2UXCO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxcO00
1J5EO 4JI2O 3RT3C 5IWAO 2UUAO 4DUZO 3T1YO 4JI4O 4DR6O 1XMQO 1N36O 4LFCO 4JI8O 4K0KO 4DV4O 3T1HO 4DR1O 4GKJO 4YY3O 1IBKO 1IBLO 4LF4O 2VQEO 1HR0O 3M8AA 2JRIA 1N33O 4JI0O 1A32A 4LFBO 1AB3A 1IBMO 4A5UB 2UUBO 4DR7O 2FKXA 4X64O 4LF5O 1DK1A 4OX9O 4JV5O 1XEQA 1HNWO 4JI6O 2AGAA 3J80N 4B3SO 4DV3O 2E5LO 1HNXO 4OPHA 3R66A 4NXMO 4NXNO 1G1XB 5BR8O 4JI5O 4DR4O 1R1BA 1FJGO 2UXDO 3OTOO 2UUCO 4B3RO 4DR2O 4DR3O 2HHHO 5LMUO 1I94O 4DR5O 4YHHO 1FKAO 2DOSA 2ZKOA 2LW7A 4LFAO 1N34O 4B3TO 4KHPO 4X65O 1KUQA 1XNQO 2UXCO 4JYAO 4LF6O 4GKKO 3J81N 1YZBA 1AILA 1R6TA 3SDLA 5H5NA 4JI3O 4DV2O 4AQYO 4DUYO 4DV1O 1XMOO 1D2DA 4LF8O 1NS1A 3J7AU 4DV7O 5LMNO 2UU9O 1N32O 1FYJA 2ZM6O 1X59A 2N74A 5A2QN 2Z0AA 4DV5O 4JI7O 5FLXN 4B3MO 3F5TA 2UXBO 5IT9N 4X62O 5LL6Y 5BXZA 4DV6O 2DJVA 5BY1A 2F4VO 4X66O 4LF9O 1HNZO 3O65A 2VQFO 4OPAA 4LF7O 3JAMN 4DV0O 4JI1O 1XNRO 1F7YA
chains in the Genus database with same CATH superfamily
2Q7HA 1Q7YW 3T1HB 1PP9H 3FFQA 2CH7A 3JALB 4UVBA 3CE2A 5L3GA 2Q7GA 2A06H 4GX2A 4DR1O 4HZ3A 4GKJO 2BTQB 4UCTA 4JYYA 1FAFA 4YHHB 3CD6V 1YIJV 4FFKA 3B8MA 4JV5B 3S3WA 2CDYA 3ABTA 5JVDA 1GK9A 2GTSA 1FD9A 2LGQA 5ITZB 4OX9O 2EBOA 2HG5C 3C3SA 4KL1A 1PM9A 4NTWA 3J80N 1S3JA 3ZHQA 4I7ZB 1R6KA 4TQFA 1M57B 4OPHA 1KU9A 1K34A 3ETQA 1G1XB 5EC2C 1FJGO 1PNMA 3H01A 5LP6B 2Z5UA 2ZR3A 4N21A 2YS8A 4PD4F 1PNKA 2FYUH 3CCEV 5DEDA 3OT7A 2XT9A 2GHYA 1QLNA 5EBWC 1N34O 4R50A 4MS2A 3K0GA 3CX5F 1V54C 1Y74A 4AHCA 4BR6A 5JQGB 4DV7B 5E79Z 1NH2B 1YCIA 2OYQA 5JJNB 2L6LA 5EC1C 2HKOA 2Z0AA 4JI0B 4FJCC 4WBNB 5LGTA 5ITZA 5EBMC 1BHAA 4E4EA 1Y67A 4JI5B 1FXKB 1PL4A 2FB5A 5B5EZ 3VQVA 1BT8A 1K5QA 1QLEC 3R65A 4C7UA 4EFBA 1V55C 4XDKA 4UCRA 3KKYA 4CH5A 3E2EA 4IYHA 2PY5A 2JJ1G 4K0KO 3CCLV 4MTOA 2OCCC 2ZE5A 2LO1A 1FXKC 1NR1A 2ZDIA 1TUBB 1ZL8A 3MD0A 1VQKV 1AP6A 2O57A 2B1GA 1LNQA 1Y76B 1MSDA 4J9YB 4LF4B 1GKFA 4NXMB 1D5AA 2EJ7A 4X64O 1TGOA 2AXTZ 5KUMA 3QO8A 5KUKA 4BW5A 1IURA 1DTOA 3DTUB 3LSUA 4RUEA 1N34B 2UUCO 4O2AA 1VMGA 1IDSA 5BMVB 4B08A 1YVWA 1FKAO 3FAVB 3ABMB 1PV0A 1CP9A 2A7WA 3APQA 3FD9A 4X20B 5LBQA 4LFBB 2ZXWB 3VQYA 4BAYA 2CH7B 4TUYA 1D2DA 4X88A 4P9OA 1Z5VA 1GN4A 2ZT9B 1N32O 4E2LA 1WLEA 1BHBA 2EIMB 4B3SB 5CMUA 5JJJB 4JPRA 1YEWA 1M56B 5LL6Y 2V4DA 3S3XA 2ZNIA 2CAZC 1YTFD 4O4JA 2E74B 4GT1A 1KP2A 4QIWF 3OEHG 2JIZG 3E83A 2GUZB 1J95A 3TJTA 2YXYA 2PYLA 2ZCEA 3ZRSA 3CRCA 1B3QA 5C93A 4LF7B 3FB6C 1N36O 1GM9A 3TGUH 3K03A 4R8CA 2Q67A 1S76D 2NNUA 4D7SA 1N33O 5B1AC 4JI7B 1R3JC 4AQYB 5L3DA 2JJ2G 3A2FA 2QWOB 5H6QA 5JJEB 1YHQV 4CBCA 4A5UB 4CH6A 3W7SA 4LF5O 1WAZA 2QM8A 4IHJB 2P4KA 3OR6C 3A0RA 2BSKA 1EN4A 4DV3O 4X64B 5JCOC 4X1IB 3M99B 3QNEA 1J5EB 1GN2A 4HAMA 4I5SA 2YXLA 2LP7A 3L70H 5IWAB 4I0XB 3CXHF 4PI0A 4X66B 1UJWB 1Q86W 3WU2Z 1EZJA 3E8HA 3VOUA 1S5HC 2HJFC 4DRXA 3K57A 4O4IB 4N23A 4I9WA 3SR2C 4YIOA 3RW0A 5IYBO 2P90A 4XDJA 4CS3A 4X1YB 2IJJA 1QNMA 2N74A 4GZRB 4JAVA 3VBBA 1AR4A 1SKVA 2WLIA 1JQ0A 4B3MO 2YEVA 2CTWA 5KMGA 3ZMTA 4AI8A 3ASOB 3JD1A 1M56C 3UCSC 2YDEA 3P32A 5IDJA 2HLDG 4OPAA 3E8FA 1NTKH 5J2TB 1YF2A 4K35A 1E1QG 2RMKB 5CBGA 5EYPB 2LW1A 4GCZA 3RYFB 3AG4C 4QPKA 2HR3A 4HYOA 3JASB 3UO2A 1JOYA 1QLEB 4TQDA 2ILMA 2ZIOA 4DO2A 2NLJC 1GH6A 5KAFZ 5L3BA 3ABUA 4DW1A 4FZ1A 1W2BU 4LP8A 1AB3A 4O4IA 3AG4B 2KSDA 1DK1A 2ZIMA 3VQWA 4FLYA 3HKEB 4X89A 3ZRWB 1Q8IA 3JCUZ 4NXMO 2A0LA 4YJ2B 4KUMA 5KA5A 4MSWC 5CA0B 2HHHO 4LWSB 3KCYA 1P4RA 2JGUA 2ODMA 4MW8A 4YHHO 4DR2B 1GM8A 4JYCA 4IHJA 4GKJB 1GO3F 1US6A 5FPRA 4PA3A 2N05A 3LSQA 2GBOA 3HKCA 1WA8A 3FB5C 5KMGB 2E76B 4UV8A 4WFGA 3C90A 4DR6B 4DUYO 3ZEDA 4DYLA 1Q90D 2OIEA 4LF8O 2UU9O 1S0VA 1X59A 4ICGA 3I56V 4JASA 5LOVB 1B06A 3OD4A 2KB1A 1K5SA 5BXZA 2JS3A 1NQTA 3N2GA 5IE9A 2ETNA 2VQFO 2AHZA 5B1NA 1K92A 3JAMN 2F93B 5LYJB 1WNSA 3HKBA 5J2TA 1BL8A 3L73H 2XNDG 2PI4A 2Q73A 4CS2A 2P22C 3JD4A 1NJIW 1GRJA 4JI2O 1HWYA 2EILC 2RCVA 4U3JB 1VF6C 4JI8O 1VQNV 4DV2B 2P06A 4UB6Z 4JTCB 2K1EA 5KHGA 4HNAA 2VQEO 1HR0O 3D36C 1Y6XA 4TV8B 1WP7A 4MVMA 1ZLZA 4WCEV 3T2MA 5DM6V 1TA8A 1NVPB 1S5JA 5CN0A 1NT2B 3TXSA 3BHPA 4DV0B 1YTFB 4B3RB 2XUMA 2YSUB 4JI1B 1Y4MA 4DR4O 1R3IC 2UXDO 3C3TA 2ZE7A 1THZA 4B3RO 4DR2O 3F5WC 2QGNA 1RFYA 3K5OA 4LR3A 2ZD9A 4NYKA 5CB4B 1LUVA 1F51A 2BOCC 4X1IA 4EEQA 