2UXCO

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2uxcO00
1IBKO 3J81N 2UUAO 1A32A 1J5EO 4LF7O 1IBLO 4X66O 1DK1A 4JI4O 4DR6O 3OTOO 1AB3A 4X65O 5LMUO 5BY1A 4X62O 4DV2O 2LW7A 4DR4O 4YY3O 1XMQO 1D2DA 2UUBO 2UUCO 2DJVA 5LL6Y 2VQFO 4JI6O 4JI3O 4YHHO 4DV5O 4DV6O 4DV7O 4JI1O 4DV3O 4JI2O 2DOSA 2FKXA 4A5UB 2JRIA 3O65A 4DR5O 1R6TA 3T1YO 2ZKOA 4OX9O 3T1HO 1HNXO 1F7YA 2AGAA 4JV5O 4B3TO 1HNZO 1XEQA 2UXCO 4B3MO 4NXNO 4JYAO 5BR8O 4OPAA 3R66A 4LF5O 1N34O 1HNWO 1FJGO 1AILA 4LFAO 4GKKO 1N33O 4JI8O 4LF8O 4DV1O 3F5TA 5IWAO 4GKJO 4LF4O 4OPHA 3JAMN 1YZBA 1NS1A 1N32O 1FYJA 4DV4O 3RT3C 5H5NA 4DUYO 4DUZO 1IBMO 5LMNO 1N36O 2Z0AA 4X64O 3SDLA 1I94O 4LF6O 4LF9O 1G1XB 4B3SO 2UXBO 3J7AU 4NXMO 2ZM6O 2HHHO 5A2QN 1KUQA 5IT9N 1X59A 4JI7O 1XNQO 1HR0O 2UU9O 4K0KO 2N74A 1FKAO 2UXDO 1R1BA 5FLXN 1XNRO 4KHPO 4DR1O 3M8AA 2VQEO 4DR3O 2E5LO 4LFBO 4LFCO 4B3RO 4DV0O 5BXZA 2F4VO 4JI5O 4AQYO 1XMOO 4DR2O 3J80N 4JI0O 4DR7O
chains in the Genus database with same CATH superfamily
1B06A 2QWOB 2EIKC 3ZIAG 3BHPA 4ZHQA 3KZIZ 2EINB 1BCCH 3K5MA 4RUEA 4DV2O 2LW7A 1D2DA 1M57C 3ZEDA 2IH3C 1HDJA 4DRXA 4WFAV 3AK3A 4B7KA 1AVMA 2GTSA 3OM3B 4I5SA 4UCTA 1JQ0A 3W7TA 2IJKA 3ML0A 2ZKOA 1VQKV 4N23A 1MSDA 4HZ3A 4DR5B 2ZE5A 4NXNO 4CS3A 3AG1C 3W7UA 5DECA 1I0HA 1L8DA 2VWJA 3CRMA 1NKDA 3M7MX 4IIJB 1K8AW 1D5AA 3QF7A 1M93A 4H0LB 4LFBB 3IFXA 3S3XA 4ICGA 3MAQA 5IJ9B 1NS1A 1OCCB 2OCCC 1M4UA 2QE7G 4ZIBA 5LMNO 4TUYB 1YEWA 1VQOV 1G6UA 2XAQA 5BMVB 3UCSC 2AW9A 2MK3A 3K04A 1NT2B 3VQYA 2ZIOA 4I50A 3SR2C 3RYCA 2CTWA 2L6LA 3ETDA 5EBLC 4KXRA 3SYAA 2L35A 3EXAA 3HKBB 3P3NA 3F7VC 2B5UA 1K33A 5JWPA 3JARB 3KG2A 4W4LA 1M1KW 1SQGA 3FX7A 4X66B 4J7KA 1XI1A 4IT5A 5L3BA 4X9QA 1PV0A 1PNLA 1QLEC 2B1IA 3OEEG 5K1PA 1R6KA 1MOFA 4FVMA 4JI4O 3BPZA 4O4HA 1EZVH 4JYYA 1QR9A 1K9MW 4KHPB 1XMQO 2IU3A 4PI0A 4JI6O 4X20B 4IIJA 4O2BB 4OX9B 3MD0A 3GVMA 5EZYB 2YIBD 2QEXV 1W59A 3ZRWB 1SA0A 4OX9O 3K79A 4JYAB 1PNKA 2HVJC 2X6BA 5ITZA 1XEQA 1H8HG 2F43G 4XDKA 2ZIMA 5BR8O 1P4RA 4DO2A 3ASOC 1AI5A 4DV2B 2KG7A 2OIGA 4O4LA 4NTXA 4AILC 1TAEA 4LF4B 5LYJA 3NR7A 5L3FA 2IW5A 2BTQB 1NI8A 2OCHA 2G38A 2F95B 4LC1A 4KL1A 3ZMUA 4UUJC 3ZHTA 4X89A 1WB8A 1GTOA 1N32O 3IC7A 1OCZC 1KB9F 2BOCC 1L0LH 5H2FZ 4GT1A 1N36O 4UVBA 1DTOA 1TUBA 2QKSA 4YIPA 1H8EG 1SKVA 2UU9B 2QWQB 1SF9A 4TQFA 1B3QA 5IY5C 2P22C 1GN4A 1WPXA 1TVKA 3A8TA 3N2KA 4U3JA 2VQEO 4PDVA 4LFBO 2PTMA 5JQGB 1WN7A 4TV9A 2QKAA 3JASA 1RPOA 3H1HH 4RQFA 3W7XA 1BGYH 2HG5C 1VF6C 2BOBC 4R50A 1F4NA 4UFZA 2ZM6B 1Q6IA 4GX0A 3T1HB 5CBFA 3L72H 4G28B 5CA3A 2XAGA 1Y76B 3N2GA 2GDSA 5L3DA 3EVKA 1AR5A 4PELA 2E76B 4LWSA 3H1IH 3LDCA 5IY5B 4YY3O 1HNWB 4TSFG 3A0HZ 4FZ1A 3JD0A 3ZHVA 4QPKA 2VQFO 3SGIA 5CBHA 5KMGB 5EK0A 1LNQA 4GYCB 1H38A 4FLXA 3C3SA 1QQCA 4PA7A 5H6QA 3UO3A 4TUYA 3ZMSA 1WLEA 4F4LA 1VQNV 3AEIA 2PF4E 4O4JB 1KKCA 3ASOB 1Q7YW 4L8JA 4J9ZB 3BVOA 3CHXA 4TV8B 5JCOC 1RM1C 1BE3H 2CUGA 1N34B 5EYPB 1FPOA 3SPCA 2OWOA 2YI8A 3RYIB 1O9HA 2PYLA 4JASA 1R6NA 2Z3YA 2DN9A 3L74H 2UXBB 3RT3C 1GKFA 2EILB 1XDCA 4HAMA 2BE3A 3ABMC 1M57B 3E35A 4LH7A 2KQXA 1OJHA 4LR3A 4JTDB 4GX5A 2QM8A 3H9VA 4GUNA 3HKDA 4AI8A 2Q5ZA 2KG7B 1FFXA 4O4LB 4DRXB 5KAIZ 3JSLA 1HR0O 4DW0A 3DXRA 2IJHA 4D6TH 2BTQA 1EN4A 2EBOA 3TGUH 4DXWA 2QJ1A 3CWBH 4O2AB 1SQVH 3SPHA 2E5LO 3FFQA 1FXKA 2JVDA 2JK5C 3ZRSA 4J42A 2RCVA 1XBLA 3QG5A 1S5LZ 2DWDC 3HKEB 3ZRWA 4I50B 3PN1A 1G4YB 5B1OA 2VS0A 4LH6A 2ILMA 1GK9A 3H1JH 2HFEC 1V9PA 4JI3O 1Z5WA 1YITV 5LBQA 1YI2V 4X1KB 1GM7A 4JI2O 2IH1C 1T5EA 2XT9A 1GM8A 1VF7A 4J80A 1R73A 2FKXA 2OCCB 3FKSG 1SQBH 1HNZB 1XREA 5JVDA 1KP2A 1R6TA 5C8YA 3UT5A 2YXLA 2Y4UA 3T1HO 4MTOA 4Z1VA 4JI2B 4JF3A 3T4DA 1MSWD 1RP3B 5KUKA 3VBBA 3STLC 2X0LA 3BCCH 3FYIB 3JD1A 3VQXA 1IXBA 1L1FA 4JV5B 3AG1B 2A3QA 5KHGA 1V54B 1AILA 5KLVH 4LFAO 4EFEA 2CGNA 4J11A 1Q86W 3A0BZ 1YSCA 1XNRB 2ODMA 2ITDC 2ZR3A 4O2BA 3E8GA 2NN4A 3JAMN 1YF2A 3N27A 3TK1A 2WLNA 4E2LA 5L3GA 1QR8A 4JI0B 2QSAA 1KMIZ 2Q0AA 3SPJA 1EBOA 4NXNB 2A0LA 2YDEA 3OAAG 1VEWA 1OCRB 4JPRA 1H2GA 3OTOB 4X1YA 2EJ7A 1HP8A 1P84F 4IYHA 2JS3A 1YTFB 2QR4A 3AG4B 4I9QA 3SJAC 4DR7B 1CEZA 3JAKB 4I55B 5H9CA 4QIWF 3ABMB 3HKBA 3FAVA 3JCUZ 4X88A 1AJPA 4MVQA 1H2LA 2Y0PA 3OUSA 2ZNJA 3G6BA 4B3MB 2EIMC 3KCXA 2LGQA 2CH7A 5JJNB 2R70A 2Q67A 5GONB 2WA4A 3SPGA 2JIZG 