3VOUA

The crystal structure of nak-navsulp chimera channel
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MLSFILTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTVEGLRPLDALYFSVVTLTTVGDGNFSPQTDFGKVFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKETDAYRLEVMEKLEAIEKKLAEHSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal helical bundle of the tetrameric prokaryotic sodium channel accelerates the inactivation rate
pubmed doi rcsb
source organism Bacillus weihenstephanensis
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein, Voltage-gated sodium channel
total genus 54
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3vouA00
4TWKA 4PA9A 3SYCA 4P9OA 4PDMA 4X8AA 4MSWC 3RBZA 3SPJA 5EBWC 4WFFA 2Q68A 2ATKC 5J9PC 5EBMC 3JYCA 3E83A 2Q69A 3ASNC 3K0DA 3PJSK 3FB7C 4P9PA 2EINC 3F7YC 4G27B 4J9YB 1V55C 1R3KC 2WLKA 3FB8C 2Y69C 4MVSA 2EIJC 2WLLB 1R3JC 2K1EA 4CBCA 4LP8A 3BEHA 3R65A 4JTDB 3SPCA 3ABMC 3E89A 1OCCC 3ABKC 4MVMA 4X88A 3RVZA 4WFHA 2AHYA 2HFEC 4X89A 1BL8A 2ITDC 5BZBA 2QKSA 2WLLA 3LDDA 2X6BA 3IFXA 5EBLC 4PA4A 2A9HA 3SPHA 2EIMC 3TETA 1R3LC 1OCOC 4J9ZB 4HYOA 2WLMA 3LDEA 2H8PC 5KUKA 1OCZC 2HVJC 4MW8A 5IY5C 3E8FA 1JVMA 3K08A 3UKMA 4F4LA 3AG1C 4H37A 3RW0A 2Q6AA 3VOUA 4MW3A 2X6CA 4BW5A 2WLJA 1OCRC 4JTCB 2BOCC 2EILC 3SJQC 3KG2A 1M56C 4GX5A 4PA7A 4QNHB 3OUFA 2Q67A 4GX1A 2IH1C 3SPGA 2R9RB 4MVUA 4PDRA 4PDVA 3WG7C 3X2QC 2HG5C 5E1AC 4RUFA 2IH3C 3K03A 4RAIA 4XDKA 4EKWA 4UUJC 2HJFC 3ABLC 5KUMA 1J95A 5CBGA 4HZ3A 4PA6A 2BOBC 3K0GA 4R8CA 3RVYA 2W0FC 4RO2A 4WFEA 3STZC 1XL6A 5CBHA 3T4ZA 4R50A 3K06A 4MTOA 2ZD9A 3OR6C 2DYSC 5EC1C 4PDLA 5B1BC 1S5HC 4PA3A 4I9WA 4G28B 1P7BA 4QE9A 3AG2C 2A79B 3E86A 4MS2A 4P2ZA 3SYOA 3T1CA 1G4YB 3FB5C 4MVRA 2WLHA 3ASOC 5B1AC 5CBFA 4JTAB 1ORQC 3E8GA 3E8BA 2OCCC 4MVOA 4GX2A 2NLJC 5B3SC 1K4DC 2DYRC 2WLIB 3EFFK 3HPLC 3E8HA 3OGCC 4LBEC 4RUEA 4MVQA 2X6AA 3K04A 4DXWA 4R7CA 2JK5C 2HVKC 3SYAA 3STLC 1V54C 4MVZA 3UM7A 4H33A 1QLEC 1K4CC 1KKDA 2KB1A 3ZRSA 1ZWIC 4XDLA 1LNQA 2AHZA 3IGAC 4P30A 3T2MA 3TCUA 1XL4A 2WLIA 4KFMA 2ITCC 3F5WC 3OR7C 4GX0A 4MTFA 2DWEC 2A0LA 4XDJA 3AG3C 3ZJZA 3T4DA 3SYPA 2P7TC 2DWDC 1M57C 4R6ZA 3F7VC 4LCUC 2EIKC 4WFGA 3OUSA 3SYQA 3LDCA 5EC2C 1R3IC 4OXSA 4MTGA 3GB7C 3LNMB 3SPIA 3FB6C 3AG4C 2WLNA 4QE7A 3LUTB 2YEVA 2QTOA 5EK0A 4ZBMA 2ZXWC
chains in the Genus database with same CATH superfamily
4I50B 4JV5B 2DE0X 1FXHA 4WFAV 5L3DA 3T1HO 1K33A 2NNUA 4J9YB 5L3EA 2FYUH 1XEQA 2HR3A 4CH5A 3CC7V 4DUYB 2JGDB 3MAQA 3T1HB 1ZAUA 1AR1B 4DR5B 2Z0AA 3CRAA 2NN4A 5IWAB 3CCQV 3QG5A 3GWKC 4LF9O 2ETNA 5LP6C 1JVMA 3L70H 1BS3A 3VOUA 1YI2V 4LFAO 3MHHC 2IH1C 4I5SA 5KHJA 2CAZC 1I0HA 4DRXB 3G67A 2HJFC 1MZEA 1RPRA 1Q82W 2XHBA 1FKAO 5EZYB 1PP9H 3OD4A 4HZ3A 3ZCCA 2UXCO 2BTQB 1VQ9V 1EFRG 2HLDG 3STZC 5IJ9A 4G2KA 1ZUQA 2R72A 5JJEB 1H2MA 4PV1B 4NKGB 2LJ2A 2HEPA 2P67A 3CRRA 4DR6B 3OE7G 4LF8B 1NR1A 3T1YO 4DV5O 1WNSA 3CSXA 1VQ7V 4I55A 5LYJB 1MMMA 3SYAA 4UCOA 4KUMA 4X65O 2Q4PA 3FD9A 3ABMB 2WLIA 4D7SA 2ITCC 1F51A 3CYOA 2EZOA 2DWDC 4EB6B 2AW9A 2CGNA 4R6ZA 1HW7A 1QQCA 4B7EA 5F2VO 1XHZA 2OCHA 1QR9A 5EK0A 3RYIA 1YDXA 2V7QG 4LF7O 4LNUA 1AI4A 3WU2Z 2GUZB 1SQXH 1AR4A 1GTOA 1PM9A 4NXNO 1KMIZ 1NVPD 2HHHB 1M56B 2DQ0A 4NXMO 4HBNA 3S3XA 5EIBD 4JZGA 2M6YA 2ZE7A 2HFEC 2ZCEA 3J80N 4OX9O 4YJ2B 3W7XA 4IHJB 2VQEO 1R3LC 4JI1B 4F6RA 4FK5C 1Y76B 4DUZB 3WB0A 3AEIA 2HP8A 5B5EZ 3U0ZA 5IY5C 5L3BA 1HR0B 3FYIB 2ZIOA 2LQTA 1M9NA 4JI6B 3K5NA 5IJ0B 4J42A 3IC9A 3R66A 1MSDA 2UUBO 2XAJA 1S76D 1SRYA 3QO5A 4JYAB 4WCEV 3ZN1A 5JQGA 1K8AW 3ZHQA 1SA0A 4JAAA 4X1IA 2ZXWB 3FAVA 2K9PA 4PDLA 1S5HC 1ZTEA 2IW5A 4QPJA 2LW1A 3ETGA 4P2ZA 4I0XA 3T1CA 4QIWF 4NYKA 3LSQA 1HNZO 3BABA 4N23A 1XMOB 2B5UA 3WB2A 1K5SA 2WA3A 1HDJA 4LC1A 2OCCB 4R7CA 3HKEA 4ASUG 1V54C 4DV6O 3I5DA 2YIBA 3H1KH 2KB1A 3RT3C 1DF5A 1XL4A 3OR7C 3F5WC 2PYJA 3AG3C 1QR8A 2P7TC 3E35A 3SJAC 3TK1A 3ZRVA 5HFLA 3OUSA 3SYQA 3JD1A 1K9MW 3SGIA 4PHZA 4MTGA 4XBFA 1XNRB 5DM6V 4U7OA 4ZBMA 5C8YA 4P9OA 1PD3A 4WFFA 5J9PC 4UCTA 5LGUA 1V55C 4DV4O 1BHBA 2Y69C 2WLLB 2Y4UA 4DV3O 4CH3A 4FZ0A 4KHPB 3ABMC 4DV4B 5EBLC 2FKXA 1ROPA 3IFXA 1Z2GA 3FX7A 3K79A 1IBLO 1O9GA 1GMGA 1WA8B 4HAMA 4DR2O 3ZHUA 1AVMA 2Q8VA 3VBBA 4X66O 3K08A 3RYIB 2UU9B 1PPJH 4UV8A 4IL6Z 1IDSA 4DRXA 4AILC 1B06A 1KQSU 1GK9A 3UT5B 4MVUA 3TGUH 3WG7C 1YF2A 5ITZA 5E1AC 4RUFA 2IH3C 1AP6A 1JMKC 4EKWA 2P4VA 2ZKOA 5H2FZ 3CCSV 3B09A 1PNKA 4JAUA 1OCZB 2XAGA 2YICA 4DR7O 3KCYA 5LHIA 2DYSC 3ZBHA 2XAHA 2HJDA 4JYCA 3JARA 3ASOC 2QWOB 4DR4O 4N21A 5L3GA 4ZHQB 3CMAV 5A2QN 4O4LA 3JASB 3OW2U 2YI8A 4ZOLA 5KX5B 4X66B 1Q5OA 2N74A 3JD2A 5IY5B 4DR2B 4H33A 2CH7B 4X1YA 3ASOB 4X62O 3OEHG 3IGAC 1Q6IA 1ZLZA 3OM3B 4WF9V 1OHHG 1R3IC 1VQ5V 1HNZB 5JWPA 5EZYA 1IVSA 4JI8O 3FKSG 4O4IB 3RN4A 4O4IA 4TWKA 2F4VB 1Q86W 1FXVA 5EBWC 2UXCB 4YY3B 2UXNA 1JCHA 3JYCA 4JI1O 2Q69A 1XDCA 4AI8A 1DLBA 1Z5WA 2EIJC 1N36O 2ZIMA 1OZ0A 4JAVA 2QE7G 3R65A 1RPOA 4LFAB 1OCCC 4X89A 1BL8A 2YS8A 2WPDG 3B77A 3HKDB 5GONB 4J9ZB 2OIEA 4DV2O 1SKVA 4DV6B 2KQXA 2IU3A 2RDCA 2JGDA 3HR0A 3UKMA 1S77D 2B9ZA 3CCRV 1Y6XA 4YY3O 3ML0A 4RQEA 2EILC 1VQOV 1VQ8V 4FLZA 1L0LH 2F95B 5EYPA 2DYSB 3OEEG 4TV8B 2IJJA 3HKBB 1MZFA 3H1IH 1Y66A 1VQPV 4PA6A 2BOBC 1XL6A 3JCZA 1VQ6V 2QJ1A 4CZZA 1PL0A 4GKJB 1DGSA 2A79B 5ITZB 4B7KA 3P3NA 4WBNA 4JI6O 5CBFA 3OFNG 3BAAA 4FFBA 2DMXA 4IT5A 2ADPA 5IYDO 2KG7A 2PYLA 1D2DA 5KHIA 1SZTA 1YCIA 1GN4A 1QCEA 1NVPB 4NB5A 4DXWA 3K04A 1URFA 4JI4O 4FLYA 5B1OA 1KKDA 5FL7G 4K8ZA 1VARA 2EX3A 2LGQA 4MTFA 1NS1A 1MSWD 1M57C 3M8AA 4DV2B 4DR1B 5LXTB 2UUCO 2Q0OC 2UUBB 1Y67A 2A3QA 4X1KA 2YSUB 4PA9A 1IBKO 5LXTA 3ZIAG 2Q68A 5GTIZ 1THZA 4PJ0Z 3ZMUA 1IXMA 2YC0A 3F7YC 3SJCC 5FNVB 3A0HZ 3AG3B 5LMUO 4JTDB 3SPCA 1T5EA 5BZBA 1MNGA 1BMFG 3MHSC 2HHHO 3DSQA 2R70A 1N0NA 5KUKA 1RM1B 