3VOUA

The crystal structure of nak-navsulp chimera channel
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MLSFILTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTVEGLRPLDALYFSVVTLTTVGDGNFSPQTDFGKVFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKETDAYRLEVMEKLEAIEKKLAEHSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein, Voltage-gated sodium channel
publication title The C-terminal helical bundle of the tetrameric prokaryotic sodium channel accelerates the inactivation rate
pubmed doi rcsb
source organism Bacillus weihenstephanensis
total genus 54
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3vouA00
1P7BA 5BZBA 2DWEC 4PA7A 3TCUA 1R3IC 1M57C 3E8BA 5EC1C 4HYOA 3T4DA 4EKWA 1LNQA 1ZWIC 3E86A 4OXSA 3T4ZA 1K4CC 2IH1C 4PA4A 3SYOA 2A0LA 2HG5C 3SJQC 3FB6C 4WFEA 4MTOA 2WLNA 3ASNC 3WG7C 3SPHA 1R3LC 3JYCA 4WFGA 4WFHA 3OR7C 2X6AA 2BOCC 3ABLC 4GX1A 2A79B 3K04A 4J9YB 4H33A 2OCCC 4G28B 3SPIA 3UKMA 4JTCB 4LCUC 1OCCC 4P9OA 3BEHA 3ABMC 3RBZA 5IY5C 4MVZA 2R9RB 2EINC 2DWDC 3VOUA 3LDCA 2YEVA 2AHYA 1J95A 1OCRC 5EBLC 3SYPA 3T1CA 1R3KC 3EFFK 3FB5C 4QNHB 5CBHA 1V55C 3LUTB 4RUFA 4PA6A 4R50A 1G4YB 1XL6A 2H8PC 2WLIA 3IGAC 4GX2A 4P2ZA 4F4LA 3OUFA 2EIMC 4G27B 3ZRSA 2Q67A 3E8HA 2HFEC 3PJSK 4KFMA 2HVKC 3IFXA 3RW0A 3GB7C 4MSWC 5CBGA 3K06A 2ITDC 4R7CA 4X8AA 3OR6C 4ZBMA 4P30A 2ZXWC 4BW5A 3AG4C 2WLLA 2EILC 3R65A 2EIKC 4RO2A 2DYRC 3K0GA 2HVJC 1ORQC 4XDKA 3SYQA 5E1AC 3X2QC 3OUSA 2QTOA 5KUKA 1S5HC 2WLKA 4MVSA 1JVMA 4MVRA 3ASOC 4MVUA 3STLC 2Q6AA 5J9PC 4R6ZA 4XDLA 3AG2C 4JTDB 2P7TC 5B3SC 1OCOC 4QE9A 2ZD9A 4MTGA 2WLMA 3T2MA 2WLJA 3KG2A 4PDLA 4UUJC 3RVYA 3AG1C 4MTFA 1QLEC 2WLHA 4LBEC 5EBMC 3STZC 3E89A 3AG3C 3FB8C 4XDJA 2X6BA 2NLJC 3SPJA 5CBFA 3E8FA 4HZ3A 3E83A 4TWKA 2EIJC 4X89A 3E8GA 4R8CA 2Q68A 2WLIB 3FB7C 4MVOA 1KKDA 2JK5C 4MW3A 3ABKC 2ATKC 2QKSA 4LP8A 2W0FC 2X6CA 2Q69A 3K03A 3LNMB 1BL8A 3HPLC 3UM7A 4DXWA 4MW8A 4X88A 2DYSC 4PDVA 4JTAB 4WFFA 2K1EA 5EK0A 3ZJZA 3LDDA 2A9HA 4PDMA 4J9ZB 3SPCA 1OCZC 4PA9A 2WLLB 2ITCC 1K4DC 4GX5A 3K08A 4H37A 4RAIA 3F7YC 5B1BC 4PA3A 4MVMA 4RUEA 4QE7A 3OGCC 3RVZA 5B1AC 3SYAA 4PDRA 3LDEA 1M56C 3F5WC 3SYCA 3TETA 4CBCA 3K0DA 2IH3C 5EBWC 5KUMA 3F7VC 4MS2A 1V54C 3SPGA 1XL4A 5EC2C 4MVQA 2AHZA 2KB1A 4I9WA 2BOBC 4P9PA 2HJFC 4GX0A 1R3JC 2Y69C
chains in the Genus database with same CATH superfamily
2WA3A 4PA7A 3J80N 4HYOA 1N32B 1IURA 5L3DA 3CB2A 4NR1A 2HG5C 4H0LB 3SJQC 3FB6C 1YHQV 2WLNA 5KHHA 4WFGA 5A9GA 3WFVA 4GX1A 2A79B 3QO5A 2JGUA 3UKMA 3ETGA 4JV5O 2B1GA 4J7ZA 4MVZA 1XI1A 2CAZC 1ZLZA 2CGOA 1VQ5V 1JOYA 3SYPA 3ZRXA 1URFA 4W4KA 1L8DA 3BFRA 3JCUZ 2AW9A 4LFAO 1PD3A 5IYCO 2UUBB 4LFCB 3G6EV 4LF9O 5CBGA 2ZNJA 3ICXA 2UXBB 3ABUA 3TK1A 2YIAA 4J10A 2Q7EA 4X66B 1BMFG 1ORQC 3RYCA 3BA9A 1OZ0A 1B06A 2Y4TA 2Q6AA 4U3FH 1RM1B 4LFBB 4R6ZA 1K97A 3ZBHA 1H2KA 3JAMN 2F4VB 1HW7A 1QU7A 4UCSA 2CTWA 1QQCA 5CBFA 4J41A 1Q86W 3AK3A 3P30A 4YHHO 4RQFA 2V7QG 4MVOA 2B9ZA 1SQQH 3U10A 4LP8A 5KLVH 1D5NA 3HPLC 5HFMA 2HKOA 4X88A 2ARHA 4J7KA 1CPYA 3PN1A 4O2AA 3OTFA 1VQNV 2KSDA 2W6IG 4J9ZB 4FJCC 4PD4F 2OYQA 4D7SA 2LFSA 2EIKB 2VWJA 2DYRB 2L6LA 5B1AC 3P32A 2R9IA 4PDRA 1GKFA 5C8YB 1TA8A 1N34B 2Z0AA 1VQOV 1P7BA 4K3AA 1N8RW 3EVKA 5FNVA 5EC1C 4I0XB 1ZWIC 1S5LZ 3SYOA 1WPBA 3B8NA 2ZE5A 2CUGA 1DTOA 4WFHA 3OR7C 3IAYA 3DC6A 1MZEA 1HR0B 5H9CA 3ZRWB 1DF4A 4DUZO 3CRQA 5K1PA 1OCRC 4LH6A 2DE0X 2H8PC 3IGAC 4P2ZA 1FPOA 3PJSK 2BSKB 1KU9A 5LMNO 4FLTA 4JYCA 4R7CA 4X64O 1XEQA 1YJWV 4K8ZA 4RO2A 1SQFA 3QNEA 2WA4A 4LWSB 4DR6O 4ZIBA 4JAAA 3RYHA 4U3JB 4DV5B 4GKKO 5JJJB 4FM1A 3G6BA 3E89A 2QKCA 4Q20A 4GKJO 4X1KB 2EX3A 4YJ2A 1V55B 3HKEB 4R8CA 4CC6A 1YIJV 4O4HB 3ZHTA 2Q8VA 3MDSA 5J2TA 1IX9A 4F6RA 4TUYB 4DV0B 3ZX6A 3JAKA 3LDDA 2KG7B 5EIBD 2WLLB 3CRAA 3LDEA 5CA0A 1FYJA 4ZHQB 5BMVA 5KUMA 4K0KO 1Z5WA 1VF7A 2BOBC 3J7AU 1TUBA 2QWRB 5LGTA 2KQXA 1NJIW 2ZQMA 1AR5A 1AP5A 4OGQB 3FYEB 1EN6A 5D5PA 3FD9A 4J9YB 1BHAA 5LOVA 4P9OA 4O4LA 2CH7A 2JEXA 3O9OA 5CN0A 2ZE7A 5EBLC 1HNWB 1OCZB 5CBHA 2YI9A 2OTJV 3DC5A 4JYAO 4GX2A 2Q67A 1XUQA 1I94B 2UXXA 1DF5A 1VQKV 4CC5A 1M57B 2ZDIA 1L0NH 4L8JA 2L35A 2DYSB 2XAJA 4XDKA 5KMGA 3LSSA 4DR4O 4I4TB 3QO8A 3AK2A 4JI4B 2P6JA 4FVMA 2OCCB 2X7RB 2BTOA 4FPPA 5LMUB 3ZMVA 3KG2A 3I55V 1H8HG 3FKSG 3N2GB 5EYPB 4EFEA 2WWWA 2X6BA 2OWOA 1KMIZ 2EIJC 2LJ2A 4X1YB 3E8GA 5LHHA 2QWNB 1HNZB 1PPJH 4X9QA 1XQ8A 1KKDA 4JPRA 1VF6A 4B3TO 3ZEDA 3ZHRA 3QG5A 3APOA 4DXWA 2YIBD 4TQFA 3H1KH 1FKAO 4JAUA 2BTQA 5LA6A 1MMMA 4WFBV 1AJNA 2MK3A 3CX5F 4OX9O 2A9HA 4CS3A 2QA4V 3UO2A 1K4DC 3CEIA 2R70A 4MVMA 1XNQB 3NR7A 4FM0A 1COWG 3OM3B 1VEWA 3H1IH 4AILC 1K73W 5EBWC 4LNUB 5BZBA 1H2LA 1N33B 1ROPA 4NB5A 1ZUQA 3ZN1A 2OIEA 3WG7C 4XBFA 1N36B 3HB3B 4CH5A 2OCHA 4LCUC 4UB8Z 1U97A 5K1XA 4JI2O 4UCVA 2OTLV 4DR3B 2GUZA 2YS8A 2D3OW 1JMKC 2VQFB 1AI7A 4FLUA 1MSDA 1XL6A 5DN6G 1M1KW 5KHKA 1N4CA 2YICA 2HVKC 1SQGA 2ADQB 3GB7C 4JAVA 1HNXO 2RDCA 5F2VO 2ZR2A 2ODMA 4X62O 4UFZA 1NTMH 4TV9A 1GTOA 3CRCA 1SQPH 1Q43A 3G71V 4QIWF 3ML0A 4X20A 2P7TC 1OCOC 1QVGU 2ZD9A 3L71H 3K59A 2QGNA 4FZ0A 2GV9A 1SF9A 4XDJA 3JD1A 2FYUH 1F4MA 3ETQA 2R72A 1RSOA 1Q6UA 3CPWU 5KX5A 1E79G 2QKSA 2CGNA 1XMOB 3CCUV 2QDOA 3B8MA 5LYJA 2RCVA 2O57A 1FFXA 4NXMB 2F1MA 1IVSA 1FJGO 4DUZB 1GM9A 4IYHA 4H37A 3OAAG 1RPRA 2GDSA 3RVZA 3WB1A 2XAQA 1V54C 1KP3A 1UJWB 5L3GA 1K92A 4PA4A 1EN4A 4WFAV 5LMNB 3JATA 4WBNA 1Q6IA 2RJZA 5EZYA 3G67A 2P90A 4QGPA 2IM9A 2ZM6B 3JAWA 3ASNC 2XAGA 2UXDO 1R3LC 5L3CA 4JI0B 4CS4A 2E5LO 3NXSA 4GKKB 2W0XA 1SA0A 1K8AW 2ZCEA 4KXRA 3FB5C 2UUCO 4R50A 5B1AB 1FXKC 1TVKB 3JASA 5B1OA 3RYIA 3ZHQA 4G27B 2IJIA 1PV0A 1XBLA 1Q6HA 3BPZA 4I7ZB 1HDJA 3Q4HA 2BE3A 4ZBMA 2DOSA 1PL0A 4BIZA 3AG4C 5H6QA 3N2KA 2EILC 1YTFB 3SYQA 3FAVA 2JVDA 4NKGB 5J9PC 3OTOO 1BGYH 2ETNA 1Y4MA 2Q73A 4UXNA 1WN7A 4FMTA 