4G28B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport/calcium binding protein
molecule keywords Small conductance calcium-activated potassium channel protei
publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g28B00
2YEVA 4LP8A 3K0GA 3OR6C 3AG2C 3ABKC 5KUMA 5B1AC 2Q69A 2AHYA 3X2QC 2A79B 4J9YB 1R3LC 3E8FA 4H33A 3VOUA 3K08A 3JYCA 1R3IC 2AHZA 1ORQC 3EFFK 3SPHA 4MVOA 2HG5C 2ITDC 3SYCA 2EIKC 3OGCC 4LCUC 5EBMC 3RW0A 2HJFC 4R50A 2A0LA 4G27B 1LNQA 4JTCB 3T1CA 1XL6A 2X6AA 3K04A 4XDLA 4RO2A 1J95A 4TWKA 1KKDA 5J9PC 2DWDC 3STLC 1K4DC 2KB1A 3GB7C 4PDRA 2WLJA 4MSWC 3R65A 3K06A 3RBZA 4QNHB 3FB8C 4MTFA 4MVZA 2Q6AA 4P9OA 3SPCA 4HYOA 5EC2C 4MVSA 3SYQA 4MVRA 3TCUA 4OXSA 2Q68A 4LBEC 2EILC 5B1BC 2EIJC 1OCOC 4P9PA 5E1AC 3ABLC 3E89A 3K0DA 4PA6A 1R3JC 2EINC 2WLLB 3AG1C 4QE7A 3ASNC 2BOCC 2IH1C 3F5WC 3SPGA 1V54C 1K4CC 5EBLC 2WLIB 4MTOA 4BW5A 3LDDA 5KUKA 4PA3A 4RUFA 4MW8A 3SYAA 2QKSA 3T4DA 4H37A 4UUJC 4XDJA 3T4ZA 3E8GA 3SYPA 3IFXA 2JK5C 3RVZA 2QTOA 3K03A 2BOBC 2DYRC 4PDMA 2EIMC 4JTDB 2X6BA 3E8BA 2X6CA 1G4YB 2P7TC 2WLLA 4I9WA 5BZBA 2WLKA 3LUTB 4MW3A 1ZWIC 5EC1C 4QE9A 5B3SC 1R3KC 2R9RB 2HVKC 3BEHA 3F7YC 3STZC 5CBFA 2Y69C 3E86A 4XDKA 3SPIA 3AG3C 4GX0A 4P2ZA 2DYSC 2HVJC 2OCCC 4PDVA 3AG4C 3UKMA 4MTGA 4MS2A 2ITCC 3ZRSA 3E83A 2WLHA 4WFGA 1XL4A 1OCZC 1M56C 4CBCA 1OCRC 2DWEC 2H8PC 4PA7A 2K1EA 4PA4A 1M57C 3TETA 4GX5A 4WFFA 1BL8A 5EK0A 2WLNA 4DXWA 5IY5C 3FB6C 4GX2A 3WG7C 4R7CA 3ABMC 3KG2A 3LDEA 4X89A 3ASOC 3T2MA 5CBGA 3RVYA 4WFEA 2WLIA 3OUFA 1JVMA 4JTAB 4PDLA 1OCCC 4GX1A 4R6ZA 2HFEC 4ZBMA 4PA9A 4MVQA 2IH3C 4WFHA 3F7VC 1V55C 3FB7C 4R8CA 3LNMB 4MVMA 4X88A 4HZ3A 4RAIA 3PJSK 4X8AA 4RUEA 4J9ZB 2A9HA 3ZJZA 2W0FC 2ATKC 2Q67A 3FB5C 3SJQC 1QLEC 1S5HC 3IGAC 3UM7A 4F4LA 3SYOA 2NLJC 4KFMA 3OR7C 3LDCA 3E8HA 3OUSA 4G28B 4P30A 3HPLC 4MVUA 3SPJA 5CBHA 4EKWA 2WLMA 1P7BA 5EBWC 2ZXWC 2ZD9A
chains in the Genus database with same CATH superfamily
2F4VO 5B1AC 1OZ0A 4NTYA 1R3LC 1TAEA 1WN7A 3ABUA 2ZM6O 4UB8Z 1URFA 3SYCA 1VQPV 2OIEA 2F23A 5J2UA 2IBZH 4DV4O 3JAWB 4XDLA 4CH4A 1SQQH 1S76D 2DWDC 2CDYA 2IJKA 5CBHA 1P7GA 1EN6A 5CA0B 3H01A 4WFAV 2PZSA 2CTPA 2Y4UA 3WU2Z 2RNBA 5EC2C 1SA0A 4EB6B 4AILC 4UV9A 1OCOC 3ZRXA 3E89A 4PA6A 3ETEA 2DN9A 4QE7A 4O4HB 3QG5A 2Y4TA 1RP3B 4O4LA 5BY1A 2VRZA 4NB5A 1NH2D 3ABKB 3JAKB 3ETGA 4DV0O 2UXCB 5JJJB 1ZWIC 1MSDA 4B3SO 1MZEA 1SZXA 4YIOA 3W7UA 4JASA 3ZHQA 4X66O 2ITCC 3CCQV 1W0JG 1KUQA 3UO2A 4WFFA 4ZHQA 2XAHA 1AROP 2DYSB 3FAVA 2HLDG 1AP5A 1QR8A 5GONA 5CBGA 3LSSA 3OTFA 2PF4E 4JI1B 2YIAA 1GH6A 3CYOA 2UU9B 1SZTA 5IY5B 3LNMB 1B3QA 3WG7B 3OE7G 4RUEA 2A9HA 3JD2A 4TV8A 1G6UA 3B09A 5CN0A 3WB0A 1X4TA 2YXHA 1Y4MA 3E8HA 2QE7G 4IYHA 4NYKA 1S5JA 1Q3EA 2JIZG 2YIBD 3AG2C 2FMLA 3KKYA 1XNRB 2AHZA 4MVOA 2QR4A 2EX3A 3M99B 1NT2B 1Q6IA 3C3SA 2ARHA 1SQFA 1EM1A 4K0KO 1OCCB 3RBZA 3M7MX 2F66C 2ZNJA 1MNGA 3QO7A 4GKJB 4UV8A 2CTWA 4JAUA 1ZUQA 4MVRA 1XILA 2G38A 2EILC 1I5XA 3G6EV 3Q4HB 1N34O 3JAWA 2BSKB 1WLEA 4BW5A 4JAAA 4PA3A 4FZ0A 5CA0A 5LHHA 2P6JA 1JQ0A 1Y76B 3AG1B 4EB6A 4YY3B 2VQEO 4OPAA 4O4HA 1K97A 4DR4B 2ZR2A 3ZHVA 1SC5B 3F7YC 3T1YO 3J81N 3QF7A 3JAKA 1KC8W 1I94O 2HVJC 4UCSA 3UO3A 4CS4A 1G8MA 2LJ2A 3K58A 3SR2C 3FFQA 1QVFU 4PA4A 2DQ0A 1Q82W 5H9CA 4EFEA 1M9NA 1ZLZA 5DEDA 3BHPA 2L35A 2WLIA 4PDLA 4DR1B 1KKCA 4OGQB 2ZR3A 5JQGA 4N21A 5H6QA 3CB2A 5LMUO 2W0FC 5H2FZ 3SGIA 4I55B 3QTCA 2A3QA 2AZ2A 1QQCA 1WP8A 1U96A 4DV1B 2PTMA 5IYDO 1VF7A 2RCVA 2BE3A 5HFLA 4FLZA 2KG7B 1J5EO 3ZMSA 2PYJA 4JI0O 4BAYA 4ASUG 3CCVV 5LA6B 3EFFK 1WAZA 1PNMA 1IBLB 1R6NA 4R50A 3OW2U 4JTCB 1R6KA 5B1AB 1I0HA 3OT7A 1MABG 3C3TA 1I7FA 1XMOO 2ZDIA 3P32A 4MVZA 1HNZB 3CC2V 1IURA 5E1AC 4NXNB 1S5LZ 4FFKA 2BTOA 1AI7A 4PELA 1F23A 4K8ZA 2JEXA 3RVZA 2F95B 2JEUA 2P7TC 2EIKB 4WF9V 3LUTB 3ZBHA 3D36A 1EN5A 2BSKA 2Z5UA 3HKDB 2YXLA 1NH2B 2AZ0A 3E86A 1Y76A 3APOA 4DV2O 2Y0PA 3AG4C 4B3TO 4QGPA 4X1YB 5LHIA 2EJ7A 3ZMVA 1NTKH 4PI0A 1QR9A 2CGNA 5LP6C 3FB6C 1GMGA 3SJCC 5BR8O 4R7CA 2QGNA 5KHKA 2W0XA 1ENVA 2N04A 4X64O 4ZBMA 1YSCA 2GUZB 3MAQA 4ICGA 3WFVA 3CXHF 5B5EZ 4GZRB 4JI2O 3W7XA 1AJNA 4U3JB 1QBZA 2UUCB 4FLUA 3OGIB 3RT3C 1Y6XA 1NU1H 1SS3A 4DV5O 4DR3B 2A79B 3JSNA 1H8EG 1QHTA 4H33A 3VQYA 1FJGO 4I55A 1KB9F 1R3IC 1ORQC 5L3GA 4LCUC 4DV7B 2XAQA 2IJIA 3D3IA 3AG2B 1VF5B 1GM8A 5J9PC 1HNWO 1GO3F 2N74A 2KG7A 2CK3G 3B8NA 3I55V 3E22A 1AJQA 1Q86W 4JI7B 2QWPB 2JS5A 1BGYH 4DR5B 4FZ1A 2EIJC 2XOKG 3A0HZ 4UFZA 2BOCC 4CH3A 1YI2V 4LR3A 1YHQV 1V54C 3EHBB 5B1OA 5KAIZ 4D6TH 3G4SV 4MTOA 3AK2A 3S3WA 1AILA 5CB4B 3OMIB 3CRMA 4TOIA 4LF4B 4PDMA 1JJOA 2X6BA 4FPPA 2ZIOA 2GHYA 5IDJA 4MW3A 1RM1C 4QE9A 1VQMV 4JZ2A 1RFYA 2Y69C 3CWBH 1VF6A 3QO8A 1YJWV 1JPXA 3T1HB 4LWSB 2Q73A 1SF9A 2XASA 1GK9A 4ZKIA 1BHBA 5LMNB 1VQOV 3HKDA 1Y74B 2UUBB 1K5SA 2Q0OC 4JZGA 2WLNA 4X62O 3TJTA 2WA3A 4OX9B 4NXMB 1M93A 1COWG 2OTJV 2VWKA 2R9IA 1JVMA 4JTAB 4X65O 4X1YA 3L74H 2Q0AA 2VQFB 4CC6A 3D8CA 4X88A 4J9ZB 4FIPC 5JVDA 5IJ9B 4JI4B 1W0KG 2DMXA 3JALB 1UPGA 1HNXO 1S77D 2NLJC 4J41A 4IT5A 3BRCA 3ZRVA 4JPRA 1D5NA 2JGUA 4Z1VA 1JCHA 2GUZA 1Q90D 1P4RA 4KP4A 2HHHO 1F4MA 3L70H 1FXKC 4JYAO 4DW1A 3VOUA 4GKKB 4U3JA 4FM0A 2QEXV 2XHBA 1CP9A 1GN3A 2B5UA 3MD0A 4BIUA 4J42A 4DK1A 1J95A 1E79G 4FM1A 1VQNV 1BCCH 2FKXA 1UJWB 4WBNB 3ZMTA 1AJPA 1KBHA 5A2QN 3QVNA 1L0NH 4UUJC 2ZXWB 1KQSU 2P67A 3CCMV 3HKBB 1NR7A 1IXMA 5JCOC 3K5NA 4DR6O 2D3OW 4TV9B 1K92A 5BZBA 2NN4A 3DTUB 4IL6Z 2YXYA 3CP1A 4RWUA 5CB4A 3CRCA 3O65A 1JFFB 2CTRA 1N33B 4IIJB 4GUNA 2ADPA 2E5LB 3B8MA 1F51A 2RMKB 4LFAO 3ZHRA 1H2SB 1JX9A 4DV6B 3EVKA 1GM9A 1ZSPA 4PHZA 1M57C 5AG2A 2QDOA 5EK0A 1NKDA 1Q43A 1BZKA 3AG4B 4JI8B 3ASOC 1M5IA 3IJ4A 1YXBA 2V4DA 2KSDA 1K33A 4WFHA 3F7VC 2YC0A 2ZKOA 2R70A 3AEIA 2UXBO 2QM8A 1Y74A 2UXDO 4DV3B 4LF8O 