1MZEA

Human factor inhibiting hif (fih1)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
337
structure length
335
Chain Sequence
SGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords factor inhibiting HIF1
publication title Structure of Factor-Inhibiting Hypoxia-Inducible Factor 1: An Asparaginyl Hydroxylase Involved in the Hypoxic Response Pathway
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 335
sequence length 337
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 1mzeA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1mzeA01
4B7EA 1IZ3A 2Y0IA 2YDEA 3P3NA 4JAAA 1H2LA 2WA3A 3D8CA 1MZEA 2CGNA 2W0XA 1MZFA 3KCYA 2CGOA 3OD4A 2YC0A 4AI8A 3P3PA 4QU2A 4NR1A 1YCIA 1H2MA 2ILMA 3KCXA 2WA4A 1H2NA 4Z2WA 2XUMA 4Z1VA 5JWPA 1H2KA 4B7KA 4BIOA
chains in the Genus database with same CATH superfamily
1GZWB 4WFAV 1O91A 1Y4WA 3FZ3A 3WW4A 1OCRC 1ULGA 2B39A 5IVJA 5APAA 1QWRA 1VQ9V 1FD9A 3AMQA 3TETA 4K0KO 1CJDA 4HN0A 3D3QA 1P84F 2VZVA 2A9HA 2OTJV 3E6CC 3B02A 2X09A 2XB6C 1OD3A 3Q4HA 2VE1A 1US2A 4AE2A 4JQTA 1GWMA 2O14A 1R093 2I07B 1OA3A 3FLTA 4C90A 4DR3B 3M2MA 3C3SA 4OVEA 5FR3A 3QLQA 1FPN3 2EAAA 3HEIA 4LF6O 3F2ZA 4CEYB 4Q6GA 1SLIA 1YSCA 2ZEZA 5EZYA 2VS0A 1QHTA 5GZEA 1L0LH 2PHLA 2PLV1 1LOFC 5T5JA 2IXCA 5C5UA 2ZE7A 1US6A 1H8TB 3GCWA 2WRAA 4OX9O 3U07A 4HKWA 2CDOA 3P3PA 5FOJB 1WPXA 1EPZA 3ST7A 3VBRC 3L72H 5LMUO 1RYYA 5CBFA 2VVEA 1QR9A 1KJLA 4ZXKA 4DR4B 1DZTA 4MLOA 3AMPA 3ZKYA 2FMYA 1MPXA 2AHYA 4L11A 3IDAA 2VXRA 2YBPA 3LA7A 4Q8LA 5EBWC 3DCQA 4TN7A 2OQ7A 1A8MA 2A6YA 2RVAA 1N3OA 4K7JA 1S1AA 1LJ7A 2YY1A 2VCAA 4X1KA 1FJGB 1NKGA 4AL9A 3C2UA 3OMNB 5L3DA 4R9CA 1VBA3 3BVCA 2Y6KA 2ILMA 5GJ6A 4F8AA 4GWMA 1ZM1A 2ZT9B 1POV3 2QTSA 4AEDC 2CDYA 2IU3A 5LBCA 3BN6A 3I8TA 3WQ7A 4OHZA 3H1MA 5B4XA 3K48A 5JZGC 3HNBM 3JARB 1S2EA 2XJTA 3S7EA 4K8FA 1B35A 1H2NA 2CAUA 2FMLA 4XHBA 2KKWA 3H8RA 2VNOA 2ZGUA 1S0EA 2GTAA 5DAWA 2N04A 4KG8A 3RSJA 4BQ3A 1QY4A 1V55B 5T5LA 5CKQA 4EQVA 2GDSA 2LFSA 1FOD3 5FZ9A 3HKBB 4HOOA 2F4LA 3I3DA 1A6CA 2NPIA 4C8DA 3ZMSA 3M70A 5LA0A 5JQGB 3NJVA 1XU2A 3DYOA 3A22A 3E5QA 3MBWA 3BAAA 2YXHA 4L8QA 4DOUA 4KBBA 5G05L 4GB32 3SKJE 2YFUA 1RUD3 3CRCA 1VF5B 5IVCA 3SCHA 4L92A 4K20A 3ETGA 2A6XA 4TYSA 4KGGA 4BOWA 2WNUB 2FQPA 2B8MA 1F9KA 2ZS6B 1F4HA 5AFBA 1M56B 5IT6A 1K5MB 1W2TA 1QR8A 3WP3A 5JIUA 2OCHA 2RS13 4MGIE 3CRMA 1Y74A 4JYBA 2NYYA 4CXWA 2Z4FA 1KKCA 5SV5A 2UY8A 5A1AA 5LHIA 5IVVA 2DYSB 2VULA 3TRSB 3DL3A 1R64A 2D3PA 1XHXA 1SC5B 2VH9A 5DG1A 1AL0G 3OGIB 4X65O 5FTTC 1LOFA 2OCCC 4AFDA 1YQ2A 1VQKV 4XZPA 3M3QA 3R65A 5D21A 1RXFA 4XZUG 4EZHA 4CC6A 5CADA 3UGHA 2BEOA 3VBRA 3LQCA 1QKQA 5CVRA 3B77A 3E8GA 5GLWA 4BE3A 5FUIA 4OZOA 2WLLB 4B8EA 4Q26A 3CQOA 4DV3O 4N53A 2OVUA 4IXLA 4X6RB 1OOPC 2HBUA 5GTHZ 2MHFA 3N7KA 3AFKA 4DUVA 4JYAB 4RS5C 4AQYB 2UU8A 3N27A 2UWAA 2VMGA 4FLXA 3QTCA 3WU2Z 1X4TA 2TEPA 1UWWA 1F23A 4JI6B 1RITA 2PLV3 3AYCA 3JALB 3JSNA 5LBFA 1XREA 2ZIMA 1UW8A 1S0IA 4FQZA 1OFSA 2D6PA 4AEDA 2PGGA 3OGSA 5L3GA 1XYNA 3DTUB 2V5DA 3BU0A 1AR61 2VQFB 5JZGA 1IVSA 4O9EA 5BNPB 4WBNB 2PQQA 2D5HA 1M06G 2XR4A 2QQMA 5EJZB 3J26N 2PYLA 2ZXWB 3B9CA 3JD0A 3OYWA 4MH0E 5FY0A 3KF5A 1IXMA 2WLPA 2ZZJA 2B5HA 3KT1A 4LE4A 1M93A 2DBNA 4DUZO 2YBSA 2JGDA 5JI9A 4LTAA 4GX0A 1SFYA 1DGLA 3STLC 1HX6A 1ZBA1 1JXNA 3RYKA 4CDXC 1K97A 3IAPA 5A70A 2ZR3A 2E26A 1UCXA 1JJOA 2XBO2 3J7AU 5F5AA 1RUG1 4P9IA 4HSJA 1IS4A 1PM4A 1RUI1 5JH7B 4A7YA 2C0ZA 1DF4A 1Y76A 2QJVA 1BVP1 1ORQC 1OLME 2B9ZA 3TEZA 3RMXA 1W9TA 1TME1 4HSLA 3NL1A 1XE0A 2BSKB 3T2QA 3O1UA 4HAMA 3AXEA 1PO12 3VHNA 1Y43B 1G8MA 1ZRCA 1URFA 1QJU2 3TEYA 1Q5OA 2QE3A 1NT2B 4Q1PA 4URAA 1RUNA 3W7TA 4TWTA 2VZPA 1COV2 4WVMB 3KHCA 1Z5VA 4Y4YA 1GN6A 2VOKA 4IEVA 1AJNA 3ZMZA 1H6YA 2P1BA 3K4DA 1RL3A 4PIYA 5B4NA 4FFBB 1F35A 1PL0A 4B08A 1O3SA 4N43C 1DQ4A 4YXWG 2JS5A 3TN91 3OD4A 2Q6AA 4YW2A 1CPNA 4XF4A 1CONA 3NQHA 1WCQA 4I01A 4Q4W2 3E8HA 4DUYB 4UFJA 1FMD3 1AB3A 3KS7A 5I8YA 4CH4A 3WCRA 2WBKA 1JU3A 4N21A 4YGCA 1WLCA 2YSUB 1Y4MA 1W8OA 2P6JA 2Y69B 3MF6A 4FAHA 1M5IA 3T2PA 1OOPA 2JDAA 3E5XA 4KMQA 5A80A 3AKSA 2ZM6O 4CCMA 4FP2A 5C3RA 4E2SA 1VBC2 5LRRA 3CWBH 3BPZA 4RS5A 1XXNA 1MOFA 3DYMA 1EAH2 3RZHA 3RZMA 1W8NA 1CJPA 2JG8A 5FZ3A 3SEEA 3S5AA 4PLMA 2B42B 2ZX1A 4X64O 2BOJA 4LR3A 1W0PA 4XJZA 2OYZA 1GP5A 2RS32 2RNBA 1E5HA 2NMOA 2DVBA 3U4XA 2N7GA 4CDWB 4FPGA 1F31A 4GLXA 1D7PM 4LUMA 5LRSA 3KQ4B 3AG3B 1NCQB 4KU8A 4GULA 1LNSA 3WW3A 2R043 1TUEB 5IK5A 3VKOA 1MEC2 1LNQA 4UVBA 4Y5Z0 2VJXA 2AR6A 1YI2V 4NHLA 3ZVXA 3ZIWA 4SBVA 3ASNB 1RUH1 4CDXA 3O1TA 3H7JA 2QQLA 4A44A 3NKTA 1KS5A 4YZ2A 2BDRA 1I0HA 2QJ1A 1OCCC 5H6RA 1AR63 3WF0A 1RVF2 3OGCC 3ZDVA 1FNYA 4JI8O 4K8RB 4AHWA 3SCFA 4IE4A 3IAYA 3ZYHA 2WR9A 3PIJA 4DO0A 3M3IA 1RB8G 4LO5B 4E4DX 4AVBA 3DECA 3HKCB 1VQOV 1RGSA 2JK5C 2BWAA 4PA7A 4KWUA 4XURA 3JATA 5KX5B 3VDDB 2G4IA 1XNCA 4AQTA 4UW4A 4X62B 5CKMA 4CS2A 2WKKA 4HETA 4LF4O 1OQ1A 3AG2C 1ZBA3 3R4SA 4J10A 5F3IA 2EXJA 2W47A 1QIQA 1WNSA 1VQ5V 4KWLA 4E8DA 1EBOA 4DR5B 3JCUZ 2RQ6A 1VLNA 3RI8A 3ZSJA 5AC91 4JI3B 1RUG3 4ZHQA 1ZZCA 3O65A 3S30A 2X5IB 3T2OA 1Y9QA 5FYIA 5I8TA 4N43A 1QH7A 2RE9A 1TMF1 2HBTA 5I0DA 