1MZEA

Human factor inhibiting hif (fih1)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
total genus 96
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzeA01
4BIOA 3KCYA 4Z2WA 2XUMA 2YC0A 4B7KA 3KCXA 4JAAA 5JWPA 1MZFA 3P3NA 4NR1A 2WA4A 1YCIA 1H2MA 3OD4A 4Z1VA 2ILMA 1H2LA 1IZ3A 2WA3A 2YDEA 3P3PA 3D8CA 1H2NA 2W0XA 1H2KA 1MZEA 2CGNA 4QU2A 4AI8A 2CGOA 2Y0IA 4B7EA
chains in the Genus database with same CATH superfamily
1OI6A 3BOPA 3IWZA 4LBLA 1E79G 1FXKC 2DYRC 3D3AA 3RNSA 1Y9GA 2UUBB 2Y69B 1LEDA 4LF6O 2W08A 3WF2A 4CH6A 4AXOA 1KEXA 4BOWA 3DXUA 1RHI2 1UU4A 2H0BA 1O91A 1R3JC 1UZ0A 4KWLA 4LF8B 4XAAA 3FHQA 1JBCA 1D2SA 5FOBB 5D1IA 4FLTA 2OWOA 1J1TA 3WT3A 4LEJA 1HQWA 4QGLA 1HQLA 2D43A 4CP9B 2K1EA 3PMSA 2IFWA 3T2PA 1YYNA 3CJIC 5C8CB 3ZHUA 1RHI1 2HVKC 4WBBA 3APQA 5FY1A 3J26N 5DM6V 2Q8EA 3UV9A 2UWCA 2AEZA 3E89A 4N53A 3VKFC 1U5YA 1PZ9A 4NJ4A 3UO2A 1W9WA 4I4TB 5FMOS 2ZAHA 4CRQA 1YIFA 3WLUA 1UPSA 5DDJ2 2DBNA 2B1GA 4O7XA 4DINB 2FZ2A 1CZSA 3OUJA 4JI7B 4W8JA 2BV4A 3FLRA 3WB1A 4OX9O 1JFFB 3NAPB 2ETNA 3ZRWB 2I45A 1UNBA 1AJQA 5E8AA 4DW0A 2BEOA 2HKOA 1BCCH 1FPN3 2B39A 2VCMA 2PXJA 4GCZA 2ZA9A 1VQ9V 4QD2A 1CJDA 5LBEA 3HKCA 3JAWA 1AP6A 2UYAA 4JASA 1X8EA 4TQDA 4K8FA 4XFFA 3K03A 3N9LA 5E88A 3VBFC 1CJPA 5B1NA 5FPLA 3ZSLA 5LA6A 1NCRB 1NE6A 2RNBA 2WWSA 1PNKA 3HBKA 1UY4A 1LNSA 3L73H 5DPNA 1J84A 2D97A 3SLIA 2A75A 1ZRRA 4YY3B 2PI4A 2UWBA 1HXS1 4UVCA 1VR3A 3WQBA 1BQZA 2J1RA 2JKXA 3BVCA 3KG2A 4RR3C 2XAHA 3I4IA 3PLQA 2WZPP 5FZ9A 4LNUA 3O9OA 3T30A 1UU5A 3F7YC 4LJHA 2HWC1 5IFTA 3AFGA 1NLSA 3KV5A 5F39A 1OCOC 5CBHA 2GH8A 5KA5A 2W6JG 4JKKA 4PA3A 2KR2A 3CJIA 4TN7A 1W6PA 3AP4A 2Q9LA 4N43B 4BA6A 1MSDA 2QEXV 3OGJA 1WBFA 2D2CB 4RHV1 4X66O 4W6WA 1ZL8B 2RR12 2PGGA 1QJZA 2QDOA 2XVGA 2WFPA 4QU2A 3H1LH 4HN1A 1R3KC 2D5HA 4NXNB 3AZWA 4CH3A 3HT1A 3WG3A 2PYLA 5KXDA 1MQTC 1VBD2 3PUIA 2R042 3PVOA 3VKNA 3RVHA 3SCFA 2P06A 3G71V 2ZGMA 2ZNJA 1CAXA 4NKGB 4LE4A 2F17A 1L0LH 2WZR3 2BSKA 5EYYA 5A6YA 1LOAA 2DFBA 3VKOA 2QQMA 4PA9A 1ODMA 2IU3A 1HDKA 4WM7A 3SYQA 1QOSA 1GNYA 3KCXA 2QWQB 3UT5A 3AP6A 3RWNA 2RJZA 4X1KB 2NM1A 2J1EA 4L8JA 2K9PA 3DXTA 2BTOA 4DRRA 4IEXA 1NY72 4YFWA 1LOBA 2Q8VA 4LA3A 5K4LA 2GSMB 4AVCA 3ETEA 4LE3A 1RPRA 5CVRA 1OBNA 3K5LA 4KNCA 1N1SA 3WG1A 4UV9A 4DUYO 5LA0A 4LK6A 4YWAA 1OLQA 2VQAA 1W6OA 3WD5A 4WM7C 2WLIA 1L1FA 3MIGA 1I3HA 4XIKA 4R8CA 3MEPA 4CS4A 3HKEA 3WG2A 1PGL2 1WN7A 4ZKTB 4YRDA 4D7SA 1W0PA 2QTWB 3ZXFA 1H2KA 4NPMA 1JUIA 2D6LX 1FYJA 4MXVA 1LOEA 4Z8BA 1X9PA 4MGIE 4X88A 2YSUB 1TG7A 4RQPA 2AR6A 5IYBO 1CEZA 1PL0A 1WLTA 2M7WA 3TEXA 4Z1VA 1XHZA 1ACCA 1LU2A 1V70A 3LDCA 4KH9A 2QDRA 3KV4A 4Q29A 3E83A 2Y6FA 4CDQB 1MMMA 5CFDC 4P02B 2O8QA 4Z2AA 2WFF3 1UO9A 4BIFA 2P2KA 1M93A 2EIKB 5A3OA 1AXZA 4AHXA 2QQNA 4CUCA 1UN1A 2FDJA 4NOTA 3PU8A 4CCOA 1HRI3 1NTMH 5F7UA 3DYMA 3A0RA 1UPGA 1AI7A 1YSCA 3AM2A 3USSA 5KMGB 1J3RA 5IYCO 5EYXA 1YQ5A 2ZE7A 1MQTB 1DCSA 4HSJA 4BQ2A 4LLOA 4MSWC 3VLBB 1HNXB 4RWUA 2QNKA 4QDSA 1QQP2 2VMGA 2ARXA 4XBFA 4P9WA 1XMOB 1VAMA 3LDRA 4J11A 2P37A 2H6BA 3OMAB 3HN1A 5FXWA 1F15A 3CIHA 1EYBA 3CNAA 2A5ZA 2W9XA 3WP4A 3FX3A 1LR1A 5FO7B 4LFBO 4ZZ5A 4FLWA 1OXCA 2J1UA 1S3JA 2Z3YA 2HJDA 3QO8A 4YJ2B 4JKMA 1JMKC 1F4HA 3WF3A 4AL9A 3H42B 4CCEA 3ZFGB 1FXKA 3VDDB 3SMHA 3O14A 2JGUA 1JZ7A 3GALA 5JSOA 1C8M2 1BJQA 4YM0A 3KF3A 1O8PA 2BE3A 2JX9A 1IS5A 4COZA 1GZTA 2E6VA 4BHPA 3SEEA 2JGDB 5D5QA 4BQ1A 3R4UA 5H9PA 3N27A 1RUG1 1TE1B 1WJZA 1HNZO 2C26A 4QM8A 3K75B 1ND2B 1W6MB 2P4VA 3J7MA 2P67A 3K5OA 3UETA 2CAUA 4QQPA 3AYDA 3FMGA 5ISLA 1HQNA 1AX2A 5KC5A 1RUF3 2VOXA 2CWMA 3E6DA 5FPXA 5IK5A 1XRUA 3T1YB 3L74H 2XJQA 4CCNA 2Z79A 5AG2A 4UF0B 1I5ZA 3AG2B 4BU2A 3TN92 4AI2A 3NKGA 3VKMA 4I50B 2X53S 4XPVA 3CL1A 5JOZA 4I0BA 4JI1B 4DRXB 5CEHA 2A6WA 2DCTA 1L8DA 2PHLA 2TUNA 2Y33A 1SQVH 4EKWA 3WNLA 3WW4A 1Y67A 3PUSA 4LO6B 4Q0UA 4Y1ZA 5CB4A 1D7PM 2XQXA 5DEDA 1O3RA 4JGSA 2I74A 3GGLA 1A6CA 4BW9A 2VR4A 4XBQA 4OQ8A 1PO11 2HHHB 4K1YA 4NHXA 1EP0A 4QU1A 1PVXA 2YU1A 4J9YB 2QE7G 3H8RA 2ERFA 3VD9A 4YGCA 1F31A 4FPYA 2ZE8A 2R061 1HNXO 4FPHA 3OR6C 4MW8A 1MABG 1IPJA 3KCCA 5JDBA 2X10A 3W58A 1WD4A 1GZ9A 4AZZA 3WF4A 1ND2A 1W6MA 2RVAA 3LFMA 1AB3A 2CWSA 1BBT2 2ATKC 5EQUA 5L9RA 3C2UA 2R72A 4M00A 4P9OA 2IXCA 1SQQH 2VL4A 3ZIAG 1PVC1 4UFMA 4Y5Z0 3SYPA 4OUEA 3O1TA 5FDBA 2VMCA 3APOA 4RSUA 2WN3A 5EP9A 2FCUA 1TME2 4AEMA 3KB5A 2CK3G 5FPVA 4Q4W2 2WWWA 4DV3O 4ZI7B 3DUIA 3B3QE 5DUXA 4K3UA 2AHZA 2ZPXA 5A6XA 1IPSA 4NVPA 2XASA 2MNGA 5FP4A 1OCRB 1X82A 3OBRA 1I94O 4BDVB 2LQTA 4MGSA 4XHXA 3G6JB 3C7FA 2ORZA 1YI9A 1QOTA 1JJOA 3OUSA 3BGAA 3CKHA 4JAAA 5H9CA 4GKJB 4L9BA 4X89A 4UW6A 2ARBA 1SZTA 3MFCA 3UJQA 1R093 3W7SA 3FE5A 4RN5A 3AK0A 4B3SO 1Y4MA 3V64A 1H1IA 3JASA 1RXFA 4CTEA 4WVZA 1HXS2 2EIDA 4WVVA 4XDLA 5A3MA 2Q4PA 3WQ7A 1XYPA 2W2IA 1JPXA 4AEDB 3H1IH 1BCXA 2AXTZ 1GN6A 1FS0G 1OUSA 4MG2A 4LH6A 2A3WA 2VC9A 1NH2B 2MK3A 3HBZA 4CXWA 1ALYA 1ZNPA 1MZFA 3HKCB 3JAWB 4JI5B 4LTAA 1QVFU 5SV8A 1AJPA 2BJSA 1EN5A 2P6JA 5BV6A 1HV0A 3M7AA 1V54B 5CAZA 2VW1A 3AKRA 1VBB3 4JGZC 3B7MA 2YPJA 1LU1A 4S2FA 1VMGA 4YW2A 4FAHA 4PBOA 1HRI1 