4NYKA 1RFYA 2QKCA 5BZBA 2CTPA 2RJZA 4MVOA 4KP4A 2IJIA 1DGSA 2ADPA 4UB6Z 2CTQA 2OIEA 3ZBHA 4ZHQB 2P5OA 2Q9LA 2W6JG 3CX5F 1VF6A 2HR3A 3CYOA 1NU1H 1F7YA 1R3IC 1NJIW 1Q5OA 5C93A 4P9PA 4TOIA 1MG1A 4O4IA 2F1MA 4FM2A 1NTZH 2A79B 3R66A 1GMGA 2YC0A 1CPYA 2JGUA 2Q7EA 4FPPA 2D2CB 4WFEA 1SQXH 2WLMA 1H2SB 3HR0A 5B1AC 4U3FH 4LF9B 3K3WA 3MHSC 4H13B 1EN5A 2ATKC 5IT9N 2YEVB 2WWWA 5KX5B 4LFAB 1Q81W 4NB5A 3B77A 3BRCA 1UFIA 1URFA 2UXDO 4GKJB 2GV9A 2UUCB 1VQ6V 1N32B 1L0NH 4DV6B 1MZEA 3HKCA 2XAFA 3CCVV 2EIJC 1NBMG 1MMMA 1K3EA 2RMKB 2QM4A 5KMGA 2YIAA 4YJ3A 4YJ2B 3OTOO 4LP8A 3L9DA 2R9RB 4H37A 4YHHB 2QGNA 5A9GA 3BA8A 2BSKB 4LF8B 5LP6A 4WFBV 3CEIA 2P90A 1V54C 4UCRA 1YCIA 4X1IB 3K08A 2X6AA 1VQLV 2JRIA 4JI3B 3T1YO 4MVSA 1R3LC 3RFRA 3JD2A 4MTFA 4JYBA 4MVUA 3K9AA 2X6CA 1OZ0A 4TQDA 1SQQH 3OT7A 1XOUA 4OPAA 3VQVA 1TUEB 4AHCA 3LNMB 1VQ7V 1ENVA 4KFMA 2Q0OC 1IVSA 2Q7GA 1I5XA 5HFLA 1NQTA 4RO2A 1N0JA 5D5QA 2ZQMA 1Q6HA 1QVFU 1Y74A 4I7ZB 1KECA 1K92A 3LUTB 1ROPA 3B2EE 1LR1A 2MW2B 4HNAB 4KHPO 3ABLB 3M8AA 1XMOB 3LDEA 4WFGA 4JI6B 1SZTA 3WG7C 1J5EB 1M9NA 3E86A 2F23A 4GCZA 4UVCA 5FNVA 4DR7O 2PZSA 1P7GA 3J81N 3BY6A 1N8RW 3CRAA 2R72A 1NTMH 3L70H 4PA4A 3U10A 3K5LA 1TUBB 3DSQA 2NLJC 3HB3B 4YXWG 5FPRA 3ZN0A 1TA8A 4PD4F 4PDLA 1YIJV 1EN6A 1IXMA 4ZI7A 3K9SA 4YIOA 2K9PA 2UXCB 1G8MA 3F5WC 3TCUA 2YUAA 5AG2A 2EZPA 1FD9A 4K35A 4PJ0Z 3LNNA 2JEXA 4FJCC 1N33O 4LF8O 4DV1O 1AI7A 4WCEV 4DV4B 1NH2B 3A0RA 4DUZB 2QTSA 4X20A 2WPDG 5J9PC 1B6QA 3OR7C 3WB1A 2UXNA 3AG7A 1FYJA 1IURA 3TXQA 1KKDA 4DUZO 5TISZ 3CCMV 3T4ZA 4MSWC 2Y69C 1PNMA 1G1XB 4GLXA 5B1AB 4ZI7B 2ZM6O 3FB8C 4X1YB 2ZXWB 1FAFA 1KUQA 1JVMA 5KA5A 4PV1B 5KHIA 2HHHB 1V55B 1FKAO 3B40A 3P32A 3RVYA 1XNRO 4UCOA 4DR1O 3CRCA 2C2AA 5BXZA 4DV0O 2WLLB 3CXCU 1VQ8V 4RWUA 3WG7B 5H6RA 4P9OA 4DR1B 4D7TA 2WSSG 4PDRA 5CMUA 1FFXB 1WA8A 4WBNA 1SC5B 2AXTZ 1IBKO 3K5OA 2B1GA 5IYZA 1PKXA 4LF7O 3CJHA 4X62B 1NVPB 1W2BU 1PL4A 4UB8Z 2HKOA 4BW9A 4X65O 1NR7A 2H94A 1PM9A 4DV5B 4Z2WA 1NTKH 1JOYA 2M6YA 3K58A 3OW2U 3CCRV 3BFRA 1SETA 1OCOB 5EIBC 1QVGU 2YIDA 2GUZB 2YXYA 4YHHO 4WFFA 1GN3A 2F93B 3ABKC 4TV8A 1AJQA 2XASA 2Y0IA 3AG3C 4WFHA 1RSOA 3CC2V 3AG3B 5LGNA 2P4KA 3RBZA 2DYSB 3S3WA 2CK3G 2E74B 1RPRA 4ZBMA 3CC7V 2JDIG 3JATA 5GW7A 1M56C 4XBFA 4X1IA 5B1NA 2CDYA 5JH7A 4DV3B 2ZE6A 5IYDO 4I0XB 1NZ6A 3ICXA 3E22A 3B09A 1YZBA 4N21A 4MVRA 1YJWV 1ZL8A 1THZA 5EC2C 4CH5A 5LXTA 1O9GA 1IBMB 3ASNB 1QLNA 1GM9A 3UKMA 2DQ3A 3ZJZA 1S77D 2ZDIC 4JI8B 1WP8A 3IGAC 1XQ8A 3FD9A 4HBNA 3OFNG 4UCSA 1S72V 3ZRXA 2ARHA 5CA0A 5BMVA 1IX9A 3ZCCA 1BHBA 1ZX3A 2VRZA 2IU0A 2E3CA 5K1XA 3R65A 1XMOO 4BIOA 1NH2D 3NXSA 1ZSPA 5EYPA 3GB7C 5D5PA 2F4VB 1BHAA 2UUAO 4FLUA 3VOUA 1LUVA 3QO7A 2ZNIA 3RWRD 4OXSA 4DR6O 3HKEA 3FB5C 3Q4HB 4LNUB 4O4JA 2VQFB 5BR8B 2H3OA 2AHYA 4NKGB 1EFRG 2UUCO 1VP7A 3TJTA 3K0DA 1US6A 1EZJA 2JS5A 5B66Z 3DC5A 4F6EA 3RN4A 2P06A 3C90A 5IDJA 4JTAB 3CRQA 5FL7G 5L3EA 1CXZB 2BSKA 3UQ8A 3N2KB 2UXCO 4QGPA 3OR6C 3ZRVA 1K73W 1OHHG 1VQPV 1N34O 1KYOF 3UO2A 1JJ2U 4K0KB 5JJEB 3I5DA 2Z5UA 4I4TA 5DM6V 4DV1B 4FLYA 4DV4O 2Z0AA 3I55V 3G71V 1Y67A 1QHTA 5CA0B 5KHKA 1WPBA 1I08A 4NXMO 3WFVA 5A2QN 3N2GB 1Z5VA 1HW7A 3CPWU 4K3AA 4B3SB 4PA3A 2PUSA 1K4CC 2LFRA 3OEHG 4B7EA 4W4KA 5CB4B 4DR2B 4MTGA 5IJ0A 1OCRC 4LNUA 4IL6Z 3RVZA 2O57A 4TT3G 4DR2O 1OV9A 1I94B 5ITZB 1TGOA 5CN0A 1K4DC 5J2TA 1TVKB 4J10A 1JPXA 4I9WA 4X66O 4NR1A 1U96A 3CSXA 4E4EA 1IBKB 4U7OA 5JQGA 5LA6B 1BT8A 1IDSA 3OE7G 4X62O 2HJDA 4LF5B 5LHHA 3VQWA 3SJBC 3JYCA 4OGQB 4DV5O 3LDDA 2GSMB 1X4TA 3E8BA 3AK1A 3STZC 4FLWA 2DQ0A 1GAXA 1M5IA 2PI4A 2P4VA 1XHZA 1HNXO 2A7WA 4B3TO 5EBWC 4DR6B 1GO3F 1HNXB 3CB2A 4QNHB 2KKWA 1Q43A 2WA3A 1YHQV 2XOKG 1YTFD 4XDLA 3CCJV 4J9YB 1QCEA 2BCCH 4K8ZA 3F5TA 1SQPH 2ZT9B 1N36B 3ASNC 3AG2B 4RQEA 5LOVB 4BIUA 3ETGA 3SDLA 3UT5B 1VQ9V 1LUWA 2FL4A 2P67A 2GTAA 3JAWA 3W7SA 3CS5A 4JI7B 5EZYA 4FM0A 4MS2A 1GN6A 1XL6A 1X59A 4R7CA 4JI7O 3IC9A 4MVZA 1AJNA 4DR3O 2QM7A 4BAYA 1BL8A 2LJ2A 1ZUQA 1MZFA 3LSQA 1E1QG 2HLDG 1NR1A 3ABKB 5IYCO 4FFBB 2DYRB 5E1AC 1QU7A 2ZDIA 3JAWB 2V4DA 5B3SB 1AR1B 2WLLA 2F66C 2CGOA 4O4IB 3TXSA 4ABMA 3K06A 4JGSA 1AI4A 4DV7O 3DTUB 5C8YB 1RSOB 4JZGA 2DOSA 3LSUA 1AROP 2JEUA 1KD1W 5KA6A 3E8FA 4DV7B 3O65A 3K03A 2N05A 3B8NA 4JAVA 1ZTEA 2HEPA 2IJJA 2RN9A 1K5QA 2CH7B 