4JRLA 2JB4A 4DV5B 2XUMA 2VOVA 3CEIA 3RYIB 1RUI3 1XRUA 2EICA 3QH7A 4YVSB 2GNTA 1TME3 1XL4A 1S72V 4RFRB 3GNEA 5FZLA 2KG7A 4X6QB 2YYOA 4DR3O 3BGAA 4ZS3A 2A70A 4H33A 3I2IA 5FPZA 2ZGRA 2O1QA 4TZDA 1R73A 3VN4A 1MS3A 1UU6A 5FYCA 5GZFA 4CDUC 3EHBB 2ZA9A 2ZEYA 4DEQA 4TQFA 3OUFA 2V7QG 1OF3A 3IPVA 1HV1A 2VW0A 1BXHA 2QQJA 1ZRRA 1XDCA 4TV9B 2P5BA 1VBB1 3TN93 4ZU4A 4QHBA 5BZBA 3DUIA 3VBOA 5CFDB 3MDPA 2EJRA 4MOAA 2H0VA 1U96A 4Y1XA 1EY2A 4FCAA 1BEV1 4DV2B 1LGCA 1KECA 4O2AA 1E1RG 4DR4O 1UX7A 3A4UA 4P08A 4JGYB 2R0FA 2XJUA 4CBCA 3K04A 1YQ6A 2ZGMA 2ADDA 4AFMA 1IG3A 2K9PA 5JVDA 2LP7A 4YVWC 1FJGO 2BOBC 4MGTA 3POGA 2IH1C 4I50A 3JD71 3JBG2 4FPOB 2C9AA 1JH5A 4BXSV 1RUC2 4WBBA 2EIDA 3APQA 4Q4X2 4EN0A 1XQ8A 3AYEA 3DN7A 3L70H 3G80A 1R3KC 3JD2A 4J7KA 1YXWA 3NNMA 1YNAA 1FXHA 1YXBA 2AZ2A 1PX3A 2XJSA 2ZACA 1DF5A 4FZ1A 4M01A 5L36A 1NCRB 1UN1A 4DRXB 3APOA 4DV7B 2XG3A 2XGXA 2LS6A 3ZMUA 4BCUA 3KV4A 4IL6Z 4QX7A 4QDRA 1OF4A 2JE8A 3QH6A 4BW9A 1OH4A 2UY9A 4F6RB 1PVXA 1RUH3 2X7RB 3W58A 3ZN6B 2P4VA 4F6EA 3RYFA 4IGQA 1Z78A 1GBGA 2Q1MA 4I0BA 1UYPA 1PIV3 5H9CA 1UU4A 1BHBA 3CJXA 3T09A 2FTKA 1GQPA 5HV4A 1KYOF 4XFIA 1JMUB 1ZZ6A 3W9AA 4LCUC 3LF7A 5C4WC 3K79A 4KWJA 1AR82 2VQAA 2ZQMA 1NXMA 4NPLA 4IERA 1HKDA 1PO23 2WYSA 1CPYA 3NV3A 1HW7A 5A3OA 3DV8A 5GLTA 5E1RA 5CBHA 3D0SA 2E7AA 5B1AB 5IVFA 4CUBA 1FNZA 4B7KA 4O4HA 4R6ZA 3WDYA 1GWLA 4QKBA 1WCUA 1GOFA 2LALA 4XIOA 3U14A 2YIBA 1O4ZA 4Y20A 3WHUA 1GICA 3U37A 1H2MA 1IURA 5FYUA 3VQXA 1V6OA 1MQTA 2LW1A 3PVBB 4BK5A 4CDUA 2LGQA 1VBE1 3CCUV 2GSMB 2P17A 3H8XA 3EYPA 2HEPA 5AC93 3HKEB 5DUWA 1G6UA 2WABA 5FK8A 4N90A 4FPYA 2QZ3A 2V5YA 3K03A 1TMF3 5IW0A 3THOA 1DU3D 3BEHA 2BU9A 5FKCA 1G6NA 5IUQA 4AZZA 5B66Z 4MTFA 2RMU1 4GX5A 4A41A 4N7IA 4K40A 2D6OX 5F6LB 2B1IA 1V54B 4LF8B 4PDRA 1FATA 4FPLA 3VDAA 3ZDSA 3W5MA 3OEBA 1JFFA 3URFA 2WO1A 1FXVA 2VZ1A 2AGSA 1SQVH 1D2SA 2PYJA 4JYAO 1PX4A 2E7TA 4YPJA 4XJWA 4AQYO 1UZ0A 4YVWA 2Y4TA 4Q0PA 2FD8A 1MABG 5JWPA 1QJY2 2DFBA 4JC1A 5FYYA 4JI6O 4A3ZA 5LGUA 3I59B 3FUQA 2XAHA 2Q7GA 3I3QA 3MIFA 2XH6A 1FXKC 1UOBA 1VQNV 2WNVC 4AXOA 1VBB3 4NTWA 3WNKA 2QQWA 4OUSA 1HN1A 4XDOA 1Q43A 2VOTA 3WCSA 1CPMA 2VQFO 3MDSA 3LD8A 2PQSA 2VTXA 3Q8FA 2X53S 1C8M1 5DN6G 3H8OA 5FPUA 5HPOA 1BEV3 4CP9B 3JZVA 3B3QE 3BPSA 1ULFA 2GNDA 5K9YA 4X1KB 4B3SB 3QD6A 1JX9A 3LSQA 1EP0A 1XNKA 1WA4A 1JOBA 1AI6A 1XBLA 1HR0B 4RR3A 5JOYA 2ZHKA 4IEUA 4MX3A 4QQOA 3N4MA 3FB5C 5FMOL 1S0FA 5IVBA 5E8AA 2IJKA 3AG4C 2DQ0A 5FDBA 2G9GA 2SLIA 2IC1A 2PY5A 4CCDA 1GKFA 1H8HG 3O14A 5LP6C 2J42A 3WG7B 4K21A 3AJYA 1PGL1 3TNQA 4XIKA 4IV3B 2RM23 3NJXA 4IDZA 3EHKA 4XJ9A 1VQ4V 2Y6JA 3LSDA 1KGYA 2K0GA 3HVDA 1CZTA 1D4M1 4Q0VA 1X9PA 1F51A 3EXUA 3Q8CA 4D7TA 4YW4A 5HXMA 1DQ0A 5L7OC 4MVTA 4XBNA 1OQEA 2Y6FA 2QKCA 2JVDA 4OGQB 1JA8A 2OKXA 2ZAAA 2AENA 3O0WA 2IW5A 3DPRB 3WF4A 1OCRB 2RCVA 1W28A 3K51A 1PGW1 5DDJ2 4YSFA 3LNNA 2VY0A 4FO9A 3OEAA 3VD7A 1A8DA 5KA6A 1REEA 4M0NA 1H8EG 1CEZA 4BB3A 2IVIB 1RMU1 4B29A 4DUYO 4G2KA 4E4EA 2VCCA 3UYJA 4CDQB 1Y74B 1W6QA 1MSDA 1UIKA 1QCEA 2JEUA 5J7MA 1W6MA 3N35A 1HQNA 3MIEA 1GZTA 2JX9A 2WAMA 4LFBB 2CAVA 3V0BB 4QT6A 1DP0A 2HEYF 2CK3G 4PDWB 1BVVA 5BNNB 1QHDA 4RHV2 1VBE3 1GTOA 4YZ3A 1WJZA 1FS0G 4MADA 1YFXA 1ZZ7A 1LECA 1RXGA 1C1LA 4XACA 3I2FA 4BDVB 3LDRA 4LQRA 1FXKA 5BXZA 2AEZA 4YIOA 2FZ2A 2WNVA 5C9AB 3ZS8C 1TVGA 3OPWA 3VZJA 3POJA 3EB7A 3VL8A 2FMDA 4M4RA 4I02A 5JSPA 5DZEA 4LLOA 5EIBD 4LFCB 2E5LB 2PXJA 4RGGA 1ZLZA 1NLQA 3C8XA 2X6AA 4DR1B 1US3A 4ARXA 3ZYFA 5CFCA 5ACA2 1LOCA 1W6OB 1O8PA 4NIDA 3C3VA 1R1ZA 4KHPB 4CZZA 1O3TA 3BIWE 2VNRA 1AR72 3K3NA 2DUQA 4LF5B 2DWDC 3T4ZA 3KQRA 4AEDB 4QDQA 3VHOA 1Z0HA 3ZHUA 1N8RW 5J3UA 1JHNA 3SJQC 3S0MA 1MVEA 4QHOA 1ZNPA 3WEZA 4Q29A 3ZMTA 1H1AA 1NUKA 1NTKH 2Y0PA 5LP6A 5DPNA 5FXWA 2WDBA 4IW3A 3GXUA 2WZR2 1W0KG 4DR6B 2RJKA 1W9YA 5JJEB 5LCWL 1VRBA 1C8M3 4NHXA 2QWNB 1A3KA 1XSQA 2QTWB 5FZ6A 1VMHA 1CP9A 4BWOA 1W8ZA 1K33A 4MTXA 1WBFA 5L7OA 1L0NH 4JYYA 2H8PC 2KA3A 5ISLA 4PLNA 3N36A 4UFZA 2Z0AA 4OQ9A 4X62O 4XBLA 3ZXFA 3K3OA 5L73A 1DGRA 4NRPA 4B7EA 2WO7A 2RV9A 2AGAA 2EIGA 3OPZA 1JZ3A 2RJ2A 3CC4V 1D2DA 4WVWA 2AACA 4YFWA 1GP6A 4DR5O 5EPAA 2UUBO 3NV1A 1GZ9A 3VQWA 1YTFB 4JI3O 1YQ5A 3N9MA 4FFKA 5T54A 2ZX0A 2DJVA 4DW1A 4DV5O 2Q8OA 3UT5A 4NIAA 3MAQA 4BLJA 2ADQB 1ASJ2 2VCMA 4MVUA 1D4M3 1B09A 1SQGA 4GB31 5EYPA 4I0XB 2W3JA 4QMAA 3PUQA 5DMYA 3CCVV 3H9VA 3PLQA 1JPXA 2YXLA 3ML0A 1VBD2 4IIJA 4O4JB 1Q6HA 1PVC3 4S2FA 3MEPA 1VR3A 1W2AX 3VD9A 3H50A 4H7MA 1AVMA 2W1QA 4W65A 1O8SA 4R4XA 3U75A 3W5NA 5A3PA 4AEJA 2YIDA 4A5UB 1N3QA 1KD7A 1S5HC 1RMU3 3SYAA 1JZ2A 5LXTB 1MG1A 1DF0A 2F6BA 5EV7A 4U3FH 3UKNA 4DXZA 1S0BA 4GYCB 1XMQO 2EIJB 1WUVA 3CLPA 2YGMA 5I0SA 3T4VA 4H2AA 5A6XA 4F83A 3DC6A 4RS5B 2JICA 4DV2O 1X36A 1WP7A 3I2KA 1LOAA 4MGKE 1MACA 4I0AA 2Q7EA 4Q4Y2 3EO6A 3C7EA 4LR4A 4QB1A 4NROA 3K5MA 4H55A 2CY6A 2Z79A 3OUIA 1B06A 1FPOA 2ZGPA 2UXNA 1R083 3MHHC 3GDBA 4P5HA 4CEYC 3CEWA 3ZFFA 5LL6Y 2RS52 3NNGA 2YGLA 2QNKA 2CGOA 1VALA 4UB6Z 3HN1A 4LBLA 1HXS2 3K57A 1W0OA 3WV6A 4CA9A 4FAGA 5HFLA 3BFRA 3NAPA 1M4UA 2DQ3A 2O0OA 5GLZA 4MVZA 4RWUA 1YEWA 1KBHA 4DV7O 2GP3A 1AR1B 3RYPA 2NQYA 3HBZA 2HJFC 4O4IB 