2UXCO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxcO00
2VQFO 4DV1O 1N36O 1IBMO 5LMNO 4LF9O 4OX9O 2N74A 4X66O 1D2DA 1HR0O 4DV6O 4B3MO 1NS1A 4DV7O 4DV4O 4LF5O 2FKXA 1F7YA 4NXMO 1HNWO 2UUBO 4K0KO 1KUQA 5BR8O 4LFCO 2HHHO 1DK1A 4GKKO 4JYAO 3T1YO 3F5TA 2UUAO 4JI3O 4JI6O 2LW7A 3R66A 4JI8O 2UXCO 4JI7O 2UUCO 4LF6O 3SDLA 1XNRO 2F4VO 4A5UB 1N33O 4DV0O 3M8AA 4X65O 4DR5O 1IBKO 4DUZO 4B3RO 1N34O 5IT9N 4YHHO 4AQYO 2AGAA 4DR4O 4B3TO 2UXBO 2E5LO 4X62O 1J5EO 4LFAO 4DR2O 2ZKOA 2DJVA 4B3SO 4JI0O 2JRIA 4JI1O 5BY1A 1N32O 4OPAA 4DV5O 4DR3O 1HNZO 4DR1O 3T1HO 4GKJO 4YY3O 3J80N 1AILA 4LF7O 4X64O 3J81N 3JAMN 1FKAO 2Z0AA 4JI5O 4NXNO 5LL6Y 5BXZA 4DV3O 1G1XB 2UU9O 4LF8O 4DV2O 2UXDO 1R1BA 4OPHA 5IWAO 3O65A 1FYJA 5FLXN 1XEQA 2VQEO 1X59A 5LMUO 5A2QN 4JI2O 1I94O 4LFBO 1A32A 1XNQO 4LF4O 4JI4O 1YZBA 3J7AU 4DUYO 1XMOO 4DR6O 2DOSA 5H5NA 1IBLO 3RT3C 1HNXO 1AB3A 3OTOO 4KHPO 4JV5O 4DR7O 1XMQO 1FJGO 2ZM6O 1R6TA
chains in the Genus database with same CATH superfamily
2VQFO 1PP9H 1Q5OA 1Q8IA 2Y0IA 2Y69C 3RW0A 4OXSA 4I9WA 2EJRA 4DV5B 4F6RB 1M57B 3L75H 2LO1A 1D5NA 4EB6B 1S5JA 1H38A 3SYAA 1K4CC 5IY5B 1EFRG 3TETA 1Q86W 3E89A 1PL0A 2UXCO 2EIJB 2WLNA 4QNHB 3KZIZ 1KQSU 2Q4PA 2DN9A 2IJKA 4EFBA 3VBBA 3MHHC 5KHGA 4K3AA 2F4VB 3QVNA 2EIKC 4J7ZA 2UXBO 2Y48A 2DQ0A 1GM8A 2R9IA 5BY1A 1F4NA 3CJHA 3ZHRA 4DO2A 3ETQA 3CRRA 2ITDC 4DRXA 4DK1A 1TA8A 2YUAA 4YY3O 1VQKV 2YI9A 4H13B 4DV6B 1UPGA 4GKKB 1M9NA 4GZRB 5KLVH 2GUZB 4J7JA 2RMKB 4DR3B 3QG5A 4IIJB 4O2BA 1KB9F 3T1YB 2F93B 1S0VA 2DYSB 4BIUA 5CA1B 2EX3A 2EIKB 2BCCH 4WF9V 4LFBO 1N32B 3W7TA 1RPRA 1OCRB 1OJHA 3B2EE 5C8YA 4XBFA 4LR3A 4U3JA 4IHJB 1AB3A 1XBLA 1R6TA 4DV1O 3ZMSA 4J80A 2F95B 3CCSV 3ZCCA 4D6TH 1D2DA 1XMOB 5L3GA 4IYIA 1ZTEA 3ZMZA 4KFMA 1X4TA 3SJAC 2QM8A 1K4DC 2Q5ZA 4GT1A 2UUAO 2IJIA 3E8HA 1SQQH 4WFFA 1AROP 5CN0A 4K8XA 3H01A 4UB6Z 3ZEDA 4NTWA 4PA7A 5GONA 3LNNA 2VQFB 2E3CA 2QKAA 3SJBC 3E8BA 2AGAA 1YJ9V 4GKJB 4X62O 3N27A 1OCCC 1TAEA 4PDVA 2K1EA 2AXTZ 3AG3C 2ZE7A 1UFIA 2Z5UA 1WP7A 5JVDA 5JWPA 4UCUA 5GTHZ 2IU0A 4GKJO 1BL8A 2Q0AA 3D8CA 2JK5C 3BPZA 4O2AA 4L87A 1SQFA 5CB4B 5JCOC 3OR6C 1VQ9V 2OTJV 2E74B 2EINC 1Q7YW 4CH3A 1WAZA 5IWAO 1F51A 4H33A 4DYLA 1SQXH 2A7WA 5L3DA 1YJNV 2LGQA 3JAWA 3K0GA 1ZWIC 2CDYA 2V1DA 2VRZA 1AR1B 2IH1C 5H5NA 3JSLA 1YIJV 5HFMA 3B77A 1VF7A 4K0KB 1SZTA 1GAXA 3RYFB 1M90W 3CCVV 1ZLZA 4G28B 1NTKH 5L3FA 1B6QA 2WLIB 4F6RA 4JGSA 1P7GA 3K06A 3ZN1A 2OIEA 2GV9A 2KKWA 5EZYA 1XMQB 5CBGA 4JYAO 3QNEA 2LW7A 5LGUA 3DXRA 4FK5C 5LHGA 4J11A 4X1KB 4JI5B 3CS5A 2ZE6A 4KXRA 4OGQB 1GO3F 4DUZB 5IYCO 5KMGB 2M7WA 4IL6Z 1IXBA 2CGOA 2Q7GA 3E86A 3H9VA 1Q82W 4DW0A 4P9PA 5IYDO 4LBEC 3CCRV 1BE3H 3OW2U 3W7WA 4LWSB 2F66C 1XL4A 2HEPA 4TWKA 1NBMG 1E79G 1GM9A 2P6JA 3C3SA 4DR1B 1F4MA 3K5NA 3K5MA 2AHZA 5LMNB 4QPJA 4IIJA 2QWOB 1WPBA 5J2UB 2P90A 4LF8O 2HG5C 1BQZA 3P32A 2P22C 1RFYA 1MZEA 2QA4V 3EFFK 3OEEG 2R70A 1HP8A 5LMUO 2HJDA 5L3EA 1FJGB 1U97A 4I0XB 4RUFA 1DTOA 1AI7A 3M99B 1WLEA 5CBHA 1TUEB 1H8EG 3I5DA 4J9ZB 5IYBO 3OTOB 2D3OW 2JDIG 3H1HH 3K5LA 3HB3B 4AQYB 2EIMB 4X64B 2ZDIC 1HW7A 2UUCB 2QJ1A 1NS1A 2CE4A 4LF5O 3JATA 1HNWO 1ZUQA 3ABUA 3OAAG 4XDLA 2H8PC 1NU1H 3TGUH 4JI7O 1GKFA 1Q43A 2A0LA 4PD4F 3OE7G 2OWOA 2WAMA 2OCHA 2EIJC 5FPOA 3UO3A 4ZI7A 2IBZH 1YSCA 3DXRB 1IBKB 4YHHO 1BQ0A 3ZHUA 5L3CA 1BGYH 4FIPC 1H2NA 3WB1A 5H6RA 1N0JA 4JTAB 3EXAA 2QWQB 1V9PA 5IJ9B 3U11A 3JAKB 2LFRA 1FFTB 1N4CA 3G4SV 1PL4A 1YEWA 3X2QB 1K9MW 1J95A 3ZX6A 3AG4B 4JI5O 4FZ0A 4FLWA 3L70H 2PUSA 1NJIW 2ZIOA 4U3JB 1R3IC 1R1BA 1JQ0A 3A2FA 2WA4A 5IE9A 3H1JH 5A2QN 2CAZC 4WFGA 4AILC 2JJ1G 1JJOA 2C2AA 5IYZA 4R6ZA 3JD3A 3FAVA 5B3SB 4G27B 4O2BB 5H6QA 1LR1A 3UQ8A 1MMMA 4O4HA 3ZHVA 2ADPA 4RQEA 1M1KW 5LMNO 3HR0A 5LP6A 2QSAA 5FNVB 2EILC 1R73A 4LNUA 4QE7A 4I50A 4TOIA 2L35A 1V54B 2HJFC 3SYQA 5K1XA 2CH7A 1QVFU 1HDJA 1KP3A 2XASA 4GUNA 2K9PA 2ZT9B 3S3WA 4LF6O 4NR1A 3SDLA 3AK1A 4PV1B 4DW1A 2EJ7A 5IDJA 1TUBA 1AI6A 4YIPA 4F6EA 2ZNIA 1M4UA 4EEQA 1FXKA 4B3RB 3OFNG 4DV2B 4WFHA 4AQYO 4I55B 1E1RG 5B66Z 3IAYA 3VQYA 2ZIMA 1XOUA 2P5OA 3JAKA 1PKXA 2IW5A 4BIZA 3K58A 3RWRD 4DR3O 2ATKC 4X8AA 1DGSA 3T4DA 1JFFB 3D3IA 3LSSA 5KUKA 3CCUV 1VP7A 1NVPD 4N21A 2W0XA 3J81N 1KMIZ 1QBZA 4GLXA 2JJ2G 1XILA 1VQOV 3CRCA 4LFBB 2UXCB 2FTKA 2ETNA 2X0LA 