1MZEA

Human factor inhibiting hif (fih1)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
337
structure length
335
Chain Sequence
b'SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 96
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzeA01
1H2LA 1IZ3A 2YC0A 4B7EA 4BIOA 3KCXA 3KCYA 1MZFA 4B7KA 4Z2WA 1H2MA 4JAAA 4AI8A 3D8CA 1YCIA 2Y0IA 4QU2A 1MZEA 4NR1A 3P3PA 5JWPA 2XUMA 3P3NA 2WA4A 1H2KA 2W0XA 3OD4A 2CGNA 2ILMA 2WA3A 2YDEA 2CGOA 4Z1VA 1H2NA
chains in the Genus database with same CATH superfamily
1Y74B 1CPMA 4PQQA 4KG0A 5LMUO 3HVDA 3K58A 5KAFZ 5EYPB 1NXD1 3ILRA 5F2WA 5KMGA 4IEWA 2PHLA 1DP0A 4I3PA 2XQXA 2BSKB 5J2UA 4M3CB 4KP4A 1MR5A 3ML0A 4XXPA 2I2SA 3NAPA 1D4M3 3OEBA 4CRQA 2WFF1 4K8FA 4N43B 2OIEA 3CCJV 3LUTB 2JECA 1UZYA 1C8M3 3K4ZA 3HT2A 4TTGA 4X62O 3B00A 1HNZO 4XIKA 5A3OA 3PTYA 2HWD1 1RYYA 3FHAA 4N23A 4LHKA 1OFSA 2PTMA 3RZKA 1RUE2 3VD5A 1GANA 4JCKA 3LNMB 4K1ZA 1VAKA 3CNAA 1SQGA 1NA1B 4DV1O 3SQOA 2DURA 1UNBA 1M4WA 4GKXA 4K8XA 4MTFA 1LUVA 3IDCB 3TEXA 2OYZA 2H8PC 4IV3C 3UKNA 4ET7A 3OMAB 4J1XA 4AVBA 4MO3M 5KXDA 2X5IB 1X59A 5EZYA 4HSJA 1YC61 3GNEA 3WNXA 1OCRC 2K9PA 5IYZA 5C3PA 5A7PA 1N33O 4YW7A 1O5LA 4LITA 2A7AA 2GUZB 5A7SA 1J83A 1GNYA 4JTNA 2WS91 3P6BA 5JH7B 4K21A 4W50A 3HOBA 4Q2FA 3TXQA 4BU2A 3OEEG 1FFXB 4DNYA 4ITCA 1OJHA 2VVDA 4CPBD 3ZN4A 4OZOA 2RM23 4X1KB 3UT5B 1ND3C 2XH6A 4UAPA 2VE1A 3PJSK 3CF6E 4UVBA 3ALQA 3AB0A 3QVNA 2QUOA 1AR81 2AGSA 4NRPA 2WZR2 1W2BU 3NKGA 1H2SB 4CP0A 1FMD3 3NV4A 2ADPA 4QB2A 4LO4B 1AP5A 3VQYA 3EB7A 1CAXA 3SH5A 1QQCA 4Z8BA 3KT1A 2ZXWC 2E7QA 1LOCA 1N4CA 1RB8G 2JKXA 1ZM1A 2HG5C 2BERA 1S5JA 2HKOA 1L7QA 1I0HA 4AFMA 2VQUA 4XJ8A 2CH7A 3LIGA 2RS32 2YI8A 4X64O 3SH4A 3KCYA 2PQSA 5BNPA 5GLWA 2WN2A 1F4MA 3WW2A 3LSSA 2Y69B 1QJX2 1SDWA 4JI1B 5ANQA 3ZYJB 2ZNIA 4IV1A 1R73A 5AVAA 2K1EA 2P3KA 1EV11 1FI2A 4J80A 3N9QA 1PL0A 2VZRA 2B9VA 4QDQA 3RYKA 5LYJA 4Y1VA 1SDDB 1ST8A 2VQEO 1MS3A 2PUSA 3DEMA 4YGCA 1XNTA 4LOSA 4BM8A 3N2GA 2VZ1A 3A0NA 5JOZA 2YICA 4CC5A 2CGPA 1YYNA 2YIDA 2ARXA 4Q4Y3 3G7DA 2D6LX 4N90A 2UXNA 3K0DA 4DB5A 1W03A 4I9WA 3A7QA 3WU2Z 4CZZA 3RYHA 4UCSA 5BPXA 2ORXA 3ZR6A 2G38A 3J9SA 3D5OA 4MVMA 2X7RB 5L7OC 4I50A 3TNPB 3AP9A 2YDEA 1JYVA 4ZXEA 3O1TA 2V5DA 4GALA 1JZ5A 2ARCA 4CEYA 2TUNA 4GKJO 5ANNA 3FHIB 4WFBV 2UUCO 4CDXC 1M1KW 2WAMA 5CA3A 4DR1B 1WLTA 5A1FA 5FZKA 2A06H 3AP5A 5LZ6A 2BOIA 4EFEA 1GAXA 2WLMA 3PUIA 2EVXA 4TSFG 3CCLV 3BAAA 3KS7A 3CMGA 1XHZA 3FB6C 3OMNB 2AEYA 1A3KA 1COV1 3E89A 5DDJ3 4FFBA 3AMPA 2JE9A 4AFCA 4S2GA 5JCOA 4OXSA 3GALA 2W87A 3APBA 2R9IA 1RVF2 2BZDA 4AQTA 4TXWA 3OGGA 4ABMA 2GC1A 1UZWA 4FQZA 1NVPB 5DZEA 3C90A 4S2DA 2BDRA 5FY0A 2JDKA 3A21A 2LS6A 1QJEA 4QKFA 1H8TB 3AXEA 5JJJB 3NO8A 2VH9A 2AGAA 4H14A 1NH2B 2HP8A 1BCXA 3ZMNA 2ZT9B 3RMXA 2J1RA 4X89A 3AZZA 4NPLA 3Q8EA 3AK0A 4CXYA 4RQPA 4LO7A 4MVRA 4CP9B 2IFWA 2VVEA 1QJY2 4O9GA 2BNOA 5ERLA 4AEDA 3DL3A 2RDCA 3HKBA 3D6EA 3SPIA 3E8BA 3UM7A 3CJIB 5KWRA 2VW2A 3B2EE 4E2SA 2AH2A 5BNOA 4LHSA 5LK5A 1ZAUA 1XNRO 1CZSA 4DV4B 5CMUA 3B93A 3CC7V 4RQFA 4E8DA 3AM2A 4XMIA 3RZHA 3RRDA 2IXHA 1OCCB 1EY2A 2D3OW 3RZJA 3SYPA 3I2FA 2FDHA 2G19A 1LOBA 3WW3A 4QJFB 3GDBA 4FLXA 1MS0A 1QBZA 3T1YB 3Q8BA 2JE8A 1QNWA 3BALA 4DZGA 1VQ7V 1H8EG 1W6QB 1W9TA 4JVAA 4RHV3 3M3EA 4O4IB 2F23A 5GTHZ 1LOFA 1M4UA 4L92A 3OGRA 3U14A 2XDVA 1ZRDA 3C7HA 2BWAA 3VUOA 4OI0A 2X53S 4DV6O 5C8YB 4NPRA 1R1BA 5A32A 2GC3A 2E5LO 1V6JA 3HNYM 3HAGA 3LKJA 2ET7A 4P9OA 4AQSA 3KKYA 1CAVB 3IN9A 1S76D 5A1LA 1XU1A 3FB5C 4AWDA 2J1SA 1T6BX 1KQRA 3IPVB 4TWKA 3WUDA 4QQOA 1B35B 4TLFA 5LA6A 5GLTA 4TWTA 1YITV 5JQGB 4FOQA 4FPCA 3T1LA 5A3PA 4LFBO 1S2EA 4LP8A 1LRHA 1DGRN 4QU2A 2WSSG 5CFCC 5JR7B 3WQ0A 2EIMB 1V9U1 1VF7A 1FYUA 3LSUA 1AR73 1ZTEA 3HIFA 1SQPH 2HWC3 1BQZA 3K46A 3WXPA 3JCUZ 1I94O 5H5NA 3CJHB 4XHXA 2JG8C 2ES3A 1VAMA 3VBFB 1WZXA 1QNYA 1RUJ3 2B7YA 4Y1XA 2UXXA 4B7KA 1F4HA 5J09A 5FPXA 4QD2A 1CVNA 1R093 1AYN1 1N3PA 3S5AA 1U97A 2JG9C 3PIJA 4LBNA 2HR3A 2PHUA 4EB6B 1AJKA 4AI0A 5F2VO 2JGDA 4K0KB 4COWA 3GHMA 3S6PA 2W94A 1NCQA 1PX3A 2DE0X 5BYNA 1UN1A 4BLIA 3JCZA 3LAGA 5BNNC 4I0XA 4Y24A 4DV3O 1STMA 2DMXA 5I0SA 4YJ3B 4JI2B 3LIHA 2EINB 2G9FA 2LRPA 5FZDA 1ZBA3 4N8MA 3TYJA 5A7NA 2XAGA 3N3HA 4DY3A 5DEDA 2WFF2 1DBNA 4FT8A 1PNMA 4ZXKA 4MW3A 2Q9LA 3VDDC 1K5MA 2DV9A 3AP4A 5FLHA 4Q6GA 4JI3B 1L1FA 4QKBA 3PUSA 2JJ2G 3UKMA 2A7WA 1GP5A 1M93A 2DVAA 4FXGB 3EMRA 1KITA 2HWD2 1V6MA 2VMGA 5DPNA 1OC1A 4TSVA 5LA1A 1JYTA 4LOTA 3T2OA 3VHPA 1AVMA 3LDDA 3MICA 1N34B 4KWUA 1XC6A 1AR4A 4QHBA 4J42A 3WDWA 2DVBA 2BTVC 4HSLA 4PDMA 3I2KA 4ASMB 4OI2A 3USUA 4JF3A 4PDRA 2OVUA 2XJPA 3DUIA 4B3RB 2RS11 3IAPA 2JEMA 1OQ1A 4DR2B 3ZXEA 2GHYA 5FZIA 2DTWA 4HFSA 2ZM6O 1S55A 2MK3A 2CAZC 5JI7A 1ORQC 2YPDA 4LKFA 5L19A 2HEYF 4L2NA 5FJHA 4K9SA 4P30A 3RFRA 3CP1A 5C5TA 1US2A 2WS92 3VHNA 4W8JA 4DXWA 3K5MA 3RYFB 4B3SB 1HQLA 3U1XA 5FREA 1ZRFA 2LW7A 1SQFA 4BQWA 2X5IC 5GW7A 1QXRA 2OKXA 1KMIZ 1EUTA 4DW1A 3ACFA 5E79Z 2XJRA 1DZTA 5DAQA 2P34A 3VLBB 4DR4O 3E22B 4MGQA 5LW9A 4LR4A 1AI4A 5AVPA 4J10A 5DQ0A 3O0WA 4NMIA 4Z2WA 3QCWA 2DCZA 3VBOC 1M9NA 4DUYB 5H6RA 2A71A 2VMHA 