4G28B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g28B00
1KKDA 2HVJC 3T1CA 2P7TC 3SPIA 2ZD9A 2Y69C 4MVMA 4DXWA 1K4CC 3LNMB 2ITCC 2HFEC 1R3IC 2ATKC 2Q6AA 5CBFA 3ABMC 1XL4A 2DWDC 3BEHA 4HYOA 4P9PA 4PDLA 3FB8C 4R6ZA 4P9OA 2Q69A 2A9HA 4MVZA 2YEVA 1S5HC 4RUEA 5B3SC 1OCOC 3T4ZA 4MVOA 3LDDA 3SYCA 3F7YC 2WLIA 4MW3A 5KUMA 2EIKC 3ASNC 4JTCB 3OR6C 4WFEA 4QNHB 5CBGA 3TETA 2W0FC 2HVKC 3E8FA 3SYAA 5EBLC 4PA3A 1ORQC 4MVQA 3X2QC 3WG7C 2A79B 2WLJA 3RVZA 3SYOA 2EILC 2R9RB 1QLEC 2Q67A 4GX5A 3SJQC 2Q68A 3SYPA 4CBCA 3K03A 4MS2A 2H8PC 2K1EA 2QKSA 4MVRA 3K04A 2OCCC 5CBHA 5EC2C 4UUJC 4X89A 3E83A 2WLNA 1R3KC 4JTAB 3E8GA 4G27B 4P2ZA 3K0DA 3SPCA 4PDRA 1M57C 3UKMA 4LBEC 3FB7C 4PA7A 4H33A 4KFMA 4PA4A 3F7VC 4MVUA 2HG5C 3ZRSA 3FB6C 3STLC 4WFFA 4R50A 4LCUC 1V54C 2AHZA 4J9ZB 1ZWIC 4H37A 3T2MA 4R8CA 2BOBC 2EINC 2WLKA 3GB7C 5J9PC 2X6CA 3K0GA 2WLMA 2DWEC 4MTGA 4MSWC 3RBZA 4BW5A 4XDKA 2ZXWC 3RVYA 4XDJA 1OCZC 3E8BA 3STZC 3IFXA 3ABLC 3E8HA 4OXSA 1XL6A 4QE9A 1V55C 3T4DA 1K4DC 1P7BA 1G4YB 3AG1C 1OCCC 4MVSA 4MTOA 2QTOA 5B1BC 3KG2A 4RAIA 3HPLC 3ASOC 3R65A 3TCUA 4PA9A 4X88A 4J9YB 4P30A 3AG4C 5BZBA 5KUKA 3VOUA 2WLLB 2IH1C 2AHYA 2IH3C 4RUFA 3RW0A 1J95A 4R7CA 3SPJA 4QE7A 4JTDB 3AG2C 4GX1A 3PJSK 3F5WC 3AG3C 3FB5C 3K08A 3LDEA 3LUTB 5IY5C 3JYCA 1M56C 2A0LA 1R3JC 2DYSC 2EIMC 2X6BA 3K06A 3OUSA 4PDVA 4WFHA 1JVMA 4TWKA 5EC1C 4ZBMA 3SPGA 4X8AA 4EKWA 3ZJZA 4LP8A 4WFGA 1R3LC 5EBMC 2WLIB 2DYRC 2NLJC 5E1AC 4I9WA 4MW8A 4F4LA 4RO2A 2JK5C 3LDCA 3E86A 4GX0A 5EK0A 1BL8A 4PDMA 2EIJC 2WLHA 2WLLA 4XDLA 5B1AC 3UM7A 3SYQA 4GX2A 3OR7C 2HJFC 4G28B 4HZ3A 3OGCC 3EFFK 1LNQA 5EBWC 2BOCC 3ABKC 4MTFA 3SPHA 3E89A 3IGAC 2ITDC 2X6AA 2KB1A 4PA6A 1OCRC 3OUFA
chains in the Genus database with same CATH superfamily
5F2VO 2GTAA 4X64B 4DRXB 5KMGA 3JSNA 2VWJA 4UCUA 4CC6A 4UB6Z 1OV9A 1FFXA 1AI4A 2CTWA 4HNAA 2BCCH 1R6TA 1NTMH 3E22A 2IJJA 1Y6XA 3G80A 3JCZA 3WB0A 2RJZA 3E8FA 5D5QA 3N2GB 1ZSPA 1K34A 3QTCA 3HKDA 2K1EA 2QKSA 4JF3A 1VARA 4DR7B 3JATB 4UCTA 3UKMA 2P4VA 4BAYA 4K8ZA 3F7VC 2UUCB 2HG5C 3AEIA 4H37A 3W7WA 1VF6C 1ZL8B 5CA0A 4I50A 3BABA 1KKCA 4Q20A 3D36A 1Y74B 4K0KO 4XDKA 3J81N 3ZMUA 3E8HA 2ZE7A 3RFRA 3W7SA 3ZHVA 2GV9A 5JJNB 3HKEB 5J2TA 3G6BA 1AB3A 2QGNA 1Q6UA 1XEQA 2CTRA 2HR3A 3EHBB 3P3PA 5EZYA 5DN6G 1H2MA 2A3QA 3ZMSA 5EYPB 1J95A 3K5NA 1U96A 4FFKA 4CH5A 4JI3B 3AG3C 3L9DA 1YVWA 1L0LH 1JQ0A 1JVMA 5ITZB 3QVNA 2F43G 5E1AC 1KD1W 2Y69B 4DR4O 2JIZG 3MDSA 4O4JB 4X1IA 2WLLA 2F93B 3Q4HA 2W0XA 2CTPA 4IIJB 4TV9B 3ABUA 1CPYA 1K5QA 4IT5A 3IGAC 1G1XB 5IE9A 1TVKB 2RQ6A 1BQZA 2N04A 1ZUQA 1YZBA 4H44B 2FB5A 3CJHA 5IY5B 1KP2A 5CA3A 1R6KA 2EULA 4X66O 4AQYO 3SYCA 3ASNC 4LF7O 4QNHB 1XMQB 2LGQA 4LNUA 4B3SB 1PL4A 1WAZA 4DR3O 2B5UA 1QNMA 4ZOLB 5BMVB 2JRIA 1IZ3A 4DR6O 2Y4TA 3MHSC 3K3WA 2WPDG 1XMOO 1IBLO 2VS0A 4HNAB 3G4SV 4YIOA 1NI8A 1AR5A 3GB7C 2EINC 1SA0A 3NXSA 2IU3A 3ZN1A 4JI2O 2E5LB 2E76B 1VQ7V 3RYHB 1VQPV 2XHBA 4UV8A 4JI6O 4B08A 5KUKA 4N23A 2EJ7A 1XNRB 2AZ2A 3CCVV 2Q7GA 1JCHA 4IHJA 3T1YB 1WA8A 4DV1O 2X6BA 3IAYA 1D5NA 4CS4A 2CH7B 4X8AA 4YIPA 2DYRC 3ZHTA 3W7XA 1XNQB 1PKXA 2PZSA 1EM1A 2ZIOA 2BTOA 1H2LA 1WPBA 4B3TB 5J2TB 4GX2A 4G28B 2DJVA 2ZDIC 4KP4A 1W2BU 2GTSA 5CN0A 2ITDC 1XHZA 4JYAB 3ZN0A 2HVJC 1WP7A 3T1CA 1NVPB 3DXRA 1SQQH 3LSQA 4FVMA 1N0NA 1MMMA 1HWYA 3FX7A 2HJDA 4LFAO 4LFBO 4TOIA 4JTCB 2QWPB 3IC9A 3TETA 2JEXA 1GM7A 1F51A 3FYEB 2ZCEA 4FLYA 3FKSG 1HDJA 3RVZA 3ZCCA 3CRAA 1V55B 1K5SA 3FAVB 4CBCA 1YITV 5JWPA 2PUSA 2OWOA 2YICA 1WLEA 5B3SB 1SA0B 4DV2B 5L3BA 5LMUB 2DW4A 4UVBA 1YEWA 1HNWO 1ZWIC 4JV5O 4ZKIA 4ZI7A 2DWEC 4GKJB 3UO3A 3AG4B 3N2GA 5LOVA 3CEIA 2HP8A 1QLEB 1QLNA 3AG1C 1IX9A 4U3JB 1J5EO 3BRCA 2XASA 4O4HB 4RUFA 4QE7A 3FB5C 4X1KB 4GKKO 2IJHA 1M56C 1V9PA 5EC1C 2P5OA 3KCYA 2QTSA 4GT1A 1ZL8A 4LP8A 4LF6O 4WFGA 5B1BB 2FL4A 2ZE5A 4QPKA 1M1KW 1BL8A 1L1FA 4J41A 3BVOA 5K1XA 2M7WA 2JGDB 5DECA 1BZKA 4JI5B 3VQVA 4DR3B 3SPIA 4DR5B 1IBMB 2DE0X 3JALA 3K5MA 4J11A 5B5EZ 4UVCA 1Y66A 2EIMB 3IJ4A 5KX5A 1IBLB 2ZR3A 3CB2A 1S5HC 3OEHG 4OPAA 1H38A 1H8HG 2P4KA 3I5DA 1Q6IA 3WG7C 5BR8B 1VP7A 2AXTZ 1M5IA 1VQ9V 1JMKC 2JGDA 4JAAA 2IJIA 2V7QG 3K5LA 1BGYH 5FPRA 1GM8A 5C8YB 4B7KA 2O57A 4JTAB 4JI2B 4XBFA 2E5LO 3KCXA 1ZTEA 2YIBA 4H33A 2D2CB 3RWRD 1VQKV 1KB9F 4CC5A 1L8DA 3DSQA 4WFBV 1KYOF 1VQMV 4DR1B 2FYUH 3K0GA 4FM2A 3RBZA 1OCZC 4CS2A 4NTYA 3B40A 3T4DA 2QKCA 4X65O 1XNQO 1K8AW 4YJ2B 3ASOC 4CH4A 3ABKB 3AK1A 4X20A 2DYSB 2FTKA 5DEDA 1RFYA 4L8JA 2A06H 2F4VO 3JYCA 4N21A 3E35A 1I7FA 1FJGO 3CCSV 1EZVH 1VQOV 1B6QA 1EBOA 4WCEV 2JK5C 1K73W 5EK0A 4PDMA 3AG2B 1QHTA 1YJNV 3OAAG 5LP6A 1FPOA 3KZIZ 3QO7A 4BIUA 3DGEA 2KB1A 2NR5A 3C3SA 1HNXO 2P7TC 2Y69C 2CGNA 3C3TA 2LJ2A 1NH2D 1WA8B 1FXKA 1FD9A 4TSFG 1ENVA 2IBZH 1SETA 2FKXA 3O65A 4MVOA 4JZGA 5KLVH 3BFRA 5LMUO 2ETNA 2BE3A 2E75B 1EN6A 1NS1A 2DQ0A 2A79B 2GUZB 2W6IG 3SYOA 4I55B 5JVDB 3SJQC 2VQEO 2Q68A 2JJ1G 5D5PA 4NR1A 2PF4E 2ZXWB 1Z2GA 3E83A 3E8GA 2Z3YA 1R6NA 4PA4A 3D8CA 4DV4B 1T5EA 3RYCA 1KU9A 2ZM6B 1X4TA 1M56B 5J9PC 1R73A 1JX9A 2CTQA 2YSUB 4DYLA 1SQFA 2ZXWC 3HB3B 1IXBA 4TQDA 4DR7O 1LUVA 5B1AB 1XREA 1HR0B 1G8MA 2QWOB 4FJCC 2Q8VA 4NYKA 1QVFU 1RSOA 2ILMA 3CXHF 3I56V 1SQPH 1N36O 3SJCC 1RM1C 3TXQA 4YHHB 2GHYA 5A2QN 1RP3B 3TXSA 2ZNIA 1N33B 1K33A 5EBMC 4MW8A 1MA1A 4O4IA 3AG1B 3LDCA 3WFVA 1YIJV 2AZ0A 2JGUA 4JASA 3RYHA 3CCMV 1GN4A 3T1HB 1QVGU 4IHJB 1GKFA 4EFBA 1FXVA 3VQXA 2Q5ZA 2YXYA 1KQSU 4C7UA 4ZHQA 2IJKA 4UCVA 3MAQA 1CXZB 5IYZA 4PI2A 1R3IC 4HYOA 2H94A 3CCQV 2BTQA 3ZMZA 2R9AA 5KHGA 4LWSA 3SYAA 2YI8A 5EBLC 1SESA 1JFFB 3ZMVA 2RCVA 4I7ZB 3X2QC 3B8MA 2XAQA 3EVKA 3LNNA 1AJPA 4DV7O 1QLEC 4FK5C 4FFBA 2KQXA 2EX3A 3JD4A 3CRMA 2FMLA 4FLVA 1KMIZ 4PA7A 5GTHZ 2P06A 4BIOA 3JAWA 4O4HA 4FM1A 