1W59A 4K3AA 4DW0A 3BEHA 1JX9A 2XASA 5LHHA 4G27B 3LSSA 2LJ2A 1S72V 5E1AC 4JYAB 5LP6A 1H2LA 2L35A 3T1CA 4DV7O 1BSMA 2YUAA 4L87A 5FL7G 3K58A 1E1RG 1SESA 2YIBA 1NVPD 2XAJA 2H94A 3GWKC 2CE4A 1H2NA 4G2KA 1F4MA 1ROPA 3N2KB 4KXRA 4LF9O 3ZMUA 3DXRA 1URFA 4DV0O 3AG1C 5H9CA 4MT8A 5KHIA 4FFBA 2Y48A 2BTQA 2QEXV 4XDLA 1EZVH 4QJFB 2W6JG 2RJZA 1XI1A 4O2BB 1H38A 2X0LA 4MVRA 1XMQO 1BQ0A 1WN7A 4DV4O 3CWBH 2JK5C 2P6JA 3QVNA 3I5DA 4I55A 4DUYB 2E75B 5HFMA 1OCCB 5KX5A 4LC1A 2Q8VA 5LYJA 4PDVA 5KA6A 1ENVA 3SPGA 3ABKC 1IZ3A 2OTLV 5EIBD 2R9AA 3FB7C 1IBMO 4QGPA 4LF8B 2JEXA 4RQEA 3CMEV 2BSKB 1N33B 3OMAB 3ZN0A 5B1OA 3CCRV 1HNXO 3E86A 1HNWB 4NR1A 1R1BA 3ETDA 3CCMV 5IYZA 3IAYA 5GTIZ 1BMFG 3E8GA 3HB3B 1NU1H 4WFAV 4FLVA 4ZI7A 3HPLC 2ZXWC 2ATKC 2N04A 3DXRB 3CYOA 5GONB 4UXNA 1QU7A 4JYAO 5B1BC 1YZBA 4MVQA 3RFRA 2AZ2A 4BWAA 3JAKB 4O4JB 3SYQA 2CGNA 3LDCA 4LF5B 1E79G 1NS1A 4P30A 3ZHVA 2P67A 3K04A 4X1KB 2EINC 4JI7O 4ZIBA 4DV6B 1IVSA 5KLVH 2KG7B 5CA1A 3LNMB 4I4TB 2W0FC 3SPCA 3WG7B 4FIPC 1AJQA 3JAWA 1YJWV 1IBMB 2IU0A 5TISZ 1M1KW 4HBNA 2Y4TA 1HP8A 4FM1A 4J80A 4XBFA 1OHHG 3WB0A 5KHJA 5B3SB 4LFAB 4ZOLA 1WB8A 4PELA 1L1FA 2WLJA 4DUZO 2PTMA 1U96A 1ZAUA 4EB6B 2MW2B 1OCOC 4MVUA 1XUQA 4NKGB 2GDSA 1NTMH 3MAQA 1Q81W 1WJZA 3CPWU 4JYBA 3ABKB 3CXCU 3E22A 1AR1B 3RWRD 2IH1C 4MVOA 1XQ8A 1YXBA 3OTOB 1XEQA 3JARA 2LGWA 2VQFB 1IXMA 1K7DA 1R73A 3AG2C 4LWSA 2GUZA 3CRMA 2E5LO 2ITDC 5KX5B 2XTAA 3QO5A 2EIMC 1BS3A 3GWOA 2JVDA 1FFXA 3CJHA 3KG2A 1ZX3A 1OV9A 4IIJB 1YITV 4GX1A 1H2GA 4MTFA 2ZQMA 4I55B 1OZ0A 1Q82W 4UVAA 3F7VC 1B04A 1AILA 5H5NA 1Q6UA 4JI3O 2UXXA 3H9VA 3CB2A 1O9HA 4UCUA 3K06A 3ASOC 1RPOA 5IJ0B 2E5LB 1HNXB 1MSWD 4JI3B 2Z3YA 1AI4A 3PJSK 1G6UA 1VQ4V 4BIZA 3RYFA 2OCCB 1ZSPA 2DJVA 3JALA 5LMUB 3OGIB 2ZNJA 1HNZO 4LF7O 4TT3G 1FXHA 1L0NH 3P3NA 3SJBC 5CB4A 3RVYA 2YEVB 4CZZA 4FM0A 5B66Z 4LFCO 2ITCC 5IYDO 1PD3A 3ASNC 3SYOA 4YXWG 1AJPA 3T4ZA 3FKSG 3OE7G 2HVKC 4JF3A 3ZCCA 2ZDIC 5CBHA 3L9DA 2CTPA 3JSNA 4X62B 1ZTEA 1WB7A 4I0XA 1QCEA 2Q0OC 5CA1B 3RVZA 3E8BA 4QPJA 4JV5O 2IU3A 2M7WA 3LUTB 2ADQB 5BR8B 2DN9A 1WPXA 3ASNB 2AW9A 1MOFA 1Q5OA 3RYIB 1M57C 3JATB 3JASA 1M5IA 4F6EA 2OIGA 3H1IH 4KHPB 4J42A 3U11A 4PA4A 1KD1W 4QE9A 3RYCB 4P2ZA 4YY3B 4DV4B 1I08A 1TVKB 1VF5B 2E3CA 2UUCB 3P3PA 3ZRVA 3JCZA 4JAAA 1MNGA 4DXWA 1R6TA 4UV9A 1JJ2U 3BA8A 3UT5A 1Y74B 4FK5C 4O4HB 1DF5A 4JI6B 5JH7B 1DF4A 2CUGA 3KZIZ 4YIPA 5LMNB 4FVMA 5KAIZ 2HVJC 4ABMA 2WAMA 1HDJA 1ZUQA 3H1KH 1AR5A 5BY1A 4DRXB 5LXTB 3W7XA 1SQBH 4IIJA 1XNRO 2K9PA 4OXSA 3RGBA 3AK2A 3W7WA 1CEZA 3PN1A 1TVKA 1VIBA 1I7FA 3CHXA 1N0NA 5JVDB 2H3OA 5D5QA 2WA3A 3OUFA 1JFFA 4PA6A 3FYIB 3LNNA 5GW7A 4RWUA 4D6TH 3CMAV 3RYCA 3JAKA 4OX9B 2YI8A 4JI0O 4GYCB 4DR7B 4J9ZB 5F2VO 1JA8A 4YJ2A 3TK1A 3STZC 1GM7A 3ZMZA 5GONA 5IY5B 1NZ6A 1K97A 3UQ8A 4JI6O 2AGAA 5KHKA 5BMVA 3VQXA 2WLKA 1M4UA 2DYSC 1LUWA 3B77A 2YIDA 3JD0A 3STLC 2B9ZA 3OTOO 3ZJZA 3L75H 5EK0A 3ZS8C 1Z5WA 4I50A 1VEWA 4O4LA 4YJ3B 1XL4A 2QKSA 3APOA 3TXQA 4FLTA 1BGYH 5J2UA 1UFIA 2QKCA 1SQGA 3E89A 4ZHQA 2ZM6B 4UUJC 3OM3B 4ZKIA 2XAHA 4LFCB 2W0XA 4PDLA 4Z1VA 5D5PA 3A8TA 1FPOA 3K79A 1N0JA 1R3LC 3CC4V 3ZBHA 3W7TA 5LHGA 4PDMA 2PF4E 3M7MX 4X62O 1HNZB 1FJGB 3B4SA 4B7EA 4DV5B 2YI9A 1XHXA 1VQOV 3T1YB 1R6NA 1D5NA 1F7YA 3T4DA 3MDSA 4U3JA 3DC5A 2Q4PA 1YJNV 1YJ9V 3BFRA 3B40A 4ZHQB 1B6QA 2F23A 1NKDA 2HHHB 3WFVA 1AI7A 4DR5B 1SRYA 1IBLO 2RN9A 2QWQB 4U7NA 3M8AA 1H8EG 4F4LA 3K9SA 1O9GA 3ABLC 2A9HA 1Y76A 1AJNA 2GTAA 1SC5B 3ETEA 4DR7O 1YDXA 1TUBA 1ZL8B 5IY5C 2WLMA 2OTJV 1P7BA 3FAVA 1MA1A 2IH3C 3CRAA 4JI2B 2DYRC 5BR8O 4JI5O 2RDCA 4WF9V 2F4VB 4DR3O 1WPBA 1SQXH 1P84F 1XDCA 2DWEC 2JEUA 3G4SV 2QTSA 1IBKB 4BW9A 1XNRB 3WB1A 4X1YA 4KHPO 2XAGA 3EHBB 1FXKA 1V9PA 2BE3A 3AEIA 1YSCA 2DYRB 5EBLC 3KCXA 2UXBB 2X6BA 2KG7A 5LMNO 2LFRA 4UVCA 2VQEB 2DE0X 1BZKA 3BVOA 1JFFB 2Q9LA 1QQCA 1KECA 4KP4A 3TCUA 4UCSA 1Q6IA 1NI8A 2QWRB 3AG7A 2B1IA 3IFXA 4TUYB 4MVSA 3G80A 4TV9B 2IJIA 4O2BA 1VQ8V 4H44B 4FLZA 3B2EE 3RYHB 1SQQH 1OCRC 2BOBC 3IJ4A 5EZYA 3HKDB 2YXHA 1GAXA 2WWWA 3RT3C 4U3FH 2UUAO 4B7KA 2FMLA 2IW5A 2R9RB 4K8XA 1VF6A 1WA8B 5CBFA 3X2QC 1UPGA 2EULA 3K59A 1IBKO 2UU9B 4DR1B 2XAFA 2DMXA 4P9PA 4W4LA 1K8AW 3MHHC 4PA9A 1MZEA 1A32A 2QR4A 3AG2B 1JR9A 1VQ5V 2DQ3A 4NVPA 1K33A 4MTGA 5JQGA 5L3EA 1K4DC 