5HFLA 1OCRB 4LF4B 4JYBA 1CXZB 1KB9F 3VQWA 4W4LA 1LR1A 3SGIA 1WP8A 2YXLA 4L87A 3AG7A 2XASA 3LNMB 3M8AA 3CC7V 1JR9A 2XT9A 1WB7A 3BCCH 4B3MO 2N74A 3DSQA 4DRXA 5KA6A 3RYCB 1VQMV 3F5WC 4I50B 3SYCA 1JA8A 2IH3C 3CHXA 1XL4A 4MVQA 4Z1MG 4I9WA 4LH7A 4FZ1A 5E79Z 1NI8A 4LF7B 1IBLO 4OXSA 4ZOLA 1P4RA 2Z3YA 4HNAA 1JFFB 3CCLV 2B1IA 4DK1A 4IGGA 3JYCA 3SJCC 2HHHO 4Z1VA 3HR0A 1G6UA 3JD3A 1OCCC 2VQEO 4JI6O 3CWBH 3DXRA 2ZNIA 3ZHVA 3ZMSA 5JQGA 2PF4E 4O2AB 3E2EA 3OEEG 1J95A 5LHIA 3K5NA 3BHPA 1PNMA 3AG3B 3WB2A 2F43G 4MSWC 4JI3B 1Q3EA 1MSWD 5IWAB 3F5TA 3OT7A 1M5IA 3ZMUA 5JCOC 4LF5B 3D36A 1GN4A 4GYCB 4FM2A 1WLEA 3STLC 3ASOC 1XDCA 1YITV 1XNRO 1RPOA 3T1YB 3HKBA 4DUYO 4PHZA 4B3SB 1BE3H 5BR8O 3HKDB 4FLYA 1FXHA 2UXNA 2V1DA 5CA1A 1G1XB 4BWAA 2JIZG 1SQVH 3IC9A 4DW1A 4JI7B 3K3WA 5GW7A 2DMXA 1M93A 3ETDA 2JK5C 4AHCA 2IU3A 3ABKC 1NBMG 3CJHA 4PI2A 4DR2O 4PV1B 1EBOA 4FLWA 3L75H 4U7OA 2QE7G 2YC0A 5EK0A 3D3QA 3ZMTA 1Q5OA 5B1BC 3K08A 3S3XA 2UXCO 4QE7A 3OGCC 5H6RA 3RT3C 2EJRA 5IJ9B 1SC5B 2UUAB 4QPJA 1QBZA 2JEUA 4YY3O 3SPGA 2IU0A 3A8TA 4AQYB 1AILA 1M9NA 3E8BA 1SQBH 3RGBA 4Q6GA 3IC7A 4X62B 4GZRB 4X1IB 4YJ2B 3K79A 4YJ3A 4I5SA 2X6AA 1I7FA 5J2UA 3L74H 1GAXA 3ZHUA 2PI5A 1IBMB 4H13B 3JAKB 5B66Z 4WCEV 5FL7G 2QKAA 3LDCA 3O65A 3TXSA 1ZAUA 1R3KC 5IYBO 4QNHB 5IYZB 2YIBA 1S0VA 1LUVA 1ENVA 1FD9A 2IJJA 3RN4A 3LSUA 2V4DA 1W0JG 2HFEC 4UCUA 3IFXA 1Y76B 4J11A 1YJNV 5DECA 1MZFA 4X8AA 5ITZA 4JI8B 4HAMA 4DR7O 4X65O 3MHHC 3W7XA 4UB6Z 3OMIB 4UVBA 5E1AC 5KUKA 1S5HC 3UT5B 3WG7B 4XDLA 2IJKA 4J7JA 4UUJC 1F7YA 1VQ8V 4I9QA 1WAZA 4LBEC 5AG2A 2XOKG 2C2AA 1W2BU 1KD1W 1D2DA 3QTCA 1KP2A 4DV6B 3JSLA 3CXHF 1NQTA 1FFTB 5LXTA 3KCXA 4NTXA 3ETEA 5KMGB 1XMQB 4JASA 1M56C 2UUCB 4IL6Z 2QEXV 4DV1O 4P9PA 5EBMC 1OCOB 2XAHA 1YSCA 2GSMB 4DV3B 3W7SA 1R3IC 4IHJA 3T4ZA 1K4CC 2IH1C 3ZCCA 3OMNB 4RQEA 5LBQA 2Q5ZA 3K04A 3I56V 1YEWA 1GK9A 1PNLA 2BTQB 1AP6A 1EFRG 2DWDC 2YEVA 2WAMA 4O2BB 4BIOA 2QWQB 5H2FZ 2A06H 1YTFD 5FLXN 1AI5A 1G4YB 2RQ6A 4F4LA 2EIMC 1V54B 3QVNA 4HBNA 4TOIA 2NNUA 3K5MA 1P7GA 1LUWA 4TQDA 2QJ1A 1GN2A 2RNBA 1BSMA 1SETA 1IXMA 3ASNB 3CCRV 1H2NA 1EZJA 4DV2B 3CS5A 4JI1O 1I5YA 1AJQA 1SS3A 3FB8C 3W7TA 2UU9O 4EB6A 3VQXA 2AGAA 2GUZB 2NN4A 4UCRA 1X59A 3E8FA 1S5JA 4TT3G 4DR1O 1AI4A 2A7WA 3E22A 1FXKB 1WB8A 2DN9A 4NXNO 3A2FA 3T1HB 4JI5O 1MOFA 4ZKIA 4BW9A 3B4SA 1ZSPA 3JALA 4DV7B 4UVAA 4BR6A 1N0JA 1WP7A 2Q0AA 4LWSA 1RM1C 3AG4B 1NKDA 4U3JA 2EILB 3F7YC 1IBKO 2XAFA 4DV4O 2JGDB 4WF9V 2XUMA 3F7VC 2Q4PA 4GX0A 2Y69C 4KHPO 4LF8O 4QPKA 3HKEA 5GONA 4O4HA 1ZL8A 4JV5B 1RSOB 4YXWG 1UFIA 4EFBA 1U96A 5KAIZ 4JF3A 3HKCA 5KX5B 3SPIA 1M90W 1N32O 5LGNA 5LYJB 4U7NA 2LW1A 2F93B 5LP6A 5IJ0A 3CCEV 1AI6A 3B09A 1QLNA 4LFAB 1S3JA 4ZHQA 1BHBA 1AR4A 4LF9B 4DO2A 1BQZA 2WLIA 2HR3A 3CCSV 5D5QA 5CMUA 3JATB 2Y0IA 1AB3A 5EZYB 2UUBO 4LFCO 4IIJB 4AI8A 3JAWB 3ZHSA 2UXBO 4ASUG 3G4SV 4X66O 4YHHB 4YY3B 1Q81W 3T2MA 2P06A 3JARB 4LFBO 3DTUB 3OW2U 3JD0A 1H8EG 2QM4A 3VBBA 2ZDIC 2F4VO 3JASB 4ICGA 2ZT9B 4LC1A 4MW8A 1Y6XA 3W7UA 2LQTA 1EN5A 4O4IA 1VQ9V 2ZIMA 3Q4HB 2EULA 4I4TA 1WNSA 3N2KB 2DQ0A 2YSUB 4PA3A 3UO3A 3FAVB 1BZKA 4B7KA 1NTKH 4KP4A 1P84F 1NS1A 1VF6C 2Q9LA 1K34A 2QM8A 2DWEC 4X1YA 2ADPA 1N34O 5IT9N 3E86A 1S72V 2PUSA 4X65B 2ZINA 2KKWA 1MABG 1KC8W 1EM1A 3ABKB 3SJAC 4DYLA 1E1RG 5LP6C 4OPAA 3IJ4A 4PJ0Z 1V9PA 2AZ2A 5JVDA 1XHZA 4LNUA 5B1BB 4RUFA 2HP8A 4ZI7B 1HR0O 4PELA 4X64B 2QWOB 3GWKC 3JSNA 1W0KG 4KFMA 3D8CA 2XNDG 2PGGA 3BA8A 1ZX3A 4DR6B 1QCEA 4FFBB 2ZXWC 2VWKA 5KA5A 4ZOLB 3K0GA 1PKXA 4TV8A 3OUSA 4NTYA 3K57A 1JVMA 2ZR3A 4YIOA 3RWRD 3C3TA 4GKJB 5JJEB 1A32A 1Y74B 4CH4A 1NVPB 4MTGA 3DXRB 1SKVA 1F51A 1R73A 2W6JG 1AROP 3AG1C 5JQGB 5CB4B 1CEZA 4LF6O 2LW7A 5BY1A 2Q0OC 1VARA 1QVFU 2IJHA 3TXQA 5L3BA 3K03A 2X6CA 2Q69A 4K8XA 4BIUA 3UM7A 2LP7A 4RWUA 3P3PA 2DYSC 4F6EA 4K0KB 4RAIA 2P5OA 2EBOA 5IE9A 1I0HA 4DV0O 4CBCA 5JH7A 1OHHG 5EC2C 1VIBA 1OJHA 3KKYA 3LUTB 2VRZA 1R1BA 2FTKA 3T4DA 4O4JA 3I5DA 5CA1B 4N23A 2A0LA 3OFNG 2RN9A 2E3CA 3B2EE 3ABLC 2BOCC 3CJHB 2QSAA 1XOUA 1VP7A 1VQLV 2R9AA 4GLXA 2ZE6A 2FMLA 4JYAB 2RMKB 5IY5C 1ZTEA 2R9RB 2EINC 1DLBA 1FS0G 1GM8A 4Z2WA 4UV9A 5KHJA 4DR1B 1M56B 3L72H 2XHBA 3OUFA 1HWYA 1AJPA 4DR4B 1WA8A 2F95B 3U0ZA 1SZXA 4BW5A 2XTAA 3H1HH 2HVJC 4UV8A 1K5QA 2QTOA 4YJ3B 5KHGA 1IBKB 4MVSA 1I94O 3C3SA 4GUNA 1PP9H 2IBZH 1I08A 5J2UB 2WLMA 2ZIOA 1M4UA 3RVYA 4I55A 3STZC 4MT8A 4B3TB 1WPXA 4LF8B 1TVKA 2NLJC 1KBHA 5LHGA 4HZ3A 1H38A 4TWKA 1YZBA 3SR2C 2GBOA 1NTZH 2NR5A 1SRYA 1K5SA 2Q68A 5FNVB 2ILMA 1Q90D 4OX9B 2EIMB 1Q82W 2W0FC 1PNKA 3VQYA 1GN6A 3L73H 1HNZO 4JTAB 4WFFA 4NYKA 5ITZB 5JJNB 4PDMA 1Q7YW 4PA9A 4GX5A 3W7WA 3SYAA 1YF2A 2JJ1G 3JD2A 1SESA 1GM7A 1DGSA 2HJFC 2HLDG 3D3IA 1XNQO 1TUEB 3FFQA 2PTMA 1LNQA 3TGUH 1J5EO 5JWPA 4JI2B 4MTOA 1VQ7V 3KZIZ 1N33O 3SPHA 1F4NA 1BCCH 3QO7A 4H33A 4G28B 2CK3G 4JTCB 1N0NA 5DM6V 1GMGA 1BT8A 3ABMC 2JS5A 3RYHB 1R6KA 5LXTB 1NT2B 1B3QA 1IZ3A 4I50A 1N36O 2MW2B 3L9DA 2LGWA 1NH2B 1HNXB 2QTSA 3E8HA 2EIJB 3RYFA 4DR3O 3RW0A 2Y69B 2VQFO 3SDLA 3CD6V 5J2TB 4B3RO 1JFFA 4IHJB 4F6RB 1VF5B 3B77A 2YXHA 4FLXA 3X2QC 1XHXA 3THOA 1SZTA 5CA0B 4EEQA 1JCHA 5BMVB 1QLEC 1YXBA 5EIBC 3MAQA 2Y0PA 1JX9A 1XREA 2YEVB 3E83A 3WU2Z 5LGUA 4C7UA 2PYJA 1TUBB 3D36C 1FJGB 2QWPB 1TGOA 2M6YA 5FPOA 1VQ6V 1K9MW 3M99B 2FL4A 2H94A 2P4KA 5LOVB 5IDJA 5B5EZ 1XMOO 4O4LB 2ITCC 2CH7B 5IYDO 1QR9A 4RUEA 1GH6A 4NXMO 4DR5O 4MS2A 4B08A 3HKDA 3ZN0A 3C90A 2UXDB 1YJ9V 3QF7A 4EB6B 2E5LB 4FLVA 2E74B 1B6QA 1K7DA 1UPGA 3J81N 1RP3B 4WFEA 5H5NA 3E22B 4GCZA 2X0LA 2WSSG 4OPHA 2ZM6O 3SJBC 3JALB 5IJ9A 2AHYA 5DEDA 2H3OA 4JI0O 1YCIA 3T1CA 2AZ0A 4LF6B 3FYIB 1JJ2U 1XILA 3OEHG 1CP9A 1KKCA 1EZVH 3KCYA 1NVPD 3OTOB 4X1IA 5GONB 5LA6B 1ZL8B 2CE4A 1H2MA 1YI2V 2B5UA 2EZOA 2WLKA 5C8YA 2QM7A 4MVUA 2PYLA 4N21A 3HKCB 3AG2C 5B3SC 2OT5A 3CRRA 