2QDOA

Nbla protein from t. vulcanus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
53
structure length
53
Chain Sequence
b'VDLSFEQEFQMRVMEEQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NblA protein
molecule tags Photosynthesis
source organism Thermosynechococcus vulcanus
publication title Structural, Functional, and Mutational Analysis of the NblA Protein Provides Insight into Possible Modes of Interaction with the Phycobilisome
pubmed doi rcsb
total genus 20
structure length 53
sequence length 53
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04485 NblA Phycobilisome degradation protein nblA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.670 Mainly Alpha Orthogonal Bundle Helix Hairpins Phycobilisome degradation protein NblA 2qdoA00
2Q8VA 3CS5A 1OJHA 2QDOA
chains in the Genus database with same CATH superfamily
4X65O 1NQTA 2IH1C 2XNDG 4DR1O 5CB4A 3CWBH 1PPJH 1QVFU 2YXLA 2RJZA 5JJNB 5GONB 4LC1A 4YIOA 3ZBHA 1VF6C 1DF4A 3K5NA 5LXTA 1NT2B 2ZM6O 1F7YA 4X20B 3IC9A 4O2AB 2AHZA 2P6JA 4TV9B 3DXRA 3C3SA 3ML0A 4AI8A 4P9OA 4BW9A 3J80N 5IDJA 3CE2A 1IXMA 3WG7C 3H1KH 1VIBA 3L71H 4LBEC 3JAWA 4LF8B 1VP7A 1NH2B 4JYAO 1XMOO 1M1KW 1SZTA 4I9WA 1K33A 1N0NA 4PDMA 3SJCC 1BSMA 1DLBA 3TXQA 4K8XA 5EZYA 1S77D 2GDSA 1YJ9V 2N04A 1AI4A 1AJQA 1ZX3A 3K08A 1H2SB 3K03A 3ZMUA 2X7RB 2KKWA 2VWJA 3ZCCA 1SQXH 2QKAA 1QLNA 1MSDA 3ZRXA 1XNQB 4O4HB 1Y76B 2WSSG 2UUAB 4PI2A 1XUQA 5K1XA 4JI0O 1GN2A 1AR4A 4MT8A 1NZ6A 4IT5A 4QPJA 2NNUA 4NTXA 5EZYB 3CCMV 3OT7A 2B1IA 2OCCB 1PP9H 3R66A 1BHAA 3U0ZA 1QVGU 3OMNB 4X66O 1MZFA 3O9OA 3SPCA 4UV9A 1RM1C 4I50B 3JSLA 3F7YC 3TJTA 3SPHA 1THZA 2OTLV 4H0LB 3ZMTA 3CJHB 2UXCB 2Y0PA 2YIBD 1G8MA 2M7WA 2P4KA 5BXZA 4B3RB 2A79B 4GX1A 4X88A 5CB4B 5GONA 1PNLA 4WFFA 2QA4V 4X9QA 3OTOB 3ABLB 2IU3A 5LA6A 2UUBB 4CH5A 5IJ9A 4NXMB 2W0FC 5J2TA 3CMAV 2BSKB 4MVOA 1IVSA 3TETA 4I0XA 3SYCA 1HNZB 4I7ZB 1L1FA 1N33B 4K0KB 1SQGA 4WFHA 1V9PA 3IJ4A 1GRJA 1R3KC 3L70H 1J5EB 4DR6B 4X1IB 5EK0A 1SERA 2F66C 3W7UA 4IYHA 1OJHA 3G6BA 1F51A 1Z5VA 2QKSA 1U96A 2QM4A 5DN6G 1Q5OA 1YEWA 1URFA 4TQDA 4LWSB 2EILC 4HAMA 3OFNG 2QWOB 5B66Z 1HNZO 1ZL8B 1N34B 2UXNA 1WP8A 5FPOA 1GM8A 3A0RA 2F43G 2Q7HA 4K35A 5KA6A 4UXNA 5IWAO 4ZKIA 5IJ9B 2YIDA 4PHZA 4UCRA 3VBBA 3UKMA 4ZBMA 4FLWA 2EBOA 4DR2B 2Y4TA 3H1JH 3OM3B 2AGAA 4YIPA 1AP5A 3B40A 1GN4A 2QWQB 4DR4B 2RQ6A 1KB9F 2K9PA 2Q8VA 3UT5A 2F93B 2Z3YA 2XOKG 1XEQA 1FXHA 2CGOA 4MW3A 3ABMB 4EEQA 4UV8A 2UXDO 3H9VA 3T1CA 1BE3H 1JPXA 5LA6B 1Q81W 1F23A 4RUFA 5LOVA 2ZT9B 1UFIA 3KG2A 2WWWA 3HKEA 4DR3B 5BZBA 1KP3A 3JASA 2XTAA 3VQVA 1Y67A 2B1GA 4LF6O 3AG2B 2WLIB 4Z1VA 3HPLC 4LF9B 5BR8O 1DTOA 1KECA 1EN5A 1FXKC 1N36B 2W6JG 4U7NA 1X59A 1J5EO 4JYYA 3RFRA 1I5YA 4NYKA 2BE3A 4O2AA 4DV7B 4RWUA 1WB7A 4DV4B 5IY5C 3K5MA 3DSQA 4NXMO 3APOA 3ASOB 2JDIG 1TVKB 4JI4O 2F4VB 2FYUH 5C8YB 2PTMA 1AR5A 1HNXO 5ITZB 2ZM6B 4DV5O 4F6RA 2CH7A 4IYIA 4BWAA 2WLHA 4A5UB 1XMQB 2ADQB 3B2EE 2ARHA 1AI6A 3CCEV 2W6IG 3AG7A 1AR1B 2QTSA 1HP8A 2ADPA 1GO3F 4IHJA 4EFEA 4B3MB 1FFTB 4JI3O 3IFXA 5EC1C 3CC2V 2BCCH 3AK1A 1WPXA 3JATB 2ZKOA 4I9QA 4EFBA 4I55A 3CC7V 2HKOA 1WJZA 4PDRA 3VOUA 5H9CA 2XUMA 3ABKC 4BAYA 4WF9V 1YI2V 4NTYA 1NVPD 4Q20A 4TOIA 3G80A 1QLEC 2HVKC 2VS0A 2KG7B 2XAGA 4J41A 5KHKA 2WLNA 1XMQO 2UUCO 1K7DA 2YEVB 3CEIA 3JCUZ 1KQSU 4I4TB 4MTGA 4PELA 5B1BB 5IWAB 3ABLC 4J7JA 5L3EA 1SKVA 4W4LA 4DRXB 1ZSPA 2Y69C 3CRMA 2YXHA 5IYCO 3ETQA 1VF7A 2EINC 4CC5A 1FXKA 4LF7B 4I55B 4WFAV 4PI0A 5EYPB 2NLJC 1VQKV 4O2BA 1QR9A 4JPRA 4UCSA 3GB7C 5J9PC 4DV0O 1BQ0A 5HFLA 4DO2A 3HKEB 4MW8A 2EIJB 4DR5O 1WNSA 5LBQA 4JI4B 3G67A 2QEXV 3RYFA 4O4LA 1ENVA 5LP6A 4PDLA 2ZDIA 2ZR2A 1BT8A 4DK0A 3E83A 1XOUA 2EX3A 1XNRB 4JTDB 2JGDA 5LL6Y 2NR5A 1MMMA 3N2KA 1QBZA 5CBHA 3JASB 3TK1A 4DK1A 4X65B 1W0JG 3LDDA 5B1AC 3MHHC 1GH6A 