4G28B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g28B00
1BL8A 3F7YC 3K03A 2YEVA 1ZWIC 4PA6A 4MW3A 4P9PA 2Q6AA 2HFEC 4P9OA 3LDCA 3HPLC 3K08A 4H33A 3ZJZA 4MTFA 4QE9A 3IGAC 2WLLB 3SYCA 1V55C 2JK5C 4JTAB 2BOBC 2WLIB 3STZC 3T1CA 4P30A 2EILC 3FB7C 3VOUA 4GX5A 3ABLC 2R9RB 2IH3C 4OXSA 4R7CA 2X6AA 4F4LA 5EC2C 1OCRC 1OCCC 1K4DC 1ORQC 2Q69A 3ABKC 3EFFK 3F7VC 4H37A 3RW0A 4X88A 2DYSC 3E8BA 4PA3A 4MW8A 5BZBA 3SPIA 3E89A 3F5WC 3LDDA 2K1EA 3OUSA 1XL6A 1K4CC 3SPHA 4RO2A 3WG7C 3FB5C 5J9PC 4MTGA 1V54C 2ZD9A 1M57C 1R3LC 3LDEA 4CBCA 4RUFA 2QTOA 2BOCC 5B1BC 3SYPA 2A79B 4WFHA 4WFFA 4ZBMA 4LP8A 4MVRA 4R50A 5IY5C 4X8AA 3T4ZA 3PJSK 3AG4C 3SPCA 3E86A 1J95A 4PA7A 5EC1C 3GB7C 2OCCC 4G28B 3SPJA 3TETA 2DYRC 2AHZA 5EBLC 3UKMA 1M56C 3LNMB 4R8CA 3STLC 3AG3C 3IFXA 4QNHB 2HG5C 2WLNA 5CBGA 4R6ZA 3UM7A 2KB1A 2X6CA 4RUEA 4RAIA 2IH1C 3K06A 1KKDA 4MTOA 3K0GA 4MVMA 2EINC 3SPGA 3E8HA 5B1AC 4P2ZA 4XDJA 2EIJC 4GX2A 3FB8C 4XDKA 3KG2A 2ZXWC 4GX0A 2H8PC 4J9YB 4LBEC 1R3JC 2WLKA 4WFEA 1P7BA 3AG2C 3K0DA 4JTDB 4PDVA 3RVZA 4DXWA 3LUTB 1R3KC 2ATKC 1OCZC 4MVQA 3K04A 2AHYA 5EK0A 4BW5A 4X89A 3AG1C 4MVSA 3JYCA 2Q67A 4J9ZB 4KFMA 4PDRA 3SYOA 4MSWC 2EIKC 4PA4A 4QE7A 4XDLA 2HJFC 3T4DA 2WLHA 3OR6C 4HYOA 4MVOA 2DWDC 2DWEC 3E8GA 3OR7C 4G27B 5E1AC 4PDLA 3ASNC 5KUKA 2NLJC 2QKSA 4EKWA 2A0LA 3R65A 2WLLA 1LNQA 4JTCB 2A9HA 1R3IC 5KUMA 2WLMA 2WLIA 5B3SC 1XL4A 4PA9A 5CBFA 2WLJA 2X6BA 3SJQC 3ASOC 3BEHA 5EBWC 3ZRSA 3SYAA 4HZ3A 4MS2A 2EIMC 2ITDC 2P7TC 4MVZA 4PDMA 3RVYA 1OCOC 2ITCC 3ABMC 2W0FC 3E8FA 1JVMA 2HVJC 2HVKC 4GX1A 3OUFA 4I9WA 5EBMC 5CBHA 2Q68A 3X2QC 4LCUC 4MVUA 1QLEC 4TWKA 3OGCC 1G4YB 3E83A 3TCUA 3T2MA 4WFGA 4UUJC 3RBZA 2Y69C 3FB6C 3SYQA 1S5HC
chains in the Genus database with same CATH superfamily
4K0KO 5LP6A 1ZSPA 4WBNA 1QVFU 1H38A 4DV6B 1R73A 3ZJZA 4JPRA 2VQFO 2BOBC 5FPOA 4P30A 4N21A 3JARA 1Q5OA 1PKXA 5EZYA 1OCCC 3SPJA 4CH3A 3EFFK 1BHAA 1NTKH 2CGNA 4GZRB 1WNSA 1IURA 1SQVH 1DLBA 4N23A 1TVKA 2QTOA 2Y4TA 4J42A 2GTSA 4WFFA 1TUEB 5J2UA 1G6UA 2PTMA 3SPCA 4DK1A 1PP9H 4KL1A 3TETA 3HKBB 1MMMA 5CN0A 4X1IB 3IFXA 3B2EE 4LFAO 1VQNV 2X6CA 1QLEB 1ZUQA 1DF5A 1YTFB 4LFAB 2EIJC 1AI5A 1Z5WA 1QBZA 3JALA 1SA0A 2WLKA 1NTZH 2ZR2A 1JR9A 1R3KC 2MK3A 4ABMA 4DR3B 3G80A 3EHBB 4J9ZB 2QWOB 1FJGO 1NR7A 3G6EV 2ZKOA 2D2CB 3WFVA 1WJZA 1AILA 5J2TA 1FJGB 1THZA 1ZTEA 1GN2A 3RT3C 1HNZB 1JVMA 4GYCB 5EBMC 3C90A 3OUFA 2QM4A 1M56B 2Y69C 1B06A 3CP1A 1S5HC 3FB6C 3FAVB 2E75B 3CX5F 4YHHB 4JV5B 3ZMZA 3T1YB 2OCHA 2QTSA 4ZKIA 1BHBA 5BY1A 4JI8O 3RFRA 1FPOA 2QWPB 2XHBA 4DRXB 1MNGA 5LBQA 2N04A 1WA8B 3WU2Z 1R6NA 1EN6A 3HKDB 4LFBB 4B08A 4UCSA 2YIBD 2ZNIA 1K4DC 3JATB 3UO2A 3AG1B 2LP7A 3FD9A 4K8ZA 3G4SV 4DR2O 2EULA 1V54C 2UU9O 2Q8VA 3I56V 1RM1C 1YIJV 4ZBMA 2UU9B 4MVRA 1BE3H 2F23A 4BIUA 4ZHQA 5LOVA 2UXXA 2LGWA 2DYRC 1HNXO 3MHSC 4FIPC 5BXZA 3N2KB 4GKJO 1SRYA 2WA3A 1O9HA 1XHZA 4OPHA 1YXBA 3VBBA 3ML0A 5B1AC 1QR8A 1SESA 4ASUG 3WB0A 2PI5A 3KG2A 2H8PC 4NXNO 1WLEA 4JI4B 2CAZC 2XAFA 5IT9N 4X1KB 4DXWA 2GV9A 2WAMA 3DXRA 3JD0A 4PELA 2Y0PA 4BIZA 5LHIA 3ZHRA 1H2NA 4D7SA 5EYPB 4QE7A 3D36A 4H44B 1BZKA 1FFTB 2GSMB 3ZN1A 1IZ3A 2BTQA 2XNDG 2P90A 3EXAA 5LP6C 3JASB 3BRCA 1EM1A 3R66A 2P67A 5LHHA 1B04A 4LNUA 3OMNB 4YJ3B 3W7UA 4CC5A 3E8FA 1N32O 2DJVA 2CH7A 2OCCB 5DM6V 2Q68A 3CXCU 1N32B 2KG7B 3W7XA 3G71V 4MW3A 2EINB 2FMLA 2BTOA 4MTFA 3IGAC 1D2DA 1E1QG 3CWBH 5CA3A 2DN9A 4DV3O 4NB5A 1IBMO 3VQXA 3GVMA 1OJHA 5LYJA 4NXMB 2F66C 5H5NA 1OCRC 3RW0A 4Q6GA 1SC5B 2UXDB 4IIJA 4EFBA 2K1EA 4U3JB 2ZIOA 4MTGA 3DTUB 3C3SA 2A79B 4O4IA 4UCOA 4LP8A 3CCMV 1VF6A 4B3SO 4X8AA 1JJOA 4JZGA 3DGEA 3H9VA 3OAAG 4ZIBA 3UKMA 1Y66A 1XDCA 4E4EA 2UUBB 2FKXA 4NYKA 2ZT9B 3UT5A 2V7QG 4DO2A 3RYHA 4JAAA 3A8TA 2A7WA 3RYIB 2LGQA 2BCCH 4BW5A 5LGUA 1MZFA 5DECA 4LF4B 1Q6HA 1GKFA 3RN4A 2X7RB 4DR1O 3BPZA 4HYOA 3OR7C 5B66Z 3APQA 5C93A 5CB4A 1FXVA 1K92A 1N0NA 3NXSA 5KUMA 2F4VO 4PA9A 5L3GA 1BMFG 2UXNA 4MS2A 4LC1A 1N36O 1HNWO 1OCOC 3ZHQA 2W0FC 3DSQA 3QO5A 1HP8A 5KA5A 1HNWB 4X64B 3L72H 1VQPV 1ZL8A 4O2AB 5KX5A 4I50B 4U7OA 2IJHA 4UB8Z 1KBHA 2RN9A 1ORQC 2XAJA 2F95B 2CE4A 3OUSA 1FXKB 2JEXA 1IXBA 1VQ5V 3KZIZ 2C2AA 2ZD9A 4I0XA 2NR5A 1N34B 2E5LO 4FLYA 2R9IA 3ZCCA 5IYZB 5H6RA 1HWYA 2Q0OC 2PYJA 2E5LB 3H1IH 1NH2D 4O2BA 2HG5C 3CCRV 3KKYA 1U97A 1WP8A 5JQGA 4UCVA 3B8MA 2ZQMA 2KKWA 5K1PA 2YS8A 1KB9F 1I94B 1XUQA 3JAWB 1S5JA 3IJ4A 1YCIA 1CEZA 2ATKC 1Z5VA 4X1YA 2OIGA 1VF5B 1QLNA 1KD1W 2H3OA 3SYOA 1XHXA 1YJWV 2OIEA 4YJ2B 3EVKA 2Z0AA 2F43G 5IYCO 1Q6UA 3Q4HB 1IBKB 2QJ1A 3R65A 1LNQA 5B1OA 1WN7A 3OTOO 2WLJA 1RSOB 1AB3A 4JI1O 2UXCB 1W59A 2ITCC 4L8JA 4GX1A 2HVJC 1K7DA 1QLEC 3CCEV 1IDSA 4WFBV 4I4TB 4RWUA 4U3FH 2FYUH 2XTAA 4LH6A 4J10A 1I08A 3NR7A 1QQCA 2BSKB 3JD3A 4B3MO 4H33A 2IJKA 2HHHB 1NU1H 1PL4A 2G38A 1WB7A 1VF6C 5JVDB 4XBFA 5CMUA 4GX5A 2WWWA 2IH3C 2P5OA 1PL0A 2VS0A 4JYBA 5L3CA 1BT8A 4RQEA 4X88A 2RDCA 5BZBA 1NBMG 2AZ0A 4NTXA 4RO2A 3FB5C 3S3WA 2IU0A 3ASNB 1VQ8V 3BA8A 5FL7G 3B40A 5CA0B 3U11A 1GTOA 1ZLZA 5LMNO 3T4ZA 4DV5B 2E76B 2JRIA 3H01A 1M56C 5FNVB 3STLC 5LMNB 3L9DA 1ENVA 1I7FA 4R6ZA 3OT7A 4IT5A 1E1RG 3CHXA 4IHJB 1IBLO 4J7KA 2DQ0A 4XDJA 4GX2A 1B3QA 2Z5UA 5JCOA 1IBLB 2KQXA 4U7NA 4B3RO 2P06A 2EZOA 1KUQA 4WFEA 1HW7A 4O4HA 1HR0O 4DV4B 1NI8A 3HKEA 2EILB 5EK0A 2OYQA 3AG1C 4D7TA 4NKGB 4PDRA 5HFLA 4ZI7A 3AK3A 1D5AA 3K58A 4DUZO 2E3CA 1WPBA 3RYFB 1YZBA 1N33O 3ABUA 1F51A 2UUAO 1R3IC 1XILA 2XAGA 1K33A 4GKKO 1VQKV 2UUAB 5KAFZ 4EEQA 3LSQA 4JI6B 3OGIB 2H94A 1JX9A 3JCZA 5AG2A 4UUJC 2HP8A 1I0HA 2WPDG 3KCYA 1NR1A 3F7YC 5KHIA 4AQYO 3IAYA 5LXTB 3KCXA 1AVMA 3K08A 1EN4A 3CJHA 1X4TA 2RNBA 1P7GA 4CS2A 3ZHSA 3UO3A 3E22B 1JFFA 4LF8O 3UQ8A 4JI5O 5CA1A 4TV9A 4UCUA 1XMOO 4OX9B 3SPIA 1S77D 4JI5B 4CH5A 