P30A 1US6A 4OPHA 2M7WA 1QVFU 3PN1A 2EIKB 1Q6UA 4YJ2A 5L3CA 2ZE6A 1BMFG 1P49A 1YZBA 1FAFA 3ABMC 2DYRB 3H1KH 3QG5A 2YC0A 3LUTB 3JD1A 3ZHSA 4MVQA 4PA6A 3CXCU 5KMGA 4LF4B 1E79G 1I0HA 2IBZH 4GKJB 2NNUA 5L3BA 3BPZA 4U7OA 2XOKG 2A3QA 4K8XA 1SZTA 4JI5B 1B6QA 4NXNB 4DV1O 4QE7A 5LBQA 1OCCB 3ASOB 1NVPD 4PDVA 4QJFB 4FPPA 2VWJA 1ENVA 3RN4A 2ZNJA 3IC7A 3BHPA 1YCIA 3TGUH 2UXDO 4YHHB 2RCVA 2HLDG 3E35A 1MG1A 4X65O 4HNAA 5IWAB 2XUMA 5IT9N 2OTLV 4TV9B 3H01A 1BT8A 5LHGA 2Q8VA 4EFBA 4JYAB 1XMOO 2R9IA 3VQWA 2EINB 5EBWC 4JI7B 3GB7C 1XILA 2DWEC 3T1YO 3JSNA 1QVGU 2YICA 3SPGA 1DGSA 4DV5O 2GTSA 2B1IA 1QQCA 2FMLA 3D8CA 2XASA 3K9SA 2X6BA 3MHSC 2QE7G 3RVYA 1LR1A 1IBKB 1GN3A 5KX5A 3OT7A 1COWG 2F1MA 1AB3A 3ZHTA 3P3PA 1S5JA 2E3CA 4X8AA 3B09A 5EC2C 4WFAV 3JALA 4RUEA 5DECA 4MVSA 5H6QA 4H44B 3EFFK 1YJNV 4GYCB 1NBMG 4DV3O 3TK1A 2HHHB 1TGOA 3OUFA 2X6CA 1I08A 5KHJA 1BGYH 1L1FA 4IGGA 4NR1A 4UCUA 3ZRWB 1WB7A 3E22A 4JI8B 4OXSA 5BR8O 4PHZA 1NVPB 5JWPA 2YIBA 3I55V 3H1HH 4B7KA 4B3MO 1D5AA 5JJEB 2O57A 2ARHA 3OMIB 5IY5B 3KCYA 2Z0AA 3JATB 5LMNB 3ZIAG 4R8CA 4UCRA 1AI7A 4K0KB 4H37A 1Y74A 4BW5A 2QM4A 1TUEB 2EJRA 4NVPA 4U3JA 3K03A 1VQ9V 2Y0PA 3K06A 3H1JH 4DR1O 1VQMV 4O2AA 5IYBO 5LOVB 3OW2U 5C8YA 5JH7B 3ETQA 4G27B 5BMVB 4AI8A 4XDJA 2XAHA 4Z1MG 4BWAA 1HWYA 3ZBHA 1SQBH 3RFRA 4GKKB 4MW8A 4LF9O 2Q67A 2Q6AA 2LJ2A 5B1BC 4LWSA 2KB1A 5CMUA 4KP4A 1PNMA 1Z5VA 4CZZA 3SJAC 2FTKA 4WFEA 3RBZA 4MSWC 4IT5A 2UXBB 1K97A 4B3RB 1PP9H 5A2QN 1YF2A 1R6KA 1XMQB 3K5MA 3CEIA 5CB4B 1N32O 3ICXA 3N2GB 4DR3O 1K4CC 3SDLA 3RYFA 1L8DA 1IZ3A 2Q73A 3VQVA 2QWPB 1O9HA 1I7FA 4C7UA 3UO3A 1NT2B 2OCCC 5GONB 1H2GA 5LYJB 2CDYA 1H2MA 2A79B 5CN0A 4L87A 1XUQA 3UM7A 1VQ4V 5KAFZ 3CC4V 5K1XA 4UVCA 2ADQB 3CRRA 2FKXA 2UUAO 3FKSG 3QVNA 1GTOA 4LF4O 4BIZA 4GKJO 2JK5C 3OR7C 4EKWA 2LW1A 1P7BA 1RPOA 2X0LA 3BAAA 1PNKA 1VQ8V 3RYCB 2XT9A 1YVWA 5E79Z 3LDDA 1KU9A 2ADPA 4YY3B 4X1YA 4UVAA 2IW5A 4NXNO 3FD9A 2JJ2G 2QSAA 4NTXA 1S76D 2ZXWB 2ETNA 5E1AC 4PA9A 4EB6B 1ZL8B 4PDLA 1VP7A 2DJVA 4JI1B 1FXKB 5F2VO 2Y4UA 4IIJB 4UCOA 3FFQA 4YHHO 3P32A 3WB0A 1RM1C 3APOA 4IHJB 1GM9A 1GK9A 4FVMA 3ZJZA 4HYOA 1OCRC 3JAKB 5IWAO 1YSCA 1BQZA 1JVMA 4DW1A 4E4EA 2WPDG 4MW3A 1HNZO 4Q20A 5J9PC 4JAAA 3AG1B 4O2BB 3JD2A 3OM3B 4JYAO 3ZMVA 5JCOC 1FKAO 2OIEA 4JI7O 5FNVB 4H13B 5JCOA 3ABLC 5JQGB 3OMNB 3RYIB 3LSSA 2E76B 4J11A 3ZMSA 4B3TB 3CE2A 2E75B 1UJWB 2WLJA 1WPXA 1OCOB 4UB6Z 5IE9A 2QWQB 1M56B 4LNUB 4NXMB 4ICGA 3E8HA 4TUYB 4OX9B 2Q0AA 1XL6A 1IX9A 1H2SB 1PPJH 4PI2A 4DR2B 1PNLA 1S5LZ 4OPAA 2IJHA 2GV9A 4F6RB 1VIBA 1WA8B 1UPGA 4FFBB 3JD0A 3R66A 2C2AA 2HHHO 3M7MX 2XAFA 4LFAB 1K33A 1JX9A 1CEZA 1AILA 3ZS8C 2EIKC 1GN4A 2ZIMA 3E8BA 1S0VA 2HVJC 2DYRC 2YDEA 3L74H 3ZN1A 1CPYA 3AG3B 5B1AB 4D6TH 1XL4A 4MVMA 3SYCA 2RDCA 1SQFA 3KCXA 5LMNO 3HPLC 4K0KO 2KKWA 3OMAB 2QTOA 2OIGA 2V4DA 5IYDO 4LF8B 4CS4A 3R65A 2RNBA 1OCCC 3ASOC 2LP7A 2Q7EA 1KKDA 1F4NA 4OGQB 2PYLA 1GO3F 1MSDA 4LH7A 2JDIG 4JYCA 4MTXA 2CTRA 5FPOA 3B8MA 5H5NA 4PD4F 4GKKO 1HR0B 3RYHB 3M99B 5IYCO 2ZKOA 4RAIA 5KHKA 3CX5F 4X64B 4DR7B 3WU2Z 3OGIB 4ZI7B 1QR9A 2ZT9B 2HJDA 3TETA 3IAYA 2UXBO 3OR6C 4MTGA 1N36B 3LDEA 3OUSA 1GM8A 4TV9A 2OT5A 1AP5A 1XMQO 2EINC 