4OMDA 5LMUB 1NE4A 5FYIA 4M3CE 3BOPA 1PO21 1URFA 3RT3C 2CUGA 3IIAA 5IDJA 1S0VA 2Q8OA 3OYWA 2VPVA 3M3QA 4HPKB 2QTOA 3PMEA 2H0VA 3T1HO 3CPWU 4EN8B 1D5NA 3ZN6A 1GLHA 3T0AA 4UF0B 3E5XA 3AVSA 2OPKA 4UW5A 4FFGA 1XILA 1EV12 2WLIB 4I55B 1K45A 3I2IA 3CCMV 4X62B 1HNZB 2R30A 4QPGB 2QGNA 1TE1B 3MIBA 1OURA 3LDCA 1AL23 4HLTA 4NIHA 4YVWC 4B29A 2UXDO 1F15A 4AFDA 2E33A 4K35A 1L0LH 3OPTA 5FZCA 2BTQA 4WM8B 2BU9A 1S77D 2IXKA 5KHIA 1YIFA 3ZFEA 1PX4A 1D7PM 3ATGA 3IAQA 4PA4A 1O8SA 1RP3B 4Z1VA 1UIKA 1NTKH 3N9MA 2O1QA 4F6RB 5IJ9B 2XHNA 3MIDA 5AG2A 5CBGA 5ABJA 1NVPD 2WZEA 3MPPG 4DXTA 1YQ2A 1N33B 5F3EA 2EXJA 3UNPA 3T2TA 2IC1A 1ZL8A 1ZA7A 3JALB 2IFRA 1JODA 2WBKA 1NH2D 2VQFO 1G8MA 2WZPP 4FMTA 2MW2B 3ZM8A 2FDIA 2ODMA 5LCWL 5C3RA 4LLOA 2KKWA 1CPNA 1O5UA 4OHWA 1WMXA 3KV6A 4Y4RA 1VEWA 1HXS3 2WC2A 5A3MA 1COV2 3BTXA 2X8KA 3ZRWB 1XDCA 4JDOA 1TGOA 3WY6A 4RSUA 5CN0A 3E5QA 3QH6A 2JDYA 2J42A 2Y0PA 1VLNA 3WF3A 1BE3H 5FZFA 1BGYH 4RGKA 4AHZA 2PQQA 3K3WA 3OBZA 2QQLA 5FOBB 3CMEV 1QVFU 5B4NA 1WP7A 1N32O 4X64B 4HT1T 3ETGA 5IE9A 4CDUB 3ZXDA 3MGUA 2R9RB 4E2QA 2AZ0A 1WCQA 1TUBA 5KXCA 3MHHC 1CQ9A 3CS5A 2W0FC 2XLAA 1SHWB 5CISA 3AG7A 5GM0A 1JJ2U 5FMOL 3TB0A 1MSWD 5LXTA 1KXGA 1A6CA 1POV3 5FK7A 2RMU1 3ZKYA 1TVGA 1W6OA 1QLEB 2VQEB 1H8TC 3PVNA 4K3AA 3NV1A 1EAH1 2QFEA 5FZ9A 3AEIA 2ZMLA 5ITZA 5I0TA 1VBA3 2PAEA 1K73W 4A44A 1G9DA 4N9IA 4EYUA 4BWOA 3H8XA 3CCSV 5LASA 2IU0A 3GF6A 4CCNA 1XOUA 5L9BA 2YPJA 1LJ7A 4YW6A 2R073 3BEHA 2B8MA 4UT5A 1VF6A 2V4DA 3GZUC 2Y0OA 3H7JA 5CA6A 1M57B 2WNOA 1BEV3 1UCXA 4JKLA 1PK6B 1JN2P 5F39A 1UYXA 1RUG1 4GKJB 2UUCB 2XONA 4ZHQA 3WDUA 4OHVA 4UFIA 2JDMA 3VGIA 3GWKC 2BEOA 1PD3A 2XOKG 4HL0A 3Q8AA 3T1CA 4LE3A 4RN5A 1QDOA 4O2BB 2LTNA 1XMQO 4EN7B 2ZAAA 2VECA 3T2QA 3HKCB 4XDOA 4O65A 4L8JA 4DY5A 2WYSA 2LW1A 1QR8A 5AC91 4A41A 3ZFGA 4M3CF 1MEC3 1SRYA 5C8CB 2QWNB 5FV3A 1WLCA 3T09A 3LWCA 2PHTA 1VIBA 3J8F1 3OJBA 4X8NA 3UT0A 4Y1ZA 1RMU3 4V1PA 2XASA 2YXYA 1KJLA 4XF4A 4HZ3A 5K8SA 4YHHO 1AYM1 1V9U2 5FP9A 1EPWA 5K0UA 2D44A 1NLRA 4NAMA 1LODA 1MS1A 1NCRA 1SKVA 1UOBA 1O3SA 5A33A 1LESA 1B35C 1K5SA 2C0ZA 2XAJA 5GLZA 3FBYA 1YJWV 2PGGA 1M5IA 1I5PA 2G9ZA 2YGLA 2JIZG 1RUOA 1E1RG 1J5EO 4J11A 1ENVA 1XNRB 1OOPB 3IWZA 3HMYA 1AYN2 3A4UA 2EIMC 5C33A 2Q30A 3ACGA 3ETDA 3NW4A 3F7YC 3CRAA 3LEKA 4ZOLA 2NR5A 4O2AA 1Y9MA 1C5IA 1V6LA 1H8HG 2V4AA 1DG6A 2LALA 3DGTA 2EZOA 4YVSC 1FXZA 4GX2A 3ZXLA 1YO8A 3C2UA 1FJGO 4AEJA 2JIJA 1ULFA 5I8TA 3LPGA 3VBFC 5IJRA 3RMYA 4GMP3 1L0NH 5KX5A 1AR63 5D5PA 3MIEA 5HXMA 3Q4HA 1UU6A 5EIBD 1IKQA 3FB8C 3E6BA 3O7OA 3L71H 1XE7A 2WNUC 2ZMKA 3SGIA 4ASLA 1R1ZA 1V6IA 4G27B 3AK3A 3LA2A 4UFJA 5IJ0B 2JX9A 3UO3A 2XB6C 4DV5O 1S0BA 2ZGTA 3SHRA 2XG3A 4DV6B 1O4TA 2GBOA 2WDBA 1FXKC 5FMBA 2E5LB 1UMZA 1RSOB 2PZSA 3WG3A 1ZVFA 4MGYE 1CAWB 5GJ6A 5FYYA 1XNKA 1OD5A 2FB5A 5B1BB 4XBFA 3SYOA 1HV1A 5H9PA 4XEZA 3H3UA 2OXBA 1SERA 2D3PA 1Z2GA 1WAZA 1PIV1 1FD9A 4LFBB 4GKKO 3RVZA 4A2UA 4QPJA 1W2UA 2E31A 4JGYA 2RS12 1B09A 1JFFA 4FO9A 3N7MA 2LGWA 2A6WA 1LEMA 4CSWA 5GONB 1EZJA 2D3SA 4JHTA 1WUVA 5FFOC 3OE7G 5C70A 4Z07A 3DYMA 3VL8A 3OPZA 1I5ZA 3ZSJA 3VL9A 5C3OA 1XU2A 5EIBC 4JI8O 3M7MX 5SV8A 4YM2A 2BGPA 1HRI3 1RITA 4JDMA 5FPBA 1H2LA 5DAVA 2XKPA 3IFXA 3B40A 1L7LA 2LFRA 5FYSA 1KGYA 1J3PA 3ZFFB 1WMDA 3ZPOA 2CNAA 4GB31 4R7CA 1VBB1 2HLDG 4BQXA 4I4TA 2QTWB 3I59A 3F2ZA 4AVSA 2QQVA 2RN9A 1GWMA 3OUJA 4GH4A 4Q26A 5DMYA 1IURA 2ZE8A 4DXRA 2E32A 4PDWA 3VD7A 1MNGA 2WQ4A 4UVAA 2B46X 1PO22 3FX3A 4DV3B 3FAVA 3ZSLA 2HYXA 1OLRA 5TSWA 5A6YA 1WJZA 4U2AA 5BXXA 4FPOB 2BGCA 5J37A 3WNMA 3T08A 4GT1A 3ICXA 2R0HA 3FX7A 1RUE3 3OTOO 4R9DA 3DXRB 1M56B 2QKDA 2Q69A 4W4ZA 3E6CC 2GP5A 3UV9A 3AKPA 4TLGA 3ZX7A 1GYKA 1UYZA 5IYCO 1Y9QA 5JJEB 4KWKA 1YI7A 4UFLA 2V09A 4AGRA 2VGDA 3Q8CA 5J2TA 1R3KC 4FLVA 1KC8W 5EJ3A 5C9AB 4D6RA 2FCUA 3FN9A 1IPJA 2K46A 1JZ4A 4E8CA 1FS0G 3NV3A 2HJIA 5KR7A 5FZHA 3VBHB 1IHMA 2ZE7A 4WVMA 1YQ5A 2DVFA 1IZ3A 2OQ7A 3K51A 1W6MB 2QCSB 2IM9A 1HW5A 1W0NA 5IW0A 2ZM6B 2EALA 3W20A 1VBC1 1DYPA 3GZAA 5FYBA 2ZEXA 2YXHA 1VRH3 2RR13 4WBNA 2EIKB 5A3TA 4BMEA 2JE7A 2F4VO 3FWEA 1W05A 1XNAA 5A7WA 1RJ8A 1VQ8V 3VKOA 4WM8C 2XBO3 2QQOA 5KUKA 4X1IB 2WZR3 1WWYA 5FXWA 1IS4A 3SCHA 4CDWA 1Z0HA 3HQUA 2GC0A 1YFXA 3MD0A 2BPA2 1IX9A 2BFUL 3HT1A 1CJPA 2W2IA 2B1GA 1MS4A 2ZHLA 4LF9O 3WQ7A 5DABA 4DR4B 2FCTA 2A9HA 5KMGB 2RS33 3DPRC 3SC7X 1NYWA 1YIJV 5J2UB 4Q0VA 1Q56A 2DVDA 3NAPB 2YIBD 1PPJH 1QJX3 3RYCA 3A8TA 4FPEA 1ULPA 2TBVA 1VB2A 3B8MA 4XVHA 1EP0A 4G4FA 4JV4A 1AJPA 1KS4A 5LEJA 2DTYA 3QNEA 3TOJA 3FKSG 2ITDC 2W52A 4HZFA 5KC5A 4D6TH 1OHFA 5FZOA 3T1HB 1NZIA 3LPFA 2C26A 4JAAA 2Q5TA 1ZUQA 3W58A 5LL6Y 1H0BA 2WLPA 3CCEV 3KV5A 1HN0A 3O12A 4L8QA 2CY6A 3CO2A 3MFAA 5IVYA 1XQ8A 1XNCA 1GM9A 3A22A 3A0BZ 3LEMA 4QPIA 1WW6A 4RWUA 2TEPA 2RMU2 1I7FA 3FFZA 1OCZB 2DOSA 3L75H 1EAH2 3CRQA 4PA3A 4JAUA 1YSCA 1YQCA 2XJSA 1WNSA 2UXDB 5EZYB 1PO13 3W5MA 1TME3 1C28A 4DR5O 5IYZB 2B45X 5EWSA 1VQ9V 2H0BA 1WA8A 4LIVA 3R66A 2Y8KA 4P14A 5F6LB 1PL4A 5JWPA 1XI1A 1H30A 3ON7A 2MNGA 4GA9A 3TNQA 3HPNA 3JD71 1Q6UA 3AMNA 4W4KA 3I3EA 2Q6AA 3D0SA 2I07B 3USSA 2JB4A 4RFRB 1JCHA 