1H2MA 1QLEC 4NTXA 1S72V 4P30A 5L3CA 3ZHSA 4CC5A 2JGDB 5JH7B 1RSOB 4J7ZA 5ITZB 2Z3YA 3OR6C 1M56B 4UVBA 1Z5WA 3JYCA 5IJ9A 3D3QA 5EIBD 4DR2O 1IDSA 2E74B 3JALA 3SJBC 1ZAUA 2HJFC 5EIBC 1IBKB 1VMGA 5FPOA 3ABMB 2CH7B 2GDSA 1NJIW 4RO2A 5FLXN 4JYCA 2KB1A 2Y48A 4QNHB 3CRAA 4XBFA 4O4JB 1BQ0A 3OEHG 1XI1A 1LUVA 2IW5A 4OXSA 2Q68A 1M90W 1FKAO 3PN1A 3SPGA 4K35A 4B3MB 1F4NA 3SYAA 4ZOLB 2JK5C 2IJHA 2UUAB 2OT5A 1V54B 1SRYA 3MHHC 4ZI7B 1SERA 1EZVH 1IXBA 2PYLA 3ML0A 3STZC 2ZM6B 4GX0A 3HKBA 4YIPA 2HJDA 5IWAO 1KD1W 1RM1B 1K3EA 5DECA 4TV9A 5B1BB 4FMTA 2H8PC 4PA7A 2Y69B 1H2LA 1KP3A 1BL8A 2UXCO 1JFFA 4KXRA 4FLTA 4BIZA 4LNUB 4IIJA 1XBLA 2WA4A 3RYHB 1YDXA 4TSFG 3H1LH 5KHGA 5FPRA 1V55C 3LSUA 4BWAA 3ZJZA 2Q67A 3SJQC 4DV0B 4F4LA 3OUSA 4MVUA 1RPRA 4B3SB 4WFGA 3ZMZA 3EXAA 4I50B 2OCHA 1AP6A 2YI8A 1FFTB 1OCZB 4LFCO 4JYBA 3OMAB 4X66B 1PNLA 2UU9O 3RW0A 1IX9A 2JRIA 3K04A 2JGDA 1RSOA 5ITZA 1SETA 1FXKB 3W7WA 4W4KA 1XOUA 3JD1A 1JJ2U 4UCRA 5BXZA 3ZN0A 3OAAG 4MVSA 3N2KB 2BTQB 4P9PA 3K0DA 1R3JC 2ETNA 3K79A 3ASNC 2AGAA 3GWOA 2CGOA 3RYCB 1L8DA 2WSSG 3A0RA 4O4JA 3SYPA 4QPKA 3QNEA 3X2QB 1AI5A 4NVPA 2MK3A 2X6CA 3CRQA 4DYLA 4LH6A 5A9GA 1EFRG 1Y67A 4XDKA 4P2ZA 2OCCC 5H5NA 3UKMA 4K8XA 1XL4A 3NR7A 4ZI7A 1THZA 4K0KB 2C2AA 1D5AA 4CH6A 4L87A 2CUGA 2YSUB 2EINB 4UVAA 4YY3O 4CS2A 1PP9H 2Q5ZA 1SKVA 5C93A 1N34B 1PPJH 1DLBA 2QWQB 1XMQB 3CPWU 4JV5B 4WFBV 5BMVB 4F6RB 2X7RB 3FB5C 1K7DA 4LNUA 2VQEB 1WPBA 1SQGA 2Q8VA 3RYHA 1OJHA 2ILMA 3K5MA 4UCOA 4DUZB 2AHYA 4J7KA 3E8FA 4DR1O 1YTFB 5EZYB 1FXHA 2ITDC 4B7KA 1BQZA 4G27B 3SDLA 1KKDA 1P49A 4I50A 4BR6A 4PDRA 4KL1A 1R6TA 2Q6AA 2XTAA 1K9MW 3FD9A 4HYOA 2ZQMA 2QWRB 3JATB 3E35A 3BABA 4E4EA 2QKAA 4LFBB 1CXZB 5LMUB 1OV9A 5L3EA 1IBLO 3CCLV 3CCEV 1X59A 1N36O 3TGUH 3FX7A 2ZT9B 3N2KA 2BTQA 3KCYA 1RPOA 1WB8A 3U11A 4B7EA 4DR7O 4RQEA 2GBOA 1J5EB 4KUMA 5EC1C 4JI0B 1FFXB 2R9RB 5IE9A 2YEVB 1XREA 4MS2A 3P3NA 2ZCEA 5LGNA 1EBOA 1XMOB 2GSMB 1OCOB 2W6IG 4QJFB 1GN2A 3ZRWB 4TUYB 3JAMN 1W59A 5LOVB 3U0ZA 3Q4HA 1H8HG 1L0LH 4X89A 3T2MA 4HAMA 3RVYA 2M7WA 3ZMUA 4O4IB 1TUBB 3K5LA 1XNQB 2WAMA 4R8CA 3TXSA 4Q6GA 5KAFZ 4YJ2B 5C8YB 2HP8A 4LF7O 1B04A 3IC9A 3LDCA 3HPLC 4JF3A 5GTHZ 4X1KB 1VQ6V 4LF9O 5KUMA 4JI3B 5KA6A 5BMVA 4DO2A 1KECA 1HR0O 4F6RA 4KHPO 3K08A 4DV2B 4DK0A 2P90A 1KMIZ 3THOA 4YHHO 2N05A 3JCZA 5F2VO 3CD6V 5H6RA 2LFSA 2UUCO 4DUYO 3AG7A 4I9QA 5EZYA 3L75H 5B1NA 4OPHA 1PD3A 5FL7G 1K4CC 1VEWA 3BY6A 1YVWA 2CAZC 2ZINA 3ASNB 4J11A 3JATA 1GKFA 1E1QG 2JJ1G 4DV5B 2WLKA 2XAFA 1P84F 4GCZA 4E2LA 5LA6A 1Q6UA 2AW9A 3CEIA 5B3SC 1Q81W 4JI5O 3BEHA 2HVKC 4DR5O 4J10A 3AK1A 4ZIBA 4EEQA 4YJ3B 4B3RB 4X9QA 5KLVH 2AXTZ 3OEEG 5IYZB 1YITV 1OCRC 2EILB 3I5DA 4CS3A 5K1XA 1FFXA 2ZNIA 4LF6O 2OCCB 3A2FA 3ZHUA 3ZIAG 4WFEA 4NKGB 1B6QA 1S0VA 5KHIA 1Q8IA 4NR1A 1DF5A 5GW7A 5E79Z 4HZ3A 1AI4A 3OM3B 3ZRWA 3PJSK 4X8AA 4TUYA 5LOVA 2GV9A 1XHZA 2EBOA 4I4TB 4O4IA 1IVSA 1K8AW 2ZD9A 2E3CA 3CSXA 3ABKC 4FFBB 4O2AB 4NXMO 3BA8A 3K57A 5JJEB 5C8YA 4YJ2A 2XAGA 1TA8A 4Z1MG 1VQ8V 3DXRB 3P30A 3OTOB 1MG1A 2Q7EA 2YICA 1V9PA 3FKSG 1BE3H 3T1CA 4MT8A 3JD0A 4JI4O 4X62B 2QTSA 2WLJA 2ZE8A 3K06A 1QU7A 1NI8A 2P5OA 1MMMA 1JR9A 2QM7A 3UT5B 4HNAB 4GKKO 2EJRA 4Q20A 3BVOA 1WP7A 4RUFA 4MW8A 4JI6O 1HNXB 1Q7YW 3ETQA 3RWRD 3CCUV 2RDCA 3CXCU 5L3DA 2D2CB 2CE4A 3ABTA 2HEPA 1AR1B 4I9WA 4B08A 2IM9A 2PI4A 1YIJV 1DK1A 4X20B 4AHCA 1O9GA 3RFRA 3TK1A 3J7AU 2RJZA 3AG3C 5GTIZ 3H1IH 3RGBA 4HBNA 1N0JA 2YIBA 3K9AA 4A5UB 1QNMA 1TVKB 3CJHB 1NR1A 3QO5A 4GX2A 4YJ3A 4H13B 2DQ3A 4R6ZA 5LXTB 1OCCC 3GVMA 5IYZA 4U3FH 1SA0B 1VQ5V 1N32O 3CMAV 1PM9A 4RAIA 2E5LO 1FD9A 2QWNB 4DV6O 3D36C 1HW7A 3BFRA 4W4LA 1P7BA 3ZS8C 2OTLV 4TT3G 2YS8A 2Q69A 3F5TA 4JI8O 1FAFA 5KHHA 4LWSA 1UFIA 4BIOA 3JASB 1HWYA 1H38A 1IBMO 2R9AA 3OGCC 3ETDA 4I4TA 5LP6B 1FYJA 1JA8A 1NTMH 4DV3O 2V1DA 1F7YA 2K9PA 1TGOA 2XNDG 4FFBA 4MSWC 4DW0A 4O2AA 1N4CA 4MTFA 1WA8B 2GTAA 4P9OA 3UCSC 3CE2A 3IC7A 2B1IA 4ZHQB 1AI6A 1EN4A 1A32A 1KU9A 4AQYO 2Q4PA 2UXBB 3F5WC 5GONB 3CC7V 2FTKA 3SJAC 3LDDA 2UXDB 2DJVA 3H1HH 4LF8B 4H37A 1YJ9V 1IBKO 2DW4A 1L1FA 4TV8B 4G2KA 1SESA 3OMNB 1AB3A 3GWKC 1VQ4V 2E75B 3UT5A 4HNAA 5J2TB 1QLNA 4LF5B 4DR2B 2OYQA 2XUMA 4FJCC 3CC4V 1Z5VA 3ZEDA 3ZRSA 2EIJB 3FYEB 5KMGB 1XUQA 2UUAO 4H0LB 3AK3A 5B66Z 4X20A 2QSAA 3U10A 2EZPA 2PGGA 4WBNA 1ZTEA 1R73A 2F4VB 4CH5A 3LDEA 1OCRB 4TQFA 4NTWA 1DGSA 4PA9A 4FLXA 1BHAA 4GLXA 2YIDA 1TVKA 3JD4A 4LC1A 4DV4B 3CJHA 4BW9A 1S5HC 4KFMA 5LXTA 5EBWC 1VF6C 1OHHG 1PL4A 5CA3A 2QA4V 3H1JH 2LP7A 2MW2B 5IWAB 4K3AA 2EIKC 2FL4A 2A0LA 2UXNA 3B4SA 4L8JA 5DN6G 3RYFB 1MOFA 5IJ0B 2OIGA 2OWOA 3JASA 4JAVA 3CMEV 3CCRV 4JGSA 3ABLC 5LP6A 1PNKA 1MZFA 5LL6Y 2PUSA 4U7NA 3WB1A 4JI1O 2WLIB 1FS0G 3KCXA 4XDJA 3G80A 5JQGB 1WA8A 1YCIA 2DYRC 1BMFG 1PL0A 5JH7A 4JTDB 4FM2A 3O9OA 3E8BA 2VWJA 3VBBA 2EZOA 4LFCB 1O9HA 2FB5A 1R3KC 4X1IB 3SPIA 4FVMA 2CH7A 2IJJA 3KZIZ 4PDVA 1XNRO 1BS3A 4MTGA 1XQ8A 1H2KA 1T5EA 2PY5A 2WLHA 4O2BB 5J2TA 2DWEC 1NZ6A 2K1EA 1ZL8B 4Z2WA 3AG3B 2WWWA 4FK5C 4GKJO 4GX1A 2HFEC 3H1KH 3G71V 4ZOLA 5KMGA 3TXQA 1GRJA 2LQTA 1BT8A 4J7JA 3CHXA 4G28B 2LGWA 3N2GB 3ZX6A 3W7TA 3B40A 4DR4O 3ZHTA 1XMQO 1M57B 3BPZA 4I7ZB 4JV5O 1H2GA 2B9ZA 1VQ7V 1M4UA 3IAYA 1LNQA 1XL6A 3ASOB 5KA5A 4IGGA 4UCTA 2IU0A 2QWOB 2H3OA 4QPJA 3T1YB 4DUZO 3ZN1A 1QLEB 1I94B 4D7SA 3LSQA 3RYFA 1KYOF 3JARB 3T4DA 4YXWG 3B77A 3E8GA 5TISZ 1VIBA 3G67A 5IJ0A 4U7OA 2QTOA 2LW7A 2BOBC 4MTXA 2LW1A 2VS0A 4UXNA 4DV1O 2F93B 3ICXA 1D2DA 1WJZA 4IHJB 1FXVA 5LHGA 1CPYA 1NTZH 5IYBO 4LFBO 1GTOA 1FXKA 1HDJA 2ZE7A 4FLWA 3S3XA 3VQWA 3L72H 4X1IA 1M1KW 3VQVA 2ZE5A 3KG2A 1HNZO 4AI8A 4FLYA 3E22B 3R66A 3RYCA 4NXNO 4O2BA 3FB7C 4MVMA 1N36B 1ZL8A 1US6A 1SQPH 5HFMA 3OR7C 4DR7B 1ROPA 3ZCCA 4I0XB 2ZXWC 1XHXA 2R72A 3RYIB 3K0GA 5LBQA 5JCOA 