1D5AA 1GM7A 4XBFA 5LYJB 1H2LA 3I55V 4BR6A 1PM9A 3L74H 2CTPA 4WBNB 3CMEV 1HW7A 1SQVH 1QQCA 4X20A 2OIEA 2ITDC 1PNKA 1VQNV 3OEEG 1CPYA 4DR3O 3TCUA 1M57C 4DUZO 1XNRO 2QSAA 4JAVA 2FB5A 2EILB 3P3PA 4CH3A 4Z2WA 2HHHB 2RN9A 4JGSA 2WAMA 4YJ2A 2XAQA 3HKCA 3HR0A 2F1MA 3ZRSA 1IBMO 2EZPA 1QR8A 1JQ0A 1PL4A 2XAJA 4LFBB 4PV1B 3RWRD 2ETNA 3JAMN 3BEHA 1Q90D 2JJ2G 5H5NA 1HWYA 2P4VA 2WPDG 4X1KB 4GLXA 1RPOA 3LSUA 3LNMB 3E86A 3K5OA 3RVYA 1NJIW 3CPWU 1S5JA 3SYQA 3HKDB 4GUNA 1K5QA 2QE7G 1PL0A 4QGPA 5FLXN 2HG5C 2MW2B 4LFAB 1GAXA 2EIKC 3K3WA 5C93A 5JWPA 2CK3G 2UUAO 4NB5A 2DYSB 2R9AA 2GSMB 4CZZA 5LYJA 4OPHA 3F7VC 2B9ZA 2EJRA 4TSFG 4Q6GA 3OD4A 3GVMA 5KHHA 5TISZ 4LF4B 3AK3A 4ZHQB 4NKGB 5DEDA 4GKJO 2A7WA 3CXCU 3T1YB 3QO7A 2F4VO 4YJ3A 3L73H 4I50A 5KAFZ 2JK5C 1NR7A 4CBCA 2RDCA 2KSDA 3S3WA 1EZVH 3CRRA 2HLDG 4WFGA 1P7BA 1DF5A 1PD3A 1QCEA 1L8DA 3G71V 1ORQC 2R9IA 3EXAA 1R6TA 2AZ0A 4P30A 5KMGB 2YIAA 1YITV 3JCZA 1BMFG 2VQFO 2DMXA 4NTWA 2YEVA 2XT9A 1FPOA 2R72A 4FLYA 3HB3B 4UVCA 2EINB 1MOFA 3PN1A 4YHHB 3ZMZA 4DV1B 5KX5A 1XILA 4DR1B 1DK1A 2Q68A 3DC5A 4GKJB 5BR8B 1YIJV 2YSUB 1UJWB 3J81N 4LFAO 1OHHG 1Q6HA 4OX9O 2PUSA 1N4CA 1M90W 1H2GA 4DR7O 3WFVA 4E2LA 1S5HC 4LH6A 3FKSG 4C7UA 1H38A 1KBHA 2QWPB 2IW5A 3FFQA 3SJAC 3JYCA 4JI1B 2NN4A 2ZINA 1XREA 3ZX6A 3GWOA 4X64B 5KX5B 3L9DA 5B1AB 4LR3A 4R8CA 4FIPC 4LFBO 1VQOV 4MVUA 4PJ0Z 2CGNA 5A9GA 3UCSC 4YXWG 1K4DC 1AJNA 3RYCB 4H33A 2HHHO 2K1EA 5LMUB 4PD4F 3AK2A 2M6YA 4O2BB 3OUFA 2H8PC 3BCCH 2AHYA 2PF4E 3JSNA 3T4DA 5EBLC 1K92A 1YZBA 4OX9B 3JD4A 4H37A 4FFKA 3I5DA 4XDKA 3K5LA 2BTQB 1ZWIC 3TGUH 2E74B 2IJIA 4D6TH 1VQ6V 2CDYA 2QM7A 5EC2C 1I94B 1QNMA 2A9HA 1EZJA 4KFMA 2P06A 2KG7A 3OGCC 3K9AA 3OTFA 2P90A 1SQPH 2YS8A 5D5PA 2VWKA 2AW9A 3R65A 2KB1A 3J7AU 1IURA 1ZL8A 5KA5A 1JFFA 1VQMV 2AXTZ 1N32O 2ZNIA 4ICGA 4FVMA 3OGIB 4YJ3B 5LMUO 4J7ZA 4X1YA 4TV9A 3EHBB 3E8BA 2A06H 2Q67A 1GMGA 4FLVA 4B3TO 1JVMA 1GN6A 4KL1A 3CCVV 2R70A 2OCCC 3B4SA 3SYPA 2YICA 2LGWA 2HFEC 1YTFB 5BMVA 1J95A 4N21A 4FLUA 2UUCB 1IBMB 3APQA 3SPGA 4X64O 2ZE6A 3JAKB 4O4LB 1F4NA 3RYFB 1SQFA 4FZ0A 2FMLA 4F6RB 1KP2A 3B77A 1VF5B 5J2UB 2IU0A 3F5WC 1M93A 1M5IA 3N2GB 3BABA 1E1QG 1M56B 1OZ0A 2VQFB 1RP3B 2Q7EA 2V4DA 3NR7A 4CC6A 2DE0X 1OCRC 3UM7A 1NTZH 1K34A 1FXKB 1TUBB 5H2FZ 1FXVA 3K58A 5IE9A 2UU9O 3ZMVA 1P49A 3D3QA 1JX9A 4DV1O 1BGYH 4FM0A 1WLEA 3AG4C 3T1HO 4BIZA 2DYRB 2DW4A 3AG1C 1P84F 4RQFA 5AG2A 1XHXA 2DN9A 5CBGA 3CX5F 5KHJA 3U10A 4E4EA 4ZHQA 3ETDA 2CTWA 2A0LA 1WB8A 1KD1W 1OCZC 2IJKA 4FLXA 4JZGA 1SS3A 3ZMSA 2WA3A 2ZCEA 2ZXWB 5F2VO 5L3CA 5LP6B 1VQ5V 5KUKA 1HNXB 1M4UA 1OCCC 1XL4A 2JGDB 1H2KA 3ZHRA 4QE9A 5LHGA 4J9ZB 1XMOB 3SJQC 1R3LC 3BY6A 4HYOA 4AHCA 4LP8A 2GUZA 4LWSA 3SYOA 5JQGA 1TA8A 3QF7A 2GTAA 3ZJZA 2ATKC 3CCRV 1M56C 4DUYO 5IT9N 1OCOC 1VMGA 3B8NA 4QIWF 3ZHSA 1HR0O 3T1HB 3KCYA 3EFFK 4U7OA 4FZ1A 4JI8O 3A8TA 2UXDB 4DV3O 1NTKH 2BSKA 4DV5B 2R9RB 3QO5A 1JMKC 2Q7GA 4LH7A 5LHIA 1YVWA 2GTSA 1Y66A 1IX9A 1R1BA 1PNMA 4UFZA 1B04A 2DYRC 3AG1B 1HNWB 2FKXA 3HKBB 3ZRVA 2P7TC 2YIBA 1YHQV 3I56V 1B06A 3MAQA 3AG3B 1YTFD 1V54B 4X1YB 5IYZA 4FM1A 4DV6O 4KHPO 1UPGA 1JFFB 4HZ3A 3SPJA 5JVDA 2LGQA 2LW7A 2Y4UA 4GZRB 3ABKB 4JI1O 3ZN1A 4RUEA 1P7GA 4BW5A 2LJ2A 2WLMA 1Q7YW 2BOBC 5CA0A 3X2QB 3D3IA 1QLEB 4O4JA 2JS3A 5L3FA 2ZD9A 3ZHVA 2EIMB 2CUGA 4I0XB 3K04A 3QO8A 1GK9A 3ABUA 5CN0A 5BY1A 1K9MW 4IIJB 4R7CA 1P4RA 1JR9A 1NR1A 3IAYA 1H8EG 1M57B 4B08A 3SJBC 1NKDA 4JAAA 2X6CA 5DM6V 3ASNB 5LMNB 4FFBB 3PJSK 4EB6B 1W2BU 1Y76A 1AI7A 4IGGA 3H1IH 4UCOA 3C90A 4H13B 5B1BC 1ZLZA 4LF9O 4LCUC 3UO3A 2O57A 2WLJA 3FB5C 4AILC 3ZN0A 2HP8A 4FPPA 5GW7A 3RYCA 4JI8B 4J80A 1A32A 3FAVA 1FKAO 4JI2B 1ZTEA 3K0DA 4GKKB 3NXSA 1COWG 2E3CA 3JAWB 3LSSA 3FX7A 4GX0A 2Q9LA 2E75B 1SQBH 1W59A 2ZDIC 2X0LA 2OCHA 3ETGA 3U11A 4DR4O 1V55B 5FNVA 3FB6C 4B7EA 3LNNA 4JYAB 4LF7O 