1XL6A 4DV6O 2DE0X 2GUZB 1MA1A 1XMOB 1KQSU 4RUFA 4K8XA 3A0HZ 4KHPB 1RPRA 5H9CA 4EB6A 3CRRA 3CYOA 3PN1A 2QWRB 3TXSA 3N27A 1CXZB 1K34A 2OCCC 2QWNB 2YXHA 5GTIZ 4R8CA 3D3QA 3TJTA 4C7UA 3ICXA 1Q81W 4GCZA 5IE9A 1KKDA 2PUSA 2LFSA 2EINC 2RCVA 4JF3A 3J80N 3ZMUA 4D6TH 1SERA 3A2FA 4PDVA 2PGGA 5IY5B 2ZM6B 4DR7O 2VQEO 1R1BA 1YEWA 4FM2A 4X89A 1VF7A 2FB5A 3H1HH 4DR7B 4NTWA 2VQEB 2ZE8A 1NKDA 1GM7A 4FLUA 5LMUB 4KXRA 4PDLA 1UPGA 2YICA 3GWKC 2A0LA 1M57B 2DOSA 2WLMA 1SQGA 4DR3O 3SJQC 1AR1B 3ZRWA 5KAIZ 1OHHG 3B4SA 2HVKC 4I9WA 3W7SA 1DGSA 3SDLA 5BMVA 4WFGA 2ADPA 4PV1B 4P9PA 4UVCA 4P9OA 1TAEA 1HNZO 5KMGB 1JA8A 3AG2B 1VEWA 2ODMA 2M7WA 1MSWD 4IHJA 4TT3G 3QO8A 3L73H 4MW8A 2K9PA 4YHHO 4JV5O 3T1YO 1MABG 4X65O 1VQOV 2DMXA 2YI9A 3RWRD 4HNAA 3B09A 1R3LC 3JAKA 1YF2A 5JCOC 3WB2A 2W6IG 4X65B 1DK1A 5ITZB 3CD6V 2ZDIC 1RP3B 4JASA 4LFBO 1Y76B 3BFRA 3I5DA 1MZEA 3PJSK 1AP6A 5LHGA 5EBLC 3OMAB 4DR6O 3ABMB 4TV8B 4NTYA 4F6RB 1Y74A 1SQQH 2DYSB 2KB1A 4OGQB 4DR6B 4YXWG 1TUBB 5IWAB 2Q7HA 1SKVA 1AJQA 5JJJB 3K9AA 4TUYA 4LBEC 4JZ2A 1BCCH 5LA6B 2ZIMA 1K9MW 5GONA 4PI2A 3HB3B 4JI0B 2AHYA 2YUAA 3SJCC 3MAQA 3U0ZA 3CC2V 3T4DA 3ZHTA 5IJ9A 3OMIB 3K59A 3FX7A 3S3XA 4JI4O 1AR5A 1P84F 2JGDA 3TXQA 1HDJA 3D3IA 3ETEA 1OCZB 1F23A 3CRAA 3BHPA 2VWJA 1CPYA 1XBLA 4O4LA 1VQMV 5K1XA 4PI0A 2OT5A 3QVNA 3CRQA 3AK2A 3SYQA 3K03A 1MG1A 2YEVB 2YXYA 4FLWA 4LF6B 4UVBA 2ZXWB 5L3EA 4JTAB 2YIDA 2DW4A 3M99B 3LNNA 2EIMB 2JDIG 4R7CA 4X20B 1GN6A 1US6A 2WSSG 4I55B 1OV9A 4FLTA 4O4JB 4BIOA 2PZSA 2CTWA 1EFRG 3LDEA 4PJ0Z 1IX9A 2W0XA 5B3SB 3CCLV 4NXMO 1E79G 2CTQA 3HKBA 4X1IA 2UXDO 4YY3B 5A9GA 2Q5ZA 3QG5A 5CBGA 1XMQB 3N2GB 2UUCO 3L71H 4MTXA 2P4KA 4FFBB 1A32A 3K79A 3DC5A 2UUCB 1JPXA 1P7BA 4JYYA 3K0DA 5KHHA 2UUBO 4DUYB 4K3AA 4B7EA 3CCSV 1KC8W 2XOKG 2HJFC 1XEQA 2DWEC 5E1AC 3ASNC 4BAYA 3WG7B 5F2VO 4IYHA 4JTCB 4QJFB 4DR5O 3O9OA 2F93B 4G2KA 3IC7A 4LF4O 4LFCB 5KHKA 3RYCB 4DR5B 1H2SB 5CBHA 1PD3A 2P4VA 4FM0A 4DW0A 4TWKA 3ZHVA 5H6QA 4DV7B 3RBZA 3FAVA 1BSMA 3SJBC 1FFXB 2ILMA 3HPLC 4DRXA 1WA8A 1NVPD 2EILC 5LGNA 3HKDA 4X64O 3CCUV 4UXNA 3ZN0A 3JATA 3E8BA 2Y4UA 5L3BA 1IXMA 4DW1A 1AP5A 4LWSB 1PM9A 4X66B 3ZIAG 1K97A 2Y69B 2FTKA 2L6LA 1FXHA 4B3TO 1RPOA 2AZ2A 1YJ9V 5IJ0B 3K5MA 2Q9LA 5KLVH 4B3TB 4PA7A 4DV2B 1L0LH 3N2KA 1X59A 4L87A 1K8AW 2B9ZA 2HEPA 3MD0A 2B1GA 4UB6Z 1XNRO 3K5LA 1V9PA 5EIBD 1N34O 5D5QA 1WAZA 2CTRA 2EZPA 2YIAA 5H2FZ 1RM1B 5JH7B 1XNRB 1I5XA 4X1KA 4Z1VA 3A0RA 2CK3G 1AJNA 3CC7V 2HLDG 3JYCA 5IDJA 1KYOF 3QTCA 5EYPA 4FLVA 1ZAUA 4FK5C 1S72V 4CC6A 2DWDC 1I94O 5JWPA 3JASA 3T1HB 4EKWA 1S3JA 2GTAA 2ZNJA 5BR8B 4JYAB 5B1BB 1SQXH 4NR1A 4YJ3A 3J81N 1L1FA 1L8DA 1WPXA 2LW1A 2LQTA 5LL6Y 2KG7A 3AG3B 3T2MA 1IBKO 1BL8A 4TQDA 4QPKA 5LP6B 2IBZH 2N05A 4WBNB 1N4CA 2UXCO 2EX3A 2R9AA 1FAFA 1S0VA 1GRJA 1QNMA 3JARB 1WB8A 3SJAC 2QM7A 1KECA 4H37A 5EZYB 4GT1A 1M5IA 4JAVA 4HBNA 2R70A 3F5WC 3LDDA 4U3JA 2GHYA 2HHHO 4TQFA 1M57C 4UV9A 3ZS8C 1TVKB 2ETNA 2PY5A 4R50A 5J2UB 4JI2B 3ASOB 4J41A 1W0KG 2FL4A 2ZE6A 3CE2A 3CMEV 4LF9B 3JD1A 2M6YA 1W0JG 1VQ4V 3UM7A 1SETA 1QHTA 3APOA 3K0GA 5TISZ 2LJ2A 2EBOA 1YITV 4DV5O 3JALB 3RYIA 1SA0B 3AG2C 1V55B 1NQTA 1YSCA 2ZINA 1H8EG 3ABLB 4X62O 1FD9A 2YI8A 3ZHUA 2CUGA 1Q3EA 4PA4A 2WLHA 4X62B 3BA9A 4J7JA 4MVOA 5IYDO 4G27B 3WB1A 4FZ0A 3JSLA 4DV4O 4QPJA 5J2TB 1NVPB 2ZDIA 3ZRSA 4B7KA 1KP2A 4K35A 1EN5A 3RVYA 3ABMC 2Z3YA 1KU9A 2XASA 1SZXA 3BAAA 4UFZA 1Q43A 3H1JH 3JD2A 3ZMTA 2Q6AA 1SZTA 2A3QA 3CRCA 3CRMA 1N0JA 2E74B 4CS3A 4O2AA 1XOUA 4I50A 4QE9A 2JK5C 4FLXA 2WLIB 3T1CA 1DF4A 4GUNA 4JI6O 1NS1A 3VQYA 4UV8A 2JJ2G 3JAMN 3O65A 4A5UB 4PA3A 3OFNG 1FXKA 3OD4A 2EIKB 4DV1B 5JJEB 4BR6A 1LUWA 4CBCA 4LF5B 3CSXA 1Q82W 5KHGA 1M9NA 3ZEDA 3C3TA 4FFKA 5IYZA 4PHZA 2IW5A 1Q6IA 2JGUA 2JJ1G 1QCEA 1J95A 3CXHF 4DV0O 2IJIA 4ZHQB 5LOVB 3CCJV 1NH2B 4OX9O 4QGPA 2V4DA 4DV0B 2WLNA 1K5QA 4KHPO 2EJ7A 1YJNV 4XDKA 4ZOLB 2ZXWC 4DYLA 3JAWA 4J9YB 1JJ2U 3B77A 1W2BU 3MDSA 4E2LA 1S76D 1GO3F 3DXRB 5B5EZ 2BE3A 3ABKB 4YJ2A 2NNUA 2B1IA 3JD4A 1JOYA 2BTQB 2YC0A 4JI3O 3ETDA 4BWAA 3Q4HA 1GN3A 3FKSG 2QKSA 4K0KB 2YDEA 2ZM6O 1VQ7V 5JJNB 5B3SC 5CBFA 1RSOA 4JI3B 3ETQA 3BEHA 3THOA 5FPRA 4LNUB 3CB2A 3CCVV 4MVZA 4PDMA 1ZX3A 2VQFB 3AG4B 3BCCH 4WF9V 2CH7B 5LMUO 1PNKA 5DEDA 1PPJH 4I4TA 1XNQO 2VWKA 1Q90D 2BSKA 3L70H 3LDCA 1XNQB 2WLLB 1M93A 5JVDA 3STZC 2GBOA 2R9RB 4WCEV 3DC6A 4W4LA 3FYEB 3HR0A 4F4LA 5LYJB 1IVSA 2AW9A 1QVGU 3OM3B 1MOFA 1EZVH 3E89A 3RGBA 4IIJB 1VMGA 3WG7C 2IU3A 3QF7A 5J9PC 3A0BZ 1AI6A 3SYPA 2ZR3A 3OE7G 4WFHA 5GTHZ 4O4IB 5CA0A 2XT9A 1Y67A 1O9GA 1QU7A 3BABA 4X9QA 2ADQB 5EC1C 3GB7C 1M90W 1NT2B 1Y4MA 4UVAA 1JMKC 5FNVA 4GLXA 3LNMB 3CC4V 4JAUA 4IYIA 4FPPA 1SQFA 5FLXN 4MTOA 4AI8A 1TGOA 1WP7A 3E8HA 3SR2C 3FB8C 1GAXA 2PYLA 3UT5B 5D5PA 2WA4A 4KUMA 3P32A 3RYHB 4JTDB 4IL6Z 1K5SA 1GMGA 3CCQV 1PNMA 1M1KW 1AR4A 1UFIA 5IWAO 3OEEG 3OR6C 1B6QA 2JS5A 4LR3A 2NLJC 3AG7A 3RYFA 1J5EO 2JS3A 1MSDA 5CB4B 2A06H 1DTOA 2RJZA 3JSNA 2WLIA 2LFRA 1SQBH 1J5EB 4JI0O 1YDXA 5A2QN 4QIWF 2QGNA 3SGIA 4JI8B 2VRZA 3LSUA 2QKCA 2ARHA 5DN6G 3FYIB 1COWG 3AEIA 3G67A 3OTFA 1K3EA 3E83A 1FXKC 5LXTA 2YXLA 1R6KA 1ZL8B 4DR2B 1N8RW 1VARA 3SYCA 5KX5B 3E22A 3FB7C 3VOUA 2QA4V 1PV0A 4OXSA 2B5UA 4AHCA 4J11A 1HNXB 3HKCB 4LF6O 3ZRXA 2GUZA 1K4CC 4ZOLA 4GKJB 3I55V 4I0XB 5B1BC 4I5SA 1Q86W 5L3DA 3U10A 2IM9A 2X0LA 4NXNB 2JEUA 3M8AA 5IYBO 2GDSA 3AG3C 1SF9A 4O2BB 2RMKB 5B1NA 3X2QB 2IH1C 1BGYH 5JQGB 4P2ZA 4I9QA 2N74A 1I5YA 2P6JA 1LUVA 4FJCC 3RVZA 4YY3O 4H0LB 5GW7A 2RQ6A 2Y48A 3OW2U 1XMQO 4X1YB 2Q67A 4FMTA 1PNLA 2QEXV 1OCCB 3QO7A 4XDLA 1YI2V 2OWOA 3J7AU 4WFAV 3E8GA 4KP4A 1P49A 2WLLA 3L75H 2A9HA 5C8YB 4JGSA 3ASOC 2QM8A 3H1LH 4PD4F 5EBWC 4DUYO 2HJDA 2QKAA 4H13B 4YIOA 1FKAO 4DV3B 1VQ6V 1IBMB 2QDOA 