3VOUA

The crystal structure of nak-navsulp chimera channel
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MLSFILTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTVEGLRPLDALYFSVVTLTTVGDGNFSPQTDFGKVFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKETDAYRLEVMEKLEAIEKKLAEHSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein, Voltage-gated sodium channel
publication title The C-terminal helical bundle of the tetrameric prokaryotic sodium channel accelerates the inactivation rate
pubmed doi rcsb
source organism Bacillus weihenstephanensis
molecule tags Transport protein
total genus 54
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3vouA00
2R9RB 3RBZA 3OGCC 2X6AA 2DWEC 3RVZA 2HG5C 3BEHA 4MVUA 4MVZA 3FB8C 2Y69C 1OCZC 4PDLA 1JVMA 2A0LA 2ITDC 3LUTB 4GX5A 4HYOA 3K04A 4XDKA 5EC2C 1OCCC 1QLEC 4PA4A 3AG4C 3ZJZA 3SPCA 3LDEA 5EK0A 3FB6C 4P30A 4BW5A 2HJFC 3OUSA 4MTOA 5EBLC 3T2MA 4WFFA 3PJSK 5KUMA 2EIJC 4JTCB 2W0FC 2JK5C 3F7VC 3SYPA 3T1CA 3R65A 4H33A 4CBCA 5IY5C 1V54C 4RUEA 3FB7C 4PDRA 3RVYA 3K03A 5J9PC 5CBHA 3GB7C 2EINC 3K08A 3F7YC 1S5HC 4MTFA 4PA9A 4RUFA 3X2QC 2Q67A 2WLIA 2EIMC 4XDLA 2DWDC 4HZ3A 3EFFK 3TCUA 3KG2A 4RO2A 3E8GA 4JTAB 2DYSC 2Q68A 2Q69A 4PDMA 4JTDB 1P7BA 3UM7A 2IH1C 3ABKC 4XDJA 1LNQA 3E8BA 4GX2A 2HVJC 3STZC 3E83A 2H8PC 1K4DC 4PA6A 5B1BC 4LP8A 4MVOA 4R8CA 1V55C 4MW8A 3OR7C 2ITCC 4MS2A 4I9WA 1ZWIC 2BOBC 3IFXA 1R3LC 3ABMC 2NLJC 3JYCA 5EC1C 4TWKA 3LDCA 4X8AA 5EBMC 2WLLA 4J9ZB 2QKSA 2AHYA 3LDDA 2HFEC 1M56C 3RW0A 3E8FA 3UKMA 2BOCC 4DXWA 4H37A 4MVMA 3SYCA 4WFEA 2A79B 5CBFA 2X6CA 3K0DA 2Q6AA 3IGAC 4J9YB 3FB5C 4MW3A 3SPHA 4LBEC 4GX1A 2OCCC 4QE7A 3SYAA 2DYRC 2WLKA 2X6BA 4OXSA 4X89A 1J95A 2KB1A 2WLHA 5E1AC 4MVSA 4P2ZA 3HPLC 3TETA 3ZRSA 2P7TC 4GX0A 4LCUC 1KKDA 2YEVA 1OCRC 3VOUA 1M57C 4PDVA 2QTOA 5CBGA 1XL4A 3E89A 4MTGA 3LNMB 2WLLB 4PA7A 3T4DA 4PA3A 4WFHA 4KFMA 1XL6A 2EILC 2ZXWC 4ZBMA 2AHZA 3E8HA 3SJQC 3SYQA 2WLIB 3SPIA 2IH3C 1ORQC 4R50A 1BL8A 5EBWC 3ABLC 3OR6C 3SPJA 2ATKC 3AG1C 3K06A 3OUFA 4G28B 4WFGA 4EKWA 3E86A 1OCOC 3SPGA 3AG2C 4R7CA 3ASNC 2EIKC 1G4YB 5B1AC 4MSWC 2WLMA 4R6ZA 2K1EA 4G27B 4QE9A 1R3IC 4UUJC 3SYOA 5B3SC 4P9OA 3T4ZA 4QNHB 4P9PA 4MVRA 2WLJA 1R3KC 1K4CC 4X88A 3ASOC 3K0GA 1R3JC 2HVKC 2ZD9A 5KUKA 4RAIA 3STLC 5BZBA 3AG3C 2WLNA 3F5WC 4F4LA 3WG7C 2A9HA 4MVQA
chains in the Genus database with same CATH superfamily
4ZHQA 2VWJA 2A0LA 1RFYA 3U11A 2PF4E 4PA4A 3ZJZA 1YVWA 4JYYA 4JASA 4GKJO 3RYHA 3ASOB 1TGOA 1Q86W 4TV8A 3D3IA 1J5EB 3OEEG 2EIMB 3JALB 2CTQA 4FVMA 4LNUA 3JSNA 3CCQV 2ZQMA 2R9IA 3G67A 2UXCB 1RM1B 1N4CA 3NR7A 1EBOA 1YZBA 5FNVA 1HNZB 5JCOA 1SA0B 2IJIA 1M90W 2FL4A 2YIBA 4OX9B 3CEIA 2UXCO 1M93A 1UPGA 4MS2A 2VS0A 4JI2B 2NLJC 4I0XA 3ZRVA 4FZ0A 2DN9A 2QGNA 1HNZO 2A3QA 3MDSA 4BIOA 4OX9O 1XUQA 2AZ2A 3CD6V 3E2EA 4JI2O 4H44B 2CTWA 2ZNJA 4FZ1A 4HNAB 2KB1A 2GSMB 3TETA 1E1RG 4LCUC 3QNEA 5LL6Y 2MK3A 1NH2B 2GHYA 1SKVA 4J80A 3CCRV 3L73H 1FXKA 4CC5A 2EIKB 1X59A 1I7FA 3ABLC 4WFGA 2AW9A 1OCOC 4DK0A 4DRXA 3OFNG 2NNUA 4FM1A 3BAAA 1SETA 2HEPA 1PM9A 3UCSC 4FK5C 3K9AA 2HLDG 4UV9A 4UVAA 1Q90D 1EZJA 4DXWA 2HR3A 3ABLB 5CB4A 1B3QA 5ITZA 2X6AA 1IVSA 5J2TA 3N2KA 4PD4F 3LUTB 3K5NA 2P06A 4FLVA 3DC6A 2Z0AA 4CH4A 3GVMA 5GTIZ 2ZE5A 3OUSA 5EBLC 1AR1B 1Y66A 4IL6Z 2OWOA 4K0KB 4J41A 5IY5C 4RUEA 4UCSA 1KC8W 3K08A 1VQNV 1S0VA 1BS3A 4JI6B 1RPRA 1H2LA 4I50B 3QTCA 2Y0IA 1NTZH 4K0KO 4D6TH 1JJOA 1NVPD 1N8RW 4RO2A 3E8GA 1HR0B 2Q69A 5IJ0B 5LP6C 2E5LB 3ABKC 2F43G 2ZE8A 1LNQA 3AK2A 4JI6O 1UJWB 4UVBA 3STZC 5IY5B 2A7WA 2H8PC 4GLXA 4JI7O 1N34B 3CCJV 1ZLZA 3OR7C 4TQDA 1VF5B 2WPDG 1HR0O 2E75B 5B1OA 1XI1A 2E5LO 4FMTA 4MVMA 4U7NA 5LP6B 3JD1A 4LR3A 1SQFA 1KB9F 1W0KG 3TXSA 3W7WA 4TOIA 4DV2B 1NJIW 3ZMUA 3HPLC 1PL0A 5LA6A 4YY3O 1Q43A 1KKDA 1OCRC 2OIEA 1XL6A 3JCZA 5BR8B 3AG1B 3K5LA 2ZCEA 4O4LB 1XREA 2IM9A 2YSUB 1Y67A 4G28B 1VF6A 3AG2C 2VWKA 2QM4A 1I08A 1OCRB 5BR8O 5KA6A 3CRQA 1ZL8A 3AEIA 2C2AA 1MG1A 1QHTA 3K0GA 2ZD9A 5KUKA 1SS3A 1Y74B 3K0DA 2YIAA 2HG5C 4UCOA 3AG2B 1O9HA 2B1IA 2Y69C 3A8TA 2ITDC 4GX5A 4NKGB 4O2BA 2EIJB 2IJKA 5LMUB 1V54B 4JF3A 2O57A 4X1IA 2YIBD 5KHJA 1B04A 4F6RB 3ETEA 3GB7C 3T1YB 2Y4UA 1NU1H 5LMUO 4ZHQB 4RQFA 2PYLA 4PELA 3X2QC 4FJCC 2ETNA 4BIUA 3ZS8C 2AGAA 2IW5A 4E4EA 2NR5A 1AJQA 3CC7V 1TVKA 1P7GA 1TUBB 2XTAA 1SZXA 2R70A 5LHIA 4TWKA 4U3JB 4J9ZB 1YEWA 1CP9A 4NXNB 2ODMA 3RYCB 4BAYA 5IT9N 3SR2C 1ZTEA 5FNVB 5KMGA 4JYAB 3SYAA 4NB5A 4PHZA 1H2NA 3L72H 3BRCA 4JYBA 4NXNO 3VOUA 4B08A 1Y76B 5CBGA 4OPAA 4I55B 4BW9A 4Q20A 2EX3A 4JYAO 4KFMA 3GWOA 2JS3A 2AHZA 2OYQA 3SYQA 1FAFA 1Q7YW 5IJ9A 5L3FA 1S77D 2LW1A 3HB3B 2P4VA 3H9VA 4P9OA 3S3XA 2KG7A 2UXBB 3B8MA 1AI4A 1A32A 2ZT9B 4ABMA 4X1YA 4BIZA 4RAIA 4LF8O 3O65A 4LF7B 4MVUA 2YXYA 1M4UA 4QPJA 5H6QA 5KX5B 1OCZC 1PKXA 1JVMA 2HJDA 5DM6V 3K04A 1H2SB 4LFCB 4Z1VA 2QKAA 4LF7O 3SPCA 1H38A 4EB6A 4MTOA 3CHXA 4TUYB 3JATB 2RQ6A 5L3EA 2K9PA 4LFCO 1ENVA 4I4TB 2M6YA 4LF4B 4JI5B 4DUZB 3EXAA 3TCUA 5KHIA 1OJHA 1P7BA 2OT5A 2PGGA 4DR4O 2JJ2G 3LNNA 3WU2Z 3ZHTA 4LF4O 4JI5O 5EIBC 5AG2A 3ABMB 3WB1A 4DUZO 1HP8A 4PA6A 5B1BC 4TV9A 4R8CA 3QVNA 1MNGA 1R3LC 3JAMN 2XNDG 2WA4A 3APOA 2QKSA 4JAAA 1AR5A 2BOCC 1D5AA 1SQPH 4WFEA 3ML0A 2X6CA 2Y48A 4J9YB 1FFXB 3UT5B 1WA8A 1YXBA 5BY1A 5CA0B 4OXSA 5KAIZ 2H3OA 5B1BB 4X66B 1Z5WA 1VQ7V 4X1KA 5CMUA 2GV9A 2YEVA 2B5UA 2D2CB 4N23A 1XHZA 1N36B 2WWWA 3B40A 3ZRWA 1VQ4V 1JX9A 3ZN1A 2EILC 2QTSA 5IDJA 4ZBMA 3A0HZ 1EM1A 3G71V 4X66O 4J10A 3RWRD 2CTPA 3SJCC 3OUFA 1YTFD 1N36O 5A9GA 3SDLA 1G4YB 4FLYA 2K1EA 5F2VO 3CCVV 2W6IG 5LXTA 4B3TB 3EHBB 2EILB 5H9CA 3CRCA 3ZN0A 4O4IB 4F4LA 2QKCA 2LP7A 4B3TO 2Y0PA 4MVZA 2YICA 3C90A 3OM3B 2P4KA 1AI5A 4DUYB 4LF6B 5FPOA 3T1CA 3CRAA 3SJAC 1H2MA 4DV3B 2R72A 5JH7A 2EINC 4DUYO 4MTFA 4FM0A 4LF6O 2DWDC 4DV3O 4O2BB 