2IJJA 1ROPA 1SA0B 3JATA 4OPAA 4UB6Z 1KU9A 3QVNA 3OTOO 2F23A 2VQEO 3ASOC 2WLIA 3A2FA 4QJFB 3T1YO 4MVMA 3W7SA 1KUQA 5B3SB 3JARA 4PA7A 2Z5UA 4X66B 3JALA 3D36C 4DV2B 2JEUA 3Q4HB 3O65A 2N05A 2ZE7A 1NI8A 4GCZA 4K3AA 4DR7B 3RGBA 2N74A 4ZOLB 2JJ1G 2HR3A 4UCUA 1JCHA 5HFMA 5CA3A 2Q73A 5EBWC 1MZEA 1S76D 1D5NA 4RO2A 3E8GA 4U3FH 5H6RA 2DWEC 2GUZB 5JQGB 3E22A 3CCLV 4TV8A 3LDEA 4JI3B 2JIZG 3FYEB 2YC0A 3K59A 4I5SA 4KUMA 1U97A 4O4IB 1KMIZ 3M8AA 3W7TA 2ILMA 4KP4A 4NR1A 1SZXA 1G4YB 2ZR3A 1Q82W 5KAIZ 3HKBA 4OGQB 5LOVB 1IBLB 5JJEB 1QHTA 2DYSC 4X1KA 3VQXA 4AQYB 5LHHA 1SETA 1HR0B 1S72V 5IYDO 1IDSA 3BHPA 5J2TB 3SGIA 3E89A 4LF6B 3DGEA 2HEPA 4DUYB 4GKKO 4ABMA 3JD1A 2X6AA 2VRZA 4B3SO 1S5LZ 2BOCC 1BS3A 1XQ8A 3X2QC 3H1HH 1CP9A 4TUYA 2UXBB 4ZIBA 2LP7A 2QDOA 2WLLB 1WPBA 5GTHZ 3DC6A 1Z2GA 4DW1A 3RYIA 3OMIB 1Q8IA 3WU2Z 1GKFA 3Q4HA 2PGGA 2L6LA 4FMTA 1E79G 1DGSA 1H2MA 2XASA 3RW0A 2YI9A 1JA8A 2XAFA 3HKCB 3IC7A 4DR2O 2XHBA 3K9SA 1PKXA 1WAZA 1US6A 4FK5C 5IJ0A 5LP6C 4LFCO 2ZXWC 4O4IA 4IL6Z 2JVDA 4MVSA 4ZI7A 1EN4A 4FJCC 1EM1A 1NBMG 1WA8A 2P67A 2P22C 4FLZA 4MS2A 3OEHG 1I0HA 3OW2U 1VQ4V 3P30A 1RM1B 3BA8A 1Q3EA 5KHIA 4PA9A 4NXNO 4BIOA 3MD0A 1HDJA 4MVZA 1N34O 1G1XB 2RCVA 1JJ2U 1AROP 2ZIMA 4O4HA 5B1NA 1Y74B 4QE7A 1R6KA 3K0GA 4QPKA 3L72H 4IIJA 2V7QG 3JAKA 5FPRA 3QNEA 3N27A 3ZIAG 4H44B 4ASUG 1GN3A 1EBOA 3H01A 4L87A 5KMGA 3STZC 2OIGA 2EZOA 5C8YA 4DUZB 1MSWD 4GT1A 3CCQV 1I94O 3OE7G 3BFRA 4GX5A 2CH7B 3ZEDA 2QGNA 5IYBO 2UUBO 2IBZH 1V54C 4L8JA 1K73W 5LGTA 4G28B 4KHPB 1AVMA 3BAAA 4FLTA 1KYOF 3B09A 1B6QA 3AEIA 5KHGA 2PYLA 1O9HA 2PY5A 1G6UA 4DR6O 1VQLV 3UO2A 4MSWC 3RN4A 5LXTB 2PZSA 1YDXA 2UXCO 1B3QA 1WA8B 5KUMA 4B3MO 1OCOB 1Z5WA 1KC8W 1AB3A 2CE4A 1VQPV 3CCUV 1YXBA 3CCSV 3E8HA 5B3SC 3JD3A 4O4JB 4N23A 2W0XA 3P32A 2ZE5A 3SYAA 4DV0B 1R6NA 4UUJC 3G6EV 1KKDA 3K79A 4WFBV 1R73A 4LF5B 1MG1A 5FL7G 4JI6O 1S0VA 4DXWA 1H8HG 4TUYB 4DV4O 3STLC 2Y0IA 4X89A 1LUWA 2QR4A 4G2KA 1TVKA 4U3JB 2DOSA 3WB1A 4EB6A 1WP7A 3FD9A 4FFBA 5IJ0B 2BTOA 4CH6A 3RVZA 2PI4A 3CHXA 4F4LA 4G27B 5JCOC 4TT3G 4JI5B 4EKWA 3CXHF 2YXYA 1FD9A 4MVQA 4ZI7B 3MHSC 1WN7A 5CA0B 5JH7A 2LO1A 4D7SA 4MTFA 1BQZA 2YDEA 1CXZB 1NTMH 1SQQH 2EULA 3A0BZ 4UCTA 1XL6A 5DECA 2WA4A 2Q0OC 3SPIA 4HNAB 1NH2D 4JZ2A 1RPRA 4HBNA 4TV8B 2WLLA 4GX2A 1Q6UA 4NVPA 3OMAB 4MTXA 2D2CB 3HKDA 4J11A 4KXRA 1IBKB 1S3JA 1VEWA 3BPZA 1H2NA 3A0HZ 2EIMC 1IBLO 4RQEA 1RSOB 1TUEB 3K57A 3SR2C 1Q6IA 3VQYA 3K06A 4CS2A 3T4ZA 5E79Z 2QJ1A 1FYJA 1IBKO 3QG5A 2EJ7A 1TGOA 4WCEV 3BRCA 1YJWV 1NU1H 4LNUA 4UVBA 2JEXA 3E22B 1PV0A 2IH3C 2Q0AA 2OTJV 1VQ8V 2YUAA 4QNHB 3ASNC 4JYCA 1ZUQA 2RNBA 2ODMA 2Q6AA 3RT3C 4J9YB 4ZOLA 3ZRWB 1ZAUA 4LNUB 5L3DA 1SRYA 2Q4PA 3N2GA 1F4MA 4HNAA 3M99B 2LFRA 4WFEA 2B5UA 1MNGA 2JGUA 4UVAA 1VARA 3OR6C 4PA3A 3VQWA 1CEZA 1D2DA 4K0KO 1VF6A 3TXSA 1AJPA 1GTOA 5CBFA 3T2MA 4YJ2B 2OWOA 4CH4A 5LGUA 4TQFA 2HJFC 4DW0A 1I7FA 3AG2C 2C2AA 1BL8A 5E1AC 3UQ8A 3L75H 1V55C 3OAAG 2DQ3A 2X6BA 4B3TB 3ZS8C 2ZNJA 1QU7A 1FJGO 2QWNB 5LMNO 1X4TA 3MDSA 3FB7C 2E5LB 1TAEA 2FL4A 2XAHA 3W7WA 2RMKB 4DV2O 1FS0G 1YF2A 2H3OA 4JV5B 3RYHA 4DYLA 5CA1B 1YCIA 3CP1A 1JOYA 1SA0A 2QTOA 3JALB 4IHJB 2GBOA 4RAIA 3KZIZ 1N33O 2E5LO 4X62O 4J10A 2ZIOA 4TWKA 2BTQA 3GWKC 3JD2A 4YY3O 4U3JA 1FAFA 1OCZB 3CJHA 3CRAA 1GM9A 3RYHB 1OV9A 3FYIB 1OCRB 1SESA 3EVKA 5JVDB 3ZHQA 4JI0B 4DV3B 2UXBO 2CTRA 3E35A 5LGNA 3CS5A 2Q5ZA 3ABMC 4XDJA 3ZHUA 3THOA 2OYQA 4W4KA 4CS3A 5IYZB 4LF8O 4X62B 3WB2A 1AI5A 1Q43A 1EN6A 1M9NA 3N2KB 5B1OA 1K97A 4DR5B 4AQYO 4JTAB 2EIJC 3FAVB 1YJNV 2WLKA 3AG3C 5L3GA 1L0LH 4GYCB 1K8AW 4B3RO 1OCCB 4B7KA 1K4CC 2DQ0A 3RYIB 4X8AA 3E2EA 1Y74A 4R6ZA 3JD0A 2LQTA 4BIUA 2DJVA 1IXBA 1XBLA 3UT5B 1Q86W 2E76B 5CA1A 4FM2A 1MA1A 1O9GA 4MTOA 2MK3A 3OUSA 2UU9B 2EIKB 3LDCA 2HVJC 2G38A 1VQ9V 1NS1A 1XNQO 5K1PA 1FFXB 2JS5A 3D36A 3ICXA 3CD6V 2JRIA 