3E2EA 3TK1A 3L74H 4MVUA 1G4YB 4JI7O 2QWQB 4FLZA 1ZWIC 4PA6A 3ZMSA 1VP7A 4JI7B 2EIJB 4LFCO 1V55C 4I7ZB 1FYJA 5KMGA 1GH6A 3ABLC 3ZX6A 1L0NH 4BW9A 2X6AA 5E79Z 4B3SB 4DV7O 5EC2C 3ABTA 1Z2GA 3K9SA 1Q7YW 3ETGA 1XI1A 3K5OA 2UXBO 1Q8IA 1YHQV 1FS0G 5ITZA 2UXBB 4FZ1A 4Z2WA 5HFMA 1Y76A 3K57A 3E86A 4G28B 2Q4PA 1KMIZ 4TV8A 1D5NA 4EFEA 4F6RA 4QNHB 4CZZA 4X66O 4F6EA 4RAIA 1GM8A 3K06A 1TUBA 3JCUZ 1GM9A 3K5NA 2QSAA 1QR9A 4DR1B 4MT8A 2W6JG 1K73W 1M4UA 5LA6A 1BQZA 3P3NA 4DV2O 4TSFG 4O4HB 4MVQA 2F4VB 3HKEB 2XAHA 3H1KH 1N36B 3CMAV 3E35A 2JVDA 1GK9A 4ZI7B 2EIKC 5EIBC 2CDYA 4CH4A 1XQ8A 2V1DA 2ZE7A 1V54B 4IGGA 1AI7A 1H2MA 2CTPA 2XAQA 4Z1MG 2AXTZ 2P22C 1VQ9V 2DYRB 3LSSA 1H8HG 3HKCA 2QE7G 3T1HO 1R6TA 1U96A 2YEVA 2PF4E 1YVWA 5BR8O 4JYAO 4OPAA 5B1AB 1H2KA 3CJHB 2CGOA 2QR4A 1VQLV 1JFFB 4FVMA 4X20A 3ABKC 3G6BA 2YSUB 1OZ0A 5CA1B 3D36C 4I55A 4TV9B 4RQFA 4O4JA 3UCSC 3SPHA 2JIZG 2NN4A 1SS3A 2R72A 1GN4A 2KSDA 5IY5C 4EB6B 3BY6A 3AG4C 4J7ZA 1JCHA 1BS3A 4HAMA 3N2GA 2MW2B 2Q73A 1H2LA 2Q7EA 4FFBA 3IC9A 1F7YA 4GX0A 5C8YA 1G1XB 4LF7O 4JI2O 1S5LZ 1CP9A 3VQWA 2EJRA 2Q7GA 4LF7B 4LF9O 2ZCEA 3OTOB 3ZRVA 3QNEA 4JI1B 4KFMA 1XREA 1OCRB 1AJPA 3W7TA 3B8NA 5KUKA 5KA6A 2L35A 4J80A 1F4NA 1YTFD 3MHHC 1XL4A 4B3MB 1BQ0A 2X6BA 4Q20A 4UCRA 4HZ3A 3RYCA 2ITDC 2P7TC 3ZRWB 1UJWB 2IJJA 3D8CA 3CPWU 4W4KA 1LR1A 1KKCA 3GWOA 4JYCA 4LCUC 2LO1A 4FM1A 1EZJA 5BMVB 1H2GA 2Y0IA 3OGCC 3W7WA 2OTJV 1FFXA 2HFEC 1ROPA 5LGTA 2HKOA 2D3OW 4CS4A 1Y6XA 2OTLV 3P30A 3ZMVA 1JQ0A 3K3WA 1G8MA 4LH7A 3BVOA 2YIBA 2HR3A 1NTMH 1TA8A 2Q69A 3F7VC 1F4MA 2DYSC 4ICGA 3OEHG 4LWSA 1NJIW 1EBOA 4HNAB 3JAKB 2BOCC 3TGUH 5IJ0A 1URFA 4DR4O 4NVPA 4B3RB 1HR0B 4DR4B 2AHZA 1OCOB 4DV1O 3M7MX 3F5TA 1Y74B 1AI4A 4RUEA 4LF5O 4MVMA 1P4RA 3SPGA 4UCTA 2AGAA 4DUZB 5JH7A 4TUYB 1R3JC 2F1MA 2LW7A 1N33B 3CS5A 3VQVA 5GONB 1RFYA 3LUTB 4AILC 1OCZC 1VIBA 3K04A 2DQ3A 4GKKB 4MVSA 5KHJA 4MSWC 3ZBHA 1SQPH 1NZ6A 4YIPA 2Q0AA 5IJ9B 2ZE5A 5L3FA 2XUMA 2O57A 2JGDB 1KP3A 4AQYB 1T5EA 2PI4A 1AROP 4TOIA 3SYAA 2EIMC 3FFQA 3P3PA 4DK0A 3X2QC 4LF8B 3CEIA 4O4LB 3TCUA 4CH6A 3AK1A
chains in the Genus database with same CATH topology
1R6KA 3JD3A 1QVFU 3HPLC 2IJKA 4H33A 1N8RW 1H38A 1R73A 3ZJZA 3SYCA 4JPRA 2BOBC 1NVPD 4XBFA 4P30A 2EILC 3FB7C 3VOUA 5CMUA 4GX5A 4N21A 5LGNA 2QA4V 2WWWA 2IH3C 4OXSA 3CCUV 1PL0A 1PKXA 4UXNA 3ZN0A 4JYBA 1OCCC 3SPJA 5L3CA 3EFFK 4RQEA 2B5UA 4X88A 3E8BA 1BHAA 5L3BA 1IXMA 5BZBA 1NBMG 3ZRXA 1K4CC 3ZIAG 1K97A 2Y69B 4RO2A 2FTKA 1DLBA 3FB5C 2IU0A 4N23A 3ASNB 1VQ8V 2QTOA 3I55V 1FXHA 5B1BC 4I5SA 1RPOA 1Q86W 5FL7G 4WFFA 1YJ9V 1TUEB 5L3DA 2X0LA 1GTOA 3T4ZA 2JEUA 3SPCA 4PA7A 3TETA 5CN0A 3H01A 1M56C 3STLC 5IYBO 3AG3C 1ENVA 3IFXA 4L87A 3X2QB 5B1NA 1K8AW 4R6ZA 1VQNV 3MD0A 2X6CA 1E1RG 1QLEB 2IH1C 2B1GA 1DF5A 1YTFB 2DQ0A 4P2ZA 4XDJA 2EIJC 2EZPA 4GX2A 1AI5A 2Z5UA 1I5YA 1RM1B 4U7NA 1QBZA 2P6JA 1I5XA 2EZOA 2WLKA 4WFEA 4FJCC 2ZR2A 3RVZA 1R3KC 2MK3A 3A0RA 2CK3G 1AJNA 2EILB 3CC7V 5GW7A 5EK0A 2HLDG 2Y48A 3OW2U 3AG1C 3EHBB 3JYCA 2Q67A 4FMTA 1PNLA 4J9ZB 5IDJA 2QEXV 4PDRA 5HFLA 1OCCB 3QO7A 4XDLA 1YI2V 4FK5C 1S72V 2DWDC 4WFAV 3E8GA 1NR7A 3G6EV 4KP4A 3WFVA 4EKWA 3ABUA 1S3JA 2WLLA 1F51A 2A9HA 1R3IC 1THZA 5B1BB 4JGSA 2XAGA 3ASOC 1K33A 2QM8A 5EBWC 1VQKV 1L1FA 1JVMA 5EBMC 3OUFA 3LSQA 1VQ6V 3E2EA 3TK1A 2H94A 1M56B 1WPXA 4MVUA 1JX9A 3JCZA 1G4YB 3AG3B 3T2MA 4UUJC 2Y69C 3FB6C 3CP1A 2WPDG 1S5HC 1BL8A 1NR1A 3F7YC 4QPKA 1ZWIC 4PA6A 3ZMSA 3ZMZA 2EIJB 3K08A 4ZKIA 1BHBA 1V55C 5LBQA 3ABLC 1R6NA 1S0VA 2X6AA 5EC2C 1K4DC 1KECA 2QM7A 4H37A 3ABTA 3AG1B 2LP7A 4GT1A 4JAVA 3SPIA 3ETGA 1Q7YW 1S77D 3F5WC 3LDDA 3G4SV 1XL6A 2GHYA 1KQSU 1V54C 1YHQV 1M57C 4RUFA 4UV9A 1FS0G 3I56V 1RM1C 1YIJV 1RPRA 4ZBMA 5H9CA 5HFMA 4MVRA 4R50A 3CYOA 3ASOB 4BIUA 1W0KG 3E86A 2UXXA 1K34A 2OCCC 4G28B 2DYRC 3CMEV 4R8CA 3MHSC 3JD1A 4FIPC 1W0JG 4QNHB 4CZZA 1VQ4V 3UM7A 1Q81W 1SETA 1SRYA 4GCZA 1GM8A 4RAIA 3K06A 1KKDA 1GM9A 2LFSA 3K0GA 2EINC 1QR9A 3VBBA 3ML0A 5B1AC 1QR8A 1SESA 4ASUG 2PI5A 4MT8A 3KG2A 2EBOA 2W6JG 1K73W 1YITV 4JF3A 2H8PC 3ZMUA 1WLEA 1SERA 2XAFA 3AG2C 4PDVA 4DXWA 1V55B 4TSFG 1NQTA 2WAMA 5IY5B 4MVQA 3JD0A 4PELA 1YSCA 4BIZA 3ABLB 1H8EG 2XAHA 5LHIA 4X89A 3CMAV 3E35A 1GK9A 2EIKC 4PA4A 4QE7A 3D36A 2WLHA 1NKDA 1FFTB 2GSMB 3ZN1A 1GM7A 4MVOA 5IYDO 4G27B 2XNDG 4PDLA 2P90A 2V1DA 2A0LA 1V54B 1M57B 1AI7A 2WLMA 4QPJA 2P67A 1NVPB 2ZDIA 3SJQC 5LHHA 2XAQA 3ZRSA 1AR1B 3OMNB 1KP2A 3ZRWA 3W7UA 4Z1MG 1OHHG 3RVYA 3ABMC 3E8FA 2HVKC 2OCCB 4I9WA 5DM6V 1VQ9V 2DYRB 2Q68A 2Z3YA 3LSSA 3CXCU 3W7SA 1H8HG 2QE7G 4WFGA 2XASA 3W7XA 3G71V 2YEVA 3JD2A 4MW3A 4P9PA 3ZMTA 2Q6AA 4UVCA 1SZTA 2EINB 4P9OA 5B1AB 4MTFA 4QE9A 3IGAC 1E1QG 2JK5C 2WLIB 5CA3A 3T1CA 3AG2B 1DF4A 1VQLV 2M7WA 4UV8A 1OCRC 3ABKC 2JJ2G 3RW0A 2YSUB 1MSWD 1OZ0A 4PA3A 4RQFA 4TT3G 3OFNG 3QO8A 4MW8A 1FXKA 2EIKB 2K1EA 1MABG 3SPHA 1VQOV 2JIZG 4MTGA 3DTUB 4CBCA 1R3LC 1Q82W 2A79B 2W6IG 1M9NA 3CD6V 2ZDIC 4LP8A 4JASA 3CCMV 5IY5C 2IW5A 3BY6A 4X8AA 3PJSK 3AG4C 2JJ1G 1QCEA 1J95A 1JCHA 3DGEA 2IJIA 3CCJV 5LHGA 3OAAG 1NH2B 5EBLC 1Y66A 3OMAB 3UKMA 3ABMB 4HAMA 2WLNA 2DYSB 2KB1A 1K5QA 4YXWG 1YJNV 1AJQA 4XDKA 2ZXWC 3K9AA 4GX0A 1JJ2U 2V7QG 4J9YB 4LBEC 3B77A 4DO2A 1CP9A 1K9MW 1W2BU 2EJRA 3HB3B 4E2LA 1S76D 1GO3F 2AHYA 3ZRVA 4BW5A 5LGUA 3QNEA 1GKFA 4KFMA 3CC2V 2X7RB 1OCRB 1AJPA 3ABKB 3T4DA 2NNUA 2B1IA 4HYOA 3OMIB 3W7TA 3OR7C 3JD4A 1JOYA 3B8NA 5KUKA 5KA6A 1F4NA 5C93A 3ETDA 1FXVA 1YTFD 1K92A 3FKSG 2QKSA 3MHHC 1VQ7V 3NXSA 5KUMA 5B3SC 5CBFA 1XL4A 4PA9A 5L3GA 3D3IA 2X6BA 4Q20A 3BEHA 1BMFG 2UXNA 3ETEA 4HZ3A 4MS2A 2ITDC 2P7TC 4LC1A 3CCVV 3ZRWB 1OCZB 4MVZA 1UJWB 1F23A 4PDMA 2IJJA 1OCOC 3AG4B 3CPWU 2W0FC 4WF9V 3GWOA 3QO5A 4JYCA 5KA5A 1CPYA 4LCUC 1PNKA 1VQMV 1EZJA 1H2GA 