3VOUA

The crystal structure of nak-navsulp chimera channel
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
139
structure length
139
Chain Sequence
MLSFILTLKRMLKACLRAWKDKEFQVLFVLTFLTLTSGTIFYSTVEGLRPLDALYFSVVTLTTVGDGNFSPQTDFGKVFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNRKKETDAYRLEVMEKLEAIEKKLAEHSRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal helical bundle of the tetrameric prokaryotic sodium channel accelerates the inactivation rate
pubmed doi rcsb
source organism Bacillus weihenstephanensis
molecule tags Transport protein
molecule keywords Ion transport 2 domain protein, Voltage-gated sodium channel
total genus 54
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3vouA00
2H8PC 3JYCA 4LBEC 3IFXA 5EK0A 2NLJC 2ITDC 2DWEC 4RUEA 3LDCA 2HVJC 4QE9A 4MVMA 5CBFA 4XDLA 5B3SC 2ZXWC 3K0DA 2IH3C 4J9ZB 3E8GA 3IGAC 5E1AC 1V55C 1QLEC 2EINC 3E8FA 3OUFA 4MVUA 5B1AC 3T2MA 1M57C 5EBLC 4QE7A 4PA3A 4PDVA 1R3IC 4BW5A 3PJSK 1KKDA 2K1EA 3ABMC 3E83A 4GX5A 3SYQA 3RBZA 2AHZA 2WLLA 2WLMA 3RW0A 3STZC 4LP8A 2W0FC 3LNMB 3SPHA 3R65A 2WLHA 3SPIA 4H37A 3SPGA 3TETA 3WG7C 3F7YC 4P9PA 5J9PC 3K03A 1OCCC 4WFGA 3FB5C 4P9OA 4X89A 3RVZA 3F5WC 3VOUA 4EKWA 3AG4C 2ITCC 5EC2C 2DWDC 2OCCC 4MTGA 2DYRC 2WLIB 3RVYA 5CBGA 4JTDB 4R7CA 1LNQA 4OXSA 4RAIA 4PA9A 3T1CA 4WFFA 5IY5C 2Q69A 4KFMA 4MTFA 3T4DA 3UKMA 4H33A 2EIMC 3BEHA 2Q68A 4GX0A 4PDLA 2HJFC 4TWKA 2Y69C 2P7TC 2ATKC 3OUSA 2BOBC 4G28B 2EILC 1K4CC 2A79B 4RUFA 3SYPA 5CBHA 3SYOA 4DXWA 2A9HA 2YEVA 4X88A 2IH1C 3K08A 4MVQA 2EIJC 3LDDA 4P30A 5BZBA 3E8HA 3AG2C 4MVRA 3ASOC 1JVMA 3AG1C 4R8CA 3T4ZA 5EBWC 3SYCA 2A0LA 5KUMA 4XDKA 2WLJA 3OR7C 3SPCA 3LDEA 1P7BA 4MVZA 1M56C 4HYOA 4PDRA 1BL8A 2DYSC 1OCZC 2WLLB 2X6CA 3SYAA 1XL6A 2R9RB 1XL4A 2BOCC 2HG5C 4J9YB 4MS2A 4R50A 2AHYA 2EIKC 3LUTB 2X6AA 3OR6C 4CBCA 1R3KC 3ABKC 4GX2A 2HFEC 3HPLC 2WLIA 4GX1A 3SJQC 2ZD9A 2HVKC 3E8BA 4JTCB 3OGCC 4PA4A 2X6BA 4P2ZA 4RO2A 3K06A 1K4DC 3TCUA 3ASNC 4UUJC 2QKSA 4WFHA 4I9WA 1R3JC 3K0GA 4MW3A 2KB1A 5B1BC 3ZRSA 4MVOA 2WLKA 3AG3C 3ZJZA 4QNHB 3X2QC 3ABLC 4MVSA 4G27B 4MSWC 1OCOC 1R3LC 3FB7C 1V54C 4F4LA 1S5HC 4LCUC 3EFFK 4ZBMA 3K04A 3E89A 4PA6A 4R6ZA 2Q6AA 4MW8A 4PA7A 3SPJA 2QTOA 3FB8C 1OCRC 5EBMC 5EC1C 2Q67A 3F7VC 4XDJA 1J95A 3UM7A 2WLNA 3FB6C 5KUKA 2JK5C 1G4YB 3STLC 1ZWIC 4HZ3A 4X8AA 4MTOA 4JTAB 1ORQC 4WFEA 3E86A 3KG2A 4PDMA 3GB7C
chains in the Genus database with same CATH superfamily
3IFXA 5EK0A 2OT5A 3GWOA 2HVJC 2EJRA 5CBFA 1D5NA 2YXHA 2Y0IA 1V55C 1QLEC 5HFMA 2DYSB 1WNSA 1VQ6V 3JARA 1M57C 5JCOA 2YIBA 2YI9A 3E83A 3LNNA 4X1KA 4FFBB 2WLLA 1PPJH 4LP8A 4DW0A 1RSOA 2C2AA 1Q81W 3N2GB 2OTLV 2WSSG 3UO2A 4X89A 1K97A 4TV8A 1HNWO 3RWRD 4L8JA 5J2TA 3WB1A 4DR5B 2VS0A 4PA9A 1KKCA 5LHHA 2PI4A 1GMGA 2V1DA 2ATKC 4DR6B 3SYOA 2NN4A 4P30A 1TUEB 1DF4A 3ASOC 2OIGA 3IC9A 1JOYA 1EBOA 4B7EA 4X66B 3OR7C 1LUWA 2YICA 1FKAO 1RSOB 1Q8IA 4IGGA 1S5JA 5GTIZ 1KP3A 2CTWA 2ZQMA 5D5PA 1GAXA 4O4IB 2OCHA 4TOIA 2ODMA 4U7OA 3ZHTA 2KB1A 4JI0O 1HW7A 1H2SB 1XMOO 2RN9A 4Z2WA 1SRYA 3ZS8C 1MOFA 4B3RB 4XDJA 5JH7B 2ZIOA 4I4TB 1YJNV 4FM0A 4BIUA 4K8XA 4DR1O 3CX5F 3JAWA 1PL4A 3L75H 5L3BA 1PNLA 4JAUA 1VQLV 4H0LB 4K8ZA 1QR8A 3OW2U 2XAGA 1QVGU 3B77A 2N74A 5B1AB 2W0FC 1PNMA 3SPIA 1W59A 5J2UA 3JARB 2Y69B 2X0LA 3O65A 1XI1A 1QNMA 2WWWA 1MNGA 4X1YA 2XTAA 3VOUA 3BCCH 4EKWA 4PHZA 4GKKB 1H2NA 4FLUA 4C7UA 4JTDB 3NR7A 2UXXA 3JAWB 5ITZA 4KFMA 3JD0A 1XUQA 2BOBC 3RYCB 2AZ2A 1S77D 1KUQA 4FMTA 3T1YB 1I94B 4D6TH 2Q0AA 4MVRA 1XQ8A 1JVMA 1THZA 2A0LA 4EFEA 3CHXA 1OCRB 4DV7O 4UCTA 2BE3A 3CRMA 5KLVH 2F1MA 3MHHC 5FL7G 2BTQA 4X65O 4GX1A 4JF3A 3E8BA 3ASNC 3JAKB 3AG3C 3ZCCA 4B3SO 1KB9F 4F6RA 4I9QA 5IYZA 3WB0A 2QR4A 4FLTA 4JI1O 3APOA 2PTMA 1FXKC 3VQWA 1M56B 2Q6AA 1OCRC 5B5EZ 1X59A 4I5SA 5IYDO 2GUZA 5KUKA 4E4EA 3BABA 3BPZA 3UQ8A 4WFEA 3HKBB 1VARA 3BA8A 5JWPA 1YEWA 4O4JA 4JI4B 4QE9A 5JVDA 4JAAA 5LMNB 1MSDA 1Z5WA 4CZZA 2WPDG 1Q86W 3DGEA 1K33A 3CB2A 4E2LA 1KKDA 2ZE8A 5LL6Y 1N33B 1F7YA 3SPHA 2EJ7A 4YJ3A 2N05A 2UXBB 2CAZC 5BR8B 1OCCC 4ZIBA 4GKJO 1S76D 2GV9A 4MTXA 1R6KA 3OFNG 3H1LH 1Y6XA 3HKBA 3RYCA 1NH2B 3CC7V 3T1CA 2EINB 4GYCB 3ABMB 1Y67A 1NU1H 4QGPA 5IJ9B 1Y74A 4BAYA 4G28B 2AGAA 4X66O 2F23A 4DXWA 4OPHA 4DV0B 5IT9N 4MT8A 5BMVA 2EIJC 5BZBA 3BA9A 3SGIA 1BHAA 5EBWC 1KP2A 4FFKA 1F51A 3MDSA 1XMQB 2QWOB 1S3JA 2RDCA 2WLLB 3ZIAG 3OGIB 2NNUA 3QO7A 4IHJA 2ADPA 5LMNO 3E22A 3SJQC 2QKSA 3JALA 1G6UA 2E5LB 4LWSA 1EZJA 4I50B 4O2AB 1I5YA 2EIJB 4JI2B 1SC5B 2EIKB 2LFSA 3ABTA 1GM7A 2BTQB 3CC4V 2HKOA 4AILC 3F7VC 3OEHG 4A5UB 2XNDG 3ZMSA 2RCVA 1L8DA 4MTOA 2ZDIA 1MMMA 2YDEA 4B3TB 4MVZA 2Q9LA 3JYCA 1N34O 4X9QA 4LF6O 5E1AC 4L87A 5IE9A 3DXRA 1IBKO 3IAYA 2P67A 4LH6A 3GWKC 1JJ2U 2EIMB 3UT5B 1R3IC 2A3QA 3CE2A 4ZI7B 2OTJV 1HWYA 3B4SA 1ENVA 2WLHA 5IYCO 2YIBD 3JCZA 4WFGA 1VQ7V 3HKDB 4DV4O 2DWDC 5CBGA 1LNQA 1SQBH 4O2BA 3CD6V 2Y69C 3N2KA 4TQFA 1GN6A 1NQTA 1E79G 1JMKC 3A2FA 2A9HA 2VRZA 3LDDA 3E8HA 1SQGA 2LW1A 2ZIMA 1BT8A 5C8YA 5LGUA 1LUVA 3UCSC 5CA1B 5KHKA 2X6CA 4X1KB 2F43G 2ZD9A 4DV1B 4YJ2A 2B1GA 1R3JC 2YIAA 2E3CA 1JPXA 1P7GA 5AG2A 4ZOLB 3ABLC 1BQZA 1CXZB 4LCUC 4ZBMA 1BE3H 2YC0A 2ZNIA 1MZEA 4FFBA 4PA6A 3KCYA 4MW8A 5H6RA 4JI5O 5LP6B 3S3XA 3AK2A 1WAZA 3JASB 1NVPD 1RP3B 2Z5UA 2H3OA 1HNXB 1HR0B 3LDEA 3KG2A 4DV6B 1QHTA 2H8PC 1XDCA 3CCVV 4JPRA 1QU7A 1QBZA 2VQEO 1FJGB 1XNQO 3K0DA 2VQEB 1FJGO 3E8FA 2UUAO 1XILA 4EB6A 4LF9O 1TVKB 4QE7A 1QVFU 1SZXA 2YUAA 4DR7B 2Y4TA 3CJHA 2JIZG 4LF7O 1JFFA 3RBZA 2QSAA 1ZX3A 5LYJB 3ETEA 1VP7A 1F4MA 1SZTA 3SDLA 1GO3F 1K73W 4TSFG 3F5WC 2B5UA 3AG4C 4BW9A 2DYRC 3G80A 3E22B 4LFBB 4GZRB 3GVMA 5EYPB 2GTAA 4GX0A 1N8RW 2KKWA 2K9PA 3K5NA 2JEUA 4J11A 4I0XB 1NVPB 4I0XA 3JATA 3JD3A 1NTZH 3LSUA 1DTOA 1VQOV 1M56C 2QM8A 4K3AA 3AG4B 1UPGA 2EIKC 2GSMB 3QTCA 4O4LB 2LQTA 