3ZN4A 1VP7A 3I3MA 5IYYA 4KGQA 1QF3A 4OI1A 5FZ8A 5J48A 1BT8A 4HZ3A 3K0GA 1F2NA 2XAQA 2OA2A 5ITZA 2ZX2A 4FLVA 3ITQA 1NVPD 3KSCA 2EZOA 1A78A 1X9TA 5J36A 3QCWA 2Q1FA 4MGYE 3Q8EA 2W0XA 2LFRA 3CXCU 3VD3A 3RGBA 5LY1A 2R6QA 3B09A 4X20A 4OULA 4COYA 3E89A 1C5HA 4MXWA 2IXKA 1HV0A 1S55A 3VOUA 3CC7V 5D8AB 1JCHA 3KGLA 4FXGB 3UO2A 4CTEA 3ME2A 4PDLA 5EBMC 2XBO1 2O57A 4IHJA 2W6IG 3PMEA 1GK9A 3FB7C 3WR0A 3K3WA 1LUWA 3O7OA 4EWEA 2RMKB 1SCRA 4I0WB 2DVDA 4MVSA 3W20A 1V55C 4N43B 3P30A 2R7EB 4XDJA 3KCYA 3LEIA 2JEXA 4TLFA 5FZ1A 1O3QA 1TVKA 2JDHA 1SZBA 1O7FA 1UF2C 5H9SA 1CAVB 3K59A 2ENRA 3TWIA 1PO11 4MS2A 3DEMA 2GC1A 1Y66A 3SLIA 3VGIA 1WA8B 1QJU1 1GZWA 5CU1A 1S0GA 3WNNA 3UETA 4YRDA 1COV1 2AHZA 2WS92 3CO2A 2D6NA 1UFIA 1YZBA 4GB33 3HN3A 5C3QA 3NW4A 2WNUC 4EEQA 4LF8O 3U4SA 2GTSA 2WC2A 2R30A 2IZWA 5LK5A 3QACA 2G38A 1DG6A 1N1VA 5F2SA 1K5MC 5JJNB 2EXHA 3TJTA 3O1RA 4Q4W1 3FE5A 2R16A 3RZJA 2W2IA 3T0AA 2Z2SB 3IB3A 4RFT0 4CEYA 5FBJA 4QGNA 1G86A 2WLIB 5FPXA 1W8TA 1F5JA 1R6NA 3C7FA 2YMZA 4P9LA 1VBC1 4PBOA 1QQP2 1XL6A 4BQ4A 1EAH1 1C5IA 1KEXA 3OEEG 4DXSA 4AI8A 4L0PA 5A1LA 3OUJA 1AP5A 2OZ6A 1EN5A 1HDJA 3UQ8A 1VMJA 2OW4A 1WAZA 3ON7A 2RS31 1ND3B 3OOXA 2DVFA 4B3SO 2WO3A 3LAGA 5EYXA 4I50B 3VL9A 5IAVA 2QM7A 2LM3A 4JTNA 1HR0O 4Y1VA 5FY1A 1R1A2 2XT9A 3HWJA 2VMHA 1UKGA 1JZ6A 1MNGA 1OCCB 5DECA 2VNGA 4K3UA 2WN2A 3HBKA 2AZ5A 4CEWC 2BOCC 1COWG 1QLNA 4J6GA 4OHVA 5AVPA 3ZO0B 3Q8AA 1SQFA 5BNOB 2QKSA 3ICXA 3RW0A 2BJSA 1AYN2 1MEC1 5A3UA 2CU5A 3MF9A 3N9LA 4LWSB 1GQGA 5JSRA 1RSOB 1IOAA 4HT1T 2ARXA 4QWNA 2QWRB 2VWKA 5IK7A 4UCTA 1UY2A 2BW8A 1DZQA 5C8WA 1VE0A 4OYUA 3AG2B 3JARA 3UV9A 5BNPC 2BFUS 1S5LZ 1C8NA 4LHNA 2Z42A 3POWA 4R4ZA 2QQIA 4YJ3B 3GZEA 1S2KA 1RVF1 3CXHF 2WFF3 1Q8SA 4I5SA 3HKBA 3QF7A 2VZRA 1UZWA 4WFFA 2ZXWC 3IM0A 4MVQA 3S3WA 1AXKA 4G3YC 1KDKA 5LMNB 5IYZB 5JQGA 3C3TA 1IKPA 4BK4A 1LENA 4PDVA 1LR5A 1CZVA 2R1DA 2N74A 4KXRA 2BVVA 4O4HB 3ETDA 1SQ4A 1TAEA 3MLLA 4X9QA 4UFKA 4OXSA 2RDQA 1IBKO 4Y20B 2HEVF 1T6GC 4FPFA 3WB2A 2AZ0A 2ZGKA 3BB6A 4BZ4A 5H2FZ 3OEHG 5IJ0B 2G19A 2VU9A 4JKLA 2WNUA 2XBO3 1X8EA 2XLFA 4LFBO 3I2GA 2DCJA 4Y4RA 1AYM2 4AVVA 5H5NA 4UXAA 3FLPA 2VUAA 3H3ZA 4JI0B 5DABA 1K5MA 1WCSA 4Z1MG 2FDJA 4KNCA 1SQXH 1ZZBA 4ZZ5A 2JDMA 3A0BZ 2OIIA 4RUFA 1K3IA 4AI1A 5DUXA 4J25A 2V09A 5F8PA 1PO13 1VEWA 1WGPA 3T4HB 1QJU3 5LHHA 3AZZA 3CJIC 4XUNA 3AYAA 4LFCO 2E5LO 1VF6C 3B5LB 1COV3 2PHDA 2QZ2A 5C8CB 4RQFA 4DR1O 1UY3A 1OPMA 1IS3A 1IGOA 1ROPA 4YVWB 3ZXEA 5FJHA 3WDTA 4BQ5A 3UKVA 1UYXA 4DW0A 4D3WA 4KHPO 1DCSA 1LU1A 1O59A 1ZRIA 2WJSA 3RN4A 1L7LA 1I7FA 2BNOA 2WLHA 3VKLA 1S76D 4UVCA 3DGEA 4ZOLB 4Q4W3 2Y69C 3TNPB 4LF5O 3I4IA 2B5UA 3VQVA 4XFAA 3KMHA 4QE7A 2Q4SA 4QM9A 3NO8A 4CEWA 3FC0A 1GOGA 3POIA 3NKGA 4XMIA 4LBMA 4NN0A 4XOGA 4Q4V2 1AJQA 1VBC3 3E8BA 2JIGA 2JJ2G 5GALA 3JALA 1EAH3 3SPHA 5HV0A 5LGTA 4YZ5A 2HWB2 2X6BA 5E88A 4AI3A 4PA4A 3SJCC 2OZJA 3B69A 3HNMA 2O8OA 4CDWC 5L9BA 3JBG1 4LO7A 5B2GB 1RUC1 3SYQA 2GDFA 4Q4X1 5BNPA 2I2SA 4WBNA 3HD8B 4A7ZA 2PFWA 3IZOA 3I54A 3HPLC 5LA2A 2YBKA 2CDPA 5FZFA 5LBBA 4MHUA 1I6XA 3AK1A 2RDRA 2WT0A 2YC2A 3MI8A 5C4WB 4YW7A 3MIGA 4KWKA 4P02B 1DYOA 4CU7A 5LYJB 3D6EA 3VZNA 1GFF2 1G9AA 1OCOB 3FX7A 5B1OA 5BMVB 4LK7A 1MEC3 4YHHO 4R7CA 4H3WA 2PZSA 4Q1RA 3VBSC 2WLNA 3K46A 1W0JG 1NR1A 3LB9A 4KU7A 4UFIA 3X2QC 4EZ4A 1FX5A 5FMBA 1GANA 1DLBA 5JH7A 2KD7A 4TSVA 3WX5A 4IGPA 1FKAO 4I9WA 1HB3A 2JKXA 3FUOA 4ZIBA 4WZCA 3WUCA 1XPWA 4BR6A 2LJ2A 3I2HA 4FT8A 3SQOA 3WP6A 3JCIA 3HKDB 1AR81 4OFGA 1RVF3 4IEPA 4CYDA 2ZXQA 4PF5A 2DTWA 4PA9A 3ABKC 3R05A 3HAGA 4FPCA 1P4RA 5FIXA 3CL1A 3ACHA 3GWKC 3ZXAC 4WVMA 5FFOC 2PF4E 5EP9A 4C7UA 1BYHA 3FJSA 4N7UA 1IXBA 4XXAA 1VF6A 4D6SA 4JZGA 4N8MA 1W99A 4FFBA 1R3JC 5FAXA 4QU2A 3ALQA 3G6BA 1KITA 4I9QA 2IFWA 3VHPA 4BQXA 2ZMLA 3MICA 1OVPA 3OTFA 1JUIA 3BTAA 4BIUA 3SHRA 2ET7A 4FPHA 4UI9L 3AB0A 2VAUA 2XONA 4YLZA 2CSGA 2E75B 1F5FA 5K4LA 1FXKB 1V0AA 3RJ2X 3ZYPA 1I5XA 1W05A 1O9HA 1LRHA 3VKNA 1PV0A 3L9JT 1EV12 2F17A 4CP1A 2DCTA 2R70A 2JDYA 1SDWA 5FZKA 4CP2A 1XNDA 1K7DA 1PNKA 3POSA 5FXVA 2XUEA 1N1SA 1FPN2 3E2EA 4EWDA 3TOJA 2QQPA 4E27A 1Z2GA 1MS5A 2DU0A 4K8ZA 3ZR6A 2ZNIA 1QJY1 3KV9A 3OB8A 2Z69A 1QJZA 4FZ0A 2UWCA 4NJ4A 4WFEA 4CDWA 4YM2A 3AL5A 1STMA 2DTYA 2R062 3R4UA 1BHGA 3OGRA 1ONAA 1W90A 4NXNB 1CAWB 4UW3A 3N7JA 4JI1B 2JE7A 4DV0B 3AG4B 2QQKA 5FNVB 1NCQA 2PHTA 2VVDA 5I0UA 1JS9A 1IX9A 4GMP0 2M6YA 4JGYC 1H8VA 1PK6B 4G27B 3AKPA 1WCKA 5GM0A 5CBGA 1W6PA 4H37A 4JRAA 3CZUA 2NN4A 1PD3A 4P9XA 1BCCH 4IEWA 3A0KA 1AL22 3ZMVA 1LODA 3GJAA 4WV8A 1YFWA 1I5ZA 1HNZB 5IHRA 3VBSA 2QSAA 4YYOA 1DYPA 3PMSA 4YJ2B 1UMHA 2ARAA 1K9MW 3JBG3 2BBVA 2F1MA 3BABA 1VARA 1RUC3 1SESA 4Q4X3 4FIPC 1P49A 3ETEA 5JUVA 2QQNA 5FZAA 1NCRC 2ZOEB 5IFTA 4JI4O 3G71V 2VL4A 1OXCA 3RYHA 1H9PA 1IG0A 1UY1A 1AI7A 3CMEV 4WCEV 4DUXA 5K8SA 3FHAA 2YEVB 3VDDA 4ICGA 2EF6A 1JTZX 1SACA 4CPBA 4P00B 4HVRA 5AVAA 3IWZA 5K0UB 4IGGA 1JYCA 3CZJA 3WNPA 1XE8A 1DFQA 5JOXA 4AGGA 4FM2A 1VRH3 3BIEA 5IYDO 5EYPB 3K4AA 2JJ6A 2E7QA 4LITA 2ZBJA 4TSFG 2E63A 3D3AA 2X5IA 1SEFA 3T3YA 2ZEWA 1KD1W 5DDJ1 1RHI2 1RUD2 4J9ZB 4DR7B 3LUTB 1SLTA 4AVSA 1UNBA 4ATFA 5B1AC 4BQ2A 2H6BA 