4J42A 3CCJV 2Y69B 3LSQA 3BVOA 2DWDC 5GTIZ 1I5XA 3DTUB 2QM8A 5ITZA 1BZKA 3ETEA 2F95B 4J7KA 3KCXA 4JI5O 4PDVA 2CAZC 1IZ3A 3CSXA 3BA9A 4F6EA 1E1RG 2GV9A 1AILA 2A3QA 2GHYA 3DXRB 3P3NA 3RBZA 3W7XA 4JASA 1R3IC 4YHHO 1LNQA 1YSCA 2ITCC 4B3SB 2VQEB 3AG4B 4WBNA 3E8FA 3ZRWA 1HNWO 5A2QN 1I08A 3WG7B 3CB2A 4DV7O 4JI6B 4CS4A 2V1DA 1EFRG 1LUVA 1BHBA 5JJJB 1N36O 2HJDA 4LF5O 5H6QA 3CRCA 4R50A 2PI5A 3IGAC 1Y6XA 3C3TA 4JF3A 4P2ZA 5EIBC 3ZHTA 2QWRB 3G4SV 1N0JA 3D8CA 2AZ2A 2YI8A 4JI7B 1RSOA 4UCVA 3WB0A 1N8RW 4UB8Z 2LFSA 2LW1A 4K8ZA 5BMVB 4JTCB 2CTQA 4JI2O 4P9PA 2IJHA 1K5SA 1W0KG 2FTKA 1AP6A 1XDCA 3SDLA 1MABG 3S3XA 5J2UA 4MVRA 4JAUA 3QTCA 4PA6A 4LF4O 5KLVH 1T5EA 5CMUA 5IY5B 1XI1A 2KQXA 5L3BA 4YY3B 2Q69A 1XHZA 3KKYA 2H94A 1TUBA 3CRQA 3CYOA 2Y48A 1L0NH 5EBMC 2Z0AA 4I4TA 1VQ7V 1R3JC 3CC4V 2D3OW 4NXNB 4JI7O 3H1LH 2ZQMA 2P5OA 2IM9A 1RFYA 4Z1MG 1FFXA 5JH7B 3OR7C 4XDLA 4JYBA 1K3EA 1SC5B 4JV5O 3ABTA 3JARB 1JJOA 5EIBD 1BCCH 3FB8C 5JCOA 1KKCA 1LR1A 3M7MX 4PA4A 2ZE8A 2L35A 3B8MA 5EYPA 1FJGB 1NVPB 1N32B 2OT5A 3LUTB 2UXXA 4D7TA 4OXSA 4X1IA 3F5TA 2PYJA 5B5EZ 2QKCA 1Y4MA 5D5QA 4DV6B 4DRXA 4LFCB 1SF9A 5FNVB
chains in the Genus database with same CATH topology
2Q8VA 3CS5A 1OJHA 2QDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8V A;  3CS5 A;  1OJH A;  2QDO A; 
#chains in the Genus database with same CATH topology
 4X65 O;  1NQT A;  2IH1 C;  2XND G;  4DR1 O;  5CB4 A;  3CWB H;  1PPJ H;  1QVF U;  2YXL A;  2RJZ A;  5JJN B;  5GON B;  4LC1 A;  4YIO A;  3ZBH A;  1VF6 C;  1DF4 A;  3K5N A;  5LXT A;  1NT2 B;  2ZM6 O;  1F7Y A;  4X20 B;  3IC9 A;  4O2A B;  2AHZ A;  2P6J A;  4TV9 B;  3DXR A;  3C3S A;  3ML0 A;  4AI8 A;  4P9O A;  4BW9 A;  3J80 N;  5IDJ A;  3CE2 A;  1IXM A;  3WG7 C;  3H1K H;  1VIB A;  3L71 H;  4LBE C;  3JAW A;  4LF8 B;  1VP7 A;  1NH2 B;  4JYA O;  1XMO O;  1M1K W;  1SZT A;  4I9W A;  1K33 A;  1N0N A;  4PDM A;  3SJC C;  1BSM A;  1DLB A;  3TXQ A;  4K8X A;  5EZY A;  1S77 D;  2GDS A;  1YJ9 V;  2N04 A;  1AI4 A;  1AJQ A;  1ZX3 A;  3K08 A;  1H2S B;  3K03 A;  3ZMU A;  2X7R B;  2KKW A;  2VWJ A;  3ZCC A;  1SQX H;  2QKA A;  1QLN A;  1MSD A;  3ZRX A;  1XNQ B;  4O4H B;  1Y76 B;  2WSS G;  2UUA B;  4PI2 A;  1XUQ A;  5K1X A;  4JI0 O;  1GN2 A;  1AR4 A;  4MT8 A;  1NZ6 A;  4IT5 A;  4QPJ A;  2NNU A;  4NTX A;  5EZY B;  3CCM V;  3OT7 A;  2B1I A;  2OCC B;  1PP9 H;  3R66 A;  1BHA A;  3U0Z A;  1QVG U;  3OMN B;  4X66 O;  1MZF A;  3O9O A;  3SPC A;  4UV9 A;  1RM1 C;  4I50 B;  3JSL A;  3F7Y C;  3TJT A;  3SPH A;  1THZ A;  2OTL V;  4H0L B;  3ZMT A;  3CJH B;  2UXC B;  2Y0P A;  2YIB D;  1G8M A;  2M7W A;  2P4K A;  5BXZ A;  4B3R B;  2A79 B;  4GX1 A;  4X88 A;  5CB4 B;  5GON A;  1PNL A;  4WFF A;  2QA4 V;  4X9Q A;  3OTO B;  3ABL B;  2IU3 A;  5LA6 A;  2UUB B;  4CH5 A;  5IJ9 A;  4NXM B;  2W0F C;  5J2T A;  3CMA V;  2BSK B;  4MVO A;  1IVS A;  3TET A;  4I0X A;  3SYC A;  1HNZ B;  4I7Z B;  1L1F A;  1N33 B;  4K0K B;  1SQG A;  4WFH A;  1V9P A;  3IJ4 A;  1GRJ A;  1R3K C;  3L70 H;  1J5E B;  4DR6 B;  4X1I B;  5EK0 A;  1SER A;  2F66 C;  3W7U A;  4IYH A;  1OJH A;  3G6B A;  1F51 A;  1Z5V A;  2QKS A;  1U96 A;  2QM4 A;  5DN6 G;  1Q5O A;  1YEW A;  1URF A;  4TQD A;  4LWS B;  2EIL C;  4HAM A;  3OFN G;  2QWO B;  5B66 Z;  1HNZ O;  1ZL8 B;  1N34 B;  2UXN A;  1WP8 A;  5FPO A;  1GM8 A;  3A0R A;  2F43 G;  2Q7H A;  4K35 A;  5KA6 A;  4UXN A;  5IWA O;  4ZKI A;  5IJ9 B;  2YID A;  4PHZ A;  4UCR A;  3VBB A;  3UKM A;  4ZBM A;  4FLW A;  2EBO A;  4DR2 B;  2Y4T A;  3H1J H;  3OM3 B;  2AGA A;  4YIP A;  1AP5 A;  3B40 A;  1GN4 A;  2QWQ B;  4DR4 B;  2RQ6 A;  1KB9 F;  2K9P A;  2Q8V A;  3UT5 A;  2F93 B;  2Z3Y A;  2XOK G;  1XEQ A;  1FXH A;  2CGO A;  4MW3 A;  3ABM B;  4EEQ A;  4UV8 A;  2UXD O;  3H9V A;  3T1C A;  1BE3 H;  1JPX A;  5LA6 B;  1Q81 W;  