2P4VA 4DR3O 2DQ3A 2ZE6A 1YTFB 2LGWA 4X62O 3FYEB 2CGNA 3ZHQA 1VQ9V 4WFBV 4W4KA 4LF7B 4UB6Z 2IJIA 1IVSA 2Y48A 1B6QA 4IL6Z 3A0HZ 1Y74B 2Y4UA 1XREA 1G4YB 2PY5A 5CA1A 4ABMA 3I5DA 2E74B 4TV8B 3ZX6A 1M5IA 1YDXA 3C3SA 1F4NA 3E8GA 2JS3A 1M1KW 4UB8Z 4U3FH 2X7RB 3H1HH 3G4SV 3ETQA 3OM3B 1EFRG 1GM8A 3BAAA 4DV6O 4LFCO 2DMXA 2PYLA 5EC2C 3CMAV 3EVKA 5CB4B 5L3DA 3G6EV 1FFXB 1IDSA 4DR4O 4JAVA 1BCCH 2JS5A 1JFFB 2Q68A 4CH6A 2P7TC 2A79B 2GBOA 4ICGA 4DUYB 4LH7A 5A2QN 1PD3A 2YXYA 3WFVA 4WF9V 3DSQA 3AEIA 3P30A 2AW9A 4JI3B 4GLXA 2M7WA 1OCZC 2AHYA 1NKDA 1JQ0A 2HJDA 1E1QG 2NR5A 2X6AA 4DO2A 2DE0X 4JI7B 2DJVA 3ZRWA 1N36B 5LOVB 1H2GA 3RYIA 2HVKC 3OGCC 1K5QA 4RO2A 5KHGA 3QO5A 1NTKH 1WN7A 1Y4MA 1AR4A 3W7UA 5KHIA 2ZXWB 4FZ1A 3FAVA 5EIBD 4R6ZA 5KAIZ 2QTOA 4Q6GA 1H38A 2Q67A 1KD1W 1TUBB 2XAFA 3UM7A 5DEDA 2P06A 4K0KB 2GDSA 4ZKIA 4QPJA 1KU9A 2QGNA 1ORQC 1NI8A 5JCOC 3A0BZ 1COWG 2NLJC 3TXQA 3ICXA 4FVMA 2P22C 1VQNV 1I7FA 1L0NH 5TISZ 4DV2B 2CTQA 1WPXA 4B3MO 4IHJB 4B3MB 3RYFB 2YI8A 1AI5A 4GUNA 3CRCA 4QIWF 1J5EB 5J9PC 2EX3A 1L0LH 2JJ2G 1GN3A 2ZCEA 3J80N 4DV4B 2IJHA 1N36O 1ZSPA 3K9SA 4RAIA 4JI5B 3F5TA 4MTFA 3K3WA 4G2KA 4OX9B 1N32B 4JI8B 3ZRVA 4DR3B 5CB4A 2PF4E 1TA8A 1Q82W 2DYRB 3VQXA 1MSWD 1BMFG 1VF6A 3CXHF 1MA1A 4O2AA 2QKAA 2BSKB 1IZ3A 1R73A 3JSLA 1FFTB 4CS4A 2ZR3A 3CCSV 2DYSC 5FPOA 4PV1B 3RN4A 3D36A 2FMLA 4GX2A 2HLDG 3WU2Z 1GN2A 2HFEC 5J2TB 4UUJC 3LSQA 2UXDO 3H1IH 4UVCA 3K0GA 2UXDB 2JGDB 4H44B 3ZEDA 4DV1O 3M8AA 1P4RA 1VQ5V 1OCOC 3FB7C 1QLEB 4GKKO 3EFFK 1EN4A 1EN6A 4UV8A 3G67A 4JYAB 5LOVA 3L70H 3UT5A 2F4VO 2RJZA 4RQEA 3N2KB 2WLNA 2D3OW 1HNZO 1K5SA 3BRCA 1KYOF 3DTUB 3DC5A 4N23A 3E86A 1FFXA 1GK9A 2R9AA 3ASOB 4RUEA 2W0XA 1ZL8B 2CK3G 2QWPB 2ZXWC 4OX9O 5DM6V 3C3TA 5B1NA 4BW5A 2K1EA 1GM9A 4GX5A 2XAQA 3ABUA 4FM2A 1M9NA 4J80A 1W2BU 1Q6UA 4DV3B 1GKFA 5LGNA 4DV5O 4FIPC 1DF5A 2A7WA 5BMVB 1O9HA 4B3SB 1B3QA 3K59A 2O57A 3CS5A 4H33A 5H2FZ 5BXZA 1WLEA 2EILC 3ZMUA 1KC8W 2QA4V 1VQPV 1Q43A 3ABLB 1SQXH 1RM1C 1YIJV 5LXTA 2QM4A 1P84F 1NH2D 4FLXA 3SYCA 5KUMA 1UJWB 2OYQA 2ZKOA 3K9AA 2EZOA 4TV9A 1K3EA 2JJ1G 5DN6G 4LFAB 4JASA 3SYAA 2R70A 1R3KC 3RFRA 3K5OA 4RQFA 2BCCH 1MG1A 1EM1A 5LMUB 4WFHA 3L71H 4YY3B 2L35A 2EILB 4DV7B 2IW5A 1BGYH 2BSKA 4NTXA 4ZOLA 4QNHB 3AG2B 5J2UB 4F4LA 1V54C 2UUBB 1SA0B 4J42A 3PN1A 2WAMA 4DV5B 1VMGA 4B3TO 1ZTEA 2B9ZA 1N0JA 2OWOA 3IJ4A 3S3WA 1AR5A 4HAMA 3MD0A 4LF8B 3L72H 1SA0A 2RQ6A 1N0NA 2JRIA 4JV5B 4LBEC 4WBNA 4J7JA 1PM9A 3IGAC 1XHZA 3T2MA 3H1JH 5EBLC 3CYOA 2P6JA 1VQKV 1US6A 4PDVA 4EFBA 1VQMV 2ILMA 5KHJA 2WLMA 5JJJB 1AJPA 1FXKA 3AK1A 1YSCA 2DOSA 3JD2A 1SQFA 2YSUB 1B06A 4CC5A 4MTGA 3L9DA 2Q7EA 4TT3G 1JJOA 3P3NA 1FXKB 2UXBO 4OXSA 3J7AU 1FXHA 2QWQB 1AROP 3CCQV 1Y76A 3BEHA 4GCZA 4U3JA 1VQ8V 1N33O 1K8AW 3OTOB 3ABKB 3CCRV 4FLZA 3D36C 3CCUV 4Z1VA 4CS3A 4YJ3B 3N27A 1PL0A 2P5OA 4LNUB 1XL6A 4R50A 3VBBA 4ZHQA 4LF4B 3JD4A 1XHXA 4JYYA 4JTCB 1YJ9V 3FX7A 4FJCC 3HKEA 1WJZA 2DW4A 4KL1A 3T1YO 1AVMA 1KBHA 4G27B 4LWSB 1YHQV 1WB7A 1AI7A 1OHHG 1YJWV 2HHHO 4KUMA 2VQFB 1YF2A 2ZDIC 4IT5A 3FKSG 5LP6A 4TQDA 2VQFO 5EC1C 1NT2B 3D8CA 5EYPA 5IJ9A 1FS0G 4HZ3A 3MAQA 1G1XB 4HNAB 2XUMA 3LDCA 1O9GA 2ZT9B 4XDLA 4UCSA 1NBMG 2EINC 3Q4HB 1FXVA 1D5AA 1Z5VA 5KHHA 2AHZA 2UUCO 4LF4O 2OCCB 2WA3A 4YIOA 1QR9A 5K1XA 3CXCU 2Q5ZA 3QF7A 4LFBO 5E79Z 3JALB 3X2QB 4O4IA 4CH5A 1FYJA 5KA5A 3CRAA 1ZLZA 1FD9A 3ZRWB 4JYAO 1H8EG 3T4DA 4NTYA 2Y0PA 3CJHB 1HNZB 1AP6A 3ZMZA 5CBHA 4RUFA 2IJKA 4LF5O 1DLBA 1SKVA 2L6LA 4DUZB 1VEWA 1VF7A 4LR3A 3HR0A 1HNXO 1HR0O 2WLJA 3SPCA 1OCZB 4U3JB 2HP8A 1N4CA 1WA8A 3ABKC 3IC7A 2UUAB 3OTOO 1RPRA 1OZ0A 3ASNB 3B2EE 4LNUA 1ZL8A 5GONB 2GTSA 3J81N 4D7TA 3ZRXA 2ZE5A 2MW2B 3O9OA 3RYFA 1IXMA 1OCOB 2ZR2A 5EBMC 3LSSA 5LA6B 3WG7B 1KMIZ 1TVKA 4YIPA 2XAHA 4Q20A 2YXLA 1YTFD 2WA4A 3OAAG 4JTAB 5ITZB 1RFYA 1XMOB 2ETNA 2KG7B 2R9IA 4BIOA 1CP9A 4DK0A 1Q90D 1R6TA 1SF9A 1ZUQA 4X20B 5B1BB 1AB3A 1RPOA 3OD4A 5B1AC 4N21A 4BR6A 1CEZA 2Q0OC 2QWRB 4UVBA 1H2KA 5KMGB 2XT9A 4PI0A 3CMEV 3ZN0A 4DR1B 2FKXA 1S0VA 3OMAB 3OT7A 3AK3A 3RW0A 5KMGA 2DN9A 3LNMB 2PZSA 3WG7C 3D3IA 2JGDA 1NR1A 4UCUA 3RVZA 4FK5C 4IIJB 2ITCC 1QQCA 3ZMVA 4X65B 1Q3EA 1WB8A 5LGTA 3RVYA 2ZE7A 3JCUZ 4X1IB 1N34B 2Z3YA 2UUCB 3CC2V 4DV2O 3RYHB 3MHSC 4PJ0Z 2GHYA 1K4CC 3SYPA 4UCRA 3SR2C 4X88A 1I0HA 2IH1C 3CCEV 4FPPA 5F2VO 2UXCO 3AG2C 1JA8A 3R66A 3JD1A 3CWBH 5IYBO 3U11A 3TK1A 5L3EA 4JI4O 4HBNA 1J5EO 1XL4A 2BOCC 4J9YB 5FNVA 4CBCA 3LUTB 5LP6C 2IU0A 1AJQA 2Q7GA 1YCIA 1K92A 4DK1A 2D2CB 4LC1A 1EZVH 4I9WA 4KP4A 4DRXB 4EEQA 5GW7A 4CH4A 4DRXA 3TXSA 4YJ2B 2PYJA 4KHPO 4YHHO 4I4TA 4DV3O 1TUBA 3M7MX 3G71V 1FAFA 1VF5B 1J95A 4J7ZA 3QVNA 2EBOA 3M99B 2CDYA 4NYKA 1FPOA 1SQPH 1WP8A 1BHBA 1BQ0A 4DUYO 1R1BA 5LHIA 3AG3B 2QDOA 2XHBA 3HKCB 3OUFA 1M4UA 5HFLA 4PA3A 2E75B 2Q8VA 1NTMH 3T1HO 1OV9A 3STZC 1AI6A 4I7ZB 4JI0B 2F95B 3TGUH 1IBLB 4JI8O 2CTPA 1BZKA 5FPRA 4WFAV 3L74H 4R7CA 2Q4PA 4BIZA 5IY5C 2ZNJA 1I08A 1MZFA 4H13B 3CSXA 1SQQH 1WP7A 2Z0AA 4CH3A 2FTKA 4PDRA 5LYJA 2R9RB 4OGQB 5D5QA 5LBQA 1L1FA 4AQYB 4JI1B 3OMIB 4NKGB 4QPKA 1SETA 2YS8A 3DXRB 1UFIA 2ADQB 3ZHUA 4P2ZA 5CA0A 4X20A 2UU9B 4JZGA 3TCUA 5JVDB 3K5LA 1S5LZ 4O4JB 4MVOA 3ZJZA 1QLNA 3X2QC 4TUYB 1R3LC 3W7WA 1HDJA 1PNKA 4PD4F 1W0KG 2PGGA 3SPJA 5IWAB 1PKXA 1I94O 1NZ6A 4NTWA 3APQA 1GRJA 2KQXA 1HNWB 3STLC 1VQ4V 4X8AA 4O2BB 4X1IA 4DR5O 1Z2GA 2IJJA 4NXMB 1VF6C 5EIBC 1Q5OA 3OTFA 4JI2O 1G8MA 2RMKB 4MVUA 1M57B 5L3FA 5LA6A 1S72V 1AP5A 3HB3B 1Y76B 3FAVB 5KAFZ 4CS2A 1H2MA 1AILA 3F7YC 3CEIA 2XOKG 2UU9O 3P3PA 5CN0A 2OCCC 2YEVB 4AQYO 1QCEA 4DYLA 4WFFA 1YZBA 2CE4A 3B8NA 5H5NA 1V54B 2EIMC 4TWKA 1AI4A 2EZPA 2QEXV 4UXNA 2YEVA 3K08A 3CCJV 4CC6A 4X1YB 4DUZO 2OIEA 1IBLO 4LFCB 3CP1A 1K7DA 2HR3A 1SESA 2YIDA 4KHPB 4JYCA 1K34A 2G38A 3ZHSA 4EB6B 3QO8A 3K57A 1RM1B 3K06A 1K4DC 4J7KA 4JGSA 4YY3O 