4NPRA 5KC6A 5FPAA 1S0EA 2PFWA 3HKDB 4BE3A 4I02A 3AKQA 2W68A 3JCZA 4I9WA 1YHFA 4HT1T 1VPHA 5LA1A 5LA2A 5LBQA 3D36A 3U11A 1R3IC 2UUAB 3NQHA 4L92A 4ISQA 3RYCA 3T08A 4LHSA 1Y7BA 3RYFA 2HJIA 4CBCA 4P9YA 1AXYA 1Y74B 2WL1A 1S0DA 3CEIA 4AI1A 3SEPA 1J3PA 2ZBJA 2QWOB 2UXDB 5CKQA 4KG0A 1JHNA 1AI4A 2OZ6A 4QX1A 2JD4A 3V0AA 3O1MA 5FZ8A 3NNFA 2ZGQA 3QO7A 4HKWA 5EJ1B 1K7DA 5DUWA 5IT9N 3GDBA 4FFFA 2WN2A 2YXHA 1GWLA 5JXGA 3LA3A 4JI4B 5K0UC 3BABA 1THZA 3I54A 1WP8A 3W5NA 4NHKA 4PDWB 3T1CA 1OQDA 4CYDA 3RJ2X 3CRAA 4JZGA 1AYN1 1YFWA 4W50A 2VNVA 2WQ8A 5EJZB 1FFXB 3FYEB 1VBA3 4LK7A 4Y22A 3LA2A 4ICGA 3M1HA 2WQZC 3EFFK 3TYJA 3I7DA 4BK5A 2JG8B 2XAJA 3OBZA 4XXPA 3OEHG 2ZMNA 2UUCO 3CXCU 3MIDA 1P4RA 5JXHA 3GCXA 1M56B 3U4SA 1WMFA 4J42A 4FLVA 3JCIA 4LC1A 4QPWA 3VHOA 1JN2P 5DDJ3 1KFXL 3S5AA 5C4WB 4QWNA 2FBEA 5FV3A 1YC61 4FAGA 2OVUA 3FL7A 5EIYB 4CP1A 1Z5WA 2RMU1 1RGSA 1IKQA 2XGXA 4GUNA 3ZYBA 1AILA 1FAYA 4X64O 4UOJA 3A0BZ 2P1BA 1X59A 4GH4C 1WA4A 1VBC1 4NPLA 2E76B 3I2IA 3H3LA 4LKEA 1NCQB 1PMJX 4PJYA 4ZOLA 5FLJA 1RUC3 4KWKA 2L9LA 3KGLA 1N3PA 4CDWA 2PHDA 1RUG3 4LFAO 4CU7A 1K92A 1C5IA 5LY1A 4E4EA 4X65O 1GP4A 4TWKA 4TV8A 4X66B 4L0PA 5F5AA 4QAWA 3AKPA 1TVKA 2OYZA 2PMWB 4FPEA 5FPUA 1GAXA 1CXZB 1H8TB 2YDEA 4UCOA 4HNAA 1C57A 4U7NA 4ASMB 2ZGNA 5A7QA 1PP9H 1IVSA 5CA6A 5JR7B 1V6NA 1C8NA 2QTOA 4B8EA 4D7YA 1XNAA 1KP3A 4JTNA 1F8VA 1VBD3 5FLXN 2WSUA 4I9QA 2YI8A 4TTGA 4ZHQB 4LKFA 4K9SA 1EAH3 1ZZ7A 2LROA 4N90A 2Y64A 1ND3C 3ZOIA 3VBOB 5FOJB 2QJ1A 3JATB 5HCFA 3K0GA 2OCCB 3E22B 2VE1A 2AW9A 1PZ7A 5JVVA 3ECQA 4O4HB 2XJTA 3BPSA 1OLRA 4YGEA 3HT2A 3QACA 3ZHRA 3L9JT 4LF8O 2E5LB 3KMHA 4DO2A 2ZZQA 2JDMA 2L35A 1ZSPA 1V9PA 4HETA 1VBD1 1RYYA 1JVMA 4KGGA 1YQ2A 4WVMA 2CDYA 2A71A 3MHHC 4DQAA 3VD5A 5E79Z 1PIV2 4QPIA 1X8MA 5FYCA 4G28B 3H3UA 4JGYA 4BLIA 1TMF2 4FPGA 2G19A 5H6RA 3SITA 1NZIA 1VBA1 4QX2A 5LGNA 1XNRB 3MV01 1H1AA 2WNVB 3PURA 1DLLA 2I07B 2ZXQA 4KXRA 2DWRA 5IVBA 4XEZA 1GV9A 3OAAG 3U78A 2YIBD 3AG3C 4L99A 3C7OA 5BUVA 4DR6B 5JCOC 2ZT9B 3ZMZA 3T2OA 5CIRA 2VU9A 3AZVA 3CF6E 1IQDC 1VRH3 3SYCA 3RYCB 1UYYA 5FY7A 1HIXA 1X4TA 4C7UA 1VIWB 5L7OC 5IK7A 4QXCA 1H6XA 1AF9A 4MO3M 5KHKA 3O7OA 3W59A 2VD7A 5KBFA 5FYHA 4D94A 1BEV2 1C5HA 3LNNA 1HB3A 1UY3A 2WR9A 2DWEC 4ZS2A 2C1FA 5JSRA 3HPLC 1YTFB 3BVOA 2QVSB 3IIIA 4GX1A 4DXSA 3WW2A 4PQQA 4BQ3A 4DFSA 4JCKA 1S0JA 2ZD9A 4LHNA 3CB2A 1AR93 1AR91 5HCAA 5IY5C 2GMEA 2BGOA 1TQ5A 1VB4A 1LHWA 3UKTA 1Y9MA 2NR5A 4FFHA 2ZDIA 4P00B 3LSQA 3ASNB 3M8AA 4N53C 4MLOA 3VZOA 4IEVA 4PCRA 1W9YA 4QGPA 4W6XA 1NA1C 3B00A 1D2DA 4W6YA 4J7ZA 3OD4A 4DR4B 1W6QB 2RS12 2ZXWC 1VP6A 1RUE2 4KGQA 4CPBA 1W9SA 3ZIXA 4OYUA 3MICA 4NIAA 5LHIA 1QJEA 1OFNA 4XETA 4BWAA 5JOXA 1TVGA 1HV1A 3ZDSA 2IH1C 4XUTA 2XHKA 3AB0A 4K6BA 2OZJA 4UFKA 5EYPB 3GYDA 2WLQA 4DK0A 2ARAA 2E5LO 2DN9A 4DR5B 5L7OB 4DR1O 1R6TA 1EY2A 3J81N 2RS52 2VTFA 1XQ8A 3MLKA 4IETA 3H1JH 3ZXLA 3O1OA 1YEWA 1HP8A 4XUOA 2WLMA 2R49A 3PUHA 4H55A 3E8FA 1FMD2 4Q4W3 2E7AA 2H6CA 1S0BA 4RS5B 3I97A 2V72A 4NHYA 3ACFA 5J37A 5LATA 1QNWA 3FFZA 3RYFB 5CYYA 1ZX3A 3CCSV 3HQXA 2KXLA 5LY2A 3HKDA 3T4DA 1G9DA 1AR1B 1ODNA 2AH2A 5F3IA 2CY6A 1CQ9A 4GKKO 5C5UA 1YIPA 4GMP3 1N0NA 4M0NA 2HWB3 5T5LA 1XDCA 3GF6A 2PUSA 2VXRA 2AREA 2MEV2 1NR1A 5L3GA 1WLDA 1BVP1 1NY71 1FI2A 2VZRA 2GHYA 1HRV1 3ZR5A 5K1PA 2OPWA 5A9GA 4DXRA 2QBXA 3U07A 1XUQA 1SC5B 2ZGLA 2DUQA 1C1FA 3WDWA 2UXDO 3HNBM 3LE0A 4OCTA 3ZO0B 1UFIA 4EN7B 4LHKA 4QGMA 3OEBA 1BMV2 3SCGA 3NJXA 3CS5A 1U12A 3CRQA 1AUYA 1RUH1 1MEC3 4GH4B 5FIXA 2VZUA 4CCLA 3SH5A 4S2GA 2QCSB 5DDJ1 4FOQA 4EWAA 1F23A 2HBTA 1W2OA 3RZKA 5EBLC 5FPZA 1KD1W 1WW5A 3STLC 4AFAA 1RUF2 2W3JA 1XMQB 4HBNA 1SPPA 4HL0A 3E97A 2A70A 1IS4A 3LIHA 1RUH2 4IGPA 2XVKA 1IBLO 3FHIB 4AG4A 4Q0PA 1W0OA 2XWBB 4HG6B 1NLQA 2JG8C 1GM8A 1SACA 4UI9L 5T50A 4JI3O 5F5CA 5C8YA 1AHSA 2A3XA 1BSMA 5DECA 2PN5A 1SG3A 4X1YA 1D5AA 4Q0QA 4YW3A 1S76D 1NCQC 3FN9A 5CNAA 2VJXA 3VZLA 2EBOA 5G05L 1PPJH 5FK7A 1KMIZ 4COYA 1JYNA 2OT5A 4UB8Z 2FDGA 2G1MA 2DQ0A 2Q69A 4KFMA 3W7XA 4DO0A 4TXWA 1IG0A 4IIJB 2RDNA 1LOGA 4TLFA 4GWMA 5J36A 4WBNB 3PDQA 3HKEB 1EN6A 1HN0A 1W3XA 1MS1A 4QB2A 3AVRA 5CA3A 4D6RA 3H1WA 2KB1A 3GXUA 2FTKA 1QEXA 1TAEA 1AXKA 5ABJB 2ZEWA 4B3TB 4A7ZA 5T5PA 4GB31 2HEWF 2RDSA 2H94A 5BR8B 1CX4A 1HN1A 4CEWC 1UWWA 2BBVA 1TGOA 4Q4Y3 1U97A 3WNNA 2R1DA 2ZABA 2V4VA 4FTBA 1GKFA 3HB3B 4B3NA 1QQP3 4DR2B 1OKQA 5IWFA 3RYHB 4OZXA 5BY5A 4MHUA 1H8TA 4B4PA 4JV4A 2JD9A 5CA1B 2QKDA 3LEKA 3ZBHA 3OB8A 3BIEA 4MTXA 4JX0A 3RZJA 3RZMA 4DUXA 1KYOF 1UOJA 3T1MA 3U1XA 3AKTA 2FL4A 3CCVV 5JI7A 2X29A 5F3CA 4N43C 1AL22 4ASUG 2P34A 3OD0A 2WS93 3LOBA 3USUA 3FBYA 5FO8B 1RTVA 5ABJC 1K5MA 4IYIA 1WB7A 1QJU1 2XG3A 3UKNA 1E5SA 4G2KA 4I3GA 5FZ4A 4UFHA 5A3WA 1GZWB 3IZOA 4X9QA 1B35B 3TXSA 1W8OA 3OTOB 2HWD1 3X2QB 4QX3A 2C0ZA 1PNGA 4FFKA 2W0XA 1VQPV 3TNQA 2XOMA 2CGNA 1KD7A 1QLNA 2AEYA 4LIUA 1ST8A 4JAVA 2WT1A 3IFXA 4YSFA 1E5IA 4NIIA 1AYN3 2HLEA 2UXCB 5T5OA 4DOUA 3VBHA 2NN4A 2FYUH 2BGCA 3TCUA 2GC2A 3MW3A 2RJKA 4FPLA 4UW3A 3WV6A 4E2GA 3IC9A 1PV0A 2QR4A 1SS3A 4YIPA 3D4KA 1Y43B 4MT8A 1AYM2 4X8NA 1ULFA 3PVBB 2BOBC 