1AI5A 4TV8A 5LA6A 2Y69C 2BTOA 1KKDA 2G38A 3RYIA 1JPXA 4DR4B 3WB2A 1ZWIC 2EIJB 5CA0A 4NTXA 4NXNO 4MW3A 1H8HG 1KB9F 5AG2A 3Q4HA 4RO2A 3ZMSA 5IJ9A 1IBLB 1RM1C 4J7ZA 3DC6A 2IM9A 3CRQA 3SJAC 4LH7A 1L0LH 3EFFK 5B3SC 3J81N 3A0BZ 1JVMA 4GX0A 4X8AA 5H2FZ 2DW4A 1XMQB 4JI8B 1VARA 4G28B 5LP6C 4BIOA 4CC6A 4X65B 2XHBA 4DV1O 1XMOO 1IX9A 1KQSU 3U0ZA 3CEIA 1SF9A 4LNUA 1OCOB 5A2QN 4DV3B 4GLXA 3E35A 4DV5O 3JARB 3FX7A 1RM1B 4O4HA 4LH6A 2R70A 3K0DA 3F5TA 4FZ0A 1FS0G 1PL0A 2KQXA 3E22B 3H1HH 3CCVV 2HJDA 5K1XA 4JZGA 4X66O 4DR3B 2DQ0A 3CS5A 4JI4B 1BCCH 2X7RB 4NXNB 5CA3A 5JWPA 5IJ0A 1RP3B 4DUZB 4Z1MG 1I5YA 4LNUB 3EXAA 1J5EO 1K3EA 3K9AA 4KFMA 2A79B 2WSSG 2EILB 3D8CA 5L3CA 3MHSC 5BZBA 4GUNA 2EINB 2WLLB 5GTHZ 3RYHA 5B1AB 1L8DA 1F4NA 1XNQB 2UXCB 1AVMA 1KBHA 4R7CA 1VQLV 2FL4A 3B09A 3UT5B 5H6RA 1VQ7V 1MZFA 3BA9A 2UXDB 1XHZA 2Y69B 2WLHA 4B3SO 1BQZA 1PKXA 3D3QA 3K5MA 3K08A 3UKMA 4RUFA 3ZX6A 2WLNA 2XAQA 4IGGA 4LBEC 3QG5A 5FNVA 2FTKA 4H13B 4J7JA 3ZHTA 3ZHRA 1W0JG 2YIAA 2OCHA 1XREA 2F43G 4DR5O 2QA4V 3NXSA 4LF6B 4LFAO 3AK3A 1SZTA 1QHTA 2EZPA 5K1PA 3W7UA 1JCHA 2Q6AA 4JAUA 4ZI7B 2C2AA 3CCJV 4AQYO 3JYCA 1NTZH 4J7KA 3JSLA 3ZN1A 4F6RA 4ZOLB 2DWDC 3P30A 3NR7A 2WLLA 1IXBA 3ABMC 2M6YA 3ZHSA 2XOKG 2YIBD 2ARHA 1XILA 2F66C 3SYCA 3RBZA 4WFEA 2F4VO 1TAEA 3O65A 4L8JA 1SS3A 4CC5A 5JH7A 2LFSA 2RNBA 2OWOA 3JAWB 3BCCH 1DLBA 4PHZA 2QDOA 2MK3A 4WFFA 4X9QA 5J9PC 5FNVB 1XBLA 4WFBV 2P4VA 3OAAG 4LF4O 1N32B 2WPDG 3UO3A 4PJ0Z 2X6CA 4FPPA 4W4KA 2LQTA 2PUSA 1Q3EA 4CH4A 2Q69A 4H33A 1RSOA 4LFBO 3JATA 3DSQA 3F7YC 2A3QA 1NH2D 4H0LB 3ZRWA 1NR7A 4IT5A 1V55B 1HNWO 3L74H 3IC9A 3BRCA 1H2SB 3AG3B 3ZRXA 4J41A 2F95B 3SPJA 1KKCA 4TSFG 2D3OW 3A0HZ 4PI2A 5LGUA 2H8PC 3CCSV 5EZYB 1NBMG 5LMUO 2EIJC 3G6BA 1P7GA 3I55V 3SJQC 5B1BB 3D36A 5EYPA 2QSAA 1VF7A 1AP5A 1I5XA 2QTOA 3LDDA 2ADPA 3JD3A 3G71V 1FYJA 2ZM6O 4FFBB 1MG1A 1S5LZ 3QTCA 2NR5A 3CCQV 1XOUA 5FLXN 5IT9N 2IJHA 2JGDB 4Z2WA 2Q0AA 1TUEB 2EIKC 3WG7C 2YC0A 4OGQB 1VQPV 1F23A 1W0KG 3BAAA 2B5UA 3N2KA 5KHHA 5IYCO 4O2AB 3BY6A 1X4TA 4JI4O 3HR0A 1YI2V 4DR6O 1CXZB 2ZR2A 3GVMA 1K9MW 3T1HO 2HFEC 1KC8W 4R6ZA 2EX3A 5C8YB 3ZHUA 2EZOA 2NN4A 3CC2V 3ETGA 1EM1A 1VP7A 1U97A 1WP8A 1SERA 3CP1A 3UM7A 4EKWA 4QNHB 1QR8A 3OUSA 4U7OA 4FLUA 3L71H 2GSMB 3QF7A 2UUBB 2CTRA 3R66A 4Q6GA 1JMKC 2PGGA 4MTXA 1QR9A 1ORQC 2UUAB 1RSOB 2WLIB 3ZIAG 1XL6A 1S77D 4K8ZA 2CTQA 2ZE8A 2P7TC 2DOSA 2ZKOA 2F1MA 2LW7A 1M9NA 4X65O 1XNQO 2UXCO 4GKKO 1SZXA 5DECA 4DV2O 1AROP 3HKDA 3G67A 1N36B 4IL6Z 4WBNA 1SQPH 1SETA 3SYPA 1N8RW 3IC7A 1VQ9V 1H2KA 1OJHA 4X1KA 5IJ9B 3THOA 2UXBO 2V7QG 1K73W 2KKWA 5JCOA 1DGSA 1GMGA 4IYIA 5J2UB 4BIUA 4D7TA 4B3MB 1EFRG 4AILC 5LA6B 3H1JH 4JTDB 2OT5A 3JD2A 3H1LH 5HFLA 1MMMA 2JGDA 3CCUV 4ZBMA 2QWNB 2IBZH 4F6RB 1Z2GA 4RAIA 4DK0A 2JDIG 1G8MA 3AK1A 3OTFA 3BPZA 2UXNA 3K5LA 2PYJA 5A9GA 3FB8C 4I9QA 5IYZB 3B8NA 5EIBC 2HEPA 1M93A 3RN4A 4FMTA 1P49A 1QVFU 2WA4A 4CH3A 1AI6A 4EFEA 2YICA 2CK3G 2AZ0A 3HKEA 4FM2A 1VQMV 1I94B 4JGSA 2VRZA 3CRRA 2CGOA 4NTYA 3SGIA 4LF9B 4TOIA 2W6IG 2QWPB 3AG3C 4ASUG 5C8YA 1OCZB 3ABLB 4UB8Z 4DV1B 1XMOB 1KUQA 1FFTB 2R72A 2ZE6A 1COWG 1CPYA 2D2CB 4TWKA 4WFHA 1N4CA 1R3KC 4X20A 5DN6G 2GV9A 4K0KB 2JS5A 1KMIZ 4NB5A 3J7AU 1EN5A 3SPHA 3ZMVA 4UCOA 3SPIA 1QVGU 1FXVA 3LDEA 3X2QB 3OGCC 1OCZC 1Q6HA 3OEEG 4PDRA 2QE7G 2Q68A 4GX5A 1LR1A 2QKAA 3OW2U 2Y0IA 2Q5ZA 4FLXA 4JTAB 2V1DA 3IGAC 2PZSA 2AHYA 4GKKB 4J10A 1BE3H 2EIKB 4FLWA 4I50B 4H37A 4EB6A 5IWAO 3FYEB 1PNLA 4UCVA 3T1YO 1GTOA 2Y4UA 3OMIB 4YY3O 3SJCC 2VWKA 2QM7A 3N27A 1MABG 2EJRA 1SA0A 3OMNB 2R9IA 4B3TB 2JRIA 3AG1B 1QBZA 3TETA 3OR7C 2HP8A 2VS0A 3CSXA 1SQVH 1KP3A 2UUBO 3L72H 2FKXA 1SA0B 3EVKA 3K5NA 1Q43A 2BCCH 3ML0A 3D3IA 5LHIA 3Q4HB 4MVZA 2QJ1A 2Q7EA 1GN6A 4DK1A 2DYSB 1EN6A 1Y66A 3GB7C 1JJOA 5LGNA 1H2MA 4QE7A 2IJKA 4PA7A 1I0HA 4JZ2A 1I94O 1PPJH 2PI5A 4HNAB 1RPRA 2ZINA 1M90W 1K4CC 4B3TO 3HKBB 1V54B 3G6EV 4LF6O 4CS4A 3OFNG 3QO7A 3SDLA 1VQ6V 5FPOA 3N2GB 1EBOA 1KYOF 4J11A 2VWJA 4RQFA 1OCRB 1HR0B 1T5EA 3SYAA 4UFZA 4O4LB 4YJ3A 1HW7A 5LXTA 4LCUC 5L3FA 3DGEA 3O9OA 1OCCC 3CC7V 4PV1B 1GN3A 4DV6O 3U10A 1G4YB 4I4TA 2X6AA 4Q20A 5LOVA 2P5OA 3K3WA 2RQ6A 3HKCB 3BABA 2Y0PA 3ICXA 4JI1O 2QM4A 1FFXB 1SQFA 3CJHB 4TV9A
chains in the Genus database with same CATH topology
