1MZEA

Human factor inhibiting hif (fih1)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzeA01
3OD4A 1H2KA 4BIOA 1H2LA 4Z2WA 2Y0IA 2YC0A 3D8CA 2W0XA 4B7KA 1H2NA 4JAAA 1YCIA 3P3PA 3P3NA 2YDEA 1MZFA 3KCXA 2CGNA 2ILMA 1H2MA 2WA3A 3KCYA 4Z1VA 5JWPA 4B7EA 4QU2A 4NR1A 2CGOA 4AI8A 2XUMA 1MZEA 1IZ3A 2WA4A
chains in the Genus database with same CATH superfamily
2VS0A 3QO7A 1NQDA 1JYNA 5A3MA 3EFFK 1COWG 4DPNA 3UKVA 4YPJA 5LK7B 3ABKC 4FLXA 3HD8B 4LF7O 3HKEB 3TN92 2EULA 2JG9A 2CTWA 1P49A 2IFRA 4IYIA 4PDWC 2DBIA 2WZEA 4B1LA 4TOIA 1O4YA 1O91A 3OEEG 3LD8A 4LBQD 5BYNA 2DYSB 2O1QA 1IXMA 4NROA 5IK7A 3DV8A 3ASOB 1C8NA 3MLKA 2WZ8A 1YO8A 2WSUA 4MVSA 2UUAB 2HWD1 1E57A 3O5SA 2RR11 4BK5A 1WJZA 5AFBA 2QQJA 5DQ0A 1FKAO 3I3DA 4IE7A 4BIZA 2LW7A 1NZ6A 4GIQA 4CDXC 4QPWA 4DUZB 1AR83 3B3QE 4TSFG 5L7OB 3BIWE 1W3XA 5FYHA 2WLNA 3OR7C 4SLIA 5BNOC 1SQFA 3ETDA 4CP9A 1QJU2 3LEGA 4CEYC 1RJ8A 3IBMA 4XJWA 4H0LB 5LYJA 3VBUA 3CWBH 4DK0A 1LEMA 3Q8AA 3AP7A 4F6RA 2HEYF 1F4MA 3DC5A 5CA6A 5EJZB 1CIWA 3MD0A 4K21A 3VZMA 5LGUA 4XETA 4IIJB 1AYN3 1YF2A 3T0DA 4Q0PA 5EYYA 5JMOA 2R041 2ZXQA 4PA3A 3IZOA 4AK3A 3ZSLA 2B5UA 2FDHA 1B09A 5IDJA 4O2AB 1SPPB 3M3CA 4WM8C 3F2ZA 1PMIA 4PF1A 1FMD2 1Q8SA 5C33A 2ZHNA 1IS6A 1E1QG 2YIBD 3UKMA 3PU8A 3OGCC 1UZZA 1J59A 3U1XA 1O4ZA 1PP9H 1S0JA 1KP3A 3CPWU 4OMDA 2PHWA 2YSUB 1D4VB 1LOCA 1LB2A 1OLRA 3SISA 1Z7S1 4QKFA 2UWCA 3SJAC 3ZXGA 2BTOA 3HT1A 2KXLA 1DQ4A 4N9HA 2F6BA 5F3CA 3J4UH 5ANNA 2Q8DA 2CWMA 2ATKC 1G7YA 2JG9C 4YSFA 3KQRA 2A06H 3NO8A 2ZE5A 5EIBD 3AK3A 3ECQA 4ZHNA 4BB3A 2P22C 1HRI2 4UCOA 1ZBE1 3EJKA 3I4IA 4ISRA 2G1MA 3E22B 3H8OA 1X9PA 4E8DA 1VALA 3NNFA 5KHKA 4RO2A 3EO6A 2Q69A 1O5LA 4H33A 3KZ4C 2VZVA 1NE4A 2Q9LA 5F37A 1JMUB 2ZOEB 1M56B 3K0DA 1CGPA 2X53S 1W8ZA 1TMF2 3LOBA 1S0VA 3NJVA 2UURA 1XNRO 1G9FA 1F35A 3E22A 2VVEA 2DYSC 1VARA 1OCCB 3ASOC 1GN3A 2LROA 4CCEA 3WP3A 4O4JA 5DM6V 1U0AA 3GF6A 1FV3A 2VH9A 4I02A 3OSDA 4L9BA 3WF0A 4PDLA 3CCQV 3RYHB 2WFPA 4Z92B 4GWMA 1RUH3 1RUI1 4E27A 2VJXA 3HNMA 1LUVA 3T1HO 2P6HA 3LDRA 5L7OC 1JN2P 5DUVA 1S3JA 4LHSA 2VOKA 2QUOA 2DYRB 3E8FA 4A3ZA 2UUBO 1PZ8A 5CYYA 3ZR5A 2AGSA 2D7FA 4QE7A 2R32A 2D3SA 1CAVB 4FFBB 3D3IA 4LF4B 2K1EA 2RJ2A 4S2DA 3ME2A 5IJ0A 4DV7O 2JDHA 2R061 5AVPA 3FAVB 5EYXA 1E5SA 3STZC 4EROA 4TXWA 5JH7B 1AJPA 4FPJA 4LFAO 4X62O 2FL4A 1JOYA 3IWZA 3M3OA 3WNMA 1K5QA 2GN7A 4WFBV 1GO3F 4LE3A 1D4M1 5IVFA 1CAVA 4FFBA 3G7DA 4AI0A 2ZMLA 4FPGA 4QIWF 3AG7A 4H14A 2CY6A 3MLJA 1M4UA 4LIVA 5BMVB 1LEDA 5GLTA 1FT9A 3RWNA 3F5TA 4AHXA 3BTXA 5DZGA 3JCIA 3LOIA 1W90A 1F9KA 2HJDA 2K0GA 4MSWC 1WWYA 2HKXA 2YDEA 1NT2B 4I2OA 1OT5A 1AR63 4RAIA 3KGZA 1MOFA 3K77A 4DO2A 2PHFA 3KVBA 3BVOA 1JZ3A 5T50A 4MHUA 2Q1ZB 4JTAB 1QH7A 2YU2A 5GZDA 4XJ9A 3K5NA 2EIDA 3KCYA 2NLJC 2RS11 3VHRA 1TE1B 2A0LA 1B35A 3WNNA 3B7MA 2XBO1 3H1MA 4ARYA 3ILNA 1AYN2 4LF9O 4MG2A 2Y64A 1M56C 1NA1B 4YJ3B 3VV1A 4L99A 3K06A 4ZS2A 1Z0HA 1DZRA 3I8TA 1HQNA 4YW7A 2OA2A 4D8MA 2D5FA 4LPLA 4P9OA 2ZJCA 1NLRA 3O12A 1XNBA 4CCCA 4QNHB 4AOCA 1HIXA 2DMXA 4TUYA 4IEPA 1OCCC 2BFUS 1R6KA 1BVVA 2FZ1A 3GM8A 4GWIA 3JALB 1YYNA 5FZAA 5BUVA 1G86A 1VJ2A 4U7NA 4Q5OA 1H2LA 2X6AA 4ZZ8A 4IT5A 4HZFA 4WVMA 4U3JB 5LOVB 2RS32 4N43B 2AEYA 5ANQA 2YBSA 2WFF1 4XDKA 4JGZB 2DYRC 1NY72 2Q8EA 3I3BA 3ABLB 2DDUA 1NI8A 1W8FA 1AZDA 3E83A 1ZAUA 2KQXA 4XABA 4ONUA 5FL7G 4PT6A 2VZUA 1IDSA 2MPFA 3WP6A 2E51A 4FLZA 2D6KA 4LBKA 4UWDA 1QR8A 1K34A 4ZHQA 1I9RA 4XFGA 1PGL2 2BSKB 5FPBA 1ZM1A 3X29B 1LOFA 1S2BA 3H1LH 2TUNA 2M7WA 2WA3A 1XQ8A 4R50A 1JUHA 3VKNA 4B4QA 3BAAA 1NT0A 1TVGA 1M90W 2LFSA 4BQ4A 3ALQA 3G67A 2BCCH 2ZCEA 2PF4E 5KX5B 1QXJA 4Q1RA 4AHZA 2GC3A 4ZU4A 1V6LA 1XE8A 2PUSA 1W99A 2PLV1 1MPXA 4RD7A 3L73H 4YW2A 5GLZA 5F39A 1S4CA 4EB6A 2HWF1 1YIJV 2FQPA 2H0BA 4M0NA 4Z8BA 4R8CA 1GQHA 1HLCA 4C8DA 1XMQO 1ASJ3 4ES8A 4L92A 1GANA 4CCDA 3BOPA 1LTEA 1O8PA 5KX5A 1KFUL 4PQ9A 4CDQB 2F4VB 3OTFA 3TETA 1LJ7A 1UPIA 3O1OA 1XI1A 4RHV3 1WPBA 4DV0O 4JI1O 3QVNA 4UFZA 1Q86W 4X1YB 4CCOA 3B77A 1SZXA 2AUYA 2R073 3FBMA 4N7IA 5FYUA 5FYCA 1EM1A 2AYHA 2X5IA 4ISQA 1DCSA 3TEXA 1ODNA 1DGRN 2XAHA 4LNUA 3BEHA 4LP8A 5G05L 1PO13 1H6XA 3V0BB 4GUNA 1NA1C 5FMBA 1NLQA 3LDEA 4YG6A 1WCSA 4ZU5A 4OQ8A 3POYA 1OJHA 4YZ5A 1G9BA 2XVKA 1NXD1 2TEPA 5FYBA 4FAHA 1AYM1 1MEC3 1QMJA 3KV9A 5DDJ3 3I2OA 4DFSA 3S57A 4W6YA 3UO2A 4QE9A 4AQSA 1QVGU 1RHI3 3V0BA 4LT5A 1I7FA 4Y1ZA 1QQP2 1ND2B 1I5ZA 4B3SO 2Y0IA 4KWLA 4N43C 1AX2A 2D6PA 1RUJ3 5FAXA 4JGZC 5D2AA 3GB7C 4BMBA 1ENSA 1AL23 3CRQA 1HW7A 1Y7BA 5JWPA 4OHZA 1AR62 3ABLC 4H44B 3VHPA 3KSCA 3N9PA 3CX5F 1AR73 1KQRA 4RSUA 2B4KA 5A7SA 3ITQA 4HKLA 3HIFA 2Q30A 4CU8A 1ND2A 1PIV1 4HBNA 2RS51 2GSMB 2PYTA 4Q4V2 3VBSC 2YYOA 4J11A 3HQXA 2WLMA 2HJIA 2ZGMA 1G8WA 3S5AA 1JXNA 3MICA 4ZONA 3ZHRA 4GMP1 4B4PA 4Q4Y1 3ZRWA 1WW4A 3AK2A 5HPOA 2DVFA 1NBMG 2FTKA 4UW3A 2FHRA 4A5UB 2LGQA 3K3NA 2ZMNA 2WSVA 1H8EG 1L7LA 3K5OA 3H50A 4IV1B 3SMHA 1S55A 2AENA 2VL4A 1YI2V 1ST8A 3AP9A 2UXDO 1FAYA 4CA9A 4CXYA 2SBAA 2VQ0A 4Y20B 1G6NA 4FPEA 5H6RA 2Z5WA 3ZHSA 3MFAA 3AZZA 1R092 2ARAA 1E1RG 4JDMA 5I91A 4M0HA 4XYXA 4CH6A 1ZBA3 4PV1B 