4QIWF 3SPHA 1XNQO 3K9SA 1ZX3A 2LO1A 1FPOA 2X6AA 3N2GA 3UQ8A 3BA9A 4TWKA 3STLC 1K4DC 3K3WA 4FLVA 3FB8C 1V55B 3CX5F 5L3FA 2P22C 2WPDG 2QJ1A 3SYQA 3W7SA 4UCVA 4JI3O 2HKOA 2F43G 5EBLC 1DF4A 4B3TB 3N27A 2JS3A 1WB7A 3MDSA 2YI9A 1YZBA 3NXSA 2HR3A 3K59A 3IFXA 4LF7B 5LYJB 3HKEB 3ABLB 2EIMC 1KP2A 3CS5A 5JVDB 1NBMG 4UCUA 5BR8B 1G4YB 4LF9B 5DM6V 5FNVB 5K1PA 1HR0B 4KHPB 4X64B 3JARA 2Y0IA 2DYRB 3H9VA 4DR3O 1W2BU 4YHHB 1YJNV 3E2EA 3J80N 4UVCA 2LFRA 1VQKV 1NVPD 3JSLA 2YDEA 4JI2B 4DV7O 3VQXA 3A8TA 1M56C 3MHSC 3FYIB 1AR4A 4PD4F 2Q7HA 4DUYB 3LNNA 4GX5A 1B06A 1I08A 1GN6A 1Z2GA 1AVMA 5JWPA 2H94A 4IHJA 2KQXA 3ABMC 4EFBA 4JI7O 4GT1A 5JJNB 1FJGB 2W6JG 1G1XB 4B3RO 5D5PA 2P06A 1S3JA 1N0NA 1WNSA 5IT9N 3CRRA 3IGAC 3UM7A 1HNWB 1YEWA 3L71H 4LF4O 2B1GA 3K5OA 3C90A 2DOSA 3JD3A 4JI5B 3HKCB 2YEVA 4LP8A 3P3PA 1MA1A 2NNUA 3BCCH 1VQ9V 1DTOA 3BAAA 4JYYA 2V7QG 2HG5C 2JJ2G 1Q5OA 2L6LA 2Q9LA 5EBMC 3T1HO 4I0XA 1GM7A 2PI5A 2O57A 3RYIA 4LF6B 5LMNO 3L73H 3R65A 1YF2A 4PI2A 2UUBO 1TUBA 3SPCA 3M8AA 1JMKC 4DRXB 1LUWA 4LBEC 1E1RG 5B1BC 4J80A 4OX9O 4F6EA 4C7UA 2WLLB 1N8RW 3L9DA 2XAJA 2VQFO 3OTOO 2Q7GA 2QKSA 5KX5B 3T4ZA 5LGUA 3OD4A 1PKXA 3APQA 1AR5A 1SQXH 5CMUA 4X1KA 4PV1B 2EULA 1IZ3A 3OFNG 5KHJA 4UB6Z 4X65B 1MSWD 4I5SA 4PJ0Z 2LGQA 5LYJA 3HKEA 2DYSC 4H44B 1XDCA 3E83A 1GAXA 1OCZC 5CA1B 4IYIA 1BSMA 2A06H 5L3BA 5FNVA 1WPXA 3WB2A 4DXWA 5IY5C 1CEZA 5EYPB 3JCUZ 4N23A 3WG7C 3CCSV 3I56V 1NQTA 2DE0X 2HHHB 2IU3A 5IYCO 4JYAB 2ADQB 4WCEV 3DGEA 4MVQA 2IH3C 2RN9A 2YUAA 3G6BA 4JI6B 2QM4A 3RN4A 2ATKC 2ZDIC 1JOYA 1HP8A 4LH7A 3SYOA 2UXXA 5J2UB 2X0LA 3SPJA 4EKWA 1TUEB 1K73W 1Y66A 1PV0A 3X2QC 2ODMA 4J9YB 1VARA 1N33O 1K5QA 4O4LB 5LGTA 3HKCA 1R1BA 3GB7C 4DR6B 3A0BZ 1EZJA 2JDIG 1I5YA 1VP7A 2XT9A 3B2EE 2RQ6A 2M6YA 1U97A 2BCCH 3TCUA 2FYUH 1N32B 2EINC 3AG1C 2CTQA 2IH1C 3DSQA 4GYCB 1GN4A 5KUKA 5D5QA 4LFAB 1K34A 2P4KA 3K03A 3DC5A 4ABMA 4DRXA 1XEQA 2WLLA 2E76B 1SQVH 3DXRA 2F1MA 5CBFA 5KX5A 3FAVB 2EIMB 1IBMB 2JVDA 1QCEA 1NS1A 2ZIMA 1YTFD 1LR1A 4CBCA 2KKWA 3TETA 4D7TA 1QVGU 4CZZA 3CCJV 2QKCA 1VQLV 1NVPB 4RQFA 4AQYB 3OUFA 4LF5O 1H2NA 2ZE6A 2A7WA 2Z0AA 5CA1A 1Q6HA 2P4VA 1SQBH 4B3MO 5EYPA 2GTSA 5B3SB 4TQDA 3DC6A 2WLMA 2NR5A 3HR0A 3HB3B
chains in the Genus database with same CATH topology
1VQ6V 3W7TA 1P4RA 5KUMA 4KP4A 5B1AC 5KA6A 1F4MA 1OZ0A 1R3LC 1FXKC 1KECA 4DO2A 3VOUA 3K08A 3ABUA 1M57B 2P90A 3SYCA 1H2GA 2QEXV 1VQPV 1CP9A 2B5UA 3MD0A 4BIUA 1VQ7V 3JCZA 1LNQA 1XL6A 4XDLA 1J95A 3ASOB 5KA5A 1S76D 1E79G 3CD6V 5H6RA 2DWDC 2LFSA 2IJKA 5CBHA 2IU0A 3H01A 4WFAV 5EC2C 5B1NA 1VQNV 4QPJA 1UJWB 4UV9A 1OCOC 3ZRXA 3E89A 3ZN1A 4PA6A 1QLEB 3ETEA 1PD3A 4QE7A 3ZMTA 1AJPA 5FL7G 1K4CC 3LSQA 3T4DA 4UUJC 3BY6A 2ZXWB 4YXWG 3B77A 3E8GA 1KQSU 2P67A 1NH2D 3CCMV 4U7OA 2QTOA 3ABKB 2BOBC 1NR7A 4MTXA 3ASNB 3ETGA 1IXMA 1GKFA 1E1QG 2D3OW 4UXNA 2JJ1G 1K92A 5BZBA 2WLKA 1ZWIC 2XAFA 3DTUB 4GCZA 4E2LA 1Q81W 5B3SC 3CP1A 3BEHA 2HVKC 1FXVA 5LHGA 1CPYA 5IYBO 3B8MA 1GTOA 3W7UA 1FXKA 4JASA 2ITCC 1F51A 3CCQV 3OEEG 1YITV 1W0JG 1JX9A 1OCRC 2EILB 1GM9A 1M57C 4WFFA 2XAHA 5EK0A 1M1KW 1AROP 1NKDA 2DYSB 2OCCB 3AG4B 2HLDG 3ZIAG 1QR8A 3KG2A 3ASOC 5CBGA 3LSSA 4WFEA 1B6QA 1S0VA 1K33A 4WFHA 3CYOA 1DF5A 3F7VC 5GW7A 1SZTA 5IY5B 3FB7C 3LNMB 3AEIA 4MVMA 4HZ3A 1AI4A 2QM8A 3OM3B 3PJSK 4X8AA 3WG7B 3OE7G 4RUEA 3ZRWA 2A9HA 3JD2A 5HFMA 1QLEC 5CN0A 3OR7C 1S72V 1Y4MA 2EBOA 3E8HA 4P30A 2QE7G 5L3CA 1ROPA 3ZCCA 2JIZG 2ZXWC 1K8AW 2ZD9A 2Z3YA 3K0GA 5LBQA 3OR6C 3AG2C 3ABKC 4QIWF 1M56B 4UVBA 3JYCA 2XAGA 2AHZA 3SPHA 4Z1MG 4MVOA 1VQ8V 3M99B 3P30A 1MG1A 2HJFC 3FKSG 3T1CA 2X6AA 4MT8A 1NJIW 3ABMB 3JD0A 4RO2A 4TWKA 1OCCB 4JYCA 1K4DC 2KB1A 3K3WA 3RBZA 2WLJA 3STLC 2Y48A 3K06A 4QNHB 3FB8C 4XBFA 3QO7A 3OEHG 1V55B 4UV8A 5L3FA 2WPDG 4JAUA 2IW5A 3SYQA 4MVRA 3W7SA 4OXSA 2Q68A 1M90W 2EILC 1I5XA 3G6EV 2QM7A 2HKOA 2F43G 3SPGA 2EJRA 4Q20A 1DF4A 1WLEA 5EBLC 4BW5A 4PA3A 4RUFA 4MW8A 1F4NA 3SYAA 3NXSA 2HR3A 5LHHA 2P6JA 1Q7YW 3IFXA 1JQ0A 2JK5C 3CCUV 2IJHA 3ABLB 3CXCU 2OT5A 3AG1B 2EIMC 5L3DA 1KP2A 3ABTA 1V54B 1SRYA 3MHHC 1NBMG 1G4YB 1AR1B 4I9WA 1K97A 1SERA 5DM6V 2ZR2A 2PI4A 1YIJV 3ML0A 3STZC 3F7YC 2DYRB 3TK1A 1W2BU 3AG3C 4GX0A 1YJNV 1KC8W 3E2EA 4UVCA 2LFRA 2HVJC 1VQKV 1NVPD 1KD1W 3K9AA 1RM1B 1K3EA 1G8MA 1M56C 3MHSC 5B1BB 3FYIB 2H8PC 4FMTA 2Y69B 4PA7A 1QVFU 4PA4A 1KP3A 4GX5A 1BL8A 2DQ0A 1Q82W 5H9CA 1M9NA 1NR1A 2H94A 3QO5A 4GX2A 4BIZA 3ABMC 2WLIA 4GT1A 2DQ3A 4PDLA 4R6ZA 4TSFG 1OCCC 2W6JG 2ZR3A 1VQ5V 4N21A 3CMAV 5H6QA 1V55C 4RAIA 3ZJZA 2W0FC 2Q67A 1S3JA 3SJQC 3IGAC 3UM7A 4F4LA 2B1GA 3OUSA 4MVUA 3JD3A 1P7BA 1RPRA 2OTLV 4TT3G 4WFGA 5IYDO 3ZMZA 2YEVA 4LP8A 5HFLA 2Q69A 1FFTB 3ZMSA 1OCZB 4BAYA 2NNUA 1VQ9V 1DTOA 1HWYA 1H38A 4ASUG 3CCVV 3EFFK 2V7QG 1PNMA 4JYBA 2HG5C 3OMAB 1R6NA 1PNLA 2JJ2G 3OGCC 5EBMC 3RW0A 3ETDA 4R50A 3OW2U 4JTCB 1R6KA 3K04A 5B1AB 1GM7A 2V1DA 1MABG 1SETA 1FXKB 2PI5A 3W7WA 2XNDG 2ZDIA 3P32A 3R65A 4MSWC 4MTFA 4MVZA 3JD1A 1JJ2U 4P9OA 3ZN0A 3SPCA 3OAAG 3IC7A 2B1IA 4MVSA 1AI6A 4LBEC 1E1RG 5B1BC 4P9PA 3CC2V 5E1AC 3K0DA 1R3JC 2WLLB 3K79A 3ASNC 3F5WC 3CC7V 1N8RW 2FTKA 3GWOA 3LDDA 2XAJA 1AI7A 2QKSA 4H37A 1F23A 2WSSG 3A0RA 4PELA 3T4ZA 5LGUA 1YJ9V 2DW4A 3SYPA 2JEXA 3RVZA 4QPKA 1PKXA 3QNEA 3X2QB 5CMUA 1AI5A 2MK3A 1L1FA 4G2KA 1SESA 2JEUA 3OMNB 2X6CA 1VQ4V 2P7TC 2EIKB 4WF9V 3LUTB 3D36A 1QLNA 1EFRG 2Z5UA 3OFNG 1MSWD 4I5SA 1NH2B 3E86A 4XDKA 4P2ZA 2DYSC 2OCCC 4FJCC 3AG4C 3CC4V 3UKMA 3ZRSA 5LHIA 3E83A 1XL4A 3ZMVA 1OCZC 1THZA 2C2AA 2EIJB 3FYEB 5L3BA 4L87A 1WPXA 2YSUB 1QR9A 2EINB 4UVAA 4DXWA 2EZPA 5IY5C 1CEZA 1R73A 3FB6C 1GMGA 4N23A 4R7CA 3WG7C 3LDEA 3I56V 1NQTA 1ENVA 5C93A 3CCSV 1OCRB 2IU3A 5IYCO 1DLBA 4ZBMA 4PA9A 3DGEA 4WCEV 4MVQA 3CPWU 1YSCA 2IH3C 4WFBV 1BHAA 3WFVA 3JD4A 