2OT5A 3SYQA 3OGCC 3W7WA 1VQPV 3K03A 2OTJV 1MG1A 1ROPA 2HFEC 2YEVB 5LGTA 2HKOA 2D3OW 3LDCA 4UVBA 2OTLV 2ZXWB 3P30A 2WLLB 5L3EA 4U7OA 4JTAB 2IJHA 3ZMVA 3STZC 2DW4A 1JQ0A 3M99B 3K3WA 1G8MA 2EIMB 2JDIG 2R9RB 4R7CA 4WCEV 3FYEB 4F4LA 2HR3A 1ORQC 2Q69A 3F7VC 1F4MA 2DYSC 2WSSG 2XAJA 1QVGU 3OM3B 1MOFA 3E89A 3OEHG 3OUSA 1FXKB 2JEXA 1NJIW 1VQ5V 3WG7C 2C2AA 2IU3A 1EBOA 1EFRG 5J9PC 2ZD9A 3LDEA 1AI6A 2BOCC 3SYPA 2ZR3A 3OE7G 4WFHA 5B3SB 2R9IA 3CCLV 3ZCCA 1E79G 5H6RA 1HWYA 5EC1C 3GB7C 1M90W 1Y4MA 4UVAA 2AHZA 1OCOB 1NH2D 3LNMB 3CC4V 4JAUA 2HG5C 4FPPA 5CBGA 3CCRV 1AI4A 4RUEA 4MTOA 4MVMA 1P4RA 3B8MA 3SPGA 3E8HA 4MTXA 2ZQMA 3FB8C 3K79A 1R3JC 4KUMA 1JPXA 3P32A 1P7BA 4JTDB 3K0DA 3LUTB 1CEZA 2ATKC 1OCZC 1K5SA 1GMGA 3CCQV 3K04A 1PNMA 2DQ3A 1M1KW 3CCSV 4MVSA 1KC8W 1QLNA 1KD1W 3SYOA 4MSWC 2XOKG 2HJFC 3OEEG 1YJWV 3OR6C 1B6QA 2DWEC 5E1AC 2F43G 3ASNC 5L3FA 5IYCO 2NLJC 4BAYA 3WG7B 1KP3A 3R65A 1LNQA 4JTCB 2PI4A 1DTOA 5B1OA 4QJFB 1AROP 2WLIA 2LFRA 4G2KA 2WLJA 3IC7A 3SYAA 4QIWF 2EIMC 2ITCC 5DN6G 4GX1A 2HVJC 5CBHA 1PD3A 1K7DA 3X2QC 3FYIB 1COWG 3AEIA 1QLEC 4TWKA 3CCEV 1K3EA 3E83A 5H6QA 3TCUA 4WFBV 1FXKC 3RBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL8 A;  3F7Y C;  3K03 A;  2YEV A;  1ZWI C;  4PA6 A;  4MW3 A;  4P9P A;  2Q6A A;  2HFE C;  4P9O A;  3LDC A;  3HPL C;  3K08 A;  4H33 A;  3ZJZ A;  4MTF A;  4QE9 A;  3IGA C;  2WLL B;  3SYC A;  1V55 C;  2JK5 C;  4JTA B;  2BOB C;  2WLI B;  3STZ C;  3T1C A;  4P30 A;  2EIL C;  3FB7 C;  3VOU A;  4GX5 A;  3ABL C;  2R9R B;  2IH3 C;  4OXS A;  4R7C A;  2X6A A;  4F4L A;  5EC2 C;  1OCR C;  1OCC C;  1K4D C;  1ORQ C;  2Q69 A;  3ABK C;  3EFF K;  3F7V C;  4H37 A;  3RW0 A;  4X88 A;  2DYS C;  3E8B A;  4PA3 A;  4MW8 A;  5BZB A;  3SPI A;  3E89 A;  3F5W C;  3LDD A;  2K1E A;  3OUS A;  1XL6 A;  1K4C C;  3SPH A;  4RO2 A;  3WG7 C;  3FB5 C;  5J9P C;  4MTG A;  1V54 C;  2ZD9 A;  1M57 C;  1R3L C;  3LDE A;  4CBC A;  4RUF A;  2QTO A;  2BOC C;  5B1B C;  3SYP A;  2A79 B;  4WFH A;  4WFF A;  4ZBM A;  4LP8 A;  4MVR A;  4R50 A;  5IY5 C;  4X8A A;  3T4Z A;  3PJS K;  3AG4 C;  3SPC A;  3E86 A;  1J95 A;  4PA7 A;  5EC1 C;  3GB7 C;  2OCC C;  4G28 B;  3SPJ A;  3TET A;  2DYR C;  2AHZ A;  5EBL C;  3UKM A;  1M56 C;  3LNM B;  4R8C A;  3STL C;  3AG3 C;  3IFX A;  4QNH B;  2HG5 C;  2WLN A;  5CBG A;  4R6Z A;  3UM7 A;  2KB1 A;  2X6C A;  4RUE A;  4RAI A;  2IH1 C;  3K06 A;  1KKD A;  4MTO A;  3K0G A;  4MVM A;  2EIN C;  3SPG A;  3E8H A;  5B1A C;  4P2Z A;  4XDJ A;  2EIJ C;  4GX2 A;  3FB8 C;  4XDK A;  3KG2 A;  2ZXW C;  4GX0 A;  2H8P C;  4J9Y B;  4LBE C;  1R3J C;  2WLK A;  4WFE A;  1P7B A;  3AG2 C;  3K0D A;  4JTD B;  4PDV A;  3RVZ A;  4DXW A;  3LUT B;  1R3K C;  2ATK C;  1OCZ C;  4MVQ A;  3K04 A;  2AHY A;  5EK0 A;  4BW5 A;  4X89 A;  3AG1 C;  4MVS A;  3JYC A;  2Q67 A;  4J9Z B;  4KFM A;  4PDR A;  3SYO A;  4MSW C;  2EIK C;  4PA4 A;  4QE7 A;  4XDL A;  2HJF C;  3T4D A;  2WLH A;  3OR6 C;  4HYO A;  4MVO A;  2DWD C;  2DWE C;  3E8G A;  3OR7 C;  4G27 B;  5E1A C;  4PDL A;  3ASN C;  5KUK A;  2NLJ C;  2QKS A;  4EKW A;  2A0L A;  3R65 A;  2WLL A;  1LNQ A;  4JTC B;  2A9H A;  1R3I C;  5KUM A;  2WLM A;  2WLI A;  5B3S C;  1XL4 A;  4PA9 A;  5CBF A;  2WLJ A;  2X6B A;  3SJQ C;  3ASO C;  3BEH A;  5EBW C;  3ZRS A;  3SYA A;  4HZ3 A;  4MS2 A;  2EIM C;  2ITD C;  2P7T C;  4MVZ A;  4PDM A;  3RVY A;  1OCO C;  2ITC C;  3ABM C;  2W0F C;  3E8F A;  1JVM A;  2HVJ C;  2HVK C;  4GX1 A;  3OUF A;  4I9W A;  5EBM C;  5CBH A;  2Q68 A;  3X2Q C;  4LCU C;  4MVU A;  1QLE C;  4TWK A;  3OGC C;  1G4Y B;  3E83 A;  3TCU A;  3T2M A;  4WFG A;  4UUJ C;  3RBZ A;  2Y69 C;  3FB6 C;  3SYQ A;  1S5H C; 
#chains in the Genus database with same CATH topology
 4K0K O;  5LP6 A;  1ZSP A;  4WBN A;  1QVF U;  1H38 A;  4DV6 B;  1R73 A;  3ZJZ A;  4JPR A;  2VQF O;  2BOB C;  5FPO A;  4P30 A;  4N21 A;  3JAR A;  1Q5O A;  1PKX A;  5EZY A;  1OCC C;  3SPJ A;  4CH3 A;  3EFF K;  1BHA A;  1NTK H;  2CGN A;  4GZR B;  1WNS A;  1IUR A;  1SQV H;  1DLB A;  4N23 A;  1TVK A;  2QTO A;  2Y4T A;  4J42 A;  2GTS A;  4WFF A;  1TUE B;  5J2U A;  1G6U A;  2PTM A;  3SPC A;  4DK1 A;  1PP9 H;  4KL1 A;  3TET A;  3HKB B;  1MMM A;  5CN0 A;  4X1I B;  3IFX A;  3B2E E;  4LFA O;  1VQN V;  2X6C A;  1QLE B;  1ZUQ A;  1DF5 A;  1YTF B;  4LFA B;  2EIJ C;  1AI5 A;  1Z5W A;  1QBZ A;  3JAL A;  1SA0 A;  2WLK A;  1NTZ H;  2ZR2 A;  1JR9 A;  1R3K C;  2MK3 A;  4ABM A;  4DR3 B;  3G80 A;  3EHB B;  4J9Z B;  2QWO B;  1FJG O;  1NR7 A;  3G6E V;  2ZKO A;  2D2C B;  3WFV A;  1WJZ A;  1AIL A;  5J2T A;  1FJG B;  1THZ A;  1ZTE A;  1GN2 A;  3RT3 C;  1HNZ B;  1JVM A;  4GYC B;  5EBM C;  3C90 A;  3OUF A;  2QM4 A;  1M56 B;  2Y69 C;  1B06 A;  3CP1 A;  1S5H C;  3FB6 C;  3FAV B;  2E75 B;  3CX5 F;  4YHH B;  4JV5 B;  3ZMZ A;  3T1Y B;  2OCH A;  2QTS A;  4ZKI A;  1BHB A;  5BY1 A;  4JI8 O;  3RFR A;  1FPO A;  2QWP B;  2XHB A;  4DRX B;  1MNG A;  5LBQ A;  2N04 A;  1WA8 B;  3WU2 Z;  1R6N A;  1EN6 A;  3HKD B;  4LFB B;  4B08 A;  4UCS A;  2YIB D;  2ZNI A;  1K4D C;  3JAT B;  3UO2 A;  3AG1 B;  2LP7 A;  3FD9 A;  4K8Z A;  3G4S V;  4DR2 O;  2EUL A;  1V54 C;  2UU9 O;  2Q8V A;  3I56 V;  1RM1 C;  1YIJ V;  4ZBM A;  2UU9 B;  4MVR A;  1BE3 H;  2F23 A;  4BIU A;  4ZHQ A;  5LOV A;  2UXX A;  2LGW A;  2DYR C;  1HNX O;  3MHS C;  4FIP C;  5BXZ A;  3N2K B;  4GKJ O;  1SRY A;  2WA3 A;  1O9H A;  1XHZ A;  4OPH A;  1YXB A;  3VBB A;  3ML0 A;  5B1A C;  1QR8 A;  1SES A;  4ASU G;  3WB0 A;  2PI5 A;  3KG2 A;  2H8P C;  4NXN O;  1WLE A;  4JI4 B;  2CAZ C;  2XAF A;  5IT9 N;  4X1K B;  4DXW A;  2GV9 A;  2WAM A;  3DXR A;  3JD0 A;  4PEL A;  2Y0P A;  4BIZ A;  5LHI A;  3ZHR A;  1H2N A;  4D7S A;  