3POIA 1OCOB 4BW5A 4E9KA 3WDTA 4XIOA 4PA6A 1KKDA 1JZ5A 4DR7O 3BTYA 1UMIA 2D93A 2JJ1G 1ND3A 4GWNA 4QIWF 2JEMA 5CB4B 1K9MW 1OV9A 1WPXA 1NAEA 3BOWA 3OT7A 4IV3A 5J98B 3PUQA 3VHPA 2Q67A 4J80A 1ZYBA 4A45A 3BUCA 4GKXA 2QWNB 3CRMA 1NBMG 3MIBA 2A7AA 1V6JA 3D8CA 2QWPB 4AOCA 2LUWA 3WF0A 1US6A 1GR3A 2QQOA 3CJIB 1EZJA 1F5FA 3R65A 3E8BA 1M4WA 4Q4V3 5FYVA 5FLHA 2LS6A 5HPOA 1MSWD 3DV8A 4K7JA 4CDUA 2UXXA 1NQJA 5FY9A 1QXPA 4BXFA 2JDAA 2O8OA 3U37A 1DYPA 2WO1A 5LASA 1UZZA 5FY0A 2ZQMA 1GYKA 1EUTA 1TUBA 1Y3TA 2AUYA 3OGIB 3LSDA 1ZZBA 4JI3B 4RQPC 3DPRA 2JG8A 3K4AA 2VMHA 3KD4A 2PHUA 5FYUA 3ZEDA 3VBSA 1UW8A 1GOFA 2ZGSA 1W8TA 4DV5B 3ZN0A 2ZZJA 4DEQA 2WAOA 3M3OA 2Y6GA 4M3CE 2IUWA 1RMU3 1NX9A 4W4ZA 4ZXEA 2YEVB 1QF3A 1Z5VA 4DV2O 2W5FA 4YZ2A 3SPJA 4JYYA 4B7KA 3K2OA 1R64A 3EMRA 5DUVA 4O2BA 3WCRA 4ATEA 1DZQA 1Y76B 1BGYH 2WSSG 4CEWB 3CRCA 3TGUH 4BK4A 3ZFFC 2BNOA 1COV3 3RZGA 3OBAA 2IXIA 5LW9A 2KQXA 5LMNO 4KG8A 5B1BB 1W0KG 4JYBA 5CBLA 5K9YA 3D5OA 4LORA 4OI2A 3T1YO 2GTSA 4C90A 4DY5A 4LWSB 3IB3A 3CLPA 4GWIA 2B46X 4QKFA 5IVJA 2JXAA 1LENA 3X2QC 4YVSB 4ZS3A 3ASOC 2X0LA 3NSTA 1Q8OA 2HEPA 4UCRA 4V2VA 4U36A 2VW0A 3LUTB 4JYAB 1OSGA 4HKOA 2VULA 4UBHA 4DUZB 3C8XA 5LP6C 3CE2A 2XJVA 3J80N 4UYBA 1OMIA 1KGYA 1ENVA 5B4XA 3GCWA 4MVSA 2EILB 1GUIA 5FYTA 3L72H 4RHV3 1JXNA 5FZKA 1A3KA 1JODA 3I3DA 4J41A 1S2BA 3ZCCA 1RVF3 1M57B 2EALA 1YJLA 3ZPYA 5HXVA 4ABMA 3P6BA 1SERA 1OURA 3P30A 3RGBA 2HWE2 2ZKOA 1HB1A 5IYZB 2GZWA 4QPGA 1DF5A 4IEUA 4DV7B 1SA0B 1GU3A 4A44A 1OQ1A 1WA6X 3Q4HB 3HMYA 4TSVA 3IDAA 4GWJA 2QZ3A 3VL9A 3O0XA 3ZKUA 1PL4A 2GUZA 1W8ZA 3FB8C 3SPIA 3WQ0A 3N7MA 2PQQA 4LA2A 2MPFA 1ZVFA 1RHI3 4GX2A 5KWRA 4NIDA 1SLTA 3P3PA 3CZUA 4DRVA 1BBT1 1VF7A 4JGZA 2VWJA 3ABZA 3WCSA 1QCEA 2GMMA 3KHBA 3RQ0A 2RJ2A 4XQ4A 4IHJA 1PX3A 3OUIA 4LLFA 5JCTA 1F4AA 3M3QA 3PUAA 3F5TA 1S1AA 4YPJA 2VZ3A 2Q8CA 1OUXA 3CCQV 1HRV3 5G04L 4Q4V1 3G80A 4DV4B 3SGIA 2RDQA 4X64B 2J1SA 1NKGA 2LRPA 3N9PA 2JDZA 2VUJA 1RFYA 2P3IA 2CUGA 3VBOC 5ACA2 4ZHQA 3G4SV 3JXSA 3NNGA 1AL21 3I2OA 4IEQA 2ZX3A 1CESA 3VHNA 2VZOA 1OVSA 4Y24A 3WU2Z 5F2VO 1SHWB 5KHIA 3PN1A 2UUBO 4IW3A 4UCSA 1ASJ3 4IIJA 3RFRA 3N9OA 3WDUA 4AHCA 4CUBA 4PI0A 3J4UH 2XR4A 1GN4A 4HVOA 5DAQA 4R52A 2VZ1A 2UUAO 1XC6A 4AHWA 4U3JA 3OGCC 2OQ7A 3T2TA 3M3EA 5M0TA 5B1AC 5C8CA 3BU7A 1K73W 2R6QA 3MI8A 4XJZA 2FD8A 2ETEA 3QF7A 3ITQA 4NHLA 1FXKB 4X1YB 4IV3C 4CCKA 1DGLA 2HEYF 3V0AB 1OA2A 5A1AA 4Z92B 2WQ4A 5FZMA 1H8VA 1HNZB 4DR2O 5EIBD 2XBO2 2GN3A 2JENA 3L2HA 1O9GA 2UU9O 4FPFA 1JR9A 1PNMA 2VMIA 1NCQA 2LW8A 3I8TA 4YNIA 1AYM1 4LOTA 1PK6A 4MVRA 2QKAA 3JARA 1ZREA 4CXXA 3T2MA 5L3FA 2OT7A 4UF0A 3DECA 3BA8A 5C9AB 1XSQA 3NO8A 3RI8A 4XCAA 1VEWA 3AG1B 1KITA 1CAUA 3NW4A 5EFUA 5GZCA 3B5LB 5BNPA 4DZGA 3ML0A 5FNVA 2YS8A 2AZ0A 3BKZA 3RI9A 1NQTA 1ZBA2 5KMGA 2V09A 3POGA 2UY8A 4ZU5A 1DLBA 2BRTA 3ENRA 2Y69C 4GB33 2HP8A 5CISA 4JI7O 3AK1A 2BDRA 4X20A 2TNFA 1JMUB 1LGBA 4BIUA 3ZYGA 1IBKO 3OYWA 4O4JA 3HAGA 3ON7A 5GZGA 5JQGB 3D0SA 1LUVA 3RMXA 1M06G 3ORJA 5I0TA 1K5MC 4I55A 4YY3O 3OPTA 3RS6A 3D0JA 1O4TA 1IBLB 1O5UA 3BODA 4QDRA 4QX8A 2HLDG 1NXMA 2AZ2A 5LRSA 2WNUB 4ONUA 1C8M1 3R4DB 2PELA 4R4ZA 1O7FA 2RV9A 1D4M1 5CB7A 4FP3A 2R16A 2ADQB 3GHMA 5FY5A 5FZDA 1LHUA 3BAAA 2FDKA 1F2NA 5F1RA 1FPN1 4DR3O 1OOPB 4LR3A 4X62O 1U0AA 2BFUS 3VDBA 5A3UA 4N9IA 2YBSA 3MUZ1 1RUJ3 1UXXX 1SQFA 5FYMA 3IDBB 3ABUA 1QJY1 3KS7A 4JGYB 4KU8A 4GD4A 1TNFA 5FREA 4KQ7A 3I59B 2HKXA 5HI0A 4JTOA 1GTOA 5L7OA 4I30A 2PYJA 2FHRA 1O5LA 2AC1A 4PDWC 4DUVA 2Z69A 1Z7S1 5A7WA 2JDKA 4CCDA 5B3SB 3O65A 5F6LB 4FLXA 2EXJA 3CYOA 1PGSA 3DPRC 5JIAA 3WW3A 3K79A 5AFBA 1RUI3 5L36A 5GJ6A 4COWA 4WM8C 3NJZA 4E4SA 4LFCO 1V55B 5DQ0A 2XUMA 2Q1FA 5GW7A 3AYEA 3R0RA 3DKWA 1BHAA 1ULCA 1UQXA 5FZCA 5JMCA 1WZXA 3SCHA 3DL3A 4M0HA 1SLLA 4CDXA 5FZ1A 4LITA 5IJ0A 4P14A 4S2HA 1CZTA 1UZYA 4DV1O 4IV1C 3OGRA 3S5QA 4AI0A 1VQNV 5T5JA 1XILA 4DW1A 4FZ1A 3IGAC 1NUKA 4AR2A 4A41A 3ZMUA 2PY5A 4YJ3B 2BPA2 1B35C 2R063 3HD8B 2DJVA 1HDJA 1UOGA 1K3EA 1VRH2 4G27B 1ND3B 1FD9A 3B2EE 4ES9A 4JYCA 3RRDA 4KP4A 3OOXA 2CH7A 2PAMA 4TUYA 1W6OB 3ZYPA 4D7TA 3K5NA 2C2AA 1K42A 3CD6V 3DEMA 4QHBA 5LCWL 1OA4A 2RS32 2GNTA 4MH0E 1UMZA 1B3QA 3AZYA 2P90A 1FAFA 5EPAA 4CS3A 1EFRG 4RL7A 4NIHA 2D98A 1YI7A 5FJHA 3S0MA 1QJU3 4LF5O 4Q20A 3SNMA 5ERLA 3RYIB 2BERA 2PA7A 1UMHA 4YZ5A 2RM23 3HKBA 1IX9A 1N36O 2YG0A 5FBZA 1BHBA 5IYDO 3FKSG 4L97A 5J09A 1QHDA 2XHNA 2LO1A 3OM3B 2WT0A 4QM9A 1N32O 3HJRA 1Z7S2 4N8MA 2R072 5FXZA 4FPJA 5FZGA 1J58A 3EO6A 2BWCA 4GYCB 3GJAA 1D2QA 4BCUA 2D5FA 2XLAA 5JWPA 4H3WA 1JTZX 4W4KA 2A6VA 3E6CC 5LRRA 1Y4WA 3IBMA 1CPNA 1Y6XA 3SC7X 2WAMA 4EN8B 2A1XA 4B3RB 5C71A 3WB2A 2VH9A 4ARYA 1YFUA 3WNPA 1RB8G 4JDOA 1DHKB 4BQYA 4J10A 5FPRA 4MVZA 4MTFA 1XE7A 3OCPA 2ZE6A 2ZR3A 3GM8A 3SR2C 4IV1B 1YWKA 3WEZA 3ICXA 2E26A 2ZEYA 4PIZA 4AQ6A 1NTZH 4HKLA 2OXBA 3T4VA 4R7CA 4M4PA 3OBTA 2ZKLA 2ZIOA 1HRI2 4E4HA 4AFBA 2HWE3 3RYRA 1VRH1 3CP1A 1DLCA 2JIJA 3KF5A 1R1BA 4CUGA 1CWPA 3M2MA 3DC5A 4C1XA 4X6RB 1JZ2A 4MXWB 1LRHA 1RXGA 2XBO1 5JZGB 2ZIMA 1CP9A 2RDRA 3MFAA 1A78A 1VJ2A 1GK9A 2OTLV 3ZFEA 1GZCA 3BIWE 1JOYA 