4LC1A 2ATKC 3W7XA 1AJNA 2X7RB 2ZDIC 3FB5C 1JOYA 1QBZA 1S5HC 1K7DA 3SYOA 2UXXA 4KFMA 2X0LA 3SPJA 4EKWA 1TUEB 5EBWC 1K73W 1OHHG 1Y66A 5CA3A 2QA4V 3X2QC 2AHYA 2LP7A 2A79B 4J9YB 1H8EG 3E8FA 4H33A 1YTFB 1R3IC 1FXHA 1ORQC 5L3GA 2ITDC 1K5QA 2EIKC 4LCUC 2A0LA 4G27B 2XAQA 2IJIA 2UXNA 3D3IA 3AG2B 5LGTA 5DN6G 1KKDA 1GM8A 5J9PC 1GO3F 3GB7C 4PDRA 2CK3G 1EZJA 1MOFA 2JDIG 1I5YA 3B8NA 3I55V 2Q6AA 1K9MW 4JAVA 1AJQA 4HYOA 1Q86W 3TCUA 3CMEV 2ZQMA 3CCRV 2EIJC 4JGSA 2XOKG 3ABLC 1PNKA 3E35A 2EINC 3AG1C 2BOCC 2IH1C 4U7NA 1YI2V 1YHQV 1V54C 3EHBB 5B1OA 3G4SV 2WLIB 4MTOA 1FS0G 5L3EA 5KUKA 3CCLV 3CCEV 1K34A 4XDJA 3OMIB 3K03A 2DYRC 1BMFG 4PDMA 1PL0A 4JTDB 2X6BA 3E8BA 1RPOA 4FPPA 2WLLA 4RQEA 2GHYA 5IDJA 4MW3A 1RM1C 3VBBA 4KUMA 5EC1C 2EZOA 4QE9A 1VQMV 1R3KC 2R9RB 5CBFA 2Y69C 2EIMB 3QO8A 2YEVB 3SPIA 1YJWV 1QCEA 2IJJA 1JPXA 4PDVA 4MTGA 4MS2A 1YTFD 2XASA 2WLHA 1GK9A 4CBCA 4ZKIA 2DWEC 1EBOA 5LGNA 1BHBA 2GSMB 1OCOB 2W6IG 2K1EA 1VQOV 4QJFB 3ZRWB 3TETA 3AG3B 1K5SA 2WLNA 1QVGU 4CZZA 3CCJV 2WWWA 1VQLV 1H8HG 4FK5C 1NVPB 4X89A 3T2MA 4RQFA 4HAMA 3RVYA 1COWG 2M7WA 3ZMUA 2R9IA 1JVMA 3OUFA 4JTAB 4GX1A 2OTJV 2HFEC 3G71V 2WAMA 4R8CA 4X88A 4J9ZB 4FIPC 5B3SB 1W0KG 1S77D 2NLJC 3LDCA 4G28B 3HPLC 4JF3A 4JPRA 3ZRVA 2WLMA 1JCHA 3HB3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV A;  4LP8 A;  3K0G A;  3OR6 C;  3AG2 C;  3ABK C;  5KUM A;  5B1A C;  2Q69 A;  2AHY A;  3X2Q C;  2A79 B;  4J9Y B;  1R3L C;  3E8F A;  4H33 A;  3VOU A;  3K08 A;  3JYC A;  1R3I C;  2AHZ A;  1ORQ C;  3EFF K;  3SPH A;  4MVO A;  2HG5 C;  2ITD C;  3SYC A;  2EIK C;  3OGC C;  4LCU C;  5EBM C;  3RW0 A;  2HJF C;  4R50 A;  2A0L A;  4G27 B;  1LNQ A;  4JTC B;  3T1C A;  1XL6 A;  2X6A A;  3K04 A;  4XDL A;  4RO2 A;  1J95 A;  4TWK A;  1KKD A;  5J9P C;  2DWD C;  3STL C;  1K4D C;  2KB1 A;  3GB7 C;  4PDR A;  2WLJ A;  4MSW C;  3R65 A;  3K06 A;  3RBZ A;  4QNH B;  3FB8 C;  4MTF A;  4MVZ A;  2Q6A A;  4P9O A;  3SPC A;  4HYO A;  5EC2 C;  4MVS A;  3SYQ A;  4MVR A;  3TCU A;  4OXS A;  2Q68 A;  4LBE C;  2EIL C;  5B1B C;  2EIJ C;  1OCO C;  4P9P A;  5E1A C;  3ABL C;  3E89 A;  3K0D A;  4PA6 A;  1R3J C;  2EIN C;  2WLL B;  3AG1 C;  4QE7 A;  3ASN C;  2BOC C;  2IH1 C;  3F5W C;  3SPG A;  1V54 C;  1K4C C;  5EBL C;  2WLI B;  4MTO A;  4BW5 A;  3LDD A;  5KUK A;  4PA3 A;  4RUF A;  4MW8 A;  3SYA A;  2QKS A;  3T4D A;  4H37 A;  4UUJ C;  4XDJ A;  3T4Z A;  3E8G A;  3SYP A;  3IFX A;  2JK5 C;  3RVZ A;  2QTO A;  3K03 A;  2BOB C;  2DYR C;  4PDM A;  2EIM C;  4JTD B;  2X6B A;  3E8B A;  2X6C A;  1G4Y B;  2P7T C;  2WLL A;  4I9W A;  5BZB A;  2WLK A;  3LUT B;  4MW3 A;  1ZWI C;  5EC1 C;  4QE9 A;  5B3S C;  1R3K C;  2R9R B;  2HVK C;  3BEH A;  3F7Y C;  3STZ C;  5CBF A;  2Y69 C;  3E86 A;  4XDK A;  3SPI A;  3AG3 C;  4GX0 A;  4P2Z A;  2DYS C;  2HVJ C;  2OCC C;  4PDV A;  3AG4 C;  3UKM A;  4MTG A;  4MS2 A;  2ITC C;  3ZRS A;  3E83 A;  2WLH A;  4WFG A;  1XL4 A;  1OCZ C;  1M56 C;  4CBC A;  1OCR C;  2DWE C;  2H8P C;  4PA7 A;  2K1E A;  4PA4 A;  1M57 C;  3TET A;  4GX5 A;  4WFF A;  1BL8 A;  5EK0 A;  2WLN A;  4DXW A;  5IY5 C;  3FB6 C;  4GX2 A;  3WG7 C;  4R7C A;  3ABM C;  3KG2 A;  3LDE A;  4X89 A;  3ASO C;  3T2M A;  5CBG A;  3RVY A;  4WFE A;  2WLI A;  3OUF A;  1JVM A;  4JTA B;  4PDL A;  1OCC C;  4GX1 A;  4R6Z A;  2HFE C;  4ZBM A;  4PA9 A;  4MVQ A;  2IH3 C;  4WFH A;  3F7V C;  1V55 C;  3FB7 C;  4R8C A;  3LNM B;  4MVM A;  4X88 A;  4HZ3 A;  4RAI A;  3PJS K;  4X8A A;  4RUE A;  4J9Z B;  2A9H A;  3ZJZ A;  2W0F C;  2ATK C;  2Q67 A;  3FB5 C;  3SJQ C;  1QLE C;  1S5H C;  3IGA C;  3UM7 A;  4F4L A;  3SYO A;  2NLJ C;  4KFM A;  3OR7 C;  3LDC A;  3E8H A;  3OUS A;  4G28 B;  4P30 A;  3HPL C;  4MVU A;  3SPJ A;  5CBH A;  4EKW A;  2WLM A;  1P7B A;  5EBW C;  2ZXW C;  2ZD9 A; 
#chains in the Genus database with same CATH topology
 2F4V O;  5B1A C;  1OZ0 A;  4NTY A;  1R3L C;  1TAE A;  1WN7 A;  3ABU A;  2ZM6 O;  4UB8 Z;  1URF A;  3SYC A;  1VQP V;  2OIE A;  2F23 A;  5J2U A;  2IBZ H;  4DV4 O;  3JAW B;  4XDL A;  4CH4 A;  1SQQ H;  1S76 D;  2DWD C;  2CDY A;  2IJK A;  5CBH A;  1P7G A;  1EN6 A;  5CA0 B;  3H01 A;  4WFA V;  2PZS A;  2CTP A;  2Y4U A;  3WU2 Z;  2RNB A;  5EC2 C;  1SA0 A;  4EB6 B;  4AIL C;  4UV9 A;  1OCO C;  3ZRX A;  3E89 A;  4PA6 A;  3ETE A;  2DN9 A;  4QE7 A;  4O4H B;  3QG5 A;  2Y4T A;  1RP3 B;  4O4L A;  5BY1 A;  2VRZ A;  4NB5 A;  1NH2 D;  3ABK B;  3JAK B;  3ETG A;  4DV0 O;  2UXC B;  5JJJ B;  1ZWI C;  1MSD A;  4B3S O;  1MZE A;  1SZX A;  4YIO A;  3W7U A;  4JAS A;  3ZHQ A;  4X66 O;  2ITC C;  3CCQ V;  1W0J G;  1KUQ A;  3UO2 A;  4WFF A;  4ZHQ A;  2XAH A;  1ARO P;  2DYS B;  3FAV A;  2HLD G;  1AP5 A;  1QR8 A;  5GON A;  5CBG A;  3LSS A;  3OTF A;  2PF4 E;  4JI1 B;  2YIA A;  1GH6 A;  3CYO A;  2UU9 B;  1SZT A;  5IY5 B;  3LNM B;  1B3Q A;  3WG7 B;  3OE7 G;  4RUE A;  2A9H A;  3JD2 A;  4TV8 A;  1G6U A;  3B09 A;  5CN0 A;  3WB0 A;  1X4T A;  2YXH A;  1Y4M A;  3E8H A;  2QE7 G;  4IYH A;  4NYK A;  1S5J A;  1Q3E A;  2JIZ G;  2YIB D;  3AG2 C;  2FML A;  3KKY A;  1XNR B;  2AHZ A;  4MVO A;  2QR4 A;  2EX3 A;  3M99 B;  1NT2 B;  1Q6I A;  3C3S A;  2ARH A;  1SQF A;  1EM1 A;  4K0K O;  1OCC B;  3RBZ A;  3M7M X;  2F66 C;  2ZNJ A;  1MNG A;  3QO7 A;  4GKJ B;  4UV8 A;  2CTW A;  4JAU A;  1ZUQ A;  4MVR A;  1XIL A;  2G38 A;  2EIL C;  1I5X A;  3G6E V;  3Q4H B;  1N34 O;  3JAW A;  2BSK B;  1WLE A;  4BW5 A;  4JAA A;  4PA3 A;  4FZ0 A;  5CA0 A;  5LHH A;  2P6J A;  1JQ0 A;  1Y76 B;  3AG1 B;  4EB6 A;  4YY3 B;  2VQE O;  4OPA A;  4O4H A;  1K97 A;  4DR4 B;  2ZR2 A;  3ZHV A;  1SC5 B;  3F7Y C;  3T1Y O;  3J81 N;  3QF7 A;  3JAK A;  1KC8 W;  1I94 O;  2HVJ C;  4UCS A;  3UO3 A;  4CS4 A;  1G8M A;  2LJ2 A;  3K58 A;  