1KBHA 4DR7B 4LFCO 3HKEB 1JA8A 3EHBB 4LF7B 5HFMA 3HKCB 3RYHA 3LNNA 4IYHA 5JJNB 1NQTA 4K8XA 4CH4A 3K03A 2YDEA 3JAKB 1XNRO 5IYBO 1KP2A 1Y4MA 3RGBA 4OPAA 3MD0A 1SQQH 3K06A 3FYEB 4FLXA 1NT2B 1K3EA 5GW7A 3FFQA 1SETA 3L73H 2UXDO 4YXWG 1H2GA 3P32A 1R6TA 1XHXA 1BSMA 3ZMVA 4QJFB 2NLJC 2A06H 1ZSPA 4IGGA 2CTWA 3JD0A 4LBEC 4LF5B 4RUEA 1IURA 3JD4A 3H1JH 4B3SO 1NBMG 3RYHB 4X9QA 2QGNA 3QO8A 3ZJZA 4D7TA 3G4SV 4JI7O 3N2KB 5JH7B 3CE2A 3Q4HA 3APQA 3AG4C 1RSOB 4GZRB 1BE3H 1N32O 4DV3B 3IJ4A 3FB7C 2M7WA 2AGAA 2FL4A 1JFFB 4CH6A 1GH6A 1R3JC 4J41A 1G6UA 4NTXA 1QVGU 2DJVA 4X64B 4CS3A 1HWYA 2ZR2A 4O2AB 4BIUA 2EJRA 1X4TA 3A8TA 5LHGA 2JDIG 2YXHA 3X2QB 1M90W 4K3AA 2N05A 4KL1A 1Q7YW 1SC5B 3CX5F 1H2LA 3APOA 1K92A 3LSUA 4TQFA 2JJ2G 5IYZB 3OTOB 1P7GA 2ZM6O 2L6LA 1MG1A 4PA7A 3DXRA 1GN6A 1D5AA 3OUFA 1CP9A 1F4MA 1SQGA 3A0BZ 1VEWA 5D5QA 4UFZA 1AJQA 1OCOB 3L72H 1YSCA 3BRCA 1ZX3A 4FFBB 3UT5A 2IU0A 4AQYB 1M5IA 2IJKA 4GYCB 5IJ9B 3JAMN 4JI2O 3AG2B 3OMAB 1N0JA 4JI0O 3S3WA 1BZKA 4OX9B 3Q4HB 3E8GA 1R1BA 2Q9LA 5KHKA 1HNXO 2EBOA 2WLIB 4I4TB 2F93B 2P6JA 1EZVH 3G6BA 2F66C 4MVZA 3TXQA 5FPOA 4TV9B 3ZRSA 1ZWIC 1XMQB 1VIBA 3CCEV 5IYZA 1HNWB 2FTKA 1HNXB 5LP6A 4XDJA 2XOKG 4DV7O 4Q6GA 2D3OW 1L1FA 2EIKC 4X20B 4LF4B 2D2CB 4OXSA 1N34B 1XNQO 1YVWA 3LUTB 5CA1A 2O57A 4ICGA 2E3CA 3OGIB 5LHHA 5CA1B 4KXRA 2WLKA 3AK2A 4LR3A 4MTXA 3CRMA 5AG2A 4BIOA 4BAYA 2E5LO 2FB5A 2QTSA 1Y76A 3D3IA 4X88A 3C3TA 2QKSA 3B8NA 1B6QA 4YJ2A 2AXTZ 1JR9A 1OCOC 3D3QA 3LDEA 1WP8A 5LOVA 3GWOA 3NR7A 4MW8A 2UU9O 1U96A 3ZHSA 1QVFU 4F4LA 2X6CA 4LF4O 3QF7A 4K0KB 4FLUA 3H01A 2BCCH 2Q67A 5EIBC 3VQVA 1GO3F 4XDKA 5CA0A 1YJWV 4BIZA 2PTMA 4JI5B 5BR8O 2UXBB 1UPGA 4DYLA 1XQ8A 5EC1C 3OAAG 5JQGB 4FLVA 3ABLB 4FPPA 1JJOA 2GBOA 1O9HA 4MT8A 3O65A 4DR3B 2CK3G 1NZ6A 4WFBV 2GV9A 4GX2A 5LYJA 2QM8A 4YIPA 4QGPA 3HPLC 2JK5C 3UM7A 5DN6G 4B3MO 3BPZA 4JI3B 1K97A 3K5LA 4AHCA 2GDSA 2QM4A 3JAWA 3HKDA 5GONA 2YEVB 4J7JA 4H0LB 1QLNA 1HR0O 1ENVA 1OV9A 4O4HB 4X62B 4CS4A 4I7ZB 3K58A 3CMEV 4MSWC 2WA4A 2E76B 1SS3A 3FAVB 2ATKC 4DUYO 2QKAA 3E83A 4YJ3B 2PI4A 1SA0B 2FMLA 1LUVA 4CBCA 3H1HH 1N34O 2LP7A 1E1QG 4LP8A 1XREA 1GM7A 4B3TB 3CD6V 2XAQA 2QWNB 4O4JA 3E89A 5H6QA 2Y69B 1SQPH 4MVMA 3RVZA 4WFHA 4IIJB 3LDDA 1EN5A 5IDJA 3ZX6A 3NXSA 2WLMA 4FLWA 1RP3B 4B3TO 4UVCA 2HVJC 5LA6A 2A7WA 2Y4TA 2PGGA 3J7AU 4GLXA 2WLJA 5E79Z 5LA6B 4DUZO 4GKKB 4B3RB 3B8MA 4GX1A 4JI7B 2GTSA 2JS5A 4I50A 1H2NA 1NTKH 3ABUA 2ILMA 1J95A 4TQDA 4NXMB 1TA8A 1K73W 3K0GA 3OR6C 2G38A 3K3WA 3CP1A 2QSAA 1P4RA 2VQFB 2OIGA 1U97A 1GKFA 2LFRA 1P49A 1VQNV 2ZINA 3QTCA 4A5UB 4JI0B 2DYRC 3OGCC 1V55B 1WB8A 1I94B 2X6AA 4B3RO 5EYPB 4BR6A 5CMUA 3BA8A 1SF9A 4GCZA 4P30A 3ZMSA 3RYCA 2XAFA 2EIMB 2ZR3A 1IXBA 4L87A 2GTAA 1NTZH 1AR5A 1M93A 1FFTB 4ABMA 5BMVA 2YEVA 2QTOA 3T1YB 3JALB 2ODMA 3JD3A 1VQMV 4NVPA 1NJIW 1KYOF 2YIDA 2YXYA 1AJNA 3G6EV 1S72V 1R3KC 2R9IA 1Q8IA 5KMGA 3ZHRA 1AI6A 3CEIA 4PI0A 4FFKA 1TUEB 1D5NA 1OCCB 1L8DA 1TUBB 4FLTA 4LWSA 4JI5O 4EB6A 5KLVH 1WJZA 2QWQB 4Z2WA 3C3SA 1YEWA 4GX5A 1SERA 3AK1A 4K0KO 4I0XB 2N04A 4ZIBA 2P90A 3ZRWA 1US6A 5IT9N 1R6KA 2LGWA 1QU7A 2QKCA 3T4ZA 1A32A 5FNVA 3JSLA 4PA3A 4I9WA 3J81N 3E2EA 4G28B 4FVMA 2OYQA 5BR8B 1G4YB 2DOSA 2X0LA 2V4DA 4JTAB 1EBOA 4MVOA 2PY5A 1FYJA 5LGTA 1MA1A 3W7SA 3ZHVA 4X20A 2IJHA 4LH7A 4FJCC 1FS0G 3F7VC 2RNBA 4UV9A 4QE7A 5DEDA 3AK3A 3CRQA 4X8AA 3WG7B 5LP6B 2ZNJA 2QA4V 4H13B 2GUZA 3PJSK 1JX9A 2EINC 5JJJB 4UXNA 1NR7A 3QVNA 1JJ2U 2PF4E 1TGOA 4E4EA 1TVKB 1QBZA 1AI5A 5B1AB 3HB3B 4JGSA 2EINB 1COWG 2A9HA 3E22A 1AILA 3CCLV 4HYOA 1NH2D 2XTAA 2BE3A 2H8PC 4B3SB 3U10A 1N33B 4IHJA 3RW0A 3SJBC 4DK1A 3CCJV 3W7WA 1OCRC 4JTCB 3ICXA 4B3MB 4PDVA 1K34A 5TISZ 1YITV 2ZE5A 4TV9A 2VS0A 1H38A 4CC5A 3M7MX 1SZXA 2ZD9A 4TUYB 4J11A 1Z5VA 4O2AA 1S3JA 1Q3EA 4X1IB 2JJ1G 1VF6A 4MVRA 5H6RA 2CTRA 4UCVA 3DC5A 4DV1B 5B3SC 4NTWA 2IM9A 3N2GA 4TV8A 3EFFK 1AROP 3THOA 2OT5A 1S5LZ 3DC6A 2Q7HA 1GM9A 2ZM6B 5LL6Y 3AG7A 5KMGB 1GN3A 1B04A 1J5EB 3W7TA 3W7UA 4UCSA 5L3CA 1L0NH 1VF6C 2JRIA 3CCMV 3P3PA 5A9GA 1Q43A 3JALA 2ADQB 3RBZA 5IE9A 3D36C 5EBMC 3K0DA 2BSKA 5C8YB 3UO2A 2RJZA 3FB8C 1NH2B 1KECA 5J2TA 4LFCB 1PV0A 1RFYA 2YIBD 2RQ6A 2CUGA 1H2SB 4U3JA 3L75H 4PD4F 4F6EA 5CB4A 1R73A 1QNMA 1OCZC 2DN9A 1NI8A 1SQVH 5C93A 5CA3A 3CPWU 2RCVA 1DTOA 4JI2B 2V1DA 4BW5A 2WWWA 4DK0A 3U11A 4UCUA 5KHHA 2JEXA 2W6JG 2R9RB 4PDRA 3UO3A 4I55B 3HKCA 2QWRB 1M1KW 1EN4A 3JAWB 5BMVB 5KUMA 3AG1B 1YIJV 4GKJO 2PI5A 4OPHA 2BSKB 2GHYA 3CCUV 5K1PA 4FZ1A 5H9CA 4R50A 5B1BC 4DV1O 1KKCA 1WPXA 3UQ8A 3JASA 2JIZG 2MK3A 4EFEA 4JI4B 1FXKC 5LMNO 4U7NA 2KSDA 5LBQA 1VQLV 3JARB 4DW1A 2ZQMA 5J2UA 1XNQB 1FFXA 3RYFA 1W0JG 1BGYH 2F1MA 1HP8A 4O4JB 2EZPA 3K5OA 3ETEA 1VP7A 4UVAA 3OT7A 2E5LB 3K57A 4YJ3A 2P22C 4WFGA 1WPBA 2QR4A 2MW2B 3A2FA 5GTHZ 2OTLV 4H44B 3CXHF 3RWRD 2QM7A 2XUMA 1V9PA 2GSMB 5LMUB 2QDOA 1WLEA 3KCXA 4DO2A 1CXZB 3LSSA 4NR1A 4ZI7B 4C7UA 4JYYA 1XBLA 2AZ0A 1IBLB 4B08A 2HKOA 2LFSA 4LF5O 3VQYA 3ABKC 5JCOC 1NU1H 1IZ3A 3CXCU 4FM2A 3K9SA 1WB7A 1VQKV 1XILA 3BCCH 4J80A 1IBMO 2E74B 1FFXB 1JOYA 2EIJB 5H5NA 1XMOO 4JASA 3KG2A 4CC6A 4QNHB 1H8HG 4W4LA 4JI8B 2YIAA 1KB9F 4LFBB 2ZT9B 5JVDB 1KD1W 4NXNB 1E79G 4R8CA 4WFEA 1RM1C 4J10A 1M4UA 4JYAO 1BCCH 3E86A 3ABKB 1YXBA 1YZBA 1DF4A 1K5QA 4PI2A 4LFBO 1H2KA 1Q6UA 3CC2V 5BY1A 1FJGO 3E8HA 4IYIA 4DR4B 2ZNIA 1SQFA 3STLC 3TXSA 5JH7A 2Z5UA 1LNQA 3T2MA 1KU9A 2DWEC 1I7FA 1P84F 3A0RA 1KP3A 3SDLA 1N8RW 3O9OA 1BQ0A 1GAXA 1R6NA 1HNWO 4O4HA 2F23A 4LF8O 5IJ0A 3FB6C 3ZMZA 2A0LA 4O4LB 3B40A 1Q81W 3ZRXA 2L35A 2UXDB 2Q7GA 3WFVA 3I56V 3ASNC 4P9PA 4G27B 1F23A 4MVSA 4IIJA 3H9VA 2Q7EA 3BEHA 4GKKO 1VF5B 3QO7A 2AHYA 2P5OA 1KC8W 1G8MA 2X6BA 5B1NA 2EIMC 3SPHA 1YHQV 4J7KA 5B3SB 3P30A 1H8EG 1F4NA 4HNAA 4JZ2A 1OJHA 2UUAO 1LUWA 2YUAA 2VRZA 3K59A 4L8JA 1YJ9V 1RSOA 3SJQC 4FM1A 1I5XA 