1K34A 2PTMA 3H1IH 4Z1MG 2XAFA 3GB7C 4YHHB 4IYHA 1XEQA 1ZL8B 2A79B 2HP8A 1G4YB 2Y4UA 3ASOB 1SETA 3SPIA 4GX5A 1YZBA 5KAFZ 2RNBA 1GM7A 4O2AB 3I55V 5CB4A 3B09A 1OZ0A 1XMOO 2CTRA 3G6EV 1DF5A 4GX1A 1NT2B 1PM9A 4NKGB 1Q81W 3PN1A 2PYJA 2N05A 5LGTA 4J42A 4DV6O 3T1CA 2WPDG 1MA1A 3ZIAG 4DV4O 3ZBHA 1I08A 1VF6A 3N2KB 5LHHA 2FKXA 2BSKB 4LFCO 1OV9A 3T1YO 1K5SA 1R3KC 2FYUH 4UCTA 3MHSC 4GX2A 1OCOB 2ZE5A 5KHJA 3ZRXA 3U0ZA 2ZR3A 3GWKC 3K03A 3M8AA 4X1YB 3CE2A 5JJEB 4I4TA 2LGWA 1K5QA 4JAVA 4Q6GA 1TUBB 1QLNA 3NR7A 1S72V 2X6AA 3CRQA 1NR7A 3BFRA 1QVGU 1J5EO 4LFAO 4MSWC 3BA9A 3UT5B 2W6JG 4NYKA 2N04A 3VOUA 2CTQA 2B1IA 5CA3A 1VQLV 2JGDB 2QE7G 4JYYA 1VQPV 5EIBD 4TUYB 3L72H 5LA6A 4LF7O 2D2CB 4O4HB 1VMGA 4NTYA 3AG1B 4QIWF 1XL6A 1WPXA 2ZCEA 4FLTA 3CYOA 4FM1A 1N33B 5FLXN 2ZE8A 3RVZA 1WB8A 1Q3EA 3EVKA 1FFXB 1GRJA 1S77D 4JI2O 2WWWA 3CRAA 4UVAA 2EINB 3E22A 1IBLB 1NR1A 1Z5WA 4DUYO 4FLUA 4W4LA 4UV9A 4JI1B 2BE3A 4MVQA 3H1KH 2YDEA 3T2MA 1AVMA 1XMQO 1LNQA 2ZM6O 3N2KA 4AI8A 1BSMA 5BZBA 3QO7A 1SF9A 3OGIB 4I50B 4HNAA 5KHHA 2R9AA 4I0XA 3K0DA 3L73H 5E1AC 2UUBB 5C8YB 3F5TA 2IJHA 3PJSK 2WLLA 3CHXA 3VQWA 5KX5B 1W2BU 4GYCB 2PGGA 2YICA 4WFBV 5JQGB 4X1KA 1RM1B 2HVJC 1PPJH 3UT5A 1Y4MA 1SQPH 2BTOA 3BHPA 1CXZB 1OCZB 3L74H 3RVYA 2WLJA 4PHZA 2X7RB 4MS2A 4I4TB 1UJWB 1WJZA 1YTFD 4DR2B 1SQGA 4JZGA 2ILMA 4LFCB 3IJ4A 5KA6A 4B08A 1R3JC 1Q90D 2ZDIA 2A06H 2OCCB 4I5SA 4BW9A 5LP6C 2RCVA 4EFEA 1H2KA 1XI1A 3W7UA 4DV3O 1QNMA 2GUZA 3CCQV 2WA3A 3B8NA 4UCSA 4TV8B 2EIMC 1YCIA 3RYCB 2P67A 2QM7A 4LFAB 5EIBC 3FB7C 1H2GA 2VWJA 3CJHB 3U10A 4YJ2A 3HKDA 1SS3A 2RQ6A 3SR2C 1YVWA 1W0JG 2E75B 5BR8B 1N36O 2QKCA 4CBCA 2QR4A 1HR0O 2RDCA 2YEVB 1SA0A 3SYCA 3KKYA 3JAWB 3K79A 3RYCA 5KUMA 5KMGA 4BAYA 5BR8O 3OUSA 4JI3B 5KHKA 1YTFB 1G8MA 4JI8O 1XDCA 2XUMA 1BS3A 3VQVA 1P7BA 2VQEB 2YIBD 4DV7B 4ZBMA 2Y69B 4X1IA 1VQ4V 3JCZA 1BHBA 3TJTA 1L0LH 1ZAUA 4MTFA 4QPKA 1S76D 5IY5C 4O4LA 4TV9A 5TISZ 1JVMA 1M56C 1JX9A 1QR8A 4YXWG 4JI0O 1KKDA 2G38A 3ZHSA 4LF4B 3E22B 1GK9A 3S3XA 4MVSA 1HNZO 1KP2A 3KCYA 1THZA 1NQTA 4B3MB 2UXNA 2XAHA 4JAUA 5DM6V 3LUTB 1HNZB 4N23A 2ITCC 1SERA 5EYPA 3K08A 4FM0A 1FYJA 1H8HG 4JZ2A 2L6LA 2JEXA 1A32A 1XNQO 1AR4A 4H0LB 1VEWA 5J2TA 2V4DA 4Z2WA 2R9RB 3OD4A 3K57A 2XTAA 4UXNA 1COWG 3SJCC 3ZMUA 3CC2V 3RYIA 1XQ8A 4JV5O 3ZMVA 4DR7O 5KHIA 5B1BB 2ZR2A 4TQFA 1TVKA 1AJQA 4FFBA 3GWOA 1IZ3A 3K3WA 3RGBA 4TSFG 1IXMA 3CCEV 2HFEC 4FM2A 1PNKA 2KG7B 3JALB 2HHHO 4O4JB 4P2ZA 1XREA 2Q9LA 4ASUG 1CEZA 2H94A 2JS3A 3ZHQA 4JI6B 1H2LA 2LP7A 5EC1C 4JASA 3JD4A 3H1LH 3CD6V 1FXKB 3ZMTA 1H2SB 1WB7A 1NZ6A 1N36B 2GHYA 2MW2B 1IDSA 1K7DA 1Y76B 5IT9N 3TCUA 1TVKB 2BOBC 3N2GB 4DR4O 1N34B 1EM1A 3P3PA 5F2VO 3ASOC 2GSMB 3HKBB 1HNXB 4EB6A 4U7OA 5D5QA 2KG7A 4UV8A 1L0NH 4YJ2B 2ZNJA 4DV5O 1GTOA 4DR1O 1MZFA 1U96A 4X1YA 1AILA 3T1HB 3B8MA 4R50A 4IHJA 1Z5VA 2FB5A 1K8AW 2LJ2A 1SQBH 1RP3B 1XHXA 3K04A 1KD1W 4PJ0Z 1S5HC 3P30A 3O9OA 2QTOA 2LW1A 3W7SA 1K33A 3CPWU 4J7KA 3IGAC 5LMUB 1URFA 1PD3A 3HKEA 4JF3A 2UXBB 2F23A 1NTMH 3J7AU 4KL1A 4DR6O 4RUEA 1KECA 4DV4B 1WN7A 2Q68A 2P4KA 3F7YC 1RSOA 3SGIA 1V55B 2ARHA 1FD9A 2GTSA 5EBWC 4PA4A 5EZYB 5J2UA 3D36A 1FFXA 3CXCU 3OR7C 3A8TA 5CBFA 2XHBA 1F7YA 4NXMO 1MSWD 3CMAV 1T5EA 3RYHB 4FLXA 1DK1A 1QHTA 2UXXA 1AI5A 1MSDA 1VQ7V 3AG3B 1AJNA 2NN4A 2YIAA 3R66A 3SJQC 4PA9A 3ABKC 4A5UB 4FLZA 5EBLC 3TXQA 1IBKO 4CH5A 3OMNB 4JTCB 3I56V 1PNLA 4YJ3B 3OT7A 4WCEV 4HNAB 5IJ0B 1VQ5V 2CH7B 1SKVA 1BT8A 2YXLA 2GBOA 2WLLB 5KX5A 3N2GA 1JJ2U 4OPAA 4UCRA 3SPGA 3KG2A 2QEXV 2YI8A 2EZOA 4TUYA 5LA6B 4RQFA 2DWEC 4UCOA 3OUFA 3JAMN 3F7VC 1YDXA 1I7FA 4FFKA 4DRXB 1NH2D 4IT5A 4DV2O 2UXDO 4NTXA 2ZXWB 3BAAA 1OCCB 2E76B 4UVBA 3CCJV 4NVPA 2NLJC 2Y4TA 4UCVA 4FJCC 2XNDG 4HZ3A 2IU3A 3BVOA 5JJJB 1VIBA 1QU7A 1XNRB 2EULA 2BTQB 5B1AC 1GN4A 2KB1A 4WBNA 3RYIB 4I9QA 3ZRWB 3E35A 1K92A 3RN4A 3JCUZ 1IBMO 4OX9O 1VQ6V 2MK3A 1YITV 2N74A 4X66O 1AJPA 2HVKC 5EBMC 4JPRA 4D7TA 2NNUA 3G67A 3K9AA 3JD1A 2B9ZA 3A0HZ 1FPOA 1D5AA 3LNMB 1SRYA 1GN6A 4R8CA 4MTXA 3JATB 5A9GA 1IURA 3RYHA 3ZS8C 5H9CA 2F4VO 2OCCC 1JA8A 4NB5A 1OCOC 2XOKG 2X6BA 4PDLA 5JQGA 1LUWA 3MD0A 1TGOA 4B3RO 1N8RW 3CP1A 4X9QA 3ETEA 3ZN0A 1NH2B 1EN5A 1QCEA 2PF4E 5EK0A 2ZD9A 1AI4A 2FMLA 5CA1A 2VS0A 2ZKOA 1Q6IA 2JRIA 4HYOA 2DWDC 4ZOLA 4YY3B 3FKSG 2LFSA 