5IK7A 1RJ7A 1SCRA 1UU5A 4FBFA 1RUG2 2XUMA 1KJRA 1MS9A 4LR3A 2YU2A 2XR4A 3I8TA 5LY2A 1KU9A 3FBMA 3MI8A 5C93A 4ZY9A 1G9BA 1CAXB 1VARA 1RVF3 2J22A 4QX8A 2C1FA 4IV3A 2VZOA 3W7WA 1XNDA 4DEVA 4XF3A 1ULCA 1YI9A 3WUCA 5L3EA 1BZWA 5DZFA 1PGSA 1IDSA 4OCTA 4FPGA 2Q0AA 3IZOA 3E2EA 1DF0A 4XJAA 4CH4A 2VNVA 3ORJA 5AC92 2BOCC 3BGAA 5SV5A 3ABLB 5CADA 3IDEA 4P9XA 4UW4A 3IC9A 4EWDA 3OCPA 1SA0A 4Q0PA 2IH1C 3J8F2 1SLAA 1QEXA 4NAOA 4IV1B 2QZ3A 3DC5A 3POBA 1XSQA 2DUQA 1KDKA 2IW5A 1YQ8A 1QJY3 1R1A1 1W99A 1N32B 3QTCA 1ND3A 2EIBA 1AYM2 3MF9A 4FPLA 1OMIA 5LYJB 4DUWA 2VL4A 3SJAC 4LO5B 1BK0A 2A6YA 1RINA 1NR7A 3PMSA 3DV8A 3N2GB 4ASUG 5JMOA 1K7DA 2ARHA 2ZGSA 4H2AA 1LOAA 5AFBA 3H01A 1GN6A 3ILFA 2WZ8A 1PMHX 3N9PA 4YG3A 4LFAO 4FP3A 4DEQA 1YNAA 4ZU5A 5F3IA 5GLVA 1DLBA 3RYHB 3PVEA 4FVMA 3IC7A 3SMHA 1IS3A 3RI9A 4P9YA 3IJ4A 3ZDVA 2F4PA 3CCQV 2UU8A 2Q7HA 4CEYB 1ZZ9A 3CEWA 4RR3C 5FL7G 1MSDA 3ZMSA 1FV2A 4CA9A 1VF5B 4UFHA 1NQDA 5FPRA 4JHZA 2ILMA 1UY2A 1F8VA 5CFDA 4IEYA 4Q4W2 3CZUA 2VU9A 1GZTA 3AYAA 1G9FA 2B9UA 1UJWB 3G67A 4X65O 4O4HA 1V9PA 4FFBB 5B1NA 3GYDA 4DIQA 4CH3A 3B77A 1C8M1 4YPJA 1YTFD 4XILA 4CU8A 1XMQB 3OPWA 4TYSA 2VY0A 3WG7B 2BBAA 3BY6A 2VNOA 3WDYA 2WAOA 2C4XA 3IDBB 2P37A 2YFZA 5IFPA 1NTZH 1OT5A 2E76B 4RUFA 3ZMTA 3JD3A 3K3OA 1W8HA 3OOXA 2ZZQA 3ABMB 1FPN1 1WCKA 1RFYA 2GSMB 4CDXA 4RQPB 1Y6XA 3I97A 4BJ0A 1TVKA 1QJZA 2FDJA 1AJOA 1PIV2 4IW3A 1FT9A 4AEDB 5EJZB 3HKBB 4YHHB 3CJXA 4YGDA 3AL5A 2FDKA 5BNOB 2ZNJA 5LK7B 4OZXA 3IMNA 1W06A 4IE4A 2DYSB 1G1XB 4AQYO 4C7UA 5FPOA 4DOUA 3UGFA 3M1HA 1AR5A 4FFFA 2QVSB 5C5UA 2RM21 1PZ7A 5GZCA 2EIEA 1J5EB 1X82A 4BQ2A 2O14A 2R043 2M6YA 1GP4A 4U7OA 1BMV1 5JXIA 3M70A 4JZGA 2PFWA 1Q81W 1I5XA 2JDHA 2HH9A 1FMD1 4LBKA 3VV1A 4H3WA 4GB32 4FTEA 1VBB2 4HMZA 4IT5A 1FJGB 4LJHA 1KP2A 4CEWC 4LKSA 3WCSA 3K03A 3ZXFA 2JDAA 4RL7A 5FMCA 4XDKA 1ROPA 3LF7A 2JDZA 1KKCA 4LT5A 1U5ZA 2WFF3 4AK3A 1MZ6A 3FLRA 3EFFK 1QLNA 1B06A 5A32B 3KB5A 4UBGA 4GWMA 1VQMV 3DXTA 2JK5C 3ZIXA 2XOMA 3JAWA 1OQEA 3URFA 5IY5B 2HWD3 4P2ZA 3J26N 3APQA 4DV5B 3NWKA 2XL7A 1TAEA 1WD4A 3ZHUA 2W92A 5DG1A 2FBEA 3MFCA 2HVJC 2OT7A 4J25A 4Q8LA 3SYQA 1WW4A 1LU1A 4X20A 5D5QA 1W9WA 3I54A 5GZGA 5J7MA 1FNYA 1KS5A 3RN4A 1Q8SA 2FTKA 3UJQA 1SFYA 4Q1RA 5F32A 2QWPB 2NN8A 4ZHNA 4FIPC 1LHWA 2WUHA 1DLCA 2AYHA 1O3QA 3ZEDA 4LC1A 4R50A 5TISZ 2ADQB 4GKKB 1REEA 1HKDA 4XBLA 1IGOA 1M56C 2Y64A 4ES9A 2WS93 3VBUC 5F1RA 1YUDA 4UFZA 4LF4O 2W1WA 5KAIZ 1SFNA 2A1XA 3VBSC 1VBC2 4DK1A 5JMCA 3H3LA 5KHKA 4J6GA 4PF5A 3WP4A 2R1BA 4CCDA 2IH3C 4QQ2A 5FP7A 3R65A 5C9AC 2ZKNA 3HN3A 4GXLA 3PLQA 2OT5A 4NHXA 1W2TA 5FYCA 3WF4A 4JI8B 4YW5A 2E3CA 3C7FA 1UKGA 2YBKA 4LWSA 4HBNA 1QIQA 4CU9A 2VJXA 3A0RA 3CEIA 1GK9A 4N21A 4IDZA 4AHWA 2QNKA 3AK2A 5CFCA 5DDJ1 1GM7A 1HIXA 4XYXA 3H42B 5LHIA 4I0XB 2HWB1 2EIKC 2ZX3A 3CD6V 1AP6A 1PGL1 4R9BA 1ZRIA 5L3CA 1OD3A 5FMOS 4GJYA 4LKDA 2DWRA 4QX5A 3HKEB 4IL6Z 1Q82W 4A6OA 2JG8A 2KSDA 2YC2A 1V6NA 2F66C 4CP1A 2ETNA 3WNKA 1GICA 5DUUA 2HEVF 4TN7A 3BU7A 5CBLA 1EV13 2PYJA 1ALYA 3CBNA 2VQTA 4J7JA 1DGWA 4E4EA 5KXBA 3OSDA 5LP6A 2EIDA 4IETA 2GC2A 5FZEA 5LOVB 2Z2SB 3ZHQA 3E86A 4FM1A 2WL1A 4MVUA 4NPMA 2JG9A 1H38A 3VBBA 4XZUG 3CRRA 2ZGKA 3OTOB 2B5HA 4D7TA 2MHFA 3KWVA 3NAPC 2YEVB 4KU7A 2ADEA 1LULA 1S4CA 4NOTA 3USUB 3C3VA 4QM8A 2E51A 4FLUA 5KHHA 4A7ZA 1NI8A 1GOHA 3I55V 2QM8A 3AG1B 1SEFA 5CNAA 4RAIA 3WINE 3MIHA 1UX6A 2YUEA 5FP3A 1JZ2A 3HKDA 3QOPA 3VZOA 3JSLA 3CCUV 3MIGA 4CH5A 1O8PA 3K5LA 3WQ1A 2AZ2A 3AMQA 4AR2A 2V5YA 1TA8A 4URTA 3JD72 4MGZE 4URAA 1OLMA 5CKQA 1P49A 4LUKA 5H9RA 4JQRA 2ZMNA 2B42B 2BOBC 3ZHVA 1Y7BA 4E2LA 1G9CA 4KFMA 4GX0A 4FFHA 4O61A 1IQAA 4RHV1 3OR7C 1Q5OA 1MACA 4GLXA 2F4VB 3I49A 4INDA 1YI2V 5IATA 4N53C 4I01A 2R70A 1TMF3 4CUBA 3O5SA 2WQZC 3POGA 3OUHA 2YBSA 1MG1A 1RUC3 2W1SA 2A3XA 4J7KA 4W6WA 1JTZX 2BCCH 4LF9B 4WVVA 2HBTA 5I0DA 1NXMA 1VQKV 4MUVA 4H0LB 1HQNA 1PVC3 4B7EA 1Q8OA 2VMCA 3C3SA 4PV1B 2J1EA 3OYWB 2RMKB 4AHXA 3DF0A 2HWF3 2VNGA 1JOJA 4LK7A 3ZIWA 3ZN6B 5FUPA 4B1MA 1ENQA 1W2AX 3DECA 1PHMA 3ZLIA 4FJCC 3F5TA 4X1YA 1R1A2 2ZX0A 3UKVA 2P22C 5FY5A 3IKWA 2VXRA 2HWC1 1IXMA 2DU0A 2BTQB 5EC2C 2OUJA 3T4VA 5LBCA 5BUVA 4EZ4A 1XNQO 2ERFA 4COYA 3T4DA 1RTVA 1PZ8A 1A32A 4KWJA 4QKDA 1HB2A 3VBOA 4K40A 1RUJ1 4IV1C 1FFXA 3ACHA 5LGUA 5EBLC 1R091 3RZMA 3SITA 2VS0A 2W1QA 1UOGA 2R9AA 4JTOA 4DR5B 1JUHA 4OYUA 3ABUA 2P3IA 3NVCA 4OHZA 1ZL8B 2YGMA 2O8OA 2P4KA 5FY1A 3L9JT 3NNGA 3O1PA 5KBFA 4WFGA 5L3DA 5T5JA 4O9EA 3VKFC 1DIWA 3WP5A 2ZEZA 2Q1FA 5F5CA 1RXFA 3CCRV 3UO2A 3LDKA 4BQ5A 3AKTA 4U3JA 2RHPA 3R4UA 4YVWA 1ND2B 5C8WA 1WCDJ 3K59A 5FY7A 1JZ6A 3DCQA 1ZBA1 3RS6A 3I3BA 1CR7A 3E8FA 1C8M2 2BBVA 4HKOA 2Q8EA 4YZ4A 4YNIA 1D2DA 4PHZA 4LBQD 1K33A 1S2KA 1BHAA 5JIAA 2VOXA 5FOJB 4AF9A 2OX0A 4Z2AA 3I3QA 4AVTA 3ASIA 3QH7A 4ISQA 5IVCA 4FK5C 4QPWA 2W3JA 3V0AB 4NTXA 4GUNA 4P9IA 4P08A 5LHHA 5FNVB 1FPN2 4CCCA 4KBBA 1MZ5A 1V9U3 1TUBB 5JCOC 4BE3A 2VZTA 2LP7A 2LQTA 2ZGRA 3KQRA 1CWPA 4HKWA 2XHKA 2YYOA 1R3IC 2BGOA 2QQWA 2EILC 1W9SA 1Y67A 3WW4A 4JI7O 3SCFA 5ITZB 5IK4A 4MLOA 1F4AA 1XL6A 2I74A 3SCGA 3ABMC 3B5LB 2PHXA 4XURA 1FAFA 2ZABA 4K8RB 