1HP8A 4F6RB 4X62B 4LF9B 3N2GA 4WBNB 2Q73A 2CH7A 3U0ZA 2P4KA 4DW1A 1S5HC 1IBMB 3BFRA 5CA0B 3E89A 2B1IA 4PA7A 1SERA 3FB8C 3RYHA 1A32A 4BWAA 1KQSU 3FB6C 1I5XA 5JQGA 3JAMN 1ROPA 1XOUA 5IYZB 1V55B 3GB7C 3OEEG 5KA6A 4J41A 4XBFA 5B3SC 2IH3C 4AHCA 3THOA 3WB2A 2GUZB 3ML0A 2P90A 3I56V 1JCHA 2EULA 5JJNB 1K9MW 5B66Z 3CCMV 2A06H 3ABMC 4LF5B 1X4TA 1N32O 1BS3A 2HEPA 3BHPA 3ZHRA 3W7SA 4FM1A 1XBLA 3R65A 4H37A 3SPGA 3TETA 1XNRB 3AG7A 3W7XA 4P9PA 5LMUO 3FB5C 2AZ0A 1PV0A 3AG1B 2CUGA 2KSDA 1GTOA 1GH6A 1YITV 4DR7O 2MK3A 3ZHVA 3UKMA 1TGOA 1YI2V 2F93B 3ZMTA 4JI3O 2N04A 5B1OA 1IBKB 3H1KH 2JVDA 3T4ZA 5LHGA 4ASUG 4I55A 5IJ0A 1XEQA 3A8TA 4OPAA 2UXCB 4MS2A 3H01A 3ZBHA 4O4HB 3OR6C 4UVAA 3U10A 3HPLC 1M93A 2FYUH 5KX5B 2W6IG 4K35A 4O4HA 3SJAC 1URFA 1W0JG 5B1BC 2LJ2A 2CGOA 3ZRSA 2WLKA 1U96A 3E35A 2XASA 4HNAA 4MVSA 3B8MA 4MSWC 3HKEB 5EZYB 4B3RO 4QJFB 3OE7G 4IYHA 2RNBA 4JYBA 1VIBA 2V7QG 1H2LA 4X64B 1AJNA 4ZHQB 5C93A 4Z1MG 4UV9A 2FL4A 5L3CA 1XNQB 3E2EA 1ZWIC 2PUSA 4TUYA 2CH7B 2FB5A 3JATB 2JEXA 4U7NA 1F23A 2DWEC 1DK1A 1IBMO 2IU3A 4MVMA 3ETDA 4YXWG 5H9CA 4J9ZB 5JQGB 4JI6O 5K1PA 5IY5B 5BY1A 2QE7G 4JV5O 3RT3C 3CPWU 2W6JG 3K58A 1YVWA 1NS1A 3G6BA 3QNEA 2E76B 3SYQA 2M6YA 3BY6A 5DECA 3T1HB 3SJCC 4DR2O 4JI7O 3TJTA 1Y66A 4I50A 1OCCB 3K03A 5C8YB 2VWJA 1MABG 3ZN1A 4FLWA 1D2DA 1ZAUA 2WLIB 2LW7A 1NR7A 5IWAO 2Q69A 1P49A 4LFAO 1R6NA 1IXBA 5JH7A 3A0RA 3CCLV 3L73H 4X64O 2LO1A 4NXNO 4MVQA 3VQYA 1BSMA 1JR9A 4NVPA 3AG1C 4R8CA 2KG7A 3DC6A 4HYOA 1BL8A 3B40A 5BR8O 5FLXN 2QM7A 2HG5C 3CRRA 3FYIB 1B04A 3NXSA 4FZ0A 3KZIZ 3KKYA 4F6EA 2WLIA 2DQ0A 4W4LA 4PA4A 3D3QA 4UCVA 2JGUA 3HKDA 5EZYA 2F66C 4MW3A 1PP9H 5CMUA 4J10A 1SQVH 3RGBA 4AI8A 4LF6B 1T5EA 5GONA 2ARHA 5LXTB 4FLYA 4WCEV 4UFZA 4PI2A 3K79A 3OMNB 2QJ1A 3P32A 5KX5A 1WPBA 3Q4HA 1XMQO 5H6QA 2JK5C 1OJHA 3UO3A 1GN4A 1AR1B 4PDMA 4I55B 2HHHB 1XNRO 2ITDC 4NXNB 1EN5A 3JAKA 3SJBC 4NXMO 1Q6IA 2ZM6B 1IX9A 2E5LO 5IDJA 3PJSK 4DR4B 2IM9A 3I55V 1IURA 4NR1A 5FNVB 4NB5A 4ZI7A 2H94A 4K0KO 1V9PA 4TV9B 2V4DA 4GKJB 3EHBB 3EXAA 1Q6HA 4IIJA 4P9OA 4JI6B 3H9VA 1DGSA 1U97A 3KCXA 1SS3A 4O4LA 4DV0O 3JASA 1LR1A 3JSNA 4DR2B 4PDLA 2AXTZ 2HJFC 3FD9A 1E1RG 3OUSA 2BTOA 2F4VB 2R72A 4JZ2A 4GT1A 2IBZH 1JX9A 5JJEB 3K5MA 4KXRA 5A9GA 3CRQA 4XDKA 4D7SA 3C90A 1P7BA 5GTHZ 2CTRA 4FLVA 4UCOA 1Q7YW 3W7TA 4B7KA 2ZM6O 3B09A 2QWNB 5L3GA 2LGQA 2XAJA 5CA3A 2VWKA 2X6BA 1TAEA 2Q7HA 2ZINA 4YHHB 3FFQA 3BVOA 5B3SB 2LFRA 2UUBO 2JDIG 4PELA 2PI5A 1KECA 1CPYA 4DR6O 3VQVA 2QTSA 3K04A 4RWUA 1H8HG 2LP7A 3RYIB 1NJIW 4IYIA 4B08A 1WA8B 4LF8O 3HKCA 3ETGA 2QKCA 1YXBA 1M90W 2UXNA 3QG5A 5IJ0B
chains in the Genus database with same CATH topology
2H8PC 4LBEC 3IFXA 5EK0A 3CCVV 2IJJA 2OT5A 4JPRA 1QBZA 3GWOA 2HVJC 2EJRA 5CBFA 3K0DA 1G8MA 3IGAC 3E8FA 1V55C 1QLEC 3T2MA 5HFMA 2DYSB 4MVUA 1VQ6V 1M57B 1M57C 5EBLC 4QE7A 3CYOA 2P6JA 5L3FA 1S72V 1QVFU 1VQKV 4PDVA 2JIZG 3E83A 3HB3B 1VQMV 3RBZA 2WLLA 2WLMA 4LP8A 3ETEA 1AJPA 1FXKA 1F4MA 1SZTA 2C2AA 1YSCA 3F7YC 1GO3F 3JD2A 1Q81W 1K73W 2OTLV 2WSSG 4TSFG 1K97A 2XOKG 4X89A 2YSUB 3F5WC 2B5UA 3AG4C 5CN0A 2OCCC 4MTGA 2YEVB 2DYRC 4TT3G 1QCEA 1FXKB 4OXSA 4PA9A 4WFFA 1FXHA 1AROP 5LHHA 2PI4A 3B8NA 1GMGA 2V1DA 3CCQV 1V54B 2EIMC 3BEHA 4GCZA 4GX0A 1VQ8V 4TWKA 1K8AW 2ATKC 1AI4A 3ABKB 2EZPA 1N8RW 2QEXV 4UXNA 3SYOA 3CCRV 2JEUA 2YEVA 3K08A 3CCJV 4P30A 1TUEB 1DF4A 3ASOC 1NVPB 3CCUV 1JOYA 1EBOA 3OR7C 1PL0A 3JD3A 1DTOA 1VQOV 1M56C 2QM8A 3CP1A 1K7DA 1XL6A 3AG4B 2HR3A 4R50A 2EIKC 1SESA 2GSMB 3VBBA 3JD4A 4JYCA 1KP3A 2ZQMA 2DQ3A 1K34A 4JTCB 1YTFB 3QO8A 1YJ9V 1RM1B 3K06A 1K4DC 4U7OA 4JGSA 3FYEB 4FJCC 2KB1A 1VQ9V 4WFBV 2DW4A 4G27B 1S5HC 1YHQV 1SRYA 1AI7A 1OHHG 1YJWV 2IJIA 3E89A 4KUMA 2B1IA 2ZDIC 2Y48A 3FKSG 4PA7A 1SERA 3FB8C 1B6QA 5EC1C 1MOFA 4XDJA 1KQSU 3FB6C 1I5XA 1YJNV 1G4YB 4BIUA 1FS0G 1ROPA 4HZ3A 1V55B 3GB7C 3OEEG 5KA6A 3LDCA 5L3BA 1PNLA 4XDLA 4XBFA 5B3SC 2IH3C 1F4NA 1NBMG 3E8GA 4JAUA 1VQLV 2EINC 3ML0A 2P90A 3I56V 1JCHA 1K9MW 1QR8A 1FXVA 3CCMV 3OW2U 2XAGA 3ABMC 1M1KW 1QVGU 3B77A 5B1AB 2AHZA 2X7RB 3W7SA 2W0FC 3G4SV 1PNMA 2OCCB 3OM3B 3R65A 3SPIA 4H37A 3SPGA 1EFRG 3TETA 1GM8A 1QR9A 2Y69B 2X0LA 3W7XA 3CXCU 4P9PA 2WWWA 3FB5C 3VOUA 3X2QB 4EKWA 5EC2C 3AG1B 3CMAV 5L3DA 5KA5A 1GTOA 3G6EV 4JTDB 2UXXA 3ZRWB 1YITV 4JAVA 4KFMA 2MK3A 1H8EG 3T4DA 3UKMA 2Q68A 3JD0A 2P7TC 1YI2V 2BOBC 3ZMZA 1S77D 3ZMTA 5CBHA 2A79B 4FMTA 2IJKA 4RUFA 1DLBA 1PD3A 3WFVA 4WF9V 5B1OA 3AEIA 3P30A 4MVRA 1JVMA 3T4ZA 1THZA 5LHGA 2A0LA 4ASUG 2M7WA 2WLJA 1OCRB 3SPCA 1OCZC 1OCZB 4MS2A 3H01A 2AHYA 1NKDA 1JQ0A 2X6AA 1E1QG 3OR6C 4UVAA 4DO2A 3ABKC 3IC7A 3MHHC 3ZRWA 5FL7G 3HPLC 1H2GA 2W6IG 4GX1A 4JF3A 1RPRA 2HVKC 3E8BA 3OGCC 1OZ0A 1K5QA 4RO2A 3ASNC 3ASNB 1W0JG 5B1BC 3QO5A 3ZRSA 2WLKA 3AG3C 3E35A 2XASA 3ZCCA 4MVSA 3B8MA 1Y4MA 4MSWC 3W7UA 3ZRXA 2ZXWB 4QJFB 3OE7G 1FXKC 4JYBA 1IXMA 4R6ZA 1M56B 2Q6AA 2QTOA 1H38A 1OCRC 1OCOB 2V7QG 2Q67A 2ZR2A 5EBMC 1KD1W 1AJNA 4I5SA 2XAFA 3LSSA 5IYDO 3WG7B 5C93A 3UM7A 5KUKA 4Z1MG 2XAHA 4UV9A 4QPJA 4Q20A 4ZKIA 5L3CA 1YTFD 3E2EA 1ZWIC 3OAAG 4JTAB 1ORQC 4WFEA 2JEXA 2R9IA 1COWG 4U7NA 1F23A 2NLJC 2DWEC 2IU3A 4QE9A 4MVMA 3ETDA 1CP9A 1VQNV 4YXWG 5H9CA 4J9ZB 5B1BB 1RPOA 4CZZA 5IY5B 2WPDG 1Q86W 3DGEA 1K33A 2QE7G 4N21A 5B1AC 1CEZA 1WPXA 3CPWU 2W6JG 4UVBA 4E2LA 1KKDA 3CMEV 3QNEA 3ZN0A 3SYQA 1AI5A 1S0VA 3OMAB 3BY6A 3RW0A 3LNMB 4QIWF 3SPHA 3WG7C 1Y66A 3D3IA 1NR1A 1OCCB 3K03A 1OCCC 5J9PC 1MABG 2JJ2G 3RVZA 1S76D 3ZN1A 4FK5C 2ITCC 4MTXA 1R6KA 3ZMVA 3OFNG 2IJHA 5LGTA 3RVYA 2WLIB 1NR7A 2Z3YA 1NH2B 4RAIA 3CC7V 3T1CA 2EINB 3ABMB 2Q69A 4MTFA 3K3WA 4G2KA 1R6NA 3CC2V 3MHSC 4BAYA 2GHYA 3ZRVA 4G28B 3A0RA 1K4CC 3SYPA 3CCLV 4DXWA 4X88A 4MT8A 2IH1C 4MVQA 4FPPA 3CCEV 2EIJC 5BZBA 1Q82W 3AG2C 2DYRB 1MSWD 1BMFG 3AG1C 3JD1A 4R8CA 1BHAA 5IYBO 5EBWC 1KP2A 1F51A 1R73A 3TK1A 