3CYOA 4Q6GA 2YDEA 2IJHA 3FAVA 4YJ3B 2DQ0A 3JAWA 1K97A 4QIWF 4U7OA 4FLZA 2EINB 4JGSA 1YCIA 2Z5UA 5EC1C 1SRYA 3E35A 1AI7A 1K7DA 4JV5B 1ZSPA 1F7YA 4DR5O 1N32B 4GX1A 1V9PA 1KECA 1M57B 2WLHA 4JV5O 1GN3A 4JI0B 4B3RO 3WFVA 4UCVA 2OCHA 4DR1B 2GDSA 1N32O 3LNMB 2EJ7A 4YIPA 1ZX3A 4JI1B 3M8AA 3RYFA 3SGIA 2N04A 3J80N 4JI0O 1QCEA 4DR1O 2ATKC 3JCUZ 1MMMA 2CGOA 4R7CA 4JI1O 3T1HB 3D36A 4F6EA 3KKYA 1NTKH 1H2KA 3JSLA 1IZ3A 1VIBA 4E2LA 5K1XA 3CSXA 1HDJA 3T1HO 2WLNA 3K5OA 5LOVA 1OZ0A 4MVQA 5IJ9B 1LUWA 2HKOA 3RGBA 3BEHA 2PZSA 1FFTB 2LJ2A 1WN7A 5KHKA 1K73W 2Q5ZA 1WB7A 2KG7B 3CXCU 4XBFA 4OPHA 2Q7GA 4UFZA 1CEZA 3ZHUA 4JAUA 4X1YB 3W7UA 1TUEB 4ICGA 4KL1A 4TSFG 2D3OW 2XT9A 2P6JA 3APQA 2UUAB 4IYIA 2EIMC 3IJ4A 3G6BA 2CAZC 3VQWA 2IH1C 2UUAO 4EB6B 1V55B 3E8BA 2PUSA 1RM1C 2FMLA 5IE9A 3JD0A 2LGQA 3CS5A 1KD1W 3IFXA 4LH7A 1GO3F 1ZUQA 3IGAC 1YI2V 3CJHB 2BTQA 3BPZA 1G8MA 1J5EO 1Q3EA 2RDCA 4J11A 2IU0A 2P7TC 1XEQA 1BCCH 4CS2A 3I55V 2ZE7A 1MZEA 4D7TA 4C7UA 3SPIA 1WA8B 3ZBHA 1YSCA 3O9OA 2LFSA 1I94B 3I5DA 2ZKOA 2CE4A 2EIKC 1XMQB 1WAZA 3OTFA 4R6ZA 4X1KB 4K8XA 2BE3A 3CP1A 1RSOA 1K4CC 1XMQO 4DV6B 3JD4A 3D8CA 2QA4V 3FB8C 4DV5B 2DW4A 1NI8A 3N27A 1F23A 4BW5A 4DV6O 3PJSK 3SYPA 4DV5O 2QJ1A 5J9PC 3FB7C 1K33A 2MW2B 5LMNB 4PA9A 1VQMV 2KQXA 1HW7A 3ZX6A 4DV0B 2QR4A 4ZI7A 1JFFB 5LMNO 2V1DA 4XDJA 4GX2A 5DEDA 2PY5A 3P3PA 5JQGA 2DMXA 1XILA 2JEUA 4DV0O 3E22A 5JH7B 2P67A 3FYEB 1P4RA 3VBBA 2WLLA 3H1JH 4ASUG 3SYCA 1B6QA 4O4JB 1NR7A 2VRZA 2QWNB 5B5EZ 2WLKA 3FAVB 4QPKA 3JAWB 2YI8A 4LWSA 4L87A 3CRRA 1Q81W 2JGUA 1XDCA 4J7KA 1L8DA 2E74B 2XHBA 2Q8VA 3N2GA 1SC5B 2QEXV 2CDYA 1S5LZ 3AG1C 1N34O 3CRMA 3JARA 4EFEA 5LHGA 1XQ8A 1WB8A 1QVGU 5J2UA 4B7EA 4UV8A 1FKAO 3HKDA 5DECA 4IHJB 2YIDA 3H1LH 3CMEV 3STLC 5JVDA 1RPOA 4FFKA 4AI8A 4DV2O 2A06H 1NVPB 4UB6Z 4XDKA 4HYOA 1YITV 4GKKB 3LDEA 2HJFC 3T2MA 3MAQA 5KUMA 2EIJC 2JK5C 3R65A 1YDXA 4NTXA 1GH6A 1V54C 2EZPA 2BCCH 1WNSA 5JWPA 5LOVB 1I0HA 4FPPA 2DYSB 5EZYA 4XDLA 4X20A 4HZ3A 4L8JA 4JTAB 3LSUA 4PDMA 1YJ9V 2ARHA 4FFBA 4DV4B 2F23A 3QO7A 5KHGA 4AQYB 2OTLV 3ICXA 4LF9B 4YJ2A 3M99B 5GONA 4X8AA 3ZMZA 3J81N 2GTSA 3UKMA 4DV4O 2JVDA 3ETQA 1DF4A 4B3SB 2WSSG 1H8EG 4LF9O 1IXMA 4NR1A 2X0LA 1XNRB 3BY6A 5EYPA 1IDSA 2GTAA 3T1YO 3CXHF 3RYHB 2RN9A 3DXRA 4B3SO 2FB5A 4TV8B 3L70H 5JCOC 1FPOA 3B09A 1XNRO 2HHHB 1R6KA 4PA3A 1XOUA 4BR6A 3WB0A 1YJNV 1SQGA 4LNUB 3SJQC 4WBNA 2F93B 4G2KA 5C8YA 3ASNB 3B4SA 4R50A 3SPJA 3EVKA 1PL4A 2LO1A 5D5QA 3OE7G 1BE3H 3Q4HA 1QNMA 5BMVA 4GZRB 3BA8A 4I0XB 4FLWA 3WG7C 4ZOLA 2ZDIA 1L0LH 5H2FZ 1MOFA 5TISZ 3ETGA 1L1FA 1FXKC 3DSQA 1D5NA 2UUBB 2QM8A 1RSOB 3BVOA 1TA8A 4W4KA 2W0FC 5CA1A 1THZA 3ZHRA 3WG7B 2UUBO 1US6A 5IYDO 3ZHSA 1FXKB 1HNWB 4LFBB 2WLIA 4EFBA 2UXBO 4CS4A 4DRXB 1UFIA 1U96A 1K9MW 1HNWO 3MHHC 1AP5A 4LFBO 3U0ZA 3OT7A 4ZIBA 4NTYA 2DE0X 3ABMC 3ETDA 5CB4B 1HWYA 5ITZB 2LGWA 3F5TA 4NYKA 5J2TB 3N2KB 4X64B 1VARA 4EEQA 5EIBD 1VQ5V 1OHHG 2X6BA 4DR7B 5JQGB 4GX0A 5L3BA 2BSKA 4H13B 4MTGA 1WJZA 5B66Z 2WLLB 1GN4A 4DR7O 4KXRA 2G38A 3CCUV 1BL8A 5EBWC 3K06A 1DK1A 2L6LA 2XASA 1W2BU 2RMKB 1GM7A 3UO3A 4D7SA 5B3SC 1AJPA 2ADPA 1SA0A 2QM7A 1O9GA 4J42A 3D3QA 4JI3B 1U97A 3GWKC 4CC6A 4O2AA 5B1NA 2EULA 1I5XA 4B3MB 1SQQH 1QLEB 5LYJA 1VMGA 4PDLA 4JI3O 5B3SB 3BCCH 2IBZH 3AG4C 5IYZA 4HNAA 1XNQB 5LA6B 4YHHB 3BHPA 4WFFA 1MA1A 3P30A 5E79Z 4O4HA 5C93A 3KCXA 5CBHA 3PN1A 1VF7A 4JI8B 5BXZA 1XNQO 2WA3A 4YHHO 1IBLB 4WF9V 2B9ZA 4RWUA 3AG4B 3EFFK 3KG2A 3A0BZ 5D5PA 3ZCCA 4JI8O 1ZL8B 1IBLO 1GK9A 2XAFA 4MVOA 2ITCC 2JEXA 5HFMA 1AVMA 1R6TA 2AHYA 2P90A 1XBLA 2PYJA 3E8FA 5EZYB 3FB5C 5JJNB 1YTFB 1S5JA 3OD4A 1SERA 5GW7A 1E1QG 4QE7A 2DYRC 2Q4PA 1CXZB 3DGEA 3BA9A 4X1IB 4PI2A 4W4LA 1VQLV 1M57C 1X4TA 4PDVA 3WB2A 4WFAV 2FTKA 4X9QA 1EZVH 3CWBH 4DV7B 2Q7HA 1Q6UA 5B1AB 2QE7G 3CC4V 4FM2A 2DYRB 4TT3G 4IIJA 1URFA 1K34A 1BHAA 5DN6G 5IJ0A 4G27B 1FJGB 4QE9A 1D2DA 3K9SA 1TVKB 3HKCA 2Q7EA 4DV7O 4DR3B 4FLXA 1PNLA 1R3KC 1TAEA 3DTUB 3JD3A 4JPRA 4X65B 3KCYA 2LQTA 1FJGO 2EBOA 5C8YB 3LSQA 2R9RB 3RVZA 3OGCC 1KUQA 1IBKB 5LP6A 5KMGB 4CZZA 4X65O 1BGYH 4DV1B 1JCHA 2CK3G 3W7TA 1VQ6V 4CBCA 1MSDA 2N74A 4ZOLB 4DV1O 1GN6A 3FKSG 1F4NA 1RP3B 2ZR3A 2OIGA 3IC7A 1JOYA 2R9AA 1GTOA 1IBMB 5CN0A 3ZEDA 3E83A 4H0LB 1MABG 1M56B 3CCSV 1V55C 1QLNA 3CX5F 5LBQA 2JGDA 1Y74A 2VQFB 4I9QA 2HFEC 4JAVA 1IBMO 1YJWV 5CBFA 2F1MA 3CE2A 4UVCA 2QWPB 3AK1A 2CH7A 1QQCA 3ZMTA 2UXNA 2Q73A 2VQFO 4MVSA 1NS1A 4PV1B 3OTOB 3HKBA 3G4SV 2IU3A 2Q0AA 4F6RA 3HR0A 3OMIB 4JI4B 1XMOB 4NTWA 2LW7A 3OEHG 2ZIMA 4EKWA 3OTOO 1G6UA 1NQTA 5IYCO 4GYCB 1SQVH 1S76D 1F4MA 2WLMA 5FPRA 4JI4O 2NN4A 2QSAA 1XMOO 2BSKB 1TUBA 3AG3B 4TV9B 1W0JG 2V4DA 1NH2D 4LC1A 4LFAB 2UXDB 3BABA 4U3JA 2QWRB 2DJVA 3RBZA 3ABUA 1Q82W 3RYCA 1QR8A 4LFAO 2UXDO 4JZGA 1MSWD 3FB6C 4P30A 3ZMSA 2AXTZ 1P49A 2EZOA 2YEVB 3OW2U 3ZIAG 1Y76A 1COWG 4GCZA 4I55A 1K92A 3OMAB 3ZRWB 4PDRA 4O2AB 1I94O 2ZIOA 1S5HC 5LYJB 1AP6A 4IYHA 4UCUA 1E79G 3G80A 5IYZB 4JTDB 3UM7A 2Z3YA 1KQSU 3OMNB 5LXTB 2YI9A 5L3DA 5GTHZ 3W7XA 1GMGA 4O4HB 3MD0A 1KP3A 2JRIA 4B7KA 2JIZG 4YIOA 4WCEV 3L9DA 1DF5A 2A79B 1NT2B 3U10A 1FXHA 5KX5A 4U3FH 3SPHA 5JJEB 1EFRG 4JYCA 4LBEC 3C3SA 4X89A 2XAQA 4DYLA 4P2ZA 2AZ0A 2IJJA 3THOA 1NZ6A 4TUYA 2V7QG 2QWQB 2QTOA 3JATA 1XL4A 5IWAB 1H8HG 1SQXH 2ZXWC 4LF5B 4I4TA 3KZIZ 1OCOB 1ROPA 3HKEA 3IC9A 1FXVA 3RYIA 3OR6C 3ZMVA 5IWAO 3SPGA 3H01A 1P84F 4MSWC 5H6RA 4LF5O 1R3IC 1T5EA 1K3EA 3NXSA 2F66C 1DTOA 1KMIZ 1JQ0A 2ZXWB 2BTOA 5K1PA 2YUAA 1K5SA 4WFBV 3RN4A 5BZBA 5FLXN 3F5WC 2LFRA 2A9HA 1Q8IA 4JI7B 2JJ1G 4IIJB 4CH5A 1AROP 1NBMG 1PP9H 3VQYA 4DK1A 1FFXA 3UT5A 5EC2C 5KLVH 5CA0A 3CMAV 3FX7A 3HKCB 1SQBH 3TK1A 1OV9A 1NKDA 4CH6A 3D36C 1PNMA 2OTJV 1GKFA 4A5UB 1GN2A 3RYFB 1AB3A 4DW0A 1BMFG 4YY3B 1XHXA 1WP8A 1M9NA 1VEWA 2GUZA 3ABKB 2EJRA 1AI6A 2HP8A 1FYJA 2DYSC 1JMKC 2ILMA 