4G28B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
b'GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g28B00
1M57C 4MVZA 1OCRC 4P2ZA 4XDLA 3IGAC 4WFGA 2HVJC 4R50A 3OUFA 3F7VC 4PA7A 4JTAB 3F5WC 4XDKA 4WFFA 1ORQC 2WLIB 1R3IC 3E86A 3JYCA 4R7CA 2EIJC 5B1AC 5EC2C 2Y69C 4TWKA 3BEHA 3K06A 4G28B 4P30A 1QLEC 2IH1C 2OCCC 3SPHA 1K4DC 4JTCB 2DWEC 4RAIA 3SPIA 3SYOA 4HYOA 3SPCA 2DYRC 3ZJZA 5E1AC 3ABKC 1R3LC 3OUSA 3SPJA 2P7TC 3OGCC 3AG4C 3SYCA 4H33A 4WFHA 5CBGA 1K4CC 1V55C 2DYSC 4GX2A 4RUEA 3TCUA 4R8CA 5J9PC 4LCUC 4MVSA 5EK0A 4GX5A 1JVMA 4PDLA 4GX1A 2HVKC 3F7YC 3E8BA 4DXWA 3ASNC 2Q68A 2HFEC 2YEVA 4MVQA 2EINC 3FB8C 4UUJC 2ATKC 4RUFA 3T4DA 3ABMC 4QE7A 4CBCA 4PDVA 2BOCC 2ITCC 1LNQA 2NLJC 5CBHA 2X6BA 3EFFK 5EBMC 2EILC 4MTOA 3UKMA 1OCZC 3AG1C 3E8GA 2HG5C 2W0FC 2R9RB 4MS2A 3IFXA 1G4YB 4ZBMA 3SJQC 2WLKA 3STZC 4PDRA 3RW0A 3SYAA 5EBLC 2Q67A 2BOBC 3ZRSA 2QKSA 3ABLC 3LUTB 3SPGA 4PA3A 3PJSK 2IH3C 5KUKA 3GB7C 4HZ3A 3OR7C 1OCOC 4I9WA 5IY5C 1M56C 2A9HA 4X8AA 4JTDB 5B3SC 4MW8A 2K1EA 4OXSA 1S5HC 3RVZA 4MVMA 3K04A 4H37A 4PA6A 4XDJA 2WLLA 1R3JC 3SYQA 4LP8A 4J9ZB 1ZWIC 3LDDA 5B1BC 2KB1A 3LDCA 4MVRA 4P9PA 4PA4A 4QE9A 4KFMA 3R65A 4RO2A 1KKDA 1J95A 3LDEA 3AG3C 1XL6A 2X6AA 2DWDC 3E83A 4PA9A 4BW5A 4MVUA 3STLC 3T4ZA 5BZBA 2WLHA 1BL8A 2WLIA 2A0LA 2EIMC 1XL4A 2ZXWC 2HJFC 3E89A 1V54C 5EC1C 1R3KC 3FB7C 4GX0A 5KUMA 2WLMA 2AHZA 3T1CA 3K0DA 2H8PC 3FB5C 3LNMB 3WG7C 2X6CA 3KG2A 4MTFA 1P7BA 4WFEA 3RBZA 4J9YB 3E8HA 3VOUA 2ITDC 4EKWA 3K08A 3K03A 4QNHB 4P9OA 3ASOC 2JK5C 2Q69A 2WLJA 3AG2C 2AHYA 4G27B 4R6ZA 2WLNA 2EIKC 4PDMA 3OR6C 3UM7A 3TETA 5CBFA 3E8FA 3HPLC 3K0GA 4MW3A 4X89A 4X88A 1OCCC 2WLLB 5EBWC 3RVYA 3T2MA 3FB6C 4LBEC 2ZD9A 4MVOA 3SYPA 2Q6AA 4MSWC 2QTOA 3X2QC 2A79B 4MTGA 4F4LA
chains in the Genus database with same CATH superfamily
1PL4A 2WPDG 4ZI7A 1JCHA 1OCRC 3RT3C 4FLTA 4FZ1A 3RYCB 3B40A 3TJTA 5LP6C 4UV8A 3CX5F 3QO8A 3FKSG 3JAKB 4R7CA 2N04A 2YICA 2Q7EA 4DK0A 2UXDO 3BEHA 4LFCO 2P5OA 2OCCC 5CA0A 3T1YB 1NI8A 3VQXA 2CGOA 1RPRA 2HR3A 5E1AC 1CEZA 5C8YA 5CBGA 4PDLA 3AK1A 4UVAA 4MTXA 3FB8C 5L3GA 4PDVA 2NLJC 4ZHQB 1KB9F 4DRXB 3NR7A 3E8GA 2L35A 4F6RA 3BHPA 1SA0A 3F5TA 1P4RA 2R72A 2JGUA 1RM1B 2JS3A 4N21A 2BTOA 1WA8B 4LFAB 4I4TA 1V54B 1H2KA 1SQGA 3SGIA 1WAZA 4Q20A 3G4SV 4AQYO 1FFXA 2GBOA 4MVRA 1SZTA 1RM1C 3R65A 1E79G 1KKDA 4DR4O 4W4LA 4BW5A 1BL8A 3C90A 1V54C 3SJBC 2QE7G 1I7FA 3LSQA 5KUMA 1I5YA 4CS2A 4DUZB 3HKDB 4JI6B 3WB2A 3K9SA 2A06H 1SQBH 4DR3O 2RJZA 2YDEA 1TUBB 3AG1B 3TXQA 3UT5A 4Q6GA 3KCXA 2ADQB 2YI9A 4LWSA 2BTQB 3OEHG 3F7VC 4JTAB 5KMGA 1BT8A 3P3NA 1N34B 3CJHB 4LF6O 4FLVA 4HYOA 3ZHRA 2B1IA 1XNQB 1NS1A 4UCOA 3BA9A 4PELA 1SERA 5LXTA 4B7KA 3S3XA 2GTSA 3N2KA 2DJVA 5J9PC 1QQCA 3CCUV 3T1HO 4GX1A 3F7YC 1DK1A 4YHHO 1N4CA 3ZRVA 3J80N 4JYAO 1Y76A 4UUJC 4YIOA 1K73W 5LHIA 3CC2V 1TGOA 1LNQA 5JVDA 4DV3O 1H2SB 1Q90D 4MTOA 1PL0A 3I56V 5H2FZ 2PI4A 4B3MO 4AILC 2CAZC 2F1MA 1RSOA 2C2AA 3ZCCA 2LP7A 4JYYA 4O2BB 5LP6A 4YXWG 3QG5A 4X66O 3JD0A 3CRAA 1I5XA 4OXSA 1S5HC 4XDJA 1KMIZ 1AR1B 4O4LA 5CA1A 5FPRA 1YF2A 2YSUB 1AB3A 2VWJA 4JI1B 4LC1A 3RYCA 5IWAB 3JAKA 3CB2A 1R3KC 1SQQH 1BE3H 3ABTA 3ABKB 2AHZA 1VEWA 5JJNB 3K0DA 1ZX3A 2H8PC 3MD0A 1Q6HA 2HHHB 3J7AU 2AW9A 3DC5A 1M93A 5L3BA 4CH4A 4JI7B 1N33O 1K9MW 2DE0X 1B06A 3BFRA 3JASB 2WLNA 4ZKIA 1Q43A 2DW4A 3HPLC 1KECA 2WLLB 4DR2O 5FPOA 2Q6AA 4ZHQA 1FXKB 4DRXA 3ZN1A 5IYBO 3OUFA 3J81N 1XMOO 1G1XB 2UU9B 1R3IC 4DR1B 1S5LZ 4TWKA 3KCYA 1WA8A 1FXKC 4FFBB 1HDJA 4F6EA 2IU0A 2XASA 4LF5O 4K8ZA 4LCUC 3CXCU 1I94O 3P30A 3LSSA 2ILMA 1GN2A 2WWWA 4JZ2A 1IBMB 1Q6UA 2XTAA 4ZIBA 2W0FC 4NKGB 1G4YB 3HKDA 3TK1A 3L9DA 2PI5A 4JI0B 2X0LA 1MNGA 1AR4A 5FNVB 4OX9O 2QTSA 4H0LB 1BHBA 1WP8A 1AI5A 2A9HA 4GT1A 2YXLA 2K1EA 1YJ9V 1TUBA 3RVZA 1R3JC 2CUGA 5CA3A 3U10A 2P90A 1NTZH 3ETDA 4X9QA 4JAUA 3AG3C 1XL6A 2VQFO 2BTQA 4LF4O 5LMUB 3RYHB 1XMQB 3ASOB 1HR0B 5TISZ 1IXMA 2ZE7A 1QVFU 1BZKA 4JI3B 3CJHA 3CCRV 1OCCB 2E75B 4DV4B 4OPAA 4RWUA 4IGGA 3ASOC 1N32O 2WA3A 2CDYA 4I0XB 4NXNB 1YVWA 2KSDA 1HNXB 4NXMO 1K8AW 1OCCC 2IJIA 1XI1A 2LFSA 4DW0A 2LGQA 3OTOO 2DYRB 4D7TA 4D7SA 2QWPB 1Y66A 5K1XA 1SESA 1SZXA 3CCEV 3OTFA 3CPWU 2FMLA 2DWEC 4O2BA 1IBLB 1GAXA 2AZ0A 1PNMA 2DYRC 3ZJZA 3ABUA 1IXBA 2LFRA 3VQVA 5LGNA 4WFHA 2PYJA 3ZMTA 1JA8A 1Y67A 4GUNA 5EK0A 4I7ZB 2OWOA 1NVPB 1XBLA 1WN7A 3OM3B 4J7KA 4YY3O 2FYUH 3VQYA 3APQA 2NNUA 1WNSA 2ATKC 3WFVA 5IYDO 4CBCA 5LBQA 2Q4PA 2ZQMA 4JI8O 3IFXA 4PI2A 3SYAA 1W0KG 4X62B 2ZNJA 1VQMV 4U3FH 4UCUA 3JSNA 1JJOA 3JASA 4I9WA 1BGYH 2UXCB 4X1KB 1GKFA 2WLLA 3G71V 4C7UA 4LF7B 1F4NA 1WJZA 4JASA 1FXKA 4QJFB 4P9PA 1J95A 5GTHZ 3FD9A 3K5LA 2B5UA 2CK3G 1FJGO 4FZ0A 4NYKA 4BR6A 1NBMG 2Z5UA 2WLMA 2ZDIC 5CA0B 4TSFG 2VQEB 4FFBA 1WB7A 4DV6O 4K0KO 1PM9A 2UUAO 1SF9A 2UXDB 1QLEB 1YZBA 4MVOA 1GO3F 3HKEB 1HNZO 1E1RG 4F6RB 1SA0B 1EZVH 2E76B 1JJ2U 1Q8IA 4GLXA 5FNVA 2B9ZA 4P30A 1NVPD 1QLEC 3ABMB 4BIUA 3JAMN 3CP1A 1PNKA 2QGNA 1PD3A 2F4VB 3ICXA 1YJNV 4BIZA 2HFEC 4EEQA 5LMNB 2JGDB 4WF9V 3ABMC 2E3CA 3RYHA 3Q4HB 1N8RW 1VF6C 5IE9A 1UJWB 3H9VA 1IX9A 4AQYB 2FTKA 2WSSG 4UFZA 2P67A 5B66Z 3PJSK 2Q8VA 1Y4MA 3PN1A 4DR4B 4DW1A 4I0XA 2QA4V 4B3TO 4FLXA 3UO3A 2XAJA 4B08A 3OE7G 1RFYA 3BRCA 3EVKA 1ZWIC 5DECA 1CXZB 3H1KH 4QE9A 3JD2A 3JCUZ 3G6EV 1IBKO 3E22B 1OHHG 1MSDA 4DR3B 3ZEDA 1D5AA 3S3WA 2JEUA 4DYLA 4DUYB 1G6UA 2X6CA 2F43G 5H5NA 3HB3B 2KKWA 2F66C 3K08A 3K03A 5L3DA 2OIEA 1XDCA 2OIGA 3L75H 5EYPB 5LGUA 4LF6B 3FB6C 2F23A 3K5MA 5L3EA 3P3PA 5KHIA 3FFQA 2Q5ZA 2V4DA 3I5DA 2GV9A 2RMKB 3ZMZA 5AG2A 4Z2WA 3W7SA 2QEXV 1Q5OA 4JYAB 5BMVB 3CE2A 5L3CA 4DV3B 1XILA 3QO5A 1EBOA 5LGTA 4X1KA 2MK3A 2QWOB 2CTQA 1ZL8B 4B3MB 2ZDIA 2ARHA 1BHAA 1XQ8A 4NB5A 2Q9LA 1M9NA 1YIJV 2K9PA 3O9OA 3D8CA 5JH7B 