3CWBH 2P4KA 3X2QC 4ZOLB 2HG5C 5KAIZ 2ARHA 5J2TB 4UUJC 1Q90D 4ZHQA 3RVYA 5CBHA 1WN7A 4UCRA 1Q6HA 3SR2C 2W0XA 3BA9A 3ZEDA 1P7BA 1OCRB 4JPRA 1V54B 1XMQO 4LH6A 2OCCC 3RYFB 2Y0IA 3K5MA 4Z1MG 5JCOA 3VQWA 2UUCB 1K4DC 2LO1A 4W4KA 4FIPC 1F7YA 5KA6A 1AB3A 3AG4B 4YHHB 4J7ZA 2AHZA 2YI9A 1SESA 4TOIA 3CHXA 4OGQB 5B66Z 1Y74B 1GRJA 5DECA 1AI7A 2RN9A 4LCUC 4GT1A 2KKWA 4YHHO 3LNMB 4AQYO 2Y0PA 4NTYA 4Q20A 1N4CA 2PZSA 4Z1VA 1WAZA 2DQ3A 4UB6Z 2IJIA 5K1XA 4FM0A 3L74H 2B1GA 1KUQA 5J2UB 2WLLA 4I9QA 1X59A 1IX9A 4H37A 2Q6AA 2CDYA 2OTJV 2BOCC 1EZJA 2H94A 2WAMA 4DV0O 2CTQA 2BTOA 4DW0A 1EM1A 4E2LA 4O2BB 3ASNB 3ABLC 4RQFA 3EXAA 2VWKA 4ZI7A 2W0FC 3JCUZ 3K9AA 5KA5A 2DW4A 1FD9A 2AZ2A 4YIOA 1W59A 2XNDG 5B1AC 4LF6O 1NTMH 3CCVV 2DYRB 1XOUA 4EEQA 2VQFO 1YJNV 4LWSB 2HVKC 3L71H 1K4CC 1DK1A 3CJHA 1TAEA 5CB4B 5CN0A 4KFMA 4LNUB 4BWAA 3T4DA 3SYPA 2WSSG 2CH7A 2Q5ZA 1BT8A 4RWUA 1MOFA 3RFRA 3SPIA 3ZN0A 3ETQA 2WLNA 3GVMA 4UB8Z 3N2KA 3BHPA 4X1KB 1FPOA 3SYCA 1FJGB 4PDMA 3MDSA 4KP4A 5LMNB 1PNLA 3UCSC 3VQXA 2C2AA 3DXRB 1SQBH 3WB1A 3ZRWB 2ZE8A 4F6RB 1FAFA 1AJPA 1XUQA 3BVOA 3BY6A 3OMNB 1UFIA 1GM8A 4LF9B 4I4TA 3N2GB 1VQ4V 4BW9A 3E22B 4JF3A 5IWAO 4JI3O 2CE4A 3TETA 2KG7B 3C90A 2XASA 1TUBA 2EIKB 5LOVB 3I55V 4D6TH 1I5YA 3N27A 1JQ0A 3ZMTA 3E8FA 1FXKA 3IAYA 4X64O 2EILB 3M99B 3ABTA 1J5EO 4MW3A 3JSNA 3OMIB 1LR1A 5FPRA 3SPGA 2UUAB 4DV5B 2E75B 4RAIA 3HKBA 1IBKB 4TUYA 4K35A 4DR6O 5BXZA 1N32B 5KHGA 5JVDA 3CS5A 2EULA 4QE9A 2NR5A 3AG2C 1N36B 4JYBA 3F5TA 2WLHA 3CRCA 4U3FH 1I94O 1ORQC 2Z3YA 3IC7A 2CTPA 4DR3O 3DGEA 4UVBA 2F4VO 4DV7B 4EFBA 3RYCB 4MVQA 1ZL8B 5KAFZ 3QNEA 1W2BU 2BTQA 2YXLA 4XDLA 4KHPO 3TCUA 3CB2A 1B3QA 4HNAB 3ZS8C 3CC4V 1FXKB 4DR1O 3CJHB 2JEUA 1N33O 3OTFA 3D8CA 3LDCA 5EC2C 1S0VA 1MABG 1PL4A 2ZDIA 1QLEB 3D36A 5B1BB 2EJ7A 4CS2A 2ZXWC 4DR5O 5D5PA 1JPXA 1PNMA 3SPJA 4U3JB 3KZIZ 1PKXA 4QPKA 2R9AA 1K7DA 5KX5A 1QHTA 1M57B 2K1EA 2Q0AA 2Y48A 2ZDIC 4X1YB 4DV0B 1EN6A 4WBNB 3G71V 1IBMB 2ITDC 4O2BA 1WP7A 4PELA 1Y74A 4ZKIA 3ZHTA 2RMKB 4PA4A 1W0KG 3OTOO 3EVKA 2UXXA 1YTFD 5FLXN 1BHAA 5L3FA 3AG1C 3BFRA 1NKDA 1E1RG 2Q73A 3H1LH 1M56C 2H3OA 4TT3G 1AP5A 1TVKA 3JATA 2PUSA 3G80A 1GN2A 3JAKA 3B2EE 2LW7A 2CGOA 1UJWB 5CBGA 1JFFA 4RO2A 4MTOA 2UXBO 3KKYA 2QWPB 5CA0B 1CEZA 3TJTA 2ZE6A 4MS2A 3SYOA 4GUNA 1S5JA 3FB5C 3PN1A 1G1XB 1XI1A 3DTUB 3E8BA 2JGUA 4LF6B 2JS3A 2F43G 1WA8A 1BQZA 2VWJA 2P06A 4TSFG 1YTFB 2VQEB 2QEXV 4FMTA 1CPYA 2XT9A 1QLEC 2X7RB 2IBZH 1I08A 2OWOA 1VF7A 4GX0A 3B4SA 1VMGA 3ETDA 2B1IA 2W6IG 2JVDA 3JATB 4X65B 5IYCO 3L9DA 4JV5O 3GB7C 5LGNA 1ZL8A
chains in the Genus database with same CATH topology
4PA9A 3JD3A 3ZIAG 1Q81W 1VQMV 2Q68A 1THZA 3ZRXA 3ZMUA 1NJIW 1FXHA 3WFVA 3I56V 1IXMA 3ASNC 4P9PA 4WFAV 1AJNA 5L3DA 3G6EV 3F7YC 1K33A 1S72V 4G27B 2NNUA 4J9YB 5L3EA 1R3KC 1F23A 4MVSA 2R9IA 2HR3A 3CC7V 3AG3B 3BEHA 1AI6A 4JTDB 3SPCA 3QO7A 1AR1B 2AHYA 5BZBA 3CCQV 1KC8W 1BMFG 1G8MA 2X6BA 3MHSC 1TUEB 5B1NA 2EIMC 3SPHA 1YHQV 1OCCB 5B3SB 3P30A 5KUKA 1RM1B 1H8EG 1F4NA 1JVMA 3EHBB 3VOUA 1YI2V 5HFMA 1YJ9V 3SJQC 4GX5A 3MHHC 1SERA 1I5XA 2IH1C 4I5SA 1NQTA 3X2QC 2HG5C 3K03A 4UUJC 2HJFC 5IYBO 1RPRA 2P90A 1Q82W 1KP2A 1Y4MA 3ZRWA 4HZ3A 3ZCCA 3RVYA 1VQ9V 1EFRG 1R6KA 2HLDG 3MD0A 3STZC 5CBHA 4G2KA 3T4ZA 3K06A 3FYEB 4PA3A 1K3EA 4I9WA 5GW7A 3E2EA 4G28B 1P7BA 2P67A 1OCRB 1SETA 1G4YB 1H2GA 4JPRA 4YXWG 3P32A 2X0LA 1V54B 4JTAB 3OE7G 1EBOA 1NR1A 2OCCC 4MVOA 3ZMVA 4QJFB 4Z1MG 2NLJC 5LGTA 3W7SA 1VQ7V 1K4DC 3JD0A 4LBEC 4RUEA 3SYAA 4KUMA 4FIPC 5KA6A 3AG4B 3JD4A 2AHZA 1SESA 1NBMG 3ABMB 2WLIA 2ITCC 3QO8A 2IJHA 1F51A 3CYOA 3ZJZA 3G4SV 2EZOA 4FJCC 2DWDC 1AI7A 4R6ZA 1FS0G 3F7VC 4LCUC 4GT1A 3LNMB 4UV9A 3AG4C 4QE7A 1QR9A 5EK0A 2V7QG 4X8AA 3WG7B 2QA4V 1AI4A 4Q20A 3PJSK 3FB7C 1JX9A 2EINC 2M7WA 2DQ3A 1GTOA 4UXNA 2IJIA 1NVPD 1NR7A 1R3JC 1JJ2U 1M56B 2DQ0A 1QVGU 2B1GA 1QBZA 1AI5A 5B1AB 3HB3B 2HFEC 4JGSA 2WLLA 2EINB 1COWG 2A9HA 1HWYA 2ZR2A 3W7XA 4BIUA 1R3LC 2EJRA 3CCLV 4HYOA 5LHGA 1NH2D 4FK5C 2JDIG 2H8PC 3AEIA 3X2QB 1M90W 5IY5C 5L3BA 1Q7YW 3FYIB 4H37A 3RW0A 2Q6AA 3CCJV 1K92A 2JJ2G 3W7WA 1OCRC 4JTCB 2OTJV 1M9NA 2BOCC 1EZJA 1MG1A 4PA7A 2H94A 2WAMA 2XAJA 3OUFA 1CP9A 1F4MA 1S76D 4PDVA 1SRYA 1K34A 3QO5A 4E2LA 4WCEV 3ZN1A 1YITV 3ASNB 1AJQA 1OCOB 3ABLC 4RQFA 1K8AW 1YSCA 2IU0A 1H38A 2W0FC 3K9AA 2IJKA 5KA5A 2ZXWB 2DW4A 2ZD9A 3AG2B 4PDLA 1S5HC 2IW5A 3OMAB 4QPJA 1S3JA 2XNDG 3ETGA 4P2ZA 3T1CA 2JJ1G 4QIWF 4MVRA 5B1AC 5H6RA 3LSQA 3E8GA 4N23A 3CCVV 2B5UA 2DYRB 5B3SC 1K5SA 2EBOA 2WLIB 3EFFK 4LC1A 1YJNV 2OCCB 2P6JA 1AROP 4R7CA 2HVKC 2OT5A 1V54C 4MVZA 4ASUG 1K4CC 1GM9A 2KB1A 3ZRSA 1ZWIC 5CN0A 3CCEV 1DF5A 2FTKA 1XL4A 4KFMA 3OR7C 3F5WC 4XDJA 3AG3C 3T4DA 2XOKG 3SYPA 1QR8A 2P7TC 2WSSG 3E35A 3TK1A 3ZRVA 3W7TA 3W7UA 2D3OW 5L3CA 1L1FA 2EIKC 5HFLA 3OUSA 3SYQA 3CCMV 3JD1A 1K9MW 4OXSA 4MTGA 1MOFA 3SPIA 4XBFA 3ZN0A 2WLNA 5DM6V 3LUTB 4U7OA 4ZBMA 3SYCA 4P9OA 4PDMA 1PD3A 4KP4A 3RBZA 4WFFA 1PNLA 2C2AA 5J9PC 5EBMC 3K0DA 5LGUA 3ZRWB 5LHHA 1V55C 1NH2B 1AJPA 2WLKA 3FB8C 1KECA 4MTXA 2Y69C 1BHBA 2WLLB 4BAYA 3BY6A 3OMNB 1GM8A 3ABMC 4X88A 3D3IA 1VQ4V 2QKSA 3B8NA 5EBLC 1ROPA 3IFXA 1B6QA 4JF3A 3K79A 3TETA 1GMGA 1OCOC 4HAMA 2XASA 3LDEA 1R73A 2EIKB 3GWOA 3I55V 1OCZC 3VBBA 1I5YA 4MW8A 1JQ0A 3ZMTA 3E8FA 5C93A 3K08A 1FXKA 5CA3A 3CPWU 1QVFU 4F4LA 1DTOA 2EILB 3M99B 3ABTA 2V1DA 2X6CA 4MW3A 2WWWA 4UV8A 4BW5A 1KQSU 3OMIB 1GK9A 2JEXA 2W6JG 3H01A 2Q67A 3SPGA 2R9RB 4MVUA 4PDRA 3WG7C 1GO3F 4RUFA 2IH3C 4RAIA 5E1AC 4XDKA 4EKWA 1M1KW 5KUMA 3AG1B 1YIJV 3CCSV 1YJWV 2PI5A 4BIZA 4JAUA 1PNKA 1OCZB 2GHYA 3CCUV 2XAGA 5H9CA 4R50A 5LHIA 5B1BC 2DYSC 5EC1C 3OAAG 3ABLB 1WPXA 4FPPA 2XAHA 4QE9A 3AG2C 4JYCA 2JIZG 2MK3A 4JYBA 2WLHA 3ASOC 1FXKC 4MT8A 2CK3G 4N21A 1ORQC 5L3GA 2Z3YA 3IC7A 4WFBV 3CMAV 4U7NA 3DGEA 5LBQA 4GX2A 1VQLV 4UVBA 3OW2U 2ZQMA 