3VOUA

The crystal structure of nak-navsulp chimera channel
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MLSFILTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTVEGLRPLDALYFSVVTLTTVGDGNFSPQTDFGKVFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKETDAYRLEVMEKLEAIEKKLAEHSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ion transport 2 domain protein, Voltage-gated sodium channel
publication title The C-terminal helical bundle of the tetrameric prokaryotic sodium channel accelerates the inactivation rate
pubmed doi rcsb
source organism Bacillus weihenstephanensis
molecule tags Transport protein
total genus 54
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3vouA00
2R9RB 2YEVA 2AHZA 5B3SC 2X6BA 3E86A 2DWDC 3K06A 1LNQA 2WLHA 3OUSA 4TWKA 1QLEC 2Q69A 4WFEA 2HG5C 3STLC 4F4LA 1M57C 2EINC 2EIMC 2WLJA 4KFMA 4WFHA 3FB7C 4PDRA 4RUEA 3AG2C 1J95A 3T4DA 4EKWA 4GX0A 4PA7A 3RW0A 4G27B 2ZXWC 3GB7C 4PA9A 4H37A 5EBLC 3OR7C 5KUKA 5EK0A 1K4CC 2BOBC 3ABLC 4OXSA 5B1AC 5CBGA 2H8PC 3SYCA 3ABKC 3RBZA 3LDDA 4MVOA 2Q6AA 4WFGA 3AG3C 4ZBMA 1P7BA 2EIJC 3K0DA 4MVMA 3SJQC 2WLIB 3OR6C 2IH3C 3ABMC 4JTDB 3K03A 4XDKA 4PDLA 3UM7A 1V55C 4UUJC 3TCUA 3ZJZA 4P9OA 3T4ZA 3ASNC 1R3JC 1XL6A 2Q68A 4WFFA 4PA3A 2Q67A 1M56C 2EILC 2DYSC 3ZRSA 4LP8A 3EFFK 5EC1C 1OCRC 3OUFA 4R6ZA 4PA6A 2HVJC 3IFXA 3WG7C 2WLKA 4MTGA 1S5HC 4MVZA 3K08A 1XL4A 2ITCC 5E1AC 1V54C 4I9WA 4P9PA 3LDEA 4R8CA 3SYAA 2BOCC 3UKMA 3TETA 4LBEC 4GX5A 2WLLA 1BL8A 4PDMA 3FB5C 2KB1A 4MW3A 3SPJA 3ASOC 5IY5C 5EBWC 1OCZC 3R65A 2DYRC 3E8BA 1R3IC 3VOUA 2A0LA 2X6CA 2X6AA 3JYCA 2HVKC 4LCUC 4MTFA 2IH1C 4RUFA 4JTCB 4MVQA 2QTOA 2HJFC 1G4YB 5CBFA 2ATKC 1JVMA 3E8GA 3IGAC 3SPHA 3E8HA 2QKSA 2Y69C 5EC2C 3FB8C 4CBCA 4P2ZA 3K04A 4QE7A 4X88A 2DWEC 4MTOA 2A79B 3F7VC 4JTAB 4X89A 5EBMC 3E8FA 3RVZA 3PJSK 4R50A 3AG1C 2OCCC 4R7CA 3K0GA 5BZBA 5J9PC 1OCOC 4MS2A 4G28B 2WLMA 2AHYA 4J9ZB 5KUMA 4QE9A 1R3LC 3F7YC 4MSWC 3OGCC 2P7TC 3F5WC 2ITDC 4X8AA 3AG4C 3BEHA 3SYPA 3X2QC 2WLNA 4GX2A 2ZD9A 4PA4A 5B1BC 3SYQA 2JK5C 1K4DC 4HYOA 4H33A 4HZ3A 2K1EA 2W0FC 3E89A 4XDJA 2WLIA 4DXWA 2HFEC 3E83A 4J9YB 4P30A 1KKDA 2NLJC 3SYOA 3T2MA 3FB6C 2WLLB 4MVSA 4MVRA 4RAIA 4RO2A 3LDCA 3T1CA 3SPIA 4QNHB 2A9HA 3LUTB 1ZWIC 1ORQC 1R3KC 4PDVA 3SPCA 2EIKC 3HPLC 3KG2A 4XDLA 4BW5A 5CBHA 4GX1A 4MW8A 3RVYA 3STZC 4MVUA 3LNMB 1OCCC 3SPGA
chains in the Genus database with same CATH superfamily
2Y69B 4J42A 4LF9O 1LNQA 5H5NA 1Y74A 2VQFO 2ZNIA 3QO5A 3HKBB 1ROPA 2FMLA 3OE7G 4BAYA 1WN7A 5DN6G 3BABA 4RUEA 2DOSA 3T4DA 4KHPO 4AI8A 3FAVA 2F93B 1K7DA 4JI5O 5EZYA 3C3SA 3MHSC 4NKGB 1MMMA 2AGAA 3OR6C 2V4DA 2JGDA 4LWSB 3WB0A 2HR3A 1YZBA 1PNMA 3FD9A 3QTCA 2IJJA 5LGNA 4FLTA 3E35A 2Q67A 4X62O 1F51A 1G1XB 4KP4A 1R6KA 2QA4V 4GLXA 5LXTB 3CHXA 2RNBA 2D3OW 2E75B 2EX3A 1IDSA 4DV4O 3J7AU 3APQA 3JCZA 2OTLV 1XHXA 1EFRG 2B9ZA 3G71V 3SJAC 1NZ6A 1KP2A 4PD4F 5AG2A 1S0VA 1SETA 2ZIOA 5CB4A 1Y6XA 2Y48A 4Z1VA 5L3CA 2IH1C 3SDLA 4DR6O 5L3DA 5L3FA 2QKSA 4GKKB 3HKBA 4QE7A 4YY3O 1KD1W 5H9CA 3AG1C 3E22B 5JJJB 1AVMA 2PY5A 2XAHA 1MABG 3ETDA 5CA0B 1EN5A 4MSWC 3F7YC 4OX9O 2F4VO 3BRCA 4BWAA 4DV1B 5IDJA 2IJIA 1N36O 4B7EA 1CEZA 1VF6C 3X2QC 1GN4A 4H33A 3DC5A 2VWKA 4CS3A 1KKDA 3OD4A 4WF9V 1YTFD 4LWSA 3IC9A 3ZIAG 1X59A 1KC8W 3SPCA 2IU3A 1H2MA 4X9QA 1W0JG 1JPXA 4DK1A 1GRJA 1KP3A 4K8XA 3ZX6A 3EXAA 2XAFA 1JFFB 2P6JA 1YJ9V 4DR1B 2H3OA 1PD3A 3VBBA 4FLUA 4FPPA 2PI5A 4D7TA 1QR8A 1M9NA 1NVPD 1O9HA 4NXNB 5H6QA 1K5SA 2GUZB 1WPBA 4J7KA 5JWPA 1IBMB 5B1AC 4MT8A 2E5LO 5C93A 2O57A 4KXRA 1BS3A 5KHHA 2FB5A 4JTDB 5KHKA 3E22A 3UM7A 4I50B 4CS4A 3ZJZA 5CA0A 3T1YB 3RGBA 3N27A 2JGUA 4B3TB 1QLEB 1HNWO 5B1BB 1U97A 3I5DA 4X1IB 1K33A 4JI2B 5LYJB 1IXBA 4H0LB 2ZIMA 1KQSU 1QU7A 4N23A 2AW9A 1B3QA 1AI4A 1JFFA 2HJFC 1FPOA 1MNGA 1R6TA 3Q4HB 4ZI7B 2UXBO 3IGAC 2RDCA 5GONB 3BHPA 3ABMB 2EJRA 3CC4V 2DWEC 1XMQB 3S3XA 1H2GA 5EBMC 4LFCB 1S77D 4R7CA 1F4NA 1M57B 3LSQA 1M56B 2YC0A 1SA0A 1H2KA 4H13B 1FFXB 4O2BB 1K73W 2BE3A 2GHYA 3J80N 5FNVB 3G67A 1NS1A 4I50A 1NJIW 1VQOV 4K35A 1WJZA 4DV0O 2EIKC 1VQKV 1QNMA 2RQ6A 1WP7A 1OCCC 1XMOB 1EN6A 2Q0AA 1BT8A 4X1IA 4F4LA 3K5MA 2ZDIA 3ZEDA 2EIMC 3DSQA 3A2FA 4I55B 4PA7A 5LYJA 4LFAO 2ZXWC 1YIJV 1CP9A 1K4CC 2WWWA 3Q4HA 2GTSA 4ZI7A 1M4UA 1KMIZ 4B7KA 3OMAB 4Z2WA 3JALA 2E76B 2IH3C 4X66O 3D36A 4XDKA 3UO2A 4K0KO 1JA8A 4RWUA 1J5EB 5KHIA 4ZHQB 2YDEA 1SQVH 2AXTZ 2OIGA 4JF3A 3JAMN 1XNRB 4X64B 5LMUB 3RWRD 4OPAA 3EVKA 3ZRVA 1S76D 5KHGA 1XL4A 5FLXN 1FFXA 4O2BA 5FNVA 4JV5O 2WA4A 1QVGU 3CCSV 4UVCA 3E8BA 2N04A 4LCUC 1R73A 5CBFA 2OT5A 2GDSA 2M6YA 3CRQA 4X89A 3RYIB 4JI7O 3QF7A 4I55A 3G80A 4JI1O 4IYHA 1NR1A 1WB8A 3OGCC 1TUBA 1XQ8A 3AK2A 2QDOA 4DW1A 4GKJO 2CTPA 4B3SO 3N2KB 4PV1B 4HYOA 4J41A 3CD6V 3L70H 4P30A 2WLLB 1YVWA 1VIBA 4HBNA 3MAQA 2F43G 4JYCA 4JI3B 3SPGA 3RYCB 3W7TA 3VQXA 1EZVH 2H94A 4DRXB 1K34A 1VQ4V 4AHCA 2JEUA 4UVBA 4PDRA 3MDSA 1SQBH 3J81N 2PI4A 2BOBC 3JSNA 1RSOB 5KLVH 2UXCB 2C2AA 3P3PA 1QHTA 1MZEA 2VWJA 3RYIA 4JAVA 4JI4B 1WLEA 4DW0A 3CC7V 5E79Z 1SRYA 5B3SB 2PYJA 1NH2D 3AG7A 3OUFA 3ZHTA 3N2KA 5A9GA 4IHJA 3LDEA 3MD0A 2WLLA 5L3EA 1IBMO 3HKCB 2P5OA 2QTSA 1RPRA 2RMKB 4DV3B 4LC1A 3AG3B 4YIPA 2HVKC 1QBZA 4RUFA 5IWAO 4QPKA 4TV9A 3ETEA 2LP7A 3AK3A 3CJHA 3JSLA 3K0GA 5BZBA 2WLMA 1SKVA 1RM1C 1D5NA 4LFBO 4B3TO 1HNXO 3OT7A 1RSOA 3CPWU 3AG4C 4UV8A 2ARHA 5B1BC 2JK5C 3L74H 4OPHA 2JS3A 1KKCA 4EFBA 4D7SA 3FB6C 1CPYA 3T1CA 1PKXA 1K5QA 4LF7B 4FLXA 4KUMA 3NR7A 2V7QG 2EJ7A 2UXDO 4FIPC 2XNDG 3SR2C 4UCSA 5IJ0B 2IM9A 3JD2A 1TAEA 1M93A 4LF6O 2BSKB 1XMQO 1QQCA 5KAFZ 2ZE5A 3CCMV 2QWNB 1Q7YW 1R6NA 3T1HB 1M57C 1E1QG 2YUAA 3UQ8A 1VQLV 3CMAV 3HKCA 1AILA 2PGGA 4GX0A 4F6RA 3ZMTA 4DV7O 5CMUA 1VQ7V 1YITV 3ZN1A 1YHQV 2JJ2G 5GTHZ 1XREA 3GVMA 5LL6Y 1GN3A 4RQEA 2QWRB 4PA3A 1XEQA 4JI6B 