2UU9B 4JI7B 4JZ2A 2OCHA 1IBKO 4X1KA 4DK1A 2Y0PA 4LF9O 2IW5A 2GBOA 4J42A 4QE9A 3K59A 2Q7HA 3QNEA 1V55C 3APOA 1OCCC 2UXCB 3L72H 1SC5B 4ICGA 3QO5A 5C8YA 3VOUA 2AHYA 2F1MA 4R7CA 2ZQMA 3F5WC 1Q43A 4Q6GA 1AILA 3GWKC 2Q9LA 3OUSA 2CDYA 5KHKA 1TUEB 4DK0A 3JAWB 2RNBA 1GRJA 1HNXB 1TVKA 4E2LA 1OZ0A 4RO2A 5FLXN 5LOVB 3RYIB 5LYJB 1R1BA 4LC1A 4PV1B 4BR6A 4JI0O 2RDCA 2HJFC 5GTIZ 3MD0A 3OEEG 5EBWC 1I94O 3SGIA 1AVMA 1IXMA 1HNZO 1FAFA 5J2UA 3CCRV 4LR3A 4FZ1A 5IWAB 2F95B 2H3OA 4I0XB 3KKYA 3L75H 4UCRA 2XAGA 2DQ3A 2ATKC 4DW1A 5KHHA 4RQEA 2G38A 3BEHA 3OGIB 2YEVA 5IJ9B 3D36C 3OTOO 1Q5OA 2VRZA 1ZLZA 2YC0A 2GSMB 2W0FC 2WA3A 4NB5A 1YHQV 3JASB 2ZM6O 1K97A 2EILC 1PNMA 3TK1A 3LSUA 4Z1MG 1O9HA 5EC2C 4QGPA 4X89A 5GONA 1UJWB 1R3KC 3GWOA 1F23A 3ZMTA 1JFFA 4LFBB 2R72A 4LBEC 4KFMA 4LH7A 3B77A 3STLC 1N34B 2YXLA 5L3DA 1P4RA 3BAAA 4R8CA 2BSKB 1XI1A 4OPHA 4BW9A 3AG3B 2QR4A 1N33O 4OGQB 3E8BA 1TAEA 4UFZA 5CA1B 3MHHC 4O2BB 4K8XA 3AK2A 2L6LA 3TCUA 4IL6Z 1HNWB 2XAFA 1AR1B 1EN4A 1EFRG 4BIZA 1AP5A 4WF9V 1YTFD 1BMFG 5LA6B 1WJZA 4DRXA 2OT5A 4LH6A 4XDLA 5B1AC 2LFSA 1D5AA 4D7SA 3OR7C 1WP8A 5JH7B 3EFFK 3K5OA 3N27A 2YIDA 1OCCB 5EIBC 2NN4A 3ZHQA 3AK3A 2Q0AA 4LF6B 2QWNB 4B3RO 4QPJA 3CCJV 2Q6AA 3RYFB 1OCRB 1NQTA 1YJWV 1NBMG 2A9HA 3G67A 1Q8IA 4GYCB 4I0XA 1MG1A 2QM8A 3N2KB 4JI5O 2UU9O 4NTXA 3X2QB 1SZTA 1MNGA 4LF9B 2F66C 3ZEDA 2ZE6A 4EB6B 5FPOA 1S5LZ 1FXKB 4J7KA 3HKCA 2PYLA 3FB6C 4WFFA 1SQVH 5BR8O 1XQ8A 4U7OA 1B04A 4LF8B 2PY5A 4JI1O 3CC7V 4W4KA 4DV0O 1YXBA 5FL7G 3N2KA 1O9GA 3RN4A 3ZRWB 4LF5B 4QJFB 1PV0A 1H2KA 1NKDA 1P7BA 3NR7A 2EJRA 4UB8Z 5ITZA 5B1BC 3D3QA 1GN6A 5KMGB 1QR8A 5EIBD 3CSXA 4DR1O 1JJOA 4DUZB 4RQFA 2QA4V 1SRYA 3OFNG 1NR7A 3K08A 3ML0A 2ADPA 4JYAO 4X64O 2MW2B 3J80N 1I5XA 1ROPA 4KXRA 4UCSA 2NLJC 3ASOB 2P90A 3CCEV 3J7AU 3D3IA 1EZJA 2WLHA 3WU2Z 1S0VA 3IC7A 3CMAV 4LFAB 2HHHB 2BOCC 4MTFA 3R66A 4JAVA 4CH3A 3C90A 4JPRA 1AROP 2NNUA 3OM3B 1KECA 2OTJV 1VQLV 4LFCO 1WN7A 5KA5A 5JH7A 3CHXA 2DWDC 4R6ZA 3FB8C 1D2DA 5HFLA 1VF7A 5CA0B 5JQGA 3K57A 2ZINA 3T4ZA 3ETGA 1SERA 3F7YC 4MW3A 5KUMA 2EIKC 3UQ8A 1PL0A 3JSLA 3OR6C 4ASUG 4WFEA 5IJ0A 1JPXA 1COWG 1TUBA 2ZT9B 4JV5B 4MVQA 3BA9A 4FIPC 1FYJA 1L0NH 4JGSA 2UUBB 4ZHQB 1XDCA 2QKAA 2HEPA 1PPJH 2WLNA 4YJ2A 3ICXA 4G27B 3JARA 3HR0A 4MVUA 4R50A 4FLUA 4FLXA 1URFA 5B1OA 1WB7A 4NXMB 4DV5O 5A9GA 3L73H 3RVYA 2XUMA 3L71H 2HLDG 4DR2B 1IURA 5L3FA 4WBNB 4DV6O 4DR4B 2UXBO 2OIGA 2UUCO 4F6EA 4X88A 1K9MW 4P30A 3CE2A 3OD4A 1AP6A 3LDEA 5LL6Y 2Q4PA 4ZIBA 2AW9A 5J2UB 3JAKB 3TJTA 4B3RB 2WLIB 3CWBH 1S72V 1I0HA 3U11A 2RN9A 2QM7A 1XILA 1GTOA 3O9OA 4MT8A 3OE7G 3S3WA 3BHPA 2LFRA 4O2BA 4CH6A 4LF7B 4YHHO 3H01A 1XMQO 4B3SO 4PA6A 4JI4B 2EBOA 3CCUV 3CD6V 1LUWA 5EYPA 3ZHUA 4DR6B 1FFTB 3ETQA 5LYJA 1YI2V 1XMOB 1GH6A 1GO3F 1VIBA 2JDIG 4YXWG 4JAUA 2N74A 2HVKC 3FD9A 1MSWD 1DF4A 2DMXA 3DTUB 4TV9A 3K9AA 1Y67A 1IVSA 4I9QA 2H8PC 1NR1A 1VQ5V 3VQWA 4X20B 4ABMA 3CP1A 4X66B 4D7TA 3SPCA 5LP6C 4AQYB 1M57C 4AILC 2LGWA 5IJ9A 3RYFA 1Y76B 4JI8B 4B3MO 1MOFA 1SS3A 2CE4A 4DW0A 5IJ0B 4DV7B 1KUQA 2WLMA 4X9QA 4AHCA 3JCUZ 4DV1B 2A7WA 4XDJA 1VQ6V 2EIKB 1CEZA 1QCEA 1PNLA 2XAHA 4UXNA 3JD0A 2YXHA 2QTOA 4O4IB 1AI6A 3JATA 1Y74A 1AJQA 1NU1H 1FXKC 2C2AA 2VQFO 3H1IH 2WWWA 4TWKA 3UO2A 2K9PA 1VF5B 3ZRVA 4UVAA 2EIJB 4F4LA 5KHJA 4I9WA 2CUGA 1YDXA 3E86A 2IM9A 2AGAA 4K3AA 4LWSB 4KHPO 1XNRO 4CS3A 4I55A 2ZR2A 4DUYB 5CB4B 5KX5B 3ABKC 1EN5A 4O4LA 5JJJB 1YTFB 1OCRC 3ZHSA 5DM6V 5LMNB 2X0LA 5LBQA 1SQBH 3GVMA 1DF5A 2ZIMA 2VQEB 1CP9A 4NXNO 2YDEA 2E3CA 3CC4V 5L3EA 3Q4HB 3A0RA 3M7MX 4JI0B 1BCCH 4EB6A 1PNKA 2Q0OC 4YJ3A 2ODMA 5B1NA 1Q86W 1I94B 1VQNV 5CBGA 1MSDA 4MTXA 1ZX3A 3OW2U 5LHHA 4FZ0A 1FXHA 1SQXH 4NXMO 1Y76A 4DV5B 2Q67A 3ABTA 4RWUA 1G6UA 1Q3EA 2UXXA 4GKJO 5B66Z 2LO1A 1K92A 1SZXA 4DR2O 4X62B 2QSAA 1BSMA 2QWQB 3CJHB 4J7JA 4PDRA 4EFEA 3WG7B 2YS8A 3FFQA 1GN3A 3WB2A 3T2MA 2UUAO 1M4UA 2WLKA 5JJEB 1H2GA 1YSCA 1FKAO 4GKKB 4J80A 3STZC 4OXSA 1TUBB 5H6QA 1YF2A 5L3GA 3ZRXA 4MTOA 5KA6A 3M99B 3SJBC 1BT8A 2LW7A 2IH1C 3JARB 1OCOB 1X59A 4FPPA 3LUTB 2OTLV 5LHGA 3CRCA 4JYYA 2M6YA 2ADQB 1R3JC 4WFHA 2QM4A 3M8AA 2ARHA 1KP3A 5LGUA 1HP8A 3DXRB 2EIJC 1VEWA 2P6JA 4E4EA 3E89A 4JI3O 1Q7YW 4J10A 1B06A 3BA8A 2Q7EA 1H2NA 3CCLV 4MVMA 1K4CC 2ITCC 4I5SA 4K35A 5LP6B 4UCOA 4P9PA 1E79G 3HKBB 1OCOC 5GONB 4O4LB 2WLIA 1NJIW 4B3MB 2Q73A 3B8NA 5CMUA 1SQGA 4AI8A 4GX5A 5K1PA 1IBKB 2R9IA 4MS2A 1E1QG 1A32A 5CA1A 5IYDO 1VQ8V 4PI0A 2XTAA 4QIWF 3LSSA 1PM9A 3ABMB 2VWKA 3UT5A 3ZRSA 3JASA 5IDJA 1V54C 4J9ZB 1RPOA 3H1KH 2N05A 2X6CA 4BW5A 3S3XA 5H9CA 1Q90D 1Z5WA 5IT9N 1FJGB 4X1YA 3K9SA 1H2SB 4FLZA 1AI5A 4FMTA 4MVSA 4BWAA 3KG2A 5TISZ 4O4JA 4X1IB 1V54B 5H5NA 3FYIB 5BZBA 5C93A 2Z0AA 1W59A 2WLLB 4TV8B 2YI9A 1OHHG 1NVPD 5GW7A 4JI1B 5IY5C 3H1LH 4F6RA 2XT9A 4Z2WA 1BQ0A 3UCSC 3DC5A 2QDOA 4LF5O 1R3LC 4Z1VA 5KAFZ 1M90W 1RSOB 1E1RG 1NZ6A 1NT2B 4JI6B 3HKEA 2PI5A 3UM7A 2JS3A 4HZ3A 3OGCC 2ZE8A 2W6JG 1F4NA 4UUJC 5FNVB 3JD2A 4LNUB 1KKDA 1S5JA 1S76D 3JAKA 2Y4UA 3RT3C 3LNMB 5BMVA 2EZPA 3B09A 4GCZA 5CBFA 2B1GA 2PI4A 4IIJA 1OJHA 4WFAV 2EINB 2PTMA 3PN1A 4FFBB 1H8EG 1RPRA 2Y48A 1N34O 1ORQC 2EILB 2UUAB 2R9RB 4KL1A 4LFCB 1I08A 2D3OW 2P67A 1XOUA 4KUMA 1XHXA 2UXNA 2YIBD 4P2ZA 3A2FA 1US6A 1JA8A 3FB7C 4X1YB 1N8RW 3G71V 2KG7A 4NTWA 1VQ4V 2AHZA 2OYQA 3QO8A 3SDLA 1N36B 2V4DA 3H1HH 1AI7A 2P22C 2PGGA 4MSWC 4PELA 3VQYA 2UUBO 3CYOA 4I4TA 1I5YA 4DV2O 3A0HZ 3UT5B 3THOA 5JVDA 1P84F 4CZZA 1KC8W 4DV4O 1GAXA 2Y0IA 1FS0G 3RYIA 4LF4O 3T1HO 2UXDB 1NH2B 3CRQA 3QG5A 3CC2V 5CB4A 1QBZA 2A0LA 2DYSC 3K06A 4PDVA 4DO2A 3SPGA 1HR0O 2YIAA 3SJAC 5FNVA 4H0LB 4DV6B 1VMGA 1K7DA 4TUYA 4A5UB 1J5EB 4JYBA 1N32B 3JAMN 4O2AB 2JJ2G 2ZNJA 1S3JA 3E22B 3ZIAG 1DK1A 4UV9A 4FLTA 4B7EA 3OUFA 