4YVSA 3D36C 2P4KA 4J7JA 2L6LA 2RR13 2XQRA 1DDLA 4X66B 5FO7B 3MUY1 2R1BA 3DYPA 2HWC2 3K5LA 3IIIA 4LA2A 3WG3A 1EPWA 2YG0A 4RGAA 1Q6UA 2CE4A 5LGNA 1S4CA 4JVAA 2UU9B 1AILA 3IMNA 3SYOA 4FVMA 3TYJA 3SJAC 2EIMB 4EB6B 2BNMA 3KV5A 1EN6A 3NVCA 1UY4A 4YW3A 2WYFA 2IUWA 4PA3A 2NLRA 1WW5A 1JBCA 4RHV1 4TV9A 2D3SA 5JXGA 3T0DA 2XLAA 4OMDA 3NJZA 1XMOB 5FYHA 3JASB 4M3CE 4TQDA 5CFDA 5CEHA 3JD1A 1NAEA 1RP3B 1DQ2A 3AVSA 4FPPA 3NNLA 2ZGTA 1RFYA 4J42A 2VCBA 1GQHA 1Q8IA 4JI5B 1V54C 4KQ7A 3T1YB 2ADEA 1HB1A 3K06A 2WPDG 4JGYA 3OMIB 1JVMA 1H4GA 4FP3A 3A7QA 5ACA1 3ZXGA 4XDKA 3R66A 1JUHA 2GN7A 1DZRA 4PDMA 3W7SA 4X1YA 3O1MA 1AR71 5HI0A 4XDLA 4LOTA 3FWEA 2MEV2 2QCSB 1DGSA 2XHKA 3PU8A 1QJY3 4E2QA 4CCEA 4B3RB 4FVVA 1HB2A 1OHFA 3PTYA 5L3EA 1GKBA 3POBA 3SPJA 2GSYA 1KJRA 2JE9A 1RUOA 2ZGSA 1EUUA 4PJ0Z 1NCRA 5DEDA 4DRXA 4K35A 4G9SB 2WZR1 2JDZA 2H0BA 3SGIA 3K75B 4CZSA 1JYWA 4OPHA 3FFZA 1RUE2 1QGLA 3VUOA 2Y48A 3UGFA 2XAFA 4NIGA 5LMNO 3V0AA 4JGSA 4UCUA 4XF0A 5FCCA 1UZZA 2VBDA 1JQ0A 4HPKB 1OUXA 3ZN6A 3RI9A 5GONB 1PPJH 1NLRA 2ADPA 1BGYH 1KKDA 2YXYA 2WAOA 2W87A 2YPDA 1W06A 4RQPB 2BERA 4HANA 2JD9A 3ZX6A 3WG7C 2BTOA 2WQ4A 3UK9A 3ZX7A 2E74B 4GZRB 4IV3C 2PMWB 2QM4A 3AKQA 3CCMV 1NA1C 2MNGA 3OJBA 4FOWA 4DS0A 1IZ3A 3ABZA 3D36A 5A7WB 3AZWA 2VC9A 1REFA 4JI0O 1TVKB 1OPOA 4OLLA 3PDQA 3OFNG 1NR7A 3L71H 4KH9A 1ASJ1 4AGRA 5LOVB 4TT3G 3DPRC 2HWD3 2GN3A 3J81N 4GWNA 4NHKA 5A6QA 4QNHB 2C9KA 1BHAA 4MGQA 1YHQV 1N36B 2IBZH 3CCSV 5FV3A 3W59A 1SA0B 5CAZA 5E79Z 5D5QA 1K92A 4W4KA 3HKEA 3U11A 2GUZB 1J59A 1VBD1 1Z7S2 1G9BA 3FN9A 3V64A 3M8AA 3WG4A 1YITV 5ABJC 5DDJ3 3ZM8A 4H14A 5IE9A 3N7MA 4QE9A 1KRIA 3S7IA 1GN4A 1WLDA 3ABMB 4DIQA 1Y9MA 3CU7A 1NJIW 1JZ5A 3M3EA 4N9IA 4CDQC 4GMP1 2VNVA 4GKKB 3RJRA 1AR5A 3ETQA 1BS3A 2A73B 3B8MA 4JDNA 5A7NA 1FMD2 2XAGA 2QDNA 1NU1H 1B3QA 1XNTA 3LDDA 4PDWC 4RUEA 3LWCA 4COZA 5BNNC 2IXHA 1YJLA 1S0DA 4WVVA 1XNQO 1ZRFA 5FY9A 4Q4Y1 1SFPA 3FYIB 3I59A 1ZX3A 3ENRA 2P6HA 3BOPA 1Q8OA 3UKTA 2P3IA 4RHV3 4UW6A 4B3TB 5C9AC 4UXNA 2VRZA 2BQPA 3GJBA 5DAQA 5KHJA 1K12A 2UXBO 3V56A 1L7RA 1XU1A 2NN8A 2AYHA 2GMEA 5FZOB 2CV6A 4MW8A 1GH6A 2P22C 4LKDA 4DV6O 2VECA 4LKSA 1SERA 1O6UA 2TNFA 4PHZA 2RS51 3WP4A 4CP9A 1G7YA 3K5OA 1F4AA 1JR9A 5FP9A 3VBHB 3FBMA 1HXS1 1SFNA 3ASOB 3WNXA 1IS6A 4CCCA 1W2UA 5HCAA 4BYYA 1IPSA 4PLOA 2C1FA 4IEOA 3SCGA 1Y7BA 3MYXA 4MUVA 1CX4A 4GT1A 5FPOA 3VHRA 2QVSB 1IPKA 2ATFA 2R042 5L9RA 4JI2B 3QO5A 5JCTA 1YRZA 2W94A 3VDCA 3ZKUA 1AR73 4MYEA 1VP6A 2BV4A 5J96B 3MW4A 1AXYA 4QHZA 4JTCB 1N47A 3LNMB 4YW1A 1OMIA 1W39A 2HWF2 4Q0QA 4XFHA 1RM1C 3N2KB 2BP6A 2YU1A 4IV3A 5IVYA 1L8DA 4NPMA 1NA1A 4LE3A 4FJCC 1FV2A 1DLCA 3SJBC 1QJX2 2AC1A 3CBNA 3JSLA 3ZRWA 1ZBE2 3CKHA 1BMFG 4IE5A 1U0AA 4J11A 4LLFA 4HL0A 3BODA 1W0NA 2A6ZA 2EIEA 2W0FC 1SKVA 4ZPIA 1AJPA 3LOIA 2VBPA 4O7XA 3DPRA 5DG2A 1UPSA 4ET7A 1NH2D 5IWAB 1X82A 4GX1A 5KMGB 3WQ1A 3SISA 1POQA 4D6RA 5C3PA 1HWYA 4HONA 4K3AA 4LMFA 1NKDA 4UVAA 1BCXA 1HRI2 1PMIA 2RN9A 2WWUA 4XJUA 1VAMA 4LHSA 2BUKA 3K2OA 5ABJA 1WBLA 4K6BA 3R4DB 3RZGA 4V2WA 5FXZA 1ULOA 3E8FA 3UGGA 4NRMA 4FFFA 2WT1A 3ZN1A 1GP4A 3CS5A 2D40A 4D6TH 1V70A 2VQUA 4CDQA 4A6SA 3WOGA 1NLSA 4RQEA 1UOFA 4INDA 1ASJ3 3DKWA 5A3LA 3Q8BA 3V0BA 5LA9A 3ZRSA 3MLKA 2IU0A 2WS91 1D0GA 4PDWA 5BNNA 3RRDA 5KAFZ 1VB2A 3RQ0A 1ND2C 4I3PA 2WSSG 2HG5C 3K4ZA 1VBD3 2E53A 3VZOA 3B4SA 4TWKA 5C9AA 3OGVA 4BM8A 5LASA 3IJ4A 1YIPA 2IVJA 2DCYA 2ZGQA 3IIAA 5EJ1B 4AHYA 4MXVA 2WZPP 1GNYA 5KHKA 1XYPA 2EIJC 5FZBA 3JQWA 3OY8A 5LW9A 4GMP3 4NXNO 4YZ1A 2BPA2 1N32B 4CEWB 2ZMKA 4JI1O 1V6MA 4XBFA 4DV0O 2X05A 1SPPA 3I56V 2BGPA 2GMMA 1DTOA 1QQP1 1W6OA 3AK2A 2DE0X 5BV6A 3NXSA 1Q82W 3PURA 1R6KA 1A34A 2JDKA 1CIYA 1K34A 4LNUB 1E79G 3AX4A 5H6QA 4HLTA 4YM0A 2EILB 4LHLA 1J3RA 4Q4Y3 1DGWX 2YI8A 2DCKA 5C5TA 1XILA 3OBTA 5EIYB 3VDBA 3OD0A 1W03A 2E33A 4KBZA 2VTXJ 1MS0A 4U36A 1HNZO 4CU6A 1H6XA 1R1A1 1DK1A 2YICA 3ASIA 4XUTA 3MW2A 1OT5A 3BOWA 3JYCA 2JG9C 4BWAA 4OUMA 4Z07A 3RVHA 3ZXDA 2PYTA 5F3CA 1WA6X 4P9YA 1R3IC 4W6YA 3PL0A 5H9RA 3UCSC 2J1EA 1RUF2 2RS53 1UZYA 3DKQA 4BW5A 2K1EA 4QAWA 1AROP 1KB9F 1HXS3 2CGNA 1R1BA 1AYN1 4LOSA 2AREA 4CSWA 4A4AA 3DGTA 1I5YA 4AI9A 2XPJA 2JEMA 4PA6A 4EROA 3GF6A 2IJHA 4PF1A 3ZOIA 3USSA 2WWWA 2Y60A 4DK1A 3K77A 4R9DA 2E32A 1W3VA 4JHZA 4X88A 2ZKNA 4TUYA 1X8MA 1AJKA 5F2VO 3MUZ1 4LBQA 5IJRA 1O3RA 5C70A 2ETNA 5CYYA 3ZLIA 1JZ8A 2W9XA 2OT7A 5KR7A 1T2XA 4XFGA 1PIV2 1QDOA 4QGLA 3AG1C 1VJ2A 2JIZG 3PUIA 1WN7A 1WKYA 2V4AA 5J09A 3JB8A 3WDWA 1GYKA 4Z1VA 1PO22 4QGMA 5CA6A 2IXJA 5D8AC 3A0NA 2W5FA 3THTA 4X66O 2W39A 4I0XA 2GV9A 2PUSA 2P34A 4GUNA 3BCCH 3CJIB 4O4JA 2ES3A 1VQPV 2D6LX 2UU9O 3CYOA 1ND2A 5FY5A 2IM9A 4PV1B 2VMFA 3ACLA 2CTVA 1AYM1 2OXBA 2A3WA 2IWGB 1POV0 1I08A 4YGBA 3HT2A 2BTQB 3SYPA 3WHTA 5FREA 1NY72 1XNRO 3ECQA 5LXTA 2ZJCA 3VBBA 1LULA 4GQ7A 3H1HH 3RZZA 4LEJA 2VQTA 1C57A 3CD6V 4MGSA 3T1CA 4BQWA 3AKRA 5AFEA 2C5DA 4JI5O 2GU9A 3BTYA 3NWKA 1LEDA 2PAMA 4NWVA 1XJAA 1OI6A 4ORFA 5D2AA 2VZ3A 1E57A 3N2GA 1YWKA 4FPKA 4RGKA 5HBAA 2WS93 3UNPA 2VUCA 2W1SA 4FFIA 2YI9A 1NTMH 1N33B 1GZCA 2J1UA 2W91A 2EJ7A 3OBRA 3BCWA 4CS3A 3FYEB 2GP5A 1H0BA 2VQEB 2UYBA 5J2TA 3OBZA 