1J5EO 4JI2O 3RT3C 5IWAO 2UUAO 4DUZO 3T1YO 4JI4O 4DR6O 1XMQO 1N36O 4LFCO 4JI8O 4K0KO 4DV4O 3T1HO 4DR1O 4GKJO 4YY3O 1IBKO 1IBLO 4LF4O 2VQEO 1HR0O 3M8AA 2JRIA 1N33O 4JI0O 1A32A 4LFBO 1AB3A 1IBMO 4A5UB 2UUBO 4DR7O 2FKXA 4X64O 4LF5O 1DK1A 4OX9O 4JV5O 1XEQA 1HNWO 4JI6O 2AGAA 3J80N 4B3SO 4DV3O 2E5LO 1HNXO 4OPHA 3R66A 4NXMO 4NXNO 1G1XB 5BR8O 4JI5O 4DR4O 1R1BA 1FJGO 2UXDO 3OTOO 2UUCO 4B3RO 4DR2O 4DR3O 2HHHO 5LMUO 1I94O 4DR5O 4YHHO 1FKAO 2DOSA 2ZKOA 2LW7A 4LFAO 1N34O 4B3TO 4KHPO 4X65O 1KUQA 1XNQO 2UXCO 4JYAO 4LF6O 4GKKO 3J81N 1YZBA 1AILA 1R6TA 3SDLA 5H5NA 4JI3O 4DV2O 4AQYO 4DUYO 4DV1O 1XMOO 1D2DA 4LF8O 1NS1A 3J7AU 4DV7O 5LMNO 2UU9O 1N32O 1FYJA 2ZM6O 1X59A 2N74A 5A2QN 2Z0AA 4DV5O 4JI7O 5FLXN 4B3MO 3F5TA 2UXBO 5IT9N 4X62O 5LL6Y 5BXZA 4DV6O 2DJVA 5BY1A 2F4VO 4X66O 4LF9O 1HNZO 3O65A 2VQFO 4OPAA 4LF7O 3JAMN 4DV0O 4JI1O 1XNRO 1F7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E O;  4JI2 O;  3RT3 C;  5IWA O;  2UUA O;  4DUZ O;  3T1Y O;  4JI4 O;  4DR6 O;  1XMQ O;  1N36 O;  4LFC O;  4JI8 O;  4K0K O;  4DV4 O;  3T1H O;  4DR1 O;  4GKJ O;  4YY3 O;  1IBK O;  1IBL O;  4LF4 O;  2VQE O;  1HR0 O;  3M8A A;  2JRI A;  1N33 O;  4JI0 O;  1A32 A;  4LFB O;  1AB3 A;  1IBM O;  4A5U B;  2UUB O;  4DR7 O;  2FKX A;  4X64 O;  4LF5 O;  1DK1 A;  4OX9 O;  4JV5 O;  1XEQ A;  1HNW O;  4JI6 O;  2AGA A;  3J80 N;  4B3S O;  4DV3 O;  2E5L O;  1HNX O;  4OPH A;  3R66 A;  4NXM O;  4NXN O;  1G1X B;  5BR8 O;  4JI5 O;  4DR4 O;  1R1B A;  1FJG O;  2UXD O;  3OTO O;  2UUC O;  4B3R O;  4DR2 O;  4DR3 O;  2HHH O;  5LMU O;  1I94 O;  4DR5 O;  4YHH O;  1FKA O;  2DOS A;  2ZKO A;  2LW7 A;  4LFA O;  1N34 O;  4B3T O;  4KHP O;  4X65 O;  1KUQ A;  1XNQ O;  2UXC O;  4JYA O;  4LF6 O;  4GKK O;  3J81 N;  1YZB A;  1AIL A;  1R6T A;  3SDL A;  5H5N A;  4JI3 O;  4DV2 O;  4AQY O;  4DUY O;  4DV1 O;  1XMO O;  1D2D A;  4LF8 O;  1NS1 A;  3J7A U;  4DV7 O;  5LMN O;  2UU9 O;  1N32 O;  1FYJ A;  2ZM6 O;  1X59 A;  2N74 A;  5A2Q N;  2Z0A A;  4DV5 O;  4JI7 O;  5FLX N;  4B3M O;  3F5T A;  2UXB O;  5IT9 N;  4X62 O;  5LL6 Y;  5BXZ A;  4DV6 O;  2DJV A;  5BY1 A;  2F4V O;  4X66 O;  4LF9 O;  1HNZ O;  3O65 A;  2VQF O;  4OPA A;  4LF7 O;  3JAM N;  4DV0 O;  4JI1 O;  1XNR O;  1F7Y A; 
#chains in the Genus database with same CATH topology
 2Q7H A;  1Q7Y W;  3T1H B;  1PP9 H;  3FFQ A;  2CH7 A;  3JAL B;  4UVB A;  3CE2 A;  5L3G A;  2Q7G A;  2A06 H;  4GX2 A;  4DR1 O;  4HZ3 A;  4GKJ O;  2BTQ B;  4UCT A;  4JYY A;  1FAF A;  4YHH B;  3CD6 V;  1YIJ V;  4FFK A;  3B8M A;  4JV5 B;  3S3W A;  2CDY A;  3ABT A;  5JVD A;  1GK9 A;  2GTS A;  1FD9 A;  2LGQ A;  5ITZ B;  4OX9 O;  2EBO A;  2HG5 C;  3C3S A;  4KL1 A;  1PM9 A;  4NTW A;  3J80 N;  1S3J A;  3ZHQ A;  4I7Z B;  1R6K A;  4TQF A;  1M57 B;  4OPH A;  1KU9 A;  1K34 A;  3ETQ A;  1G1X B;  5EC2 C;  1FJG O;  1PNM A;  3H01 A;  5LP6 B;  2Z5U A;  2ZR3 A;  4N21 A;  2YS8 A;  4PD4 F;  1PNK A;  2FYU H;  3CCE V;  5DED A;  3OT7 A;  2XT9 A;  2GHY A;  1QLN A;  5EBW C;  1N34 O;  4R50 A;  4MS2 A;  3K0G A;  3CX5 F;  1V54 C;  1Y74 A;  4AHC A;  4BR6 A;  5JQG B;  4DV7 B;  5E79 Z;  1NH2 B;  1YCI A;  2OYQ A;  5JJN B;  2L6L A;  5EC1 C;  2HKO A;  2Z0A A;  4JI0 B;  4FJC C;  4WBN B;  5LGT A;  5ITZ A;  5EBM C;  1BHA A;  4E4E A;  1Y67 A;  4JI5 B;  1FXK B;  1PL4 A;  2FB5 A;  5B5E Z;  3VQV A;  1BT8 A;  1K5Q A;  1QLE C;  3R65 A;  4C7U A;  4EFB A;  1V55 C;  4XDK A;  4UCR A;  3KKY A;  4CH5 A;  3E2E A;  4IYH A;  2PY5 A;  2JJ1 G;  4K0K O;  3CCL V;  4MTO A;  2OCC C;  2ZE5 A;  2LO1 A;  1FXK C;  1NR1 A;  2ZDI A;  1TUB B;  1ZL8 A;  3MD0 A;  1VQK V;  1AP6 A;  2O57 A;  2B1G A;  1LNQ A;  1Y76 B;  1MSD A;  4J9Y B;  4LF4 B;  1GKF A;  4NXM B;  1D5A A;  2EJ7 A;  4X64 O;  1TGO A;  2AXT Z;  5KUM A;  3QO8 A;  5KUK A;  4BW5 A;  1IUR A;  1DTO A;  3DTU B;  3LSU A;  4RUE A;  1N34 B;  2UUC O;  4O2A A;  1VMG A;  1IDS A;  5BMV B;  4B08 A;  1YVW A;  1FKA O;  3FAV B;  3ABM B;  1PV0 A;  1CP9 A;  2A7W A;  3APQ A;  3FD9 A;  4X20 B;  5LBQ A;  4LFB B;  2ZXW B;  3VQY A;  4BAY A;  2CH7 B;  4TUY A;  1D2D A;  4X88 A;  4P9O A;  1Z5V A;  1GN4 A;  2ZT9 B;  1N32 O;  4E2L A;  1WLE A;  1BHB A;  2EIM B;  4B3S B;  5CMU A;  5JJJ B;  4JPR A;  1YEW A;  1M56 B;  5LL6 Y;  2V4D A;  3S3X A;  2ZNI A;  