2UXCO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxcO00
4DR4O 4LF5O 4JI3O 4B3RO 5BY1A 5LMUO 4DUYO 2E5LO 4X65O 4DV2O 4DV3O 1D2DA 1HR0O 3T1YO 4DR2O 3O65A 2FKXA 4JYAO 1R6TA 4DV0O 1HNXO 4OX9O 5BR8O 1J5EO 1AB3A 4A5UB 1AILA 3OTOO 4DR6O 3JAMN 1X59A 3R66A 2UU9O 2DOSA 5IWAO 4X66O 4NXMO 4X62O 4JI2O 3J7AU 4LFAO 4DR7O 4DUZO 1IBKO 3T1HO 4OPAA 2Z0AA 2UUAO 2N74A 2UUCO 2ZM6O 3RT3C 4LF6O 2LW7A 4YHHO 1A32A 4DV4O 3M8AA 1N34O 1N33O 2UXDO 2ZKOA 4LFCO 5H5NA 1KUQA 2AGAA 2VQEO 2VQFO 4GKKO 5IT9N 4B3TO 1IBLO 1YZBA 2F4VO 5LMNO 4B3SO 1N36O 5A2QN 2UXCO 4LF9O 4DR1O 4DV7O 1XMOO 4JI6O 4JI7O 1XNQO 1XMQO 4JI8O 1NS1A 4LFBO 4JI0O 1XNRO 1F7YA 1IBMO 1G1XB 4X64O 4B3MO 3SDLA 4LF7O 4DR3O 2JRIA 1R1BA 5FLXN 4GKJO 1HNWO 3J81N 5BXZA 4KHPO 2HHHO 2UUBO 1HNZO 1I94O 1FYJA 4DV6O 1N32O 4OPHA 3F5TA 4NXNO 4LF8O 4AQYO 1FKAO 4LF4O 3J80N 4JI4O 5LL6Y 1DK1A 4JV5O 2DJVA 1FJGO 4DR5O 2UXBO 4DV1O 4DV5O 4JI1O 4JI5O 4YY3O 4K0KO 1XEQA
chains in the Genus database with same CATH superfamily
4BW5A 3SR2C 1HDJA 1GMGA 1SZXA 1P7BA 2WLMA 4DK1A 2CGNA 1R6KA 4JI0B 4Q6GA 3UKMA 4X1KA 3ZMVA 3Q4HA 4HNAA 1Q6UA 2EINC 2IJJA 3D3QA 3W7TA 4DR3B 4ZIBA 1QCEA 4B08A 5L3GA 3RYHA 3I56V 2EILB 4JASA 4K3AA 4NKGB 2GSMB 3JCZA 2EIJB 3RT3C 4LF6O 1SQBH 4K8XA 3DC6A 3TK1A 4CC5A 1EBOA 1W2BU 2BTQA 2IJIA 3JD0A 4LNUB 3CPWU 2UXBB 5H5NA 4JI5B 1KMIZ 1AI5A 5B1AB 3CCRV 4FLWA 1S72V 1XBLA 1JX9A 2XASA 4U7NA 1R3LC 3B2EE 3GWOA 1XL6A 1B3QA 3UM7A 2HR3A 1SQXH 4YIPA 2XTAA 3G4SV 4P2ZA 2LJ2A 3WB2A 2P90A 1HNWO 3J81N 1SQQH 2BOBC 1XILA 2YIDA 3MDSA 3X2QC 2CE4A 5C8YB 3KCXA 4O4IB 3K58A 2CTRA 1VQKV 5LHIA 1T5EA 3RBZA 1EM1A 2W0FC 1V54C 2BSKB 3K03A 1Z5VA 1VQ8V 2Q67A 4LNUA 2ZNJA 4WFAV 2EZPA 4LF5O 1SC5B 2R70A 1GN4A 1CP9A 5GONB 4DV2O 2ADPA 2B5UA 3AG1B 1AI4A 2ODMA 3KCYA 5LHHA 2WLJA 2YI9A 1OCCC 1SQPH 4MTOA 5CN0A 2GTAA 1DTOA 4MW8A 1GAXA 3ZRVA 1OV9A 3ZEDA 4UCSA 2PYLA 3E83A 3F7YC 3LSSA 2GTSA 3I5DA 4LFAO 1BGYH 2AZ2A 1N32B 4PD4F 4MVUA 5KX5B 1TA8A 5EIBC 5C8YA 5CA1B 4O4IA 2Z5UA 3NXSA 1N33O 3AK1A 1M57B 2EULA 2BSKA 4WBNB 4K0KB 1IBLO 3H1LH 1I7FA 2JJ1G 4BAYA 4DO2A 3ABUA 5DEDA 5EIBD 5GONA 2EJ7A 1EN6A 5B1NA 2KQXA 3HB3B 2WLKA 1BMFG 2A0LA 2B1IA 1XOUA 1QNMA 2RDCA 1OZ0A 2EINB 2JEXA 1ENVA 3M99B 2CUGA 4JAAA 2Q69A 4PDLA 4DV6O 3ZRSA 3BABA 2VWKA 4I5SA 1ZL8B 5JCOA 3G67A 2IJKA 4JI8B 2WLHA 4GUNA 1K73W 3K06A 5CA1A 3RYIB 1IX9A 5J2UB 4FM1A 3RWRD 3PN1A 3K04A 1QBZA 2P22C 4YY3O 5L3EA 1RM1B 2PUSA 4WBNA 3HKDA 4X89A 5BMVB 3JARB 3QO7A 2ZXWC 3LUTB 1YI2V 2E75B 3CB2A 5EC2C 2Y4TA 3JASB 1XNQB 3CRQA 4B7KA 5FPOA 4X64B 3DGEA 3AG2B 3K57A 4I55B 3F7VC 1VQ7V 2LFRA 2P4VA 2Y69C 3IAYA 2YUAA 2KSDA 5B3SC 1QU7A 2EX3A 2ZE8A 3X2QB 1I94B 3WB1A 3D36C 1NTMH 3CCMV 2AHYA 2N74A 4O4LB 1ZSPA 1ZL8A 4PDMA 1V54B 4DW0A 2PI4A 5JJEB 1NR1A 2AHZA 2GV9A 3RYIA 1FJGB 3SPHA 4PI0A 5J2UA 1AR4A 2P67A 3ZN0A 2JJ2G 1SRYA 3QO5A 5LGNA 2UXCO 4DR2B 4JI6O 3JARA 3O9OA 1OCCB 1WN7A 4J9YB 5BR8B 3E2EA 2A9HA 3JASA 2A06H 3RVZA 1M90W 2CK3G 2ZR3A 5IWAB 4LR3A 4I55A 4FM0A 3ML0A 2QE7G 2Q68A 2QWQB 5K1XA 4O4LA 1EFRG 3M7MX 1B04A 1N34B 3JALB 4DR5O 2VS0A 1XQ8A 4KP4A 1HP8A 1AR5A 4KHPB 5FPRA 2ZDIC 1VF7A 2QGNA 2PYJA 1L8DA 3FKSG 1HR0O 4NB5A 4FLYA 5D5QA 4UVBA 2YICA 5IYDO 5JWPA 2RNBA 4JV5B 4FLUA 1SETA 1JVMA 4PA9A 3R66A 4F6EA 1THZA 1G8MA 1P4RA 1K5SA 3OEEG 2BTOA 1L0NH 3B8MA 1OCZC 1I08A 2CH7B 4X65B 1JPXA 1H2KA 3VQVA 3OE7G 3ZRWB 2FYUH 1NR7A 4BIOA 4LF4B 1GTOA 1RSOB 2YSUB 4YJ2B 5JH7B 2PTMA 3RFRA 2Z3YA 5KUMA 1SESA 3JALA 2VQEO 2VQFO 3CCSV 1YZBA 3EHBB 3BA9A 1P49A 4TV8B 2ZXWB 4O4HB 3K08A 2X6BA 1QLEC 1XMQO 4JI8O 1UJWB 2Q7GA 1Q8IA 3ZMUA 4LH6A 4LWSB 2B1GA 2JGUA 4EB6B 1R1BA 4GKJO 5B1BB 2Y69B 3IC9A 3OMAB 1YSCA 4IGGA 1E1RG 1M93A 5EZYB 3CSXA 2FL4A 2X7RB 2R9AA 1H2NA 3F5TA 3AG4B 4UFZA 2CH7A 3SJAC 3HKEB 2C2AA 4JZ2A 1YHQV 1O9GA 1PV0A 4LF6B 2XHBA 1JJ2U 3ZRWA 1DK1A 2DQ3A 3ICXA 2WLNA 3LSUA 3OR6C 2OCHA 4P9PA 3JAWB 1KU9A 2QDOA 1RSOA 1AI7A 3ZHUA 4YJ2A 5JH7A 3B40A 3CE2A 4J41A 1SZTA 5E79Z 1FAFA 3ABLC 1WP8A 3ZMZA 4DV0O 4TV8A 4O4HA 3K79A 4A5UB 1L1FA 3JAMN 4MSWC 4RUEA 3ABKC 4LWSA 1FFTB 4EB6A 2MK3A 2ZCEA 1HNWB 4CBCA 2NN4A 1WAZA 1S76D 2X0LA 5EZYA 2WAMA 3CC2V 5B66Z 3D36A 2ATKC 3L72H 2DYRC 4MVRA 4Z2WA 1NI8A 2R9RB 3RW0A 3DSQA 2WA4A 3JAWA 2RCVA 1QR9A 3F5WC 5H6RA 4H44B 4KL1A 4DV2B 4EEQA 4AI8A 4RQFA 4QPJA 2OYQA 