5EYP B;  4QE7 A;  3D36 A;  4H44 B;  1BZK A;  1FFT B;  2GSM B;  3ZN1 A;  1IZ3 A;  2BTQ A;  2XND G;  2P90 A;  3EXA A;  5LP6 C;  3JAS B;  3BRC A;  1EM1 A;  3R66 A;  2P67 A;  5LHH A;  1B04 A;  4LNU A;  3OMN B;  4YJ3 B;  3W7U A;  4CC5 A;  3E8F A;  1N32 O;  2DJV A;  2CH7 A;  2OCC B;  5DM6 V;  2Q68 A;  3CXC U;  1N32 B;  2KG7 B;  3W7X A;  3G71 V;  4MW3 A;  2EIN B;  2FML A;  2BTO A;  4MTF A;  3IGA C;  1D2D A;  1E1Q G;  3CWB H;  5CA3 A;  2DN9 A;  4DV3 O;  4NB5 A;  1IBM O;  3VQX A;  3GVM A;  1OJH A;  5LYJ A;  4NXM B;  2F66 C;  5H5N A;  1OCR C;  3RW0 A;  4Q6G A;  1SC5 B;  2UXD B;  4IIJ A;  4EFB A;  2K1E A;  4U3J B;  2ZIO A;  4MTG A;  3DTU B;  3C3S A;  2A79 B;  4O4I A;  4UCO A;  4LP8 A;  3CCM V;  1VF6 A;  4B3S O;  4X8A A;  1JJO A;  4JZG A;  3DGE A;  3H9V A;  3OAA G;  4ZIB A;  3UKM A;  1Y66 A;  1XDC A;  4E4E A;  2UUB B;  2FKX A;  4NYK A;  2ZT9 B;  3UT5 A;  2V7Q G;  4DO2 A;  3RYH A;  4JAA A;  3A8T A;  2A7W A;  3RYI B;  2LGQ A;  2BCC H;  4BW5 A;  5LGU A;  1MZF A;  5DEC A;  4LF4 B;  1Q6H A;  1GKF A;  3RN4 A;  2X7R B;  4DR1 O;  3BPZ A;  4HYO A;  3OR7 C;  5B66 Z;  3APQ A;  5C93 A;  5CB4 A;  1FXV A;  1K92 A;  1N0N A;  3NXS A;  5KUM A;  2F4V O;  4PA9 A;  5L3G A;  1BMF G;  2UXN A;  4MS2 A;  4LC1 A;  1N36 O;  1HNW O;  1OCO C;  3ZHQ A;  2W0F C;  3DSQ A;  3QO5 A;  1HP8 A;  5KA5 A;  1HNW B;  4X64 B;  3L72 H;  1VQP V;  1ZL8 A;  4O2A B;  5KX5 A;  4I50 B;  4U7O A;  2IJH A;  4UB8 Z;  1KBH A;  2RN9 A;  1ORQ C;  2XAJ A;  2F95 B;  2CE4 A;  3OUS A;  1FXK B;  2JEX A;  1IXB A;  1VQ5 V;  3KZI Z;  2C2A A;  2ZD9 A;  4I0X A;  2NR5 A;  1N34 B;  2E5L O;  4FLY A;  2R9I A;  3ZCC A;  5IYZ B;  5H6R A;  1HWY A;  2Q0O C;  2PYJ A;  2E5L B;  3H1I H;  1NH2 D;  4O2B A;  2HG5 C;  3CCR V;  3KKY A;  1U97 A;  1WP8 A;  5JQG A;  4UCV A;  3B8M A;  2ZQM A;  2KKW A;  5K1P A;  2YS8 A;  1KB9 F;  1I94 B;  1XUQ A;  3JAW B;  1S5J A;  3IJ4 A;  1YCI A;  1CEZ A;  2ATK C;  1Z5V A;  4X1Y A;  2OIG A;  1VF5 B;  1QLN A;  1KD1 W;  2H3O A;  3SYO A;  1XHX A;  1YJW V;  2OIE A;  4YJ2 B;  3EVK A;  2Z0A A;  2F43 G;  5IYC O;  1Q6U A;  3Q4H B;  1IBK B;  2QJ1 A;  3R65 A;  1LNQ A;  5B1O A;  1WN7 A;  3OTO O;  2WLJ A;  1RSO B;  1AB3 A;  4JI1 O;  2UXC B;  1W59 A;  2ITC C;  4L8J A;  4GX1 A;  2HVJ C;  1K7D A;  1QLE C;  3CCE V;  1IDS A;  4WFB V;  4I4T B;  4RWU A;  4U3F H;  2FYU H;  2XTA A;  4LH6 A;  4J10 A;  1I08 A;  3NR7 A;  1QQC A;  2BSK B;  3JD3 A;  4B3M O;  4H33 A;  2IJK A;  2HHH B;  1NU1 H;  1PL4 A;  2G38 A;  1WB7 A;  1VF6 C;  5JVD B;  4XBF A;  5CMU A;  4GX5 A;  2WWW A;  2IH3 C;  2P5O A;  1PL0 A;  2VS0 A;  4JYB A;  5L3C A;  1BT8 A;  4RQE A;  4X88 A;  2RDC A;  5BZB A;  1NBM G;  2AZ0 A;  4NTX A;  4RO2 A;  3FB5 C;  3S3W A;  2IU0 A;  3ASN B;  1VQ8 V;  3BA8 A;  5FL7 G;  3B40 A;  5CA0 B;  3U11 A;  1GTO A;  1ZLZ A;  5LMN O;  3T4Z A;  4DV5 B;  2E76 B;  2JRI A;  3H01 A;  1M56 C;  5FNV B;  3STL C;  5LMN B;  3L9D A;  1ENV A;  1I7F A;  4R6Z A;  3OT7 A;  4IT5 A;  1E1R G;  3CHX A;  4IHJ B;  1IBL O;  4J7K A;  2DQ0 A;  4XDJ A;  4GX2 A;  1B3Q A;  2Z5U A;  5JCO A;  1IBL B;  2KQX A;  4U7N A;  4B3R O;  2P06 A;  2EZO A;  1KUQ A;  4WFE A;  1HW7 A;  4O4H A;  1HR0 O;  4DV4 B;  1NI8 A;  3HKE A;  2EIL B;  5EK0 A;  2OYQ A;  3AG1 C;  4D7T A;  4NKG B;  4PDR A;  5HFL A;  4ZI7 A;  3AK3 A;  1D5A A;  3K58 A;  4DUZ O;  2E3C A;  1WPB A;  3RYF B;  1YZB A;  1N33 O;  3ABU A;  1F51 A;  2UUA O;  1R3I C;  1XIL A;  2XAG A;  1K33 A;  4GKK O;  1VQK V;  2UUA B;  5KAF Z;  4EEQ A;  3LSQ A;  4JI6 B;  3OGI B;  2H94 A;  1JX9 A;  3JCZ A;  5AG2 A;  4UUJ C;  2HP8 A;  1I0H A;  2WPD G;  3KCY A;  1NR1 A;  3F7Y C;  5KHI A;  4AQY O;  3IAY A;  5LXT B;  3KCX A;  1AVM A;  3K08 A;  1EN4 A;  3CJH A;  1X4T A;  2RNB A;  1P7G A;  4CS2 A;  3ZHS A;  3UO3 A;  3E22 B;  1JFF A;  4LF8 O;  3UQ8 A;  4JI5 O;  5CA1 A;  4TV9 A;  4UCU A;  1XMO O;  4OX9 B;  3SPI A;  1S77 D;  4JI5 B;  4CH5 A;  1XL6 A;  4DV6 O;  2DE0 X;  2GUZ B;  1MA1 A;  1XMO B;  1KQS U;  4RUF A;  4K8X A;  3A0H Z;  4KHP B;  1RPR A;  5H9C A;  4EB6 A;  3CRR A;  3CYO A;  3PN1 A;  2QWR B;  3TXS A;  3N27 A;  1CXZ B;  1K34 A;  2OCC C;  2QWN B;  2YXH A;  5GTI Z;  4R8C A;  3D3Q A;  3TJT A;  4C7U A;  3ICX A;  1Q81 W;  4GCZ A;  5IE9 A;  1KKD A;  2PUS A;  2LFS A;  2EIN C;  2RCV A;  4JF3 A;  3J80 N;  3ZMU A;  4D6T H;  1SER A;  3A2F A;  4PDV A;  2PGG A;  5IY5 B;  2ZM6 B;  4DR7 O;  2VQE O;  1R1B A;  1YEW A;  4FM2 A;  4X89 A;  1VF7 A;  2FB5 A;  3H1H H;  4DR7 B;  4NTW A;  2VQE B;  2ZE8 A;  1NKD A;  1GM7 A;  4FLU A;  5LMU B;  4KXR A;  4PDL A;  1UPG A;  2YIC A;  3GWK C;  2A0L A;  1M57 B;  2DOS A;  2WLM A;  1SQG A;  4DR3 O;  3SJQ C;  1AR1 B;  3ZRW A;  5KAI Z;  1OHH G;  3B4S A;  2HVK C;  4I9W A;  3W7S A;  1DGS A;  3SDL A;  5BMV A;  4WFG A;  2ADP A;  4PV1 B;  4P9P A;  4UVC A;  4P9O A;  1TAE A;  1HNZ O;  5KMG B;  1JA8 A;  3AG2 B;  1VEW A;  2ODM A;  2M7W A;  1MSW D;  4IHJ A;  4TT3 G;  3QO8 A;  3L73 H;  4MW8 A;  2K9P A;  4YHH O;  4JV5 O;  3T1Y O;  1MAB G;  4X65 O;  1VQO V;  2DMX A;  2YI9 A;  3RWR D;  4HNA A;  3B09 A;  1R3L C;  3JAK A;  1YF2 A;  5JCO C;  3WB2 A;  2W6I G;  4X65 B;  1DK1 A;  5ITZ B;  3CD6 V;  2ZDI C;  1RP3 B;  4JAS A;  4LFB O;  1Y76 B;  3BFR A;  3I5D A;  1MZE A;  3PJS K;  1AP6 A;  5LHG A;  5EBL C;  3OMA B;  4DR6 O;  3ABM B;  4TV8 B;  4NTY A;  4F6R B;  1Y74 A;  1SQQ H;  2DYS B;  2KB1 A;  4OGQ B;  4DR6 B;  4YXW G;  1TUB B;  5IWA B;  2Q7H A;  1SKV A;  1AJQ A;  5JJJ B;  3K9A A;  4TUY A;  4LBE C;  4JZ2 A;  1BCC H;  5LA6 B;  2ZIM A;  1K9M W;  5GON A;  4PI2 A;  3HB3 B;  4JI0 B;  2AHY A;  2YUA A;  3SJC C;  3MAQ A;  3U0Z A;  3CC2 V;  3T4D A;  3ZHT A;  5IJ9 A;  3OMI B;  3K59 A;  