3CCMV 3J80N 5H2FZ 2X6CA 1NKDA 4X64O 1JPXA 5J2TB 1Y6XA 1KBHA 3DC5A 2HKOA 2P06A 4B7KA 5LL6Y 1I94B 1VF5B 3F5WC 4OPHA 2CTWA 3O65A 4JYCA 5JCOA 1EBOA 4CS3A 4R7CA 1Y74A 4CH4A 1M93A 2QGNA 1ORQC 3WG7B 4TT3G 1I94O 2JGDA 5E79Z 4B7EA 2CUGA 4JYBA 1EN6A 4KP4A 2PI5A 4X88A 1GN3A 5B1OA 1R6NA 3G6BA 4YJ3A 1O9HA 1B04A 2VWKA 3UCSC 4UB8Z 2YIDA 4J41A 4WBNB 2UXDB 3ABMB 1VF6C 1PNMA 4DV7O 5LXTA 3CSXA 3A0BZ 1GN2A 4LP8A 5LGNA 5CMUA 3D3QA 3C90A 3ETGA 4UFZA 1SESA 4G2KA 2WLIA 3EHBB 3APQA 2CGNA 5LOVB 4EKWA 3WG7C 1WA8A 3RBZA 2XAQA 3FB5C 5FL7G 1Q6HA 3ZHTA 3E8FA 4NXNB 4FFBB 1OCRC 4B3SB 3BRCA 2OTLV 3X2QC 2UU9B 1IBMB 3AG2C 2QWRB 3LDDA 4MVMA 4PA3A 4X66B 4FLYA 3FD9A 4LWSA 4ZHQA 2Q7EA 3VQXA 4X62B 2JGUA 5DN6G 4B3SO 1Z2GA 1B3QA 5J9PC 1BCCH 1N32O 3UO2A 2BSKA 1HR0B 2PY5A 4LF5B 2E5LB 2QDOA 1KC8W 1M56B 2DMXA 3D36C 1Y76A 1MOFA 4ZOLB 1ZL8A 3RFRA 5BXZA 5LP6B 1US6A 5IWAB 5EYPB 2OYQA 3C3TA 2A3QA 5JH7B 1S3JA 4JI2B 4QE9A 1SA0B 3DSQA 2F43G 3AG2B 1VQMV 2Q6AA 4QJFB 3BA8A 3ICXA 2HR3A 4QGPA 1Q6UA 4U3FH 1FAFA 2DOSA 1IBLO 2DW4A 4XDKA 3WB2A 1BHAA 4E2LA 3BEHA 4FPPA 4KHPO 3RYFA 3W7XA 5DECA 3JD2A 5ITZA 5LBQA 4B3MO 1V55C 3FB8C 1O9GA 2UUBO 1KUQA 4X65B 4GKKO 4GX0A 3JALA 5B1BC 2PZSA 5CA0A 2KQXA 1CPYA 1JCHA 5BMVA 2XAJA 1DF4A 3SPCA 4JAAA 3DC6A 1W0KG 2Z3YA 4MVZA 3FFQA 1XHZA 4X65O 2YIBA 4DUZO 2Q67A 1I5YA 4PA6A 2CTPA 1NTZH 2IJJA 2NR5A 1V54C 3MDSA 3AG4C 4DR2O 4J10A 4RO2A 3CB2A 3ML0A 3ZRSA 2JS5A 2O57A 4CZZA 3HKBA 4MW3A 3CC4V 5AG2A 4MT8A 1L1FA 1YXBA 3FYIB 3ABLB 4MVUA 4Z1VA 2AW9A 2GTAA 2DYSC 2WSSG 1YJWV 2HHHB 1EZJA 2DYRB 3SPJA 2BTQA 2ZXWC 4CS4A 4NXNO 3WB0A 5K1PA 1G1XB 2UU9O 1G6UA 2UUAB 2ADQB 2YXHA 4LF8B 4TV8A 3IC7A 4P30A 5D5PA 3ASNC 1B06A 1EN4A 2JIZG 3IC9A 2P7TC 2FL4A 4LF4O 1ZX3A 4HBNA 3CMEV 4DR4B 2ZQMA 3AG1C 1GH6A 1SZXA 3BABA 3MAQA 5FNVA 4ICGA 3RT3C 1SQVH 1RSOB 1HNXO 3OTOO 3LSQA 4NXMB 1KKCA 1M57C 1JMKC 3AK2A 5IYZB 1S5LZ 3CX5F 4E4EA 4FMTA 4LH7A 1OHHG 3FAVB 3ZRVA 4RWUA 4MW8A 5CA0B 2PYLA 4GCZA 3T4ZA 3STZC 3A0RA 2W6IG 1AP6A 4MTGA 2B1GA 4WFEA 4K8ZA 2GDSA 2JVDA 1BMFG 3WFVA 4JI3O 4JI7B 3TXSA 3UKMA 4H44B 2WLKA 4BR6A 4ZKIA 1N33O 3QO5A 1IVSA 3LSUA 3OEHG 3ABTA 4F4LA 3P3NA 4DR7B 1NI8A 1YI2V 1FXKC 2QWPB 4RAIA 3CRMA 2R72A 1I5XA 2YSUB 2CK3G 2QKSA 5EC2C 1M5IA 4JI0B 4CC6A 4WFAV 2QM4A 3G71V 3E8GA 2BOCC 2AHYA 4JI1O 3ABLC 5GW7A 1Y66A 4LC1A 1BZKA 1RM1C 3BY6A 3THOA 1XUQA 4C7UA 1ROPA 4X1IB 4LH6A 4PELA 5KA5A 1FKAO 3NXSA 2B5UA 1I0HA 1WP8A 3FB6C 1YF2A 2KSDA 4AHCA 4JYAB 4JI4B 2EILB 4CC5A 2P4VA 1K73W 5LXTB 4U7NA 3HKCB 1KYOF 4D7SA 4UVCA 4FZ1A 4JI4O 2Q69A 4OX9B 1VQ8V 1SC5B 1IX9A 4ZIBA 4DV0B 2JEUA 3R65A 4MVOA 4XDJA 2H3OA 3DTUB 3FX7A 3QTCA 3OM3B 4LCUC 3HKDB 4JV5B 3K9SA 3IFXA 2QWNB 4LF7B 4I55A 1MABG 5GONB 5LHIA 4CH6A 2RN9A 2XT9A 1OCZC 1AP5A 1VQNV 4BWAA 2IH3C 1P4RA 1FS0G 3UM7A 3CWBH 2XAGA 3OGCC 2F1MA 4K0KO 4K35A 2YXYA 2LQTA 5GTIZ 4ZHQB 1JR9A 2W0FC 1JFFA 3OMAB 4JI6O 4L8JA 4DV3B 5BMVB 1WNSA 2EZPA 3CEIA 4IGGA 3SYPA 4DR6B 3JASA 3OTFA 3SPHA 3QF7A 3ASNB 3LDCA 5IJ9A 3JYCA 4DR5O 1F23A 4MVRA 2DYRC 3FYEB 1P84F 3CCLV 4DUYB 1N34O 3AG7A 5B3SC 1AR5A 2ZM6B 2DJVA 5JH7A 4PI0A 4YIOA 3JARB 1EZVH 5L3BA 4O4LB 3L71H 3T1HO 1MNGA 5B1NA 1ZSPA 2OIGA 4O4IA 3KCXA 4ZI7B 3M7MX 2AZ2A 5IJ0A 1P49A 4J9YB 1FXHA 4P9OA 3ZRWA 4ABMA 3LDEA 3G80A 1FXVA 2RJZA 3APOA 2YS8A 3AEIA 2DQ3A 1Y74B 2DE0X 4JI8B 4MTOA 5ITZB 4H37A 1N0NA 5JVDB 2VQEO 2A9HA 2Q73A 4KUMA 2OT5A 3ABKB 3CXHF 1L8DA 4X89A 3GVMA 4X20A 3BCCH 2IM9A 2V7QG 5LYJB 4LF9B 4LF6B 1H2MA 3E83A 3WU2Z 1QLEB 2EBOA 4PDMA 3L9DA 4O4IB 1VARA 1DLBA 3SYOA 3JSNA 1FJGO 4LF9O 4JTDB 4O4JA 4PI2A 5HFLA 4FLVA 4I7ZB 5B5EZ 2HLDG 3ZJZA 1HWYA 2Q7HA 3CC7V 3Q4HA 3ABMC 3STLC 1W59A 3HKEB 2UUCO 3JD0A 4W4KA 1XNRO 3B40A 4B3TB 2QTSA 1WA8B 4DV0O 3ETDA 1HNWB 3DGEA 3K59A 2AZ0A 4LNUB 3E2EA 1QLEC 1R6KA 3JARA 1XNQB 3JASB 1J5EB 4DK0A 4B3TO 2YEVA 2E5LO 5B1AB 5JJNB 3HKCA 4BIOA 3K5OA 1NVPB 5FPRA 4BW5A 1R3LC 2Q0OC 1KU9A 2Y0PA 2M6YA 3AK3A 4Q20A 3Q4HB 2YC0A 1K97A 2WLMA 1YHQV 1JOYA 4DV1B 2Z0AA 4DR5B 1E1QG 4UUJC 4DXWA 5DEDA 5C93A 1QR9A 4FVMA 3TK1A 3B4SA 1K3EA 4TV9B 4PDRA 1ENVA 3HPLC 1X59A 4HAMA 4KHPB 1CP9A 1RPOA 1GMGA 4TQDA 1PV0A 2ODMA 2PI4A 2ZINA 1QQCA 2WLHA 1Y67A 1MG1A 1LUVA 4CS2A 5KAIZ 4X20B 2Q8VA 5LOVA 3QO8A 5LYJA 3OMIB
chains in the Genus database with same CATH topology