4X66B 1N36O 4IHJB 2XOKG 1S3JA 2OYQA 3STZC 3CRRA 4PDRA 1Y6XA 1EN6A 2HKOA 3ZIAG 5GTIZ 3GB7C 5BXZA 5D5QA 2ZCEA 1VP7A 5H6RA 2QJ1A 2YIAA 1NR7A 1K33A 2XAFA 3A0RA 1K5SA 3HKEA 2PYLA 1N33B 2EX3A 3DC6A 5GW7A 2WLHA 1S77D 2F95B 4JV5B 1VF7A 2NR5A 1EM1A 1FS0G 3CS5A 3QVNA 4YJ3B 4DR2B 3ETGA 2VS0A 3K79A 1VF6A 5KHKA 2N05A 3VOUA 1XMOB 3CRQA 4TQFA 2WLJA 5JJJB 3CCVV 2CTPA 3CRMA 4X89A 2JGDA 4FVMA 1ZLZA 3Q4HA 2ZD9A 5LHGA 1HNWB 4J10A 4WFGA 4GKJB 2YC0A 4LF5B 3AG7A 3E86A 1I94B 4H44B 1VQ9V 3WU2Z 2ZR2A 3IJ4A 1R6TA 1LUVA 1QR8A 1FYJA 1VQOV 4JGSA 5HFLA 4GX5A 1JVMA 1KC8W 1YITV 3L70H 3E8BA 4FLWA 3CCQV 4OX9B 3E22A 4RUFA 5CBHA 4IT5A 1KD1W 2X6BA 1AVMA 2JEXA 3TGUH 3AG1C 4PI0A 3CMEV 1XEQA 3C3SA 2Y0PA 2Q67A 3HKBB 3P32A 1QCEA 1RP3B 2VQFB 4LF4B 3KZIZ 4HZ3A 1H2NA 4E2LA 5EYPA 2JIZG 1YI2V 4I50B 4D6TH 4LP8A 4IYHA 1GH6A 3LDEA 3D3QA 2DWDC 1JR9A 1XL4A 2EIKB 4NXMB 4UB8Z 5BMVA 5K1PA 3OTOB 3RBZA 3JD3A 4J9YB 2Y48A 3DGEA 1ZL8A 1NR1A 5JQGB 1DF5A 4R6ZA 4GKKO 4G27B 2CH7B 2EIKC 2VRZA 1WB8A 1I0HA 2QWNB 3HKCB 3K0GA 3D3IA 2ZM6B 5EBWC 5JH7A 4MVZA 1NT2B 4IHJA 4DR7O 3THOA 4XDLA 1O9GA 5IYCO 2DMXA 2WLIB 4YY3B 2ETNA 1SC5B 1MSWD 2ADPA 4HAMA 3CSXA 4QPKA 3SPHA 3SYOA 1M5IA 1PP9H 3BABA 3ABKC 2ZE6A 5IT9N 4KXRA 4JI8B 2OT5A 2JDIG 1GM7A 5CB4B 3W7TA 1H2LA 3G67A 1OJHA 3A8TA 3M7MX 5KLVH 2RQ6A 4K3AA 2A7WA 1KP3A 1U96A 4YJ3A 1KP2A 5DEDA 3RW0A 2AZ2A 3C3TA 1KBHA 3GWOA 3JD4A 2GUZB 1FJGB 4J41A 1KKCA 1XOUA 2EIMB 1D2DA 3I55V 1NZ6A 4UVBA 3AEIA 1QR9A 1M1KW 1RPOA 1J5EB 4DV0O 2X7RB 4KFMA 5IJ0A 2CTRA 4NTXA 4DUZO 4DV6B 4K0KB 2EIMC 4A5UB 3AG2B 4JI6O 2HJFC 2UUAB 4N23A 1QNMA 1NKDA 3ZMSA 2LO1A 4NTYA 5B1NA 3LNMB 1HNZB 3VQWA 1T5EA 4FM0A 3FYEB 2YUAA 1F23A 2YIDA 2AHYA 3AG2C 3A0HZ 3SJCC 3E8FA 2ZNIA 4O4HB 3CC4V 3HR0A 2QTOA 4F4LA 2UUBB 2UXBO 3L73H 3JARB 1N34O 1YCIA 5EIBC 4UCTA 4XDKA 2XAHA 4EB6B 2JRIA 3HKBA 1AJPA 5B1OA 3WB0A 5KX5B 2LW1A 2EILB 3MDSA 4JI2O 4I50A 2D2CB 1HP8A 2LJ2A 4DR5O 1WP7A 3N2GB 2FKXA 1QHTA 3BCCH 1K7DA 2BOCC 3ZHUA 5KA5A 1IURA 4X64O 2P22C 5EBMC 2EILC 5B3SB 1COWG 2HG5C 1YHQV 1NQTA 4ZBMA 3CXHF 1YTFB 1BSMA 2QKSA 5IYZB 4FMTA 2IH3C 3U11A 5JQGA 2BE3A 2CH7A 1AJQA 5B3SC 4NTWA 3HKCA 2E5LO 2OTJV 1ENVA 3QTCA 1XNRB 2UXXA 2KB1A 5LA6B 4AI8A 4JAAA 4BWAA 1HW7A 3M8AA 1JQ0A 2NN4A 4J7JA 4DV1O 4B3SO 1Q7YW 2N74A 2WLIA 4ZOLB 4GX0A 5EIBD 1PKXA 3ETQA 1SS3A 4DV7O 2UUCO 1M57B 4JF3A 2XAQA 2P4VA 4DR6B 2JS5A 3BA8A 3BAAA 4RQFA 1JX9A 5CB4A 1QBZA 3B4SA 3OR6C 2IU3A 1M90W 1NTKH 2EIJB 5A2QN 4LF8O 1LR1A 3G6BA 2A79B 4UCRA 4DR1O 1VF5B 1M57C 3SR2C 5JJEB 1FD9A 5BR8B 2EIJC 4J80A 2ODMA 3RGBA 2IH1C 2GTAA 2DQ3A 2GUZA 2JJ2G 2QWQB 1L0LH 1OV9A 4LFCB 3H1JH 3E35A 4L8JA 4K35A 1IBMO 1B3QA 2O57A 1JMKC 2AXTZ 4MVQA 1YTFD 2IJJA 2L6LA 2AGAA 2PF4E 5D5PA 1M56B 3CYOA 1IZ3A 2WAMA 4LFBO 3N27A 2P4KA 2YI8A 1US6A 4CC6A 5JCOC 4JZGA 3DXRB 4PHZA 3K58A 4TT3G 2F93B 2YXYA 1M56C 4JTDB 4Z1VA 3CHXA 3SYQA 4O4HA 1XMQO 3WG7B 5KA6A 1XHZA 4PA4A 4DV5O 2DOSA 2BCCH 3MHHC 3JARA 4HNAB 4XBFA 4FFKA 2YS8A 5BZBA 2IJKA 4EB6A 3E89A 4CH3A 1MOFA 2VWKA 1DLBA 3WG7C 3CMAV 4I55B 5KX5A 4LH7A 4QPJA 1VQ7V 3E2EA 1VMGA 2PZSA 3H1HH 4QNHB 1BQ0A 3N2GA 1GM8A 5B1AB 2Y69B 1VQ6V 2Z0AA 5ITZB 3RVYA 4PV1B 1X59A 1AI4A 4Z1MG 4WBNB 2R9IA 3AG4B 1MZEA 4FLZA 4R50A 2RCVA 2YIBD 1IBLO 5KHHA 3SJAC 5IYZA 5B1AC 1EZJA 2Y69C 4JYCA 1F51A 5H9CA 4B3RO 3SPJA 3OUSA 3AG4C 3SYCA 4J11A 2H94A 4FM1A 5JWPA 3CCMV 5LA6A 2HVKC 2Y0IA 4IL6Z 1U97A 1BQZA 3OD4A 3T1HB 3JAWB 3EFFK 4ZOLA 1S0VA 4YHHB 3QO7A 4LR3A 4FLYA 1N0JA 1Z5VA 1BCCH 4X65O 1B04A 5BY1A 1E1QG 3ZRWB 3O65A 2UXCO 2QWRB 5KHJA 3ZBHA 3GVMA 3OR7C 1VQ5V 2ZXWB 2Z3YA 4MVMA 4H37A 4K8XA 5F2VO 1EN5A 2JVDA 2BSKB 4RO2A 2YEVB 3B2EE 1AP6A 2FB5A 4PA9A 2OCCB 2VQEO 2QSAA 2OCHA 5CMUA 4GKKB 1L1FA 2ZXWC 2CGNA 4RQEA 1YJWV 4E4EA 1GMGA 3W7UA 2LQTA 2YIBA 3A2FA 4TOIA 4DR7B 4BW9A 1WPBA 3CRCA 5JCOA 5CBFA 3H01A 4JYBA 4MW3A 4G2KA 4QIWF 5J2UB 3T2MA 1D5NA 4MSWC 2DQ0A 1R6KA 1YXBA 3BPZA 4PA7A 2DYSB 1V55B 1L8DA 2EZPA 4U7OA 5LL6Y 1F4MA 5EC2C 3DXRA 5HFMA 3ASNB 4B7EA 3B77A 1K4DC 4JTCB 1S5JA 3SPCA 1KQSU 2F4VO 4LF9O 1W2BU 1JPXA 2Q7HA 1ROPA 2GDSA 5LMNO 1K4CC 1V55C 2DYSC 1K97A 2XNDG 1SQPH 1YEWA 4R8CA 3ASNC 5IJ0B 4YJ2B 3ABLB 4HNAA 4DK1A 1CPYA 4PJ0Z 4QE7A 3EXAA 3UCSC 2W0XA 4NVPA 1A32A 2ITCC 5DN6G 1JFFB 2JJ1G 2ZIMA 2ZR3A 1OZ0A 3K3WA 4CS3A 2R9RB 3W7WA 2WA4A 4DV0B 4I55A 3ZRSA 3ABLC 1GTOA 5DM6V 1H2GA 3K59A 1WLEA 3JD1A 4FJCC 3KKYA 4X8AA 1P49A 5EZYB 2OTLV 4KHPO 1AROP 4MW8A 4TV8B 5ITZA 3L74H 3AK2A 4FPPA 1UPGA 3B8NA 4WBNA 4JI5O 1L0NH 3DSQA 2RNBA 4DUYO 4MVUA 5J2TB 2E74B 5EC1C 2GHYA 3ZHSA 3RYFB 2ZT9B 2KQXA 2A3QA 4EFEA 3JATB 1P7BA 1DTOA 2UXBB 4DV2O 2ITDC 4EKWA 1GRJA 4IYIA 2JK5C 2Q69A 1ZUQA 4J42A 2YXHA 1KUQA 2H3OA 2CTWA 1K3EA 1N32B 2IBZH 3JALB 1YSCA 4KUMA 3JAWA 2ZE5A 4UCSA 2M6YA 4JI4O 4P2ZA 4EFBA 4JI2B 3IGAC 1SRYA 2HVJC 1YDXA 1K92A 2HP8A 3F5WC 4CZZA 4DR5B 3ZRWA 4I9QA 1R6NA 4I5SA 1IDSA 4X64B 1K34A 1Z2GA 2PY5A 3FX7A 1NTMH 5IJ9B 4GX2A 1EFRG 3DTUB 2HEPA 5LOVB 2BSKA 5KHGA 4UCVA 3IAYA 2YEVA 1MZFA 3G80A 1O9HA 3CCJV 3T1YO 5IY5B 1Q82W 1AILA 4GCZA 3K5NA 2E5LB 1VQNV 2QKAA 2QM7A 3ZHVA 1NH2B 2R9AA 2QDOA 3ZHQA 3CWBH 4O2AB 5B1BB 1ZAUA 4X1YB 1VQ4V 3D36C 3LUTB 4FK5C 3BY6A 5LHHA 3RYIB 1URFA 2CE4A 4DV1B 4B3SB 2V7QG 4UVCA 5IY5C 4TQDA 1AI6A 3K04A 5J2UA 1FKAO 1VQ8V 3LDDA 5B1BC 3MAQA 3LDCA 1BS3A 1QU7A 4DV7B 2UUCB 4O4JB 4JV5O 1DF4A 4NR1A 5L3FA 2ZINA 1AR5A 2RDCA 4YIPA 4LFAO 3K9AA 1R1BA 3CCSV 3OMNB 4UV9A 2P06A 4LF8B 1SQVH 2B1GA 3FB5C 4X1IB 3ZHTA 3E8HA 1ZSPA 4P9OA 1GN4A 2ZKOA 3R66A 4FIPC 1HNWO 3LNNA 4HBNA 3IC9A 4YJ2A 1KU9A 1TAEA 2LGWA 3LSUA 4GKJO 2G38A 4LBEC 1AP5A 5B5EZ 1JFFA 4KL1A 4TV9B 4O4IB 3QNEA 1PNLA 3JSLA 4KP4A 1FXHA 4WFFA 3OMAB 3UQ8A 3CEIA 3APOA 3OT7A 3SDLA 1X4TA 4JAVA 2EINB 1JOYA 1MG1A 4RAIA 3ZRXA 3SPIA 1Q81W 