1F23 A;  4RUF A;  5LOV A;  2ZT9 B;  1UFI A;  3KG2 A;  2WWW A;  3HKE A;  4DR3 B;  5BZB A;  1KP3 A;  3JAS A;  2XTA A;  3VQV A;  1Y67 A;  2B1G A;  4LF6 O;  3AG2 B;  2WLI B;  4Z1V A;  3HPL C;  4LF9 B;  5BR8 O;  1DTO A;  1KEC A;  1EN5 A;  1FXK C;  1N36 B;  2W6J G;  4U7N A;  1X59 A;  1J5E O;  4JYY A;  3RFR A;  1I5Y A;  4NYK A;  2BE3 A;  4O2A A;  4DV7 B;  4RWU A;  1WB7 A;  4DV4 B;  5IY5 C;  3K5M A;  3DSQ A;  4NXM O;  3APO A;  3ASO B;  2JDI G;  1TVK B;  4JI4 O;  2F4V B;  2FYU H;  5C8Y B;  2PTM A;  1AR5 A;  1HNX O;  5ITZ B;  2ZM6 B;  4DV5 O;  4F6R A;  2CH7 A;  4IYI A;  4BWA A;  2WLH A;  4A5U B;  1XMQ B;  2ADQ B;  3B2E E;  2ARH A;  1AI6 A;  3CCE V;  2W6I G;  3AG7 A;  1AR1 B;  2QTS A;  1HP8 A;  2ADP A;  1GO3 F;  4IHJ A;  4EFE A;  4B3M B;  1FFT B;  4JI3 O;  3IFX A;  5EC1 C;  3CC2 V;  2BCC H;  3AK1 A;  1WPX A;  3JAT B;  2ZKO A;  4I9Q A;  4EFB A;  4I55 A;  3CC7 V;  2HKO A;  1WJZ A;  4PDR A;  3VOU A;  5H9C A;  2XUM A;  3ABK C;  4BAY A;  4WF9 V;  1YI2 V;  4NTY A;  1NVP D;  4Q20 A;  4TOI A;  3G80 A;  1QLE C;  2HVK C;  2VS0 A;  2KG7 B;  2XAG A;  4J41 A;  5KHK A;  2WLN A;  1XMQ O;  2UUC O;  1K7D A;  2YEV B;  3CEI A;  3JCU Z;  1KQS U;  4I4T B;  4MTG A;  4PEL A;  5B1B B;  5IWA B;  3ABL C;  4J7J A;  5L3E A;  1SKV A;  4W4L A;  4DRX B;  1ZSP A;  2Y69 C;  3CRM A;  2YXH A;  5IYC O;  3ETQ A;  1VF7 A;  2EIN C;  4CC5 A;  1FXK A;  4LF7 B;  4I55 B;  4WFA V;  4PI0 A;  5EYP B;  2NLJ C;  1VQK V;  4O2B A;  1QR9 A;  4JPR A;  4UCS A;  3GB7 C;  5J9P C;  4DV0 O;  1BQ0 A;  5HFL A;  4DO2 A;  3HKE B;  4MW8 A;  2EIJ B;  4DR5 O;  1WNS A;  5LBQ A;  4JI4 B;  3G67 A;  2QEX V;  3RYF A;  4O4L A;  1ENV A;  5LP6 A;  4PDL A;  2ZDI A;  2ZR2 A;  1BT8 A;  4DK0 A;  3E83 A;  1XOU A;  2EX3 A;  1XNR B;  4JTD B;  2JGD A;  5LL6 Y;  2NR5 A;  1MMM A;  3N2K A;  1QBZ A;  5CBH A;  3JAS B;  3TK1 A;  4DK1 A;  4X65 B;  1W0J G;  3LDD A;  5B1A C;  3MHH C;  1GH6 A;  1D5A A;  1GM7 A;  4XBF A;  5LYJ B;  1H2L A;  3I55 V;  4BR6 A;  1PM9 A;  3L74 H;  2CTP A;  4WBN B;  3CME V;  1HW7 A;  1SQV H;  1QQC A;  4X20 A;  2OIE A;  2ITD C;  1PNK A;  1VQN V;  3OEE G;  1CPY A;  4DR3 O;  3TCU A;  1M57 C;  4DUZ O;  1XNR O;  2QSA A;  4JAV A;  2FB5 A;  2EIL B;  3P3P A;  4CH3 A;  4Z2W A;  2HHH B;  2RN9 A;  4JGS A;  2WAM A;  4YJ2 A;  2XAQ A;  3HKC A;  3HR0 A;  2F1M A;  3ZRS A;  1IBM O;  2EZP A;  1QR8 A;  1JQ0 A;  1PL4 A;  2XAJ A;  4LFB B;  4PV1 B;  3RWR D;  2ETN A;  3JAM N;  3BEH A;  1Q90 D;  2JJ2 G;  5H5N A;  1HWY A;  2P4V A;  2WPD G;  4X1K B;  4GLX A;  1RPO A;  3LSU A;  3LNM B;  3E86 A;  3K5O A;  3RVY A;  1NJI W;  3CPW U;  1S5J A;  3SYQ A;  3HKD B;  4GUN A;  1K5Q A;  2QE7 G;  1PL0 A;  4QGP A;  5FLX N;  2HG5 C;  2MW2 B;  4LFA B;  1GAX A;  2EIK C;  3K3W A;  5C93 A;  5JWP A;  2CK3 G;  2UUA O;  4NB5 A;  2DYS B;  2R9A A;  2GSM B;  4CZZ A;  5LYJ A;  4OPH A;  3F7V C;  2B9Z A;  2EJR A;  4TSF G;  4Q6G A;  3OD4 A;  3GVM A;  5KHH A;  5TIS Z;  4LF4 B;  3AK3 A;  4ZHQ B;  4NKG B;  5DED A;  4GKJ O;  2A7W A;  3CXC U;  3T1Y B;  3QO7 A;  2F4V O;  4YJ3 A;  3L73 H;  4I50 A;  5KAF Z;  2JK5 C;  1NR7 A;  4CBC A;  2RDC A;  2KSD A;  3S3W A;  1EZV H;  3CRR A;  2HLD G;  4WFG A;  1P7B A;  1DF5 A;  1PD3 A;  1QCE A;  1L8D A;  3G71 V;  1ORQ C;  2R9I A;  3EXA A;  1R6T A;  2AZ0 A;  4P30 A;  5KMG B;  2YIA A;  1YIT V;  3JCZ A;  1BMF G;  2VQF O;  2DMX A;  4NTW A;  2YEV A;  2XT9 A;  1FPO A;  2R72 A;  4FLY A;  3HB3 B;  4UVC A;  2EIN B;  1MOF A;  3PN1 A;  4YHH B;  3ZMZ A;  4DV1 B;  5KX5 A;  1XIL A;  4DR1 B;  1DK1 A;  2Q68 A;  3DC5 A;  4GKJ B;  5BR8 B;  1YIJ V;  2YSU B;  1UJW B;  3J81 N;  4LFA O;  1OHH G;  1Q6H A;  4OX9 O;  2PUS A;  1N4C A;  1M90 W;  1H2G A;  4DR7 O;  3WFV A;  4E2L A;  1S5H C;  4LH6 A;  3FKS G;  4C7U A;  1H38 A;  1KBH A;  2QWP B;  2IW5 A;  3FFQ A;  3SJA C;  3JYC A;  4JI1 B;  2NN4 A;  2ZIN A;  1XRE A;  3ZX6 A;  3GWO A;  4X64 B;  5KX5 B;  3L9D A;  5B1A B;  4LR3 A;  4R8C A;  4FIP C;  4LFB O;  1VQO V;  4MVU A;  4PJ0 Z;  2CGN A;  5A9G A;  3UCS C;  4YXW G;  1K4D C;  1AJN A;  3RYC B;  4H33 A;  2HHH O;  2K1E A;  5LMU B;  4PD4 F;  3AK2 A;  2M6Y A;  4O2B B;  3OUF A;  2H8P C;  3BCC H;  2AHY A;  2PF4 E;  3JSN A;  3T4D A;  5EBL C;  1K92 A;  1YZB A;  4OX9 B;  3JD4 A;  4H37 A;  4FFK A;  3I5D A;  4XDK A;  3K5L A;  2BTQ B;  1ZWI C;  3TGU H;  2E74 B;  2IJI A;  4D6T H;  1VQ6 V;  2CDY A;  2QM7 A;  5EC2 C;  1I94 B;  1QNM A;  2A9H A;  1EZJ A;  4KFM A;  2P06 A;  2KG7 A;  3OGC C;  3K9A A;  3OTF A;  2P90 A;  1SQP H;  2YS8 A;  5D5P A;  2VWK A;  2AW9 A;  3R65 A;  2KB1 A;  3J7A U;  1IUR A;  1ZL8 A;  5KA5 A;  1JFF A;  1VQM V;  2AXT Z;  1N32 O;  2ZNI A;  4ICG A;  4FVM A;  3OGI B;  4YJ3 B;  5LMU O;  4J7Z A;  4X1Y A;  4TV9 A;  3EHB B;  3E8B A;  2A06 H;  2Q67 A;  1GMG A;  4FLV A;  4B3T O;  1JVM A;  1GN6 A;  4KL1 A;  3CCV V;  2R70 A;  2OCC C;  3B4S A;  3SYP A;  2YIC A;  2LGW A;  2HFE C;  1YTF B;  5BMV A;  1J95 A;  4N21 A;  4FLU A;  2UUC B;  1IBM B;  3APQ A;  3SPG A;  4X64 O;  2ZE6 A;  3JAK B;  4O4L B;  1F4N A;  3RYF B;  1SQF A;  4FZ0 A;  2FML A;  4F6R B;  1KP2 A;  3B77 A;  1VF5 B;  5J2U B;  2IU0 A;  3F5W C;  1M93 A;  1M5I A;  3N2G B;  3BAB A;  1E1Q G;  1M56 B;  1OZ0 A;  2VQF B;  1RP3 B;  2Q7E A;  2V4D A;  3NR7 A;  4CC6 A;  2DE0 X;  1OCR C;  3UM7 A;  1NTZ H;  1K34 A;  1FXK B;  1TUB B;  5H2F Z;  1FXV A;  3K58 A;  5IE9 A;  2UU9 O;  3ZMV A;  1P49 A;  3D3Q A;  1JX9 A;  4DV1 O;  1BGY H;  4FM0 A;  1WLE A;  3AG4 C;  3T1H O;  4BIZ A;  2DYR B;  2DW4 A;  3AG1 C;  1P84 F;  4RQF A;  5AG2 A;  1XHX A;  2DN9 A;  5CBG A;  3CX5 F;  5KHJ A;  3U10 A;  4E4E A;  4ZHQ A;  3ETD A;  2CTW A;  2A0L A;  1WB8 A;  1KD1 W;  1OCZ C;  2IJK A;  4FLX A;  4JZG A;  1SS3 A;  3ZMS A;  2WA3 A;  2ZCE A;  2ZXW B;  5F2V O;  5L3C A;  5LP6 B;  1VQ5 V;  5KUK A;  1HNX B;  1M4U A;  1OCC C;  1XL4 A;  2JGD B;  1H2K A;  3ZHR A;  4QE9 A;  5LHG A;  4J9Z B;  1XMO B;  3SJQ C;  1R3L C;  3BY6 A;  4HYO A;  4AHC A;  4LP8 A;  2GUZ A;  4LWS A;  3SYO A;  5JQG A;  1TA8 A;  3QF7 A;  2GTA A;  3ZJZ A;  2ATK C;  3CCR V;  1M56 C;  4DUY O;  5IT9 N;  1OCO C;  1VMG A;  3B8N A;  4QIW F;  3ZHS A;  1HR0 O;  3T1H B;  3KCY A;  3EFF K;  4U7O A;  4FZ1 A;  4JI8 O;  3A8T A;  2UXD B;  4DV3 O;  1NTK H;  2BSK A;  4DV5 B;  2R9R B;  3QO5 A;  1JMK C;  2Q7G A;  4LH7 A;  5LHI A;  1YVW A;  2GTS A;  1Y66 A;  1IX9 A;  1R1B A;  1PNM A;  4UFZ A;  1B04 A;  2DYR C;  3AG1 B;  1HNW B;  2FKX A;  3HKB B;  3ZRV A;  2P7T C;  2YIB A;  1YHQ V;  3I56 V;  1B06 A;  3MAQ A;  3AG3 B;  1YTF D;  1V54 B;  4X1Y B;  5IYZ A;  4FM1 A;  4DV6 O;  4KHP O;  1UPG A;  1JFF B;  4HZ3 A;  3SPJ A;  5JVD A;  2LGQ A;  2LW7 A;  2Y4U A;  4GZR B;  3ABK B;  4JI1 O;  3ZN1 A;  4RUE A;  1P7G A;  4BW5 A;  2LJ2 A;  2WLM A;  1Q7Y W;  2BOB C;  5CA0 A;  3X2Q B;  3D3I A;  1QLE B;  4O4J A;  2JS3 A;  5L3F A;  2ZD9 A;  3ZHV A;  2EIM B;  2CUG A;  4I0X B;  3K04 A;  3QO8 A;  1GK9 A;  3ABU A;  5CN0 A;  5BY1 A;  1K9M W;  4IIJ B;  4R7C A;  1P4R A;  1JR9 A;  1NR1 A;  3IAY A;  1H8E G;  1M57 B;  4B08 A;  3SJB C;  1NKD A;  4JAA A;  2X6C A;  5DM6 V;  3ASN B;  5LMN B;  4FFB B;  3PJS K;  4EB6 B;  1W2B U;  1Y76 A;  1AI7 A;  4IGG A;  3H1I H;  4UCO A;  3C90 A;  4H13 B;  5B1B C;  1ZLZ A;  4LF9 O;  4LCU C;  3UO3 A;  2O57 A;  2WLJ A;  3FB5 C;  4AIL C;  3ZN0 A;  2HP8 A;  4FPP A;  5GW7 A;  3RYC A;  4JI8 B;  4J80 A;  1A32 A;  3FAV A;  1FKA O;  4JI2 B;  1ZTE A;  3K0D A;  4GKK B;  3NXS A;  1COW G;  2E3C A;  3JAW B;  3LSS A;  3FX7 A;  4GX0 A;  2Q9L A;  2E75 B;  1SQB H;  1W59 A;  2ZDI C;  2X0L A;  2OCH A;  3ETG A;  3U11 A;  4DR4 O;  1V55 B;  5FNV A;  3FB6 C;  4B7E A;  