1F23A 1GRJA 5LP6B 5IJ0B 2WLJA 4PDLA 5IYZA 1Z2GA 2WLHA 1Y67A 1HP8A 3AG3C 4I0XA 3M7MX 3L70H 1S77D 3H01A 1IXBA 1Y76A 2Z5UA 2WLIB 4CH6A 1X4TA 4B3MB 3R66A 3G80A 2M7WA 5C93A 4LF4O 2D2CB 3ZRWA 3P3NA 3CMAV 3K9AA 3ZJZA 2FB5A 4B7EA 5BXZA 3UT5A 2ZXWB 3CXCU 2E76B 4KL1A 3S3WA 3TETA 3K0DA 1R6NA 1IBLB 5KHIA 2AHZA 2BSKA 2KB1A 5B1NA 3K58A 2DW4A 1NR7A 3AG1B 3E35A 2HHHB 1Y66A 4EKWA 3CSXA 4PI0A 2VQEB 4JI6B 5KAFZ 4ABMA 2P22C 3CP1A 3B40A 4FK5C 4GT1A 4QJFB 4TV9B 4LF7O 1JJOA 2GHYA 3RBZA 4O4IB 4X20B 4X1KA 3CMEV 1MG1A 3CC2V 1GN3A 4FIPC 2PI4A 2FKXA 4JGSA 4IYIA 1B04A 4TUYA 3H1LH 4DW0A 1XNRB 2LFRA 4DK0A 2KG7A 4P30A 1FFXB 2WLLA 2BCCH 4DUYB 2EIKC 2DYRC 3CRMA 1NU1H 1AVMA 4J80A 4JI3O 5BR8B 1MA1A 4MVRA 5IWAO 1TAEA 1K3EA 4JYYA 1QHTA 3WB0A 3ABLB 4JTDB 4CH3A 4LF5O 1VMGA 4O2BA 3A0RA 3ABTA 4MTFA 3CE2A 5IY5B 1I5XA 3DGEA 2EINB 4DR2B 3T1YO 5JVDB 4KUMA 5L3EA 1L1FA 4WBNB 1H2GA 1J5EB 4B3SO 3GVMA 4MW3A 3MHSC 1THZA 1VQ4V 3OGIB 2UXCB 3ZS8C 4JI7O 2YIDA 1W59A 3BAAA 5GTHZ 1OCCB 2CTQA 2N05A 2HEPA 1OV9A 1P49A 4TV8B 1O9GA 1SA0B 2IW5A 1R6TA 1IDSA 3K5OA 2F66C 3BABA 2JRIA 3RYIB 2N04A 1R3JC 2QR4A 2LO1A 3TCUA 1NR1A 3CC4V 2UUAO 3H9VA 1FXKA 4B3RB 1KECA 3EXAA 1NH2D 4AQYO 4CZZA 2OIGA 4MTXA 5FPRA 1KQSU 3ASOB 2JS3A 3ZMZA 3N2GA 2JGDA 5EYPA 4H44B 3VOUA 4BAYA 1JPXA 2PZSA 3EFFK 1V55C 4PA6A 2YUAA 2F23A 1PM9A 1KYOF 1IBMO 2E75B 4NTWA 5JH7B 4DR7B 4JZ2A 3BRCA 3OE7G 1JQ0A 2K9PA 4D6TH 3VQVA 3OR6C 3UCSC 1DK1A 4O4JB 1GO3F 3R65A 2CTPA 1AR1B 4DRXB 5TISZ 4JI8O 4DR5B 1O9HA 3A0HZ 4QE9A 4UCTA 2JDIG 3ABMB 3JCZA 1RFYA 1QNMA 2Q7HA 4X89A 2CDYA 4JZGA 1YVWA 3ZRVA 2ATKC 4HNAB 1BL8A 1S76D 1YDXA 3LSQA 4UCOA 1G8MA 1FXVA 2Q7GA 3TJTA 3U11A 4PDVA 5L3FA 4IT5A 2K1EA 4IIJA 1WA8B 4K35A 3H1JH 2ZKOA 4DV1B 1OCZC 1E1QG 2Y4UA 2WPDG 3CCQV 2GTSA 4DV6O 4CS2A 5CA3A 3ZIAG 5A2QN 3X2QB 2YXYA 4DV5O 3UQ8A 3OD4A 3APQA 3JARA 4UVCA 4G2KA 1WJZA 1Q8IA 3JD4A 1XMQO 4YIPA 2VS0A 4I55B 1QLEB 2YI8A 2YDEA 4NVPA 4TSFG 1D5AA 1M57C 2GTAA 1BS3A 4J42A 3BY6A 3N27A 2EZPA 2Y48A 3RFRA 4DV3O 1H2SB 3K9SA 2DJVA 2OCCC 1K33A 5JCOA 3BEHA 2AXTZ 4FFKA 2ZE8A 3EHBB 2LGQA 4E4EA 2G38A 3HKBB 2P67A 1T5EA 1SERA 3ZRSA 1QR8A 3FX7A 4LR3A 1VQPV 5GTIZ 3K06A 2JJ2G 2CTRA 2ITDC 4E2LA 3CCMV 2HJDA 2EJ7A 5LL6Y 4JI1B 1US6A 2UU9B 3CCVV 4A5UB 3CCJV 1MNGA 2A3QA 4FLZA 4ZI7A 1HNWO 4NXNB 3SPJA 2PY5A 4D7TA 1FAFA 4JI5B 4DV2O 1KUQA 3AK1A 3FB7C 3K5LA 3GWOA 1NZ6A 3RYFB 4FFBA 4DV4B 2P4VA 3LNNA 3MD0A 1PL4A 1BQ0A 3A0BZ 3SPCA 1L0LH 3CYOA 1Y74A 1Z5VA 3T1HO 4KHPB 3OMAB 4JI4O 4DV7O 1SQXH 3BVOA 5LMUO 3AG2B 5CB4A 5B3SB 2DQ3A 3AEIA
chains in the Genus database with same CATH topology
4WFAV 4PA7A 4QPKA 1YJ9V 4HYOA 2P90A 5L3DA 4YXWG 1B6QA 1K7DA 4PA4A 2HG5C 3SJQC 3FB6C 4WFEA 1YHQV 2WLNA 3ASNC 2X0LA 2XAGA 4GCZA 1R3LC 4JF3A 4WFGA 3WFVA 4GX1A 2WSSG 5L3CA 2A79B 3SPIA 3QO5A 3UKMA 1M90W 3ETGA 5LGNA 3NXSA 4U7NA 2B1GA 3CCEV 1AI6A 1QLNA 4MVZA 1S3JA 1K8AW 1VQ5V 1JOYA 2AHYA 3SYPA 3ZRXA 1BHBA 3T1CA 3FB5C 4R50A 3FYIB 5B1AB 1FXKC 5B1OA 4DO2A 2WLIA 1JJ2U 2HR3A 4G27B 3OEHG 1PD3A 5IYCO 2IJIA 1CP9A 3CCSV 3G6EV 1NVPD 5CMUA 5CBGA 3ABUA 3TK1A 4ZBMA 1PL0A 4BIZA 3AG4C 5H6QA 1BMFG 2EILC 1YTFB 1ORQC 3SYQA 1YI2V 1OZ0A 2B5UA 2EZOA 2WLKA 2QM7A 5J9PC 4MVUA 2Q6AA 4N21A 4ASUG 1RM1B 4R6ZA 3AG2C 5B3SC 1K97A 2OT5A 1Y4MA 3G4SV 1F23A 1Q81W 3T2MA 2WLJA 4PDLA 4UXNA 2WLHA 3AG3C 3DTUB 5CBFA 4FMTA 5HFLA 3OW2U 3JD0A 1H8EG 1OCRB 4JYBA 3VBBA 1Q86W 1S77D 3P30A 3H01A 4RQFA 2ZDIC 2V7QG 2Z5UA 2WLIB 4MVOA 4L87A 4LP8A 4LC1A 2XASA 3LNMB 2M7WA 3HPLC 4MW8A 5HFMA 2HKOA 5C93A 4X88A 3CC7V 3ZRWA 3W7UA 1CPYA 3CMAV 1VQ9V 3K9AA 3ZJZA 1VQNV 2W6IG 4J9ZB 4FJCC 2ZXWB 3CXCU 2DQ0A 2LFSA 2YSUB 5KA6A 2EIKB 4PA3A 2DYRB 1VQMV 5B1AC 3P32A 2R9IA 4PDRA 1GKFA 3F5WC 3SYCA 3TETA 3K0DA 1R6NA 2IH3C 1XL4A 4MVQA 4Z1MG 2AHZA 2KB1A 4I9WA 4KP4A 5B1NA 1VQOV 1P7BA 1K34A 2QM8A 2DW4A 1NR7A 2DWEC 3AG1B 1N8RW 3E35A 5EC1C 1Y66A 4EKWA 1ZWIC 4OXSA 3E86A 1S72V 1P4RA 2Z3YA 3SYOA 3B8NA 3CCLV 2B1IA 3CP1A 3JYCA 1MABG 1DTOA 4FK5C 4GT1A 4WFHA 3OR7C 1KC8W 4QJFB 3ABKB 3JD3A 1OCCC 1E1RG 2GHYA 5H9CA 3ZRWB 1DF4A 3RBZA 3ZMSA 3E2EA 3OEEG 1J95A 1OCRC 5LHIA 3CMEV 5B1BB 1MG1A 4RUFA 3CC2V 1PNMA 3AG3B 2H8PC 3IGAC 4P2ZA 4PELA 2F43G 4FIPC 1W0KG 3PJSK 2PI4A 4KFMA 2XNDG 4JGSA 4MSWC 1MSWD 4JYCA 2LFRA 1QCEA 4R7CA 4P30A 2ZXWC 3ZMUA 1YJWV 3D36A 2WLLA 5KA5A 4RO2A 2EIKC 2DYRC 3K0GA 1PKXA 3QNEA 3OUSA 1WLEA 4MVRA 1JVMA 2ZR3A 3ASOC 3STLC 1YITV 1RPOA 1K3EA 3ABLB 4JTDB 1NVPB 4MTGA 3A0RA 3ABTA 1F51A 1R73A 2W6JG 1AROP 3AG1C 4MTFA 5IY5B 1I5XA 3E89A 1FXHA 3DGEA 1CEZA 2EINB 2UXNA 4Q20A 2V1DA 1QVFU 4KUMA 5L3EA 1L1FA 1H2GA 2IJHA 1V55B 2JIZG 4R8CA 1YIJV 3K3WA 5GW7A 3ETDA 2JK5C 2IU3A 4MW3A 3ABKC 1NBMG 3MHSC 1THZA 3K03A 2X6CA 2Q69A 5L3BA 4BIUA 1EBOA 3UM7A 1VQ4V 2LP7A 4U7OA 2DYSC 2QE7G 5EK0A 3LDDA 3ZMTA 1OCCB 4RAIA 2WLLB 5B1BC 2EBOA 3K08A 4QE7A 3OGCC 5H6RA 3LDEA 2EJRA 2IW5A 4CBCA 4QPJA 5KUMA 1QBZA 1OHHG 2JEUA 3SPGA 5EC2C 2BOBC 2IU0A 1R3JC 3LUTB 3TCUA 1NR1A 1M9NA 2FTKA 3E8BA 3CC4V 3T4DA 1FXKA 1KECA 3IC7A 5LGTA 1NH2D 1NJIW 4N23A 2A0LA 3OFNG 3K79A 2ZQMA 4CZZA 4I5SA 3FYEB 4MTXA 2X6AA 2BOCC 3ABLC 4J9YB 1KQSU 1BHAA 1VQLV 2PI5A 3ASOB 4P9OA 3ZMZA 5IY5C 2JEXA 2EINC 2R9RB 1DLBA 5FL7G 3VOUA 4BAYA 3LDCA 5CN0A 4WCEV 1JPXA 1FS0G 1GM8A 5EBLC 1OCZB 1R3KC 3EFFK 4UV9A 5IYBO 4QNHB 1V55C 5CBHA 4PA6A 1S0VA 2OTJV 1ENVA 1M56B 4GX2A 2IJJA 3OUFA 2Q67A 1W0JG 2HFEC 3IFXA 1HWYA 3OE7G 1AJPA 1YJNV 1JQ0A 2UXXA 1DF5A 4X8AA 3OR6C 1VQKV 1M57B 2ZDIA 4HAMA 4BW5A 1GO3F 3MHHC 3R65A 3W7XA 2DYSB 2XAJA 2HVJC 4UV8A 4UVBA 1K5QA 3OMIB 4XDKA 5E1AC 3LSSA 1AR1B 2QTOA 5KUKA 1S5HC 4MVSA 3QO8A 3WG7B 2P6JA 4XDLA 2OCCB 2X7RB 4QE9A 4FPPA 3ZMVA 2JDIG 2IJKA 2WLMA 3KG2A 4UUJC 3RVYA 3ABMB 3I55V 1H8HG 1VQ8V 4LBEC 3STZC 3FKSG 3JCZA 4MT8A 1WPXA 2WWWA 2X6BA 2NLJC 5LHGA 4HZ3A 1H38A 4TWKA 2EIJC 1Q7YW 4X89A 3E8GA 