2VQFO 4DV1O 1N36O 1IBMO 5LMNO 4LF9O 4OX9O 2N74A 4X66O 1D2DA 1HR0O 4DV6O 4B3MO 1NS1A 4DV7O 4DV4O 4LF5O 2FKXA 1F7YA 4NXMO 1HNWO 2UUBO 4K0KO 1KUQA 5BR8O 4LFCO 2HHHO 1DK1A 4GKKO 4JYAO 3T1YO 3F5TA 2UUAO 4JI3O 4JI6O 2LW7A 3R66A 4JI8O 2UXCO 4JI7O 2UUCO 4LF6O 3SDLA 1XNRO 2F4VO 4A5UB 1N33O 4DV0O 3M8AA 4X65O 4DR5O 1IBKO 4DUZO 4B3RO 1N34O 5IT9N 4YHHO 4AQYO 2AGAA 4DR4O 4B3TO 2UXBO 2E5LO 4X62O 1J5EO 4LFAO 4DR2O 2ZKOA 2DJVA 4B3SO 4JI0O 2JRIA 4JI1O 5BY1A 1N32O 4OPAA 4DV5O 4DR3O 1HNZO 4DR1O 3T1HO 4GKJO 4YY3O 3J80N 1AILA 4LF7O 4X64O 3J81N 3JAMN 1FKAO 2Z0AA 4JI5O 4NXNO 5LL6Y 5BXZA 4DV3O 1G1XB 2UU9O 4LF8O 4DV2O 2UXDO 1R1BA 4OPHA 5IWAO 3O65A 1FYJA 5FLXN 1XEQA 2VQEO 1X59A 5LMUO 5A2QN 4JI2O 1I94O 4LFBO 1A32A 1XNQO 4LF4O 4JI4O 1YZBA 3J7AU 4DUYO 1XMOO 4DR6O 2DOSA 5H5NA 1IBLO 3RT3C 1HNXO 1AB3A 3OTOO 4KHPO 4JV5O 4DR7O 1XMQO 1FJGO 2ZM6O 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQF O;  4DV1 O;  1N36 O;  1IBM O;  5LMN O;  4LF9 O;  4OX9 O;  2N74 A;  4X66 O;  1D2D A;  1HR0 O;  4DV6 O;  4B3M O;  1NS1 A;  4DV7 O;  4DV4 O;  4LF5 O;  2FKX A;  1F7Y A;  4NXM O;  1HNW O;  2UUB O;  4K0K O;  1KUQ A;  5BR8 O;  4LFC O;  2HHH O;  1DK1 A;  4GKK O;  4JYA O;  3T1Y O;  3F5T A;  2UUA O;  4JI3 O;  4JI6 O;  2LW7 A;  3R66 A;  4JI8 O;  2UXC O;  4JI7 O;  2UUC O;  4LF6 O;  3SDL A;  1XNR O;  2F4V O;  4A5U B;  1N33 O;  4DV0 O;  3M8A A;  4X65 O;  4DR5 O;  1IBK O;  4DUZ O;  4B3R O;  1N34 O;  5IT9 N;  4YHH O;  4AQY O;  2AGA A;  4DR4 O;  4B3T O;  2UXB O;  2E5L O;  4X62 O;  1J5E O;  4LFA O;  4DR2 O;  2ZKO A;  2DJV A;  4B3S O;  4JI0 O;  2JRI A;  4JI1 O;  5BY1 A;  1N32 O;  4OPA A;  4DV5 O;  4DR3 O;  1HNZ O;  4DR1 O;  3T1H O;  4GKJ O;  4YY3 O;  3J80 N;  1AIL A;  4LF7 O;  4X64 O;  3J81 N;  3JAM N;  1FKA O;  2Z0A A;  4JI5 O;  4NXN O;  5LL6 Y;  5BXZ A;  4DV3 O;  1G1X B;  2UU9 O;  4LF8 O;  4DV2 O;  2UXD O;  1R1B A;  4OPH A;  5IWA O;  3O65 A;  1FYJ A;  5FLX N;  1XEQ A;  2VQE O;  1X59 A;  5LMU O;  5A2Q N;  4JI2 O;  1I94 O;  4LFB O;  1A32 A;  1XNQ O;  4LF4 O;  4JI4 O;  1YZB A;  3J7A U;  4DUY O;  1XMO O;  4DR6 O;  2DOS A;  5H5N A;  1IBL O;  3RT3 C;  1HNX O;  1AB3 A;  3OTO O;  4KHP O;  4JV5 O;  4DR7 O;  1XMQ O;  1FJG O;  2ZM6 O;  1R6T A; 
#chains in the Genus database with same CATH topology
 2VQF O;  1PP9 H;  1Q5O A;  1Q8I A;  2Y0I A;  2Y69 C;  3RW0 A;  4OXS A;  4I9W A;  2EJR A;  4DV5 B;  4F6R B;  1M57 B;  3L75 H;  2LO1 A;  1D5N A;  4EB6 B;  1S5J A;  1H38 A;  3SYA A;  1K4C C;  5IY5 B;  1EFR G;  3TET A;  1Q86 W;  3E89 A;  1PL0 A;  2UXC O;  2EIJ B;  2WLN A;  4QNH B;  3KZI Z;  1KQS U;  2Q4P A;  2DN9 A;  2IJK A;  4EFB A;  3VBB A;  3MHH C;  5KHG A;  4K3A A;  2F4V B;  3QVN A;  2EIK C;  4J7Z A;  2UXB O;  2Y48 A;  2DQ0 A;  1GM8 A;  2R9I A;  5BY1 A;  1F4N A;  3CJH A;  3ZHR A;  4DO2 A;  3ETQ A;  3CRR A;  2ITD C;  4DRX A;  4DK1 A;  1TA8 A;  2YUA A;  4YY3 O;  1VQK V;  2YI9 A;  4H13 B;  4DV6 B;  1UPG A;  4GKK B;  1M9N A;  4GZR B;  5KLV H;  2GUZ B;  4J7J A;  2RMK B;  4DR3 B;  3QG5 A;  4IIJ B;  4O2B A;  1KB9 F;  3T1Y B;  2F93 B;  1S0V A;  2DYS B;  4BIU A;  5CA1 B;  2EX3 A;  2EIK B;  2BCC H;  4WF9 V;  4LFB O;  1N32 B;  3W7T A;  1RPR A;  1OCR B;  1OJH A;  3B2E E;  5C8Y A;  4XBF A;  4LR3 A;  4U3J A;  4IHJ B;  1AB3 A;  1XBL A;  1R6T A;  4DV1 O;  3ZMS A;  4J80 A;  2F95 B;  3CCS V;  3ZCC A;  4D6T H;  1D2D A;  1XMO B;  5L3G A;  4IYI A;  1ZTE A;  3ZMZ A;  4KFM A;  1X4T A;  3SJA C;  2QM8 A;  1K4D C;  2Q5Z A;  4GT1 A;  2UUA O;  2IJI A;  3E8H A;  1SQQ H;  4WFF A;  1ARO P;  5CN0 A;  4K8X A;  3H01 A;  4UB6 Z;  3ZED A;  4NTW A;  4PA7 A;  5GON A;  3LNN A;  2VQF B;  2E3C A;  2QKA A;  3SJB C;  3E8B A;  2AGA A;  1YJ9 V;  4GKJ B;  4X62 O;  3N27 A;  1OCC C;  1TAE A;  4PDV A;  2K1E A;  2AXT Z;  3AG3 C;  2ZE7 A;  1UFI A;  2Z5U A;  1WP7 A;  5JVD A;  5JWP A;  4UCU A;  5GTH Z;  2IU0 A;  4GKJ O;  1BL8 A;  2Q0A A;  3D8C A;  2JK5 C;  3BPZ A;  4O2A A;  4L87 A;  1SQF A;  5CB4 B;  5JCO C;  3OR6 C;  1VQ9 V;  2OTJ V;  2E74 B;  2EIN C;  1Q7Y W;  4CH3 A;  1WAZ A;  5IWA O;  1F51 A;  4H33 A;  4DYL A;  1SQX H;  2A7W A;  5L3D A;  1YJN V;  2LGQ A;  3JAW A;  3K0G A;  1ZWI C;  2CDY A;  2V1D A;  2VRZ A;  1AR1 B;  2IH1 C;  5H5N A;  3JSL A;  1YIJ V;  5HFM