2ZDIC 3H1LH 1XREA 1KP3A 1OCZB 4U7NA 1TUBB 2XNDG 3M8AA 2QWRB 3CB2A 1FD9A 3D3QA 4DV6B 1DLBA 1SA0B 4HZ3A 1XHXA 4UCVA 4ZHQB 1T5EA 2JIZG 4NTWA 3E8GA 2XHBA 1G1XB 3SJQC 4RQFA 3G67A 4J10A 1JFFB 2JRIA 2WLHA 4BIOA 4G28B 1L0NH 2Y69B 1QLNA 3CXHF 4O4IB 3BEHA 3O9OA 2JVDA 3THOA 2GHYA 3J81N 2WLIB 4DW0A 5EZYB 4DV4B 2EILB 4JV5B 1D5NA 4YY3O 1H2KA 4J7KA 2HEPA 1DTOA 1B06A 2Q7HA 2ZINA 1MMMA 4WFFA 3ZRWA 4AQYB 5IJ9B 1IBMB 4LF7O 5LL6Y 2AXTZ 1OHHG 1GAXA 3JASB 2MK3A 3SYQA 2BTQB 4JI1O 5IY5C 1QHTA 4EEQA 1XHZA 2OYQA 5ITZB 3A0RA 3JATA 1BL8A 2V1DA 4WCEV 1M9NA 1TVKB 4BAYA 4I50B 5EC1C 3BFRA 3ABKB 2Y48A 4J41A 4NB5A 1EN4A 1K7DA 1XDCA 3ZHUA 1QNMA 2E5LO 3CC2V 5LOVA 4X9QA 5JH7A 3T1HO 4WFGA 4DR4O 3L72H 2GSMB 4O4HA 5B5EZ 1Z2GA 3SJBC 3D36C 3U11A 2GDSA 4JYBA 2EZPA 4B3TO 3CRCA 3D36A 2BSKA 2IU3A 1I94B 4GT1A 4WBNB 4DRXB 3WB2A 5CBFA 1JMKC 4I9QA 3SGIA 4X66O 4O4LB 4DR2O 3WFVA 4DV2B 1Q90D 2IH3C 1G8MA 3B40A 2H94A 4B3SB 4E2LA 3E86A 5HFMA 1RPRA 2N04A 2QGNA 1K9MW 1VF7A 2XAJA 3QF7A 1PL4A 5CB4A 2CUGA 4X62B 4K8ZA 1RFYA 3N2GA 2P22C 2CK3G 3EVKA 4LFAO 1N8RW 1MABG 4I0XA 3RT3C 2QEXV 3CS5A 4JASA 4JYYA 1YJWV 1FXHA 3N27A 5GONA 1GMGA 1SERA 1Q3EA 5LYJA 1EN5A 3X2QB 1JOYA 2W6JG 3AG4B 1WJZA 4PV1B 3DSQA 5FLXN 1TAEA 3FAVB 4MTOA 2W0XA 2OWOA 2IH1C 3RYCA 3BA9A 4LBEC 2Q0OC 4XDKA 2GUZB 5KHIA 2L6LA 5LMUB 3CWBH 2ZXWC 3QNEA 1XEQA 2AHZA 2F93B 2R72A 1HDJA 1KUQA 3AK1A 1J95A 2UXCB 3OFNG 1FXKC 4EB6A 3G6EV 4QPKA 1HR0O 5EBMC 4LF6B 3EHBB 2Q9LA 2PI5A 5CA1B 3FB7C 4IIJA 4XBFA 4X64O 4DR7O 2DE0X 4FM0A 4RO2A 4IL6Z 4JPRA 3F7VC 5GW7A 4IHJA 3H9VA 4DUZB 2ZNIA 1HNWB 1KECA 3ZHQA 3AG1C 2EX3A 1N36O 1K5QA 1R3IC 4GUNA 2UUBB 1IXBA 1QBZA 2ZE8A 4O2BA 4FM2A 3OGCC 3DXRB 1VQ5V 2A9HA 1XNQB 5EYPB 5FNVA 1R3KC 1Q7YW 3N2KB 5LA6B 2EJ7A 5JQGA 4DV6O 4BW9A 3SYAA 3RYIA 4LFBB 1OCOC 2QWNB 1M56C 4NKGB 1S72V 1W59A 1Q43A 3FB5C 1WN7A 3WG7B 2CE4A 3HKCB 4LNUA 2BTOA 3WB1A 2G38A 4TUYA 2WLKA 5TISZ 4WFBV 2YSUB 2A06H 4GX1A 4F6RA 3B2EE 1G4YB 2IU0A 1WA8A 4Z1VA 4FFBA 4ZIBA 3UO2A 1XBLA 1Q6HA 2ZR3A 2F4VB 3B77A 3S3WA 4DV4O 3UT5A 4R7CA 2LQTA 4JV5O 1NZ6A 1AP6A 1N4CA 1IBLB 3C3SA 5FPRA 1S5HC 3K0DA 4AQYO 4GX0A 3GVMA 1NJIW 4QPJA 1IBMO 2FL4A 3AEIA 3E83A 4WFHA 1N0NA 4I55B 3AG3C 5B1AC 3ZRVA 4LF5B 4WF9V 3VQXA 4MTFA 3W7XA 3BCCH 2Y0IA 2W6IG 1AJNA 3IC9A 5DN6G 1SZXA 1ZLZA 4G2KA 2YS8A 1MNGA 3EXAA 4FIPC 3T2MA 5L3EA 4L8JA 2X6AA 5CA0B 1JQ0A 2YIBD 3QO7A 2VQEB 2D3OW 4TQFA 4BR6A 4JTCB 2UUCB 2PGGA 1P84F 2PI4A 1XQ8A 2P67A 1YIJV 1DK1A 3G80A 1YTFD 4H0LB 3FYIB 4P30A 2B9ZA 1YHQV 1YXBA 1J5EB 2UU9B 1VARA 1FYJA 3W7TA 2Q68A 2AGAA 1KD1W 3RYHA 3CMAV 1OJHA 4PI0A 1LNQA 4PJ0Z 2YIDA 1Y6XA 1UFIA 4JI5O 2A7WA 1WP7A 3B4SA 2NLJC 3JAWB 3JAMN 2NN4A 2KQXA 3BA8A 3QO8A 4TV8B 4DV2O 5KLVH 4B3SO 2YIAA 3CRMA 4I7ZB 4LCUC 1OCZC 4RUFA 4JZ2A 2GTAA 1QCEA 3T4DA 1TUBA 5C93A 1LUWA 2Q69A 4RQEA 3ZRXA 3MAQA 2WAMA 1SA0A 3CRQA 1SQVH 3JARB 2UXXA 1M1KW 4ZHQA 5L3DA 3OE7G 1Y76B 3DGEA 2Y69C 5LGUA 3SPIA 4UV8A 1JFFA 3SYPA 4LH6A 4PDRA 4UFZA 1R1BA 1H8HG 2EILC 4H33A 1Q5OA 4P9PA 2WLIA 3APQA 1W2BU 5EZYA 1WLEA 5JVDB 3E2EA 1JR9A 3K0GA 2KG7A 5LMUO 5FL7G 1SETA 4GX5A 1NH2D 1IBKO 5IJ9A 1N34B 2WLMA 2UXCO 2PTMA 4FLWA 4LFCB 2PUSA 3CCVV 3JASA 1N0JA 1XI1A 2BTQA 5EIBD 