1SCRA 2VULA 3NMBA 1REEA 5CKNA 5E89A 1NAEA 4CDQC 2C2AA 3AXEA 1Q5OA 1HW5A 1S77D 5FZ6A 4IV1A 4CEWB 1B3QA 2CAVA 2GDSA 1BCXA 3EHBB 1UFIA 3ACIA 4Y20A 5EC2C 2P67A 2GC0A 3POIA 4FT8A 1Q8PA 1W8TA 5CIRA 4UBHA 1BLZA 3AL5A 5EBMC 4CEWA 3ZR6A 5C5TA 2JDMA 5I0DA 3ZHTA 3OOXA 4GB32 1OLMA 2GSYA 4JV4A 3D8CA 1BMFG 5LCWL 2RDQA 2P4KA 2P3YA 1LESA 4RR3B 1NTKH 3ZYFA 4I55B 1ND2C 5C3RA 3X2QB 4MTGA 5JR2A 5JVDB 2UU9O 2CAZC 2NQYA 3HPLC 3H7JA 4LXLA 1H8HG 1YQ6A 5FFOC 1F31A 3ZFFA 3WNOA 4FLWA 2B9VA 1SKVA 1LR5A 4IL7A 3HPNA 2D44A 1RXGA 4RQFA 3EXUA 4RHV2 2LUWA 3RT3C 1VBC1 2Q5TA 4M4PA 3M1HA 3MPPG 5F1RA 5EBWC 4DXTA 2YFZA 4CCJA 5T54A 1ODMA 2NZ9A 5JVDA 2MNGA 5FZFA 2Y69C 4QPGB 2LW1A 3A7QA 4XURA 1Y9GA 3U4SA 2LQTA 3MF9A 3SPHA 1OV9A 1QU7A 1VBB3 1JU4A 4BQ2A 1AJKA 2CU5A 3ZRVA 1EN6A 2VY0A 2QQMA 2AHZA 1QJX1 1JU3A 1DYOA 3ZXEA 3NSTA 1J3PA 4DV0B 4QPGA 4IV1C 3SPIA 3QF7A 4E2LA 2BBAA 2GU9A 1Z2GA 5D1IA 3MI8A 1ZRDA 1DTOA 1UX7A 4UBGA 4AG4A 5LGNA 3ZBHA 1QLEB 2NNUA 1LR1A 1RUF1 4KWJA 2VCMA 4IL6Z 1IURA 4QDSA 3RVYA 2A73B 4MW3A 1AL22 2LALA 1WCUA 1UYYA 4D6QA 4JQTA 4CEWC 2XVGA 5FUNA 1VQKV 3ZFEC 5DUXA 2QWQB 5H2FZ 1HRV2 4LFBO 1AR72 3IJ4A 3T2OA 2VUAA 1DQ5A 3MIHA 1J1LA 2ZGNA 4JI6B 2QQKA 2CDPA 4Y1UA 1JI6A 4AVCA 1SBEA 2CE4A 3T30A 3NR7A 5JXJA 2VQUA 4I3PA 1AX0A 3O1PA 2VUJA 3TGUH 4HVRA 3APOA 4YY3O 1DQ0A 2JS3A 1EYBA 1K5JA 3WLUA 4COUA 1NG0A 3QH7A 4MADA 3CMAV 3CYOA 5CA3A 4RR3C 4K6BA 1LRHA 1KRIA 3VD7A 3AP6A 3X2QC 1ROPA 1HWYA 1WA8B 1OH3A 1MR5A 1R3LC 2ZEZA 3FUOA 5IE9A 5CISA 4GQ7A 4MS2A 2ZKNA 4FQZA 2VW2A 5KUKA 1FI2A 2WJSA 1ZBA2 2BVVA 2G9GA 3QCWA 5EQUA 4FZ0A 2UUCB 4JI3O 1V9U1 1C28A 1WKYA 2FDFA 2XAGA 3HBZA 2JIJA 1V55B 4UVBA 2PQSA 2IXIA 5IATA 4EQVA 5T5LA 1WA8A 2XNDG 3Q8FA 4YJ2B 5IJRA 4QPGC 5ACA1 4Q4X1 3I3EA 3H1JH 2WWWA 5KHJA 4NN0A 1N33O 2V72A 4ZBMA 4AQTA 4FOVA 5C71A 2FB5A 1S0BA 3U75A 3CP1A 2X10A 3NV2A 4JHTA 2RE9A 5BNPA 5C8CB 2CUGA 1LHVA 1PGW1 4UAPA 1QJZA 3ZMZA 2VZRA 1SA0B 1QEXA 1U5XA 3J9SA 2G4IA 1THZA 3N4MA 3P3NA 4I4TB 5KHGA 3C7HA 4AVAA 5CVRA 4LO6B 3ZDSA 2V5DA 4D0QA 3SKVA 1QLEC 4LC1A 1SFPA 2WNUA 2JWPA 3ZKUA 1ND3A 5C3SA 1MS8A 1KC8W 5BNQA 4BWOA 2UWBA 4KBZA 4A45A 3F7YC 1AX1A 1GNYA 3RVHA 1YI9A 4XXAA 2C6SA 2W91A 2QJ1A 4DRRA 2JD9A 3JXSA 5KHHA 1M5IA 3S7IA 4E4SA 2E7QA 3P3PA 3S6PA 4IESA 3OGIB 2B5HA 4LO8A 3BTZA 2GDFA 4KL1A 1NTZH 1IPSA 2ZX2A 4YARA 4PDRA 4JGYB 2GHYA 3FLRA 2VMDA 3JZVA 1VBB2 2WO7A 1OBNA 5EYPB 1V6KA 2CWSA 1M57B 4BIFA 5CEHA 3K04A 3TOJA 4P9GA 5T52A 3CJIA 1MACA 3IKWA 2X6BA 3RZJA 3D36A 2BU9A 2VZ3A 1JPXA 4B29A 1PD3A 1OF4A 1K5SA 2V5YA 5F6LB 2JKBA 4JGYA 2CL2A 4NIGA 5LY1A 3GZUC 5EYPA 5IYZB 4AEKA 1ZZ6A 1V9PA 3JAWA 2KKWA 3WB1A 2ADEA 3ZYJB 2WO2A 4DIQA 4GZRB 1TAEA 5L3EA 4GULA 3TB0A 2ORXA 5EK0A 4JI0B 1SFNA 4XF0A 1TZOA 5A7PA 1V55C 5IK8A 2YGLA 2D93A 2ZPXA 4YGEA 1GLHA 2HWC1 3BPZA 3CCVV 2HWB1 5LBQA 3IM0A 3TYJA 2WLIB 2PQQA 2D40A 5KXBA 2JE7A 3ZFGA 3U78A 4QM9A 1GBGA 2FMYA 1RUD1 5GALA 4FSJA 2E31A 3EQEA 3HWJA 1LHOA 4GJYA 3FB6C 4NTYA 1VMGA 1G9DA 5DABA 1R1ZA 4FTSA 3PTRB 3CIHA 2CHHA 2DTWA 4URTA 5C8CC 1I94B 3JSNA 4JI2B 4DB5A 1CEZA 2VCAA 5SV8A 4RN5A 2DWEC 2F93B 5KA6A 3SC7X 2EICA 4Q26A 3TWIA 3ZSKA 5GZGA 2YPJA 1DP0A 3OPWA 5K8SA 2OZ6A 3CEIA 5L3GA 4MGYE 2WZR3 3I59B 2WPDG 2FDIA 1F2NA 1ULDA 4XPVA 4I3GA 1H1IA 2CTQA 2Q4SA 1D7PM 3M2MA 3LEKA 1AI5A 3ZYRA 4X20B 1X9TA 2CTRA 5FYIA 5FYZA 5FLHA 3LSSA 4NAOA 3I59A 1QJY2 3BY6A 1H4GA 1G8MA 1WBFA 3D36C 2QDNA 1XNAA 1ZZ9A 1AROP 5H9RA 1LOAA 5T5OA 3MF6A 2XONA 1IG0A 5CA1B 4JGYC 2NMNA 5J36A 4LBQB 1SETA 1DGWX 2XXZA 4X20A 3AMNA 3BCCH 3POGA 1ZL8B 1J58A 4GYCB 1HV1A 3T0AA 1QJFA 4JI4O 1K45A 2EXHA 5T3NA 3O1VA 1D5NA 1H2SB 3KZIZ 1XSRA 3B01A 1AI7A 1GOFA 2ZKOA 5CA1A 2WN3A 3VGIA 4DR6B 2EAAA 3WW1A 1S5HC 3ACFA 2XB6C 4NXNB 4DS0A 1ZL8A 4GKKO 1CQ9A 4GA9A 1FXKB 3THPA 4HT1T 3K57A 5FZOB 3HR9A 3FX7A 1I1EA 4HXCA 4Q27A 2A6XA 4FTBA 3SNMA 1FPN3 1IS5A 2D6NA 1A32A 2WS92 3EHKA 4LBOA 1D2DA 1W6MA 5H9SA 4IGGA 4J9YB 2ZT9B 4IUGA 3NAPB 4UFIA 3FLPA 4LK7A 2BGCA 3CXCU 1POV1 4HVQA 1PVC3 4K1YA 3TXQA 3WX5A 3MFCA 2YUAA 5H9CA 5C5UA 3USUB 2QM4A 1FXKA 1K3IA 4R52A 4BQ1A 5FZOA 2VO5A 5JQGB 3AZWA 1QXPA 1HNWB 4JRLA 4OYUA 2NPIA 1QCEA 1WD4A 4P9XA 5A1LA 2IJKA 3NAPA 3BRCA 3IIAA 1NCQB 4AQYB 4H13B 1M06G 5KMGA 3WP5A 3ZS8C 1HB1A 1RJ7A 2VCBA 5JQGA 2XTAA 4XUTA 3UKTA 4DXWA 4OHYA 1UMHA 1VMHA 2Y6GA 2H6CA 2V4VA 2VMEA 5A6QA 2ZACA 3WNPA 4DY5A 1EAH2 1HRI1 1SESA 1NCQA 4B3RB 4NE9A 3OAAG 4LHLA 5EC1C 3AYAA 2BOCC 1VP7A 1ULEA 4JYCA 4JTOA 1N36B 2Z79A 5LRSA 1ENVA 3HKCB 2XOMA 2J1VA 2E33A 3JCZA 4OCTA 2FYUH 1XNTA 3RNSA 5FXWA 4X64B 4KWUA 5B2GB 4COVA 4MGSA 1BEV1 5A7WB 4KQ7A 3RG0A 1MZ5A 1FS0G 1UZWA 1TUBB 4XCAA 2IXKA 2RMKB 1IZ3A 4DV5O 4RS5B 2WLKA 1J84A 3KCCA 2BPA2 5FQ0A 1BMV2 1OSGA 4FLUA 3RFRA 4XFAA 1CONA 2BV4A 2P34A 1TVKA 3I3QA 4CCLA 1FD9A 4B4RA 4QAWA 2C9AA 1SHWB 2VW0A 3E1F1 3VBOB 4AZZA 1GN4A 4UV9A 1AR92 2JB4A 4A6OA 3TBDA 3AM2A 2OUJA 3FFZA 1OLME 2O0OA 4H3WA 1TUBA 2WN2A 4FXKB 3PNAA 1UY3A 2PXJA 4E4DX 4RS5A 2DCKA 2RMU3 2KB1A 2IW5A 2D3PA 5E6HA 1N3QA 3G80A 2XASA 2DUPA 1FXKC 4N23A 5JSRA 2GNMA 5JUVA 3W5MA 3T2QA 3ETQA 3VBOA 4ZY9A 4YM0A 4O2BB 4HYOA 1ZTEA 