2CAZ C;  1YTF D;  4O4J A;  2E74 B;  4GT1 A;  1KP2 A;  4QIW F;  3OEH G;  2JIZ G;  3E83 A;  2GUZ B;  1J95 A;  3TJT A;  2YXY A;  2PYL A;  2ZCE A;  3ZRS A;  3CRC A;  1B3Q A;  5C93 A;  4LF7 B;  3FB6 C;  1N36 O;  1GM9 A;  3TGU H;  3K03 A;  4R8C A;  2Q67 A;  1S76 D;  2NNU A;  4D7S A;  1N33 O;  5B1A C;  4JI7 B;  1R3J C;  4AQY B;  5L3D A;  2JJ2 G;  3A2F A;  2QWO B;  5H6Q A;  5JJE B;  1YHQ V;  4CBC A;  4A5U B;  4CH6 A;  3W7S A;  4LF5 O;  1WAZ A;  2QM8 A;  4IHJ B;  2P4K A;  3OR6 C;  3A0R A;  2BSK A;  1EN4 A;  4DV3 O;  4X64 B;  5JCO C;  4X1I B;  3M99 B;  3QNE A;  1J5E B;  1GN2 A;  4HAM A;  4I5S A;  2YXL A;  2LP7 A;  3L70 H;  5IWA B;  4I0X B;  3CXH F;  4PI0 A;  4X66 B;  1UJW B;  1Q86 W;  3WU2 Z;  1EZJ A;  3E8H A;  3VOU A;  1S5H C;  2HJF C;  4DRX A;  3K57 A;  4O4I B;  4N23 A;  4I9W A;  3SR2 C;  4YIO A;  3RW0 A;  5IYB O;  2P90 A;  4XDJ A;  4CS3 A;  4X1Y B;  2IJJ A;  1QNM A;  2N74 A;  4GZR B;  4JAV A;  3VBB A;  1AR4 A;  1SKV A;  2WLI A;  1JQ0 A;  4B3M O;  2YEV A;  2CTW A;  5KMG A;  3ZMT A;  4AI8 A;  3ASO B;  3JD1 A;  1M56 C;  3UCS C;  2YDE A;  3P32 A;  5IDJ A;  2HLD G;  4OPA A;  3E8F A;  1NTK H;  5J2T B;  1YF2 A;  4K35 A;  1E1Q G;  2RMK B;  5CBG A;  5EYP B;  2LW1 A;  4GCZ A;  3RYF B;  3AG4 C;  4QPK A;  2HR3 A;  4HYO A;  3JAS B;  3UO2 A;  1JOY A;  1QLE B;  4TQD A;  2ILM A;  2ZIO A;  4DO2 A;  2NLJ C;  1GH6 A;  5KAF Z;  5L3B A;  3ABU A;  4DW1 A;  4FZ1 A;  1W2B U;  4LP8 A;  1AB3 A;  4O4I A;  3AG4 B;  2KSD A;  1DK1 A;  2ZIM A;  3VQW A;  4FLY A;  3HKE B;  4X89 A;  3ZRW B;  1Q8I A;  3JCU Z;  4NXM O;  2A0L A;  4YJ2 B;  4KUM A;  5KA5 A;  4MSW C;  5CA0 B;  2HHH O;  4LWS B;  3KCY A;  1P4R A;  2JGU A;  2ODM A;  4MW8 A;  4YHH O;  4DR2 B;  1GM8 A;  4JYC A;  4IHJ A;  4GKJ B;  1GO3 F;  1US6 A;  5FPR A;  4PA3 A;  2N05 A;  3LSQ A;  2GBO A;  3HKC A;  1WA8 A;  3FB5 C;  5KMG B;  2E76 B;  4UV8 A;  4WFG A;  3C90 A;  4DR6 B;  4DUY O;  3ZED A;  4DYL A;  1Q90 D;  2OIE A;  4LF8 O;  2UU9 O;  1S0V A;  1X59 A;  4ICG A;  3I56 V;  4JAS A;  5LOV B;  1B06 A;  3OD4 A;  2KB1 A;  1K5S A;  5BXZ A;  2JS3 A;  1NQT A;  3N2G A;  5IE9 A;  2ETN A;  2VQF O;  2AHZ A;  5B1N A;  1K92 A;  3JAM N;  2F93 B;  5LYJ B;  1WNS A;  3HKB A;  5J2T A;  1BL8 A;  3L73 H;  2XND G;  2PI4 A;  2Q73 A;  4CS2 A;  2P22 C;  3JD4 A;  1NJI W;  1GRJ A;  4JI2 O;  1HWY A;  2EIL C;  2RCV A;  4U3J B;  1VF6 C;  4JI8 O;  1VQN V;  4DV2 B;  2P06 A;  4UB6 Z;  4JTC B;  2K1E A;  5KHG A;  4HNA A;  2VQE O;  1HR0 O;  3D36 C;  1Y6X A;  4TV8 B;  1WP7 A;  4MVM A;  1ZLZ A;  4WCE V;  3T2M A;  5DM6 V;  1TA8 A;  1NVP B;  1S5J A;  5CN0 A;  1NT2 B;  3TXS A;  3BHP A;  4DV0 B;  1YTF B;  4B3R B;  2XUM A;  2YSU B;  4JI1 B;  1Y4M A;  4DR4 O;  1R3I C;  2UXD O;  3C3T A;  2ZE7 A;  1THZ A;  4B3R O;  4DR2 O;  3F5W C;  2QGN A;  1RFY A;  3K5O A;  4LR3 A;  2ZD9 A;  4NYK A;  5CB4 B;  1LUV A;  1F51 A;  2BOC C;  4X1I A;  4EEQ A;  1W59 A;  4K3A A;  4DW0 A;  3BEH A;  1JX9 A;  2XAS A;  5LHH A;  4G27 B;  3LSS A;  2LJ2 A;  1S72 V;  5E1A C;  4JYA B;  5LP6 A;  1H2L A;  2L35 A;  3T1C A;  4DV7 O;  1BSM A;  2YUA A;  4L87 A;  5FL7 G;  3K58 A;  1E1R G;  1SES A;  2YIB A;  1NVP D;  2XAJ A;  2H94 A;  3GWK C;  2CE4 A;  1H2N A;  4G2K A;  1F4M A;  1ROP A;  3N2K B;  4KXR A;  4LF9 O;  3ZMU A;  3DXR A;  1URF A;  4DV0 O;  3AG1 C;  5H9C A;  4MT8 A;  5KHI A;  4FFB A;  2Y48 A;  2BTQ A;  2QEX V;  4XDL A;  1EZV H;  4QJF B;  2W6J G;  2RJZ A;  1XI1 A;  4O2B B;  1H38 A;  2X0L A;  4MVR A;  1XMQ O;  1BQ0 A;  1WN7 A;  4DV4 O;  3CWB H;  2JK5 C;  2P6J A;  3QVN A;  3I5D A;  4I55 A;  4DUY B;  2E75 B;  5HFM A;  1OCC B;  5KX5 A;  4LC1 A;  2Q8V A;  5LYJ A;  4PDV A;  5KA6 A;  1ENV A;  3SPG A;  3ABK C;  1IZ3 A;  2OTL V;  5EIB D;  2R9A A;  3FB7 C;  1IBM O;  4QGP A;  4LF8 B;  2JEX A;  4RQE A;  3CME V;  2BSK B;  1N33 B;  3OMA B;  3ZN0 A;  5B1O A;  3CCR V;  1HNX O;  3E86 A;  1HNW B;  4NR1 A;  1R1B A;  3ETD A;  3CCM V;  5IYZ A;  3IAY A;  5GTI Z;  1BMF G;  3E8G A;  3HB3 B;  1NU1 H;  4WFA V;  4FLV A;  4ZI7 A;  3HPL C;  2ZXW C;  2ATK C;  2N04 A;  3DXR B;  3CYO A;  5GON B;  4UXN A;  1QU7 A;  4JYA O;  5B1B C;  1YZB A;  4MVQ A;  3RFR A;  2AZ2 A;  4BWA A;  3JAK B;  4O4J B;  3SYQ A;  2CGN A;  3LDC A;  4LF5 B;  1E79 