5EZYA 3B09A 4MT8A 4TV8A 4LFBB 5C93A 5LYJB 3AG3B 1CP9A 2Q0AA 3MHSC 1ZTEA 1NH2D 1VIBA 2EINC 5E79Z 1SQFA 3OGIB 4CH6A 5J2TA 1HWYA 2EULA 3NXSA 1XNQO 3UKMA 4H13B 2P6JA 3RYFA 3ZS8C 4AHCA 4U3JB 4MS2A 3JATA 2Q7GA 4DV5B 3OEEG 2QKCA 3FYIB 4LH6A 1KYOF 2Q73A 1Q3EA 2XUMA 4ABMA 4TUYB 3VBBA 3JALA 4X20B 4B3TB 3ZN0A 4IIJB 4GZRB 2HLDG 3CD6V 2ZIOA 2QR4A 3STLC 2XHBA 3CCLV 1BMFG 1XHXA 3FB7C 1IBKB 5GONB 2QM8A 5IDJA 1VQLV 4BIOA 3OFNG 4UXNA 4BAYA 1B6QA 3KG2A 1FPOA 4MTFA 2ZE8A 1FXVA 1FAFA 1Y74B 5IJ9A 4W4KA 4JI1O 2IJHA 1MABG 1N0NA 5IWAO 2ZM6O 1P7GA 5LOVA 1WPXA 3UM7A 3TETA 3D36A 4X88A 4FM2A 2PGGA 2V1DA 2HHHO 3ZX6A 1VARA 4LNUB 4JI7O 2W6JG 4B3RB 1DGSA 4ASUG 3RWRD 1TA8A 4O2AA 4X1YA 3L71H 2FL4A 4PD4F 1M4UA 3RYIA 4G28B 3B8MA 3CC7V 2QM4A 2GSMB 3FAVB 1V9PA 2D3OW 1H2MA 5H6QA 3W7XA 1R3LC 4U7NA 2P7TC 1OCZB 3OGCC 4H33A 1TVKB 3ZMVA 4RUEA 3TCUA 2PTMA 4MVSA 3K57A 2UU9O 3RN4A 4X65B 4O4JA 1TUEB 2KG7B 4DXWA 3OMIB 3ETEA 5CN0A 3JCZA 5KAIZ 1EN4A 3K5OA 1OCZC 1SETA 4ZI7B 3M99B 3TXSA 4WFBV 3SJQC 4X1IA 1FFTB 2BOBC 4JPRA 2Q0OC 1N36B 1H8EG 3SPGA 5KUKA 3EHBB 5KAFZ 5FL7G 1SQXH 1J5EO 1VQPV 1XREA 3AK3A 1H38A 2IM9A 1GK9A 4PA6A 5C8YB 2Y4UA 1G8MA 5A9GA 4JI0O 1AJNA 4TV9A 1MA1A 3H1LH 4O4IA 2X6AA 1PPJH 2XAGA 4DO2A 4OGQB 3E83A 3T4ZA 2R70A 1AI7A 1R73A 1Z5WA 1GN3A 2UXNA 4J7ZA 4CC5A 1W59A 4WFEA 5LYJA 5LMUO 2MW2B 1HR0O 4PDMA 1XUQA 4QGPA 4I4TB 4WCEV 2UUBO 3L72H 4JI3O 2IW5A 2Y4TA 2LW7A 4CS4A 1FFXB 3SYPA 1S76D 3A0BZ 4LF9B 1H8HG 4DV4O 1THZA 1I08A 4ICGA 4U3JA 2HJDA 1ORQC 3JYCA 4FLUA 4NXNO 1MMMA 4L87A 1GM9A 1HNXO 1S72V 3K06A 1UFIA 2RN9A 1QLNA 4CH5A 4TUYA 1NJIW 1QVGU 1P84F 3RFRA 4UB6Z 3OW2U 4X20A 4IIJA 2Q68A 3T4DA 2EBOA 3UT5B 3WB1A 1OCOB 3H1IH 1K5QA 4OPHA 4KHPB 5GONA 1Q86W 4LWSB 2WLKA 2DN9A 5EBLC 1LUWA 4PA3A 1SKVA 5KMGB 1Y74A 4JI5B 1PV0A 1W0JG 4GYCB 3QF7A 1OCOC 1XNRO 3ZMUA 2EJ7A 1F7YA 1NU1H 5LXTB 3N2KB 4J9ZB 4LNUA 4X62O 1IVSA 3UO2A 5FLXN 2W6IG 2EZOA 4DV2B 1Y76B 2PUSA 3U0ZA 5JVDB 2A0LA 2EJRA 1VQKV 3T1CA 3GWKC 3BVOA 4DR6O 4LF7O 3FAVA 2XT9A 1RSOB 3X2QB 4JI4B 1OCRB 1TVKA 3ML0A 4WFAV 5LP6B 2M7WA 3IC7A 2KG7A 1Q6IA 4O4LB 5CA1B 5BR8O 3OAAG 1GN6A 3X2QC 4MTGA
chains in the Genus database with same CATH topology
2WPDG 1JCHA 1OCRC 1E1RG 4P2ZA 3IGAC 1SRYA 2HVJC 1K92A 3F5WC 4XDKA 4UV8A 2XAHA 4CZZA 1JJ2U 3QO8A 3FKSG 4R7CA 3ZRWA 1R6NA 3BEHA 4P30A 1NVPD 1QLEC 4I5SA 1AJPA 5B1OA 2OCCC 3ABMB 1K34A 1RPRA 2HR3A 5E1AC 2EILB 4BIUA 3CP1A 1CEZA 1PNKA 5CBGA 4GX2A 1EFRG 1PD3A 3DTUB 4PDLA 1YJNV 4UVAA 4BIZA 2HFEC 2YEVA 4MTXA 3FB8C 5L3GA 4WF9V 3ABMC 1K7DA 3CCJV 4PDVA 2BOCC 2NLJC 5KA5A 1N8RW 5IY5B 1Q82W 5EBMC 2EILC 1UJWB 5B3SB 4GCZA 1COWG 3E8GA 2HG5C 1YHQV 1NQTA 4ZBMA 1VQNV 2QM7A 1NH2B 2FTKA 2WSSG 1YTFB 1P4RA 2P67A 5B1BB 2QKSA 1VQ4V 3LUTB 4FMTA 3PJSK 4FK5C 2IH3C 3BY6A 5LHHA 1RM1B 1Y4MA 4N21A 2V7QG 4UVCA 5IY5C 2QA4V 1AJQA 5B3SC 1V54B 2XAJA 1AI6A 3K04A 2OTJV 1ENVA 1VQ8V 4Q20A 3G4SV 3OE7G 2UXXA 1ZWIC 3LDDA 5B1BC 2KB1A 3LDCA 4MVRA 1SZTA 4QE9A 1DF4A 5L3FA 3JD2A 3R65A 1RM1C 1E79G 1KKDA 1JQ0A 3G6EV 1OHHG 1Q7YW 4BW5A 2WLIA 1BL8A 3K9AA 1V54C 2QE7G 3CCSV 4GX0A 3LSQA 5KUMA 1PKXA 3OMNB 4UV9A 1I5YA 2JEUA 2B1GA 3FB5C 2X6CA 2F43G 1M57B 3HB3B 4JF3A 3E8HA 2XAQA 3K08A 3K03A 4P9OA 5L3DA 4RQFA 1JX9A 4FIPC 1QBZA 3OR6C 2IU3A 1M90W 2EIJB 3AG1B 5LGUA 3FB6C 4LBEC 2A79B 5L3EA 1M57C 3QNEA 3OEHG 3ZMZA 1PNLA 3F7VC 4JTAB 4KP4A 1FXHA 4WFFA 3OMAB 3W7SA 2EIJC 2QEXV 2IH1C 4JAVA 2EINB 5L3CA 1JOYA 1MG1A 4RAIA 3ZRXA 3SPIA 2DQ3A 2JJ2G 1Q81W 4HYOA 2B1IA 4MT8A 3QO5A 1EBOA 5LGTA 4PELA 1SERA 2MK3A 5C93A 2ZDIA 3AG3B 3E35A 5J9PC 1CP9A 3MHSC 3CCUV 4GX1A 1BHAA 3F7YC 1NH2D 4MVQA 3ZRVA 1YTFD 2EINC 2IJJA 4UUJC 1K73W 1M9NA 5LHIA 1YIJV 3CC2V 1LNQA 1HWYA 3NXSA 1M56B 3CYOA 4MTOA 3UKMA 2WAMA 1PL0A 3I56V 2P6JA 2XOKG 2PI4A 1S3JA 3STZC 4MS2A 4PDRA 2C2AA 2HKOA 3ZIAG 3OEEG 3ZCCA 4TT3G 3GB7C 2LP7A 3FYIB 1M56C 4JTDB 4YXWG 5H6RA 3JD0A 1I5XA 4OXSA 1S5HC 4XDJA 1AR1B 1NR7A 3SYQA 3VBBA 1K33A 2XAFA 3A0RA 3WG7B 5KA6A 1K5SA 4PA4A 3ZN0A 3MHHC 2HLDG 2YSUB 3CD6V 4XBFA 4LC1A 5GW7A 3STLC 5BZBA 2IJKA 2WLHA 3CCLV 1BMFG 1S77D 3E89A 1R3KC 3FB7C 2QM8A 3ABTA 5IDJA 1VQLV 3ABKB 2AHZA 1FS0G 1MOFA 3OFNG 1DLBA 4UXNA 3ETGA 3K0DA 2H8PC 3MD0A 3WG7C 4BAYA 3CMAV 1B6QA 3K79A 3KG2A 5L3BA 4MTFA 4QPJA 1VQ7V 1FXVA 3E2EA 1K9MW 3VOUA 2IJHA 4QNHB 1MABG 2WLJA 2WLNA 4ZKIA 1WPXA 3UM7A 2DW4A 3TETA 1GM8A 3D36A 5B1AB 3CCVV 2Y69B 3HPLC 4X89A 4X88A 1KECA 2V1DA 1VQ6V 2WLLB 3RVYA 2ZD9A 5LHGA 2Q6AA 1FXKB 2W6JG 3ZN1A 1AI4A 4Z1MG 4ASUG 2R9IA 3AG4B 4WFGA 5IYBO 4R50A 3OUFA 3E86A 1R3IC 5B1AC 1EZJA 2Y69C 1VQ9V 4TWKA 4G28B 2ZR2A 3B8MA 3CC7V 4JYCA 2GSMB 1FXKC 1F51A 5H9CA 2D3OW 5H6QA 1QR8A 3W7XA 1R3LC 3OUSA 4U7NA 2P7TC 1OCZB 3AG4C 3OGCC 4H33A 3SPJA 2IU0A 3SYCA 2XASA 1VQOV 2H94A 4JGSA 4RUEA 3ZMVA 4F4LA 3TCUA 5HFLA 4LCUC 4MVSA 4GX5A 1JVMA 1KC8W 3CXCU 3CCMV 1YITV 2HVKC 1TUEB 3E8BA 3P30A 3OMIB 4DXWA 3CCQV 3LSSA 2WWWA 4RUFA 3ETEA 5CN0A 5CBHA 1KD1W 2X6BA 3EFFK 3JCZA 2JEXA 1S0VA 3QO7A 1OCZC 1SETA 3AG1C 3M99B 3CMEV 2W0FC 4WFBV 3SJQC 1G4YB 3TK1A 1FFTB 2Q67A 2BOBC 2PI5A 2X0LA 4JPRA 1H8EG 3P32A 3SPGA 1E1QG 1QCEA 5KUKA 3EHBB 3ZRWB 5FL7G 4HZ3A 3OR7C 1BHBA 1AI5A 4E2LA 2A9HA 1VQPV 1VQ5V 4GT1A 1H38A 2ZXWB 1GK9A 2JIZG 2K1EA 2Z3YA 1YI2V 3RVZA 4MVMA 4H37A 4PA6A 1YJ9V 1R3JC 4LP8A 1G8MA 1AJNA 5CA3A 2P90A 3ETDA 4RO2A 2YEVB 3LDEA 3AG3C 1XL6A 4JAUA 2X6AA 2XAGA 4DO2A 2DWDC 3E83A 4PA9A 2OCCB 3ASOB 3T4ZA 1IXMA 1AI7A 5CMUA 1R73A 1XL4A 2ZXWC 1L1FA 2EIKB 1QVFU 2UXNA 4RQEA 1YJWV 3CCRV 1GMGA 1OCCB 3W7UA 4WFEA 3RBZA 3JD3A 4J9YB 2Y48A 3DGEA 1NR1A 1DF5A 3ASOC 4R6ZA 4G27B 2EIKC 4PDMA 5CBFA 4WCEV 3H01A 4JYBA 3K0GA 3D3IA 4G2KA 2IW5A 4MW3A 4QIWF 1K8AW 1OCCC 3T2MA 2IJIA 5EBWC 2LFSA 3SYPA 1S76D 4MSWC 1H8HG 2DYRB 4MVZA 1THZA 2DQ0A 4XDLA 