3LDEA 5L3EA 1FFTB 1S3JA 4HYOA 2ZR3A 1BL8A 3CCSV 2DYSC 2WLLB 3ZIAG 2QM7A 1XL4A 2BOCC 2HG5C 3FYIB 4J9YB 3NXSA 3LUTB 4CBCA 3D36A 2NNUA 4GX2A 2HLDG 3QO7A 2IU0A 1AJQA 2HFEC 1K92A 2WLIA 2DQ0A 4LC1A 3SJQC 4PA4A 4UUJC 2QKSA 3LSQA 4UVCA 4I9WA 4KP4A 3K0GA 4MW3A 5CMUA 1EZJA 5GW7A 1I5YA 1P4RA 1VQ5V 2EIJB 1OCOC 3FB7C 1QLEB 2EIKB 2LFSA 3EFFK 3ABTA 4UV8A 4WCEV 3K79A 3OMNB 3P32A 1GM7A 3CC4V 3G71V 2HKOA 3F7VC 3OEHG 4RQEA 1J95A 2WLNA 2XNDG 3ZMSA 5H6QA 2JK5C 2D3OW 2EBOA 1K5SA 3M99B 4MTOA 3DTUB 1AR1B 2ZDIA 4N23A 3E86A 4PDMA 1GK9A 4MVZA 1BHBA 3JYCA 3ASOB 2ITDC 4RUEA 2CK3G 5LHIA 3AG3B 2ZXWC 5E1AC 4L87A 5DM6V 5HFLA 3OUFA 2P67A 4PA3A 5IDJA 1JJ2U 2EIMB 1R3IC 5B1NA 3PJSK 4BW5A 2K1EA 3I55V 1GM9A 4GX5A 2OTJV 1HWYA 2H94A 2XAQA 3ABUA 3STZC 1M9NA 1ENVA 1W2BU 1AI6A 2WLHA 5IYCO 3EHBB 1GKFA 5LGNA 3JCZA 4WFGA 1VQ7V 4P9OA 4FIPC 1DF5A 2DWDC 5CBGA 4WFAV 4R7CA 4BIZA 1LNQA 5IY5C 4H33A 3CD6V 4PDLA 2HJFC 2Y69C 1E1RG 1WLEA 3OUSA 1NQTA 2EILC 3ZMUA 1E79G 1KC8W 2QA4V 1VQPV 2A9HA 3ABLB 3LDDA 1RM1C 3E8HA 4GT1A 1YIJV 1JX9A 5LGUA 1NH2D 3SYCA 5KUMA 4XDKA 1UJWB 2FTKA 3K9AA 2EZOA 1P7BA 4PDRA 1K3EA 2JJ1G 5DN6G 4JASA 2X6CA 3SYAA 2R9RB 1Q7YW 5LBQA 3W7TA 1R3KC 1L1FA 2F43G 5L3GA 4RQFA 3OMIB 4QPKA 1SETA 2XAJA 5CA3A 2ZD9A 2X6BA 4P2ZA 1MG1A 3TCUA 2B1GA 4WFHA 1R3JC 2EILB 2IW5A 4MVOA 3ZJZA 5B3SB 1JPXA 3AG2B 4QNHB 2LFRA 1QLNA 2JDIG 3ABLC 3X2QC 4F4LA 1R3LC 4PELA 3W7WA 1V54C 2PI5A 4LCUC 1KECA 1CPYA 1PNKA 4ZBMA 3K04A 1H8HG 2WAMA 1W0KG 2LP7A 4PA6A 4MW8A 1NJIW 5H6RA 3SPJA 1PKXA 4HAMA 3MD0A 1NVPD 3STLC 1VQ4V 3ETGA 4X8AA 1M90W 2Z5UA 2UXNA 3KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  3JYC A;  4LBE C;  3IFX A;  5EK0 A;  2NLJ C;  2ITD C;  2DWE C;  4RUE A;  3LDC A;  2HVJ C;  4QE9 A;  4MVM A;  5CBF A;  4XDL A;  5B3S C;  2ZXW C;  3K0D A;  2IH3 C;  4J9Z B;  3E8G A;  3IGA C;  5E1A C;  1V55 C;  1QLE C;  2EIN C;  3E8F A;  3OUF A;  4MVU A;  5B1A C;  3T2M A;  1M57 C;  5EBL C;  4QE7 A;  4PA3 A;  4PDV A;  1R3I C;  4BW5 A;  3PJS K;  1KKD A;  2K1E A;  3ABM C;  3E83 A;  4GX5 A;  3SYQ A;  3RBZ A;  2AHZ A;  2WLL A;  2WLM A;  3RW0 A;  3STZ C;  4LP8 A;  2W0F C;  3LNM B;  3SPH A;  3R65 A;  2WLH A;  3SPI A;  4H37 A;  3SPG A;  3TET A;  3WG7 C;  3F7Y C;  4P9P A;  5J9P C;  3K03 A;  1OCC C;  4WFG A;  3FB5 C;  4P9O A;  4X89 A;  3RVZ A;  3F5W C;  3VOU A;  4EKW A;  3AG4 C;  2ITC C;  5EC2 C;  2DWD C;  2OCC C;  4MTG A;  2DYR C;  2WLI B;  3RVY A;  5CBG A;  4JTD B;  4R7C A;  1LNQ A;  4OXS A;  4RAI A;  4PA9 A;  3T1C A;  4WFF A;  5IY5 C;  2Q69 A;  4KFM A;  4MTF A;  3T4D A;  3UKM A;  4H33 A;  2EIM C;  3BEH A;  2Q68 A;  4GX0 A;  4PDL A;  2HJF C;  4TWK A;  2Y69 C;  2P7T C;  2ATK C;  3OUS A;  2BOB C;  4G28 B;  2EIL C;  1K4C C;  2A79 B;  4RUF A;  3SYP A;  5CBH A;  3SYO A;  4DXW A;  2A9H A;  2YEV A;  4X88 A;  2IH1 C;  3K08 A;  4MVQ A;  2EIJ C;  3LDD A;  4P30 A;  5BZB A;  3E8H A;  3AG2 C;  4MVR A;  3ASO C;  1JVM A;  3AG1 C;  4R8C A;  3T4Z A;  5EBW C;  3SYC A;  2A0L A;  5KUM A;  4XDK A;  2WLJ A;  3OR7 C;  3SPC A;  3LDE A;  1P7B A;  4MVZ A;  1M56 C;  4HYO A;  4PDR A;  1BL8 A;  2DYS C;  1OCZ C;  2WLL B;  2X6C A;  3SYA A;  1XL6 A;  2R9R B;  1XL4 A;  2BOC C;  2HG5 C;  4J9Y B;  4MS2 A;  4R50 A;  2AHY A;  2EIK C;  3LUT B;  2X6A A;  3OR6 C;  4CBC A;  1R3K C;  3ABK C;  4GX2 A;  2HFE C;  3HPL C;  2WLI A;  4GX1 A;  3SJQ C;  2ZD9 A;  2HVK C;  3E8B A;  4JTC B;  3OGC C;  4PA4 A;  2X6B A;  4P2Z A;  4RO2 A;  3K06 A;  1K4D C;  3TCU A;  3ASN C;  4UUJ C;  2QKS A;  4WFH A;  4I9W A;  1R3J C;  3K0G A;  4MW3 A;  2KB1 A;  5B1B C;  3ZRS A;  4MVO A;  2WLK A;  3AG3 C;  3ZJZ A;  4QNH B;  3X2Q C;  3ABL C;  4MVS A;  4G27 B;  4MSW C;  1OCO C;  1R3L C;  3FB7 C;  1V54 C;  4F4L A;  1S5H C;  4LCU C;  3EFF K;  4ZBM A;  3K04 A;  3E89 A;  4PA6 A;  4R6Z A;  2Q6A A;  4MW8 A;  4PA7 A;  3SPJ A;  2QTO A;  3FB8 C;  1OCR C;  5EBM C;  5EC1 C;  2Q67 A;  3F7V C;  4XDJ A;  1J95 A;  3UM7 A;  2WLN A;  3FB6 C;  5KUK A;  2JK5 C;  1G4Y B;  3STL C;  1ZWI C;  4HZ3 A;  4X8A A;  4MTO A;  4JTA B;  1ORQ C;  4WFE A;  3E86 A;  3KG2 A;  4PDM A;  3GB7 C; 
#chains in the Genus database with same CATH topology
 3IFX A;  5EK0 A;  2OT5 A;  3GWO A;  2HVJ C;  2EJR A;  5CBF A;  1D5N A;  2YXH A;  2Y0I A;  1V55 C;  1QLE C;  5HFM A;  2DYS B;  1WNS A;  1VQ6 V;  3JAR A;  1M57 C;  5JCO A;  2YIB A;  2YI9 A;  3E83 A;  3LNN A;  4X1K A;  4FFB B;  2WLL A;  1PPJ H;  4LP8 A;  4DW0 A;  1RSO A;  2C2A A;  1Q81 W;  3N2G B;  2OTL V;  2WSS G;  3UO2 A;  4X89 A;  1K97 A;  4TV8 A;  1HNW O;  3RWR D;  4L8J A;  5J2T A;  3WB1 A;  4DR5 B;  2VS0 A;  4PA9 A;  1KKC A;  5LHH A;  2PI4 A;  1GMG A;  2V1D A;  2ATK C;  4DR6 B;  3SYO A;  2NN4 A;  4P30 A;  1TUE B;  1DF4 A;  3ASO C;  2OIG A;  3IC9 A;  1JOY A;  1EBO A;  4B7E A;  4X66 B;  3OR7 C;  1LUW A;  2YIC A;  1FKA O;  1RSO B;  1Q8I A;  4IGG A;  1S5J A;  5GTI Z;  1KP3 A;  2CTW A;  2ZQM A;  5D5P A;  1GAX A;  4O4I B;  2OCH A;  4TOI A;  2ODM A;  4U7O A;  3ZHT A;  2KB1 A;  4JI0 O;  1HW7 A;  1H2S B;  1XMO O;  2RN9 A;  4Z2W A;  1SRY A;  3ZS8 C;  1MOF A;  4B3R B;  4XDJ A;  5JH7 B;  2ZIO A;  4I4T B;  1YJN V;  4FM0 A;  4BIU A;  4K8X A;  4DR1 O;  3CX5 F;  3JAW A;  1PL4 A;  3L75 H;  5L3B A;  1PNL A;  4JAU A;  1VQL V;  4H0L B;  4K8Z A;  1QR8 A;  3OW2 U;  2XAG A;  1QVG U;  3B77 A;  2N74 A;  5B1A B;  2W0F C;  1PNM A;  3SPI A;  1W59 A;  5J2U A;  3JAR B;  2Y69 B;  2X0L A;  3O65 A;  1XI1 A;  1QNM A;  2WWW A;  1MNG A;  4X1Y A;  2XTA A;  3VOU A;  3BCC H;  4EKW A;  4PHZ A;  4GKK B;  1H2N A;  4FLU A;  4C7U A;  4JTD B;  3NR7 A;  2UXX A;  3JAW B;  5ITZ A;  4KFM A;  3JD0 A;  1XUQ A;  2BOB C;  3RYC B;  2AZ2 A;  1S77 D;  1KUQ A;  4FMT A;  3T1Y B;  1I94 B;  4D6T H;  2Q0A A;  4MVR A;  1XQ8 A;  1JVM A;  1THZ A;  2A0L A;  4EFE