1RP3B 1WB7A 4CH5A 2Q5ZA 2JRIA 2HKOA 1LUVA 4GCZA 4BWAA 2JK5C 4KHPO 2P06A 1F51A 3OMNB 3CCJV 2BCCH 1W0JG 2ZIMA 4LFAB 1MABG 3ZHSA 1FS0G 4LBEC 5H9CA 3THOA 4HYOA 2QKAA 1GM8A 3IJ4A 4UVCA 4PA3A 4JI4O 3CD6V 3E35A 4NYKA 1S5HC 4UCVA 4JV5O 4J80A 3RVYA 3OT7A 4U7OA 3UT5B 4GX2A 1N33B 1TVKB 3B4SA 2EZOA 3HPLC 2NNUA 4DR4O 5IYBO 1IBLB 2FTKA 4X65O 1H2LA 3CWBH 3STLC 4TQDA 4TQFA 4TT3G 1QLEB 2YI8A 5EC1C 4OX9O 3VQYA 4UCOA 1VEWA 4DW1A 4DR6O 2PI5A 2DWDC 5L3BA 2L35A 1BCCH 4NXMO 1RPOA 1ZTEA 4JI3B 2Y0IA 5J2TB 4DV6B 1Q86W 3AG3B 3CEIA 4ICGA 2G38A 5LA6B 3SYAA 5LOVB 3A2FA 3ETQA 3R65A 3ZCCA 4FLVA 1F4NA 1Y76B 2OCCC 2YIAA 5KLVH 2JIZG 2OIEA 2IM9A 4DV4O 1GN6A 3SGIA 4YXWG 3JSLA 1KB9F 3UT5A 4YY3B 4FFBB 1TVKA 4B3TO 3FB7C 2WLIB 1QR8A 2CTWA 3AK3A 1Q6HA 3APOA 2L6LA 4N23A 1TAEA 4RAIA 3OW2U 5DM6V 2VWJA 1XNRO 2Y0PA 3DXRB 5CA3A 1PKXA 3CRRA 4UXNA 1KKCA 3BEHA 1L0LH 5EBLC 1XHZA 4PA6A 3ABKB 3JCUZ 3OM3B 4JYBA 1FD9A 2YXLA 1U97A 2D3OW 2UUBO 1P84F 2EBOA 3AK2A 3E8BA 2QA4V 1N0JA 5J2TA 1K4CC 3LDCA 4BW9A 4TV9B 3SPIA 4LFBB 5LA6A 5DN6G 2IJHA 5LOVA 3H01A 4WFFA 1J95A 1VQNV 1QQCA 1S5LZ 1Y76A 2GBOA 3MHHC 4CS2A 2DMXA 3FAVB 4FFBA 2RJZA 3STZC 4BIUA 4JAUA 2WLIA 4E2LA 2UXCB 4UV8A 1N0NA 4U3JB 4JI6B 4HAMA 4FZ0A 4NTXA 5IYZB 1M4UA 1VQ4V 2YS8A 4W4KA 3ZHTA 3DXRA 1M56C 4KUMA 1KYOF 5L3DA 4J7JA 2QKCA 2GHYA 2PZSA 4NTYA 1WPBA 1BHAA 1GRJA 2ARHA 1YDXA 3U10A 4PI2A 2Z0AA 3FFQA 4J42A 2UUCO 5LGTA 4ZKIA 4UB6Z 2AZ0A 4TV9A 1SERA 1R3KC 3OUSA 1VQ5V 4DR5B 5ITZB 2E3CA 4X66B 2ZD9A 4GX5A 1JCHA 2F66C 1Q82W 3BA8A 4B3SO 3TJTA 3FAVA 2ZQMA 3CCEV 1HR0B 2UXXA 2Q4PA 5HFLA 1MSWD 2FB5A 3BRCA 5GW7A 3CXCU 3L70H 4E4EA 2AW9A 2XAGA 4U3JA 5KMGB 4R50A 5IYZA 2UXNA 2MW2B 4XBFA 3FYIB 3FB8C 4UUJC 1ZWIC 3HKDB 1FFXB 4FM2A 4R6ZA 1DF5A 4LF9B 3G80A 1UPGA 3APQA 1WPXA 4R8CA 2HLDG 5JJNB 1NBMG 4X1IB 2XT9A 4FMTA 3BHPA 2LFSA 4DK0A 4G2KA 3CCUV 5IJ9B 2YEVB 1FXHA 3LNMB 1PD3A 1IZ3A 4X9QA 2VQEB 2VQFB 4JI3O 2A7WA 5ITZA 4DUYO 3ZX6A 1YEWA 2E5LO 1KKDA 1MNGA 3ZIAG 3FX7A 1TUBB 2YIBD 4JYAO 2F23A 4W4LA 2HEPA 1K5QA 1XMQB 1PM9A 1I5YA 1D5AA 1YVWA 2VRZA 4RO2A 2P6JA 5KMGA 1KC8W 4GKJB 2LGQA 2QWPB 4MVQA 3ASNC 1JA8A 1S0VA 3JYCA 4QPKA 3A0BZ 4NTWA 1TUEB 4D6TH 1FFXA 5B1OA 1SA0B 4DRXB 3MD0A 2DW4A 4R7CA 4YHHO 4X1IA 2Q6AA 2D2CB 4MVMA 5IJ9A 5HFMA 2YEVA 1AP6A 4GKKO 1K4DC 3E86A 2F4VO 4PA7A 4IYIA 3IC7A 4MTXA 1K8AW 3ASOC 1OCRC 4H13B 4DV7O 2QWRB 1B6QA 4DV0B 2ZIOA 1TUBA 4LFBO 4C7UA 4CZZA 2DQ0A 4B3MO 1PL0A 1Y6XA 1BQ0A 1M56B 5EYPB 1FXVA 3SPJA 3B8NA 5BXZA 1GM9A 1XDCA 1SQVH 1Z5WA 2HJFC 1N4CA 1ZUQA 4OPHA 3EXAA 3OEHG 4QNHB 1IXMA 4XDKA 5CA0B 2P7TC 2W6JG 1OHHG 1SA0A 4DRXA 4JGSA 1MMMA 3GWKC 1AVMA 1VQ9V 3ZMSA 1S3JA 2RQ6A 5LXTB 2CGOA 4WFHA 3H1KH 1R6TA 4ZI7B 2H8PC 1QVFU 3T2MA 1AB3A 1AILA 2O57A 3UCSC 1Q43A 3QF7A 4MTFA 4X66O 5KA5A 3KG2A 5EYPA 1EN5A 1M5IA 4UCTA 1IBKO 3CRAA 4EFBA 2LW7A 2A79B 5CA0A 3OFNG 4H0LB 3UQ8A 3K59A 4JI4B 1US6A 3M8AA 3FYEB 3N2GB 3OMIB 2UXDO 1KUQA 4K8ZA 2P4KA 3L71H 4MVZA 4CH4A 4DR4B 4Q20A 1I5XA 4LH7A 3JATA 4LF9O 5LXTA 1CPYA 1XMOO 2UUAB 1Q5OA 1NS1A 4OX9B 1DF4A 4ZI7A 1GK9A 4Z1VA 1BS3A 1QHTA 1VQPV 4DR6B 1JR9A 2N04A 3K5OA 5KUKA 2W0XA 3S3XA 1K34A 1B06A 2PGGA 4MT8A 4NXMB 3ASNB 1OJHA 4LC1A 1HNZO 1LR1A 4MW3A 5TISZ 4JTCB 5KAIZ 4LF8O 5FNVB 4I0XB 2JDIG 1JFFA 4X20B 4L8JA 1EZJA 2F1MA 2X6CA 5K1PA 2YIBA 4GLXA 4DV4B 4X1YB 1LUWA 3N2GA 3ABTA 1P7GA 2WLLB 4B3RO 5LMUO 5B3SB 4B3TB 1D2DA 3SYQA 1NVPD 4PELA 3O65A 1V9PA 3ASOB 3E8HA 1OCRB 4RUFA 1AJNA 4P30A 1Y67A 2DN9A 1W59A 3BCCH 1XNRB 2GUZB 1ZX3A 4QE7A 3SPCA 3OD4A 2B9ZA 3JD1A 4I50B 4FZ1A 3VQXA 2UUBB 4DYLA 3T1HO 2ITCC 2WWWA 5JJJB 5E1AC 1Q7YW 2ZM6O 5FNVA 4I0XA 5GTIZ 4H33A 1MG1A 4X20A 3OTOB 3CCQV 1BQZA 1M1KW 4QGPA 3ZJZA 4X1YA 3LSQA 3QG5A 4X62B 5EBWC 1VQLV 2Q0AA 4B7EA 1BE3H 1R3JC 2V7QG 2WLLA 3QTCA 5IYCO 2W6IG 2EIJC 2PY5A 3K9AA 4QJFB 3G6EV 2KKWA 1JOYA 5GTHZ 1F7YA 1WJZA 3C3SA 4D7TA 1AROP 2GUZA 1WB8A 1SQFA 5B1AC 4CS4A 4MVSA 1YCIA 4F4LA 1MA1A 1LNQA 4MVOA 1YF2A 4FJCC 4I50A 3W7XA 4JZGA 4NXNO 3QNEA 3E22B 2GDSA 3H1HH 3A8TA 2UUCB 1R73A 3TXQA 3ZBHA 1NTZH 4OXSA 4TOIA 4DV5O 1DLBA 4FIPC 3GVMA 1IVSA 4TUYB 2OTJV 3KZIZ 1OCZB 1RPRA 4B3SB 1K9MW 3JSNA 3FB5C 1E79G 1D5NA 5KHHA 4UB8Z 1VF6C 3A0RA 3TGUH 1EZVH 2LGWA 5L3CA 3A0HZ 5KAFZ 2N05A 2A3QA 1KQSU 1XI1A 5KA6A 5KHIA 2ZNIA 3J7AU 3AG1C 4DR7O 