5I91A 1NXD1 1LEMA 1BZKA 1MS9A 4LULA 5T55A 2EBOA 4HG6B 1AX0A 4IGOA 3MIDA 4GH4C 4QPGC 4YG6A 4B3RO 3JAKA 4UYBA 2JG9A 1Q8PA 3BYWA 4AQ6A 1V6JA 1HDKA 5JCOC 2MW2B 2NP0A 4I2OA 2XKOA 3KG2A 3J7MA 2QM8A 2XMLA 5K1XA 4O9GA 4Q4V1 4NB5A 3MIBA 1W6PB 1QQP3 1ZL8B 1OURA 1IBMB 2HLDG 1E5RA 1ND3C 2DOSA 3THDA 4O4IA 2IH3C 4B3MB 2QWPB 4NKGB 5T5OA 5GLUA 4EE2A 2ZTNA 2YS8A 3VBFC 1ULDA 2HWB1 4W6WA 5F32A 5LWBA 3C7OA 3VBSB 2G9FA 1S77D 5DUUA 4QD2A 3X2QB 2HR3A 1T6BX 4HNAA 3S5QA 1GSLA 3F5WC 4C0BA 3UT0A 4JCKA 3U1XA 5KXBA 2OPWA 5D1IA 1ZUQA 1R1A3 4QDSA 1XOUA 4HFSA 4XUQA 1MZFA 1BK1A 4W8JA 4DV3B 5FLJA 1WCDJ 4XTMA 5BNOC 4NO4A 1M4WA 2Q1ZB 5IK4A 1LR1A 4JZ2A 3RYHB 3O1PA 2XL7A 3CCRV 4QQ2A 3ABKB 5A6ZA 2D5FA 2OT5A 4BIZA 2A0LA 1PHMA 2VQ0A 3IKWA 2RM22 2UXCB 4QXHA 5DAXA 2EXIA 5D8AA 4JKKA 3SEPA 3TGUH 1FXZA 1QNMA 4A6OA 1Q8QA 1WLEA 1UOGA 1I1EA 5LEKA 1LAJA 1ZSPA 5IVEA 3N7LA 4NIIA 4D8MA 3GM8A 2RJZA 3LOBA 4HKOA 5SV8A 4XJ8A 4EV0A 4R50A 3WG1A 1ULCA 3KVAA 4ZI7B 2D98A 1U5ZA 4PCRA 1BBT2 5FPRA 3IDBB 4LFAB 2M7WA 5L3BA 1MZ6A 1CAVA 5FYMA 4XBQA 1WA8A 1SQBH 1QVGU 1YQ8A 3WB1A 3H0OA 5FKBA 5JJJB 3WQBA 4NTXA 3POEA 2CAZC 4XF3A 1RC6A 2D93A 2J1SA 1JOYA 2B45X 4GKKO 4DUZB 4FQ4A 5FP7A 4Y22B 4Z2AA 1UY0A 1WB7A 4E2LA 5T50A 4FSJA 2HWE2 4FXKB 4BAYA 2DDUA 2EA7A 5B1BC 1IDSA 2VO5A 2EXKA 1T5EA 1AYM3 2W52A 3BY6A 5LA1A 3BKZA 4SLIA 2ARCA 2K2SA 3J7HA 4B3TO 3N9PA 5EWSA 5BNQA 1OBNA 3BHPA 2Q69A 2WLIA 4GH4A 4QPGA 4I30A 4HVOA 3QO8A 1EV11 5GKAC 2PN5A 2ZINA 2HEWF 4N9HA 4CU9A 3GB7C 2ITCC 5JCOA 5K1PA 3RYCB 2KXLA 4EN6B 3M1HA 2QGNA 5C8CC 3DSQA 1BQZA 4GD4A 1NS1A 4X1IB 3O0XA 1FPN1 3VD4A 2R9IA 4QX5A 4DY3A 1AHSA 5J98B 1ND3A 3A0HZ 1UYZA 3GBGA 1WP8A 2WAAA 3VBFA 4X1YB 4AAXA 3J4UH 1PNGA 1N4CA 5I8SA 3WFVA 3FAVB 2R061 3SH4A 3OTOB 5IK8A 4XCBA 4JI2O 2WNEA 2GHYA 3A2FA 1V6KA 4NRQA 3ZIXA 4QXBA 3ATGA 4ISQA 2Q8VA 3K58A 1TQ5A 4IQPA 4AW7A 2PHXA 5BNOA 3W21A 3BTZA 1GMGA 4FFGA 2YIBD 4LWSA 3WINE 1W2BU 3SMHA 1RSOA 4Q4V3 3DXRA 3M7AA 4PI2A 3TAYA 1UQXA 1AL21 3V0AB 2BVBA 1VF7A 1NT0A 1C28A 5KHHA 3AVRA 1LKNA 2L9LA 3T0BA 2ZCWA 4Y1UA 3LPGA 4GWIA 4YJ3A 4OI2A 3H9AA 5IWAO 1POV1 2R0HA 3JD4A 3GHNA 3AKTA 2FCTA 1AXZA 1G4YB 4X89A 3PTRB 1KQRA 3ABLB 5IYZA 3CCEV 3RWRD 1X7NA 3GBWA 1S0CA 1XOYA 3H01A 4DRRA 1V00A 3CIHA 1OCOC 3J8F2 3AMHA 3BVOA 1QJFA 3JAWB 4LHKA 3PJYA 2UXDB 2QUOA 1OJHA 4P9WA 3U78A 4HK9A 3GBFA 4ZU7A 4G28B 5KXEA 4I4TB 5IJ0A 3H1IH 2XL9A 2HVKC 3PVNA 4XETA 3ZHTA 3ES1A 1WW4A 2KQXA 4NE9A 3RS6A 4FLYA 2E51A 4C0HA 3VZMA 1RHI1 1RUD1 1UJWB 4A2UA 1WD4A 1OKQA 2ITDC 1AZDA 3VQYA 5FZHA 3IN9A 2Y0IA 3N3HA 1PVC2 4JI8B 2CYFA 4CXYA 4MTOA 1J1LA 1GOHA 3RMYA 4LO8A 4O2BB 2A3QA 5FUNA 2D3RA 5G04L 4DPNA 4OCTA 5KA5A 2HWC1 2VMIA 4AWDA 4P30A 1QXJA 3AMMA 3WP5A 4QPWA 2XTAA 4YIPA 4ZONA 5C8CA 3KKYA 2QWQB 4LBEC 4XILA 3H1LH 3Q9OA 1C1FA 1N32O 5FYSA 4NR1A 1SLBA 1FFTB 1NVPB 4PI0A 3MFAA 2BTVC 5A1FA 4D6QA 2XJRA 5JXHA 1U12A 2Q8EA 5IWFA 4S2GA 1SZXA 1YJNV 4ZOLA 2FCUA 4WZFA 1NBMG 5K7PA 3TK1A 1HNXB 5A3NA 4JPRA 2FKXA 4XAAA 4HBNA 4A3XA 3ZIAG 3PUHA 2AUYA 4JKMA 1R082 1EV13 2QEXV 1XUQA 2ZCEA 5C71A 3KF3A 4DZGA 4AYUA 3OMAB 1SDDB 5LZ6A 4BJ0A 2QQVA 1QOTA 1ZYBA 2MEV1 2OIEA 2P4EA 4XABA 4LH6A 1BK0A 1FFXA 3JD73 2ET1A 3MHZA 4XDPA 4FK5C 4EFBA 2XOMA 4ZXEA 2BRTA 2Q30A 2VZTA 2R063 4JAUA 4HVQA 2PHFA 2QKDA 2UXXA 3QVNA 5C4WA 4LKFA 1PK6C 1IQDC 5LYJA 3N9OA 1NA1B 4XVHA 1LOGA 5GZCA 2A1XA 4GZ9A 5EYYA 1Q81W 1BE3H 3ZRWB 2ORXA 4IV1B 2ZABA 1HNWB 2JDIG 1SG3A 4N53C 5BMVA 1RUE1 1CGPA 3D4KA 1MA1A 4KFMA 5JR7B 4AFCA 4UWDA 1NQJA 2OYQA 3WZ1A 2D2CB 4PJYA 3CE2A 3K9AA 2JKBA 5FJKA 5H9PA 1BZWA 4TOIA 1AL23 4LUKA 4QX8A 4FTBA 1OLMA 1K4DC 1F15A 1OFNA 4WM7B 1LU2A 1OV9A 4R8CA 4QPIB 2VD7A 5FWEA 1MR5A 4QGPA 1JZ7A 1DGRN 5FP4A 1YVWA 4Z82A 5E1AC 4NMIA 3HKDA 5FXXA 4LO6B 4YM3A 4HZFA 1G9FA 2CTPA 2A6WA 4GKXA 4E4ZA 3ZHQA 3RT3C 3CPWU 5ABJB 4NHMA 2J1TA 1WMEA 3O5SA 3LDEA 2A79B 2V4DA 4LIUA 5FZIA 5K0UC 4B1MA 2ZKOA 4DXTA 1M1KW 2LUWA 3HR0A 1OUSA 3ZFGC 2DU1A 2V1DA 4NXMB 3LZZA 3ZYIB 2J7MA 1ST8A 3KCCA 3WXPA 1MMMA 2ZDIC 5JAXA 4IEZA 3AP4A 2ARBA 3AC0A 3FD9A 4ITCA 3L2HA 1M57C 1ENRA 2ZE5A 3J9SA 2ZNJA 3T08A 4L99A 1DQ5A 5HFMA 3AZVA 4DV4B 4Y5SA 3CC2V 2W1UA 4QIWF 3QOPA 4OI0A 2DFCA 2BCCH 4X8AA 1TZOA 2F4PA 1Z7S1 3WB0A 4Z8BA 4AFBA 3A0RA 1G1XB 5C93A 2K46A 1RHI3 1N33O 3ILNA 1E5IA 3H1YA 2UUAB 1NE6A 1THZA 5B1NA 4FLZA 1KMIZ 2VQEO 2RG4A 1E1QG 4BQ1A 3KLSA 1WWYA 2D6MA 4UFLA 5BXXA 2EIBA 4XUPA 4D69A 2XAJA 4UBGA 2A71A 3I97A 3OY8B 3I3EA 2RMU3 1SF9A 3RDIA 1FMD1 2EIMC 2HWC3 2XVKA 5CG8A 1SPPB 4BMBA 2HKXA 1UMIA 4UV8A 2OX0A 3B00A 2QKAA 3ABTA 1VB4A 3WF2A 1TA8A 3HNYM 5J37A 4OHXA 1J83A 4O4LB 2VZOA 2LO1A 2AXTZ 1IBMO 5KBFA 5EC2C 4B3MO 5B3SB 2VZSA 3GZAA 1PNLA 1CAWA 3B2EE 2IJIA 1QJEA 5FNVA 1WMXA 2CUGA 1F4MA 2ZGOA 1RM1B 1PGSA 4YM1A 1PK6A 2A6VA 1ACCA 2Y6LA 2GALA 2Q5ZA 1R6TA 4P2ZA 2I45A 2V4VA 5A32B 2R9AA 2VM9A 5FZ7A 3POFA 4YG0A 2OQ6A 2QBXA 5CIRA 3EVKA 3AFGA 3SR2C 4YJ2A 2R041 2OWOA 1DHKB 2VTFA 2UXCO 2A7AA 2UUCB 1EUTA 2MEV3 2JG8C 3WSOA 1UPGA 4TTGA 4PIZA 1J5EB 3I3BA 2FB5A 2O8QA 3D82A 3ZHSA 2HWF1 4TUYB 5FO8B 4EN7B 4IEXA 2NM1A 4LBQB 4DB5A 4AEKA 3TEWA 3LSEA 4LT5A 3PIGA 1QJX1 2NNUA 3VD5A 2YEVA 5IYCO 4WFBV 1ZBE1 2A75A 5GZGA 