4P9YA 3UK9A 4YG0A 3PLQA 2DUOA 2CAUA 1QLNA 3NAPC 2Y0OA 2ID4A 3VD4A 3U11A 3LUTB 2FMDA 4LOTA 1COV2 1XE7A 3WDYA 4INDA 3WQ7A 3RWRD 4NHYA 3JATB 5FTTC 4KUMA 4XBLA 1OPMA 2IXCA 2QTSA 1W2OA 1DYPA 4LF5B 4IHJB 4S2HA 4P5YA 5IK5A 3CE2A 3IDBB 1VQ5V 3MV01 1GSLA 1UJWB 1NLSA 3WDVA 3TEYA 1WGPA 1NCQC 3WF3A 1XNQB 4PA4A 1K92A 4XBQA 1UD1A 1V0AA 1IBMO 3LKJA 2WWSA 1C8M3 3JATA 3ZDVA 1AR81 3A0BZ 3WR0A 2XJPA 2OPWA 2QQOA 4I9WA 4FK5C 4OZXA 2W94A 2VQEO 5CBHA 1BQZA 3HB3B 2BOBC 1BBT2 3HVDA 2PI5A 4LFCB 1SACA 3OW2U 2VE1A 5BR8B 1VF6A 2M6YA 1SLCA 1R3JC 3SPGA 4FPOB 3U4XA 4FO9A 3H1WA 4HONA 4AWDA 4DR1B 3D3AA 4FAGA 5IT9N 2Z42A 4ES9A 5HFMA 3RZGA 4XILA 1WLCA 4META 4YHHO 1EV13 1K4DC 1PVC2 4FZ1A 4GX2A 1KGYA 3POBA 2XJTA 3GZAA 3ZPYA 3ZXJA 2VVDA 1T6GC 4RS5C 1VBE2 3W20A 4LJHA 1HNZO 1OLQA 1GQPA 1GZWB 2DCZA 3I7DA 4UCTA 1XEQA 4ZXKA 3ZN5A 2QSAA 3OFNG 3I56V 4H7LA 4B3TO 1JZ8A 3VBOC 4LNVA 4UCRA 5K1XA 4GLXA 3CZUA 2RM22 5LK5A 2UWAA 3ZMOA 3C7OA 3DKQA 3HJRA 2PMWB 1CR7A 2VTFA 3L2YA 5LB6A 1JZ6A 5J09A 1IPKA 1GZWA 2W1SA 2A3QA 1UKGA 3ZJZA 4DXRA 4PJ0Z 5FXXA 1N32O 1XSQA 3JAMN 3WU2Z 3BFRA 4Y4YA 1PGL1 2NP0A 5G04L 1W39A 5DAXA 1GZTA 1UYXA 3AMMA 4CH3A 2YFUA 5L73A 1D0HA 2RJKA 1L7RA 4RL7A 5ABJB 4U7OA 4KXRA 3BPSA 3PVBB 3CZJA 5LA2A 1Q43A 4XAAA 2P06A 4YW1A 1MZ6A 3HR0A 2IXJA 5GZEA 2KSDA 1KECA 1V6OA 4JYAB 2PFWA 4GJZA 3SCFA 4DMIA 3VKOA 4OQ9A 2GC1A 2WAOA 3ZHUA 4YGCA 3FWEA 3WG1A 2W0FC 1QR9A 1VF6C 4LBLA 2D6MA 2ZR3A 2XAQA 1RUH1 2GZWA 3DYOA 3TK1A 1GZCA 4QKNA 4XMIA 4NTXA 5JJNB 4AHYA 3ZYBA 2VM9A 4MVZA 4KGGA 1VQNV 4DR7B 5H5NA 2VZOA 4QPYA 4PA6A 1NKGA 1LGBA 5A3LA 4DV5B 4M3CF 2VC9A 3NJXA 5GJ6A 5AC93 3VB9A 3WCSA 4K9SA 5F3IA 1Y4MA 4F6EA 4FXGB 4X8NA 3GVMA 1PO22 1PNKA 2JDIG 3W7XA 1YTFD 4QKBA 4LE4A 4MTOA 3WQBA 2WIIB 1N1VA 1NVPD 1YQ5A 2VZTA 3AK1A 4ZOLB 2J1EA 2E53A 4NR1A 1VBA3 1Q6IA 2K46A 1S2EA 3DGEA 3SYPA 4TLFA 3NWKA 2PY5A 3IMNA 3IT8A 4OI1A 4DV6B 1QNWA 3RI9A 5KR7A 3ZN1A 4EYUA 3KS7A 2NLRA 1R6TA 1IBLB 2D3OW 3CSXA 2PELA 2ZGRA 3VHOA 3ABTA 1ZWIC 4LF8O 3GBWA 5FLJA 3FC0A 1CIYA 4ZOLA 1RUC3 4BQ5A 3W7SA 2R1DA 4CCMA 1I5XA 3KM5A 3KD4A 1IHMA 2QKAA 4WVVA 2F66C 1NYWA 5T55A 5JJEB 1VF5B 2W87A 4EN6B 5J96B 1C8M2 2WBKA 4JZ2A 1L3JA 2GN3A 4BW5A 3J7MA 2NYYA 1Q7YW 3RVZA 4E2SA 3LDDA 5FKCA 5F5AA 2A75A 3BU0A 2W47A 3H9VA 2D98A 3WZ1A 1W6QB 1FOD3 5BZBA 1N8RW 1BZWA 4JI8O 4E2GA 4MXVA 4LO4B 2EALA 2E5LO 2FMLA 3N27A 2L6LA 4JI7B 2GMPA 2A7WA 5L3FA 3ZSJA 2V4AA 2WT0A 2RDRA 5F9TA 4QB6A 3R6SA 4X6RB 2BWCA 4MGTA 1VMJA 1RB8G 1OXCA 5ABJC 4XDQA 3IAPA 1EV12 3AYEA 2ZGOA 1W6QA 1XYPA 1RC6A 1IG3A 1FYJA 4X8PA 3S3XA 2VMFA 3AP5A 5I0UA 2OTLV 2CGNA 1WCQA 4Q0VA 1KKCA 4B7EA 5K9YA 4LWSB 4ZU7A 4I0WB 1VE0A 3J8F2 5C3OA 4DV4O 2DVAA 4FLTA 1BZKA 3APQA 4GH4B 3OD0A 1R1A3 4Y4RA 3LA2A 2HWD3 4I9QA 3C7GA 3NW4A 4COYA 4KP4A 1TNRA 1CJDA 1GMGA 4YZ2A 3BYWA 3V0AB 2PAMA 3SH3A 3WD5A 3ZMTA 2CGPA 2IXLA 1BHGA 3TEZA 1RMU3 5LMNB 4BLIA 4NYKA 2FDJA 4Z82A 3WDUA 5J1XA 3CNAA 4PDMA 4XFFA 1QGLA 4PBPA 4BXFA 2VZSA 4QQ2A 1Q8IA 2F4PA 1OC1A 3R66A 4TN7A 3AMQA 2YXYA 1JVMA 2LW8A 4UFMA 3JD2A 3JU9A 4OUMA 1CAWB 3MYXA 3POFA 3RBZA 2D5HA 5JIAA 4BISA 4FFGA 1W9WA 4UXNA 1YRZA 4YFWA 3NJZA 2R043 2PI4A 2LM3A 2ZM6B 2OCCB 5F2SA 4J80A 5C8YB 4HN1A 3MIGA 2QE3A 2GNBA 4NO4A 5TISZ 3H3LA 1N32B 1IS3A 2JG8A 3T4VA 1JZ4A 4KHPB 1CAWA 5FPAA 3ZIXA 4CUGA 2P4EA 1YZBA 3LF7A 1S76D 1DBNA 2QTWB 2B1IA 1ASJ1 1ULGA 4P00B 1EN5A 2Y0PA 1DZTA 4NXMO 1TME3 4FMTA 3RZMA 2CTVA 1Z7S3 2WABA 1H8TB 4RHV1 1RPRA 4XF9A 3RZKA 2P6CA 3IDAA 4DUYO 4DR5B 3MW3A 1JOBA 2VXJA 3LA7A 2OW4A 3THTA 2R071 1H9PA 5AC92 5C7GA 4JHZA 2WWJA 4YXWG 3C8XA 2NMOA 1PO11 2EIKB 4ABMA 4P2ZA 5A1AA 3MHSC 2A3YA 1H8TA 4DYLA 1RUG1 1VPHA 5KLVH 4WM7B 1BGYH 4LUKA 4X65B 1YC61 1T2XA 3N2GA 1MEC1 4ARXA 1YIPA 4J25A 5DDJ1 3M7MX 2D6LX 2UY8A 2G9FA 5FYTA 3PJYA 2WA4A 3WV6A 1RHI1 2JDKA 1YIFA 1BQPA 2Q1MA 1BL8A 1U5IA 1RUC2 3VKMA 2OX0A 5JZGB 4MVOA 4QGMA 4GH4C 1HP8A 2F4LA 2WO1A 2A1XA 3ZX7A 1W0KG 3WW2A 1RUJ1 1HR0O 3H1YA 4YG3A 3K2OA 3GWOA 1MSWD 1Q90D 2PHLA 2JENA 1OD5A 4COWA 3CO2A 1N0NA 4WFGA 1JA8A 3A22A 4C91A 4IQPA 1UY1A 4X1IA 5IVCA 3KG2A 4M3CB 4M4RA 5JZGA 4LOSA 4D6RA 3IAYA 4FPLA 1PM4A 4JKMA 4LHKA 1X33A 4RGAA 1BQ0A 1YFXA 1D2SA 5FP8A 4RGKA 3G6EV 4Q1PA 1CESA 2JICA 4AI9A 2R063 5CKQA 4X88A 2MEV3 3ACLA 1EPWA 4IE4A 1W2UA 4U3FH 4QQLA 4D3WA 3O0VA 4M3CA 4QQOA 2OCCC 4Z2AA 4UCUA 5FY8A 1CZTA 3ETGA 3TN93 4DUZO 4GT1A 1GK9A 4EWAA 4Q29A 4X9QA 1K8AW 1JOJA 2Y60A 4EEQA 5LP6B 3SLIA 2VZ1A 2ES3A 4NPLA 1F5FA 3KV4A 3ZXFA 5FZMA 4EN0A 4QWNA 1US6A 4QXKA 5A33B 5LA0A 3JB4C 2VGDA 2VD7A 4LULA 4K3UA 3ZYHA 5ITZB 3ZXKA 1M93A 2ZHLA 2ZGQA 2HWD2 4HVOA 1KEXA 2CH7B 3U37A 2RR12 1H8TC 3KLSA 3DPRA 5GLWA 2Q67A 3GALA 2BWAA 3I55V 1Z5WA 5LP6A 4HNAA 2AZ5A 5B1NA 4RQPB 4N53B 2OCHA 1F4AA 5JLVA 1K12A 1QJEA 5A33A 2XKOA 2J1TA 2EIKC 5FMOL 5GTHZ 1KP2A 4IETA 4XACA 5EV7A 4CC5A 4YW4A 3H7YA 2YBPA 3VLBB 1AVMA 5E1AC 5L9BA 1AR4A 2ZGPA 4EWEA 4WM7C 3WQ1A 4CH4A 4XTMA 1FNZA 4FVVA 3C90A 1GN6A 4A4AA 4RQPA 2WT1A 4YVSA 1W6NB 3R0RA 1X36A 2R042 4GKJB 2H8PC 2CTPA 3JQXA 3T09A 1ZZCA 5CBGA 3CJXA 4NIAA 4QX7A 4CTEA 3CD6V 4BJ0A 5JZGC 3OBRA 5CB4A 1VRH3 