5LHHA 1SRYA 1K5SA 2Q68A 3ZRVA 2XOKG 2C2AA 1W2BU 4JPRA 1KKDA 1KD1W 2ATKC 2EIMB 1KP2A 1Q82W 2W0FC 1PNKA 1BL8A 4DXWA 1S76D 3LSQA 4JAUA 1G8MA 1NQTA 1FXVA 1FFTB 4PDVA 4JTAB 5L3FA 4WFFA 2K1EA 4WFBV 1AJNA 2MK3A 2A9HA 4PDMA 2QA4V 1OCZC 1E1QG 4PA9A 2WPDG 1K4DC 4GX5A 3CCQV 3ETEA 5CA3A 3W7WA 3ZIAG 4MVMA 3SYAA 4JASA 3X2QB 1M56C 1COWG 2JJ1G 3OM3B 1K73W 5EBWC 3JD2A 1SESA 2QEXV 1GM7A 2XAHA 1OCOB 2HJFC 4G2KA 4P9PA 1YSCA 4UVCA 5EBMC 5BZBA 3JD4A 2HLDG 3D3IA 2GSMB 1TUEB 1ROPA 3W7SA 1QLEB 1R3IC 4TSFG 1M57C 1LNQA 3T4ZA 1K4CC 2IH1C 3BY6A 3ZCCA 2EZPA 2Y48A 3ZN1A 3OMNB 4MTOA 1VQ7V 3WG7C 4RQEA 3SPHA 5LBQA 1F4NA 4XBFA 3QO7A 3K04A 3HB3B 2OCCC 1K33A 2CK3G 4G28B 4H33A 4JTCB 3I56V 4LCUC 1GK9A 1PNLA 5DM6V 1GMGA 3BEHA 3ABMC 1R6KA 3EHBB 1EFRG 2DWDC 2OTLV 2YEVA 2WAMA 2D3OW 1NH2B 2P67A 1YTFD 1AI5A 1AI7A 1G4YB 1XL6A 5DN6G 1M1KW 1SERA 4F4LA 2EIMC 3ZRSA 3E8HA 2EIJB 1V54B 2HVKC 3RW0A 3GB7C 4JAVA 1QR8A 1VQPV 2Y69B 3CD6V 3K06A 2JJ2G 3CCMV 2ITDC 4E2LA 2NNUA 2ZR2A 3B77A 1SETA 3X2QC 1GTOA 1IXMA 3ASNB 3CCRV 3CCVV 3G71V 3CCJV 4QIWF 3ML0A 2P7TC 1OCOC 1EZJA 1QVGU 1SZTA 2ZD9A 1JCHA 1I5YA 1AJQA 1QLEC 3FB8C 4XDJA 1JX9A 3JD1A 3W7TA 1F4MA 3SPJA 2YEVB 3E8FA 3E83A 3CPWU 5LGUA 4TT3G 1AI4A 1FXKB 3FB7C 3GWOA 1E79G 2QKSA 3CCUV 1VQ6V 3B8MA 1K9MW 1MOFA 4ZKIA 3M99B 4UVAA 3MD0A 2H94A 3SPCA 5IDJA 1GM9A 1RM1C 3AG4B 2ITCC 1NKDA 4H37A 5IYDO 1QR9A 2EILB 3F7YC 2XAFA 3CYOA 3OAAG 4RUEA 1RPRA 3RVZA 3OMAB 4WF9V 2XAQA 3F7VC 4MS2A 1V54C 1KP3A 3AG2B 3ZN0A 5B3SB 1UJWB 5L3GA 2DQ3A 1K92A 4GX0A 3AEIA 2Y69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7B A;  5BZB A;  2DWE C;  4PA7 A;  3TCU A;  1R3I C;  1M57 C;  3E8B A;  5EC1 C;  4HYO A;  3T4D A;  4EKW A;  1LNQ A;  1ZWI C;  3E86 A;  4OXS A;  3T4Z A;  1K4C C;  2IH1 C;  4PA4 A;  3SYO A;  2A0L A;  2HG5 C;  3SJQ C;  3FB6 C;  4WFE A;  4MTO A;  2WLN A;  3ASN C;  3WG7 C;  3SPH A;  1R3L C;  3JYC A;  4WFG A;  4WFH A;  3OR7 C;  2X6A A;  2BOC C;  3ABL C;  4GX1 A;  2A79 B;  3K04 A;  4J9Y B;  4H33 A;  2OCC C;  4G28 B;  3SPI A;  3UKM A;  4JTC B;  4LCU C;  1OCC C;  4P9O A;  3BEH A;  3ABM C;  3RBZ A;  5IY5 C;  4MVZ A;  2R9R B;  2EIN C;  2DWD C;  3VOU A;  3LDC A;  2YEV A;  2AHY A;  1J95 A;  1OCR C;  5EBL C;  3SYP A;  3T1C A;  1R3K C;  3EFF K;  3FB5 C;  4QNH B;  5CBH A;  1V55 C;  3LUT B;  4RUF A;  4PA6 A;  4R50 A;  1G4Y B;  1XL6 A;  2H8P C;  2WLI A;  3IGA C;  4GX2 A;  4P2Z A;  4F4L A;  3OUF A;  2EIM C;  4G27 B;  3ZRS A;  2Q67 A;  3E8H A;  2HFE C;  3PJS K;  4KFM A;  2HVK C;  3IFX A;  3RW0 A;  3GB7 C;  4MSW C;  5CBG A;  3K06 A;  2ITD C;  4R7C A;  4X8A A;  3OR6 C;  4ZBM A;  4P30 A;  2ZXW C;  4BW5 A;  3AG4 C;  2WLL A;  2EIL C;  3R65 A;  2EIK C;  4RO2 A;  2DYR C;  3K0G A;  2HVJ C;  1ORQ C;  4XDK A;  3SYQ A;  5E1A C;  3X2Q C;  3OUS A;  2QTO A;  5KUK A;  1S5H C;  2WLK A;  4MVS A;  1JVM A;  4MVR A;  3ASO C;  4MVU A;  3STL C;  2Q6A A;  5J9P C;  4R6Z A;  4XDL A;  3AG2 C;  4JTD B;  2P7T C;  5B3S C;  1OCO C;  4QE9 A;  2ZD9 A;  4MTG A;  2WLM A;  3T2M A;  2WLJ A;  3KG2 A;  4PDL A;  4UUJ C;  3RVY A;  3AG1 C;  4MTF A;  1QLE C;  2WLH A;  4LBE C;  5EBM C;  3STZ C;  3E89 A;  3AG3 C;  3FB8 C;  4XDJ A;  2X6B A;  2NLJ C;  3SPJ A;  5CBF A;  3E8F A;  4HZ3 A;  3E83 A;  4TWK A;  2EIJ C;  4X89 A;  3E8G A;  4R8C A;  2Q68 A;  2WLI B;  3FB7 C;  4MVO A;  1KKD A;  2JK5 C;  4MW3 A;  3ABK C;  2ATK C;  2QKS A;  4LP8 A;  2W0F C;  2X6C A;  2Q69 A;  3K03 A;  3LNM B;  1BL8 A;  3HPL C;  3UM7 A;  4DXW A;  4MW8 A;  4X88 A;  2DYS C;  4PDV A;  4JTA B;  4WFF A;  2K1E A;  5EK0 A;  3ZJZ A;  3LDD A;  2A9H A;  4PDM A;  4J9Z B;  3SPC A;  1OCZ C;  4PA9 A;  2WLL B;  2ITC C;  1K4D C;  4GX5 A;  3K08 A;  4H37 A;  4RAI A;  3F7Y C;  5B1B C;  4PA3 A;  4MVM A;  4RUE A;  4QE7 A;  3OGC C;  3RVZ A;  5B1A C;  3SYA A;  4PDR A;  3LDE A;  1M56 C;  3F5W C;  3SYC A;  3TET A;  4CBC A;  3K0D A;  2IH3 C;  5EBW C;  5KUM A;  3F7V C;  4MS2 A;  1V54 C;  3SPG A;  1XL4 A;  5EC2 C;  4MVQ A;  2AHZ A;  2KB1 A;  4I9W A;  2BOB C;  4P9P A;  2HJF C;  4GX0 A;  1R3J C;  2Y69 C; 
#chains in the Genus database with same CATH topology
 2WA3 A;  4PA7 A;  3J80 N;  4HYO A;  1N32 B;  1IUR A;  5L3D A;  3CB2 A;  4NR1 A;  2HG5 C;  4H0L B;  3SJQ C;  3FB6 C;  1YHQ V;  2WLN A;  5KHH A;  4WFG A;  5A9G A;  3WFV A;  4GX1 A;  2A79 B;  3QO5 A;  2JGU A;  3UKM A;  3ETG A;  4JV5 O;  2B1G A;  4J7Z A;  4MVZ A;  1XI1 A;  2CAZ C;  1ZLZ A;  2CGO A;  1VQ5 V;  1JOY A;  3SYP A;  3ZRX A;  1URF A;  4W4K A;  1L8D A;  3BFR A;  3JCU Z;  2AW9 A;  4LFA O;  1PD3 A;  5IYC O;  2UUB B;  4LFC B;  3G6E V;  4LF9 O;  5CBG A;  2ZNJ A;  3ICX A;  2UXB B;  3ABU A;  3TK1 A;  2YIA A;  4J10 A;  2Q7E A;  4X66 B;  1BMF G;  1ORQ C;  3RYC A;  3BA9 A;  1OZ0 A;  1B06 A;  2Y4T A;  2Q6A A;  4U3F H;  1RM1 B;  4LFB B;  4R6Z A;  1K97 A;  3ZBH A;  1H2K A;  3JAM N;  2F4V B;  1HW7 A;  1QU7 A;  4UCS A;  2CTW A;  1QQC A;  5CBF A;  4J41 A;  1Q86 W;  3AK3 A;  3P30 A;  4YHH O;  4RQF A;  2V7Q G;  4MVO A;  2B9Z A;  1SQQ H;  3U10 A;  4LP8 A;  5KLV H;  1D5N A;  3HPL C;  5HFM A;  2HKO A;  4X88 A;  2ARH A;  4J7K A;  1CPY A;  3PN1 A;  4O2A A;  3OTF A;  1VQN V;  2KSD A;  2W6I G;  4J9Z B;  4FJC C;  4PD4 F;  2OYQ A;  4D7S A;  2LFS A;  2EIK B;  2VWJ A;  2DYR B;  2L6L A;  5B1A C;  3P32 A;  2R9I A;  4PDR A;  1GKF A;  5C8Y B;  1TA8 A;  1N34 B;  2Z0A A;  1VQO V;  1P7B A;  4K3A A;  1N8R W;  3EVK A;  5FNV A;  5EC1 C;  4I0X B;  1ZWI C;  1S5L Z;  3SYO A;  1WPB A;  3B8N A;  2ZE5 A;  2CUG A;  1DTO A;  4WFH A;  3OR7 C;  3IAY A;  3DC6 A;  1MZE A;  1HR0 B;  5H9C A;  3ZRW B;  1DF4 A;  4DUZ O;  3CRQ A;  5K1P A;  1OCR C;  4LH6 A;  2DE0 X;  2H8P C;  3IGA C;  4P2Z A;  1FPO A;  3PJS K;  2BSK B;  1KU9 A;  5LMN O;  4FLT A;  4JYC A;  4R7C A;  4X64 O;  1XEQ A;  1YJW