4AFBA 1ZZ8A 4UXNA 1QCEA 4FLTA 3X2QB 1QXPA 3N9NA 4DR7O 3BIWE 2RM22 3CKHA 4LFAB 3CCVV 5EBWC 3ZBHA 2IVIB 3O1RA 4XUOA 2QZ2A 1RPRA 5JUVA 5GTIZ 3MHZA 3BABA 4KH9A 1DGLA 1BMV2 3H0OA 3B69A 5BNOC 4MOAA 1FMD2 3K2OA 5H9QA 3P3NA 4HVRA 4FVVA 4JI3O 1RUH1 4OMCA 2DYSC 4UW6A 4ZHQB 4GWIA 1RUF3 4CBCA 1BQ0A 2A6ZA 5FQ0A 4XMAA 1A8DA 1ZBE3 4LEJA 3SEEA 4DO0A 2ZA9A 5LMNO 1COWG 4BYYA 2W68A 1N34O 4BPZA 1YRZA 4K7JA 4G2KA 2PLV3 2KB1A 4MV2A 1N1VA 4X65B 2WWWA 1O9GA 4CP9A 2VMDA 3WNNA 4B3RO 3ZFGB 2VCCA 2XAFA 1F5JA 3DYPA 1LOFC 4ZBMA 1ZZBA 3W7XA 3KT4A 3L74H 1AL21 5LB6A 4U3FH 3JAKA 4DW0A 1HDJA 1K97A 1Z5WA 1RHI1 1CGPA 3RW0A 3JQWA 3MV01 2RS13 1C4RA 4IESA 4EE2A 3TN93 1LAJA 1UIJA 3WV6A 5K0UB 2NQYA 2WO1A 2B9ZA 1NCRB 5DECA 5A33B 5HFMA 1RUI1 4XIOA 2BFUS 2WNVB 4UUJC 4MHRA 5EV7A 2A73B 1GUIA 5B1AC 3CLPA 4OI4A 1HX6A 5A70A 4HN1A 1MA1A 1PNGA 2UWBA 3CIHA 4O2AB 4BXFA 3ITQA 4A45A 4AQYB 2FMDA 2ZPXA 3LDRA 3U75A 2IXJA 4P9LA 1AZDA 4C91A 3NR7A 1WPBA 4XFCA 2HYKA 2VZSA 3TBDA 2PHWA 4LA3A 1LU2A 1OH3A 3MW2A 4XFGA 4EN9B 4RGAA 1HXS1 5KX5B 5DDJ2 2L35A 3Q4HB 5FJKA 1R081 3VZNA 3VZKA 1QGLA 3ZR5A 2HEWF 1S72V 2HWB2 1H2MA 3E6DA 4NIGA 4H55A 3IPVA 1WW5A 1N8RW 5FCCA 1PGL2 5ACA3 4PCRA 1K4CC 5HCAA 3LE0A 4IXLA 1MQTB 4DR3O 1H9WA 3QACA 1SZTA 4AGVA 5JQGA 3EJKA 1BJQA 1UXZA 2A70A 4B3MO 3B09A 1O6UA 3GBWA 1HB3A 5HCBA 1KRIA 2ZCEA 2B5UA 4QGNA 2JB8A 3CMAV 5IK5A 2WIIB 3BUCA 4YM1A 1LB2A 2BNNA 2BTOA 2HLEA 5FYTA 1LR1A 2AHYA 4HAMA 2PMWB 3ES4A 1Q3EA 4YVSA 4JI4O 3H1MA 1HRV3 4YLZA 3E1F1 4ZI7B 4R52A 2OTLV 2B39A 3NRUA 3H8OA 4D6QA 4XTMA 1PP9H 2EX3A 3VBFA 4NUBA 3FB7C 2XNDG 4H37A 1VBA1 5B5EZ 4JGYB 2DBIA 4QQPA 2WNUA 2XXZA 2NP0A 1OVPA 2ZGOA 5EYYA 1HR0O 5HV0A 4CCEA 1AXYA 4ARXA 1Y76A 3AKSA 3QO8A 4EQVA 1VRBA 3RWKX 3JZVA 1SBFA 1XE8A 2GZWA 3A23A 1ONAA 1MS8A 1UYYA 3N7KA 2CWSA 1FXKA 1S3JA 3SR2C 2D6PA 4AYUA 4OVEA 4LF4B 3KG2A 4Y5Z0 4LQRA 1UMIA 3E8GA 5LEKA 1XPWA 1H6XA 3AG1C 1PGW1 2ZX4A 2X6BA 1QF3A 1VBD2 1QJU3 2K2SA 5DUVA 2RDQA 4YFZA 4BOWA 3PU3A 2O0OA 2NZ9A 1EYBA 1UF2C 1RUD3 4Y5SA 4I4TB 5JZGB 5CYYA 3JAMN 2QBXA 4GH4B 1GN2A 1W8NA 4ZS3A 4PDWB 4E9KA 1NQJA 4BXSV 2YHJA 5FWJA 3FAVB 1EUUA 1JX9A 2BW8A 2W6IG 4N9HA 2AENA 4PBPA 5BXZA 5T5PA 3MZHA 4QB1A 2Y0IA 4BISA 2ZE6A 2IJHA 2W1UA 3AXDA 3UGGA 1P7BA 4HYOA 2LFSA 1RMU1 2RJ2A 2W46A 3RPQA 2PY5A 4MVTA 4FTBA 4HG6B 1GN3A 3MBWA 4QGMA 3BCCH 3H1IH 4CDQC 2WN3A 5J3UA 1XL4A 3H50A 1UWWA 4COUA 1H2KA 4BLJA 2ID4A 5C3SA 3SYCA 1EAH3 2HWC2 4RS5A 1NY71 1GQHA 4XFIA 5IFTA 4JZRA 4ZZ5A 5I0RA 3ZYIB 5J2TB 1WN7A 1V55C 4LBMA 2VTXA 4FPFA 1RUJ2 1IG0A 2PYTA 4WFEA 1VBE1 4H7LA 1WMEA 2EXIA 2ZKLA 3H3ZA 1S2BA 3AJYA 3FC0A 2WKKA 1W59A 3GBGA 3HR9A 3I4IA 3IM0A 2RDNA 3D3AA 1EFRG 1NT2B 5L3BA 4WBNB 2OUHA 5HFLA 2DQ3A 4EFBA 1GNZA 4XAAA 5A7WB 4IEXA 3SKVA 1CEZA 1G86A 4J9ZB 2ZZJA 4QXCA 1OF4A 4BQYA 4CDWB 5FLXN 2WA4A 2XVLA 5KUMA 5FPAA 3HJRA 4HPKA 1ZBA2 1J1LA 4ARYA 4LNVA 3ACIA 4C1XA 3CE2A 4UF0A 1F23A 3ZRXA 3FYEB 4YM0A 1F5FA 1ZX3A 4PD4F 1AR93 3V56A 3AG4B 4PQ9A 2QDRA 5IWAO 1VB4A 1SQXH 3K75B 5LHGA 3IIIA 1N36O 2VZUA 1RGSA 1ND2C 4ZKTB 1WB7A 1IBKO 1UYPA 1S0GA 3ZMUA 3MLKA 1AYM3 2ZGNA 4NE9A 3JD0A 4PDLA 4YARA 5FZOB 1FYJA 3CXCU 1N3OA 3UESA 1RM1C 1W8TA 4X9QA 2QE7G 1Q86W 4CE8A 4FAGA 2VTXJ 2GH8A 3H9VA 4QPIB 1OKOA 2UWAA 3TCUA 3WQBA 4XHBA 1VE0A 2CTPA 3WDVA 1DLLA 1KFXL 2WAAA 2QKAA 4UV8A 4DXSA 2ADDA 2X6CA 3KHCA 1I1EA 1CAUA 3MHSC 3DPRA 3JXSA 1PNLA 1QQP1 1XNQB 1VJ2A 1O9HA 1Q7YW 1WA8B 2GSYA 5JVVA 4Q4V3 4UFMA 5APAA 1N47A 1VP6A 4P9WA 4H13B 3FLTA 1ZX5A 4QX3A 3SXWA 3RZGA 3OM3B 3B01A 4QMAA 1RIRA 2CAUA 4NO4A 3JASA 1XYNA 2B1IA 4META 3VBRC 3DC6A 2VMFA 1GN4A 3WB2A 3EYPA 4NKGB 4WZFA 3BOWA 4Q4W3 3EXUA 1RUH2 2P6HA 3R6SA 4FPPA 1BVVA 2OPWA 4IL7A 3L9DA 4IEUA 5FP8A 3N9OA 1UPGA 4GCZA 1R3LC 5JVDA 4IV3B 3FE5A 4FOWA 4YZ5A 1YF2A 1YDXA 3HN1A 3VD4A 3V65A 4FLZA 3VOUA 1ENRA 1OCRB 3CXHF 2GTAA 1UY1A 2WSUA 5FZ0A 4XJ9A 4AOCA 2MEV2 2R1DA 1NG0A 4QM9A 3RZZA 2K9ZA 3JD1A 1SA0B 1Z5VA 1AL22 1UW8A 3ENRA 4GX5A 1NZCA 1PIV3 1RC6A 3NQHA 1RUNA 2FZ2A 1RHI2 4FPHA 1Q6HA 1ND3B 4LF7O 4YW2A 2YIBA 2WR9A 5DAPA 3MW4A 3RYRA 3VD3A 5A7OA 1RPOA 3ES1A 4X88A 1BBT3 5FYVA 1NU1H 3BODA 2ZINA 4L87A 1VIWB 2VC9A 5LATA 1RUI2 4P02B 4HXCA 3POEA 2Y6FA 1R3JC 1HV0A 5JJNB 3D3QA 2YFUA 4NYKA 4LUMA 1J59A 5FUNA 4JI7B 1VRH1 2RR11 4XFFA 1FOD3 3RBZA 1J1TA 2FMLA 1XMOO 1F31A 3PN1A 3LDBA 4PI0A 2XBO1 2VUJA 5K0UC 5F3CA 2WZR1 3QO5A 1CZTA 4HONA 5H9CA 5CVRA 3CQOA 3AP6A 2ZGUA 1TNRA 2DWEC 4GB33 3N9LA 5FPVA 3VKMA 4MVOA 4KHPO 1NLSA 5LBQA 4DR7B 4XCBA 1JMUB 1YHQV 2LUWA 2WNVC 1HXS2 4MYEA 2VCAA 4HNAB 1R082 2ZS6B 5CFDB 2F95B 1ZRCA 2Y4UA 2RS31 5C3QA 2C5DA 1O3TA 4XJZA 2VG9A 4L0PA 4P9JA 2WWSA 4Q0QA 1ZLZA 3DTUB 3V0BA 1OA2A 1P8JA 2IWGB 3OF1A 4X66O 2VTFA 2GMEA 2QWRB 1GMGA 1GZCA 4Y22B 4AAPA 1SACA 2V73A 3RG0A 5LMNB 1MVEA 2QM4A 3PVBB 2F4LA 3HQRA 4N43C 4GX1A 1WGPA 5FZLA 3H1KH 4LH6A 1ACCA 3MDPA 2OA2A 1KYOF 2C6SA 2GNDA 2RE9A 4CDXB 4RR3A 1B3QA 1ASJ3 1MQTC 3FZ3A 3BVOA 1R6KA 3BIEA 2D7FA 4AW7A 3O0XA 4PJYA 1ODNA 1AJQA 1TVKB 1VBA2 4N7UA 2ZGPA 5KC6A 3WZ1A 1PO11 3M2MA 1TME1 1NA1C 3ZS8C 2J1TA 4NRQA 3O1MA 3IAYA 4XF0A 1OLQA 1BSMA 1VPHA 5LA9A 1VBC3 3AYEA 