5IYYA 2ZE5A 3MIEA 1SQBH 5I8YA 4JDMA 4XJWA 3WVJA 4UFZA 1NR7A 4X1IB 2FKXA 5C8YB 4HN0A 4AEDC 2XPJA 4YVWA 5FO9B 1QGLA 1YTFD 2B1IA 3NKTA 3ACHA 5JSPA 1RINA 3POFA 2EIEA 4JRAA 3N2GB 3J8F3 1QIQA 4LBQB 4LUKA 4OMCA 1VAKA 2VRZA 3T0AA 4BMBA 2ADEA 1C4RA 1M90W 3WR0A 2B7YA 1AL0G 1LHVA 4QPIC 4FFGA 4GIQA 1YLLA 2VUCA 5FZOB 1GANA 2ARHA 5EV7A 4FI9A 4F83A 5KX5B 4B1LA 4JGZB 5FYBA 1S4CA 3FYIB 3K08A 3JASB 1K12A 3J8F1 4BIZA 4JV5B 5FY8A 1DK1A 4IEOA 2B9VA 1OPOA 1V6IA 3IM0A 5H9SA 3ZM8A 3AL5A 3OGSA 2F6BA 2JDNA 4RQEA 1V9U1 4HK9A 2AHYA 1OHHG 1RPOA 2Y34A 1OHFA 1G9BA 4TV8B 4JYAO 4AE2A 5BNOC 2EZOA 1H8HG 2JECA 1QJY3 4Y5TA 4MUVA 2W1SA 3NNMA 3SH3A 4LBJA 1S0CA 1W8NA 1XBFA 2EZPA 3ZVXA 3ACGA 2A6XA 2DF7A 1N3QA 2EIMC 1G6UA 1DGWA 4GX0A 4PHZA 1NYWA 2Q30A 2QUOA 1C3HA 1T6GC 1JUHA 5CG8A 3B69A 4AAXA 1M9NA 4I7ZB 4Q8KA 2IBZH 4CS2A 5C4WA 1LULA 1YDXA 1W6PB 3VOUA 3CCUV 2O1QA 4XUPA 2VCBA 4Q1PA 4Q4V2 3N4MA 2IJHA 4J1XA 4Y3OA 3ZFGA 4RS5A 4AQSA 2WO7A 3M4FA 1IQAA 1HB2A 1K5MB 4Q0VA 1MZ5A 3QTCA 3NR7A 3O1SA 4LO8A 3SYAA 2EILC 3NJYA 4NR1A 3WUDA 1J95A 2CYFA 4LNVA 4MSVA 2RM22 5KHGA 4B4QA 2R9RB 1UYPA 1FNZA 1HLCA 1KJLA 2Y0OA 2WLIB 1XU1A 4KMQA 2CDPA 2DYCA 1STMA 2JJ2G 5GONA 4B08A 1PHMA 3K9SA 4HFSA 5J7MA 3I2GA 2IXKA 4YM1A 1SZXA 2YHJA 4J6GA 2K0GA 3ROUA 3JBG3 4K1ZA 4WVMB 2XH6A 2G4IA 3AMNA 3OF1A 2VNRA 4RA0A 2WLLA 2VQ0A 4UVBA 3H1YA 3UKVA 4FTSA 1PO22 3L71H 4WM7B 4AW7A 4O4IA 2YROA 4H37A 2JIZG 3AKSA 4JDNA 3F7VC 1SBDA 1FJGO 5JOYA 1YCIA 3AMQA 1SCSA 2V1DA 2NPIA 2CTPA 4HANA 1AYM3 4UAPA 2VVFA 2P6HA 4A42A 3AG3B 4JZRA 1IGOA 3LZZA 3PIJA 4HK8A 1ZWIC 3TEWA 4DR1B 2W95A 5D8AC 5JJJB 1AYN2 3VQWA 4FVVA 4R9DA 1XL4A 4QX0A 4FT8A 2PLV3 4XZUG 3RN4A 5IVCA 3OSDA 1T2XA 4EB6A 2ZGTA 2PF4E 4IYHA 5GALA 3S7EA 1H8TC 3THDA 4H2AA 4HAMA 2OX0A 2JWPA 2YZ4A 2XXZA 4H33A 4EROA 4YZ1A 2A9HA 4NWWA 2ZCWA 1RSOB 3THCA 3CRRA 3A2FA 4XTMA 2WLJA 1HKDA 2QQIA 3OMIB 4FP2A 5FYZA 4ZY9A 4U3FH 2Z2SB 5F5QA 5LMNB 3OY8A 4YG0A 1I08A 1W6NB 1J5EO 2Y6LA 1WCUA 4E27A 4C91A 5FWJA 4BWOA 1DZTA 2RHPA 2VY0A 3KKYA 1JU4A 2JE8A 1Z78A 2B5UA 2BBAA 1JJ2U 4O4JB 4B1MA 2NZ9A 3J7HA 5L3BA 2PHRA 2ZX1A 1NU1H 2P6CA 2CE4A 1DZRA 4NXMO 3TN93 3VQXA 3CX5F 1AROP 1ZAUA 3AXEA 3O12A 2JG9C 1PMIA 1I1EA 4AFDA 2LFSA 3CCLV 3L75H 3B9IA 2H3OA 4UCVA 1OLMA 1LECA 3IKWA 1Z7S3 1AR63 3ABKB 2EIBA 4NTWA 1JX9A 5AFEA 1YQ6A 2F43G 4CEYC 3ZFGC 2SBAA 5A80A 3I2FA 1GWMA 5B1BC 3BU0A 4WF9V 5KUMA 3VUOA 3CEWA 4NYKA 3ZN4A 1NLRA 1ULOA 4CEWA 4DR7B 2EA7A 1S0IA 1OT5A 5CFDB 1S0VA 2VVEA 4YW7A 4HLTA 1ZBA3 4MOAA 4J7JA 5BNOB 3BHPA 1DYOA 2P22C 5CZKA 1VF6C 3RDIA 4HNAB 3ZRSA 2ZHKA 4M3CB 3N2KA 3OGGA 1JOPA 4LBOA 1LKNA 1D0GA 1WW7A 4A2UA 4UXAA 3ZHTA 3AMMA 3CMGA 3I3EA 1DDLA 1QJX2 3NNLA 5C3QA 2XOKG 2D3SA 2YV8A 1WMDA 5FZHA 1LAJA 4CDXC 1JI6A 3TETA 1WMXA 1ZZCA 5FRAA 1BLZA 3AC0A 3D3IA 2J22A 4MVOA 5F8PA 3ZMOA 5IK8A 2Q7EA 4YVSC 1XNCA 1XPWA 2XJUA 4BZ4A 4XW3A 2GN7A 1XEQA 5FZ7A 3JD71 2EXHA 3JD0A 3JD73 4QX5A 2QQPA 3VBUC 3SHRA 3ZS8C 1YF2A 1GQGA 1KXGA 4OI4A 1FT9A 2TEPA 2W91A 3DGTA 3JSNA 3VBHC 3ZXDA 3D36C 1IZ3A 1EZVH 3ES1A 1G9CA 3I3BA 5LHGA 4LFCB 4LF6B 2GSYA 4XUQA 3CC4V 5F3EA 5FYSA 4OZOA 3LDDA 5C5TA 3GB7C 3VBUB 4O2AB 5L3DA 2J1AA 3MUY1 1ZM1A 3ZXAC 3GBFA 3T4ZA 1K4DC 3RW0A 2ENRA 4AVVA 3CWBH 2DMXA 2PLV2 2VGDA 2LM3A 4URAA 5GZDA 3RWKX 3WG7C 5FXVA 1ZBE1 1Q8IA 3B02A 2WZ8A 2D7FA 4BPZA 1JYCA 1H8EG 2ZACA 3H7JA 1ZRFA 5FMBA 3EJKA 4N43A 1R1ZA 1NG0A 4ZU4A 1ROPA 1LJ7A 3OY8B 4WZFA 5EYPA 1YVWA 5FZLA 2VUAA 3APBA 2HEVF 2OIEA 4FZ0A 1AZDA 1UYZA 3WINE 2VECA 1E1RG 5IYZA 3K58A 5LA9A 5JZGA 1SDWA 4LBKA 5GLWA 3ZHQA 3JAMN 2WZR1 2RR11 1IKPA 4FXGB 1YJKA 3CC7V 1QJX1 4WZCA 3VDCA 1I94B 2DDUA 2QM4A 1VBE2 2R041 5FXXA 3LWCA 4XOGA 2ZHLA 2Y6JA 2QWRB 4DR6O 1QNMA 2CH7B 2X5IC 4YJ3A 5FQ0B 3K04A 2GDSA 2VCAA 1PO21 1S72V 4ZBMA 2HYKA 4NN0A 5BNNA 2NN8A 3JD3A 2WZR2 1QU0A 1ZBE2 3AXDA 5E1AC 3BTAA 5F32A 5F3GA 2ZMLA 4E8CA 1MZ6A 2D6MA 1K34A 4AF9A 3M8LA 4IDZA 4CPBD 4A6OA 4YLZA 2XVLA 1CGPA 1AR72 5FZAA 4RR3A 3MDPA 1WLWA 4MGTA 5KXEA 4Y1UA 1RP3B 3MV11 3WDVA 4XJAA 1OCCC 2VQEO 3IAPA 1PK6B 4Q6GA 4RR3B 4E8DA 1UD1A 2I2SA 1MNGA 5A3NA 4QB1A 1Q81W 2ZR2A 3DSQA 5A6ZA 3A23A 3VBSC 3BFRA 1UYXA 1YJWV 3TB0A 1HX6A 4QHZA 1PVC3 3TN91 4LO7A 2UXBO 2IU0A 1TZOA 1Q56A 1PO23 3FAVB 2DYRB 1SBEA 2OKXA 1Q8PA 1AVMA 4M3CF 5GZEA 1P7GA 4RUEA 3UL2A 5FZ6A 1MVEA 2XTAA 1BMV1 2R70A 3S3WA 2ZGKA 3FUOA 3ZR6A 4GKKB 3WB0A 1O3QA 4QPGB 5FY4A 4QHOA 4DPNA 2BNMA 2RMU3 2ID4A 4LF7O 1X50A 3NNJA 1OFSA 2D6OX 2P5OA 5FUIA 4ZI7A 5DN2A 2KG7B 3S3XA 1RMU2 3PMEA 5JH7A 4WFAV 2PI5A 1W9FA 3ZXEA 4L8QA 3OMNB 4H7LA 4XMAA 2N74A 3IMNA 2CNAA 3NVCA 1JZ6A 3QO5A 3AEIA 4K0KB 1YXWA 1V6LA 4JI6O 2CTVA 4CZSA 4CDWC 5A7WB 3AG7A 2Q0AA 2ZGOA 4XC9A 1SF9A 1ND2C 5C93A 4IE7A 1XOUA 2Z5UA 1W8FA 4MX3A 3O1UA 1TEIA 3LCPA 1KU9A 2P3KA 1FOD3 1FOD1 4LF9B 1ZZ8A 1IDSA 1L0NH 1QKQA 5D8AB 3FB6C 5LK5A 4FFBB 2JEXA 4LHLA 3TEZA 2BWAA 3PL0A 3QG5A 1PIV1 2JB8A 2ZKNA 4LKSA 2WZEA 1QJY2 4A4AA 4LFBB 4OLLA 1W59A 1SFPA 3QCWA 4PBPA 2Y60A 2ZX0A 3PJSK 5FZOA 4R8HA 3V0BB 2BTVC 3KT1A 5L19A 1W39A 1R1A2 2CHHA 1XNQB 3FX7A 3VN4A 3WZ1A 2QQLA 2VBDA 1I6XA 1ZBA1 2XB6C 4WCEV 4N53B 1SKVA 1GWKA 