2CH7A 4TV8A 3BY6A 1WPXA 4DXWA 5H2FZ 3HKDB 1IDSA 2CK3G 4U3FH 3ZHRA 1XL4A 4PDLA 2JEUA 4NVPA 4P9OA 1TGOA 4RUEA 2XNDG 3LDDA 1GK9A 4I50B 3APQA 4PA3A 4TUYB 4JI4O 3ZRWA 2JS5A 1SF9A 1MZFA 4L87A 3SYPA 3K03A 4MVRA 3K04A 4DV0B 1F7YA 1BS3A 3P3NA 1M9NA 1BHAA 1Z5VA 1MABG 1GMGA 1YCIA 2KKWA 1Q81W 1QQCA 3RGBA 5EZYB 3IFXA 1OCZB 5LXTB 1N0JA 2ZDIA 4OX9B 3CXCU 2KG7B 5AG2A 4RAIA 3K58A 2WA4A 4IYIA 2DYRB 4PA9A 4B3TO 1BHBA 1WB8A 3SPJA 2B1IA 4D6TH 2EIMC 4ZBMA 4EKWA 2YEVB 3ZBHA 4DV3B 4TQFA 4GZRB 4I4TB 1XUQA 1M57B 3ETEA 3CRRA 2QE7G 2YUAA 1THZA 5LXTA 1JR9A 3BCCH 3SYQA 1P7GA 3QF7A 1JOYA 3SPHA 2WSSG 5LHIA 2X6AA 1NTZH 5LA6A 1W0JG 2VQFB 1GN2A 3W7UA 3OMIB 2ZD9A 5BY1A 2RMKB 2L35A 4O2AA 3ABMC 3B4SA 4PHZA 1NTKH 1KBHA 4F6RB 5LGNA 2B9ZA 2Q69A 4MVZA 4KHPB 3P32A 4DUYO 1HNZB 3TGUH 2CGOA 4YY3O 4TT3G 5KHIA 5LMNO 5IWAO 2WLJA 3SR2C 4NXNB 2PYJA 1DTOA 1PP9H 2F23A 2OCCC 5CBHA 4IYHA 5IYZB 5KAIZ 3OTOB 3K0DA 3U10A 3H9VA 1RM1B 2LP7A 2UXBB 2BTQB 4NKGB 4H13B 4LCUC 4FM0A 2GDSA 1U97A 3OMAB 4LF4B 2BOBC 2UXDO 1UFIA 2Z5UA 4MTGA 2OCCB 3H1JH 4W4LA 3ABLC 4X62O 2CAZC 3I55V 1Q6HA 3L74H 2LW1A 2QJ1A 3L70H 1K3EA 4HAMA 3BPZA 3HPLC 4J9YB 1N32O 1HW7A 3CS5A 2LQTA 1QU7A 2ZKOA 4GX1A 4K0KB 1F4MA 4DR5O 2DOSA 3EXAA 2KSDA 4HBNA 1IBMO 1AJNA 5JQGB 4YJ3B 4GX0A 3ETDA 4JYCA 2QEXV 3OMNB 1XBLA 5IYCO 1FFXB 3A8TA 4ZOLA 3A0BZ 3U0ZA 1LNQA 2DN9A 1BE3H 3CMEV 3CX5F 3G6EV 5LGTA 3OT7A 3ZS8C 2HFEC 1PD3A 2X7RB 2WAMA 1LR1A 5JCOA 5B3SC 5E79Z 4GLXA 1DLBA 1P49A 4JI8O 1QR9A 3AG7A 3K79A 3JD1A 4PJ0Z 2XAJA 3VBBA 4ZI7B 3JD3A 3DC6A 3P30A 1AR4A 2XOKG 4U3JA 4GUNA 4G2KA 2EZOA 4U7NA 1GM9A 4OX9O 4X65B 2V1DA 1W0KG 1N4CA 4WBNA 2QWRB 1MZEA 1B3QA 2GUZA 3ASNB 5HFMA 4IGGA 2R70A 1UPGA 2MK3A 2F4VB 4J7ZA 1YJ9V 1JJ2U 1XL6A 4DV3O 1K4DC 1G4YB 3CPWU 2BSKA 3B2EE 1DGSA 3R65A 1Q82W 3AG4C 5JCOC 2HKOA 4JI7O 2IH3C 3RW0A 2HHHO 1Y4MA 3HKCB 4JTDB 3RYCB 3AG2C 3PJSK 1M93A 4LF8O 3OTFA 3JALB 3E2EA 3ZJZA 5BXZA 3ZX6A 4FLWA 5L3CA 1ZAUA 2JVDA 3W7TA 3HKBA 2UXCO 3WB1A 1SKVA 2E74B 4PD4F 5IYBO 1TA8A 5H6RA 1VF6A 2IU0A 3F5TA 3ABLB 4DUZO 2OIEA 3FAVA 1WNSA 3T1YO 1S77D 4YY3B 4EEQA
chains in the Genus database with same CATH topology
3JD2A 1KKDA 1AROP 1S76D 2NNUA 3OM3B 2P7TC 2Y69C 1KECA 2OTJV 1VQLV 3LNMB 2EZPA 4GCZA 1NH2D 5CBFA 2B1GA 5KA5A 1FXKA 4TSFG 1AI4A 2DWDC 2PI4A 1ENVA 4R6ZA 3FB8C 5HFLA 1SETA 4WFAV 3T4ZA 2EINB 3ETGA 4MVOA 1SERA 3F7YC 2IJJA 4MW3A 2EIKC 5KUMA 1PL0A 3OR6C 1H8EG 4ASUG 4WFEA 3JCZA 1RPRA 3E8FA 2Y48A 1JPXA 1COWG 2DQ0A 1ORQC 2EILB 4MVQA 2A79B 2W6IG 4FIPC 3SYOA 2R9RB 1K34A 3SJQC 2Q68A 4JGSA 2JJ1G 2K1EA 2QKSA 2D3OW 2P67A 4JF3A 2ZXWB 4KUMA 3E83A 2WLNA 2UXNA 3E8GA 4G27B 2Z3YA 4P2ZA 1R6NA 3UKMA 3FB7C 4BAYA 4PA4A 3F7VC 4MVUA 1N8RW 2HG5C 3G71V 4R50A 3AEIA 1VQ4V 2AHZA 4H37A 3QO8A 3W7WA 1M56B 4Q20A 5B1OA 5J9PC 1R73A 1JX9A 1AI7A 2YSUB 3D36A 4MSWC 4PELA 4XDKA 2ZXWC 3RVYA 3HB3B 3ZMUA 3CYOA 3E8HA 5B1AB 2HLDG 1I5YA 3W7SA 5L3FA 1G8MA 4FJCC 4CZZA 1KC8W 1QVFU 4X88A 1K9MW 4P30A 3I56V 2HR3A 3EHBB 5DN6G 1FS0G 1RM1C 3ZMSA 1J95A 1NH2B 2GHYA 3CC2V 3AG3C 3LDEA 1K33A 1QBZA 2A0LA 2DYSC 3K06A 4PDVA 1JQ0A 4DO2A 1JVMA 3SPGA 2F43G 5EBMC 2WLIB 1S72V 5E1AC 4MW8A 1KD1W 2Y69B 2QM7A 3WFVA 3AG1B 2JIZG 3LDCA 1YIJV 1K7DA 1GTOA 4JYBA 2WLLA 4MT8A 2JJ2G 3OE7G 4JASA 3CCMV 1S3JA 3ZIAG 3ABUA 2LFRA 1QVGU 1CPYA 1K5QA 3H01A 4UV9A 1GKFA 3IGAC 1FXVA 4PA6A 3OUFA 2EBOA 3CCUV 3CD6V 1KQSU 2IJKA 3BY6A 1WPXA 4DXWA 1R3IC 1FFTB 2CK3G 5IY5B 1KP2A 5CA3A 1XL4A 4HYOA 4PDLA 1R6KA 2JEUA 1YI2V 4P9OA 2H94A 1GO3F 3CCQV 2JDIG 2XNDG 4RUEA 3ZMZA 3LDDA 4YXWG 3SYCA 1GK9A 3ASNC 4JAUA 4QNHB 2HVKC 3SYAA 5EBLC 1MSWD 1DF4A 1SESA 4PA3A 3DTUB 3ZMVA 3X2QC 3B8MA 2XAQA 3ZRWA 1AJPA 3K9AA 1QLEC 2B5UA 4L87A 3SYPA 4FK5C 3K03A 2H8PC 1NR1A 3MHSC 3K04A 4MVRA 3K3WA 1M9NA 1VQ5V 2WPDG 1BHAA 1MABG 1GMGA 3CP1A 3JD4A 3SPCA 1M57C 3G4SV 4PA7A 1Q81W 1MOFA 3GB7C 2EINC 2WLMA 3NXSA 4XDJA 1VQ6V 2EIKB 2IW5A 3IFXA 1CEZA 1QCEA 1OCZB 1PNLA 2IU3A 2XAHA 4UXNA 3ZN1A 4QE9A 2ZDIA 3QNEA 1V55C 3JD0A 3CXCU 1VQ7V 1OCCC 2QTOA 4RAIA 1VQPV 4UV8A 1AI6A 3QO5A 2DYRB 4PA9A 5KUKA 4N23A 1AJQA 3VOUA 1BHBA 2AHYA 4R7CA 3SPJA 2B1IA 3CCVV 1FXKC 2ZQMA 1JCHA 3F5WC 2C2AA 3OUSA 2EIMC 2X6BA 4ZBMA 1TUEB 4EKWA 4TWKA 2WWWA 2YEVB 4X8AA 3ZRVA 4UVAA 4E2LA 2EIJB 4F4LA 2DYRC 3W7XA 4I9WA 1OZ0A 4RO2A 1M57B 1PKXA 3ETEA 3E86A 2QE7G 1THZA 4LC1A 3SYQA 2ZR2A 4GX2A 2HJFC 4G28B 3MD0A 2ZDIC 3OEEG 4KP4A 1W2BU 5EBWC 3ABKC 1JOYA 3SPHA 2WSSG 5CN0A 2ITDC 5LHIA 2X6AA 1IXMA 1YTFB 1OCRC 1W0JG 5DM6V 3CCRV 3ZN0A 3W7UA 2X0LA 5LBQA 2HVJC 3OMIB 3T1CA 2ZD9A 1NVPB 1DF5A 1CP9A 2XAGA 3CC4V 2DQ3A 2ATKC 5L3EA 3ABMC 4RQEA 3BEHA 3A0RA 3LSQA 5LGNA 2Q69A 1HWYA 2YEVA 4MVZA 3P32A 1PNKA 4JTCB 5B1NA 1Q86W 2GSMB 1VQNV 5CBGA 3TETA 2W0FC 2JEXA 1YHQV 1GM7A 1F51A 4TT3G 4MTXA 3FYEB 3FKSG 1K97A 3OW2U 2WLJA 5LHHA 3RVZA 1FXHA 2EILC 1PNMA 2Q67A 3ZCCA 1V55B 1K5SA 1YITV 3ABTA 3TK1A 4CBCA 1DTOA 2UXXA 2OCCC 4Z1MG 5CBHA 1WLEA 1K92A 5B3SB 5EC2C 4X89A 1UJWB 5L3BA 1R3KC 3GWOA 3K0DA 1F23A 4PDRA 3ZMTA 3WG7B 4LBEC 1RM1B 2LP7A 2DW4A 4KFMA 4UVBA 3B77A 3STLC 4LCUC 1ZWIC 5L3DA 1P4RA 3T2MA 4R8CA 3OMAB 2BOBC 2WLKA 4ZKIA 1H2GA 1YSCA 3AG3B 2Z5UA 2DWEC 4MTGA 2OCCB 3E8BA 3STZC 3ABLC 4OXSA 3AG4B 5H6QA 3I55V 3MHHC 5L3GA 1QLNA 1QLEB 3ZRXA 3AG1C 4MTOA 1K3EA 5KA6A 3M99B 4HAMA 3HPLC 3TCUA 2XASA 4J9YB 2IH1C 4RUFA 2XAFA 1OCOB 4FPPA 4QE7A 1AR1B 4GX1A 3FB5C 3LUTB 2OTLV 5LHGA 2IJHA 1M56C 1R3JC 1EFRG 4BIZA 4WFHA 5EC1C 1F4MA 4GT1A 4WF9V 1YTFD 1BMFG 4LP8A 4WFGA 5B1BB 1AJNA 2OT5A 1KP3A 5LGUA 4QPKA 1M1KW 4GX0A 1BL8A 3ETDA 2EIJC 4JYCA 1L1FA 2QEXV 4XDLA 3OMNB 5B1AC 2LFSA 5IYCO 2P6JA 3OR7C 2M7WA 3EFFK 1LNQA 3E89A 1Q7YW 3CMEV 1OCCB 3G6EV 5LGTA 3SPIA 3CCLV 4MVMA 4QPJA 3CCJV 1K4CC 2ITCC 2HFEC 1PD3A 2Q6AA 4I5SA 4UVCA 4P9PA 1Y66A 