2UXCO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxcO00
1FKAO 4X64O 5A2QN 4DV3O 4JI6O 4LF5O 2E5LO 4DUYO 5BY1A 4JYAO 5IWAO 1A32A 1J5EO 4B3TO 2DJVA 3OTOO 2LW7A 4LF9O 4JI8O 1N36O 4DV7O 1I94O 3J7AU 4DR3O 4LF8O 4LFAO 2UUCO 2FKXA 4DV4O 4KHPO 1AILA 2JRIA 2N74A 3O65A 3M8AA 4LF4O 4YY3O 4DR1O 4DR7O 1XMOO 2ZM6O 3JAMN 1G1XB 5FLXN 4OX9O 4JI0O 4GKKO 4DR6O 1NS1A 2DOSA 4DR2O 4OPAA 5LMNO 4X66O 1N34O 1FYJA 3T1HO 2UXCO 1DK1A 2AGAA 1FJGO 5LL6Y 1XMQO 1HR0O 4NXMO 1XNQO 5LMUO 3SDLA 4X65O 1HNWO 4LFBO 4LFCO 4JI5O 1KUQA 1X59A 2UXBO 1XEQA 4K0KO 1R6TA 4DV5O 3T1YO 4B3SO 4B3RO 4OPHA 1AB3A 4X62O 5BR8O 4AQYO 5BXZA 4YHHO 2UU9O 4DR5O 4JI7O 4NXNO 4JI3O 1IBMO 4GKJO 1HNXO 3R66A 4DV2O 4DUZO 1HNZO 4LF7O 1F7YA 1N33O 1YZBA 3J81N 4DV1O 5IT9N 1N32O 4DR4O 2HHHO 2Z0AA 4JI1O 2UUBO 2ZKOA 4JV5O 3F5TA 2UXDO 1IBLO 2VQFO 4DV0O 2VQEO 4DV6O 4LF6O 4B3MO 4JI2O 1IBKO 3RT3C 3J80N 2UUAO 5H5NA 4A5UB 1R1BA 2F4VO 1XNRO 4JI4O 1D2DA
chains in the Genus database with same CATH superfamily
5IJ9A 4J10A 3OEEG 2ETNA 3OMAB 3LUTB 3IJ4A 4DW1A 2Q8VA 1AI6A 1WN7A 3RYHA 4B3TO 4FK5C 2LW7A 4LBEC 1TA8A 1J5EB 1CP9A 3RW0A 5LXTA 1P84F 4JI8B 4WCEV 1GK9A 4H0LB 1B6QA 4TUYA 2DE0X 3VQYA 3E22A 3H9VA 3AG7A 3OM3B 4KUMA 4DR7B 3NR7A 1AJNA 1ZWIC 4DV5B 4O4HB 4DR6B 4LWSA 4PDLA 5L3EA 4EEQA 4X66O 1ENVA 3ZHVA 2FB5A 2UXCO 1XHXA 1W2BU 3E86A 2QWOB 1HR0O 1Y74B 5L3DA 3SJBC 1KP2A 3ZRSA 1D5AA 4EB6A 4UVBA 4JI5B 3ZMUA 1BZKA 1R6TA 1RPRA 2JGUA 1GTOA 5CA1A 2P67A 3A2FA 3KG2A 2ITDC 2JDIG 2ZE8A 3ICXA 2UU9B 1VQ8V 4GCZA 3ML0A 3GWKC 1N33O 1VQ5V 2QKCA 1FAFA 4DRXB 4ZI7A 3J81N 1R3LC 1X4TA 4FLTA 4MTXA 2Q67A 3BA8A 3RYIA 5CA0A 4JV5O 3CCEV 3F5TA 4NTXA 3P3PA 5DECA 3RVZA 4NB5A 1QVFU 1AROP 3JAKA 1NTKH 2ZXWB 3C3SA 4O4JB 2IJKA 3LSQA 2HKOA 4QPKA 5J2UB 4MS2A 5KA5A 3CC4V 3APOA 3UO2A 3P3NA 5KHJA 3ZRWA 1VQLV 4WFEA 5KX5A 4LF5O 4X20B 3F7YC 2IW5A 3FAVB 4DUYB 5IYZA 3OUSA 1K92A 2QWQB 2A79B 1KMIZ 1YCIA 2W6JG 3I5DA 3K5OA 3BRCA 4LNUA 5GTHZ 2AZ2A 2UUCO 4LF8B 1WAZA 3TGUH 4DR1O 1HNWB 1XMOO 1O9GA 1G1XB 3G67A 3ASOC 5IYCO 3CCMV 2D2CB 1EBOA 4AHCA 4UV9A 5LMNO 2WLJA 1N34O 5K1XA 1WB7A 1Q90D 1LR1A 1MSWD 2GTSA 3H1HH 1Q6IA 5JJJB 3ZIAG 1KECA 2ADPA 4G2KA 1XUQA 5E79Z 4MW3A 3WU2Z 2E76B 4U3JB 2W0FC 2ODMA 1BQ0A 3OFNG 3CRAA 1BHAA 1Z5VA 4IYHA 1AP6A 2QTOA 5TISZ 1EM1A 2H94A 4UB8Z 2DMXA 5IDJA 1K4DC 5HFMA 4TV9B 2Y69C 3WG7C 5H9CA 4QE9A 3SJQC 3QO7A 4IYIA 1YIJV 5DEDA 4ABMA 3RBZA 2ZT9B 4XDKA 4JTAB 3CYOA 4B3MO 5H2FZ 3FYIB 4TV8B 4ZOLB 2JGDB 4CC5A 5EZYB 1H2KA 5A2QN 4JI4B 3JARB 3TETA 2K1EA 2YSUB 2R9AA 1WA8A 4MVZA 5LGUA 3SJCC 3LNMB 2YUAA 2JJ2G 1Y4MA 1I94O 5CB4B 3UM7A 4YJ3B 5IYDO 1M5IA 5FL7G 4NTYA 3K0DA 1QNMA 1KBHA 1WP8A 5IY5B 2ZM6B 4I9QA 3TCUA 3W7TA 4TSFG 3W7WA 2A7WA 3HKEB 1Y67A 3L73H 2HVKC 1SA0B 1FJGO 1PV0A 3RN4A 1RSOA 1Q7YW 3BEHA 4LFBO 1N0JA 3JALA 1Q82W 1UFIA 1XNQB 1FPOA 3HKDB 5IYBO 5FNVB 4LFCB 4DV5O 4BW5A 1JX9A 4JAVA 1S77D 2PUSA 2CE4A 4DO2A 4FM0A 3CE2A 2VQEB 2OCCB 1TUEB 3MHSC 3S3XA 2KSDA 2O57A 3ZMZA 2A06H 4JI3O 4GKJO 1AR5A 3L9DA 3HKCA 4LF7O 4CS2A 4MSWC 5IJ9B 4YIPA 1F4NA 3ZRXA 5JJEB 3AK3A 1XOUA 2GBOA 2YI8A 3K06A 3N2GA 4RUFA 1DLBA 1H8HG 5LXTB 2ILMA 4LF6O 4U3FH 3CCRV 2PY5A 4IHJA 3U11A 4TUYB 2VRZA 2RCVA 4DR3B 3E22B 3HKBA 3OE7G 3PN1A 1OJHA 1TGOA 2YIAA 2E5LO 2OWOA 3P32A 5IWAO 4R50A 3IAYA 4PA6A 4BIZA 3CRRA 4LWSB 2XNDG 1JMKC 4B3TB 2BE3A 2OYQA 4PELA 5A9GA 3MDSA 3WFVA 4FFKA 3ZMSA 1AP5A 1W0KG 4AILC 2HR3A 2EILB 4WFFA 5KHHA 3OR6C 1AILA 4N23A 5EBMC 3H1JH 1L8DA 4YY3O 1NH2B 3LSSA 2JEXA 2YIDA 5CA1B 5KA6A 4ASUG 2YICA 4G28B 4UCSA 1M1KW 3B4SA 5B1OA 4GX5A 2YEVA 3UQ8A 1NTMH 4PDMA 4K35A 3SPGA 3ETEA 1QR8A 3T4DA 1NBMG 4K8XA 3ABTA 4X66B 4ZI7B 3THOA 1AR1B 4CH4A 5JJNB 1HNWO 3SPIA 1HR0B 4TQDA 3RYIB 2LGQA 5CA0B 1PL0A 2PF4E 2X6AA 2QSAA 4B3SO 3T1YO 3JAKB 4IGGA 4AQYO 2QKSA 1JJ2U 3ZHUA 2WLHA 2WLNA 3FB6C 1FFTB 3ZS8C 5GTIZ 5FPRA 2YXYA 2EIKC 3ZRWB 2QWRB 1XL6A 5KX5B 1COWG 1Q86W 2QEXV 2OCHA 1V54B 2CAZC 1DGSA 1N32O 1N33B 1E1RG 2K9PA 2RN9A 4P9OA 3ZX6A 4GLXA 2ZKOA 2GSMB 5IYZB 1IBLO 2F1MA 3F7VC 3FFQA 4JV5B 1KP3A 2BOBC 4FVMA 1K97A 2UUAO 4LNUB 1OCRC 1SQBH 2F4VO 2Y69B 3WG7B 2GHYA 2XAQA 3VQVA 1DTOA 3AK1A 4JYAO 3VQXA 1GM8A 4RWUA 2KB1A 4LF5B 5B5EZ 1KKDA 4I55A 4LF9O 1BHBA 3ZRVA 1YF2A 3EXAA 5JQGA 3T1HB 1NVPD 3ZN1A 1VQNV 1Z2GA 2JRIA 2N74A 1VF6A 2YXLA 