3IAYA 2R9AA 3WB0A 4LF5O 1DF5A 1H2NA 1I5YA 4O4HB 4KUMA 2WLKA 3ZMZA 3A2FA 3CCQV 4ASUG 3GWOA 5GTHZ 4CS4A 1JR9A 3E2EA 3H01A 4D7SA 2Y69B 4PA9A 4K8XA 2B9ZA 5LHGA 4EKWA 3D8CA 1K34A 1PP9H 1FXKB 2NNUA 1BZKA 5LMNB 2ZXWC 1AR4A 2D3OW 4GZRB 4CH6A 3FB7C 2QTOA 5GTIZ 3G6EV 1WA8B 1E1RG 5DN6G 2XUMA 2LFSA 1S5HC 3G67A 3ZHSA 2Q7HA 4UVAA 1JX9A 4EFBA 4AQYO 4QPJA 2OTJV 1YVWA 4XDJA 4EB6B 2WLHA 2LP7A 4MT8A 4FLTA 3RYIA 3ZHRA 5CA1B 2RNBA 3OMIB 5LMUB 1R3KC 2FYUH 2JGDB 1R3JC 4FZ0A 2WLIA 2K1EA 5LMUO 3PJSK 3JALA 4JI4B 2OT5A 3E83A 3U11A 5IJ0B 2UUBO 3CMEV 2PGGA 1K5SA 5LL6Y 5IE9A 3RYHB 3SYCA 1Y6XA 1UPGA 1XILA 2Q4PA 3JD4A 4BR6A 3BABA 3X2QB 4U7NA 5LHIA 1MA1A 2LGWA 4JV5O 4FK5C 1VQ5V 1RM1B 3B8MA 1Y74B 3E22B 3ABLC 2PI5A 3RYFB 4CH4A 4H44B 4JYAO 4B3TB 4UV9A 4YY3B 1HNWO 4GKKO 3CP1A 2DE0X 2W0FC 2JJ1G 1AI6A 3CXHF 4F6RB 3K59A 1ORQC 4GKJO 3CE2A 2Y4TA 4L87A 2BTOA 4LF4O 2ZE8A 4DV0B 4IHJA 1BS3A 3K57A 2WLJA 2XTAA 4J41A 1ZWIC 1IBLB 1BQ0A 2Q8VA 1VQMV 5FNVB 2QWRB 1XNQO 4CC5A 4LFCB 2UU9O 4X65B 1QLEB 4BW5A 4K0KO 3ZMTA 4J7ZA 3FB6C 3SJCC 5FLXN 2GHYA 2XNDG 1XNQB 5LXTB 2AZ0A 3ZS8C 2EULA 4CH3A 3SYPA 2DWEC 2DMXA 4DR3B 1FXKC 1Y66A 1Q6UA 4LBEC 1Y76A 4CBCA 1XHXA 3T1YB 1Q3EA 2Y48A 1DK1A 5LYJB 3JARA 1K97A 2W0XA 1AB3A 3QVNA 3QO8A 4ZOLB 4TV9B 3WB2A 1HWYA 3FYEB 3HKCB 2R9IA 2YS8A 2P6JA 1QBZA 2YI9A 4GX1A 4CZZA 1KU9A 3JATB 1SA0B 1SZXA 2OTLV 3SYQA 2OYQA 2ZCEA 5CA1A 4MW8A 2ZD9A 3ZX6A 3OMNB 1JMKC 4WF9V 2AGAA 4LF6B 4C7UA 4IYIA 3APQA 3ZHQA 1ZL8B 3T1CA 5FPOA 5IJ9A 4ZKIA 3E8HA 4LWSB 3D36A 5KAFZ 5L3CA 2XAJA 2DYSC 3L75H 2UUBB 1DF4A 1AP6A 3D3IA 3H1LH 5DEDA 1Q8IA 2GUZA 4JYCA 1M56B 2ITCC 1N0NA 3D36C 2WAMA 4B3RB 3BA9A 4DUYO 2EIKB 3QNEA 1KBHA 2E75B 1FXHA 2QWNB 4RUFA 2UXBO 2PY5A 3GWKC 3J7AU 4DUYB 5B1BC 1SQFA 1UJWB 3CJHB 2ZE7A 2HHHO 2EINC 4WBNB 4GKKB 3G80A 4DK1A 4PI2A 3M99B 1F23A 1XUQA 2IM9A 1H2KA 2H8PC 2CE4A 3L73H 1FFTB 2UXDB 3EFFK 1KP3A 4LF7B 3OGIB 1D5NA 3J80N 5F2VO 4X8AA 4B08A 2EJRA 2CTRA 1GRJA 1IBLO 4DK0A 1I7FA 1M90W 2LQTA 2AHZA 3TETA 3FAVB 4FLVA 4EEQA 3QO5A 5CBGA 1WP7A 1J95A 3CCSV 3L71H 2LO1A 2VQEB 3RGBA 3X2QC 3F7YC 4PA6A 5JVDB 4JI1O 1COWG 3OMAB 5JH7B 1V55C 2V7QG 3P30A 4YJ3B 4YJ2A 4FFBA 2KB1A 3RYHA 5IYZB 4MTXA 2VWKA 1SS3A 2XAHA 4NTYA 4R8CA 4I55A 2P7TC 1MABG 1HNZO 2W6IG 4B3MO 3MDSA 2YXHA 2DYRC 4MW3A 5GONA 1GH6A 1WJZA 4RAIA 4H33A 3HPLC 2UXXA 5J2UB 1PD3A 1SESA 1F4MA 1W0KG 4MVMA 3WU2Z 2V1DA 5KX5A 1IBMO 4X64O 5E79Z 1I94O 3JAKA 4LF6O 3ZN1A 4O2AA 2X7RB 4GX2A 3CMAV 4R6ZA 1JFFA 1K7DA 4FLZA 5EIBD 3ETEA 1W0JG 2HJFC 2N74A 5EC1C 3RYCB 1F51A 4HYOA 1BQZA 2EIJB 1XMQB 3U0ZA 2QWPB 4UXNA 4LFCO 1JFFB 4IGGA 4BIZA 4Z1MG 5EBMC 3I56V 3B4SA 3KKYA 3CCLV 2HP8A 2ZINA 3SPIA 2QA4V 1A32A 1J5EO 5JCOA 4CC6A 1SERA 2ZR2A 2CAZC 3SYOA 2RQ6A 2PYJA 4DR4B 1OCCC 1HR0B 4TWKA 3THOA 5BY1A 4Q20A 4DR4O 4QE9A 2FTKA 3OD4A 3ABUA 1GN2A 2DJVA 5LA6A 3CCUV 3OGCC 3CD6V 4DV6O 2QDOA 4AQYB 4DV3O 4UV8A 1KQSU 5LP6C 3E89A 3P3PA 1WB7A 5J2TB 3ZHUA 4DR5O 2NR5A 1N4CA 2KSDA 3K0GA 5LP6B 1YDXA 2FB5A 1U97A 2FMLA 1Q82W 3APOA 4ZOLA 1EM1A 5KHHA 5B3SC 2Q6AA 4JI8O 5KHJA 4BWAA 4JTCB 1S0VA 3O9OA 3BAAA 1H2MA 4HNAA 1IZ3A 4X1KA 3RW0A 3K5NA 3HKDB 3JSNA 5B1BB 1N33B 3JD3A 1P49A 2XHBA 1VARA 3AG4C 4NXMB 2EILC 2JGDA 4LF9O 3H1KH 4B3SO 3Q4HA 5B5EZ 3AK2A 1JA8A 4NTWA 4FM1A 4J7JA 4F6RA 1JJOA 1QNMA 2EZOA 2ADQB 4CS2A 4EB6A 1MNGA 2YSUB 1FS0G 2YEVA 2ETNA 1R1BA 3LSSA 1BMFG 4LCUC 1XL4A 1WAZA 4QE7A 4JI5O 3AG2C 5LOVA 4NVPA 4X64B 4DYLA 1VQ4V 1E79G 2IBZH 4FIPC 3DXRB 4JI0O 4JI5B 1WNSA 1BSMA 2YICA 3DGEA 1YXBA 2DW4A 3UM7A 1AP5A 3IJ4A 1FXVA 5KUMA 2Q69A 3JASB 1CP9A 1Q90D 3DC6A 2HVKC 2JJ2G 4FFKA 1JCHA 4G27B 4U3JB 1ZLZA 2YIBA 1B04A 1VIBA 3W7WA 1YJNV 3C3TA 3CC4V 4UCUA 5LGUA 1PPJH 3SJQC 3CCEV 4A5UB 5J2UA 1DLBA 1PL0A 1Y4MA 3EHBB 4JI1B 5HFMA 4P30A 4JAAA 2EX3A 4G2KA 4IHJB 5IWAB 2LW1A 4P2ZA 3OTFA 1OCOC 4JAUA 4DW1A 2AZ2A 1FJGO 5IWAO 5CB4A 3G4SV 5LGTA 1FJGB 3ABTA 4UCVA 2E5LB 4JZ2A 1KC8W 3CRRA 4OPHA 3RYFA 5JJJB 5H5NA 4QJFB 3D3QA 4Q6GA 2GBOA 1VMGA 2A9HA 1Z2GA 3MHHC 1SRYA 2RDCA 1NVPD 1S5JA 4I0XA 2M7WA 2EIMB 4FMTA 1S76D 2A06H 5IYBO 3ZMVA 4PHZA 3T2MA 4I4TB 1OCZB 4PDMA 3JALB 2N04A 2Q73A 1YJ9V 3ETQA 4B3RO 3QTCA 2WLIB 2F4VO 1P7BA 2UUAB 3BEHA 3OUFA 2Q68A 1S3JA 1ZAUA 3JCZA 3KCYA 1VF5B
chains in the Genus database with same CATH topology