3ASIA 4EQVA 1M56C 1FFTB 3I2KA 2B9ZA 5F2SA 1LHNA 1P7BA 5IHRA 3FLPA 2QTSA 4QXKA 2FMLA 5FMCA 1E5RA 4FFIA 1HWYA 1XOYA 2N05A 2DVDA 5J96B 2GDFA 1GMGA 3SPHA 1V9U3 1R081 5JUVA 1NH2D 2WPDG 1FOD2 5CKMA 4UWDA 4X65B 1M4UA 4CEYB 2YBKA 5BNOA 3BTZA 2F93B 3ZHSA 3EYPA 1WB8A 4GZ9A 1J83A 1DQ5A 1W0NA 3NV1A 4IESA 4FPCA 3CU7A 3MF6A 1REFA 4Q4X3 3HOBA 3W9AA 5IE9A 1DU3D 1U5ZA 4FFBA 2ZOEB 2NMNA 1SLCA 4MGQA 1LCLA 4AVSA 1VQMV 1DGRN 2Y0IA 3H1KH 4Q0SA 4DV5O 3RZLA 3JD2A 4IHJB 4XJ9A 5K0UB 3GHNA 2B4KA 4HPKA 4DXZA 3TBDA 1POV0 2XONA 1M5IA 4RAIA 3PVEA 4Q1RA 4COUA 4CCCA 5AC91 1ONAA 2GC3A 2JDUA 3A22A 4ZKIA 4MZUA 2YXLA 1RUH3 4QJFB 4OUMA 2UWAA 1NKDA 3UT0A 4CCMA 2NMOA 4PLOA 2CAZC 1AX0A 2BSKB 2HWD2 4I09A 2A7WA 3P1IA 2VMEA 4DXTA 3LEMA 3A8TA 3C7EA 5DAPA 1UZWA 1IG3A 3N2KB 2DVAA 2D3PA 3PTRB 2EXIA 3ZFEC 2Y8KA 4FPOB 4JGYC 3THPA 1VBC3 4LF5B 2LW1A 1NA1A 3TEYA 1NA1B 3VBRA 1QJX3 1SQXH 2YUAA 3H8OA 2GH2A 5KXCA 5FYIA 1QHTA 4JV5O 4MVQA 4LULA 4RGGA 2FB5A 4Z2WA 2G9ZA 2JDIG 2R073 3CPWU 2CTRA 4B29A 1W06A 5A1LA 2HG5C 3WP3A 4Y5SA 1VQ5V 2ZHNA 5IWAO 4GKYA 2Q5ZA 1H1MA 3WNOA 3ASNC 4CC5A 1GQPA 4S2DA 1DF4A 2XMLA 1H9WA 2DTWA 1QDOA 1ZZ6A 3S7IA 4DV3B 4GJYA 3AG4B 2RS31 5KAFZ 1LESA 3WXPA 4C1WA 2RMU2 4HMZA 4MADA 4XHBA 4GJZA 1C8M3 3ZPOA 2BVVA 4NRMA 1Q86W 5A3LA 1Y9QA 3IJ4A 1OVPA 3BA9A 3GJBA 4HOOA 1HR0B 2YMZA 1VQOV 2W92A 1BT8A 1XBLA 3JATA 2DYSB 3THOA 1ULDA 2EAKA 2LW7A 3B01A 1RUD2 5LMUO 4UW5A 1W8HA 3UESA 1H38A 2B8MA 4PLNA 3PIGA 4P9XA 2BP6A 4G3YC 2ADPA 1NT0A 2WLNA 3AK2A 3HPNA 3ZFFB 3ZLIA 4MYEA 1XL6A 2CSGA 4F6RA 4E2SA 3B9CA 3VZNA 3E6BA 1BMFG 2VNGA 1LNQA 2DFCA 1XB9A 3BALA 4IERA 1TME3 4EV0A 1FPOA 3AFKA 1B04A 4XF4A 2ZX2A 5KUKA 3AJZA 5FP3A 1Q6UA 2YC0A 1CZVA 2WKKA 1I5XA 3GWKC 5DZEA 4IEPA 5J1XA 3DYPA 2IJJA 3B93A 1LGCA 3OUFA 4CP0A 2VUDA 4OVEA 3CCRV 1K3IA 1TMF1 3OPWA 3T4HB 2LGWA 4ARXA 4TV9A 1G7YA 1G9AA 4BISA 1N34B 2JE9A 3LDKA 1EN4A 1AL23 2GV9A 3L70H 4GULA 4YW5A 3V0BA 3NAPC 4YHHB 1JS9A 4AEJA 1N33O 2EXKA 3MF9A 2JDYA 3O0WA 4AI3A 3ZMSA 4I2OA 3CJXA 1SQPH 4H0LB 1N47A 2HWF2 2IXLA 3B40A 1VF6A 3ZX6A 5L3CA 2QQWA 1ZUQA 3AVSA 4JQRA 4I50A 1S2KA 3F95A 1AR61 1S5JA 5GONB 3CCJV 1N3OA 2UXCO 2VZTA 1F4MA 2XUEA 4JVAA 4FQZA 3VZJA 2JS3A 3RZZA 4HVQA 4ZZ8A 1QMJA 4XAEA 1P49A 2VTXA 1AVBA 5IJ9A 2XL9A 1W2AX 3QD6A 2DCZA 5DG2A 2A73B 3NV4A 4HYOA 4O4IB 3JBG2 3SKJE 3GZEA 4JI8O 4IQPA 4MV2A 1CPYA 5FPOA 4QPYA 1ENXA 4XF9A 5T52A 5LXTB 1S0GA 1EV13 4R9BA 3HWJA 1TUBB 1U5XA 2OA2A 4NHMA 4RGKA 1DYKA 4CXYA 4DUZO 2WLHA 3H7YA 5BNQA 1F51A 1NOVA 2XJRA 1AJKA 3ZRWA 4CZZA 3PNAA 4NMIA 3PTYA 2VTXJ 1YUDA 5LL6Y 1BEV1 2CL2A 2PHXA 1GN3A 4F8AA 3KT7A 5CA0B 2IM9A 2NLJC 5A32A 5FUPA 1JH5A 3RYIA 3FFQA 3OE7G 4XCBA 2VQFB 2C5DA 2ZX4A 1WCDJ 2R043 2LP7A 3WG4A 2WAAA 4I0XA 4MXWA 3NV3A 1D4M2 1O9HA 4AQ2A 1OCRC 3ZYJB 2EIGA 3A21A 1ENQA 4XDOA 4EB6B 1HRV2 1SDDB 4BH9A 3H0OA 4X62B 1NZ6A 2XT9A 1ENRA 1DQ1A 3QH6A 2FDHA 3GNEA 1DTOA 2F1MA 2BGPA 5JXJA 4U3JB 2KSDA 1DBNA 1G8MA 3POEA 3JBG1 3LOIA 4WFEA 4JTAB 4WVWA 2LGQA 2Q68A 1H4HA 3W21A 3DYOA 1RL3A 3KM5A 1K45A 5APAA 1POQA 1XJAA 3CZJA 3ZMNA 1Q82W 2W6IG 2JJ6A 4FPKA 2G38A 3S30A 3ZDVA 2WNOA 2C9AA 4B4RA 1IXBA 5I0RA 4N7UA 5LMUB 1QQCA 1POV3 4U2AA 2EICA 2OPKA 1R1A1 1GH6A 4AVTA 5ITZA 4URTA 2IW5A 3VZMA 5A6QA 2IC1A 1VLNA 2JDHA 2VOTA 3HQRA 4OXSA 5D8AA 1S5HC 2YBPA 2PHFA 1IBMB 1WUVA 2SLIA 3ABTA 4QMAA 2YB7A 3MW2A 2G9GA 3SXWA 1CAXB 3POWA 5FP8A 1UX6A 4QXHA 3ZN6B 1RMU1 1VF5B 3ZHVA 2VCCA 4UBGA 5B1AB 4EFEA 5BXZA 4E4ZA 2GAUA 2VOKA 4OHZA 1W0JG 1GSLA 4XUNA 4CDUC 4Y26A 2FCVA 3VD3A 1FKAO 2AGSA 4UXNA 3Q4HA 1G8WA 3J8F2 4SLIA 2PZSA 1GNHA 4O4LA 3ZSJA 5A33B 2IZWA 1FMD3 1R6NA 3K5MA 3N9NA 1OPMA 4JRLA 4YVWB 4Y4YA 3K3WA 4YARA 4TQFA 4JQTA 4RO2A 2GC1A 2K9ZA 2JICA 2QGNA 1V55C 3M99B 4IXLA 4IUGA 4XQWA 1KQRA 3TAYA 4AQTA 2W39A 2WNUA 3VL8A 3KVBA 4BYYA 2X5IA 2F4LA 2VZQA 5FKCA 3WP5A 1GRJA 4LBEC 4QKNA 2DTYA 2YC4A 4FOYA 1OA3A 3WDXA 1O3TA 3OEAA 1YFYA 1C1LA 4Y1VA 1VMJA 4UCUA 2ILMA 1IXMA 2MHFA 3UJOA 1BXHA 4EWEA 4PDLA 1YO8A 2VWKA 1WBLA 1GP6A 4FLUA 4X20B 5LYJA 4FLYA 1YI2V 2ZTNA 4AAPA 1RC6A 2EF6A 1O6UA 4OGQB 1N36B 4B3MO 2VG9A 4GQ7A 1XXNA 1JYWA 4YXWG 4OHVA 1Q90D 2QQKA 2R1BA 1N1VA 2KM2A 1OF3A 3H1MA 1YNAA 4Q27A 3EB7A 5LOVB 4AHZA 1F5JA 2WSVA 3OUHA 3P32A 4J25A 4V2WA 4RHV2 3EXAA 2WT2A 4BQXA 1IURA 3GVMA 3W7WA 4UV8A 2QM7A 3KGZA 4D6TH 1GFF2 4MHRA 1G1XB 4E4DX 4CVUA 2E75B 3WSOA 1JOJA 5A7OA 3TWIA 4XZPA 1SETA 4WFGA 5AVPA 3I2DA 3R05A 4ZXKA 4K20A 2N7GA 5IAXA 1WP7A 4LO4B 5I93A 3E2EA 4DR3B 1NTKH 5BXXA 1BQPA 2JG9A 2QQVA 3DCQA 3OG2A 4AVAA 4LBMA 5LYJB 4H13B 3I5DA 1VBB2 1ZLZA 2M6YA 2Z5WA 1SLBA 1G6NA 2YFUA 4BQ4A 2VS0A 4IE5A 3WF1A 2VZSA 3SH4A 5KLVH 3S57A 3ABMB 2ES3A 2A3YA 4CDQC 2PYTA 2TBVA 4FO9A 4M3CA 1CN1A 2Q1ZB 4NAMA 4QXBA 5H6QA 3MBWA 4GKJO 4QPIB 1W99A 4OHYA 4QQLA 1TMF3 3I2HA 1W9TA 1Q8VA 5SV5A 4WFBV 4AI8A 2Y26A 3LIGA 2NLRA 4LKDA 2XWJB 3KT4A 3EQEA 1YQ8A 2DVFA 1J59A 1E57A 3IN9A 3H50A 3VDDA 4UCTA 2MEV1 2BU9A 5GZFA 1L7QA 4P08A 1SFNA 2V7QG 3AP5A 1PO13 2E53A 1Y66A 3ILFA 5D5PA 1URXA 4CDXB 2BOIA 5KHHA 3EHKA 3E5UA 1AR4A 4IV3B 4LBQD 3TJTA 5JR2A 4KHPO 4X6QB 5BMVB 4KBBA 2WYSA 1I5YA 3DXRB 