2Q68A 1GAXA 2ADQB 2F4VB 4DO2A 3C3TA 3QO8A 4DR6B 4DW1A 3SJBC 1KP2A 1SF9A 4MW8A 1BT8A 1EN6A 5EBMC 1Z5VA 2F4VO 4GKKO 3LDDA 4O4IA 4KP4A 5CA3A 3H1KH 3JAKA 1JR9A 3LSSA 4DR6O 3FYIB 4NXMB 4MW3A 1QBZA 3L71H 2XAHA 2CGNA 1IXBA 1WPBA 2VQEB 1PNKA 3CC2V 2FKXA 4NXMO 2CUGA 2JGDB 4LH6A 2DQ3A 3CCLV 2VQEO 2DOSA 4Z2WA 2CH7B 1H2GA 4MT8A 4AQYO 1R73A 3JASA 1Q6HA 3ASNC 2UXXA 4GT1A 2YXLA 4Z1MG 3SYOA 4YJ3A 4K8ZA 4IGGA 4FIPC 4P9PA 3HKBB 4X88A 5LGUA 1DGSA 4J7JA 2Y69B 5A2QN 4RQEA 1VQ9V 2BTQB 3RT3C 4J7ZA 2HHHO 3J7AU 1HNXB 1Z2GA 4JTCB 4HAMA 1MZFA 4AILC 3S3WA 3AK3A 4I7ZB 3X2QB 5KA5A 1N0NA 1Q5OA 2E76B 3F7YC 4IT5A 1HNXO 1QU7A 1Y4MA 1WPXA 2FYUH 2P22C 3QO5A 2WAMA 3AG7A 1FD9A 1IX9A 3VQVA 1N0JA 4MTXA 2GBOA 2UU9B 3FD9A 4K35A 2W0XA 1K4DC 1FS0G 3QG5A 4LP8A 1LUVA 1PPJH 4I9WA 2ZM6B 4UB8Z 1VQOV 2PTMA 1KBHA 4KUMA 4UXNA 3P3NA 2ZNIA 3CPWU 2UU9O 1VQPV 2ZR2A 3B8NA 1JPXA 2YC0A 4LF8B 2ZM6O 3K5MA 5E1AC 1I5YA 2F95B 2PI4A 2E3CA 2N05A 4PA7A 1BSMA 1VP7A 5KHHA 2IH3C 1YHQV 3K59A 2RCVA 5JJJB 1QVFU 4ZI7B 4CH3A 4UUJC 4N21A 5LGTA 4QNHB 4MVRA 3E22B 4X64O 2XAJA 5L3CA 4DR4B 2W6JG 3RFRA 4DR2B 4YXWG 4BWAA 1OCZB 3JALA 3HKEB 3RYIB 3CJHA 4HBNA 4FLUA 1QLEC 4DR2O 4LWSB 5EK0A 3TGUH 1ZAUA 1IURA 3OGIB 4UCRA 2UUCB 2CTRA 4NVPA 1BHBA 2Y4TA 3K03A 5IYBO 4RUFA 3DC5A 2Q67A 3N2GB 3CCEV 1JJ2U 2UUCO 3JARB 5FL7G 3TXQA 2JDIG 5J2UB 1VF6C 2M7WA 1VQ8V 1CPYA 3HKDB 1Y6XA 4B3MO 5L3GA 1R1BA 1ZWIC 2BOBC 3JYCA 5JVDB 4PI0A 3LDCA 3RW0A 4QGPA 1GM9A 2XAGA 1BQZA 2GUZB 2Q6AA 2YS8A 1KU9A 2L35A 1KYOF 3K58A 3I56V 1F51A 2OCCC 1AILA 2JS5A 3FFQA 1J95A 3ABTA 3ZRXA 2ZINA 3ZRSA 1S72V 1N33B 4PJ0Z 4FLTA 1K5QA 2ZE6A 3E89A 3MHSC 1LR1A 5HFLA 3ZHQA 3R66A 1BQ0A 4OGQB 3UO2A 3JAKB 3JD2A 5LGNA 1PV0A 1GM8A 1N33O 3CB2A 2OCCB 5LHHA 4X20B 2RJZA 3E86A 1M1KW 3K57A 5B1AC 1JFFA 4X62B 4FFBB 1JA8A 2H94A 4JZ2A 2WLJA 1L0NH 3W7SA 1R3JC 4YJ2B 5GONB 1EN4A 2QDOA 4X62O 1KKCA 5KAFZ 1BZKA 2DWEC 3QF7A 2KSDA 4O4JA 4I50A 3JASB 2XOKG 1NTMH 5EYPB 1OCCC 4I5SA 2X7RB 4TQFA 2RNBA 2Q0OC 3ZHVA 4CS3A 1WLEA 1EN5A 3A0RA 1WP7A 3DXRB 4DR5B 3F7VC 4H33A 1VQKV 3K79A 3RVYA 3A2FA 3G6EV 3VQXA 4WBNB 4B3RB 1YF2A 2B1GA 4DR3O 1G1XB 1M5IA 1OCCB 1YIJV 4QJFB 1R6NA 1GRJA 3B2EE 2ZDIC 1K8AW 2PI5A 4GUNA 5H5NA 2HVJC 1QR9A 3H1HH 3Q4HB 1AJNA 1W59A 4IHJA 1IBKO 5BMVB 1M56C 4H37A 3IAYA 4O4LA 3OAAG 1SESA 3TJTA 4K3AA 1S3JA 3B77A 2YXHA 3P32A 2Q9LA 1DLBA 5CA1B 3L74H 1B06A 3M7MX 3T4DA 2QWOB 2KKWA 4WFHA 1SZTA 4ZKIA 3L75H 1AR4A 3E8HA 2WLIB 1NR1A 4KHPB 2P5OA 1ORQC 3UQ8A 3H1IH 1Q6IA 1PD3A 4AHCA 3T4ZA 3K3WA 4KHPO 3BFRA 2XUMA 3ASOC 2HVKC 3AG3C 4UCTA 3CCMV 4GKJB
chains in the Genus database with same CATH topology
2LP7A 2ZDIA 2JJ1G 4MVZA 1AROP 1MOFA 1NBMG 3ETGA 1L1FA 1FXKC 2A0LA 5EC2C 3CMAV 3OM3B 4PA4A 3ZJZA 3TK1A 1AI5A 2QM8A 4JASA 1NKDA 3ASOB 1Q86W 1PNMA 2W0FC 2OTJV 3T1CA 1THZA 1GKFA 3D3IA 3WG7B 3OEEG 2EIMB 2EINC 5IYDO 1BMFG 4MTFA 1FXKB 2WLIA 3CCQV 1M9NA 2ZQMA 3ABKB 2EJRA 2DWDC 2R9IA 1AI6A 3CYOA 1RM1B 2DYSC 2Q68A 1EBOA 4DO2A 1K9MW 2IJHA 2DQ0A 4QIWF 1K97A 2IJIA 4U7OA 3MHHC 3QO8A 1M90W 1KP2A 2EINB 4MW8A 4JGSA 4MS2A 3ABMC 2NLJC 2Z5UA 5EC1C 3CCMV 1SRYA 3E35A 5EBMC 1AI7A 3ZRVA 3ETDA 3LDDA 4KP4A 1K7DA 1HWYA 5CA3A 3LSSA 3FYIB 3CD6V 4MW3A 1QBZA 4GX1A 2XAHA 1VQ5V 3E2EA 1OHHG 2X6BA 1KECA 1PNKA 1M57B 2KB1A 2WLHA 2GSMB 3TETA 1E1RG 3CC2V 4GX0A 4LCUC 5L3BA 3QNEA 3WFVA 2MK3A 4MTGA 1NH2B 3LNMB 2DQ3A 2GHYA 2WLLB 3CCLV 3CCRV 3CCUV 1FXKA 1QCEA 2EIKB 1H2GA 4MT8A 1BL8A 1R73A 5EBWC 3ABLC 2ATKC 3K06A 4WFGA 2XASA 1OCOC 4R7CA 1W2BU 3OFNG 2NNUA 1GM7A 3ASNC 2UXXA 4GT1A 4Z1MG 3D36A 1SETA 3SYOA 5B3SC 4FK5C 1AJPA 3K9AA 4FIPC 2QM7A 4P9PA 2HLDG 4X88A 4E2LA 4UV9A 5LGUA 4UVAA 2Y69B 2WLNA 5B1NA 1EZJA 4DXWA 1OZ0A 3ABLB 2HR3A 4MVQA 1I5XA 2X6AA 2HKOA 4RQEA 3BEHA 1VQ9V 1QLEB 1FFTB 4PDLA 3LUTB 5B3SB 1K73W 3AG4C 3OUSA 5EBLC 1AR1B 4XBFA 1Y66A 3CXCU 4WFFA 4JTCB 1CEZA 4JAUA 3W7UA 1TUEB 3P30A 4HAMA 5IY5C 5C93A 2D3OW 4RUEA 4TSFG 3X2QB 5KA5A 5CBHA 1KC8W 2P6JA 3K08A 1VQNV 1S0VA 3F7YC 1RPRA 4WF9V 2EIMC 1Y4MA 1WPXA 3AG4B 1NVPD 1N8RW 3EFFK 3KG2A 3QO5A 3E8GA 4RO2A 2WAMA 3ZCCA 2Q69A 2IH1C 3ABKC 2F43G 1LNQA 1V55B 4MTXA 3E8BA 1UJWB 4UVBA 1RM1C 3STZC 5IY5B 1GK9A 2XAFA 2H8PC 1K4DC 3JD0A 1FS0G 4LP8A 4MVOA 3CCJV 3OR7C 2ITCC 2WPDG 2JEXA 4I9WA 3IFXA 5B1OA 5HFMA 1KD1W 4FMTA 1VQOV 4KUMA 2AHYA 4UXNA 2P90A 3E8FA 3CPWU 1GO3F 4MVMA 4U7NA 1VQPV 2ZR2A 3IGAC 1YI2V 3JD1A 3B8NA 3FB5C 1YTFB 1G8MA 1JPXA 1W0KG 1SERA 5GW7A 1E1QG 4QE7A 2DYRC 3W7WA 3DGEA 5E1AC 1NJIW 3ZMUA 3HPLC 1I5YA 1PL0A 2IU0A 2P7TC 1VQLV 1KKDA 1OCRC 1M57C 4PDVA 4WFAV 2PI4A 3I55V 2FTKA 4PA7A 3JCZA 1XL6A 3AG1B 3SPIA 5B1AB 2QE7G 3CC4V 2IH3C 1YHQV 2DYRB 2YSUB 4TT3G 4G28B 1QVFU 1YSCA 2LFSA 3AG2C 1K34A 1BHAA 2EIKC 5DN6G 4R6ZA 1OCRB 4G27B 4QE9A 5KA6A 4UUJC 4N21A 3AEIA 2C2AA 5LGTA 3CP1A 4QNHB 4MVRA 1MG1A 1PNLA 1R3KC 1K4CC 3DTUB 3JD3A 2XAJA 4JPRA 5L3CA 3K0GA 2ZD9A 5KUKA 2W6JG 4YXWG 1OCZB 3K0DA 2EBOA 3LSQA 2R9RB 3RVZA 3OGCC 3JD4A 2HG5C 3AG2B 2QA4V 3FB8C 2Y69C 2B1IA 2DW4A 2ITDC 4GX5A 4CZZA 1QLEC 2EIJB 2IJKA 5EK0A 1F23A 4BW5A 1V54B 1JCHA 2CK3G 4JF3A 3W7TA 1VQ6V 3PJSK 3SYPA 4CBCA 1BHBA 5J9PC 3FB7C 1K33A 3K03A 3ETEA 3GB7C 5IYBO 4RQFA 4PELA 3FKSG 1F4NA 4PA9A 4RUFA 1VQMV 3X2QC 4FJCC 2Q67A 3CCEV 1JJ2U 4BIUA 2ZR3A 2IW5A 3IC7A 5FL7G 1JOYA 2JDIG 1AJQA 2V1DA 4XDJA 3CC7V 1GTOA 4GX2A 5CN0A 2M7WA 1VQ8V 1CPYA 3E83A 1MABG 2JEUA 5L3GA 1M56B 3CCSV 1V55C 2P67A 1QLNA 3FYEB 5LHIA 1ZWIC 2BOBC 1P4RA 3JYCA 5LBQA 4TWKA 3LDCA 3VBBA 2WLLA 4J9ZB 2HFEC 3RW0A 4JAVA 4ASUG 1YJWV 1GM9A 2XAGA 3SYCA 5CBFA 1B6QA 4UVCA 1CP9A 2Q6AA 4BAYA 1NR7A 3ZMTA 3I56V 1F51A 2OCCC 2UXNA 3SYAA 2WLKA 4QPKA 1J95A 3ABTA 4MVSA 3ZRXA 4JYBA 4L87A 3ZRSA 1S72V 3VOUA 1K5QA 5CBGA 1Q81W 3E89A 3WG7C 3MHSC 3G4SV 4Q20A 5HFLA 2IU3A 4KFMA 3GWOA 3JD2A 5LGNA 2AHZA 3OMIB 3SYQA 1GM8A 1Q7YW 2OCCB 5LHHA 3OEHG 2QEXV 