4F8AA 1NLQA 1K34A 1AXKA 4JKMA 1REDA 2IBZH 5FKCA 2VWJA 4OX9O 1IXBA 3RGBA 3TEWA 4ZZ8A 1AR82 1OF3A 1JHJA 5FXZA 3UCSC 3U11A 3PDQA 2EA7A 2IXCA 1G6UA 2P1BA 4TOIA 4ATEA 3G80A 4IIJA 5FY9A 5FO7B 3ZXKA 1G9AA 4WZCA 2VBBA 3S7EA 3NJXA 2AEZA 4A3ZA 1NX9A 1U5IA 4AHCA 1PGW2 4JX0A 3SPJA 5B66Z 3VHOA 5FR3A 5CEHA 3POSA 5E16A 1X8MA 1O4YA 4LCUC 1JH5A 2UY9A 1NS1A 1OSGA 3BTYA 3R4DB 2LJ2A 2Q8VA 2BP6A 3STZC 1H4HA 1W28A 3ZOIA 4UB8Z 4HETA 3T1MA 4R8HA 1RSOA 5FY4A 1VQPV 3H7YA 3PVOA 3ECQA 3WF1A 1CAWA 4UBHA 1V0AA 1E5IA 4BIOA 3ROUA 1W2NA 4XQ4A 2Z79A 4XAEA 1J58A 1BMFG 4DR3B 1RMU2 4K3UA 2CDYA 5IAVA 5JZGC 2D5HA 4B3MB 2WLLB 3O1UA 2XJVA 2Y69C 3LGRA 5JOWA 2E74B 4GZRB 4QX1A 4X20B 5H6QA 2P90A 5GONA 4K1YA 2Z4FA 5EJ1B 4F6EA 5C4WA 3S3XA 4CU6A 3PJYA 4FAHA 3OEHG 1JPXA 1NY72 1XEQA 1D4VB 1D2SA 4JI4B 4ISRA 3GBFA 4LO8A 1XBLA 5EIYB 2VMIA 4CEWA 1CZVA 4W6XA 1NAEA 2DQ0A 1X4TA 3KGZA 1XNBA 1VBE2 5IYYA 4CCKA 3PJQA 1ENXA 4BQ3A 4B3TO 4FLWA 4F3JA 4G28B 2VD7A 1HR0B 3SEPA 5CG8A 3WD5A 1VALA 2VZ3A 1WCUA 3T4HB 4TUYA 4O7XA 1LGNA 3BFRA 3MV11 1HNXO 1WA6X 5GKAC 2H6CA 3ABZA 2Y38A 3C7OA 1NZ6A 4I9QA 4JYBA 4LWSB 2D3RA 1R6TA 3QF7A 5JXJA 4JTCB 1QXJA 1ENSA 4H33A 2VUDA 3LOBA 1XB9A 5JPMB 1IBLO 3WCRA 5A80A 2WLHA 1DF5A 3CRMA 4LMFA 3JATA 4CU7A 2IXIA 3DXRA 2JG8B 1ZNPA 2DYCA 4YG6A 3VBUA 1UKRA 2Y6JA 2ZAHA 3WX5A 4LO6B 2XVGA 3VBSA 5BR8O 2Y6KA 2PI4A 1AROP 2H6BA 2ZQMA 1RXGA 3K48A 5LP6B 5IVVA 4IYHA 2NN4A 2JG9B 2YSUB 3O0VA 4D94A 3ZRVA 4ZKIA 1XXNA 1K92A 2V7QG 4YW1A 2NNUA 4O4JA 1UY4A 2VNRA 2JS3A 4Z82A 3NJVA 3N36A 4TZDA 3NL1A 1PKXA 3RDIA 3I5DA 2JRIA 2VUCA 5HI0A 1RL3A 2W08A 2D5FA 4PLMA 5T3NA 4PJ0Z 5E1RA 1LHUA 3RNSA 4I09A 4OQ9A 3GCWA 4RA0A 4XE9A 3LSDA 4RD7A 3CJIC 1QQP2 2Y26A 2L6LA 4XZPA 2IU3A 1CPYA 3G6BA 3HKDB 2RVAA 2GDFA 1W8OA 2ZBJA 4AAXA 1AHSA 5FDBA 1SETA 4W65A 3I3MA 1AILA 1CX4A 1AX0A 5CZKA 1VQLV 5FYHA 2R041 3JBG3 3JCIA 4R4ZA 5LRRA 2YG0A 2WPDG 1OCCC 4DQAA 4JASA 1YQ6A 1YIPA 1BQPA 1SBDA 4W4LA 5EYXA 5FMDA 4Y20A 3W59A 1Q8VA 2WT1A 5FY8A 5GZEA 3WOGA 5GZDA 4GQ7A 2QQIA 2SBAA 5K4LA 2Z0AA 3D36C 1AVBA 1NE6A 1HP8A 3J7LA 1NQTA 2RJLA 4CTEA 1EN6A 2QQMA 1AI5A 4MS2A 1AR1B 4IEQA 4JI6O 1NKGA 1JOPA 1A34A 2UY8A 4C8DA 1MOFA 3FMGA 2E53A 4ASKA 2VOKA 3ZYFA 1ZWIC 3WF2A 3HB3B 3VZLA 4EROA 4EWEA 3DKQA 5IVFA 3O1OA 1TNFA 3P3PA 2LROA 1U12A 4CYDA 2VZVA 1DGWX 3A0HZ 1WD3A 1R6NA 2GMMA 1FPN3 2CGNA 4O4LA 4XBNA 5IWAB 2KXLA 4OLLA 4X1YB 2GV9A 3N7JA 2VQAA 2CK3G 1N36B 1VR3A 3OD0A 5B2GB 5GZFA 4Q0SA 1Q8PA 4YZ1A 1UX7A 1IBKB 4LBEC 4BZ4A 1SLCA 3CL1A 4MXWA 4A7YA 4DPNA 2JS5A 3WEZA 2K0GA 2EXKA 4WF9V 4J41A 1QWRA 4FQ4A 3TEYA 5FZAA 1VP7A 1H6YA 5KA5A 4MH0E 3ZMZA 4CS2A 4N53A 1QR9A 1SLBA 2RNBA 5FZGA 5CU1A 1F51A 2W47A 4ONUA 4GIQA 2Y6HA 3RZLA 3OB8A 1VQ6V 1SPPA 2VO5A 3VBOB 3JD4A 3SKJE 4XPVA 1VRH2 1PMIA 2RR12 3ZXJA 1W6PA 3KF3A 3OMIB 1AI7A 3ZDSA 1GP6A 1TG7A 2ZR3A 4DINB 3UGHA 1JVMA 1Z7S3 2XBO2 4HK8A 2QQPA 1JR9A 4CVUA 4KNCA 1P7GA 2ZACA 5G05L 3POWA 1EPZA 3BN6A 2VZQA 5DM6V 3M99B 1BS3A 2YUAA 4I02A 1D0HA 5K1XA 2IXLA 2NLJC 3T30A 3AVRA 2P17A 4BB3A 4B3NA 2RV9A 3ASOB 4MSVA 4OUMA 3SYAA 2JDPA 4AHYA 4UW3A 4U3JB 2GU9A 1QU7A 1EM1A 4YVWB 2A3QA 5A2QN 3QD6A 4XDJA 2DJVA 4ZPIA 1GH6A 2W39A 4YJ2A 4E4HA 1NBMG 4JGZB 3OGCC 4AL9A 4M00A 2C24A 3N2KA 2EINC 5E6HA 3TAYA 4CZSA 3J81N 3KD4A 5CFDC 2R0FA 4PBOA 3THTA 4AVAA 3BTZA 1GZWB 2YC4A 2UXBO 1NT0A 3OBAA 1QOTA 4LHNA 3JU9A 1S5HC 1XRUA 2D2CB 1PVXA 3F5WC 5BMVA 2AC1A 1HQWA 4XBQA 1C8NA 1PO12 3NXSA 1OA3A 4OULA 1TME2 4XJWA 1UMHA 1O3RA 4ZIBA 4LF7B 2XAQA 3K4AA 2R061 3PL0A 3WNOA 1JXNA 3WLUA 1IS6A 3PNAA 1SLIA 1ZZCA 2HWE1 2XMLA 1DCSA 4AVCA 3DGEA 3HR0A 1YHFA 2EIJB 2C9KA 1AX1A 2KQXA 2WFPA 5FP4A 3HPLC 2HJFC 1GMMA 4JRAA 1MPXA 1C1LA 3FUOA 4BIZA 3E8HA 1XMOB 4DR6O 1QU0A 2WLKA 3U0ZA 5EQUA 1JU4A 1IQDC 2ZDIC 1TMF1 1LR5A 2ZKOA 2HWB3 5I91A 3I56V 3CU7A 1YJKA 1RUC1 3QLQA 2YXLA 2XLFA 4KHPB 4Y1YA 2YZ4A 2JD4A 2CTRA 3NNJA 1K12A 2FKXA 3L2HA 4DUXA 2JJ6A 4NWVA 5FXVA 5GLUA 4AQ2A 5FQ0B 4A5UB 4LIUA 4XUPA 2LM3A 4RFT0 4V2VA 1PVC1 4YZ2A 4XQDA 3AMMA 4AE2A 3J4UH 2FDGA 1SMVA 1T5EA 1DQ4A 3ZYGA 4IHJA 1ULDA 3ASNB 2HWF1 5DAWA 3GJAA 4E4DX 3NJYA 2W95A 2CYFA 3RSJA 4OUEA 1X8EA 1VQNV 5IYDO 1US3A 1YXWA 4X66B 4DV7O 1SG3A 4LBJA 2KG7A 3FFQA 4WV8A 1VQ4V 3K08A 3ETPA 5I8YA 5HPOA 4HVQA 1O91A 3VHRA 1MZEA 1LHVA 4LF5O 3ETEA 4GULA 3BA8A 3JAKB 3W7TA 2Q4PA 4MXVA 2AHZA 4KGGA 3U37A 4QPGC 4LBQA 1UZVA 1H1AA 1I5YA 3EQEA 1GV9A 5DN6G 5LA2A 1QOSA 1S1AA 5A9GA 3WNLA 3APOA 1IG3A 2D98A 4JRLA 3OD4A 4LPLA 1F7YA 1GBGA 2GP3A 3UJOA 4ORFA 3O65A 1FV3A 2J1UA 4BHPA 4TT3G 2RS51 3VQVA 2XL9A 2QDOA 5K7PA 4QE7A 3OY8B 2UU9O 1XQNA 3M8AA 5GALA 1OH4A 4C0HA 1JQ0A 2WABA 5D8AB 2DDUA 4OX9B 1U5YA 4NN0A 1VBD3 1WA4A 5F5QA 4Y5TA 4BQ4A 4WM7A 5CB4A 3N35A 2A75A 4FZ0A 2QR4A 3FL7A 4DV0O 4UB6Z 1JS9A 1PM4A 2JD9A 4TQFA 1KD1W 3JQXA 2G1MA 2C9AA 5JPNB 1YVWA 1IBMB 1XJAA 1GFF2 3CC2V 1AF9A 2P2KA 1LGCA 1JU3A 4CUAA 2FYUH 3U07A 4IUGA 5FLIA 3E35A 4COZA 2PHRA 4I3GA 1W2OA 5CBHA 3JB8A 3THPA 3GVMA 4NB5A 5FO9B 4LH7A 2EXHA 2W6JG 4M0HA 4QNHB 3ZKUA 3ME2A 4QHZA 1VMHA 3O1SA 2HFEC 2E6VA 3VQXA 4DS0A 2P3JA 2FDFA 3NKTA 2ZHMA 4R8CA 3PIGA 4KQ7A 4BDVB 4PA6A 2HJDA 4Q4X1 