3AYDA 4P14A 4CRQA 2DUOA 2NMNA 2WFF2 2JENA 4LFAO 5K0UA 2P3YA 3MIHA 4LF9B 3AK0A 3ZFGA 4LA3A 1RUE3 4QPJA 3K08A 2XJVA 2FZ1A 2ZDIA 3KVBA 5FMOS 3HQRA 3G4SV 2VBBA 2PHWA 1N0JA 2DW4A 2R72A 3R0RA 4RQPC 4YY3B 4CC5A 4EKWA 1HJGA 1DQ6A 2PI5A 3S6PA 4U2AA 4Y1ZA 3UKMA 4JAVA 3O1OA 1HRI1 3AM2A 4QB2A 1GAXA 3OCPA 1ND2B 3BA8A 1LUVA 2WWJA 4NYKA 1AR92 3ZMOA 3FMGA 3BI3A 4IETA 2WWSA 2DV9A 2EINB 1Q7YW 3ZYBA 5CA0B 4B3NA 4XPVA 4DR2B 1K5SA 1ALYA 3M99B 3B8NA 4R9AA 5CISA 2E31A 1W8WA 2AW9A 2Q67A 5IY5C 3JAMN 1R3LC 4ABMA 3D5OA 5IFPA 1IQAA 5DZGA 4EB6A 3ZFEB 2JJ1G 4IESA 2BZDA 4TXWA 3MV01 1Q90D 1H1MA 4XC9A 3N2GB 1NZ6A 1H38A 3CF6E 4M3CB 4FBFA 4DUWA 3ZPYA 3FHIB 4IYIA 5FLHA 1CX1A 2AH2A 2YB7A 4XW3A 3CHXA 3JASA 3L73H 1Z7S3 3OGGA 3ABMC 3ZXKA 3GWOA 5J2TB 5KXDA 1LHVA 3J80N 1L7QA 4EN9B 4WFGA 2CTQA 4J80A 4O65A 3HIFA 4MZUA 1CAUA 4AR2A 3GCXA 5T3NA 3OTOO 1QEXA 4CUCA 5EQUA 4JV5B 3JAKB 2JG9B 4PT6A 3VKMA 5C8YB 1W8HA 3UJOA 5GZDA 2ID4A 3ZYRA 3GYDA 1BQPA 2DWRA 3ROUA 2WLMA 5J2UA 4MVOA 4K9SA 4DEVA 1K42A 5A7OA 3WT3A 1HRV2 5FPVA 3AMNA 4DY5A 4AFAA 4TV8B 2LROA 3ZJZA 5FBZA 4Z92B 1UXZA 4F4LA 5EK0A 2CH7B 2GZWA 3AXDA 3PJQA 3EMRA 3P5BA 2X6CA 4FM1A 4ZY9A 3BU7A 4J1WA 3CCLV 4NWWA 4HNAB 1XQNA 3CRRA 1WLTA 5FPLA 4MV2A 1GM7A 3VBHC 3IDCB 4C1WA 1S0JA 3CB2A 2Z5UA 2W92A 3ASOC 3IBMA 3WW1A 4IEQA 1RUF1 1AP6A 3VBOC 3AG1B 4PQ9A 3ZYJB 5F37A 5FP3A 1ZTEA 3I5DA 3HJRA 1TNFA 3UM7A 3C7HA 3GZTB 3MLJA 1SLCA 5CBLA 2HVJC 4HPKA 1PZ8A 1ENSA 3KZIZ 5GONA 1J95A 2HYXA 3TXQA 5A7QA 2UXDO 3HPNA 4QX0A 2P6CA 5KXCA 1W04A 4RQPA 4QQPA 1YF2A 2H3OA 4UF0B 1FV3A 1OCZB 4J9YB 1GWKA 4I55B 2HWF3 3O1VA 3PN1A 4M3CF 1PIV1 2YC0A 5A7WA 3M8LA 1AX2A 1S5JA 1QJX3 3LA3A 3CJHB 1ZBE3 1NX9A 1TUBB 3AP7A 4ASMB 5LOVA 1N1YA 1QLEC 4Y3OA 1PO21 3F5TA 4OHYA 4WM8B 2ZPXA 3ZSMA 3W7XA 4ATEA 3T1MA 4EWAA 1D0HA 2WLKA 2WQZC 3IMMA 4PBPA 4YWAA 3TB0A 2YC4A 1SA0A 4UB8Z 2R49A 3FFQA 2GUZA 3E6BA 5B5EZ 1N0NA 2GNBA 4U7NA 2XLGA 1YFYA 2RDCA 1W6NB 2JDNA 1K45A 1HRI3 2DMXA 2C6SA 3HMYA 4NVPA 1NY71 2FDGA 2CWMA 2Q0OC 3SPCA 2UUBB 4I09A 1QNYA 3K0DA 1SMVA 5IJ9A 5FZGA 3OAAG 3APBA 1ZVFA 3OUSA 4K1ZA 3TXSA 4GH4B 4QPGB 5J1XA 2H6CA 4EN8B 3MHSC 5FL7G 3G7DA 1VIBA 3T4DA 5A33B 1VQMV 1NOVA 4CH3A 4R8HA 1W9WA 1HNXO 1SCSA 1FI2A 3G6JB 5FQ0B 1AI5A 2VUJA 2XJQA 1V9U2 4H44B 4AVAA 3IGAC 3B93A 3IC7A 4EYUA 2Q9LA 4UFMA 3VBFB 1QDCA 2CL2A 2P37A 2YZ4A 4RO2A 1MQTC 1PKXA 5FZOA 4ES8A 3ZN5A 3JD3A 1CIWA 3JB4C 2OUHA 4XFFA 5JXIA 2BGOA 2XNDG 2Z3YA 4AAPA 3FB6C 5CB4A 1XNBA 2GMPA 3VBHA 4BXFA 4YGDA 4XEZA 3VZLA 1Y3TA 1I5PA 2GAUA 3INAA 2YIAA 1NZIA 2R9RB 5I93A 1GN3A 2CTRA 1UD1A 1XMQB 5DQ0A 2N05A 1GRJA 1GU3A 2P90A 2LW8A 2EILC 4LF7B 2DVAA 3DF0A 3DXRB 3JQXA 1HNWO 2Q7HA 4JYCA 1ENXA 5CB7A 4QKNA 4I7ZB 2B4KA 4XJAA 2DWEC 4D7SA 5EC1C 1AI4A 1ZAUA 2XHBA 3N2KA 5FYVA 2PTMA 3LDBA 1EZVH 4LBJA 4LO4B 4F3JA 4NTYA 2Y6HA 1G9CA 1M9NA 4XQWA 1BKZA 4LXLA 2QWOB 3KGZA 5JVVA 1J3PA 5F5IA 4JDOA 3H1KH 1FYJA 4JX0A 1KQSU 2G1MA 2WO2A 4Y5TA 1RUF3 3OF1A 4BLIA 2RM21 1ZA4A 4AVCA 1AVBA 2RDNA 4N23A 5KMGA 4FOYA 3P3NA 3M4FA 5A2QN 2R072 4NXMO 3WDUA 2Y6GA 3THCA 1P8JA 4IE6A 1JYXA 3IC9A 1PL4A 3IAQA 1QVFU 4CU8A 4C1XA 2LQTA 1VRH2 2DUPA 4DV4O 3EJKA 4COUA 4UOJA 1QU0A 4RR3C 5E89A 5B1BB 1BBT1 3L75H 2QDRA 1OLRA 4JI7B 1AF9A 5LA6B 2F43G 1WLWA 1NI8A 1F8VA 1K8AW 5FZ4A 2Q68A 1H9WA 2UUAO 3PJSK 2QFEA 4RYDA 4QM8A 1O4YA 2RR12 1YQCA 2WT2A 2WUHA 3KT4A 4GJYA 3KCXA 1RUJ2 1DIWA 4QPKA 1H30A 3SPIA 5F1RA 1WW6A 1REDA 4ES9A 2XASA 3J7NA 4BH9A 2Q0AA 3E83A 1N1TA 4M0HA 3E86A 2HWE1 2Y38A 4RN5A 1I3HA 1O5UA 5A3WA 2XOKG 1N34B 3N9QA 2TBVA 3ZSKA 3CRQA 4LBNA 2FCVA 1D5AA 1HLCA 4FMTA 3WDVA 1C3HA 5A3TA 1BJQA 2GH8A 2GNMA 4QKDA 2KR2A 5HCBA 3H3LA 3U0ZA 3RVZA 3Q4HB 3OM3B 5L3FA 4QX1A 2DYRB 5HCFA 1CD3G 4XQDA 4DR6O 4LNUA 1YUDA 5F5QA 1OSGA 3LKJA 2D7FA 4NAMA 2YV8A 4OMCA 1FYUA 4QQLA 1U97A 3STZC 1CAXA 3SKVA 2RS33 1ZA7A 5C3SA 1LTEA 3SITA 5EZYB 3T1HB 3C7GA 1FFXB 1Q6IA 2VUDA 2DN9A 4QU1A 4MHRA 2P67A 2UUCO 2G9ZA 4CCLA 3K5NA 3EBRA 1J5EO 2JRIA 2ZHNA 3UO3A 1BMV2 4B4PA 2YHJA 3WW2A 4R9BA 4IEYA 1XBFA 1PZ7A 2WFPA 3FHQA 4JTAB 3RZKA 4ISRA 2HJIA 4GIQA 2TUNA 2DVGA 5FMCA 4FLWA 2JECA 4P9GA 4LF9O 5CFCC 3OBAA 3B9IA 2VMEA 5KUKA 4GWJA 4OUEA 3I49A 3AZYA 4QXKA 4YY3O 3X29B 3WY6A 3PUSA 3GVMA 3ZCCA 2W6JG 2GC0A 4ZU5A 1HQWA 4FFHA 4GA9A 3NNFA 1UKRA 2PHRA 1PNFA 4AILC 3J8F1 1VMGA 4BQYA 2MK3A 5AG2A 4NOTA 2GC3A 4DR2O 3QG5A 1B35B 4LBKA 3G6EV 4UT5A 4JV4A 4UCOA 4CH5A 5DN2A 5KAIZ 4MW3A 1DYKA 3MO4A 3CJIA 1GM8A 3ZRXA 4XF1A 5EIBC 4UCSA 4LH7A 3M3OA 4TLGA 4JZRA 5F39A 2VZQA 3ACGA 1H1IA 1OLQA 4S2DA 1LCLA 2C26A 2HWD2 2JD4A 5EJ3A 2BTQA 5JOWA 5A9GA 2EIKC 3H1JH 1KS4A 5DAPA 4IE0A 5FZDA 4RL7A 3MFCA 4LORA 2XKPA 1BBT3 1PVC1 3USUA 3SDLA 5CA1A 1BLZA 1LOBA 4DXWA 1X33A 3AEIA 1YYNA 4P9JA 1R092 5ERLA 1NG0A 3MPPG 2HP8A 4HMZA 4Q20A 4YZ4A 4QQHA 1WD3A 4JV5O 4GKYA 4HN1A 1IBKB 4JGZC 3LSSA 1OVSA 5FY4A 1ULPA 1YO8A 2Q8CA 4ZHNA 4K1YA 2HWE3 2XVGA 2JXAA 1OKOA 1W3XA 1EN4A 2B9UA 4DXRA 3WDXA 2FHRA 3RYRA 3MD0A 3QBQA 1RJ7A 2D44A 1NH2B 5KLVH 2VW2A 4QJFB 4DMIA 5JOZA 2X0LA 2A3YA 5FYZA 4AHCA 2SBAA 5GLVA 3ZR5A 4R52A 4CPBD 2JGUA 4GKJB 1R081 2P06A 1GNHA 5JLVA 2A3XA 3VBRB 4FTEA 2F93B 3NNJA 1ZL8A 4PD4F 2QA4V 1NZCA 