3FX7 A;  3S3X A;  4JI4 O;  1AR5 A;  1P84 F;  2JGD A;  3TXQ A;  1HDJ A;  3D3I A;  3ETE A;  1OCZ B;  1F23 A;  3CRA A;  3BHP A;  2VWJ A;  1CPY A;  1XBL A;  4O4L A;  1VQM V;  5K1X A;  4PI0 A;  2OT5 A;  3QVN A;  3CRQ A;  3AK2 A;  3SYQ A;  3K03 A;  1MG1 A;  2YEV B;  2YXY A;  4FLW A;  4LF6 B;  4UVB A;  2ZXW B;  5L3E A;  4JTA B;  2YID A;  2DW4 A;  3M99 B;  3LNN A;  2EIM B;  2JDI G;  4R7C A;  4X20 B;  1GN6 A;  1US6 A;  2WSS G;  4I55 B;  1OV9 A;  4FLT A;  4O4J B;  4BIO A;  2PZS A;  2CTW A;  1EFR G;  3LDE A;  4PJ0 Z;  1IX9 A;  2W0X A;  5B3S B;  3CCL V;  4NXM O;  1E79 G;  2CTQ A;  3HKB A;  4X1I A;  2UXD O;  4YY3 B;  5A9G A;  2Q5Z A;  3QG5 A;  5CBG A;  1XMQ B;  3N2G B;  2UUC O;  3L71 H;  4MTX A;  2P4K A;  4FFB B;  1A32 A;  3K79 A;  3DC5 A;  2UUC B;  1JPX A;  1P7B A;  4JYY A;  3K0D A;  5KHH A;  2UUB O;  4DUY B;  4K3A A;  4B7E A;  3CCS V;  1KC8 W;  2XOK G;  2HJF C;  1XEQ A;  2DWE C;  5E1A C;  3ASN C;  4BAY A;  3WG7 B;  5F2V O;  4IYH A;  4JTC B;  4QJF B;  4DR5 O;  3O9O A;  2F93 B;  4G2K A;  3IC7 A;  4LF4 O;  4LFC B;  5KHK A;  3RYC B;  4DR5 B;  1H2S B;  5CBH A;  1PD3 A;  2P4V A;  4FM0 A;  4DW0 A;  4TWK A;  3ZHV A;  5H6Q A;  4DV7 B;  3RBZ A;  3FAV A;  1BSM A;  3SJB C;  1FFX B;  2ILM A;  3HPL C;  4DRX A;  1WA8 A;  1NVP D;  2EIL C;  5LGN A;  3HKD A;  4X64 O;  3CCU V;  4UXN A;  3ZN0 A;  3JAT A;  3E8B A;  2Y4U A;  5L3B A;  1IXM A;  4DW1 A;  1AP5 A;  4LWS B;  1PM9 A;  4X66 B;  3ZIA G;  1K97 A;  2Y69 B;  2FTK A;  2L6L A;  1FXH A;  4B3T O;  1RPO A;  2AZ2 A;  1YJ9 V;  5IJ0 B;  3K5M A;  2Q9L A;  5KLV H;  4B3T B;  4PA7 A;  4DV2 B;  1L0L H;  3N2K A;  1X59 A;  4L87 A;  1K8A W;  2B9Z A;  2HEP A;  3MD0 A;  2B1G A;  4UB6 Z;  1XNR O;  3K5L A;  1V9P A;  5EIB D;  1N34 O;  5D5Q A;  1WAZ A;  2CTR A;  2EZP A;  2YIA A;  5H2F Z;  1RM1 B;  5JH7 B;  1XNR B;  1I5X A;  4X1K A;  4Z1V A;  3A0R A;  2CK3 G;  1AJN A;  3CC7 V;  2HLD G;  3JYC A;  5IDJ A;  1KYO F;  3QTC A;  5EYP A;  4FLV A;  1ZAU A;  4FK5 C;  1S72 V;  4CC6 A;  2DWD C;  1I94 O;  5JWP A;  3JAS A;  3T1H B;  4EKW A;  1S3J A;  2GTA A;  2ZNJ A;  5BR8 B;  4JYA B;  5B1B B;  1SQX H;  4NR1 A;  4YJ3 A;  3J81 N;  1L1F A;  1L8D A;  1WPX A;  2LW1 A;  2LQT A;  5LL6 Y;  2KG7 A;  3AG3 B;  3T2M A;  1IBK O;  1BL8 A;  4TQD A;  4QPK A;  5LP6 B;  2IBZ H;  2N05 A;  4WBN B;  1N4C A;  2UXC O;  2EX3 A;  2R9A A;  1FAF A;  1S0V A;  1GRJ A;  1QNM A;  3JAR B;  1WB8 A;  3SJA C;  2QM7 A;  1KEC A;  4H37 A;  5EZY B;  4GT1 A;  1M5I A;  4JAV A;  4HBN A;  2R70 A;  3F5W C;  3LDD A;  4U3J A;  2GHY A;  2HHH O;  4TQF A;  1M57 C;  4UV9 A;  3ZS8 C;  1TVK B;  2ETN A;  2PY5 A;  4R50 A;  5J2U B;  4JI2 B;  3ASO B;  4J41 A;  1W0K G;  2FL4 A;  2ZE6 A;  3CE2 A;  3CME V;  4LF9 B;  3JD1 A;  2M6Y A;  1W0J G;  1VQ4 V;  3UM7 A;  1SET A;  1QHT A;  3APO A;  3K0G A;  5TIS Z;  2LJ2 A;  2EBO A;  1YIT V;  4DV5 O;  3JAL B;  3RYI A;  1SA0 B;  3AG2 C;  1V55 B;  1NQT A;  1YSC A;  2ZIN A;  1H8E G;  3ABL B;  4X62 O;  1FD9 A;  2YI8 A;  3ZHU A;  2CUG A;  1Q3E A;  4PA4 A;  2WLH A;  4X62 B;  3BA9 A;  4J7J A;  4MVO A;  5IYD O;  4G27 B;  3WB1 A;  4FZ0 A;  3JSL A;  4DV4 O;  4QPJ A;  5J2T B;  1NVP B;  2ZDI A;  3ZRS A;  4B7K A;  1KP2 A;  4K35 A;  1EN5 A;  3RVY A;  3ABM C;  2Z3Y A;  1KU9 A;  2XAS A;  1SZX A;  3BAA A;  4UFZ A;  1Q43 A;  3H1J H;  3JD2 A;  3ZMT A;  2Q6A A;  1SZT A;  2A3Q A;  3CRC A;  3CRM A;  1N0J A;  2E74 B;  4CS3 A;  4O2A A;  1XOU A;  4I50 A;  4QE9 A;  2JK5 C;  4FLX A;  2WLI B;  3T1C A;  1DF4 A;  4GUN A;  4JI6 O;  1NS1 A;  3VQY A;  4UV8 A;  2JJ2 G;  3JAM N;  3O65 A;  4A5U B;  4PA3 A;  3OFN G;  1FXK A;  3OD4 A;  2EIK B;  4DV1 B;  5JJE B;  4BR6 A;  1LUW A;  4CBC A;  4LF5 B;  3CSX A;  1Q82 W;  5KHG A;  1M9N A;  3ZED A;  3C3T A;  4FFK A;  5IYZ A;  4PHZ A;  2IW5 A;  1Q6I A;  2JGU A;  2JJ1 G;  1QCE A;  1J95 A;  3CXH F;  4DV0 O;  2IJI A;  4ZHQ B;  5LOV B;  3CCJ V;  1NH2 B;  4OX9 O;  4QGP A;  2V4D A;  4DV0 B;  2WLN A;  1K5Q A;  4KHP O;  2EJ7 A;  1YJN V;  4XDK A;  4ZOL B;  2ZXW C;  4DYL A;  3JAW A;  4J9Y B;  1JJ2 U;  3B77 A;  1W2B U;  3MDS A;  4E2L A;  1S76 D;  1GO3 F;  3DXR B;  5B5E Z;  2BE3 A;  3ABK B;  4YJ2 A;  2NNU A;  2B1I A;  3JD4 A;  1JOY A;  2BTQ B;  2YC0 A;  4JI3 O;  3ETD A;  4BWA A;  3Q4H A;  1GN3 A;  3FKS G;  2QKS A;  4K0K B;  2YDE A;  2ZM6 O;  1VQ7 V;  5JJN B;  5B3S C;  5CBF A;  1RSO A;  4JI3 B;  3ETQ A;  3BEH A;  3THO A;  5FPR A;  4LNU B;  3CB2 A;  3CCV V;  4MVZ A;  4PDM A;  1ZX3 A;  2VQF B;  3AG4 B;  3BCC H;  4WF9 V;  2CH7 B;  5LMU O;  1PNK A;  5DED A;  1PPJ H;  4I4T A;  1XNQ O;  2VWK A;  1Q90 D;  2BSK A;  3L70 H;  3LDC A;  1XNQ B;  2WLL B;  1M93 A;  5JVD A;  3STZ C;  2GBO A;  2R9R B;  4WCE V;  3DC6 A;  4W4L A;  3FYE B;  3HR0 A;  4F4L A;  5LYJ B;  1IVS A;  2AW9 A;  1QVG U;  3OM3 B;  1MOF A;  1EZV H;  3E89 A;  3RGB A;  4IIJ B;  1VMG A;  3WG7 C;  2IU3 A;  3QF7 A;  5J9P C;  3A0B Z;  1AI6 A;  3SYP A;  2ZR3 A;  3OE7 G;  4WFH A;  5GTH Z;  4O4I B;  5CA0 A;  2XT9 A;  1Y67 A;  1O9G A;  1QU7 A;  3BAB A;  4X9Q A;  2ADQ B;  5EC1 C;  3GB7 C;  1M90 W;  1NT2 B;  1Y4M A;  4UVA A;  1JMK C;  5FNV A;  4GLX A;  3LNM B;  3CC4 V;  4JAU A;  4IYI A;  4FPP A;  1SQF A;  5FLX N;  4MTO A;  4AI8 A;  1TGO A;  1WP7 A;  3E8H A;  3SR2 C;  3FB8 C;  1GAX A;  2PYL A;  3UT5 B;  5D5P A;  2WA4 A;  4KUM A;  3P32 A;  3RYH B;  4JTD B;  4IL6 Z;  1K5S A;  1GMG A;  3CCQ V;  1PNM A;  1M1K W;  1AR4 A;  1UFI A;  5IWA O;  3OEE G;  3OR6 C;  1B6Q A;  2JS5 A;  4LR3 A;  2NLJ C;  3AG7 A;  3RYF A;  1J5E O;  2JS3 A;  1MSD A;  5CB4 B;  2A06 H;  1DTO A;  2RJZ A;  3JSN A;  2WLI A;  2LFR A;  1SQB H;  1J5E B;  4JI0 O;  1YDX A;  5A2Q N;  4QIW F;  2QGN A;  3SGI A;  4JI8 