G;  1NS1 A;  4P30 A;  3ZHV A;  2P67 A;  3K04 A;  4X1K B;  2EIN C;  4JI7 O;  4ZIB A;  4DV6 B;  1IVS A;  5KLV H;  2KG7 B;  5CA1 A;  3LNM B;  4I4T B;  2W0F C;  3SPC A;  3WG7 B;  4FIP C;  1AJQ A;  3JAW A;  1YJW V;  1IBM B;  2IU0 A;  5TIS Z;  1M1K W;  4HBN A;  2Y4T A;  1HP8 A;  4FM1 A;  4J80 A;  4XBF A;  1OHH G;  3WB0 A;  5KHJ A;  5B3S B;  4LFA B;  4ZOL A;  1WB8 A;  4PEL A;  1L1F A;  2WLJ A;  4DUZ O;  2PTM A;  1U96 A;  1ZAU A;  4EB6 B;  2MW2 B;  1OCO C;  4MVU A;  1XUQ A;  4NKG B;  2GDS A;  1NTM H;  3MAQ A;  1Q81 W;  1WJZ A;  3CPW U;  4JYB A;  3ABK B;  3CXC U;  3E22 A;  1AR1 B;  3RWR D;  2IH1 C;  4MVO A;  1XQ8 A;  1YXB A;  3OTO B;  1XEQ A;  3JAR A;  2LGW A;  2VQF B;  1IXM A;  1K7D A;  1R73 A;  3AG2 C;  4LWS A;  2GUZ A;  3CRM A;  2E5L O;  2ITD C;  5KX5 B;  2XTA A;  3QO5 A;  2EIM C;  1BS3 A;  3GWO A;  2JVD A;  1FFX A;  3CJH A;  3KG2 A;  1ZX3 A;  1OV9 A;  4IIJ B;  1YIT V;  4GX1 A;  1H2G A;  4MTF A;  2ZQM A;  4I55 B;  1OZ0 A;  1Q82 W;  4UVA A;  3F7V C;  1B04 A;  1AIL A;  5H5N A;  1Q6U A;  4JI3 O;  2UXX A;  3H9V A;  3CB2 A;  1O9H A;  4UCU A;  3K06 A;  3ASO C;  1RPO A;  5IJ0 B;  2E5L B;  1HNX B;  1MSW D;  4JI3 B;  2Z3Y A;  1AI4 A;  3PJS K;  1G6U A;  1VQ4 V;  4BIZ A;  3RYF A;  2OCC B;  1ZSP A;  2DJV A;  3JAL A;  5LMU B;  3OGI B;  2ZNJ A;  1HNZ O;  4LF7 O;  4TT3 G;  1FXH A;  1L0N H;  3P3N A;  3SJB C;  5CB4 A;  3RVY A;  2YEV B;  4CZZ A;  4FM0 A;  5B66 Z;  4LFC O;  2ITC C;  5IYD O;  1PD3 A;  3ASN C;  3SYO A;  4YXW G;  1AJP A;  3T4Z A;  3FKS G;  3OE7 G;  2HVK C;  4JF3 A;  3ZCC A;  2ZDI C;  5CBH A;  3L9D A;  2CTP A;  3JSN A;  4X62 B;  1ZTE A;  1WB7 A;  4I0X A;  1QCE A;  2Q0O C;  5CA1 B;  3RVZ A;  3E8B A;  4QPJ A;  4JV5 O;  2IU3 A;  2M7W A;  3LUT B;  2ADQ B;  5BR8 B;  2DN9 A;  1WPX A;  3ASN B;  2AW9 A;  1MOF A;  1Q5O A;  3RYI B;  1M57 C;  3JAT B;  3JAS A;  1M5I A;  4F6E A;  2OIG A;  3H1I H;  4KHP B;  4J42 A;  3U11 A;  4PA4 A;  1KD1 W;  4QE9 A;  3RYC B;  4P2Z A;  4YY3 B;  4DV4 B;  1I08 A;  1TVK B;  1VF5 B;  2E3C A;  2UUC B;  3P3P A;  3ZRV A;  3JCZ A;  4JAA A;  1MNG A;  4DXW A;  1R6T A;  4UV9 A;  1JJ2 U;  3BA8 A;  3UT5 A;  1Y74 B;  4FK5 C;  4O4H B;  1DF5 A;  4JI6 B;  5JH7 B;  1DF4 A;  2CUG A;  3KZI Z;  4YIP A;  5LMN B;  4FVM A;  5KAI Z;  2HVJ C;  4ABM A;  2WAM A;  1HDJ A;  1ZUQ A;  3H1K H;  1AR5 A;  5BY1 A;  4DRX B;  5LXT B;  3W7X A;  1SQB H;  4IIJ A;  1XNR O;  2K9P A;  4OXS A;  3RGB A;  3AK2 A;  3W7W A;  1CEZ A;  3PN1 A;  1TVK A;  1VIB A;  1I7F A;  3CHX A;  1N0N A;  5JVD B;  2H3O A;  5D5Q A;  2WA3 A;  3OUF A;  1JFF A;  4PA6 A;  3FYI B;  3LNN A;  5GW7 A;  4RWU A;  4D6T H;  3CMA V;  3RYC A;  3JAK A;  4OX9 B;  2YI8 A;  4JI0 O;  4GYC B;  4DR7 B;  4J9Z B;  5F2V O;  1JA8 A;  4YJ2 A;  3TK1 A;  3STZ C;  1GM7 A;  3ZMZ A;  5GON A;  5IY5 B;  1NZ6 A;  1K97 A;  3UQ8 A;  4JI6 O;  2AGA A;  5KHK A;  5BMV A;  3VQX A;  2WLK A;  1M4U A;  2DYS C;  1LUW A;  3B77 A;  2YID A;  3JD0 A;  3STL C;  2B9Z A;  3OTO O;  3ZJZ A;  3L75 H;  5EK0 A;  3ZS8 C;  1Z5W A;  4I50 A;  1VEW A;  4O4L A;  4YJ3 B;  1XL4 A;  2QKS A;  3APO A;  3TXQ A;  4FLT A;  1BGY H;  5J2U A;  1UFI A;  2QKC A;  1SQG A;  3E89 A;  4ZHQ A;  2ZM6 B;  4UUJ C;  3OM3 B;  4ZKI A;  2XAH A;  4LFC B;  2W0X A;  4PDL A;  4Z1V A;  5D5P A;  3A8T A;  1FPO A;  3K79 A;  1N0J A;  1R3L C;  3CC4 V;  3ZBH A;  3W7T A;  5LHG A;  4PDM A;  2PF4 E;  3M7M X;  4X62 O;  1HNZ B;  1FJG B;  3B4S A;  4B7E A;  4DV5 B;  2YI9 A;  1XHX A;  1VQO V;  3T1Y B;  1R6N A;  1D5N A;  1F7Y A;  3T4D A;  3MDS A;  4U3J A;  3DC5 A;  2Q4P A;  1YJN V;  1YJ9 V;  3BFR A;  3B40 A;  4ZHQ B;  1B6Q A;  2F23 A;  1NKD A;  2HHH B;  3WFV A;  1AI7 A;  4DR5 B;  1SRY A;  1IBL O;  2RN9 A;  2QWQ B;  4U7N A;  3M8A A;  1H8E G;  4F4L A;  3K9S A;  1O9G A;  3ABL C;  2A9H A;  1Y76 A;  1AJN A;  2GTA A;  1SC5 B;  3ETE A;  4DR7 O;  1YDX A;  1TUB A;  1ZL8 B;  5IY5 C;  2WLM A;  2OTJ V;  1P7B A;  3FAV A;  1MA1 A;  2IH3 C;  3CRA A;  4JI2 B;  2DYR C;  5BR8 O;  4JI5 O;  2RDC A;  4WF9 V;  2F4V B;  4DR3 O;  1WPB A;  1SQX H;  1P84 F;  1XDC A;  2DWE C;  2JEU A;  3G4S V;  2QTS A;  1IBK B;  4BW9 A;  1XNR B;  3WB1 A;  4X1Y A;  4KHP O;  2XAG A;  3EHB B;  1FXK A;  1V9P A;  2BE3 A;  3AEI A;  1YSC A;  2DYR B;  