3DTUB 4G27B 5LHGA 1KECA 2ZDIA 1NVPB 3CHXA 2UUAO 2AXTZ 2Q0OC 2YXHA 3E22A 5IJ0B 2LQTA 1Y66A 4GYCB 5DECA 1VARA 1RFYA 4MS2A 1G6UA 3JAKB 1OCOC 1VF5B 3B77A 2R9IA 3HKBB 2K1EA 1K3EA 5IT9N 4ZHQB 3RGBA 4JPRA 4DUYB 3AG7A 5JCOC 4TUYA 2E5LB 2EJRA 1N36O 4CH3A 3GB7C 1NT2B 4RWUA 2H3OA 3ZMTA 4JI7O 4JYAB 1H2SB 1PP9H 2DYSC 3EFFK 3CCLV 3T1CA 4G28B 1FPOA 4LF7O 1M57C 4Z1MG 3OUFA 1PPJH 3RN4A 4BR6A 1BL8A 3SJCC 2ILMA 2P5OA 3L73H 1JQ0A 3D8CA 1S5JA 3QVNA 4J11A 3ABLB 1YXBA 1BZKA 4AQYO 3B09A 3EVKA 2Q7EA 2IU3A 5AG2A 2ADQB 3CS5A 1N8RW 1F23A 5LL6Y 1EN4A 4N21A 4YHHB 4J7ZA 5IJ0A 1FXKC 3SYPA 3JAKA 3HKBA 5BY1A 4GKKB 4KFMA 2F4VB 4DV3O 4ZHQA 1H8EG 4OGQB 3T1YO 2QWOB 2F93B 3C90A 4QE9A 2XNDG 4DV7B 2RMKB 1S77D 3CC4V 4J10A 1CEZA 3OTOO 3FB6C 3K5MA 3P3NA 4B3MB 3CX5F 1QLNA 2DYRB 2JEUA 3UO3A 4KXRA 4JI1B 3TETA 1RM1C 1R3IC 5A9GA 4QIWF 3OAAG 4X62O 2KB1A 4U3FH 3HKCB 4XDJA 4DUZO 1K92A 2DWEC 3UO2A 4FLXA 1K7DA 1MSDA 3MHSC 2K9PA 3P30A 3AG2C 1AP5A 1Y74B 2V1DA 2ZKOA 1CXZB 4O2AB 3JD2A 4JYYA 2M6YA 5CB4B 3P3PA 2IBZH 4BIZA 2WPDG 3FD9A 3BPZA 3TXSA 1Y4MA 3LNNA 1IBMO 3WFVA 3SDLA 1WA8B 4PDVA 4RQEA 1AJQA 2EIMC 1NQTA 3E8GA 2HG5C 4AHCA 1M9NA 4I4TB 1IBKB 3CMAV 4FLTA 3HKCA 4DR1B 1FKAO 1ORQC 4AILC 1U96A 2NR5A 1XL4A 1MOFA 2QWNB 3J80N 1JMKC 3BFRA 2LP7A 5IDJA 5H2FZ 1OCOB 4MTGA 2UXDB 3SPGA 1XEQA 1HWYA 1Y74A 1AR1B 4O2AA 3K5LA 4IIJB 1YITV 1NH2D 3DC5A 1MZEA 3BY6A 2E74B 4O2BB 2IU0A 5CB4A 2ITDC 2QM4A 2BE3A 3LDEA 2HVJC 3CCVV 1HNXO 1XMOB 2DYSB 1J5EO 2BOCC 2IW5A 2YXYA 2OCCB 1VF6A 3K3WA 2H94A 2UU9O 5JQGB 2Q8VA 4TWKA 1WA8A 4JYCA 4JI2O 1HNZB 5B5EZ 1PNMA 4FK5C 1AJPA 3LDDA 1HW7A 3K5NA 1Q6IA 4LF8B 4I4TA 5J9PC 1BT8A 1ZLZA 3CYOA 1GN2A 1A32A 1FXKB 4ZOLB 3VBBA 2XAHA 4UCRA 3HR0A 2AGAA 3U11A 4NR1A 4PA4A 4B3RB 3AEIA 5LMUB 1VP7A 2CTPA 4IIJA 5A2QN 4GZRB 4FLZA 1SS3A 1WLEA 1BHBA 2QTSA 4O2BA 1VQMV 5KX5A 4JI0O 1Z2GA 4PDRA 5LYJB 1PNKA 4DR3O 1SKVA 4WCEV 5BZBA 1AI6A 4LFCB 5FLXN 3G6BA 4J7KA 2WSSG 3OR7C 1GO3F 5JQGA 3CJHB 4I9QA 1VQ6V 5LMNB 1H2GA 2XUMA 3ZRXA 2RN9A 3T4ZA 3T1HB 2NLJC 2QJ1A 3H1IH 2ZM6B 1X4TA 3WU2Z 3RYFB 4WF9V 4JTAB 4IHJB 2UXBO 2ZE6A 2HVKC 4EFEA 4JI5O 4JI1O 5B1BC 3P32A 2HFEC 1FXKA 4ZOLA 1NTKH 5F2VO 1IDSA 5CBGA 3VQWA 3OGCC 1Q3EA 3RYCB 3AG4C 1UFIA 3SYCA 1I0HA 5C93A 1COWG 2Q7HA 3H1JH 1NU1H 1KP3A 3KKYA 2Y4UA 3PJSK 5LYJA 5EBMC 5D5PA 2CTQA 4GX0A 1ROPA 2EIMB 4XDLA 4DXWA 1W0KG 3JATB 1SF9A 5H6QA 1NH2B 3ETDA 3CJHA 4NVPA 4UVAA 5LBQA 1JJOA 4JTDB 4PJ0Z 5KHKA 4NXNB 5BMVA 2JS5A 1BSMA 1IXBA 2DE0X 2JS3A 2V4DA 3SJBC 1PNLA 1K33A 5LP6C 5CBFA 4X8AA 1XHXA 3RYFA 5LGUA 1O9HA 4J9ZB 5KHGA 1VQOV 4IHJA 4DV5B 2JGDB 3T4DA 1QVGU 2EIKC 4PV1B 3ZHVA 3RYCA 1KP2A 1JFFB 4DR1O 4CS3A 1KD1W 2OWOA 3WG7C 4D7SA 1G1XB 1R6NA 3E8FA 2JVDA 2CAZC 3H9VA 4YJ3B 1YIJV 3N27A 1PL4A 1GH6A 2ZT9B 1KBHA 1GN3A 3ABMC 2OT5A 3L9DA 1FYJA 2YDEA 4P9OA 1N32O 1ZAUA 4DR7B 4LP8A 1YJNV 1DGSA 2XAJA 3C3TA 1K97A 2DJVA 3CC7V 3SYOA 1V55C 2QM8A 4K0KO 2QEXV 4UV9A 3K0DA 2HHHB 3CXHF 2JGDA 4O4JB 2IH3C 2OTLV 3CRMA 2X6AA 1N36B 2FKXA 2QR4A 4FPPA 3L74H 3K9SA 4JI7B 4TSFG 1IURA 1YJWV 3OTFA 2CDYA 4LF7B 4DV1B 1H2MA 3JD3A 4YJ3A 5L3FA 1GM7A 4WFEA 2ETNA 2ZE5A 1G4YB 4K35A 5IY5C 2E76B 2XAFA 4OPAA 3JD4A 4AQYB 2QM7A 4ASUG 1YTFD 1VMGA 4GX1A 4I9WA 3IGAC 4LFCO 3IFXA 4IL6Z 2M7WA 1NKDA 4FVMA 5LMNO 3AG3C 3CP1A 3ZS8C 5CMUA 4DV3B 4O4JA 3N2KB 3U0ZA 3T1YB 3W7WA 2QKSA 1XNQO 5JVDB 3WB0A 2Q73A 4X64O 1NJIW 1E1QG 3QO8A 2PF4E 1Q81W 2EILC 3ZHRA 2QTOA 1TGOA 4HBNA 5KHJA 1I94O 4EKWA 1F4MA 4LCUC 3BVOA 4H37A 1WNSA 4DUZB 2Y48A 1VIBA 2HP8A 3W7SA 3MAQA 2QSAA 3TCUA 1MZFA 4IT5A 5LP6B 1H8HG 5FL7G 3D3IA 4F6RB 1FJGO 4IYHA 2EIKB 2R72A 4FFKA 3G71V 4DR2O 4I7ZB 5EK0A 3HKEA 3N2KA 3WG7B 1SQGA 5BR8O 2ZR2A 1IBMB 4GT1A 5JVDA 1NZ6A 2LW1A 1X59A 4ABMA 2DOSA 5IWAO 3ABMB 2F95B 1YJ9V 2KG7B 1H38A 4LF5B 2ZE7A 1WP7A 3ETGA 3CMEV 4YIOA 2LO1A 2XOKG 2F43G 4HZ3A 4CH6A 3ZN1A 4ZBMA 2OIGA 3L75H 2WA3A 4JF3A 1N34O 1Q90D 5LP6A 2IH1C 1V55B 4CC6A 4WFBV 2YC0A 4X88A 4F6RA 3SJQC 2Q9LA 2ZINA 2HJDA 1XREA 1XUQA 4UCUA 4JAVA 4X1KB 1HNXB 3Q4HB 4HNAB 1J5EB 3OGIB 3RYHB 3ETEA 1YTFB 3E89A 3I55V 2UU9B 5CBHA 2HHHO 4WFGA 5IY5B 4JI2B 2KG7A 3W7UA 3ZHQA 1GKFA 4L87A 5IE9A 3K0GA 2BTQB 3CRCA 1URFA 2FMLA 4LF4O 3VOUA 3BAAA 3S3WA 4DV1O 4PHZA 3NR7A 2XAQA
chains in the Genus database with same CATH topology