4Y1YA 4YG3A 1UL9A 2RHPA 4IL7A 4N53B 4A7KA 3G67A 3SC7X 3VZKA 1MVQA 4H7LA 1DBNA 4META 4LKEA 1ZWIC 1VBA2 1JJ2U 3JU9A 1Y6XA 5LBEA 4AHZA 3IFXA 1J3QA 1YJ9V 3EXAA 4XUOA 3VKFC 2DURA 5EHDA 4YARA 2W46A 1RINA 4DNYA 5FK7A 2XXZA 4HYOA 1PM9A 1W8FA 1YFUA 2LRPA 4KG0A 3TBDA 3OE7G 3NSTA 5H9QA 4IYHA 4CUGA 3I2OA 5JZGB 3ZFFC 2B9VA 4L87A 3QO7A 1FOD2 4AVTA 1MZ5A 2F66C 2LGWA 4MSWC 3ZFGB 1G8WA 3UL2A 4X8PA 5FO9B 1OZ0A 4AG4A 3B94A 1W9FA 3POYA 1SBDA 2VOXA 1UYYA 1M57B 3NAPC 1QU7A 2V73A 1ODMA 2ZGNA 3OYWB 3RZLA 1D5NA 4Z2WA 1XSRA 1G9DA 4ZI7A 2WLJA 1YJWV 2OTLV 2NR5A 3CSXA 2JGDB 2A06H 3ABLC 4LC1A 1OA2A 2IJJA 4V1PA 4QXCA 3BALA 1XEQA 4BA6A 1AR83 1IPJA 2MPFA 2IFRA 1JOPA 3JUUA 2VG9A 5CMUA 1Y9GA 1QMJA 3SNMA 1SETA 4Q8KA 3AG7A 1JODA 4Q5OA 4AGVA 3J8F3 4RSUA 4MVRA 1W9SA 1U5IA 2EX3A 4XFCA 1Y76B 3P6BA 3WNLA 4Y22A 3NJYA 4XTPA 2RS12 5F2WA 3CP1A 4YHHB 4URTA 3P1IA 2B1GA 3ZRVA 3ZXLA 1IBLB 3TCUA 4COVA 4JGZA 4ONUA 5DAVA 1CVNA 1XYOA 1YHFA 4QX2A 1MS8A 2Y0OA 1H2KA 3MGUA 3RNSA 3ACFA 1KFXL 2UWBA 4ZKIA 4XMAA 4DRVA 3FBYA 2PELA 2OCCB 1CAUB 3RVYA 3OG2A 3RYCA 5DM6V 5JSOA 2ORZA 2Y64A 4QB6A 4X1IA 3ORJA 4E2GA 4JQRA 4W50A 4DYLA 1YCIA 3PNAA 1MS1A 2D97A 3IDEA 5J2UB 4DV1B 3VBUC 2HHHB 5FPAA 1VAVA 3FB8C 1UPIA 2JIJA 3ABUA 1OOPB 5DZFA 5LB6A 3T30A 4AI2A 3FAVA 4LF7O 4M4PA 1ZRDA 2PLV2 4FLTA 5JPMB 2B46X 3HOBA 3AJZA 2JG8B 4XDQA 2YUEA 5LHGA 2XWBB 4BPZA 4JASA 4P9PA 1J1TA 2VGDA 3BUCA 1EZJA 4Q2FA 2BE3A 4EJRA 1W2OA 1GUIA 2UYAA 4Y26A 2ATKC 1J84A 3RPQA 2DYCA 3LA2A 1Q3EA 4U3JA 4AF9A 2BFUL 5CKNA 1K4CC 4M00A 2QR4A 1CWPA 3E22A 5KUMA 2YROA 3AP6A 1XC6A 3AL6A 4BMEA 4OZXA 1L3JA 1YDXA 4E9KA 1OD5A 1H8TC 3OGJA 3TEXA 3I2DA 4KL1A 1SRYA 2A7WA 4OHWA 2ZEXA 4A45A 2V72A 5LK7B 2W08A 4CDXB 2RJLA 4D7YA 1SHWB 4IV1C 5A6YA 4KP4A 1U5YA 1AUYA 1PMHX 4G4FA 1SZTA 5F6KA 1TGOA 3O12A 3JAWA 3L9DA 2WFF1 4JI7O 5BR8B 3ZPOA 2WA4A 1JOJA 3MZHA 4I4TA 3NV2A 1SBEA 4MVMA 1HQLA 2C4XA 4FI9A 4WM7C 5IY5B 3OR7C 3SH5A 4QPIC 5I0RA 1UAIA 3MW3A 1SLAA 4GJZA 2D3OW 4MGZE 1JZ4A 4DINB 1QXPA 3ZYGA 4AQSA 4XF9A 1IHMA 2K9ZA 1MS4A 1JN2P 5BYNA 3JATB 4D0QA 1KXGA 1APNA 3U10A 3DXTA 3E97A 2BBAA 2JDUA 1AR91 3CX5F 1URXA 3JXSA 5JPNB 1I94B 4JTDB 2P7TC 4O2BA 1JU4A 1DGWA 4DO2A 3H1WA 1EYBA 4Y24A 3OW2U 1UO9A 1WMFA 4JI4B 1N34O 4XYXA 1IKQA 2IXLA 4IE7A 4L97A 4ZHQB 1X59A 5IJ9B 2XJPA 2L35A 2ZHLA 4OPAA 2WLQA 3GALA 3LIGA 1UIJA 3E35A 3PUAA 5HCHA 1GV9A 5HXVA 3LEMA 3VBUA 2KG7B 1HIXA 3BRCA 5EXOA 2B7YA 2VWJA 1UU5A 1CXZB 2E9QA 2X8KA 3T2TA 4GAZA 3E1F1 3RWNA 1D2QA 3O0VA 1BQ0A 4JF3A 4S2HA 2E6VA 3MPBA 2BWCA 2P3JA 3T1HO 4WF9V 1PZ9A 4YW5A 1LB2A 1TNRA 2WQ8A 1M56C 5CB4B 3IPVB 3CMAV 4L9BA 1BSMA 4AK3A 3KM5A 4AOCA 4MT8A 1YI9A 3NR7A 1TG7A 3ZSLA 4NAOA 4LIVA 3LDCA 2CNAA 2HH9A 4Q0SA 4CUAA 3VBOB 1SQQH 1HJFA 4MG2A 3PU3A 2DYSC 1HRV1 4AQ2A 5ACA3 4FLUA 3LFIA 3PVOA 1KP3A 4PELA 1JYNA 4CH6A 2D6KA 2QQUA 2WL1A 5B3SC 2NZ9A 2OUJA 4O2AB 5KWRA 2BOIA 1XI1A 3WD5A 1H8TA 3D3IA 4CCOA 2Q5TA 1OHHG 4UFHA 5TSWA 4LBOA 2ZHMA 3E6DA 1TEIA 3O9OA 5JVDB 1L1FA 1V6IA 3ES4A 3D0JA 2VW1A 2ZD9A 4XE9A 4IV1A 2F95B 2Y34A 1AR62 5EFUA 3M7MX 5FMDA 1RJ8A 2WZR3 2PI4A 2ODMA 4CVUA 2ZMNA 3OSDA 1AR4A 3CDZB 3W7WA 4NUBA 4EFEA 1OQDA 5CA3A 1XB9A 1QLEB 3LGRA 2F4VB 5FZEA 2ZIOA 2EAKA 1SS3A 3GZUC 4WM7A 1OA4A 2FDKA 4RA0A 4W6XA 2WIIB 4QPIA 4LPLA 1K73W 1J58A 1JI6A 1LHOA 2QDOA 4CP0A 4OI4A 1ZBA2 3B7MA 5A7PA 3WNMA 2YUAA 2P5OA 2HKOA 1LHNA 3ZBHA 5FUPA 2J1RA 1JW6A 1YJKA 1NYWA 1RUG2 5L19A 2XVLA 3KZ4C 4QPYA 3ZXJA 4ASUG 1VQ6V 3RYFB 2BGCA 5JDBA 1KP2A 1F7YA 4BIFA 2HLEA 3D8CA 1MZEA 3SYCA 3H8UA 1RUI2 1GN2A 4D94A 4Q0UA 1WMDA 3OR6C 5IAXA 2QE7G 4W4ZA 4WVZA 2EALA 1JYIA 4BIOA 1TME2 5LBQA 4IT5A 1UOJA 3JCZA 4XHXA 1O4TA 1H2SB 5KHIA 3F7YC 3ZN0A 1VAKA 4FM0A 3RFRA 1ZREA 4ZKTB 2WZ8A 2EINC 4OQ8A 1KC8W 2WN3A 2CHHA 2ZE8A 3BTXA 2E3CA 1SQPH 2P2KA 3LPFA 1AR93 5T5PA 5FY8A 2EVXA 2HYKA 1CQ9A 1MQTB 4KI5M 4CDUB 1UMZA 2JB8A 1UX6A 3WNOA 3TN92 5BPXA 2PAEA 2YU2A 1ULEA 2Q8DA 2KSDA 3W7UA 1QH6A 3RBZA 5LY2A 4UUJC 1DLLA 1SLLA 3ZFEC 1CZSA 1LHUA 3FX3A 2VXJA 5JMCA 4FTSA 4GKJO 3H3UA 3FKSG 1ZZ9A 4O4LA 3B40A 2W95A 1V9U1 2Y26A 1VQLV 2DCZA 3AK3A 5C6CA 1BL8A 4K0KB 4UCVA 1CAXB 2C24A 4LBQD 1YTFD 1K5JA 1PP9H 4LJHA 3S3XA 2JDPA 4FOQA 2FDHA 1P7BA 1JFFB 1JMKC 1K5QA 3AP5A 5JXJA 2WINB 1QOOA 1FT9A 3FLRA 3RWKX 2WLLA 5KC6A 2Q73A 4LF6B 5A32A 3SPGA 3WG2A 2ZZQA 1VMFA 1VPHA 2ETEA 4A42A 5F3GA 1I9RA 1W8UA 1EM1A 1TE1B 3LFMA 4NPRA 1KU9A 1XNAA 3WUDA 4XFBA 1F4NA 1HRV3 1QOSA 1S0VA 1DQ1A 4UBHA 1UZVA 3K9SA 1XNQB 1OC1A 1XHZA 4OX9B 1QXRA 2OPKA 4HXCA 1AJOA 4J41A 1RPRA 5LMUB 1PMJX 3UJQA 3WQ0A 5C3OA 1RUH2 2D43A 5ANQA 2GH2A 2UXBB 3HT1A 3LIHA 4BU2A 4RR3B 2HJDA 3KD4A 4RD7A 4DV6B 4DR7O 1ODNA 3PVEA 5FP8A 3DC5A 2ZGLA 1H4HA 3EQEA 3AG3C 1NCQC 4CCKA 3R6SA 2PA7A 4JAAA 1GNZA 4UAPA 5E16A 5LATA 5C33A 2R071 1LHWA 5FY7A 3OUHA 2C2AA 3UESA 4V2VA 1OCZC 3OPTA 3ASNC 4PIXA 2FBEA 4Y33A 5JMOA 4BHPA 3SXWA 1C4RA 1VQ7V 1VRH1 3CMGA 5L3CA 3ZHRA 2XDVA 5CA0A 4AI0A 1IBLO 1E5SA 4UCRA 3H7YA 4UW5A 5F5CA 5FYTA 4H13B 4FPJA 1Q86W 2DF7A 5IATA 1HB4A 2QQOA 1XMOO 2YXSA 2I74A 5AC92 4E4SA 2WSUA 4CXXA 3BA9A 3LSUA 3USUB 4WM8C 4FOVA 3VB9A 3A21A 2VVFA 3WVJA 5CA1B 1TMF2 4CS4A 5FZ0A 3F7VC 4NHYA 3A23A 5ANNA 