3AG2C 2XT9A 4DR1B 3AG1C 3MD0A 1XMOB 2LO1A 4BWAA 1UPGA 2FYUH 4HAMA 4LH7A 4X1YA 2FMLA 5LMNB 2P5OA 3JSLA 1N34B 3G71V 1YTFB 4NXMO 4NTWA 3K79A 4HNAA 5DN6G 1ZL8A 3BCCH 2B1IA 4PDRA 1HP8A 2HFEC 3RYFA 5EC1C 1HNXO 1IXBA 2ZIOA 4P9PA 4FLYA 4O2AA 1CXZB 2IH3C 3K03A 1WA8B 1SERA 3K0GA 2P90A 1VF6C 2Z0AA 3VOUA 3OMIB 5D5QA 2QWNB 4RUEA 4W4LA 1H2LA 2FTKA 1H38A 2VQEO 4P30A 3OTOB 2AZ0A 2OIEA 3ZJZA 4LCUC 1VEWA 4B3MB 3K08A 4WFHA 1FKAO 1H2SB 2P4VA 1K34A 3VBBA 1SETA 2OT5A 3EFFK 1M57C 3JATB 1MNGA 2IU3A 4ZIBA 4UCOA 2E74B 3G80A 5B66Z 1FXKA 4DV7O 3GVMA 4J7JA 1FD9A 1MZEA 4DR3O 1RSOB 3HPLC 5BZBA 1GAXA 2Q4PA 3JALB 5LGTA 4DV4O 4LR3A 1VQ4V 1XMQB 3OGIB 3RYCA 5B1BC 1QU7A 3W7XA 1SF9A 3ETDA 4F4LA 3LDDA 4PI2A 3A0HZ 4Q6GA 4PHZA 1BMFG 1PKXA 5IY5C 3HKCB 3SPCA 1I5YA 1MA1A 1FFXA 3C90A 4UCTA 4DUZB 5EBLC 4KL1A 1FJGB 3JD4A 1K5SA 1N4CA 2AXTZ 2Q7HA 4B7KA 4LFBB 2ZE5A 5EK0A 4X62O 2Z3YA 4IHJB 3K04A 4FLXA 3CMEV 1FXKC 2L35A 2R9RB 2F93B 3HKBB 2XTAA 1BSMA 3FX7A 4JI3B 3X2QC 4GKJB 1B3QA 2OCCC 1ZSPA 4LF7B 2PYJA 2HJDA 2UUBO 3B09A 5KHIA 5J9PC 4ZBMA 2P22C 1VQMV 3ABKB 2EIKB 5GONA 1RM1C 1HDJA 3ABLC 4LF6B 1S76D 4RQFA 2CGNA 1XNRO 3OAAG 1VQPV 2NNUA 1WJZA 1KQSU 4WBNA 5EYPA 4Z1VA 1R3KC 1Y6XA 4PD4F 5B1AC 4TOIA 3SYOA 2E5LB 4QE7A 5JVDA 5IWAB 2Q6AA 2GUZA 2YEVB 4ICGA 4FZ1A 1OCRB 1N36O 2B5UA 4WFGA 1WP7A 2X0LA 1GMGA 1Y66A 4X1KA 1BT8A 5B3SC 1YEWA 4O4LA 1GN3A 1YJ9V 3CXCU 2FKXA 3M8AA 1PNKA 1L1FA 5FLXN 2EIMC 2EILC 4YY3B 2DQ3A 4DR2O 3VQWA 4X9QA 1DF4A 2BTOA 2YIBD 1QLEC 3T1HO 1QHTA 1ORQC 2HP8A 4J11A 5KHGA 3AG2B 1MMMA 1KUQA 1V9PA 3AG1B 3G6BA 3STZC 2BTQA 3MAQA 1XEQA 4OPHA 3STLC 3QO8A 4MVMA 3LDCA 1VARA 5KAFZ 4B3SB 2CH7A 3T1YB 2Y0IA 2ZE7A 3N27A 1ZUQA 4AQYB 4NXNO 3DXRA 2YC0A 1I5XA 4JAUA 1L0NH 4LH6A 3CCVV 3CJHA 1M9NA 2QGNA 1YZBA 2QA4V 3JAWA 1RPOA 2Q5ZA 2UXXA 1YSCA 4I55B 1N32B 3W7UA 1V54C 5F2VO 3BVOA 3JD1A 4R8CA 4F6RA 1CPYA 1PP9H 2IH1C 5JQGB 1IBLB 3BFRA 4IIJA 1G8MA 1S5LZ 3U10A 1I0HA 3WB0A 2WLIA 2UUAB 2F4VB 3CRCA 3BY6A 1IURA 4R6ZA 2Z5UA 4I0XA 5FPOA 1J95A 4JYAB 2ITCC 5KUKA 3OTOO 2X7RB 2H3OA 3LNNA 2EX3A 4X1YB 5EIBD 3JCZA 4XBFA 1NT2B 4LF9B 2QTSA 2V7QG 4MVQA 4HNAB 3OGCC 2DWDC 3BA9A 3CPWU 2PZSA 1M57B 5E1AC 3KKYA 5LA6A 2LJ2A 2Q0AA 1ROPA 4GZRB 1SQQH 4OPAA 1M90W 3RYFB 1R6KA 3K5NA 2MW2B 5GW7A 4MTOA 1DK1A 4O2AB 1XMQO 5B1BB 3AG3C 3FD9A 3ETGA 5C8YA 1GN6A 2QWPB 1JQ0A 4C7UA 4NXMB 2XAHA 5CA3A 2ZD9A 4DV1B 4U7NA 4JF3A 4P2ZA 2EJRA 3EHBB 1OZ0A 4NVPA 4GX2A 2CDYA 1YJWV 3W7SA 1GM9A 1IZ3A 4DV0B 2ZCEA 3CWBH 1WPXA 2EIJC 3CCSV 4EKWA 3BPZA 2XOKG 4DUZO 3E83A 5LHIA 5L3BA 1HNXB 3CP1A 3TJTA 1YITV 4H44B 3SR2C 2HHHO 1BS3A 2Y48A 3E8FA 1YDXA 1K33A 3B40A 1FXKB 3H1KH 2RNBA 3M99B 3D36A 3X2QB 3RT3C 5H5NA 4A5UB 1F4MA 1PNLA 2KQXA 5LHGA 2XHBA 3RYCB 4X64O 3ZEDA 3JD0A 3RYHB 1JCHA 1RM1B 2A0LA 1HWYA 4UCUA 3FB7C 3ABLB 1VQOV 1H8EG 4GUNA 1YVWA 1BL8A 2CGOA 2CTQA 4J9YB 1FFXB 4DV7B 1KYOF 3ASNB 1SQFA 1AJPA 1MG1A 4JYYA 4H13B 5B1AB 2QDOA 3CHXA 2CUGA 4LF4O 4CH5A 2Q7GA 4DV4B 4YJ2A 5B3SB 2YS8A 3KCYA 2UXNA 4J42A 3CB2A 3N2KA 2ZR2A 4DR5B 5IJ0A 3TXSA 2P06A 2CTWA 5LL6Y 2VWKA 2EIMB 3CRQA 4X65O 5L3FA 1X59A 1ZAUA 4UUJC 4QGPA 4EB6B 1UJWB 2F66C 2IU0A 3JASA 4J9ZB 4B3RO 1P4RA 1K8AW 4UVCA 1QLEB 4MVRA 5GONB 3IC9A 1NKDA 5ITZA 2Y4UA 4X62B 4I50A 1E1QG 4K3AA 4D7TA 1KB9F 4YXWG 5JCOA 4E4EA 1XREA 1PM9A 4XDLA 3ZN0A 3BABA 1F51A 5JH7A 1XDCA 5EYPB 1SRYA 1SZTA 4ZKIA 4DRXA 4D7SA 4ZHQA 5JVDB 2GUZB 4B08A 1MOFA 5JWPA 4FLVA 1B04A 1K3EA 2VQFO 2UUBB 1FS0G 4X1KB 3ZHQA 2GDSA 3SYPA 3SGIA 4FLZA 1GRJA 4JTCB 1D5NA 2CTPA 3CS5A 3ABKC 5J2UA 1P7BA 4X1IA 2ATKC 1MZFA 2BCCH 4JI6O 1XNRB 2ZNJA 1OCCB 2KG7A 4AI8A 2XASA 3OUFA 3JD2A 1JFFA 2Q73A 2OTLV 4CH3A 1M4UA 1N36B 4JASA 3ZMTA 1TVKA 3SYAA 2QM7A 5JCOC 4JZ2A 3L71H 3CMAV 3A0RA 2QR4A 3APQA 1NR1A 3CCJV 2CTRA 2JEUA 3O65A 4CZZA 1URFA 4Z2WA 4LP8A 4FLUA 4J80A 4I4TA 3K3WA 1VP7A 1AJQA 2CH7B 4FM2A 3WB1A 5LP6A 1NVPB 4XDJA 3DXRB 4DR2B 3ZHRA 3CC2V 2DW4A 2AGAA 3CJHB 3JAWB 3OEHG 5LMUO 4WFAV 1M56C 1AR4A 1S0VA 1S5JA 2F95B 4O4IA 4LC1A 1GN4A 2ZR3A 3C3TA 4K0KO 1NI8A 3MHHC 1AB3A 2LFSA 3AG4C 4F6RB 3DSQA 5BXZA 2ADQB 3CXHF 4IIJB 4X88A 3AG3B 3B2EE 2P7TC 1PNMA 5L3GA 4DYLA 2HG5C 2WLIB 2JK5C 2PI4A 4NXNB 4IL6Z 1WNSA 4DV1O 2JJ1G 4I0XB 3ETQA 4JI1O 1VQ9V 4OXSA 3OTFA 1NJIW 3RGBA 2UXDO 3R65A 2EIJB 2WSSG 4DV0O 4DK0A 