1IBKO 3J81N 2UUAO 1A32A 1J5EO 4LF7O 1IBLO 4X66O 1DK1A 4JI4O 4DR6O 3OTOO 1AB3A 4X65O 5LMUO 5BY1A 4X62O 4DV2O 2LW7A 4DR4O 4YY3O 1XMQO 1D2DA 2UUBO 2UUCO 2DJVA 5LL6Y 2VQFO 4JI6O 4JI3O 4YHHO 4DV5O 4DV6O 4DV7O 4JI1O 4DV3O 4JI2O 2DOSA 2FKXA 4A5UB 2JRIA 3O65A 4DR5O 1R6TA 3T1YO 2ZKOA 4OX9O 3T1HO 1HNXO 1F7YA 2AGAA 4JV5O 4B3TO 1HNZO 1XEQA 2UXCO 4B3MO 4NXNO 4JYAO 5BR8O 4OPAA 3R66A 4LF5O 1N34O 1HNWO 1FJGO 1AILA 4LFAO 4GKKO 1N33O 4JI8O 4LF8O 4DV1O 3F5TA 5IWAO 4GKJO 4LF4O 4OPHA 3JAMN 1YZBA 1NS1A 1N32O 1FYJA 4DV4O 3RT3C 5H5NA 4DUYO 4DUZO 1IBMO 5LMNO 1N36O 2Z0AA 4X64O 3SDLA 1I94O 4LF6O 4LF9O 1G1XB 4B3SO 2UXBO 3J7AU 4NXMO 2ZM6O 2HHHO 5A2QN 1KUQA 5IT9N 1X59A 4JI7O 1XNQO 1HR0O 2UU9O 4K0KO 2N74A 1FKAO 2UXDO 1R1BA 5FLXN 1XNRO 4KHPO 4DR1O 3M8AA 2VQEO 4DR3O 2E5LO 4LFBO 4LFCO 4B3RO 4DV0O 5BXZA 2F4VO 4JI5O 4AQYO 1XMOO 4DR2O 3J80N 4JI0O 4DR7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK O;  3J81 N;  2UUA O;  1A32 A;  1J5E O;  4LF7 O;  1IBL O;  4X66 O;  1DK1 A;  4JI4 O;  4DR6 O;  3OTO O;  1AB3 A;  4X65 O;  5LMU O;  5BY1 A;  4X62 O;  4DV2 O;  2LW7 A;  4DR4 O;  4YY3 O;  1XMQ O;  1D2D A;  2UUB O;  2UUC O;  2DJV A;  5LL6 Y;  2VQF O;  4JI6 O;  4JI3 O;  4YHH O;  4DV5 O;  4DV6 O;  4DV7 O;  4JI1 O;  4DV3 O;  4JI2 O;  2DOS A;  2FKX A;  4A5U B;  2JRI A;  3O65 A;  4DR5 O;  1R6T A;  3T1Y O;  2ZKO A;  4OX9 O;  3T1H O;  1HNX O;  1F7Y A;  2AGA A;  4JV5 O;  4B3T O;  1HNZ O;  1XEQ A;  2UXC O;  4B3M O;  4NXN O;  4JYA O;  5BR8 O;  4OPA A;  3R66 A;  4LF5 O;  1N34 O;  1HNW O;  1FJG O;  1AIL A;  4LFA O;  4GKK O;  1N33 O;  4JI8 O;  4LF8 O;  4DV1 O;  3F5T A;  5IWA O;  4GKJ O;  4LF4 O;  4OPH A;  3JAM N;  1YZB A;  1NS1 A;  1N32 O;  1FYJ A;  4DV4 O;  3RT3 C;  5H5N A;  4DUY O;  4DUZ O;  1IBM O;  5LMN O;  1N36 O;  2Z0A A;  4X64 O;  3SDL A;  1I94 O;  4LF6 O;  4LF9 O;  1G1X B;  4B3S O;  2UXB O;  3J7A U;  4NXM O;  2ZM6 O;  2HHH O;  5A2Q N;  1KUQ A;  5IT9 N;  1X59 A;  4JI7 O;  1XNQ O;  1HR0 O;  2UU9 O;  4K0K O;  2N74 A;  1FKA O;  2UXD O;  1R1B A;  5FLX N;  1XNR O;  4KHP O;  4DR1 O;  3M8A A;  2VQE O;  4DR3 O;  2E5L O;  4LFB O;  4LFC O;  4B3R O;  4DV0 O;  5BXZ A;  2F4V O;  4JI5 O;  4AQY O;  1XMO O;  4DR2 O;  3J80 N;  4JI0 O;  4DR7 O; 
#chains in the Genus database with same CATH topology
 1B06 A;  2QWO B;  2EIK C;  3ZIA G;  3BHP A;  4ZHQ A;  3KZI Z;  2EIN B;  1BCC H;  3K5M A;  4RUE A;  4DV2 O;  2LW7 A;  1D2D A;  1M57 C;  3ZED A;  2IH3 C;  1HDJ A;  4DRX A;  4WFA V;  3AK3 A;  4B7K A;  1AVM A;  2GTS A;  3OM3 B;  4I5S A;  4UCT A;  1JQ0 A;  3W7T A;  2IJK A;  3ML0 A;  2ZKO A;  1VQK V;  4N23 A;  1MSD A;  4HZ3 A;  4DR5 B;  2ZE5 A;  4NXN O;  4CS3 A;  3AG1 C;  3W7U A;  5DEC A;  1I0H A;  1L8D A;  2VWJ A;  3CRM A;  1NKD A;  3M7M X;  4IIJ B;  1K8A W;  1D5A A;  3QF7 A;  1M93 A;  4H0L B;  4LFB B;  3IFX A;  3S3X A;  4ICG A;  3MAQ A;  5IJ9 B;  1NS1 A;  1OCC B;  2OCC C;  1M4U A;  2QE7 G;  4ZIB A;  5LMN O;  4TUY B;  1YEW A;  1VQO V;  1G6U A;  2XAQ A;  5BMV B;  3UCS C;  2AW9 A;  2MK3 A;  3K04 A;  1NT2 B;  3VQY A;  2ZIO A;  4I50 A;  3SR2 C;  3RYC A;  2CTW A;  2L6L A;  3ETD A;  5EBL C;  4KXR A;  3SYA A;  2L35 A;  3EXA A;  3HKB B;  3P3N A;  3F7V C;  2B5U A;  1K33 A;  5JWP A;  3JAR B;  3KG2 A;  4W4L A;  1M1K W;  1SQG A;  3FX7 A;  4X66 B;  4J7K A;  1XI1 A;  4IT5 A;  5L3B A;  4X9Q A;  1PV0 A;  1PNL A;  1QLE C;  2B1I A;  3OEE G;  5K1P A;  1R6K A;  1MOF A;  4FVM A;  4JI4 O;  3BPZ A;  4O4H A;  1EZV H;  4JYY A;  1QR9 A;  1K9M W;  4KHP B;  1XMQ O;  2IU3 A;  4PI0 A;  4JI6 O;  4X20 B;  4IIJ A;  4O2B B;  4OX9 B;  3MD0 A;  3GVM A;  5EZY B;  2YIB D;  2QEX V;  1W59 A;  3ZRW B;  1SA0 A;  4OX9 O;  3K79 A;  4JYA B;  1PNK A;  2HVJ C;  2X6B A;  5ITZ A;  1XEQ A;  1H8H G;  2F43 G;  4XDK A;  2ZIM A;  5BR8 O;  1P4R A;  4DO2 A;  3ASO C;  1AI5 A;  4DV2 B;  2KG7 A;  2OIG A;  4O4L A;  4NTX A;  4AIL C;  1TAE A;  4LF4 B;  5LYJ A;  3NR7 A;  5L3F A;  2IW5 A;  2BTQ B;  1NI8 A;  2OCH A;  2G38 A;  2F95 B;  4LC1 A;  4KL1 A;  3ZMU A;  4UUJ C;  3ZHT A;  4X89 A;  1WB8 A;  1GTO A;  1N32 O;  3IC7 A;  1OCZ C;  1KB9 F;  2BOC C;  1L0L H;  5H2F Z;  4GT1 A;  1N36 O;  4UVB A;  1DTO A;  1TUB A;  2QKS A;  4YIP A;  1H8E G;  1SKV A;  2UU9 B;  2QWQ B;  1SF9 A;  4TQF