1R6KA 4PA7A 4U7OA 2DYSB 1V55B 2EZPA 5IYCO 1ORQC 2WLIB 3JYCA 1F4MA 5EC2C 1Y66A 1GM9A 4L87A 5HFMA 1S72V 1SESA 3ASNB 3K06A 1MSWD 3CCEV 4HAMA 3B77A 4QPKA 3SPHA 1K4DC 4JTCB 2DWEC 3SYOA 3CPWU 3SPCA 1PNMA 2DYRC 3ZJZA 1KQSU 1W2BU 3ABUA 1QLNA 2LFRA 3ABKC 1JPXA 5LGNA 4WFHA 1ROPA 2OT5A 1NJIW 3ZMTA 1K4CC 1V55C 2DYSC 1QVGU 1K97A 2JDIG 2XNDG 4R8CA 1GM7A 5EK0A 3OW2U 3W7TA 1NVPB 3OM3B 3ASNC 2Q68A 3ABLB 1CPYA 2NNUA 2ATKC 3T4DA 3WFVA 5IYDO 4QE7A 4CBCA 2ITCC 2EBOA 1OCOB 5DN6G 5LBQA 2JJ1G 1K5QA 2ZR3A 1OZ0A 1Q86W 1KP3A 3K3WA 2ZQMA 2R9RB 3IFXA 3W7WA 2WLKA 1KP2A 3RW0A 3SYAA 1W0KG 5EBLC 3ZRSA 3ABLC 1VQMV 4PA3A 1GTOA 5DM6V 3GWOA 1H2GA 1WLEA 3JD4A 1W0JG 3JD1A 4FJCC 1OCOC 4I9WA 4X8AA 3ZMUA 2EIMB 2OTLV 3I55V 1AROP 4UVBA 3AEIA 1QR9A 4MW8A 1M1KW 1GKFA 2WLLA 3G71V 1RPOA 1F4NA 4J9ZB 4JASA 1FXKA 4QJFB 4P9PA 4FPPA 2W6IG 2X7RB 4KFMA 3B8NA 1J95A 2EZOA 2B5UA 2CK3G 4MVUA 2A0LA 2EIMC 3AG2B 2GHYA 2HJFC 2EJRA 4N23A 1NBMG 5EC1C 1VQKV 1NKDA 2Z5UA 3ZMSA 2WLMA 3T1CA 2ZDIC 4TSFG 5B1NA 3LNMB 3X2QB 1P7BA 1DTOA 1OCRB 2ITDC 3ML0A 4EKWA 4WFAV 3FYEB 2JK5C 2Q69A 1F23A 3AG2C 2AHYA 2M7WA 3IC7A 3E8FA 1K3EA 1QLEB 3CC4V 4KUMA 1YSCA 4MVOA 3OAAG 2QTOA 3X2QC 4MTGA 1GO3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M57 C;  4MVZ A;  1OCR C;  4P2Z A;  4XDL A;  3IGA C;  4WFG A;  2HVJ C;  4R50 A;  3OUF A;  3F7V C;  4PA7 A;  4JTA B;  3F5W C;  4XDK A;  4WFF A;  1ORQ C;  2WLI B;  1R3I C;  3E86 A;  3JYC A;  4R7C A;  2EIJ C;  5B1A C;  5EC2 C;  2Y69 C;  4TWK A;  3BEH A;  3K06 A;  4G28 B;  4P30 A;  1QLE C;  2IH1 C;  2OCC C;  3SPH A;  1K4D C;  4JTC B;  2DWE C;  4RAI A;  3SPI A;  3SYO A;  4HYO A;  3SPC A;  2DYR C;  3ZJZ A;  5E1A C;  3ABK C;  1R3L C;  3OUS A;  3SPJ A;  2P7T C;  3OGC C;  3AG4 C;  3SYC A;  4H33 A;  4WFH A;  5CBG A;  1K4C C;  1V55 C;  2DYS C;  4GX2 A;  4RUE A;  3TCU A;  4R8C A;  5J9P C;  4LCU C;  4MVS A;  5EK0 A;  4GX5 A;  1JVM A;  4PDL A;  4GX1 A;  2HVK C;  3F7Y C;  3E8B A;  4DXW A;  3ASN C;  2Q68 A;  2HFE C;  2YEV A;  4MVQ A;  2EIN C;  3FB8 C;  4UUJ C;  2ATK C;  4RUF A;  3T4D A;  3ABM C;  4QE7 A;  4CBC A;  4PDV A;  2BOC C;  2ITC C;  1LNQ A;  2NLJ C;  5CBH A;  2X6B A;  3EFF K;  5EBM C;  2EIL C;  4MTO A;  3UKM A;  1OCZ C;  3AG1 C;  3E8G A;  2HG5 C;  2W0F C;  2R9R B;  4MS2 A;  3IFX A;  1G4Y B;  4ZBM A;  3SJQ C;  2WLK A;  3STZ C;  4PDR A;  3RW0 A;  3SYA A;  5EBL C;  2Q67 A;  2BOB C;  3ZRS A;  2QKS A;  3ABL C;  3LUT B;  3SPG A;  4PA3 A;  3PJS K;  2IH3 C;  5KUK A;  3GB7 C;  4HZ3 A;  3OR7 C;  1OCO C;  4I9W A;  5IY5 C;  1M56 C;  2A9H A;  4X8A A;  4JTD B;  5B3S C;  4MW8 A;  2K1E A;  4OXS A;  1S5H C;  3RVZ A;  4MVM A;  3K04 A;  4H37 A;  4PA6 A;  4XDJ A;  2WLL A;  1R3J C;  3SYQ A;  4LP8 A;  4J9Z B;  1ZWI C;  3LDD A;  5B1B C;  2KB1 A;  3LDC A;  4MVR A;  4P9P A;  4PA4 A;  4QE9 A;  4KFM A;  3R65 A;  4RO2 A;  1KKD A;  1J95 A;  3LDE A;  3AG3 C;  1XL6 A;  2X6A A;  2DWD C;  3E83 A;  4PA9 A;  4BW5 A;  4MVU A;  3STL C;  3T4Z A;  5BZB A;  2WLH A;  1BL8 A;  2WLI A;  2A0L A;  2EIM C;  1XL4 A;  2ZXW C;  2HJF C;  3E89 A;  1V54 C;  5EC1 C;  1R3K C;  3FB7 C;  4GX0 A;  5KUM A;  2WLM A;  2AHZ A;  3T1C A;  3K0D A;  2H8P C;  3FB5 C;  3LNM B;  3WG7 C;  2X6C A;  3KG2 A;  4MTF A;  1P7B A;  4WFE A;  3RBZ A;  4J9Y B;  3E8H A;  3VOU A;  2ITD C;  4EKW A;  3K08 A;  3K03 A;  4QNH B;  4P9O A;  3ASO C;  2JK5 C;  2Q69 A;  2WLJ A;  3AG2 C;  2AHY A;  4G27 B;  4R6Z A;  2WLN A;  2EIK C;  4PDM A;  3OR6 C;  3UM7 A;  3TET A;  5CBF A;  3E8F A;  3HPL C;  3K0G A;  4MW3 A;  4X89 A;  4X88 A;  1OCC C;  2WLL B;  5EBW C;  3RVY A;  3T2M A;  3FB6 C;  4LBE C;  2ZD9 A;  4MVO A;  3SYP A;  2Q6A A;  4MSW C;  2QTO A;  3X2Q C;  2A79 B;  4MTG A;  4F4L A; 
#chains in the Genus database with same CATH topology
 1PL4 A;  2WPD G;  4ZI7 A;  1JCH A;  1OCR C;  3RT3 C;  4FLT A;  4FZ1 A;  3RYC B;  3B40 A;  3TJT A;  5LP6 C;  4UV8 A;  3CX5 F;  3QO8 A;  3FKS G;  3JAK B;  4R7C A;  2N04 A;  2YIC A;  2Q7E A;  4DK0 A;  2UXD O;  3BEH A;  4LFC O;  2P5O A;  2OCC C;  5CA0 A;  3T1Y B;  1NI8 A;  3VQX A;  2CGO A;  1RPR A;  2HR3 A;  5E1A C;  1CEZ A;  5C8Y A;  5CBG A;  4PDL A;  3AK1 A;  4UVA A;  4MTX A;  3FB8 C;  5L3G A;  4PDV A;  2NLJ C;  4ZHQ B;  1KB9 F;  4DRX B;  3NR7 A;  3E8G A;  2L35 A;  4F6R A;  3BHP A;  1SA0 A;  3F5T A;  1P4R A;  2R72 A;  2JGU A;  1RM1 B;  2JS3 A;  4N21 A;  2BTO A;  1WA8 B;  4LFA B;  4I4T A;  1V54 B;  1H2K A;  1SQG A;  3SGI A;  1WAZ A;  4Q20 A;  3G4S V;  4AQY O;  1FFX A;  2GBO A;  4MVR A;  1SZT A;  1RM1 C;  3R65 A;  1E79 G;  1KKD A;  4DR4 O;  4W4L A;  4BW5 A;  1BL8 A;  3C90 A;  1V54 C;  3SJB C;  2QE7 G;  1I7F A;  3LSQ A;  5KUM A;  1I5Y A;  4CS2 A;  4DUZ B;  3HKD B;  4JI6 B;  3WB2 A;  3K9S A;  2A06 H;  1SQB H;  4DR3 O;  2RJZ A;  2YDE A;  1TUB B;  3AG1 B;  3TXQ A;  3UT5 A;  4Q6G A;  3KCX A;  2ADQ B;  2YI9 A;  4LWS A;  2BTQ B;  3OEH G;  3F7V C;  4JTA B;  5KMG A;  1BT8 A;  3P3N A;  1N34 B;  3CJH B;  4LF6 O;  4FLV A;  4HYO A;  3ZHR A;  2B1I A;  1XNQ B;  1NS1 A;  4UCO A;  3BA9 A;  4PEL A;  1SER A;  5LXT A;  4B7K A;  3S3X A;  2GTS A;  3N2K A;  2DJV A;  5J9P C;  1QQC A;  3CCU V;  3T1H O;  4GX1 A;  3F7Y C;  1DK1 A;  4YHH O;  1N4C A;  3ZRV A;  3J80 N;  4JYA O;  1Y76 A;  4UUJ C;  4YIO A;  1K73 W;  5LHI A;  3CC2 V;  1TGO A;  1LNQ A;  5JVD A;  4DV3 O;  1H2S B;  1Q90 D;  4MTO A;  1PL0 A;  3I56 V;  5H2F Z;  2PI4 A;  4B3M O;  4AIL C;  2CAZ C;  2F1M A;  1RSO A;  2C2A A;  3ZCC A;  2LP7 A;  4JYY A;  4O2B B;  5LP6 A;  4YXW G;  3QG5 A;  4X66 O;  3JD0 A;  3CRA A;  1I5X A;  4OXS A;  1S5H C;  4XDJ A;  1KMI Z;  1AR1 B;  4O4L A;  5CA1 A;  5FPR A;  1YF2 A;  2YSU B;  1AB3 A;  2VWJ A;  4JI1 B;  4LC1 A;  3RYC A;  5IWA B;  