B;  2VRZ A;  3LSU A;  2QKC A;  2ARH A;  5DN6 G;  3FYI B;  1COW G;  3AEI A;  3G67 A;  3OTF A;  1K3E A;  3E83 A;  1FXK C;  5LXT A;  2YXL A;  1R6K A;  1ZL8 B;  4DR2 B;  1N8R W;  1VAR A;  3SYC A;  5KX5 B;  3E22 A;  3FB7 C;  3VOU A;  2QA4 V;  1PV0 A;  4OXS A;  2B5U A;  4AHC A;  4J11 A;  1HNX B;  3HKC B;  4LF6 O;  3ZRX A;  2GUZ A;  1K4C C;  4ZOL A;  4GKJ B;  3I55 V;  4I0X B;  5B1B C;  4I5S A;  1Q86 W;  5L3D A;  3U10 A;  2IM9 A;  2X0L A;  4NXN B;  2JEU A;  3M8A A;  5IYB O;  2GDS A;  3AG3 C;  1SF9 A;  4O2B B;  2RMK B;  5B1N A;  3X2Q B;  2IH1 C;  1BGY H;  5JQG B;  4P2Z A;  4I9Q A;  2N74 A;  1I5Y A;  2P6J A;  1LUV A;  4FJC C;  3RVZ A;  4YY3 O;  4H0L B;  5GW7 A;  2RQ6 A;  2Y48 A;  3OW2 U;  1XMQ O;  4X1Y B;  2Q67 A;  4FMT A;  1PNL A;  2QEX V;  1OCC B;  3QO7 A;  4XDL A;  1YI2 V;  2OWO A;  3J7A U;  4WFA V;  3E8G A;  4KP4 A;  1P49 A;  2WLL A;  3L75 H;  2A9H A;  5C8Y B;  4JGS A;  3ASO C;  2QM8 A;  3H1L H;  4PD4 F;  5EBW C;  4DUY O;  2HJD A;  2QKA A;  4H13 B;  4YIO A;  1FKA O;  4DV3 B;  1VQ6 V;  1IBM B;  2QDO A;  3E2E A;  3TK1 A;  3L74 H;  4MVU A;  1G4Y B;  4JI7 O;  2QWQ B;  4FLZ A;  1ZWI C;  4PA6 A;  3ZMS A;  1VP7 A;  4JI7 B;  2EIJ B;  4LFC O;  1V55 C;  4I7Z B;  1FYJ A;  5KMG A;  1GH6 A;  3ABL C;  3ZX6 A;  1L0N H;  4BW9 A;  2X6A A;  5E79 Z;  4B3S B;  4DV7 O;  5EC2 C;  3ABT A;  1Z2G A;  3K9S A;  1Q7Y W;  3ETG A;  1XI1 A;  3K5O A;  2UXB O;  1Q8I A;  1YHQ V;  1FS0 G;  5ITZ A;  2UXB B;  4FZ1 A;  4Z2W A;  5HFM A;  1Y76 A;  3K57 A;  3E86 A;  4G28 B;  2Q4P A;  1KMI Z;  4TV8 A;  1D5N A;  4EFE A;  4F6R A;  4QNH B;  4CZZ A;  4X66 O;  4F6E A;  4RAI A;  1GM8 A;  3K06 A;  1TUB A;  3JCU Z;  1GM9 A;  3K5N A;  2QSA A;  1QR9 A;  4DR1 B;  4MT8 A;  2W6J G;  1K73 W;  1M4U A;  5LA6 A;  1BQZ A;  3P3N A;  4DV2 O;  4TSF G;  4O4H B;  4MVQ A;  2F4V B;  3HKE B;  2XAH A;  3H1K H;  1N36 B;  3CMA V;  3E35 A;  2JVD A;  1GK9 A;  4ZI7 B;  2EIK C;  5EIB C;  2CDY A;  4CH4 A;  1XQ8 A;  2V1D A;  2ZE7 A;  1V54 B;  4IGG A;  1AI7 A;  1H2M A;  2CTP A;  2XAQ A;  4Z1M G;  2AXT Z;  2P22 C;  1VQ9 V;  2DYR B;  3LSS A;  1H8H G;  3HKC A;  2QE7 G;  3T1H O;  1R6T A;  1U96 A;  2YEV A;  2PF4 E;  1YVW A;  5BR8 O;  4JYA O;  4OPA A;  5B1A B;  1H2K A;  3CJH B;  2CGO A;  2QR4 A;  1VQL V;  1JFF B;  4FVM A;  4X20 A;  3ABK C;  3G6B A;  2YSU B;  1OZ0 A;  5CA1 B;  3D36 C;  4I55 A;  4TV9 B;  4RQF A;  4O4J A;  3UCS C;  3SPH A;  2JIZ G;  2NN4 A;  1SS3 A;  2R72 A;  1GN4 A;  2KSD A;  5IY5 C;  4EB6 B;  3BY6 A;  3AG4 C;  4J7Z A;  1JCH A;  1BS3 A;  4HAM A;  3N2G A;  2MW2 B;  2Q73 A;  1H2L A;  2Q7E A;  4FFB A;  3IC9 A;  1F7Y A;  4GX0 A;  5C8Y A;  1G1X B;  4LF7 O;  4JI2 O;  1S5L Z;  1CP9 A;  3VQW A;  2EJR A;  2Q7G A;  4LF7 B;  4LF9 O;  2ZCE A;  3OTO B;  3ZRV A;  3QNE A;  4JI1 B;  4KFM A;  1XRE A;  1OCR B;  1AJP A;  3W7T A;  3B8N A;  5KUK A;  5KA6 A;  2L35 A;  4J80 A;  1F4N A;  1YTF D;  3MHH C;  1XL4 A;  4B3M B;  1BQ0 A;  2X6B A;  4Q20 A;  4UCR A;  4HZ3 A;  3RYC A;  2ITD C;  2P7T C;  3ZRW B;  1UJW B;  2IJJ A;  3D8C A;  3CPW U;  4W4K A;  1LR1 A;  1KKC A;  3GWO A;  4JYC A;  4LCU C;  2LO1 A;  4FM1 A;  1EZJ A;  5BMV B;  1H2G A;  2Y0I A;  3OGC C;  3W7W A;  2OTJ V;  1FFX A;  2HFE C;  1ROP A;  5LGT A;  2HKO A;  2D3O W;  4CS4 A;  1Y6X A;  2OTL V;  3P30 A;  3ZMV A;  1JQ0 A;  3K3W A;  1G8M A;  4LH7 A;  3BVO A;  2YIB A;  2HR3 A;  1NTM H;  1TA8 A;  2Q69 A;  3F7V C;  1F4M A;  2DYS C;  4ICG A;  3OEH G;  4LWS A;  1NJI W;  1EBO A;  4HNA B;  3JAK B;  2BOC C;  3TGU H;  5IJ0 A;  1URF A;  4DR4 O;  4NVP A;  4B3R B;  1HR0 B;  4DR4 B;  2AHZ A;  1OCO B;  4DV1 O;  3M7M X;  3F5T A;  1Y74 B;  1AI4 A;  4RUE A;  4LF5 O;  4MVM A;  1P4R A;  3SPG A;  4UCT A;  2AGA A;  4DUZ B;  5JH7 A;  4TUY B;  1R3J C;  2F1M A;  2LW7 A;  1N33 B;  3CS5 A;  3VQV A;  5GON B;  1RFY A;  3LUT B;  4AIL C;  1OCZ C;  1VIB A;  3K04 A;  2DQ3 A;  4GKK B;  4MVS A;  5KHJ A;  4MSW C;  3ZBH A;  1SQP H;  1NZ6 A;  4YIP A;  2Q0A A;  5IJ9 B;  2ZE5 A;  5L3F A;  2XUM A;  2O57 A;  2JGD B;  1KP3 A;  4AQY B;  1T5E A;  2PI4 A;  1ARO P;  4TOI A;  3SYA A;  2EIM C;  3FFQ A;  3P3P A;  4DK0 A;  3X2Q C;  4LF8 B;  3CEI A;  4O4L B;  3TCU A;  4CH6 A;  3AK1 A; 
#chains in the Genus database with same CATH homology
 1R6K A;  3JD3 A;  1QVF U;  3HPL C;  2IJK A;  4H33 A;  1N8R W;  1H38 A;  1R73 A;  3ZJZ A;  3SYC A;  4JPR A;  2BOB C;  1NVP D;  4XBF A;  4P30 A;  2EIL C;  3FB7 C;  3VOU A;  5CMU A;  4GX5 A;  4N21 A;  5LGN A;  2QA4 V;  2WWW A;  2IH3 C;  4OXS A;  3CCU V;  1PL0 A;  1PKX A;  4UXN A;  3ZN0 A;  4JYB A;  1OCC C;  3SPJ A;  5L3C A;  3EFF K;  4RQE A;  2B5U A;  4X88 A;  3E8B A;  1BHA A;  5L3B A;  1IXM A;  5BZB A;  1NBM G;  3ZRX A;  1K4C C;  3ZIA G;  1K97 A;  2Y69 B;  4RO2 A;  2FTK A;  1DLB A;  3FB5 C;  2IU0 A;  4N23 A;  3ASN B;  1VQ8 V;  2QTO A;  3I55 V;  1FXH A;  5B1B C;  4I5S A;  1RPO A;  1Q86 W;  5FL7 G;  4WFF A;  1YJ9 V;  1TUE B;  5L3D A;  2X0L A;  1GTO A;  3T4Z A;  2JEU A;  3SPC A;  4PA7 A;  3TET A;  5CN0 A;  3H01 A;  1M56 C;  3STL C;  5IYB O;  3AG3 C;  1ENV A;  3IFX A;  4L87 A;  3X2Q B;  5B1N A;  1K8A W;  4R6Z A;  1VQN V;  3MD0 A;  2X6C A;  1E1R G;  1QLE B;  2IH1 C;  2B1G A;  1DF5 A;  1YTF B;  2DQ0 A;  4P2Z A;  4XDJ A;  2EIJ C;  2EZP A;  4GX2 A;  1AI5 A;  2Z5U A;  1I5Y A;  1RM1 B;  4U7N A;  1QBZ A;  2P6J A;  1I5X A;  2EZO A;  2WLK A;  4WFE A;  4FJC C;  2ZR2 A;  3RVZ A;  1R3K C;  2MK3 A;  3A0R A;  2CK3 G;  1AJN A;  2EIL B;  3CC7 V;  5GW7 A;  5EK0 A;  2HLD G;  2Y48 A;  3OW2 U;  3AG1 C;  3EHB B;  3JYC A;  2Q67 A;  4FMT A;  1PNL A;  4J9Z B;  5IDJ A;  2QEX V;  4PDR A;  5HFL A;  1OCC B;  3QO7 A;  4XDL A;  1YI2 V;  4FK5 C;  1S72 V;  2DWD