4EKWA 5L3FA 3AG1C 3E86A 1S77D 5LHGA 1NQTA 1M1KW 3HB3B 5IYCO 5B1AC 1F4MA 1S76D 2WLMA 1QVGU 4UV8A 2H94A 4P9OA 3AG3B 3B8MA 1AI4A 2WLJA 1W0JG 3W7SA 1NH2D 1R3JC 4BIZA 3CMEV 4LC1A 4RAIA 3STLC 1RPOA 3RBZA 2DWEC 4MVUA 4QPJA 3ABUA 5H6QA 1NVPB 1Q82W 1OCZC 1PKXA 1JVMA 2XOKG 4XDKA 4HYOA 5DM6V 1QR8A 3K04A 1OCCC 1YITV 4I5SA 2X7RB 3SPCA 3LDEA 1MSWD 3FB6C 4P30A 3ZMSA 1H38A 2HJFC 4MTOA 1WLEA 3T2MA 3A0RA 2EZOA 2YEVB 5KUMA 2EIJC 3OW2U 2JK5C 3F7VC 3ZIAG 3R65A 4H33A 1VQKV 3K79A 5L3EA 1COWG 1V54C 4GCZA 2EZPA 1K92A 3OMAB 3RVYA 4PDRA 3ZRWB 1ENVA 3G6EV 1S5HC 4FPPA 2DYSB 2B1GA 1OCCB 1YIJV 4QJFB 4XDLA 1R6NA 4HZ3A 1E79G 3TCUA 2ZDIC 4JTAB 1K8AW 4PDMA 1YJ9V 4JTDB 1P7BA 2OT5A 3UM7A 2PI5A 2JJ2G 2Z3YA 1KQSU 3OMNB 2HVJC 1QR9A 3ABMB 3QO7A 5L3DA 3W7XA 1GMGA 1AJNA 2OTLV 4PA6A 5B1BC 3MD0A 4R8CA 1KP3A 1R3LC 3M99B 4X8AA 2XNDG 2JIZG 3ZMZA 2QKSA 4WCEV 1M56C 3UKMA 2BOCC 4H37A 1DF4A 1DF5A 2A79B 3ML0A 4WFEA 1FXHA 2X6CA 2WSSG 2Y48A 4J9YB 1H8EG 3SPHA 1IXMA 1EFRG 4JYCA 2X0LA 3OAAG 4LBEC 1SESA 3BY6A 4OXSA 4X89A 1S3JA 3B77A 2XAQA 3P32A 5B1BB 1DLBA 4P2ZA 1VQ7V 2IJJA 5CMUA 2YEVA 2V7QG 2B5UA 2QTOA 4N23A 1XL4A 1H8HG 2WWWA 3ZRWA 1VQ4V 1R6KA 4PA3A 4WFHA 1JX9A 3T4DA 2EILC 2ZXWC 1SZTA 3ZN1A 5IDJA 4ZBMA 4ZKIA 3G71V 1YJNV 1OCOB 3E8HA 3SJQC 1ROPA 2WLIB 4G2KA 1NR1A 3ASNB 1FXVA 1ORQC 4R50A 3OR6C 3SPJA 3ZMVA 3OUFA 1YTFD 3SPGA 3H01A 1PD3A 1G4YB 4MSWC 2K1EA 5H6RA 1R3IC 3CCVV 1K3EA 2W6IG 3NXSA 3T4ZA 3EHBB 3K3WA 3OE7G 1DTOA 1JQ0A 2EILB 2ZXWB 5H9CA 3ASOC 1K5SA 2HVKC 4WFBV 3ZN0A 5BZBA 3AG3C 3F5WC 4F4LA 2LFRA 2A9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9R B;  3RBZ A;  3OGC C;  2X6A A;  2DWE C;  3RVZ A;  2HG5 C;  3BEH A;  4MVU A;  4MVZ A;  3FB8 C;  2Y69 C;  1OCZ C;  4PDL A;  1JVM A;  2A0L A;  2ITD C;  3LUT B;  4GX5 A;  4HYO A;  3K04 A;  4XDK A;  5EC2 C;  1OCC C;  1QLE C;  4PA4 A;  3AG4 C;  3ZJZ A;  3SPC A;  3LDE A;  5EK0 A;  3FB6 C;  4P30 A;  4BW5 A;  2HJF C;  3OUS A;  4MTO A;  5EBL C;  3T2M A;  4WFF A;  3PJS K;  5KUM A;  2EIJ C;  4JTC B;  2W0F C;  2JK5 C;  3F7V C;  3SYP A;  3T1C A;  3R65 A;  4H33 A;  4CBC A;  5IY5 C;  1V54 C;  4RUE A;  3FB7 C;  4PDR A;  3RVY A;  3K03 A;  5J9P C;  5CBH A;  3GB7 C;  2EIN C;  3K08 A;  3F7Y C;  1S5H C;  4MTF A;  4PA9 A;  4RUF A;  3X2Q C;  2Q67 A;  2WLI A;  2EIM C;  4XDL A;  2DWD C;  4HZ3 A;  3EFF K;  3TCU A;  3KG2 A;  4RO2 A;  3E8G A;  4JTA B;  2DYS C;  2Q68 A;  2Q69 A;  4PDM A;  4JTD B;  1P7B A;  3UM7 A;  2IH1 C;  3ABK C;  4XDJ A;  1LNQ A;  3E8B A;  4GX2 A;  2HVJ C;  3STZ C;  3E83 A;  2H8P C;  1K4D C;  4PA6 A;  5B1B C;  4LP8 A;  4MVO A;  4R8C A;  1V55 C;  4MW8 A;  3OR7 C;  2ITC C;  4MS2 A;  4I9W A;  1ZWI C;  2BOB C;  3IFX A;  1R3L C;  3ABM C;  2NLJ C;  3JYC A;  5EC1 C;  4TWK A;  3LDC A;  4X8A A;  5EBM C;  2WLL A;  4J9Z B;  2QKS A;  2AHY A;  3LDD A;  2HFE C;  1M56 C;  3RW0 A;  3E8F A;  3UKM A;  2BOC C;  4DXW A;  4H37 A;  4MVM A;  3SYC A;  4WFE A;  2A79 B;  5CBF A;  2X6C A;  3K0D A;  2Q6A A;  3IGA C;  4J9Y B;  3FB5 C;  4MW3 A;  3SPH A;  4LBE C;  4GX1 A;  2OCC C;  4QE7 A;  3SYA A;  2DYR C;  2WLK A;  2X6B A;  4OXS A;  4X89 A;  1J95 A;  2KB1 A;  2WLH A;  5E1A C;  4MVS A;  4P2Z A;  3HPL C;  3TET A;  3ZRS A;  2P7T C;  4GX0 A;  4LCU C;  1KKD A;  2YEV A;  1OCR C;  3VOU A;  1M57 C;  4PDV A;  2QTO A;  5CBG A;  1XL4 A;  3E89 A;  4MTG A;  3LNM B;  2WLL B;  4PA7 A;  3T4D A;  4PA3 A;  4WFH A;  4KFM A;  1XL6 A;  2EIL C;  2ZXW C;  4ZBM A;  2AHZ A;  3E8H A;  3SJQ C;  3SYQ A;  2WLI B;  3SPI A;  2IH3 C;  1ORQ C;  4R50 A;  1BL8 A;  5EBW C;  3ABL C;  3OR6 C;  3SPJ A;  2ATK C;  3AG1 C;  3K06 A;  3OUF A;  4G28 B;  4WFG A;  4EKW A;  3E86 A;  1OCO C;  3SPG A;  3AG2 C;  4R7C A;  3ASN C;  2EIK C;  1G4Y B;  5B1A C;  4MSW C;  2WLM A;  4R6Z A;  2K1E A;  4G27 B;  4QE9 A;  1R3I C;  4UUJ C;  3SYO A;  5B3S C;  4P9O A;  3T4Z A;  4QNH B;  4P9P A;  4MVR A;  2WLJ A;  1R3K C;  1K4C C;  4X88 A;  3ASO C;  3K0G A;  1R3J C;  2HVK C;  2ZD9 A;  5KUK A;  4RAI A;  3STL C;  5BZB A;  3AG3 C;  2WLN A;  3F5W C;  4F4L A;  3WG7 C;  2A9H A;  4MVQ A; 
#chains in the Genus database with same CATH topology
 4ZHQ A;  2VWJ A;  2A0L A;  1RFY A;  3U11 A;  2PF4 E;  4PA4 A;  3ZJZ A;  1YVW A;  4JYY A;  4JAS A;  4GKJ O;  3RYH A;  3ASO B;  1TGO A;  1Q86 W;  4TV8 A;  3D3I A;  1J5E B;  3OEE G;  2EIM B;  3JAL B;  2CTQ A;  4FVM A;  4LNU A;  3JSN A;  3CCQ V;  2ZQM A;  2R9I A;  3G67 A;  2UXC B;  1RM1 B;  1N4C A;  3NR7 A;  1EBO A;  1YZB A;  5FNV A;  1HNZ B;  5JCO A;  1SA0 B;  2IJI A;  1M90 W;  2FL4 A;  2YIB A;  4OX9 B;  3CEI A;  2UXC O;  1M93 A;  1UPG A;  4MS2 A;  2VS0 A;  4JI2 B;  2NLJ C;  4I0X A;  3ZRV A;  4FZ0 A;  2DN9 A;  2QGN A;  1HNZ O;  2A3Q A;  3MDS A;  4BIO A;  4OX9 O;  1XUQ A;  2AZ2 A;  3CD6 V;  3E2E A;  4JI2 O;  4H44 B;  2CTW A;  2ZNJ A;  4FZ1 A;  4HNA B;  2KB1 A;  2GSM B;  3TET A;  1E1R G;  4LCU C;  3QNE A;  5LL6 Y;  2MK3 A;  1NH2 B;  2GHY A;  1SKV A;  4J80 A;  3CCR V;  3L73 H;  1FXK A;  4CC5 A;  2EIK B;  1X59 A;  1I7F A;  3ABL C;  4WFG A;  2AW9 A;  1OCO C;  4DK0 A;  4DRX A;  3OFN G;  2NNU A;  4FM1 A;  3BAA A;  1SET A;  2HEP A;  1PM9 A;  3UCS C;  4FK5 C;  3K9A A;  2HLD G;  4UV9 A;  4UVA A;  1Q90 D;  1EZJ A;  4DXW A;  2HR3 A;  3ABL B;  5CB4 A;  1B3Q A;  5ITZ A;  2X6A A;  1IVS A;  5J2T A;  3N2K A;  4PD4 F;  3LUT B;  3K5N A;  2P06 A;  4FLV A;  3DC6 A;  2Z0A A;  4CH4 A;  3GVM A;  5GTI Z;  2ZE5 A;  3OUS A;  5EBL C;  1AR1 B;  1Y66 A;  4IL6 Z;  2OWO A;  4K0K B;  4J41 A;  5IY5 C;  4RUE A;  4UCS A;  1KC8 W;  3K08 A;  1VQN V;  1S0V A;  1BS3 A;  4JI6 B;  1RPR A;  1H2L A;  4I50 B;  3QTC A;  2Y0I A;  1NTZ H;  4K0K O;  4D6T H;  1JJO A;  1NVP D;  1N8R W;  4RO2 A;  3E8G A;  1HR0 B;  2Q69 A;  5IJ0 B;  5LP6 C;  2E5L B;  3ABK C;  2F43 G;  2ZE8 