A;  1B3Q A;  5IY5 C;  2P22 C;  1GN4 A;  1WPX A;  1TVK A;  3A8T A;  3N2K A;  4U3J A;  2VQE O;  4PDV A;  4LFB O;  2PTM A;  5JQG B;  1WN7 A;  4TV9 A;  2QKA A;  3JAS A;  1RPO A;  3H1H H;  4RQF A;  3W7X A;  1BGY H;  2HG5 C;  1VF6 C;  2BOB C;  4R50 A;  1F4N A;  4UFZ A;  2ZM6 B;  1Q6I A;  4GX0 A;  3T1H B;  5CBF A;  3L72 H;  4G28 B;  5CA3 A;  2XAG A;  1Y76 B;  3N2G A;  2GDS A;  5L3D A;  3EVK A;  1AR5 A;  4PEL A;  2E76 B;  4LWS A;  3H1I H;  3LDC A;  5IY5 B;  4YY3 O;  1HNW B;  4TSF G;  3A0H Z;  4FZ1 A;  3JD0 A;  3ZHV A;  4QPK A;  2VQF O;  3SGI A;  5CBH A;  5KMG B;  5EK0 A;  1LNQ A;  4GYC B;  1H38 A;  4FLX A;  3C3S A;  1QQC A;  4PA7 A;  5H6Q A;  3UO3 A;  4TUY A;  3ZMS A;  1WLE A;  4F4L A;  1VQN V;  3AEI A;  2PF4 E;  4O4J B;  1KKC A;  3ASO B;  1Q7Y W;  4L8J A;  4J9Z B;  3BVO A;  3CHX A;  4TV8 B;  5JCO C;  1RM1 C;  1BE3 H;  2CUG A;  1N34 B;  5EYP B;  1FPO A;  3SPC A;  2OWO A;  2YI8 A;  3RYI B;  1O9H A;  2PYL A;  4JAS A;  1R6N A;  2Z3Y A;  2DN9 A;  3L74 H;  2UXB B;  3RT3 C;  1GKF A;  2EIL B;  1XDC A;  4HAM A;  2BE3 A;  3ABM C;  1M57 B;  3E35 A;  4LH7 A;  2KQX A;  1OJH A;  4LR3 A;  4JTD B;  4GX5 A;  2QM8 A;  3H9V A;  4GUN A;  3HKD A;  4AI8 A;  2Q5Z A;  2KG7 B;  1FFX A;  4O4L B;  4DRX B;  5KAI Z;  3JSL A;  1HR0 O;  4DW0 A;  3DXR A;  2IJH A;  4D6T H;  2BTQ A;  1EN4 A;  2EBO A;  3TGU H;  4DXW A;  2QJ1 A;  3CWB H;  4O2A B;  1SQV H;  3SPH A;  2E5L O;  3FFQ A;  1FXK A;  2JVD A;  2JK5 C;  3ZRS A;  4J42 A;  2RCV A;  1XBL A;  3QG5 A;  1S5L Z;  2DWD C;  3HKE B;  3ZRW A;  4I50 B;  3PN1 A;  1G4Y B;  5B1O A;  2VS0 A;  4LH6 A;  2ILM A;  1GK9 A;  3H1J H;  2HFE C;  1V9P A;  4JI3 O;  1Z5W A;  1YIT V;  5LBQ A;  1YI2 V;  4X1K B;  1GM7 A;  4JI2 O;  2IH1 C;  1T5E A;  2XT9 A;  1GM8 A;  1VF7 A;  4J80 A;  1R73 A;  2FKX A;  2OCC B;  3FKS G;  1SQB H;  1HNZ B;  1XRE A;  5JVD A;  1KP2 A;  1R6T A;  5C8Y A;  3UT5 A;  2YXL A;  2Y4U A;  3T1H O;  4MTO A;  4Z1V A;  4JI2 B;  4JF3 A;  3T4D A;  1MSW D;  1RP3 B;  5KUK A;  3VBB A;  3STL C;  2X0L A;  3BCC H;  3FYI B;  3JD1 A;  3VQX A;  1IXB A;  1L1F A;  4JV5 B;  3AG1 B;  2A3Q A;  5KHG A;  1V54 B;  1AIL A;  5KLV H;  4LFA O;  4EFE A;  2CGN A;  4J11 A;  1Q86 W;  3A0B Z;  1YSC A;  1XNR B;  2ODM A;  2ITD C;  2ZR3 A;  4O2B A;  3E8G A;  2NN4 A;  3JAM N;  1YF2 A;  3N27 A;  3TK1 A;  2WLN A;  4E2L A;  5L3G A;  1QR8 A;  4JI0 B;  2QSA A;  1KMI Z;  2Q0A A;  3SPJ A;  1EBO A;  4NXN B;  2A0L A;  2YDE A;  3OAA G;  1VEW A;  1OCR B;  4JPR A;  1H2G A;  3OTO B;  4X1Y A;  2EJ7 A;  1HP8 A;  1P84 F;  4IYH A;  2JS3 A;  1YTF B;  2QR4 A;  3AG4 B;  4I9Q A;  3SJA C;  4DR7 B;  1CEZ A;  3JAK B;  4I55 B;  5H9C A;  4QIW F;  3ABM B;  3HKB A;  3FAV A;  3JCU Z;  4X88 A;  1AJP A;  4MVQ A;  1H2L A;  2Y0P A;  3OUS A;  2ZNJ A;  3G6B A;  4B3M B;  2EIM C;  3KCX A;  2LGQ A;  2CH7 A;  5JJN B;  2R70 A;  2Q67 A;  5GON B;  2WA4 A;  3SPG A;  2JIZ G;  4NYK A;  1RFY A;  2QKC A;  5BZB A;  2CTP A;  2RJZ A;  4MVO A;  4KP4 A;  2IJI A;  1DGS A;  2ADP A;  4UB6 Z;  2CTQ A;  2OIE A;  3ZBH A;  4ZHQ B;  2P5O A;  2Q9L A;  2W6J G;  3CX5 F;  1VF6 A;  2HR3 A;  3CYO A;  1NU1 H;  1F7Y A;  1R3I C;  1NJI W;  1Q5O A;  5C93 A;  4P9P A;  4TOI A;  1MG1 A;  4O4I A;  2F1M A;  4FM2 A;  1NTZ H;  2A79 B;  3R66 A;  1GMG A;  2YC0 A;  1CPY A;  2JGU A;  2Q7E A;  4FPP A;  2D2C B;  4WFE A;  1SQX H;  2WLM A;  1H2S B;  3HR0 A;  5B1A C;  4U3F H;  4LF9 B;  3K3W A;  3MHS C;  4H13 B;  1EN5 A;  2ATK C;  5IT9 N;  2YEV B;  2WWW A;  5KX5 B;  4LFA B;  1Q81 W;  4NB5 A;  3B77 A;  3BRC A;  1UFI A;  1URF A;  2UXD O;  4GKJ B;  2GV9 A;  2UUC B;  1VQ6 V;  1N32 B;  1L0N H;  4DV6 B;  1MZE A;  3HKC A;  2XAF A;  3CCV V;  2EIJ C;  1NBM G;  1MMM A;  1K3E A;  2RMK B;  2QM4 A;  5KMG A;  2YIA A;  4YJ3 A;  4YJ2 B;  3OTO O;  4LP8 A;  3L9D A;  2R9R B;  4H37 A;  4YHH B;  2QGN A;  5A9G A;  3BA8 A;  2BSK B;  4LF8 B;  5LP6 A;  4WFB V;  3CEI A;  2P90 A;  1V54 C;  4UCR A;  1YCI A;  4X1I B;  3K08 A;  2X6A A;  1VQL V;  2JRI A;  4JI3 B;  3T1Y O;  4MVS A;  1R3L C;  3RFR A;  3JD2 A;  4MTF A;  4JYB A;  4MVU A;  3K9A A;  2X6C A;  1OZ0 A;  4TQD A;  1SQQ H;  3OT7 A;  1XOU A;  4OPA A;  3VQV A;  1TUE B;  4AHC A;  3LNM B;  1VQ7 V;  1ENV A;  4KFM A;  2Q0O C;  1IVS A;  2Q7G