2EIMB 1OCRB 1NQTA 2X7RB 1YJWV 1NBMG 2A9HA 2WAMA 2ZR3A 1S5HC 5B3SC 1E79G 3OEHG 1OCOC 2WLIA 1DLBA 1NJIW 1H8HG 1H38A 1MG1A 2QM8A 1QR9A 3K79A 3WG7C 3B8NA 5CMUA 3JD1A 3X2QB 1SZTA 4GX5A 2XAJA 3VBBA 2R9IA 3JD3A 1VQ9V 4MS2A 2IJIA 3P30A 2XOKG 2V7QG 4G2KA 2EZOA 1GM8A 4JTAB 4U7NA 1E1QG 1GM9A 1VQ8V 4XBFA 5IYDO 1FXKB 2V1DA 4QIWF 1W0KG 4H33A 3LSSA 3ABMB 1VQKV 3ZRSA 3FB6C 4WFFA 5IDJA 1V54C 4J9ZB 4WFBV 3ASNB 1RPOA 1VQMV 5HFMA 4U7OA 2X6CA 3K0GA 2MK3A 3RBZA 4BW5A 3CC7V 5H9CA 1OCZC 1YJ9V 5FL7G 1JJ2U 1XL6A 3ZRWB 3T4DA 4QJFB 1K4DC 1NKDA 1P7BA 1G4YB 2EJRA 1AI5A 4FMTA 4MVSA 1K8AW 3CPWU 5B1BC 3KG2A 1V54B 3ASOC 3FYIB 3R65A 3ABKB 1Q82W 3AG4C 5BZBA 5C93A 1QR8A 2HKOA 2WLLB 2IH3C 2DYSB 2FTKA 3RW0A 1Y4MA 4JTDB 4RQFA 2QA4V 3AG2C 1OHHG 1SRYA 3OFNG 3PJSK 1NR7A 3K08A 3ML0A 1NVPD 5GW7A 5IY5C 3JYCA 4N21A 3E35A 3CCSV 3E2EA 1I5XA 3ZJZA 1ROPA 1VQOV 1R3LC 2NLJC 3ASOB 1B6QA 5L3CA 1M90W 2P90A 1E1RG 1EBOA 3W7TA 2JK5C 4WCEV 3CCEV 1K73W 5EK0A 4PDMA 3D3IA 5IYBO 3AG2B 1EZJA 2WLHA 2PI5A 3UM7A 5H6RA 1YJNV 3OAAG 1S0VA 3IC7A 2IU0A 3CMAV 3ABLB 4HZ3A 3OGCC 3QO7A 2BOCC 4MTFA 4BIUA 4JAVA 2W6JG 1S77D 1F4NA 3DGEA 4JPRA 2KB1A 4UUJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKD A;  2HVJ C;  3T1C A;  2P7T C;  3SPI A;  2ZD9 A;  2Y69 C;  4MVM A;  4DXW A;  1K4C C;  3LNM B;  2ITC C;  2HFE C;  1R3I C;  2ATK C;  2Q6A A;  5CBF A;  3ABM C;  1XL4 A;  2DWD C;  3BEH A;  4HYO A;  4P9P A;  4PDL A;  3FB8 C;  4R6Z A;  4P9O A;  2Q69 A;  2A9H A;  4MVZ A;  2YEV A;  1S5H C;  4RUE A;  5B3S C;  1OCO C;  3T4Z A;  4MVO A;  3LDD A;  3SYC A;  3F7Y C;  2WLI A;  4MW3 A;  5KUM A;  2EIK C;  3ASN C;  4JTC B;  3OR6 C;  4WFE A;  4QNH B;  5CBG A;  3TET A;  2W0F C;  2HVK C;  3E8F A;  3SYA A;  5EBL C;  4PA3 A;  1ORQ C;  4MVQ A;  3X2Q C;  3WG7 C;  2A79 B;  2WLJ A;  3RVZ A;  3SYO A;  2EIL C;  2R9R B;  1QLE C;  2Q67 A;  4GX5 A;  3SJQ C;  2Q68 A;  3SYP A;  4CBC A;  3K03 A;  4MS2 A;  2H8P C;  2K1E A;  2QKS A;  4MVR A;  3K04 A;  2OCC C;  5CBH A;  5EC2 C;  4UUJ C;  4X89 A;  3E83 A;  2WLN A;  1R3K C;  4JTA B;  3E8G A;  4G27 B;  4P2Z A;  3K0D A;  3SPC A;  4PDR A;  1M57 C;  3UKM A;  4LBE C;  3FB7 C;  4PA7 A;  4H33 A;  4KFM A;  4PA4 A;  3F7V C;  4MVU A;  2HG5 C;  3ZRS A;  3FB6 C;  3STL C;  4WFF A;  4R50 A;  4LCU C;  1V54 C;  2AHZ A;  4J9Z B;  1ZWI C;  4H37 A;  3T2M A;  4R8C A;  2BOB C;  2EIN C;  2WLK A;  3GB7 C;  5J9P C;  2X6C A;  3K0G A;  2WLM A;  2DWE C;  4MTG A;  4MSW C;  3RBZ A;  4BW5 A;  4XDK A;  2ZXW C;  3RVY A;  4XDJ A;  1OCZ C;  3E8B A;  3STZ C;  3IFX A;  3ABL C;  3E8H A;  4OXS A;  1XL6 A;  4QE9 A;  1V55 C;  3T4D A;  1K4D C;  1P7B A;  1G4Y B;  3AG1 C;  1OCC C;  4MVS A;  4MTO A;  2QTO A;  5B1B C;  3KG2 A;  4RAI A;  3HPL C;  3ASO C;  3R65 A;  3TCU A;  4PA9 A;  4X88 A;  4J9Y B;  4P30 A;  3AG4 C;  5BZB A;  5KUK A;  3VOU A;  2WLL B;  2IH1 C;  2AHY A;  2IH3 C;  4RUF A;  3RW0 A;  1J95 A;  4R7C A;  3SPJ A;  4QE7 A;  4JTD B;  3AG2 C;  4GX1 A;  3PJS K;  3F5W C;  3AG3 C;  3FB5 C;  3K08 A;  3LDE A;  3LUT B;  5IY5 C;  3JYC A;  1M56 C;  2A0L A;  1R3J C;  2DYS C;  2EIM C;  2X6B A;  3K06 A;  3OUS A;  4PDV A;  4WFH A;  1JVM A;  4TWK A;  5EC1 C;  4ZBM A;  3SPG A;  4X8A A;  4EKW A;  3ZJZ A;  4LP8 A;  4WFG A;  1R3L C;  5EBM C;  2WLI B;  2DYR C;  2NLJ C;  5E1A C;  4I9W A;  4MW8 A;  4F4L A;  4RO2 A;  2JK5 C;  3LDC A;  3E86 A;  4GX0 A;  5EK0 A;  1BL8 A;  4PDM A;  2EIJ C;  2WLH A;  2WLL A;  4XDL A;  5B1A C;  3UM7 A;  3SYQ A;  4GX2 A;  3OR7 C;  2HJF C;  4G28 B;  4HZ3 A;  3OGC C;  3EFF K;  1LNQ A;  5EBW C;  2BOC C;  3ABK C;  4MTF A;  3SPH A;  3E89 A;  3IGA C;  2ITD C;  2X6A A;  2KB1 A;  4PA6 A;  1OCR C;  3OUF A; 
#chains in the Genus database with same CATH topology
 5F2V O;  2GTA A;  4X64 B;  4DRX B;  5KMG A;  3JSN A;  2VWJ A;  4UCU A;  4CC6 A;  4UB6 Z;  1OV9 A;  1FFX A;  1AI4 A;  2CTW A;  4HNA A;  2BCC H;  1R6T A;  1NTM H;  3E22 A;  2IJJ A;  1Y6X A;  3G80 A;  3JCZ A;  3WB0 A;  2RJZ A;  3E8F A;  5D5Q A;  3N2G B;  1ZSP A;  1K34 A;  3QTC A;  3HKD A;  2K1E A;  2QKS A;  4JF3 A;  1VAR A;  4DR7 B;  3JAT B;  4UCT A;  3UKM A;  2P4V A;  4BAY A;  4K8Z A;  3F7V C;  2UUC B;  2HG5 C;  3AEI A;  4H37 A;  3W7W A;  1VF6 C;  1ZL8 B;  5CA0 A;  4I50 A;  3BAB A;  1KKC A;  4Q20 A;  3D36 A;  1Y74 B;  4K0K O;  4XDK A;  3J81 N;  3ZMU A;  3E8H A;  2ZE7 A;  3RFR A;  3W7S A;  3ZHV A;  2GV9 A;  5JJN B;  3HKE B;  5J2T A;  3G6B A;  1AB3 A;  2QGN A;  1Q6U A;  1XEQ A;  2CTR A;  2HR3 A;  3EHB B;  3P3P A;  5EZY A;  5DN6 G;  1H2M A;  2A3Q A;  3ZMS A;  5EYP B;  1J95 A;  3K5N A;  1U96 A;  4FFK A;  4CH5 A;  4JI3 B;  3AG3 C;  3L9D A;  1YVW A;  1L0L H;  1JQ0 A;  1JVM A;  5ITZ B;  3QVN A;  2F43 G;  5E1A C;  1KD1 W;  2Y69 B;  4DR4 O;  2JIZ G;  3MDS A;  4O4J B;  4X1I A;  2WLL A;  2F93 B;  3Q4H A;  2W0X A;  2CTP A;  4IIJ B;  4TV9 B;  3ABU A;  1CPY A;  1K5Q A;  4IT5 A;  3IGA C;  1G1X B;  5IE9 A;  1TVK B;  2RQ6 A;  1BQZ A;  2N04 A;  1ZUQ A;  1YZB A;  4H44 B;  2FB5 A;  3CJH A;  5IY5 B;  1KP2 A;  5CA3 A;  1R6K A;  2EUL A;  4X66 O;  4AQY O;  3SYC A;  3ASN C;  4LF7 O;  4QNH B;  1XMQ B;  2LGQ A;  4LNU A;  4B3S B;  1PL4 A;  1WAZ A;  4DR3 O;  2B5U A;  1QNM A;  4ZOL B;  5BMV B;  2JRI A;  1IZ3 A;  4DR6 O;  2Y4T A;  3MHS C;  3K3W A;  2WPD G;  1XMO O;  1IBL O;  2VS0 A;  4HNA B;  3G4S V;  4YIO A;  1NI8 A;  1AR5 A;  3GB7 C;  2EIN C;  1SA0 A;  3NXS A;  2IU3 A;  3ZN1 A;  4JI2 O;  2E5L B;  2E76 B;  1VQ7 V;  3RYH B;  1VQP V;  2XHB A;  4UV8 A;  4JI6 O;  4B08 A;  5KUK A;  4N23 A;  2EJ7 A;  1XNR B;  2AZ2 A;  3CCV V;  2Q7G A;  1JCH A;  4IHJ A;  3T1Y B;  1WA8 A;  4DV1 O;  2X6B A;  3IAY A;  1D5N A;  4CS4 A;  2CH7 B;  4X8A A;  4YIP A;  2DYR C;  