3SR2 C;  3FFQ A;  1QVF U;  4PA4 A;  2DQ0 A;  1Q82 W;  5H9C A;  4EFE A;  1M9N A;  1ZLZ A;  5DED A;  3BHP A;  2L35 A;  2WLI A;  4PDL A;  4DR1 B;  1KKC A;  4OGQ B;  2ZR3 A;  5JQG A;  4N21 A;  5H6Q A;  3CB2 A;  5LMU O;  2W0F C;  5H2F Z;  3SGI A;  4I55 B;  3QTC A;  2A3Q A;  2AZ2 A;  1QQC A;  1WP8 A;  1U96 A;  4DV1 B;  2PTM A;  5IYD O;  1VF7 A;  2RCV A;  2BE3 A;  5HFL A;  4FLZ A;  2KG7 B;  1J5E O;  3ZMS A;  2PYJ A;  4JI0 O;  4BAY A;  4ASU G;  3CCV V;  5LA6 B;  3EFF K;  1WAZ A;  1PNM A;  1IBL B;  1R6N A;  4R50 A;  3OW2 U;  4JTC B;  1R6K A;  5B1A B;  1I0H A;  3OT7 A;  1MAB G;  3C3T A;  1I7F A;  1XMO O;  2ZDI A;  3P32 A;  4MVZ A;  1HNZ B;  3CC2 V;  1IUR A;  5E1A C;  4NXN B;  1S5L Z;  4FFK A;  2BTO A;  1AI7 A;  4PEL A;  1F23 A;  4K8Z A;  2JEX A;  3RVZ A;  2F95 B;  2JEU A;  2P7T C;  2EIK B;  4WF9 V;  3LUT B;  3ZBH A;  3D36 A;  1EN5 A;  2BSK A;  2Z5U A;  3HKD B;  2YXL A;  1NH2 B;  2AZ0 A;  3E86 A;  1Y76 A;  3APO A;  4DV2 O;  2Y0P A;  3AG4 C;  4B3T O;  4QGP A;  4X1Y B;  5LHI A;  2EJ7 A;  3ZMV A;  1NTK H;  4PI0 A;  1QR9 A;  2CGN A;  5LP6 C;  3FB6 C;  1GMG A;  3SJC C;  5BR8 O;  4R7C A;  2QGN A;  5KHK A;  2W0X A;  1ENV A;  2N04 A;  4X64 O;  4ZBM A;  1YSC A;  2GUZ B;  3MAQ A;  4ICG A;  3WFV A;  3CXH F;  5B5E Z;  4GZR B;  4JI2 O;  3W7X A;  1AJN A;  4U3J B;  1QBZ A;  2UUC B;  4FLU A;  3OGI B;  3RT3 C;  1Y6X A;  1NU1 H;  1SS3 A;  4DV5 O;  4DR3 B;  2A79 B;  3JSN A;  1H8E G;  1QHT A;  4H33 A;  3VQY A;  1FJG O;  4I55 A;  1KB9 F;  1R3I C;  1ORQ C;  5L3G A;  4LCU C;  4DV7 B;  2XAQ A;  2IJI A;  3D3I A;  3AG2 B;  1VF5 B;  1GM8 A;  5J9P C;  1HNW O;  1GO3 F;  2N74 A;  2KG7 A;  2CK3 G;  3B8N A;  3I55 V;  3E22 A;  1AJQ A;  1Q86 W;  4JI7 B;  2QWP B;  2JS5 A;  1BGY H;  4DR5 B;  4FZ1 A;  2EIJ C;  2XOK G;  3A0H Z;  4UFZ A;  2BOC C;  4CH3 A;  1YI2 V;  4LR3 A;  1YHQ V;  1V54 C;  3EHB B;  5B1O A;  5KAI Z;  4D6T H;  3G4S V;  4MTO A;  3AK2 A;  3S3W A;  1AIL A;  5CB4 B;  3OMI B;  3CRM A;  4TOI A;  4LF4 B;  4PDM A;  1JJO A;  2X6B A;  4FPP A;  2ZIO A;  2GHY A;  5IDJ A;  4MW3 A;  1RM1 C;  4QE9 A;  1VQM V;  4JZ2 A;  1RFY A;  2Y69 C;  3CWB H;  1VF6 A;  3QO8 A;  1YJW V;  1JPX A;  3T1H B;  4LWS B;  2Q73 A;  1SF9 A;  2XAS A;  1GK9 A;  4ZKI A;  1BHB A;  5LMN B;  1VQO V;  3HKD A;  1Y74 B;  2UUB B;  1K5S A;  2Q0O C;  4JZG A;  2WLN A;  4X62 O;  3TJT A;  2WA3 A;  4OX9 B;  4NXM B;  1M93 A;  1COW G;  2OTJ V;  2VWK A;  2R9I A;  1JVM A;  4JTA B;  4X65 O;  4X1Y A;  3L74 H;  2Q0A A;  2VQF B;  4CC6 A;  3D8C A;  4X88 A;  4J9Z B;  4FIP C;  5JVD A;  5IJ9 B;  4JI4 B;  1W0K G;  2DMX A;  3JAL B;  1UPG A;  1HNX O;  1S77 D;  2NLJ C;  4J41 A;  4IT5 A;  3BRC A;  3ZRV A;  4JPR A;  1D5N A;  2JGU A;  4Z1V A;  1JCH A;  2GUZ A;  1Q90 D;  1P4R A;  4KP4 A;  2HHH O;  1F4M A;  3L70 H;  1FXK C;  4JYA O;  4DW1 A;  3VOU A;  4GKK B;  4U3J A;  4FM0 A;  2QEX V;  2XHB A;  1CP9 A;  1GN3 A;  2B5U A;  3MD0 A;  4BIU A;  4J42 A;  4DK1 A;  1J95 A;  1E79 G;  4FM1 A;  1VQN V;  1BCC H;  2FKX A;  1UJW B;  4WBN B;  3ZMT A;  1AJP A;  1KBH A;  5A2Q N;  3QVN A;  1L0N H;  4UUJ C;  2ZXW B;  1KQS U;  2P67 A;  3CCM V;  3HKB B;  1NR7 A;  1IXM A;  5JCO C;  3K5N A;  4DR6 O;  2D3O W;  4TV9 B;  1K92 A;  5BZB A;  2NN4 A;  3DTU B;  4IL6 Z;  2YXY A;  3CP1 A;  4RWU A;  5CB4 A;  3CRC A;  3O65 A;  1JFF B;  2CTR A;  1N33 B;  4IIJ B;  4GUN A;  2ADP A;  2E5L B;  3B8M A;  1F51 A;  2RMK B;  4LFA O;  3ZHR A;  1H2S B;  1JX9 A;  4DV6 B;  3EVK A;  1GM9 A;  1ZSP A;  4PHZ A;  1M57 C;  5AG2 A;  2QDO A;  5EK0 A;  1NKD A;  1Q43 A;  1BZK A;  3AG4 B;  4JI8 B;  3ASO C;  1M5I A;  3IJ4 A;  1YXB A;  2V4D A;  2KSD A;  1K33 A;  4WFH A;  3F7V C;  2YC0 A;  2ZKO A;  2R70 A;  3AEI A;  2UXB O;  2QM8 A;  1Y74 A;  2UXD O;  4DV3 B;  4LF8 O;  1H2M A;  1QLE C;  4NTX A;  1S72 V;  4P30 A;  5L3C A;  3ZHS A;  4CC5 A;  2JGD B;  5JH7 B;  1RSO B;  4J7Z A;  5ITZ B;  2Z3Y A;  3OR6 C;  1M56 B;  4UVB A;  1Z5W A;  3JYC A;  5IJ9 A;  3D3Q A;  5EIB D;  4DR2 O;  1IDS A;  2E74 B;  3JAL A;  3SJB C;  1ZAU A;  2HJF C;  5EIB C;  1IBK B;  1VMG A;  5FPO A;  3ABM B;  2CH7 B;  2GDS A;  1NJI W;  4RO2 A;  5FLX N;  4JYC A;  2KB1 A;  2Y48 A;  4QNH B;  3CRA A;  4XBF A;  4O4J B;  1BQ0 A;  3OEH G;  1XI1 A;  1LUV A;  2IW5 A;  4OXS A;  2Q68 A;  1M90 W;  1FKA O;  3PN1 A;  3SPG A;  4K35 A;  4B3M B;  1F4N A;  3SYA A;  4ZOL B;  2JK5 C;  2IJH A;  2UUA B;  2OT5 A;  1V54 B;  1SRY A;  3MHH C;  4ZI7 B;  1SER A;  1EZV H;  1IXB A;  2PYL A;  3ML0 A;  3STZ C;  2ZM6 B;  4GX0 A;  3HKB A;  4YIP A;  2HJD A;  5IWA O;  1KD1 W;  1RM1 B;  1K3E A;  5DEC A;  4TV9 A;  5B1B B;  4FMT A;  2H8P C;  4PA7 A;  2Y69 B;  1H2L A;  1KP3 A;  1BL8 A;  2UXC O;  1JFF A;  4KXR A;  4FLT A;  4BIZ A;  4LNU B;  4IIJ A;  1XBL A;  2WA4 A;  3RYH B;  1YDX A;  4TSF G;  3H1L H;  5KHG A;  5FPR A;  1V55 C;  3LSU A;  4BWA A;  3ZJZ A;  2Q67 A;  3SJQ C;  4DV0 B;  4F4L A;  3OUS A;  4MVU A;  1RPR A;  4B3S B;  4WFG A;  3ZMZ A;  3EXA A;  4I50 B;  2OCH A;  1AP6 A;  2YI8 A;  1FFT B;  1OCZ B;  4LFC O;  4JYB A;  3OMA B;  4X66 B;  1PNL A;  2UU9 O;  3RW0 A;  1IX9 A;  2JRI A;  3K04 A;  2JGD A;  1RSO A;  5ITZ A;  1SET A;  1FXK B;  3W7W A;  4W4K A;  1XOU A;  3JD1 A;  1JJ2 U;  4UCR A;  5BXZ A;  3ZN0 A;  3OAA G;  4MVS A;  3N2K B;  2BTQ B;  4P9P A;  3K0D A;  1R3J C;  2ETN A;  3K79 A;  3ASN C;  2AGA A;  3GWO A;  2CGO A;  3RYC B;  1L8D A;  2WSS G;  3A0R A;  4O4J A;  3SYP A;  4QPK A;  3QNE A;  3X2Q B;  1AI5 A;  4NVP A;  2MK3 A;  2X6C A;  3CRQ A;  4DYL A;  4LH6 A;  5A9G A;  1EFR G;  1Y67 A;  4XDK A;  4P2Z A;  2OCC C;  5H5N A;  3UKM A;  4K8X A;  1XL4 A;  3NR7 A;  4ZI7 A;  1THZ A;  4K0K B;  2C2A A;  1D5A A;  4CH6 A;  4L87 A;  2CUG A;  2YSU