A;  1I5X A;  5HFL A;  1NQT A;  4RO2 A;  1N0J A;  5D5Q A;  2ZQM A;  1Q6H A;  1QVF U;  1Y74 A;  4I7Z B;  1KEC A;  1K92 A;  3LUT B;  1ROP A;  3B2E E;  1LR1 A;  2MW2 B;  4HNA B;  4KHP O;  3ABL B;  3M8A A;  1XMO B;  3LDE A;  4WFG A;  4JI6 B;  1SZT A;  3WG7 C;  1J5E B;  1M9N A;  3E86 A;  2F23 A;  4GCZ A;  4UVC A;  5FNV A;  4DR7 O;  2PZS A;  1P7G A;  3J81 N;  3BY6 A;  1N8R W;  3CRA A;  2R72 A;  1NTM H;  3L70 H;  4PA4 A;  3U10 A;  3K5L A;  1TUB B;  3DSQ A;  2NLJ C;  3HB3 B;  4YXW G;  5FPR A;  3ZN0 A;  1TA8 A;  4PD4 F;  4PDL A;  1YIJ V;  1EN6 A;  1IXM A;  4ZI7 A;  3K9S A;  4YIO A;  2K9P A;  2UXC B;  1G8M A;  3F5W C;  3TCU A;  2YUA A;  5AG2 A;  2EZP A;  1FD9 A;  4K35 A;  4PJ0 Z;  3LNN A;  2JEX A;  4FJC C;  1N33 O;  4LF8 O;  4DV1 O;  1AI7 A;  4WCE V;  4DV4 B;  1NH2 B;  3A0R A;  4DUZ B;  2QTS A;  4X20 A;  2WPD G;  5J9P C;  1B6Q A;  3OR7 C;  3WB1 A;  2UXN A;  3AG7 A;  1FYJ A;  1IUR A;  3TXQ A;  1KKD A;  4DUZ O;  5TIS Z;  3CCM V;  3T4Z A;  4MSW C;  2Y69 C;  1PNM A;  1G1X B;  4GLX A;  5B1A B;  4ZI7 B;  2ZM6 O;  3FB8 C;  4X1Y B;  2ZXW B;  1FAF A;  1KUQ A;  1JVM A;  5KA5 A;  4PV1 B;  5KHI A;  2HHH B;  1V55 B;  1FKA O;  3B40 A;  3P32 A;  3RVY A;  1XNR O;  4UCO A;  4DR1 O;  3CRC A;  2C2A A;  5BXZ A;  4DV0 O;  2WLL B;  3CXC U;  1VQ8 V;  4RWU A;  3WG7 B;  5H6R A;  4P9O A;  4DR1 B;  4D7T A;  2WSS G;  4PDR A;  5CMU A;  1FFX B;  1WA8 A;  4WBN A;  1SC5 B;  2AXT Z;  1IBK O;  3K5O A;  2B1G A;  5IYZ A;  1PKX A;  4LF7 O;  3CJH A;  4X62 B;  1NVP B;  1W2B U;  1PL4 A;  4UB8 Z;  2HKO A;  4BW9 A;  4X65 O;  1NR7 A;  2H94 A;  1PM9 A;  4DV5 B;  4Z2W A;  1NTK H;  1JOY A;  2M6Y A;  3K58 A;  3OW2 U;  3CCR V;  3BFR A;  1SET A;  1OCO B;  5EIB C;  1QVG U;  2YID A;  2GUZ B;  2YXY A;  4YHH O;  4WFF A;  1GN3 A;  2F93 B;  3ABK C;  4TV8 A;  1AJQ A;  2XAS A;  2Y0I A;  3AG3 C;  4WFH A;  1RSO A;  3CC2 V;  3AG3 B;  5LGN A;  2P4K A;  3RBZ A;  2DYS B;  3S3W A;  2CK3 G;  2E74 B;  1RPR A;  4ZBM A;  3CC7 V;  2JDI G;  3JAT A;  5GW7 A;  1M56 C;  4XBF A;  4X1I A;  5B1N A;  2CDY A;  5JH7 A;  4DV3 B;  2ZE6 A;  5IYD O;  4I0X B;  1NZ6 A;  3ICX A;  3E22 A;  3B09 A;  1YZB A;  4N21 A;  4MVR A;  1YJW V;  1ZL8 A;  1THZ A;  5EC2 C;  4CH5 A;  5LXT A;  1O9G A;  1IBM B;  3ASN B;  1QLN A;  1GM9 A;  3UKM A;  2DQ3 A;  3ZJZ A;  1S77 D;  2ZDI C;  4JI8 B;  1WP8 A;  3IGA C;  1XQ8 A;  3FD9 A;  4HBN A;  3OFN G;  4UCS A;  1S72 V;  3ZRX A;  2ARH A;  5CA0 A;  5BMV A;  1IX9 A;  3ZCC A;  1BHB A;  1ZX3 A;  2VRZ A;  2IU0 A;  2E3C A;  5K1X A;  3R65 A;  1XMO O;  4BIO A;  1NH2 D;  3NXS A;  1ZSP A;  5EYP A;  3GB7 C;  5D5P A;  2F4V B;  1BHA A;  2UUA O;  4FLU A;  3VOU A;  1LUV A;  3QO7 A;  2ZNI A;  3RWR D;  4OXS A;  4DR6 O;  3HKE A;  3FB5 C;  3Q4H B;  4LNU B;  4O4J A;  2VQF B;  5BR8 B;  2H3O A;  2AHY A;  4NKG B;  1EFR G;  2UUC O;  1VP7 A;  3TJT A;  3K0D A;  1US6 A;  1EZJ A;  2JS5 A;  5B66 Z;  3DC5 A;  4F6E A;  3RN4 A;  2P06 A;  3C90 A;  5IDJ A;  4JTA B;  3CRQ A;  5FL7 G;  5L3E A;  1CXZ B;  2BSK A;  3UQ8 A;  3N2K B;  2UXC O;  4QGP A;  3OR6 C;  3ZRV A;  1K73 W;  1OHH G;  1VQP V;  1N34 O;  1KYO F;  3UO2 A;  1JJ2 U;  4K0K B;  5JJE B;  3I5D A;  2Z5U A;  4I4T A;  5DM6 V;  4DV1 B;  4FLY A;  4DV4 O;  2Z0A A;  3I55 V;  3G71 V;  1Y67 A;  1QHT A;  5CA0 B;  5KHK A;  1WPB A;  1I08 A;  4NXM O;  3WFV A;  5A2Q N;  3N2G B;  1Z5V A;  1HW7 A;  3CPW U;  4K3A A;  4B3S B;  4PA3 A;  2PUS A;  1K4C C;  2LFR A;  3OEH G;  4B7E A;  4W4K A;  5CB4 B;  4DR2 B;  4MTG A;  5IJ0 A;  1OCR C;  4LNU A;  4IL6 Z;  3RVZ A;  2O57 A;  4TT3 G;  4DR2 O;  1OV9 A;  1I94 B;  5ITZ B;  1TGO A;  5CN0 A;  1K4D C;  5J2T A;  1TVK B;  4J10 A;  1JPX A;  4I9W A;  4X66 O;  4NR1 A;  1U96 A;  3CSX A;  4E4E A;  1IBK B;  4U7O A;  5JQG A;  5LA6 B;  1BT8 A;  1IDS A;  3OE7 G;  4X62 O;  2HJD A;  4LF5 B;  5LHH A;  3VQW A;  3SJB C;  3JYC A;  4OGQ B;  4DV5 O;  3LDD A;  2GSM B;  1X4T A;  3E8B A;  3AK1 A;  3STZ C;  4FLW A;  2DQ0 A;  1GAX A;  1M5I A;  2PI4 A;  2P4V A;  1XHZ A;  1HNX O;  2A7W A;  4B3T O;  5EBW C;  4DR6 B;  1GO3 F;  1HNX B;  3CB2 A;  4QNH B;  2KKW A;  1Q43 A;  2WA3 A;  1YHQ V;  2XOK G;  1YTF D;  4XDL A;  3CCJ V;  4J9Y B;  1QCE A;  2BCC H;  4K8Z A;  3F5T A;  1SQP H;  2ZT9 B;  1N36 B;  