2Q7GA 1P4RA 1MSWD 3JSLA 3CPWU 5ITZA 1OZ0A 3E8FA 4I5SA 5CA3A 3ABKC 4O2AB 3OAAG 4DUZO 4I50A 1HNWO 3SPHA 1RSOB 1AJQA 2D2CB 2P6JA 3O65A 4UB8Z 2UUBO 4JI8O 1FS0G 1U96A 3K04A 4DUYB 4J9ZB 3F7YC 1MOFA 5LGNA 4U3FH 3AG7A 1V55B 3CMEV 3K58A 1K8AW 2Q5ZA 1BSMA 5KHHA 4DV7B 1FFTB 4LFBO 2EIMB 4JI2B 1PV0A 4JI3B 1NQTA 2LO1A 4WBNA 4ZBMA 4DRXA 2CAZC 4X1IB 3CCEV 5BXZA 1ZX3A 3ETDA 4O4LA 1XMOB 2CH7B 1CXZB 4TWKA 1TA8A 3ZRSA 2XTAA 1ZUQA 4FLVA 3CD6V 4DV5B 4QIWF 3TCUA 2BCCH 3ZMUA 4J7JA 4X20B 1E1RG 2BOBC 1IBLO 4QNHB 3Q4HB 1M57B 2AW9A 3F5TA 4TOIA 2OTJV 3STZC 3HR0A 3X2QC 3CP1A 4F4LA 3AG4C 1AROP 4B3RO 4YJ3B 4FK5C 1PL0A 5IJ0B 3ZMTA 2R9AA 2EBOA 2X7RB 3TJTA 4CBCA 1THZA 2WWWA 2QTSA 2VWKA 4DV3B 4GX2A 5KUKA 1R3JC 2ZDIA 3K59A 1P7GA 3FAVA 1FFXB 3NXSA 4MS2A 3K5LA 1AR1B 3OTOB 3ZCCA 4GZRB 2VQEO 2GUZA 1F51A 5BR8B 2UUCO 3K5NA 4YXWG 3CCQV 4HBNA 2WLLB 3FB6C 2LGWA 5GTIZ 1PD3A 1WB8A 2DQ0A 2DOSA 3VOUA 4CH5A 4ABMA 3KZIZ 5H9CA 2ZM6B 1MA1A 1H2LA 2R9RB 2QWOB 2UU9O 4UV9A 2IJJA 3F5WC 4FLZA 2CTWA 2QKAA 1JJOA 1Y67A 4GLXA 5CA1A 2JGUA 5A9GA 4X88A 4I9WA 1QU7A 3CCJV 1KMIZ 3ZMZA 1M90W 4W4LA 4KXRA 2WSSG 4R50A 4IYIA
chains in the Genus database with same CATH topology
3CS5A 2QDOA 1OJHA 2Q8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CS5 A;  2QDO A;  1OJH A;  2Q8V A; 
#chains in the Genus database with same CATH topology
 4O4J B;  2AZ2 A;  4JI6 B;  2EIJ B;  2HKO A;  4LF9 B;  3C90 A;  3I56 V;  2F43 G;  5EYP A;  2VRZ A;  3RGB A;  4KL1 A;  4MVR A;  5LA6 A;  2H8P C;  3UKM A;  4KHP B;  4LP8 A;  1NR1 A;  4I4T B;  3WG7 C;  2F23 A;  1FXV A;  3HKE B;  4DR5 B;  1EZJ A;  1SQP H;  2DYS B;  3HKC A;  2K9P A;  2IJI A;  4Z2W A;  2CGN A;  5BY1 A;  1V54 B;  5J2T B;  1R3L C;  4FLY A;  3CJH B;  1BE3 H;  1IDS A;  3UCS C;  4TT3 G;  5BMV A;  2JGD B;  5K1P A;  3PJS K;  4JTD B;  1BHA A;  4B7E A;  3LNM B;  3ABT A;  5HFL A;  2PZS A;  2AZ0 A;  4PA7 A;  1M5I A;  2QJ1 A;  1NTM H;  1QLE B;  4PDM A;  2WLN A;  4QGP A;  1AVM A;  4NXM O;  3DC5 A;  3ML0 A;  4OX9 O;  1VMG A;  1N34 O;  1Q6I A;  2UUA B;  4IYH A;  3ASN B;  4I55 A;  1SKV A;  1RP3 B;  1OV9 A;  1W0K G;  2R70 A;  3MDS A;  4LFC O;  1VEW A;  4JAV A;  2HP8 A;  2ZQM A;  3BRC A;  3A2F A;  2YUA A;  2LGQ A;  4HAM A;  1V9P A;  4DR6 B;  3OTF A;  4DYL A;  1Q86 W;  4NYK A;  1BCC H;  3CCL V;  3AG2 B;  4D7T A;  3CRA A;  5CA0 A;  1X4T A;  3ABU A;  4DUY O;  5J2U B;  1WNS A;  1Z5W A;  1I5Y A;  1NTZ H;  4UVB A;  1H38 A;  1AR5 A;  2N05 A;  2IM9 A;  3MHH C;  3J7A U;  3JCZ A;  4YIO A;  1KBH A;  3SPJ A;  4DV7 O;  1ZSP A;  5LP6 B;  1M4U A;  2B1G A;  2P4K A;  5CBG A;  4JI2 O;  3HKB B;  5EK0 A;  1GM7 A;  3RVZ A;  1Q82 W;  1HNX B;  2H3O A;  3G71 V;  3LNN A;  4JI3 O;  5B3S B;  2IJK A;  4NTY A;  2PY5 A;  4LF8 O;  3L9D A;  2ATK C;  3T1C A;  1HNZ B;  4LR3 A;  1R6T A;  3JAW A;  4X1K B;  2JJ1 G;  3HKD B;  1BHB A;  3MD0 A;  4XDL A;  2YXH A;  3SJC C;  4DXW A;  2L35 A;  4QE9 A;  4TV8 A;  2ILM A;  1E1Q G;  2YXY A;  3QTC A;  4FLT A;  1GRJ A;  2Y4T A;  4JZG A;  1SQQ H;  3L71 H;  5LHH A;  1ZL8 A;  2HG5 C;  1Q8I A;  4CS2 A;  5L3G A;  3VBB A;  1FXK A;  1IVS A;  3S3X A;  1N33 B;  5DM6 V;  1B3Q A;  4FFK A;  4FMT