A;  3B77 A;  1VF7 A;  4K0K B;  1SZT A;  1GAX A;  3RYF B;  1M90 W;  3CCV V;  1ZLZ A;  4G28 B;  1NTK H;  5L3F A;  1B6Q A;  2WLI B;  4F6R A;  4JGS A;  1P7G A;  3K06 A;  3ZN1 A;  2OIE A;  2GV9 A;  2KKW A;  5EZY A;  1XMQ B;  5CBG A;  4JYA O;  3QNE A;  2LW7 A;  5LGU A;  3DXR A;  4FK5 C;  5LHG A;  4J11 A;  4X1K B;  4JI5 B;  3CS5 A;  2ZE6 A;  4KXR A;  4OGQ B;  1GO3 F;  4DUZ B;  5IYC O;  5KMG B;  2M7W A;  4IL6 Z;  1IXB A;  2CGO A;  2Q7G A;  3E86 A;  3H9V A;  1Q82 W;  4DW0 A;  4P9P A;  5IYD O;  4LBE C;  3CCR V;  1BE3 H;  3OW2 U;  3W7W A;  4LWS B;  2F66 C;  1XL4 A;  2HEP A;  4TWK A;  1NBM G;  1E79 G;  1GM9 A;  2P6J A;  3C3S A;  4DR1 B;  1F4M A;  3K5N A;  3K5M A;  2AHZ A;  5LMN B;  4QPJ A;  4IIJ A;  2QWO B;  1WPB A;  5J2U B;  2P90 A;  4LF8 O;  2HG5 C;  1BQZ A;  3P32 A;  2P22 C;  1RFY A;  1MZE A;  2QA4 V;  3EFF K;  3OEE G;  2R70 A;  1HP8 A;  5LMU O;  2HJD A;  5L3E A;  1FJG B;  1U97 A;  4I0X B;  4RUF A;  1DTO A;  1AI7 A;  3M99 B;  1WLE A;  5CBH A;  1TUE B;  1H8E G;  3I5D A;  4J9Z B;  5IYB O;  3OTO B;  2D3O W;  2JDI G;  3H1H H;  3K5L A;  3HB3 B;  4AQY B;  2EIM B;  4X64 B;  2ZDI C;  1HW7 A;  2UUC B;  2QJ1 A;  1NS1 A;  2CE4 A;  4LF5 O;  3JAT A;  1HNW O;  1ZUQ A;  3ABU A;  3OAA G;  4XDL A;  2H8P C;  1NU1 H;  3TGU H;  4JI7 O;  1GKF A;  1Q43 A;  2A0L A;  4PD4 F;  3OE7 G;  2OWO A;  2WAM A;  2OCH A;  2EIJ C;  5FPO A;  3UO3 A;  4ZI7 A;  2IBZ H;  1YSC A;  3DXR B;  1IBK B;  4YHH O;  1BQ0 A;  3ZHU A;  5L3C A;  1BGY H;  4FIP C;  1H2N A;  3WB1 A;  5H6R A;  1N0J A;  4JTA B;  3EXA A;  2QWQ B;  1V9P A;  5IJ9 B;  3U11 A;  3JAK B;  2LFR A;  1FFT B;  1N4C A;  3G4S V;  1PL4 A;  1YEW A;  3X2Q B;  1K9M W;  1J95 A;  3ZX6 A;  3AG4 B;  4JI5 O;  4FZ0 A;  4FLW A;  3L70 H;  2PUS A;  1NJI W;  2ZIO A;  4U3J B;  1R3I C;  1R1B A;  1JQ0 A;  3A2F A;  2WA4 A;  5IE9 A;  3H1J H;  5A2Q N;  2CAZ C;  4WFG A;  4AIL C;  2JJ1 G;  1JJO A;  2C2A A;  5IYZ A;  4R6Z A;  3JD3 A;  3FAV A;  5B3S B;  4G27 B;  4O2B B;  5H6Q A;  1LR1 A;  3UQ8 A;  1MMM A;  4O4H A;  3ZHV A;  2ADP A;  4RQE A;  1M1K W;  5LMN O;  3HR0 A;  5LP6 A;  2QSA A;  5FNV B;  2EIL C;  1R73 A;  4LNU A;  4QE7 A;  4I50 A;  4TOI A;  2L35 A;  1V54 B;  2HJF C;  3SYQ A;  5K1X A;  2CH7 A;  1QVF U;  1HDJ A;  1KP3 A;  2XAS A;  4GUN A;  2K9P A;  2ZT9 B;  3S3W A;  4LF6 O;  4NR1 A;  3SDL A;  3AK1 A;  4PV1 B;  4DW1 A;  2EJ7 A;  5IDJ A;  1TUB A;  1AI6 A;  4YIP A;  4F6E A;  2ZNI A;  1M4U A;  4EEQ A;  1FXK A;  4B3R B;  3OFN G;  4DV2 B;  4WFH A;  4AQY O;  4I55 B;  1E1R G;  5B66 Z;  3IAY A;  3VQY A;  2ZIM A;  1XOU A;  2P5O A;  3JAK A;  1PKX A;  2IW5 A;  4BIZ A;  3K58 A;  3RWR D;  4DR3 O;  2ATK C;  4X8A A;  1DGS A;  3T4D A;  1JFF B;  3D3I A;  3LSS A;  5KUK A;  3CCU V;  1VP7 A;  1NVP D;  4N21 A;  2W0X A;  3J81 N;  1KMI Z;  1QBZ A;  4GLX A;  2JJ2 G;  1XIL A;  1VQO V;  3CRC A;  4LFB B;  2UXC B;  2FTK A;  2ETN A;  2X0L A;  1K34 A;  2PTM A;  3H1I H;  4Z1M G;  2XAF A;  3GB7 C;  4YHH B;  4IYH A;  1XEQ A;  1ZL8 B;  2A79 B;  2HP8 A;  1G4Y B;  2Y4U A;  3ASO B;  1SET A;  3SPI A;  4GX5 A;  1YZB A;  5KAF Z;  2RNB A;  1GM7 A;  4O2A B;  3I55 V;  5CB4 A;  3B09 A;  1OZ0 A;  1XMO O;  2CTR A;  3G6E V;  1DF5 A;  4GX1 A;  1NT2 B;  1PM9 A;  4NKG B;  1Q81 W;  3PN1 A;  2PYJ A;  2N05 A;  5LGT A;  4J42 A;  4DV6 O;  3T1C A;  2WPD G;  1MA1 A;  3ZIA G;  4DV4 O;  3ZBH A;  1I08 A;  1VF6 A;  3N2K B;  5LHH A;  2FKX A;  2BSK B;  4LFC O;  1OV9 A;  3T1Y O;  1K5S A;  1R3K C;  2FYU H;  4UCT A;  3MHS C;  4GX2 A;  1OCO B;  2ZE5 A;  5KHJ A;  3ZRX A;  3U0Z A;  2ZR3 A;  3GWK C;  3K03 A;  3M8A A;  4X1Y B;  3CE2 A;  5JJE B;  4I4T A;  2LGW A;  1K5Q A;  4JAV A;  4Q6G A;  1TUB B;  1QLN A;  3NR7 A;  1S72 V;  2X6A A;  3CRQ A;  1NR7 A;  3BFR A;  1QVG U;  1J5E O;  4LFA O;  4MSW C;  3BA9 A;  3UT5 B;  2W6J G;  4NYK A;  2N04 A;  3VOU A;  2CTQ A;  2B1I A;  5CA3 A;  1VQL V;  2JGD B;  2QE7 G;  4JYY A;  1VQP V;  5EIB D;  4TUY B;  3L72 H;  5LA6 A;  4LF7 O;  2D2C B;  4O4H B;  1VMG A;  4NTY A;  3AG1 B;  4QIW F;  1XL6 A;  1WPX A;  2ZCE A;  4FLT A;  3CYO A;  4FM1 A;  1N33 B;  5FLX N;  2ZE8 A;  3RVZ A;  1WB8 A;  1Q3E A;  3EVK A;  1FFX B;  1GRJ A;  1S77 D;  4JI2 O;  2WWW A;  3CRA A;  4UVA A;  2EIN B;  3E22 A;  1IBL B;  1NR1 