A;  1LNQ A;  3AK2 A;  4JI6 O;  1UJW B;  4UVB A;  3STZ C;  5IY5 B;  2A7W A;  2H8P C;  4GLX A;  4JI7 O;  1N34 B;  3CCJ V;  1ZLZ A;  3OR7 C;  4TQD A;  1VF5 B;  2WPD G;  1HR0 O;  2E75 B;  5B1O A;  1XI1 A;  2E5L O;  4FMT A;  4MVM A;  4U7N A;  5LP6 B;  3JD1 A;  4LR3 A;  1SQF A;  1KB9 F;  1W0K G;  3TXS A;  3W7W A;  4TOI A;  4DV2 B;  1NJI W;  3ZMU A;  3HPL C;  1PL0 A;  5LA6 A;  4YY3 O;  1Q43 A;  1KKD A;  1OCR C;  2OIE A;  1XL6 A;  3JCZ A;  5BR8 B;  3AG1 B;  3K5L A;  2ZCE A;  4O4L B;  1XRE A;  2IM9 A;  2YSU B;  1Y67 A;  4G28 B;  1VF6 A;  3AG2 C;  2VWK A;  2QM4 A;  1I08 A;  1OCR B;  5BR8 O;  5KA6 A;  3CRQ A;  1ZL8 A;  3AEI A;  2C2A A;  1MG1 A;  1QHT A;  3K0G A;  2ZD9 A;  5KUK A;  1SS3 A;  1Y74 B;  3K0D A;  2YIA A;  2HG5 C;  4UCO A;  3AG2 B;  1O9H A;  2B1I A;  2Y69 C;  3A8T A;  2ITD C;  4GX5 A;  4NKG B;  4O2B A;  2EIJ B;  2IJK A;  5LMU B;  1V54 B;  4JF3 A;  2O57 A;  4X1I A;  2YIB D;  5KHJ A;  1B04 A;  4F6R B;  3ETE A;  3GB7 C;  3T1Y B;  2Y4U A;  1NU1 H;  5LMU O;  4ZHQ B;  4RQF A;  2PYL A;  4PEL A;  3X2Q C;  4FJC C;  2ETN A;  4BIU A;  3ZS8 C;  2AGA A;  2IW5 A;  4E4E A;  2NR5 A;  1AJQ A;  3CC7 V;  1TVK A;  1P7G A;  1TUB B;  2XTA A;  1SZX A;  2R70 A;  5LHI A;  4TWK A;  4U3J B;  4J9Z B;  1YEW A;  1CP9 A;  4NXN B;  2ODM A;  3RYC B;  4BAY A;  5IT9 N;  3SR2 C;  1ZTE A;  5FNV B;  5KMG A;  4JYA B;  3SYA A;  4NB5 A;  4PHZ A;  1H2N A;  3L72 H;  3BRC A;  4JYB A;  4NXN O;  3VOU A;  4B08 A;  1Y76 B;  5CBG A;  4OPA A;  4I55 B;  4BW9 A;  4Q20 A;  2EX3 A;  4JYA O;  4KFM A;  3GWO A;  2JS3 A;  2AHZ A;  2OYQ A;  3SYQ A;  1FAF A;  1Q7Y W;  5IJ9 A;  5L3F A;  1S77 D;  2LW1 A;  3HB3 B;  2P4V A;  3H9V A;  4P9O A;  3S3X A;  2KG7 A;  2UXB B;  3B8M A;  1AI4 A;  1A32 A;  2ZT9 B;  4ABM A;  4X1Y A;  4BIZ A;  4RAI A;  4LF8 O;  3O65 A;  4LF7 B;  4MVU A;  2YXY A;  1M4U A;  4QPJ A;  5H6Q A;  5KX5 B;  1OCZ C;  1PKX A;  1JVM A;  2HJD A;  5DM6 V;  3K04 A;  1H2S B;  4LFC B;  4Z1V A;  2QKA A;  4LF7 O;  3SPC A;  1H38 A;  4EB6 A;  4MTO A;  3CHX A;  4TUY B;  3JAT B;  2RQ6 A;  5L3E A;  2K9P A;  4LFC O;  1ENV A;  4I4T B;  2M6Y A;  4LF4 B;  4JI5 B;  4DUZ B;  3EXA A;  3TCU A;  5KHI A;  1OJH A;  1P7B A;  2OT5 A;  2PGG A;  4DR4 O;  2JJ2 G;  3LNN A;  3WU2 Z;  3ZHT A;  4LF4 O;  4JI5 O;  5EIB C;  5AG2 A;  3ABM B;  3WB1 A;  4DUZ O;  1HP8 A;  4PA6 A;  5B1B C;  4TV9 A;  4R8C A;  3QVN A;  1MNG A;  1R3L C;  3JAM N;  2XND G;  2WA4 A;  3APO A;  2QKS A;  4JAA A;  1AR5 A;  2BOC C;  1D5A A;  1SQP H;  4WFE A;  3ML0 A;  2X6C A;  2Y48 A;  4J9Y B;  1FFX B;  3UT5 B;  1WA8 A;  1YXB A;  5BY1 A;  5CA0 B;  4OXS A;  5KAI Z;  2H3O A;  5B1B B;  4X66 B;  1Z5W A;  1VQ7 V;  4X1K A;  5CMU A;  2GV9 A;  2YEV A;  2B5U A;  2D2C B;  4N23 A;  1XHZ A;  1N36 B;  2WWW A;  3B40 A;  3ZRW A;  1VQ4 V;  1JX9 A;  3ZN1 A;  2EIL C;  2QTS A;  5IDJ A;  4ZBM A;  3A0H Z;  1EM1 A;  3G71 V;  4X66 O;  4J10 A;  3RWR D;  2CTP A;  3SJC C;  3OUF A;  1YTF D;  1N36 O;  5A9G A;  3SDL A;  1G4Y B;  4FLY A;  2K1E A;  5F2V O;  3CCV V;  2W6I G;  5LXT A;  4B3T B;  3EHB B;  2EIL B;  5H9C A;  3CRC A;  3ZN0 A;  4O4I B;  4F4L A;  2QKC A;  2LP7 A;  4B3T O;  2Y0P A;  4MVZ A;  2YIC A;  3C90 A;  3OM3 B;  2P4K A;  1AI5 A;  4DUY B;  4LF6 B;  5FPO A;  3T1C A;  3CRA A;  3SJA C;  1H2M A;  4DV3 B;  2R72 A;  5JH7 A;  2EIN C;  4DUY O;  4MTF A;  4FM0 A;  4LF6 O;  2DWD C;  4DV3 O;  4O2B B;  3CYO A;  4Q6G A;  2YDE A;  2IJH A;  3FAV A;  4YJ3 B;  2DQ0 A;  3JAW A;  1K97 A;  4QIW F;  4U7O A;  4FLZ A;  2EIN B;  4JGS A;  1YCI A;  2Z5U A;  5EC1 C;  1SRY A;  3E35 A;  1AI7 A;  1K7D A;  4JV5 B;  1ZSP A;  1F7Y A;  4DR5 O;  1N32 B;  4GX1 A;  1V9P A;  1KEC A;  1M57 B;  2WLH A;  4JV5 O;  1GN3 A;  4JI0 B;  4B3R O;  3WFV A;  4UCV A;  2OCH A;  4DR1 B;  2GDS A;  1N32 O;  3LNM B;  2EJ7 A;  4YIP A;  1ZX3 A;  4JI1 B;  3M8A A;  3RYF A;  3SGI A;  2N04 A;  3J80 N;  4JI0 O;  1QCE A;  4DR1 O;  2ATK C;  3JCU Z;  1MMM A;  2CGO A;  4R7C A;  4JI1 O;  3T1H B;  3D36 A;  4F6E A;  3KKY A;  1NTK H;  1H2K A;  3JSL A;  1IZ3 A;  1VIB A;  4E2L A;  5K1X A;  3CSX A;  1HDJ A;  3T1H O;  2WLN A;  3K5O A;  5LOV A;  1OZ0 A;  4MVQ A;  5IJ9 B;  1LUW A;  2HKO A;  3RGB A;  3BEH A;  2PZS A;  1FFT B;  2LJ2 A;  1WN7 A;  5KHK A;  1K73 W;  2Q5Z A;  1WB7 A;  2KG7 B;  3CXC U;  4XBF A;  4OPH A;  2Q7G A;  4UFZ A;  1CEZ A;  3ZHU A;  4JAU A;  4X1Y B;  3W7U A;  1TUE B;  4ICG A;  4KL1 A;  4TSF G;  2D3O W;  2XT9 A;  2P6J A;  3APQ A;  2UUA B;  4IYI A;  2EIM C;  3IJ4 A;  3G6B A;  2CAZ C;  3VQW A;  2IH1 C;  2UUA O;  4EB6 B;  1V55 B;  3E8B A;  2PUS A;  1RM1 C;  2FML A;  5IE9 A;  3JD0 A;  2LGQ A;  3CS5 A;  1KD1 W;  3IFX A;  4LH7 A;  1GO3 F;  1ZUQ A;  3IGA C;  1YI2 V;  3CJH B;  2BTQ A;  3BPZ A;  1G8M A;  1J5E O;  1Q3E A;  2RDC A;  4J11 A;  2IU0 A;  2P7T C;  1XEQ A;  1BCC H;  4CS2 A;  3I55 V;  2ZE7 A;  1MZE A;  4D7T A;  4C7U A;  3SPI A;  1WA8 B;  3ZBH A;  1YSC A;  3O9O A;  2LFS A;  1I94 B;  3I5D A;  2ZKO A;  2CE4 A;  2EIK C;  1XMQ B;  1WAZ A;  3OTF A;  4R6Z A;  4X1K B;  4K8X A;  2BE3 A;  3CP1 A;  1RSO A;  1K4C C;  1XMQ O;  4DV6 B;  3JD4 A;  3D8C A;  2QA4 V;  3FB8 C;  4DV5 B;  2DW4 A;  1NI8 A;  3N27 A;  1F23 A;  4BW5 A;  4DV6 O;  3PJS K;  3SYP A;  4DV5 O;  2QJ1 A;  5J9P C;  3FB7 C;  1K33 A;  2MW2 B;  5LMN B;  4PA9 A;  1VQM V;  2KQX A;  1HW7 A;  3ZX6 A;  4DV0 B;  2QR4 A;  4ZI7 A;  1JFF B;  5LMN O;  2V1D A;  4XDJ A;  4GX2 A;  5DED A;  2PY5 A;  3P3P A;  5JQG A;  2DMX A;  1XIL A;  2JEU A;  4DV0 O;  3E22 A;  5JH7 B;  2P67 A;  3FYE B;  1P4R A;  3VBB A;  2WLL A;  3H1J H;  4ASU G;  3SYC A;  1B6Q A;  4O4J B;  1NR7 A;  2VRZ A;  2QWN B;  5B5E Z;  2WLK A;  3FAV B;  4QPK A;  3JAW B;  2YI8 A;  4LWS A;  4L87 A;  3CRR A;  1Q81 W;  2JGU A;  1XDC A;  4J7K A;  1L8D A;  