A;  4ASU G;  1VQP V;  3JAR A;  3JAK A;  2A0L A;  2DWD C;  2YEV B;  2VQF B;  2PF4 E;  1Y76 A;  1M93 A;  1NI8 A;  2ZCE A;  3ETE A;  3HB3 B;  2DW4 A;  5LHI A;  5LGT A;  3U10 A;  4JI0 B;  1H8E G;  1AJP A;  4JF3 A;  1EFR G;  4CH4 A;  1SC5 B;  3JCU Z;  4PA4 A;  2Q4P A;  1SS3 A;  1FJG B;  2EZO A;  5KAI Z;  4W4K A;  3SR2 C;  2W0F C;  3W7W A;  3OTO O;  1H2N A;  3JYC A;  5JVD A;  1VQL V;  1A32 A;  4DK1 A;  5LXT B;  2HJF C;  2WA4 A;  4N23 A;  1ZWI C;  2YI9 A;  1NS1 A;  2BE3 A;  2ZM6 O;  1K73 W;  5GTH Z;  4ZOL B;  2QKS A;  3ZHV A;  2ZD9 A;  3AK3 A;  3QO5 A;  5D5Q A;  1ZAU A;  3KG2 A;  4DV0 B;  2FYU H;  5IYZ B;  1O9G A;  1D2D A;  1R6N A;  5B1N A;  3K08 A;  1BS3 A;  2QM8 A;  4JAU A;  4K35 A;  4YJ2 B;  1S77 D;  2YXL A;  2Z5U A;  1K34 A;  1GN2 A;  1MZF A;  5BZB A;  1RSO A;  4JGS A;  1ROP A;  5KHG A;  4O4H B;  4PA3 A;  1GKF A;  4JI6 O;  3ABM B;  4CS3 A;  5KMG B;  4DK0 A;  2P5O A;  1V55 C;  4R6Z A;  1MZE A;  3J80 N;  1EN6 A;  1XNR B;  2RMK B;  2CGO A;  2BSK B;  2EIM C;  4RWU A;  1WPB A;  1R73 A;  4ZKI A;  2K1E A;  4KHP O;  5L3F A;  3AK2 A;  1IXM A;  2JS3 A;  1WP8 A;  2CTQ A;  2UXN A;  3CSX A;  1KKC A;  4DR5 O;  1F23 A;  1VF6 C;  4AIL C;  2KSD A;  1HP8 A;  4FLX A;  1X59 A;  3BVO A;  4B08 A;  4X1I A;  1VF6 A;  2B5U A;  1QR8 A;  1VQN V;  1VQ6 V;  2CH7 A;  1EM1 A;  3ZX6 A;  1ZTE A;  4FZ1 A;  3K79 A;  2DMX A;  2DN9 A;  4FJC C;  3IJ4 A;  4I0X B;  2ITD C;  2JEU A;  2HFE C;  2P90 A;  1M57 C;  4HNA B;  1G6U A;  3BAB A;  4X20 A;  1JA8 A;  5KUM A;  3ZHR A;  2DQ3 A;  3G6B A;  1I94 O;  3LDC A;  2QKC A;  3Q4H A;  1PKX A;  4N21 A;  4ZI7 A;  4UCS A;  3LSU A;  2LFS A;  4FLU A;  3LSQ A;  1JCH A;  2HR3 A;  1W0J G;  3H1I H;  4YJ3 A;  3FB8 C;  3GWO A;  5IJ0 A;  1WAZ A;  5EIB C;  3CHX A;  4X62 O;  4UXN A;  4DR6 O;  4JI4 B;  1SES A;  1FFX A;  1KB9 F;  1SQX H;  3DTU B;  4J9Y B;  1L0L H;  3T4Z A;  5KX5 B;  3VQY A;  2FB5 A;  4LF7 B;  1YEW A;  2LFR A;  4KFM A;  1PM9 A;  2P06 A;  4CH3 A;  2WLL A;  3JAL B;  1AI5 A;  1VQ7 V;  1DF5 A;  4MVU A;  3RW0 A;  2ITC C;  2LW7 A;  4D7S A;  3JD3 A;  2HVK C;  5AG2 A;  1VQO V;  1KC8 W;  4O4I A;  1HNX O;  1DF4 A;  4MT8 A;  1AI6 A;  1YIT V;  1Y66 A;  3E22 B;  4PEL A;  1VF5 B;  2E5L B;  1BQ0 A;  3ZN0 A;  3T1H B;  1JJ2 U;  2EIJ C;  4DR4 B;  1KP2 A;  4O4J A;  1K3E A;  5H2F Z;  2VS0 A;  3L73 H;  2QR4 A;  3CCU V;  1YTF B;  3KKY A;  5EBL C;  2ZE5 A;  1Y74 B;  2QA4 V;  5DED A;  3CC7 V;  4LF6 O;  2ZE7 A;  1CP9 A;  4U3J B;  2P4V A;  1N33 O;  2XAQ A;  3K3W A;  1K92 A;  1B04 A;  3ZED A;  2ZIO A;  1HW7 A;  5CBH A;  3CYO A;  1S3J A;  4JTA B;  2DYS C;  4I4T A;  4X66 B;  1EBO A;  4DV1 B;  1TVK A;  1ORQ C;  3OEH G;  5C8Y B;  3HKE A;  1U97 A;  4KUM A;  1SQG A;  4TSF G;  1V54 C;  1K4D C;  1F7Y A;  1BZK A;  2VQF O;  3A0B Z;  4Q6G A;  1I5X A;  5J2T A;  3SYO A;  3IGA C;  4MVZ A;  2UXD B;  3UT5 B;  4JI0 O;  4LWS B;  3CJH A;  2OCH A;  5H6R A;  1NU1 H;  2E74 B;  1XNQ O;  1JPX A;  5KA5 A;  2PYJ A;  1YI2 V;  1GH6 A;  2JGD A;  5B1B B;  1FJG O;  3CCM V;  4BIU A;  1QLE C;  3K9A A;  4X65 B;  4CH6 A;  3L75 H;  2N74 A;  4UCT A;  2NR5 A;  1LUV A;  3NR7 A;  3ASN C;  4FM1 A;  2YI8 A;  4MVO