1PP9H 1N4CA 4R6ZA 2ETNA 1JCHA 2BOCC 5IYDO 3HR0A 1FXHA 4O4IB 2K9PA 3JAKB 1VEWA 4J7ZA 4YHHB 4LF4B 2NR5A 3DTUB 5JCOC 5IJ0A 1WA8B 4JTCB 4TOIA 2BSKA 4FM0A 5FPOA 3M7MX 1S72V 5KMGB 2QM7A 2LW7A 4U3JB 2KKWA 1COWG 1Y74B 1Q5OA 2AHYA 2VRZA 4JZ2A 5EYPB 1R3LC 2CE4A 1YJWV 1NTZH 5CA3A 3SYPA 5IYZB 3FAVB 2WLNA 3KKYA 3ABKB 2K1EA 1IVSA 3WFVA 4J9YB 1Q43A 1O9GA 3K3WA 4PDVA 1XNQO 3F5TA 3M99B 2A06H 2JGDB 2FYUH 3KCXA 2QE7G 2ZE6A 1MOFA 3E86A 4UB6Z 3STLC 1SZTA 1BHAA 3CS5A 3VQVA 3WB1A 4EKWA 1KB9F 1Y66A 4O4IA 2PF4E 3JAKA 1I08A 1WA8A 2DYRB 5CBGA 4H44B 2H8PC 3LNNA 3ML0A 4ZBMA 4I9QA 2DW4A 5CB4B 5KMGA 4U3JA 1PV0A 1SESA 5LMNB 1W2BU 1GO3F 2UUAB 2HEPA 5EYPA 1S5LZ 4JI3O 1DF4A 3H1LH 2XAGA 4LH7A 3D3QA 5IYZA 5CN0A 2ITCC 2QM4A 2UU9B 4UXNA 1BL8A 2CAZC 4X65O 5DECA 5EBWC 2B1IA 1IBLO 1FAFA 1A32A 4DUZO 4IYIA 4MVQA 4CH4A 1I94B 4CBCA 2ZE8A 5JVDB 3RVZA 5DM6V 1Z5WA 2UUBB 1IX9A 4J11A 1ZLZA 2ZCEA 1P49A 1XBLA 3B8NA 2ADQB 1HWYA 4DR7O 4C7UA 2N74A 3C3TA 3E89A 4DXWA 2ILMA 3ZHUA 3TXQA 1I0HA 4GUNA 1OCZB 3CCRV 4TUYB 1NTMH 5GTIZ 2UUCB 4GX1A 2ZM6B 1M1KW 3H9VA 2YIBD 4HAMA 4YJ2A 1N33O 2ZT9B 4MTXA 2VQEO 1OZ0A 2DQ3A 3FB7C 3JD0A 2YXLA 1AI6A 3U0ZA 4H37A 3CCLV 2JDIG 4MVOA 2IJHA 2EIJC 3LSUA 2L35A 2CGOA 3CSXA 2JRIA 5JVDA 4DR5B 4JI0O 2Y0IA 5BR8O 3K59A 2ZKOA 4Q6GA 2HP8A 2FKXA 4BW9A 5LP6C 4NR1A 1M90W 4LP8A 5LHIA 4RQFA 1VMGA 2DMXA 1DK1A 1JX9A 2YEVB 1N34B 3DC6A 1VQ8V 4R8CA 1SA0B 3TETA 5B66Z 1AB3A 4DR4O 1HNZO 4UV9A 1Y76B 4TUYA 2YS8A 1P4RA 2ZINA 3ABLB 4UCRA 2OYQA 1PL4A 3JYCA 3L73H 4DV5B 4LF5O 1WPXA 1URFA 4JZGA 2CDYA 4JPRA 1I5YA 1SQPH 4P2ZA 2HHHO 5EIBC 1V55B 3E8FA 4GT1A 4JI6O 1KBHA 1K97A 3AG2B 4QE9A 3ZHQA 1YTFB 4TSFG 1OCRB 4L87A 4I7ZB 4JYAB 1V54B 3OEHG 3G6BA 1OHHG 4XDJA 3SGIA 1SZXA 2R72A 2X0LA 1OV9A 1Q81W 4QNHB 4NXMB 1BGYH 3ASOB 3K79A 3JALB 3RYHB 2QWQB 1F4MA 1FXKC 1HW7A 4ICGA 2P90A 5BMVB 1NVPB 2YEVA 4TV8A 4WFBV 4DV2O 4JI8O 1MZFA 2HG5C 1R1BA 2MW2B 4KFMA 2P4VA 3O9OA 2RJZA 2HJDA 1ZSPA 4DR3B 1N32B 1Y76A 1JOYA 2ZQMA 1TUEB 1JMKC 3OR7C 3BPZA 1TGOA 3HKEB 3ABKC 4LH6A 1AR4A 4FMTA 3D8CA 4DUYB 3SJQC 1NR7A 2DN9A 1H2NA 3ABUA 3K03A 1B04A 1Q3EA 3CRMA 5JQGB 4UUJC 2E3CA 2Q68A 4WFFA 5B1OA 4B3RB 5JH7A 2QJ1A 2DYSC 3OTOB 1IBKB 1HR0B 4I0XB 1S5HC 3D3IA 5KA5A 1TUBB 5LHHA 1EN4A 1YF2A 5DEDA 1ZAUA 1WP8A 1SQGA 1FJGO 3RYHA 5JJNB 4DR2O 3CCJV 2DYRC 4TQDA 2R9IA 1YEWA 3ETGA 4J10A 5LGTA 1LUWA 5BMVA 1GN6A 4FLYA 2Y69C 2WAMA 1Q82W 4MTOA 4EEQA 3ABTA 4AILC 5J9PC 1NQTA 4MS2A 3ETQA 3RN4A 2AZ0A 4IIJB 1W0KG 1H2SB 3F5WC 1V9PA 2DQ0A 4F6EA 4X8AA 3HKEA 3QG5A 3WG7B 3I56V 2LFRA 1JQ0A 1JJ2U 3A8TA 3SYQA 4N21A 2W0FC 3CB2A 3G4SV 3E83A 2P22C 3O65A 1L8DA 1Y67A 3KCYA 5JQGA 3RT3C 2BTOA 3LUTB 3PN1A 1RPOA 1OJHA 5BY1A 1UJWB 1XDCA 3ASNB 3RYFA 2JJ1G 4I0XA 5J2TB 2AHZA 1HP8A 1AI7A 2YSUB 4J7JA 3CX5F 1DTOA 2NNUA 4IHJB 4W4LA 4BIZA 3FFQA 5IY5B 3OTFA 1GKFA 3SYCA 4JYBA 3B09A 2JS5A 3HB3B 4GKKO 4DK0A 4TV9B 4PDLA 3K5NA 4QJFB 4IIJA 1KECA 1EZJA 1OCOB 1XL6A 2HLDG 3CJHB 5IYBO 3TK1A 4DV1O 2IJKA 4QIWF 4LF9B 2YI9A 2VQFB 3APOA 1N0JA 2L6LA 1D2DA 3L72H 3JCUZ 1XHZA 5H6RA 4PDMA 4KHPB 1EM1A 4PHZA 4J80A 3R65A 3BCCH 3CE2A 4JI5B 3C90A 3VQWA 1I7FA 2KG7B 1BCCH 5J2TA 3WU2Z 1BQ0A 1B06A 4DR1O 5IT9N 3H01A 2A79B 1JJOA 4X62B 4NXNO 2Y4UA 1VP7A 4F6RB 1NKDA 5BXZA 3KZIZ 4GX2A 4NYKA 4UCUA 2HFEC 4DV4B 1UPGA 1E1RG 4MVSA 1ZWIC 4MW8A 3AEIA 4DV5O 4MVUA 4FFKA 3T1YO 4DR6B 1Q86W 2R9RB 1FD9A 1SQFA 2EZPA 2X6BA 2YICA 1BSMA 1VQ9V 1QLEC 4YY3B 2OCHA 3ZMVA 2XAQA 1GAXA 3LSSA 3AG2C 1F7YA 1J95A 2KQXA 2ZDIC 1AJQA 4A5UB 4OX9B 4JI2O 2F4VB 3GB7C 4X1YB 5EIBD 1N36B 3X2QB 3CCVV 2KG7A 3LDDA 4WFGA 5LOVB 1L0LH 4UVAA 3ABMC 3N2GA 4LFCO 3D36C 2CTRA 2EZOA 4PJ0Z 4UB8Z 4E4EA 1YJNV 1M56C 4WCEV 5FL7G 1SF9A 1K92A 5E1AC 4U3FH 1N32O 2A3QA 3UKMA 4Z1MG 1ZX3A 2A7WA 3MHHC 5KHJA 2QR4A 3QNEA 1VQMV 1R3IC 5B1AB 3B2EE 4WFAV 2LFSA 2A0LA 3BAAA 2GTAA 1XMOO 1PNLA 5D5PA 5B5EZ 3E8HA 5EC2C 5HFMA 2Z5UA 2Q8VA 4JTAB 4R50A 5IJ9A 4QGPA 3ZS8C 2LJ2A 3ZMSA 1LR1A 4FM2A 1PL0A 4X1YA 1VF6A 2R9AA 1JR9A 5LOVA 1HNWB 1K4DC 3CC2V 1P7GA 1DGSA 4O4HB 4FK5C 3H1HH 3JARB 1J5EO 1GH6A 1BMFG 1VF5B 3IC7A 2UXBB 1XNRO 1Y4MA 4X64O 3QO8A 4CS2A 5LMUO 4HNAB 3CXCU 2MK3A 2RCVA 3P3NA 4WFEA 2FL4A 4JGSA 1YXBA 2N05A 1I5XA 4TT3G 3WB2A 2WLJA 2OIEA 2F23A 3U10A 4O2AB 4KL1A 5EBLC 4FLVA 4OXSA 4W4KA 3RBZA 3B77A 4DYLA 3CYOA 1AROP 4I4TA 4CH6A 3CCEV 5J2UB 2EIKB 1VARA 4DV0B 1ZUQA 4P9OA 2OCCB 3ASNC 1OCCB 3A0BZ 1X4TA 2G38A 4PA6A 2OTJV 2HVJC 3IFXA 3TJTA 2R70A 3W7SA 5L3BA 1MG1A 3SJBC 2EIMB 2B5UA 4GX5A 3TXSA 4O4HA 2CH7B 1YCIA 1WNSA 2KB1A 2ZXWB 4G2KA 4LFAB 4TQFA 2YIAA 5TISZ 3JARA 5IY5C 3BA9A 4BIOA 1AJNA 1RP3B 1JVMA 4HNAA 4LR3A 4E2LA 4IL6Z 4YJ2B 4X66B 5KAIZ 3UT5B 3ZBHA 1OCOC 4K0KB 4G28B 4XBFA 2RN9A 4J9ZB 4CH5A 1MSWD 2PZSA 3OFNG 4O2AA 4B3MB 3U11A 1KYOF 2UXCO 3CMEV 3CXHF 4JV5B 5J2UA 2A9HA 1R3KC 4JI4O 1GM7A 1TA8A 4CZZA 4JASA 4LF8B 4ASUG 1ZTEA 3AK1A 1YI2V 1VF7A 5B3SC 1MA1A 2IBZH 2Q69A 4L8JA 2PYLA 2FTKA 2Q7EA 5ITZB 2LGQA 4PELA 1AP5A 4JI7B 3K9SA 2CH7A 2UXXA 4JI1B 3VQYA 2GBOA 3BA8A 4G27B 4PI0A 1FKAO 2Q7HA 4DV3O 5EK0A 4GKJB 1AI5A 4B3SB 1N8RW 2QWOB 3AG3C 5L3GA 2W6IG 4ZOLA 3JASA 4O4JB 3UT5A 1FS0G 4ABMA 3M8AA 1QCEA 4U7NA 2QM8A 3OW2U 3T4ZA 1GK9A 1SQQH 2F95B 1BHBA 1GTOA 5EC1C 2XHBA 2XAJA 5IE9A 2JEXA 3K08A 4P9PA 1F23A 4LBEC 3W7XA 1XUQA 4GYCB 4LF7O 1VQ6V 4MW3A 2Z3YA 4BR6A 4IGGA 2ZNJA 2Z0AA 1G4YB 5C8YB 5LBQA 3DGEA 3K04A 5H2FZ 5ITZA 3T1HO 3K5LA 4TV8B 1Q6IA 2CTWA 5LXTA 3SJCC 1CXZB 1NU1H 2Y0PA 1E79G 3H1IH 3UO3A 2V1DA 1UFIA 4O4JA 4X1KB 2X7RB 3ZCCA 1ORQC 4GCZA 1DF5A 1Q6HA 5IWAB 2ZR3A 4EB6B 3K06A 4FJCC 5JH7B 3JAWB 2PUSA 5GW7A 1IXMA 1N0NA 2QSAA 4WFHA 4AQYB 1RM1B 1XI1A 4LFBB 1XOUA 5IYCO 1HNXB 3AG4B 3G6EV 2ZE7A 3THOA 2BTQB 4YHHO 4LF4O 1THZA 3L9DA 3JD1A 1QVFU 3ZRWB 5C8YA 5A2QN 1H8EG 2ZR2A 3B4SA 1NI8A 3CP1A 1AR5A 3CRCA 1NT2B 4NTYA 3UCSC 3FYEB 4BIUA 3TCUA 4DV6B 3ZHVA 2UXDB 1YSCA 5B1NA 3CCQV 3EFFK 1GN2A 4LF6B 2GSMB 1G8MA 3K58A 4MTGA 4MVZA 3I55V 3SYAA 2YIBA 1K8AW 1YDXA 2YI8A 4X1KA 3CCUV 3ICXA 1GM8A 2GUZA 3HKDB 1H2LA 2IW5A 2E74B 2QGNA 4GZRB 4DV7B 2YXHA 2D2CB 3JD4A 2QTOA 2YXYA 4EB6A 1SERA 3JAWA 1MSDA 2B1GA 3RYFB 1VQPV 4K3AA 2OCCC 2KSDA 2EINB 5K1XA 3ZMUA 2BTQA 1FFTB 3ZRWA 4PA4A 3TGUH 1NTKH 4HZ3A 3K5OA 1L1FA 1AP6A 3QVNA 4YJ3B 5D5QA 5LMNO 2UUAO 3KG2A 3HPLC 4LNUB 5CBHA 3H1KH 5GONA 3STZC 1QR9A 4OGQB 1T5EA 2EILB 4ZKIA 1TVKB 1Q6UA 4U7OA 2PTMA 1M5IA 2WLHA 3OUSA 4TWKA 2DJVA 4FM1A 1H38A 2VS0A 2UU9O 3HKDA 4B3MO 2Q7GA 1GM9A 1PM9A 3RW0A 2QWPB 1PPJH 2Q6AA 1P7BA 3K0DA 3EHBB 4PI2A 1K9MW 1I94O 2WLIB 4O4LB 2P4KA 4LF8O 2P06A 1XNQB 2UUBO 3BVOA 1D5AA 3OGIB 2F66C 2YIDA 4YXWG 2CUGA 3DXRB 2LO1A 5LHGA 3S3WA 3FYIB 4YJ3A 4EFEA 2XT9A 2QEXV 1BZKA 2BCCH 3A0HZ 5FPRA 4LNUA 4WBNB 5JCOA 4FZ1A 1OCZC 4CC5A 3L71H 2UUCO 3VOUA 2ZM6O 2JVDA 1DLBA 2X6AA 2Y4TA 1TVKA 2ATKC 3SPHA 1BQZA 3CRRA 3PJSK 4ZHQA 1SC5B 2CTQA 4NTWA 3OEEG 5LA6B 3ZN0A 1HDJA 2OWOA 2P7TC 2ITDC 2LQTA 1S3JA 5JJEB 3ZHRA 1WB7A 4IT5A 2WLIA 4FZ0A 4I5SA 3A0RA 4O4LA 4RO2A 3SPIA 4DR5O 4X65B 4BW5A 1IBLB 3RVYA 4DUZB 3N2GB 2Q73A 4JYYA 3DXRA 1IZ3A 1XILA 1N34O 1FXVA 5F2VO 2CGNA 2CK3G 3GWKC 3ZMZA 1KU9A 3RFRA 4WBNA 4ZIBA 2GV9A 3L75H 1ZL8B 1RFYA 4DR7B 4UCTA 1P84F 3ABLC 2UXNA 1B6QA 4MVMA 3IJ4A 4YIOA 1QLNA 1EBOA 1V55C 5LA6A 3IAYA 2W0XA 4K8ZA 2QKCA 3OMIB 3AG1B 4Q20A 3B8MA 3RYCA 2Q0OC 3NXSA 2Q4PA 5IJ9B 3ZRSA 3ZRXA 1N33B 4DRXA 1OCRC 4JYAO 2WLKA 2VQEB 1V54C 4I9WA 4X20B 4AQYO 4NXMO 2XUMA 3CWBH 5KX5B 4FLWA 3ASOC 1NH2B 1Z5VA 2Q9LA 1FYJA 1ENVA 4CC6A 1SS3A 4MTFA 2EIJB 4UFZA 2DE0X 1SQXH 3FB8C 4DO2A 4X88A 4UCOA 4JI0B 4DV6O 1PNKA 5BR8B 4DR3O 3E2EA 5LP6B 2W6JG 5KUMA 1KUQA 1ZL8A 1Z2GA 5LGUA 3P32A 2LGWA 3OMNB 3BEHA 3W7UA 1K3EA 1VQNV 4FFBB 4NB5A 4FLZA 2E5LB 3BFRA 4DUYO 4DR4B 3W7WA 3FKSG 4D6TH 1HNZB 2NLJC 4MVRA 3LDCA 2EBOA 2WSSG 4I4TB 4FVMA 4XDLA 5CA1B 3K57A 4B3RO 4LF5B 4UCVA 3OTOO 1IBKO 4QPJA 3JATB 1US6A 1HR0O 2DWDC 2XOKG 2HHHB 4X20A 2EINC 2NN4A 5HFLA 3FX7A 5KX5A 1NBMG 2WA3A 3ZHSA 4PA9A 2HKOA 2WPDG 3R66A 5KUKA 4JAAA 3CEIA 1BE3H 4NVPA 2LW1A 2XASA 4NTXA 3JD3A 3BY6A 4JAUA 2Q5ZA 4B08A 1IURA 5LP6A 1Q8IA 1FXKB 2P67A 1R3JC 2JIZG 3OAAG 1G6UA 1VQ5V 3CRAA 2EILC 1LUVA 2ADPA 5K1PA 3WG7C 4DV2B 4JI8B 4FFBA 3QO7A 3B40A 1L0NH 3FB5C 1U96A 5CA1A 2AZ2A 2XTAA 3SPJA 1Q90D 2X6CA 2QKAA 5EZYB 3JATA 3E8GA 3F7VC 1AR1B 2EULA 1WAZA 3K9AA 5KA6A 1S5JA 2IU0A 4CH3A 2DYSB 1W59A 3H1JH 2ODMA 3P30A 1GMGA 2ZD9A 3GWOA 3T2MA 3SYOA 1FJGB 4RAIA 2F1MA 3OM3B 4DR2B 4ZOLB 3JASB 1FXKA 2M7WA 1AJPA 1H8HG 3LNMB
chains in the Genus database with same CATH topology
2Y69B 2AHZA 3K06A 3CCMV 1LNQA 4FJCC 1AI7A 1Q7YW 1R6NA 2YSUB 3QO5A 5GW7A 1ROPA 1IXMA 1M57C 1DTOA 3OE7G 4BAYA 1E1QG 2NNUA 4WFHA 5DN6G 4RUEA 1VQLV 1RM1B 3CMAV 3T4DA 4GX0A 4BIZA 5IYCO 3AG4B 3G6EV 1K7DA 3ZMTA 5IY5B 1GKFA 1THZA 1VQ7V 5CMUA 3SYCA 1YITV 3JD1A 1QVFU 3MHSC 3ZRWB 1H8EG 3ZN1A 2ZR2A 3CP1A 4JYBA 1YHQV 2JJ2G 3HB3B 3OR6C 4PDLA 3FYEB 4QJFB 4BIUA 3TCUA 2HR3A 1PNMA 1KECA 1EZJA 2IJJA 5LGNA 1OCOB 1XL6A 2HLDG 4RQEA 3E35A 1YSCA 4PA3A 2Q67A 5B1NA 5IYBO 1F51A 3TK1A 3CCQV 2IJKA 3EFFK 4QIWF 4R6ZA 4KP4A 2GSMB 1G8MA 1R6KA 4MTGA 4MVZA 2QA4V 3I55V 3SYAA 2D3OW 1K8AW 1JCHA 2BOCC 3CCUV 5IYDO 1GM8A 3JCZA 2IW5A 5H6RA 2OTLV 4PDMA 1FXHA 1EFRG 3G71V 3R65A 1KP2A 1S0VA 1SETA 3DTUB 2Y48A 5L3CA 2IH1C 3JD4A 4JTCB 2QTOA 1SERA 5L3DA 5L3FA 2QKSA 2B1GA 3H01A 4QE7A 2A79B 1KD1W 1VQPV 1S72V 5H9CA 2QM7A 3AG1C 2OCCC 1COWG 2EINB 2AHYA 2XAHA 1MABG 3ETDA 1R3LC 3F7YC 4MSWC 3ZMUA 1YJWV 5IDJA 2IJIA 1NKDA 1CEZA 5CA3A 1FFTB 3SYPA 3X2QC 3ZRWA 2WLNA 4GX2A 4PA4A 3ABKB 4H33A 4HZ3A 2K1EA 1L1FA 3WFVA 2HFEC 1KKDA 4J9YB 4WF9V 1YTFD 1E1RG 4MVSA 3ZIAG 3K3WA 1KC8W 1ZWIC 2IU3A 4PDVA 3SPCA 3KG2A 3HPLC 5CBHA 4MW8A 3AEIA 3M99B 1W0JG 3STZC 4MVUA 1JPXA 1QR9A 2QE7G 1KP3A 1Q86W 2EILB 2R9RB 4ZKIA 2XAFA 2P6JA 2EZPA 1MOFA 2X6BA 3E86A 3OUSA 2WLHA 4TWKA 4U7OA 1YJ9V 1QLEC 1VQ9V 1H38A 3STLC 1PD3A 3VBBA 1SZTA 4FPPA 3ZMVA 2PI5A 1BHAA 2XAQA 1QR8A 3LSSA 3AG2C 1J95A 1M9NA 2ZDIC 1NVPD 1AJQA 1GM9A 4EKWA 1Y66A 3RW0A 5H6QA 3GB7C 1K5SA 3X2QB 3CCVV 5B1AC 2DYRB 5CBGA 4MT8A 2H8PC 3LDDA 3ML0A 2Q6AA 4WFGA 5C93A 4ZBMA 1P7BA 3K0DA 3EHBB 2DW4A 4UVAA 1K9MW 2WLIB 3ABMC 4JTDB 3UM7A 1SESA 1W2BU 1GO3F 3ZJZA 2EZOA 1YJNV 1M56C 1DF4A 2XAGA 4WCEV 5FL7G 4YXWG 5CN0A 1QLEB 1K92A 2ITCC 5E1AC 5LHGA 5B1BB 3UKMA 4Z1MG 3FYIB 4UXNA 1BL8A 3MHHC 1K33A 3QNEA 2QEXV 5EBWC 1OCZC 1VQMV 1R3IC 2B1IA 5B1AB 3VOUA 4WFAV 2LFSA 2A0LA 1KQSU 1DLBA 2X6AA 4N23A 4MVQA 1AI4A 2HJFC 2ATKC 1PNLA 3IGAC 3SPHA 3E8HA 5EC2C 3ABMB 4CBCA 5HFMA 2EJRA 2Z5UA 2DWEC 3CC4V 4JTAB 1H2GA 5EBMC 3RVZA 3PJSK 1S77D 4R50A 4R7CA 5DM6V 1F4NA 3OEEG 1M57B 3ZMSA 3LSQA 3ZN0A 1M56B 1PL0A 2P7TC 3B8NA 1HWYA 2ITDC 1S3JA 1K4DC 3CC2V 3E89A 4DXWA 2WLIA 1K73W 2GHYA 3A0RA 4I5SA 4RO2A 3SPIA 1NJIW 4FK5C 3CCRV 1OCZB 1VQOV 1VQKV 2EIKC 4BW5A 4GX1A 3RVYA 1BMFG 1M1KW 3IC7A 4HAMA 1OCCC 1Y4MA 3QO8A 3CXCU 4MTXA 2MK3A 1FXVA 4WFEA 4JGSA 2CK3G 1I5XA 4F4LA 3ZMZA 1OZ0A 4TT3G 2ZDIA 2EIMC 2WLJA 2DQ3A 3FB7C 3JD0A 1AI6A 4PA7A 2ZXWC 4H37A 5EBLC 1YIJV 1CP9A 1K4CC 3ABLC 4OXSA 3CCLV 2JDIG 2WWWA 2UXNA 3RBZA 3B77A 4MVOA 1B6QA 2IJHA 2EIJC 3CYOA 1AROP 3OMAB 4MVMA 1QLNA 3CCEV 2IH3C 1EBOA 3D36A 4XDKA 1V55C 2EIKB 3OMIB 4P9OA 3AG1B 2OCCB 3B8MA 4Q20A 3ASNC 3NXSA 1OCCB 3ZRSA 3ZRXA 1M90W 4LP8A 4JF3A 5LHIA 1OCRC 4RQFA 4PA6A 1JX9A 2HVJC 2YEVB 3IFXA 2WLKA 3ZRVA 3W7SA 1S76D 2OTJV 1XL4A 1VQ8V 5L3BA 1V54C 4I9WA 1MG1A 4R8CA 2EIMB 3TETA 2B5UA 4GX5A 4UV9A 2KB1A 2ZXWB 1P4RA 4G2KA 1QVGU 5IY5C 3ASOC 3CCSV 1NH2B 4UVCA 3E8BA 3ABLB 1ENVA 1AJNA 3JYCA 4LCUC 4MTFA 1WPXA 1R73A 2EIJB 5CBFA 1JVMA 4E2LA 2OT5A 4JPRA 3FB8C 1I5YA 4P2ZA 4DO2A 4X88A 1V55B 4X89A 1PNKA 3E8FA 1OCOC 4GT1A 4G28B 4XBFA 3E2EA 2W6JG 4J9ZB 5KUMA 