4DV6O 2R72A 5LP6C 1SZXA 4J7ZA 1QR9A 4PA3A 4BIUA 1EZJA 1EN4A 3UCSC 4KXRA 4JAAA 3TK1A 4CH6A 4JZGA 3K59A 2DYRC 1YTFD 4UCRA 1N8RW 4UCVA 5EIBC 1KC8W 4MT8A 4CC6A 4DW0A 1VF5B 1NU1H 1M93A 2G38A 2JIZG 4YJ3A 4UFZA 4IT5A 5C8YB 4CS4A 3K9SA 4FFBA 5C93A 1XL4A 4JYBA 3S3WA 3KCXA 2NN4A 4UXNA 3U0ZA 4GT1A 1JA8A 4L87A 4TT3G 4H37A 2Q0OC 4FJCC 1FXVA 2PYLA 1OCOB 1K73W 5CMUA 4GX1A 2XUMA 4J41A 1O9HA 3QG5A 4H33A 3ABMB 2QE7G 2AW9A 5K1PA 4FIPC 2IJIA 4I9WA 1PL4A 5D5PA 5BR8O 3UT5A 3E8GA 3UKMA 4DR5O 4UV8A 1AI4A 4PDVA 5LYJA 3Q4HA 4NR1A 4TQFA 4BR6A 1IBMO 4K8ZA 4DV2O 1HNZO 1Q6UA 1VQ6V 1R3IC 1YI2V 3N2GB 1XI1A 4EFEA 4QJFB 2HHHB 4W4KA 1AI7A 3ZCCA 1V55B 4MVSA 4FMTA 4PA4A 5EBWC 3WB2A 1Y76A 2JVDA 1R1BA 3B8MA 3JYCA 2LQTA 2VS0A 1QVGU 4YJ2B 1ZLZA 3CRMA 4X64B 2P4KA 1F23A 1NR7A 2DWEC 3N2KB 5IJ0B 2H8PC 3I56V 1H2MA 1QCEA 2EZOA 2N04A 2QKAA 4MW8A 2Y4TA 4LFAO 2PGGA 3CC7V 4UB6Z 1P7GA 1JJOA 1TUBA 2E75B 1CEZA 1Z5WA 3L70H 1R3JC 2OIGA 3ASNC 3JASB 4PJ0Z 4LF4B 4JI0O 1L0LH 2XAJA 5BMVA 5ITZB 4I50B 4KP4A 1VIBA 4PA9A 1LUVA 1K9MW 4O2BA 2E3CA 3ZHSA 5CBHA 5JH7B 3CCLV 1W0JG 3L75H 4ZHQB 2Q7EA 4BW9A 1OV9A 1VQ7V 2BSKA 4X8AA 1H2GA 4X65B 1BGYH 2LFRA 1GN2A 5AG2A 3B77A 4YIOA 3NXSA 4RQEA 4L8JA 1K7DA 4B3RB 5KMGA 3IFXA 1XILA 1M56B 3JCUZ 4X1IB 3E8BA 2QJ1A 3RFRA 3BAAA 4OGQB 4I7ZB 2KG7B 3AG4B 3L72H 4NKGB 2Q68A 2WA4A 1JFFB 4CS3A 3T2MA 2D3OW 4JI2O 2VQFB 1TVKB 1MSDA 5B1NA 3JSNA 3H01A 5LOVA 1PPJH 1SQXH 2ZE6A 4DV3O 4PI0A 1EZVH 4JI6B 4I4TB 3T4ZA 2ZIMA 5LP6B 2XAGA 3CCQV 1OCCC 4JPRA 4HYOA 2A9HA 1XHZA 2AHYA 5H6QA 1WLEA 1R6NA 3QTCA 5LBQA 3QNEA 2DYRB 4J7KA 3CEIA 4O4IB 4KHPO 3TXQA 1R73A 3OD4A 2DYSC 1JR9A 3JAMN 1P49A 1AVMA 4MTGA 4GKKO 4GX0A 5KAIZ 5H6RA 4JTDB 5CN0A 3T1CA 4RO2A 2CK3G 2WPDG 4JGSA 4PV1B 3GB7C 5J2TA 3CD6V 3E89A 2LW1A 4E2LA 4QIWF 5KUMA 3G6EV 5LMUB 2UXBO 1ZL8B 1ZX3A 4K0KB 2YDEA 2JS5A 4JI7O 3SJAC 1OCZC 3DTUB 2JS3A 1F7YA 2NR5A 5IT9N 1WB8A 2WLKA 2KKWA 4DR4O 2QM4A 5DM6V 2Q69A 1MABG 4QNHB 4HBNA 2YI9A 3D3QA 4DXWA 1SQVH 3LSUA 4JI1B 3QO5A 3CCUV 2UXDB 2WWWA 5KHKA 2R70A 1IBKO 2DN9A 3L74H 3DC6A 4DV6B 3M7MX 2F43G 2X6BA 4MVUA 2GV9A 4FFBB 3ZMVA 3O9OA 3K5MA 2FL4A 1A32A 1JVMA 1J5EO 1SKVA 4OX9B 4TWKA 5IE9A 3OW2U 4JI8O 2V1DA 3SYCA 3JATA 4CBCA 1YHQV 2WLLA 3HB3B 1NZ6A 1HW7A 1QLNA 2N05A 1Q3EA 3DGEA 3H1IH 2L6LA 4JYCA 4X89A 4DR7O 1DF5A 2EJ7A 2IJJA 4DR6O 1EN6A 2F23A 3UT5B 2M6YA 2WAMA 1G6UA 3RVYA 5LYJB 3ZBHA 3Q4HB 2YXHA 1BE3H 4Z1MG 1BQZA 4YHHB 1FYJA 1H2NA 1U96A 3LDEA 1IVSA 2QM8A 2A3QA 3DC5A 4F6EA 1Q43A 1W59A 3OT7A 2OTJV 4JI5O 1QBZA 3FYEB 1OCOC 1NQTA 2EINC 1GKFA 2GTAA 5CBFA 3ABMC 2UU9O 2PTMA 4EFBA 4O4HA 5CBGA 4U7OA 5BR8B 1Y76B 3ABUA 3H1LH 3CSXA 3FB5C 2EZPA 3R66A 1B06A 3D36C 1GM7A 2EULA 3KZIZ 1IBMB 3F5WC 4DV2B 1HNZB 1Y74A 3E35A 4NYKA 1I08A 4B7EA 2ZINA 3D8CA 1IX9A 4N21A 1N0NA 3AEIA 1TAEA 2ARHA 3OR7C 1WPBA 1TUBB 1PD3A 1V55C 1SC5B 4HZ3A 5KLVH 2C2AA 1D2DA 5LGNA 4WBNB 1Q8IA 3G4SV 2NLJC 5BY1A 4DUYO 1K5QA 5BMVB 2BOCC 3P30A 3K58A 1SESA 3I55V 2R9IA 2DJVA 2YIBA 4O2BB 1NH2D 2M7WA 3CX5F 4O4LB 3JD3A 4LF8O 4O4JA 1VF7A 2WA3A 2UXCB 3ASOB 3E2EA 1K4CC 2BSKB 3A0BZ 4BAYA 4MVOA 4LFAB 2PI5A 2XAFA 1JOYA 3IC7A 4X20A 3FAVA 1NS1A 2DOSA 2HLDG 5KMGB 1T5EA 4JI0B 1SS3A 1S5HC 1KKCA 4QPJA 2DYSB 1S3JA 2Y0PA 3D3IA 3HR0A 3SDLA 1JPXA 2LGWA 3K5LA 2BTQB 4PA7A 5LHHA 3BHPA 1SQGA 4G27B 2ZQMA 5EC2C 3SPJA 2P6JA 5HFLA 3B8NA 2W0XA 4WFBV 5LOVB 1RFYA 4MTFA 1OHHG 1NTZH 2ZXWC 2RQ6A 2X6CA 2ZNIA 3K57A 1SQPH 2EBOA 4GYCB 2MK3A 1S72V 4FM1A 3IGAC 4U3JA 2Q9LA 1OCZB 2IM9A 3AK2A 1EFRG 4JI2B 4JI4O 3ZHTA 3FKSG 2RJZA 3OMNB 2UUCB 4BIOA 4TV9A 1BCCH 4DV3B 4WF9V 2DQ0A 2ZDIA 4KFMA 1FXHA 2HEPA 4FLWA 2IJHA 3SPHA 1KD1W 1GH6A 3FB8C 5J2TB 3J7AU 1G4YB 4FZ0A 4TV8A 1Q6HA 1US6A 4ZOLA 2RMKB 2JGDA 5EZYA 1XBLA 5LA6B 2HJFC 3RWRD 5L3CA 2IBZH 2ZM6O 4KHPB 1Q5OA 1XQ8A 3JARA 4OX9O 1LNQA 3E8HA 3SYQA 4GKKB 2B9ZA 1THZA 1IDSA 1YJNV 5CB4A 1XNQO 3GWOA 3A8TA 2VWJA 4LFCO 1E79G 1QQCA 4Q20A 1I7FA 1RP3B 4UVAA 3PJSK 2UXBB 4R7CA 3K9AA 2W6IG 2LP7A 2AHZA 1VMGA 2ZDIC 4YHHO 3QF7A 4DK1A 4JI7B 3HKEA 4RAIA 1KU9A 1YXBA 1SA0A 1GO3F 2WLMA 2EINB 4I5SA 3QVNA 1VQKV 1AI5A 1IXMA 1Q81W 3HKDA 1ZTEA 2B1GA 3EVKA 5FNVA 4DR4B 1LUWA 3UO3A 2WLLB 1EN5A 2V4DA 4FPPA 2RDCA 3J80N 4D6TH 1I94B 1IBKB 2HVJC 1U97A
chains in the Genus database with same CATH topology