A;  3G4S V;  4CC5 A;  1XOU A;  4J42 A;  3U0Z A;  4X89 A;  3W7S A;  3RYF B;  3I5D A;  3OEE G;  3OD4 A;  4EFE A;  3T1Y B;  1VQK V;  4DV0 O;  5JJJ B;  1KQS U;  1NKD A;  2F4V O;  3UQ8 A;  3AG2 C;  5JJN B;  1AI4 A;  2M6Y A;  1YDX A;  1F4M A;  2OCC B;  4P9O A;  4YIP A;  4K3A A;  4F6E A;  2JS5 A;  2JEX A;  5J2U A;  2AHY A;  2V7Q G;  1NH2 B;  3B8N A;  4LF5 O;  1XNR O;  1URF A;  1NTK H;  5LP6 C;  2CTP A;  5D5P A;  5LP6 A;  3K5O A;  2EUL A;  2F66 C;  4X1Y B;  5B3S C;  2F95 B;  3D3I A;  3RWR D;  3HKB A;  5B1O A;  4A5U B;  4J80 A;  3IFX A;  4AHC A;  1FPO A;  4X1K A;  2WA3 A;  3HKD A;  5KA6 A;  4J7Z A;  4B3M B;  2GBO A;  1J5E O;  1IUR A;  2XAG A;  4UUJ C;  1SRY A;  3FX7 A;  3TXS A;  1GN6 A;  1SF9 A;  1RM1 B;  3STL C;  2ZR2 A;  1OCR B;  2ODM A;  2RN9 A;  5B66 Z;  3CCR V;  4DR1 B;  1NR7 A;  3CCS V;  3K57 A;  1Y4M A;  3TXQ A;  4P2Z A;  2QDO A;  2YEV A;  4TQD A;  3A0H Z;  3BY6 A;  1AR4 A;  4JI4 O;  3ABL B;  3DXR A;  2Z3Y A;  3JD4 A;  2RJZ A;  2KG7 B;  3C3T A;  3N2K A;  3P3N A;  5IDJ A;  4LC1 A;  4GCZ A;  2RQ6 A;  2P7T C;  2BOC C;  1K5S A;  3GWK C;  3L70 H;  1YJ9 V;  2MW2 B;  3SPC A;  5LXT A;  4DO2 A;  4FZ0 A;  1Q81 W;  3E89 A;  1N32 B;  4DR3 B;  4ZOL A;  3ETG A;  1KYO F;  1EZV H;  2QM7 A;  3A8T A;  3DC6 A;  4CC6 A;  3W7U A;  5IYZ A;  3FYE B;  3P30 A;  1US6 A;  4OPH A;  2M7W A;  1QVF U;  3PN1 A;  2EIK B;  1Q6U A;  4YJ2 A;  5L3C A;  2ZE6 A;  1BMF G;  1P49 A;  1YZB A;  1FAF A;  3ABM C;  2DYR B;  3H1K H;  3QG5 A;  2YC0 A;  3LUT B;  3JD1 A;  3ZHS A;  4MVQ A;  4PA6 A;  3CXC U;  5KMG A;  4LF4 B;  1E79 G;  1I0H A;  2IBZ H;  4GKJ B;  2NNU A;  5L3B A;  3BPZ A;  4U7O A;  2XOK G;  2A3Q A;  4K8X A;  1SZT A;  4JI5 B;  1B6Q A;  4NXN B;  4DV1 O;  4QE7 A;  5LBQ A;  1OCC B;  3ASO B;  1NVP D;  4PDV A;  4QJF B;  4FPP A;  2VWJ A;  1ENV A;  3RN4 A;  2ZNJ A;  3IC7 A;  3BHP A;  1YCI A;  3TGU H;  2UXD O;  4YHH B;  2RCV A;  2HLD G;  3E35 A;  1MG1 A;  4X65 O;  4HNA A;  5IWA B;  2XUM A;  5IT9 N;  2OTL V;  4TV9 B;  3H01 A;  1BT8 A;  5LHG A;  2Q8V A;  4EFB A;  4JYA B;  1XMO O;  2R9I A;  3VQW A;  2EIN B;  5EBW C;  4JI7 B;  3GB7 C;  1XIL A;  2DWE C;  3T1Y O;  3JSN A;  1QVG U;  2YIC A;  3SPG A;  1DGS A;  4DV5 O;  2GTS A;  2B1I A;  1QQC A;  2FML A;  3D8C A;  2XAS A;  3K9S A;  2X6B A;  3MHS C;  2QE7 G;  3RVY A;  1LR1 A;  1IBK B;  1GN3 A;  5KX5 A;  3OT7 A;  1COW G;  2F1M A;  1AB3 A;  3ZHT A;  3P3P A;  1S5J A;  2E3C A;  4X8A A;  3B09 A;  5EC2 C;  4WFA V;  3JAL A;  4RUE A;  5DEC A;  4MVS A;  5H6Q A;  4H44 B;  3EFF K;  1YJN V;  4GYC B;  1NBM G;  4DV3 O;  3TK1 A;  2HHH B;  1TGO A;  3OUF A;  2X6C A;  1I08 A;  5KHJ A;  1BGY H;  1L1F A;  4IGG A;  4NR1 A;  4UCU A;  3ZRW B;  1WB7 A;  3E22 A;  4JI8 B;  4OXS A;  5BR8 O;  4PHZ A;  1NVP B;  5JWP A;  2YIB A;  3I55 V;  3H1H H;  4B7K A;  4B3M O;  1D5A A;  5JJE B;  2O57 A;  2ARH A;  3OMI B;  5IY5 B;  3KCY A;  2Z0A A;  3JAT B;  5LMN B;  3ZIA G;  4R8C A;  4UCR A;  1AI7 A;  4K0K B;  4H37 A;  1Y74 A;  4BW5 A;  2QM4 A;  1TUE B;  2EJR A;  4NVP A;  4U3J A;  3K03 A;  1VQ9 V;  2Y0P A;  3K06 A;  3H1J H;  4DR1 O;  1VQM V;  4O2A A;  5IYB O;  5LOV B;  3OW2 U;  5C8Y A;  5JH7 