1K97A 3AG2B 1NR1A 4QE9A 1MSWD 3OFNG 1YTFB 3OGCC 4TSFG 5LGUA 1OCRB 4L87A 3P32A 3OMNB 3BEHA 3W7UA 3CMEV 1V54B 3OEHG 1OHHG 1K3EA 4HYOA 1VQNV 4XDJA 3CD6V 3W7WA 2X0LA 3FKSG 4P30A 2NLJC 1Q81W 2WLLB 4MVRA 4QNHB 3LDCA 2A9HA 3ASOB 2EBOA 1R3KC 2WSSG 3K79A 1GM7A 4CZZA 1F4MA 4JASA 4XDLA 4ASUG 1FXKC 2P90A 2F43G 1NVPB 4JYCA 1YI2V 4QPJA 3SPGA 3W7TA 2YEVA 5B3SC 4WFBV 2DWDC 2XOKG 2Q69A 2H94A 2HG5C 2FTKA 1K34A 1VQ4V 2JEUA 2EINC 4KFMA 4PELA 4UVBA 4PDRA 5HFLA 1NBMG 1JOYA 2UXXA 2ZQMA 1TUEB 4G27B 4PA9A 2HKOA 2WPDG 3OR7C 5KUKA 5EK0A 2PI4A 2BOBC 1AI5A 2C2AA 3ABKC 4FMTA 1N8RW 2XASA 3AG3C 5L3GA 3JD3A 3SJQC 2W6IG 3BY6A 1NR7A 4JAUA 1FS0G 3ABUA 3K03A 1QCEA 4JAVA 4U7NA 4UUJC 1WLEA 2QM8A 3OW2U 1FXKB 1GK9A 2P67A 3T4ZA 1BHBA 1R3JC 2JIZG 2Q68A 3OAAG 4WFFA 5B1OA 1VQ5V 2EILC 2DYSC 3CC7V 1SRYA 5B3SB 1GTOA 5EC1C 1NH2D 3OUFA 2XAJA 3WG7C 1S5HC 2JEXA 3D3IA 3K08A 5KA5A 5LHHA 4P9PA 1F23A 3LDEA 3MD0A 4LBEC 3W7XA 2WLLA 3QO7A 3FB5C 5L3EA 1VQ6V 4MW3A 3CCJV 3SPJA 1RPRA 2DYRC 2R9IA 4LC1A 2X6CA 3ETGA 5LGTA 2Z3YA 3AG3B 2HVKC 1QBZA 4RUFA 4QPKA 1G4YB 3ETEA 3E8GA 2LP7A 2Y69C 5LBQA 3DGEA 2WAMA 3K04A 1Q82W 4MTOA 3F7VC 1AR1B 3K9AA 3ABTA 5KA6A 3K0GA 5BZBA 5J9PC 1NQTA 4MS2A 2IU0A 2WLMA 1W0KG 1RM1C 2DYSB 3F5WC 2DQ0A 4X8AA 3WG7B 3AG4C 3CPWU 1E79G 4UV8A 3I56V 2LFRA 1JQ0A 3P30A 1JJ2U 1GMGA 5B1BC 2ZD9A 3SYQA 2JK5C 4N21A 2W0FC 2V1DA 3G4SV 3E83A 3GWOA 3T2MA 3SYOA 3FB6C 1CPYA 2X7RB 4RAIA 1PKXA 3T1CA 1K5QA 3LUTB 3OM3B 3ZCCA 1ORQC 4KUMA 1FXKA 1RPOA 2V7QG 2M7WA 4GCZA 1AJPA 1H8HG 1DF5A 1UJWB 3ASNB 3LNMB 2XNDG 4FIPC 2ZR3A 3JD2A 2JJ1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9R B;  2YEV A;  2AHZ A;  5B3S C;  2X6B A;  3E86 A;  2DWD C;  3K06 A;  1LNQ A;  2WLH A;  3OUS A;  4TWK A;  1QLE C;  2Q69 A;  4WFE A;  2HG5 C;  3STL C;  4F4L A;  1M57 C;  2EIN C;  2EIM C;  2WLJ A;  4KFM A;  4WFH A;  3FB7 C;  4PDR A;  4RUE A;  3AG2 C;  1J95 A;  3T4D A;  4EKW A;  4GX0 A;  4PA7 A;  3RW0 A;  4G27 B;  2ZXW C;  3GB7 C;  4PA9 A;  4H37 A;  5EBL C;  3OR7 C;  5KUK A;  5EK0 A;  1K4C C;  2BOB C;  3ABL C;  4OXS A;  5B1A C;  5CBG A;  2H8P C;  3SYC A;  3ABK C;  3RBZ A;  3LDD A;  4MVO A;  2Q6A A;  4WFG A;  3AG3 C;  4ZBM A;  1P7B A;  2EIJ C;  3K0D A;  4MVM A;  3SJQ C;  2WLI B;  3OR6 C;  2IH3 C;  3ABM C;  4JTD B;  3K03 A;  4XDK A;  4PDL A;  3UM7 A;  1V55 C;  4UUJ C;  3TCU A;  3ZJZ A;  4P9O A;  3T4Z A;  3ASN C;  1R3J C;  1XL6 A;  2Q68 A;  4WFF A;  4PA3 A;  2Q67 A;  1M56 C;  2EIL C;  2DYS C;  3ZRS A;  4LP8 A;  3EFF K;  5EC1 C;  1OCR C;  3OUF A;  4R6Z A;  4PA6 A;  2HVJ C;  3IFX A;  3WG7 C;  2WLK A;  4MTG A;  1S5H C;  4MVZ A;  3K08 A;  1XL4 A;  2ITC C;  5E1A C;  1V54 C;  4I9W A;  4P9P A;  3LDE A;  4R8C A;  3SYA A;  2BOC C;  3UKM A;  3TET A;  4LBE C;  4GX5 A;  2WLL A;  1BL8 A;  4PDM A;  3FB5 C;  2KB1 A;  4MW3 A;  3SPJ A;  3ASO C;  5IY5 C;  5EBW C;  1OCZ C;  3R65 A;  2DYR C;  3E8B A;  1R3I C;  3VOU A;  2A0L A;  2X6C A;  2X6A A;  3JYC A;  2HVK C;  4LCU C;  4MTF A;  2IH1 C;  4RUF A;  4JTC B;  4MVQ A;  2QTO A;  2HJF C;  1G4Y B;  5CBF A;  2ATK C;  1JVM A;  3E8G A;  3IGA C;  3SPH A;  3E8H A;  2QKS A;  2Y69 C;  5EC2 C;  3FB8 C;  4CBC A;  4P2Z A;  3K04 A;  4QE7 A;  4X88 A;  2DWE C;  4MTO A;  2A79 B;  3F7V C;  4JTA B;  4X89 A;  5EBM C;  3E8F A;  3RVZ A;  3PJS K;  4R50 A;  3AG1 C;  2OCC C;  4R7C A;  3K0G A;  5BZB A;  5J9P C;  1OCO C;  4MS2 A;  4G28 B;  2WLM A;  2AHY A;  4J9Z B;  5KUM A;  4QE9 A;  1R3L C;  3F7Y C;  4MSW C;  3OGC C;  2P7T C;  3F5W C;  2ITD C;  4X8A A;  3AG4 C;  3BEH A;  3SYP A;  3X2Q C;  2WLN A;  4GX2 A;  2ZD9 A;  4PA4 A;  5B1B C;  3SYQ A;  2JK5 C;  1K4D C;  4HYO A;  4H33 A;  4HZ3 A;  2K1E A;  2W0F C;  3E89 A;  4XDJ A;  2WLI A;  4DXW A;  2HFE C;  3E83 A;  4J9Y B;  4P30 A;  1KKD A;  2NLJ C;  3SYO A;  3T2M A;  3FB6 C;  2WLL B;  4MVS A;  4MVR A;  4RAI A;  4RO2 A;  3LDC A;  3T1C A;  3SPI A;  4QNH B;  2A9H A;  3LUT B;  1ZWI C;  1ORQ C;  1R3K C;  4PDV A;  3SPC A;  2EIK C;  3HPL C;  3KG2 A;  4XDL A;  4BW5 A;  5CBH A;  4GX1 A;  4MW8 A;  3RVY A;  3STZ C;  4MVU A;  3LNM B;  1OCC C;  3SPG A; 
#chains in the Genus database with same CATH topology
 2Y69 B;  4J42 A;  4LF9 O;  1LNQ A;  5H5N A;  1Y74 A;  2VQF O;  2ZNI A;  3QO5 A;  3HKB B;  1ROP A;  2FML A;  3OE7 G;  4BAY A;  1WN7 A;  5DN6 G;  3BAB A;  4RUE A;  2DOS A;  3T4D A;  4KHP O;  4AI8 A;  3FAV A;  2F93 B;  1K7D A;  4JI5 O;  5EZY A;  3C3S A;  3MHS C;  4NKG B;  1MMM A;  2AGA A;  3OR6 C;  2V4D A;  2JGD A;  4LWS B;  3WB0 A;  2HR3 A;  1YZB A;  1PNM A;  3FD9 A;  3QTC A;  2IJJ A;  5LGN A;  4FLT A;  3E35 A;  2Q67 A;  4X62 O;  1F51 A;  1G1X B;  4KP4 A;  1R6K A;  2QA4 V;  4GLX A;  5LXT B;  3CHX A;  2RNB A;  2D3O W;  2E75 B;  2EX3 A;  1IDS A;  4DV4 O;  3J7A U;  3APQ A;  3JCZ A;  2OTL V;  1XHX A;  1EFR G;  2B9Z A;  3G71 V;  3SJA C;  1NZ6 A;  1KP2 A;  4PD4 F;  5AG2 A;  1S0V A;  1SET A;  2ZIO A;  5CB4 A;  1Y6X A;  2Y48 A;  4Z1V A;  5L3C A;  2IH1 C;  3SDL A;  4DR6 O;  5L3D A;  5L3F A;  2QKS A;  4GKK B;  3HKB A;  4QE7 A;  4YY3 O;  1KD1 W;  5H9C A;  3AG1 C;  3E22 B;  5JJJ B;  1AVM A;  2PY5 A;  2XAH A;  1MAB G;  3ETD A;  5CA0 B;  1EN5 A;  4MSW C;  3F7Y C;  4OX9 O;  2F4V O;  3BRC A;  4BWA A;  4DV1 B;  5IDJ A;  2IJI A;  1N36 O;  4B7E A;  1CEZ A;  1VF6 C;  3X2Q C;  1GN4 A;  4H33 A;  3DC5 A;  2VWK A;  4CS3 A;  1KKD A;  3OD4 A;  4WF9 V;  1YTF D;  4LWS A;  3IC9 A;  3ZIA G;  1X59 A;  1KC8 W;  3SPC A;  2IU3 A;  1H2M A;  4X9Q A;  1W0J G;  1JPX A;  4DK1 A;  1GRJ A;  1KP3 A;  4K8X A;  3ZX6 A;  3EXA A;  2XAF A;  1JFF B;  2P6J A;  1YJ9 V;  4DR1 B;  2H3O A;  1PD3 A;  3VBB A;  4FLU A;  4FPP A;  2PI5 A;  4D7T A;  1QR8 A;  1M9N A;  1NVP D;  1O9H A;  4NXN B;  5H6Q A;  1K5S A;  2GUZ B;  1WPB A;  4J7K A;  5JWP A;  1IBM B;  5B1A C;  