3LNN A;  4JYA B;  4LF7 O;  2IJJ A;  1ROP A;  1SA0 B;  3JAT A;  4OPA A;  4UB6 Z;  1KU9 A;  3QVN A;  3OTO O;  2F23 A;  2VQE O;  3ASO C;  2WLI A;  3A2F A;  4QJF B;  3T1Y O;  4MVM A;  3W7S A;  1KUQ A;  5B3S B;  3JAR A;  4PA7 A;  2Z5U A;  4X66 B;  3JAL A;  3D36 C;  4DV2 B;  2JEU A;  3Q4H B;  3O65 A;  2N05 A;  2ZE7 A;  1NI8 A;  4GCZ A;  4K3A A;  4DR7 B;  3RGB A;  2N74 A;  4ZOL B;  2JJ1 G;  2HR3 A;  4UCU A;  1JCH A;  5HFM A;  5CA3 A;  2Q73 A;  5EBW C;  1MZE A;  1S76 D;  1D5N A;  4RO2 A;  3E8G A;  4U3F H;  5H6R A;  2DWE C;  2GUZ B;  5JQG B;  3E22 A;  3CCL V;  4TV8 A;  3LDE A;  4JI3 B;  2JIZ G;  3FYE B;  2YC0 A;  3K59 A;  4I5S A;  4KUM A;  1U97 A;  4O4I B;  1KMI Z;  3M8A A;  3W7T A;  2ILM A;  4KP4 A;  4NR1 A;  1SZX A;  1G4Y B;  2ZR3 A;  1Q82 W;  5KAI Z;  3HKB A;  4OGQ B;  5LOV B;  1IBL B;  5JJE B;  1QHT A;  2DYS C;  4X1K A;  3VQX A;  4AQY B;  5LHH A;  1SET A;  1HR0 B;  1S72 V;  5IYD O;  1IDS A;  3BHP A;  5J2T B;  3SGI A;  3E89 A;  4LF6 B;  3DGE A;  2HEP A;  4DUY B;  4GKK O;  4ABM A;  3JD1 A;  2X6A A;  2VRZ A;  4B3S O;  1S5L Z;  2BOC C;  1BS3 A;  1XQ8 A;  3X2Q C;  3H1H H;  1CP9 A;  4TUY A;  2UXB B;  4ZIB A;  2LP7 A;  2QDO A;  2WLL B;  1WPB A;  5GTH Z;  3DC6 A;  1Z2G A;  4DW1 A;  3RYI A;  3OMI B;  1Q8I A;  3WU2 Z;  1GKF A;  3Q4H A;  2PGG A;  2L6L A;  4FMT A;  1E79 G;  1DGS A;  1H2M A;  2XAS A;  3RW0 A;  2YI9 A;  1JA8 A;  2XAF A;  3HKC B;  3IC7 A;  4DR2 O;  2XHB A;  3K9S A;  1PKX A;  1WAZ A;  1US6 A;  4FK5 C;  5IJ0 A;  5LP6 C;  4LFC O;  2ZXW C;  4O4I A;  4IL6 Z;  2JVD A;  4MVS A;  4ZI7 A;  1EN4 A;  4FJC C;  1EM1 A;  1NBM G;  1WA8 A;  2P67 A;  2P22 C;  4FLZ A;  4MS2 A;  3OEH G;  1I0H A;  3OW2 U;  1VQ4 V;  3P30 A;  1RM1 B;  3BA8 A;  1Q3E A;  5KHI A;  4PA9 A;  4NXN O;  4BIO A;  3MD0 A;  1HDJ A;  4MVZ A;  1N34 O;  1G1X B;  2RCV A;  1JJ2 U;  1ARO P;  2ZIM A;  4O4H A;  5B1N A;  1Y74 B;  4QE7 A;  1R6K A;  3K0G A;  4QPK A;  3L72 H;  4IIJ A;  2V7Q G;  3JAK A;  5FPR A;  3QNE A;  3N27 A;  3ZIA G;  4H44 B;  4ASU G;  1GN3 A;  1EBO A;  3H01 A;  4L87 A;  5KMG A;  3STZ C;  2OIG A;  2EZO A;  5C8Y A;  4DUZ B;  1MSW D;  4GT1 A;  3CCQ V;  1I94 O;  3OE7 G;  3BFR A;  4GX5 A;  2CH7 B;  3ZED A;  2QGN A;  5IYB O;  2UUB O;  2IBZ H;  1V54 C;  4L8J A;  1K73 W;  5LGT A;  4G28 B;  4KHP B;  1AVM A;  3BAA A;  4FLT A;  1KYO F;  3B09 A;  1B6Q A;  3AEI A;  5KHG A;  2PYL A;  1O9H A;  2PY5 A;  1G6U A;  4DR6 O;  1VQL V;  3UO2 A;  4MSW C;  3RN4 A;  5LXT B;  2PZS A;  1YDX A;  2UXC O;  1B3Q A;  1WA8 B;  5KUM A;  4B3M O;  1OCO B;  1Z5W A;  1KC8 W;  1AB3 A;  2CE4 A;  1VQP V;  3CCU V;  1YXB A;  3CCS V;  3E8H A;  5B3S C;  3JD3 A;  4O4J B;  4N23 A;  2W0X A;  3P32 A;  2ZE5 A;  3SYA A;  4DV0 B;  1R6N A;  4UUJ C;  3G6E V;  1KKD A;  3K79 A;  4WFB V;  1R73 A;  4LF5 B;  1MG1 A;  5FL7 G;  4JI6 O;  1S0V A;  4DXW A;  1H8H G;  4TUY B;  4DV4 O;  3STL C;  2Y0I A;  4X89 A;  1LUW A;  2QR4 A;  4G2K A;  1TVK A;  4U3J B;  2DOS A;  3WB1 A;  4EB6 A;  1WP7 A;  3FD9 A;  4FFB A;  5IJ0 B;  2BTO A;  4CH6 A;  3RVZ A;  2PI4 A;  3CHX A;  4F4L A;  4G27 B;  5JCO C;  4TT3 G;  4JI5 B;  4EKW A;  3CXH F;  2YXY A;  1FD9 A;  4MVQ A;  4ZI7 B;  3MHS C;  1WN7 A;  5CA0 B;  5JH7 A;  2LO1 A;  4D7S A;  4MTF A;  1BQZ A;  2YDE A;  1CXZ B;  1NTM H;  1SQQ H;  2EUL A;  3A0B Z;  4UCT A;  1XL6 A;  5DEC A;  2WA4 A;  2Q0O C;  3SPI A;  4HNA B;  1NH2 D;  4JZ2 A;  1RPR A;  4HBN A;  4TV8 B;  2WLL A;  4GX2 A;  1Q6U A;  4NVP A;  3OMA B;  4MTX A;  2D2C B;  3HKD A;  4J11 A;  4KXR A;  1IBK B;  1S3J A;  1VEW A;  3BPZ A;  1H2N A;  3A0H Z;  2EIM C;  1IBL O;  4RQE A;  1RSO B;  1TUE B;  3K57 A;  3SR2 C;  1Q6I A;  3VQY A;  3K06 A;  4CS2 A;  3T4Z A;  5E79 Z;  2QJ1 A;  1FYJ A;  1IBK O;  3QG5 A;  2EJ7 A;  1TGO A;  4WCE V;  3BRC A;  1YJW V;  1NU1 H;  4LNU A;  