1FKAO 4X64O 5A2QN 4DV3O 4JI6O 4LF5O 2E5LO 4DUYO 5BY1A 4JYAO 5IWAO 1A32A 1J5EO 4B3TO 2DJVA 3OTOO 2LW7A 4LF9O 4JI8O 1N36O 4DV7O 1I94O 3J7AU 4DR3O 4LF8O 4LFAO 2UUCO 2FKXA 4DV4O 4KHPO 1AILA 2JRIA 2N74A 3O65A 3M8AA 4LF4O 4YY3O 4DR1O 4DR7O 1XMOO 2ZM6O 3JAMN 1G1XB 5FLXN 4OX9O 4JI0O 4GKKO 4DR6O 1NS1A 2DOSA 4DR2O 4OPAA 5LMNO 4X66O 1N34O 1FYJA 3T1HO 2UXCO 1DK1A 2AGAA 1FJGO 5LL6Y 1XMQO 1HR0O 4NXMO 1XNQO 5LMUO 3SDLA 4X65O 1HNWO 4LFBO 4LFCO 4JI5O 1KUQA 1X59A 2UXBO 1XEQA 4K0KO 1R6TA 4DV5O 3T1YO 4B3SO 4B3RO 4OPHA 1AB3A 4X62O 5BR8O 4AQYO 5BXZA 4YHHO 2UU9O 4DR5O 4JI7O 4NXNO 4JI3O 1IBMO 4GKJO 1HNXO 3R66A 4DV2O 4DUZO 1HNZO 4LF7O 1F7YA 1N33O 1YZBA 3J81N 4DV1O 5IT9N 1N32O 4DR4O 2HHHO 2Z0AA 4JI1O 2UUBO 2ZKOA 4JV5O 3F5TA 2UXDO 1IBLO 2VQFO 4DV0O 2VQEO 4DV6O 4LF6O 4B3MO 4JI2O 1IBKO 3RT3C 3J80N 2UUAO 5H5NA 4A5UB 1R1BA 2F4VO 1XNRO 4JI4O 1D2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKA O;  4X64 O;  5A2Q N;  4DV3 O;  4JI6 O;  4LF5 O;  2E5L O;  4DUY O;  5BY1 A;  4JYA O;  5IWA O;  1A32 A;  1J5E O;  4B3T O;  2DJV A;  3OTO O;  2LW7 A;  4LF9 O;  4JI8 O;  1N36 O;  4DV7 O;  1I94 O;  3J7A U;  4DR3 O;  4LF8 O;  4LFA O;  2UUC O;  2FKX A;  4DV4 O;  4KHP O;  1AIL A;  2JRI A;  2N74 A;  3O65 A;  3M8A A;  4LF4 O;  4YY3 O;  4DR1 O;  4DR7 O;  1XMO O;  2ZM6 O;  3JAM N;  1G1X B;  5FLX N;  4OX9 O;  4JI0 O;  4GKK O;  4DR6 O;  1NS1 A;  2DOS A;  4DR2 O;  4OPA A;  5LMN O;  4X66 O;  1N34 O;  1FYJ A;  3T1H O;  2UXC O;  1DK1 A;  2AGA A;  1FJG O;  5LL6 Y;  1XMQ O;  1HR0 O;  4NXM O;  1XNQ O;  5LMU O;  3SDL A;  4X65 O;  1HNW O;  4LFB O;  4LFC O;  4JI5 O;  1KUQ A;  1X59 A;  2UXB O;  1XEQ A;  4K0K O;  1R6T A;  4DV5 O;  3T1Y O;  4B3S O;  4B3R O;  4OPH A;  1AB3 A;  4X62 O;  5BR8 O;  4AQY O;  5BXZ A;  4YHH O;  2UU9 O;  4DR5 O;  4JI7 O;  4NXN O;  4JI3 O;  1IBM O;  4GKJ O;  1HNX O;  3R66 A;  4DV2 O;  4DUZ O;  1HNZ O;  4LF7 O;  1F7Y A;  1N33 O;  1YZB A;  3J81 N;  4DV1 O;  5IT9 N;  1N32 O;  4DR4 O;  2HHH O;  2Z0A A;  4JI1 O;  2UUB O;  2ZKO A;  4JV5 O;  3F5T A;  2UXD O;  1IBL O;  2VQF O;  4DV0 O;  2VQE O;  4DV6 O;  4LF6 O;  4B3M O;  4JI2 O;  1IBK O;  3RT3 C;  3J80 N;  2UUA O;  5H5N A;  4A5U B;  1R1B A;  2F4V O;  1XNR O;  4JI4 O;  1D2D A; 
#chains in the Genus database with same CATH topology
 5IJ9 A;  4J10 A;  3OEE G;  2ETN A;  3OMA B;  3LUT B;  3IJ4 A;  4DW1 A;  2Q8V A;  1AI6 A;  1WN7 A;  3RYH A;  4B3T O;  4FK5 C;  2LW7 A;  4LBE C;  1TA8 A;  1J5E B;  1CP9 A;  3RW0 A;  5LXT A;  1P84 F;  4JI8 B;  4WCE V;  1GK9 A;  4H0L B;  1B6Q A;  4TUY A;  2DE0 X;  3VQY A;  3E22 A;  3H9V A;  3AG7 A;  3OM3 B;  4KUM A;  4DR7 B;  3NR7 A;  1AJN A;  1ZWI C;  4DV5 B;  4O4H B;  4DR6 B;  4LWS A;  4PDL A;  5L3E A;  4EEQ A;  4X66 O;  1ENV A;  3ZHV A;  2FB5 A;  2UXC O;  1XHX A;  1W2B U;  3E86 A;  2QWO B;  1HR0 O;  1Y74 B;  5L3D A;  3SJB C;  1KP2 A;  3ZRS A;  1D5A A;  4EB6 A;  4UVB A;  4JI5 B;  3ZMU A;  1BZK A;  1R6T A;  1RPR A;  2JGU A;  1GTO A;  5CA1 A;  2P67 A;  3A2F A;  3KG2 A;  2ITD C;  2JDI G;  2ZE8 A;  3ICX A;  2UU9 B;  1VQ8 V;  4GCZ A;  3ML0 A;  3GWK C;  1N33 O;  1VQ5 V;  2QKC A;  1FAF A;  4DRX B;  4ZI7 A;  3J81 N;  1R3L C;  1X4T A;  4FLT A;  4MTX A;  2Q67 A;  3BA8 A;  3RYI A;  5CA0 A;  4JV5 O;  3CCE V;  3F5T A;  4NTX A;  3P3P A;  5DEC A;  3RVZ A;  4NB5 A;  1QVF U;  1ARO P;  3JAK A;  1NTK H;  2ZXW B;  3C3S A;  4O4J B;  2IJK A;  3LSQ A;  2HKO A;  4QPK A;  5J2U B;  4MS2 A;  5KA5 A;  3CC4 V;  3APO A;  3UO2 A;  3P3N A;  5KHJ A;  3ZRW A;  1VQL V;  4WFE A;  5KX5 A;  4LF5 O;  4X20 B;  3F7Y C;  2IW5 A;  3FAV B;  4DUY B;  5IYZ A;  3OUS A;  1K92 A;  2QWQ B;  2A79 B;  1KMI Z;  1YCI A;  2W6J G;  3I5D A;  3K5O A;  3BRC A;  4LNU A;  5GTH Z;  2AZ2 A;  2UUC O;  4LF8 B;  1WAZ A;  3TGU H;  4DR1 O;  1HNW B;  1XMO O;  1O9G A;  1G1X B;  3G67 A;  3ASO C;  5IYC O;  3CCM V;  2D2C B;  1EBO A;  4AHC A;  4UV9 A;  5LMN O;  2WLJ A;  1N34 O;  5K1X A;  1WB7 A;  1Q90 D;  1LR1 A;  1MSW D;  2GTS A;  3H1H H;  1Q6I A;  5JJJ B;  3ZIA G;  1KEC A;  2ADP A;  4G2K A;  1XUQ A;  5E79 Z;  4MW3 A;  3WU2 Z;  2E76 B;  4U3J B;  2W0F C;  2ODM A;  1BQ0 A;  3OFN G;  3CRA A;  1BHA A;  1Z5V A;  4IYH A;  1AP6 A;  2QTO A;  5TIS Z;  1EM1 A;  2H94 A;  4UB8 Z;  2DMX A;  5IDJ A;  