1TQ5A 3SPHA 4MGSA 2XWBB 4H7MA 2XGXA 1HNWO 3D8CA 4YVSB 5KHJA 2AACA 4KL1A 1EN5A 3RVYA 3U78A 2JGUA 4CDUC 5ISLA 3EHKA 3C8XA 3ZMOA 1POQA 4IE7A 1UPSA 4GWJA 4B8EA 2IJJA 5JCTA 4XETA 4LXLA 4PA7A 2GDSA 3WG2A 4Q8KA 2Q1MA 2WNUB 5LP6C 4NIIA 3K57A 4Z92B 1QLEC 2AR6A 3VDCA 5G04L 4DRXA 1Y76B 4AZZA 2PXJA 3IGAC 4DFSA 2R042 1S0DA 1FXKB 1X36A 1CX1A 4L99A 1WLEA 4YGEA 2QTSA 2Q0OC 1SQBH 4DUZO 4B3TB 2J1AA 5LA0A 1YFUA 4IEOA 1HDKA 5EP9A 1N1TA 3V64A 3JD2A 3E97A 2WWUA 4QXKA 1TEIA 5FZ7A 4OPHA 1RUF1 1Y4WA 1GQPA 3ZVXA 1LUWA 3TXSA 3HKEA 1HNXB 1OV9A 1M57C 1Q8IA 5JSRA 4EZHA 1XREA 1D0GA 1GM8A 1ZBE1 2QQKA 1X9TA 2CH7B 1ZREA 1PK6C 2D93A 1WW7A 5BNPB 3ZN5A 2PLV1 2A3YA 1F35A 3ACLA 4XOGA 4MADA 2JEUA 5LOVA 1Q8QA 1VAVA 3KM5A 1IBLB 3N7LA 4GAZA 2OS2A 1HN1A 4A6SA 5IAXA 2F1MA 3KF5A 4IGQA 1OBNA 4FPKA 1J95A 4YGBA 1KECA 4YWAA 4YIOA 2YEVA 3F7VC 2E7AA 4CUGA 4B4QA 1GO3F 4KXRA 2PA7A 5F5IA 3X29B 3MW3A 4B4RA 4R9AA 5BR8B 5C8CC 2Q8CA 4QQLA 3TN91 3RYPA 3L70H 3VDAA 2Y48A 3AK1A 2CTWA 1F4NA 3MEPA 4RS5B 4D7SA 2XKOA 5A6ZA 3P32A 1IVSA 2N05A 1SQQH 4AI3A 4X6RB 4I50B 5FWEA 3FHQA 5DUWA 2Q67A 1CJDA 2BRTA 4LF8O 3KLSA 5JOYA 1WCSA 3W7SA 1UU4A 5T5LA 1FATA 2VULA 1GRJA 3AFGA 5E8AA 3VZMA 4DRRA 4WFAV 3ABTA 5B3SB 1OLME 3BCWA 4GD4A 4UVCA 1OOPC 4LBOA 1RUH3 4R6ZA 4UCRA 3MF6A 1ODMA 3TRSB 1BHGA 4JZ2A 1D4M1 4CDQA 3C7EA 4QXBA 4CPBA 3GZEA 2LO1A 1ZZ6A 2CWMA 4BK4A 2V72A 2OWOA 4LNUA 4KGQA 3AC0A 4XUTA 5H9SA 3N4MA 4C0BA 5ACA1 2VRZA 2D6MA 2E75B 2XT9A 1XE0A 3B02A 1EBOA 5L7OA 4LULA 1THZA 5DG2A 4UXAA 1U96A 2MEV3 5FZ3A 5K9YA 1XYPA 5KXEA 1T6GC 5CBFA 3RYIA 4JI6B 1DF4A 5F6KA 3ASOC 4RQEA 4Q5OA 5EFUA 2UWCA 1HW7A 4PI2A 3QO7A 1LENA 2WWJA 3T0DA 1RHI3 1HRV1 3AJZA 4AILC 2Z69A 1DTOA 2V4VA 3AG3B 3VQWA 4YY3O 2P4VA 3K9SA 4A3XA 3FJSA 1G4YB 4DV1B 4LF6O 2D40A 3H1LH 4JGZC 2JICA 3LEIA 1CN1A 3S57A 4GKYA 5B1BC 1IKPA 2D43A 3POIA 1ULEA 1RUI3 3LSEA 4DK0A 5IT9N 2R062 3OG2A 4QIWF 2Z5UA 4XDLA 4BW5A 3U4XA 3WVJA 2HWE2 4Y26A 2JJ1G 2Q73A 1B6QA 1E5RA 2CDPA 3WHUA 1K9MW 1WLWA 2Q4SA 5IVJA 1CAUB 5B4XA 3K5OA 3DPRB 3THDA 2QKCA 3JSNA 4NXMO 4C1WA 2ZX2A 2E26A 3S0MA 3LDEA 2DFCA 2E9QA 1BXHA 2RJKA 3AG2B 4DO2A 3U10A 4JTDB 1QMJA 3M3IA 4QAWA 4SLIA 3KQ4B 1ND2A 5CA0A 3JASB 2NPIA 3O14A 1O4ZA 3I2DA 4XFHA 1M06G 1QJU1 3K0GA 3HNMA 1R083 1TMF2 1QNMA 1RUD1 4DV2O 2EIJC 1RUC2 2ZJCA 4DYLA 3M4FA 1OXCA 3WDXA 1JI6A 4QX0A 2VUAA 2G9GA 1V6OA 3ZFFC 1N3QA 4JV5O 4WFHA 1K5QA 5FAXA 4QT6A 1JMKC 5JLVA 5JVDB 4IE5A 3UL2A 3ZCCA 3JARA 2GNMA 3P1IA 1PVC2 4ZU4A 2ATFA 4UCUA 3V0AA 4JDNA 3GM8A 4AG4A 5LA6B 4OPAA 2HWF2 5FNVA 1OI6A 5LGNA 3SJCC 3H1YA 3WT3A 4G9SB 3HWJA 2W91A 4M01A 3LA3A 5BZBA 2ET1A 3LFIA 4Q4Y1 3MDSA 1O7FA 1NKDA 4LA2A 1GWLA 1Y3TA 3ZJZA 1LGBA 4Y3OA 1KDMA 3VBRA 2WQ8A 3ZYHA 2GMPA 4KG8A 1LOGA 4OHYA 3WB0A 3ASNC 2RQ6A 5T50A 1LTEA 1KQSU 2GNTA 5FYUA 4YSFA 2UXBB 1W6NA 5LWBA 2GNBA 2QWOB 5L9VA 5T55A 4F83A 4NXNO 4COVA 4FM0A 3FD9A 3RI8A 1OPMA 1J3RA 3B3QE 2WO3A 2X10A 1AR83 2HBUA 3FYIB 4DXZA 2JGDB 2RS52 4JPRA 1C3HA 3VBHC 3E5UA 1ZSPA 1NCQB 1QHDA 3RJ2X 4JKKA 3KCCA 3POYA 4TV9A 2X0LA 3KMHA 2DFBA 3TETA 4NVPA 2NMNA 3G4SV 5EBMC 4TV8A 4KI5M 1B04A 5KA6A 1H1MA 4OUSA 3O1VA 3LFMA 1P84F 1YJNV 1H8VA 4UI9L 1R64A 5IVEA 2BQPA 1ULGA 4DR6B 2D6NA 3KSCA 5JDBA 2FHRA 1D2QA 2VR4A 3OTFA 2Y34A 3PHMA 4BCUA 5T54A 2CTVA 3M3OA 4KMQA 2F6BA 1K5MB 4WFFA 1WB8A 1YCIA 2TNFA 1AR91 4JI5O 1SS3A 1S0FA 5D8AC 4FPYA 4JGSA 2OQ6A 3V0BB 1CP9A 4QXHA 2CV6A 4YRDA 4MG2A 2MPFA 5FTTC 2QJVA 1UAIA 1E5SA 1Q6IA 2IJKA 2A3WA 1BCCH 3IB3A 1NJIW 4Q4X2 1G8WA 3B9IA 2XQRA 4AFAA 5CA1A 1UY0A 4LORA 3QG5A 5BNNA 4NTWA 4DV7B 3RQ0A 1LHOA 1H9PA 1LHNA 3C7GA 4RR3B 3L72H 2PI5A 1IPSA 4I30A 2FL4A 3R0RA 1UL9A 3K77A 4MVZA 1DQ2A 1GSLA 1CIYA 2WNVA 2CHHA 2P4EA 3H9AA 1JJOA 2ZEYA 4FOYA 1KB9F 4LF5B 4XF9A 3VDDA 2VZPA 1VBE3 1H4GA 1W8UA 2IZWA 2J1VA 4LFCO 2EICA 3SISA 3P5BA 3SPCA 2DVGA 4CS3A 2UUAO 5FZBA 1OCZC 1HWYA 1Y74A 4U36A 3PUAA 1PZ9A 1URXA 3GCXA 4OI1A 5J1XA 4I7ZB 4Q4V1 5EYPA 3WW1A 4YW4A 3CB2A 3HBKA 2O8QA 3EVKA 2BSKA 4M3CA 1COV3 2ZE5A 3IMMA 4UCVA 4N43A 5FRAA 1W9FA 4IIJB 4CXWA 4I5SA 1SLLA 4Q4W1 2BWCA 2UXCO 2Q1ZB 5J36A 3BRCA 2UU9B 1S0JA 3RVHA 4QU1A 1RUF2 3THCA 1QHTA 1QKQA 5H2FZ 1AI6A 1MQTA 2WT0A 4XDQA 3U4SA 1ZBE2 5L73A 4DV0B 3ZHSA 2WLNA 2VOTA 1SQVH 1OCOB 3CHXA 3WG1A 3NJZA 1H1IA 2XVKA 2PLV2 1NA1A 3LOIA 4IE0A 4J9YB 1Q90D 1SQ4A 1C57A 1TUEB 4IGPA 3POFA 2ZX1A 1JUIA 2XJQA 4V2WA 2X5IA 1BKZA 1QDCA 3ZXAC 4EN0A 1G6NA 4ZI7A 1GQGA 5L9RA 1G7YA 5EXOA 1AR71 3INAA 5EPAA 4JI0O 1AJNA 5BNPC 2GUZA 2VAUA 1NTMH 3ABLC 2VM9A 2N74A 1KBHA 3CWBH 1HB4A 1F2NA 5JH7A 1L3JA 3TN92 2P7TC 3I2GA 2DU1A 3ZFEB 3H1WA 5C4WB 2LW8A 1BBT1 3NNMA 4FFIA 3KT7A 1T2XA 4KU8A 2GAUA 1IOAA 1HNWB 1OUXA 1YTFB 4X1KA 4CC6A 4MT8A 3UT5A 3BB6A 2BJSA 3QBQA 2ZXQA 1OFNA 5ABJB 1I94B 4CEWB 2IVJA 4FM2A 1QQP3 2YS8A 3ABKB 2P5BA 4Q27A 4EN6B 3LD8A 1FOD1 1JA8A 2IUWA 2JWPA 4WVZA 2WRAA 4HN0A 2H3OA 5DN2A 5EHDA 1GOGA 5FBJA 3S7IA 2E63A 3HNBM 2QEXV 2Q8DA 4RS5C 3KVAA 1JW6A 1S0IA 4TUYB 3ZN1A 2FCVA 3G6JB 5JZGA 1AB3A 2DCJA 4MTXA 5LY1A 3A0KA 3K3NA 4EV0A 3VB9A 2QQJA 1WMFA 5CIRA 1D4M2 4DUZB 4M4PA 1E1QG 1JBCA 5J9PC 3AKRA 3LA7A 4CEYC 5FPLA 1UZZA 1W9YA 