3LE0A 2ETNA 1NE6A 1FMD3 1MZFA 3IIIA 4R4XA 3AYCA 4V2WA 3KGLA 1W6NA 2R9RB 4A3XA 4QKDA 2YC4A 1TME2 2JRIA 2P6JA 2JEMA 1LHUA 2BNOA 3GCXA 1RYYA 1Z7S2 3ETEA 1OQDA 4HAMA 1H6YA 4EFBA 2JVDA 4OVEA 4PDWA 4TLGA 4JKLA 3JD71 3CRMA 2J1AA 1YSCA 4AHCA 1QOTA 3RYPA 5A6ZA 4F83A 1MMMA 4FPCA 3DXTA 2HR3A 2ZE6A 4CS2A 2HHHB 5LA6A 3H8UA 3QNEA 1ZBE2 3D0JA 1WBLA 1GH6A 3N9OA 3WG3A 4Y5Z0 5IUQA 2IJJA 4ZKIA 2ZQMA 3RYCB 2AR6A 5FYMA 4CDXA 2XL9A 4LTAA 4KMQA 2EJRA 1PHMA 2NN8A 2UU8A 1J1TA 4MGQA 1XYNA 5IHRA 1SZTA 2JE9A 4KWKA 5EIYB 1UYZA 2RV9A 3SJBC 5LP6C 1TMF3 4XCBA 4C1XA 2ZTNA 1W8NA 5JOYA 4CEYA 1JJOA 4KU8A 2JJ2G 1UY0A 4HL0A 5CAZA 1GM7A 2GP3A 3SEEA 1ZVFA 2DWDC 4LF4O 3WXPA 2DURA 3RYCA 3BABA 2DF7A 4B8EA 1DLCA 3ZMUA 1CJPA 4DZGA 3AC0A 5F7UA 3E8HA 3H01A 2ZCWA 1PK6B 3WG4A 1RUI2 4DV3B 1DLBA 3N9MA 2RHPA 4XFHA 4RQPC 4N53C 1PVXA 5LATA 3WINE 5FK8A 4TTGA 4IEWA 3OTOB 4PLNA 4DUVA 4WFFA 4JAVA 4O4HB 4JDNA 5A6YA 2OWOA 4WM8A 2ZAAA 2HLEA 5IVVA 2J1SA 1AILA 4CXXA 1JZ2A 4DV2B 1J3RA 2R0FA 5B1BB 3QLQA 2R062 3PN1A 1V6JA 1REFA 1L0LH 5J2TB 3I54A 2RDSA 5HV0A 1OVPA 1PK6A 5KC6A 2EZPA 3I2DA 2OZJA 4PI2A 1AI4A 2VR4A 3H42B 4O4HA 2VNVA 4Y5TA 3ZXDA 1Q3EA 1N34B 1D4M2 3O1SA 4PCRA 2GNTA 2ZNJA 3C3VA 3O14A 3I97A 3DTUB 4FVMA 3WB0A 4RUFA 5D5PA 5J2TA 3J81N 4IGOA 3LNMB 1MG1A 3WF4A 2EIEA 3RYFB 1BS3A 2OYZA 5DMYA 1L1FA 1VQ9V 1URFA 2YXLA 1V6MA 2VNOA 5CA0B 1SEFA 4WVWA 1ZUQA 3HKEA 2WINB 1GAXA 4JQRA 4QX8A 3THOA 3DXUA 5FZ9A 2VOVA 3OUHA 1GN2A 4QGLA 1FXHA 3RYFA 1YXBA 1GWKA 3O1RA 3K9SA 3IC9A 4XF3A 5FZ7A 2IU0A 2KG7B 1MS5A 3ILFA 3AEIA 3IMMA 4LO7A 1ZREA 4ASMB 5LWBA 2W68A 3A0KA 3IFXA 4TT3G 4HKOA 3ZN0A 2RS12 3HN3A 2DU1A 1F5JA 5JCTA 3JARB 5A6XA 2F1MA 2P3JA 2XBO2 4G9SB 4LLFA 4QDQA 3STLC 2Z3YA 4L0PA 2PYLA 2WLHA 5L7OA 4BW9A 5T5JA 4EN9B 1SZBA 1C3HA 5IYBO 2FCUA 1YFUA 1RPOA 2E3CA 1PM7A 3E2EA 3LEIA 4BK4A 2JK5C 3VQXA 5DN2A 3JARA 3UESA 1VRH2 2ZEXA 5GW7A 2DOSA 1UWWA 3DEMA 1O3QA 1R3IC 5I8YA 3CMGA 3NKGA 4AXOA 1H38A 4K8FA 4DEVA 4LKDA 2HP8A 4IIJA 5KXEA 2ARHA 3E8BA 5FO8B 1PK6C 1AJQA 4JI5B 4MVUA 4B08A 4JAUA 1G1XB 3N7LA 5FYYA 4OPAA 2DFBA 1HQWA 2RS33 4O2AA 1PMJX 1SPPA 5DZFA 5A80A 4H7MA 2ENRA 2EIMB 3BA8A 4WF9V 3HN1A 3N35A 4QX5A 1HNXB 3VKLA 5B1BC 2JJ1G 3S30A 3AKQA 1MNGA 3M7AA 1H2NA 4NWVA 1OZ0A 3E89A 5HFLA 3CKHA 4M00A 2IUWA 4BE3A 1Y3TA 1Q8VA 4UFHA 3AXDA 3ABUA 2E26A 4R4ZA 2DV9A 3QO5A 1JTZX 3I2HA 4CYDA 2ZAHA 5LXTB 4BR6A 1JHNA 4WV8A 2W08A 3AKSA 2F4VO 3WOGA 1OH4A 1GP5A 3P6BA 2F23A 1B06A 1UXXX 2PLV2 1YQ8A 4OGQB 3NKTA 1R6NA 1DZQA 2LS6A 4A7YA 3JB8A 3CRAA 4EV0A 4WZFA 4AVBA 1QDOA 2FCTA 3JASB 2WSSG 3L9DA 3OGRA 1UN1A 3T1YB 4ATFA 1H2MA 1VQ8V 4DNYA 4MGZE 1YQCA 4G3YC 1RIRA 2BGPA 1NXMA 1W2BU 4LBJA 4XHXA 1RUOA 2WLQA 4B7KA 4UW6A 1W0JG 3PVOA 4XDLA 5BNNB 4XUOA 2JDAA 3RYHA 5JXGA 2ETEA 4BIUA 4W4ZA 1MA1A 4H55A 1EY2A 4K8RB 4IE6A 2GALA 3B69A 3VZJA 2WZPP 3U07A 4ASUG 2VCCA 4SBVA 4EN8B 2B9ZA 3HKDB 2VUDA 1AYM2 2RG4A 2WZR1 2KR2A 2F17A 1HN1A 4QQPA 1YITV 4FOWA 5BNNA 2E7AA 3FAVA 3H0OA 3RZHA 5ERLA 5JH7A 1RINA 2WQZC 2JDPA 1OA4A 2FD8A 3W9AA 1PNGA 2QWNB 5LMUB 4I0XB 2VVFA 1QQP3 2PAKA 4OFGA 1I6XA 3I3MA 3HKDA 4ICGA 5LEKA 2EIMC 2JGDB 5IWAB 1H9WA 5F8PA 2ZABA 5KUMA 3FL7A 3ZX6A 2Q7HA 5BMVA 2ZX4A 5IWFA 3INAA 2F95B 2WRAA 3OT7A 1PIV2 3PHMA 2RS52 4I0XA 1R1BA 1F15A 2PZSA 1PX3A 3SKJE 1F4HA 1WNSA 4Q4V3 2YICA 1UQXA 3K5MA 3K48A 4MX3A 4QT6A 3POWA 3PDQA 1KUQA 3N3HA 5D8AB 3K5LA 4XQ4A 3LFIA 2OIGA 3OEHG 3CCUV 1CAUB 5E88A 4AYUA 3O1UA 2JIGA 5JXHA 3LA3A 4JF3A 2A3WA 2XHNA 2XUEA 3T2PA 2EIJB 1Q6HA 1CZVA 1FPN1 3L9JT 3RI8A 1U5ZA 1NA1A 4YJ3A 1UMIA 1R093 4LCUC 1OFSA 2ZGKA 3OG2A 1FX5A 5JJJB 2Y6LA 2HWE3 2GC2A 5FXZA 5I0SA 1PVC1 5J2UB 4CU9A 5FPOA 2UXCB 2NN4A 3SQOA 3ZYPA 3PVNA 3JALA 5JOWA 3DXRB 1CPNA 4QX1A 4KU7A 1W04A 1MSDA 5BNNC 1S0CA 4Q4X3 4E4EA 2XJVA 4Y26A 4U3JA 5LOVA 3VBSB 4XFBA 4N43A 1CZSA 4IV3B 4DR3B 1NX9A 3LSUA 4JGZA 3JD1A 4M3CE 1IXBA 4XMAA 1GMMA 2OTJV 5BY1A 1UY2A 1JS9A 4A2UA 2R16A 3TCUA 2VWKA 1A8MA 1K4CC 2AZ2A 2ITCC 3IC7A 4GXLA 3DXRA 4DV1B 2B8MA 3WNLA 4GB33 1ALYA 3CMEV 3NV4A 5JOZA 1GV9A 3WT3A 1LKNA 3GJBA 3VBSA 5LZ6A 2EXKA 2BSKA 1CX1A 1XMOB 2ZZQA 1XUQA 2VZPA 1VQPV 5LHIA 4MHRA 1H1AA 4DY3A 3AB0A 4FOQA 1YVWA 4F7ZA 3HKBB 2P90A 2W5FA 2EIBA 3TEWA 1R3KC 1APNA 5E8AA 1AUYA 2EIGA 2AH2A 4Z1VA 1N1TA 5LBFA 3PJQA 1K73W 1GKBA 5FY4A 3OE7G 5FZCA 3ON7A 5FZ0A 5CKMA 3WFVA 3CXHF 3SCHA 1GOGA 5FJKA 2QJVA 4LITA 2UXXA 3IN9A 5B3SB 3HKBA 4UXAA 1PNLA 2IVJA 5D8AC 2Y4UA 2QQIA 2GBOA 1PX4A 1JUIA 5BXXA 3ZN6B 5LY2A 3H3UA 4AI1A 4CDQA 3WQ0A 2OQ6A 3P30A 1AJOA 1R081 2ZE7A 2RMU1 4X1YA 3DCQA 1UW8A 1VAVA 3U0ZA 1H8VA 5J98B 4J10A 1KQSU 1YFWA 4OZOA 2EIJC 4JI6O 3KVAA 4COZA 4GZ9A 4XXPA 1XL6A 4K35A 3W21A 1NVPB 1KS5A 1RUF2 1YFYA 1WZXA 3PVEA 3NNMA 5GLUA 3O9OA 3WCRA 1OI6A 2QE7G 3PMSA 1G6UA 1DG6A 1PNMA 1IQDC 2WR9A 5C70A 2RVAA 4N90A 1YJNV 4J7JA 4IEYA 3GWKC 1HRV3 3SEPA 3FYIB 1FFXB 3RSJA 4W50A 2R1BA 4DR2B 4FPFA 1W0NA 2QCSB 2EZOA 2Z0AA 3WG2A 3B4SA 1HJFA 1PMHX 1L8DA 3ZLIA 5FWEA 5JSPA 5L9VA 2ZR2A 2J7MA 2N7GA 5A7QA 4IV3C 2Y69B 2QKCA 2BERA 1RGSA 4M01A 3AG1B 2UXBB 3HAGA 2VUCA 1ENXA 1FFXA 1W2AX 2PGGA 2UUCO 1ACCA 1Q56A 