3ASN C;  3AG2 B;  4RQE A;  5LOV B;  4BIU A;  3ETG A;  3SDL A;  3UT5 B;  1VQ9 V;  1LUW A;  2FL4 A;  2P67 A;  2GTA A;  3JAW A;  3W7S A;  3CS5 A;  4JI7 B;  5EZY A;  4FM0 A;  4MS2 A;  1GN6 A;  1XL6 A;  1X59 A;  4R7C A;  4JI7 O;  3IC9 A;  4MVZ A;  1AJN A;  4DR3 O;  2QM7 A;  4BAY A;  1BL8 A;  2LJ2 A;  1ZUQ A;  1MZF A;  3LSQ A;  1E1Q G;  2HLD G;  1NR1 A;  3ABK B;  5IYC O;  4FFB B;  2DYR B;  5E1A C;  1QU7 A;  2ZDI A;  3JAW B;  2V4D A;  5B3S B;  1AR1 B;  2WLL A;  2F66 C;  2CGO A;  4O4I B;  3TXS A;  4ABM A;  3K06 A;  4JGS A;  1AI4 A;  4DV7 O;  3DTU B;  5C8Y B;  1RSO B;  4JZG A;  2DOS A;  3LSU A;  1ARO P;  2JEU A;  1KD1 W;  5KA6 A;  3E8F A;  4DV7 B;  3O65 A;  3K03 A;  2N05 A;  3B8N A;  4JAV A;  1ZTE A;  2HEP A;  2IJJ A;  2RN9 A;  1K5Q A;  2CH7 B;  3IAY A;  2R9A A;  3WB0 A;  4LF5 O;  1DF5 A;  1H2N A;  1I5Y A;  4O4H B;  4KUM A;  2WLK A;  3ZMZ A;  3A2F A;  3CCQ V;  4ASU G;  3GWO A;  5GTH Z;  4CS4 A;  1JR9 A;  3E2E A;  3H01 A;  4D7S A;  2Y69 B;  4PA9 A;  4K8X A;  2B9Z A;  5LHG A;  4EKW A;  3D8C A;  1K34 A;  1PP9 H;  1FXK B;  2NNU A;  1BZK A;  5LMN B;  2ZXW C;  1AR4 A;  2D3O W;  4GZR B;  4CH6 A;  3FB7 C;  2QTO A;  5GTI Z;  3G6E V;  1WA8 B;  1E1R G;  5DN6 G;  2XUM A;  2LFS A;  1S5H C;  3G67 A;  3ZHS A;  2Q7H A;  4UVA A;  1JX9 A;  4EFB A;  4AQY O;  4QPJ A;  2OTJ V;  1YVW A;  4XDJ A;  4EB6 B;  2WLH A;  2LP7 A;  4MT8 A;  4FLT A;  3RYI A;  3ZHR A;  5CA1 B;  2RNB A;  3OMI B;  5LMU B;  1R3K C;  2FYU H;  2JGD B;  1R3J C;  4FZ0 A;  2WLI A;  2K1E A;  5LMU O;  3PJS K;  3JAL A;  4JI4 B;  2OT5 A;  3E83 A;  3U11 A;  5IJ0 B;  2UUB O;  3CME V;  2PGG A;  1K5S A;  5LL6 Y;  5IE9 A;  3RYH B;  3SYC A;  1Y6X A;  1UPG A;  1XIL A;  2Q4P A;  3JD4 A;  4BR6 A;  3BAB A;  3X2Q B;  4U7N A;  5LHI A;  1MA1 A;  2LGW A;  4JV5 O;  4FK5 C;  1VQ5 V;  1RM1 B;  3B8M A;  1Y74 B;  3E22 B;  3ABL C;  2PI5 A;  3RYF B;  4CH4 A;  4H44 B;  4JYA O;  4B3T B;  4UV9 A;  4YY3 B;  1HNW O;  4GKK O;  3CP1 A;  2DE0 X;  2W0F C;  2JJ1 G;  1AI6 A;  3CXH F;  4F6R B;  3K59 A;  1ORQ C;  4GKJ O;  3CE2 A;  2Y4T A;  4L87 A;  2BTO A;  4LF4 O;  2ZE8 A;  4DV0 B;  4IHJ A;  1BS3 A;  3K57 A;  2WLJ A;  2XTA A;  4J41 A;  1ZWI C;  1IBL B;  1BQ0 A;  2Q8V A;  1VQM V;  5FNV B;  2QWR B;  1XNQ O;  4CC5 A;  4LFC B;  2UU9 O;  4X65 B;  1QLE B;  4BW5 A;  4K0K O;  3ZMT A;  4J7Z A;  3FB6 C;  3SJC C;  5FLX N;  2GHY A;  2XND G;  1XNQ B;  5LXT B;  2AZ0 A;  3ZS8 C;  2EUL A;  4CH3 A;  3SYP A;  2DWE C;  2DMX A;  4DR3 B;  1FXK C;  1Y66 A;  1Q6U A;  4LBE C;  1Y76 A;  4CBC A;  1XHX A;  3T1Y B;  1Q3E A;  2Y48 A;  1DK1 A;  5LYJ B;  3JAR A;  1K97 A;  2W0X A;  1AB3 A;  3QVN A;  3QO8 A;  4ZOL B;  4TV9 B;  3WB2 A;  1HWY A;  3FYE B;  3HKC B;  2R9I A;  2YS8 A;  2P6J A;  1QBZ A;  2YI9 A;  4GX1 A;  4CZZ A;  1KU9 A;  3JAT B;  1SA0 B;  1SZX A;  2OTL V;  3SYQ A;  2OYQ A;  2ZCE A;  5CA1 A;  4MW8 A;  2ZD9 A;  3ZX6 A;  3OMN B;  1JMK C;  4WF9 V;  2AGA A;  4LF6 B;  4C7U A;  4IYI A;  3APQ A;  3ZHQ A;  1ZL8 B;  3T1C A;  5FPO A;  5IJ9 A;  4ZKI A;  3E8H A;  4LWS B;  3D36 A;  5KAF Z;  5L3C A;  2XAJ A;  2DYS C;  3L75 H;  2UUB B;  1DF4 A;  1AP6 A;  3D3I A;  3H1L H;  5DED A;  1Q8I A;  2GUZ A;  4JYC A;  1M56 B;  2ITC C;  1N0N A;  3D36 C;  2WAM A;  4B3R B;  3BA9 A;  4DUY O;  2EIK B;  3QNE A;  1KBH A;  2E75 B;  1FXH A;  2QWN B;  4RUF A;  2UXB O;  2PY5 A;  3GWK C;  3J7A U;  4DUY B;  5B1B C;  1SQF A;  1UJW B;  3CJH B;  2ZE7 A;  2HHH O;  2EIN C;  4WBN B;  4GKK B;  3G80 A;  4DK1 A;  4PI2 A;  3M99 B;  1F23 A;  1XUQ A;  2IM9 A;  1H2K A;  2H8P C;  2CE4 A;  3L73 H;  1FFT B;  2UXD B;  3EFF K;  1KP3 A;  4LF7 B;  3OGI B;  1D5N A;  3J80 N;  5F2V O;  4X8A A;  4B08 A;  2EJR A;  2CTR A;  1GRJ A;  1IBL O;  4DK0 A;  1I7F A;  1M90 W;  2LQT A;  2AHZ A;  3TET A;  3FAV B;  4FLV A;  4EEQ A;  3QO5 A;  5CBG A;  1WP7 A;  1J95 A;  3CCS V;  3L71 H;  2LO1 A;  2VQE B;  3RGB A;  3X2Q C;  3F7Y C;  4PA6 A;  5JVD B;  4JI1 O;  1COW G;  3OMA B;  5JH7 B;  1V55 C;  2V7Q G;  3P30 A;  4YJ3 B;  4YJ2 A;  4FFB A;  2KB1 A;  3RYH A;  5IYZ B;  4MTX A;  2VWK A;  1SS3 A;  2XAH A;  4NTY A;  4R8C A;  4I55 A;  2P7T C;  1MAB G;  1HNZ O;  2W6I G;  4B3M O;  3MDS A;  2YXH A;  2DYR C;  4MW3 A;  5GON A;  1GH6 A;  1WJZ A;  4RAI A;  