A;  1Z5W A;  4DUY O;  4FLU A;  4W4L A;  4UV9 A;  4JI1 B;  2BE3 A;  4MVQ A;  3H1K H;  2YDE A;  3T2M A;  1AVM A;  1XMQ O;  1LNQ A;  2ZM6 O;  3N2K A;  4AI8 A;  1BSM A;  5BZB A;  3QO7 A;  1SF9 A;  3OGI B;  4I50 B;  4HNA A;  5KHH A;  2R9A A;  4I0X A;  3K0D A;  3L73 H;  5E1A C;  2UUB B;  5C8Y B;  3F5T A;  2IJH A;  3PJS K;  2WLL A;  3CHX A;  3VQW A;  5KX5 B;  1W2B U;  4GYC B;  2PGG A;  2YIC A;  4WFB V;  5JQG B;  4X1K A;  1RM1 B;  2HVJ C;  1PPJ H;  3UT5 A;  1Y4M A;  1SQP H;  2BTO A;  3BHP A;  1CXZ B;  1OCZ B;  3L74 H;  3RVY A;  2WLJ A;  4PHZ A;  2X7R B;  4MS2 A;  4I4T B;  1UJW B;  1WJZ A;  1YTF D;  4DR2 B;  1SQG A;  4JZG A;  2ILM A;  4LFC B;  3IJ4 A;  5KA6 A;  4B08 A;  1R3J C;  1Q90 D;  2ZDI A;  2A06 H;  2OCC B;  4I5S A;  4BW9 A;  5LP6 C;  2RCV A;  4EFE A;  1H2K A;  1XI1 A;  3W7U A;  4DV3 O;  1QNM A;  2GUZ A;  3CCQ V;  2WA3 A;  3B8N A;  4UCS A;  4TV8 B;  2EIM C;  1YCI A;  3RYC B;  2P67 A;  2QM7 A;  4LFA B;  5EIB C;  3FB7 C;  1H2G A;  2VWJ A;  3CJH B;  3U10 A;  4YJ2 A;  3HKD A;  1SS3 A;  2RQ6 A;  3SR2 C;  1YVW A;  1W0J G;  2E75 B;  5BR8 B;  1N36 O;  2QKC A;  4CBC A;  2QR4 A;  1HR0 O;  2RDC A;  2YEV B;  1SA0 A;  3SYC A;  3KKY A;  3JAW B;  3K79 A;  3RYC A;  5KUM A;  5KMG A;  4BAY A;  5BR8 O;  3OUS A;  4JI3 B;  5KHK A;  1YTF B;  1G8M A;  4JI8 O;  1XDC A;  2XUM A;  1BS3 A;  3VQV A;  1P7B A;  2VQE B;  2YIB D;  4DV7 B;  4ZBM A;  2Y69 B;  4X1I A;  1VQ4 V;  3JCZ A;  1BHB A;  3TJT A;  1L0L H;  1ZAU A;  4MTF A;  4QPK A;  1S76 D;  5IY5 C;  4O4L A;  4TV9 A;  5TIS Z;  1JVM A;  1M56 C;  1JX9 A;  1QR8 A;  4YXW G;  4JI0 O;  1KKD A;  2G38 A;  3ZHS A;  4LF4 B;  3E22 B;  1GK9 A;  3S3X A;  4MVS A;  1HNZ O;  1KP2 A;  3KCY A;  1THZ A;  1NQT A;  4B3M B;  2UXN A;  2XAH A;  4JAU A;  5DM6 V;  3LUT B;  1HNZ B;  4N23 A;  2ITC C;  1SER A;  5EYP A;  3K08 A;  4FM0 A;  1FYJ A;  1H8H G;  4JZ2 A;  2L6L A;  2JEX A;  1A32 A;  1XNQ O;  1AR4 A;  4H0L B;  1VEW A;  5J2T A;  2V4D A;  4Z2W A;  2R9R B;  3OD4 A;  3K57 A;  2XTA A;  4UXN A;  1COW G;  3SJC C;  3ZMU A;  3CC2 V;  3RYI A;  1XQ8 A;  4JV5 O;  3ZMV A;  4DR7 O;  5KHI A;  5B1B B;  2ZR2 A;  4TQF A;  1TVK A;  1AJQ A;  4FFB A;  3GWO A;  1IZ3 A;  3K3W A;  3RGB A;  4TSF G;  1IXM A;  3CCE V;  2HFE C;  4FM2 A;  1PNK A;  2KG7 B;  3JAL B;  2HHH O;  4O4J B;  4P2Z A;  1XRE A;  2Q9L A;  4ASU G;  1CEZ A;  2H94 A;  2JS3 A;  3ZHQ A;  4JI6 B;  1H2L A;  2LP7 A;  5EC1 C;  4JAS A;  3JD4 A;  3H1L H;  3CD6 V;  1FXK B;  3ZMT A;  1H2S B;  1WB7 A;  1NZ6 A;  1N36 B;  2GHY A;  2MW2 B;  1IDS A;  1K7D A;  1Y76 B;  5IT9 N;  3TCU A;  1TVK B;  2BOB C;  3N2G B;  4DR4 O;  1N34 B;  1EM1 A;  3P3P A;  5F2V O;  3ASO C;  2GSM B;  3HKB B;  1HNX B;  4EB6 A;  4U7O A;  5D5Q A;  2KG7 A;  4UV8 A;  1L0N H;  4YJ2 B;  2ZNJ A;  4DV5 O;  1GTO A;  4DR1 O;  1MZF A;  1U96 A;  4X1Y A;  1AIL A;  3T1H B;  3B8M A;  4R50 A;  4IHJ A;  1Z5V A;  2FB5 A;  1K8A W;  2LJ2 A;  1SQB H;  1RP3 B;  1XHX A;  3K04 A;  1KD1 W;  4PJ0 Z;  1S5H C;  3P30 A;  3O9O A;  2QTO A;  2LW1 A;  3W7S A;  1K33 A;  3CPW U;  4J7K A;  3IGA C;  5LMU B;  1URF A;  1PD3 A;  3HKE A;  4JF3 A;  2UXB B;  2F23 A;  1NTM H;  3J7A U;  4KL1 A;  4DR6 O;  4RUE A;  1KEC A;  4DV4 B;  1WN7 A;  2Q68 A;  2P4K A;  3F7Y C;  1RSO A;  3SGI A;  1V55 B;  2ARH A;  1FD9 A;  2GTS A;  5EBW C;  4PA4 A;  5EZY B;  5J2U A;  3D36 A;  1FFX A;  3CXC U;  3OR7 C;  3A8T A;  5CBF A;  2XHB A;  1F7Y A;  4NXM O;  1MSW D;  3CMA V;  1T5E A;  3RYH B;  4FLX A;  1DK1 A;  1QHT A;  2UXX A;  1AI5 A;  1MSD A;  1VQ7 V;  3AG3 B;  1AJN A;  2NN4 A;  2YIA A;  3R66 A;  3SJQ C;  4PA9 A;  3ABK C;  4A5U B;  4FLZ A;  5EBL C;  3TXQ A;  1IBK O;  4CH5 A;  3OMN B;  4JTC B;  3I56 V;  1PNL A;  4YJ3 B;  3OT7 A;  4WCE V;  4HNA B;  5IJ0 B;  1VQ5 V;  2CH7 B;  1SKV A;  1BT8 A;  2YXL A;  2GBO A;  2WLL B;  5KX5 A;  3N2G A;  1JJ2 U;  4OPA A;  4UCR A;  3SPG A;  3KG2 A;  2QEX V;  2YI8 A;  2EZO A;  4TUY A;  5LA6 B;  4RQF A;  2DWE C;  4UCO A;  3OUF A;  3JAM N;  3F7V C;  1YDX A;  1I7F A;  4FFK A;  4DRX B;  1NH2 D;  4IT5 A;  4DV2 O;  2UXD O;  4NTX A;  2ZXW B;  3BAA A;  1OCC B;  2E76 B;  4UVB A;  3CCJ V;  4NVP A;  2NLJ C;  2Y4T A;  4UCV A;  4FJC C;  2XND G;  4HZ3 A;  2IU3 A;  3BVO A;  5JJJ B;  1VIB A;  