V;  4K8Z A;  4RO2 A;  1SQF A;  3QNE A;  2WA4 A;  4LWS B;  4DR6 O;  4ZIB A;  4JAA A;  3RYH A;  4U3J B;  4DV5 B;  4GKK O;  5JJJ B;  4FM1 A;  3G6B A;  3E89 A;  2QKC A;  4Q20 A;  4GKJ O;  4X1K B;  2EX3 A;  4YJ2 A;  1V55 B;  3HKE B;  4R8C A;  4CC6 A;  1YIJ V;  4O4H B;  3ZHT A;  2Q8V A;  3MDS A;  5J2T A;  1IX9 A;  4F6R A;  4TUY B;  4DV0 B;  3ZX6 A;  3JAK A;  3LDD A;  2KG7 B;  5EIB D;  2WLL B;  3CRA A;  3LDE A;  5CA0 A;  1FYJ A;  4ZHQ B;  5BMV A;  5KUM A;  4K0K O;  1Z5W A;  1VF7 A;  2BOB C;  3J7A U;  1TUB A;  2QWR B;  5LGT A;  2KQX A;  1NJI W;  2ZQM A;  1AR5 A;  1AP5 A;  4OGQ B;  3FYE B;  1EN6 A;  5D5P A;  3FD9 A;  4J9Y B;  1BHA A;  5LOV A;  4P9O A;  4O4L A;  2CH7 A;  2JEX A;  3O9O A;  5CN0 A;  2ZE7 A;  5EBL C;  1HNW B;  1OCZ B;  5CBH A;  2YI9 A;  2OTJ V;  3DC5 A;  4JYA O;  4GX2 A;  2Q67 A;  1XUQ A;  1I94 B;  2UXX A;  1DF5 A;  1VQK V;  4CC5 A;  1M57 B;  2ZDI A;  1L0N H;  4L8J A;  2L35 A;  2DYS B;  2XAJ A;  4XDK A;  5KMG A;  3LSS A;  4DR4 O;  4I4T B;  3QO8 A;  3AK2 A;  4JI4 B;  2P6J A;  4FVM A;  2OCC B;  2X7R B;  2BTO A;  4FPP A;  5LMU B;  3ZMV A;  3KG2 A;  3I55 V;  1H8H G;  3FKS G;  3N2G B;  5EYP B;  4EFE A;  2WWW A;  2X6B A;  2OWO A;  1KMI Z;  2EIJ C;  2LJ2 A;  4X1Y B;  3E8G A;  5LHH A;  2QWN B;  1HNZ B;  1PPJ H;  4X9Q A;  1XQ8 A;  1KKD A;  4JPR A;  1VF6 A;  4B3T O;  3ZED A;  3ZHR A;  3QG5 A;  3APO A;  4DXW A;  2YIB D;  4TQF A;  3H1K H;  1FKA O;  4JAU A;  2BTQ A;  5LA6 A;  1MMM A;  4WFB V;  1AJN A;  2MK3 A;  3CX5 F;  4OX9 O;  2A9H A;  4CS3 A;  2QA4 V;  3UO2 A;  1K4D C;  3CEI A;  2R70 A;  4MVM A;  1XNQ B;  3NR7 A;  4FM0 A;  1COW G;  3OM3 B;  1VEW A;  3H1I H;  4AIL C;  1K73 W;  5EBW C;  4LNU B;  5BZB A;  1H2L A;  1N33 B;  1ROP A;  4NB5 A;  1ZUQ A;  3ZN1 A;  2OIE A;  3WG7 C;  4XBF A;  1N36 B;  3HB3 B;  4CH5 A;  2OCH A;  4LCU C;  4UB8 Z;  1U97 A;  5K1X A;  4JI2 O;  4UCV A;  2OTL V;  4DR3 B;  2GUZ A;  2YS8 A;  2D3O W;  1JMK C;  2VQF B;  1AI7 A;  4FLU A;  1MSD A;  1XL6 A;  5DN6 G;  1M1K W;  5KHK A;  1N4C A;  2YIC A;  2HVK C;  1SQG A;  2ADQ B;  3GB7 C;  4JAV A;  1HNX O;  2RDC A;  5F2V O;  2ZR2 A;  2ODM A;  4X62 O;  4UFZ A;  1NTM H;  4TV9 A;  1GTO A;  3CRC A;  1SQP H;  1Q43 A;  3G71 V;  4QIW F;  3ML0 A;  4X20 A;  2P7T C;  1OCO C;  1QVG U;  2ZD9 A;  3L71 H;  3K59 A;  2QGN A;  4FZ0 A;  2GV9 A;  1SF9 A;  4XDJ A;  3JD1 A;  2FYU H;  1F4M A;  3ETQ A;  2R72 A;  1RSO A;  1Q6U A;  3CPW U;  5KX5 A;  1E79 G;  2QKS A;  2CGN A;  1XMO B;  3CCU V;  2QDO A;  3B8M A;  5LYJ A;  2RCV A;  2O57 A;  1FFX A;  4NXM B;  2F1M A;  1IVS A;  1FJG O;  4DUZ B;  1GM9 A;  4IYH A;  4H37 A;  3OAA G;  1RPR A;  2GDS A;  3RVZ A;  3WB1 A;  2XAQ A;  1V54 C;  1KP3 A;  1UJW B;  5L3G A;  1K92 A;  4PA4 A;  1EN4 A;  4WFA V;  5LMN B;  3JAT A;  4WBN A;  1Q6I A;  2RJZ A;  5EZY A;  3G67 A;  2P90 A;  4QGP A;  2IM9 A;  2ZM6 B;  3JAW A;  3ASN C;  2XAG A;  2UXD O;  1R3L C;  5L3C A;  4JI0 B;  4CS4 A;  2E5L O;  3NXS A;  4GKK B;  2W0X A;  1SA0 A;  1K8A W;  2ZCE A;  4KXR A;  3FB5 C;  2UUC O;  4R50 A;  5B1A B;  1FXK C;  1TVK B;  3JAS A;  5B1O A;  3RYI A;  3ZHQ A;  4G27 B;  2IJI A;  1PV0 A;  1XBL A;  1Q6H A;  3BPZ A;  4I7Z B;  1HDJ A;  3Q4H A;  2BE3 A;  4ZBM A;  2DOS A;  1PL0 A;  4BIZ A;  3AG4 C;  5H6Q A;  3N2K A;  2EIL C;  1YTF B;  3SYQ A;  3FAV A;  2JVD A;  4NKG B;  5J9P C;  3OTO O;  1BGY H;  2ETN A;  1Y4M A;  2Q73 A;  4UXN A;  1WN7 A;  4FMT A;  5HFL A;  1OCR B;  4LF4 B;  4JYB A;  1CXZ B;  1KB9 F;  3VQW A;  4W4L A;  1LR1 A;  3SGI A;  1WP8 A;  2YXL A;  4L87 A;  3AG7 A;  2XAS A;  3LNM B;  3M8A A;  3CC7 V;  1JR9 A;  2XT9 A;  1WB7 A;  3BCC H;  4B3M O;  2N74 A;  3DSQ A;  4DRX A;  5KA6 A;  3RYC B;  1VQM V;  3F5W C;  4I50 B;  3SYC A;  1JA8 A;  2IH3 C;  3CHX A;  1XL4 A;  4MVQ A;  4Z1M G;  4I9W A;  4LH7 A;  4FZ1 A;  5E79 Z;  1NI8 A;  4LF7 B;  1IBL O;  4OXS A;  4ZOL A;  1P4R A;  2Z3Y A;  4HNA A;  1JFF B;  3CCL V;  2B1I A;  4DK1 A;  4IGG A;  3JYC A;  3SJC C;  2HHH O;  4Z1V A;  3HR0 A;  1G6U A;  3JD3 A;  1OCC C;  2VQE O;  4JI6 O;  3CWB H;  3DXR A;  2ZNI A;  3ZHV A;  3ZMS A;  5JQG A;  2PF4 E;  4O2A B;  3E2E A;  3OEE G;  1J95 A;  5LHI A;  3K5N A;  3BHP A;  1PNM A;  3AG3 B;  3WB2 A;  2F43 G;  4MSW C;  4JI3 B;  1Q3E A;  1MSW D;  5IWA B;  3F5T A;  3OT7 A;  1M5I A;  3ZMU A;  5JCO C;  4LF5 B;  3D36 A;  1GN4 A;  4GYC B;  4FM2 A;  1WLE A;  3STL C;  3ASO C;  1XDC A;  1YIT V;  1XNR O;  1RPO A;  3T1Y B;  3HKB A;  4DUY O;  4PHZ A;  4B3S B;  1BE3 H;  5BR8 O;  3HKD B;  4FLY A;  1FXH A;  2UXN A;  2V1D A;  5CA1 A;  1G1X B;  4BWA A;  2JIZ G;  1SQV H;  3IC9 A;  4DW1 A;  4JI7 B;  3K3W A;  5GW7 A;  2DMX A;  1M93 A;  3ETD A;  2JK5 C;  4AHC A;  2IU3 A;  3ABK C;  1NBM G;  3CJH A;  4PI2 A;  4DR2 O;  4PV1 B;  1EBO A;  4FLW A;  3L75 H;  4U7O A;  2QE7 G;  2YC0 A;  5EK0 A;  3D3Q A;  3ZMT A;  1Q5O A;  5B1B C;  3K08 A;  3S3X A;  2UXC O;  4QE7 A;  3OGC C;  5H6R A;  3RT3 C;  2EJR A;  5IJ9 B;  1SC5 B;  2UUA B;  4QPJ A;  1QBZ A;  2JEU A;  4YY3 O;  3SPG A;  2IU0 A;  3A8T A;  4AQY B;  1AIL A;  1M9N A;  3E8B A;  1SQB H;  3RGB A;  4Q6G A;  3IC7 A;  4X62 B;  4GZR B;  4X1I B;  4YJ2 B;  3K79 A;  4YJ3 A;  4I5S A;  2X6A A;  1I7F A;  5J2U A;  3L74 H;  1GAX A;  3ZHU A;  2PI5 A;  1IBM B;  4H13 B;  3JAK B;  5B66 Z;  4WCE V;  5FL7 G;  2QKA A;  3LDC A;  3O65 A;  3TXS A;  1ZAU A;  1R3K C;  5IYB O;  4QNH B;  5IYZ B;  2YIB A;  1S0V A;  1LUV A;  1ENV A;  1FD9 A;  2IJJ A;  3RN4 A;  3LSU A;  2V4D A;  1W0J G;  2HFE C;  4UCU A;  3IFX A;  1Y76 B;  4J11 A;  1YJN V;  5DEC A;  1MZF A;  4X8A A;  5ITZ A;  4JI8 B;  4HAM A;  4DR7 O;  4X65 O;  3MHH C;  3W7X A;  4UB6 Z;  3OMI B;  4UVB A;  5E1A C;  5KUK A;  1S5H C;  3UT5 B;  3WG7 B;  4XDL A;  2IJK A;  4J7J A;  4UUJ C;  1F7Y A;  1VQ8 