5EBL C;  3KCX A;  2UXB B;  2X6B A;  2KG7 A;  5LMN O;  2LFR A;  4UVC A;  2VQE B;  2DE0 X;  1BZK A;  3BVO A;  1JFF B;  2Q9L A;  1QQC A;  1KEC A;  4KP4 A;  3TCU A;  4UCS A;  1Q6I A;  1NI8 A;  2QWR B;  3AG7 A;  2B1I A;  3IFX A;  4TUY B;  4MVS A;  3G80 A;  4TV9 B;  2IJI A;  4O2B A;  1VQ8 V;  4H44 B;  4FLZ A;  3B2E E;  3RYH B;  1SQQ H;  1OCR C;  2BOB C;  3IJ4 A;  5EZY A;  3HKD B;  2YXH A;  1GAX A;  2WWW A;  3RT3 C;  4U3F H;  2UUA O;  4B7K A;  2FML A;  2IW5 A;  2R9R B;  4K8X A;  1VF6 A;  1WA8 B;  5CBF A;  3X2Q C;  1UPG A;  2EUL A;  3K59 A;  1IBK O;  2UU9 B;  4DR1 B;  2XAF A;  2DMX A;  4P9P A;  4W4L A;  1K8A W;  3MHH C;  4PA9 A;  1MZE A;  1A32 A;  2QR4 A;  3AG2 B;  1JR9 A;  1VQ5 V;  2DQ3 A;  4NVP A;  1K33 A;  4MTG A;  5JQG A;  5L3E A;  1K4D C;  1AI5 A;  4TV8 A;  5LA6 A;  2Y69 C;  2BTO A;  1KKD A;  2G38 A;  3RYI A;  1JPX A;  4DR4 B;  3WB2 A;  1ZWI C;  2EIJ B;  5CA0 A;  4NTX A;  4NXN O;  4MW3 A;  1H8H G;  1KB9 F;  5AG2 A;  3Q4H A;  4RO2 A;  3ZMS A;  5IJ9 A;  1IBL B;  1RM1 C;  4J7Z A;  3DC6 A;  2IM9 A;  3CRQ A;  3SJA C;  4LH7 A;  1L0L H;  3EFF K;  5B3S C;  3J81 N;  3A0B Z;  1JVM A;  4GX0 A;  4X8A A;  5H2F Z;  2DW4 A;  1XMQ B;  4JI8 B;  1VAR A;  4G28 B;  5LP6 C;  4BIO A;  4CC6 A;  4X65 B;  2XHB A;  4DV1 O;  1XMO O;  1IX9 A;  1KQS U;  3U0Z A;  3CEI A;  1SF9 A;  4LNU A;  1OCO B;  5A2Q N;  4DV3 B;  4GLX A;  3E35 A;  4DV5 O;  3JAR B;  3FX7 A;  1RM1 B;  4O4H A;  4LH6 A;  2R70 A;  3K0D A;  3F5T A;  4FZ0 A;  1FS0 G;  1PL0 A;  2KQX A;  3E22 B;  3H1H H;  3CCV V;  2HJD A;  5K1X A;  4JZG A;  4X66 O;  4DR3 B;  2DQ0 A;  3CS5 A;  4JI4 B;  1BCC H;  2X7R B;  4NXN B;  5CA3 A;  5JWP A;  5IJ0 A;  1RP3 B;  4DUZ B;  4Z1M G;  1I5Y A;  4LNU B;  3EXA A;  1J5E O;  1K3E A;  3K9A A;  4KFM A;  2A79 B;  2WSS G;  2EIL B;  3D8C A;  5L3C A;  3MHS C;  5BZB A;  4GUN A;  2EIN B;  2WLL B;  5GTH Z;  3RYH A;  5B1A B;  1L8D A;  1F4N A;  1XNQ B;  2UXC B;  1AVM A;  1KBH A;  4R7C A;  1VQL V;  2FL4 A;  3B09 A;  3UT5 B;  5H6R A;  1VQ7 V;  1MZF A;  3BA9 A;  2UXD B;  1XHZ A;  2Y69 B;  2WLH A;  4B3S O;  1BQZ A;  1PKX A;  3D3Q A;  3K5M A;  3K08 A;  3UKM A;  4RUF A;  3ZX6 A;  2WLN A;  2XAQ A;  4IGG A;  4LBE C;  3QG5 A;  5FNV A;  2FTK A;  4H13 B;  4J7J A;  3ZHT A;  3ZHR A;  1W0J G;  2YIA A;  2OCH A;  1XRE A;  2F43 G;  4DR5 O;  2QA4 V;  3NXS A;  4LF6 B;  4LFA O;  3AK3 A;  1SZT A;  1QHT A;  2EZP A;  5K1P A;  3W7U A;  1JCH A;  2Q6A A;  4JAU A;  4ZI7 B;  2C2A A;  3CCJ V;  4AQY O;  3JYC A;  1NTZ H;  4J7K A;  3JSL A;  3ZN1 A;  4F6R A;  4ZOL B;  2DWD C;  3P30 A;  3NR7 A;  2WLL A;  1IXB A;  3ABM C;  2M6Y A;  3ZHS A;  2XOK G;  2YIB D;  2ARH A;  1XIL A;  2F66 C;  3SYC A;  3RBZ A;  4WFE A;  2F4V O;  1TAE A;  3O65 A;  4L8J A;  1SS3 A;  4CC5 A;  5JH7 A;  2LFS A;  2RNB A;  2OWO A;  3JAW B;  3BCC H;  1DLB A;  4PHZ A;  2QDO A;  2MK3 A;  4WFF A;  4X9Q A;  5J9P C;  5FNV B;  1XBL A;  4WFB V;  2P4V A;  3OAA G;  4LF4 O;  1N32 B;  2WPD G;  3UO3 A;  4PJ0 Z;  2X6C A;  4FPP A;  4W4K A;  2LQT A;  2PUS A;  1Q3E A;  4CH4 A;  2Q69 A;  4H33 A;  1RSO A;  4LFB O;  3JAT A;  3DSQ A;  3F7Y C;  2A3Q A;  1NH2 D;  4H0L B;  3ZRW A;  1NR7 A;  4IT5 A;  1V55 B;  1HNW O;  3L74 H;  3IC9 A;  3BRC A;  1H2S B;  3AG3 B;  3ZRX A;  4J41 A;  2F95 B;  3SPJ A;  1KKC A;  4TSF G;  2D3O W;  3A0H Z;  4PI2 A;  5LGU A;  2H8P C;  3CCS V;  5EZY B;  1NBM G;  5LMU O;  2EIJ C;  3G6B A;  1P7G A;  3I55 V;  3SJQ C;  5B1B B;  3D36 A;  5EYP A;  2QSA A;  1VF7 A;  1AP5 A;  1I5X A;  2QTO A;  3LDD A;  2ADP A;  3JD3 A;  3G71 V;  1FYJ A;  2ZM6 O;  4FFB B;  1MG1 A;  1S5L Z;  3QTC A;  2NR5 A;  3CCQ V;  1XOU A;  5FLX N;  5IT9 N;  2IJH A;  2JGD B;  4Z2W A;  2Q0A A;  1TUE B;  2EIK C;  3WG7 C;  2YC0 A;  4OGQ B;  1VQP V;  1F23 A;  1W0K G;  3BAA A;  2B5U A;  3N2K A;  5KHH A;  5IYC O;  4O2A B;  3BY6 A;  1X4T A;  4JI4 O;  3HR0 A;  1YI2 V;  4DR6 O;  1CXZ B;  2ZR2 A;  3GVM A;  1K9M W;  3T1H O;  2HFE C;  1KC8 W;  4R6Z A;  2EX3 A;  5C8Y B;  3ZHU A;  2EZO A;  2NN4 A;  3CC2 V;  3ETG A;  1EM1 A;  1VP7 A;  1U97 A;  1WP8 A;  1SER A;  3CP1 A;  3UM7 A;  4EKW A;  4QNH B;  1QR8 A;  3OUS A;  4U7O A;  4FLU A;  3L71 H;  2GSM B;  3QF7 A;  2UUB B;  2CTR A;  3R66 A;  4Q6G A;  1JMK C;  2PGG A;  4MTX A;  