2E74 B;  2XHB A;  2Q8V A;  3N2G A;  1SC5 B;  2QEX V;  2CDY A;  1S5L Z;  3AG1 C;  1N34 O;  3CRM A;  3JAR A;  4EFE A;  5LHG A;  1XQ8 A;  1WB8 A;  1QVG U;  5J2U A;  4B7E A;  4UV8 A;  1FKA O;  3HKD A;  5DEC A;  4IHJ B;  2YID A;  3H1L H;  3CME V;  3STL C;  5JVD A;  1RPO A;  4FFK A;  4AI8 A;  4DV2 O;  2A06 H;  1NVP B;  4UB6 Z;  4XDK A;  4HYO A;  1YIT V;  4GKK B;  3LDE A;  2HJF C;  3T2M A;  3MAQ A;  5KUM A;  2EIJ C;  2JK5 C;  3R65 A;  1YDX A;  4NTX A;  1GH6 A;  1V54 C;  2EZP A;  2BCC H;  1WNS A;  5JWP A;  5LOV B;  1I0H A;  4FPP A;  2DYS B;  5EZY A;  4XDL A;  4X20 A;  4HZ3 A;  4L8J A;  4JTA B;  3LSU A;  4PDM A;  1YJ9 V;  2ARH A;  4FFB A;  4DV4 B;  2F23 A;  3QO7 A;  5KHG A;  4AQY B;  2OTL V;  3ICX A;  4LF9 B;  4YJ2 A;  3M99 B;  5GON A;  4X8A A;  3ZMZ A;  3J81 N;  2GTS A;  3UKM A;  4DV4 O;  2JVD A;  3ETQ A;  1DF4 A;  4B3S B;  2WSS G;  1H8E G;  4LF9 O;  1IXM A;  4NR1 A;  2X0L A;  1XNR B;  3BY6 A;  5EYP A;  1IDS A;  2GTA A;  3T1Y O;  3CXH F;  3RYH B;  2RN9 A;  3DXR A;  4B3S O;  2FB5 A;  4TV8 B;  3L70 H;  5JCO C;  1FPO A;  3B09 A;  1XNR O;  2HHH B;  1R6K A;  4PA3 A;  1XOU A;  4BR6 A;  3WB0 A;  1YJN V;  1SQG A;  4LNU B;  3SJQ C;  4WBN A;  2F93 B;  4G2K A;  5C8Y A;  3ASN B;  3B4S A;  4R50 A;  3SPJ A;  3EVK A;  1PL4 A;  2LO1 A;  5D5Q A;  3OE7 G;  1BE3 H;  3Q4H A;  1QNM A;  5BMV A;  4GZR B;  3BA8 A;  4I0X B;  4FLW A;  3WG7 C;  4ZOL A;  2ZDI A;  1L0L H;  5H2F Z;  1MOF A;  5TIS Z;  3ETG A;  1L1F A;  1FXK C;  3DSQ A;  1D5N A;  2UUB B;  2QM8 A;  1RSO B;  3BVO A;  1TA8 A;  4W4K A;  2W0F C;  5CA1 A;  1THZ A;  3ZHR A;  3WG7 B;  2UUB O;  1US6 A;  5IYD O;  3ZHS A;  1FXK B;  1HNW B;  4LFB B;  2WLI A;  4EFB A;  2UXB O;  4CS4 A;  4DRX B;  1UFI A;  1U96 A;  1K9M W;  1HNW O;  3MHH C;  1AP5 A;  4LFB O;  3U0Z A;  3OT7 A;  4ZIB A;  4NTY A;  2DE0 X;  3ABM C;  3ETD A;  5CB4 B;  1HWY A;  5ITZ B;  2LGW A;  3F5T A;  4NYK A;  5J2T B;  3N2K B;  4X64 B;  1VAR A;  4EEQ A;  5EIB D;  1VQ5 V;  1OHH G;  2X6B A;  4DR7 B;  5JQG B;  4GX0 A;  5L3B A;  2BSK A;  4H13 B;  4MTG A;  1WJZ A;  5B66 Z;  2WLL B;  1GN4 A;  4DR7 O;  4KXR A;  2G38 A;  3CCU V;  1BL8 A;  5EBW C;  3K06 A;  1DK1 A;  2L6L A;  2XAS A;  1W2B U;  2RMK B;  1GM7 A;  3UO3 A;  4D7S A;  5B3S C;  1AJP A;  2ADP A;  1SA0 A;  2QM7 A;  1O9G A;  4J42 A;  3D3Q A;  4JI3 B;  1U97 A;  3GWK C;  4CC6 A;  4O2A A;  5B1N A;  2EUL A;  1I5X A;  4B3M B;  1SQQ H;  1QLE B;  5LYJ A;  1VMG A;  4PDL A;  4JI3 O;  5B3S B;  3BCC H;  2IBZ H;  3AG4 C;  5IYZ A;  4HNA A;  1XNQ B;  5LA6 B;  4YHH B;  3BHP A;  4WFF A;  1MA1 A;  3P30 A;  5E79 Z;  4O4H A;  5C93 A;  3KCX A;  5CBH A;  3PN1 A;  1VF7 A;  4JI8 B;  5BXZ A;  1XNQ O;  2WA3 A;  4YHH O;  1IBL B;  4WF9 V;  2B9Z A;  4RWU A;  3AG4 B;  3EFF K;  3KG2 A;  3A0B Z;  5D5P A;  3ZCC A;  4JI8 O;  1ZL8 B;  1IBL O;  1GK9 A;  2XAF A;  4MVO A;  2ITC C;  2JEX A;  5HFM A;  1AVM A;  1R6T A;  2AHY A;  2P90 A;  1XBL A;  2PYJ A;  3E8F A;  5EZY B;  3FB5 C;  5JJN B;  1YTF B;  1S5J A;  3OD4 A;  1SER A;  5GW7 A;  1E1Q G;  4QE7 A;  2DYR C;  2Q4P A;  1CXZ B;  3DGE A;  3BA9 A;  4X1I B;  4PI2 A;  4W4L A;  1VQL V;  1M57 C;  1X4T A;  4PDV A;  3WB2 A;  4WFA V;  2FTK A;  4X9Q A;  1EZV H;  3CWB H;  4DV7 B;  2Q7H A;  1Q6U A;  5B1A B;  2QE7 G;  3CC4 V;  4FM2 A;  2DYR B;  4TT3 G;  4IIJ A;  1URF A;  1K34 A;  1BHA A;  5DN6 G;  5IJ0 A;  4G27 B;  1FJG B;  4QE9 A;  1D2D A;  3K9S A;  1TVK B;  3HKC A;  2Q7E A;  4DV7 O;  4DR3 B;  4FLX A;  1PNL A;  1R3K C;  1TAE A;  3DTU B;  3JD3 A;  4JPR A;  4X65 B;  3KCY A;  2LQT A;  1FJG O;  2EBO A;  5C8Y B;  3LSQ A;  2R9R B;  3RVZ A;  3OGC C;  1KUQ A;  1IBK B;  5LP6 A;  5KMG B;  4CZZ A;  4X65 O;  1BGY H;  4DV1 B;  1JCH A;  2CK3 G;  3W7T A;  1VQ6 V;  4CBC A;  1MSD A;  2N74 A;  4ZOL B;  4DV1 O;  1GN6 A;  3FKS G;  1F4N A;  1RP3 B;  2ZR3 A;  2OIG A;  3IC7 A;  1JOY A;  2R9A A;  1GTO A;  1IBM B;  5CN0 A;  3ZED A;  3E83 A;  4H0L B;  1MAB G;  1M56 B;  3CCS V;  1V55 C;  1QLN A;  3CX5 F;  5LBQ A;  2JGD A;  1Y74 A;  2VQF B;  4I9Q A;  2HFE C;  4JAV A;  1IBM O;  1YJW V;  5CBF A;  2F1M A;  3CE2 A;  4UVC A;  2QWP B;  3AK1 A;  2CH7 A;  1QQC A;  3ZMT A;  2UXN A;  2Q73 A;  2VQF O;  4MVS A;  1NS1 A;  4PV1 B;  3OTO B;  3HKB A;  3G4S V;  2IU3 A;  2Q0A A;  4F6R A;  3HR0 A;  3OMI B;  4JI4 B;  1XMO B;  4NTW A;  2LW7 A;  3OEH G;  2ZIM A;  4EKW A;  3OTO O;  1G6U A;  1NQT A;  5IYC O;  4GYC B;  1SQV H;  1S76 D;  1F4M A;  2WLM A;  5FPR A;  4JI4 O;  2NN4 A;  2QSA A;  1XMO O;  2BSK B;  1TUB A;  3AG3 B;  4TV9 B;  1W0J G;  2V4D A;  1NH2 D;  4LC1 A;  4LFA B;  2UXD B;  3BAB A;  4U3J A;  2QWR B;  2DJV A;  3RBZ A;  3ABU A;  1Q82 W;  3RYC A;  1QR8 A;  4LFA O;  2UXD O;  4JZG A;  1MSW D;  3FB6 C;  4P30 A;  3ZMS A;  2AXT Z;  1P49 A;  2EZO A;  2YEV B;  3OW2 U;  3ZIA G;  1Y76 A;  1COW G;  4GCZ A;  4I55 A;  1K92 A;  3OMA B;  3ZRW B;  4PDR A;  4O2A B;  1I94 O;  2ZIO A;  1S5H C;  5LYJ B;  1AP6 A;  4IYH A;  4UCU A;  1E79 G;  3G80 A;  5IYZ B;  4JTD B;  3UM7 A;  2Z3Y A;  1KQS U;  3OMN B;  5LXT B;  2YI9 A;  5L3D A;  5GTH Z;  3W7X A;  1GMG A;  4O4H B;  3MD0 A;  1KP3 A;  2JRI A;  4B7K A;  2JIZ G;  4YIO A;  4WCE V;  3L9D A;  1DF5 A;  2A79 B;  1NT2 B;  3U10 A;  1FXH A;  5KX5 A;  4U3F H;  3SPH A;  5JJE B;  1EFR G;  4JYC A;  4LBE C;  3C3S A;  4X89 A;  2XAQ A;  4DYL A;  4P2Z A;  2AZ0 A;  2IJJ A;  3THO A;  1NZ6 A;  4TUY A;  2V7Q G;  2QWQ B;  2QTO A;  3JAT A;  1XL4 A;  5IWA B;  1H8H G;  1SQX H;  2ZXW C;  4LF5 B;  4I4T A;  3KZI Z;  1OCO B;  1ROP A;  3HKE A;  3IC9 A;  1FXV A;  3RYI A;  3OR6 C;  3ZMV A;  5IWA O;  3SPG A;  3H01 A;  1P84 F;  4MSW C;  5H6R A;  4LF5 O;  1R3I C;  1T5E A;  1K3E A;  3NXS A;  2F66 C;  1DTO A;  1KMI Z;  1JQ0 A;  2ZXW B;  2BTO A;  5K1P A;  2YUA A;  1K5S