1K4D C;  5HFM A;  4TV9 B;  2Y69 C;  3WG7 C;  5H9C A;  4QE9 A;  3SJQ C;  3QO7 A;  4IYI A;  1YIJ V;  5DED A;  4ABM A;  3RBZ A;  2ZT9 B;  4XDK A;  4JTA B;  3CYO A;  4B3M O;  5H2F Z;  3FYI B;  4TV8 B;  4ZOL B;  2JGD B;  4CC5 A;  5EZY B;  1H2K A;  5A2Q N;  4JI4 B;  3JAR B;  3TET A;  2K1E A;  2YSU B;  2R9A A;  1WA8 A;  4MVZ A;  5LGU A;  3SJC C;  3LNM B;  2YUA A;  2JJ2 G;  1Y4M A;  1I94 O;  5CB4 B;  3UM7 A;  4YJ3 B;  5IYD O;  1M5I A;  5FL7 G;  4NTY A;  3K0D A;  1QNM A;  1KBH A;  1WP8 A;  5IY5 B;  2ZM6 B;  4I9Q A;  3TCU A;  3W7T A;  4TSF G;  3W7W A;  2A7W A;  3HKE B;  1Y67 A;  3L73 H;  2HVK C;  1SA0 B;  1FJG O;  1PV0 A;  3RN4 A;  1RSO A;  1Q7Y W;  3BEH A;  4LFB O;  1N0J A;  3JAL A;  1Q82 W;  1UFI A;  1XNQ B;  1FPO A;  3HKD B;  5IYB O;  5FNV B;  4LFC B;  4DV5 O;  4BW5 A;  1JX9 A;  4JAV A;  1S77 D;  2PUS A;  2CE4 A;  4DO2 A;  4FM0 A;  3CE2 A;  2VQE B;  2OCC B;  1TUE B;  3MHS C;  3S3X A;  2KSD A;  2O57 A;  3ZMZ A;  2A06 H;  4JI3 O;  4GKJ O;  1AR5 A;  3L9D A;  3HKC A;  4LF7 O;  4CS2 A;  4MSW C;  5IJ9 B;  4YIP A;  1F4N A;  3ZRX A;  5JJE B;  3AK3 A;  1XOU A;  2GBO A;  2YI8 A;  3K06 A;  3N2G A;  4RUF A;  1DLB A;  1H8H G;  5LXT B;  2ILM A;  4LF6 O;  4U3F H;  3CCR V;  2PY5 A;  4IHJ A;  3U11 A;  4TUY B;  2VRZ A;  2RCV A;  4DR3 B;  3E22 B;  3HKB A;  3OE7 G;  3PN1 A;  1OJH A;  1TGO A;  2YIA A;  2E5L O;  2OWO A;  3P32 A;  5IWA O;  4R50 A;  3IAY A;  4PA6 A;  4BIZ A;  3CRR A;  4LWS B;  2XND G;  1JMK C;  4B3T B;  2BE3 A;  2OYQ A;  4PEL A;  5A9G A;  3MDS A;  3WFV A;  4FFK A;  3ZMS A;  1AP5 A;  1W0K G;  4AIL C;  2HR3 A;  2EIL B;  4WFF A;  5KHH A;  3OR6 C;  1AIL A;  4N23 A;  5EBM C;  3H1J H;  1L8D A;  4YY3 O;  1NH2 B;  3LSS A;  2JEX A;  2YID A;  5CA1 B;  5KA6 A;  4ASU G;  2YIC A;  4G28 B;  4UCS A;  1M1K W;  3B4S A;  5B1O A;  4GX5 A;  2YEV A;  3UQ8 A;  1NTM H;  4PDM A;  4K35 A;  3SPG A;  3ETE A;  1QR8 A;  3T4D A;  1NBM G;  4K8X A;  3ABT A;  4X66 B;  4ZI7 B;  3THO A;  1AR1 B;  4CH4 A;  5JJN B;  1HNW O;  3SPI A;  1HR0 B;  4TQD A;  3RYI B;  2LGQ A;  5CA0 B;  1PL0 A;  2PF4 E;  2X6A A;  2QSA A;  4B3S O;  3T1Y O;  3JAK B;  4IGG A;  4AQY O;  2QKS A;  1JJ2 U;  3ZHU A;  2WLH A;  2WLN A;  3FB6 C;  1FFT B;  3ZS8 C;  5GTI Z;  5FPR A;  2YXY A;  2EIK C;  3ZRW B;  2QWR B;  1XL6 A;  5KX5 B;  1COW G;  1Q86 W;  2QEX V;  2OCH A;  1V54 B;  2CAZ C;  1DGS A;  1N32 O;  1N33 B;  1E1R G;  2K9P A;  2RN9 A;  4P9O A;  3ZX6 A;  4GLX A;  2ZKO A;  2GSM B;  5IYZ B;  1IBL O;  2F1M A;  3F7V C;  3FFQ A;  4JV5 B;  1KP3 A;  2BOB C;  4FVM A;  1K97 A;  2UUA O;  4LNU B;  1OCR C;  1SQB H;  2F4V O;  2Y69 B;  3WG7 B;  2GHY A;  2XAQ A;  3VQV A;  1DTO A;  3AK1 A;  4JYA O;  3VQX A;  1GM8 A;  4RWU A;  2KB1 A;  4LF5 B;  5B5E Z;  1KKD A;  4I55 A;  4LF9 O;  1BHB A;  3ZRV A;  1YF2 A;  3EXA A;  5JQG A;  3T1H B;  1NVP D;  3ZN1 A;  1VQN V;  1Z2G A;  2JRI A;  2N74 A;  1VF6 A;  2YXL A;  3AG2 C;  2XT9 A;  4DR1 B;  3AG1 C;  3MD0 A;  1XMO B;  2LO1 A;  4BWA A;  1UPG A;  2FYU H;  4HAM A;  4LH7 A;  4X1Y A;  2FML A;  5LMN B;  2P5O A;  3JSL A;  1N34 B;  3G71 V;  1YTF B;  4NXM O;  4NTW A;  3K79 A;  4HNA A;  5DN6 G;  1ZL8 A;  3BCC H;  2B1I A;  4PDR A;  1HP8 A;  2HFE C;  3RYF A;  5EC1 C;  1HNX O;  1IXB A;  2ZIO A;  4P9P A;  4FLY A;  4O2A A;  1CXZ B;  2IH3 C;  3K03 A;  1WA8 B;  1SER A;  3K0G A;  2P90 A;  1VF6 C;  2Z0A A;  3VOU A;  3OMI B;  5D5Q A;  2QWN B;  4RUE A;  4W4L A;  1H2L A;  2FTK A;  1H38 A;  2VQE O;  4P30 A;  3OTO B;  2AZ0 A;  2OIE A;  3ZJZ A;  4LCU C;  1VEW A;  4B3M B;  3K08 A;  4WFH A;  1FKA O;  1H2S B;  2P4V A;  1K34 A;  3VBB A;  1SET A;  2OT5 A;  3EFF K;  1M57 C;  3JAT B;  1MNG A;  2IU3 A;  4ZIB A;  4UCO A;  2E74 B;  3G80 A;  5B66 Z;  1FXK A;  4DV7 O;  3GVM A;  4J7J A;  1FD9 A;  1MZE A;  4DR3 O;  1RSO B;  3HPL C;  5BZB A;  1GAX A;  2Q4P A;  3JAL B;  5LGT A;  4DV4 O;  4LR3 A;  1VQ4 V;  1XMQ B;  3OGI B;  3RYC A;  5B1B C;  1QU7 A;  3W7X A;  1SF9 A;  3ETD A;  4F4L A;  3LDD A;  4PI2 A;  3A0H Z;  4Q6G A;  4PHZ A;  1BMF G;  1PKX A;  5IY5 C;  3HKC B;  3SPC A;  1I5Y A;  1MA1 A;  1FFX A;  3C90 A;  4UCT A;  4DUZ B;  5EBL C;  4KL1 A;  1FJG B;  3JD4 A;  1K5S A;  1N4C A;  2AXT Z;  2Q7H A;  4B7K A;  4LFB B;  2ZE5 A;  5EK0 A;  4X62 