V;  4I9Q A;  1WAZ A;  4LBE C;  5AG2 A;  2XOK G;  2C2A A;  1W2B U;  1KD1 W;  1D2D A;  3QTC A;  1KP2 A;  4DV6 B;  3JSL A;  3CXH F;  1NQT A;  1FFT B;  5LXT A;  3KCX A;  4NTX A;  3ETE A;  5KMG B;  1XMQ B;  4JAS A;  1M56 C;  2UUC B;  4IL6 Z;  2QEX V;  4DV1 O;  4P9P A;  5EBM C;  1OCO B;  2XAH A;  1YSC A;  2GSM B;  4DV3 B;  3W7S A;  1R3I C;  4IHJ A;  3T4Z A;  1K4C C;  2IH1 C;  3ZCC A;  3OMN B;  4RQE A;  5LBQ A;  2Q5Z A;  3K04 A;  3I56 V;  1YEW A;  1GK9 A;  1PNL A;  2BTQ B;  1AP6 A;  1EFR G;  2DWD C;  2YEV A;  2WAM A;  4O2B B;  4BIO A;  2QWQ B;  5H2F Z;  2A06 H;  1YTF D;  5FLX N;  1AI5 A;  1G4Y B;  2RQ6 A;  4F4L A;  2EIM C;  1V54 B;  3QVN A;  4HBN A;  4TOI A;  2NNU A;  3K5M A;  1P7G A;  1LUW A;  4TQD A;  2QJ1 A;  1GN2 A;  2RNB A;  1BSM A;  1SET A;  1IXM A;  3ASN B;  3CCR V;  1H2N A;  1EZJ A;  4DV2 B;  3CS5 A;  4JI1 O;  1I5Y A;  1AJQ A;  1SS3 A;  3FB8 C;  3W7T A;  2UU9 O;  4EB6 A;  3VQX A;  2AGA A;  2GUZ B;  2NN4 A;  4UCR A;  1X59 A;  3E8F A;  1S5J A;  4TT3 G;  4DR1 O;  1AI4 A;  2A7W A;  3E22 A;  1FXK B;  1WB8 A;  2DN9 A;  4NXN O;  3A2F A;  3T1H B;  4JI5 O;  1MOF A;  4ZKI A;  4BW9 A;  3B4S A;  1ZSP A;  3JAL A;  4DV7 B;  4UVA A;  4BR6 A;  1N0J A;  1WP7 A;  2Q0A A;  4LWS A;  1RM1 C;  3AG4 B;  1NKD A;  4U3J A;  2EIL B;  3F7Y C;  1IBK O;  2XAF A;  4DV4 O;  2JGD B;  4WF9 V;  2XUM A;  3F7V C;  2Q4P A;  4GX0 A;  2Y69 C;  4KHP O;  4LF8 O;  4QPK A;  3HKE A;  5GON A;  4O4H A;  1ZL8 A;  4JV5 B;  1RSO B;  4YXW G;  1UFI A;  4EFB A;  1U96 A;  5KAI Z;  4JF3 A;  3HKC A;  5KX5 B;  3SPI A;  1M90 W;  1N32 O;  5LGN A;  5LYJ B;  4U7N A;  2LW1 A;  2F93 B;  5LP6 A;  5IJ0 A;  3CCE V;  1AI6 A;  3B09 A;  1QLN A;  4LFA B;  1S3J A;  4ZHQ A;  1BHB A;  1AR4 A;  4LF9 B;  4DO2 A;  1BQZ A;  2WLI A;  2HR3 A;  3CCS V;  5D5Q A;  5CMU A;  3JAT B;  2Y0I A;  1AB3 A;  5EZY B;  2UUB O;  4LFC O;  4IIJ B;  4AI8 A;  3JAW B;  3ZHS A;  2UXB O;  4ASU G;  3G4S V;  4X66 O;  4YHH B;  4YY3 B;  1Q81 W;  3T2M A;  2P06 A;  3JAR B;  4LFB O;  3DTU B;  3OW2 U;  3JD0 A;  1H8E G;  2QM4 A;  3VBB A;  2ZDI C;  2F4V O;  3JAS B;  4ICG A;  2ZT9 B;  4LC1 A;  4MW8 A;  1Y6X A;  3W7U A;  2LQT A;  1EN5 A;  4O4I A;  1VQ9 V;  2ZIM A;  3Q4H B;  2EUL A;  4I4T A;  1WNS A;  3N2K B;  2DQ0 A;  2YSU B;  4PA3 A;  3UO3 A;  3FAV B;  1BZK A;  4B7K A;  1NTK H;  4KP4 A;  1P84 F;  1NS1 A;  1VF6 C;  2Q9L A;  1K34 A;  2QM8 A;  2DWE C;  4X1Y A;  2ADP A;  1N34 O;  5IT9 N;  3E86 A;  1S72 V;  2PUS A;  4X65 B;  2ZIN A;  2KKW A;  1MAB G;  1KC8 W;  1EM1 A;  3ABK B;  3SJA C;  4DYL A;  1E1R G;  5LP6 C;  4OPA A;  3IJ4 A;  4PJ0 Z;  1V9P A;  2AZ2 A;  5JVD A;  1XHZ A;  4LNU A;  5B1B B;  4RUF A;  2HP8 A;  4ZI7 B;  1HR0 O;  4PEL A;  4X64 B;  2QWO B;  3GWK C;  3JSN A;  1W0K G;  4KFM A;  3D8C A;  2XND G;  2PGG A;  3BA8 A;  1ZX3 A;  4DR6 B;  1QCE A;  4FFB B;  2ZXW C;  2VWK A;  5KA5 A;  4ZOL B;  3K0G A;  1PKX A;  4TV8 A;  3OUS A;  4NTY A;  3K57 A;  1JVM A;  2ZR3 A;  4YIO A;  3RWR D;  3C3T A;  4GKJ B;  5JJE B;  1A32 A;  1Y74 B;  4CH4 A;  1NVP B;  4MTG A;  3DXR B;  1SKV A;  1F51 A;  1R73 A;  2W6J G;  1ARO P;  3AG1 C;  5JQG B;  5CB4 B;  1CEZ A;  4LF6 O;  2LW7 A;  5BY1 A;  2Q0O C;  1VAR A;  1QVF U;  2IJH A;  3TXQ A;  5L3B A;  3K03 A;  2X6C A;  2Q69 A;  4K8X A;  4BIU A;  3UM7 A;  2LP7 A;  4RWU A;  3P3P A;  2DYS C;  4F6E A;  4K0K B;  4RAI A;  2P5O A;  2EBO A;  5IE9 A;  1I0H A;  4DV0 O;  4CBC A;  5JH7 A;  1OHH G;  5EC2 C;  1VIB A;  1OJH A;  3KKY A;  3LUT B;  2VRZ A;  1R1B A;  2FTK A;  3T4D A;  4O4J A;  3I5D A;  5CA1 B;  4N23 A;  2A0L A;  3OFN G;  2RN9 A;  2E3C A;  3B2E E;  3ABL C;  2BOC C;  3CJH B;  2QSA A;  1XOU A;  1VP7 A;  1VQL V;  2R9A A;  4GLX A;  2ZE6 A;  2FML A;  4JYA B;  2RMK B;  5IY5 C;  1ZTE A;  2R9R B;  2EIN C;  1DLB A;  1FS0 G;  1GM8 A;  4Z2W A;  4UV9 A;  5KHJ A;  4DR1 B;  1M56 B;  3L72 H;  2XHB A;  3OUF A;  1HWY A;  1AJP A;  4DR4 B;  1WA8 A;  2F95 B;  3U0Z A;  1SZX A;  4BW5 A;  2XTA A;  3H1H H;  2HVJ C;  4UV8 A;  1K5Q A;  2QTO A;  4YJ3 B;  5KHG A;  1IBK B;  4MVS A;  1I94 O;  3C3S A;  4GUN A;  1PP9 H;  2IBZ H;  1I08 A;  5J2U B;  2WLM A;  2ZIO A;  1M4U A;  3RVY A;  4I55 A;  3STZ C;  4MT8 A;  4B3T B;  1WPX A;  4LF8 B;  1TVK A;  2NLJ C;  1KBH A;  5LHG A;  4HZ3 A;  1H38 A;  4TWK A;  1YZB A;  3SR2 C;  2GBO A;  1NTZ H;  2NR5 A;  1SRY A;  1K5S A;  2Q68 A;  5FNV B;  2ILM A;  1Q90 D;  4OX9 B;  2EIM B;  1Q82 W;  2W0F C;  1PNK A;  3VQY A;  1GN6 A;  3L73 H;  1HNZ O;  4JTA B;  4WFF A;  4NYK A;  5ITZ B;  5JJN B;  4PDM A;  1Q7Y W;  4PA9 A;  4GX5 A;  3W7W A;  3SYA A;  1YF2 A;  2JJ1 G;  3JD2 A;  1SES A;  1GM7 A;  1DGS A;  2HJF C;  2HLD G;  3D3I A;  1XNQ O;  1TUE B;  3FFQ A;  2PTM A;  1LNQ A;  3TGU H;  1J5E O;  5JWP A;  4JI2 B;  4MTO A;  1VQ7 V;  3KZI Z;  1N33 O;  3SPH A;  1F4N A;  1BCC H;  3QO7 A;  4H33 A;  4G28 B;  2CK3 G;  4JTC B;  1N0N A;  5DM6 V;  1GMG A;  1BT8 A;  3ABM C;  2JS5 A;  3RYH B;  1R6K A;  5LXT B;  1NT2 B;  1B3Q A;  1IZ3 A;  4I50 A;  1N36 O;  2MW2 B;  3L9D A;  2LGW A;  1NH2 B;  1HNX B;  2QTS A;  3E8H A;  2EIJ B;  3RYF A;  4DR3 O;  3RW0 A;  2Y69 B;  2VQF O;  3SDL A;  3CD6 V;  5J2T B;  4B3R O;  1JFF A;  4IHJ B;  4F6R B;  1VF5 B;  3B77 A;  2YXH A;  4FLX A;  3X2Q C;  1XHX A;  3THO A;  1SZT A;  5CA0 B;  4EEQ A;  1JCH A;  5BMV B;  1QLE C;  1YXB A;  5EIB C;  3MAQ A;  2Y0P A;  1JX9 A;  1XRE A;  2YEV B;  3E83 A;  3WU2 Z;  5LGU A;  4C7U A;  2PYJ A;  1TUB B;  3D36 C;  1FJG B;  2QWP B;  1TGO A;  2M6Y A;  5FPO A;  1VQ6 V;  1K9M W;  3M99 B;  2FL4 A;  2H94 A;  2P4K A;  5LOV B;  5IDJ A;  5B5E Z;  1XMO O;  4O4L B;  2ITC C;  2CH7 B;  5IYD O;  1QR9 A;  4RUE A;  1GH6 A;  4NXM O;  4DR5 O;  4MS2 A;  4B08 A;  3HKD A;  3ZN0 A;  3C90 A;  2UXD B;  1YJ9 V;  3QF7 A;  4EB6 