4DV0O 1D5NA 2IFRA 4NXNO 1NZCA 1VAVA 2YUEA 4KUMA 3ETQA 1FATA 3VHRA 5B1OA 3OTOO 2WS91 4Y20B 3TOJA 5C3RA 4AEKA 3WG7B 1K5QA 4I4TA 4ASKA 5ACA1 1MQTA 1TA8A 2YIAA 4N7IA 4XQDA 5JI9A 4FTEA 3FD9A 2F23A 4MVUA 1GQHA 4HZFA 5EBWC 2EINB 2WC2A 1RUI2 2QA4V 1CAVA 2DVBA 3QH7A 1KECA 3CSXA 3K46A 2ITDC 5C9AA 1UXZA 5FL7G 2YC2A 4DUYB 1AJOA 3ALQA 5E1RA 1GM9A 3ETDA 2ZGUA 4PLMA 3SYOA 1V6MA 3VBRB 1RUG2 3ABLB 3ZN5A 2RN9A 5JVDA 5IATA 4QE7A 3FJSA 2QFEA 2IVJA 2B42B 5CFCA 2Q5TA 1FXZA 1YJ9V 3JARB 3E8GA 4C0BA 5LBFA 5FZIA 5C70A 1VBB1 4FBFA 4UVAA 1XI1A 2IXHA 4PELA 1A8MA 3ST7A 2Q73A 3FLTA 4YG6A 5BNNC 5LA6B 5FFOC 1J5EB 1W90A 2XQRA 2A79B 5KAIZ 4QKBA 5DN6G 3POSA 1WMEA 2Q7HA 2X05A 2P4KA 2BTQB 3E22A 3ZSMA 1RUE1 4P5HA 4EN0A 1JYTA 2ZCEA 4YVSA 4CH4A 3I56V 2VMFA 4PF5A 2WUHA 3LSEA 4XJUA 1I7FA 1SCRA 1DQ0A 5EK0A 4XBLA 3ZSEA 1OQEA 4WFFA 1BKZA 5JOWA 4QPKA 1COWG 1VALA 3A0NA 3ES4A 1SLIA 3THTA 4PDMA 1O8SA 2Y4TA 5AC93 4HXCA 1DQ4A 2VO5A 1AR81 3ETPA 2WFF1 4DV6B 1XMQO 1RUD1 3UQ8A 3LNMB 3JD72 2UXBB 2X6CA 2X6BA 2JKBA 4XDQA 3JU9A 2D3OW 4CU9A 1OF4A 2IWGB 3AX4A 3D82A 4HZ3A 2E51A 3ILNA 3HR0A 1UY1A 5AVAA 2E3CA 1PZ8A 1QXJA 1W2TA 1AX1A 2BOCC 4FOVA 3VGIA 2Y4UA 3RJRA 4K8XA 1UIJA 2OQ6A 3SJAC 4XF3A 3VV1A 2GUZB 4NTXA 4XURA 5T55A 4YHHO 1RUOA 2E7QA 2ET7A 4K8ZA 2V73A 4COVA 5JAXA 3JALB 4QQHA 2CTWA 4FPPA 2ZMKA 3W5MA 5B3SC 4YZ4A 4FVMA 1W03A 5HV4A 1HNWB 1OCZC 1D4M3 2XNDG 3T1LA 4XDPA 5LBBA 3AJYA 5I0DA 1EM1A 2Q7GA 4LMFA 1SEFA 5AC92 5GTIZ 1WKYA 1ASJ2 2QKCA 4DXWA 4AQYB 4LF4O 1UY2A 3JQXA 4OX9B 1CAWA 2FZ1A 3MLLA 1Y74A 1ZBE3 4R4XA 1N8RW 1Q3EA 2UU9B 3T1HO 3AL6A 2IJKA 1WW4A 4LQRA 2GP5A 4LH7A 4I0AA 4W65A 1F7YA 5T3NA 1A8DA 2YYOA 1E1QG 1MACA 2P3YA 3INAA 1X9TA 3AYCA 3ZRVA 2DU1A 3RG0A 3WUCA 1MS3A 1KDKA 3IAQA 3UM7A 2OS2A 4XFBA 3WDYA 5JMOA 2Y48A 1U96A 3B4SA 3BCWA 5FBJA 1H30A 4MVTA 4GZRB 2RDCA 3JZVA 4JHZA 1GOHA 3NAPA 2DWDC 4XTPA 5DZFA 5LEKA 1N0JA 4P30A 1UCXA 2F4VB 1R73A 3ACLA 2WLLB 1ZRIA 3K51A 2VXJA 3HNYM 1B09A 4IE4A 1RM1B 4GALA 2Y38A 4GXLA 4FM0A 5J9PC 3C3TA 1UJWB 4R6ZA 2HWF3 1S55A 4RFT0 2HWC3 3ME2A 1H2LA 2YEVA 2V5DA 2A6YA 4PIYA 3LEIA 3OPZA 3NJVA 3DTUB 2ZEZA 3G6EV 3K3OA 3AG1C 4IE6A 3MD0A 1PGW2 2P4EA 2MW2B 3AP7A 3USUB 1GO3F 1CAWB 2F66C 5LZ6A 3T0BA 4J7KA 1MPXA 5DAWA 4FMTA 5EC2C 4N23A 3UGHA 3NRUA 2P3JA 5CG9A 1LOFA 2Z0AA 4PV1B 2W94A 3K4DA 4LWSA 2P7TC 4X8AA 4GLXA 1NVPB 4EEQA 3AMPA 2YI9A 3O1VA 1DGSA 2R0FA 1SZBA 4F6RB 1BEV3 3K59A 3R4SA 1YQCA 3W20A 1UPIA 1WW6A 1AR83 3W7UA 1WPBA 4PDWA 1GM7A 2RR13 2WWJA 3POJA 4H7MA 3SPGA 4XFHA 2OUHA 2OCHA 3ZN6A 4OQ9A 5JLVA 4L11A 4XF0A 5J2UA 3MHZA 4P2ZA 2QZ2A 5I0UA 5JXIA 1GN2A 4YW6A 1DF0A 3Q8AA 2DW4A 2XBO3 3RPQA 1L7RA 4CCJA 3RWRD 1QJFA 4WM8B 1BYHA 3KSCA 2ATFA 4XFGA 5LP6A 1Q6IA 5LK7B 5J2UB 1MVQA 4NUBA 2JEUA 1BS3A 2XLGA 1RUE3 2GNBA 1H2MA 2VMDA 5A7PA 5BY1A 1GMMA 3V65A 1WLEA 4PT6A 1OCCB 1VQLV 1WCQA 4KBZA 4J9ZB 3VKLA 2QQJA 4MW3A 1V0AA 4IEYA 3ZMVA 1JQ0A 5C3OA 3B09A 5KHJA 4G9SB 3ZMTA 5LB6A 3LAGA 1W2BU 2F4VO 4BLJA 1CONA 2DYSC 2WDBA 4GA9A 1I5PA 1LHOA 3WHTA 4GB32 1RSOA 5JCOA 4GX5A 4DEVA 4D8MA 3M70A 1K5JA 3ATGA 3FBMA 4ZIBA 1JW6A 2E32A 1LEMA 2GMPA 5C3PA 2ZAAA 3LDBA 1IBKB 3CMEV 5I8TA 4CEYA 2A0LA 1XYNA 4JI6B 1APNA 2WNVA 1MS5A 5DAXA 3ZSKA 1DG6A 4NRPA 4WV8A 2XJSA 4HSLA 3FZ3A 4AQYO 4GH4A 2HYXA 1SQ4A 4B7EA 5GLVA 3RT3C 4JHTA 4XFIA 4DK1A 2QSAA 5E16A 5HXMA 1QLEC 3H01A 1VBC2 4META 2LTNA 1F35A 3MLJA 3UCSC 5I8SA 5K8SA 3G7DA 2UXNA 1V00A 2RJLA 1KJRA 1KB9F 4OHXA 1PM4A 1W2NA 4BMEA 5LEJA 3VDAA 1OKOA 5H2FZ 1XQNA 3B77A 4CSWA 1X33A 3G67A 3MDSA 2BYVE 5C4WC 3R66A 2WRAA 5EC1C 1K5SA 1RUC2 4UFLA 2X7RB 2VZPA 3NL1A 4JTCB 5JJNB 1NI8A 3SJCC 3CCMV 4PI2A 1XSRA 4F7ZA 3UGFA 2WNVC 3GZTB 3RVYA 4SBVA 4LOSA 3LPGA 4YG3A 3T0DA 1P84F 3TNPB 4PF1A 4XBNA 2X09A 4EYUA 4O9GA 1O59A 1ZX5A 1MG1A 2UUCB 5B4NA 1WA8B 2J1VA 5IDJA 2K46A 1V6OA 5E6HA 1W8UA 1LOFC 5TISZ 5CFDA 2ZM6B 1WLCA 5FMOL 3D6EA 1BE3H 2R071 2BOJA 1FXVA 2HR3A 2N04A 3VBFB 3AZZA 5JH7B 2AENA 3IDCB 1MS4A 4P9LA 1OJHA 4C0HA 3ZXJA 5L73A 1F9KA 3Q8EA 3KV6A 4AGVA 5C9AC 5FP9A 3CO2A 5CA0A 1YHQV 3UK9A 1KDMA 3ZFEB 3RYHA 1N1YA 3H8UA 1YRZA 1RJ8A 3MPPG 3VBFA 1VQ7V 3K06A 5L9VA 2IJIA 1QOOA 1XYOA 2GC0A 4I55B 5DG1A 4NB5A 1UIKA 3HNMA 2WLKA 2YGLA 1K97A 2AYHA 1Z2GA 3SDLA 4M01A 3ZYHA 5FYYA 5CKNA 4BJ0A 3IAYA 5KXBA 5CBFA 5F37A 3POBA 4TUYB 2FDIA 3K4ZA 4BXSV 1KUQA 1RUJ1 2RS51 5IT6A 4QB6A 1OH3A 4LBNA 3EHBB 4I0WB 1SMVA 3E5QA 3LDEA 4FM2A 1UZVA 2KA3A 2WINB 4PDVA 4K35A 4JKLA 4IEWA 5L9BA 5FR3A 1MA1A 2XJPA 3FUQA 1C28A 3K57A 1WCSA 2H8PC 4NRQA 5A2QN 4FOWA 3HKBB 2CV6A 2VQTA 3HIFA 5FZFA 5K0UA 2PAKA 1HW7A 4BIOA 4ASLA 4KU7A 1RUC1 3UGGA 2YIDA 5A70A 1BL8A 4IGOA 2BW8A 4BQ5A 1OOPC 4CC6A 4Q4X1 4LXLA 2FMYA 4XABA 4A7KA 1R3LC 4HVRA 4WFHA 3O1PA 4PD4F 2BUKA 3MIFA 2KKWA 3KVAA 1EAH1 4LNUB 1UF2C 2ARCA 1L3JA 1PO12 2HBUA 3KLSA 2WNUC 2WJSA 2Y6HA 1D4VB 2Q1MA 3ZYFA 2ZGRA 4XDKA 1HR0O 2B5HA 3FHAA 3H9AA 1NXD1 1QJU2 4NROA 2PAEA 1BZWA 1EV12 1NE4A 1ULPA 1RM1C 3PVNA 2PHTA 2LJ2A 1VARA 5C8WA 3AZXA 2RS33 5IJRA 4XE9A 3O0VA 3CCEV 1CX1A 2ADDA 4MS2A 5DXDA 1R092 2JG9B 5IAVA 1RVF1 1JZ3A 3CC2V 3OFNG 1VQ4V 3C3SA 1PVC2 1GLHA 1US2A 3AG4C 