4MT8 A;  2E5L O;  5C93 A;  2O57 A;  4KXR A;  1BS3 A;  5KHH A;  2FB5 A;  4JTD B;  5KHK A;  3E22 A;  3UM7 A;  4I50 B;  4CS4 A;  3ZJZ A;  5CA0 A;  3T1Y B;  3RGB A;  3N27 A;  2JGU A;  4B3T B;  1QLE B;  1HNW O;  5B1B B;  1U97 A;  3I5D A;  4X1I B;  1K33 A;  4JI2 B;  5LYJ B;  1IXB A;  4H0L B;  2ZIM A;  1KQS U;  1QU7 A;  4N23 A;  2AW9 A;  1B3Q A;  1AI4 A;  1JFF A;  2HJF C;  1FPO A;  1MNG A;  1R6T A;  3Q4H B;  4ZI7 B;  2UXB O;  3IGA C;  2RDC A;  5GON B;  3BHP A;  3ABM B;  2EJR A;  3CC4 V;  2DWE C;  1XMQ B;  3S3X A;  1H2G A;  5EBM C;  4LFC B;  1S77 D;  4R7C A;  1F4N A;  1M57 B;  3LSQ A;  1M56 B;  2YC0 A;  1SA0 A;  1H2K A;  4H13 B;  1FFX B;  4O2B B;  1K73 W;  2BE3 A;  2GHY A;  3J80 N;  5FNV B;  3G67 A;  1NS1 A;  4I50 A;  1NJI W;  1VQO V;  4K35 A;  1WJZ A;  4DV0 O;  2EIK C;  1VQK V;  1QNM A;  2RQ6 A;  1WP7 A;  1OCC C;  1XMO B;  1EN6 A;  2Q0A A;  1BT8 A;  4X1I A;  4F4L A;  3K5M A;  2ZDI A;  3ZED A;  2EIM C;  3DSQ A;  3A2F A;  4I55 B;  4PA7 A;  5LYJ A;  4LFA O;  2ZXW C;  1YIJ V;  1CP9 A;  1K4C C;  2WWW A;  3Q4H A;  2GTS A;  4ZI7 A;  1M4U A;  1KMI Z;  4B7K A;  3OMA B;  4Z2W A;  3JAL A;  2E76 B;  2IH3 C;  4X66 O;  3D36 A;  4XDK A;  3UO2 A;  4K0K O;  1JA8 A;  4RWU A;  1J5E B;  5KHI A;  4ZHQ B;  2YDE A;  1SQV H;  2AXT Z;  2OIG A;  4JF3 A;  3JAM N;  1XNR B;  4X64 B;  5LMU B;  3RWR D;  4OPA A;  3EVK A;  3ZRV A;  1S76 D;  5KHG A;  1XL4 A;  5FLX N;  1FFX A;  4O2B A;  5FNV A;  4JV5 O;  2WA4 A;  1QVG U;  3CCS V;  4UVC A;  3E8B A;  2N04 A;  4LCU C;  1R73 A;  5CBF A;  2OT5 A;  2GDS A;  2M6Y A;  3CRQ A;  4X89 A;  3RYI B;  4JI7 O;  3QF7 A;  4I55 A;  3G80 A;  4JI1 O;  4IYH A;  1NR1 A;  1WB8 A;  3OGC C;  1TUB A;  1XQ8 A;  3AK2 A;  2QDO A;  4DW1 A;  4GKJ O;  2CTP A;  4B3S O;  3N2K B;  4PV1 B;  4HYO A;  4J41 A;  3CD6 V;  3L70 H;  4P30 A;  2WLL B;  1YVW A;  1VIB A;  4HBN A;  3MAQ A;  2F43 G;  4JYC A;  4JI3 B;  3SPG A;  3RYC B;  3W7T A;  3VQX A;  1EZV H;  2H94 A;  4DRX B;  1K34 A;  1VQ4 V;  4AHC A;  2JEU A;  4UVB A;  4PDR A;  3MDS A;  1SQB H;  3J81 N;  2PI4 A;  2BOB C;  3JSN A;  1RSO B;  5KLV H;  2UXC B;  2C2A A;  3P3P A;  1QHT A;  1MZE A;  2VWJ A;  3RYI A;  4JAV A;  4JI4 B;  1WLE A;  4DW0 A;  3CC7 V;  5E79 Z;  1SRY A;  5B3S B;  2PYJ A;  1NH2 D;  3AG7 A;  3OUF A;  3ZHT A;  3N2K A;  5A9G A;  4IHJ A;  3LDE A;  3MD0 A;  2WLL A;  5L3E A;  1IBM O;  3HKC B;  2P5O A;  2QTS A;  1RPR A;  2RMK B;  4DV3 B;  4LC1 A;  3AG3 B;  4YIP A;  2HVK C;  1QBZ A;  4RUF A;  5IWA O;  4QPK A;  4TV9 A;  3ETE A;  2LP7 A;  3AK3 A;  3CJH A;  3JSL A;  3K0G A;  5BZB A;  2WLM A;  1SKV A;  1RM1 C;  1D5N A;  4LFB O;  4B3T O;  1HNX O;  3OT7 A;  1RSO A;  3CPW U;  3AG4 C;  4UV8 A;  2ARH A;  5B1B C;  2JK5 C;  3L74 H;  4OPH A;  2JS3 A;  1KKC A;  4EFB A;  4D7S A;  3FB6 C;  1CPY A;  3T1C A;  1PKX A;  1K5Q A;  4LF7 B;  4FLX A;  4KUM A;  3NR7 A;  2V7Q G;  2EJ7 A;  2UXD O;  4FIP C;  2XND G;  3SR2 C;  4UCS A;  5IJ0 B;  2IM9 A;  3JD2 A;  1TAE A;  1M93 A;  4LF6 O;  2BSK B;  1XMQ O;  1QQC A;  5KAF Z;  2ZE5 A;  3CCM V;  2QWN B;  1Q7Y W;  1R6N A;  3T1H B;  1M57 C;  1E1Q G;  2YUA A;  3UQ8 A;  1VQL V;  3CMA V;  3HKC A;  1AIL A;  2PGG A;  4GX0 A;  4F6R A;  3ZMT A;  4DV7 O;  5CMU A;  1VQ7 V;  1YIT V;  3ZN1 A;  1YHQ V;  2JJ2 G;  5GTH Z;  1XRE A;  3GVM A;  5LL6 Y;  1GN3 A;  4RQE A;  2QWR B;  4PA3 A;  1XEQ A;  4JI6 B;  1PP9 H;  1N4C A;  4R6Z A;  2ETN A;  1JCH A;  2BOC C;  5IYD O;  3HR0 A;  1FXH A;  4O4I B;  2K9P A;  3JAK B;  1VEW A;  4J7Z A;  4YHH B;  4LF4 B;  2NR5 A;  3DTU B;  5JCO C;  5IJ0 A;  1WA8 B;  4JTC B;  4TOI A;  2BSK A;  4FM0 A;  5FPO A;  3M7M X;  1S72 V;  5KMG B;  2QM7 A;  2LW7 A;  4U3J B;  2KKW A;  1COW G;  1Y74 B;  1Q5O A;  2AHY A;  2VRZ A;  4JZ2 A;  5EYP B;  1R3L C;  2CE4 A;  1YJW V;  1NTZ H;  5CA3 A;  3SYP A;  5IYZ B;  3FAV B;  2WLN A;  3KKY A;  3ABK B;  2K1E A;  1IVS A;  3WFV A;  4J9Y B;  1Q43 A;  1O9G A;  3K3W A;  4PDV A;  1XNQ O;  3F5T A;  3M99 B;  2A06 H;  2JGD B;  2FYU H;  3KCX A;  2QE7 G;  2ZE6 A;  1MOF A;  3E86 A;  4UB6 Z;  3STL C;  1SZT A;  1BHA A;  3CS5 A;  3VQV A;  3WB1 A;  4EKW A;  1KB9 F;  1Y66 A;  4O4I A;  2PF4 E;  3JAK A;  1I08 A;  1WA8 A;  2DYR B;  5CBG A;  4H44 B;  2H8P C;  3LNN A;  3ML0 A;  4ZBM A;  4I9Q A;  2DW4 A;  5CB4 B;  5KMG A;  4U3J A;  1PV0 A;  1SES A;  5LMN B;  1W2B U;  1GO3 F;  2UUA B;  2HEP A;  5EYP A;  1S5L Z;  4JI3 O;  1DF4 A;  3H1L H;  2XAG A;  4LH7 A;  3D3Q A;  5IYZ A;  5CN0 A;  2ITC C;  2QM4 A;  2UU9 B;  4UXN A;  1BL8 A;  2CAZ C;  4X65 O;  5DEC A;  5EBW C;  2B1I A;  1IBL O;  1FAF A;  1A32 A;  4DUZ O;  4IYI A;  4MVQ A;  4CH4 A;  1I94 B;  4CBC A;  2ZE8 A;  5JVD B;  3RVZ A;  5DM6 V;  1Z5W A;  2UUB B;  1IX9 A;  4J11 A;  1ZLZ A;  2ZCE A;  1P49 A;  1XBL A;  3B8N A;  2ADQ B;  1HWY A;  4DR7 O;  4C7U A;  2N74 A;  3C3T A;  3E89 A;  4DXW A;  2ILM A;  3ZHU A;  3TXQ A;  1I0H A;  4GUN A;  1OCZ B;  3CCR V;  4TUY B;  1NTM H;  5GTI Z;  2UUC B;  4GX1 A;  2ZM6 B;  1M1K W;  3H9V A;  2YIB D;  4HAM A;  4YJ2 A;  1N33 O;  2ZT9 B;  4MTX A;  2VQE O;  1OZ0 A;  2DQ3 A;  3FB7 C;  3JD0 A;  2YXL A;  1AI6 A;  3U0Z A;  4H37 A;  3CCL V;  2JDI G;  4MVO A;  2IJH A;  2EIJ C;  3LSU A;  2L35 A;  2CGO A;  3CSX A;  2JRI A;  5JVD A;  4DR5 B;  4JI0 O;  2Y0I A;  5BR8 O;  3K59 A;  2ZKO A;  4Q6G A;  2HP8 A;  2FKX A;  4BW9 A;  5LP6 C;  4NR1 A;  1M90 W;  4LP8 A;  5LHI A;  4RQF A;  1VMG A;  2DMX A;  1DK1 A;  1JX9 A;  2YEV B;  1N34 B;  3DC6 A;  1VQ8 V;  4R8C A;  1SA0 B;  3TET A;  5B66 Z;  1AB3 A;  4DR4 O;  1HNZ O;  4UV9 A;  1Y76 B;  4TUY A;  2YS8 A;  1P4R A;  2ZIN A;  3ABL B;  4UCR A;  2OYQ A;  1PL4 A;  3JYC A;  3L73 H;  4DV5 B;  4LF5 O;  1WPX A;  1URF A;  4JZG A;  2CDY A;  4JPR A;  1I5Y A;  1SQP H;  4P2Z A;  2HHH O;  5EIB C;  1V55 B;  