4H33 A;  3HPL C;  2UXX A;  5J2U B;  1PD3 A;  1SES A;  1F4M A;  1W0K G;  4MVM A;  3WU2 Z;  2V1D A;  5KX5 A;  1IBM O;  4X64 O;  5E79 Z;  1I94 O;  3JAK A;  4LF6 O;  3ZN1 A;  4O2A A;  2X7R B;  4GX2 A;  3CMA V;  4R6Z A;  1JFF A;  1K7D A;  4FLZ A;  5EIB D;  3ETE A;  1W0J G;  2HJF C;  2N74 A;  5EC1 C;  3RYC B;  1F51 A;  4HYO A;  1BQZ A;  2EIJ B;  1XMQ B;  3U0Z A;  2QWP B;  4UXN A;  4LFC O;  1JFF B;  4IGG A;  4BIZ A;  4Z1M G;  5EBM C;  3I56 V;  3B4S A;  3KKY A;  3CCL V;  2HP8 A;  2ZIN A;  3SPI A;  2QA4 V;  1A32 A;  1J5E O;  5JCO A;  4CC6 A;  1SER A;  2ZR2 A;  2CAZ C;  3SYO A;  2RQ6 A;  2PYJ A;  4DR4 B;  1OCC C;  1HR0 B;  4TWK A;  3THO A;  5BY1 A;  4Q20 A;  4DR4 O;  4QE9 A;  2FTK A;  3OD4 A;  3ABU A;  1GN2 A;  2DJV A;  5LA6 A;  3CCU V;  3OGC C;  3CD6 V;  4DV6 O;  2QDO A;  4AQY B;  4DV3 O;  4UV8 A;  1KQS U;  5LP6 C;  3E89 A;  3P3P A;  1WB7 A;  5J2T B;  3ZHU A;  4DR5 O;  2NR5 A;  1N4C A;  2KSD A;  3K0G A;  5LP6 B;  1YDX A;  2FB5 A;  1U97 A;  2FML A;  1Q82 W;  3APO A;  4ZOL A;  1EM1 A;  5KHH A;  5B3S C;  2Q6A A;  4JI8 O;  5KHJ A;  4BWA A;  4JTC B;  1S0V A;  3O9O A;  3BAA A;  1H2M A;  4HNA A;  1IZ3 A;  4X1K A;  3RW0 A;  3K5N A;  3HKD B;  3JSN A;  5B1B B;  1N33 B;  3JD3 A;  1P49 A;  2XHB A;  1VAR A;  3AG4 C;  4NXM B;  2EIL C;  2JGD A;  4LF9 O;  3H1K H;  4B3S O;  3Q4H A;  5B5E Z;  3AK2 A;  1JA8 A;  4NTW A;  4FM1 A;  4J7J A;  4F6R A;  1JJO A;  1QNM A;  2EZO A;  2ADQ B;  4CS2 A;  4EB6 A;  1MNG A;  2YSU B;  1FS0 G;  2YEV A;  2ETN A;  1R1B A;  3LSS A;  1BMF G;  4LCU C;  1XL4 A;  1WAZ A;  4QE7 A;  4JI5 O;  3AG2 C;  5LOV A;  4NVP A;  4X64 B;  4DYL A;  1VQ4 V;  1E79 G;  2IBZ H;  4FIP C;  3DXR B;  4JI0 O;  4JI5 B;  1WNS A;  1BSM A;  2YIC A;  3DGE A;  1YXB A;  2DW4 A;  3UM7 A;  1AP5 A;  3IJ4 A;  1FXV A;  5KUM A;  2Q69 A;  3JAS B;  1CP9 A;  1Q90 D;  3DC6 A;  2HVK C;  2JJ2 G;  4FFK A;  1JCH A;  4G27 B;  4U3J B;  1ZLZ A;  2YIB A;  1B04 A;  1VIB A;  3W7W A;  1YJN V;  3C3T A;  3CC4 V;  4UCU A;  5LGU A;  1PPJ H;  3SJQ C;  3CCE V;  4A5U B;  5J2U A;  1DLB A;  1PL0 A;  1Y4M A;  3EHB B;  4JI1 B;  5HFM A;  4P30 A;  4JAA A;  2EX3 A;  4G2K A;  4IHJ B;  5IWA B;  2LW1 A;  4P2Z A;  3OTF A;  1OCO C;  4JAU A;  4DW1 A;  2AZ2 A;  1FJG O;  5IWA O;  5CB4 A;  3G4S V;  5LGT A;  1FJG B;  3ABT A;  4UCV A;  2E5L B;  4JZ2 A;  1KC8 W;  3CRR A;  4OPH A;  3RYF A;  5JJJ B;  5H5N A;  4QJF B;  3D3Q A;  4Q6G A;  2GBO A;  1VMG A;  2A9H A;  1Z2G A;  3MHH C;  1SRY A;  2RDC A;  1NVP D;  1S5J A;  4I0X A;  2M7W A;  2EIM B;  4FMT A;  1S76 D;  2A06 H;  5IYB O;  3ZMV A;  4PHZ A;  3T2M A;  4I4T B;  1OCZ B;  4PDM A;  3JAL B;  2N04 A;  2Q73 A;  1YJ9 V;  3ETQ A;  4B3R O;  3QTC A;  2WLI B;  2F4V O;  1P7B A;  2UUA B;  3BEH A;  3OUF A;  2Q68 A;  1S3J A;  1ZAU A;  3JCZ A;  3KCY A;  1VF5 B; 
#chains in the Genus database with same CATH homology
 1IBK O;  3J81 N;  2UUA O;  1A32 A;  1J5E O;  4LF7 O;  1IBL O;  4X66 O;  1DK1 A;  4JI4 O;  4DR6 O;  3OTO O;  1AB3 A;  4X65 O;  5LMU O;  5BY1 A;  4X62 O;  4DV2 O;  2LW7 A;  4DR4 O;  4YY3 O;  1XMQ O;  1D2D A;  2UUB O;  2UUC O;  2DJV A;  5LL6 Y;  2VQF O;  4JI6 O;  4JI3 O;  4YHH O;  4DV5 O;  4DV6 O;  4DV7 O;  4JI1 O;  4DV3 O;  4JI2 O;  2DOS A;  2FKX A;  4A5U B;  2JRI A;  3O65 A;  4DR5 O;  1R6T A;  3T1Y O;  2ZKO A;  4OX9 O;  3T1H O;  1HNX O;  1F7Y A;  2AGA A;  4JV5 O;  4B3T O;  1HNZ O;  1XEQ A;  2UXC O;  4B3M O;  4NXN O;  4JYA O;  5BR8 O;  4OPA A;  3R66 A;  4LF5 O;  1N34 O;  1HNW O;  1FJG O;  1AIL A;  4LFA O;  4GKK O;  1N33 O;  4JI8 O;  4LF8 O;  4DV1 O;  3F5T A;  5IWA O;  4GKJ O;  4LF4 O;  4OPH A;  3JAM N;  1YZB A;  1NS1 A;  1N32 O;  1FYJ A;  4DV4 O;  3RT3 C;  5H5N A;  4DUY O;  4DUZ O;  1IBM O;  5LMN O;  1N36 O;  2Z0A A;  4X64 O;  3SDL A;  1I94 O;  4LF6 O;  4LF9 O;  1G1X B;  4B3S O;  2UXB O;  3J7A U;  4NXM O;  2ZM6 O;  2HHH O;  5A2Q N;  1KUQ A;  5IT9 N;  1X59 A;  4JI7 O;  1XNQ O;  1HR0 O;  2UU9 O;  4K0K O;  2N74 A;  1FKA O;  2UXD O;  1R1B A;  5FLX N;  1XNR O;  4KHP O;  4DR1 O;  3M8A A;  2VQE O;  4DR3 O;  2E5L O;  4LFB O;  4LFC O;  4B3R O;  4DV0 O;  5BXZ A;  2F4V O;  4JI5 O;  4AQY O;  1XMO O;  4DR2 O;  3J80 N;  4JI0 O;  4DR7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...