A;  3CHX A;  1OCR B;  4DV7 O;  4UCT A;  2BE3 A;  3CRM A;  5KLV H;  2F1M A;  3MHH C;  5FL7 G;  2BTQ A;  4X65 O;  4GX1 A;  4JF3 A;  3E8B A;  3ASN C;  3JAK B;  3AG3 C;  3ZCC A;  4B3S O;  1KB9 F;  4F6R A;  4I9Q A;  5IYZ A;  3WB0 A;  2QR4 A;  4FLT A;  4JI1 O;  3APO A;  2PTM A;  1FXK C;  3VQW A;  1M56 B;  2Q6A A;  1OCR C;  5B5E Z;  1X59 A;  4I5S A;  5IYD O;  2GUZ A;  5KUK A;  4E4E A;  3BAB A;  3BPZ A;  3UQ8 A;  4WFE A;  3HKB B;  1VAR A;  3BA8 A;  5JWP A;  1YEW A;  4O4J A;  4JI4 B;  4QE9 A;  5JVD A;  4JAA A;  5LMN B;  1MSD A;  1Z5W A;  4CZZ A;  2WPD G;  1Q86 W;  3DGE A;  1K33 A;  3CB2 A;  4E2L A;  1KKD A;  2ZE8 A;  5LL6 Y;  1N33 B;  1F7Y A;  3SPH A;  2EJ7 A;  4YJ3 A;  2N05 A;  2UXB B;  2CAZ C;  5BR8 B;  1OCC C;  4ZIB A;  4GKJ O;  1S76 D;  2GV9 A;  4MTX A;  1R6K A;  3OFN G;  3H1L H;  1Y6X A;  3HKB A;  3RYC A;  1NH2 B;  3CC7 V;  3T1C A;  2EIN B;  4GYC B;  3ABM B;  1Y67 A;  1NU1 H;  4QGP A;  5IJ9 B;  1Y74 A;  4BAY A;  4G28 B;  2AGA A;  4X66 O;  2F23 A;  4DXW A;  4OPH A;  4DV0 B;  5IT9 N;  4MT8 A;  5BMV A;  2EIJ C;  5BZB A;  3BA9 A;  3SGI A;  1BHA A;  5EBW C;  1KP2 A;  4FFK A;  1F51 A;  3MDS A;  1XMQ B;  2QWO B;  1S3J A;  2RDC A;  2WLL B;  3ZIA G;  3OGI B;  2NNU A;  3QO7 A;  4IHJ A;  2ADP A;  5LMN O;  3E22 A;  3SJQ C;  2QKS A;  3JAL A;  1G6U A;  2E5L B;  4LWS A;  1EZJ A;  4I50 B;  4O2A B;  1I5Y A;  2EIJ B;  4JI2 B;  1SC5 B;  2EIK B;  2LFS A;  3ABT A;  1GM7 A;  2BTQ B;  3CC4 V;  2HKO A;  4AIL C;  3F7V C;  3OEH G;  4A5U B;  2XND G;  3ZMS A;  2RCV A;  1L8D A;  4MTO A;  2ZDI A;  1MMM A;  2YDE A;  4B3T B;  4MVZ A;  2Q9L A;  3JYC A;  1N34 O;  4X9Q A;  4LF6 O;  5E1A C;  4L87 A;  5IE9 A;  3DXR A;  1IBK O;  3IAY A;  2P67 A;  4LH6 A;  3GWK C;  1JJ2 U;  2EIM B;  3UT5 B;  1R3I C;  2A3Q A;  3CE2 A;  4ZI7 B;  2OTJ V;  1HWY A;  3B4S A;  1ENV A;  2WLH A;  5IYC O;  2YIB D;  3JCZ A;  4WFG A;  1VQ7 V;  3HKD B;  4DV4 O;  2DWD C;  5CBG A;  1LNQ A;  1SQB H;  4O2B A;  3CD6 V;  2Y69 C;  3N2K A;  4TQF A;  1GN6 A;  1NQT A;  1E79 G;  1JMK C;  3A2F A;  2A9H A;  2VRZ A;  3LDD A;  3E8H A;  1SQG A;  2LW1 A;  2ZIM A;  1BT8 A;  5C8Y A;  5LGU A;  1LUV A;  3UCS C;  5CA1 B;  5KHK A;  2X6C A;  4X1K B;  2F43 G;  2ZD9 A;  4DV1 B;  4YJ2 A;  2B1G A;  1R3J C;  2YIA A;  2E3C A;  1JPX A;  1P7G A;  5AG2 A;  4ZOL B;  3ABL C;  1BQZ A;  1CXZ B;  4LCU C;  4ZBM A;  1BE3 H;  2YC0 A;  2ZNI A;  1MZE A;  4FFB A;  4PA6 A;  3KCY A;  4MW8 A;  5H6R A;  4JI5 O;  5LP6 B;  3S3X A;  3AK2 A;  1WAZ A;  3JAS B;  1NVP D;  1RP3 B;  2Z5U A;  2H3O A;  1HNX B;  1HR0 B;  3LDE A;  3KG2 A;  4DV6 B;  1QHT A;  2H8P C;  1XDC A;  3CCV V;  4JPR A;  1QU7 A;  1QBZ A;  2VQE O;  1FJG B;  1XNQ O;  3K0D A;  2VQE B;  1FJG O;  3E8F A;  2UUA O;  1XIL A;  4EB6 A;  4LF9 O;  1TVK B;  4QE7 A;  1QVF U;  1SZX A;  2YUA A;  4DR7 B;  2Y4T A;  3CJH A;  2JIZ G;  4LF7 O;  1JFF A;  3RBZ A;  2QSA A;  1ZX3 A;  5LYJ B;  3ETE A;  1VP7 A;  1F4M A;  1SZT A;  3SDL A;  1GO3 F;  1K73 W;  4TSF G;  3F5W C;  2B5U A;  3AG4 C;  4BW9 A;  2DYR C;  3G80 A;  3E22 B;  4LFB B;  4GZR B;  3GVM A;  5EYP B;  2GTA A;  4GX0 A;  1N8R W;  2KKW A;  2K9P A;  3K5N A;  2JEU A;  4J11 A;  4I0X B;  1NVP B;  4I0X A;  3JAT A;  3JD3 A;  1NTZ H;  3LSU A;  1DTO A;  1VQO V;  1M56 C;  2QM8 A;  4K3A A;  3AG4 B;  1UPG A;  2EIK C;  2GSM B;  3QTC A;  4O4L B;  2LQT A;  2P4V A;  4DR3 O;  2DQ3 A;  2ZE6 A;  1YTF B;  2LGW A;  4X62 O;  3FYE B;  2CGN A;  3ZHQ A;  1VQ9 V;  4WFB V;  4W4K A;  4LF7 B;  4UB6 Z;  2IJI A;  1IVS A;  2Y48 A;  1B6Q A;  4IL6 Z;  3A0H Z;  1Y74 B;  2Y4U A;  1XRE A;  1G4Y B;  2PY5 A;  5CA1 A;  4ABM A;  3I5D A;  2E74 B;  4TV8 B;  3ZX6 A;  1M5I A;  1YDX A;  3C3S A;  1F4N A;  3E8G A;  2JS3 A;  1M1K W;  4UB8 Z;  4U3F H;  2X7R B;  3H1H H;  3G4S V;  3ETQ A;  3OM3 B;  1EFR G;  1GM8 A;  3BAA A;  4DV6 O;  4LFC O;  2DMX A;  2PYL A;  5EC2 C;  3CMA V;  3EVK A;  5CB4 B;  5L3D A;  3G6E V;  1FFX B;  1IDS A;  4DR4 O;  4JAV A;  1BCC H;  2JS5 A;  1JFF B;  2Q68 A;  4CH6 A;  2P7T C;  2A79 B;  2GBO A;  4ICG A;  4DUY B;  4LH7 A;  5A2Q N;  1PD3 A;  2YXY A;  3WFV A;  4WF9 V;  3DSQ A;  3AEI A;  3P30 A;  2AW9 A;  4JI3 B;  4GLX A;  2M7W A;  1OCZ C;  2AHY A;  1NKD A;  1JQ0 A;  2HJD A;  1E1Q G;  2NR5 A;  2X6A A;  4DO2 A;  2DE0 X;  4JI7 B;  2DJV A;  3ZRW A;  1N36 B;  5LOV B;  1H2G A;  3RYI A;  2HVK C;  3OGC C;  1K5Q A;  4RO2 A;  5KHG A;  3QO5 A;  1NTK H;  1WN7 A;  1Y4M A;  1AR4 A;  3W7U A;  5KHI A;  2ZXW B;  4FZ1 A;  3FAV A;  5EIB D;  4R6Z A;  5KAI Z;  2QTO A;  4Q6G A;  1H38 A;  2Q67 A;  1KD1 W;  1TUB B;  2XAF A;  3UM7 A;  5DED A;  2P06 A;  4K0K B;  2GDS A;  4ZKI A;  4QPJ A;  1KU9 A;  2QGN A;  1ORQ C;  1NI8 A;  5JCO C;  3A0B Z;  1COW G;  2NLJ C;  3TXQ A;  3ICX A;  4FVM A;  2P22 C;  1VQN V;  1I7F A;  1L0N H;  5TIS Z;  4DV2 B;  2CTQ A;  1WPX A;  4B3M O;  4IHJ B;  4B3M B;  3RYF B;  2YI8 A;  1AI5 A;  4GUN A;  3CRC A;  4QIW F;  1J5E B;  5J9P C;  2EX3 A;  1L0L H;  2JJ2 G;  1GN3 A;  2ZCE A;  3J80 N;  4DV4 B;  2IJH A;  1N36 O;  1ZSP A;  3K9S A;  4RAI A;  4JI5 B;  3F5T A;  4MTF A;  3K3W A;  4G2K A;  4OX9 B;  1N32 B;  4JI8 B;  3ZRV A;  4DR3 B;  5CB4 A;  2PF4 E;  1TA8 A;  1Q82 W;  2DYR B;  3VQX A;  1MSW D;  1BMF G;  1VF6 A;  3CXH F;  1MA1 A;  4O2A A;  2QKA A;  2BSK B;  1IZ3 A;  1R73 A;  3JSL A;  1FFT B;  4CS4 A;  2ZR3 A;  3CCS V;  2DYS C;  5FPO A;  4PV1 B;  3RN4 A;  3D36 A;  2FML A;  4GX2 A;  2HLD G;  3WU2 Z;  1GN2 A;  2HFE C;  5J2T B;  4UUJ C;  3LSQ A;  2UXD O;  3H1I H;  4UVC A;  3K0G A;  2UXD B;  2JGD B;  4H44 B;  3ZED A;  4DV1 O;  3M8A A;  1P4R A;  1VQ5 V;  1OCO C;  3FB7 C;  1QLE B;  4GKK O;  3EFF K;  1EN4 A;  1EN6 A;  4UV8 A;  3G67 A;  4JYA B;  5LOV A;  3L70 H;  3UT5 A;  2F4V O;  2RJZ A;  4RQE A;  3N2K B;  2WLN A;  2D3O