2QM8A 3HPLC 4MVQA 3JD2A 5IY5B 2JK5C 3QNEA 3UM7A 1W0JG 5DN6G 4H33A 1W2BU 3ASOB 3OEHG 2EZPA 4XDLA 1K97A 3IGAC 3ETEA 3TCUA 3OM3B 4WF9V 4UVAA 3CC4V 2YEVB 1FXKB 1QLNA 1OHHG 2JEUA 4WFGA 3LDCA 5EC2C 1S0VA 1R3IC 1ENVA 1VQ5V 2OTLV 1MABG 2ZDIA 1QLEB 3FKSG 3D36A 5B1BB 3CMEV 2ZXWC 4TWKA 2QM7A 1JPXA 4MSWC 1PNMA 3SPJA 1Q86W 1FXVA 5EBWC 2GSMB 1WLEA 2ATKC 1PKXA 2UXNA 1JCHA 3JYCA 3E83A 2Q69A 4QPKA 4DO2A 3LSSA 2PI4A 1K7DA 1DLBA 4CBCA 2EIJC 1M57B 2K1EA 2LP7A 1E1QG 4LP8A 1OZ0A 4JAVA 1GM7A 2HKOA 2QE7G 3R65A 2LFSA 3CD6V 2XAQA 2Y48A 2ZDIC 3E89A 5H6QA 1RPOA 2Y69B 1OCCC 3ABKC 4MVMA 3RVZA 3G71V 4WFHA 4X89A 1BL8A 2ITDC 4PELA 3LDDA 2WPDG 4ZKIA 3B77A 4PA4A 5IDJA 1W0KG 4J9ZB 3NXSA 3CXCU 1VQKV 2WLMA 2UXXA 1YTFD 4UVCA 2HVJC 2IU3A 1BHAA 1JOYA 3UKMA 2EIJB 3AG1C 5L3FA 1S77D 3CCRV 4JASA 2WLJA 1NKDA 1E1RG 3ML0A 4RQEA 2EILC 1VQOV 1VQ8V 3KG2A 1M56C 4QNHB 2DYSB 4TT3G 3B8MA 4GX1A 1H8HG 3OEEG 2IJJA 3ABUA 1J95A 1UJWB 5CBGA 1KD1W 1E79G 1Y66A 4PA6A 2BOBC 1VQPV 3K0GA 4R8CA 1K73W 4RO2A 4WFEA 1XL6A 3JCZA 1RM1C 1VQ6V 4MTOA 3OR6C 3K3WA 4CZZA 3CP1A 1PL0A 1CEZA 1P4RA 2A79B 3E86A 4MS2A 3SYOA 3FB5C 3ABKB 1DF4A 5CBFA 1K5QA 3DTUB 3E8BA 1GKFA 3OFNG 2LFRA 3CC2V 2F43G 1VQNV 5IYDO 1SZTA 2DYRC 3OGCC 4TSFG 1YTFB 1QCEA 1V55B 3E8HA 1NVPB 2QEXV 4DXWA 2X6AA 3K04A 4FMTA 3STLC 1CPYA 5B1OA 1QLEC 2X7RB 1KKDA 5CMUA 5FL7G 2Z5UA 1LNQA 3T2MA 4GCZA 4P30A 3ZMSA 2XAFA 4GX0A 4MTFA 2DWEC 2EIMB 3ETDA 2ZR3A 3A0RA 1KP3A 4L87A 1N8RW 1MSWD 1M57C 2B1IA 2W6IG 5IYCO 1R6NA 1FFTB 3GB7C 5LGNA 3FB6C 2YEVA 2QTOA 3ZMZA 2YSUB 2A0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TWK A;  4PA9 A;  3SYC A;  4P9O A;  4PDM A;  4X8A A;  4MSW C;  3RBZ A;  3SPJ A;  5EBW C;  4WFF A;  2Q68 A;  2ATK C;  5J9P C;  5EBM C;  3JYC A;  3E83 A;  2Q69 A;  3ASN C;  3K0D A;  3PJS K;  3FB7 C;  4P9P A;  2EIN C;  3F7Y C;  4G27 B;  4J9Y B;  1V55 C;  1R3K C;  2WLK A;  3FB8 C;  2Y69 C;  4MVS A;  2EIJ C;  2WLL B;  1R3J C;  2K1E A;  4CBC A;  4LP8 A;  3BEH A;  3R65 A;  4JTD B;  3SPC A;  3ABM C;  3E89 A;  1OCC C;  3ABK C;  4MVM A;  4X88 A;  3RVZ A;  4WFH A;  2AHY A;  2HFE C;  4X89 A;  1BL8 A;  2ITD C;  5BZB A;  2QKS A;  2WLL A;  3LDD A;  2X6B A;  3IFX A;  5EBL C;  4PA4 A;  2A9H A;  3SPH A;  2EIM C;  3TET A;  1R3L C;  1OCO C;  4J9Z B;  4HYO A;  2WLM A;  3LDE A;  2H8P C;  5KUK A;  1OCZ C;  2HVJ C;  4MW8 A;  5IY5 C;  3E8F A;  1JVM A;  3K08 A;  3UKM A;  4F4L A;  3AG1 C;  4H37 A;  3RW0 A;  2Q6A A;  3VOU A;  4MW3 A;  2X6C A;  4BW5 A;  2WLJ A;  1OCR C;  4JTC B;  2BOC C;  2EIL C;  3SJQ C;  3KG2 A;  1M56 C;  4GX5 A;  4PA7 A;  4QNH B;  3OUF A;  2Q67 A;  4GX1 A;  2IH1 C;  3SPG A;  2R9R B;  4MVU A;  4PDR A;  4PDV A;  3WG7 C;  3X2Q C;  2HG5 C;  5E1A C;  4RUF A;  2IH3 C;  3K03 A;  4RAI A;  4XDK A;  4EKW A;  4UUJ C;  2HJF C;  3ABL C;  5KUM A;  1J95 A;  5CBG A;  4HZ3 A;  4PA6 A;  2BOB C;  3K0G A;  4R8C A;  3RVY A;  2W0F C;  4RO2 A;  4WFE A;  3STZ C;  1XL6 A;  5CBH A;  3T4Z A;  4R50 A;  3K06 A;  4MTO A;  2ZD9 A;  3OR6 C;  2DYS C;  5EC1 C;  4PDL A;  5B1B C;  1S5H C;  4PA3 A;  4I9W A;  4G28 B;  1P7B A;  4QE9 A;  3AG2 C;  2A79 B;  3E86 A;  4MS2 A;  4P2Z A;  3SYO A;  3T1C A;  1G4Y B;  3FB5 C;  4MVR A;  2WLH A;  3ASO C;  5B1A C;  5CBF A;  4JTA B;  1ORQ C;  3E8G A;  3E8B A;  2OCC C;  4MVO A;  4GX2 A;  2NLJ C;  5B3S C;  1K4D C;  2DYR C;  2WLI B;  3EFF K;  3HPL C;  3E8H A;  3OGC C;  4LBE C;  4RUE A;  4MVQ A;  2X6A A;  3K04 A;  4DXW A;  4R7C A;  2JK5 C;  2HVK C;  3SYA A;  3STL C;  1V54 C;  4MVZ A;  3UM7 A;  4H33 A;  1QLE C;  1K4C C;  1KKD A;  2KB1 A;  3ZRS A;  1ZWI C;  4XDL A;  1LNQ A;  2AHZ A;  3IGA C;  4P30 A;  3T2M A;  3TCU A;  1XL4 A;  2WLI A;  4KFM A;  2ITC C;  3F5W C;  3OR7 C;  4GX0 A;  4MTF A;  2DWE C;  2A0L A;  4XDJ A;  3AG3 C;  3ZJZ A;  3T4D A;  3SYP A;  2P7T C;  2DWD C;  1M57 C;  4R6Z A;  3F7V C;  4LCU C;  2EIK C;  4WFG A;  3OUS A;  3SYQ A;  3LDC A;  5EC2 C;  1R3I C;  4OXS A;  4MTG A;  3GB7 C;  3LNM B;  3SPI A;  3FB6 C;  3AG4 C;  2WLN A;  4QE7 A;  3LUT B;  2YEV A;  2QTO A;  5EK0 A;  4ZBM A;  2ZXW C; 
#chains in the Genus database with same CATH topology
 4I50 B;  4JV5 B;  2DE0 X;  1FXH A;  4WFA V;  5L3D A;  3T1H O;  1K33 A;  2NNU A;  4J9Y B;  5L3E A;  2FYU H;  1XEQ A;  2HR3 A;  4CH5 A;  3CC7 V;  4DUY B;  2JGD B;  3MAQ A;  3T1H B;  1ZAU A;  1AR1 B;  4DR5 B;  2Z0A A;  3CRA A;  2NN4 A;  5IWA B;  3CCQ V;  3QG5 A;  3GWK C;  4LF9 O;  2ETN A;  5LP6 C;  1JVM A;  3L70 H;  1BS3 A;  3VOU A;  1YI2 V;  4LFA O;  3MHH C;  2IH1 C;  4I5S A;  5KHJ A;  2CAZ C;  1I0H A;  4DRX B;  3G67 A;  2HJF C;  1MZE A;  1RPR A;  1Q82 W;  2XHB A;  1FKA O;  5EZY B;  1PP9 H;  3OD4 A;  4HZ3 A;  3ZCC A;  2UXC O;  2BTQ B;  1VQ9 V;  1EFR G;  2HLD G;  3STZ C;  5IJ9 A;  4G2K A;  1ZUQ A;  2R72 A;  5JJE B;  1H2M A;  4PV1 B;  4NKG B;  2LJ2 A;  2HEP A;  2P67 A;  3CRR A;  4DR6 B;  3OE7 G;  4LF8 B;  1NR1 A;  3T1Y O;  4DV5 O;  1WNS A;  3CSX A;  1VQ7 V;  4I55 A;  5LYJ B;  1MMM A;  3SYA A;  4UCO A;  4KUM A;  4X65 O;  2Q4P A;  3FD9 A;  3ABM B;  2WLI A;  4D7S A;  2ITC C;  1F51 A;  3CYO A;  2EZO A;  2DWD C;  4EB6 B;  2AW9 A;  2CGN A;  4R6Z A;  1HW7 A;  1QQC A;  4B7E A;  5F2V O;  1XHZ A;  2OCH A;  1QR9 A;  5EK0 A;  3RYI A;  1YDX A;  2V7Q G;  4LF7 O;  4LNU A;  1AI4 A;  3WU2 Z;  2GUZ B;  1SQX H;  1AR4 A;  1GTO A;  1PM9 A;  4NXN O;  1KMI Z;  1NVP D;  2HHH B;  1M56 B;  2DQ0 A;  4NXM O;  4HBN A;  3S3X A;  5EIB D;  4JZG A;  2M6Y A;  2ZE7 A;  2HFE C;  2ZCE A;  3J80 N;  4OX9 O;  4YJ2 B;  3W7X A;  4IHJ B;  2VQE O;  1R3L C;  4JI1 B;  4F6R A;  4FK5 C;  1Y76 B;  4DUZ B;  3WB0 A;  3AEI A;  2HP8 A;  5B5E Z;  3U0Z A;  5IY5 C;  5L3B A;  1HR0 B;  3FYI B;  2ZIO A;  2LQT A;  1M9N A;  4JI6 B;  3K5N A;  5IJ0 B;  4J42 A;  3IC9 A;  3R66 A;  1MSD A;  