B;  2E5L B;  4FLV A;  2E74 B;  1B6Q A;  1K7D A;  1UPG A;  3J81 N;  1RP3 B;  4WFE A;  5H5N A;  3E22 B;  4GCZ A;  2X0L A;  2WSS G;  4OPH A;  2ZM6 O;  3SJB C;  3JAL B;  5IJ9 A;  2AHY A;  5DED A;  2H3O A;  4JI0 O;  1YCI A;  3T1C A;  2AZ0 A;  4LF6 B;  3FYI B;  1JJ2 U;  1XIL A;  3OEH G;  1CP9 A;  1KKC A;  1EZV H;  3KCY A;  1NVP D;  3OTO B;  4X1I A;  5GON B;  5LA6 B;  1ZL8 B;  2CE4 A;  1H2M A;  1YI2 V;  2B5U A;  2EZO A;  2WLK A;  5C8Y A;  2QM7 A;  4MVU A;  2PYL A;  4N21 A;  3HKC B;  3AG2 C;  5B3S C;  2OT5 A;  3CRR A;  1F23 A;  1GRJ A;  5LP6 B;  5IJ0 B;  2WLJ A;  4PDL A;  5IYZ A;  1Z2G A;  2WLH A;  1Y67 A;  1HP8 A;  3AG3 C;  4I0X A;  3M7M X;  3L70 H;  1S77 D;  3H01 A;  1IXB A;  1Y76 A;  2Z5U A;  2WLI B;  4CH6 A;  1X4T A;  4B3M B;  3R66 A;  3G80 A;  2M7W A;  5C93 A;  4LF4 O;  2D2C B;  3ZRW A;  3P3N A;  3CMA V;  3K9A A;  3ZJZ A;  2FB5 A;  4B7E A;  5BXZ A;  3UT5 A;  2ZXW B;  3CXC U;  2E76 B;  4KL1 A;  3S3W A;  3TET A;  3K0D A;  1R6N A;  1IBL B;  5KHI A;  2AHZ A;  2BSK A;  2KB1 A;  5B1N A;  3K58 A;  2DW4 A;  1NR7 A;  3AG1 B;  3E35 A;  2HHH B;  1Y66 A;  4EKW A;  3CSX A;  4PI0 A;  2VQE B;  4JI6 B;  5KAF Z;  4ABM A;  2P22 C;  3CP1 A;  3B40 A;  4FK5 C;  4GT1 A;  4QJF B;  4TV9 B;  4LF7 O;  1JJO A;  2GHY A;  3RBZ A;  4O4I B;  4X20 B;  4X1K A;  3CME V;  1MG1 A;  3CC2 V;  1GN3 A;  4FIP C;  2PI4 A;  2FKX A;  4JGS A;  4IYI A;  1B04 A;  4TUY A;  3H1L H;  4DW0 A;  1XNR B;  2LFR A;  4DK0 A;  2KG7 A;  4P30 A;  1FFX B;  2WLL A;  2BCC H;  4DUY B;  2EIK C;  2DYR C;  3CRM A;  1NU1 H;  1AVM A;  4J80 A;  4JI3 O;  5BR8 B;  1MA1 A;  4MVR A;  5IWA O;  1TAE A;  1K3E A;  4JYY A;  1QHT A;  3WB0 A;  3ABL B;  4JTD B;  4CH3 A;  4LF5 O;  1VMG A;  4O2B A;  3A0R A;  3ABT A;  4MTF A;  3CE2 A;  5IY5 B;  1I5X A;  3DGE A;  2EIN B;  4DR2 B;  3T1Y O;  5JVD B;  4KUM A;  5L3E A;  1L1F A;  4WBN B;  1H2G A;  1J5E B;  4B3S O;  3GVM A;  4MW3 A;  3MHS C;  1THZ A;  1VQ4 V;  3OGI B;  2UXC B;  3ZS8 C;  4JI7 O;  2YID A;  1W59 A;  3BAA A;  5GTH Z;  1OCC B;  2CTQ A;  2N05 A;  2HEP A;  1OV9 A;  1P49 A;  4TV8 B;  1O9G A;  1SA0 B;  2IW5 A;  1R6T A;  1IDS A;  3K5O A;  2F66 C;  3BAB A;  2JRI A;  3RYI B;  2N04 A;  1R3J C;  2QR4 A;  2LO1 A;  3TCU A;  1NR1 A;  3CC4 V;  2UUA O;  3H9V A;  1FXK A;  4B3R B;  1KEC A;  3EXA A;  1NH2 D;  4AQY O;  4CZZ A;  2OIG A;  4MTX A;  5FPR A;  1KQS U;  3ASO B;  2JS3 A;  3ZMZ A;  3N2G A;  2JGD A;  5EYP A;  4H44 B;  3VOU A;  4BAY A;  1JPX A;  2PZS A;  3EFF K;  1V55 C;  4PA6 A;  2YUA A;  2F23 A;  1PM9 A;  1KYO F;  1IBM O;  2E75 B;  4NTW A;  5JH7 B;  4DR7 B;  4JZ2 A;  3BRC A;  3OE7 G;  1JQ0 A;  2K9P A;  4D6T H;  3VQV A;  3OR6 C;  3UCS C;  1DK1 A;  4O4J B;  1GO3 F;  3R65 A;  2CTP A;  1AR1 B;  4DRX B;  5TIS Z;  4JI8 O;  4DR5 B;  1O9H A;  3A0H Z;  4QE9 A;  4UCT A;  2JDI G;  3ABM B;  3JCZ A;  1RFY A;  1QNM A;  2Q7H A;  4X89 A;  2CDY A;  4JZG A;  1YVW A;  3ZRV A;  2ATK C;  4HNA B;  1BL8 A;  1S76 D;  1YDX A;  3LSQ A;  4UCO A;  1G8M A;  1FXV A;  2Q7G A;  3TJT A;  3U11 A;  4PDV A;  5L3F A;  4IT5 A;  2K1E A;  4IIJ A;  1WA8 B;  4K35 A;  3H1J H;  2ZKO A;  4DV1 B;  1OCZ C;  1E1Q G;  2Y4U A;  2WPD G;  3CCQ V;  2GTS A;  4DV6 O;  4CS2 A;  5CA3 A;  3ZIA G;  5A2Q N;  3X2Q B;  2YXY A;  4DV5 O;  3UQ8 A;  3OD4 A;  3APQ A;  3JAR A;  4UVC A;  4G2K A;  1WJZ A;  1Q8I A;  3JD4 A;  1XMQ O;  4YIP A;  2VS0 A;  4I55 B;  1QLE B;  2YI8 A;  2YDE A;  4NVP A;  4TSF G;  1D5A A;  1M57 C;  2GTA A;  1BS3 A;  4J42 A;  3BY6 A;  3N27 A;  2EZP A;  2Y48 A;  3RFR A;  4DV3 O;  1H2S B;  3K9S A;  2DJV A;  2OCC C;  1K33 A;  5JCO A;  3BEH A;  2AXT Z;  4FFK A;  2ZE8 A;  3EHB B;  2LGQ A;  4E4E A;  2G38 A;  3HKB B;  2P67 A;  1T5E A;  1SER A;  3ZRS A;  1QR8 A;  3FX7 A;  4LR3 A;  1VQP V;  5GTI Z;  3K06 A;  2JJ2 G;  2CTR A;  2ITD C;  4E2L A;  3CCM V;  2HJD A;  2EJ7 A;  5LL6 Y;  4JI1 B;  1US6 A;  2UU9 B;  3CCV V;  4A5U B;  3CCJ V;  1MNG A;  2A3Q A;  4FLZ A;  4ZI7 A;  1HNW O;  4NXN B;  3SPJ A;  2PY5 A;  4D7T A;  1FAF A;  4JI5 B;  4DV2 O;  1KUQ A;  3AK1 A;  3FB7 C;  3K5L A;  3GWO A;  1NZ6 A;  3RYF B;  4FFB A;  4DV4 B;  2P4V A;  3LNN A;  3MD0 A;  1PL4 A;  1BQ0 A;  3A0B Z;  3SPC A;  1L0L H;  3CYO A;  1Y74 A;  1Z5V A;  3T1H O;  4KHP B;  3OMA B;  4JI4 O;  4DV7 O;  1SQX H;  3BVO A;  5LMU O;  3AG2 B;  5CB4 A;  5B3S B;  2DQ3 A;  3AEI A; 
#chains in the Genus database with same CATH homology
 4WFA V;  4PA7 A;  4QPK A;  1YJ9 V;  4HYO A;  2P90 A;  5L3D A;  4YXW G;  1B6Q A;  1K7D A;  4PA4 A;  2HG5 C;  3SJQ C;  3FB6 C;  4WFE A;  1YHQ V;  2WLN A;  3ASN C;  2X0L A;  2XAG A;  4GCZ A;  1R3L C;  4JF3 A;  4WFG A;  3WFV A;  4GX1 A;  2WSS G;  5L3C A;  2A79 B;  3SPI A;  3QO5 A;  3UKM A;  1M90 W;  3ETG A;  5LGN A;  3NXS A;  4U7N A;  2B1G A;  3CCE V;  1AI6 A;  1QLN A;  4MVZ A;  1S3J A;  1K8A W;  1VQ5 V;  1JOY A;  2AHY A;  3SYP A;  3ZRX A;  1BHB A;  3T1C A;  3FB5 C;  4R50 A;  3FYI B;  5B1A B;  1FXK C;  5B1O A;  4DO2 A;  2WLI A;  1JJ2 U;  2HR3 A;  4G27 B;  3OEH G;  1PD3 A;  5IYC O;  2IJI A;  1CP9 A;  3CCS V;  3G6E V;  1NVP D;  5CMU A;  5CBG A;  3ABU A;  3TK1 A;  4ZBM A;  1PL0 A;  4BIZ A;  3AG4 C;  5H6Q A;  1BMF G;  2EIL C;  1YTF B;  1ORQ C;  3SYQ A;  1YI2 V;  1OZ0 A;  2B5U A;  2EZO A;  2WLK A;  2QM7 A;  5J9P C;  4MVU A;  2Q6A A;  4N21 A;  4ASU G;  1RM1 B;  4R6Z A;  3AG2 C;  5B3S C;  1K97 A;  2OT5 A;  1Y4M A;  3G4S V;  1F23 A;  1Q81 W;  3T2M A;  2WLJ A;  4PDL A;  4UXN A;  2WLH A;  3AG3 C;  3DTU B;  5CBF A;  4FMT A;  5HFL A;  3OW2 U;  3JD0 A;  1H8E G;  1OCR B;  4JYB A;  3VBB A;  1Q86 W;  1S77 D;  3P30 A;  3H01 A;  4RQF A;  2ZDI C;  2V7Q G;  2Z5U A;  2WLI B;  4MVO A;  4L87 A;  4LP8 A;  4LC1 A;  2XAS A;  3LNM B;  2M7W A;  3HPL C;  4MW8 A;  5HFM A;  2HKO A;  5C93 