W;  1HNZ O;  1K5S A;  3BRC A;  1KYO F;  3DTU B;  3DC5 A;  4N23 A;  3E86 A;  1FFX A;  1GK9 A;  2R9A A;  3ASO B;  4RUE A;  2W0X A;  1ZL8 B;  2CK3 G;  2QWP B;  2ZXW C;  4OX9 O;  5DM6 V;  3C3T A;  5B1N A;  4BW5 A;  2K1E A;  1GM9 A;  4GX5 A;  2XAQ A;  3ABU A;  4FM2 A;  1M9N A;  4J80 A;  1W2B U;  1Q6U A;  4DV3 B;  1GKF A;  5LGN A;  4DV5 O;  4FIP C;  1DF5 A;  2A7W A;  5BMV B;  1O9H A;  4B3S B;  1B3Q A;  3K59 A;  2O57 A;  3CS5 A;  4H33 A;  5H2F Z;  5BXZ A;  1WLE A;  2EIL C;  3ZMU A;  1KC8 W;  2QA4 V;  1VQP V;  1Q43 A;  3ABL B;  1SQX H;  1RM1 C;  1YIJ V;  5LXT A;  2QM4 A;  1P84 F;  1NH2 D;  4FLX A;  3SYC A;  5KUM A;  1UJW B;  2OYQ A;  2ZKO A;  3K9A A;  2EZO A;  4TV9 A;  1K3E A;  2JJ1 G;  5DN6 G;  4LFA B;  4JAS A;  3SYA A;  2R70 A;  1R3K C;  3RFR A;  3K5O A;  4RQF A;  2BCC H;  1MG1 A;  1EM1 A;  5LMU B;  4WFH A;  3L71 H;  4YY3 B;  2L35 A;  2EIL B;  4DV7 B;  2IW5 A;  1BGY H;  2BSK A;  4NTX A;  4ZOL A;  4QNH B;  3AG2 B;  5J2U B;  4F4L A;  1V54 C;  2UUB B;  1SA0 B;  4J42 A;  3PN1 A;  2WAM A;  4DV5 B;  1VMG A;  4B3T O;  1ZTE A;  2B9Z A;  1N0J A;  2OWO A;  3IJ4 A;  3S3W A;  1AR5 A;  4HAM A;  3MD0 A;  4LF8 B;  3L72 H;  1SA0 A;  2RQ6 A;  1N0N A;  2JRI A;  4JV5 B;  4LBE C;  4WBN A;  4J7J A;  1PM9 A;  3IGA C;  1XHZ A;  3T2M A;  3H1J H;  5EBL C;  3CYO A;  2P6J A;  1VQK V;  1US6 A;  4PDV A;  4EFB A;  1VQM V;  2ILM A;  5KHJ A;  2WLM A;  5JJJ B;  1AJP A;  1FXK A;  3AK1 A;  1YSC A;  2DOS A;  3JD2 A;  1SQF A;  2YSU B;  1B06 A;  4CC5 A;  4MTG A;  3L9D A;  2Q7E A;  4TT3 G;  1JJO A;  3P3N A;  1FXK B;  2UXB O;  4OXS A;  3J7A U;  1FXH A;  2QWQ B;  1ARO P;  3CCQ V;  1Y76 A;  3BEH A;  4GCZ A;  4U3J A;  1VQ8 V;  1N33 O;  1K8A W;  3OTO B;  3ABK B;  3CCR V;  4FLZ A;  3D36 C;  3CCU V;  4Z1V A;  4CS3 A;  4YJ3 B;  3N27 A;  1PL0 A;  2P5O A;  4LNU B;  1XL6 A;  4R50 A;  3VBB A;  4ZHQ A;  4LF4 B;  3JD4 A;  1XHX A;  4JYY A;  4JTC B;  1YJ9 V;  3FX7 A;  4FJC C;  3HKE A;  1WJZ A;  2DW4 A;  4KL1 A;  3T1Y O;  1AVM A;  1KBH A;  4G27 B;  4LWS B;  1YHQ V;  1WB7 A;  1AI7 A;  1OHH G;  1YJW V;  2HHH O;  4KUM A;  2VQF B;  1YF2 A;  2ZDI C;  4IT5 A;  3FKS G;  5LP6 A;  4TQD A;  2VQF O;  5EC1 C;  1NT2 B;  3D8C A;  5EYP A;  5IJ9 A;  1FS0 G;  4HZ3 A;  3MAQ A;  1G1X B;  4HNA B;  2XUM A;  3LDC A;  1O9G A;  2ZT9 B;  4XDL A;  4UCS A;  1NBM G;  2EIN C;  3Q4H B;  1FXV A;  1D5A A;  1Z5V A;  5KHH A;  2AHZ A;  2UUC O;  4LF4 O;  2OCC B;  2WA3 A;  4YIO A;  1QR9 A;  5K1X A;  3CXC U;  2Q5Z A;  3QF7 A;  4LFB O;  5E79 Z;  3JAL B;  3X2Q B;  4O4I A;  4CH5 A;  1FYJ A;  5KA5 A;  3CRA A;  1ZLZ A;  1FD9 A;  3ZRW B;  4JYA O;  1H8E G;  3T4D A;  4NTY A;  2Y0P A;  3CJH B;  1HNZ B;  1AP6 A;  3ZMZ A;  5CBH A;  4RUF A;  2IJK A;  4LF5 O;  1DLB A;  1SKV A;  2L6L A;  4DUZ B;  1VEW A;  1VF7 A;  4LR3 A;  3HR0 A;  1HNX O;  1HR0 O;  2WLJ A;  3SPC A;  1OCZ B;  4U3J B;  2HP8 A;  1N4C A;  1WA8 A;  3ABK C;  3IC7 A;  2UUA B;  3OTO O;  1RPR A;  1OZ0 A;  3ASN B;  3B2E E;  4LNU A;  1ZL8 A;  5GON B;  2GTS A;  3J81 N;  4D7T A;  3ZRX A;  2ZE5 A;  2MW2 B;  3O9O A;  3RYF A;  1IXM A;  1OCO B;  2ZR2 A;  5EBM C;  3LSS A;  5LA6 B;  3WG7 B;  1KMI Z;  1TVK A;  4YIP A;  2XAH A;  4Q20 A;  2YXL A;  1YTF D;  2WA4 A;  3OAA G;  4JTA B;  5ITZ B;  1RFY A;  1XMO B;  2ETN A;  2KG7 B;  2R9I A;  4BIO A;  1CP9 A;  4DK0 A;  1Q90 D;  1R6T A;  1SF9 A;  1ZUQ A;  4X20 B;  5B1B B;  1AB3 A;  1RPO A;  3OD4 A;  5B1A C;  4N21 A;  4BR6 A;  1CEZ A;  2Q0O C;  2QWR B;  4UVB A;  1H2K A;  5KMG B;  2XT9 A;  4PI0 A;  3CME V;  3ZN0 A;  4DR1 B;  2FKX A;  1S0V A;  3OMA B;  3OT7 A;  3AK3 A;  3RW0 A;  5KMG A;  2DN9 A;  3LNM B;  2PZS A;  3WG7 C;  3D3I A;  2JGD A;  1NR1 A;  4UCU A;  3RVZ A;  4FK5 C;  4IIJ B;  2ITC C;  1QQC A;  3ZMV A;  4X65 B;  1Q3E A;  1WB8 A;  5LGT A;  3RVY A;  2ZE7 A;  3JCU Z;  4X1I B;  1N34 B;  2Z3Y A;  2UUC B;  3CC2 V;  4DV2 O;  3RYH B;  3MHS C;  4PJ0 Z;  2GHY A;  1K4C C;  3SYP A;  4UCR A;  3SR2 C;  4X88 A;  1I0H A;  2IH1 C;  3CCE V;  4FPP A;  5F2V O;  2UXC O;  3AG2 C;  1JA8 A;  3R66 A;  3JD1 A;  3CWB H;  5IYB O;  3U11 A;  3TK1 A;  5L3E A;  4JI4 O;  4HBN A;  1J5E O;  1XL4 A;  2BOC C;  4J9Y B;  5FNV A;  4CBC A;  3LUT B;  5LP6 C;  2IU0 A;  1AJQ A;  2Q7G A;  1YCI A;  1K92 A;  4DK1 A;  2D2C B;  4LC1 A;  1EZV H;  4I9W A;  4KP4 A;  4DRX B;  4EEQ A;  5GW7 A;  4CH4 A;  4DRX A;  3TXS A;  4YJ2 B;  2PYJ A;  4KHP O;  4YHH O;  4I4T A;  4DV3 O;  1TUB A;  3M7M X;  3G71 V;  1FAF A;  1VF5 B;  1J95 A;  4J7Z A;  3QVN A;  2EBO A;  3M99 B;  2CDY A;  4NYK A;  1FPO A;  1SQP H;  1WP8 A;  1BHB A;  1BQ0 A;  4DUY O;  1R1B A;  5LHI A;  3AG3 B;  2QDO A;  2XHB A;  3HKC B;  3OUF A;  1M4U A;  5HFL A;  4PA3 A;  2E75 B;  2Q8V A;  1NTM H;  3T1H O;  1OV9 A;  3STZ C;  1AI6 A;  4I7Z B;  4JI0 B;  2F95 B;  3TGU H;  1IBL B;  4JI8 O;  2CTP A;  1BZK A;  5FPR A;  4WFA V;  3L74 H;  4R7C A;  2Q4P A;  4BIZ A;  5IY5 C;  2ZNJ A;  1I08 A;  1MZF A;  4H13 B;  3CSX A;  1SQQ H;  1WP7 A;  2Z0A A;  4CH3 A;  2FTK A;  4PDR A;  5LYJ A;  2R9R B;  4OGQ B;  5D5Q A;  5LBQ A;  1L1F A;  4AQY B;  4JI1 B;  3OMI B;  4NKG B;  4QPK A;  1SET A;  2YS8 A;  3DXR B;  1UFI A;  2ADQ B;  3ZHU A;  4P2Z A;  5CA0 A;  4X20 A;  2UU9 B;  4JZG A;  3TCU A;  5JVD B;  3K5L A;  1S5L Z;  4O4J B;  4MVO A;  3ZJZ A;  1QLN A;  3X2Q C;  4TUY B;  1R3L C;  3W7W A;  1HDJ A;  1PNK A;  4PD4 F;  1W0K G;  2PGG A;  3SPJ A;  5IWA B;  1PKX A;  1I94 O;  1NZ6 A;  4NTW A;  3APQ A;  1GRJ A;  2KQX A;  1HNW B;  3STL C;  1VQ4 V;  4X8A A;  4O2B B;  4X1I A;  4DR5 O;  1Z2G A;  2IJJ A;  4NXM B;  1VF6 C;  5EIB C;  1Q5O A;  3OTF A;  4JI2 O;  1G8M A;  2RMK B;  4MVU A;  1M57 B;  5L3F A;  5LA6 A;  1S72 V;  1AP5 A;  3HB3 B;  1Y76 B;  3FAV B;  5KAF Z;  4CS2 A;  1H2M A;  1AIL A;  3F7Y C;  3CEI