1QR9 A;  1ORQ C;  2UUA B;  1RSO B;  2WLI B;  3ZIA G;  1XL6 A;  1S77 D;  4K8Z A;  2CTQ A;  2ZE8 A;  2P7T C;  2DOS A;  2ZKO A;  2F1M A;  2LW7 A;  1M9N A;  4X65 O;  1XNQ O;  2UXC O;  4GKK O;  1SZX A;  5DEC A;  4DV2 O;  1ARO P;  3HKD A;  3G67 A;  1N36 B;  4IL6 Z;  4WBN A;  1SQP H;  1SET A;  3SYP A;  1N8R W;  3IC7 A;  1VQ9 V;  1H2K A;  1OJH A;  4X1K A;  5IJ9 B;  3THO A;  2UXB O;  2V7Q G;  1K73 W;  2KKW A;  5JCO A;  1DGS A;  1GMG A;  4IYI A;  5J2U B;  4BIU A;  4D7T A;  4B3M B;  1EFR G;  4AIL C;  5LA6 B;  3H1J H;  4JTD B;  2OT5 A;  3JD2 A;  3H1L H;  5HFL A;  1MMM A;  2JGD A;  3CCU V;  4ZBM A;  2QWN B;  2IBZ H;  4F6R B;  1Z2G A;  4RAI A;  4DK0 A;  2JDI G;  1G8M A;  3AK1 A;  3OTF A;  3BPZ A;  2UXN A;  3K5L A;  2PYJ A;  5A9G A;  3FB8 C;  4I9Q A;  5IYZ B;  3B8N A;  5EIB C;  2HEP A;  1M93 A;  3RN4 A;  4FMT A;  1P49 A;  1QVF U;  2WA4 A;  4CH3 A;  1AI6 A;  4EFE A;  2YIC A;  2CK3 G;  2AZ0 A;  3HKE A;  4FM2 A;  1VQM V;  1I94 B;  4JGS A;  2VRZ A;  3CRR A;  2CGO A;  4NTY A;  3SGI A;  4LF9 B;  4TOI A;  2W6I G;  2QWP B;  3AG3 C;  4ASU G;  5C8Y A;  1OCZ B;  3ABL B;  4UB8 Z;  4DV1 B;  1XMO B;  1KUQ A;  1FFT B;  2R72 A;  2ZE6 A;  1COW G;  1CPY A;  2D2C B;  4TWK A;  4WFH A;  1N4C A;  1R3K C;  4X20 A;  5DN6 G;  2GV9 A;  4K0K B;  2JS5 A;  1KMI Z;  4NB5 A;  3J7A U;  1EN5 A;  3SPH A;  3ZMV A;  4UCO A;  3SPI A;  1QVG U;  1FXV A;  3LDE A;  3X2Q B;  3OGC C;  1OCZ C;  1Q6H A;  3OEE G;  4PDR A;  2QE7 G;  2Q68 A;  4GX5 A;  1LR1 A;  2QKA A;  3OW2 U;  2Y0I A;  2Q5Z A;  4FLX A;  4JTA B;  2V1D A;  3IGA C;  2PZS A;  2AHY A;  4GKK B;  4J10 A;  1BE3 H;  2EIK B;  4FLW A;  4I50 B;  4H37 A;  4EB6 A;  5IWA O;  3FYE B;  1PNL A;  4UCV A;  3T1Y O;  1GTO A;  2Y4U A;  3OMI B;  4YY3 O;  3SJC C;  2VWK A;  2QM7 A;  3N27 A;  1MAB G;  2EJR A;  1SA0 A;  3OMN B;  2R9I A;  4B3T B;  2JRI A;  3AG1 B;  1QBZ A;  3TET A;  3OR7 C;  2HP8 A;  2VS0 A;  3CSX A;  1SQV H;  1KP3 A;  2UUB O;  3L72 H;  2FKX A;  1SA0 B;  3EVK A;  3K5N A;  1Q43 A;  2BCC H;  3ML0 A;  3D3I A;  5LHI A;  3Q4H B;  4MVZ A;  2QJ1 A;  2Q7E A;  1GN6 A;  4DK1 A;  2DYS B;  1EN6 A;  1Y66 A;  3GB7 C;  1JJO A;  5LGN A;  1H2M A;  4QE7 A;  2IJK A;  4PA7 A;  1I0H A;  4JZ2 A;  1I94 O;  1PPJ H;  2PI5 A;  4HNA B;  1RPR A;  2ZIN A;  1M90 W;  1K4C C;  4B3T O;  3HKB B;  1V54 B;  3G6E V;  4LF6 O;  4CS4 A;  3OFN G;  3QO7 A;  3SDL A;  1VQ6 V;  5FPO A;  3N2G B;  1EBO A;  1KYO F;  4J11 A;  2VWJ A;  4RQF A;  1OCR B;  1HR0 B;  1T5E A;  3SYA A;  4UFZ A;  4O4L B;  4YJ3 A;  1HW7 A;  5LXT A;  4LCU C;  5L3F A;  3DGE A;  3O9O A;  1OCC C;  3CC7 V;  4PV1 B;  1GN3 A;  4DV6 O;  3U10 A;  1G4Y B;  4I4T A;  2X6A A;  4Q20 A;  5LOV A;  2P5O A;  3K3W A;  2RQ6 A;  3HKC B;  3BAB A;  2Y0P A;  3ICX A;  4JI1 O;  2QM4 A;  1FFX B;  1SQF A;  3CJH B;  4TV9 A; 
#chains in the Genus database with same CATH homology
 1J5E O;  4JI2 O;  3RT3 C;  5IWA O;  2UUA O;  4DUZ O;  3T1Y O;  4JI4 O;  4DR6 O;  1XMQ O;  1N36 O;  4LFC O;  4JI8 O;  4K0K O;  4DV4 O;  3T1H O;  4DR1 O;  4GKJ O;  4YY3 O;  1IBK O;  1IBL O;  4LF4 O;  2VQE O;  1HR0 O;  3M8A A;  2JRI A;  1N33 O;  4JI0 O;  1A32 A;  4LFB O;  1AB3 A;  1IBM O;  4A5U B;  2UUB O;  4DR7 O;  2FKX A;  4X64 O;  4LF5 O;  1DK1 A;  4OX9 O;  4JV5 O;  1XEQ A;  1HNW O;  4JI6 O;  2AGA A;  3J80 N;  4B3S O;  4DV3 O;  2E5L O;  1HNX O;  4OPH A;  3R66 A;  4NXM O;  4NXN O;  1G1X B;  5BR8 O;  4JI5 O;  4DR4 O;  1R1B A;  1FJG O;  2UXD O;  3OTO O;  2UUC O;  4B3R O;  4DR2 O;  4DR3 O;  2HHH O;  5LMU O;  1I94 O;  4DR5 O;  4YHH O;  1FKA O;  2DOS A;  2ZKO A;  2LW7 A;  4LFA O;  1N34 O;  4B3T O;  4KHP O;  4X65 O;  1KUQ A;  1XNQ O;  2UXC O;  4JYA O;  4LF6 O;  4GKK O;  3J81 N;  1YZB A;  1AIL A;  1R6T A;  3SDL A;  5H5N A;  4JI3 O;  4DV2 O;  4AQY O;  4DUY O;  4DV1 O;  1XMO O;  1D2D A;  4LF8 O;  1NS1 A;  3J7A U;  4DV7 O;  5LMN O;  2UU9 O;  1N32 O;  1FYJ A;  2ZM6 O;  1X59 A;  2N74 A;  5A2Q N;  2Z0A A;  4DV5 O;  4JI7 O;  5FLX N;  4B3M O;  3F5T A;  2UXB O;  5IT9 N;  4X62 O;  5LL6 Y;  5BXZ A;  4DV6 O;  2DJV A;  5BY1 A;  2F4V O;  4X66 O;  4LF9 O;  1HNZ O;  3O65 A;  2VQF O;  4OPA A;  4LF7 O;  3JAM N;  4DV0 O;  4JI1 O;  1XNR O;  1F7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...