4DR4O 4LF5O 4JI3O 4B3RO 5BY1A 5LMUO 4DUYO 2E5LO 4X65O 4DV2O 4DV3O 1D2DA 1HR0O 3T1YO 4DR2O 3O65A 2FKXA 4JYAO 1R6TA 4DV0O 1HNXO 4OX9O 5BR8O 1J5EO 1AB3A 4A5UB 1AILA 3OTOO 4DR6O 3JAMN 1X59A 3R66A 2UU9O 2DOSA 5IWAO 4X66O 4NXMO 4X62O 4JI2O 3J7AU 4LFAO 4DR7O 4DUZO 1IBKO 3T1HO 4OPAA 2Z0AA 2UUAO 2N74A 2UUCO 2ZM6O 3RT3C 4LF6O 2LW7A 4YHHO 1A32A 4DV4O 3M8AA 1N34O 1N33O 2UXDO 2ZKOA 4LFCO 5H5NA 1KUQA 2AGAA 2VQEO 2VQFO 4GKKO 5IT9N 4B3TO 1IBLO 1YZBA 2F4VO 5LMNO 4B3SO 1N36O 5A2QN 2UXCO 4LF9O 4DR1O 4DV7O 1XMOO 4JI6O 4JI7O 1XNQO 1XMQO 4JI8O 1NS1A 4LFBO 4JI0O 1XNRO 1F7YA 1IBMO 1G1XB 4X64O 4B3MO 3SDLA 4LF7O 4DR3O 2JRIA 1R1BA 5FLXN 4GKJO 1HNWO 3J81N 5BXZA 4KHPO 2HHHO 2UUBO 1HNZO 1I94O 1FYJA 4DV6O 1N32O 4OPHA 3F5TA 4NXNO 4LF8O 4AQYO 1FKAO 4LF4O 3J80N 4JI4O 5LL6Y 1DK1A 4JV5O 2DJVA 1FJGO 4DR5O 2UXBO 4DV1O 4DV5O 4JI1O 4JI5O 4YY3O 4K0KO 1XEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 O;  4LF5 O;  4JI3 O;  4B3R O;  5BY1 A;  5LMU O;  4DUY O;  2E5L O;  4X65 O;  4DV2 O;  4DV3 O;  1D2D A;  1HR0 O;  3T1Y O;  4DR2 O;  3O65 A;  2FKX A;  4JYA O;  1R6T A;  4DV0 O;  1HNX O;  4OX9 O;  5BR8 O;  1J5E O;  1AB3 A;  4A5U B;  1AIL A;  3OTO O;  4DR6 O;  3JAM N;  1X59 A;  3R66 A;  2UU9 O;  2DOS A;  5IWA O;  4X66 O;  4NXM O;  4X62 O;  4JI2 O;  3J7A U;  4LFA O;  4DR7 O;  4DUZ O;  1IBK O;  3T1H O;  4OPA A;  2Z0A A;  2UUA O;  2N74 A;  2UUC O;  2ZM6 O;  3RT3 C;  4LF6 O;  2LW7 A;  4YHH O;  1A32 A;  4DV4 O;  3M8A A;  1N34 O;  1N33 O;  2UXD O;  2ZKO A;  4LFC O;  5H5N A;  1KUQ A;  2AGA A;  2VQE O;  2VQF O;  4GKK O;  5IT9 N;  4B3T O;  1IBL O;  1YZB A;  2F4V O;  5LMN O;  4B3S O;  1N36 O;  5A2Q N;  2UXC O;  4LF9 O;  4DR1 O;  4DV7 O;  1XMO O;  4JI6 O;  4JI7 O;  1XNQ O;  1XMQ O;  4JI8 O;  1NS1 A;  4LFB O;  4JI0 O;  1XNR O;  1F7Y A;  1IBM O;  1G1X B;  4X64 O;  4B3M O;  3SDL A;  4LF7 O;  4DR3 O;  2JRI A;  1R1B A;  5FLX N;  4GKJ O;  1HNW O;  3J81 N;  5BXZ A;  4KHP O;  2HHH O;  2UUB O;  1HNZ O;  1I94 O;  1FYJ A;  4DV6 O;  1N32 O;  4OPH A;  3F5T A;  4NXN O;  4LF8 O;  4AQY O;  1FKA O;  4LF4 O;  3J80 N;  4JI4 O;  5LL6 Y;  1DK1 A;  4JV5 O;  2DJV A;  1FJG O;  4DR5 O;  2UXB O;  4DV1 O;  4DV5 O;  4JI1 O;  4JI5 O;  4YY3 O;  4K0K O;  1XEQ A; 
#chains in the Genus database with same CATH topology
 4BW5 A;  3SR2 C;  1HDJ A;  1GMG A;  1SZX A;  1P7B A;  2WLM A;  4DK1 A;  2CGN A;  1R6K A;  4JI0 B;  4Q6G A;  3UKM A;  4X1K A;  3ZMV A;  3Q4H A;  4HNA A;  1Q6U A;  2EIN C;  2IJJ A;  3D3Q A;  3W7T A;  4DR3 B;  4ZIB A;  1QCE A;  4B08 A;  5L3G A;  3RYH A;  3I56 V;  2EIL B;  4JAS A;  4K3A A;  4NKG B;  2GSM B;  3JCZ A;  2EIJ B;  3RT3 C;  4LF6 O;  1SQB H;  4K8X A;  3DC6 A;  3TK1 A;  4CC5 A;  1EBO A;  1W2B U;  2BTQ A;  2IJI A;  3JD0 A;  4LNU B;  3CPW U;  2UXB B;  5H5N A;  4JI5 B;  1KMI Z;  1AI5 A;  5B1A B;  3CCR V;  4FLW A;  1S72 V;  1XBL A;  1JX9 A;  2XAS A;  4U7N A;  1R3L C;  3B2E E;  3GWO A;  1XL6 A;  1B3Q A;  3UM7 A;  2HR3 A;  1SQX H;  4YIP A;  2XTA A;  3G4S V;  4P2Z A;  2LJ2 A;  3WB2 A;  2P90 A;  1HNW O;  3J81 N;  1SQQ H;  2BOB C;  1XIL A;  2YID A;  3MDS A;  3X2Q C;  2CE4 A;  5C8Y B;  3KCX A;  4O4I B;  3K58 A;  2CTR A;  1VQK V;  5LHI A;  1T5E A;  3RBZ A;  1EM1 A;  2W0F C;  1V54 C;  2BSK B;  3K03 A;  1Z5V A;  1VQ8 V;  2Q67 A;  4LNU A;  2ZNJ A;  4WFA V;  2EZP A;  4LF5 O;  1SC5 B;  2R70 A;  1GN4 A;  1CP9 A;  5GON B;  4DV2 O;  2ADP A;  2B5U A;  3AG1 B;  1AI4 A;  2ODM A;  3KCY A;  5LHH A;  2WLJ A;  2YI9 A;  1OCC C;  1SQP H;  4MTO A;  5CN0 A;  2GTA A;  1DTO A;  4MW8 A;  1GAX A;  3ZRV A;  1OV9 A;  3ZED A;  4UCS A;  2PYL A;  3E83 A;  3F7Y C;  3LSS A;  2GTS A;  3I5D A;  4LFA O;  1BGY H;  2AZ2 A;  1N32 B;  4PD4 F;  4MVU A;  5KX5 B;  1TA8 A;  5EIB C;  5C8Y A;  5CA1 B;  4O4I A;  2Z5U A;  3NXS A;  1N33 O;  3AK1 A;  1M57 B;  2EUL A;  2BSK A;  4WBN B;  4K0K B;  1IBL O;  3H1L H;  1I7F A;  2JJ1 G;  4BAY A;  4DO2 A;  3ABU A;  5DED A;  5EIB D;  5GON A;  2EJ7 A;  1EN6 A;  5B1N A;  2KQX A;  3HB3 B;  2WLK A;  1BMF G;  2A0L A;  2B1I A;  1XOU A;  1QNM A;  2RDC A;  1OZ0 A;  2EIN B;  2JEX A;  1ENV A;  3M99 B;  2CUG A;  4JAA A;  2Q69 A;  4PDL A;  4DV6 O;  3ZRS A;  3BAB A;  2VWK A;  4I5S A;  1ZL8 B;  5JCO A;  3G67 A;  2IJK A;  4JI8 B;  2WLH A;  