1M9NA 3NQHA 3Q4HB 1XRUA 2DW4A 4P30A 2GV9A 4C0BA 3L72H 3S7EA 3T1MA 5KWRA 1W9FA 2VAUA 1N47A 4Y3OA 3POJA 2ZGUA 1HB4A 3LPFA 2VMHA 3A0RA 1T6BX 2AC1A 1D0GA 3QG5A 3KHBA 4GD4A 2W1WA 3ELNA 3ETPA 3ZYGA 2P1BA 4R9CA 4LORA 3ABMB 4MYEA 4XUQA 1VQ7V 5IK4A 5FR3A 3O7OA 2W95A 1N4CA 1O3RA 2HWE2 4ZZ5A 2GTAA 1OKOA 1XBFA 1WN7A 2X05A 4AE2A 4OULA 4QDRA 5F5IA 2IXHA 2E75B 5FPVA 3OD4A 2L9LA 3ZFEB 4DW0A 4K0KB 2SLIA 4FPYA 5ACA2 3TRSB 5B3SC 4QHZA 5EXOA 4Q4X2 3TNQA 3LDKA 1NR1A 3D4KA 1H0BA 4B3MB 1JBCA 1RFYA 4R9DA 4XQWA 1GYKA 3BTAA 3ZFEA 1IQAA 4KG0A 1TQ5A 1PGW2 4BYYA 3WW4A 4UT5A 1KB9F 3GNEA 4JV5B 3L74H 2ET1A 2Y33A 3N7JA 3VBHB 2HEPA 2RQ6A 2PA7A 2VPVA 4R7CA 3A2FA 2YHJA 2YC0A 4UB6Z 4A7KA 1IBKB 2P2KA 3I2JA 4LF6B 1LU2A 1QY4A 3URFA 3SH4A 1VF7A 5EP9A 1ENRA 3WEZA 2HYXA 4X89A 2A70A 4QPKA 4QU2A 4G28B 4XW3A 4BIOA 3MIDA 3Q8CA 3WF2A 3L71H 3I5DA 1OF3A 5DAVA 4MXWB 5E16A 2ZMKA 2B45X 1TNFA 4W8JA 3K03A 1US3A 2PYJA 1Y74B 1R64A 5APAA 3VZNA 4JDOA 3N7KA 2C0ZA 3CEWA 4RR3A 1JYTA 1POV3 3ZN4A 1VAKA 3T4HB 1RUE1 2WT2A 4I55A 3JQWA 2QA4V 1YXWA 1QHDA 3OMNB 4FLVA 3BODA 2V4DA 3ACGA 2JGUA 1QH6A 3FX3A 3UGFA 3SYOA 4W4LA 4MXWA 3AG1C 5BY5A 3GHNA 4YWAA 1NCRB 4ITCA 2EXIA 3LWCA 5BXZA 2NR5A 3DC6A 2R7EB 1DHKB 3AP4A 1UYPA 3RN4A 4C1WA 3ZIAG 5FK7A 4JI0O 4CDWB 1GP4A 4UYBA 4XAEA 1MS1A 2DVBA 3AMPA 2YZ4A 4K8ZA 4QQHA 4QU1A 2EXJA 2HEVF 1NCRA 3AZVA 1Q82W 1BK0A 3ABMC 1WAZA 4DO0A 2V7QG 4I7ZB 1X8MA 3TNPB 1VBA1 1YEWA 3ZKYA 3OPZA 2B42B 4BA6A 1XXNA 4AFCA 1I94O 2WKKA 3AG3B 4JI2O 5FZ8A 2VNRA 2R30A 3FHAA 1BEV3 1W6OB 1YUDA 4TQDA 4F4LA 2PN5A 3MAQA 1YCIA 1FJGB 3ORJA 1RUC1 4UOJA 3CQOA 3SHRA 4XIKA 3EMRA 3E86A 4NWWA 4HMZA 3M4FA 5JVVA 5HV4A 4XOGA 3ZO0B 2AXTZ 3OGSA 4X66O 4BWAA 4QX0A 3NV1A 1Q8OA 3WHTA 3SCGA 1W6OA 4P9WA 3VBHC 3MDSA 3N9QA 4QJFB 2XGXA 4JC1A 5FOJB 1FOD1 4BMEA 4K40A 1S0EA 2EILB 3S3WA 3CCMV 5IVBA 2ATFA 5D5QA 3Q8BA 3R4SA 3FB8C 5B1AB 5DPNA 3JD4A 5LBBA 4LKSA 4UFKA 1CD3G 1WMEA 5EFUA 5DAPA 3TJTA 1PV0A 1YNAA 4XHBA 3ZMNA 1SDWA 2HVJC 1VB2A 1AHSA 1WLEA 1KD7A 1QJY3 1J5EB 1UMZA 1AR1B 4XDOA 4XZPA 4DR6O 2J22A 4OMCA 3DF0A 1EUUA 3GYDA 5IVYA 3S5QA 1NCRC 4MSVA 1LENA 4NXNO 1MZEA 5IYDO 1DQ1A 3PUQA 3W58A 1R1A1 1MS4A 4CP9B 3BTYA 4CUBA 5L3BA 3VOUA 1HXS1 4Q4W3 2X0LA 5LYJB 4CDWC 1VQOV 3VBUB 2JX9A 1DF0A 2C26A 3NNLA 2RJZA 3KB5A 3C3TA 2R6QA 4F6RB 4YJ2A 4MVMA 3K46A 3N7MA 2BVBA 5IVEA 4DOUA 2VRZA 4AI2A 5F6KA 1RMU1 4EZ4A 5AVAA 4DK1A 2XMLA 1W8OA 4A7ZA 5CG9A 2A6VA 4ASKA 4OX9O 2WLLB 2YC2A 5C8WA 3C2UA 1FNYA 5LW9A 4EKWA 1EN4A 3CJHB 3ES4A 4TYSA 5C8CA 5IT6A 3W7TA 1HNWO 1W28A 3GZEA 3AG3C 2XLAA 4XF1A 4WFEA 1SA0A 5AG2A 2WS93 3SYQA 2PHTA 4AQYO 1SDDB 3ATGA 4I4TA 1SG3A 1L7QA 2WLLA 3J26N 5JPNB 2VQFB 5FO9B 4YIPA 3CJHA 3E6BA 3BOWA 3JSLA 4I01A 4OI0A 3KF3A 3OUFA 1WB7A 4UVAA 2D6OX 1V6NA 3USSA 5B4XA 3L2HA 4CPBA 3ACHA 1F8VA 3EVKA 4B3RO 1TME1 1JQ0A 3G71V 3K51A 1N36O 1WCKA 3N9NA 2BBVA 3CHXA 4XTPA 2EILC 2WYFA 2Q7EA 2Q4PA 5EZYB 3W59A 2HBUA 3R65A 2JB8A 5B1OA 4X64O 2WNEA 4FOYA 1NH2B 3A21A 5B1AC 3WDTA 4AQ6A 2VZQA 1O8SA 4WVZA 4NHLA 1EAH3 2N04A 1LECA 5KHIA 1N1YA 5EZYA 3JD3A 2B1GA 2DFCA 1O3SA 4O4JB 5IAXA 4DUXA 2CSGA 2HG5C 2BFUL 2RCVA 5DAQA 3ZMSA 4UW4A 5FZKA 1BEV2 1DF5A 4EJRA 1S5LZ 1RXFA 4Q2FA 3T1CA 3OCPA 3OR6C 5IYZA 4IEQA 1VBD1 1ENQA 1X59A 1IOAA 2B39A 1W8HA 1IKPA 2YI8A 5FREA 3J7LA 5JI9A 3C3SA 4MW8A 1YJLA 3AZXA 4IEVA 2BZDA 1LNSA 4G2KA 3MUY1 3VBUC 4TZDA 4Y5SA 5IJ0B 5L9RA 3LNNA 1HB2A 1O6UA 2WLIA 1LCLA 3DYPA 5FPZA 1AR93 3NJYA 3AKRA 4NHKA 5GLVA 3SXWA 2QKSA 5L3CA 4YRDA 2I07B 4ATEA 4CUAA 2A7AA 3ENRA 1U12A 2P5BA 1N3PA 1WA4A 4UV8A 1WA6X 2V09A 2Y6KA 1WMXA 4LF5O 4OHWA 5FPUA 1G9AA 2MEV1 2VW1A 1O9HA 4L11A 4X66B 1E5IA 4J1XA 2IZWA 1SLIA 2ZX0A 3OGGA 2DVGA 4LA2A 1WW7A 2A6ZA 4NIHA 1XNKA 1XNQO 2QWPB 3OM3B 2I2SA 1G9CA 2ZINA 4A44A 3H1IH 3MHHC 1SQPH 4I0AA 4TV8B 1BKZA 4CBCA 3TN91 1PZ9A 1OHFA 1COV3 4J9ZB 5A3WA 4HK8A 2DWRA 1ULPA 1YJ9V 3AKTA 1YWKA 3OJBA 1NUKA 4LEJA 4BDVB 2OYQA 2CDOA 1BYHA 4BQWA 3NL1A 4LFCO 1SBDA 1NQTA 2G9ZA 3FZ3A 4DQAA 5BR8O 4Q4W2 4P14A 3WNKA 3H1HH 3OEBA 4BZ4A 4TV8A 4N21A 1B35B 1GQGA 4IXLA 4LF7B 4Y33A 1H4HA 3AYDA 3R4DB 5HXMA 5C9AB 4DR1O 1AR82 4WFHA 3SITA 4Y1XA 1JJ2U 4YNIA 4LBQA 1BBT3 1QJU1 2EF6A 4AGGA 3ZOIA 1DDLA 1RTVA 4TUYB 5DUUA 1WW6A 3SGIA 3M8LA 3ZM8A 2R0HA 3N36A 2B7YA 3CLPA 4KFMA 5C9AA 2OIIA 2VMGA 5CN0A 3FHQA 3H1KH 1PPJH 3ROUA 3UYJA 3KCXA 4J6GA 4P9LA 1V54B 3UJOA 1ONAA 5CFCB 3ZIWA 5CZKA 4NOTA 1C1FA 4WVMB 1HDJA 5E1RA 4GCZA 4EWDA 2ZZJA 4GWJA 1Y76B 1J95A 2PHDA 1P7GA 4QGPA 4OX9B 4MUVA 1VRH1 3KQ4B 1XYOA 1ZA4A 2JJ6A 1CWPA 3WY6A 1FMD1 1VBE3 4XF4A 2Y26A 2ZD9A 4RYDA 3NVCA 3U10A 4R9BA 5CFCA 3G6JB 3VUOA 4ZHQB 4Q0SA 2Q7GA 1LOBA 2RM23 4UF0B 3ZCCA 4JX0A 1Y76A 1NQJA 3USUA 1HKDA 1JZ7A 5KAIZ 3M99B 4PIZA 2DCYA 5KAFZ 1TG7A 2XJSA 2YIBA 1STMA 2Z4FA 2ZE8A 5LA1A 2PAEA 4P9PA 2R9AA 3ZHQA 5FP4A 5FPLA 1A8DA 1Y66A 2XHBA 4JYAO 3DYMA 4UCSA 2X7RB 5EJ1B 3WHUA 5FZGA 4UF0A 4LUMA 3T2MA 2W0XA 3MDPA 4HG6B 3KWVA 4EB6B 3RW0A 2AW9A 3WDWA 4S2GA 2N74A 3VQVA 1RUNA 2W52A 4NIDA 3SPJA 1TMF1 5EHDA 2OIEA 2ADPA 4MVTA 4PJYA 4DR7O 3RMXA 1HJGA 4TV9B 1EZVH 3HKCA 2XR4A 2VWJA 1UL9A 5C93A 1SFYA 