O;  2Z3Y A;  4IHJ B;  3K04 A;  4FLX A;  3CME V;  1FXK C;  2L35 A;  2R9R B;  2F93 B;  3HKB B;  2XTA A;  1BSM A;  3FX7 A;  4JI3 B;  3X2Q C;  4GKJ B;  1B3Q A;  2OCC C;  1ZSP A;  4LF7 B;  2PYJ A;  2HJD A;  2UUB O;  3B09 A;  5KHI A;  5J9P C;  4ZBM A;  2P22 C;  1VQM V;  3ABK B;  2EIK B;  5GON A;  1RM1 C;  1HDJ A;  3ABL C;  4LF6 B;  1S76 D;  4RQF A;  2CGN A;  1XNR O;  3OAA G;  1VQP V;  2NNU A;  1WJZ A;  1KQS U;  4WBN A;  5EYP A;  4Z1V A;  1R3K C;  1Y6X A;  4PD4 F;  5B1A C;  4TOI A;  3SYO A;  2E5L B;  4QE7 A;  5JVD A;  5IWA B;  2Q6A A;  2GUZ A;  2YEV B;  4ICG A;  4FZ1 A;  1OCR B;  1N36 O;  2B5U A;  4WFG A;  1WP7 A;  2X0L A;  1GMG A;  1Y66 A;  4X1K A;  1BT8 A;  5B3S C;  1YEW A;  4O4L A;  1GN3 A;  1YJ9 V;  3CXC U;  2FKX A;  3M8A A;  1PNK A;  1L1F A;  5FLX N;  2EIM C;  2EIL C;  4YY3 B;  2DQ3 A;  4DR2 O;  3VQW A;  4X9Q A;  1DF4 A;  2BTO A;  2YIB D;  1QLE C;  3T1H O;  1QHT A;  1ORQ C;  2HP8 A;  4J11 A;  5KHG A;  3AG2 B;  1MMM A;  1KUQ A;  1V9P A;  3AG1 B;  3G6B A;  3STZ C;  2BTQ A;  3MAQ A;  1XEQ A;  4OPH A;  3STL C;  3QO8 A;  4MVM A;  3LDC A;  1VAR A;  5KAF Z;  4B3S B;  2CH7 A;  3T1Y B;  2Y0I A;  2ZE7 A;  3N27 A;  1ZUQ A;  4AQY B;  4NXN O;  3DXR A;  2YC0 A;  1I5X A;  4JAU A;  1L0N H;  4LH6 A;  3CCV V;  3CJH A;  1M9N A;  2QGN A;  1YZB A;  2QA4 V;  3JAW A;  1RPO A;  2Q5Z A;  2UXX A;  1YSC A;  4I55 B;  1N32 B;  3W7U A;  1V54 C;  5F2V O;  3BVO A;  3JD1 A;  4R8C A;  4F6R A;  1CPY A;  1PP9 H;  2IH1 C;  5JQG B;  1IBL B;  3BFR A;  4IIJ A;  1G8M A;  1S5L Z;  3U10 A;  1I0H A;  3WB0 A;  2WLI A;  2UUA B;  2F4V B;  3CRC A;  3BY6 A;  1IUR A;  4R6Z A;  2Z5U A;  4I0X A;  5FPO A;  1J95 A;  4JYA B;  2ITC C;  5KUK A;  3OTO O;  2X7R B;  2H3O A;  3LNN A;  2EX3 A;  4X1Y B;  5EIB D;  3JCZ A;  4XBF A;  1NT2 B;  4LF9 B;  2QTS A;  2V7Q G;  4MVQ A;  4HNA B;  3OGC C;  2DWD C;  3BA9 A;  3CPW U;  2PZS A;  1M57 B;  5E1A C;  3KKY A;  5LA6 A;  2LJ2 A;  2Q0A A;  1ROP A;  4GZR B;  1SQQ H;  4OPA A;  1M90 W;  3RYF B;  1R6K A;  3K5N A;  2MW2 B;  5GW7 A;  4MTO A;  1DK1 A;  4O2A B;  1XMQ O;  5B1B B;  3AG3 C;  3FD9 A;  3ETG A;  5C8Y A;  1GN6 A;  2QWP B;  1JQ0 A;  4C7U A;  4NXM B;  2XAH A;  5CA3 A;  2ZD9 A;  4DV1 B;  4U7N A;  4JF3 A;  4P2Z A;  2EJR A;  3EHB B;  1OZ0 A;  4NVP A;  4GX2 A;  2CDY A;  1YJW V;  3W7S A;  1GM9 A;  1IZ3 A;  4DV0 B;  2ZCE A;  3CWB H;  1WPX A;  2EIJ C;  3CCS V;  4EKW A;  3BPZ A;  2XOK G;  4DUZ O;  3E83 A;  5LHI A;  5L3B A;  1HNX B;  3CP1 A;  3TJT A;  1YIT V;  4H44 B;  3SR2 C;  2HHH O;  1BS3 A;  2Y48 A;  3E8F A;  1YDX A;  1K33 A;  3B40 A;  1FXK B;  3H1K H;  2RNB A;  3M99 B;  3D36 A;  3X2Q B;  3RT3 C;  5H5N A;  4A5U B;  1F4M A;  1PNL A;  2KQX A;  5LHG A;  2XHB A;  3RYC B;  4X64 O;  3ZED A;  3JD0 A;  3RYH B;  1JCH A;  1RM1 B;  2A0L A;  1HWY A;  4UCU A;  3FB7 C;  3ABL B;  1VQO V;  1H8E G;  4GUN A;  1YVW A;  1BL8 A;  2CGO A;  2CTQ A;  4J9Y B;  1FFX B;  4DV7 B;  1KYO F;  3ASN B;  1SQF A;  1AJP A;  1MG1 A;  4JYY A;  4H13 B;  5B1A B;  2QDO A;  3CHX A;  2CUG A;  4LF4 O;  4CH5 A;  2Q7G A;  4DV4 B;  4YJ2 A;  5B3S B;  2YS8 A;  3KCY A;  2UXN A;  4J42 A;  3CB2 A;  3N2K A;  2ZR2 A;  4DR5 B;  5IJ0 A;  3TXS A;  2P06 A;  2CTW A;  5LL6 Y;  2VWK A;  2EIM B;  3CRQ A;  4X65 O;  5L3F A;  1X59 A;  1ZAU A;  4UUJ C;  4QGP A;  4EB6 B;  1UJW B;  2F66 C;  2IU0 A;  3JAS A;  4J9Z B;  4B3R O;  1P4R A;  1K8A W;  4UVC A;  1QLE B;  4MVR A;  5GON B;  3IC9 A;  1NKD A;  5ITZ A;  2Y4U A;  4X62 B;  4I50 A;  1E1Q G;  4K3A A;  4D7T A;  1KB9 F;  4YXW G;  5JCO A;  4E4E A;  1XRE A;  1PM9 A;  4XDL A;  3ZN0 A;  3BAB A;  1F51 A;  5JH7 A;  1XDC A;  5EYP B;  1SRY A;  1SZT A;  4ZKI A;  4DRX A;  4D7S A;  4ZHQ A;  5JVD B;  2GUZ B;  4B08 A;  1MOF A;  5JWP A;  4FLV A;  1B04 A;  1K3E A;  2VQF O;  2UUB B;  1FS0 G;  4X1K B;  3ZHQ A;  2GDS A;  3SYP A;  3SGI A;  4FLZ A;  1GRJ A;  4JTC B;  1D5N A;  2CTP A;  3CS5 A;  3ABK C;  5J2U A;  1P7B A;  4X1I A;  2ATK C;  1MZF A;  2BCC H;  4JI6 O;  1XNR B;  2ZNJ A;  1OCC B;  2KG7 A;  4AI8 A;  2XAS A;  3OUF A;  3JD2 A;  1JFF A;  2Q73 A;  2OTL V;  4CH3 A;  1M4U A;  1N36 B;  4JAS A;  3ZMT A;  1TVK A;  3SYA A;  2QM7 A;  5JCO C;  4JZ2 A;  3L71 H;  3CMA V;  3A0R A;  2QR4 A;  3APQ A;  1NR1 A;  3CCJ V;  2CTR A;  2JEU A;  3O65 A;  4CZZ A;  1URF A;  4Z2W A;  4LP8 A;  4FLU A;  4J80 A;  4I4T A;  3K3W A;  1VP7 A;  1AJQ A;  2CH7 B;  4FM2 A;  3WB1 A;  5LP6 A;  1NVP B;  4XDJ A;  3DXR B;  4DR2 B;  3ZHR A;  3CC2 V;  2DW4 A;  2AGA A;  3CJH B;  3JAW B;  3OEH G;  5LMU O;  4WFA V;  1M56 C;  1AR4 A;  1S0V A;  1S5J A;  2F95 B;  4O4I A;  4LC1 A;  1GN4 A;  2ZR3 A;  3C3T A;  4K0K O;  1NI8 A;  3MHH C;  1AB3 A;  2LFS A;  3AG4 C;  4F6R B;  3DSQ A;  5BXZ A;  2ADQ B;  3CXH F;  4IIJ B;  4X88 A;  3AG3 B;  3B2E E;  2P7T C;  1PNM A;  5L3G A;  4DYL A;  2HG5 C;  2WLI B;  2JK5 C;  2PI4 A;  4NXN B;  4IL6 Z;  1WNS A;  4DV1 O;  2JJ1 G;  4I0X B;  3ETQ A;  4JI1 O;  1VQ9 V;  4OXS A;  3OTF A;  1NJI W;  3RGB A;  2UXD O;  3R65 A;  2EIJ B;  2WSS G;  4DV0 O;  4DK0 A;  4DV6 O;  2R72 A;  5LP6 C;  1SZX A;  4J7Z A;  1QR9 A;  4PA3 A;  4BIU A;  1EZJ A;  1EN4 A;  3UCS C;  4KXR A;  4JAA A;  3TK1 A;  4CH6 A;  4JZG A;  3K59 A;  2DYR C;  1YTF D;  4UCR A;  1N8R W;  4UCV A;  5EIB C;  1KC8 W;  4MT8 A;  4CC6 A;  4DW0 A;  1VF5 B;  1NU1 H;  1M93 A;  2G38 A;  2JIZ G;  4YJ3 A;  4UFZ A;  4IT5 A;  5C8Y B;  4CS4 A;  3K9S A;  4FFB A;  5C93 A;  1XL4 A;  4JYB A;  3S3W A;  3KCX A;  2NN4 A;  4UXN A;  3U0Z A;  4GT1 A;  1JA8 A;  4L87 A;  4TT3 G;  4H37 A;  2Q0O C;  4FJC C;  1FXV A;  2PYL A;  1OCO B;  1K73 W;  5CMU A;  4GX1 A;  2XUM A;  4J41 A;  1O9H A;  3QG5 A;  4H33 A;  3ABM B;  2QE7 G;  2AW9 A;  5K1P A;  4FIP C;  2IJI A;  4I9W A;  1PL4 A;  5D5P A;  5BR8 O;  3UT5 A;  3E8G A;  3UKM A;  4DR5 O;  4UV8 A;  1AI4 A;  4PDV A;  5LYJ A;  3Q4H A;  4NR1 A;  4TQF A;  4BR6 A;  1IBM O;  4K8Z A;  4DV2 O;  1HNZ O;  1Q6U A;  1VQ6 V;  1R3I C;  1YI2 V;  3N2G B;  1XI1 A;  4EFE A;  4QJF B;  2HHH B;  4W4K A;  1AI7 A;  3ZCC A;  1V55 B;  4MVS A;  4FMT A;  4PA4 A;  5EBW C;  3WB2 A;  1Y76 A;  2JVD A;  1R1B A;  3B8M A;  3JYC A;  2LQT A;  2VS0 A;  1QVG U;  4YJ2 B;  1ZLZ A;  3CRM A;  4X64 B;  2P4K A;  1F23 A;  1NR7 A;  2DWE C;  3N2K B;  5IJ0 B;  2H8P C;  3I56 V;  1H2M A;  1QCE A;  2EZO A;  2N04 A;  2QKA A;  4MW8 A;  2Y4T A;  4LFA O;  2PGG A;  3CC7 V;  4UB6 Z;  1P7G A;  1JJO A;  1TUB A;  2E75 B;  1CEZ A;  1Z5W A;  3L70 H;  1R3J C;  2OIG A;  3ASN C;  3JAS B;  4PJ0 Z;  4LF4 B;  4JI0 O;  1L0L H;  2XAJ A;  5BMV A;  5ITZ B;  4I50 B;  4KP4 A;  1VIB A;  4PA9 A;  1LUV A;  1K9M W;  4O2B A;  2E3C A;  3ZHS A;  5CBH A;  5JH7 B;  3CCL V;  1W0J G;  3L75 H;  4ZHQ B;  2Q7E A;  4BW9 A;  1OV9 A;  1VQ7 V;  2BSK A;  4X8A A;  1H2G A;  4X65 B;  1BGY H;  2LFR A;  1GN2 A;  5AG2 A;  3B77 A;  4YIO A;  3NXS A;  4RQE A;  4L8J A;  1K7D A;  4B3R B;  5KMG A;  3IFX A;  1XIL A;  1M56 B;  3JCU Z;  4X1I B;  3E8B A;  2QJ1 A;  3RFR A;  3BAA A;  4OGQ B;  4I7Z B;  2KG7 B;  3AG4 B;  3L72 H;  4NKG B;  2Q68 A;  2WA4 A;  1JFF B;  4CS3 A;  3T2M A;  2D3O W;  4JI2 O;  2VQF B;  1TVK B;  1MSD A;  5B1N A;  3JSN A;  3H01 A;  5LOV A;  1PPJ H;  1SQX H;  2ZE6 A;  4DV3 O;  4PI0 A;  1EZV H;  4JI6 B;  4I4T B;  3T4Z A;  2ZIM A;  5LP6 B;  2XAG A;  3CCQ V;  1OCC C;  4JPR A;  4HYO A;  2A9H A;  1XHZ A;  2AHY A;  5H6Q A;  1WLE A;  1R6N A;  3QTC A;  5LBQ A;  3QNE A;  2DYR B;  4J7K A;  3CEI A;  4O4I B;  4KHP O;  3TXQ A;  1R73 A;  3OD4 A;  2DYS C;  1JR9 A;  3JAM N;  1P49 A;  1AVM A;  4MTG A;  4GKK O;  4GX0 A;  5KAI Z;  5H6R A;  4JTD B;  5CN0 A;  3T1C A;  4RO2 A;  2CK3 G;  2WPD G;  4JGS A;  4PV1 B;  3GB7 C;  5J2T A;  3CD6 V;  3E89 A;  2LW1 A;  4E2L A;  4QIW F;  5KUM A;  3G6E V;  5LMU B;  2UXB O;  1ZL8 B;  1ZX3 A;  4K0K B;  2YDE A;  2JS5 A;  4JI7 O;  3SJA C;  1OCZ C;  3DTU B;  2JS3 A;  1F7Y A;  2NR5 A;  5IT9 N;  1WB8 A;  2WLK A;  2KKW A;  4DR4 O;  2QM4 A;  5DM6 V;  2Q69 A;  1MAB G;  4QNH B;  4HBN A;  2YI9 A;  3D3Q A;  4DXW A;  1SQV H;  3LSU A;  4JI1 B;  3QO5 A;  3CCU V;  2UXD B;  2WWW A;  5KHK A;  2R70 A;  1IBK O;  2DN9 A;  3L74 H;  3DC6 A;  4DV6 B;  3M7M X;  2F43 G;  2X6B A;  4MVU A;  2GV9 A;  4FFB B;  3ZMV A;  3O9O A;  3K5M A;  2FL4 A;  1A32 A;  1JVM A;  1J5E O;  1SKV A;  4OX9 B;  4TWK A;  5IE9 A;  3OW2 U;  4JI8 O;  2V1D A;  3SYC A;  3JAT A;  4CBC A;  1YHQ V;  2WLL A;  3HB3 B;  1NZ6 A;  1HW7 A;  1QLN A;  2N05 A;  1Q3E A;  3DGE A;  3H1I H;  2L6L A;  4JYC A;  4X89 A;  4DR7 O;  1DF5 A;  2EJ7 A;  