4GUN A;  1K73 W;  3K06 A;  5CA1 A;  3RYI B;  1IX9 A;  5J2U B;  4FM1 A;  3RWR D;  3PN1 A;  3K04 A;  1QBZ A;  2P22 C;  4YY3 O;  5L3E A;  1RM1 B;  2PUS A;  4WBN A;  3HKD A;  4X89 A;  5BMV B;  3JAR B;  3QO7 A;  2ZXW C;  3LUT B;  1YI2 V;  2E75 B;  3CB2 A;  5EC2 C;  2Y4T A;  3JAS B;  1XNQ B;  3CRQ A;  4B7K A;  5FPO A;  4X64 B;  3DGE A;  3AG2 B;  3K57 A;  4I55 B;  3F7V C;  1VQ7 V;  2LFR A;  2P4V A;  2Y69 C;  3IAY A;  2YUA A;  2KSD A;  5B3S C;  1QU7 A;  2EX3 A;  2ZE8 A;  3X2Q B;  1I94 B;  3WB1 A;  3D36 C;  1NTM H;  3CCM V;  2AHY A;  2N74 A;  4O4L B;  1ZSP A;  1ZL8 A;  4PDM A;  1V54 B;  4DW0 A;  2PI4 A;  5JJE B;  1NR1 A;  2AHZ A;  2GV9 A;  3RYI A;  1FJG B;  3SPH A;  4PI0 A;  5J2U A;  1AR4 A;  2P67 A;  3ZN0 A;  2JJ2 G;  1SRY A;  3QO5 A;  5LGN A;  2UXC O;  4DR2 B;  4JI6 O;  3JAR A;  3O9O A;  1OCC B;  1WN7 A;  4J9Y B;  5BR8 B;  3E2E A;  2A9H A;  3JAS A;  2A06 H;  3RVZ A;  1M90 W;  2CK3 G;  2ZR3 A;  5IWA B;  4LR3 A;  4I55 A;  4FM0 A;  3ML0 A;  2QE7 G;  2Q68 A;  2QWQ B;  5K1X A;  4O4L A;  1EFR G;  3M7M X;  1B04 A;  1N34 B;  3JAL B;  4DR5 O;  2VS0 A;  1XQ8 A;  4KP4 A;  1HP8 A;  1AR5 A;  4KHP B;  5FPR A;  2ZDI C;  1VF7 A;  2QGN A;  2PYJ A;  1L8D A;  3FKS G;  1HR0 O;  4NB5 A;  4FLY A;  5D5Q A;  4UVB A;  2YIC A;  5IYD O;  5JWP A;  2RNB A;  4JV5 B;  4FLU A;  1SET A;  1JVM A;  4PA9 A;  3R66 A;  4F6E A;  1THZ A;  1G8M A;  1P4R A;  1K5S A;  3OEE G;  2BTO A;  1L0N H;  3B8M A;  1OCZ C;  1I08 A;  2CH7 B;  4X65 B;  1JPX A;  1H2K A;  3VQV A;  3OE7 G;  3ZRW B;  2FYU H;  1NR7 A;  4BIO A;  4LF4 B;  1GTO A;  1RSO B;  2YSU B;  4YJ2 B;  5JH7 B;  2PTM A;  3RFR A;  2Z3Y A;  5KUM A;  1SES A;  3JAL A;  2VQE O;  2VQF O;  3CCS V;  1YZB A;  3EHB B;  3BA9 A;  1P49 A;  4TV8 B;  2ZXW B;  4O4H B;  3K08 A;  2X6B A;  1QLE C;  1XMQ O;  4JI8 O;  1UJW B;  2Q7G A;  1Q8I A;  3ZMU A;  4LH6 A;  4LWS B;  2B1G A;  2JGU A;  4EB6 B;  1R1B A;  4GKJ O;  5B1B B;  2Y69 B;  3IC9 A;  3OMA B;  1YSC A;  4IGG A;  1E1R G;  1M93 A;  5EZY B;  3CSX A;  2FL4 A;  2X7R B;  2R9A A;  1H2N A;  3F5T A;  3AG4 B;  4UFZ A;  2CH7 A;  3SJA C;  3HKE B;  2C2A A;  4JZ2 A;  1YHQ V;  1O9G A;  1PV0 A;  4LF6 B;  2XHB A;  1JJ2 U;  3ZRW A;  1DK1 A;  2DQ3 A;  3ICX A;  2WLN A;  3LSU A;  3OR6 C;  2OCH A;  4P9P A;  3JAW B;  1KU9 A;  2QDO A;  1RSO A;  1AI7 A;  3ZHU A;  4YJ2 A;  5JH7 A;  3B40 A;  3CE2 A;  4J41 A;  1SZT A;  5E79 Z;  1FAF A;  3ABL C;  1WP8 A;  3ZMZ A;  4DV0 O;  4TV8 A;  4O4H A;  3K79 A;  4A5U B;  1L1F A;  3JAM N;  4MSW C;  4RUE A;  3ABK C;  4LWS A;  1FFT B;  4EB6 A;  2MK3 A;  2ZCE A;  1HNW B;  4CBC A;  2NN4 A;  1WAZ A;  1S76 D;  2X0L A;  5EZY A;  2WAM A;  3CC2 V;  5B66 Z;  3D36 A;  2ATK C;  3L72 H;  2DYR C;  4MVR A;  4Z2W A;  1NI8 A;  2R9R B;  3RW0 A;  3DSQ A;  2WA4 A;  3JAW A;  2RCV A;  1QR9 A;  3F5W C;  5H6R A;  4H44 B;  4KL1 A;  4DV2 B;  4EEQ A;  4AI8 A;  4RQF A;  4QPJ A;  2OYQ A;  1RP3 B;  1WB7 A;  4CH5 A;  2Q5Z A;  2JRI A;  2HKO A;  1LUV A;  4GCZ A;  4BWA A;  2JK5 C;  4KHP O;  2P06 A;  1F51 A;  3OMN B;  3CCJ V;  2BCC H;  1W0J G;  2ZIM A;  4LFA B;  1MAB G;  3ZHS A;  1FS0 G;  4LBE C;  5H9C A;  3THO A;  4HYO A;  2QKA A;  1GM8 A;  3IJ4 A;  4UVC A;  4PA3 A;  4JI4 O;  3CD6 V;  3E35 A;  4NYK A;  1S5H C;  4UCV A;  4JV5 O;  4J80 A;  3RVY A;  3OT7 A;  4U7O A;  3UT5 B;  4GX2 A;  1N33 B;  1TVK B;  3B4S A;  2EZO A;  3HPL C;  2NNU A;  4DR4 O;  5IYB O;  1IBL B;  2FTK A;  4X65 O;  1H2L A;  3CWB H;  3STL C;  4TQD A;  4TQF A;  4TT3 G;  1QLE B;  2YI8 A;  5EC1 C;  4OX9 O;  3VQY A;  4UCO A;  1VEW A;  4DW1 A;  4DR6 O;  2PI5 A;  2DWD C;  5L3B A;  2L35 A;  1BCC H;  4NXM O;  1RPO A;  1ZTE A;  4JI3 B;  2Y0I A;  5J2T B;  4DV6 B;  1Q86 W;  3AG3 B;  3CEI A;  4ICG A;  2G38 A;  5LA6 B;  3SYA A;  5LOV B;  3A2F A;  3ETQ A;  3R65 A;  3ZCC A;  4FLV A;  1F4N A;  1Y76 B;  2OCC C;  2YIA A;  5KLV H;  2JIZ G;  2OIE A;  2IM9 A;  4DV4 O;  1GN6 A;  3SGI A;  4YXW G;  3JSL A;  1KB9 F;  3UT5 A;  4YY3 B;  4FFB B;  1TVK A;  4B3T O;  3FB7 C;  2WLI B;  1QR8 A;  2CTW A;  3AK3 A;  1Q6H A;  3APO A;  2L6L A;  4N23 A;  1TAE A;  4RAI A;  3OW2 U;  5DM6 V;  2VWJ A;  1XNR O;  2Y0P A;  3DXR B;  5CA3 A;  1PKX A;  3CRR A;  4UXN A;  1KKC A;  3BEH A;  1L0L H;  5EBL C;  1XHZ A;  4PA6 A;  3ABK B;  3JCU Z;  3OM3 B;  4JYB A;  1FD9 A;  2YXL A;  1U97 A;  2D3O W;  2UUB O;  1P84 F;  2EBO A;  3AK2 A;  3E8B A;  2QA4 V;  1N0J A;  5J2T A;  1K4C C;  3LDC A;  4BW9 A;  4TV9 B;  3SPI A;  4LFB B;  5LA6 A;  5DN6 G;  2IJH A;  5LOV A;  3H01 A;  4WFF A;  1J95 A;  1VQN V;  1QQC A;  1S5L Z;  1Y76 A;  2GBO A;  3MHH C;  4CS2 A;  2DMX A;  3FAV B;  4FFB A;  2RJZ A;  3STZ C;  4BIU A;  4JAU A;  2WLI A;  4E2L A;  2UXC B;  4UV8 A;  1N0N A;  4U3J B;  4JI6 B;  4HAM A;  4FZ0 A;  4NTX A;  5IYZ B;  1M4U A;  1VQ4 V;  2YS8 A;  4W4K A;  3ZHT A;  3DXR A;  1M56 C;  4KUM A;  1KYO F;  5L3D A;  4J7J A;  2QKC A;  2GHY A;  2PZS A;  4NTY A;  1WPB A;  1BHA A;  1GRJ A;  2ARH A;  1YDX A;  3U10 A;  4PI2 A;  2Z0A A;  3FFQ A;  4J42 A;  2UUC O;  5LGT A;  4ZKI A;  4UB6 Z;  2AZ0 A;  4TV9 A;  1SER A;  1R3K C;  3OUS A;  1VQ5 V;  4DR5 B;  5ITZ B;  2E3C A;  4X66 B;  2ZD9 A;  4GX5 A;  1JCH A;  2F66 C;  1Q82 W;  3BA8 A;  4B3S O;  3TJT A;  3FAV A;  2ZQM A;  3CCE V;  1HR0 B;  2UXX A;  2Q4P A;  5HFL A;  1MSW D;  2FB5 A;  3BRC A;  5GW7 A;  3CXC U;  3L70 H;  4E4E A;  2AW9 A;  2XAG A;  4U3J A;  5KMG B;  4R50 A;  5IYZ A;  2UXN A;  2MW2 B;  4XBF A;  3FYI B;  3FB8 C;  4UUJ C;  1ZWI C;  3HKD B;  1FFX B;  4FM2 A;  4R6Z A;  1DF5 A;  4LF9 B;  3G80 A;  1UPG A;  3APQ A;  1WPX A;  4R8C A;  2HLD G;  5JJN B;  1NBM G;  4X1I B;  2XT9 A;  4FMT A;  3BHP A;  2LFS A;  4DK0 A;  4G2K A;  3CCU V;  5IJ9 B;  2YEV B;  1FXH A;  3LNM B;  1PD3 A;  1IZ3 A;  4X9Q A;  2VQE B;  2VQF B;  4JI3 O;  2A7W A;  5ITZ A;  4DUY O;  3ZX6 A;  1YEW A;  2E5L O;  1KKD A;  1MNG A;  3ZIA G;  3FX7 A;  1TUB B;  2YIB D;  4JYA O;  2F23 A;  4W4L A;  2HEP A;  1K5Q A;  1XMQ B;  1PM9 A;  1I5Y A;  1D5A A;  1YVW A;  2VRZ A;  4RO2 A;  2P6J A;  5KMG A;  1KC8 W;  4GKJ B;  2LGQ A;  2QWP B;  4MVQ A;  3ASN C;  1JA8 A;  1S0V A;  3JYC A;  4QPK A;  3A0B Z;  4NTW A;  1TUE B;  4D6T H;  1FFX A;  5B1O A;  1SA0 B;  4DRX B;  3MD0 A;  2DW4 A;  4R7C A;  4YHH O;  4X1I A;  2Q6A A;  2D2C B;  4MVM A;  5IJ9 A;  5HFM A;  2YEV A;  1AP6 A;  4GKK O;  1K4D C;  3E86 A;  2F4V O;  4PA7 A;  4IYI A;  3IC7 A;  4MTX A;  1K8A W;  3ASO C;  1OCR C;  4H13 B;  4DV7 O;  2QWR B;  1B6Q A;  4DV0 B;  2ZIO A;  1TUB A;  4LFB O;  4C7U A;  4CZZ A;  2DQ0 A;  4B3M O;  1PL0 A;  1Y6X A;  1BQ0 A;  1M56 B;  5EYP B;  1FXV A;  3SPJ A;  3B8N A;  5BXZ A;  1GM9 A;  1XDC A;  1SQV H;  1Z5W A;  2HJF C;  1N4C A;  1ZUQ A;  4OPH A;  3EXA A;  3OEH G;  4QNH B;  1IXM A;  4XDK A;  5CA0 B;  2P7T C;  2W6J G;  1OHH G;  1SA0 A;  4DRX A;  4JGS A;  1MMM A;  3GWK C;  1AVM A;  1VQ9 V;  3ZMS A;  1S3J A;  2RQ6 A;  5LXT B;  2CGO A;  4WFH A;  3H1K H;  1R6T A;  4ZI7 B;  2H8P C;  1QVF U;  3T2M A;  1AB3 A;  1AIL A;  2O57 A;  3UCS C;  1Q43 A;  3QF7 A;  4MTF A;  4X66 O;  5KA5 A;  3KG2 A;  5EYP A;  1EN5 A;  1M5I A;  4UCT A;  1IBK O;  3CRA A;  4EFB A;  2LW7 A;  2A79 B;  5CA0 A;  3OFN G;  4H0L B;  3UQ8 A;  3K59 A;  4JI4 B;  1US6 A;  3M8A A;  3FYE B;  3N2G B;  3OMI B;  2UXD O;  1KUQ A;  4K8Z A;  2P4K A;  3L71 H;  4MVZ A;  4CH4 A;  4DR4 B;  4Q20 A;  1I5X A;  4LH7 A;  3JAT A;  4LF9 O;  5LXT A;  1CPY A;  1XMO O;  2UUA B;  1Q5O A;  1NS1 A;  4OX9 B;  1DF4 A;  4ZI7 A;  1GK9 A;  4Z1V A;  1BS3 A;  1QHT A;  1VQP V;  4DR6 B;  1JR9 A;  2N04 A;  3K5O A;  5KUK A;  2W0X A;  3S3X A;  1K34 A;  1B06 A;  2PGG A;  4MT8 A;  4NXM B;  3ASN B;  1OJH A;  4LC1 A;  1HNZ O;  1LR1 A;  4MW3 A;  5TIS Z;  4JTC B;  5KAI Z;  4LF8 O;  5FNV B;  4I0X B;  2JDI G;  1JFF A;  4X20 B;  4L8J A;  1EZJ A;  2F1M A;  2X6C A;  5K1P A;  2YIB A;  4GLX A;  4DV4 B;  4X1Y B;  1LUW A;  3N2G A;  3ABT A;  1P7G A;  2WLL B;  4B3R O;  5LMU O;  5B3S B;  4B3T B;  1D2D A;  3SYQ A;  1NVP D;  4PEL A;  3O65 A;  1V9P A;  3ASO B;  3E8H A;  1OCR B;  4RUF A;  1AJN A;  4P30 A;  1Y67 A;  2DN9 A;  1W59 A;  3BCC H;  1XNR B;  2GUZ B;  1ZX3 A;  4QE7 A;  3SPC A;  3OD4 A;  2B9Z A;  3JD1 A;  4I50 B;  4FZ1 A;  3VQX A;  2UUB B;  4DYL A;  3T1H O;  2ITC C;  2WWW A;  5JJJ B;  5E1A C;  1Q7Y W;  2ZM6 O;  5FNV A;  4I0X A;  5GTI Z;  4H33 A;  1MG1 A;  4X20 A;  3OTO B;  3CCQ V;  1BQZ A;  1M1K W;  4QGP A;  3ZJZ A;  4X1Y A;  3LSQ A;  3QG5 A;  4X62 B;  5EBW C;  1VQL V;  2Q0A A;  4B7E A;  1BE3 H;  1R3J C;  2V7Q