1EZJA 1BHAA 1XQNA 1RL3A 5I8TA 3LSQA 3LAGA 1M1KW 2X5IB 5GTIZ 4FIPC 1B35C 5FZ4A 1ULOA 3PIJA 4MVRA 4LNUB 1RUH2 1LGNA 5C9AC 5FP7A 3UETA 3N9LA 5A7WA 3A0HZ 5GZFA 1GRJA 2ADQB 1CPMA 4AQ2A 1K97A 4PI0A 1OCRB 2H0VA 4TV9A 1UOBA 5FY0A 1K5MB 4DV6O 3B2EE 1XNRB 1P8JA 1ZYBA 3RZZA 4A42A 2O57A 4P5HA 1IBLO 3IGAC 3LB9A 5A2QN 4XJUA 5JPMB 4TWTA 1OA2A 4JYYA 1OHHG 3SPCA 4CS3A 1YDXA 4J7ZA 3I2IA 1PO23 3B94A 3POEA 1N1SA 3K4ZA 1V54C 5CFCC 2OPKA 3PUHA 2Q68A 1RUG3 3CRCA 1K5MA 5F2WA 3T1HB 3FLTA 3PU3A 1AVBA 1S0FA 4Q0UA 2I74A 1SC5B 5FIXA 2UUBB 2ZKLA 3OB8A 2QQPA 3A23A 2D43A 2F43G 1WD3A 4HFSA 1I0HA 3CF6E 4DV7B 1MS3A 2RDNA 5FWJA 3VQYA 4O2BA 3ST7A 1JYVA 4AI8A 1X7NA 2TBVA 2EAKA 4FLYA 5A3TA 3HNBM 4NUBA 1UZ0A 4LFAB 4X62B 5IYYA 4JI7O 4DEQA 4WFAV 5B5EZ 3WDXA 4LA3A 4WBBA 2XJRA 4PELA 3UQ8A 1LOFC 1JHJA 2VOXA 1C4RA 2A6YA 4HKWA 5A3NA 4IHJA 1UNBA 1KBHA 3KT1A 3ZRWB 1M4WA 1DFQA 3O0WA 5EIBC 3R4UA 3CCLV 4AILC 3MW2A 2WYSA 4BM8A 1O9GA 1X4TA 2K9PA 4FI9A 4DR4O 1RITA 2Y8KA 4XBFA 1BVP1 1S5JA 1XC6A 2BNMA 1AYN1 2FDGA 3M3EA 4AAPA 4BQYA 4IE5A 5IYCO 4JYBA 4AAXA 3WUCA 3UNPA 4GX1A 3KF5A 1WW5A 4YW6A 2LFRA 5A1FA 3K0GA 2BJSA 3CCSV 4IEZA 4QXBA 1KMIZ 4QPIB 3LDCA 1OKQA 1SBFA 3AVSA 1X8EA 1EBOA 1VMFA 5LMNO 4FP2A 4RA0A 2QTOA 3I2KA 2W6JG 2X5IC 3V64A 1QWRA 1NZIA 2AREA 3J8F3 3RQ0A 5FZIA 5E79Z 1SF9A 1REDA 4IW3A 1RVF3 4LF9B 4HOOA 1KKDA 4XJ8A 1VIWB 2RS31 4DUWA 1OCRC 4X6QB 4Q6GA 1OMIA 1K5MC 1NY71 3OUIA 4QPIA 4DXZA 2DE0X 2QVSB 3BUCA 3AJYA 4CCKA 2ZM6O 3BHPA 1SCSA 5DZEA 3MPBA 4AEDB 4EZHA 5F32A 4D69A 2BOIA 2H6BA 5KXCA 3B00A 4HN0A 1MS0A 1OUXA 1FXVA 1Z5VA 4MGKE 1Q6UA 4KHPO 4LKEA 1VQLV 1WP8A 2NM1A 2ZNIA 3BI3A 5CG8A 1DIWA 3CRRA 4GWNA 1DGSA 5FZDA 3SDLA 3ASIA 5FMCA 3Q9OA 4NTWA 1W0OA 5EWSA 4QX3A 3AMHA 4NHMA 4Z07A 3F95A 5FY9A 5CNAA 2QR4A 3ZFFB 1JFFB 4AEDA 5K0UB 1KJRA 1I5YA 1TEIA 5LGTA 4LLOA 4BHPA 4Z1MG 4DR5O 1WMDA 2G19A 3T2TA 5CFDB 2GMMA 1HDKA 2P37A 3S0MA 2BYVE 4MLOA 1RSOB 3D82A 4A6SA 4G27B 4W65A 2D2CB 1RP3B 1ASJ2 5FUIA 3K58A 5FOBB 3M70A 5ABJA 1JFFA 2AEZA 4E8CA 1QBZA 5K0UA 4IE0A 1NTMH 2Y6HA 2DCTA 4C0HA 4X65O 3JBG3 3J7AU 5CFDA 2HBTA 3VZOA 1E79G 5JR7B 3O1MA 5FP3A 5B66Z 2OS2A 2XJQA 2VNGA 2R072 3KHCA 3JD73 4ZS3A 1RSOA 3LIHA 1POQA 1UOFA 2ORZA 1TGOA 5A32B 3QO8A 2WQ8A 2ODMA 3W7UA 4OHXA 5J37A 1PO12 3GCWA 1XMQB 3ZMVA 3NNJA 2LJ2A 1RUG2 2DN9A 4GMP0 3L75H 2VTXJ 5CMUA 3DKWA 1ZNPA 4K7JA 4JI1B 1MEC2 5A32A 4QPIC 1S2KA 1GM8A 5DDJ2 1W2TA 3ZSEA 3O0XA 2XLFA 3B8NA 1RHI2 1GWLA 2WNVB 1QQP1 1KU9A 3C7EA 2V1DA 1PZ7A 3SYAA 1RUJ2 4NRMA 3B9IA 2IJIA 2B46X 1UU6A 1ZZ8A 3LIGA 2VOTA 3BU7A 1A3KA 1YQ2A 2DCJA 5JOXA 4XJAA 1AR61 4BCUA 4RFT0 3B5LB 2RN9A 2BQPA 3RS6A 5CB7A 3NNGA 3UL2A 3VN4A 4CH5A 2WNVA 3M3IA 2WO3A 4AEDC 2YUEA 4ZPIA 3O1TA 4Q4V1 2Y6FA 1KDMA 3T0BA 5KBFA 2ZX3A 4RWUA 2P3KA 3JUUA 1PL4A 4IEOA 2YMZA 4B3SB 2QM7A 1GM9A 3Q8EA 1UPGA 3LCPA 1PL0A 4X1KB 2XKPA 3ZEDA 1BXHA 2BE3A 2QQNA 2YXSA 4FP3A 5GM0A 1CN1A 4ET7A 4HSJA 3ZFFC 3EB7A 5K0UC 4XIOA 2LO1A 2QKDA 5TSWA 3D3QA 3CS5A 2ZS6B 2QGNA 4OXSA 2A6WA 1OCZB 1EPZA 3PUSA 1XBLA 1F23A 1VLNA 5CFDC 1GFF2 2GTSA 4HLTA 3KMHA 4PHZA 4X1KA 3HT2A 1C5HA 2GAUA 5FZ1A 4DR4B 3RJ2X 1QIQA 4FFIA 5C3QA 4AFBA 4TSVA 1ZRIA 1R091 4BAYA 1RVF2 1JX9A 1TA8A 3QACA 2HWE1 4WZCA 1UIKA 4CP1A 2BTQB 3VBBA 1P7BA 2EBOA 3CC7V 1XOYA 3BB6A 2JEXA 1K9MW 3JD0A 2VQAA 4A41A 1LUWA 2YXHA 4K20A 1VRBA 2RR13 2G38A 3VBRB 2E9QA 5BNPB 2N05A 2EA7A 4LWSA 4GKJO 4QXHA 1BJQA 3RMYA 2UXDB 3OBZA 2OT5A 1FATA 1OVSA 3FUQA 1SERA 2JD4A 2ARXA 2QQUA 4GH4A 2YB7A 2BTQA 1QHTA 3MIEA 4LKFA 2HKOA 3OUJA 2ZDIA 2LGWA 2IJHA 2WNUB 3VBRA 1QQCA 3V0AA 2HYKA 1ND3B 1MS9A 3KV6A 2Q0AA 3AG2B 5IAVA 3OF1A 3KV5A 4GB31 1C5IA 5I0TA 1W8WA 3NXSA 2CNAA 5DG2A 1VB4A 3J80N 4JGSA 2YIDA 3DSQA 2WNVC 1V6IA 5HCFA 3POSA 4H37A 3GDBA 2AHYA 5FMDA 2HLDG 4L87A 1W9TA 5I8SA 2HHHO 2PHXA 1YLLA 3K9AA 3RYIB 1SLAA 1AXYA 5HI0A 4UCVA 2AGAA 1JYIA 2DBNA 3ZVXA 5JSOA 5C8YA 2XQXA 1AJNA 3JBG2 2ZA9A 3LFMA 3NRUA 1LODA 5AFEA 3CJIB 1O5UA 4F8AA 2JDYA 2QQLA 1XNDA 3JD72 4JZRA 2VU9A 2IM9A 5A70A 2XG3A 3OGVA 4I5SA 1QKQA 5J9PC 2UU9B 3RYIA 4QX2A 2W1QA 3P5BA 2A9HA 4HANA 3MEPA 1ZBE3 4E2QA 5GONB 4D7YA 3JAWB 3E35A 1XREA 2Z69A 4FPKA 2WL1A 2UYAA 2E63A 1OCZC 3MZHA 4DV3O 4YVWB 3B9CA 1CAXB 3OTOO 1IGOA 1SLBA 3MIFA 3ZFGB 3SR2C 5IY5B 1XB9A 5GONA 4DV2O 1MQTB 3B02A 3MUZ1 1VQMV 2YI9A 3K08A 3F7VC 1Y9MA 5LEJA 4JASA 4WM7A 2JDZA 1W03A 3VDCA 2XQRA 5K4LA 1BT8A 1AL21 4KNCA 2ZDIC 4NJ4A 2EINB 5FJHA 2UY9A 4YVWA 4X8AA 3VBRC 2Y6JA 5BNPC 5IVJA 5LA9A 4O4IB 1A78A 1CAXA 4FFHA 4U36A 1HRV1 5DN6G 1AR71 3UT5B 2MK3A 3OY8B 2W2IA 1RUI3 3E6CC 5LL6Y 5J48A 3LSEA 1UAIA 1N34O 1AP5A 1G4YB 1MQTA 4HK9A 4E4HA 4AI3A 1PGSA 5H6QA 1XNCA 1Q81W 3VL8A 3WF1A 2QDOA 2WAMA 3RWKX 1GU3A 1OA3A 3FKSG 1QNMA 1GICA 5EZWA 2ZIMA 4CCNA 3PUIA 2W92A 1O3TA 2WNUC 2FCVA 4ASLA 4O4IA 3CCJV 2QDRA 1CXZB 1ND3C 4N7UA 3UT5A 1U5YA 1OFNA 3AG2C 3OY8A 2HJFC 2IBZH 3IAQA 3DECA 4LFBB 2VQTA 1XL4A 3CB2A 1SQQH 3UKNA 1D4M3 2MHFA 1JYWA 2XH6A 1AL0G 4NKGB 2VOWA 4KH9A 2PHUA 3ILRA 4L2NA 4XZUG 2OVUA 3PMEA 3E5XA 1EUTA 1GWMA 4D6TH 3FFQA 3CDZB 1ZBA1 2Z5UA 4YY3B 2ILMA 3ZYIB 1J83A 2ZGTA 5CBLA 1W59A 