3ZHT A;  3W7X A;  1XNQ B;  1PKX A;  2PZS A;  1EM1 A;  2ZIO A;  2BTO A;  1H2L A;  1WPB A;  4B3T B;  5J2T B;  4GX2 A;  4G28 B;  2DJV A;  2ZDI C;  4KP4 A;  1W2B U;  2GTS A;  5CN0 A;  2ITD C;  1XHZ A;  4JYA B;  3ZN0 A;  2HVJ C;  1WP7 A;  3T1C A;  1NVP B;  3DXR A;  1SQQ H;  3LSQ A;  4FVM A;  1N0N A;  1MMM A;  1HWY A;  3FX7 A;  2HJD A;  4LFA O;  4LFB O;  4TOI A;  4JTC B;  2QWP B;  3IC9 A;  3TET A;  2JEX A;  1GM7 A;  1F51 A;  3FYE B;  2ZCE A;  4FLY A;  3FKS G;  1HDJ A;  3RVZ A;  3ZCC A;  3CRA A;  1V55 B;  1K5S A;  3FAV B;  4CBC A;  1YIT V;  5JWP A;  2PUS A;  2OWO A;  2YIC A;  1WLE A;  5B3S B;  1SA0 B;  4DV2 B;  5L3B A;  5LMU B;  2DW4 A;  4UVB A;  1YEW A;  1HNW O;  1ZWI C;  4JV5 O;  4ZKI A;  4ZI7 A;  2DWE C;  4GKJ B;  3UO3 A;  3AG4 B;  3N2G A;  5LOV A;  3CEI A;  2HP8 A;  1QLE B;  1QLN A;  3AG1 C;  1IX9 A;  4U3J B;  1J5E O;  3BRC A;  2XAS A;  4O4H B;  4RUF A;  4QE7 A;  3FB5 C;  4X1K B;  4GKK O;  2IJH A;  1M56 C;  1V9P A;  5EC1 C;  2P5O A;  3KCY A;  2QTS A;  4GT1 A;  1ZL8 A;  4LP8 A;  4LF6 O;  4WFG A;  5B1B B;  2FL4 A;  2ZE5 A;  4QPK A;  1M1K W;  1BL8 A;  1L1F A;  4J41 A;  3BVO A;  5K1X A;  2M7W A;  2JGD B;  5DEC A;  1BZK A;  4JI5 B;  3VQV A;  4DR3 B;  3SPI A;  4DR5 B;  1IBM B;  2DE0 X;  3JAL A;  3K5M A;  4J11 A;  5B5E Z;  4UVC A;  1Y66 A;  2EIM B;  3IJ4 A;  5KX5 A;  1IBL B;  2ZR3 A;  3CB2 A;  1S5H C;  3OEH G;  4OPA A;  1H38 A;  1H8H G;  2P4K A;  3I5D A;  1Q6I A;  3WG7 C;  5BR8 B;  1VP7 A;  2AXT Z;  1M5I A;  1VQ9 V;  1JMK C;  2JGD A;  4JAA A;  2IJI A;  2V7Q G;  3K5L A;  1BGY H;  5FPR A;  1GM8 A;  5C8Y B;  4B7K A;  2O57 A;  4JTA B;  4JI2 B;  4XBF A;  2E5L O;  3KCX A;  1ZTE A;  2YIB A;  4H33 A;  2D2C B;  3RWR D;  1VQK V;  1KB9 F;  4CC5 A;  1L8D A;  3DSQ A;  4WFB V;  1KYO F;  1VQM V;  4DR1 B;  2FYU H;  3K0G A;  4FM2 A;  3RBZ A;  1OCZ C;  4CS2 A;  4NTY A;  3B40 A;  3T4D A;  2QKC A;  4X65 O;  1XNQ O;  1K8A W;  4YJ2 B;  3ASO C;  4CH4 A;  3ABK B;  3AK1 A;  4X20 A;  2DYS B;  2FTK A;  5DED A;  1RFY A;  4L8J A;  2A06 H;  2F4V O;  3JYC A;  4N21 A;  3E35 A;  1I7F A;  1FJG O;  3CCS V;  1EZV H;  1VQO V;  1B6Q A;  1EBO A;  4WCE V;  2JK5 C;  1K73 W;  5EK0 A;  4PDM A;  3AG2 B;  1QHT A;  1YJN V;  3OAA G;  5LP6 A;  1FPO A;  3KZI Z;  3QO7 A;  4BIU A;  3DGE A;  2KB1 A;  2NR5 A;  3C3S A;  1HNX O;  2P7T C;  2Y69 C;  2CGN A;  3C3T A;  2LJ2 A;  1NH2 D;  1WA8 B;  1FXK A;  1FD9 A;  4TSF G;  1ENV A;  2IBZ H;  1SET A;  2FKX A;  3O65 A;  4MVO A;  4JZG A;  5KLV H;  3BFR A;  5LMU O;  2ETN A;  2BE3 A;  2E75 B;  1EN6 A;  1NS1 A;  2DQ0 A;  2A79 B;  2GUZ B;  2W6I G;  3SYO A;  4I55 B;  5JVD B;  3SJQ C;  2VQE O;  2Q68 A;  2JJ1 G;  5D5P A;  4NR1 A;  2PF4 E;  2ZXW B;  1Z2G A;  3E83 A;  3E8G A;  2Z3Y A;  1R6N A;  4PA4 A;  3D8C A;  4DV4 B;  1T5E A;  3RYC A;  1KU9 A;  2ZM6 B;  1X4T A;  1M56 B;  5J9P C;  1R73 A;  1JX9 A;  2CTQ A;  2YSU B;  4DYL A;  1SQF A;  2ZXW C;  3HB3 B;  1IXB A;  4TQD A;  4DR7 O;  1LUV A;  5B1A B;  1XRE A;  1HR0 B;  1G8M A;  2QWO B;  4FJC C;  2Q8V A;  4NYK A;  1QVF U;  1RSO A;  2ILM A;  3CXH F;  3I56 V;  1SQP H;  1N36 O;  3SJC C;  1RM1 C;  3TXQ A;  4YHH B;  2GHY A;  5A2Q N;  1RP3 B;  3TXS A;  2ZNI A;  1N33 B;  1K33 A;  5EBM C;  4MW8 A;  1MA1 A;  4O4I A;  3AG1 B;  3LDC A;  3WFV A;  1YIJ V;  2AZ0 A;  2JGU A;  4JAS A;  3RYH A;  3CCM V;  1GN4 A;  3T1H B;  1QVG U;  4IHJ B;  1GKF A;  4EFB A;  1FXV A;  3VQX A;  2Q5Z A;  2YXY A;  1KQS U;  4C7U A;  4ZHQ A;  2IJK A;  4UCV A;  3MAQ A;  1CXZ B;  5IYZ A;  4PI2 A;  1R3I C;  4HYO A;  2H94 A;  3CCQ V;  2BTQ A;  3ZMZ A;  2R9A A;  5KHG A;  4LWS A;  3SYA A;  2YI8 A;  5EBL C;  1SES A;  1JFF B;  3ZMV A;  2RCV A;  4I7Z B;  3X2Q C;  3B8M A;  2XAQ A;  3EVK A;  3LNN A;  1AJP A;  4DV7 O;  1QLE C;  4FK5 C;  4FFB A;  2KQX A;  2EX3 A;  3JD4 A;  3CRM A;  2FML A;  4FLV A;  1KMI Z;  4PA7 A;  5GTH Z;  2P06 A;  4BIO A;  3JAW A;  4O4H A;  4FM1 A;  2UU9 B;  4JI7 B;  4JZ2 A;  2OCH A;  1IBK O;  4X1K A;  4DK1 A;  2Y0P A;  4LF9 O;  2IW5 A;  2GBO A;  4J42 A;  4QE9 A;  3K59 A;  2Q7H A;  3QNE A;  1V55 C;  3APO A;  1OCC C;  2UXC B;  3L72 H;  1SC5 B;  4ICG A;  3QO5 A;  5C8Y A;  3VOU A;  2AHY A;  2F1M A;  4R7C A;  2ZQM A;  3F5W C;  1Q43 A;  4Q6G A;  1AIL A;  3GWK C;  2Q9L A;  3OUS A;  2CDY A;  5KHK A;  1TUE B;  4DK0 A;  3JAW B;  2RNB A;  1GRJ A;  1HNX B;  1TVK A;  4E2L A;  1OZ0 A;  4RO2 A;  5FLX N;  5LOV B;  3RYI B;  5LYJ B;  1R1B A;  4LC1 A;  4PV1 B;  4BR6 A;  4JI0 O;  2RDC A;  2HJF C;  5GTI Z;  3MD0 A;  3OEE G;  5EBW C;  1I94 O;  3SGI A;  1AVM A;  1IXM A;  1HNZ O;  1FAF A;  5J2U A;  3CCR V;  4LR3 A;  4FZ1 A;  5IWA B;  2F95 B;  2H3O A;  4I0X B;  3KKY A;  3L75 H;  4UCR A;  2XAG A;  2DQ3 A;  2ATK C;  4DW1 A;  5KHH A;  4RQE A;  2G38 A;  3BEH A;  3OGI B;  2YEV A;  5IJ9 B;  3D36 C;  3OTO O;  1Q5O A;  2VRZ A;  1ZLZ A;  2YC0 A;  2GSM B;  2W0F C;  2WA3 A;  4NB5 A;  1YHQ V;  3JAS B;  2ZM6 O;  1K97 A;  2EIL C;  1PNM A;  3TK1 A;  3LSU A;  4Z1M G;  1O9H A;  5EC2 C;  4QGP A;  4X89 A;  5GON A;  1UJW B;  1R3K C;  3GWO A;  1F23 A;  3ZMT A;  1JFF A;  4LFB B;  2R72 A;  4LBE C;  4KFM A;  4LH7 A;  3B77 A;  3STL C;  1N34 B;  2YXL A;  5L3D A;  1P4R A;  3BAA A;  4R8C A;  2BSK B;  1XI1 A;  4OPH A;  4BW9 A;  3AG3 B;  2QR4 A;  1N33 O;  4OGQ B;  3E8B A;  1TAE A;  4UFZ A;  5CA1 B;  3MHH C;  4O2B B;  4K8X A;  3AK2 A;  2L6L A;  3TCU A;  4IL6 Z;  1HNW B;  2XAF A;  1AR1 B;  1EN4 A;  1EFR G;  4BIZ A;  1AP5 A;  4WF9 V;  1YTF D;  1BMF G;  5LA6 B;  1WJZ A;  4DRX A;  2OT5 A;  4LH6 A;  4XDL A;  5B1A C;  2LFS A;  1D5A A;  4D7S A;  3OR7 C;  1WP8 A;  5JH7 B;  3EFF K;  3K5O A;  3N27 A;  2YID A;  1OCC B;  5EIB C;  2NN4 A;  3ZHQ A;  