A;  2XOK G;  2UU9 O;  3P3P A;  5CN0 A;  2OCC C;  2YEV B;  4AQY O;  1QCE A;  4DYL A;  4WFF A;  1YZB A;  2CE4 A;  3B8N A;  5H5N A;  1V54 B;  2EIM C;  4TWK A;  1AI4 A;  2EZP A;  2QEX V;  4UXN A;  2YEV A;  3K08 A;  3CCJ V;  4CC6 A;  4X1Y B;  4DUZ O;  2OIE A;  1IBL O;  4LFC B;  3CP1 A;  1K7D A;  2HR3 A;  1SES A;  2YID A;  4KHP B;  4JYC A;  1K34 A;  2G38 A;  3ZHS A;  4EB6 B;  3QO8 A;  3K57 A;  1RM1 B;  3K06 A;  1K4D C;  4J7K A;  4JGS A;  4YY3 O;  1HP8 A;  4F6R B;  4X62 B;  4LF9 B;  3N2G A;  4WBN B;  2Q73 A;  2CH7 A;  3U0Z A;  2P4K A;  4DW1 A;  1S5H C;  1IBM B;  3BFR A;  5CA0 B;  3E89 A;  2B1I A;  4PA7 A;  1SER A;  3FB8 C;  3RYH A;  1A32 A;  4BWA A;  1KQS U;  3FB6 C;  1I5X A;  5JQG A;  3JAM N;  1ROP A;  1XOU A;  5IYZ B;  1V55 B;  3GB7 C;  3OEE G;  5KA6 A;  4J41 A;  4XBF A;  5B3S C;  2IH3 C;  4AHC A;  3THO A;  3WB2 A;  2GUZ B;  3ML0 A;  2P90 A;  3I56 V;  1JCH A;  2EUL A;  5JJN B;  1K9M W;  5B66 Z;  3CCM V;  2A06 H;  3ABM C;  4LF5 B;  1X4T A;  1N32 O;  1BS3 A;  2HEP A;  3BHP A;  3ZHR A;  3W7S A;  4FM1 A;  1XBL A;  3R65 A;  4H37 A;  3SPG A;  3TET A;  1XNR B;  3AG7 A;  3W7X A;  4P9P A;  5LMU O;  3FB5 C;  2AZ0 A;  1PV0 A;  3AG1 B;  2CUG A;  2KSD A;  1GTO A;  1GH6 A;  1YIT V;  4DR7 O;  2MK3 A;  3ZHV A;  3UKM A;  1TGO A;  1YI2 V;  2F93 B;  3ZMT A;  4JI3 O;  2N04 A;  5B1O A;  1IBK B;  3H1K H;  2JVD A;  3T4Z A;  5LHG A;  4ASU G;  4I55 A;  5IJ0 A;  1XEQ A;  3A8T A;  4OPA A;  2UXC B;  4MS2 A;  3H01 A;  3ZBH A;  4O4H B;  3OR6 C;  4UVA A;  3U10 A;  3HPL C;  1M93 A;  2FYU H;  5KX5 B;  2W6I G;  4K35 A;  4O4H A;  3SJA C;  1URF A;  1W0J G;  5B1B C;  2LJ2 A;  2CGO A;  3ZRS A;  2WLK A;  1U96 A;  3E35 A;  2XAS A;  4HNA A;  4MVS A;  3B8M A;  4MSW C;  3HKE B;  5EZY B;  4B3R O;  4QJF B;  3OE7 G;  4IYH A;  2RNB A;  4JYB A;  1VIB A;  2V7Q G;  1H2L A;  4X64 B;  1AJN A;  4ZHQ B;  5C93 A;  4Z1M G;  4UV9 A;  2FL4 A;  5L3C A;  1XNQ B;  3E2E A;  1ZWI C;  2PUS A;  4TUY A;  2CH7 B;  2FB5 A;  3JAT B;  2JEX A;  4U7N A;  1F23 A;  2DWE C;  1DK1 A;  1IBM O;  2IU3 A;  4MVM A;  3ETD A;  4YXW G;  5H9C A;  4J9Z B;  5JQG B;  4JI6 O;  5K1P A;  5IY5 B;  5BY1 A;  2QE7 G;  4JV5 O;  3RT3 C;  3CPW U;  2W6J G;  3K58 A;  1YVW A;  1NS1 A;  3G6B A;  3QNE A;  2E76 B;  3SYQ A;  2M6Y A;  3BY6 A;  5DEC A;  3T1H B;  3SJC C;  4DR2 O;  4JI7 O;  3TJT A;  1Y66 A;  4I50 A;  1OCC B;  3K03 A;  5C8Y B;  2VWJ A;  1MAB G;  3ZN1 A;  4FLW A;  1D2D A;  1ZAU A;  2WLI B;  2LW7 A;  1NR7 A;  5IWA O;  2Q69 A;  1P49 A;  4LFA O;  1R6N A;  1IXB A;  5JH7 A;  3A0R A;  3CCL V;  3L73 H;  4X64 O;  2LO1 A;  4NXN O;  4MVQ A;  3VQY A;  1BSM A;  1JR9 A;  4NVP A;  3AG1 C;  4R8C A;  2KG7 A;  3DC6 A;  4HYO A;  1BL8 A;  3B40 A;  5BR8 O;  5FLX N;  2QM7 A;  2HG5 C;  3CRR A;  3FYI B;  1B04 A;  3NXS A;  4FZ0 A;  3KZI Z;  3KKY A;  4F6E A;  2WLI A;  2DQ0 A;  4W4L A;  4PA4 A;  3D3Q A;  4UCV A;  2JGU A;  3HKD A;  5EZY A;  2F66 C;  4MW3 A;  1PP9 H;  5CMU A;  4J10 A;  1SQV H;  3RGB A;  4AI8 A;  4LF6 B;  1T5E A;  5GON A;  2ARH A;  5LXT B;  4FLY A;  4WCE V;  4UFZ A;  4PI2 A;  3K79 A;  3OMN B;  2QJ1 A;  3P32 A;  5KX5 A;  1WPB A;  3Q4H A;  1XMQ O;  5H6Q A;  2JK5 C;  1OJH A;  3UO3 A;  1GN4 A;  1AR1 B;  4PDM A;  4I55 B;  2HHH B;  1XNR O;  2ITD C;  4NXN B;  1EN5 A;  3JAK A;  3SJB C;  4NXM O;  1Q6I A;  2ZM6 B;  1IX9 A;  2E5L O;  5IDJ A;  3PJS K;  4DR4 B;  2IM9 A;  3I55 V;  1IUR A;  4NR1 A;  5FNV B;  4NB5 A;  4ZI7 A;  2H94 A;  4K0K O;  1V9P A;  4TV9 B;  2V4D A;  4GKJ B;  3EHB B;  3EXA A;  1Q6H A;  4IIJ A;  4P9O A;  4JI6 B;  3H9V A;  1DGS A;  1U97 A;  3KCX A;  1SS3 A;  4O4L A;  4DV0 O;  3JAS A;  1LR1 A;  3JSN A;  4DR2 B;  4PDL A;  2AXT Z;  2HJF C;  3FD9 A;  1E1R G;  3OUS A;  2BTO A;  2F4V B;  2R72 A;  4JZ2 A;  4GT1 A;  2IBZ H;  1JX9 A;  5JJE B;  3K5M A;  4KXR A;  5A9G A;  3CRQ A;  4XDK A;  4D7S A;  3C90 A;  1P7B A;  5GTH Z;  2CTR A;  4FLV A;  4UCO A;  1Q7Y W;  3W7T A;  4B7K A;  2ZM6 O;  3B09 A;  2QWN B;  5L3G A;  2LGQ A;  2XAJ A;  5CA3 A;  2VWK A;  2X6B A;  1TAE A;  2Q7H A;  2ZIN A;  4YHH B;  3FFQ A;  3BVO A;  5B3S B;  2LFR A;  2UUB O;  2JDI G;  4PEL A;  2PI5 A;  1KEC A;  1CPY A;  4DR6 O;  3VQV A;  2QTS A;  3K04 A;  4RWU A;  1H8H G;  2LP7 A;  3RYI B;  1NJI W;  4IYI A;  4B08 A;  1WA8 B;  4LF8 O;  3HKC A;  3ETG A;  2QKC A;  1YXB A;  1M90 W;  2UXN A;  3QG5 A;  5IJ0 B; 
#chains in the Genus database with same CATH homology
 2H8P C;  4LBE C;  3IFX A;  5EK0 A;  3CCV V;  2IJJ A;  2OT5 A;  4JPR A;  1QBZ A;  3GWO A;  2HVJ C;  2EJR A;  5CBF A;  3K0D A;  1G8M A;  3IGA C;  3E8F A;  1V55 C;  1QLE C;  3T2M A;  5HFM A;  2DYS B;  4MVU A;  1VQ6 V;  1M57 B;  1M57 C;  5EBL C;  4QE7 A;  3CYO A;  2P6J A;  5L3F A;  1S72 V;  1QVF U;  1VQK V;  4PDV A;  2JIZ G;  3E83 A;  3HB3 B;  1VQM V;  3RBZ A;  2WLL A;  2WLM A;  4LP8 A;  3ETE A;  1AJP A;  1FXK A;  1F4M A;  1SZT A;  2C2A A;  1YSC A;  3F7Y C;  1GO3 F;  3JD2 A;  1Q81 W;  1K73 W;  2OTL V;  2WSS G;  4TSF G;  1K97 A;  2XOK G;  4X89 A;  2YSU B;  3F5W C;  2B5U A;  3AG4 C;  5CN0 A;  2OCC C;  4MTG A;  2YEV B;  2DYR C;  4TT3 G;  1QCE A;  1FXK B;  4OXS A;  4PA9 A;  4WFF A;  1FXH A;  1ARO P;  5LHH A;  2PI4 A;  3B8N A;  1GMG A;  2V1D A;  3CCQ V;  1V54 B;  2EIM C;  3BEH A;  4GCZ A;  4GX0 A;  1VQ8 V;  4TWK A;  1K8A W;  2ATK C;  1AI4 A;  3ABK B;  2EZP A;  1N8R W;  2QEX V;  4UXN A;  3SYO A;  3CCR V;  2JEU A;  2YEV A;  3K08 A;  3CCJ V;  4P30 A;  1TUE B;  1DF4 A;  3ASO C;  1NVP B;  3CCU V;  1JOY A;  1EBO A;  3OR7 C;  1PL0 A;  3JD3 A;  1DTO A;  1VQO V;  1M56 C;  2QM8 A;  3CP1 A;  1K7D A;  1XL6 A;  3AG4 B;  2HR3 A;  4R50 A;  2EIK C;  1SES A;  2GSM B;  3VBB A;  3JD4 A;  4JYC A;  1KP3 A;  2ZQM A;  2DQ3 A;  1K34 A;  4JTC B;  1YTF B;  3QO8 A;  1YJ9 V;  1RM1 