3JAK A;  3CB2 A;  1R3K C;  1SQQ H;  1BE3 H;  3ABT A;  3ABK B;  2AHZ A;  1VEW A;  5JJN B;  3K0D A;  1ZX3 A;  2H8P C;  3MD0 A;  1Q6H A;  2HHH B;  3J7A U;  2AW9 A;  3DC5 A;  1M93 A;  5L3B A;  4CH4 A;  4JI7 B;  1N33 O;  1K9M W;  2DE0 X;  1B06 A;  3BFR A;  3JAS B;  2WLN A;  4ZKI A;  1Q43 A;  2DW4 A;  3HPL C;  1KEC A;  2WLL B;  4DR2 O;  5FPO A;  2Q6A A;  4ZHQ A;  1FXK B;  4DRX A;  3ZN1 A;  5IYB O;  3OUF A;  3J81 N;  1XMO O;  1G1X B;  2UU9 B;  1R3I C;  4DR1 B;  1S5L Z;  4TWK A;  3KCY A;  1WA8 A;  1FXK C;  4FFB B;  1HDJ A;  4F6E A;  2IU0 A;  2XAS A;  4LF5 O;  4K8Z A;  4LCU C;  3CXC U;  1I94 O;  3P30 A;  3LSS A;  2ILM A;  1GN2 A;  2WWW A;  4JZ2 A;  1IBM B;  1Q6U A;  2XTA A;  4ZIB A;  2W0F C;  4NKG B;  1G4Y B;  3HKD A;  3TK1 A;  3L9D A;  2PI5 A;  4JI0 B;  2X0L A;  1MNG A;  1AR4 A;  5FNV B;  4OX9 O;  2QTS A;  4H0L B;  1BHB A;  1WP8 A;  1AI5 A;  2A9H A;  4GT1 A;  2YXL A;  2K1E A;  1YJ9 V;  1TUB A;  3RVZ A;  1R3J C;  2CUG A;  5CA3 A;  3U10 A;  2P90 A;  1NTZ H;  3ETD A;  4X9Q A;  4JAU A;  3AG3 C;  1XL6 A;  2VQF O;  2BTQ A;  4LF4 O;  5LMU B;  3RYH B;  1XMQ B;  3ASO B;  1HR0 B;  5TIS Z;  1IXM A;  2ZE7 A;  1QVF U;  1BZK A;  4JI3 B;  3CJH A;  3CCR V;  1OCC B;  2E75 B;  4DV4 B;  4OPA A;  4RWU A;  4IGG A;  3ASO C;  1N32 O;  2WA3 A;  2CDY A;  4I0X B;  4NXN B;  1YVW A;  2KSD A;  1HNX B;  4NXM O;  1K8A W;  1OCC C;  2IJI A;  1XI1 A;  2LFS A;  4DW0 A;  2LGQ A;  3OTO O;  2DYR B;  4D7T A;  4D7S A;  2QWP B;  1Y66 A;  5K1X A;  1SES A;  1SZX A;  3CCE V;  3OTF A;  3CPW U;  2FML A;  2DWE C;  4O2B A;  1IBL B;  1GAX A;  2AZ0 A;  1PNM A;  2DYR C;  3ZJZ A;  3ABU A;  1IXB A;  2LFR A;  3VQV A;  5LGN A;  4WFH A;  2PYJ A;  3ZMT A;  1JA8 A;  1Y67 A;  4GUN A;  5EK0 A;  4I7Z B;  2OWO A;  1NVP B;  1XBL A;  1WN7 A;  3OM3 B;  4J7K A;  4YY3 O;  2FYU H;  3VQY A;  3APQ A;  2NNU A;  1WNS A;  2ATK C;  3WFV A;  5IYD O;  4CBC A;  5LBQ A;  2Q4P A;  2ZQM A;  4JI8 O;  3IFX A;  4PI2 A;  3SYA A;  1W0K G;  4X62 B;  2ZNJ A;  1VQM V;  4U3F H;  4UCU A;  3JSN A;  1JJO A;  3JAS A;  4I9W A;  1BGY H;  2UXC B;  4X1K B;  1GKF A;  2WLL A;  3G71 V;  4C7U A;  4LF7 B;  1F4N A;  1WJZ A;  4JAS A;  1FXK A;  4QJF B;  4P9P A;  1J95 A;  5GTH Z;  3FD9 A;  3K5L A;  2B5U A;  2CK3 G;  1FJG O;  4FZ0 A;  4NYK A;  4BR6 A;  1NBM G;  2Z5U A;  2WLM A;  2ZDI C;  5CA0 B;  4TSF G;  2VQE B;  4FFB A;  1WB7 A;  4DV6 O;  4K0K O;  1PM9 A;  2UUA O;  1SF9 A;  2UXD B;  1QLE B;  1YZB A;  4MVO A;  1GO3 F;  3HKE B;  1HNZ O;  1E1R G;  4F6R B;  1SA0 B;  1EZV H;  2E76 B;  1JJ2 U;  1Q8I A;  4GLX A;  5FNV A;  2B9Z A;  4P30 A;  1NVP D;  1QLE C;  3ABM B;  4BIU A;  3JAM N;  3CP1 A;  1PNK A;  2QGN A;  1PD3 A;  2F4V B;  3ICX A;  1YJN V;  4BIZ A;  2HFE C;  4EEQ A;  5LMN B;  2JGD B;  4WF9 V;  3ABM C;  2E3C A;  3RYH A;  3Q4H B;  1N8R W;  1VF6 C;  5IE9 A;  1UJW B;  3H9V A;  1IX9 A;  4AQY B;  2FTK A;  2WSS G;  4UFZ A;  2P67 A;  5B66 Z;  3PJS K;  2Q8V A;  1Y4M A;  3PN1 A;  4DR4 B;  4DW1 A;  4I0X A;  2QA4 V;  4B3T O;  4FLX A;  3UO3 A;  2XAJ A;  4B08 A;  3OE7 G;  1RFY A;  3BRC A;  3EVK A;  1ZWI C;  5DEC A;  1CXZ B;  3H1K H;  4QE9 A;  3JD2 A;  3JCU Z;  3G6E V;  1IBK O;  3E22 B;  1OHH G;  1MSD A;  4DR3 B;  3ZED A;  1D5A A;  3S3W A;  2JEU A;  4DYL A;  4DUY B;  1G6U A;  2X6C A;  2F43 G;  5H5N A;  3HB3 B;  2KKW A;  2F66 C;  3K08 A;  3K03 A;  5L3D A;  2OIE A;  1XDC A;  2OIG A;  3L75 H;  5EYP B;  5LGU A;  4LF6 B;  3FB6 C;  2F23 A;  3K5M A;  5L3E A;  3P3P A;  5KHI A;  3FFQ A;  2Q5Z A;  2V4D A;  3I5D A;  2GV9 A;  2RMK B;  3ZMZ A;  5AG2 A;  4Z2W A;  3W7S A;  2QEX V;  1Q5O A;  4JYA B;  5BMV B;  3CE2 A;  5L3C A;  4DV3 B;  1XIL A;  3QO5 A;  1EBO A;  5LGT A;  4X1K A;  2MK3 A;  2QWO B;  2CTQ A;  1ZL8 B;  4B3M B;  2ZDI A;  2ARH A;  1BHA A;  1XQ8 A;  4NB5 A;  2Q9L A;  1M9N A;  1YIJ V;  2K9P A;  3O9O A;  3D8C A;  5JH7 B;  4X66 B;  1N36 O;  4IHJ B;  2XOK G;  1S3J A;  2OYQ A;  3STZ C;  3CRR A;  4PDR A;  1Y6X A;  1EN6 A;  2HKO A;  3ZIA G;  5GTI Z;  3GB7 C;  5BXZ A;  5D5Q A;  2ZCE A;  1VP7 A;  5H6R A;  2QJ1 A;  2YIA A;  1NR7 A;  1K33 A;  2XAF A;  3A0R A;  1K5S A;  3HKE A;  2PYL A;  1N33 B;  2EX3 A;  3DC6 A;  5GW7 A;  2WLH A;  1S77 D;  2F95 B;  4JV5 B;  1VF7 A;  2NR5 A;  1EM1 A;  1FS0 G;  3CS5 A;  3QVN A;  4YJ3 B;  4DR2 B;  3ETG A;  2VS0 A;  3K79 A;  1VF6 A;  5KHK A;  2N05 A;  3VOU A;  1XMO B;  3CRQ A;  4TQF A;  2WLJ A;  5JJJ B;  3CCV V;  2CTP A;  3CRM A;  4X89 A;  2JGD A;  4FVM A;  1ZLZ A;  3Q4H A;  2ZD9 A;  5LHG A;  1HNW B;  4J10 A;  4WFG A;  4GKJ B;  2YC0 A;  4LF5 B;  3AG7 A;  3E86 A;  1I94 B;  4H44 B;  1VQ9 V;  3WU2 Z;  2ZR2 A;  3IJ4 A;  1R6T A;  1LUV A;  1QR8 A;  1FYJ A;  1VQO V;  4JGS A;  5HFL A;  4GX5 A;  1JVM A;  1KC8 W;  1YIT V;  3L70 H;  3E8B A;  4FLW A;  3CCQ V;  4OX9 B;  3E22 A;  4RUF A;  5CBH A;  4IT5 A;  1KD1 W;  2X6B A;  1AVM A;  2JEX A;  3TGU H;  3AG1 C;  4PI0 A;  3CME V;  1XEQ A;  3C3S A;  2Y0P A;  2Q67 A;  3HKB B;  3P32 A;  1QCE A;  1RP3 B;  2VQF B;  4LF4 B;  3KZI Z;  4HZ3 A;  1H2N A;  4E2L A;  5EYP A;  2JIZ G;  1YI2 V;  4I50 B;  4D6T H;  4LP8 A;  4IYH A;  1GH6 A;  3LDE A;  3D3Q A;  2DWD C;  1JR9 A;  1XL4 A;  2EIK B;  4NXM B;  4UB8 Z;  5BMV A;  5K1P A;  3OTO B;  3RBZ A;  3JD3 A;  4J9Y B;  2Y48 A;  3DGE A;  1ZL8 A;  1NR1 A;  5JQG B;  1DF5 A;  4R6Z A;  4GKK O;  4G27 B;  2CH7 B;  2EIK C;  2VRZ A;  1WB8 A;  1I0H A;  2QWN B;  3HKC B;  3K0G A;  3D3I A;  2ZM6 B;  5EBW C;  5JH7 A;  4MVZ A;  1NT2 B;  4IHJ A;  4DR7 O;  3THO A;  4XDL A;  1O9G A;  5IYC O;  2DMX A;  2WLI B;  4YY3 B;  2ETN A;  1SC5 B;  1MSW D;  2ADP A;  4HAM A;  3CSX A;  4QPK A;  3SPH A;  3SYO A;  1M5I A;  1PP9 H;  3BAB A;  3ABK C;  2ZE6 A;  