B;  2EIN B;  4UVA A;  4YY3 O;  4CS2 A;  1PP9 H;  2Q5Z A;  1SKV A;  5C93 A;  1N34 B;  1PPJ H;  1DLB A;  2QWQ B;  1XMQ B;  3CPW U;  4JV5 B;  4WFB V;  5BMV B;  4F6R B;  2X7R B;  3FB5 C;  1K7D A;  4LNU A;  2VQE B;  1WPB A;  1SQG A;  2Q8V A;  3RYH A;  1OJH A;  2ILM A;  3K5M A;  4UCO A;  4DUZ B;  2AHY A;  4J7K A;  3E8F A;  4DR1 O;  1YTF B;  5EZY B;  1FXH A;  2ITD C;  4B7K A;  1BQZ A;  4G27 B;  3SDL A;  1KKD A;  1P49 A;  4I50 A;  4BR6 A;  4PDR A;  4KL1 A;  1R6T A;  2Q6A A;  2XTA A;  1K9M W;  3FD9 A;  4HYO A;  2ZQM A;  2QWR B;  3JAT B;  3E35 A;  3BAB A;  4E4E A;  2QKA A;  4LFB B;  1CXZ B;  5LMU B;  1OV9 A;  5L3E A;  1IBL O;  3CCL V;  3CCE V;  1X59 A;  1N36 O;  3TGU H;  3FX7 A;  2ZT9 B;  3N2K A;  2BTQ A;  3KCY A;  1RPO A;  1WB8 A;  3U11 A;  4B7E A;  4DR7 O;  4RQE A;  2GBO A;  1J5E B;  4KUM A;  5EC1 C;  4JI0 B;  1FFX B;  2R9R B;  5IE9 A;  2YEV B;  1XRE A;  4MS2 A;  3P3N A;  2ZCE A;  5LGN A;  1EBO A;  1XMO B;  2GSM B;  1OCO B;  2W6I G;  4QJF B;  1GN2 A;  3ZRW B;  4TUY B;  3JAM N;  1W59 A;  5LOV B;  3U0Z A;  3Q4H A;  1H8H G;  1L0L H;  4X89 A;  3T2M A;  4HAM A;  3RVY A;  2M7W A;  3ZMU A;  4O4I B;  1TUB B;  3K5L A;  1XNQ B;  2WAM A;  4R8C A;  3TXS A;  4Q6G A;  5KAF Z;  4YJ2 B;  5C8Y B;  2HP8 A;  4LF7 O;  1B04 A;  3IC9 A;  3LDC A;  3HPL C;  4JF3 A;  5GTH Z;  4X1K B;  1VQ6 V;  4LF9 O;  5KUM A;  4JI3 B;  5KA6 A;  5BMV A;  4DO2 A;  1KEC A;  1HR0 O;  4F6R A;  4KHP O;  3K08 A;  4DV2 B;  4DK0 A;  2P90 A;  1KMI Z;  3THO A;  4YHH O;  2N05 A;  3JCZ A;  5F2V O;  3CD6 V;  5H6R A;  2LFS A;  2UUC O;  4DUY O;  3AG7 A;  4I9Q A;  5EZY A;  3L75 H;  5B1N A;  4OPH A;  1PD3 A;  5FL7 G;  1K4C C;  1VEW A;  3BY6 A;  1YVW A;  2CAZ C;  2ZIN A;  3ASN B;  4J11 A;  3JAT A;  1GKF A;  1E1Q G;  2JJ1 G;  4DV5 B;  2WLK A;  2XAF A;  1P84 F;  4GCZ A;  4E2L A;  5LA6 A;  1Q6U A;  2AW9 A;  3CEI A;  5B3S C;  1Q81 W;  4JI5 O;  3BEH A;  2HVK C;  4DR5 O;  4J10 A;  3AK1 A;  4ZIB A;  4EEQ A;  4YJ3 B;  4B3R B;  4X9Q A;  5KLV H;  2AXT Z;  3OEE G;  5IYZ B;  1YIT V;  1OCR C;  2EIL B;  3I5D A;  4CS3 A;  5K1X A;  1FFX A;  2ZNI A;  4LF6 O;  2OCC B;  3A2F A;  3ZHU A;  3ZIA G;  4WFE A;  4NKG B;  1B6Q A;  1S0V A;  5KHI A;  1Q8I A;  4NR1 A;  1DF5 A;  5GW7 A;  5E79 Z;  4HZ3 A;  1AI4 A;  3OM3 B;  3ZRW A;  3PJS K;  4X8A A;  4TUY A;  5LOV A;  2GV9 A;  1XHZ A;  2EBO A;  4I4T B;  4O4I A;  1IVS A;  1K8A W;  2ZD9 A;  2E3C A;  3CSX A;  3ABK C;  4FFB B;  4O2A B;  4NXM O;  3BA8 A;  3K57 A;  5JJE B;  5C8Y A;  4YJ2 A;  2XAG A;  1TA8 A;  4Z1M G;  1VQ8 V;  3DXR B;  3P30 A;  3OTO B;  1MG1 A;  2Q7E A;  2YIC A;  1V9P A;  3FKS G;  1BE3 H;  3T1C A;  4MT8 A;  3JD0 A;  4JI4 O;  4X62 B;  2QTS A;  2WLJ A;  2ZE8 A;  3K06 A;  1QU7 A;  1NI8 A;  2P5O A;  1MMM A;  1JR9 A;  2QM7 A;  3UT5 B;  4HNA B;  4GKK O;  2EJR A;  4Q20 A;  3BVO A;  1WP7 A;  4RUF A;  4MW8 A;  4JI6 O;  1HNX B;  1Q7Y W;  3ETQ A;  3RWR D;  3CCU V;  2RDC A;  3CXC U;  5L3D A;  2D2C B;  2CE4 A;  3ABT A;  2HEP A;  1AR1 B;  4I9W A;  4B08 A;  2IM9 A;  2PI4 A;  1YIJ V;  1DK1 A;  4X20 B;  4AHC A;  1O9G A;  3RFR A;  3TK1 A;  3J7A U;  2RJZ A;  3AG3 C;  5GTI Z;  3H1I H;  3RGB A;  4HBN A;  1N0J A;  2YIB A;  3K9A A;  4A5U B;  1QNM A;  1TVK B;  3CJH B;  1NR1 A;  3QO5 A;  4GX2 A;  4YJ3 A;  4H13 B;  2DQ3 A;  4R6Z A;  5LXT B;  1OCC C;  3GVM A;  5IYZ A;  4U3F H;  1SA0 B;  1VQ5 V;  1N32 O;  3CMA V;  1PM9 A;  4RAI A;  2E5L O;  1FD9 A;  2QWN B;  4DV6 O;  3D36 C;  1HW7 A;  3BFR A;  4W4L A;  1P7B A;  3ZS8 C;  2OTL V;  4TT3 G;  2YS8 A;  2Q69 A;  3F5T A;  4JI8 O;  1FAF A;  5KHH A;  4LWS A;  1UFI A;  4BIO A;  3JAS B;  1HWY A;  1H38 A;  1IBM O;  2R9A A;  3OGC C;  3ETD A;  4I4T A;  5LP6 B;  1FYJ A;  1JA8 A;  1NTM H;  4DV3 O;  2V1D A;  1F7Y A;  2K9P A;  1TGO A;  2XND G;  4FFB A;  4MSW C;  4DW0 A;  4O2A A;  1N4C A;  4MTF A;  1WA8 B;  2GTA A;  4P9O A;  3UCS C;  3CE2 A;  3IC7 A;  2B1I A;  4ZHQ B;  1AI6 A;  1EN4 A;  1A32 A;  1KU9 A;  4AQY O;  2Q4P A;  2UXB B;  3F5W C;  5GON B;  3CC7 V;  2FTK A;  3SJA C;  3LDD A;  2UXD B;  2DJV A;  3H1H H;  4LF8 B;  4H37 A;  1YJ9 V;  1IBK O;  2DW4 A;  1L1F A;  4TV8 B;  4G2K A;  1SES A;  3OMN B;  1AB3 A;  3GWK C;  1VQ4 V;  2E75 B;  3UT5 A;  4HNA A;  5J2T B;  1QLN A;  4LF5 B;  4DR2 B;  2OYQ A;  2XUM A;  4FJC C;  3CC4 V;  1Z5V A;  3ZED A;  3ZRS A;  2EIJ B;  3FYE B;  5KMG B;  1XUQ A;  2UUA O;  4H0L B;  3AK3 A;  5B66 Z;  4X20 A;  2QSA A;  3U10 A;  2EZP A;  2PGG A;  4WBN A;  1ZTE A;  1R73 A;  2F4V B;  4CH5 A;  3LDE A;  1OCR B;  4TQF A;  4NTW A;  1DGS A;  4PA9 A;  4FLX A;  1BHA A;  4GLX A;  2YID A;  1TVK A;  3JD4 A;  4LC1 A;  4DV4 B;  3CJH A;  4BW9 A;  1S5H C;  4KFM A;  5LXT A;  5EBW C;  1VF6 C;  1OHH G;  1PL4 A;  5CA3 A;  2QA4 V;  3H1J H;  2LP7 A;  2MW2 B;  5IWA B;  4K3A A;  2EIK C;  2FL4 A;  2A0L A;  2UXN A;  3B4S A;  4L8J A;  5DN6 G;  3RYF B;  1MOF A;  5IJ0 B;  2OIG A;  2OWO A;  3JAS A;  4JAV A;  3CME V;  3CCR V;  4JGS A;  3ABL C;  5LP6 A;  1PNK A;  1MZF A;  5LL6 Y;  2PUS A;  4U7N A;  3WB1 A;  4JI1 O;  2WLI B;  1FS0 G;  3KCX A;  4XDJ A;  3G80 A;  5JQG B;  1WA8 A;  1YCI A;  2DYR C;  1BMF G;  1PL0 A;  5JH7 A;  4JTD B;  4FM2 A;  3O9O A;  3E8B A;  2VWJ A;  3VBB A;  2EZO A;  4LFC B;  1O9H A;  2FB5 A;  1R3K C;  4X1I B;  3SPI A;  4FVM A;  2CH7 A;  2IJJ A;  3KZI Z;  4PDV A;  1XNR O;  1BS3 A;  4MTG A;  1XQ8 A;  1H2K A;  1T5E A;  2PY5 A;  2WLH A;  4O2B B;  5J2T A;  2DWE C;  1NZ6 A;  2K1E A;  1ZL8 B;  4Z2W A;  3AG3 B;  2WWW A;  4FK5 C;  4GKJ O;  4GX1 A;  2HFE C;  3H1K H;  3G71 V;  4ZOL A;  5KMG A;  3TXQ A;  1GRJ A;  2LQT A;  1BT8 A;  4J7J A;  3CHX A;  4G28 B;  2LGW A;  3N2G B;  3ZX6 A;  3W7T A;  3B40 A;  4DR4 O;  3ZHT A;  1XMQ O;  