G;  2WLL A;  3QTC A;  5IYC O;  2W6I G;  2EIJ C;  2PY5 A;  3K9A A;  4QJF B;  3G6E V;  2KKW A;  1JOY A;  5GTH Z;  1F7Y A;  1WJZ A;  3C3S A;  4D7T A;  1ARO P;  2GUZ A;  1WB8 A;  1SQF A;  5B1A C;  4CS4 A;  4MVS A;  1YCI A;  4F4L A;  1MA1 A;  1LNQ A;  4MVO A;  1YF2 A;  4FJC C;  4I50 A;  3W7X A;  4JZG A;  4NXN O;  3QNE A;  3E22 B;  2GDS A;  3H1H H;  3A8T A;  2UUC B;  1R73 A;  3TXQ A;  3ZBH A;  1NTZ H;  4OXS A;  4TOI A;  4DV5 O;  1DLB A;  4FIP C;  3GVM A;  1IVS A;  4TUY B;  2OTJ V;  3KZI Z;  1OCZ B;  1RPR A;  4B3S B;  1K9M W;  3JSN A;  3FB5 C;  1E79 G;  1D5N A;  5KHH A;  4UB8 Z;  1VF6 C;  3A0R A;  3TGU H;  1EZV H;  2LGW A;  5L3C A;  3A0H Z;  5KAF Z;  2N05 A;  2A3Q A;  1KQS U;  1XI1 A;  5KA6 A;  5KHI A;  2ZNI A;  3J7A U;  3AG1 C;  4DR7 O;  3DTU B;  4G27 B;  5LHG A;  1KEC A;  2ZDI A;  1NVP B;  3CHX A;  2UUA O;  2AXT Z;  2Q0O C;  2YXH A;  3E22 A;  5IJ0 B;  2LQT A;  1Y66 A;  4GYC B;  5DEC A;  1VAR A;  1RFY A;  4MS2 A;  1G6U A;  3JAK B;  1OCO C;  1VF5 B;  3B77 A;  2R9I A;  3HKB B;  2K1E A;  1K3E A;  5IT9 N;  4ZHQ B;  3RGB A;  4JPR A;  4DUY B;  3AG7 A;  5JCO C;  4TUY A;  2E5L B;  2EJR A;  1N36 O;  4CH3 A;  3GB7 C;  1NT2 B;  4RWU A;  2H3O A;  3ZMT A;  4JI7 O;  4JYA B;  1H2S B;  1PP9 H;  2DYS C;  3EFF K;  3CCL V;  3T1C A;  4G28 B;  1FPO A;  4LF7 O;  1M57 C;  4Z1M G;  3OUF A;  1PPJ H;  3RN4 A;  4BR6 A;  1BL8 A;  3SJC C;  2ILM A;  2P5O A;  3L73 H;  1JQ0 A;  3D8C A;  1S5J A;  3QVN A;  4J11 A;  3ABL B;  1YXB A;  1BZK A;  4AQY O;  3B09 A;  3EVK A;  2Q7E A;  2IU3 A;  5AG2 A;  2ADQ B;  3CS5 A;  1N8R W;  1F23 A;  5LL6 Y;  1EN4 A;  4N21 A;  4YHH B;  4J7Z A;  5IJ0 A;  1FXK C;  3SYP A;  3JAK A;  3HKB A;  5BY1 A;  4GKK B;  4KFM A;  2F4V B;  4DV3 O;  4ZHQ A;  1H8E G;  4OGQ B;  3T1Y O;  2QWO B;  2F93 B;  3C90 A;  4QE9 A;  2XND G;  4DV7 B;  2RMK B;  1S77 D;  3CC4 V;  4J10 A;  1CEZ A;  3OTO O;  3FB6 C;  3K5M A;  3P3N A;  4B3M B;  3CX5 F;  1QLN A;  2DYR B;  2JEU A;  3UO3 A;  4KXR A;  4JI1 B;  3TET A;  1RM1 C;  1R3I C;  5A9G A;  4QIW F;  3OAA G;  4X62 O;  2KB1 A;  4U3F H;  3HKC B;  4XDJ A;  4DUZ O;  1K92 A;  2DWE C;  3UO2 A;  4FLX A;  1K7D A;  1MSD A;  3MHS C;  2K9P A;  3P30 A;  3AG2 C;  1AP5 A;  1Y74 B;  2V1D A;  2ZKO A;  1CXZ B;  4O2A B;  3JD2 A;  4JYY A;  2M6Y A;  5CB4 B;  3P3P A;  2IBZ H;  4BIZ A;  2WPD G;  3FD9 A;  3BPZ A;  3TXS A;  1Y4M A;  3LNN A;  1IBM O;  3WFV A;  3SDL A;  1WA8 B;  4PDV A;  4RQE A;  1AJQ A;  2EIM C;  1NQT A;  3E8G A;  2HG5 C;  4AHC A;  1M9N A;  4I4T B;  1IBK B;  3CMA V;  4FLT A;  3HKC A;  4DR1 B;  1FKA O;  1ORQ C;  4AIL C;  1U96 A;  2NR5 A;  1XL4 A;  1MOF A;  2QWN B;  3J80 N;  1JMK C;  3BFR A;  2LP7 A;  5IDJ A;  5H2F Z;  1OCO B;  4MTG A;  2UXD B;  3SPG A;  1XEQ A;  1HWY A;  1Y74 A;  1AR1 B;  4O2A A;  3K5L A;  4IIJ B;  1YIT V;  1NH2 D;  3DC5 A;  1MZE A;  3BY6 A;  2E74 B;  4O2B B;  2IU0 A;  5CB4 A;  2ITD C;  2QM4 A;  2BE3 A;  3LDE A;  2HVJ C;  3CCV V;  1HNX O;  1XMO B;  2DYS B;  1J5E O;  2BOC C;  2IW5 A;  2YXY A;  2OCC B;  1VF6 A;  3K3W A;  2H94 A;  2UU9 O;  5JQG B;  2Q8V A;  4TWK A;  1WA8 A;  4JYC A;  4JI2 O;  1HNZ B;  5B5E Z;  1PNM A;  4FK5 C;  1AJP A;  3LDD A;  1HW7 A;  3K5N A;  1Q6I A;  4LF8 B;  4I4T A;  5J9P C;  1BT8 A;  1ZLZ A;  3CYO A;  1GN2 A;  1A32 A;  1FXK B;  4ZOL B;  3VBB A;  2XAH A;  4UCR A;  3HR0 A;  2AGA A;  3U11 A;  4NR1 A;  4PA4 A;  4B3R B;  3AEI A;  5LMU B;  1VP7 A;  2CTP A;  4IIJ A;  5A2Q N;  4GZR B;  4FLZ A;  1SS3 A;  1WLE A;  1BHB A;  2QTS A;  4O2B A;  1VQM V;  5KX5 A;  4JI0 O;  1Z2G A;  4PDR A;  5LYJ B;  1PNK A;  4DR3 O;  1SKV A;  4WCE V;  5BZB A;  1AI6 A;  4LFC B;  5FLX N;  3G6B A;  4J7K A;  2WSS G;  3OR7 C;  1GO3 F;  5JQG A;  3CJH B;  4I9Q A;  1VQ6 V;  5LMN B;  1H2G A;  2XUM A;  3ZRX A;  2RN9 A;  3T4Z A;  3T1H B;  2NLJ C;  2QJ1 A;  3H1I H;  2ZM6 B;  1X4T A;  3WU2 Z;  3RYF B;  4WF9 V;  4JTA B;  4IHJ B;  2UXB O;  2ZE6 A;  2HVK C;  4EFE A;  4JI5 O;  4JI1 O;  5B1B C;  3P32 A;  2HFE C;  1FXK A;  4ZOL A;  1NTK H;  5F2V O;  1IDS A;  5CBG A;  3VQW A;  3OGC C;  1Q3E A;  3RYC B;  3AG4 C;  1UFI A;  3SYC A;  1I0H A;  5C93 A;  1COW G;  2Q7H A;  3H1J H;  1NU1 H;  1KP3 A;  3KKY A;  2Y4U A;  3PJS K;  5LYJ A;  5EBM C;  5D5P A;  2CTQ A;  