2UUB O;  2XAJ A;  1S76 D;  1SRY A;  3QO5 A;  4JYA B;  4WCE V;  3ZN1 A;  5JQG A;  1K8A W;  3ZHQ A;  1SA0 A;  4JAA A;  4X1I A;  2ZXW B;  3FAV A;  2K9P A;  4PDL A;  1S5H C;  1ZTE A;  2IW5 A;  4QPJ A;  2LW1 A;  3ETG A;  4P2Z A;  4I0X A;  3T1C A;  4QIW F;  4NYK A;  3LSQ A;  1HNZ O;  3BAB A;  4N23 A;  1XMO B;  2B5U A;  3WB2 A;  1K5S A;  2WA3 A;  1HDJ A;  4LC1 A;  2OCC B;  4R7C A;  3HKE A;  4ASU G;  1V54 C;  4DV6 O;  3I5D A;  2YIB A;  3H1K H;  2KB1 A;  3RT3 C;  1DF5 A;  1XL4 A;  3OR7 C;  3F5W C;  2PYJ A;  3AG3 C;  1QR8 A;  2P7T C;  3E35 A;  3SJA C;  3TK1 A;  3ZRV A;  5HFL A;  3OUS A;  3SYQ A;  3JD1 A;  1K9M W;  3SGI A;  4PHZ A;  4MTG A;  4XBF A;  1XNR B;  5DM6 V;  4U7O A;  4ZBM A;  5C8Y A;  4P9O A;  1PD3 A;  4WFF A;  5J9P C;  4UCT A;  5LGU A;  1V55 C;  4DV4 O;  1BHB A;  2Y69 C;  2WLL B;  2Y4U A;  4DV3 O;  4CH3 A;  4FZ0 A;  4KHP B;  3ABM C;  4DV4 B;  5EBL C;  2FKX A;  1ROP A;  3IFX A;  1Z2G A;  3FX7 A;  3K79 A;  1IBL O;  1O9G A;  1GMG A;  1WA8 B;  4HAM A;  4DR2 O;  3ZHU A;  1AVM A;  2Q8V A;  3VBB A;  4X66 O;  3K08 A;  3RYI B;  2UU9 B;  1PPJ H;  4UV8 A;  4IL6 Z;  1IDS A;  4DRX A;  4AIL C;  1B06 A;  1KQS U;  1GK9 A;  3UT5 B;  4MVU A;  3TGU H;  3WG7 C;  1YF2 A;  5ITZ A;  5E1A C;  4RUF A;  2IH3 C;  1AP6 A;  1JMK C;  4EKW A;  2P4V A;  2ZKO A;  5H2F Z;  3CCS V;  3B09 A;  1PNK A;  4JAU A;  1OCZ B;  2XAG A;  2YIC A;  4DR7 O;  3KCY A;  5LHI A;  2DYS C;  3ZBH A;  2XAH A;  2HJD A;  4JYC A;  3JAR A;  3ASO C;  2QWO B;  4DR4 O;  4N21 A;  5L3G A;  4ZHQ B;  3CMA V;  5A2Q N;  4O4L A;  3JAS B;  3OW2 U;  2YI8 A;  4ZOL A;  5KX5 B;  4X66 B;  1Q5O A;  2N74 A;  3JD2 A;  5IY5 B;  4DR2 B;  4H33 A;  2CH7 B;  4X1Y A;  3ASO B;  4X62 O;  3OEH G;  3IGA C;  1Q6I A;  1ZLZ A;  3OM3 B;  4WF9 V;  1OHH G;  1R3I C;  1VQ5 V;  1HNZ B;  5JWP A;  5EZY A;  1IVS A;  4JI8 O;  3FKS G;  4O4I B;  3RN4 A;  4O4I A;  4TWK A;  2F4V B;  1Q86 W;  1FXV A;  5EBW C;  2UXC B;  4YY3 B;  2UXN A;  1JCH A;  3JYC A;  4JI1 O;  2Q69 A;  1XDC A;  4AI8 A;  1DLB A;  1Z5W A;  2EIJ C;  1N36 O;  2ZIM A;  1OZ0 A;  4JAV A;  2QE7 G;  3R65 A;  1RPO A;  4LFA B;  1OCC C;  4X89 A;  1BL8 A;  2YS8 A;  2WPD G;  3B77 A;  3HKD B;  5GON B;  4J9Z B;  2OIE A;  4DV2 O;  1SKV A;  4DV6 B;  2KQX A;  2IU3 A;  2RDC A;  2JGD A;  3HR0 A;  3UKM A;  1S77 D;  2B9Z A;  3CCR V;  1Y6X A;  4YY3 O;  3ML0 A;  4RQE A;  2EIL C;  1VQO V;  1VQ8 V;  4FLZ A;  1L0L H;  2F95 B;  5EYP A;  2DYS B;  3OEE G;  4TV8 B;  2IJJ A;  3HKB B;  1MZF A;  3H1I H;  1Y66 A;  1VQP V;  4PA6 A;  2BOB C;  1XL6 A;  3JCZ A;  1VQ6 V;  2QJ1 A;  4CZZ A;  1PL0 A;  4GKJ B;  1DGS A;  2A79 B;  5ITZ B;  4B7K A;  3P3N A;  4WBN A;  4JI6 O;  5CBF A;  3OFN G;  3BAA A;  4FFB A;  2DMX A;  4IT5 A;  2ADP A;  5IYD O;  2KG7 A;  2PYL A;  1D2D A;  5KHI A;  1SZT A;  1YCI A;  1GN4 A;  1QCE A;  1NVP B;  4NB5 A;  4DXW A;  3K04 A;  1URF A;  4JI4 O;  4FLY A;  5B1O A;  1KKD A;  5FL7 G;  4K8Z A;  1VAR A;  2EX3 A;  2LGQ A;  4MTF A;  1NS1 A;  1MSW D;  1M57 C;  3M8A A;  4DV2 B;  4DR1 B;  5LXT B;  2UUC O;  2Q0O C;  2UUB B;  1Y67 A;  2A3Q A;  4X1K A;  2YSU B;  4PA9 A;  1IBK O;  5LXT A;  3ZIA G;  2Q68 A;  5GTI Z;  1THZ A;  4PJ0 Z;  3ZMU A;  1IXM A;  2YC0 A;  3F7Y C;  3SJC C;  5FNV B;  3A0H Z;  3AG3 B;  5LMU O;  4JTD B;  3SPC A;  1T5E A;  5BZB A;  1MNG A;  1BMF G;  3MHS C;  2HHH O;  3DSQ A;  2R70 A;  1N0N A;  5KUK A;  1RM1 B;  1KBH A;  4DR7 B;  4LFC O;  3HKE B;  1JA8 A;  3EHB B;  4LF7 B;  5HFM A;  3HKC B;  3RYH A;  3LNN A;  4IYH A;  5JJN B;  1NQT A;  4K8X A;  4CH4 A;  3K03 A;  2YDE A;  3JAK B;  1XNR O;  5IYB O;  1KP2 A;  1Y4M A;  3RGB A;  4OPA A;  3MD0 A;  1SQQ H;  3K06 A;  3FYE B;  4FLX A;  1NT2 B;  1K3E A;  5GW7 A;  3FFQ A;  1SET A;  3L73 H;  2UXD O;  4YXW G;  1H2G A;  3P32 A;  1R6T A;  1XHX A;  1BSM A;  3ZMV A;  4QJF B;  2NLJ C;  2A06 H;  1ZSP A;  4IGG A;  2CTW A;  3JD0 A;  4LBE C;  4LF5 B;  4RUE A;  1IUR A;  3JD4 A;  3H1J H;  4B3S O;  1NBM G;  3RYH B;  4X9Q A;  2QGN A;  3QO8 A;  3ZJZ A;  4D7T A;  3G4S V;  4JI7 O;  3N2K B;  5JH7 B;  3CE2 A;  3Q4H A;  3APQ A;  3AG4 C;  1RSO B;  4GZR B;  1BE3 H;  1N32 O;  4DV3 B;  3IJ4 A;  3FB7 C;  2M7W A;  2AGA A;  2FL4 A;  1JFF B;  4CH6 A;  1GH6 A;  1R3J C;  4J41 A;  1G6U A;  4NTX A;  1QVG U;  2DJV A;  4X64 B;  4CS3 A;  1HWY A;  2ZR2 A;  4O2A B;  4BIU A;  2EJR A;  1X4T A;  3A8T A;  5LHG A;  2JDI G;  2YXH A;  3X2Q B;  1M90 W;  4K3A A;  2N05 A;  4KL1 A;  1Q7Y W;  1SC5 B;  3CX5 F;  1H2L A;  3APO A;  1K92 A;  3LSU A;  4TQF A;  2JJ2 G;  5IYZ B;  3OTO B;  1P7G A;  2ZM6 O;  2L6L A;  1MG1 A;  4PA7 A;  3DXR A;  1GN6 A;  1D5A A;  3OUF A;  1CP9 A;  1F4M A;  1SQG A;  3A0B Z;  1VEW A;  5D5Q A;  4UFZ A;  1AJQ A;  1OCO B;  3L72 H;  1YSC A;  3BRC A;  1ZX3 A;  4FFB B;  3UT5 A;  2IU0 A;  4AQY B;  1M5I A;  2IJK A;  4GYC B;  5IJ9 B;  3JAM N;  4JI2 O;  3AG2 B;  3OMA B;  1N0J A;  4JI0 O;  3S3W A;  1BZK A;  4OX9 B;  3Q4H B;  3E8G A;  1R1B A;  2Q9L A;  5KHK A;  1HNX O;  2EBO A;  2WLI B;  4I4T B;  2F93 B;  2P6J A;  1EZV H;  3G6B A;  2F66 C;  4MVZ A;  3TXQ A;  5FPO A;  4TV9 B;  3ZRS A;  1ZWI C;  1XMQ B;  1VIB A;  3CCE V;  5IYZ A;  1HNW B;  2FTK A;  1HNX B;  5LP6 A;  4XDJ A;  2XOK G;  4DV7 O;  4Q6G A;  2D3O W;  1L1F A;  2EIK C;  4X20 B;  4LF4 B;  2D2C B;  4OXS A;  1N34 B;  1XNQ O;  1YVW A;  3LUT B;  5CA1 A;  2O57 A;  4ICG A;  2E3C A;  3OGI B;  5LHH A;  5CA1 B;  4KXR A;  2WLK A;  3AK2 A;  4LR3 A;  4MTX A;  3CRM A;  5AG2 A;  4BIO A;  4BAY A;  2E5L O;  2FB5 A;  2QTS A;  1Y76 A;  3D3I A;  4X88 A;  3C3T A;  2QKS A;  3B8N A;  1B6Q A;  4YJ2 A;  2AXT Z;  1JR9 A;  1OCO C;  3D3Q A;  3LDE A;  1WP8 A;  5LOV A;  3GWO A;  3NR7 A;  4MW8 A;  2UU9 O;  1U96 A;  3ZHS A;  1QVF U;  4F4L A;  2X6C A;  4LF4 O;  3QF7 A;  4K0K