3AK3 A;  2Q0A A;  4LF6 B;  2QWN B;  4B3R O;  4QPJ A;  3CCJ V;  2Q6A A;  3RYF B;  1OCR B;  1NQT A;  1YJW V;  1NBM G;  2A9H A;  3G67 A;  1Q8I A;  4GYC B;  4I0X A;  1MG1 A;  2QM8 A;  3N2K B;  4JI5 O;  2UU9 O;  4NTX A;  3X2Q B;  1SZT A;  1MNG A;  4LF9 B;  2F66 C;  3ZED A;  2ZE6 A;  4EB6 B;  5FPO A;  1S5L Z;  1FXK B;  4J7K A;  3HKC A;  2PYL A;  3FB6 C;  4WFF A;  1SQV H;  5BR8 O;  1XQ8 A;  4U7O A;  1B04 A;  4LF8 B;  2PY5 A;  4JI1 O;  3CC7 V;  4W4K A;  4DV0 O;  1YXB A;  5FL7 G;  3N2K A;  1O9G A;  3RN4 A;  3ZRW B;  4LF5 B;  4QJF B;  1PV0 A;  1H2K A;  1NKD A;  1P7B A;  3NR7 A;  2EJR A;  4UB8 Z;  5ITZ A;  5B1B C;  3D3Q A;  1GN6 A;  5KMG B;  1QR8 A;  5EIB D;  3CSX A;  4DR1 O;  1JJO A;  4DUZ B;  4RQF A;  2QA4 V;  1SRY A;  3OFN G;  1NR7 A;  3K08 A;  3ML0 A;  2ADP A;  4JYA O;  4X64 O;  2MW2 B;  3J80 N;  1I5X A;  1ROP A;  4KXR A;  4UCS A;  2NLJ C;  3ASO B;  2P90 A;  3CCE V;  3J7A U;  3D3I A;  1EZJ A;  2WLH A;  3WU2 Z;  1S0V A;  3IC7 A;  3CMA V;  4LFA B;  2HHH B;  2BOC C;  4MTF A;  3R66 A;  4JAV A;  4CH3 A;  3C90 A;  4JPR A;  1ARO P;  2NNU A;  3OM3 B;  1KEC A;  2OTJ V;  1VQL V;  4LFC O;  1WN7 A;  5KA5 A;  5JH7 A;  3CHX A;  2DWD C;  4R6Z A;  3FB8 C;  1D2D A;  5HFL A;  1VF7 A;  5CA0 B;  5JQG A;  3K57 A;  2ZIN A;  3T4Z A;  3ETG A;  1SER A;  3F7Y C;  4MW3 A;  5KUM A;  2EIK C;  3UQ8 A;  1PL0 A;  3JSL A;  3OR6 C;  4ASU G;  4WFE A;  5IJ0 A;  1JPX A;  1COW G;  1TUB A;  2ZT9 B;  4JV5 B;  4MVQ A;  3BA9 A;  4FIP C;  1FYJ A;  1L0N H;  4JGS A;  2UUB B;  4ZHQ B;  1XDC A;  2QKA A;  2HEP A;  1PPJ H;  2WLN A;  4YJ2 A;  3ICX A;  4G27 B;  3JAR A;  3HR0 A;  4MVU A;  4R50 A;  4FLU A;  4FLX A;  1URF A;  5B1O A;  1WB7 A;  4NXM B;  4DV5 O;  5A9G A;  3L73 H;  3RVY A;  2XUM A;  3L71 H;  2HLD G;  4DR2 B;  1IUR A;  5L3F A;  4WBN B;  4DV6 O;  4DR4 B;  2UXB O;  2OIG A;  2UUC O;  4F6E A;  4X88 A;  1K9M W;  4P30 A;  3CE2 A;  3OD4 A;  1AP6 A;  3LDE A;  5LL6 Y;  2Q4P A;  4ZIB A;  2AW9 A;  5J2U B;  3JAK B;  3TJT A;  4B3R B;  2WLI B;  3CWB H;  1S72 V;  1I0H A;  3U11 A;  2RN9 A;  2QM7 A;  1XIL A;  1GTO A;  3O9O A;  4MT8 A;  3OE7 G;  3S3W A;  3BHP A;  2LFR A;  4O2B A;  4CH6 A;  4LF7 B;  4YHH O;  3H01 A;  1XMQ O;  4B3S O;  4PA6 A;  4JI4 B;  2EBO A;  3CCU V;  3CD6 V;  1LUW A;  5EYP A;  3ZHU A;  4DR6 B;  1FFT B;  3ETQ A;  5LYJ A;  1YI2 V;  1XMO B;  1GH6 A;  1GO3 F;  1VIB A;  2JDI G;  4YXW G;  4JAU A;  2N74 A;  2HVK C;  3FD9 A;  1MSW D;  1DF4 A;  2DMX A;  3DTU B;  4TV9 A;  3K9A A;  1Y67 A;  1IVS A;  4I9Q A;  2H8P C;  1NR1 A;  1VQ5 V;  3VQW A;  4X20 B;  4ABM A;  3CP1 A;  4X66 B;  4D7T A;  3SPC A;  5LP6 C;  4AQY B;  1M57 C;  4AIL C;  2LGW A;  5IJ9 A;  3RYF A;  1Y76 B;  4JI8 B;  4B3M O;  1MOF A;  1SS3 A;  2CE4 A;  4DW0 A;  5IJ0 B;  4DV7 B;  1KUQ A;  2WLM A;  4X9Q A;  4AHC A;  3JCU Z;  4DV1 B;  2A7W A;  4XDJ A;  1VQ6 V;  2EIK B;  1CEZ A;  1QCE A;  1PNL A;  2XAH A;  4UXN A;  3JD0 A;  2YXH A;  2QTO A;  4O4I B;  1AI6 A;  3JAT A;  1Y74 A;  1AJQ A;  1NU1 H;  1FXK C;  2C2A A;  2VQF O;  3H1I H;  2WWW A;  4TWK A;  3UO2 A;  2K9P A;  1VF5 B;  3ZRV A;  4UVA A;  2EIJ B;  4F4L A;  5KHJ A;  4I9W A;  2CUG A;  1YDX A;  3E86 A;  2IM9 A;  2AGA A;  4K3A A;  4LWS B;  4KHP O;  1XNR O;  4CS3 A;  4I55 A;  2ZR2 A;  4DUY B;  5CB4 B;  5KX5 B;  3ABK C;  1EN5 A;  4O4L A;  5JJJ B;  1YTF B;  1OCR C;  3ZHS A;  5DM6 V;  5LMN B;  2X0L A;  5LBQ A;  1SQB H;  3GVM A;  1DF5 A;  2ZIM A;  2VQE B;  1CP9 A;  4NXN O;  2YDE A;  2E3C A;  3CC4 V;  5L3E A;  3Q4H B;  3A0R A;  3M7M X;  4JI0 B;  1BCC H;  4EB6 A;  1PNK A;  2Q0O C;  4YJ3 A;  2ODM A;  5B1N A;  1Q86 W;  1I94 B;  1VQN V;  5CBG A;  1MSD A;  4MTX A;  1ZX3 A;  3OW2 U;  5LHH A;  4FZ0 A;  1FXH A;  1SQX H;  4NXM O;  1Y76 A;  4DV5 B;  2Q67 A;  3ABT A;  4RWU A;  1G6U A;  1Q3E A;  2UXX A;  4GKJ O;  5B66 Z;  2LO1 A;  1K92 A;  1SZX A;  4DR2 O;  4X62 B;  2QSA A;  1BSM A;  2QWQ B;  3CJH B;  4J7J A;  4PDR A;  4EFE A;  3WG7 B;  2YS8 A;  3FFQ A;  1GN3 A;  3WB2 A;  3T2M A;  2UUA O;  1M4U A;  2WLK A;  5JJE B;  1H2G A;  1YSC A;  1FKA O;  4GKK B;  4J80 A;  3STZ C;  4OXS A;  1TUB B;  5H6Q A;  1YF2 A;  5L3G A;  3ZRX A;  4MTO A;  5KA6 A;  3M99 B;  3SJB C;  1BT8 A;  2LW7 A;  2IH1 C;  3JAR B;  1OCO B;  1X59 A;  4FPP A;  3LUT B;  2OTL V;  5LHG A;  3CRC A;  4JYY A;  2M6Y A;  2ADQ B;  1R3J C;  4WFH A;  2QM4 A;  3M8A A;  2ARH A;  1KP3 A;  5LGU A;  1HP8 A;  3DXR B;  2EIJ C;  1VEW A;  2P6J A;  4E4E A;  3E89 A;  4JI3 O;  1Q7Y W;  4J10 A;  1B06 A;  3BA8 A;  2Q7E A;  1H2N A;  3CCL V;  4MVM A;  1K4C C;  2ITC C;  4I5S A;  4K35 A;  5LP6 B;  4UCO A;  4P9P A;  1E79 G;  3HKB B;  1OCO C;  5GON B;  4O4L B;  2WLI A;  1NJI W;  4B3M B;  2Q73 A;  3B8N A;  5CMU A;  1SQG A;  4AI8 A;  4GX5 A;  5K1P A;  1IBK B;  2R9I A;  4MS2 A;  1E1Q G;  1A32 A;  5CA1 A;  5IYD O;  1VQ8 V;  4PI0 A;  2XTA A;  4QIW F;  3LSS A;  1PM9 A;  3ABM B;  2VWK A;  3UT5 A;  3ZRS A;  3JAS A;  5IDJ A;  1V54 C;  4J9Z B;  1RPO A;  3H1K H;  2N05 A;  2X6C A;  4BW5 A;  3S3X A;  5H9C A;  1Q90 D;  1Z5W A;  5IT9 N;  1FJG B;  4X1Y A;  3K9S A;  1H2S B;  4FLZ A;  1AI5 A;  4FMT A;  4MVS A;  4BWA A;  3KG2 A;  5TIS Z;  4O4J A;  4X1I B;  1V54 B;  5H5N A;  3FYI B;  5BZB A;  5C93 A;  2Z0A A;  1W59 A;  2WLL B;  4TV8 B;  2YI9 A;  1OHH G;  1NVP D;  5GW7 A;  4JI1 B;  5IY5 C;  3H1L H;  4F6R A;  2XT9 A;  4Z2W A;  1BQ0 A;  3UCS C;  3DC5 A;  2QDO A;  4LF5 O;  1R3L C;  4Z1V A;  5KAF Z;  1M90 W;  1RSO B;  1E1R G;  1NZ6 A;  1NT2 B;  4JI6 B;  3HKE A;  2PI5 A;  3UM7 A;  2JS3 A;  4HZ3 A;  3OGC C;  2ZE8 A;  2W6J G;  1F4N A;  4UUJ C;  5FNV B;  3JD2 A;  4LNU B;  1KKD A;  1S5J A;  1S76 D;  3JAK A;  2Y4U A;  3RT3 C;  3LNM B;  5BMV