3E8F A;  4GT1 A;  4JI6 O;  1KBH A;  1K97 A;  3AG2 B;  4QE9 A;  3ZHQ A;  1YTF B;  4TSF G;  1OCR B;  4L87 A;  4I7Z B;  4JYA B;  1V54 B;  3OEH G;  3G6B A;  1OHH G;  4XDJ A;  3SGI A;  1SZX A;  2R72 A;  2X0L A;  1OV9 A;  1Q81 W;  4QNH B;  4NXM B;  1BGY H;  3ASO B;  3K79 A;  3JAL B;  3RYH B;  2QWQ B;  1F4M A;  1FXK C;  1HW7 A;  4ICG A;  2P90 A;  5BMV B;  1NVP B;  2YEV A;  4TV8 A;  4WFB V;  4DV2 O;  4JI8 O;  1MZF A;  2HG5 C;  1R1B A;  2MW2 B;  4KFM A;  2P4V A;  3O9O A;  2RJZ A;  2HJD A;  1ZSP A;  4DR3 B;  1N32 B;  1Y76 A;  1JOY A;  2ZQM A;  1TUE B;  1JMK C;  3OR7 C;  3BPZ A;  1TGO A;  3HKE B;  3ABK C;  4LH6 A;  1AR4 A;  4FMT A;  3D8C A;  4DUY B;  3SJQ C;  1NR7 A;  2DN9 A;  1H2N A;  3ABU A;  3K03 A;  1B04 A;  1Q3E A;  3CRM A;  5JQG B;  4UUJ C;  2E3C A;  2Q68 A;  4WFF A;  5B1O A;  4B3R B;  5JH7 A;  2QJ1 A;  2DYS C;  3OTO B;  1IBK B;  1HR0 B;  4I0X B;  1S5H C;  3D3I A;  5KA5 A;  1TUB B;  5LHH A;  1EN4 A;  1YF2 A;  5DED A;  1ZAU A;  1WP8 A;  1SQG A;  1FJG O;  3RYH A;  5JJN B;  4DR2 O;  3CCJ V;  2DYR C;  4TQD A;  2R9I A;  1YEW A;  3ETG A;  4J10 A;  5LGT A;  1LUW A;  5BMV A;  1GN6 A;  4FLY A;  2Y69 C;  2WAM A;  1Q82 W;  4MTO A;  4EEQ A;  3ABT A;  4AIL C;  5J9P C;  1NQT A;  4MS2 A;  3ETQ A;  3RN4 A;  2AZ0 A;  4IIJ B;  1W0K G;  1H2S B;  3F5W C;  1V9P A;  2DQ0 A;  4F6E A;  4X8A A;  3HKE A;  3QG5 A;  3WG7 B;  3I56 V;  2LFR A;  1JQ0 A;  1JJ2 U;  3A8T A;  3SYQ A;  4N21 A;  2W0F C;  3CB2 A;  3G4S V;  3E83 A;  2P22 C;  3O65 A;  1L8D A;  1Y67 A;  3KCY A;  5JQG A;  3RT3 C;  2BTO A;  3LUT B;  3PN1 A;  1RPO A;  1OJH A;  5BY1 A;  1UJW B;  1XDC A;  3ASN B;  3RYF A;  2JJ1 G;  4I0X A;  5J2T B;  2AHZ A;  1HP8 A;  1AI7 A;  2YSU B;  4J7J A;  3CX5 F;  1DTO A;  2NNU A;  4IHJ B;  4W4L A;  4BIZ A;  3FFQ A;  5IY5 B;  3OTF A;  1GKF A;  3SYC A;  4JYB A;  3B09 A;  2JS5 A;  3HB3 B;  4GKK O;  4DK0 A;  4TV9 B;  4PDL A;  3K5N A;  4QJF B;  4IIJ A;  1KEC A;  1EZJ A;  1OCO B;  1XL6 A;  2HLD G;  3CJH B;  5IYB O;  3TK1 A;  4DV1 O;  2IJK A;  4QIW F;  4LF9 B;  2YI9 A;  2VQF B;  3APO A;  1N0J A;  2L6L A;  1D2D A;  3L72 H;  3JCU Z;  1XHZ A;  5H6R A;  4PDM A;  4KHP B;  1EM1 A;  4PHZ A;  4J80 A;  3R65 A;  3BCC H;  3CE2 A;  4JI5 B;  3C90 A;  3VQW A;  1I7F A;  2KG7 B;  1BCC H;  5J2T A;  3WU2 Z;  1BQ0 A;  1B06 A;  4DR1 O;  5IT9 N;  3H01 A;  2A79 B;  1JJO A;  4X62 B;  4NXN O;  2Y4U A;  1VP7 A;  4F6R B;  1NKD A;  5BXZ A;  3KZI Z;  4GX2 A;  4NYK A;  4UCU A;  2HFE C;  4DV4 B;  1UPG A;  1E1R G;  4MVS A;  1ZWI C;  4MW8 A;  3AEI A;  4DV5 O;  4MVU A;  4FFK A;  3T1Y O;  4DR6 B;  1Q86 W;  2R9R B;  1FD9 A;  1SQF A;  2EZP A;  2X6B A;  2YIC A;  1BSM A;  1VQ9 V;  1QLE C;  4YY3 B;  2OCH A;  3ZMV A;  2XAQ A;  1GAX A;  3LSS A;  3AG2 C;  1F7Y A;  1J95 A;  2KQX A;  2ZDI C;  1AJQ A;  4A5U B;  4OX9 B;  4JI2 O;  2F4V B;  3GB7 C;  4X1Y B;  5EIB D;  1N36 B;  3X2Q B;  3CCV V;  2KG7 A;  3LDD A;  4WFG A;  5LOV B;  1L0L H;  4UVA A;  3ABM C;  3N2G A;  4LFC O;  3D36 C;  2CTR A;  2EZO A;  4PJ0 Z;  4UB8 Z;  4E4E A;  1YJN V;  1M56 C;  4WCE V;  5FL7 G;  1SF9 A;  1K92 A;  5E1A C;  4U3F H;  1N32 O;  2A3Q A;  3UKM A;  4Z1M G;  1ZX3 A;  2A7W A;  3MHH C;  5KHJ A;  2QR4 A;  3QNE A;  1VQM V;  1R3I C;  5B1A B;  3B2E E;  4WFA V;  2LFS A;  2A0L A;  3BAA A;  2GTA A;  1XMO O;  1PNL A;  5D5P A;  5B5E Z;  3E8H A;  5EC2 C;  5HFM A;  2Z5U A;  2Q8V A;  4JTA B;  4R50 A;  5IJ9 A;  4QGP A;  3ZS8 C;  2LJ2 A;  3ZMS A;  1LR1 A;  4FM2 A;  1PL0 A;  4X1Y A;  1VF6 A;  2R9A A;  1JR9 A;  5LOV A;  1HNW B;  1K4D C;  3CC2 V;  1P7G A;  1DGS A;  4O4H B;  4FK5 C;  3H1H H;  3JAR B;  1J5E O;  1GH6 A;  1BMF G;  1VF5 B;  3IC7 A;  2UXB B;  1XNR O;  1Y4M A;  4X64 O;  3QO8 A;  4CS2 A;  5LMU O;  4HNA B;  3CXC U;  2MK3 A;  2RCV A;  3P3N A;  4WFE A;  2FL4 A;  4JGS A;  1YXB A;  2N05 A;  1I5X A;  4TT3 G;  3WB2 A;  2WLJ A;  2OIE A;  2F23 A;  3U10 A;  4O2A B;  4KL1 A;  5EBL C;  4FLV A;  4OXS A;  4W4K A;  3RBZ A;  3B77 A;  4DYL A;  3CYO A;  1ARO P;  4I4T A;  4CH6 A;  3CCE V;  5J2U B;  2EIK B;  1VAR A;  4DV0 B;  1ZUQ A;  4P9O A;  2OCC B;  3ASN C;  1OCC B;  3A0B Z;  1X4T A;  2G38 A;  4PA6 A;  2OTJ V;  2HVJ C;  3IFX A;  3TJT A;  2R70 A;  3W7S A;  5L3B A;  1MG1 A;  3SJB C;  2EIM B;  2B5U A;  4GX5 A;  3TXS A;  4O4H A;  2CH7 B;  1YCI A;  1WNS A;  2KB1 A;  2ZXW B;  4G2K A;  4LFA B;  4TQF A;  2YIA A;  5TIS Z;  3JAR A;  5IY5 C;  3BA9 A;  4BIO A;  1AJN A;  1RP3 B;  1JVM A;  4HNA A;  4LR3 A;  4E2L A;  4IL6 Z;  4YJ2 B;  4X66 B;  5KAI Z;  3UT5 B;  3ZBH A;  1OCO C;  4K0K B;  4G28 B;  4XBF A;  2RN9 A;  4J9Z B;  4CH5 A;  1MSW D;  2PZS A;  3OFN G;  4O2A A;  4B3M B;  3U11 A;  1KYO F;  2UXC O;  3CME V;  3CXH F;  4JV5 B;  5J2U A;  2A9H A;  1R3K C;  4JI4 O;  1GM7 A;  1TA8 A;  4CZZ A;  4JAS A;  4LF8 B;  4ASU G;  1ZTE A;  3AK1 A;  1YI2 V;  1VF7 A;  5B3S C;  1MA1 A;  2IBZ H;  2Q69 A;  4L8J A;  2PYL A;  2FTK A;  2Q7E A;  5ITZ B;  2LGQ A;  4PEL A;  1AP5 A;  4JI7 B;  3K9S A;  2CH7 A;  2UXX A;  4JI1 B;  3VQY A;  2GBO A;  3BA8 A;  4G27 B;  4PI0 A;  1FKA O;  2Q7H A;  4DV3 O;  5EK0 A;  4GKJ B;  1AI5 A;  4B3S B;  1N8R W;  2QWO B;  3AG3 C;  5L3G A;  2W6I G;  4ZOL A;  3JAS A;  4O4J B;  3UT5 A;  1FS0 G;  4ABM A;  3M8A A;  1QCE A;  4U7N A;  2QM8 A;  3OW2 U;  3T4Z A;  1GK9 A;  1SQQ H;  2F95 B;  1BHB A;  1GTO A;  5EC1 C;  2XHB A;  2XAJ A;  5IE9 A;  2JEX A;  3K08 A;  4P9P A;  1F23 A;  4LBE C;  3W7X A;  1XUQ A;  4GYC B;  4LF7 O;  1VQ6 V;  4MW3 A;  2Z3Y A;  4BR6 A;  4IGG A;  2ZNJ A;  2Z0A A;  1G4Y B;  5C8Y B;  5LBQ A;  3DGE A;  3K04 A;  5H2F Z;  5ITZ A;  3T1H O;  3K5L A;  4TV8 B;  1Q6I A;  2CTW A;  5LXT A;  3SJC C;  1CXZ B;  1NU1 H;  2Y0P A;  1E79 G;  3H1I H;  3UO3 A;  2V1D A;  1UFI A;  4O4J A;  4X1K B;  2X7R B;  3ZCC A;  