2IJJ A;  4DR6 O;  1EN6 A;  2F23 A;  3UT5 B;  2M6Y A;  2WAM A;  1G6U A;  3RVY A;  5LYJ B;  3ZBH A;  3Q4H B;  2YXH A;  1BE3 H;  4Z1M G;  1BQZ A;  4YHH B;  1FYJ A;  1H2N A;  1U96 A;  3LDE A;  1IVS A;  2QM8 A;  2A3Q A;  3DC5 A;  4F6E A;  1Q43 A;  1W59 A;  3OT7 A;  2OTJ V;  4JI5 O;  1QBZ A;  3FYE B;  1OCO C;  1NQT A;  2EIN C;  1GKF A;  2GTA A;  5CBF A;  3ABM C;  2UU9 O;  2PTM A;  4EFB A;  4O4H A;  5CBG A;  4U7O A;  5BR8 B;  1Y76 B;  3ABU A;  3H1L H;  3CSX A;  3FB5 C;  2EZP A;  3R66 A;  1B06 A;  3D36 C;  1GM7 A;  2EUL A;  3KZI Z;  1IBM B;  3F5W C;  4DV2 B;  1HNZ B;  1Y74 A;  3E35 A;  4NYK A;  1I08 A;  4B7E A;  2ZIN A;  3D8C A;  1IX9 A;  4N21 A;  1N0N A;  3AEI A;  1TAE A;  2ARH A;  3OR7 C;  1WPB A;  1TUB B;  1PD3 A;  1V55 C;  1SC5 B;  4HZ3 A;  5KLV H;  2C2A A;  1D2D A;  5LGN A;  4WBN B;  1Q8I A;  3G4S V;  2NLJ C;  5BY1 A;  4DUY O;  1K5Q A;  5BMV B;  2BOC C;  3P30 A;  3K58 A;  1SES A;  3I55 V;  2R9I A;  2DJV A;  2YIB A;  4O2B B;  1NH2 D;  2M7W A;  3CX5 F;  4O4L B;  3JD3 A;  4LF8 O;  4O4J A;  1VF7 A;  2WA3 A;  2UXC B;  3ASO B;  3E2E A;  1K4C C;  2BSK B;  3A0B Z;  4BAY A;  4MVO A;  4LFA B;  2PI5 A;  2XAF A;  1JOY A;  3IC7 A;  4X20 A;  3FAV A;  1NS1 A;  2DOS A;  2HLD G;  5KMG B;  1T5E A;  4JI0 B;  1SS3 A;  1S5H C;  1KKC A;  4QPJ A;  2DYS B;  1S3J A;  2Y0P A;  3D3I A;  3HR0 A;  3SDL A;  1JPX A;  2LGW A;  3K5L A;  2BTQ B;  4PA7 A;  5LHH A;  3BHP A;  1SQG A;  4G27 B;  2ZQM A;  5EC2 C;  3SPJ A;  2P6J A;  5HFL A;  3B8N A;  2W0X A;  4WFB V;  5LOV B;  1RFY A;  4MTF A;  1OHH G;  1NTZ H;  2ZXW C;  2RQ6 A;  2X6C A;  2ZNI A;  3K57 A;  1SQP H;  2EBO A;  4GYC B;  2MK3 A;  1S72 V;  4FM1 A;  3IGA C;  4U3J A;  2Q9L A;  1OCZ B;  2IM9 A;  3AK2 A;  1EFR G;  4JI2 B;  4JI4 O;  3ZHT A;  3FKS G;  2RJZ A;  3OMN B;  2UUC B;  4BIO A;  4TV9 A;  1BCC H;  4DV3 B;  4WF9 V;  2DQ0 A;  2ZDI A;  4KFM A;  1FXH A;  2HEP A;  4FLW A;  2IJH A;  3SPH A;  1KD1 W;  1GH6 A;  3FB8 C;  5J2T B;  3J7A U;  1G4Y B;  4FZ0 A;  4TV8 A;  1Q6H A;  1US6 A;  4ZOL A;  2RMK B;  2JGD A;  5EZY A;  1XBL A;  5LA6 B;  2HJF C;  3RWR D;  5L3C A;  2IBZ H;  2ZM6 O;  4KHP B;  1Q5O A;  1XQ8 A;  3JAR A;  4OX9 O;  1LNQ A;  3E8H A;  3SYQ A;  4GKK B;  2B9Z A;  1THZ A;  1IDS A;  1YJN V;  5CB4 A;  1XNQ O;  3GWO A;  3A8T A;  2VWJ A;  4LFC O;  1E79 G;  1QQC A;  4Q20 A;  1I7F A;  1RP3 B;  4UVA A;  3PJS K;  2UXB B;  4R7C A;  3K9A A;  2W6I G;  2LP7 A;  2AHZ A;  1VMG A;  2ZDI C;  4YHH O;  3QF7 A;  4DK1 A;  4JI7 B;  3HKE A;  4RAI A;  1KU9 A;  1YXB A;  1SA0 A;  1GO3 F;  2WLM A;  2EIN B;  4I5S A;  3QVN A;  1VQK V;  1AI5 A;  1IXM A;  1Q81 W;  3HKD A;  1ZTE A;  2B1G A;  3EVK A;  5FNV A;  4DR4 B;  1LUW A;  3UO3 A;  2WLL B;  1EN5 A;  2V4D A;  4FPP A;  2RDC A;  3J80 N;  4D6T H;  1I94 B;  1IBK B;  2HVJ C;  1U97 A; 
#chains in the Genus database with same CATH homology
 1FKA O;  4X64 O;  5A2Q N;  4DV3 O;  4JI6 O;  4LF5 O;  2E5L O;  4DUY O;  5BY1 A;  4JYA O;  5IWA O;  1A32 A;  1J5E O;  4B3T O;  2DJV A;  3OTO O;  2LW7 A;  4LF9 O;  4JI8 O;  1N36 O;  4DV7 O;  1I94 O;  3J7A U;  4DR3 O;  4LF8 O;  4LFA O;  2UUC O;  2FKX A;  4DV4 O;  4KHP O;  1AIL A;  2JRI A;  2N74 A;  3O65 A;  3M8A A;  4LF4 O;  4YY3 O;  4DR1 O;  4DR7 O;  1XMO O;  2ZM6 O;  3JAM N;  1G1X B;  5FLX N;  4OX9 O;  4JI0 O;  4GKK O;  4DR6 O;  1NS1 A;  2DOS A;  4DR2 O;  4OPA A;  5LMN O;  4X66 O;  1N34 O;  1FYJ A;  3T1H O;  2UXC O;  1DK1 A;  2AGA A;  1FJG O;  5LL6 Y;  1XMQ O;  1HR0 O;  4NXM O;  1XNQ O;  5LMU O;  3SDL A;  4X65 O;  1HNW O;  4LFB O;  4LFC O;  4JI5 O;  1KUQ A;  1X59 A;  2UXB O;  1XEQ A;  4K0K O;  1R6T A;  4DV5 O;  3T1Y O;  4B3S O;  4B3R O;  4OPH A;  1AB3 A;  4X62 O;  5BR8 O;  4AQY O;  5BXZ A;  4YHH O;  2UU9 O;  4DR5 O;  4JI7 O;  4NXN O;  4JI3 O;  1IBM O;  4GKJ O;  1HNX O;  3R66 A;  4DV2 O;  4DUZ O;  1HNZ O;  4LF7 O;  1F7Y A;  1N33 O;  1YZB A;  3J81 N;  4DV1 O;  5IT9 N;  1N32 O;  4DR4 O;  2HHH O;  2Z0A A;  4JI1 O;  2UUB O;  2ZKO A;  4JV5 O;  3F5T A;  2UXD O;  1IBL O;  2VQF O;  4DV0 O;  2VQE O;  4DV6 O;  4LF6 O;  4B3M O;  4JI2 O;  1IBK O;  3RT3 C;  3J80 N;  2UUA O;  5H5N A;  4A5U B;  1R1B A;  2F4V O;  1XNR O;  4JI4 O;  1D2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...