B;  3ETQ A;  4G27 B;  5BMV B;  4AI8 A;  4XDJ A;  2XAH A;  4Z1M G;  4BWA A;  1HWY A;  3ZBH A;  1SQB H;  3RFR A;  4GKK B;  4MW8 A;  4LF9 O;  2Q67 A;  2Q6A A;  2LJ2 A;  5B1B C;  4LWS A;  2KB1 A;  5CMU A;  4KP4 A;  1PNM A;  1Z5V A;  4CZZ A;  3SJA C;  2FTK A;  4WFE A;  3RBZ A;  4MSW C;  4IT5 A;  2UXB B;  1K97 A;  4B3R B;  1PP9 H;  5A2Q N;  1YF2 A;  1R6K A;  1XMQ B;  3K5M A;  3CEI A;  5CB4 B;  1N32 O;  3ICX A;  3N2G B;  4DR3 O;  1K4C C;  3SDL A;  3RYF A;  1L8D A;  1IZ3 A;  2Q73 A;  3VQV A;  2QWP B;  1O9H A;  1I7F A;  4C7U A;  3UO3 A;  1NT2 B;  2OCC C;  5GON B;  1H2G A;  5LYJ B;  2CDY A;  1H2M A;  2A79 B;  5CN0 A;  4L87 A;  1XUQ A;  3UM7 A;  1VQ4 V;  5KAF Z;  3CC4 V;  5K1X A;  4UVC A;  2ADQ B;  3CRR A;  2FKX A;  2UUA O;  3FKS G;  3QVN A;  1GTO A;  4LF4 O;  4BIZ A;  4GKJ O;  2JK5 C;  3OR7 C;  4EKW A;  2LW1 A;  1P7B A;  1RPO A;  2X0L A;  3BAA A;  1PNK A;  1VQ8 V;  3RYC B;  2XT9 A;  1YVW A;  5E79 Z;  3LDD A;  1KU9 A;  2ADP A;  4YY3 B;  4X1Y A;  4UVA A;  2IW5 A;  4NXN O;  3FD9 A;  2JJ2 G;  2QSA A;  4NTX A;  1S76 D;  2ZXW B;  2ETN A;  5E1A C;  4PA9 A;  4EB6 B;  1ZL8 B;  4PDL A;  1VP7 A;  2DJV A;  4JI1 B;  1FXK B;  5F2V O;  2Y4U A;  4IIJ B;  4UCO A;  3FFQ A;  4YHH O;  3P32 A;  3WB0 A;  1RM1 C;  3APO A;  4IHJ B;  1GM9 A;  1GK9 A;  4FVM A;  3ZJZ A;  4HYO A;  1OCR C;  3JAK B;  5IWA O;  1YSC A;  1BQZ A;  1JVM A;  4DW1 A;  4E4E A;  2WPD G;  4MW3 A;  1HNZ O;  4Q20 A;  5J9P C;  4JAA A;  3AG1 B;  4O2B B;  3JD2 A;  3OM3 B;  4JYA O;  3ZMV A;  5JCO C;  1FKA O;  2OIE A;  4JI7 O;  5FNV B;  4H13 B;  5JCO A;  3ABL C;  5JQG B;  3OMN B;  3RYI B;  3LSS A;  2E76 B;  4J11 A;  3ZMS A;  4B3T B;  3CE2 A;  2E75 B;  1UJW B;  2WLJ A;  1WPX A;  1OCO B;  4UB6 Z;  5IE9 A;  2QWQ B;  1M56 B;  4LNU B;  4NXM B;  4ICG A;  3E8H A;  4TUY B;  4OX9 B;  2Q0A A;  1XL6 A;  1IX9 A;  1H2S B;  1PPJ H;  4PI2 A;  4DR2 B;  1PNL A;  1S5L Z;  4OPA A;  2IJH A;  2GV9 A;  4F6R B;  1VIB A;  1WA8 B;  1UPG A;  4FFB B;  3JD0 A;  3R66 A;  2C2A A;  2HHH O;  3M7M X;  2XAF A;  4LFA B;  1K33 A;  1JX9 A;  1CEZ A;  1AIL A;  3ZS8 C;  2EIK C;  1GN4 A;  2ZIM A;  3E8B A;  1S0V A;  2HVJ C;  2DYR C;  2YDE A;  3L74 H;  3ZN1 A;  1CPY A;  3AG3 B;  5B1A B;  4D6T H;  1XL4 A;  4MVM A;  3SYC A;  2RDC A;  1SQF A;  3KCX A;  5LMN O;  3HPL C;  4K0K O;  2KKW A;  3OMA B;  2QTO A;  2OIG A;  2V4D A;  5IYD O;  4LF8 B;  4CS4 A;  3R65 A;  2RNB A;  1OCC C;  3ASO C;  2LP7 A;  2Q7E A;  1KKD A;  1F4N A;  4OGQ B;  2PYL A;  1GO3 F;  1MSD A;  4LH7 A;  2JDI G;  4JYC A;  4MTX A;  2CTR A;  5FPO A;  3B8M A;  5H5N A;  4PD4 F;  4GKK O;  1HR0 B;  3RYH B;  3M99 B;  5IYC O;  2ZKO A;  4RAI A;  5KHK A;  3CX5 F;  4X64 B;  4DR7 B;  3WU2 Z;  3OGI B;  4ZI7 B;  1QR9 A;  2ZT9 B;  2HJD A;  3TET A;  3IAY A;  2UXB O;  3OR6 C;  4MTG A;  1N36 B;  3LDE A;  3OUS A;  1GM8 A;  4TV9 A;  2OT5 A;  1AP5 A;  1XMQ O;  2EIN C;  2ZDI C;  3H1L H;  1XRE A;  1KP3 A;  1OCZ B;  4U7N A;  1TUB B;  2XND G;  3M8A A;  2QWR B;  3CB2 A;  1FD9 A;  3D3Q A;  4DV6 B;  1DLB A;  1SA0 B;  4HZ3 A;  1XHX A;  4UCV A;  4ZHQ B;  1T5E A;  2JIZ G;  4NTW A;  3E8G A;  2XHB A;  1G1X B;  3SJQ C;  4RQF A;  