1ORQ C;  4GCZ A;  1DF5 A;  1Q6H A;  5IWA B;  2ZR3 A;  4EB6 B;  3K06 A;  4FJC C;  5JH7 B;  3JAW B;  2PUS A;  5GW7 A;  1IXM A;  1N0N A;  2QSA A;  4WFH A;  4AQY B;  1RM1 B;  1XI1 A;  4LFB B;  1XOU A;  5IYC O;  1HNX B;  3AG4 B;  3G6E V;  2ZE7 A;  3THO A;  2BTQ B;  4YHH O;  4LF4 O;  1THZ A;  3L9D A;  3JD1 A;  1QVF U;  3ZRW B;  5C8Y A;  5A2Q N;  1H8E G;  2ZR2 A;  3B4S A;  1NI8 A;  3CP1 A;  1AR5 A;  3CRC A;  1NT2 B;  4NTY A;  3UCS C;  3FYE B;  4BIU A;  3TCU A;  4DV6 B;  3ZHV A;  2UXD B;  1YSC A;  5B1N A;  3CCQ V;  3EFF K;  1GN2 A;  4LF6 B;  2GSM B;  1G8M A;  3K58 A;  4MTG A;  4MVZ A;  3I55 V;  3SYA A;  2YIB A;  1K8A W;  1YDX A;  2YI8 A;  4X1K A;  3CCU V;  3ICX A;  1GM8 A;  2GUZ A;  3HKD B;  1H2L A;  2IW5 A;  2E74 B;  2QGN A;  4GZR B;  4DV7 B;  2YXH A;  2D2C B;  3JD4 A;  2QTO A;  2YXY A;  4EB6 A;  1SER A;  3JAW A;  1MSD A;  2B1G A;  3RYF B;  1VQP V;  4K3A A;  2OCC C;  2KSD A;  2EIN B;  5K1X A;  3ZMU A;  2BTQ A;  1FFT B;  3ZRW A;  4PA4 A;  3TGU H;  1NTK H;  4HZ3 A;  3K5O A;  1L1F A;  1AP6 A;  3QVN A;  4YJ3 B;  5D5Q A;  5LMN O;  2UUA O;  3KG2 A;  3HPL C;  4LNU B;  5CBH A;  3H1K H;  5GON A;  3STZ C;  1QR9 A;  4OGQ B;  1T5E A;  2EIL B;  4ZKI A;  1TVK B;  1Q6U A;  4U7O A;  2PTM A;  1M5I A;  2WLH A;  3OUS A;  4TWK A;  2DJV A;  4FM1 A;  1H38 A;  2VS0 A;  2UU9 O;  3HKD A;  4B3M O;  2Q7G A;  1GM9 A;  1PM9 A;  3RW0 A;  2QWP B;  1PPJ H;  2Q6A A;  1P7B A;  3K0D A;  3EHB B;  4PI2 A;  1K9M W;  1I94 O;  2WLI B;  4O4L B;  2P4K A;  4LF8 O;  2P06 A;  1XNQ B;  2UUB O;  3BVO A;  1D5A A;  3OGI B;  2F66 C;  2YID A;  4YXW G;  2CUG A;  3DXR B;  2LO1 A;  5LHG A;  3S3W A;  3FYI B;  4YJ3 A;  4EFE A;  2XT9 A;  2QEX V;  1BZK A;  2BCC H;  3A0H Z;  5FPR A;  4LNU A;  4WBN B;  5JCO A;  4FZ1 A;  1OCZ C;  4CC5 A;  3L71 H;  2UUC O;  3VOU A;  2ZM6 O;  2JVD A;  1DLB A;  2X6A A;  2Y4T A;  1TVK A;  2ATK C;  3SPH A;  1BQZ A;  3CRR A;  3PJS K;  4ZHQ A;  1SC5 B;  2CTQ A;  4NTW A;  3OEE G;  5LA6 B;  3ZN0 A;  1HDJ A;  2OWO A;  2P7T C;  2ITD C;  2LQT A;  1S3J A;  5JJE B;  3ZHR A;  1WB7 A;  4IT5 A;  2WLI A;  4FZ0 A;  4I5S A;  3A0R A;  4O4L A;  4RO2 A;  3SPI A;  4DR5 O;  4X65 B;  4BW5 A;  1IBL B;  3RVY A;  4DUZ B;  3N2G B;  2Q73 A;  4JYY A;  3DXR A;  1IZ3 A;  1XIL A;  1N34 O;  1FXV A;  5F2V O;  2CGN A;  2CK3 G;  3GWK C;  3ZMZ A;  1KU9 A;  3RFR A;  4WBN A;  4ZIB A;  2GV9 A;  3L75 H;  1ZL8 B;  1RFY A;  4DR7 B;  4UCT A;  1P84 F;  3ABL C;  2UXN A;  1B6Q A;  4MVM A;  3IJ4 A;  4YIO A;  1QLN A;  1EBO A;  1V55 C;  5LA6 A;  3IAY A;  2W0X A;  4K8Z A;  2QKC A;  3OMI B;  3AG1 B;  4Q20 A;  3B8M A;  3RYC A;  2Q0O C;  3NXS A;  2Q4P A;  5IJ9 B;  3ZRS A;  3ZRX A;  1N33 B;  4DRX A;  1OCR C;  4JYA O;  2WLK A;  2VQE B;  1V54 C;  4I9W A;  4X20 B;  4AQY O;  4NXM O;  2XUM A;  3CWB H;  5KX5 B;  4FLW A;  3ASO C;  1NH2 B;  1Z5V A;  2Q9L A;  1FYJ A;  1ENV A;  4CC6 A;  1SS3 A;  4MTF A;  2EIJ B;  4UFZ A;  2DE0 X;  1SQX H;  3FB8 C;  4DO2 A;  4X88 A;  4UCO A;  4JI0 B;  4DV6 O;  1PNK A;  5BR8 B;  4DR3 O;  3E2E A;  5LP6 B;  2W6J G;  5KUM A;  1KUQ A;  1ZL8 A;  1Z2G A;  5LGU A;  3P32 A;  2LGW A;  3OMN B;  3BEH A;  3W7U A;  1K3E A;  1VQN V;  4FFB B;  4NB5 A;  4FLZ A;  2E5L B;  3BFR A;  4DUY O;  4DR4 B;  3W7W A;  3FKS G;  4D6T H;  1HNZ B;  2NLJ C;  4MVR A;  3LDC A;  2EBO A;  2WSS G;  4I4T B;  4FVM A;  4XDL A;  5CA1 B;  3K57 A;  4B3R O;  4LF5 B;  4UCV A;  3OTO O;  1IBK O;  4QPJ A;  3JAT B;  1US6 A;  1HR0 O;  2DWD C;  2XOK G;  2HHH B;  4X20 A;  2EIN C;  2NN4 A;  5HFL A;  3FX7 A;  5KX5 A;  1NBM G;  2WA3 A;  3ZHS A;  4PA9 A;  2HKO A;  2WPD G;  3R66 A;  5KUK A;  4JAA A;  3CEI A;  1BE3 H;  4NVP A;  2LW1 A;  2XAS A;  4NTX A;  3JD3 A;  3BY6 A;  4JAU A;  2Q5Z A;  4B08 A;  1IUR A;  5LP6 A;  1Q8I A;  1FXK B;  2P67 A;  1R3J C;  2JIZ G;  3OAA G;  1G6U A;  1VQ5 V;  3CRA A;  2EIL C;  1LUV A;  2ADP A;  5K1P A;  3WG7 C;  4DV2 B;  4JI8 B;  4FFB A;  3QO7 A;  3B40 A;  1L0N H;  3FB5 C;  1U96 A;  5CA1 A;  2AZ2 A;  2XTA A;  3SPJ A;  1Q90 D;  2X6C A;  2QKA A;  5EZY B;  3JAT A;  3E8G A;  3F7V C;  1AR1 B;  2EUL A;  1WAZ A;  3K9A A;  5KA6 A;  1S5J A;  2IU0 A;  4CH3 A;  2DYS B;  1W59 A;  3H1J H;  2ODM A;  3P30 A;  1GMG A;  2ZD9 A;  3GWO A;  3T2M A;  3SYO A;  1FJG B;  4RAI A;  2F1M A;  3OM3 B;  4DR2 B;  4ZOL B;  3JAS B;  1FXK A;  2M7W A;  1AJP A;  1H8H G;  3LNM B; 
#chains in the Genus database with same CATH homology
 2Y69 B;  2AHZ A;  3K06 A;  3CCM V;  1LNQ A;  4FJC C;  1AI7 A;  1Q7Y W;  1R6N A;  2YSU B;  3QO5 A;  5GW7 A;  1ROP A;  1IXM A;  1M57 C;  1DTO A;  3OE7 G;  4BAY A;  1E1Q G;  2NNU A;  4WFH A;  5DN6 G;  4RUE A;  1VQL V;  1RM1 B;  3CMA V;  3T4D A;  4GX0 A;  4BIZ A;  5IYC O;  3AG4 B;  3G6E V;  1K7D A;  3ZMT A;  5IY5 B;  1GKF A;  1THZ A;  1VQ7 V;  5CMU A;  3SYC A;  1YIT V;  3JD1 A;  1QVF U;  3MHS C;  3ZRW B;  1H8E G;  3ZN1 A;  2ZR2 A;  3CP1 A;  4JYB A;  1YHQ V;  2JJ2 G;  3HB3 B;  3OR6 C;  4PDL A;  3FYE B;  4QJF B;  4BIU A;  3TCU A;  2HR3 A;  1PNM A;  1KEC A;  1EZJ A;  2IJJ A;  5LGN A;  1OCO B;  1XL6 A;  2HLD G;  4RQE A;  3E35 A;  1YSC A;  4PA3 A;  2Q67 A;  5B1N A;  5IYB O;  1F51 A;  3TK1 A;  3CCQ V;  2IJK A;  3EFF K;  4QIW F;  4R6Z A;  4KP4 A;  2GSM B;  1G8M A;  1R6K A;  4MTG A;  4MVZ A;  2QA4 V;  3I55 V;  3SYA A;  2D3O W;  1K8A W;  1JCH A;  2BOC C;  3CCU V;  5IYD O;  1GM8 A;  3JCZ A;  2IW5 A;  5H6R A;  2OTL V;  4PDM A;  1FXH A;  1EFR G;  3G71 V;  3R65 A;  1KP2 A;  1S0V A;  1SET A;  3DTU B;  2Y48 A;  5L3C A;  2IH1 C;  3JD4 A;  4JTC B;  2QTO A;  1SER A;  5L3D A;  5L3F A;  2QKS A;  2B1G A;  3H01 A;  4QE7 A;  2A79 B;  1KD1 W;  1VQP V;  1S72 V;  5H9C A;  2QM7 A;  3AG1 C;  2OCC C;  1COW G;  2EIN B;  2AHY A;  2XAH A;  1MAB G;  3ETD A;  1R3L C;  3F7Y C;  4MSW