2VQFO 1TNRA 4P9IA 5BZBA 4DIQA 1FJGB 4R9AA 4K21A 2R9AA 4OPHA 1RUF1 4TLGA 2R062 2GALA 2NYYA 4EN6B 1JFFA 5DMYA 3PHMA 3NMBA 3N7LA 1M57C 3V56A 2FDFA 5LGUA 4O2AA 2YXSA 4AI9A 1FV2A 2L6LA 5FJKA 2EX3A 1POV1 2A6ZA 4ZU7A 3E35A 3BB6A 2OIGA 2DQ3A 4JI2B 3MHSC 4D6SA 4IL6Z 5KX5A 3AP9A 5EZYB 2Q4SA 1ZL8A 1FNYA 3ABLC 4Y1YA 4FM1A 2MEV3 5GLZA 4M4RA 2UYBA 2XAGA 4UUJC 1TVKB 2D6PA 3ETGA 5FUNA 1T6BX 4JF3A 1BZKA 1CR7A 1X7NA 1NS1A 3WW1A 5JPMB 1B6QA 2HJFC 2GU9A 4TV9B 1YFXA 1COV1 5TSWA 3ASOB 1O3SA 3JALA 3LF7A 3DKQA 2CTQA 4KWUA 1OC1A 3A0HZ 1JOBA 3IIAA 4FLZA 5H9RA 3UO3A 2LALA 1XE0A 1S5LZ 1HXS3 4ZHNA 2VW2A 4ZPIA 1IHMA 1P8JA 1YIJV 5JPNB 3LGRA 2DCKA 2ZNIA 2VAUA 1SPPB 5A1FA 4K40A 4QGNA 2CGOA 3K3NA 1JHJA 3S6PA 1V54C 1DIWA 1V6KA 1XNTA 4XMIA 5HCBA 3MAQA 4AVBA 5FWEA 3ZIWA 3T2QA 5IW0A 1T5EA 4KHPB 3JAKA 4XDJA 3OR7C 1EBOA 5IVVA 4K0KO 2YIBA 4YFZA 4Q2FA 1LB2A 4DV2B 1AR5A 3RBZA 1CAVB 1RUD3 1H0BA 4ATFA 1KP2A 5CBGA 3IPVA 4UFJA 2O14A 2ZDIC 4ZOLB 4ITCA 5I91A 1PNLA 1OH4A 4LF9O 1HJFA 3T1HB 2YU2A 4DUWA 3VBUA 4JI1O 5J3UA 1YJNV 2D44A 1R091 3BYWA 4PIXA 1H2SB 1W28A 1XNRO 2NNUA 2WBKA 3VBOA 1HJGA 1Q7YW 2GBOA 4TT3G 3VQVA 1U5IA 3M3CA 2NQYA 1QNYA 2X6AA 2R9IA 4RD7A 1CPMA 3CDZB 1UOBA 4LR4A 4EWDA 1O4ZA 3H1HH 5EZWA 2BTQA 4O2BB 3WQ1A 5JIUA 3KQRA 2RS11 3I55V 2DCJA 2FQPA 5FQ0A 2QDNA 1R082 5BNNB 5CN0A 5GM0A 3IPVB 4Y22B 1S2EA 3T3YA 3JAKB 3SJBC 1DGRA 4U7OA 4FJCC 3X29B 3L2YA 3KV9A 1ZRDA 1FV3A 2QKSA 1W04A 1ZZ9A 5IUQA 3LQCA 4JAUA 4A5UB 4F3JA 1RUNA 1GP5A 1MEC2 2OTJV 1Q8QA 3HEIA 3ILRA 5DUUA 4TZDA 2FMDA 2NP0A 2EINC 4DV7O 1N32B 2R32A 5CFCB 4FQ4A 4OULA 4CDWB 4EZHA 2H0VA 3HR9A 2JGDA 2VPVA 2X5IB 5BYNA 4RQFA 2ZINA 1M1KW 4CDUB 1TME1 2HWD3 3W7TA 2R7EB 4O61A 1W6QA 1YXBA 5HBAA 3FC0A 4P9GA 3VBRC 4KL1A 1UKRA 2VBBA 4K3AA 4D6QA 2W47A 3GWOA 4RUFA 4KWJA 1Q43A 3LSSA 4B3TO 4LP8A 3C7GA 2QJVA 3OYWB 3QLQA 2W46A 3POYA 1HW5A 3HN3A 2WFF2 1NQDA 4B3SB 2W87A 4LF7B 4I5SA 3SPCA 2D6KA 1W3VA 4CU8A 3PJYA 1OZ0A 4YZ3A 5ACA3 1W05A 2VNOA 4OMDA 1OCZB 4MGYE 3AYAA 5C8CC 4Y4RA 3RSJA 1UL9A 2ZJCA 5I0SA 5BMVA 1W2UA 1AR62 5FPBA 2A3QA 1PGL1 1H4GA 4Y20A 1H9PA 3GBGA 3ELNA 3WNXA 5LP6B 4YYOA 1BK1A 4CP2A 4N9HA 1VRBA 4MTOA 4PJ0Z 3MZHA 4QT6A 2HVJC 4RFRB 4Q4Y1 1QH7A 5GLUA 4P9PA 1JYIA 1V9U2 3QNEA 2WYFA 3WP6A 5HCHA 3ZRXA 1ZA4A 1KFUL 1G4YB 4RQPB 1A34A 1XNDA 5A3PA 5DZGA 1LTEA 1GOGA 1GZWA 3BI3A 1Y76A 2GTAA 2DOSA 2BVBA 4CDQA 3C3VA 3JCUZ 2C6SA 4XXAA 3F5WC 2B9UA 1H2GA 2KD7A 1R1A3 1QDCA 4TSFG 4AYUA 4O9EA 5F9TA 2PQSA 4JI0O 2E74B 3DN7A 3VBSB 1URFA 4O4LB 3ZXKA 2RM21 3H8XA 4QNHB 4LUMA 5FZ3A 3DPRB 5CA1A 2CU5A 1SA0A 3RYPA 5L3EA 1JU3A 3ABKC 4PQ9A 4IV1A 1I9RA 1UY0A 4ES8A 2VM9A 1ZTEA 4BB3A 3IMMA 1XMOO 2W0FC 1AR92 2VQUA 3DC6A 3VDDC 4TWTA 1DQ6A 2ZHMA 1QY4A 4RYDA 4ZONA 2V4DA 3BPZA 4CE8A 2HFEC 5KA6A 3MO4A 3A7QA 5A7SA 4EJRA 2X8KA 1WD3A 4NWVA 5FZBA 2CGPA 3O1RA 1H6YA 3PU3A 3ZN1A 1MS8A 4F4LA 5LOVA 2JRIA 3CMAV 4RGAA 4XF1A 3UYJA 4FIPC 2E7TA 1QU7A 1WNSA 3B8NA 4DRXA 2ITCC 4TOIA 2JK5C 2RS53 1NCRC 3K9AA 3NXSA 1OD5A 4ISRA 4AGGA 4LPLA 4NAOA 2Y6KA 1E5HA 5EWSA 3GZAA 3M7MX 3B94A 2F95B 1EUUA 4R50A 4UW4A 2DV9A 1IBMO 1UU6A 3JD4A 3EXUA 2XKPA 1N4CA 1QXRA 4NTYA 1COV2 4JC1A 1N34O 2ZM6O 3HQUA 2CAVA 2P5BA 4YM3A 4XFAA 3GBWA 2ZEXA 4K8RB 2RS13 1OOPA 1JCHA 4XACA 5FMDA 4V1PA 2BQPA 1W6NA 1DQ2A 2WO2A 1IPKA 4FK5C 3WFVA 2EULA 2VQEB 2OCCC 3QVNA 4GT1A 5DABA 2JB4A 5LHHA 3CJHA 4CU6A 4PA4A 1PM7A 4XVHA 2DURA 3PJQA 3U4XA 4HPKB 1BK0A 4NO4A 1BQ0A 2ET1A 4QQ2A 3FAVA 3MGUA 2HWF1 4UFIA 4QE9A 1DFQA 1K8AW 1L7LA 2YY1A 3JB4C 4EE2A 3FB5C 4HONA 1TUEB 2HH9A 3N2GA 5KR7A 1ZA7A 1OLME 4DS0A 1FPN2 2GNDA 5JQGA 2YFZA 5FZ0A 1AR71 5A33A 1QR8A 2QQUA 3LSUA 3VB9A 4X1IA 2C24A 5CFCC 2E31A 1VB2A 1ENSA 2YGMA 4DMIA 3JQWA 2VOWA 4JZ2A 5A7NA 4JI4O 3K0DA 3HVDA 2PTMA 4Q5OA 1XNKA 3UNPA 3ACIA 3SQOA 3MIHA 1VIBA 3MW4A 4W4LA 3MPBA 4BM8A 1H2NA 5E89A 4B3MB 1UKGA 3OW2U 3E5XA 4OPAA 3C7HA 2RG4A 5ITZB 3LEGA 1W8WA 2XHBA 3U14A 1QWRA 1HNWO 5K1XA 2DE0X 1KC8W 4NIGA 2EIMB 3C90A 1VBE3 4YVWC 2W52A 3FWEA 3LB9A 3F2ZA 3WY6A 1WAZA 1PGW1 4MGKE 3M3IA 1PM9A 3I59A 4QX7A 2EJRA 4AILC 2D40A 1LODA 3RVZA 1CD3G 1N1TA 4AFMA 1LUWA 2Q8OA 5H5NA 1GKBA 3ZYIB 3E86A 2Q8DA 1RVF2 4YGDA 3CXHF 4OHWA 5GTHZ 1SBFA 2Z42A 4JI8B 4IGQA 4CP9A 1MEC1 3E1F1 3BRCA 2AGAA 3WX5A 2CDOA 1J1LA 2ODMA 4UT5A 3J7NA 4DNYA 4IEZA 3KZIZ 4Q4X2 1VQ6V 4GAZA 5ANQA 1K4CC 3JYCA 1AR82 4ORFA 1EPZA 4NE9A 1AI5A 3Q8FA 1Q5OA 3ZYRA 2Q6AA 1FX5A 1XNQO 1EAH2 5IVEA 1ULGA 3Q9OA 1EPWA 2G9FA 2ZXWB 3P5BA 2EIJC 1FXHA 2EIKC 5F5IA 1BBT3 1PKXA 1VBA2 1Q8SA 2J7MA 3B8MA 5FK8A 4JTDB 3Q8BA 2UURA 1EV11 1UOFA 2WWUA 2DVGA 3T09A 4I01A 1WWYA 1XE8A 3ZXGA 3MYXA 5C3SA 3J7LA 5CADA 4YJ2A 3I2JA 1REDA 3J7AU 1MOFA 1KS4A 3H3ZA 4BQWA 1Q6HA 4DV6O 4DV4O 1GNZA 2WABA 2W1UA 4E2QA 3N36A 4WBNA 5IJ9B 2C4XA 2HWC2 4AK3A 4AHYA 1AI6A 3NV2A 4DY3A 3G6BA 2EVXA 2ZS6B 1SESA 2DUPA 1D0HA 4D3WA 2E9QA 5IVYA 3CQOA 4UB6Z 5FAXA 3BTXA 2JS5A 5C7GA 3QOPA 4MGZE 2C9KA 1RJ7A 2BNNA 2F4PA 1VE0A 3STZC 1S77D 5FCCA 2XL7A 3GZUC 1BHGA 4Z82A 3WNMA 3URFA 1RUI1 4DV0B 3LFIA 4N21A 5IJ0B 3DXRA 4EN9B 1R083 4LBQA 5J2TA 5IFPA 3K48A 1QR9A 3ZJZA 1MS0A 4LF4B 2BFUL 4RS5C 