A;  2EZP A;  3B09 A;  4GCZ A;  5CBF A;  2B1G A;  2PI4 A;  4IIJ A;  1OJH A;  4WFA V;  2EIN B;  2PTM A;  3PN1 A;  4FFB B;  1H8E G;  1RPR A;  2Y48 A;  1N34 O;  1ORQ C;  2EIL B;  2UUA B;  2R9R B;  4KL1 A;  4LFC B;  1I08 A;  2D3O W;  2P67 A;  1XOU A;  4KUM A;  1XHX A;  2UXN A;  2YIB D;  4P2Z A;  3A2F A;  1US6 A;  1JA8 A;  3FB7 C;  4X1Y B;  1N8R W;  3G71 V;  2KG7 A;  4NTW A;  1VQ4 V;  2AHZ A;  2OYQ A;  3QO8 A;  3SDL A;  1N36 B;  2V4D A;  3H1H H;  1AI7 A;  2P22 C;  2PGG A;  4MSW C;  4PEL A;  3VQY A;  2UUB O;  3CYO A;  4I4T A;  1I5Y A;  4DV2 O;  3A0H Z;  3UT5 B;  3THO A;  5JVD A;  1P84 F;  4CZZ A;  1KC8 W;  4DV4 O;  1GAX A;  2Y0I A;  1FS0 G;  3RYI A;  4LF4 O;  3T1H O;  2UXD B;  1NH2 B;  3CRQ A;  3QG5 A;  3CC2 V;  5CB4 A;  1QBZ A;  2A0L A;  2DYS C;  3K06 A;  4PDV A;  4DO2 A;  3SPG A;  1HR0 O;  2YIA A;  3SJA C;  5FNV A;  4H0L B;  4DV6 B;  1VMG A;  1K7D A;  4TUY A;  4A5U B;  1J5E B;  4JYB A;  1N32 B;  3JAM N;  4O2A B;  2JJ2 G;  2ZNJ A;  1S3J A;  3E22 B;  3ZIA G;  1DK1 A;  4UV9 A;  4FLT A;  4B7E A;  3OUF A;  2CH7 A;  4TV8 A;  3BY6 A;  1WPX A;  4DXW A;  5H2F Z;  3HKD B;  1IDS A;  2CK3 G;  4U3F H;  3ZHR A;  1XL4 A;  4PDL A;  2JEU A;  4NVP A;  4P9O A;  1TGO A;  4RUE A;  2XND G;  3LDD A;  1GK9 A;  4I50 B;  3APQ A;  4PA3 A;  4TUY B;  4JI4 O;  3ZRW A;  2JS5 A;  1SF9 A;  1MZF A;  4L87 A;  3SYP A;  3K03 A;  4MVR A;  3K04 A;  4DV0 B;  1F7Y A;  1BS3 A;  3P3N A;  1M9N A;  1BHA A;  1Z5V A;  1MAB G;  1GMG A;  1YCI A;  2KKW A;  1Q81 W;  1QQC A;  3RGB A;  5EZY B;  3IFX A;  1OCZ B;  5LXT B;  1N0J A;  2ZDI A;  4OX9 B;  3CXC U;  2KG7 B;  5AG2 A;  4RAI A;  3K58 A;  2WA4 A;  4IYI A;  2DYR B;  4PA9 A;  4B3T O;  1BHB A;  1WB8 A;  3SPJ A;  2B1I A;  4D6T H;  2EIM C;  4ZBM A;  4EKW A;  2YEV B;  3ZBH A;  4DV3 B;  4TQF A;  4GZR B;  4I4T B;  1XUQ A;  1M57 B;  3ETE A;  3CRR A;  2QE7 G;  2YUA A;  1THZ A;  5LXT A;  1JR9 A;  3BCC H;  3SYQ A;  1P7G A;  3QF7 A;  1JOY A;  3SPH A;  2WSS G;  5LHI A;  2X6A A;  1NTZ H;  5LA6 A;  1W0J G;  2VQF B;  1GN2 A;  3W7U A;  3OMI B;  2ZD9 A;  5BY1 A;  2RMK B;  2L35 A;  4O2A A;  3ABM C;  3B4S A;  4PHZ A;  1NTK H;  1KBH A;  4F6R B;  5LGN A;  2B9Z A;  2Q69 A;  4MVZ A;  4KHP B;  3P32 A;  4DUY O;  1HNZ B;  3TGU H;  2CGO A;  4YY3 O;  4TT3 G;  5KHI A;  5LMN O;  5IWA O;  2WLJ A;  3SR2 C;  4NXN B;  2PYJ A;  1DTO A;  1PP9 H;  2F23 A;  2OCC C;  5CBH A;  4IYH A;  5IYZ B;  5KAI Z;  3OTO B;  3K0D A;  3U10 A;  3H9V A;  1RM1 B;  2LP7 A;  2UXB B;  2BTQ B;  4NKG B;  4H13 B;  4LCU C;  4FM0 A;  2GDS A;  1U97 A;  3OMA B;  4LF4 B;  2BOB C;  2UXD O;  1UFI A;  2Z5U A;  4MTG A;  2OCC B;  3H1J H;  4W4L A;  3ABL C;  4X62 O;  2CAZ C;  3I55 V;  1Q6H A;  3L74 H;  2LW1 A;  2QJ1 A;  3L70 H;  1K3E A;  4HAM A;  3BPZ A;  3HPL C;  4J9Y B;  1N32 O;  1HW7 A;  3CS5 A;  2LQT A;  1QU7 A;  2ZKO A;  4GX1 A;  4K0K B;  1F4M A;  4DR5 O;  2DOS A;  3EXA A;  2KSD A;  4HBN A;  1IBM O;  1AJN A;  5JQG B;  4YJ3 B;  4GX0 A;  3ETD A;  4JYC A;  2QEX V;  3OMN B;  1XBL A;  5IYC O;  1FFX B;  3A8T A;  4ZOL A;  3A0B Z;  3U0Z A;  1LNQ A;  2DN9 A;  1BE3 H;  3CME V;  3CX5 F;  3G6E V;  5LGT A;  3OT7 A;  3ZS8 C;  2HFE C;  1PD3 A;  2X7R B;  2WAM A;  1LR1 A;  5JCO A;  5B3S C;  5E79 Z;  4GLX A;  1DLB A;  1P49 A;  4JI8 O;  1QR9 A;  3AG7 A;  3K79 A;  3JD1 A;  4PJ0 Z;  2XAJ A;  3VBB A;  4ZI7 B;  3JD3 A;  3DC6 A;  3P30 A;  1AR4 A;  2XOK G;  4U3J A;  4GUN A;  4G2K A;  2EZO A;  4U7N A;  1GM9 A;  4OX9 O;  4X65 B;  2V1D A;  1W0K G;  1N4C A;  4WBN A;  2QWR B;  1MZE A;  1B3Q A;  2GUZ A;  3ASN B;  5HFM A;  4IGG A;  2R70 A;  1UPG A;  2MK3 A;  2F4V B;  4J7Z A;  1YJ9 V;  1JJ2 U;  1XL6 A;  4DV3 O;  1K4D C;  1G4Y B;  3CPW U;  2BSK A;  3B2E E;  1DGS A;  3R65 A;  1Q82 W;  3AG4 C;  5JCO C;  2HKO A;  4JI7 O;  2IH3 C;  3RW0 A;  2HHH O;  1Y4M A;  3HKC B;  4JTD B;  3RYC B;  3AG2 C;  3PJS K;  1M93 A;  4LF8 O;  3OTF A;  3JAL B;  3E2E A;  3ZJZ A;  5BXZ A;  3ZX6 A;  4FLW A;  5L3C A;  1ZAU A;  2JVD A;  3W7T A;  3HKB A;  2UXC O;  3WB1 A;  1SKV A;  2E74 B;  4PD4 F;  5IYB O;  1TA8 A;  5H6R A;  1VF6 A;  2IU0 A;  3F5T A;  3ABL B;  4DUZ O;  2OIE A;  3FAV A;  1WNS A;  3T1Y O;  1S77 D;  4YY3 B;  4EEQ A; 
#chains in the Genus database with same CATH homology
 3JD2 A;  1KKD A;  1ARO P;  1S76 D;  2NNU A;  3OM3 B;  2P7T C;  2Y69 C;  1KEC A;  2OTJ V;  1VQL V;  3LNM B;  2EZP A;  4GCZ A;  1NH2 D;  5CBF A;  2B1G A;  5KA5 A;  1FXK A;  4TSF G;  1AI4 A;  2DWD C;  2PI4 A;  1ENV A;  4R6Z A;  3FB8 C;  5HFL A;  1SET A;  4WFA V;  3T4Z A;  2EIN B;  3ETG A;  4MVO A;  1SER A;  3F7Y C;  2IJJ A;  4MW3 A;  2EIK C;  5KUM A;  1PL0 A;  3OR6 C;  1H8E G;  4ASU G;  4WFE A;  3JCZ A;  1RPR A;  3E8F A;  2Y48 A;  1JPX A;  1COW G;  2DQ0 A;  1ORQ C;  2EIL B;  4MVQ A;  2A79 B;  2W6I G;  4FIP C;  3SYO A;  2R9R B;  1K34 A;  3SJQ C;  2Q68 A;  4JGS A;  2JJ1 G;  2K1E A;  2QKS A;  2D3O W;  2P67 A;  4JF3 A;  2ZXW B;  4KUM A;  3E83 A;  2WLN A;  2UXN A;  3E8G A;  4G27 B;  2Z3Y A;  4P2Z A;  1R6N A;  3UKM A;  3FB7 C;  4BAY A;  4PA4 A;  3F7V C;  4MVU A;  1N8R W;  2HG5 C;  3G71 V;  4R50 A;  3AEI A;  1VQ4 V;  2AHZ A;  4H37 A;  3QO8 A;  3W7W A;  1M56 B;  4Q20 A;  5B1O A;  5J9P C;  1R73 A;  1JX9 A;  1AI7 A;  2YSU B;  3D36 A;  4MSW C;  4PEL A;  4XDK A;  2ZXW C;  3RVY A;  3HB3 B;  3ZMU A;  3CYO A;  3E8H A;  5B1A B;  2HLD G;  1I5Y A;  3W7S A;  5L3F A;  1G8M A;  4FJC C;  4CZZ A;  1KC8 W;  1QVF U;  4X88 A;  1K9M W;  4P30 A;  3I56 V;  2HR3 A;  3EHB B;  5DN6 G;  1FS0 G;  1RM1 C;  3ZMS A;  1J95 A;  1NH2 B;  2GHY A;  3CC2 V;  3AG3 C;  3LDE A;  1K33 A;  1QBZ A;  2A0L A;  2DYS C;  3K06 A;  4PDV A;  1JQ0 A;  4DO2 A;  1JVM A;  3SPG A;  2F43 