1M57 B;  3BPZ A;  4I7Z B;  4JV5 O;  1H2G A;  2B9Z A;  1VQ7 V;  1M4U A;  3IAY A;  1LNQ A;  1XL6 A;  3ASO B;  5KA5 A;  4IGG A;  4UCT A;  2IU0 A;  2QWO B;  2H3O A;  4QPJ A;  3T1Y B;  4DUZ O;  3ZN1 A;  1QLE B;  1I94 B;  4D7S A;  3LSQ A;  3RYF A;  1KYO F;  3JAR B;  3T4D A;  4YXW G;  3B77 A;  3E8G A;  5TIS Z;  1VIB A;  3G67 A;  5IJ0 A;  4U7O A;  2QTO A;  2LW7 A;  2BOB C;  4MTX A;  2LW1 A;  2VS0 A;  4UXN A;  4DV1 O;  2F93 B;  3ICX A;  1D2D A;  1WJZ A;  4IHJ B;  1FXV A;  5LHG A;  1CPY A;  1NTZ H;  5IYB O;  4LFB O;  1GTO A;  1FXK A;  1HDJ A;  2ZE7 A;  4FLW A;  3S3X A;  3VQW A;  3L72 H;  4X1I A;  1M1K W;  3VQV A;  2ZE5 A;  3KG2 A;  1HNZ O;  4AI8 A;  4FLY A;  3E22 B;  3R66 A;  3RYC A;  4NXN O;  4O2B A;  3FB7 C;  4MVM A;  1N36 B;  1ZL8 A;  1US6 A;  1SQP H;  5HFM A;  3OR7 C;  4DR7 B;  1ROP A;  3ZCC A;  4I0X B;  2ZXW C;  1XHX A;  2R72 A;  3RYI B;  3K0G A;  5LBQ A;  5JCO A;  4QIW F;  3SPH A;  1XNQ O;  3K9S A;  1ZX3 A;  2LO1 A;  1FPO A;  2X6A A;  3N2G A;  3UQ8 A;  3BA9 A;  4TWK A;  3STL C;  1K4D C;  3K3W A;  4FLV A;  3FB8 C;  1V55 B;  3CX5 F;  5L3F A;  2P22 C;  2WPD G;  2QJ1 A;  3SYQ A;  3W7S A;  4UCV A;  4JI3 O;  2HKO A;  2F43 G;  5EBL C;  1DF4 A;  4B3T B;  3N27 A;  2JS3 A;  1WB7 A;  3MDS A;  2YI9 A;  1YZB A;  3NXS A;  2HR3 A;  3K59 A;  3IFX A;  4LF7 B;  5LYJ B;  3HKE B;  3ABL B;  2EIM C;  1KP2 A;  3CS5 A;  5JVD B;  1NBM G;  4UCU A;  5BR8 B;  1G4Y B;  4LF9 B;  5DM6 V;  5FNV B;  5K1P A;  1HR0 B;  4KHP B;  4X64 B;  3JAR A;  2Y0I A;  2DYR B;  3H9V A;  4DR3 O;  1W2B U;  4YHH B;  1YJN V;  3E2E A;  3J80 N;  4UVC A;  2LFR A;  1VQK V;  1NVP D;  3JSL A;  2YDE A;  4JI2 B;  4DV7 O;  3VQX A;  3A8T A;  1M56 C;  3MHS C;  3FYI B;  1AR4 A;  4PD4 F;  2Q7H A;  4DUY B;  3LNN A;  4GX5 A;  1B06 A;  1I08 A;  1GN6 A;  1Z2G A;  1AVM A;  5JWP A;  2H94 A;  4IHJ A;  2KQX A;  3ABM C;  4EFB A;  4JI7 O;  4GT1 A;  5JJN B;  1FJG B;  2W6J G;  1G1X B;  4B3R O;  5D5P A;  2P06 A;  1S3J A;  1N0N A;  1WNS A;  5IT9 N;  3CRR A;  3IGA C;  3UM7 A;  1HNW B;  1YEW A;  3L71 H;  4LF4 O;  2B1G A;  3K5O A;  3C90 A;  2DOS A;  3JD3 A;  4JI5 B;  3HKC B;  2YEV A;  4LP8 A;  3P3P A;  1MA1 A;  2NNU A;  3BCC H;  1VQ9 V;  1DTO A;  3BAA A;  4JYY A;  2V7Q G;  2HG5 C;  2JJ2 G;  1Q5O A;  2L6L A;  2Q9L A;  5EBM C;  3T1H O;  4I0X A;  1GM7 A;  2PI5 A;  2O57 A;  3RYI A;  4LF6 B;  5LMN O;  3L73 H;  3R65 A;  1YF2 A;  4PI2 A;  2UUB O;  1TUB A;  3SPC A;  3M8A A;  1JMK C;  4DRX B;  1LUW A;  4LBE C;  1E1R G;  5B1B C;  4J80 A;  4OX9 O;  4F6E A;  4C7U A;  2WLL B;  1N8R W;  3L9D A;  2XAJ A;  2VQF O;  3OTO O;  2Q7G A;  2QKS A;  5KX5 B;  3T4Z A;  5LGU A;  3OD4 A;  1PKX A;  3APQ A;  1AR5 A;  1SQX H;  5CMU A;  4X1K A;  4PV1 B;  2EUL A;  1IZ3 A;  3OFN G;  5KHJ A;  4UB6 Z;  4X65 B;  1MSW D;  4I5S A;  4PJ0 Z;  2LGQ A;  5LYJ A;  3HKE A;  2DYS C;  4H44 B;  1XDC A;  3E83 A;  1GAX A;  1OCZ C;  5CA1 B;  4IYI A;  1BSM A;  2A06 H;  5L3B A;  5FNV A;  1WPX A;  3WB2 A;  4DXW A;  5IY5 C;  1CEZ A;  5EYP B;  3JCU Z;  4N23 A;  3WG7 C;  3CCS V;  3I56 V;  1NQT A;  2DE0 X;  2HHH B;  2IU3 A;  5IYC O;  4JYA B;  2ADQ B;  4WCE V;  3DGE A;  4MVQ A;  2IH3 C;  2RN9 A;  2YUA A;  3G6B A;  4JI6 B;  2QM4 A;  3RN4 A;  2ATK C;  2ZDI C;  1JOY A;  1HP8 A;  4LH7 A;  3SYO A;  2UXX A;  5J2U B;  2X0L A;  3SPJ A;  4EKW A;  1TUE B;  1K73 W;  1Y66 A;  1PV0 A;  3X2Q C;  2ODM A;  4J9Y B;  1VAR A;  1N33 O;  1K5Q A;  4O4L B;  5LGT A;  3HKC A;  1R1B A;  3GB7 C;  4DR6 B;  3A0B Z;  1EZJ A;  2JDI G;  1I5Y A;  1VP7 A;  2XT9 A;  3B2E E;  2RQ6 A;  2M6Y A;  1U97 A;  2BCC H;  3TCU A;  2FYU H;  1N32 B;  2EIN C;  3AG1 C;  2CTQ A;  2IH1 C;  3DSQ A;  4GYC B;  1GN4 A;  5KUK A;  5D5Q A;  4LFA B;  1K34 A;  2P4K A;  3K03 A;  3DC5 A;  4ABM A;  4DRX A;  1XEQ A;  2WLL A;  2E76 B;  1SQV H;  3DXR A;  2F1M A;  5CBF A;  5KX5 A;  3FAV B;  2EIM B;  1IBM B;  2JVD A;  1QCE A;  1NS1 A;  2ZIM A;  1YTF D;  1LR1 A;  4CBC A;  2KKW A;  3TET A;  4D7T A;  1QVG U;  4CZZ A;  3CCJ V;  2QKC A;  1VQL V;  1NVP B;  4RQF A;  4AQY B;  3OUF A;  4LF5 O;  1H2N A;  2ZE6 A;  2A7W A;  2Z0A A;  5CA1 A;  1Q6H A;  2P4V A;  1SQB H;  4B3M O;  5EYP A;  2GTS A;  5B3S B;  4TQD A;  3DC6 A;  2WLM A;  2NR5 A;  3HR0 A;  3HB3 B; 
#chains in the Genus database with same CATH homology
 1VQ6 V;  3W7T A;  1P4R A;  5KUM A;  4KP4 A;  5B1A C;  5KA6 A;  1F4M A;  1OZ0 A;  1R3L C;  1FXK C;  1KEC A;  4DO2 A;  3VOU A;  3K08 A;  3ABU A;  1M57 B;  2P90 A;  3SYC A;  1H2G A;  2QEX V;  1VQP V;  1CP9 A;  2B5U A;  3MD0 A;  4BIU A;  1VQ7 V;  3JCZ A;  1LNQ A;  1XL6 A;  4XDL A;  1J95 A;  3ASO B;  5KA5 A;  1S76 D;  1E79 G;  3CD6 V;  5H6R A;  2DWD C;  2LFS A;  2IJK A;  5CBH A;  2IU0 A;  3H01 A;  4WFA V;  5EC2 C;  5B1N A;  1VQN V;  4QPJ A;  1UJW B;  4UV9 A;  1OCO C;  3ZRX A;  3E89 A;  3ZN1 A;  4PA6 A;  1QLE B;  3ETE A;  1PD3 A;  4QE7 A;  3ZMT A;  1AJP A;  5FL7 G;  1K4C C;  3LSQ A;  3T4D A;  4UUJ C;  3BY6 A;  2ZXW B;  4YXW G;  3B77 A;  3E8G A;  1KQS U;  2P67 A;  1NH2 D;  3CCM V;  4U7O A;  2QTO A;  3ABK B;  2BOB C;  1NR7 A;  4MTX A;  3ASN B;  3ETG A;  1IXM A;  1GKF A;  1E1Q G;  2D3O W;  4UXN A;  2JJ1 G;  1K92 A;  5BZB A;  2WLK A;  1ZWI C;  2XAF A;  3DTU B;  4GCZ A;  4E2L A;  1Q81 W;  5B3S C;  3CP1 A;  3BEH A;  2HVK C;  1FXV A;  5LHG A;  1CPY A;  5IYB O;  3B8M A;  1GTO A;  3W7U A;  1FXK A;  4JAS A;  2ITC C;  1F51 A;  3CCQ V;  3OEE G;  1YIT V;  1W0J G;  1JX9 A;  1OCR C;  2EIL B;  1GM9 A;  1M57 C;  4WFF A;  2XAH A;  5EK0 A;  1M1K W;  1ARO P;  1NKD A;  2DYS B;  2OCC B;  3AG4 B;  2HLD G;  3ZIA G;  1QR8 A;  3KG2 A;  3ASO C;  5CBG A;  3LSS A;  4WFE A;  1B6Q A;  1S0V A;  1K33 A;  4WFH A;  3CYO A;  1DF5 A;  3F7V C;  