1QVGU 2DU0A 2WLPA 3EBRA 2O0OA 1NT2B 2VZVA 2W1QA 1A32A 1WCKA 3NWKA 5DAVA 4A6SA 2BZDA 3TRSB 4H14A 5JZGC 1R6KA 3U75A 2EAAA 2J1TA 4ET7A 2XLFA 2B45X 4I0XB 5IWAB 3JD1A 3AMHA 1WA8A 4DV1B 2V5YA 2V4AA 1J3QA 2P17A 4A7YA 3BEHA 2DUOA 1JZ8A 1Z0HA 3KWVA 1B35A 4AGRA 3O5SA 4R9CA 1FMD1 3OTFA 1ULEA 1VMHA 4INDA 1PD3A 4EZ4A 3U0ZA 1KS5A 3N7JA 1OD3A 2YPDA 3LKJA 4FCAA 3LPFA 3ZFFA 2XAQA 4IGGA 5A32B 3CBNA 5J2TB 4L87A 1KKCA 2R30A 4A3XA 2Q0OC 5FKBA 3H9VA 2Y0PA 3D3QA 4MTGA 2DCYA 4X1KA 3Q8CA 3E8HA 4H44B 1MS9A 5FLIA 1QQP1 3N35A 1JYXA 2RQ6A 5ABJA 2LFRA 1KQSU 3P3NA 1VMFA 2EIJB 2A06H 3UT5B 1DGWX 2D6NA 3JSLA 3SISA 1XNBA 3BY6A 3BCCH 2QE3A 5LWBA 4PA7A 4Y33A 4FSJA 2XKOA 3RMYA 3U10A 2E63A 2W1WA 2R0HA 2ORXA 3I49A 3IDEA 1US3A 3ABMC 4D0QA 2WA3A 1AR73 5EJ3A 5IK4A 4Z1MG 3KHCA 2BCCH 1YZBA 3EVKA 5D2AA 5BPXA 1IS6A 1CIYA 3BN6A 4OI0A 1YITV 1SFYA 3KCYA 4QQOA 4FXKB 4LO5B 4CA9A 1LGNA 3I3QA 5LBCA 3LA7A 2K2SA 5FNVB 2WS92 3TXQA 5HFMA 3N9MA 1XU2A 4YGBA 2VBPA 2JE7A 5HFLA 1X36A 5IVFA 2KG7A 1S0FA 1JZ4A 2UU8A 1SQGA 1IS3A 3KQ4B 4I3PA 3A0KA 1XREA 2YXYA 2WA4A 3ZKYA 2O57A 4IE0A 4CH5A 3K77A 1RUJ2 5BR8O 2QM8A 1AJNA 2OW4A 5JVDB 4D69A 5LXTA 4XILA 1ORQC 5B5EZ 5B2GB 1UX7A 1PNFA 4Q4Y2 3WNKA 3QBQA 4Q8LA 3CJHB 4Y1XA 2WIIB 5F6KA 3J9SA 2D3RA 4F6EA 1QH6A 5LGTA 4X8PA 5D21A 1QLEB 3ZX7A 3LD8A 4IL7A 4QPJA 4A3ZA 4WM8A 4JI2O 1BVVA 4P5YA 5FTTC 1F4NA 2DBIA 4YM2A 2RE9A 3FB7C 4DR5O 2J42A 1CIWA 5EZYA 2VVDA 3VD7A 4XJ8A 5BNPC 1ZRCA 3VBBA 1PMHX 1G86A 1NCRA 1WGPA 1N33B 1MR5A 2HHHO 5GKAC 1PK6C 5C6CA 4CUAA 4OFGA 1KRIA 2RMKB 2IH3C 1RITA 1AP5A 4DB5A 3OEEG 4C8DA 3DF0A 1PX4A 4O4HA 4QKDA 3R6SA 3I3MA 5BNPB 2JIGA 5K7PA 1K33A 1KBHA 3N3HA 1O4YA 4AWDA 2WO3A 4Q26A 4IT5A 4PDRA 3L9DA 5T54A 4GMP1 3DGEA 2JVDA 4P9JA 4BR6A 1VQKV 2E33A 2HWB1 4MVMA 5A3TA 3IT8A 4GMP0 2EJ7A 4G4FA 2XAFA 1JA8A 4OI1A 5GLTA 4AFCA 3TK1A 2Z4FA 5EBMC 4O65A 1GBGA 1REEA 5F2WA 4YW4A 1VQ8V 1JYVA 2VOVA 1LR5A 1GICA 2JDPA 5EHDA 4Q4W1 4L2NA 4E2LA 5HV0A 2PHWA 2GP3A 1NJIW 1LOCA 3JB8A 2AZ5A 4XYXA 3SKVA 5JJEB 1B06A 3CHXA 3VQYA 2UY9A 2IVIB 1UAIA 5C33A 2OYQA 3RYKA 5FP7A 2PLV1 2FCTA 1RIRA 1SLAA 5B66Z 1I0HA 3JUUA 4JI0B 4J1WA 2OUJA 4EFBA 4BAYA 4KI5M 4LIVA 1HB4A 2OIIA 4NXMB 1CVNA 5J48A 2GNMA 3UKMA 1IOAA 1PIV3 4DR4O 5CU1A 3AK3A 5FZEA 3OJBA 4YW1A 2WNEA 5H9QA 3WOGA 5EIBC 5IY5B 3N7KA 1NVPD 2HWB2 3N9QA 3SJQC 4JI5O 4LCUC 3A4UA 4TYSA 2IXJA 3VD4A 2YICA 1XHXA 2ZGPA 3RZHA 4AEDA 5ANNA 4OUSA 4YIOA 3WHUA 4JPRA 5EXOA 3VZKA 4Z07A 1G9FA 1MZEA 4LFAB 3AG2C 4DYLA 1VP7A 1ASJ1 2AACA 2RCVA 1VBE1 1QBZA 3IC7A 1CAUB 2HWE1 4LT5A 4QPGC 1FYUA 3OGVA 3VBHB 1SRYA 4QDQA 4XFCA 5CMUA 4B3RO 3KZ4C 1DP0A 1FFXA 2XDVA
chains in the Genus database with same CATH topology
1OI6A 3BOPA 3IWZA 5GLVA 4LBLA 3D4KA 4XFIA 1Y43B 3RNSA 1AYM2 4X8NA 3VBSC 5E16A 1ULFA 2WBQA 1LEDA 1VBC2 3PVBB 2W08A 4META 2LTNA 3TB0A 1HX6A 4AXOA 1PVC3 3MLJA 3TN91 5I8SA 1OIJC 4BOWA 4LO7A 1RHI2 4E9KA 1Q56A 3WDTA 5K8SA 3G7DA 4XIOA 1PO23 1UU4A 2H0BA 1O91A 1V00A 2RJLA 1KJRA 4KWLA 1SBEA 4OHXA 1JBCA 1Q8PA 4BMEA 5LEJA 4M3CF 5GZEA 1XQNA 2D93A 1ND3A 4GWNA 2JEMA 3UL2A 5KEUA 1MVEA 1D2SA 1BMV1 1X33A 5FOBB 2ZGKA 5D1IA 3FUOA 2BYVE 5C4WC 1J1TA 3WT3A 4LEJA 3BOWA 1HQWA 4QPGB 1O3QA 4QGLA 4IV3A 1HQLA 2D43A 5J98B 4DPNA 3VHPA 1RUC2 3PMSA 2BNMA 2IFWA 2RMU3 3NL1A 1YYNA 1X50A 1OFSA 2D6OX 3CJIC 4BG1A 1ZYBA 5C8CB 1RHI1 4GKXA 1RMU2 3MIBA 4WBBA 2A7AA 1V6JA 3D8CA 3PMEA 3J26N 1DRTA 4F7ZA 3UV9A 2LUWA 2UWCA 3ZXEA 2WNVC 4N53A 3VKFC 3GZTB 4L8QA 1U5YA 1PZ9A 4SBVA 1GR3A 4H7LA 3CJIB 4XMAA 3IMNA 4YG3A 2ZAHA 5FMOS 2CNAA 1F5FA 3TNPB 4XBNA 3NVCA 4CRQA 1M4WA 1YIFA 4O9GA 1ZX5A 3WLUA 4Q4V3 1UPSA 5DDJ2 4DINB 2FZ2A 5FLHA 3DV8A 4K7JA 4CDUA 1YXWA 1V6LA 1V6OA 3FLRA 2CTVA 1NQJA 4CZSA 1LOFC 1QXPA 5CFDA 1WLCA 4CDWC 5FMOL 3NAPB 2O8OA 3D6EA 1DYPA 2I45A 2Q0AA 2ZGOA 2R071 1UZZA 1ND2C 1GYKA 5E8AA 1Y3TA 2BEOA 2AUYA 3VBFB 3AZZA 3LSDA 4MX3A 2AENA 1ZZBA 1TEIA 3IDCB 1MS4A 4P9LA 1FPN3 3LCPA 2B39A 4C0HA 4RQPC 2P3KA 3ZXJA 5L73A 1F9KA 2ZA9A 3DPRA 1FOD3 1CJDA 4QD2A 1FOD1 2JG8A 4AGVA 3KD4A 2VMHA 4M26A 1ZZ8A 2PHUA 2UYAA 1X8EA 5C9AC 4K8FA 1QKQA 5D8AB 3VBSA 1UW8A 5LK5A 3CO2A 4XFFA 2ZGSA 3UK9A 1KDMA 3ZFEB 5E88A 1N1YA 3H8UA 3VBFC 1CJPA 1YRZA 2ZZJA 4LHLA 1RJ8A 3ZSLA 1NCRB 3M3OA 3MPPG 2BWAA 1NE6A 3VBFA 4M3CE 1RMU3 2WWSA 1PIV1 2ZKNA 1QOOA 1QJY2 1XYOA 1QF3A 4OLLA 5J92A 2GC0A 3QCWA 5DG1A 2D97A 4PBPA 3SLIA 4YZ2A 2ZX0A 2A75A 1UIKA 1ZRRA 4B7KA 4R8HA 3V0BB 2BTVC 3KT1A 5L19A 1W39A 2UWBA 5DUVA 2YGLA 3PVJA 1HXS1 1R1A2 2AYHA 1VR3A 3WCRA 4M01A 3WZ1A 3VN4A 4ATEA 1DZQA 5KXBA 4CEWB 4RR3C 1I6XA 3ZFFC 3I4IA 3PLQA 2WZPP 2BNOA 1ZBA1 2XB6C 1COV3 4N53B 3ASIA 4YLMX 2IXIA 1UU5A 4KG8A 2HWC1 5CBLA 1RUJ1 2RS51 3AFGA 5K9YA 5IT6A 1NLSA 3D5OA 1LHNA 4LBNA 3FLPA 4QXKA 4OI2A 4I0WB 1SMVA 4C90A 4DY5A 2GH8A 3CLPA 3E5QA 2B46X 2JXAA 2DVDA 2KA3A 1LENA 2WINB 5J96B 2GDFA 3CJIA 4YVSB 1W6PA 3AP4A 1V9U3 1R081 4IEWA 4N43B 4BA6A 1FOD2 4M2IA 3NSTA 3OGJA 1WBFA 1Q8OA 4BHGA 2XJPA 4RHV1 4W6WA 3FUQA 4U36A 4CEYB 1OTJA 2RR12 1C28A 2VW0A 1QJZA 1WCSA 5BNOA 2XVGA 4FOWA 2WFPA 1OSGA 2CV6A 4QU2A 4HKOA 2VULA 4UBHA 3HIFA 4HN1A 5K0UA 2PAKA 4BIOA