3RJRA 2F43G 1ULOA 1C1FA 1XYOA 4QQHA 4ZONA 5ACA2 1E57A 1MZFA 3K06A 4LK6A 2Q7GA 3KGLA 3KZIZ 1CD3G 3DXUA 5B3SC 1VMFA 4Q29A 1YFYA 3KV9A 3JATB 4B08A 5A7QA 1OHHG 1GZ9A 5JSPA 2DCKA 1BYHA 3PUHA 3GXUA 3VBUB 2WT2A 2M7WA 5FYMA 4YM3A 5M0TA 2XJUA 3PTRB 4UV9A 3MYXA 5BV6A 3VBSB 1QJFA 5LXTB 2P3YA 1NUKA 2DF7A 1HRV2 4MTGA 2W9XA 3WG7C 1SZXA 1ASJ1 4FXKB 1DZQA 1W6OB 3T4ZA 4IEVA 4A7KA 5BY1A 1Y4MA 5JAXA 4O4JB 4D6SA 4ZU7A 1I6XA 2ZIMA 4FSJA 1AYN3 2PN5A 3GB7C 1YJ9V 3WP3A 2EULA 4XACA 4LLFA 4RQPC 3AZYA 3UQ8A 2EBOA 5FUIA 1DQ6A 3W7UA 3MLLA 4D3WA 4J7ZA 5CB7A 4AEDC 2RDSA 3AG3C 2ITCC 4QDRA 3I2JA 5IWFA 2NM1A 2OCCB 1KKDA 1MABG 4Q20A 4K20A 4TQDA 2HKXA 4D69A 1ZZ7A 3UYJA 4LF8B 1OZ0A 4CCOA 2W0XA 1W0OA 3AKQA 2JDNA 2DUOA 1LKNA 4GZ9A 2AW9A 1YZBA 2N7GA 1QJU2 2R6QA 4D0QA 1MMMA 2YBPA 2D6OX 1VQ5V 1LOEA 1FXHA 5FPUA 5FK8A 3SNMA 1H8TA 1RUD2 4MX3A 4Y20B 4JTAB 5JI9A 1FNZA 1FPOA 3KHBA 5LBFA 4EJRA 3OAAG 3WDTA 4QGLA 1VMJA 4WBBA 2YIAA 5CAZA 4NR1A 3AG2C 4NROA 4UYBA 5HCFA 5A3WA 3OR6C 3WSOA 5KHGA 4QX7A 4I2OA 3N27A 3BA9A 3K79A 3BKZA 4UOJA 1KP3A 2KD7A 3CJIA 2QA4V 3DYOA 2A0LA 1V54B 5E89A 4QB6A 4MVQA 1Y9GA 4QGPA 4EKWA 3LCPA 2PHFA 1MVQA 1K4DC 4O4LB 1BLZA 1UQXA 5IY5C 4R9CA 4Q4Y2 5FXXA 3AZVA 2BVBA 3AZXA 3BU0A 2Z3YA 4MGKE 2Y33A 5LGTA 4OHXA 1IPKA 3NSTA 2D97A 4MXWB 2ZGLA 4NWWA 5LRSA 4YY3B 5E1AC 2N04A 3OGSA 4HKLA 4BWAA 4LF6B 2BE3A 4AEKA 4XFBA 4N53B 4AI1A 2R16A 3D36A 2DUPA 2Y60A 2CU5A 3SLIA 4KUMA 1W6QA 2X6AA 1TZOA 3NNFA 3RWNA 4O4IA 4QWNA 4ZOLB 1GU3A 5I0UA 2OIGA 1SPPB 2YXSA 3MLJA 3CSXA 2QM7A 1QH7A 4L97A 1UFIA 4OQ8A 4LE4A 1W6PB 5EZWA 3JYCA 5C8YA 2ORZA 3SPGA 5FBZA 3GGLA 2CL2A 3GWOA 3K9AA 2VQ0A 4YW3A 2C2AA 1J3QA 2VQFB 1CAVA 4NTYA 1DDLA 4NXMB 3OFNG 5A1AA 1PO23 4WCEV 4AVVA 4BK5A 4UFKA 1JZ8A 2A6VA 3EBRA 2HHHO 1B35A 1W8ZA 5DAXA 1CONA 3OGIB 3Q8FA 4HOOA 2Q68A 5CKNA 4K8ZA 5IK8A 4XC9A 1XHXA 1SLTA 1BL8A 1U5XA 3I7DA 1GKBA 4IGGA 4NHKA 3KCXA 1NCQC 3LQCA 2JVDA 2YV8A 5D2AA 4DV2B 1AR92 2JIGA 1PNFA 2UYBA 2VVFA 2JXAA 3BI3A 4YJ2B 3J80N 4FCAA 3S3WA 4JV5B 1Y43B 4IEZA 2VOWA 3M8LA 3BYWA 5J96B 3ZX6A 3WF0A 3LNNA 3N2KB 2W5FA 4GJZA 2E7TA 1UY3A 1POV1 3CJHA 2ZOEB 1BZKA 1SBEA 2F17A 3SH3A 2CGOA 3AYCA 4HVOA 3O9OA 4ATFA 2P06A 1K5MC 3R4SA 4UCOA 1V6KA 2ZHNA 4Y1UA 1IS5A 3MPBA 1POV0 3AP7A 3I2HA 1XBFA 1JFFB 1ZA4A 1GOFA 3BVCA 4MZUA 4PIXA 3WG4A 3KZ4C 5BMVB 1W3XA 5AFEA 4EB6A 2QE3A 2QDNA 4ZS2A 1L8DA 4KBZA 5D21A 3WFVA 2R071 3UETA 3G6EV 3ZHRA 3BPZA 5IT6A 2WYFA 2UUBO 4XJUA 1BEV1 1JYCA 5HXVA 1X7NA 4Y33A 3OUIA 3ZSEA 3F95A 4Q4V2 1OA4A 4NXNB 2BOJA 2VMEA 2O57A 3M7AA 4NJ4A 2ZGMA 1NR1A 3MIFA 1JYWA 4RHV2 1UZ0A 4YJ3A 3OT7A 3JBG1 1D5AA 4MVSA 2RG4A 3AZWA 4AXOA 4ICGA 2WO2A 5BY5A 1SF9A 2QJ1A 4HNAA 1DHKB 1JOYA 4QKNA 5FZMA 5F2SA 3B94A 2AXTZ 4I0BA 1QVGU 2NLRA 1LNQA 3I59B 3A2FA 2FQPA 4PT6A 2PELA 2P67A 2BV4A 2DWDC 4JYAO 4Y22A 2RDRA 2L9LA 3LZZA 3K04A 4P5YA 1MEC1 4P9GA 1JYXA 3E83A 4MHUA 3IBMA 2EILB 1V70A 1SC5B 1FFTB 3GJBA 4J1WA 2QSAA 4PLNA 1GR3A 4N7IA 4BA6A 3DN7A 3THOA 3OBTA 2WINB 4XCAA 2Z42A 2KM2A 4XUNA 3T2PA 2EAAA 4IHJB 3AFKA 4JI5B 1SCSA 2WSVA 4FPJA 4E4SA 2JEXA 2RMU3 2PF4E 1AR72 4DUYO 4DUVA 2WLQA 5CG9A 1FAYA 2KG7B 1XOYA 3WB1A 1AX2A 3H8UA 4D7YA 5JR2A 1OCOC 1WKYA 3HQXA 1HJGA 3RYFA 1W0PA 3ZYBA 2X29A 2ZDIA 1BBT2 5A6XA 1H2GA 1R092 3JB4C 4WVMB 2P5OA 4IE6A 1WLDA 5L36A 4LBQB 3CDZB 1IBMO 4BW9A 4B4PA 1CIWA 1E79G 4CUCA 3E22A 3K5NA 4XXAA 3L73H 2OYQA 1N1SA 3J7HA 1FOD2 1QH6A 1GTOA 4I0AA 2HEPA 1RUG3 2R32A 1I3HA 1Z7S1 4LFCB 4GMP1 2GH2A 1AR61 3LEGA 3ZFEC 5C4WC 2UUAB 1UXXX 4NIDA 2DYRB 4JYYA 5ABJC 4GMP0 4CCJA 3ABKC 4WM7B 5CB4B 3B9CA 4WVWA 3ZO0B 4FOVA 5IUQA 4AQ6A 5AC93 2Q7EA 2WLIA 4I55A 2UXCB 2XLGA 3WP6A 2YC0A 2XJTA 4QE9A 2AZ5A 1DQ1A 3S30A 4QPGA 3RYCB 3VN4A 1SESA 3J8F3 5FKBA 4JC1A 1DK1A 4RO2A 2X05A 1CXZB 5HCHA 4RYDA 3W21A 3UKTA 5FZ1A 2WLLA 2AREA 4L11A 4WM8A 4YXWG 3L2YA 1C5HA 3CYOA 1W8FA 2CAVA 3ZYPA 4XF1A 5B1AB 4IGOA 2ZIOA 3CZJA 3ZIAG 2YY1A 4F6RA 5IJ9A 2H94A 2B4KA 1W8WA 4IEPA 1ASJ2 2EJRA 2OW4A 4ES8A 2SLIA 3JUUA 1YWKA 1CESA 1MS5A 4JI0B 3JALA 5C7GA 1A78A 1VQOV 3AX4A 4QPYA 3OBRA 3BHPA 3W9AA 1GNHA 2VBDA 2QQNA 1K42A 4FTSA 2WO7A 3K4DA 4OFGA 1HRI1 4L9BA 1PM9A 2YU1A 4CCLA 3J7MA 2AUYA 4FP2A 1ZRRA 4XTPA 1KD7A 2ZHKA 4CXXA 4YYOA 4Y4YA 2WLJA 4S2HA 3TJTA 1FX5A 3STLC 3HD8B 1I08A 1UO9A 2JENA 3PUQA 3EXAA 4DRXB 3ZRWA 1OQDA 2P6CA 4CCMA 4A4AA 2YI9A 3T0BA 2ENRA 3J7AU 3OUFA 3OEAA 1PNKA 2J7MA 1X9PA 4CS4A 5FIXA 1S5LZ 2VWKA 4JI1O 4BR6A 3X2QC 1U0AA 2NMOA 2ZEWA 4S2FA 2DW4A 2OZJA 2BVVA 4LTAA 1GWKA 5FZ6A 1VF6C 2YMZA 4YZ3A 4CDUA 2OCCC 1DYOA 4NHLA 4RUEA 5A3NA 3D0JA 1Y66A 1RUE1 4B1LA 4XFAA 5F5AA 4AI2A 4SBVA 1GKFA 2DBNA 1DGSA 4P9PA 1ZYBA 4G3YC 3PURA 3EHBB 3ZSMA 1O59A 1DU3D 3TK1A 4JYCA 3KV4A 3FLPA 3POJA 1JZ3A 3FUQA 1BHBA 5IYBO 5B1OA 5C6CA 4X8PA 1DQ0A 2XUEA 3AL6A 3MO4A 3ZFGC 2UYAA 5EK0A 1HB1A 5JSOA 2CTQA 4F7ZA 4DR1O 2ZXWB 2CDOA 4PELA 1X33A 2FD8A 4RGGA 4QDSA 4C90A 2EZPA 3GHNA 4LHLA 2R063 1I9RA 1V54C 4EEQA 1JYNA 2HWE3 1QOOA 4AEMA 2ARBA 5IHRA 2BUKA 1PK6A 5DXDA 1JYIA 1DFQA 4E27A 4DMIA 1F9KA 1W04A 3OUSA 2V1DA 4BAYA 3LB9A 1H2NA 1XUQA 3MAQA 1NCRC 4PA9A 3VKNA 5JXGA 1VBB3 2OIIA 4MW8A 4O2BA 