5IT9 N;  4KXR A;  4JI8 B;  2OT5 A;  2JDI G;  1GM7 A;  5CB4 B;  3W7T A;  1H2L A;  3G67 A;  1OJH A;  3A8T A;  3M7M X;  5KLV H;  2RQ6 A;  4K3A A;  2A7W A;  1KP3 A;  1U96 A;  4YJ3 A;  1KP2 A;  5DED A;  3RW0 A;  2AZ2 A;  3C3T A;  1KBH A;  3GWO A;  3JD4 A;  2GUZ B;  1FJG B;  4J41 A;  1KKC A;  1XOU A;  2EIM B;  1D2D A;  3I55 V;  1NZ6 A;  4UVB A;  3AEI A;  1QR9 A;  1M1K W;  1RPO A;  1J5E B;  4DV0 O;  2X7R B;  4KFM A;  5IJ0 A;  2CTR A;  4NTX A;  4DUZ O;  4DV6 B;  4K0K B;  2EIM C;  4A5U B;  3AG2 B;  4JI6 O;  2HJF C;  2UUA B;  4N23 A;  1QNM A;  1NKD A;  3ZMS A;  2LO1 A;  4NTY A;  5B1N A;  3LNM B;  1HNZ B;  3VQW A;  1T5E A;  4FM0 A;  3FYE B;  2YUA A;  1F23 A;  2YID A;  2AHY A;  3AG2 C;  3A0H Z;  3SJC C;  3E8F A;  2ZNI A;  4O4H B;  3CC4 V;  3HR0 A;  2QTO A;  4F4L A;  2UUB B;  2UXB O;  3L73 H;  3JAR B;  1N34 O;  1YCI A;  5EIB C;  4UCT A;  4XDK A;  2XAH A;  4EB6 B;  2JRI A;  3HKB A;  1AJP A;  5B1O A;  3WB0 A;  5KX5 B;  2LW1 A;  2EIL B;  3MDS A;  4JI2 O;  4I50 A;  2D2C B;  1HP8 A;  2LJ2 A;  4DR5 O;  1WP7 A;  3N2G B;  2FKX A;  1QHT A;  3BCC H;  1K7D A;  2BOC C;  3ZHU A;  5KA5 A;  1IUR A;  4X64 O;  2P22 C;  5EBM C;  2EIL C;  5B3S B;  1COW G;  2HG5 C;  1YHQ V;  1NQT A;  4ZBM A;  3CXH F;  1YTF B;  1BSM A;  2QKS A;  5IYZ B;  4FMT A;  2IH3 C;  3U11 A;  5JQG A;  2BE3 A;  2CH7 A;  1AJQ A;  5B3S C;  4NTW A;  3HKC A;  2E5L O;  2OTJ V;  1ENV A;  3QTC A;  1XNR B;  2UXX A;  2KB1 A;  5LA6 B;  4AI8 A;  4JAA A;  4BWA A;  1HW7 A;  3M8A A;  1JQ0 A;  2NN4 A;  4J7J A;  4DV1 O;  4B3S O;  1Q7Y W;  2N74 A;  2WLI A;  4ZOL B;  4GX0 A;  5EIB D;  1PKX A;  3ETQ A;  1SS3 A;  4DV7 O;  2UUC O;  1M57 B;  4JF3 A;  2XAQ A;  2P4V A;  4DR6 B;  2JS5 A;  3BA8 A;  3BAA A;  4RQF A;  1JX9 A;  5CB4 A;  1QBZ A;  3B4S A;  3OR6 C;  2IU3 A;  1M90 W;  1NTK H;  2EIJ B;  5A2Q N;  4LF8 O;  1LR1 A;  3G6B A;  2A79 B;  4UCR A;  4DR1 O;  1VF5 B;  1M57 C;  3SR2 C;  5JJE B;  1FD9 A;  5BR8 B;  2EIJ C;  4J80 A;  2ODM A;  3RGB A;  2IH1 C;  2GTA A;  2DQ3 A;  2GUZ A;  2JJ2 G;  2QWQ B;  1L0L H;  1OV9 A;  4LFC B;  3H1J H;  3E35 A;  4L8J A;  4K35 A;  1IBM O;  1B3Q A;  2O57 A;  1JMK C;  2AXT Z;  4MVQ A;  1YTF D;  2IJJ A;  2L6L A;  2AGA A;  2PF4 E;  5D5P A;  1M56 B;  3CYO A;  1IZ3 A;  2WAM A;  4LFB O;  3N27 A;  2P4K A;  2YI8 A;  1US6 A;  4CC6 A;  5JCO C;  4JZG A;  3DXR B;  4PHZ A;  3K58 A;  4TT3 G;  2F93 B;  2YXY A;  1M56 C;  4JTD B;  4Z1V A;  3CHX A;  3SYQ A;  4O4H A;  1XMQ O;  3WG7 B;  5KA6 A;  1XHZ A;  4PA4 A;  4DV5 O;  2DOS A;  2BCC H;  3MHH C;  3JAR A;  4HNA B;  4XBF A;  4FFK A;  2YS8 A;  5BZB A;  2IJK A;  4EB6 A;  3E89 A;  4CH3 A;  1MOF A;  2VWK A;  1DLB A;  3WG7 C;  3CMA V;  4I55 B;  5KX5 A;  4LH7 A;  4QPJ A;  1VQ7 V;  3E2E A;  1VMG A;  2PZS A;  3H1H H;  4QNH B;  1BQ0 A;  3N2G A;  1GM8 A;  5B1A B;  2Y69 B;  1VQ6 V;  2Z0A A;  5ITZ B;  3RVY A;  4PV1 B;  1X59 A;  1AI4 A;  4Z1M G;  4WBN B;  2R9I A;  3AG4 B;  1MZE A;  4FLZ A;  4R50 A;  2RCV A;  2YIB D;  1IBL O;  5KHH A;  3SJA C;  5IYZ A;  5B1A C;  1EZJ A;  2Y69 C;  4JYC A;  1F51 A;  5H9C A;  4B3R O;  3SPJ A;  3OUS A;  3AG4 C;  3SYC A;  4J11 A;  2H94 A;  4FM1 A;  5JWP A;  3CCM V;  5LA6 A;  2HVK C;  2Y0I A;  4IL6 Z;  1U97 A;  1BQZ A;  3OD4 A;  3T1H B;  3JAW B;  3EFF K;  4ZOL A;  1S0V A;  4YHH B;  3QO7 A;  4LR3 A;  4FLY A;  1N0J A;  1Z5V A;  1BCC H;  4X65 O;  1B04 A;  5BY1 A;  1E1Q G;  3ZRW B;  3O65 A;  2UXC O;  2QWR B;  5KHJ A;  3ZBH A;  3GVM A;  3OR7 C;  1VQ5 V;  2ZXW B;  2Z3Y A;  4MVM A;  4H37 A;  4K8X A;  5F2V O;  1EN5 A;  2JVD A;  2BSK B;  4RO2 A;  2YEV B;  3B2E E;  1AP6 A;  2FB5 A;  4PA9 A;  2OCC B;  2VQE O;  2QSA A;  2OCH A;  5CMU A;  4GKK B;  1L1F A;  2ZXW C;  2CGN A;  4RQE A;  1YJW V;  4E4E A;  1GMG A;  3W7U A;  2LQT A;  2YIB A;  3A2F A;  4TOI A;  4DR7 B;  4BW9 A;  1WPB A;  3CRC A;  5JCO A;  5CBF A;  3H01 A;  4JYB A;  4MW3 A;  4G2K A;  4QIW F;  5J2U B;  3T2M A;  1D5N A;  4MSW C;  2DQ0 A;  1R6K A;  1YXB A;  3BPZ A;  4PA7 A;  2DYS B;  1V55 B;  1L8D A;  2EZP A;  4U7O A;  5LL6 Y;  1F4M A;  5EC2 C;  3DXR A;  5HFM A;  3ASN B;  4B7E A;  3B77 A;  1K4D C;  4JTC B;  1S5J A;  3SPC A;  1KQS U;  2F4V O;  4LF9 O;  1W2B U;  1JPX A;  2Q7H A;  1ROP A;  2GDS A;  5LMN O;  1K4C C;  1V55 C;  2DYS C;  1K97 A;  2XND G;  1SQP H;  1YEW A;  4R8C A;  3ASN C;  5IJ0 B;  4YJ2 B;  3ABL B;  4HNA A;  4DK1 A;  1CPY A;  4PJ0 Z;  4QE7 A;  3EXA A;  3UCS C;  2W0X A;  4NVP A;  1A32 A;  2ITC C;  5DN6 G;  1JFF B;  2JJ1 G;  2ZIM A;  2ZR3 A;  1OZ0 A;  3K3W A;  4CS3 A;  2R9R B;  3W7W A;  2WA4 A;  4DV0 B;  4I55 A;  3ZRS A;  3ABL C;  1GTO A;  5DM6 V;  1H2G A;  3K59 A;  1WLE A;  3JD1 A;  4FJC C;  3KKY A;  4X8A A;  1P49 A;  5EZY B;  2OTL V;  4KHP O;  1ARO P;  4MW8 A;  4TV8 B;  5ITZ A;  3L74 H;  3AK2 A;  4FPP A;  1UPG A;  3B8N A;  4WBN A;  4JI5 O;  1L0N H;  3DSQ A;  2RNB A;  4DUY O;  4MVU A;  5J2T B;  2E74 B;  5EC1 C;  2GHY A;  3ZHS A;  3RYF B;  2ZT9 B;  2KQX A;  2A3Q A;  4EFE A;  3JAT B;  1P7B A;  1DTO A;  2UXB B;  4DV2 O;  2ITD C;  4EKW A;  1GRJ A;  4IYI A;  2JK5 C;  2Q69 A;  1ZUQ A;  4J42 A;  2YXH A;  1KUQ A;  2H3O A;  2CTW A;  1K3E A;  1N32 B;  2IBZ H;  3JAL B;  1YSC A;  4KUM A;  3JAW A;  2ZE5 A;  4UCS A;  2M6Y A;  4JI4 O;  4P2Z A;  4EFB A;  4JI2 B;  3IGA C;  1SRY A;  2HVJ C;  1YDX A;  1K92 A;  2HP8 A;  3F5W C;  4CZZ A;  4DR5 B;  3ZRW A;  4I9Q A;  1R6N A;  4I5S A;  1IDS A;  4X64 B;  1K34 A;  1Z2G A;  2PY5 A;  3FX7 A;  1NTM H;  5IJ9 B;  4GX2 A;  1EFR G;  3DTU B;  2HEP A;  5LOV B;  2BSK A;  5KHG A;  4UCV A;  3IAY A;  2YEV A;  1MZF A;  3G80 A;  1O9H A;  3CCJ V;  3T1Y O;  5IY5 B;  1Q82 W;  1AIL A;  4GCZ A;  3K5N A;  2E5L B;  1VQN V;  2QKA A;  