A;  4WFB V;  3RN4 A;  5BZB A;  5FLX N;  3F5W C;  2LFR A;  2A9H A;  1Q8I A;  4JI7 B;  2JJ1 G;  4IIJ B;  4CH5 A;  1ARO P;  1NBM G;  1PP9 H;  3VQY A;  4DK1 A;  1FFX A;  3UT5 A;  5EC2 C;  5KLV H;  5CA0 A;  3CMA V;  3FX7 A;  3HKC B;  1SQB H;  3TK1 A;  1OV9 A;  1NKD A;  4CH6 A;  3D36 C;  1PNM A;  2OTJ V;  1GKF A;  4A5U B;  1GN2 A;  3RYF B;  1AB3 A;  4DW0 A;  1BMF G;  4YY3 B;  1XHX A;  1WP8 A;  1M9N A;  1VEW A;  2GUZ A;  3ABK B;  2EJR A;  1AI6 A;  2HP8 A;  1FYJ A;  2DYS C;  1JMK C;  2ILM A;  2Q68 A;  1GAX A;  2ADQ B;  2F4V B;  4DO2 A;  3C3T A;  3QO8 A;  4DR6 B;  4DW1 A;  3SJB C;  1KP2 A;  1SF9 A;  4MW8 A;  1BT8 A;  1EN6 A;  5EBM C;  1Z5V A;  2F4V O;  4GKK O;  3LDD A;  4O4I A;  4KP4 A;  5CA3 A;  3H1K H;  3JAK A;  1JR9 A;  3LSS A;  4DR6 O;  3FYI B;  4NXM B;  4MW3 A;  1QBZ A;  3L71 H;  2XAH A;  2CGN A;  1IXB A;  1WPB A;  2VQE B;  1PNK A;  3CC2 V;  2FKX A;  4NXM O;  2CUG A;  2JGD B;  4LH6 A;  2DQ3 A;  3CCL V;  2VQE O;  2DOS A;  4Z2W A;  2CH7 B;  1H2G A;  4MT8 A;  4AQY O;  1R73 A;  3JAS A;  1Q6H A;  3ASN C;  2UXX A;  4GT1 A;  2YXL A;  4Z1M G;  3SYO A;  4YJ3 A;  4K8Z A;  4IGG A;  4FIP C;  4P9P A;  3HKB B;  4X88 A;  5LGU A;  1DGS A;  4J7J A;  2Y69 B;  5A2Q N;  4RQE A;  1VQ9 V;  2BTQ B;  3RT3 C;  4J7Z A;  2HHH O;  3J7A U;  1HNX B;  1Z2G A;  4JTC B;  4HAM A;  1MZF A;  4AIL C;  3S3W A;  3AK3 A;  4I7Z B;  3X2Q B;  5KA5 A;  1N0N A;  1Q5O A;  2E76 B;  3F7Y C;  4IT5 A;  1HNX O;  1QU7 A;  1Y4M A;  1WPX A;  2FYU H;  2P22 C;  3QO5 A;  2WAM A;  3AG7 A;  1FD9 A;  1IX9 A;  3VQV A;  1N0J A;  4MTX A;  2GBO A;  2UU9 B;  3FD9 A;  4K35 A;  2W0X A;  1K4D C;  1FS0 G;  3QG5 A;  4LP8 A;  1LUV A;  1PPJ H;  4I9W A;  2ZM6 B;  4UB8 Z;  1VQO V;  2PTM A;  1KBH A;  4KUM A;  4UXN A;  3P3N A;  2ZNI A;  3CPW U;  2UU9 O;  1VQP V;  2ZR2 A;  3B8N A;  1JPX A;  2YC0 A;  4LF8 B;  2ZM6 O;  3K5M A;  5E1A C;  1I5Y A;  2F95 B;  2PI4 A;  2E3C A;  2N05 A;  4PA7 A;  1BSM A;  1VP7 A;  5KHH A;  2IH3 C;  1YHQ V;  3K59 A;  2RCV A;  5JJJ B;  1QVF U;  4ZI7 B;  4CH3 A;  4UUJ C;  4N21 A;  5LGT A;  4QNH B;  4MVR A;  3E22 B;  4X64 O;  2XAJ A;  5L3C A;  4DR4 B;  2W6J G;  3RFR A;  4DR2 B;  4YXW G;  4BWA A;  1OCZ B;  3JAL A;  3HKE B;  3RYI B;  3CJH A;  4HBN A;  4FLU A;  1QLE C;  4DR2 O;  4LWS B;  5EK0 A;  3TGU H;  1ZAU A;  1IUR A;  3OGI B;  4UCR A;  2UUC B;  2CTR A;  4NVP A;  1BHB A;  2Y4T A;  3K03 A;  5IYB O;  4RUF A;  3DC5 A;  2Q67 A;  3N2G B;  3CCE V;  1JJ2 U;  2UUC O;  3JAR B;  5FL7 G;  3TXQ A;  2JDI G;  5J2U B;  1VF6 C;  2M7W A;  1VQ8 V;  1CPY A;  3HKD B;  1Y6X A;  4B3M O;  5L3G A;  1R1B A;  1ZWI C;  2BOB C;  3JYC A;  5JVD B;  4PI0 A;  3LDC A;  3RW0 A;  4QGP A;  1GM9 A;  2XAG A;  1BQZ A;  2GUZ B;  2Q6A A;  2YS8 A;  1KU9 A;  2L35 A;  1KYO F;  3K58 A;  3I56 V;  1F51 A;  2OCC C;  1AIL A;  2JS5 A;  3FFQ A;  1J95 A;  3ABT A;  3ZRX A;  2ZIN A;  3ZRS A;  1S72 V;  1N33 B;  4PJ0 Z;  4FLT A;  1K5Q A;  2ZE6 A;  3E89 A;  3MHS C;  1LR1 A;  5HFL A;  3ZHQ A;  3R66 A;  1BQ0 A;  4OGQ B;  3UO2 A;  3JAK B;  3JD2 A;  5LGN A;  1PV0 A;  1GM8 A;  1N33 O;  3CB2 A;  2OCC B;  5LHH A;  4X20 B;  2RJZ A;  3E86 A;  1M1K W;  3K57 A;  5B1A C;  1JFF A;  4X62 B;  4FFB B;  1JA8 A;  2H94 A;  4JZ2 A;  2WLJ A;  1L0N H;  3W7S A;  1R3J C;  4YJ2 B;  5GON B;  1EN4 A;  2QDO A;  4X62 O;  1KKC A;  5KAF Z;  1BZK A;  2DWE C;  3QF7 A;  2KSD A;  4O4J A;  4I50 A;  3JAS B;  2XOK G;  1NTM H;  5EYP B;  1OCC C;  4I5S A;  2X7R B;  4TQF A;  2RNB A;  2Q0O C;  3ZHV A;  4CS3 A;  1WLE A;  1EN5 A;  3A0R A;  1WP7 A;  3DXR B;  4DR5 B;  3F7V C;  4H33 A;  1VQK V;  3K79 A;  3RVY A;  3A2F A;  3G6E V;  3VQX A;  4WBN B;  4B3R B;  1YF2 A;  2B1G A;  4DR3 O;  1G1X B;  1M5I A;  1OCC B;  1YIJ V;  4QJF B;  1R6N A;  1GRJ A;  3B2E E;  2ZDI C;  1K8A W;  2PI5 A;  4GUN A;  5H5N A;  2HVJ C;  1QR9 A;  3H1H H;  3Q4H B;  1AJN A;  1W59 A;  4IHJ A;  1IBK O;  5BMV B;  1M56 C;  4H37 A;  3IAY A;  4O4L A;  3OAA G;  1SES A;  3TJT A;  4K3A A;  1S3J A;  3B77 A;  2YXH A;  3P32 A;  2Q9L A;  1DLB A;  5CA1 B;  3L74 H;  1B06 A;  3M7M X;  3T4D A;  2QWO B;  2KKW A;  4WFH A;  1SZT A;  4ZKI A;  3L75 H;  1AR4 A;  3E8H A;  2WLI B;  1NR1 A;  4KHP B;  2P5O A;  1ORQ C;  3UQ8 A;  3H1I H;  1Q6I A;  1PD3 A;  4AHC A;  3T4Z A;  3K3W A;  4KHP O;  3BFR A;  2XUM A;  3ASO C;  2HVK C;  3AG3 C;  4UCT A;  3CCM V;  4GKJ B; 
#chains in the Genus database with same CATH homology
 2LP7 A;  2ZDI A;  2JJ1 G;  4MVZ A;  1ARO P;  1MOF A;  1NBM G;  3ETG A;  1L1F A;  1FXK C;  2A0L A;  5EC2 C;  3CMA V;  3OM3 B;  4PA4 A;  3ZJZ A;  3TK1 A;  1AI5 A;  2QM8 A;  4JAS A;  1NKD A;  3ASO B;  1Q86 W;  1PNM A;  2W0F C;  2OTJ V;  3T1C A;  1THZ A;  1GKF A;  3D3I A;  3WG7 B;  3OEE G;  2EIM B;  2EIN C;  5IYD O;  1BMF G;  4MTF A;  1FXK B;  2WLI A;  3CCQ V;  1M9N A;  2ZQM A;  3ABK B;  2EJR A;  2DWD C;  2R9I A;  1AI6 A;  3CYO A;  1RM1 B;  2DYS C;  2Q68 A;  1EBO A;  4DO2 A;  1K9M W;  2IJH A;  2DQ0 A;  4QIW F;  1K97 A;  2IJI A;  4U7O A;  3MHH C;  3QO8 A;  1M90 W;  1KP2 A;  2EIN B;  4MW8 A;  4JGS A;  4MS2 A;  3ABM C;  2NLJ C;  2Z5U A;  5EC1 C;  3CCM V;  1SRY A;  3E35 A;  5EBM C;  1AI7 A;  3ZRV A;  3ETD A;  3LDD A;  4KP4 A;  1K7D A;  1HWY A;  5CA3 A;  3LSS A;  3FYI B;  3CD6 V;  4MW3 A;  1QBZ A;  4GX1 A;  2XAH A;  1VQ5 V;  3E2E A;  1OHH G;  2X6B A;  1KEC A;  1PNK A;  1M57 B;  2KB1 A;  2WLH A;  2GSM B;  3TET A;  1E1R G;  3CC2 V;  4GX0 A;  4LCU C;  5L3B A;  3QNE A;  3WFV A;  2MK3 A;  4MTG A;  1NH2 B;  3LNM B;  2DQ3 A;  2GHY A;  2WLL B;  3CCL V;  3CCR V;  3CCU V;  1FXK A;  1QCE A;  2EIK B;  1H2G A;  4MT8 A;  1BL8 A;  1R73 A;  5EBW C;  3ABL C;  2ATK C;  3K06 A;  4WFG A;  2XAS A;  1OCO C;  4R7C A;  1W2B U;  3OFN G;  2NNU A;  1GM7 A;  3ASN C;  2UXX A;  4GT1 A;  