C;  4WFA V;  3E8G A;  1NR7 A;  3G6E V;  4KP4 A;  3WFV A;  4EKW A;  3ABU A;  1S3J A;  2WLL A;  1F51 A;  2A9H A;  1R3I C;  1THZ A;  5B1B B;  4JGS A;  2XAG A;  3ASO C;  1K33 A;  2QM8 A;  5EBW C;  1VQK V;  1L1F A;  1JVM A;  5EBM C;  3OUF A;  3LSQ A;  1VQ6 V;  3E2E A;  3TK1 A;  2H94 A;  1M56 B;  1WPX A;  4MVU A;  1JX9 A;  3JCZ A;  1G4Y B;  3AG3 B;  3T2M A;  4UUJ C;  2Y69 C;  3FB6 C;  3CP1 A;  2WPD G;  1S5H C;  1BL8 A;  1NR1 A;  3F7Y C;  4QPK A;  1ZWI C;  4PA6 A;  3ZMS A;  3ZMZ A;  2EIJ B;  3K08 A;  4ZKI A;  1BHB A;  1V55 C;  5LBQ A;  3ABL C;  1R6N A;  1S0V A;  2X6A A;  5EC2 C;  1K4D C;  1KEC A;  2QM7 A;  4H37 A;  3ABT A;  3AG1 B;  2LP7 A;  4GT1 A;  4JAV A;  3SPI A;  3ETG A;  1Q7Y W;  1S77 D;  3F5W C;  3LDD A;  3G4S V;  1XL6 A;  2GHY A;  1KQS U;  1V54 C;  1YHQ V;  1M57 C;  4RUF A;  4UV9 A;  1FS0 G;  3I56 V;  1RM1 C;  1YIJ V;  1RPR A;  4ZBM A;  5H9C A;  5HFM A;  4MVR A;  4R50 A;  3CYO A;  3ASO B;  4BIU A;  1W0K G;  3E86 A;  2UXX A;  1K34 A;  2OCC C;  4G28 B;  2DYR C;  3CME V;  4R8C A;  3MHS C;  3JD1 A;  4FIP C;  1W0J G;  4QNH B;  4CZZ A;  1VQ4 V;  3UM7 A;  1Q81 W;  1SET A;  1SRY A;  4GCZ A;  1GM8 A;  4RAI A;  3K06 A;  1KKD A;  1GM9 A;  2LFS A;  3K0G A;  2EIN C;  1QR9 A;  3VBB A;  3ML0 A;  5B1A C;  1QR8 A;  1SES A;  4ASU G;  2PI5 A;  4MT8 A;  3KG2 A;  2EBO A;  2W6J G;  1K73 W;  1YIT V;  4JF3 A;  2H8P C;  3ZMU A;  1WLE A;  1SER A;  2XAF A;  3AG2 C;  4PDV A;  4DXW A;  1V55 B;  4TSF G;  1NQT A;  2WAM A;  5IY5 B;  4MVQ A;  3JD0 A;  4PEL A;  1YSC A;  4BIZ A;  3ABL B;  1H8E G;  2XAH A;  5LHI A;  4X89 A;  3CMA V;  3E35 A;  1GK9 A;  2EIK C;  4PA4 A;  4QE7 A;  3D36 A;  2WLH A;  1NKD A;  1FFT B;  2GSM B;  3ZN1 A;  1GM7 A;  4MVO A;  5IYD O;  4G27 B;  2XND G;  4PDL A;  2P90 A;  2V1D A;  2A0L A;  1V54 B;  1M57 B;  1AI7 A;  2WLM A;  4QPJ A;  2P67 A;  1NVP B;  2ZDI A;  3SJQ C;  5LHH A;  2XAQ A;  3ZRS A;  1AR1 B;  3OMN B;  1KP2 A;  3ZRW A;  3W7U A;  4Z1M G;  1OHH G;  3RVY A;  3ABM C;  3E8F A;  2HVK C;  2OCC B;  4I9W A;  5DM6 V;  1VQ9 V;  2DYR B;  2Q68 A;  2Z3Y A;  3LSS A;  3CXC U;  3W7S A;  1H8H G;  2QE7 G;  4WFG A;  2XAS A;  3W7X A;  3G71 V;  2YEV A;  3JD2 A;  4MW3 A;  4P9P A;  3ZMT A;  2Q6A A;  4UVC A;  1SZT A;  2EIN B;  4P9O A;  5B1A B;  4MTF A;  4QE9 A;  3IGA C;  1E1Q G;  2JK5 C;  2WLI B;  5CA3 A;  3T1C A;  3AG2 B;  1DF4 A;  1VQL V;  2M7W A;  4UV8 A;  1OCR C;  3ABK C;  2JJ2 G;  3RW0 A;  2YSU B;  1MSW D;  1OZ0 A;  4PA3 A;  4RQF A;  4TT3 G;  3OFN G;  3QO8 A;  4MW8 A;  1FXK A;  2EIK B;  2K1E A;  1MAB G;  3SPH A;  1VQO V;  2JIZ G;  4MTG A;  3DTU B;  4CBC A;  1R3L C;  1Q82 W;  2A79 B;  2W6I G;  1M9N A;  3CD6 V;  2ZDI C;  4LP8 A;  4JAS A;  3CCM V;  5IY5 C;  2IW5 A;  3BY6 A;  4X8A A;  3PJS K;  3AG4 C;  2JJ1 G;  1QCE A;  1J95 A;  1JCH A;  3DGE A;  2IJI A;  3CCJ V;  5LHG A;  3OAA G;  1NH2 B;  5EBL C;  1Y66 A;  3OMA B;  3UKM A;  3ABM B;  4HAM A;  2WLN A;  2DYS B;  2KB1 A;  1K5Q A;  4YXW G;  1YJN V;  1AJQ A;  4XDK A;  2ZXW C;  3K9A A;  4GX0 A;  1JJ2 U;  2V7Q G;  4J9Y B;  4LBE C;  3B77 A;  4DO2 A;  1CP9 A;  1K9M W;  1W2B U;  2EJR A;  3HB3 B;  4E2L A;  1S76 D;  1GO3 F;  2AHY A;  3ZRV A;  4BW5 A;  5LGU A;  3QNE A;  1GKF A;  4KFM A;  3CC2 V;  2X7R B;  1OCR B;  1AJP A;  3ABK B;  3T4D A;  2NNU A;  2B1I A;  4HYO A;  3OMI B;  3W7T A;  3OR7 C;  3JD4 A;  1JOY A;  3B8N A;  5KUK A;  5KA6 A;  1F4N A;  5C93 A;  3ETD A;  1FXV A;  1YTF D;  1K92 A;  3FKS G;  2QKS A;  3MHH C;  1VQ7 V;  3NXS A;  5KUM A;  5B3S C;  5CBF A;  1XL4 A;  4PA9 A;  5L3G A;  3D3I A;  2X6B A;  4Q20 A;  3BEH A;  1BMF G;  2UXN A;  3ETE A;  4HZ3 A;  4MS2 A;  2ITD C;  2P7T C;  4LC1 A;  3CCV V;  3ZRW B;  1OCZ B;  4MVZ A;  1UJW B;  1F23 A;  4PDM A;  2IJJ A;  1OCO C;  3AG4 B;  3CPW U;  2W0F C;  4WF9 V;  3GWO A;  3QO5 A;  4JYC A;  5KA5 A;  1CPY A;  4LCU C;  1PNK A;  1VQM V;  1EZJ A;  1H2G A;  2OT5 A;  3SYQ A;  3OGC C;  3W7W A;  1VQP V;  3K03 A;  2OTJ V;  1MG1 A;  1ROP A;  2HFE C;  2YEV B;  5LGT A;  2HKO A;  2D3O W;  3LDC A;  4UVB A;  2OTL V;  2ZXW B;  3P30 A;  2WLL B;  5L3E A;  4U7O A;  4JTA B;  2IJH A;  3ZMV A;  3STZ C;  2DW4 A;  1JQ0 A;  3M99 B;  3K3W A;  1G8M A;  2EIM B;  2JDI G;  2R9R B;  4R7C A;  4WCE V;  3FYE B;  4F4L A;  2HR3 A;  1ORQ C;  2Q69 A;  3F7V C;  1F4M A;  2DYS C;  2WSS G;  2XAJ A;  1QVG U;  3OM3 B;  1MOF A;  3E89 A;  3OEH G;  3OUS A;  1FXK B;  2JEX A;  1NJI W;  1VQ5 V;  3WG7 C;  2C2A A;  2IU3 A;  1EBO A;  1EFR G;  5J9P C;  2ZD9 A;  3LDE A;  1AI6 A;  2BOC C;  3SYP A;  2ZR3 A;  3OE7 G;  4WFH A;  5B3S B;  2R9I A;  3CCL V;  3ZCC A;  1E79 G;  5H6R A;  1HWY A;  5EC1 C;  3GB7 C;  1M90 W;  1Y4M A;  4UVA A;  2AHZ A;  1OCO B;  1NH2 D;  3LNM B;  3CC4 V;  4JAU A;  2HG5 C;  4FPP A;  5CBG A;  3CCR V;  1AI4 A;  4RUE A;  4MTO A;  4MVM A;  1P4R A;  3B8M A;  3SPG A;  3E8H A;  4MTX A;  2ZQM A;  3FB8 C;  3K79 A;  1R3J C;  4KUM A;  1JPX A;  3P32 A;  1P7B A;  4JTD B;  3K0D A;  3LUT B;  1CEZ A;  2ATK C;  1OCZ C;  1K5S A;  1GMG A;  3CCQ V;  3K04 A;  1PNM A;  2DQ3 A;  1M1K W;  3CCS V;  4MVS A;  1KC8 W;  1QLN A;  1KD1 W;  3SYO A;  4MSW C;  2XOK G;  2HJF C;  3OEE G;  1YJW V;  3OR6 C;  1B6Q A;  2DWE C;  5E1A C;  2F43 G;  3ASN C;  5L3F A;  5IYC O;  2NLJ C;  4BAY A;  3WG7 B;  1KP3 A;  3R65 A;  1LNQ A;  4JTC B;  2PI4 A;  1DTO A;  5B1O A;  4QJF B;  1ARO P;  2WLI A;  2LFR A;  4G2K A;  2WLJ A;  3IC7 A;  3SYA A;  4QIW F;  2EIM C;  2ITC C;  5DN6 G;  4GX1 A;  2HVJ C;  5CBH A;  1PD3 A;  1K7D A;  3X2Q C;  3FYI B;  1COW G;  3AEI A;  1QLE C;  4TWK A;  3CCE V;  1K3E A;  3E83 A;  5H6Q A;  3TCU A;  4WFB V;  1FXK C;  3RBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...