4GX0 A;  1ROP A;  2EIM B;  4XDL A;  4DXW A;  1W0K G;  3JAT B;  1SF9 A;  5H6Q A;  1NH2 B;  3ETD A;  3CJH A;  4NVP A;  4UVA A;  5LBQ A;  1JJO A;  4JTD B;  4PJ0 Z;  5KHK A;  4NXN B;  5BMV A;  2JS5 A;  1BSM A;  1IXB A;  2DE0 X;  2JS3 A;  2V4D A;  3SJB C;  1PNL A;  1K33 A;  5LP6 C;  5CBF A;  4X8A A;  1XHX A;  3RYF A;  5LGU A;  1O9H A;  4J9Z B;  5KHG A;  1VQO V;  4IHJ A;  4DV5 B;  2JGD B;  3T4D A;  1QVG U;  2EIK C;  4PV1 B;  3ZHV A;  3RYC A;  1KP2 A;  1JFF B;  4DR1 O;  4CS3 A;  1KD1 W;  2OWO A;  3WG7 C;  4D7S A;  1G1X B;  1R6N A;  3E8F A;  2JVD A;  2CAZ C;  3H9V A;  4YJ3 B;  1YIJ V;  3N27 A;  1PL4 A;  1GH6 A;  2ZT9 B;  1KBH A;  1GN3 A;  3ABM C;  2OT5 A;  3L9D A;  1FYJ A;  2YDE A;  4P9O A;  1N32 O;  1ZAU A;  4DR7 B;  4LP8 A;  1YJN V;  1DGS A;  2XAJ A;  3C3T A;  1K97 A;  2DJV A;  3CC7 V;  3SYO A;  1V55 C;  2QM8 A;  4K0K O;  2QEX V;  4UV9 A;  3K0D A;  2HHH B;  3CXH F;  2JGD A;  4O4J B;  2IH3 C;  2OTL V;  3CRM A;  2X6A A;  1N36 B;  2FKX A;  2QR4 A;  4FPP A;  3L74 H;  3K9S A;  4JI7 B;  4TSF G;  1IUR A;  1YJW V;  3OTF A;  2CDY A;  4LF7 B;  4DV1 B;  1H2M A;  3JD3 A;  4YJ3 A;  5L3F A;  1GM7 A;  4WFE A;  2ETN A;  2ZE5 A;  1G4Y B;  4K35 A;  5IY5 C;  2E76 B;  2XAF A;  4OPA A;  3JD4 A;  4AQY B;  2QM7 A;  4ASU G;  1YTF D;  1VMG A;  4GX1 A;  4I9W A;  3IGA C;  4LFC O;  3IFX A;  4IL6 Z;  2M7W A;  1NKD A;  4FVM A;  5LMN O;  3AG3 C;  3CP1 A;  3ZS8 C;  5CMU A;  4DV3 B;  4O4J A;  3N2K B;  3U0Z A;  3T1Y B;  3W7W A;  2QKS A;  1XNQ O;  5JVD B;  3WB0 A;  2Q73 A;  4X64 O;  1NJI W;  1E1Q G;  3QO8 A;  2PF4 E;  1Q81 W;  2EIL C;  3ZHR A;  2QTO A;  1TGO A;  4HBN A;  5KHJ A;  1I94 O;  4EKW A;  1F4M A;  4LCU C;  3BVO A;  4H37 A;  1WNS A;  4DUZ B;  2Y48 A;  1VIB A;  2HP8 A;  3W7S A;  3MAQ A;  2QSA A;  3TCU A;  1MZF A;  4IT5 A;  5LP6 B;  1H8H G;  5FL7 G;  3D3I A;  4F6R B;  1FJG O;  4IYH A;  2EIK B;  2R72 A;  4FFK A;  3G71 V;  4DR2 O;  4I7Z B;  5EK0 A;  3HKE A;  3N2K A;  3WG7 B;  1SQG A;  5BR8 O;  2ZR2 A;  1IBM B;  4GT1 A;  5JVD A;  1NZ6 A;  2LW1 A;  1X59 A;  4ABM A;  2DOS A;  5IWA O;  3ABM B;  2F95 B;  1YJ9 V;  2KG7 B;  1H38 A;  4LF5 B;  2ZE7 A;  1WP7 A;  3ETG A;  3CME V;  4YIO A;  2LO1 A;  2XOK G;  2F43 G;  4HZ3 A;  4CH6 A;  3ZN1 A;  4ZBM A;  2OIG A;  3L75 H;  2WA3 A;  4JF3 A;  1N34 O;  1Q90 D;  5LP6 A;  2IH1 C;  1V55 B;  4CC6 A;  4WFB V;  2YC0 A;  4X88 A;  4F6R A;  3SJQ C;  2Q9L A;  2ZIN A;  2HJD A;  1XRE A;  1XUQ A;  4UCU A;  4JAV A;  4X1K B;  1HNX B;  3Q4H B;  4HNA B;  1J5E B;  3OGI B;  3RYH B;  3ETE A;  1YTF B;  3E89 A;  3I55 V;  2UU9 B;  5CBH A;  2HHH O;  4WFG A;  5IY5 B;  4JI2 B;  2KG7 A;  3W7U A;  3ZHQ A;  1GKF A;  4L87 A;  5IE9 A;  3K0G A;  2BTQ B;  3CRC A;  1URF A;  2FML A;  4LF4 O;  3VOU A;  3BAA A;  3S3W A;  4DV1 O;  4PHZ A;  3NR7 A;  2XAQ A; 
#chains in the Genus database with same CATH homology
 4DR4 O;  4LF5 O;  4JI3 O;  4B3R O;  5BY1 A;  5LMU O;  4DUY O;  2E5L O;  4X65 O;  4DV2 O;  4DV3 O;  1D2D A;  1HR0 O;  3T1Y O;  4DR2 O;  3O65 A;  2FKX A;  4JYA O;  1R6T A;  4DV0 O;  1HNX O;  4OX9 O;  5BR8 O;  1J5E O;  1AB3 A;  4A5U B;  1AIL A;  3OTO O;  4DR6 O;  3JAM N;  1X59 A;  3R66 A;  2UU9 O;  2DOS A;  5IWA O;  4X66 O;  4NXM O;  4X62 O;  4JI2 O;  3J7A U;  4LFA O;  4DR7 O;  4DUZ O;  1IBK O;  3T1H O;  4OPA A;  2Z0A A;  2UUA O;  2N74 A;  2UUC O;  2ZM6 O;  3RT3 C;  4LF6 O;  2LW7 A;  4YHH O;  1A32 A;  4DV4 O;  3M8A A;  1N34 O;  1N33 O;  2UXD O;  2ZKO A;  4LFC O;  5H5N A;  1KUQ A;  2AGA A;  2VQE O;  2VQF O;  4GKK O;  5IT9 N;  4B3T O;  1IBL O;  1YZB A;  2F4V O;  5LMN O;  4B3S O;  1N36 O;  5A2Q N;  2UXC O;  4LF9 O;  4DR1 O;  4DV7 O;  1XMO O;  4JI6 O;  4JI7 O;  1XNQ O;  1XMQ O;  4JI8 O;  1NS1 A;  4LFB O;  4JI0 O;  1XNR O;  1F7Y A;  1IBM O;  1G1X B;  4X64 O;  4B3M O;  3SDL A;  4LF7 O;  4DR3 O;  2JRI A;  1R1B A;  5FLX N;  4GKJ O;  1HNW O;  3J81 N;  5BXZ A;  4KHP O;  2HHH O;  2UUB O;  1HNZ O;  1I94 O;  1FYJ A;  4DV6 O;  1N32 O;  4OPH A;  3F5T A;  4NXN O;  4LF8 O;  4AQY O;  1FKA O;  4LF4 O;  3J80 N;  4JI4 O;  5LL6 Y;  1DK1 A;  4JV5 O;  2DJV A;  1FJG O;  4DR5 O;  2UXB O;  4DV1 O;  4DV5 O;  4JI1 O;  4JI5 O;  4YY3 O;  4K0K O;  1XEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...