1VQ8V 2RR11 2P3KA 2VR4A 3AP9A 3N9NA 3ZFEA 2BSKA 5FPBA 3T1YO 1OH3A 1QQCA 4GX2A 1O5LA 1RUJ1 2Y8KA 4M3CA 2ZKLA 1H2LA 3VDDC 3OT7A 2GBOA 1WB8A 2XWJB 4JDMA 2PHUA 3V65A 1W6QB 4W4LA 2J1VA 4DV1O 1GLHA 1B04A 2HHHO 1W6MB 1ZZ8A 1Q56A 3WF3A 3I55V 3KV6A 1YLLA 3LE0A 3FL7A 1K3EA 5FZMA 2X5IC 1H2GA 2FYUH 5C8YA 2NLJC 4YNIA 1VBB2 2WNOA 4YVSC 5A7SA 1HN0A 4GXLA 3PHMA 5FOBB 5D5PA 2X10A 2WNVB 4TV8A 3KHBA 5LEJA 2CWSA 1BEV2 2CH7A 3VV1A 3NV4A 4X65B 5IT9N 4P9OA 1VIWB 1V9U3 3J7LA 4JTOA 3RG0A 5CFCB 1O9GA 5JI7A 4DQAA 1CR7A 3HB3B 3LCPA 2FDIA 1NTZH 1MSWD 3JD72 3EFFK 4F7ZA 1W2NA 2YPJA 4QX3A 1V9PA 1Q8VA 1B6QA 5DXDA 5CFDC 1LESA 1GR3A 1BMV1 2BYVE 2FDFA 1WZXA 3C90A 1FAFA 1EFRG 5A3MA 1AYN3 3GHMA 4RAIA 3WLUA 2UURA 4U7OA 5LP6B 3QNEA 1QBZA 5BR8O 5F7UA 5DUVA 4KUMA 1X50A 1W59A 4UF0A 2GC2A 1IS5A 4XCAA 4CCNA 4I55A 2VOWA 4AEMA 1N36O 2W1WA 5EBLC 3ZHVA 4XAEA 4MO3M 4ZZ8A 5BY1A 2PAKA 2VMDA 3HQXA 5L7OB 2EZPA 5TISZ 4YGEA 5FLIA 2X29A 4NIHA 2EIKB 4L8JA 1CESA 3H42B 3CJHA 4L2NA 1TUBA 4COWA 1A32A 5T52A 2RDSA 1Y67A 3F95A 4WM8A 2ARHA 1I94O 3NRUA 3ELNA 3KWVA 1YI7A 5BY5A 2YDEA 2Q4PA 3HKCA 2KB1A 4HK8A 3O1SA 4LK6A 1M90W 1U5XA 4UV9A 1KFUL 5KX5A 3GGLA 4J1XA 2R073 2AEYA 1ENQA 5KHGA 1GMMA 4AHXA 3UT5B 1W6NA 2HWD1 4JGZB 2WA3A 4IUGA 2ZE6A 4JHTA 4YW6A 3T2MA 1V6LA 1VBE2 1QNWA 2OS2A 4DFSA 4E4HA 1XE7A 1D4VB 3M3CA 2LW7A 3RYIA 1AX1A 4IIJB 1PNMA 1R091 5A33A 5FLXN 3A8TA 4WFHA 2WSVA 3MV11 5FQ0A 5CZKA 2FL4A 5BUVA 2XHNA 1RIRA 3S57A 3ZEDA 1RUJ3 2RMU2 5GTIZ 1WPBA 3THPA 1P7GA 1SBFA 2VPVA 3CCJV 3ETPA 3I2JA 3L2YA 1YIFA 4ZBMA 4HKLA 5M0TA 2ZX3A 1RTVA 5FRAA 2CTWA 2OIGA 1XNRB 2ZR2A 2CGPA 5IDJA 2HFEC 1YC61 1PM7A 1NQTA 2DYRC 4ASKA 5F3EA 4MSVA 3LEGA 3NMBA 5JR2A 3CNAA 4H0LB 1N3PA 4XQ4A 2ZM6B 5CNAA 2VMCA 3ZMNA 4K8XA 2ZX4A 4U3JB 4GALA 3ILFA 3ZFFB 3DXUA 1C8M2 4X64B 3AZXA 1LGNA 1S3JA 3SH3A 3E22B 4CE8A 5C7GA 4J7ZA 2ERFA 1LOEA 1WW7A 3LEKA 2Z5WA 3L74H 1UXXX 2HWB3 1GM9A 1VBA1 4ARYA 1JHJA 2F4VO 2DBIA 4LNVA 3I7DA 5IYBO 3NAPB 4B4RA 5CN0A 5JIAA 3KT7A 1S2BA 3HR9A 5E6HA 3IT8A 4XXPA 5FZCA 3WF1A 5GW7A 4CCJA 4GCZA 1HW5A 2JS3A 1KUQA 3LDKA 4YFZA 2Y33A 5KC5A 2YFZA 2KM2A 4B1LA 1NE4A 1ZX5A 1FAYA 3T1LA 5L9VA 1PGL2 2QTOA 1V6NA 5J9PC 1FOD1 4I3GA 2Y4UA 5ITZB 4MTGA 4C91A 3CRAA 2J1AA 1KDMA 4ZS2A 1GO3F 2A5ZA 2R32A 1D4M2 3VLBB 4ASLA 2ZAHA 2IXIA 2BNNA 4BISA 2EULA 4X8NA 4X20B 4F6RA 5EZWA 3CCQV 4FPEA 4QKFA 1ENVA 4MXWB 4PQQA 5I0TA 3P32A 5CG9A 5LA6A 4LP8A 2WZEA 5FWJA 2H94A 3ILRA 3KB5A 3ZSEA 3B01A 3HQUA 1HP8A 1PGW2 4IHJB 2LTNA 1B35C 1JYVA 1Z5WA 1NQDA 3E5UA 2F23A 5FYBA 2XQXA 2W68A 1RPOA 3ACIA 1RMU2 1CN1A 4P5YA 1JYTA 2RS11 1YIJV 2E76B 2VZUA 4O61A 5F9TA 2J22A 4LF4B 4E8CA 1LGBA 4B4QA 4DK0A 2JWPA 4Q27A 3VBUB
chains in the Genus database with same CATH topology
4OI1A 1GZWB 2ZJCA 1O91A 1LULA 4GQ7A 4ISRA 2HJIA 3RZZA 4GIQA 4LEJA 2TUNA 3FZ3A 3WW4A 5J48A 2DVGA 1ULGA 2JECA 2B39A 4P9GA 1C57A 1F2NA 1OIKA 3AKRA 2OA2A 5AFEA 1QWRA 2C5DA 5CFCC 3AMQA 2ZX2A 3B9IA 1CJDA 4HN0A 3AZYA 3KSCA 2GU9A 3E6CC 3B02A 1LEDA 2PAMA 2XB6C 3NWKA 4NWVA 1A78A 4AE2A 1OI6A 4ORFA 5J36A 1E57A 3QCWA 1YWKA 4FPKA 5HBAA 4QXKA 2WS93 4MGYE 1NX4A 3X29B 2W0XA 1R093 2I07B 1OA3A 1GZCA 2R6QA 3WY6A 3FLTA 4OULA 4C90A 3OBRA 3BCWA 3M2MA 4COYA 2GC0A 2UYBA 4ZU5A 1H0BA 1C5HA 1HQWA 4GA9A 4MXWA 2IXKA 4OVEA 5I91A 1HV0A 1NXD1 1S55A 1LEMA 1UKRA 2PHRA 3QLQA 1PNFA 1FPN3 5D8AB 2EAAA 3J8F1 3KGLA 4FXGB 4CEYB 1MS9A 4LULA 5T55A 4NOTA 4CTEA 2GC3A 1SLIA 1B35B 1AX0A 3ME2A 4LBKA 2XBO1 3MIDA 4GH4C 4QPGC 4YG6A 5GZEA 3PMEA 3SWTA 2PHLA 3WR0A 4JV4A 2JG9A 1Q8PA 2PLV1 3O7OA 4AQ6A 4BHGA 1LOFC 4EWEA 5T5JA 2IXCA 1DYKA 1V6JA 3CJIA 1HDKA 3V15A 1SCRA 4I0WB 2DVDA 1H8TB 4XF1A 2NP0A 4I2OA 3M3OA 4N43B 2XKOA 4C5WA 3KCYA 3U07A 4O9GA 4Q4V1 4HKWA 1H1IA 3P3PA 1OLQA 4S2DA 1LCLA 5FOJB 2HWD2 3MIBA 1W6PB 2JD4A 5EJ3A 1EPZA 4TLFA 1QQP3 3ST7A 3VBRC 5JOWA 1O3QA 1O7FA 1ND3C 1UF2C 2VVEA 5H9SA 1CAVB 2ENRA 3TWIA 5T5OA 1PO11 5GLUA 1KS4A 2ZTNA 1KJLA 2GC1A 3VBFC 1ULDA 2HWB1 4ZXKA 4RL7A 3SLIA 4FFAA 1QJU1 4W6WA 1GZWA 5CU1A 3VGIA 3MFCA 2WBQA 2XKPA 1S0GA 1BBT3 1PVC1 3USUA 1DZTA 4MLOA 3VBSB 3AMPA 2FMYA 4YRDA 2G9FA 1LOBA 1COV1 1X33A 4L11A 5DUUA 4QD2A 2WS92 2VXRA 3CO2A 3LA7A 2D6NA 4Q8LA 1YYNA 1GSLA 4P9JA 1R092 4C0BA 4GB33 4JCKA 1NG0A 1A8MA 3MPPG 5KXBA 2A6YA 5D1IA 3NW4A 1N3OA 2WNUC 1S1AA 1LJ7A 2YY1A 4HMZA 4K7JA 1R1A3 3C2UA 4HFSA 1MZFA 2WC2A 2R30A 4YZ4A 1BK1A 2IZWA 5LK5A 4QQHA 4R9CA 1VBA3 3QACA 5FLJA 1DG6A 1N1VA 1WD3A 1WCDJ 4XTMA 5BNOC 4NO4A 1M4WA 2ILMA 4GKYA 4HN1A 2Q1ZB 5GJ6A 5IK4A 4F8AA 4GWMA 1ZM1A 1K5MC 2EXHA 2XL7A 1POV3 4AEDC 4JGZC 4QQ2A 4Q4W1 3FE5A 2R16A 2D5FA 3I8TA 3WQ7A 2VQ0A 1PHMA 1YO8A 3IKWA 4OHZA 2RM22 3H1MA 4K1YA 2EXIA 3K48A 2HWE3 5D8AA 2Z2SB 5JZGC 2XVGA 4RFT0 4CEYA 2JXAA 4QGNA 1FXZA 1G86A 2XJTA 3S7EA 5FPXA 4K8FA 1B35A 2B9UA 1F5JA 1H2NA 2CAUA 4XHBA 1Q8QA 2YMZA 4P9LA 3EATX 2VNOA 3WDXA 1I1EA 2FHRA 5LEKA 1VBC1 3RYRA 3N7LA 4PBOA 2ZGUA 1QQP2 1S0EA 3QBQA 1RJ7A 1DS1A 4KG8A 3RSJA 1QY4A 1EAH1 2D44A 5T5LA 3LOBA 4HKOA 1C5IA 1FOD3 2VW2A 4XJ8A 5SV8A 4DMIA 4EV0A 3WG1A 4AI8A 5JOZA 2A3YA 1ULCA 1A6CA 2SBAA 2NPIA 5GLVA 4R52A 3M70A 2OZ6A 2D98A 1U5ZA 1R081 1GNHA 4PCRA 5JLVA 2A3XA 3VBRB 1BBT