C;  3ZMU A;  1YJW V;  5IDJ A;  2IJI A;  1NKD A;  1CEZ A;  5CA3 A;  1FFT B;  3SYP A;  3X2Q C;  3ZRW A;  2WLN A;  4GX2 A;  4PA4 A;  3ABK B;  4H33 A;  4HZ3 A;  2K1E A;  1L1F A;  3WFV A;  2HFE C;  1KKD A;  4J9Y B;  4WF9 V;  1YTF D;  1E1R G;  4MVS A;  3ZIA G;  3K3W A;  1KC8 W;  1ZWI C;  2IU3 A;  4PDV A;  3SPC A;  3KG2 A;  3HPL C;  5CBH A;  4MW8 A;  3AEI A;  3M99 B;  1W0J G;  3STZ C;  4MVU A;  1JPX A;  1QR9 A;  2QE7 G;  1KP3 A;  1Q86 W;  2EIL B;  2R9R B;  4ZKI A;  2XAF A;  2P6J A;  2EZP A;  1MOF A;  2X6B A;  3E86 A;  3OUS A;  2WLH A;  4TWK A;  4U7O A;  1YJ9 V;  1QLE C;  1VQ9 V;  1H38 A;  3STL C;  1PD3 A;  3VBB A;  1SZT A;  4FPP A;  3ZMV A;  2PI5 A;  1BHA A;  2XAQ A;  1QR8 A;  3LSS A;  3AG2 C;  1J95 A;  1M9N A;  2ZDI C;  1NVP D;  1AJQ A;  1GM9 A;  4EKW A;  1Y66 A;  3RW0 A;  5H6Q A;  3GB7 C;  1K5S A;  3X2Q B;  3CCV V;  5B1A C;  2DYR B;  5CBG A;  4MT8 A;  2H8P C;  3LDD A;  3ML0 A;  2Q6A A;  4WFG A;  5C93 A;  4ZBM A;  1P7B A;  3K0D A;  3EHB B;  2DW4 A;  4UVA A;  1K9M W;  2WLI B;  3ABM C;  4JTD B;  3UM7 A;  1SES A;  1W2B U;  1GO3 F;  3ZJZ A;  2EZO A;  1YJN V;  1M56 C;  1DF4 A;  2XAG A;  4WCE V;  5FL7 G;  4YXW G;  5CN0 A;  1QLE B;  1K92 A;  2ITC C;  5E1A C;  5LHG A;  5B1B B;  3UKM A;  4Z1M G;  3FYI B;  4UXN A;  1BL8 A;  3MHH C;  1K33 A;  3QNE A;  2QEX V;  5EBW C;  1OCZ C;  1VQM V;  1R3I C;  2B1I A;  5B1A B;  3VOU A;  4WFA V;  2LFS A;  2A0L A;  1KQS U;  1DLB A;  2X6A A;  4N23 A;  4MVQ A;  1AI4 A;  2HJF C;  2ATK C;  1PNL A;  3IGA C;  3SPH A;  3E8H A;  5EC2 C;  3ABM B;  4CBC A;  5HFM A;  2EJR A;  2Z5U A;  2DWE C;  3CC4 V;  4JTA B;  1H2G A;  5EBM C;  3RVZ A;  3PJS K;  1S77 D;  4R50 A;  4R7C A;  5DM6 V;  1F4N A;  3OEE G;  1M57 B;  3ZMS A;  3LSQ A;  3ZN0 A;  1M56 B;  1PL0 A;  2P7T C;  3B8N A;  1HWY A;  2ITD C;  1S3J A;  1K4D C;  3CC2 V;  3E89 A;  4DXW A;  2WLI A;  1K73 W;  2GHY A;  3A0R A;  4I5S A;  4RO2 A;  3SPI A;  1NJI W;  4FK5 C;  3CCR V;  1OCZ B;  1VQO V;  1VQK V;  2EIK C;  4BW5 A;  4GX1 A;  3RVY A;  1BMF G;  1M1K W;  3IC7 A;  4HAM A;  1OCC C;  1Y4M A;  3QO8 A;  3CXC U;  4MTX A;  2MK3 A;  1FXV A;  4WFE A;  4JGS A;  2CK3 G;  1I5X A;  4F4L A;  3ZMZ A;  1OZ0 A;  4TT3 G;  2ZDI A;  2EIM C;  2WLJ A;  2DQ3 A;  3FB7 C;  3JD0 A;  1AI6 A;  4PA7 A;  2ZXW C;  4H37 A;  5EBL C;  1YIJ V;  1CP9 A;  1K4C C;  3ABL C;  4OXS A;  3CCL V;  2JDI G;  2WWW A;  2UXN A;  3RBZ A;  3B77 A;  4MVO A;  1B6Q A;  2IJH A;  2EIJ C;  3CYO A;  1ARO P;  3OMA B;  4MVM A;  1QLN A;  3CCE V;  2IH3 C;  1EBO A;  3D36 A;  4XDK A;  1V55 C;  2EIK B;  3OMI B;  4P9O A;  3AG1 B;  2OCC B;  3B8M A;  4Q20 A;  3ASN C;  3NXS A;  1OCC B;  3ZRS A;  3ZRX A;  1M90 W;  4LP8 A;  4JF3 A;  5LHI A;  1OCR C;  4RQF A;  4PA6 A;  1JX9 A;  2HVJ C;  2YEV B;  3IFX A;  2WLK A;  3ZRV A;  3W7S A;  1S76 D;  2OTJ V;  1XL4 A;  1VQ8 V;  5L3B A;  1V54 C;  4I9W A;  1MG1 A;  4R8C A;  2EIM B;  3TET A;  2B5U A;  4GX5 A;  4UV9 A;  2KB1 A;  2ZXW B;  1P4R A;  4G2K A;  1QVG U;  5IY5 C;  3ASO C;  3CCS V;  1NH2 B;  4UVC A;  3E8B A;  3ABL B;  1ENV A;  1AJN A;  3JYC A;  4LCU C;  4MTF A;  1WPX A;  1R73 A;  2EIJ B;  5CBF A;  1JVM A;  4E2L A;  2OT5 A;  4JPR A;  3FB8 C;  1I5Y A;  4P2Z A;  4DO2 A;  4X88 A;  1V55 B;  4X89 A;  1PNK A;  3E8F A;  1OCO C;  4GT1 A;  4G28 B;  4XBF A;  3E2E A;  2W6J G;  4J9Z B;  5KUM A;  1K97 A;  3AG2 B;  1NR1 A;  4QE9 A;  1MSW D;  3OFN G;  1YTF B;  3OGC C;  4TSF G;  5LGU A;  1OCR B;  4L87 A;  3P32 A;  3OMN B;  3BEH A;  3W7U A;  3CME V;  1V54 B;  3OEH G;  1OHH G;  1K3E A;  4HYO A;  1VQN V;  4XDJ A;  3CD6 V;  3W7W A;  2X0L A;  3FKS G;  4P30 A;  2NLJ C;  1Q81 W;  2WLL B;  4MVR A;  4QNH B;  3LDC A;  2A9H A;  3ASO B;  2EBO A;  1R3K C;  2WSS G;  3K79 A;  1GM7 A;  4CZZ A;  1F4M A;  4JAS A;  4XDL A;  4ASU G;  1FXK C;  2P90 A;  2F43 G;  1NVP B;  4JYC A;  1YI2 V;  4QPJ A;  3SPG A;  3W7T A;  2YEV A;  5B3S C;  4WFB V;  2DWD C;  2XOK G;  2Q69 A;  2H94 A;  2HG5 C;  2FTK A;  1K34 A;  1VQ4 V;  2JEU A;  2EIN C;  4KFM A;  4PEL A;  4UVB A;  4PDR A;  5HFL A;  1NBM G;  1JOY A;  2UXX A;  2ZQM A;  1TUE B;  4G27 B;  4PA9 A;  2HKO A;  2WPD G;  3OR7 C;  5KUK A;  5EK0 A;  2PI4 A;  2BOB C;  1AI5 A;  2C2A A;  3ABK C;  4FMT A;  1N8R W;  2XAS A;  3AG3 C;  5L3G A;  3JD3 A;  3SJQ C;  2W6I G;  3BY6 A;  1NR7 A;  4JAU A;  1FS0 G;  3ABU A;  3K03 A;  1QCE A;  4JAV A;  4U7N A;  4UUJ C;  1WLE A;  2QM8 A;  3OW2 U;  1FXK B;  1GK9 A;  2P67 A;  3T4Z A;  1BHB A;  1R3J C;  2JIZ G;  2Q68 A;  3OAA G;  4WFF A;  5B1O A;  1VQ5 V;  2EIL C;  2DYS C;  3CC7 V;  1SRY A;  5B3S B;  1GTO A;  5EC1 C;  1NH2 D;  3OUF A;  2XAJ A;  3WG7 C;  1S5H C;  2JEX A;  3D3I A;  3K08 A;  5KA5 A;  5LHH A;  4P9P A;  1F23 A;  3LDE A;  3MD0 A;  4LBE C;  3W7X A;  2WLL A;  3QO7 A;  3FB5 C;  5L3E A;  1VQ6 V;  4MW3 A;  3CCJ V;  3SPJ A;  1RPR A;  2DYR C;  2R9I A;  4LC1 A;  2X6C A;  3ETG A;  5LGT A;  2Z3Y A;  3AG3 B;  2HVK C;  1QBZ A;  4RUF A;  4QPK A;  1G4Y B;  3ETE A;  3E8G A;  2LP7 A;  2Y69 C;  5LBQ A;  3DGE A;  2WAM A;  3K04 A;  1Q82 W;  4MTO A;  3F7V C;  1AR1 B;  3K9A A;  3ABT A;  5KA6 A;  3K0G A;  5BZB A;  5J9P C;  1NQT A;  4MS2 A;  2IU0 A;  2WLM A;  1W0K G;  1RM1 C;  2DYS B;  3F5W C;  2DQ0 A;  4X8A A;  3WG7 B;  3AG4 C;  3CPW U;  1E79 G;  4UV8 A;  3I56 V;  2LFR A;  1JQ0 A;  3P30 A;  1JJ2 U;  1GMG A;  5B1B C;  2ZD9 A;  3SYQ A;  2JK5 C;  4N21 A;  2W0F C;  2V1D A;  3G4S V;  3E83 A;  3GWO A;  3T2M A;  3SYO A;  3FB6 C;  1CPY A;  2X7R B;  4RAI A;  1PKX A;  3T1C A;  1K5Q A;  3LUT B;  3OM3 B;  3ZCC A;  1ORQ C;  4KUM A;  1FXK A;  1RPO A;  2V7Q G;  2M7W A;  4GCZ A;  1AJP A;  1H8H G;  1DF5 A;  1UJW B;  3ASN B;  3LNM B;  2XND G;  4FIP C;  2ZR3 A;  3JD2 A;  2JJ1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...