B;  3K06 A;  1K4D C;  4U7O A;  4JGS A;  3FYE B;  4FJC C;  2KB1 A;  1VQ9 V;  4WFB V;  2DW4 A;  4G27 B;  1S5H C;  1YHQ V;  1SRY A;  1AI7 A;  1OHH G;  1YJW V;  2IJI A;  3E89 A;  4KUM A;  2B1I A;  2ZDI C;  2Y48 A;  3FKS G;  4PA7 A;  1SER A;  3FB8 C;  1B6Q A;  5EC1 C;  1MOF A;  4XDJ A;  1KQS U;  3FB6 C;  1I5X A;  1YJN V;  1G4Y B;  4BIU A;  1FS0 G;  1ROP A;  4HZ3 A;  1V55 B;  3GB7 C;  3OEE G;  5KA6 A;  3LDC A;  5L3B A;  1PNL A;  4XDL A;  4XBF A;  5B3S C;  2IH3 C;  1F4N A;  1NBM G;  3E8G A;  4JAU A;  1VQL V;  2EIN C;  3ML0 A;  2P90 A;  3I56 V;  1JCH A;  1K9M W;  1QR8 A;  1FXV A;  3CCM V;  3OW2 U;  2XAG A;  3ABM C;  1M1K W;  1QVG U;  3B77 A;  5B1A B;  2AHZ A;  2X7R B;  3W7S A;  2W0F C;  3G4S V;  1PNM A;  2OCC B;  3OM3 B;  3R65 A;  3SPI A;  4H37 A;  3SPG A;  1EFR G;  3TET A;  1GM8 A;  1QR9 A;  2Y69 B;  2X0L A;  3W7X A;  3CXC U;  4P9P A;  2WWW A;  3FB5 C;  3VOU A;  3X2Q B;  4EKW A;  5EC2 C;  3AG1 B;  3CMA V;  5L3D A;  5KA5 A;  1GTO A;  3G6E V;  4JTD B;  2UXX A;  3ZRW B;  1YIT V;  4JAV A;  4KFM A;  2MK3 A;  1H8E G;  3T4D A;  3UKM A;  2Q68 A;  3JD0 A;  2P7T C;  1YI2 V;  2BOB C;  3ZMZ A;  1S77 D;  3ZMT A;  5CBH A;  2A79 B;  4FMT A;  2IJK A;  4RUF A;  1DLB A;  1PD3 A;  3WFV A;  4WF9 V;  5B1O A;  3AEI A;  3P30 A;  4MVR A;  1JVM A;  3T4Z A;  1THZ A;  5LHG A;  2A0L A;  4ASU G;  2M7W A;  2WLJ A;  1OCR B;  3SPC A;  1OCZ C;  1OCZ B;  4MS2 A;  3H01 A;  2AHY A;  1NKD A;  1JQ0 A;  2X6A A;  1E1Q G;  3OR6 C;  4UVA A;  4DO2 A;  3ABK C;  3IC7 A;  3MHH C;  3ZRW A;  5FL7 G;  3HPL C;  1H2G A;  2W6I G;  4GX1 A;  4JF3 A;  1RPR A;  2HVK C;  3E8B A;  3OGC C;  1OZ0 A;  1K5Q A;  4RO2 A;  3ASN C;  3ASN B;  1W0J G;  5B1B C;  3QO5 A;  3ZRS A;  2WLK A;  3AG3 C;  3E35 A;  2XAS A;  3ZCC A;  4MVS A;  3B8M A;  1Y4M A;  4MSW C;  3W7U A;  3ZRX A;  2ZXW B;  4QJF B;  3OE7 G;  1FXK C;  4JYB A;  1IXM A;  4R6Z A;  1M56 B;  2Q6A A;  2QTO A;  1H38 A;  1OCR C;  1OCO B;  2V7Q G;  2Q67 A;  2ZR2 A;  5EBM C;  1KD1 W;  1AJN A;  4I5S A;  2XAF A;  3LSS A;  5IYD O;  3WG7 B;  5C93 A;  3UM7 A;  5KUK A;  4Z1M G;  2XAH A;  4UV9 A;  4QPJ A;  4Q20 A;  4ZKI A;  5L3C A;  1YTF D;  3E2E A;  1ZWI C;  3OAA G;  4JTA B;  1ORQ C;  4WFE A;  2JEX A;  2R9I A;  1COW G;  4U7N A;  1F23 A;  2NLJ C;  2DWE C;  2IU3 A;  4QE9 A;  4MVM A;  3ETD A;  1CP9 A;  1VQN V;  4YXW G;  5H9C A;  4J9Z B;  5B1B B;  1RPO A;  4CZZ A;  5IY5 B;  2WPD G;  1Q86 W;  3DGE A;  1K33 A;  2QE7 G;  4N21 A;  5B1A C;  1CEZ A;  1WPX A;  3CPW U;  2W6J G;  4UVB A;  4E2L A;  1KKD A;  3CME V;  3QNE A;  3ZN0 A;  3SYQ A;  1AI5 A;  1S0V A;  3OMA B;  3BY6 A;  3RW0 A;  3LNM B;  4QIW F;  3SPH A;  3WG7 C;  1Y66 A;  3D3I A;  1NR1 A;  1OCC B;  3K03 A;  1OCC C;  5J9P C;  1MAB G;  2JJ2 G;  3RVZ A;  1S76 D;  3ZN1 A;  4FK5 C;  2ITC C;  4MTX A;  1R6K A;  3ZMV A;  3OFN G;  2IJH A;  5LGT A;  3RVY A;  2WLI B;  1NR7 A;  2Z3Y A;  1NH2 B;  4RAI A;  3CC7 V;  3T1C A;  2EIN B;  3ABM B;  2Q69 A;  4MTF A;  3K3W A;  4G2K A;  1R6N A;  3CC2 V;  3MHS C;  4BAY A;  2GHY A;  3ZRV A;  4G28 B;  3A0R A;  1K4C C;  3SYP A;  3CCL V;  4DXW A;  4X88 A;  4MT8 A;  2IH1 C;  4MVQ A;  4FPP A;  3CCE V;  2EIJ C;  5BZB A;  1Q82 W;  3AG2 C;  2DYR B;  1MSW D;  1BMF G;  3AG1 C;  3JD1 A;  4R8C A;  1BHA A;  5IYB O;  5EBW C;  1KP2 A;  1F51 A;  1R73 A;  3TK1 A;  3LDE A;  5L3E A;  1FFT B;  1S3J A;  4HYO A;  2ZR3 A;  1BL8 A;  3CCS V;  2DYS C;  2WLL B;  3ZIA G;  2QM7 A;  1XL4 A;  2BOC C;  2HG5 C;  3FYI B;  4J9Y B;  3NXS A;  3LUT B;  4CBC A;  3D36 A;  2NNU A;  4GX2 A;  2HLD G;  3QO7 A;  2IU0 A;  1AJQ A;  2HFE C;  1K92 A;  2WLI A;  2DQ0 A;  4LC1 A;  3SJQ C;  4PA4 A;  4UUJ C;  2QKS A;  3LSQ A;  4UVC A;  4I9W A;  4KP4 A;  3K0G A;  4MW3 A;  5CMU A;  1EZJ A;  5GW7 A;  1I5Y A;  1P4R A;  1VQ5 V;  2EIJ B;  1OCO C;  3FB7 C;  1QLE B;  2EIK B;  2LFS A;  3EFF K;  3ABT A;  4UV8 A;  4WCE V;  3K79 A;  3OMN B;  3P32 A;  1GM7 A;  3CC4 V;  3G71 V;  2HKO A;  3F7V C;  3OEH G;  4RQE A;  1J95 A;  2WLN A;  2XND G;  3ZMS A;  5H6Q A;  2JK5 C;  2D3O W;  2EBO A;  1K5S A;  3M99 B;  4MTO A;  3DTU B;  1AR1 B;  2ZDI A;  4N23 A;  3E86 A;  4PDM A;  1GK9 A;  4MVZ A;  1BHB A;  3JYC A;  3ASO B;  2ITD C;  4RUE A;  2CK3 G;  5LHI A;  3AG3 B;  2ZXW C;  5E1A C;  4L87 A;  5DM6 V;  5HFL A;  3OUF A;  2P67 A;  4PA3 A;  5IDJ A;  1JJ2 U;  2EIM B;  1R3I C;  5B1N A;  3PJS K;  4BW5 A;  2K1E A;  3I55 V;  1GM9 A;  4GX5 A;  2OTJ V;  1HWY A;  2H94 A;  2XAQ A;  3ABU A;  3STZ C;  1M9N A;  1ENV A;  1W2B U;  1AI6 A;  2WLH A;  5IYC O;  3EHB B;  1GKF A;  5LGN A;  3JCZ A;  4WFG A;  1VQ7 V;  4P9O A;  4FIP C;  1DF5 A;  2DWD C;  5CBG A;  4WFA V;  4R7C A;  4BIZ A;  1LNQ A;  5IY5 C;  4H33 A;  3CD6 V;  4PDL A;  2HJF C;  2Y69 C;  1E1R G;  1WLE A;  3OUS A;  1NQT A;  2EIL C;  3ZMU A;  1E79 G;  1KC8 W;  2QA4 V;  1VQP V;  2A9H A;  3ABL B;  3LDD A;  1RM1 C;  3E8H A;  4GT1 A;  1YIJ V;  1JX9 A;  5LGU A;  1NH2 D;  3SYC A;  5KUM A;  4XDK A;  1UJW B;  2FTK A;  3K9A A;  2EZO A;  1P7B A;  4PDR A;  1K3E A;  2JJ1 G;  5DN6 G;  4JAS A;  2X6C A;  3SYA A;  2R9R B;  1Q7Y W;  5LBQ A;  3W7T A;  1R3K C;  1L1F A;  2F43 G;  5L3G A;  4RQF A;  3OMI B;  4QPK A;  1SET A;  2XAJ A;  5CA3 A;  2ZD9 A;  2X6B A;  4P2Z A;  1MG1 A;  3TCU A;  2B1G A;  4WFH A;  1R3J C;  2EIL B;  2IW5 A;  4MVO A;  3ZJZ A;  5B3S B;  1JPX A;  3AG2 B;  4QNH B;  2LFR A;  1QLN A;  2JDI G;  3ABL C;  3X2Q C;  4F4L A;  1R3L C;  4PEL A;  3W7W A;  1V54 C;  2PI5 A;  4LCU C;  1KEC A;  1CPY A;  1PNK A;  4ZBM A;  3K04 A;  1H8H G;  2WAM A;  1W0K G;  2LP7 A;  4PA6 A;  4MW8 A;  1NJI W;  5H6R A;  3SPJ A;  1PKX A;  4HAM A;  3MD0 A;  1NVP D;  3STL C;  1VQ4 V;  3ETG A;  4X8A A;  1M90 W;  2Z5U A;  2UXN A;  3KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...