A;  4X88 A;  3CC7 V;  3ZRW A;  3W7U A;  1CPY A;  3CMA V;  1VQ9 V;  3K9A A;  3ZJZ A;  1VQN V;  2W6I G;  4J9Z B;  4FJC C;  2ZXW B;  3CXC U;  2DQ0 A;  2LFS A;  2YSU B;  5KA6 A;  2EIK B;  4PA3 A;  2DYR B;  1VQM V;  5B1A C;  3P32 A;  2R9I A;  4PDR A;  1GKF A;  3F5W C;  3SYC A;  3TET A;  3K0D A;  1R6N A;  2IH3 C;  1XL4 A;  4MVQ A;  4Z1M G;  2AHZ A;  2KB1 A;  4I9W A;  4KP4 A;  5B1N A;  1VQO V;  1P7B A;  1K34 A;  2QM8 A;  2DW4 A;  1NR7 A;  2DWE C;  3AG1 B;  1N8R W;  3E35 A;  5EC1 C;  1Y66 A;  4EKW A;  1ZWI C;  4OXS A;  3E86 A;  1S72 V;  1P4R A;  2Z3Y A;  3SYO A;  3B8N A;  3CCL V;  2B1I A;  3CP1 A;  3JYC A;  1MAB G;  1DTO A;  4FK5 C;  4GT1 A;  4WFH A;  3OR7 C;  1KC8 W;  4QJF B;  3ABK B;  3JD3 A;  1OCC C;  1E1R G;  2GHY A;  5H9C A;  3ZRW B;  1DF4 A;  3RBZ A;  3ZMS A;  3E2E A;  3OEE G;  1J95 A;  1OCR C;  5LHI A;  3CME V;  5B1B B;  1MG1 A;  4RUF A;  3CC2 V;  1PNM A;  3AG3 B;  2H8P C;  3IGA C;  4P2Z A;  4PEL A;  2F43 G;  4FIP C;  1W0K G;  3PJS K;  2PI4 A;  4KFM A;  2XND G;  4JGS A;  4MSW C;  1MSW D;  4JYC A;  2LFR A;  1QCE A;  4R7C A;  4P30 A;  2ZXW C;  3ZMU A;  1YJW V;  3D36 A;  2WLL A;  5KA5 A;  4RO2 A;  2EIK C;  2DYR C;  3K0G A;  1PKX A;  3QNE A;  3OUS A;  1WLE A;  4MVR A;  1JVM A;  2ZR3 A;  3ASO C;  3STL C;  1YIT V;  1RPO A;  1K3E A;  3ABL B;  4JTD B;  1NVP B;  4MTG A;  3A0R A;  3ABT A;  1F51 A;  1R73 A;  2W6J G;  1ARO P;  3AG1 C;  4MTF A;  5IY5 B;  1I5X A;  3E89 A;  1FXH A;  3DGE A;  1CEZ A;  2EIN B;  2UXN A;  4Q20 A;  2V1D A;  1QVF U;  4KUM A;  5L3E A;  1L1F A;  1H2G A;  2IJH A;  1V55 B;  2JIZ G;  4R8C A;  1YIJ V;  3K3W A;  5GW7 A;  3ETD A;  2JK5 C;  2IU3 A;  4MW3 A;  3ABK C;  1NBM G;  3MHS C;  1THZ A;  3K03 A;  2X6C A;  2Q69 A;  5L3B A;  4BIU A;  1EBO A;  3UM7 A;  1VQ4 V;  2LP7 A;  4U7O A;  2DYS C;  2QE7 G;  5EK0 A;  3LDD A;  3ZMT A;  1OCC B;  4RAI A;  2WLL B;  5B1B C;  2EBO A;  3K08 A;  4QE7 A;  3OGC C;  5H6R A;  3LDE A;  2EJR A;  2IW5 A;  4CBC A;  4QPJ A;  5KUM A;  1QBZ A;  1OHH G;  2JEU A;  3SPG A;  5EC2 C;  2BOB C;  2IU0 A;  1R3J C;  3LUT B;  3TCU A;  1NR1 A;  1M9N A;  2FTK A;  3E8B A;  3CC4 V;  3T4D A;  1FXK A;  1KEC A;  3IC7 A;  5LGT A;  1NH2 D;  1NJI W;  4N23 A;  2A0L A;  3OFN G;  3K79 A;  2ZQM A;  4CZZ A;  4I5S A;  3FYE B;  4MTX A;  2X6A A;  2BOC C;  3ABL C;  4J9Y B;  1KQS U;  1BHA A;  1VQL V;  2PI5 A;  3ASO B;  4P9O A;  3ZMZ A;  5IY5 C;  2JEX A;  2EIN C;  2R9R B;  1DLB A;  5FL7 G;  3VOU A;  4BAY A;  3LDC A;  5CN0 A;  4WCE V;  1JPX A;  1FS0 G;  1GM8 A;  5EBL C;  1OCZ B;  1R3K C;  3EFF K;  4UV9 A;  5IYB O;  4QNH B;  1V55 C;  5CBH A;  4PA6 A;  1S0V A;  2OTJ V;  1ENV A;  1M56 B;  4GX2 A;  2IJJ A;  3OUF A;  2Q67 A;  1W0J G;  2HFE C;  3IFX A;  1HWY A;  3OE7 G;  1AJP A;  1YJN V;  1JQ0 A;  2UXX A;  1DF5 A;  4X8A A;  3OR6 C;  1VQK V;  1M57 B;  2ZDI A;  4HAM A;  4BW5 A;  1GO3 F;  3MHH C;  3R65 A;  3W7X A;  2DYS B;  2XAJ A;  2HVJ C;  4UV8 A;  4UVB A;  1K5Q A;  3OMI B;  4XDK A;  5E1A C;  3LSS A;  1AR1 B;  2QTO A;  5KUK A;  1S5H C;  4MVS A;  3QO8 A;  3WG7 B;  2P6J A;  4XDL A;  2OCC B;  2X7R B;  4QE9 A;  4FPP A;  3ZMV A;  2JDI G;  2IJK A;  2WLM A;  3KG2 A;  4UUJ C;  3RVY A;  3ABM B;  3I55 V;  1H8H G;  1VQ8 V;  4LBE C;  3STZ C;  3FKS G;  3JCZ A;  4MT8 A;  1WPX A;  2WWW A;  2X6B A;  2NLJ C;  5LHG A;  4HZ3 A;  1H38 A;  4TWK A;  2EIJ C;  1Q7Y W;  4X89 A;  3E8G A;  5LHH A;  1SRY A;  1K5S A;  2Q68 A;  3ZRV A;  2XOK G;  2C2A A;  1W2B U;  4JPR A;  1KKD A;  1KD1 W;  2ATK C;  2EIM B;  1KP2 A;  1Q82 W;  2W0F C;  1PNK A;  1BL8 A;  4DXW A;  1S76 D;  3LSQ A;  4JAU A;  1G8M A;  1NQT A;  1FXV A;  1FFT B;  4PDV A;  4JTA B;  5L3F A;  4WFF A;  2K1E A;  4WFB V;  1AJN A;  2MK3 A;  2A9H A;  4PDM A;  2QA4 V;  1OCZ C;  1E1Q G;  4PA9 A;  2WPD G;  1K4D C;  4GX5 A;  3CCQ V;  3ETE A;  5CA3 A;  3W7W A;  3ZIA G;  4MVM A;  3SYA A;  4JAS A;  3X2Q B;  1M56 C;  1COW G;  2JJ1 G;  3OM3 B;  1K73 W;  5EBW C;  3JD2 A;  1SES A;  2QEX V;  1GM7 A;  2XAH A;  1OCO B;  2HJF C;  4G2K A;  4P9P A;  1YSC A;  4UVC A;  5EBM C;  5BZB A;  3JD4 A;  2HLD G;  3D3I A;  2GSM B;  1TUE B;  1ROP A;  3W7S A;  1QLE B;  1R3I C;  4TSF G;  1M57 C;  1LNQ A;  3T4Z A;  1K4C C;  2IH1 C;  3BY6 A;  3ZCC A;  2EZP A;  2Y48 A;  3ZN1 A;  3OMN B;  4MTO A;  1VQ7 V;  3WG7 C;  4RQE A;  3SPH A;  5LBQ A;  1F4N A;  4XBF A;  3QO7 A;  3K04 A;  3HB3 B;  2OCC C;  1K33 A;  2CK3 G;  4G28 B;  4H33 A;  4JTC B;  3I56 V;  4LCU C;  1GK9 A;  1PNL A;  5DM6 V;  1GMG A;  3BEH A;  3ABM C;  1R6K A;  3EHB B;  1EFR G;  2DWD C;  2OTL V;  2YEV A;  2WAM A;  2D3O W;  1NH2 B;  2P67 A;  1YTF D;  1AI5 A;  1AI7 A;  1G4Y B;  1XL6 A;  5DN6 G;  1M1K W;  1SER A;  4F4L A;  2EIM C;  3ZRS A;  3E8H A;  2EIJ B;  1V54 B;  2HVK C;  3RW0 A;  3GB7 C;  4JAV A;  1QR8 A;  1VQP V;  2Y69 B;  3CD6 V;  3K06 A;  2JJ2 G;  3CCM V;  2ITD C;  4E2L A;  2NNU A;  2ZR2 A;  3B77 A;  1SET A;  3X2Q C;  1GTO A;  1IXM A;  3ASN B;  3CCR V;  3CCV V;  3G71 V;  3CCJ V;  4QIW F;  3ML0 A;  2P7T C;  1OCO C;  1EZJ A;  1QVG U;  1SZT A;  2ZD9 A;  1JCH A;  1I5Y A;  1AJQ A;  1QLE C;  3FB8 C;  4XDJ A;  1JX9 A;  3JD1 A;  3W7T A;  1F4M A;  3SPJ A;  2YEV B;  3E8F A;  3E83 A;  3CPW U;  5LGU A;  4TT3 G;  1AI4 A;  1FXK B;  3FB7 C;  3GWO A;  1E79 G;  2QKS A;  3CCU V;  1VQ6 V;  3B8M A;  1K9M W;  1MOF A;  4ZKI A;  3M99 B;  4UVA A;  3MD0 A;  2H94 A;  3SPC A;  5IDJ A;  1GM9 A;  1RM1 C;  3AG4 B;  2ITC C;  1NKD A;  4H37 A;  5IYD O;  1QR9 A;  2EIL B;  3F7Y C;  2XAF A;  3CYO A;  3OAA G;  4RUE A;  1RPR A;  3RVZ A;  3OMA B;  4WF9 V;  2XAQ A;  3F7V C;  4MS2 A;  1V54 C;  1KP3 A;  3AG2 B;  3ZN0 A;  5B3S B;  1UJW B;  5L3G A;  2DQ3 A;  1K92 A;  4GX0 A;  3AEI A;  2Y69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...