B;  4FLU A;  3H01 A;  2BCC H;  2Q67 A;  5EIB C;  3VQV A;  1GO3 F;  4XDK A;  5CA0 A;  1YJW V;  4BIZ A;  2PTM A;  4JI5 B;  5BR8 O;  2UXB B;  1UPG A;  4DYL A;  1XQ8 A;  5EC1 C;  3OAA G;  5JQG B;  4FLV A;  3ABL B;  4FPP A;  1JJO A;  2GBO A;  1O9H A;  4MT8 A;  3O65 A;  4DR3 B;  2CK3 G;  1NZ6 A;  4WFB V;  2GV9 A;  4GX2 A;  5LYJ A;  2QM8 A;  4YIP A;  4QGP A;  3HPL C;  2JK5 C;  3UM7 A;  5DN6 G;  4B3M O;  3BPZ A;  4JI3 B;  1K97 A;  3K5L A;  4AHC A;  2GDS A;  2QM4 A;  3JAW A;  3HKD A;  5GON A;  2YEV B;  4J7J A;  4H0L B;  1QLN A;  1HR0 O;  1ENV A;  1OV9 A;  4O4H B;  4X62 B;  4CS4 A;  4I7Z B;  3K58 A;  3CME V;  4MSW C;  2WA4 A;  2E76 B;  1SS3 A;  3FAV B;  2ATK C;  4DUY O;  2QKA A;  3E83 A;  4YJ3 B;  2PI4 A;  1SA0 B;  2FML A;  1LUV A;  4CBC A;  3H1H H;  1N34 O;  2LP7 A;  1E1Q G;  4LP8 A;  1XRE A;  1GM7 A;  4B3T B;  3CD6 V;  2XAQ A;  2QWN B;  4O4J A;  3E89 A;  5H6Q A;  2Y69 B;  1SQP H;  4MVM A;  3RVZ A;  4WFH A;  4IIJ B;  3LDD A;  1EN5 A;  5IDJ A;  3ZX6 A;  3NXS A;  2WLM A;  4FLW A;  1RP3 B;  4B3T O;  4UVC A;  2HVJ C;  5LA6 A;  2A7W A;  2Y4T A;  2PGG A;  3J7A U;  4GLX A;  2WLJ A;  5E79 Z;  5LA6 B;  4DUZ O;  4GKK B;  4B3R B;  3B8M A;  4GX1 A;  4JI7 B;  2GTS A;  2JS5 A;  4I50 A;  1H2N A;  1NTK H;  3ABU A;  2ILM A;  1J95 A;  4TQD A;  4NXM B;  1TA8 A;  1K73 W;  3K0G A;  3OR6 C;  2G38 A;  3K3W A;  3CP1 A;  2QSA A;  1P4R A;  2VQF B;  2OIG A;  1U97 A;  1GKF A;  2LFR A;  1P49 A;  1VQN V;  2ZIN A;  3QTC A;  4A5U B;  4JI0 B;  2DYR C;  3OGC C;  1V55 B;  1WB8 A;  1I94 B;  2X6A A;  4B3R O;  5EYP B;  4BR6 A;  5CMU A;  3BA8 A;  1SF9 A;  4GCZ A;  4P30 A;  3ZMS A;  3RYC A;  2XAF A;  2EIM B;  2ZR3 A;  1IXB A;  4L87 A;  2GTA A;  1NTZ H;  1AR5 A;  1M93 A;  1FFT B;  4ABM A;  5BMV A;  2YEV A;  2QTO A;  3T1Y B;  3JAL B;  2ODM A;  3JD3 A;  1VQM V;  4NVP A;  1NJI W;  1KYO F;  2YID A;  2YXY A;  1AJN A;  3G6E V;  1S72 V;  1R3K C;  2R9I A;  1Q8I A;  5KMG A;  3ZHR A;  1AI6 A;  3CEI A;  4PI0 A;  4FFK A;  1TUE B;  1D5N A;  1OCC B;  1L8D A;  1TUB B;  4FLT A;  4LWS A;  4JI5 O;  4EB6 A;  5KLV H;  1WJZ A;  2QWQ B;  4Z2W A;  3C3S A;  1YEW A;  4GX5 A;  1SER A;  3AK1 A;  4K0K O;  4I0X B;  2N04 A;  4ZIB A;  2P90 A;  3ZRW A;  1US6 A;  5IT9 N;  1R6K A;  2LGW A;  1QU7 A;  2QKC A;  3T4Z A;  1A32 A;  5FNV A;  3JSL A;  4PA3 A;  4I9W A;  3J81 N;  3E2E A;  4G28 B;  4FVM A;  2OYQ A;  5BR8 B;  1G4Y B;  2DOS A;  2X0L A;  2V4D A;  4JTA B;  1EBO A;  4MVO A;  2PY5 A;  1FYJ A;  5LGT A;  1MA1 A;  3W7S A;  3ZHV A;  4X20 A;  2IJH A;  4LH7 A;  4FJC C;  1FS0 G;  3F7V C;  2RNB A;  4UV9 A;  4QE7 A;  5DED A;  3AK3 A;  3CRQ A;  4X8A A;  3WG7 B;  5LP6 B;  2ZNJ A;  2QA4 V;  4H13 B;  2GUZ A;  3PJS K;  1JX9 A;  2EIN C;  5JJJ B;  4UXN A;  1NR7 A;  3QVN A;  1JJ2 U;  2PF4 E;  1TGO A;  4E4E A;  1TVK B;  1QBZ A;  1AI5 A;  5B1A B;  3HB3 B;  4JGS A;  2EIN B;  1COW G;  2A9H A;  3E22 A;  1AIL A;  3CCL V;  4HYO A;  1NH2 D;  2XTA A;  2BE3 A;  2H8P C;  4B3S B;  3U10 A;  1N33 B;  4IHJ A;  3RW0 A;  3SJB C;  4DK1 A;  3CCJ V;  3W7W A;  1OCR C;  4JTC B;  3ICX A;  4B3M B;  4PDV A;  1K34 A;  5TIS Z;  1YIT V;  2ZE5 A;  4TV9 A;  2VS0 A;  1H38 A;  4CC5 A;  3M7M X;  1SZX A;  2ZD9 A;  4TUY B;  4J11 A;  1Z5V A;  4O2A A;  1S3J A;  1Q3E A;  4X1I B;  2JJ1 G;  1VF6 A;  4MVR A;  5H6R A;  2CTR A;  4UCV A;  3DC5 A;  4DV1 B;  5B3S C;  4NTW A;  2IM9 A;  3N2G A;  4TV8 A;  3EFF K;  1ARO P;  3THO A;  2OT5 A;  1S5L Z;  3DC6 A;  2Q7H A;  1GM9 A;  2ZM6 B;  5LL6 Y;  3AG7 A;  5KMG B;  1GN3 A;  1B04 A;  1J5E B;  3W7T A;  3W7U A;  4UCS A;  5L3C A;  1L0N H;  1VF6 C;  2JRI A;  3CCM V;  3P3P A;  5A9G A;  1Q43 A;  3JAL A;  2ADQ B;  3RBZ A;  5IE9 A;  3D36 C;  5EBM C;  3K0D A;  2BSK A;  5C8Y B;  3UO2 A;  2RJZ A;  3FB8 C;  1NH2 B;  1KEC A;  5J2T A;  4LFC B;  1PV0 A;  1RFY A;  2YIB D;  2RQ6 A;  2CUG A;  1H2S B;  4U3J A;  3L75 H;  4PD4 F;  4F6E A;  5CB4 A;  1R73 A;  1QNM A;  1OCZ C;  2DN9 A;  1NI8 A;  1SQV H;  5C93 A;  5CA3 A;  3CPW U;  2RCV A;  1DTO A;  4JI2 B;  2V1D A;  4BW5 A;  2WWW A;  4DK0 A;  3U11 A;  4UCU A;  5KHH A;  2JEX A;  2W6J G;  2R9R B;  4PDR A;  3UO3 A;  4I55 B;  3HKC A;  2QWR B;  1M1K W;  1EN4 A;  3JAW B;  5BMV B;  5KUM A;  3AG1 B;  1YIJ V;  4GKJ O;  2PI5 A;  4OPH A;  2BSK B;  2GHY A;  3CCU V;  5K1P A;  4FZ1 A;  5H9C A;  4R50 A;  5B1B C;  4DV1 O;  1KKC A;  1WPX A;  3UQ8 A;  3JAS A;  2JIZ G;  2MK3 A;  4EFE A;  4JI4 B;  1FXK C;  5LMN O;  4U7N A;  2KSD A;  5LBQ A;  1VQL V;  3JAR B;  4DW1 A;  2ZQM A;  5J2U A;  1XNQ B;  1FFX A;  3RYF A;  1W0J G;  1BGY H;  2F1M A;  1HP8 A;  4O4J B;  2EZP A;  3K5O A;  3ETE A;  1VP7 A;  4UVA A;  3OT7 A;  2E5L B;  3K57 A;  4YJ3 A;  2P22 C;  4WFG A;  1WPB A;  2QR4 A;  2MW2 B;  3A2F A;  5GTH Z;  2OTL V;  4H44 B;  3CXH F;  3RWR D;  2QM7 A;  2XUM A;  1V9P A;  2GSM B;  5LMU B;  2QDO A;  1WLE A;  3KCX A;  4DO2 A;  1CXZ B;  3LSS A;  4NR1 A;  4ZI7 B;  4C7U A;  4JYY A;  1XBL A;  2AZ0 A;  1IBL B;  4B08 A;  2HKO A;  2LFS A;  4LF5 O;  3VQY A;  3ABK C;  5JCO C;  1NU1 H;  1IZ3 A;  3CXC U;  4FM2 A;  3K9S A;  1WB7 A;  1VQK V;  1XIL A;  3BCC H;  4J80 A;  1IBM O;  2E74 B;  1FFX B;  1JOY A;  2EIJ B;  5H5N A;  1XMO O;  4JAS A;  3KG2 A;  4CC6 A;  4QNH B;  1H8H G;  4W4L A;  4JI8 B;  2YIA A;  1KB9 F;  4LFB B;  2ZT9 B;  5JVD B;  1KD1 W;  4NXN B;  1E79 G;  4R8C A;  4WFE A;  1RM1 C;  4J10 A;  1M4U A;  4JYA O;  1BCC H;  3E86 A;  3ABK B;  1YXB A;  1YZB A;  1DF4 A;  1K5Q A;  4PI2 A;  4LFB O;  1H2K A;  1Q6U A;  3CC2 V;  5BY1 A;  1FJG O;  3E8H A;  4IYI A;  4DR4 B;  2ZNI A;  1SQF A;  3STL C;  3TXS A;  5JH7 A;  2Z5U A;  1LNQ A;  3T2M A;  1KU9 A;  2DWE C;  1I7F A;  1P84 F;  3A0R A;  1KP3 A;  3SDL A;  1N8R W;  3O9O A;  1BQ0 A;  1GAX A;  1R6N A;  1HNW O;  4O4H A;  