5GW7 A;  1SZT A;  5IY5 B;  3FB7 C;  3LNM B;  3AEI A;  4MVM A;  4HZ3 A;  1AI4 A;  2QM8 A;  3OM3 B;  3PJS K;  4X8A A;  3WG7 B;  3OE7 G;  4RUE A;  3ZRW A;  2A9H A;  3JD2 A;  5HFM A;  1QLE C;  5CN0 A;  3OR7 C;  1S72 V;  1Y4M A;  2EBO A;  3E8H A;  4P30 A;  2QE7 G;  5L3C A;  1ROP A;  3ZCC A;  2JIZ G;  2ZXW C;  1K8A W;  2ZD9 A;  2Z3Y A;  3K0G A;  5LBQ A;  3OR6 C;  3AG2 C;  3ABK C;  4QIW F;  1M56 B;  4UVB A;  3JYC A;  2XAG A;  2AHZ A;  3SPH A;  4Z1M G;  4MVO A;  1VQ8 V;  3M99 B;  3P30 A;  1MG1 A;  2HJF C;  3FKS G;  3T1C A;  2X6A A;  4MT8 A;  1NJI W;  3ABM B;  3JD0 A;  4RO2 A;  4TWK A;  1OCC B;  4JYC A;  1K4D C;  2KB1 A;  3K3W A;  3RBZ A;  2WLJ A;  3STL C;  2Y48 A;  3K06 A;  4QNH B;  3FB8 C;  4XBF A;  3QO7 A;  3OEH G;  1V55 B;  4UV8 A;  5L3F A;  2WPD G;  4JAU A;  2IW5 A;  3SYQ A;  4MVR A;  3W7S A;  4OXS A;  2Q68 A;  1M90 W;  2EIL C;  1I5X A;  3G6E V;  2QM7 A;  2HKO A;  2F43 G;  3SPG A;  2EJR A;  4Q20 A;  1DF4 A;  1WLE A;  5EBL C;  4BW5 A;  4PA3 A;  4RUF A;  4MW8 A;  1F4N A;  3SYA A;  3NXS A;  2HR3 A;  5LHH A;  2P6J A;  1Q7Y W;  3IFX A;  1JQ0 A;  2JK5 C;  3CCU V;  2IJH A;  3ABL B;  3CXC U;  2OT5 A;  3AG1 B;  2EIM C;  5L3D A;  1KP2 A;  3ABT A;  1V54 B;  1SRY A;  3MHH C;  1NBM G;  1G4Y B;  1AR1 B;  4I9W A;  1K97 A;  1SER A;  5DM6 V;  2ZR2 A;  2PI4 A;  1YIJ V;  3ML0 A;  3STZ C;  3F7Y C;  2DYR B;  3TK1 A;  1W2B U;  3AG3 C;  4GX0 A;  1YJN V;  1KC8 W;  3E2E A;  4UVC A;  2LFR A;  2HVJ C;  1VQK V;  1NVP D;  1KD1 W;  3K9A A;  1RM1 B;  1K3E A;  1G8M A;  1M56 C;  3MHS C;  5B1B B;  3FYI B;  2H8P C;  4FMT A;  2Y69 B;  4PA7 A;  1QVF U;  4PA4 A;  1KP3 A;  4GX5 A;  1BL8 A;  2DQ0 A;  1Q82 W;  5H9C A;  1M9N A;  1NR1 A;  2H94 A;  3QO5 A;  4GX2 A;  4BIZ A;  3ABM C;  2WLI A;  4GT1 A;  2DQ3 A;  4PDL A;  4R6Z A;  4TSF G;  1OCC C;  2W6J G;  2ZR3 A;  1VQ5 V;  4N21 A;  3CMA V;  5H6Q A;  1V55 C;  4RAI A;  3ZJZ A;  2W0F C;  2Q67 A;  1S3J A;  3SJQ C;  3IGA C;  3UM7 A;  4F4L A;  2B1G A;  3OUS A;  4MVU A;  3JD3 A;  1P7B A;  1RPR A;  2OTL V;  4TT3 G;  4WFG A;  5IYD O;  3ZMZ A;  2YEV A;  4LP8 A;  5HFL A;  2Q69 A;  1FFT B;  3ZMS A;  1OCZ B;  4BAY A;  2NNU A;  1VQ9 V;  1DTO A;  1HWY A;  1H38 A;  4ASU G;  3CCV V;  3EFF K;  2V7Q G;  1PNM A;  4JYB A;  2HG5 C;  3OMA B;  1R6N A;  1PNL A;  2JJ2 G;  3OGC C;  5EBM C;  3RW0 A;  3ETD A;  4R50 A;  3OW2 U;  4JTC B;  1R6K A;  3K04 A;  5B1A B;  1GM7 A;  2V1D A;  1MAB G;  1SET A;  1FXK B;  2PI5 A;  3W7W A;  2XND G;  2ZDI A;  3P32 A;  3R65 A;  4MSW C;  4MTF A;  4MVZ A;  3JD1 A;  1JJ2 U;  4P9O A;  3ZN0 A;  3SPC A;  3OAA G;  3IC7 A;  2B1I A;  4MVS A;  1AI6 A;  4LBE C;  1E1R G;  5B1B C;  4P9P A;  3CC2 V;  5E1A C;  3K0D A;  1R3J C;  2WLL B;  3K79 A;  3ASN C;  3F5W C;  3CC7 V;  1N8R W;  2FTK A;  3GWO A;  3LDD A;  2XAJ A;  1AI7 A;  2QKS A;  4H37 A;  1F23 A;  2WSS G;  3A0R A;  4PEL A;  3T4Z A;  5LGU A;  1YJ9 V;  2DW4 A;  3SYP A;  2JEX A;  3RVZ A;  4QPK A;  1PKX A;  3QNE A;  3X2Q B;  5CMU A;  1AI5 A;  2MK3 A;  1L1F A;  4G2K A;  1SES A;  2JEU A;  3OMN B;  2X6C A;  1VQ4 V;  2P7T C;  2EIK B;  4WF9 V;  3LUT B;  3D36 A;  1QLN A;  1EFR G;  2Z5U A;  3OFN G;  1MSW D;  4I5S A;  1NH2 B;  3E86 A;  4XDK A;  4P2Z A;  2DYS C;  2OCC C;  4FJC C;  3AG4 C;  3CC4 V;  3UKM A;  3ZRS A;  5LHI A;  3E83 A;  1XL4 A;  3ZMV A;  1OCZ C;  1THZ A;  2C2A A;  2EIJ B;  3FYE B;  5L3B A;  4L87 A;  1WPX A;  2YSU B;  1QR9 A;  2EIN B;  4UVA A;  4DXW A;  2EZP A;  5IY5 C;  1CEZ A;  1R73 A;  3FB6 C;  1GMG A;  4N23 A;  4R7C A;  3WG7 C;  3LDE A;  3I56 V;  1NQT A;  1ENV A;  5C93 A;  3CCS V;  1OCR B;  2IU3 A;  5IYC O;  1DLB A;  4ZBM A;  4PA9 A;  3DGE A;  4WCE V;  4MVQ A;  3CPW U;  1YSC A;  2IH3 C;  4WFB V;  1BHA A;  3WFV A;  3JD4 A;  4LC1 A;  2ATK C;  3W7X A;  1AJN A;  2X7R B;  2ZDI C;  3FB5 C;  1JOY A;  1QBZ A;  1S5H C;  1K7D A;  3SYO A;  2UXX A;  4KFM A;  2X0L A;  3SPJ A;  4EKW A;  1TUE B;  5EBW C;  1K73 W;  1OHH G;  1Y66 A;  5CA3 A;  2QA4 V;  3X2Q C;  2AHY A;  2LP7 A;  2A79 B;  4J9Y B;  1H8E G;  3E8F A;  4H33 A;  1YTF B;  1R3I C;  1FXH A;  1ORQ C;  5L3G A;  2ITD C;  1K5Q A;  2EIK C;  4LCU C;  2A0L A;  4G27 B;  2XAQ A;  2IJI A;  2UXN A;  3D3I A;  3AG2 B;  5LGT A;  5DN6 G;  1KKD A;  1GM8 A;  5J9P C;  1GO3 F;  3GB7 C;  4PDR A;  2CK3 G;  1EZJ A;  1MOF A;  2JDI G;  1I5Y A;  3B8N A;  3I55 V;  2Q6A A;  1K9M W;  4JAV A;  1AJQ A;  4HYO A;  1Q86 W;  3TCU A;  3CME V;  2ZQM A;  3CCR V;  2EIJ C;  4JGS A;  2XOK G;  3ABL C;  1PNK A;  3E35 A;  2EIN C;  3AG1 C;  2BOC C;  2IH1 C;  4U7N A;  1YI2 V;  1YHQ V;  1V54 C;  3EHB B;  5B1O A;  3G4S V;  2WLI B;  4MTO A;  1FS0 G;  5L3E A;  5KUK A;  3CCL V;  3CCE V;  1K34 A;  4XDJ A;  3OMI B;  3K03 A;  2DYR C;  1BMF G;  4PDM A;  1PL0 A;  4JTD B;  2X6B A;  3E8B A;  1RPO A;  4FPP A;  2WLL A;  4RQE A;  2GHY A;  5IDJ A;  4MW3 A;  1RM1 C;  3VBB A;  4KUM A;  5EC1 C;  2EZO A;  4QE9 A;  1VQM V;  1R3K C;  2R9R B;  5CBF A;  2Y69 C;  2EIM B;  3QO8 A;  2YEV B;  3SPI A;  1YJW V;  1QCE A;  2IJJ A;  1JPX A;  4PDV A;  4MTG A;  4MS2 A;  1YTF D;  2XAS A;  2WLH A;  1GK9 A;  4CBC A;  4ZKI A;  2DWE C;  1EBO A;  5LGN A;  1BHB A;  2GSM B;  1OCO B;  2W6I G;  2K1E A;  1VQO V;  4QJF B;  3ZRW B;  3TET A;  3AG3 B;  1K5S A;  2WLN A;  1QVG U;  4CZZ A;  3CCJ V;  2WWW A;  1VQL V;  1H8H G;  4FK5 C;  1NVP B;  4X89 A;  3T2M A;  4RQF A;  4HAM A;  3RVY A;  1COW G;  2M7W A;  3ZMU A;  2R9I A;  1JVM A;  3OUF A;  4JTA B;  4GX1 A;  2OTJ V;  2HFE C;  3G71 V;  2WAM A;  4R8C A;  4X88 A;  4J9Z B;  4FIP C;  5B3S B;  1W0K G;  1S77 D;  2NLJ C;  3LDC A;  4G28 B;  3HPL C;  4JF3 A;  4JPR A;  3ZRV A;  2WLM A;  1JCH A;  3HB3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...