G;  5EBM C;  2WLI B;  1S72 V;  5E1A C;  4MW8 A;  1KD1 W;  2Y69 B;  2QM7 A;  3WFV A;  3AG1 B;  2JIZ G;  3LDC A;  1YIJ V;  1K7D A;  1GTO A;  4JYB A;  2WLL A;  4MT8 A;  2JJ2 G;  3OE7 G;  4JAS A;  3CCM V;  1S3J A;  3ZIA G;  3ABU A;  2LFR A;  1QVG U;  1CPY A;  1K5Q A;  3H01 A;  4UV9 A;  1GKF A;  3IGA C;  1FXV A;  4PA6 A;  3OUF A;  2EBO A;  3CCU V;  3CD6 V;  1KQS U;  2IJK A;  3BY6 A;  1WPX A;  4DXW A;  1R3I C;  1FFT B;  2CK3 G;  5IY5 B;  1KP2 A;  5CA3 A;  1XL4 A;  4HYO A;  4PDL A;  1R6K A;  2JEU A;  1YI2 V;  4P9O A;  2H94 A;  1GO3 F;  3CCQ V;  2JDI G;  2XND G;  4RUE A;  3ZMZ A;  3LDD A;  4YXW G;  3SYC A;  1GK9 A;  3ASN C;  4JAU A;  4QNH B;  2HVK C;  3SYA A;  5EBL C;  1MSW D;  1DF4 A;  1SES A;  4PA3 A;  3DTU B;  3ZMV A;  3X2Q C;  3B8M A;  2XAQ A;  3ZRW A;  1AJP A;  3K9A A;  1QLE C;  2B5U A;  4L87 A;  3SYP A;  4FK5 C;  3K03 A;  2H8P C;  1NR1 A;  3MHS C;  3K04 A;  4MVR A;  3K3W A;  1M9N A;  1VQ5 V;  2WPD G;  1BHA A;  1MAB G;  1GMG A;  3CP1 A;  3JD4 A;  3SPC A;  1M57 C;  3G4S V;  4PA7 A;  1Q81 W;  1MOF A;  3GB7 C;  2EIN C;  2WLM A;  3NXS A;  4XDJ A;  1VQ6 V;  2EIK B;  2IW5 A;  3IFX A;  1CEZ A;  1QCE A;  1OCZ B;  1PNL A;  2IU3 A;  2XAH A;  4UXN A;  3ZN1 A;  4QE9 A;  2ZDI A;  3QNE A;  1V55 C;  3JD0 A;  3CXC U;  1VQ7 V;  1OCC C;  2QTO A;  4RAI A;  1VQP V;  4UV8 A;  1AI6 A;  3QO5 A;  2DYR B;  4PA9 A;  5KUK A;  4N23 A;  1AJQ A;  3VOU A;  1BHB A;  2AHY A;  4R7C A;  3SPJ A;  2B1I A;  3CCV V;  1FXK C;  2ZQM A;  1JCH A;  3F5W C;  2C2A A;  3OUS A;  2EIM C;  2X6B A;  4ZBM A;  1TUE B;  4EKW A;  4TWK A;  2WWW A;  2YEV B;  4X8A A;  3ZRV A;  4UVA A;  4E2L A;  2EIJ B;  4F4L A;  2DYR C;  3W7X A;  4I9W A;  1OZ0 A;  4RO2 A;  1M57 B;  1PKX A;  3ETE A;  3E86 A;  2QE7 G;  1THZ A;  4LC1 A;  3SYQ A;  2ZR2 A;  4GX2 A;  2HJF C;  4G28 B;  3MD0 A;  2ZDI C;  3OEE G;  4KP4 A;  1W2B U;  5EBW C;  3ABK C;  1JOY A;  3SPH A;  2WSS G;  5CN0 A;  2ITD C;  5LHI A;  2X6A A;  1IXM A;  1YTF B;  1OCR C;  1W0J G;  5DM6 V;  3CCR V;  3ZN0 A;  3W7U A;  2X0L A;  5LBQ A;  2HVJ C;  3OMI B;  3T1C A;  2ZD9 A;  1NVP B;  1DF5 A;  1CP9 A;  2XAG A;  3CC4 V;  2DQ3 A;  2ATK C;  5L3E A;  3ABM C;  4RQE A;  3BEH A;  3A0R A;  3LSQ A;  5LGN A;  2Q69 A;  1HWY A;  2YEV A;  4MVZ A;  3P32 A;  1PNK A;  4JTC B;  5B1N A;  1Q86 W;  2GSM B;  1VQN V;  5CBG A;  3TET A;  2W0F C;  2JEX A;  1YHQ V;  1GM7 A;  1F51 A;  4TT3 G;  4MTX A;  3FYE B;  3FKS G;  1K97 A;  3OW2 U;  2WLJ A;  5LHH A;  3RVZ A;  1FXH A;  2EIL C;  1PNM A;  2Q67 A;  3ZCC A;  1V55 B;  1K5S A;  1YIT V;  3ABT A;  3TK1 A;  4CBC A;  1DTO A;  2UXX A;  2OCC C;  4Z1M G;  5CBH A;  1WLE A;  1K92 A;  5B3S B;  5EC2 C;  4X89 A;  1UJW B;  5L3B A;  1R3K C;  3GWO A;  3K0D A;  1F23 A;  4PDR A;  3ZMT A;  3WG7 B;  4LBE C;  1RM1 B;  2LP7 A;  2DW4 A;  4KFM A;  4UVB A;  3B77 A;  3STL C;  4LCU C;  1ZWI C;  5L3D A;  1P4R A;  3T2M A;  4R8C A;  3OMA B;  2BOB C;  2WLK A;  4ZKI A;  1H2G A;  1YSC A;  3AG3 B;  2Z5U A;  2DWE C;  4MTG A;  2OCC B;  3E8B A;  3STZ C;  3ABL C;  4OXS A;  3AG4 B;  5H6Q A;  3I55 V;  3MHH C;  5L3G A;  1QLN A;  1QLE B;  3ZRX A;  3AG1 C;  4MTO A;  1K3E A;  5KA6 A;  3M99 B;  4HAM A;  3HPL C;  3TCU A;  2XAS A;  4J9Y B;  2IH1 C;  4RUF A;  2XAF A;  1OCO B;  4FPP A;  4QE7 A;  1AR1 B;  4GX1 A;  3FB5 C;  3LUT B;  2OTL V;  5LHG A;  2IJH A;  1M56 C;  1R3J C;  1EFR G;  4BIZ A;  4WFH A;  5EC1 C;  1F4M A;  4GT1 A;  4WF9 V;  1YTF D;  1BMF G;  4LP8 A;  4WFG A;  5B1B B;  1AJN A;  2OT5 A;  1KP3 A;  5LGU A;  4QPK A;  1M1K W;  4GX0 A;  1BL8 A;  3ETD A;  2EIJ C;  4JYC A;  1L1F A;  2QEX V;  4XDL A;  3OMN B;  5B1A C;  2LFS A;  5IYC O;  2P6J A;  3OR7 C;  2M7W A;  3EFF K;  1LNQ A;  3E89 A;  1Q7Y W;  3CME V;  1OCC B;  3G6E V;  5LGT A;  3SPI A;  3CCL V;  4MVM A;  4QPJ A;  3CCJ V;  1K4C C;  2ITC C;  2HFE C;  1PD3 A;  2Q6A A;  4I5S A;  4UVC A;  4P9P A;  1Y66 A;  2EIM B;  1OCR B;  1NQT A;  2X7R B;  1YJW V;  1NBM G;  2A9H A;  2WAM A;  2ZR3 A;  1S5H C;  5B3S C;  1E79 G;  3OEH G;  1OCO C;  2WLI A;  1DLB A;  1NJI W;  1H8H G;  1H38 A;  1MG1 A;  2QM8 A;  1QR9 A;  3K79 A;  3WG7 C;  3B8N A;  5CMU A;  3JD1 A;  3X2Q B;  1SZT A;  4GX5 A;  2XAJ A;  3VBB A;  2R9I A;  3JD3 A;  1VQ9 V;  4MS2 A;  2IJI A;  3P30 A;  2XOK G;  2V7Q G;  4G2K A;  2EZO A;  1GM8 A;  4JTA B;  4U7N A;  1E1Q G;  1GM9 A;  1VQ8 V;  4XBF A;  5IYD O;  1FXK B;  2V1D A;  4QIW F;  1W0K G;  4H33 A;  3LSS A;  3ABM B;  1VQK V;  3ZRS A;  3FB6 C;  4WFF A;  5IDJ A;  1V54 C;  4J9Z B;  4WFB V;  3ASN B;  1RPO A;  1VQM V;  5HFM A;  4U7O A;  2X6C A;  3K0G A;  2MK3 A;  3RBZ A;  4BW5 A;  3CC7 V;  5H9C A;  1OCZ C;  1YJ9 V;  5FL7 G;  1JJ2 U;  1XL6 A;  3ZRW B;  3T4D A;  4QJF B;  1K4D C;  1NKD A;  1P7B A;  1G4Y B;  2EJR A;  1AI5 A;  4FMT A;  4MVS A;  1K8A W;  3CPW U;  5B1B C;  3KG2 A;  1V54 B;  3ASO C;  3FYI B;  3R65 A;  3ABK B;  1Q82 W;  3AG4 C;  5BZB A;  5C93 A;  1QR8 A;  2HKO A;  2WLL B;  2IH3 C;  2DYS B;  2FTK A;  3RW0 A;  1Y4M A;  4JTD B;  4RQF A;  2QA4 V;  3AG2 C;  1OHH G;  1SRY A;  3OFN G;  3PJS K;  1NR7 A;  3K08 A;  3ML0 A;  1NVP D;  5GW7 A;  5IY5 C;  3JYC A;  4N21 A;  3E35 A;  3CCS V;  3E2E A;  1I5X A;  3ZJZ A;  1ROP A;  1VQO V;  1R3L C;  2NLJ C;  3ASO B;  1B6Q A;  5L3C A;  1M90 W;  2P90 A;  1E1R G;  1EBO A;  3W7T A;  2JK5 C;  4WCE V;  3CCE V;  1K73 W;  5EK0 A;  4PDM A;  3D3I A;  5IYB O;  3AG2 B;  1EZJ A;  2WLH A;  2PI5 A;  3UM7 A;  5H6R A;  1YJN V;  3OAA G;  1S0V A;  3IC7 A;  2IU0 A;  3CMA V;  3ABL B;  4HZ3 A;  3OGC C;  3QO7 A;  2BOC C;  4MTF A;  4BIU A;  4JAV A;  2W6J G;  1S77 D;  1F4N A;  3DGE A;  4JPR A;  2KB1 A;  4UUJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...