3A0NA 2DYCA 1SRYA 4ZIBA 3CJIC 4FPHA 1SMVA 2W39A 5CBFA 3GBGA 1XILA 4MOAA 1O59A 5A3PA 2KM2A 1SLLA 1S0GA 5IW0A 4AFMA 3K4DA 2KA3A 4BQ3A 5ITZA 3AK0A 1AI6A 1FPOA 1X82A 3CBNA 2BEOA 4JI3B 4AFAA 4FM1A 4UFJA 1M57C 2CH7A 2W6IG 3K75B 2RS13 4YYOA 2XBO3 1D5AA 4D7TA 2A5ZA 4K8XA 1ZSPA 1K33A 2J1RA 2Q6AA 4N53A 3UGHA 4JI5O 4YVWC 3UM7A 1B6QA 2ERFA 2QBXA 4E9KA 2WAAA 1W6MB 5H9PA 5HCAA 3OYWB 3BKZA 2R72A 4YZ1A 3VL9A 4H2AA 4LMFA 2OKXA 5JI7A 3VKFC 2X09A 3ZFGC 3J7HA 2XOKG 2XDVA 5IY5C 1MQTC 2JXAA 1HNXO 3H3ZA 1N33B 1NS1A 2DQ0A 1XPWA 4K3AA 1WLTA 1DYKA 3F5WC 1VR3A 2YBKA 1YJWV 1E5HA 4IEUA 4JAAA 2QWOB 4TQFA 2EINC 1UU5A 3OGJA 3QBQA 4CRQA 1XOUA 3AL6A 1YHQV 3ZSMA 3OYWA 3C7FA 5J7MA 5HCHA 3OEAA 5DG1A 4IGPA 4MVQA 3GHMA 4AGVA 2WFF3 4QD2A 3KT4A 1D2QA 3WVJA 5KMGB 3QTCA 2C5DA 5F2VO 1VEWA 3LSDA 2WLJA 1KS4A 2XVLA 5EPAA 1Y9QA 5F5QA 4YZ4A 1GTOA 2XL7A 4P02B 4F3JA 3TAYA 4XBNA 3K3OA 3LPGA 2JEUA 2HFEC 5LRRA 4AFDA 2WWUA 2IWGB 4RQEA 1VBB1 3E5QA 5IFTA 2D97A 4BH9A 3CCRV 1U97A 4UUJC 5FBZA 2DTYA 4YGDA 4JRAA 3OBAA 1K42A 1QF3A 2K9ZA 5JXIA 4Q0QA 1K7DA 2V73A 2OQ7A 4PD4F 3CC2V 3IB3A 4V1PA 5FRAA 3T1YO 1UZYA 4PQQA 3H8XA 4PIXA 2CGOA 1BSMA 4JVAA 1W6PB 2X29A 4I30A 1UO9A 5FUPA 4PA7A 1Y6XA 2UXNA 1F7YA 2PLV3 1UKRA 1ULFA 3QOPA 4CUCA 1T5EA 5FQ0B 2YIAA 2HWF3 3FBYA 2IFWA 2QZ2A 1Z78A 1TVKB 2YS8A 3PL0A 1N0JA 5FYSA 4MTXA 4GX5A 5FCCA 4QM8A 1XU1A 5LBEA 3E8GA 2C9KA 5EBLC 2Q8CA 1W6PA 1WLDA 1KJLA 4DRXB 1R73A 2WDBA 3IPVB 5FKBA 1ULCA 2E7TA 3LGRA 1I5PA 4BOWA 2XUMA 4YLZA 4XUNA 3WG7B 1UZVA 2LP7A 1KFXL 4MTFA 4OUSA 4AEMA 4OI2A 2QFEA 4LIUA 5LASA 5HBAA 2AZ0A 1O7FA 3HMYA 5FZLA 5LMUO 1DLLA 4QMAA 3OMAB 2BW8A 4OI4A 5FMOS 1XE0A 4DRXA 4LQRA 3EYPA 1W9YA 3IPVA 3WB2A 4DXSA 1N3OA 2XPJA 4V2VA 4FM2A 4CC6A 1EFRG 4QXCA 5C3PA 1R083 3KT7A 5IWAO 2W3JA 2WZR2 1QNYA 1X50A 1WUVA 4FPPA 3RJRA 1AYM3 4YM3A 2QZ3A 4JTCB 3ES1A 4XE9A 1K3EA 1NKDA 1XDCA 3P1IA 1H30A 2D3RA 1BE3H 2R9IA 1OUSA 2ARBA 4ZI7B 4YFZA 4MH0E 1POV0 2H94A 3AFKA 3GJAA 1QJY1 4WBNB 4N9IA 2VTXA 5A3UA 1CVNA 1UX6A 3KKYA 3BALA 3JYCA 4FJCC 3GBFA 1PIV3 4BXSV 2RS53 3U14A 3A8TA 1JODA 4NVPA 4O4LB 4ZI7A 3LZZA 1C57A 5CA0A 1DGWA 2ET7A 5D21A 1OURA 3BN6A 4Q4W1 4W6XA 4PLMA 2VBPA 1NOVA 4Y22B 1FFTB 4AW7A 1WMFA 5CADA 4CZSA 4WBNA 3R05A 3FB7C 3AZYA 3ICXA 4P08A 3T4ZA 4GMP3 3E6DA 5K7PA 3BGAA 4ZXEA 4MT8A 4Q4Y3 2KG7A 3ZHVA 5JDBA 4DRVA 5FNVB 1S72V 1KD1W 1IKQA 3VZLA 4O4LA 5A7NA 1S1AA 2IC1A 2UXCO 4QB1A 1YHFA 3PTYA 3RPQA 1KITA 4Y22A 4UW5A 5GKAC 1CP9A 4Q8KA 1FPN2 3EBRA 4JI4B 2GMEA 2WS91 2ZIOA 5FNVA 4DR3O 3VQWA 1JR9A 4UI9L 2BP6A 5GZCA 2WFF2 4CS4A 2YV8A 2E6VA 2E74B 3PUAA 4D7SA 5KA5A 4CP2A 4DV1O 2VXRA 3WG7C 4O9GA 4GKKB 1ZRRA 2FBEA 1NU1H 3D0SA 3WP4A 4Q20A 3FMGA 3GXUA 3PIGA 4CP0A 3VD5A 2ZX1A 2ITDC 2YY1A 4IDZA 1US2A 3ZRXA 1XMOO 2VMIA 4D94A 2LRPA 1W05A 2Q5ZA 1ZRFA 4YM2A 5FZ3A 4TWKA 1UIJA 1ZRCA 4LBMA 2EX3A 2YEVB 4LBEC 1XHZA 1W06A 4XFIA 2PHRA 2CDYA 1BK1A 3ZPOA 1FAFA 4QPJA 1QOSA 3JCUZ 4W6WA 3RYRA 1EAH1 3RGBA 1SQ4A 2XJUA 5FDBA 5FY7A 1HV0A 4YGBA 3UO3A 1VQ4V 2HWF2 1HQLA 5KXDA 4J41A 2KD7A 3HOBA 2YEVA 4BLJA 5LXTA 4KBBA 2JDNA 1GZ9A 2QNKA 1SQXH 2B9UA 1DQ6A 5JAXA 2XT9A 3T08A 1SS3A 4Y1VA 2JE8A 1IVSA 1RUE3 4ZKTB 4EFEA 3B8MA 3QD6A 1VBC3 4MV2A 3MHZA 2ZHMA 3THDA 1WP7A 5DAWA 1A34A 1BMV1 4Q8LA 4LHNA 2FDKA 3PURA 3B93A 1JOPA 3JASA 2RJLA 5I93A 5DUWA 2LTNA 2FZ2A 1AR91 3DGTA 1WPXA 4AGRA 3ZXLA 1IPJA 1R082 1OCOB 2J1UA 2X8KA 4RFRB 2RMU2 2E76B 1QJX3 1W2NA 4O7XA 4QB2A 1W8UA 2FKXA 3IDEA 2GNDA 4HZ3A 3VZKA 4NIIA 1UCXA 4DR2O 1B04A 3LEMA 4XFCA 5HCBA 1AB3A 1GOHA 2JIZG 1LHWA 1RUF3 1F51A 2GP5A 2ADDA 4NAMA 3W5NA 2UXBO 3ASNB 2YPDA 1BHBA 4OLLA 5FZHA 2W46A 2P3IA 4RUEA 1ZX5A 2JECA 1COV1 4P9IA 1ZZBA 5BPXA 3BA9A 3MW4A 3UV9A 4C90A 5FV3A 4O65A 3UCSC 4I09A 5J3UA 3WSOA 5FY5A 2BRTA 1DU3D 2C1FA 3H9AA 2IH1C 3E5UA 3VD3A 4AF9A 3FE5A 2CV6A 1JYXA 1H2GA 2JGDA 1BCCH 4JKKA 2HEWF 5FBJA 1U96A 1XU2A 3T1LA 2R49A 4GAZA 3EXAA 1SLTA 4Q4Y2 4XDPA 4HETA 2GH2A 2VECA 4FFKA 4BPZA 2Q8VA 4D6SA 3D5OA 1QU0A 3N2KB 1BBT1 5KC5A 4K0KO 1MVEA 3FD9A 1LHNA 3DN7A 1QXRA 2AACA 3K3WA 4LO5B 5D8AA 2CK3G 1EP0A 2XWBB 2HH9A 3T4DA 1IBMB 2Y34A 5ISLA 3ABZA 4B3MO 2YU1A 2Z2SB 1AR5A 2ZHKA 1GP6A 1UOGA 1MVQA 1CAUA 4LBNA 3TXSA 4HPKB 5C4WB 1Y4WA 1V9U3 3V65A 3G4SV 2XAJA 3N2KA 4UB8Z 1GNZA 2VQEB 5T5PA 2E32A 1GKFA 4CXWA 4JV5O 1DGRA 1KYOF 4PDVA 2IH3C 1DGLA 5DXDA 1VBE1 1OQ1A 4QHBA 4DW1A 1IBKO 1IX9A 5LHHA 3SH5A 5ACA3 4LF6O 4UVCA 3AX4A 1UXZA 2ZBJA 3B09A 4HPKA 3OPTA 4FFFA 1LGCA 5C4WA 1DF4A 2C4XA 3SJCC 3SJQC 2RM21 2P17A 4YHHB 1HXS3 5J2UA 4URAA 1OCOC 5JCOA 2XLGA 4IGQA 2MW2B 2EJ7A 1AXKA 1SQGA 4CDUB 5SV5A 2K2SA 2WC2A 1L0NH 2A79B 5FP9A 3LDBA 1HNZB 3HNYM 3UGGA 3P32A 4FM0A 2JKXA 1H2KA 4EN7B 5F3EA 4AR2A 3CU7A 1J3QA 4B3TB 3AVRA 4XUPA 4IV3A 4JPRA 4LR4A 5FZBA 2JG8B 5FLXN 4NMIA 3ASNC 4CDUA 4Z2WA 1JH5A 2R70A 2QWRB 2XHKA 3MV11 1H1MA 4LH7A 5FLIA 4LK6A 3AJZA 1GR3A 5BV6A 3M3QA 1HB3A 1RUE2 5I0RA 4R6ZA 5L3DA 5FY1A 4GALA 4EE2A 3RRDA 1CPYA 4YM1A 1VBC2 1I3HA 4CU7A 1NZCA 2XAFA 3HQUA 2VG9A 4WCEV 2DQ3A 2BDRA 2JS5A 4I50B 2OUHA 4JTDB 1LOGA 5HXVA 1C1LA 4LH6A 2ZEWA 3FJSA 1KDKA 3DUIA 4CU6A 5A9GA 1OQEA 