1QU7 A;  1XNR B;  2EUL A;  2BTQ B;  5B1A C;  1GN4 A;  2KB1 A;  4WBN A;  3RYI B;  4I9Q A;  3ZRW B;  3E35 A;  1K92 A;  3RN4 A;  3JCU Z;  1IBM O;  4OX9 O;  1VQ6 V;  2MK3 A;  1YIT V;  2N74 A;  4X66 O;  1AJP A;  2HVK C;  5EBM C;  4JPR A;  4D7T A;  2NNU A;  3G67 A;  3K9A A;  3JD1 A;  2B9Z A;  3A0H Z;  1FPO A;  1D5A A;  3LNM B;  1SRY A;  1GN6 A;  4R8C A;  4MTX A;  3JAT B;  5A9G A;  1IUR A;  3RYH A;  3ZS8 C;  5H9C A;  2F4V O;  2OCC C;  1JA8 A;  4NB5 A;  1OCO C;  2XOK G;  2X6B A;  4PDL A;  5JQG A;  1LUW A;  3MD0 A;  1TGO A;  4B3R O;  1N8R W;  3CP1 A;  4X9Q A;  3ETE A;  3ZN0 A;  1NH2 B;  1EN5 A;  1QCE A;  2PF4 E;  5EK0 A;  2ZD9 A;  1AI4 A;  2FML A;  5CA1 A;  2VS0 A;  2ZKO A;  1Q6I A;  2JRI A;  4HYO A;  2DWD C;  4ZOL A;  4YY3 B;  3FKS G;  2LFS A;  3CCM V;  3J80 N;  5H2F Z;  2X6C A;  1NKD A;  4X64 O;  1JPX A;  5J2T B;  1Y6X A;  1KBH A;  3DC5 A;  2HKO A;  2P06 A;  4B7K A;  5LL6 Y;  1I94 B;  1VF5 B;  3F5W C;  4OPH A;  2CTW A;  3O65 A;  4JYC A;  5JCO A;  1EBO A;  4CS3 A;  4R7C A;  1Y74 A;  4CH4 A;  1M93 A;  2QGN A;  1ORQ C;  3WG7 B;  4TT3 G;  1I94 O;  2JGD A;  5E79 Z;  4B7E A;  2CUG A;  4JYB A;  1EN6 A;  4KP4 A;  2PI5 A;  4X88 A;  1GN3 A;  5B1O A;  1R6N A;  3G6B A;  4YJ3 A;  1O9H A;  1B04 A;  2VWK A;  3UCS C;  4UB8 Z;  2YID A;  4J41 A;  4WBN B;  2UXD B;  3ABM B;  1VF6 C;  1PNM A;  4DV7 O;  5LXT A;  3CSX A;  3A0B Z;  1GN2 A;  4LP8 A;  5LGN A;  5CMU A;  3D3Q A;  3C90 A;  3ETG A;  4UFZ A;  1SES A;  4G2K A;  2WLI A;  3EHB B;  3APQ A;  2CGN A;  5LOV B;  4EKW A;  3WG7 C;  1WA8 A;  3RBZ A;  2XAQ A;  3FB5 C;  5FL7 G;  1Q6H A;  3ZHT A;  3E8F A;  4NXN B;  4FFB B;  1OCR C;  4B3S B;  3BRC A;  2OTL V;  3X2Q C;  2UU9 B;  1IBM B;  3AG2 C;  2QWR B;  3LDD A;  4MVM A;  4PA3 A;  4X66 B;  4FLY A;  3FD9 A;  4LWS A;  4ZHQ A;  2Q7E A;  3VQX A;  4X62 B;  2JGU A;  5DN6 G;  4B3S O;  1Z2G A;  1B3Q A;  5J9P C;  1BCC H;  1N32 O;  3UO2 A;  2BSK A;  1HR0 B;  2PY5 A;  4LF5 B;  2E5L B;  2QDO A;  1KC8 W;  1M56 B;  2DMX A;  3D36 C;  1Y76 A;  1MOF A;  4ZOL B;  1ZL8 A;  3RFR A;  5BXZ A;  5LP6 B;  1US6 A;  5IWA B;  5EYP B;  2OYQ A;  3C3T A;  2A3Q A;  5JH7 B;  1S3J A;  4JI2 B;  4QE9 A;  1SA0 B;  3DSQ A;  2F43 G;  3AG2 B;  1VQM V;  2Q6A A;  4QJF B;  3BA8 A;  3ICX A;  2HR3 A;  4QGP A;  1Q6U A;  4U3F H;  1FAF A;  2DOS A;  1IBL O;  2DW4 A;  4XDK A;  3WB2 A;  1BHA A;  4E2L A;  3BEH A;  4FPP A;  4KHP O;  3RYF A;  3W7X A;  5DEC A;  3JD2 A;  5ITZ A;  5LBQ A;  4B3M O;  1V55 C;  3FB8 C;  1O9G A;  2UUB O;  1KUQ A;  4X65 B;  4GKK O;  4GX0 A;  3JAL A;  5B1B C;  2PZS A;  5CA0 A;  2KQX A;  1CPY A;  1JCH A;  5BMV A;  2XAJ A;  1DF4 A;  3SPC A;  4JAA A;  3DC6 A;  1W0K G;  2Z3Y A;  4MVZ A;  3FFQ A;  1XHZ A;  4X65 O;  2YIB A;  4DUZ O;  2Q67 A;  1I5Y A;  4PA6 A;  2CTP A;  1NTZ H;  2IJJ A;  2NR5 A;  1V54 C;  3MDS A;  3AG4 C;  4DR2 O;  4J10 A;  4RO2 A;  3CB2 A;  3ML0 A;  3ZRS A;  2JS5 A;  2O57 A;  4CZZ A;  3HKB A;  4MW3 A;  3CC4 V;  5AG2 A;  4MT8 A;  1L1F A;  1YXB A;  3FYI B;  3ABL B;  4MVU A;  4Z1V A;  2AW9 A;  2GTA A;  2DYS C;  2WSS G;  1YJW V;  2HHH B;  1EZJ A;  2DYR B;  3SPJ A;  2BTQ A;  2ZXW C;  4CS4 A;  4NXN O;  3WB0 A;  5K1P A;  1G1X B;  2UU9 O;  1G6U A;  2UUA B;  2ADQ B;  2YXH A;  4LF8 B;  4TV8 A;  3IC7 A;  4P30 A;  5D5P A;  3ASN C;  1B06 A;  1EN4 A;  2JIZ G;  3IC9 A;  2P7T C;  2FL4 A;  4LF4 O;  1ZX3 A;  4HBN A;  3CME V;  4DR4 B;  2ZQM A;  3AG1 C;  1GH6 A;  1SZX A;  3BAB A;  3MAQ A;  5FNV A;  4ICG A;  3RT3 C;  1SQV H;  1RSO B;  1HNX O;  3OTO O;  3LSQ A;  4NXM B;  1KKC A;  1M57 C;  1JMK C;  3AK2 A;  5IYZ B;  1S5L Z;  3CX5 F;  4E4E A;  4FMT A;  4LH7 A;  1OHH G;  3FAV B;  3ZRV A;  4RWU A;  4MW8 A;  5CA0 B;  2PYL A;  4GCZ A;  3T4Z A;  3STZ C;  3A0R A;  2W6I G;  1AP6 A;  4MTG A;  2B1G A;  4WFE A;  4K8Z A;  2GDS A;  2JVD A;  1BMF G;  3WFV A;  4JI3 O;  4JI7 B;  3TXS A;  3UKM A;  4H44 B;  2WLK A;  4BR6 A;  4ZKI A;  1N33 O;  3QO5 A;  1IVS A;  3LSU A;  3OEH G;  3ABT A;  4F4L A;  3P3N A;  4DR7 B;  1NI8 A;  1YI2 V;  1FXK C;  2QWP B;  4RAI A;  3CRM A;  2R72 A;  1I5X A;  2YSU B;  2CK3 G;  2QKS A;  5EC2 C;  1M5I A;  4JI0 B;  4CC6 A;  4WFA V;  2QM4 A;  3G71 V;  3E8G A;  2BOC C;  2AHY A;  4JI1 O;  3ABL C;  5GW7 A;  1Y66 