3G67 A;  4J10 A;  1JFF B;  2JRI A;  2WLH A;  4BIO A;  4G28 B;  1L0N H;  2Y69 B;  1QLN A;  3CXH F;  4O4I B;  3BEH A;  3O9O A;  2JVD A;  3THO A;  2GHY A;  3J81 N;  2WLI B;  4DW0 A;  5EZY B;  4DV4 B;  2EIL B;  4JV5 B;  1D5N A;  4YY3 O;  1H2K A;  4J7K A;  2HEP A;  1DTO A;  1B06 A;  2Q7H A;  2ZIN A;  1MMM A;  4WFF A;  3ZRW A;  4AQY B;  5IJ9 B;  1IBM B;  4LF7 O;  5LL6 Y;  2AXT Z;  1OHH G;  1GAX A;  3JAS B;  2MK3 A;  3SYQ A;  2BTQ B;  4JI1 O;  5IY5 C;  1QHT A;  4EEQ A;  1XHZ A;  2OYQ A;  5ITZ B;  3A0R A;  3JAT A;  1BL8 A;  2V1D A;  4WCE V;  1M9N A;  1TVK B;  4BAY A;  4I50 B;  5EC1 C;  3BFR A;  3ABK B;  2Y48 A;  4J41 A;  4NB5 A;  1EN4 A;  1K7D A;  1XDC A;  3ZHU A;  1QNM A;  2E5L O;  3CC2 V;  5LOV A;  4X9Q A;  5JH7 A;  3T1H O;  4WFG A;  4DR4 O;  3L72 H;  2GSM B;  4O4H A;  5B5E Z;  1Z2G A;  3SJB C;  3D36 C;  3U11 A;  2GDS A;  4JYB A;  2EZP A;  4B3T O;  3CRC A;  3D36 A;  2BSK A;  2IU3 A;  1I94 B;  4GT1 A;  4WBN B;  4DRX B;  3WB2 A;  5CBF A;  1JMK C;  4I9Q A;  3SGI A;  4X66 O;  4O4L B;  4DR2 O;  3WFV A;  4DV2 B;  1Q90 D;  2IH3 C;  1G8M A;  3B40 A;  2H94 A;  4B3S B;  4E2L A;  3E86 A;  5HFM A;  1RPR A;  2N04 A;  2QGN A;  1K9M W;  1VF7 A;  2XAJ A;  3QF7 A;  1PL4 A;  5CB4 A;  2CUG A;  4X62 B;  4K8Z A;  1RFY A;  3N2G A;  2P22 C;  2CK3 G;  3EVK A;  4LFA O;  1N8R W;  1MAB G;  4I0X A;  3RT3 C;  2QEX V;  3CS5 A;  4JAS A;  4JYY A;  1YJW V;  1FXH A;  3N27 A;  5GON A;  1GMG A;  1SER A;  1Q3E A;  5LYJ A;  1EN5 A;  3X2Q B;  1JOY A;  2W6J G;  3AG4 B;  1WJZ A;  4PV1 B;  3DSQ A;  5FLX N;  1TAE A;  3FAV B;  4MTO A;  2W0X A;  2OWO A;  2IH1 C;  3RYC A;  3BA9 A;  4LBE C;  2Q0O C;  4XDK A;  2GUZ B;  5KHI A;  2L6L A;  5LMU B;  3CWB H;  2ZXW C;  3QNE A;  1XEQ A;  2AHZ A;  2F93 B;  2R72 A;  1HDJ A;  1KUQ A;  3AK1 A;  1J95 A;  2UXC B;  3OFN G;  1FXK C;  4EB6 A;  3G6E V;  4QPK A;  1HR0 O;  5EBM C;  4LF6 B;  3EHB B;  2Q9L A;  2PI5 A;  5CA1 B;  3FB7 C;  4IIJ A;  4XBF A;  4X64 O;  4DR7 O;  2DE0 X;  4FM0 A;  4RO2 A;  4IL6 Z;  4JPR A;  3F7V C;  5GW7 A;  4IHJ A;  3H9V A;  4DUZ B;  2ZNI A;  1HNW B;  1KEC A;  3ZHQ A;  3AG1 C;  2EX3 A;  1N36 O;  1K5Q A;  1R3I C;  4GUN A;  2UUB B;  1IXB A;  1QBZ A;  2ZE8 A;  4O2B A;  4FM2 A;  3OGC C;  3DXR B;  1VQ5 V;  2A9H A;  1XNQ B;  5EYP B;  5FNV A;  1R3K C;  1Q7Y W;  3N2K B;  5LA6 B;  2EJ7 A;  5JQG A;  4DV6 O;  4BW9 A;  3SYA A;  3RYI A;  4LFB B;  1OCO C;  2QWN B;  1M56 C;  4NKG B;  1S72 V;  1W59 A;  1Q43 A;  3FB5 C;  1WN7 A;  3WG7 B;  2CE4 A;  3HKC B;  4LNU A;  2BTO A;  3WB1 A;  2G38 A;  4TUY A;  2WLK A;  5TIS Z;  4WFB V;  2YSU B;  2A06 H;  4GX1 A;  4F6R A;  3B2E E;  1G4Y B;  2IU0 A;  1WA8 A;  4Z1V A;  4FFB A;  4ZIB A;  3UO2 A;  1XBL A;  1Q6H A;  2ZR3 A;  2F4V B;  3B77 A;  3S3W A;  4DV4 O;  3UT5 A;  4R7C A;  2LQT A;  4JV5 O;  1NZ6 A;  1AP6 A;  1N4C A;  1IBL B;  3C3S A;  5FPR A;  1S5H C;  3K0D A;  4AQY O;  4GX0 A;  3GVM A;  1NJI W;  4QPJ A;  1IBM O;  2FL4 A;  3AEI A;  3E83 A;  4WFH A;  1N0N A;  4I55 B;  3AG3 C;  5B1A C;  3ZRV A;  4LF5 B;  4WF9 V;  3VQX A;  4MTF A;  3W7X A;  3BCC H;  2Y0I A;  2W6I G;  1AJN A;  3IC9 A;  5DN6 G;  1SZX A;  1ZLZ A;  4G2K A;  