2QM7 A;  3ZHV A;  1NH2 B;  2R9A A;  2QDO A;  3ZHQ A;  3CWB H;  4O2A B;  5B1B B;  1ZAU A;  4X1Y B;  1VQ4 V;  3D36 C;  3LUT B;  4FK5 C;  3BY6 A;  5LHH A;  3RYI B;  1URF A;  2CE4 A;  4DV1 B;  4B3S B;  2V7Q G;  4UVC A;  5IY5 C;  4TQD A;  1AI6 A;  3K04 A;  5J2U A;  1FKA O;  1VQ8 V;  3LDD A;  5B1B C;  3MAQ A;  3LDC A;  1BS3 A;  1QU7 A;  4DV7 B;  2UUC B;  4O4J B;  4JV5 O;  1DF4 A;  4NR1 A;  5L3F A;  2ZIN A;  1AR5 A;  2RDC A;  4YIP A;  4LFA O;  3K9A A;  1R1B A;  3CCS V;  3OMN B;  4UV9 A;  2P06 A;  4LF8 B;  1SQV H;  2B1G A;  3FB5 C;  4X1I B;  3ZHT A;  3E8H A;  1ZSP A;  4P9O A;  1GN4 A;  2ZKO A;  3R66 A;  4FIP C;  1HNW O;  3LNN A;  4HBN A;  3IC9 A;  4YJ2 A;  1KU9 A;  1TAE A;  2LGW A;  3LSU A;  4GKJ O;  2G38 A;  4LBE C;  1AP5 A;  5B5E Z;  1JFF A;  4KL1 A;  4TV9 B;  4O4I B;  3QNE A;  1PNL A;  3JSL A;  4KP4 A;  1FXH A;  4WFF A;  3OMA B;  3UQ8 A;  3CEI A;  3APO A;  3OT7 A;  3SDL A;  1X4T A;  4JAV A;  2EIN B;  1JOY A;  1MG1 A;  4RAI A;  3ZRX A;  3SPI A;  1Q81 W;  5EZY A;  3B09 A;  4MT8 A;  4TV8 A;  4LFB B;  5C93 A;  5LYJ B;  3AG3 B;  1CP9 A;  2Q0A A;  3MHS C;  1ZTE A;  1NH2 D;  1VIB A;  2EIN C;  5E79 Z;  1SQF A;  3OGI B;  4CH6 A;  5J2T A;  1HWY A;  2EUL A;  3NXS A;  1XNQ O;  3UKM A;  4H13 B;  2P6J A;  3RYF A;  3ZS8 C;  4AHC A;  4U3J B;  4MS2 A;  3JAT A;  2Q7G A;  4DV5 B;  3OEE G;  2QKC A;  3FYI B;  4LH6 A;  1KYO F;  2Q73 A;  1Q3E A;  2XUM A;  4ABM A;  4TUY B;  3VBB A;  3JAL A;  4X20 B;  4B3T B;  3ZN0 A;  4IIJ B;  4GZR B;  2HLD G;  3CD6 V;  2ZIO A;  2QR4 A;  3STL C;  2XHB A;  3CCL V;  1BMF G;  1XHX A;  3FB7 C;  1IBK B;  5GON B;  2QM8 A;  5IDJ A;  1VQL V;  4BIO A;  3OFN G;  4UXN A;  4BAY A;  1B6Q A;  3KG2 A;  1FPO A;  4MTF A;  2ZE8 A;  1FXV A;  1FAF A;  1Y74 B;  5IJ9 A;  4W4K A;  4JI1 O;  2IJH A;  1MAB G;  1N0N A;  5IWA O;  2ZM6 O;  1P7G A;  5LOV A;  1WPX A;  3UM7 A;  3TET A;  3D36 A;  4X88 A;  4FM2 A;  2PGG A;  2V1D A;  2HHH O;  3ZX6 A;  1VAR A;  4LNU B;  4JI7 O;  2W6J G;  4B3R B;  1DGS A;  4ASU G;  3RWR D;  1TA8 A;  4O2A A;  4X1Y A;  3L71 H;  2FL4 A;  4PD4 F;  1M4U A;  3RYI A;  4G28 B;  3B8M A;  3CC7 V;  2QM4 A;  2GSM B;  3FAV B;  1V9P A;  2D3O W;  1H2M A;  5H6Q A;  3W7X A;  1R3L C;  4U7N A;  2P7T C;  1OCZ B;  3OGC C;  4H33 A;  1TVK B;  3ZMV A;  4RUE A;  3TCU A;  2PTM A;  4MVS A;  3K57 A;  2UU9 O;  3RN4 A;  4X65 B;  4O4J A;  1TUE B;  2KG7 B;  4DXW A;  3OMI B;  3ETE A;  5CN0 A;  3JCZ A;  5KAI Z;  1EN4 A;  3K5O A;  1OCZ C;  1SET A;  4ZI7 B;  3M99 B;  3TXS A;  4WFB V;  3SJQ C;  4X1I A;  1FFT B;  2BOB C;  4JPR A;  2Q0O C;  1N36 B;  1H8E G;  3SPG A;  5KUK A;  3EHB B;  5KAF Z;  5FL7 G;  1SQX H;  1J5E O;  1VQP V;  1XRE A;  3AK3 A;  1H38 A;  2IM9 A;  1GK9 A;  4PA6 A;  5C8Y B;  2Y4U A;  1G8M A;  5A9G A;  4JI0 O;  1AJN A;  4TV9 A;  1MA1 A;  3H1L H;  4O4I A;  2X6A A;  1PPJ H;  2XAG A;  4DO2 A;  4OGQ B;  3E83 A;  3T4Z A;  2R70 A;  1AI7 A;  1R73 A;  1Z5W A;  1GN3 A;  2UXN A;  4J7Z A;  4CC5 A;  1W59 A;  4WFE A;  5LYJ A;  5LMU O;  2MW2 B;  1HR0 O;  4PDM A;  1XUQ A;  4QGP A;  4I4T B;  4WCE V;  2UUB O;  3L72 H;  4JI3 O;  2IW5 A;  2Y4T A;  2LW7 A;  4CS4 A;  1FFX B;  3SYP A;  1S76 D;  3A0B Z;  4LF9 B;  1H8H G;  4DV4 O;  1THZ A;  1I08 A;  4ICG A;  4U3J A;  2HJD A;  1ORQ C;  3JYC A;  4FLU A;  4NXN O;  1MMM A;  4L87 A;  1GM9 A;  1HNX O;  1S72 V;  3K06 A;  1UFI A;  2RN9 A;  1QLN A;  4CH5 A;  4TUY A;  1NJI W;  1QVG U;  1P84 F;  3RFR A;  4UB6 Z;  3OW2 U;  4X20 A;  4IIJ A;  2Q68 A;  3T4D A;  2EBO A;  3UT5 B;  3WB1 A;  1OCO B;  3H1I H;  1K5Q A;  4OPH A;  4KHP B;  5GON A;  1Q86 W;  4LWS B;  2WLK A;  2DN9 A;  5EBL C;  1LUW A;  4PA3 A;  1SKV A;  5KMG B;  1Y74 A;  4JI5 B;  1PV0 A;  1W0J G;  4GYC B;  3QF7 A;  1OCO C;  1XNR O;  3ZMU A;  2EJ7 A;  1F7Y A;  1NU1 H;  5LXT B;  3N2K B;  4J9Z B;  4LNU A;  4X62 O;  1IVS A;  3UO2 A;  5FLX N;  2W6I G;  2EZO A;  4DV2 B;  1Y76 B;  2PUS A;  3U0Z A;  5JVD B;  2A0L A;  2EJR A;  1VQK V;  3T1C A;  3GWK C;  3BVO A;  4DR6 O;  4LF7 O;  3FAV A;  2XT9 A;  1RSO B;  3X2Q B;  4JI4 B;  1OCR B;  1TVK A;  3ML0 A;  4WFA V;  5LP6 B;  2M7W A;  3IC7 A;  2KG7 A;  1Q6I A;  4O4L B;  5CA1 B;  5BR8 O;  3OAA G;  1GN6 A;  3X2Q C;  4MTG A; 
#chains in the Genus database with same CATH homology
 2WPD G;  1JCH A;  1OCR C;  1E1R G;  4P2Z A;  3IGA C;  1SRY A;  2HVJ C;  1K92 A;  3F5W C;  4XDK A;  4UV8 A;  2XAH A;  4CZZ A;  1JJ2 U;  3QO8 A;  3FKS G;  4R7C A;  3ZRW A;  1R6N A;  3BEH A;  4P30 A;  1NVP D;  1QLE C;  4I5S A;  1AJP A;  5B1O A;  2OCC C;  3ABM B;  1K34 A;  1RPR A;  2HR3 A;  5E1A C;  2EIL B;  4BIU A;  3CP1 A;  1CEZ A;  1PNK A;  5CBG A;  4GX2 A;  1EFR G;  1PD3 A;  3DTU B;  4PDL A;  1YJN V;  4UVA A;  4BIZ A;  2HFE C;  2YEV A;  4MTX A;  3FB8 C;  5L3G A;  4WF9 V;  3ABM C;  1K7D A;  3CCJ V;  4PDV A;  2BOC C;  2NLJ C;  5KA5 A;  1N8R W;  5IY5 B;  1Q82 W;  5EBM C;  2EIL C;  1UJW B;  5B3S B;  4GCZ A;  1COW G;  3E8G A;  2HG5 C;  1YHQ V;  1NQT A;  4ZBM A;  1VQN V;  2QM7 A;  1NH2 B;  2FTK A;  2WSS G;  1YTF B;  1P4R A;  2P67 A;  5B1B B;  2QKS A;  1VQ4 V;  3LUT B;  4FMT A;  3PJS K;  4FK5 C;  2IH3 C;  3BY6 A;  5LHH A;  1RM1 B;  1Y4M A;  4N21 A;  2V7Q G;  4UVC A;  5IY5 C;  2QA4 V;  1AJQ A;  5B3S C;  1V54 B;  2XAJ A;  1AI6 A;  3K04 A;  2OTJ V;  1ENV A;  1VQ8 V;  4Q20 A;  3G4S V;  3OE7 G;  2UXX A;  1ZWI C;  3LDD A;  5B1B C;  2KB1 A;  3LDC A;  4MVR A;  1SZT A;  4QE9 A;  1DF4 A;  5L3F A;  3JD2 A;  3R65 A;  1RM1 C;  1E79 G;  1KKD A;  1JQ0 A;  3G6E V;  1OHH G;  1Q7Y W;  4BW5 A;  2WLI A;  1BL8 A;  3K9A A;  1V54 C;  2QE7 G;  3CCS V;  4GX0 A;  3LSQ A;  5KUM A;  1PKX A;  3OMN B;  4UV9 A;  1I5Y A;  2JEU A;  2B1G A;  3FB5 C;  2X6C