4Z1M G;  3D36 A;  1SET A;  3SYO A;  5B3S C;  4FK5 C;  1AJP A;  3K9A A;  4FIP C;  2QM7 A;  4P9P A;  2HLD G;  4X88 A;  4E2L A;  4UV9 A;  5LGU A;  4UVA A;  2Y69 B;  2WLN A;  5B1N A;  1EZJ A;  4DXW A;  1OZ0 A;  3ABL B;  2HR3 A;  4MVQ A;  1I5X A;  2X6A A;  2HKO A;  4RQE A;  3BEH A;  1VQ9 V;  1QLE B;  1FFT B;  4PDL A;  3LUT B;  5B3S B;  1K73 W;  3AG4 C;  3OUS A;  5EBL C;  1AR1 B;  4XBF A;  1Y66 A;  3CXC U;  4WFF A;  4JTC B;  1CEZ A;  4JAU A;  3W7U A;  1TUE B;  3P30 A;  4HAM A;  5IY5 C;  5C93 A;  2D3O W;  4RUE A;  4TSF G;  3X2Q B;  5KA5 A;  5CBH A;  1KC8 W;  2P6J A;  3K08 A;  1VQN V;  1S0V A;  3F7Y C;  1RPR A;  4WF9 V;  2EIM C;  1Y4M A;  1WPX A;  3AG4 B;  1NVP D;  1N8R W;  3EFF K;  3KG2 A;  3QO5 A;  3E8G A;  4RO2 A;  2WAM A;  3ZCC A;  2Q69 A;  2IH1 C;  3ABK C;  2F43 G;  1LNQ A;  1V55 B;  4MTX A;  3E8B A;  1UJW B;  4UVB A;  1RM1 C;  3STZ C;  5IY5 B;  1GK9 A;  2XAF A;  2H8P C;  1K4D C;  3JD0 A;  1FS0 G;  4LP8 A;  4MVO A;  3CCJ V;  3OR7 C;  2ITC C;  2WPD G;  2JEX A;  4I9W A;  3IFX A;  5B1O A;  5HFM A;  1KD1 W;  4FMT A;  1VQO V;  4KUM A;  2AHY A;  4UXN A;  2P90 A;  3E8F A;  3CPW U;  1GO3 F;  4MVM A;  4U7N A;  1VQP V;  2ZR2 A;  3IGA C;  1YI2 V;  3JD1 A;  3B8N A;  3FB5 C;  1YTF B;  1G8M A;  1JPX A;  1W0K G;  1SER A;  5GW7 A;  1E1Q G;  4QE7 A;  2DYR C;  3W7W A;  3DGE A;  5E1A C;  1NJI W;  3ZMU A;  3HPL C;  1I5Y A;  1PL0 A;  2IU0 A;  2P7T C;  1VQL V;  1KKD A;  1OCR C;  1M57 C;  4PDV A;  4WFA V;  2PI4 A;  3I55 V;  2FTK A;  4PA7 A;  3JCZ A;  1XL6 A;  3AG1 B;  3SPI A;  5B1A B;  2QE7 G;  3CC4 V;  2IH3 C;  1YHQ V;  2DYR B;  2YSU B;  4TT3 G;  4G28 B;  1QVF U;  1YSC A;  2LFS A;  3AG2 C;  1K34 A;  1BHA A;  2EIK C;  5DN6 G;  4R6Z A;  1OCR B;  4G27 B;  4QE9 A;  5KA6 A;  4UUJ C;  4N21 A;  3AEI A;  2C2A A;  5LGT A;  3CP1 A;  4QNH B;  4MVR A;  1MG1 A;  1PNL A;  1R3K C;  1K4C C;  3DTU B;  3JD3 A;  2XAJ A;  4JPR A;  5L3C A;  3K0G A;  2ZD9 A;  5KUK A;  2W6J G;  4YXW G;  1OCZ B;  3K0D A;  2EBO A;  3LSQ A;  2R9R B;  3RVZ A;  3OGC C;  3JD4 A;  2HG5 C;  3AG2 B;  2QA4 V;  3FB8 C;  2Y69 C;  2B1I A;  2DW4 A;  2ITD C;  4GX5 A;  4CZZ A;  1QLE C;  2EIJ B;  2IJK A;  5EK0 A;  1F23 A;  4BW5 A;  1V54 B;  1JCH A;  2CK3 G;  4JF3 A;  3W7T A;  1VQ6 V;  3PJS K;  3SYP A;  4CBC A;  1BHB A;  5J9P C;  3FB7 C;  1K33 A;  3K03 A;  3ETE A;  3GB7 C;  5IYB O;  4RQF A;  4PEL A;  3FKS G;  1F4N A;  4PA9 A;  4RUF A;  1VQM V;  3X2Q C;  4FJC C;  2Q67 A;  3CCE V;  1JJ2 U;  4BIU A;  2ZR3 A;  2IW5 A;  3IC7 A;  5FL7 G;  1JOY A;  2JDI G;  1AJQ A;  2V1D A;  4XDJ A;  3CC7 V;  1GTO A;  4GX2 A;  5CN0 A;  2M7W A;  1VQ8 V;  1CPY A;  3E83 A;  1MAB G;  2JEU A;  5L3G A;  1M56 B;  3CCS V;  1V55 C;  2P67 A;  1QLN A;  3FYE B;  5LHI A;  1ZWI C;  2BOB C;  1P4R A;  3JYC A;  5LBQ A;  4TWK A;  3LDC A;  3VBB A;  2WLL A;  4J9Z B;  2HFE C;  3RW0 A;  4JAV A;  4ASU G;  1YJW V;  1GM9 A;  2XAG A;  3SYC A;  5CBF A;  1B6Q A;  4UVC A;  1CP9 A;  2Q6A A;  4BAY A;  1NR7 A;  3ZMT A;  3I56 V;  1F51 A;  2OCC C;  2UXN A;  3SYA A;  2WLK A;  4QPK A;  1J95 A;  3ABT A;  4MVS A;  3ZRX A;  4JYB A;  4L87 A;  3ZRS A;  1S72 V;  3VOU A;  1K5Q A;  5CBG A;  1Q81 W;  3E89 A;  3WG7 C;  3MHS C;  3G4S V;  4Q20 A;  5HFL A;  2IU3 A;  4KFM A;  3GWO A;  3JD2 A;  5LGN A;  2AHZ A;  3OMI B;  3SYQ A;  1GM8 A;  1Q7Y W;  2OCC B;  5LHH A;  3OEH G;  2QEX V;  4EKW A;  5L3F A;  3AG1 C;  3E86 A;  1S77 D;  5LHG A;  1NQT A;  1M1K W;  3HB3 B;  5IYC O;  5B1A C;  1F4M A;  1S76 D;  2WLM A;  1QVG U;  4UV8 A;  2H94 A;  4P9O A;  3AG3 B;  3B8M A;  1AI4 A;  2WLJ A;  1W0J G;  3W7S A;  1NH2 D;  1R3J C;  4BIZ A;  3CME V;  4LC1 A;  4RAI A;  3STL C;  1RPO A;  3RBZ A;  2DWE C;  4MVU A;  4QPJ A;  3ABU A;  5H6Q A;  1NVP B;  1Q82 W;  1OCZ C;  1PKX A;  1JVM A;  2XOK G;  4XDK A;  4HYO A;  5DM6 V;  1QR8 A;  3K04 A;  1OCC C;  1YIT V;  4I5S A;  2X7R B;  3SPC A;  3LDE A;  1MSW D;  3FB6 C;  4P30 A;  3ZMS A;  1H38 A;  2HJF C;  4MTO A;  1WLE A;  3T2M A;  3A0R A;  2EZO A;  2YEV B;  5KUM A;  2EIJ C;  3OW2 U;  2JK5 C;  3F7V C;  3ZIA G;  3R65 A;  4H33 A;  1VQK V;  3K79 A;  5L3E A;  1COW G;  1V54 C;  4GCZ A;  2EZP A;  1K92 A;  3OMA B;  3RVY A;  4PDR A;  3ZRW B;  1ENV A;  3G6E V;  1S5H C;  4FPP A;  2DYS B;  2B1G A;  1OCC B;  1YIJ V;  4QJF B;  4XDL A;  1R6N A;  4HZ3 A;  1E79 G;  3TCU A;  2ZDI C;  4JTA B;  1K8A W;  4PDM A;  1YJ9 V;  4JTD B;  1P7B A;  2OT5 A;  3UM7 A;  2PI5 A;  2JJ2 G;  2Z3Y A;  1KQS U;  3OMN B;  2HVJ C;  1QR9 A;  3ABM B;  3QO7 A;  5L3D A;  3W7X A;  1GMG A;  1AJN A;  2OTL V;  4PA6 A;  5B1B C;  3MD0 A;  4R8C A;  1KP3 A;  1R3L C;  3M99 B;  4X8A A;  2XND G;  2JIZ G;  3ZMZ A;  2QKS A;  4WCE V;  1M56 C;  3UKM A;  2BOC C;  4H37 A;  1DF4 A;  1DF5 A;  2A79 B;  3ML0 A;  4WFE A;  1FXH A;  2X6C A;  2WSS G;  2Y48 A;  4J9Y B;  1H8E G;  3SPH A;  1IXM A;  1EFR G;  4JYC A;  2X0L A;  3OAA G;  4LBE C;  1SES A;  3BY6 A;  4OXS A;  4X89 A;  1S3J A;  3B77 A;  2XAQ A;  3P32 A;  5B1B B;  1DLB A;  4P2Z A;  1VQ7 V;  2IJJ A;  5CMU A;  2YEV A;  2V7Q G;  2B5U A;  2QTO A;  4N23 A;  1XL4 A;  1H8H G;  2WWW A;  3ZRW A;  1VQ4 V;  1R6K A;  4PA3 A;  4WFH A;  1JX9 A;  3T4D A;  2EIL C;  2ZXW C;  1SZT A;  3ZN1 A;  5IDJ A;  4ZBM A;  4ZKI A;  3G71 V;  1YJN V;  1OCO B;  3E8H A;  3SJQ C;  1ROP A;  2WLI B;  4G2K A;  1NR1 A;  3ASN B;  1FXV A;  1ORQ C;  4R50 A;  3OR6 C;  3SPJ A;  3ZMV A;  3OUF A;  1YTF D;  3SPG A;  3H01 A;  1PD3 A;  1G4Y B;  4MSW C;  2K1E A;  5H6R A;  1R3I C;  3CCV V;  1K3E A;  2W6I G;  3NXS A;  3T4Z A;  3EHB B;  3K3W A;  3OE7 G;  1DTO A;  1JQ0 A;  2EIL B;  2ZXW B;  5H9C A;  3ASO C;  1K5S A;  2HVK C;  4WFB V;  3ZN0 A;  5BZB A;  3AG3 C;  3F5W C;  4F4L A;  2LFR A;  2A9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...