A;  4LC1 A;  1BZK A;  1RM1 C;  3BY6 A;  3THO A;  1XUQ A;  4C7U A;  1ROP A;  4X1I B;  4LH6 A;  4PEL A;  5KA5 A;  1FKA O;  3NXS A;  2B5U A;  1I0H A;  1WP8 A;  3FB6 C;  1YF2 A;  2KSD A;  4AHC A;  4JYA B;  4JI4 B;  2EIL B;  4CC5 A;  2P4V A;  1K73 W;  5LXT B;  4U7N A;  3HKC B;  1KYO F;  4D7S A;  4UVC A;  4FZ1 A;  4JI4 O;  2Q69 A;  4OX9 B;  1VQ8 V;  1SC5 B;  1IX9 A;  4ZIB A;  4DV0 B;  2JEU A;  3R65 A;  4MVO A;  4XDJ A;  2H3O A;  3DTU B;  3FX7 A;  3QTC A;  3OM3 B;  4LCU C;  3HKD B;  4JV5 B;  3K9S A;  3IFX A;  2QWN B;  4LF7 B;  4I55 A;  1MAB G;  5GON B;  5LHI A;  4CH6 A;  2RN9 A;  2XT9 A;  1OCZ C;  1AP5 A;  1VQN V;  4BWA A;  2IH3 C;  1P4R A;  1FS0 G;  3UM7 A;  3CWB H;  2XAG A;  3OGC C;  2F1M A;  4K0K O;  4K35 A;  2YXY A;  2LQT A;  5GTI Z;  4ZHQ B;  1JR9 A;  2W0F C;  1JFF A;  3OMA B;  4JI6 O;  4L8J A;  4DV3 B;  5BMV B;  1WNS A;  2EZP A;  3CEI A;  4IGG A;  3SYP A;  4DR6 B;  3JAS A;  3OTF A;  3SPH A;  3QF7 A;  3ASN B;  3LDC A;  5IJ9 A;  3JYC A;  4DR5 O;  1F23 A;  4MVR A;  2DYR C;  3FYE B;  1P84 F;  3CCL V;  4DUY B;  1N34 O;  3AG7 A;  5B3S C;  1AR5 A;  2ZM6 B;  2DJV A;  5JH7 A;  4PI0 A;  4YIO A;  3JAR B;  1EZV H;  5L3B A;  4O4L B;  3L71 H;  3T1H O;  1MNG A;  5B1N A;  1ZSP A;  2OIG A;  4O4I A;  3KCX A;  4ZI7 B;  3M7M X;  2AZ2 A;  5IJ0 A;  1P49 A;  4J9Y B;  1FXH A;  4P9O A;  3ZRW A;  4ABM A;  3LDE A;  3G80 A;  1FXV A;  2RJZ A;  3APO A;  2YS8 A;  3AEI A;  2DQ3 A;  1Y74 B;  2DE0 X;  4JI8 B;  4MTO A;  5ITZ B;  4H37 A;  1N0N A;  5JVD B;  2VQE O;  2A9H A;  2Q73 A;  4KUM A;  2OT5 A;  3ABK B;  3CXH F;  1L8D A;  4X89 A;  3GVM A;  4X20 A;  3BCC H;  2IM9 A;  2V7Q G;  5LYJ B;  4LF9 B;  4LF6 B;  1H2M A;  3E83 A;  3WU2 Z;  1QLE B;  2EBO A;  4PDM A;  3L9D A;  4O4I B;  1VAR A;  1DLB A;  3SYO A;  3JSN A;  1FJG O;  4LF9 O;  4JTD B;  4O4J A;  4PI2 A;  5HFL A;  4FLV A;  4I7Z B;  5B5E Z;  2HLD G;  3ZJZ A;  1HWY A;  2Q7H A;  3CC7 V;  3Q4H A;  3ABM C;  3STL C;  1W59 A;  3HKE B;  2UUC O;  3JD0 A;  4W4K A;  1XNR O;  3B40 A;  4B3T B;  2QTS A;  1WA8 B;  4DV0 O;  3ETD A;  1HNW B;  3DGE A;  3K59 A;  2AZ0 A;  4LNU B;  3E2E A;  1QLE C;  1R6K A;  3JAR A;  1XNQ B;  3JAS B;  1J5E B;  4DK0 A;  4B3T O;  2YEV A;  2E5L O;  5B1A B;  5JJN B;  3HKC A;  4BIO A;  3K5O A;  1NVP B;  5FPR A;  4BW5 A;  1R3L C;  2Q0O C;  1KU9 A;  2Y0P A;  2M6Y A;  3AK3 A;  4Q20 A;  3Q4H B;  2YC0 A;  1K97 A;  2WLM A;  1YHQ V;  1JOY A;  4DV1 B;  2Z0A A;  4DR5 B;  1E1Q G;  4UUJ C;  4DXW A;  5DED A;  5C93 A;  1QR9 A;  4FVM A;  3TK1 A;  3B4S A;  1K3E A;  4TV9 B;  4PDR A;  1ENV A;  3HPL C;  1X59 A;  4HAM A;  4KHP B;  1CP9 A;  1RPO A;  1GMG A;  4TQD A;  1PV0 A;  2ODM A;  2PI4 A;  2ZIN A;  1QQC A;  2WLH A;  1Y67 A;  1MG1 A;  1LUV A;  4CS2 A;  5KAI Z;  4X20 B;  2Q8V A;  5LOV A;  3QO8 A;  5LYJ A;  3OMI B; 
#chains in the Genus database with same CATH homology
 2VQF O;  4DV1 O;  1N36 O;  1IBM O;  5LMN O;  4LF9 O;  4OX9 O;  2N74 A;  4X66 O;  1D2D A;  1HR0 O;  4DV6 O;  4B3M O;  1NS1 A;  4DV7 O;  4DV4 O;  4LF5 O;  2FKX A;  1F7Y A;  4NXM O;  1HNW O;  2UUB O;  4K0K O;  1KUQ A;  5BR8 O;  4LFC O;  2HHH O;  1DK1 A;  4GKK O;  4JYA O;  3T1Y O;  3F5T A;  2UUA O;  4JI3 O;  4JI6 O;  2LW7 A;  3R66 A;  4JI8 O;  2UXC O;  4JI7 O;  2UUC O;  4LF6 O;  3SDL A;  1XNR O;  2F4V O;  4A5U B;  1N33 O;  4DV0 O;  3M8A A;  4X65 O;  4DR5 O;  1IBK O;  4DUZ O;  4B3R O;  1N34 O;  5IT9 N;  4YHH O;  4AQY O;  2AGA A;  4DR4 O;  4B3T O;  2UXB O;  2E5L O;  4X62 O;  1J5E O;  4LFA O;  4DR2 O;  2ZKO A;  2DJV A;  4B3S O;  4JI0 O;  2JRI A;  4JI1 O;  5BY1 A;  1N32 O;  4OPA A;  4DV5 O;  4DR3 O;  1HNZ O;  4DR1 O;  3T1H O;  4GKJ O;  4YY3 O;  3J80 N;  1AIL A;  4LF7 O;  4X64 O;  3J81 N;  3JAM N;  1FKA O;  2Z0A A;  4JI5 O;  4NXN O;  5LL6 Y;  5BXZ A;  4DV3 O;  1G1X B;  2UU9 O;  4LF8 O;  4DV2 O;  2UXD O;  1R1B A;  4OPH A;  5IWA O;  3O65 A;  1FYJ A;  5FLX N;  1XEQ A;  2VQE O;  1X59 A;  5LMU O;  5A2Q N;  4JI2 O;  1I94 O;  4LFB O;  1A32 A;  1XNQ O;  4LF4 O;  4JI4 O;  1YZB A;  3J7A U;  4DUY O;  1XMO O;  4DR6 O;  2DOS A;  5H5N A;  1IBL O;  3RT3 C;  1HNX O;  1AB3 A;  3OTO O;  4KHP O;  4JV5 O;  4DR7 O;  1XMQ O;  1FJG O;  2ZM6 O;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...