A;  2F43 G;  1M57 B;  3HB3 B;  4JF3 A;  3E8H A;  2XAQ A;  3K08 A;  3K03 A;  4P9O A;  5L3D A;  4RQF A;  1JX9 A;  4FIP C;  1QBZ A;  3OR6 C;  2IU3 A;  1M90 W;  2EIJ B;  3AG1 B;  5LGU A;  3FB6 C;  4LBE C;  2A79 B;  5L3E A;  1M57 C;  3QNE A;  3OEH G;  3ZMZ A;  1PNL A;  3F7V C;  4JTA B;  4KP4 A;  1FXH A;  4WFF A;  3OMA B;  3W7S A;  2EIJ C;  2QEX V;  2IH1 C;  4JAV A;  2EIN B;  5L3C A;  1JOY A;  1MG1 A;  4RAI A;  3ZRX A;  3SPI A;  2DQ3 A;  2JJ2 G;  1Q81 W;  4HYO A;  2B1I A;  4MT8 A;  3QO5 A;  1EBO A;  5LGT A;  4PEL A;  1SER A;  2MK3 A;  5C93 A;  2ZDI A;  3AG3 B;  3E35 A;  5J9P C;  1CP9 A;  3MHS C;  3CCU V;  4GX1 A;  1BHA A;  3F7Y C;  1NH2 D;  4MVQ A;  3ZRV A;  1YTF D;  2EIN C;  2IJJ A;  4UUJ C;  1K73 W;  1M9N A;  5LHI A;  1YIJ V;  3CC2 V;  1LNQ A;  1HWY A;  3NXS A;  1M56 B;  3CYO A;  4MTO A;  3UKM A;  2WAM A;  1PL0 A;  3I56 V;  2P6J A;  2XOK G;  2PI4 A;  1S3J A;  3STZ C;  4MS2 A;  4PDR A;  2C2A A;  2HKO A;  3ZIA G;  3OEE G;  3ZCC A;  4TT3 G;  3GB7 C;  2LP7 A;  3FYI B;  1M56 C;  4JTD B;  4YXW G;  5H6R A;  3JD0 A;  1I5X A;  4OXS A;  1S5H C;  4XDJ A;  1AR1 B;  1NR7 A;  3SYQ A;  3VBB A;  1K33 A;  2XAF A;  3A0R A;  3WG7 B;  5KA6 A;  1K5S A;  4PA4 A;  3ZN0 A;  3MHH C;  2HLD G;  2YSU B;  3CD6 V;  4XBF A;  4LC1 A;  5GW7 A;  3STL C;  5BZB A;  2IJK A;  2WLH A;  3CCL V;  1BMF G;  1S77 D;  3E89 A;  1R3K C;  3FB7 C;  2QM8 A;  3ABT A;  5IDJ A;  1VQL V;  3ABK B;  2AHZ A;  1FS0 G;  1MOF A;  3OFN G;  1DLB A;  4UXN A;  3ETG A;  3K0D A;  2H8P C;  3MD0 A;  3WG7 C;  4BAY A;  3CMA V;  1B6Q A;  3K79 A;  3KG2 A;  5L3B A;  4MTF A;  4QPJ A;  1VQ7 V;  1FXV A;  3E2E A;  1K9M W;  3VOU A;  2IJH A;  4QNH B;  1MAB G;  2WLJ A;  2WLN A;  4ZKI A;  1WPX A;  3UM7 A;  2DW4 A;  3TET A;  1GM8 A;  3D36 A;  5B1A B;  3CCV V;  2Y69 B;  3HPL C;  4X89 A;  4X88 A;  1KEC A;  2V1D A;  1VQ6 V;  2WLL B;  3RVY A;  2ZD9 A;  5LHG A;  2Q6A A;  1FXK B;  2W6J G;  3ZN1 A;  1AI4 A;  4Z1M G;  4ASU G;  2R9I A;  3AG4 B;  4WFG A;  5IYB O;  4R50 A;  3OUF A;  3E86 A;  1R3I C;  5B1A C;  1EZJ A;  2Y69 C;  1VQ9 V;  4TWK A;  4G28 B;  2ZR2 A;  3B8M A;  3CC7 V;  4JYC A;  2GSM B;  1FXK C;  1F51 A;  5H9C A;  2D3O W;  5H6Q A;  1QR8 A;  3W7X A;  1R3L C;  3OUS A;  4U7N A;  2P7T C;  1OCZ B;  3AG4 C;  3OGC C;  4H33 A;  3SPJ A;  2IU0 A;  3SYC A;  2XAS A;  1VQO V;  2H94 A;  4JGS A;  4RUE A;  3ZMV A;  4F4L A;  3TCU A;  5HFL A;  4LCU C;  4MVS A;  4GX5 A;  1JVM A;  1KC8 W;  3CXC U;  3CCM V;  1YIT V;  2HVK C;  1TUE B;  3E8B A;  3P30 A;  3OMI B;  4DXW A;  3CCQ V;  3LSS A;  2WWW A;  4RUF A;  3ETE A;  5CN0 A;  5CBH A;  1KD1 W;  2X6B A;  3EFF K;  3JCZ A;  2JEX A;  1S0V A;  3QO7 A;  1OCZ C;  1SET A;  3AG1 C;  3M99 B;  3CME V;  2W0F C;  4WFB V;  3SJQ C;  1G4Y B;  3TK1 A;  1FFT B;  2Q67 A;  2BOB C;  2PI5 A;  2X0L A;  4JPR A;  1H8E G;  3P32 A;  3SPG A;  1E1Q G;  1QCE A;  5KUK A;  3EHB B;  3ZRW B;  5FL7 G;  4HZ3 A;  3OR7 C;  1BHB A;  1AI5 A;  4E2L A;  2A9H A;  1VQP V;  1VQ5 V;  4GT1 A;  1H38 A;  2ZXW B;  1GK9 A;  2JIZ G;  2K1E A;  2Z3Y A;  1YI2 V;  3RVZ A;  4MVM A;  4H37 A;  4PA6 A;  1YJ9 V;  1R3J C;  4LP8 A;  1G8M A;  1AJN A;  5CA3 A;  2P90 A;  3ETD A;  4RO2 A;  2YEV B;  3LDE A;  3AG3 C;  1XL6 A;  4JAU A;  2X6A A;  2XAG A;  4DO2 A;  2DWD C;  3E83 A;  4PA9 A;  2OCC B;  3ASO B;  3T4Z A;  1IXM A;  1AI7 A;  5CMU A;  1R73 A;  1XL4 A;  2ZXW C;  1L1F A;  2EIK B;  1QVF U;  2UXN A;  4RQE A;  1YJW V;  3CCR V;  1GMG A;  1OCC B;  3W7U A;  4WFE A;  3RBZ A;  3JD3 A;  4J9Y B;  2Y48 A;  3DGE A;  1NR1 A;  1DF5 A;  3ASO C;  4R6Z A;  4G27 B;  2EIK C;  4PDM A;  5CBF A;  4WCE V;  3H01 A;  4JYB A;  3K0G A;  3D3I A;  4G2K A;  2IW5 A;  4MW3 A;  4QIW F;  1K8A W;  1OCC C;  3T2M A;  2IJI A;  5EBW C;  2LFS A;  3SYP A;  1S76 D;  4MSW C;  1H8H G;  2DYR B;  4MVZ A;  1THZ A;  2DQ0 A;  4XDL A;  1R6K A;  4PA7 A;  4U7O A;  2DYS B;  1V55 B;  2EZP A;  5IYC O;  1ORQ C;  2WLI B;  3JYC A;  1F4M A;  5EC2 C;  1Y66 A;  1GM9 A;  4L87 A;  5HFM A;  1S72 V;  1SES A;  3ASN B;  3K06 A;  1MSW D;  3CCE V;  4HAM A;  3B77 A;  4QPK A;  3SPH A;  1K4D C;  4JTC B;  2DWE C;  3SYO A;  3CPW U;  3SPC A;  1PNM A;  2DYR C;  3ZJZ A;  1KQS U;  1W2B U;  3ABU A;  1QLN A;  2LFR A;  3ABK C;  1JPX A;  5LGN A;  4WFH A;  1ROP A;  2OT5 A;  1NJI W;  3ZMT A;  1K4C C;  1V55 C;  2DYS C;  1QVG U;  1K97 A;  2JDI G;  2XND G;  4R8C A;  1GM7 A;  5EK0 A;  3OW2 U;  3W7T A;  1NVP B;  3OM3 B;  3ASN C;  2Q68 A;  3ABL B;  1CPY A;  2NNU A;  2ATK C;  3T4D A;  3WFV A;  5IYD O;  4QE7 A;  4CBC A;  2ITC C;  2EBO A;  1OCO B;  5DN6 G;  5LBQ A;  2JJ1 G;  1K5Q A;  2ZR3 A;  1OZ0 A;  1Q86 W;  1KP3 A;  3K3W A;  2ZQM A;  2R9R B;  3IFX A;  3W7W A;  2WLK A;  1KP2 A;  3RW0 A;  3SYA A;  1W0K G;  5EBL C;  3ZRS A;  3ABL C;  1VQM V;  4PA3 A;  1GTO A;  5DM6 V;  3GWO A;  1H2G A;  1WLE A;  3JD4 A;  1W0J G;  3JD1 A;  4FJC C;  1OCO C;  4I9W A;  4X8A A;  3ZMU A;  2EIM B;  2OTL V;  3I55 V;  1ARO P;  4UVB A;  3AEI A;  1QR9 A;  4MW8 A;  1M1K W;  1GKF A;  2WLL A;  3G71 V;  1RPO A;  1F4N A;  4J9Z B;  4JAS A;  1FXK A;  4QJF B;  4P9P A;  4FPP A;  2W6I G;  2X7R B;  4KFM A;  3B8N A;  1J95 A;  2EZO A;  2B5U A;  2CK3 G;  4MVU A;  2A0L A;  2EIM C;  3AG2 B;  2GHY A;  2HJF C;  2EJR A;  4N23 A;  1NBM G;  5EC1 C;  1VQK V;  1NKD A;  2Z5U A;  3ZMS A;  2WLM A;  3T1C A;  2ZDI C;  4TSF G;  5B1N A;  3LNM B;  3X2Q B;  1P7B A;  1DTO A;  1OCR B;  2ITD C;  3ML0 A;  4EKW A;  4WFA V;  3FYE B;  2JK5 C;  2Q69 A;  1F23 A;  3AG2 C;  2AHY A;  2M7W A;  3IC7 A;  3E8F A;  1K3E A;  1QLE B;  3CC4 V;  4KUM A;  1YSC A;  4MVO A;  3OAA G;  2QTO A;  3X2Q C;  4MTG A;  1GO3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...