4UVB A;  2JEX A;  3E22 B;  1PV0 A;  2IH3 C;  2Q0A A;  2OTJ V;  1VQ8 V;  2YUA A;  4QNH B;  3ASN C;  4JYC A;  1ZUQ A;  2RNB A;  2ODM A;  2Q6A A;  3RT3 C;  4J9Y B;  4ZOL A;  3ZRW B;  1ZAU A;  4LNU B;  5L3D A;  1SRY A;  2Q4P A;  3N2G A;  1F4M A;  4HNA A;  3M99 B;  2LFR A;  4WFE A;  2B5U A;  1MNG A;  2JGU A;  4UVA A;  1VAR A;  3OR6 C;  4PA3 A;  3VQW A;  1CEZ A;  1D2D A;  4K0K O;  1VF6 A;  3TXS A;  1AJP A;  1GTO A;  5CBF A;  3T2M A;  4YJ2 B;  2OWO A;  4CH4 A;  5LGU A;  4TQF A;  2HJF C;  4DW0 A;  1I7F A;  3AG2 C;  2C2A A;  1BL8 A;  5E1A C;  3UQ8 A;  3L75 H;  1V55 C;  3OAA G;  2DQ3 A;  2X6B A;  4B3T B;  3ZS8 C;  2ZNJ A;  1QU7 A;  1FJG O;  2QWN B;  5LMN O;  1X4T A;  3MDS A;  3FB7 C;  2E5L B;  1TAE A;  2FL4 A;  2XAH A;  3W7W A;  2RMK B;  4DV2 O;  1FS0 G;  1YF2 A;  2H3O A;  4JV5 B;  3RYH A;  4DYL A;  5CA1 B;  1YCI A;  3CP1 A;  1JOY A;  1SA0 A;  2QTO A;  3JAL B;  4IHJ B;  2GBO A;  4RAI A;  3KZI Z;  1N33 O;  2E5L O;  4X62 O;  4J10 A;  2ZIO A;  4TWK A;  2BTQ A;  3GWK C;  3JD2 A;  4YY3 O;  4U3J A;  1FAF A;  1OCZ B;  3CJH A;  3CRA A;  1GM9 A;  3RYH B;  1OV9 A;  3FYI B;  1OCR B;  1SES A;  3EVK A;  5JVD B;  3ZHQ A;  4JI0 B;  4DV3 B;  2UXB O;  2CTR A;  3E35 A;  5LGN A;  3CS5 A;  2Q5Z A;  3ABM C;  4XDJ A;  3ZHU A;  3THO A;  2OYQ A;  4W4K A;  4CS3 A;  5IYZ B;  4LF8 O;  4X62 B;  3WB2 A;  1AI5 A;  1Q43 A;  1EN6 A;  1M9N A;  3N2K B;  5B1O A;  1K97 A;  4DR5 B;  4AQY O;  4JTA B;  2EIJ C;  3FAV B;  1YJN V;  2WLK A;  3AG3 C;  5L3G A;  1L0L H;  4GYC B;  1K8A W;  4B3R O;  1OCC B;  4B7K A;  1K4C C;  2DQ0 A;  3RYI B;  4X8A A;  3E2E A;  1Y74 A;  4R6Z A;  3JD0 A;  2LQT A;  4BIU A;  2DJV A;  1IXB A;  1XBL A;  3UT5 B;  1Q86 W;  2E76 B;  5CA1 A;  4FM2 A;  1MA1 A;  1O9G A;  4MTO A;  2MK3 A;  3OUS A;  2UU9 B;  2EIK B;  3LDC A;  2HVJ C;  2G38 A;  1VQ9 V;  1NS1 A;  1XNQ O;  5K1P A;  1FFX B;  2JS5 A;  3D36 A;  3ICX A;  3CD6 V;  2JRI A;  4J42 A;  3CCJ V;  2Y69 B;  3LSQ A;  3BVO A;  2DWD C;  5GTI Z;  1I5X A;  3DTU B;  2QM8 A;  5ITZ A;  1BZK A;  3ETE A;  2F95 B;  4J7K A;  3KCX A;  4JI5 O;  4PDV A;  2CAZ C;  1IZ3 A;  3CSX A;  3BA9 A;  4F6E A;  1E1R G;  2GV9 A;  1AIL A;  2A3Q A;  2GHY A;  3DXR B;  3P3N A;  3RBZ A;  3W7X A;  4JAS A;  1R3I C;  4YHH O;  1LNQ A;  1YSC A;  2ITC C;  4B3S B;  2VQE B;  3AG4 B;  4WBN A;  3E8F A;  3ZRW A;  1HNW O;  5A2Q N;  1I08 A;  3WG7 B;  3CB2 A;  4DV7 O;  4JI6 B;  4CS4 A;  2V1D A;  1EFR G;  1LUV A;  1BHB A;  5JJJ B;  1N36 O;  2HJD A;  4LF5 O;  5H6Q A;  3CRC A;  4R50 A;  2PI5 A;  3IGA C;  1Y6X A;  3C3T A;  4JF3 A;  4P2Z A;  5EIB C;  3ZHT A;  2QWR B;  3G4S V;  1N0J A;  3D8C A;  2AZ2 A;  2YI8 A;  4JI7 B;  1RSO A;  4UCV A;  3WB0 A;  1N8R W;  4UB8 Z;  2LFS A;  2LW1 A;  4K8Z A;  5BMV B;  4JTC B;  2CTQ A;  4JI2 O;  4P9P A;  2IJH A;  1K5S A;  1W0K G;  2FTK A;  1AP6 A;  1XDC A;  3SDL A;  1MAB G;  3S3X A;  5J2U A;  4MVR A;  4JAU A;  3QTC A;  4PA6 A;  4LF4 O;  5KLV H;  1T5E A;  5CMU A;  5IY5 B;  1XI1 A;  2KQX A;  5L3B A;  4YY3 B;  2Q69 A;  1XHZ A;  3KKY A;  2H94 A;  1TUB A;  3CRQ A;  3CYO A;  2Y48 A;  1L0N H;  5EBM C;  2Z0A A;  4I4T A;  1VQ7 V;  1R3J C;  3CC4 V;  2D3O W;  4NXN B;  4JI7 O;  3H1L H;  2ZQM A;  2P5O A;  2IM9 A;  1RFY A;  4Z1M G;  1FFX A;  5JH7 B;  3OR7 C;  4XDL A;  4JYB A;  1K3E A;  1SC5 B;  4JV5 O;  3ABT A;  3JAR B;  1JJO A;  5EIB D;  1BCC H;  3FB8 C;  5JCO A;  1KKC A;  1LR1 A;  3M7M X;  4PA4 A;  2ZE8 A;  2L35 A;  3B8M A;  5EYP A;  1FJG B;  1NVP B;  1N32 B;  2OT5 A;  3LUT B;  2UXX A;  4D7T A;  4OXS A;  4X1I A;  3F5T A;  2PYJ A;  5B5E Z;  2QKC A;  1Y4M A;  5D5Q A;  4DV6 B;  4DRX A;  4LFC B;  1SF9 A;  5FNV B; 
#chains in the Genus database with same CATH homology
 2Q8V A;  3CS5 A;  1OJH A;  2QDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...