1LU1A 3O65A 1TUEB 3J7NA 2UYBA 1JCHA 3BCWA 2Y48A 1QJX2 2BNNA 4JTNA 4FQ4A 2Y4TA 2O8OA 1A6CA 1QVFU 3IDCB 3SYCA 3N2GB 2YROA 4CVUA 3K79A 2IU3A 5JMCA 1NR7A 4I50A 4FBFA 3K59A 4L8QA 2HVKC 2ZXWB 1FJGO 3ZN6A 3VDDB 5FPRA 5FYVA 1PO21 4XEZA 1YTFB 4KI5M 1ZX3A 1P4RA 4IERA 1VBA2 3ZRSA 2BUKA 5C4WC 3GZTB 4XQDA 2CYFA 3AKPA 5FPXA 5JCOC 3CC4V 2HWC3 2HWB3 1RM1B 5LBCA 4QHOA 2Q1FA 3BVCA 3VDDA 2QEXV 4YW3A 4OUEA 3B40A 4N8MA 5FXVA 1GUIA 4X1IB 1VBD3 2VBBA 1VAMA 1RUD3 2P7TC 4UFLA 2GUZB 1QDCA 1WLWA 2ZGLA 4J1WA 3E97A 4XC9A 2ARCA 1OOPB 1W3VA 1HN0A 4AVSA 2DUQA 1UY4A 1LAJA 1C8M1 4LR3A 4CZZA 2BOJA 4CSWA 4CDUC 4KGQA 4J7KA 2VMCA 2W1UA 3JAKB 4K1ZA 1CX4A 4NPMA 1FOD2 2GH8A 2GUZA 4LF8B 5A7OA 2VBDA 4QGNA 3FHIB 1JYCA 2WLPA 5L19A 4AVVA 2QQVA 4YZ3A 1ORQC 1UOJA 3ZXAC 4YIOA 1J5EO 4CE8A 1OOPA 2JG8C 4XVHA 1ZA7A 4B3NA 3MLLA 1GNHA 3FB5C 3W7WA 1PM9A 3HBKA 2RNBA 4E4ZA 4U2AA 3WUDA 5CU1A 3JAKA 1PNFA 3Q4HA 4XJZA 1W9SA 4Y1YA 1EV11 2P4VA 1XHXA 3MIBA 1V9U2 2UUAO 1DQ2A 4RGGA 3G6BA 4JZGA 4OPHA 1ZLZA 1UU4A 4XDJA 2X6CA 5IFPA 4JI8B 3DPRB 4MGIE 4ORFA 3A4UA 3MO4A 2E5LB 4R9AA 3UJQA 4YW5A 4HNAB 1AXZA 3AG4B 3THCA 1OPOA 5H9QA 3J8F1 1P84F 2A71A 3T3YA 3CCEV 1RVF1 3MBWA 1FXZA 4I0BA 5DECA 1R1A2 5M0TA 2DVDA 2QQWA 1HXS2 3APBA 3LQCA 2DU0A 2O8QA 5IJ9B 2A3XA 1LULA 4GX0A 3QH6A 1HX6A 4NB5A 4NRPA 2P5OA 3VHNA 3DL3A 4YVSB 1RMU2 1JZ5A 3OUSA 2ZEYA 4PLOA 2VQFO 2ZXWC 4DV4B 4NRQA 4GKXA 3VDDC 1URXA 5EJ3A 3WW3A 5FO7B 1QJU3 5IJ9A 3BIEA 3VBFB 5CB4B 2Y38A 4NHXA 1SQVH 4DINB 4O61A 1VIBA 1AF9A 3I49A 4J42A 4JCKA 4CPBD 3VBHA 3RDIA 4L8JA 2H3OA 3L70H 4KG8A 4PBOA 1RM1C 5JIUA 4PIYA 1JMKC 3ABKB 4AL9A 2BGOA 2WQ4A 3VDBA 5K1PA 4O9EA 3VBFA 3H8RA 1LOEA 4PDWB 5C6CA 3M8AA 2OT7A 2L35A 2RDCA 4IEXA 2JDUA 4B1MA 1NJIW 1Q8QA 1OOPC 1MABG 1SQBH 1VP6A 4FTEA 4P9JA 3CL1A 2W9XA 2WNOA 5LA6B 1Y74A 4HSLA 4MZUA 3K4AA 2XWJB 3RYKA 1IS4A 1Y43B 4MO3M 1I08A 3JBG1 2I45A 1W0PA 4Y24A 1LNQA 4R8HA 1VQ6V 1E5RA 2YGMA 4W4KA 2ZGSA 4AVTA 5A3OA 4CDXB 2Q73A 1NH2D 1F4NA 1PKXA 5AC91 1KXGA 1ZZ7A 5BNOB 3FYEB 2C24A 3OMIB 1HRI3 4CEYB 4NXMB 5FZEA 4IYHA 1V00A 1QOOA 5L36A 1XJAA 2BTVC 2QM8A 1YI7A 4CDWA 3AFGA 3I2GA 4L97A 2WUHA 1OD3A 3NV3A 1FV2A 3D6EA 3V56A 3MGUA 5B4NA 4FCAA 4DUYB 2HWC2 3WNXA 3DPRC 2Q0OC 2HWB2 5F3GA 4C7UA 3ML0A 2O14A 4PF5A 5BNOA 1Y67A 1WCDJ 3PJSK 3AG4C 1VBD2 1RUD2 1WB8A 3VDAA 1FYUA 5F5CA 1O4TA 2Q8OA 4WM8B 4NPRA 2TNFA 1DK1A 1AP6A 1YJKA 4PA9A 3GGLA 3RZLA 3UT0A 2DJVA 3HQRA 4BQXA 1S0DA 4BU2A 4G4FA 5DEDA 1UPSA 2EVXA 4YVSC 1S0IA 3FN9A 2IVIB 3OBTA 4OHVA 1UF2C 3HEIA 2PTMA 4AEJA 2OXBA 4GKYA 3VD9A 2JG9B 4S2FA 3VBFC 5LHGA 2J42A 1HR0B 3I2FA 2MEV2 2YG0A 4AHWA 1V70A 1JW6A
chains in the Genus database with same CATH topology
5JOZA 1NQDA 3NV4A 2VQAA 1GV9A 3WT3A 1LKNA 4RS5B 5A3MA 3KCCA 4K20A 2RR13 2BPA2 5FQ0A 1BMV2 1OSGA 3VBRB 3VBSA 2E9QA 5BNPB 4XFAA 1CONA 2EA7A 2P34A 2EXKA 4DPNA 4B4RA 1BJQA 3UKVA 2C9AA 2R6SA 2VW0A 3RMYA 5LK7B 1FATA 3VBOB 3HD8B 2ZZQA 3FUQA 1AR92 3TN92 2JG9A 2JD4A 2ARXA 3TBDA 4GH4A 3AM2A 2OUJA 3FFZA 2O0OA 1H1AA 4DY3A 2IFRA 4H3WA 4PDWC 3AB0A 4FOQA 4FXKB 3PNAA 4F7ZA 3MIEA 4E4DX 4RS5A 2DCKA 2RMU3 1APNA 2D3PA 2WNUB 5E8AA 1AUYA 3VBRA 1N3QA 3V0AA 2EIGA 2HYKA 1O4YA 2AH2A 1O91A 1ND3B 2DUPA 5BYNA 4LBQD 4Z1VA 1MS9A 1N1TA 2O1QA 2Q0AA 5JSRA 3PJQA 5IK7A 2GNMA 3DV8A 3ETQA 1GKBA 1C8NA 3VBOA 3MLKA 4OJ8A 1YO8A 3OF1A 2WSUA 4GB31 2HWD1 1E57A 3O5SA 2RR11 4YM0A 1C5IA 5AFBA 5I0TA 3SCHA 4P9YA 2OG7A 2CNAA 4YG0A 3PLQA 2QJVA 3UK9A 5DG2A 2DUOA 3IN9A 4GIQA 1VB4A 2CAUA 4CDXC 3NAPC 4UXAA 4M2FA 2WNVC 5D8AC 1V6IA 1AR83 3B3QE 2Y0OA 5HCFA 5L7OB 3BIWE 1JUIA 5BXXA 3U11A 3POSA 3ZN6B 2FMDA 4SLIA 3H3UA 4AI1A 1COV2 1XE7A 5BNOC 4CDQA 3WDYA 5I8SA 4INDA 3WQ7A 3WQ0A 2PHXA 1QJU2 1YLLA 4CEYC 5FTTC 1AJOA 1R081 4XBLA 1RJ8A 1OPMA 1SLAA 1AXYA 2IXCA 2RMU1 4FFAA 3IBMA 4XJWA 1DYPA 5HI0A 1UW8A 4S2HA 3VBUA 1VAVA 1JYIA 1LEMA 5IK5A 3ZVXA 1DRTA 3IDBB 3AP7A 5JSOA 1GSLA 2HEYF 3U0ZA 1NLSA 3JBG2 1H8VA 5CA6A 1CIWA 5J98B 2ZA9A 3WDVA 1YFWA 4K21A 3VZMA 1LODA 1WGPA 4XETA 1NCQC 5AFEA 1AYN3 1O5UA 3CJIB 4F8AA 4Q0PA 5EYYA 1XNDA 3JD72 2R041 4XBQA 2VU9A 1UD1A 4AK3A 4COZA 4XXPA 3ZSLA 1B09A 2XG3A 3LKJA 1KS5A 1RUF2 2WWSA 1C8M3 1YFYA 1QKQA 3PVEA 5GLUA 3M3CA 1AR81 3WR0A 2XJPA 4WM8C 3WCRA 1OI6A 3PMSA 1PMIA 1DG6A 4OZXA 1FMD2 4HANA 1Q8SA 5C33A 2ZHNA 1IS6A 3MEPA 1ZBE3 4N90A 4E2QA 4D7YA 4YLMX 1UZZA 4IEYA 1BBT2 1J59A 1HRV3 2Z69A 1O4ZA 4FPKA 1S0JA 1SACA 3RSJA 2R1BA 4FPFA 2QCSB 2WL1A 2UYAA 3WG2A 2E63A 2PHWA 1D4VB 1LB2A 1LOCA 5JSPA 1OLRA 3SISA 3MZHA 1SLCA 1Z7S1 2UWCA 4FPOB 4YVWB 3U4XA 4FO9A 3H1WA 3ZXGA 3HT1A 2KXLA 2N7GA 1CAXB 3B9CA 1DQ4A 4N9HA 2F6BA 3J4UH 1IGOA 4IV3C 4AWDA 2CWMA 4FAGA 1SLBA 2Z42A 3MIFA 4ES9A 1RGSA 3ZFGB 4M01A 4XILA 1WLCA 4META 1EV13 3HAGA 1MQTB 3B02A 1G7YA 1PVC2 2JG9C 1ENXA 4YSFA 3KQRA 5LEJA 3NO8A 2XJTA 4WM7A 2JDZA 3GZAA 3ZPYA 3ZXJA 1Q56A 3ECQA 2VVDA 1HRI2 1AL21 1XRUA 1T6GC 4KNCA 1VBE2 4RS5C 2UY9A 1ZBE1 3EJKA 4YVWA 3I4IA 4ISRA 1OLQA 4C0BA 3S7EA 3VBRC 3T1MA 5BNPC 2DCZA 1GZWB 5KWRA 3I7DA 1A78A 1CAXA 1N47A 4U36A 4ZXKA 1HRV1 3ZN5A 2ZGUA 1AR71 2VMHA 1VALA 1D0GA 3OY8B 4H7LA 1RUI3 3E6CC 5J48A