2F23 A;  4LF8 O;  5IJ0 A;  3FB6 C;  3ZMZ A;  2A0L A;  4O4L B;  3B40 A;  1Q81 W;  3ZRX A;  2L35 A;  2UXD B;  2Q7G A;  3WFV A;  3I56 V;  3ASN C;  4P9P A;  4G27 B;  1F23 A;  4MVS A;  4IIJ A;  3H9V A;  2Q7E A;  3BEH A;  4GKK O;  1VF5 B;  3QO7 A;  2AHY A;  2P5O A;  1KC8 W;  1G8M A;  2X6B A;  5B1N A;  2EIM C;  3SPH A;  1YHQ V;  4J7K A;  5B3S B;  3P30 A;  1H8E G;  1F4N A;  4HNA A;  4JZ2 A;  1OJH A;  2UUA O;  1LUW A;  2YUA A;  2VRZ A;  3K59 A;  4L8J A;  1YJ9 V;  1RSO A;  3SJQ C;  4FM1 A;  1I5X A;  3CWB H;  2P4K A;  3X2Q C;  4ZOL B;  2HG5 C;  5KAI Z;  2ARH A;  5J2T B;  4UUJ C;  1Q90 D;  4ZHQ A;  3RVY A;  5CBH A;  1WN7 A;  4UCR A;  1Q6H A;  3SR2 C;  2W0X A;  3BA9 A;  3ZED A;  1P7B A;  1OCR B;  4JPR A;  1V54 B;  1XMQ O;  4LH6 A;  2OCC C;  3RYF B;  2Y0I A;  3K5M A;  4Z1M G;  5JCO A;  3VQW A;  2UUC B;  1K4D C;  2LO1 A;  4W4K A;  4FIP C;  1F7Y A;  5KA6 A;  1AB3 A;  3AG4 B;  4YHH B;  4J7Z A;  2AHZ A;  2YI9 A;  1SES A;  4TOI A;  3CHX A;  4OGQ B;  5B66 Z;  1Y74 B;  1GRJ A;  5DEC A;  1AI7 A;  2RN9 A;  4LCU C;  4GT1 A;  2KKW A;  4YHH O;  3LNM B;  4AQY O;  2Y0P A;  4NTY A;  4Q20 A;  1N4C A;  2PZS A;  4Z1V A;  1WAZ A;  2DQ3 A;  4UB6 Z;  2IJI A;  5K1X A;  4FM0 A;  3L74 H;  2B1G A;  1KUQ A;  5J2U B;  2WLL A;  4I9Q A;  1X59 A;  1IX9 A;  4H37 A;  2Q6A A;  2CDY A;  2OTJ V;  2BOC C;  1EZJ A;  2H94 A;  2WAM A;  4DV0 O;  2CTQ A;  2BTO A;  4DW0 A;  1EM1 A;  4E2L A;  4O2B B;  3ASN B;  3ABL C;  4RQF A;  3EXA A;  2VWK A;  4ZI7 A;  2W0F C;  3JCU Z;  3K9A A;  5KA5 A;  2DW4 A;  1FD9 A;  2AZ2 A;  4YIO A;  1W59 A;  2XND G;  5B1A C;  4LF6 O;  1NTM H;  3CCV V;  2DYR B;  1XOU A;  4EEQ A;  2VQF O;  1YJN V;  4LWS B;  2HVK C;  3L71 H;  1K4C C;  1DK1 A;  3CJH A;  1TAE A;  5CB4 B;  5CN0 A;  4KFM A;  4LNU B;  4BWA A;  3T4D A;  3SYP A;  2WSS G;  2CH7 A;  2Q5Z A;  1BT8 A;  4RWU A;  1MOF A;  3RFR A;  3SPI A;  3ZN0 A;  3ETQ A;  2WLN A;  3GVM A;  4UB8 Z;  3N2K A;  3BHP A;  4X1K B;  1FPO A;  3SYC A;  1FJG B;  4PDM A;  3MDS A;  4KP4 A;  5LMN B;  1PNL A;  3UCS C;  3VQX A;  2C2A A;  3DXR B;  1SQB H;  3WB1 A;  3ZRW B;  2ZE8 A;  4F6R B;  1FAF A;  1AJP A;  1XUQ A;  3BVO A;  3BY6 A;  3OMN B;  1UFI A;  1GM8 A;  4LF9 B;  4I4T A;  3N2G B;  1VQ4 V;  4BW9 A;  3E22 B;  4JF3 A;  5IWA O;  4JI3 O;  2CE4 A;  3TET A;  2KG7 B;  3C90 A;  2XAS A;  1TUB A;  2EIK B;  5LOV B;  3I55 V;  4D6T H;  1I5Y A;  3N27 A;  1JQ0 A;  3ZMT A;  3E8F A;  1FXK A;  3IAY A;  4X64 O;  2EIL B;  3M99 B;  3ABT A;  1J5E O;  4MW3 A;  3JSN A;  3OMI B;  1LR1 A;  5FPR A;  3SPG A;  2UUA B;  4DV5 B;  2E75 B;  4RAI A;  3HKB A;  1IBK B;  4TUY A;  4K35 A;  4DR6 O;  5BXZ A;  1N32 B;  5KHG A;  5JVD A;  3CS5 A;  2EUL A;  4QE9 A;  2NR5 A;  3AG2 C;  1N36 B;  4JYB A;  3F5T A;  2WLH A;  3CRC A;  4U3F H;  1I94 O;  1ORQ C;  2Z3Y A;  3IC7 A;  2CTP A;  4DR3 O;  3DGE A;  4UVB A;  2F4V O;  4DV7 B;  4EFB A;  3RYC B;  4MVQ A;  1ZL8 B;  5KAF Z;  3QNE A;  1W2B U;  2BTQ A;  2YXL A;  4XDL A;  4KHP O;  3TCU A;  3CB2 A;  1B3Q A;  4HNA B;  3ZS8 C;  3CC4 V;  1FXK B;  4DR1 O;  3CJH B;  2JEU A;  1N33 O;  3OTF A;  3D8C A;  3LDC A;  5EC2 C;  1S0V A;  1MAB G;  1PL4 A;  2ZDI A;  1QLE B;  3D36 A;  5B1B B;  2EJ7 A;  4CS2 A;  2ZXW C;  4DR5 O;  5D5P A;  1JPX A;  1PNM A;  3SPJ A;  4U3J B;  3KZI Z;  1PKX A;  4QPK A;  2R9A A;  1K7D A;  5KX5 A;  1QHT A;  1M57 B;  2K1E A;  2Q0A A;  2Y48 A;  2ZDI C;  4X1Y B;  4DV0 B;  1EN6 A;  4WBN B;  3G71 V;  1IBM B;  2ITD C;  4O2B A;  1WP7 A;  4PEL A;  1Y74 A;  4ZKI A;  3ZHT A;  2RMK B;  4PA4 A;  1W0K G;  3OTO O;  3EVK A;  2UXX A;  1YTF D;  5FLX N;  1BHA A;  5L3F A;  3AG1 C;  3BFR A;  1NKD A;  1E1R G;  2Q73 A;  3H1L H;  1M56 C;  2H3O A;  4TT3 G;  1AP5 A;  1TVK A;  3JAT A;  2PUS A;  3G80 A;  1GN2 A;  3JAK A;  3B2E E;  2LW7 A;  2CGO A;  1UJW B;  5CBG A;  1JFF A;  4RO2 A;  4MTO A;  2UXB O;  3KKY A;  2QWP B;  5CA0 B;  1CEZ A;  3TJT A;  2ZE6 A;  4MS2 A;  3SYO A;  4GUN A;  1S5J A;  3FB5 C;  3PN1 A;  1G1X B;  1XI1 A;  3DTU B;  3E8B A;  2JGU A;  4LF6 B;  2JS3 A;  2F43 G;  1WA8 A;  1BQZ A;  2VWJ A;  2P06 A;  4TSF G;  1YTF B;  2VQE B;  2QEX V;  4FMT A;  1CPY A;  2XT9 A;  1QLE C;  2X7R B;  2IBZ H;  1I08 A;  2OWO A;  1VF7 A;  4GX0 A;  3B4S A;  1VMG A;  3ETD A;  2B1I A;  2W6I G;  2JVD A;  3JAT B;  4X65 B;  5IYC O;  3L9D A;  4JV5 O;  3GB7 C;  5LGN A;  1ZL8 A; 
#chains in the Genus database with same CATH homology
 4PA9 A;  3JD3 A;  3ZIA G;  1Q81 W;  1VQM V;  2Q68 A;  1THZ A;  3ZRX A;  3ZMU A;  1NJI W;  1FXH A;  3WFV A;  3I56 V;  1IXM A;  3ASN C;  4P9P A;  4WFA V;  1AJN A;  5L3D A;  3G6E V;  3F7Y C;  1K33 A;  1S72 V;  4G27 B;  2NNU A;  4J9Y B;  5L3E A;  1R3K C;  1F23 A;  4MVS A;  2R9I A;  2HR3 A;  3CC7 V;  3AG3 B;  3BEH A;  1AI6 A;  4JTD B;  3SPC A;  3QO7 A;  1AR1 B;  2AHY A;  5BZB A;  3CCQ V;  1KC8 W;  1BMF G;  1G8M A;  2X6B A;  3MHS C;  1TUE B;  5B1N A;  2EIM C;  3SPH A;  1YHQ V;  1OCC B;  5B3S B;  3P30 A;  5KUK A;  1RM1 B;  1H8E G;  1F4N A;  1JVM A;  3EHB B;  3VOU A;  1YI2 V;  5HFM A;  1YJ9 V;  3SJQ C;  4GX5 A;  3MHH C;  1SER A;  1I5X A;  2IH1 C;  4I5S A;  1NQT A;  3X2Q C;  2HG5 C;  3K03 A;  4UUJ C;  2HJF C;  5IYB O;  1RPR A;  2P90 A;  1Q82 W;  1KP2 A;  1Y4M A;  3ZRW A;  4HZ3 A;  3ZCC A;  3RVY A;  1VQ9 V;  1EFR G;  1R6K A;  2HLD G;  3MD0 A;  3STZ C;  5CBH A;  4G2K A;  3T4Z A;  3K06 A;  3FYE B;  4PA3 A;  1K3E A;  4I9W A;  5GW7 A;  3E2E A;  4G28 B;  1P7B A;  2P67 A;  1OCR B;  1SET A;  1G4Y B;  1H2G A;  4JPR A;  4YXW G;  3P32 A;  2X0L A;  1V54 B;  4JTA B;  3OE7 G;  1EBO A;  1NR1 A;  2OCC C;  4MVO A;  3ZMV A;  4QJF B;  4Z1M G;  2NLJ C;  5LGT A;  3W7S A;  1VQ7 V;  1K4D C;  3JD0 A;  4LBE C;  4RUE A;  3SYA A;  4KUM A;  4FIP C;  5KA6 A;  3AG4 B;  3JD4 A;  2AHZ A;  