4BIUA 1UOJA 5A3UA 1VBD1 4Q1PA 3ZHTA 2WA3A 3PU8A 5FLJA 1WBFA 1K3IA 3HKCA 1OKQA 4QPKA 4E4ZA 5J98B 4Q0UA 1L7RA 2ATKC 2QWQB 1HJFA 1DGRA 1KFUL 5LBBA 1P4RA 4O4HB 3OGVA 3RWRD 1W39A 5C8CA 4CDQB 4QX2A 1QJX1 1HLCA 2I45A 1K3EA 1E5HA 3HBZA 4H44B 2D6KA 3TEZA 5A6QA 5KLVH 5IVBA 4LNUB 3R05A 4GYCB 2VCBA 1N0JA 4A42A 5HBAA 2EF6A 1LNSA 5F3GA 5F9TA 3CRCA 1V55B 4YIPA 5I8SA 4M0NA 4BH9A 1REFA 5L7OB 2PYLA 3WNPA 2KR2A 4NHYA 5K1PA 2XTAA 3CC4V 1K8AW 2ZCWA 4DV4O 1BVP1 5C71A 3ZSKA 3ELNA 3ILNA 3ZMVA 3H1JH 3B4SA 3J7NA 5LBEA 3BPSA 3RYIB 3OW2U 1W3VA 2Z5WA 4OGQB 3VKLA 3ZN0A 1BK1A 2QQUA 5DZGA 3W5NA 1EZVH 5FPZA 1PMJX 4NRMA 3T3YA 1OOPA 3T1YO 4AI9A 3P30A 2VW0A 3VDBA 2BYVE 3I3DA 3MUZ1 4MGIE 2VW1A 1K5JA 4JAVA 3VZJA 2A79B 2R72A 3TWIA 2GN7A 3WR0A 3B7MA 2R072 1UPIA 2CE4A 3AMHA 1BEV2 1UOFA 4BIFA 4NHMA 3LSQA 3C3TA 2RS53 3D4KA 2OCHA 4JGYC 3AYDA 1AUYA 3T2MA 2DN9A 3JBG2 2XWJB 5IJ0A 1DYKA 1YEWA 2RCVA 1M90W 2Y4TA 3DKWA 2ZD9A 2FZ1A 3ETQA 4NIAA 1RVF1 1S0CA 5FZ8A 1W0JG 1QY4A 3ZXGA 1YLLA 2EJ7A 5CA0B 3OGJA 2P6JA 4E2GA 4P5HA 5HV4A 4PDVA 4MSWC 4JGZA 1SZBA 4M4RA 2Y6LA 1RM1B 4PIZA 5D1IA 1LCLA 3ZYRA 4Z1MG 1MEC2 4D8MA 2DCTA 1EN4A 3JAWB 2HHHB 2DCYA 4AGGA 4IQPA 5J48A 3SDLA 2OTJV 2XPJA 1J84A 1AXZA 3JARB 2PHDA 1QJY1 3ST7A 2QKSA 1GZWA 4FZ1A 1WP8A 4BMBA 2EIGA 4X6QB 4GH4C 2VXJA 5I93A 2EAKA 1N0NA 4K6BA 2R7EB 4PIYA 2F93B 4XABA 4EWAA 4PDWC 4Q4X3 4X8AA 3I2OA 3ZRSA 1WPXA 1US6A 2XHBA 3Q9OA 1APNA 2GALA 2UURA 4XUQA 4QHOA 1WBLA 3NNLA 3TGUH 3B8NA 1W90A 1LECA 1KEXA 4PF1A 4XDPA 5EC1C 2A5ZA 1SFPA 1FXVA 1LEDA 2YB7A 4K0KO 3VBRB 4GWNA 2R49A 4JQTA 1YXBA 2LGQA 1V00A 5E88A 2BNMA 3ZPYA 2OZ6A 3HEIA 1X50A 3GZTB 1W6NB 2WNEA 4HK9A 3JD73 1OVSA 1JHNA 1OPOA 3IT8A 3ZFFA 4XQWA 3KVBA 4P00B 1AL0G 2GN3A 1UD1A 1W0KG 4W6YA 1XSRA 2VBPA 5F8PA 1FKAO 4JI2O 1YFWA 2JKBA 1Z78A 2X09A 4DRVA 5BNQA 1PV0A 3D3IA 1Z7S2 4CP2A 3DSQA 1KUQA 4IERA 1N1YA 1AR62 4MGTA 2UUBB 1Q43A 3UK9A 2A6XA 2PAMA 1JOBA 3VD9A 3IDAA 4TV9B 5FZ4A 1NOVA 4MTOA 5CFCB 2XAHA 5F37A 2IJIA 4UCTA 4HANA 4TV8B 2GTSA 2WJSA 4R4XA 1DZRA 2ETEA 4FLYA 2VCMA 5JXHA 4FFKA 3NMBA 5T5OA 4YFWA 5F7UA 5JIUA 3H1HH 2CSGA 2FMYA 4CDWC 3SJQC 1A8MA 2YROA 3H8RA 4AI8A 4PLOA 5T52A 4U7NA 1JZ7A 4JYAB 2ZTNA 3EO6A 2MEV1 2DYRC 4DR2O 1R1A3 3CX5F 4CH6A 3G71V 4I0WB 4IYIA 4LKEA 4FI9A 3MUY1 4YG0A 4KWLA 4WM7C 4F4LA 3WHTA 5C9AA 1YJLA 1BT8A 1PM7A 1VMGA 2Y6GA 5L3FA 2ZR2A 3AG4C 3VBHA 2ARAA 2ZGQA 5DUXA 3BTAA 1DQ5A 1W6MA 3S5QA 4B3SO 4BQ1A 5CA1B 4UWDA 2G4IA 5BNNB 3M3CA 5L3GA 3SJBC 1S0EA 2HVKC 2NYYA 5FYZA 2RJZA 5FO8B 4X1IA 2JDIG 4XW3A 5A3LA 3NV2A 4LBLA 5CKMA 1HRI2 2Q5ZA 2PAKA 5JOXA 3VDDB 2VOVA 3OY8A 4QPIC 1OUSA 2KA3A 5D8AA 2JDUA 3D82A
chains in the Genus database with same CATH topology
2H0BA 3PHMA 1CPMA 4KG0A 4BCUA 1AL22 5T54A 2CTVA 3M3OA 1UW8A 3ENRA 2F6BA 1K5MB 1NZCA 4P14A 5F6LB 1PIV3 1NXD1 1RC6A 3ILRA 1YCIA 1RUNA 2FZ2A 4IEWA 5JWPA 1RHI2 2PHLA 2TNFA 1AR91 4I3PA 4FPHA 1H30A 1ND3B 4YW2A 1S0FA 2MNGA 5D8AC 4FPYA 4GA9A 4M3CB 3TNQA 1MR5A 3JD71 4XXPA 3RYRA 3MW4A 3V0BB 2I2SA 3NAPA 3ES1A 1D4M3 3AMNA 4CRQA 2WFF1 2CV6A 4K8FA 3D0SA 4N43B 4YRDA 1BBT3 2I07B 3USSA 2MPFA 5FTTC 2QJVA 2JECA 3BODA 1UAIA 1UZYA 1C8M3 5IK7A 3HT2A 1RJ7A 1SCRA 1UU5A 4FBFA 1RUG2 2XUMA 1VIWB 3B00A 1RUI2 1KJRA 1MS9A 2A3WA 4XIKA 3PTYA 1GQWA 2HWD1 1G8WA 3I8TA 4Q4X2 3FBMA 1HV0A 4LHKA 3B9IA 3MI8A 4AFAA 1OFSA 4LUMA 2PTMA 1J59A 4BHFA 1RUE2 5BNNA 1G9BA 1CAXB 1VRH1 1GANA 2RR11 4JCKA 1RVF3 4XFFA 1FOD3 1J1TA 1F31A 2C1FA 4IV3A 4K1ZA 3RQ0A 1LHOA 1VAKA 1H9PA 1LHNA 4RR3B 1XNDA 3CNAA 4I30A 2XBO1 3R0RA 1NA1B 4XF3A 1UL9A 2VUJA 1ULCA 5K0UC 2WZR1 2DURA 1YI9A 3WUCA 1BZWA 1DQ2A 1GSLA 5DZFA 1M4WA 2WNVA 1PGSA 4GKXA 3H9AA 4FPGA 5CVRA 3IDCB 3AP6A 2ZGUA 1TNRA 2OYZA 4FOYA 4GB33 4IV3C 3UKNA 3VKMA 2Q0AA 4J1XA 4AVBA 4FFAA 1DF0A 4XJAA 1NLSA 4XF9A 2X5IB 3VDDA 5KXDA 5AC92 1VBE3 1H4GA 5SV5A 2IZWA 5CADA 2LUWA 4HSJA 3SISA 3IDEA 4P9XA 3GNEA 4UW4A 3WNXA 2WNVC 4EWDA 3OCPA 1HXS2 4MYEA 4Q0PA 2DVGA 4U36A 3J8F2 1SLAA 1R082 1PZ9A 1URXA 4OI1A 2ZS6B 1O5LA 4IV1B 2QZ3A 2A7AA 4Q4V1 5CFDB 1ZRCA 2DUQA 1KDKA 2RS31 1QJY3 3WW1A 4YW4A 1R1A1 3N6WA 2C5DA 2O8QA 1O3TA 4XJZA 1DS0A 4JTNA 1ND3A 2WS91 2VG9A 1AYM2 3MF9A 4FPLA 4K21A 1OMIA 4M3CA 2WWSA 4P9JA 4Q0QA 1COV3 4Q2FA 3V0BA 1OA2A 2IWGB 4DNYA 3OF1A 4ITCA 2VVDA 2GMEA 4N43A 3ZN4A 5FRAA 4LO5B 1GZCA 4Y22B 1SLLA 4Q4W1 2RM23 1SACA 2V73A 1ND3C 2BWCA 2A6YA 2XH6A 3RG0A 1RINA 3PMSA 3DV8A 2Q1ZB 5J36A 1S0JA 3CF6E 3ALQA 1MVEA 3AB0A 2QUOA 1RUF2 3PVBB 1AR81 2AGSA 2WZR2 1QKQA 2ZGSA 4N43C 3NKGA 1WGPA 1MQTA 1LOAA 2WT0A 5AFBA 4XDQA 4CP0A 1FMD3 1ZBE2 3ILFA 3NV4A 5L73A 4YG3A 3MDPA 4LO4B 2OA2A 1CAXA 3SH5A 4FP3A 1YNAA 4Z8BA 4ZU5A 2GNDA 3KT1A 5GLVA 2E7QA 1LOCA 3PVEA 2RE9A 3WG1A 1RB8G 3NJZA 3SMHA 1IS3A 4RR3A 1ZM1A 4CDXB 1H1IA 2XVKA 2PLV2 3RI9A 4P9YA 1ASJ3 1MQTC 1NA1A 3FZ3A 3LOIA 2D7FA 4AW7A 3O0XA 4PJYA 2F4PA 4AFMA 1SQ4A 1C57A 4XJ8A 2UU8A 2ZX1A 2RS32 4CEYB 1ZZ9A 1VBA2 3SH4A 4N7UA 1JUIA 3CEWA 2ZGPA 4RR3C 3WZ1A 5KC6A 3KCYA 2XJQA 1PO11 2X5IA 3M2MA 5BNPA 1BKZA 5GLWA 1QDCA 3ZXAC 1TME1 1FV2A 1NA1C 4EN0A 1G6NA 3WW2A 1GQGA 1DRYA 1QJX2 1SDWA 1G7YA 1NQDA 5EXOA 1AR71 4XF0A 1OLQA