2YS8 A;  1MNG A;  3EXA A;  4FIP C;  3T2M A;  5L3E A;  4L8J A;  2X6A A;  5CA0 B;  1JQ0 A;  2YIB D;  3QO7 A;  2VQE B;  2D3O W;  4TQF A;  4BR6 A;  4JTC B;  2UUC B;  2PGG A;  1P84 F;  2PI4 A;  1XQ8 A;  2P67 A;  1YIJ V;  1DK1 A;  3G80 A;  1YTF D;  4H0L B;  3FYI B;  4P30 A;  2B9Z A;  1YHQ V;  1YXB A;  1J5E B;  2UU9 B;  1VAR A;  1FYJ A;  3W7T A;  2Q68 A;  2AGA A;  1KD1 W;  3RYH A;  3CMA V;  1OJH A;  4PI0 A;  1LNQ A;  4PJ0 Z;  2YID A;  1Y6X A;  1UFI A;  4JI5 O;  2A7W A;  1WP7 A;  3B4S A;  2NLJ C;  3JAW B;  3JAM N;  2NN4 A;  2KQX A;  3BA8 A;  3QO8 A;  4TV8 B;  4DV2 O;  5KLV H;  4B3S O;  2YIA A;  3CRM A;  4I7Z B;  4LCU C;  1OCZ C;  4RUF A;  4JZ2 A;  2GTA A;  1QCE A;  3T4D A;  1TUB A;  5C93 A;  1LUW A;  2Q69 A;  4RQE A;  3ZRX A;  3MAQ A;  2WAM A;  1SA0 A;  3CRQ A;  1SQV H;  3JAR B;  2UXX A;  1M1K W;  4ZHQ A;  5L3D A;  3OE7 G;  1Y76 B;  3DGE A;  2Y69 C;  5LGU A;  3SPI A;  4UV8 A;  1JFF A;  3SYP A;  4LH6 A;  4PDR A;  4UFZ A;  1R1B A;  1H8H G;  2EIL C;  4H33 A;  1Q5O A;  4P9P A;  2WLI A;  3APQ A;  1W2B U;  5EZY A;  1WLE A;  5JVD B;  3E2E A;  1JR9 A;  3K0G A;  2KG7 A;  5LMU O;  5FL7 G;  1SET A;  4GX5 A;  1NH2 D;  1IBK O;  5IJ9 A;  1N34 B;  2WLM A;  2UXC O;  2PTM A;  4FLW A;  4LFC B;  2PUS A;  3CCV V;  3JAS A;  1N0J A;  1XI1 A;  2BTQ A;  5EIB D;  2Q7G A;  1P4R A;  1MSW D;  3JSL A;  3CPW U;  5ITZ A;  1OZ0 A;  3E8F A;  4I5S A;  5CA3 A;  3ABK C;  4O2A B;  3OAA G;  4DUZ O;  4I50 A;  1HNW O;  3SPH A;  1RSO B;  1AJQ A;  2D2C B;  2P6J A;  3O65 A;  4UB8 Z;  2UUB O;  4JI8 O;  1FS0 G;  1U96 A;  3K04 A;  4DUY B;  4J9Z B;  3F7Y C;  1MOF A;  5LGN A;  4U3F H;  3AG7 A;  1V55 B;  3CME V;  3K58 A;  1K8A W;  2Q5Z A;  1BSM A;  5KHH A;  4DV7 B;  1FFT B;  4LFB O;  2EIM B;  4JI2 B;  1PV0 A;  4JI3 B;  1NQT A;  2LO1 A;  4WBN A;  4ZBM A;  4DRX A;  2CAZ C;  4X1I B;  3CCE V;  5BXZ A;  1ZX3 A;  3ETD A;  4O4L A;  1XMO B;  2CH7 B;  1CXZ B;  4TWK A;  1TA8 A;  3ZRS A;  2XTA A;  1ZUQ A;  4FLV A;  3CD6 V;  4DV5 B;  4QIW F;  3TCU A;  2BCC H;  3ZMU A;  4J7J A;  4X20 B;  1E1R G;  2BOB C;  1IBL O;  4QNH B;  3Q4H B;  1M57 B;  2AW9 A;  3F5T A;  4TOI A;  2OTJ V;  3STZ C;  3HR0 A;  3X2Q C;  3CP1 A;  4F4L A;  3AG4 C;  1ARO P;  4B3R O;  4YJ3 B;  4FK5 C;  1PL0 A;  5IJ0 B;  3ZMT A;  2R9A A;  2EBO A;  2X7R B;  3TJT A;  4CBC A;  1THZ A;  2WWW A;  2QTS A;  2VWK A;  4DV3 B;  4GX2 A;  5KUK A;  1R3J C;  2ZDI A;  3K59 A;  1P7G A;  3FAV A;  1FFX B;  3NXS A;  4MS2 A;  3K5L A;  1AR1 B;  3OTO B;  3ZCC A;  4GZR B;  2VQE O;  2GUZ A;  1F51 A;  5BR8 B;  2UUC O;  3K5N A;  4YXW G;  3CCQ V;  4HBN A;  2WLL B;  3FB6 C;  2LGW A;  5GTI Z;  1PD3 A;  1WB8 A;  2DQ0 A;  2DOS A;  3VOU A;  4CH5 A;  4ABM A;  3KZI Z;  5H9C A;  2ZM6 B;  1MA1 A;  1H2L A;  2R9R B;  2QWO B;  2UU9 O;  4UV9 A;  2IJJ A;  3F5W C;  4FLZ A;  2CTW A;  2QKA A;  1JJO A;  1Y67 A;  4GLX A;  5CA1 A;  2JGU A;  5A9G A;  4X88 A;  4I9W A;  1QU7 A;  3CCJ V;  1KMI Z;  3ZMZ A;  1M90 W;  4W4L A;  4KXR A;  2WSS G;  4R50 A;  4IYI A; 
#chains in the Genus database with same CATH homology
 3CS5 A;  2QDO A;  1OJH A;  2Q8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...