1SES A;  1NBM G;  3ABM B;  2WLI A;  2ITC C;  3QO8 A;  2IJH A;  1F51 A;  3CYO A;  3ZJZ A;  3G4S V;  2EZO A;  4FJC C;  2DWD C;  1AI7 A;  4R6Z A;  1FS0 G;  3F7V C;  4LCU C;  4GT1 A;  3LNM B;  4UV9 A;  3AG4 C;  4QE7 A;  1QR9 A;  5EK0 A;  2V7Q G;  4X8A A;  3WG7 B;  2QA4 V;  1AI4 A;  4Q20 A;  3PJS K;  3FB7 C;  1JX9 A;  2EIN C;  2M7W A;  2DQ3 A;  1GTO A;  4UXN A;  2IJI A;  1NVP D;  1NR7 A;  1R3J C;  1JJ2 U;  1M56 B;  2DQ0 A;  1QVG U;  2B1G A;  1QBZ A;  1AI5 A;  5B1A B;  3HB3 B;  2HFE C;  4JGS A;  2WLL A;  2EIN B;  1COW G;  2A9H A;  1HWY A;  2ZR2 A;  3W7X A;  4BIU A;  1R3L C;  2EJR A;  3CCL V;  4HYO A;  5LHG A;  1NH2 D;  4FK5 C;  2JDI G;  2H8P C;  3AEI A;  3X2Q B;  1M90 W;  5IY5 C;  5L3B A;  1Q7Y W;  3FYI B;  4H37 A;  3RW0 A;  2Q6A A;  3CCJ V;  1K92 A;  2JJ2 G;  3W7W A;  1OCR C;  4JTC B;  2OTJ V;  1M9N A;  2BOC C;  1EZJ A;  1MG1 A;  4PA7 A;  2H94 A;  2WAM A;  2XAJ A;  3OUF A;  1CP9 A;  1F4M A;  1S76 D;  4PDV A;  1SRY A;  1K34 A;  3QO5 A;  4E2L A;  4WCE V;  3ZN1 A;  1YIT V;  3ASN B;  1AJQ A;  1OCO B;  3ABL C;  4RQF A;  1K8A W;  1YSC A;  2IU0 A;  1H38 A;  2W0F C;  3K9A A;  2IJK A;  5KA5 A;  2ZXW B;  2DW4 A;  2ZD9 A;  3AG2 B;  4PDL A;  1S5H C;  2IW5 A;  3OMA B;  4QPJ A;  1S3J A;  2XND G;  3ETG A;  4P2Z A;  3T1C A;  2JJ1 G;  4QIW F;  4MVR A;  5B1A C;  5H6R A;  3LSQ A;  3E8G A;  4N23 A;  3CCV V;  2B5U A;  2DYR B;  5B3S C;  1K5S A;  2EBO A;  2WLI B;  3EFF K;  4LC1 A;  1YJN V;  2OCC B;  2P6J A;  1ARO P;  4R7C A;  2HVK C;  2OT5 A;  1V54 C;  4MVZ A;  4ASU G;  1K4C C;  1GM9 A;  2KB1 A;  3ZRS A;  1ZWI C;  5CN0 A;  3CCE V;  1DF5 A;  2FTK A;  1XL4 A;  4KFM A;  3OR7 C;  3F5W C;  4XDJ A;  3AG3 C;  3T4D A;  2XOK G;  3SYP A;  1QR8 A;  2P7T C;  2WSS G;  3E35 A;  3TK1 A;  3ZRV A;  3W7T A;  3W7U A;  2D3O W;  5L3C A;  1L1F A;  2EIK C;  5HFL A;  3OUS A;  3SYQ A;  3CCM V;  3JD1 A;  1K9M W;  4OXS A;  4MTG A;  1MOF A;  3SPI A;  4XBF A;  3ZN0 A;  2WLN A;  5DM6 V;  3LUT B;  4U7O A;  4ZBM A;  3SYC A;  4P9O A;  4PDM A;  1PD3 A;  4KP4 A;  3RBZ A;  4WFF A;  1PNL A;  2C2A A;  5J9P C;  5EBM C;  3K0D A;  5LGU A;  3ZRW B;  5LHH A;  1V55 C;  1NH2 B;  1AJP A;  2WLK A;  3FB8 C;  1KEC A;  4MTX A;  2Y69 C;  1BHB A;  2WLL B;  4BAY A;  3BY6 A;  3OMN B;  1GM8 A;  3ABM C;  4X88 A;  3D3I A;  1VQ4 V;  2QKS A;  3B8N A;  5EBL C;  1ROP A;  3IFX A;  1B6Q A;  4JF3 A;  3K79 A;  3TET A;  1GMG A;  1OCO C;  4HAM A;  2XAS A;  3LDE A;  1R73 A;  2EIK B;  3GWO A;  3I55 V;  1OCZ C;  3VBB A;  1I5Y A;  4MW8 A;  1JQ0 A;  3ZMT A;  3E8F A;  5C93 A;  3K08 A;  1FXK A;  5CA3 A;  3CPW U;  1QVF U;  4F4L A;  1DTO A;  2EIL B;  3M99 B;  3ABT A;  2V1D A;  2X6C A;  4MW3 A;  2WWW A;  4UV8 A;  4BW5 A;  1KQS U;  3OMI B;  1GK9 A;  2JEX A;  2W6J G;  3H01 A;  2Q67 A;  3SPG A;  2R9R B;  4MVU A;  4PDR A;  3WG7 C;  1GO3 F;  4RUF A;  2IH3 C;  4RAI A;  5E1A C;  4XDK A;  4EKW A;  1M1K W;  5KUM A;  3AG1 B;  1YIJ V;  3CCS V;  1YJW V;  2PI5 A;  4BIZ A;  4JAU A;  1PNK A;  1OCZ B;  2GHY A;  3CCU V;  2XAG A;  5H9C A;  4R50 A;  5LHI A;  5B1B C;  2DYS C;  5EC1 C;  3OAA G;  3ABL B;  1WPX A;  4FPP A;  2XAH A;  4QE9 A;  3AG2 C;  4JYC A;  2JIZ G;  2MK3 A;  4JYB A;  2WLH A;  3ASO C;  1FXK C;  4MT8 A;  2CK3 G;  4N21 A;  1ORQ C;  5L3G A;  2Z3Y A;  3IC7 A;  4WFB V;  3CMA V;  4U7N A;  3DGE A;  5LBQ A;  4GX2 A;  1VQL V;  4UVB A;  3OW2 U;  2ZQM A;  2QM8 A;  3HPL C;  4MVQ A;  3JD2 A;  5IY5 B;  2JK5 C;  3QNE A;  3UM7 A;  1W0J G;  5DN6 G;  4H33 A;  1W2B U;  3ASO B;  3OEH G;  2EZP A;  4XDL A;  1K97 A;  3IGA C;  3ETE A;  3TCU A;  3OM3 B;  4WF9 V;  4UVA A;  3CC4 V;  2YEV B;  1FXK B;  1QLN A;  1OHH G;  2JEU A;  4WFG A;  3LDC A;  5EC2 C;  1S0V A;  1R3I C;  1ENV A;  1VQ5 V;  2OTL V;  1MAB G;  2ZDI A;  1QLE B;  3FKS G;  3D36 A;  5B1B B;  3CME V;  2ZXW C;  4TWK A;  2QM7 A;  1JPX A;  4MSW C;  1PNM A;  3SPJ A;  1Q86 W;  1FXV A;  5EBW C;  2GSM B;  1WLE A;  2ATK C;  1PKX A;  2UXN A;  1JCH A;  3JYC A;  3E83 A;  2Q69 A;  4QPK A;  4DO2 A;  3LSS A;  2PI4 A;  1K7D A;  1DLB A;  4CBC A;  2EIJ C;  1M57 B;  2K1E A;  2LP7 A;  1E1Q G;  4LP8 A;  1OZ0 A;  4JAV A;  1GM7 A;  2HKO A;  2QE7 G;  3R65 A;  2LFS A;  3CD6 V;  2XAQ A;  2Y48 A;  2ZDI C;  3E89 A;  5H6Q A;  1RPO A;  2Y69 B;  1OCC C;  3ABK C;  4MVM A;  3RVZ A;  3G71 V;  4WFH A;  4X89 A;  1BL8 A;  2ITD C;  4PEL A;  3LDD A;  2WPD G;  4ZKI A;  3B77 A;  4PA4 A;  5IDJ A;  1W0K G;  4J9Z B;  3NXS A;  3CXC U;  1VQK V;  2WLM A;  2UXX A;  1YTF D;  4UVC A;  2HVJ C;  2IU3 A;  1BHA A;  1JOY A;  3UKM A;  2EIJ B;  3AG1 C;  5L3F A;  1S77 D;  3CCR V;  4JAS A;  2WLJ A;  1NKD A;  1E1R G;  3ML0 A;  4RQE A;  2EIL C;  1VQO V;  1VQ8 V;  3KG2 A;  1M56 C;  4QNH B;  2DYS B;  4TT3 G;  3B8M A;  4GX1 A;  1H8H G;  3OEE G;  2IJJ A;  3ABU A;  1J95 A;  1UJW B;  5CBG A;  1KD1 W;  1E79 G;  1Y66 A;  4PA6 A;  2BOB C;  1VQP V;  3K0G A;  4R8C A;  1K73 W;  4RO2 A;  4WFE A;  1XL6 A;  3JCZ A;  1RM1 C;  1VQ6 V;  4MTO A;  3OR6 C;  3K3W A;  4CZZ A;  3CP1 A;  1PL0 A;  1CEZ A;  1P4R A;  2A79 B;  3E86 A;  4MS2 A;  3SYO A;  3FB5 C;  3ABK B;  1DF4 A;  5CBF A;  1K5Q A;  3DTU B;  3E8B A;  1GKF A;  3OFN G;  2LFR A;  3CC2 V;  2F43 G;  1VQN V;  5IYD O;  1SZT A;  2DYR C;  3OGC C;  4TSF G;  1YTF B;  1QCE A;  1V55 B;  3E8H A;  1NVP B;  2QEX V;  4DXW A;  2X6A A;  3K04 A;  4FMT A;  3STL C;  1CPY A;  5B1O A;  1QLE C;  2X7R B;  1KKD A;  5CMU A;  5FL7 G;  2Z5U A;  1LNQ A;  3T2M A;  4GCZ A;  4P30 A;  3ZMS A;  2XAF A;  4GX0 A;  4MTF A;  2DWE C;  2EIM B;  3ETD A;  2ZR3 A;  3A0R A;  1KP3 A;  4L87 A;  1N8R W;  1MSW D;  1M57 C;  2B1I A;  2W6I G;  5IYC O;  1R6N A;  1FFT B;  3GB7 C;  5LGN A;  3FB6 C;  2YEV A;  2QTO A;  3ZMZ A;  2YSU B;  2A0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...