4G28B

Calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
95
structure length
87
Chain Sequence
GRKLELTKAEDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the functional binding pocket for compounds targeting small-conductance Ca(2+)-activated potassium channels.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal transport/calcium binding protein
molecule keywords Small conductance calcium-activated potassium channel protei
total genus 35
structure length 87
sequence length 95
ec nomenclature
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02888 CaMBD Calmodulin binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4g28B00
1BL8A 3X2QC 1KKDA 3SYPA 2EIKC 4WFGA 2DYRC 3KG2A 5KUMA 1K4CC 4GX5A 2ZD9A 3IFXA 3RVYA 1P7BA 3E8HA 2WLHA 3K08A 1QLEC 5B3SC 1R3JC 2P7TC 3OUSA 4LP8A 3OUFA 5EC2C 3STZC 3FB8C 2ATKC 2HG5C 3OR6C 4G27B 3BEHA 2H8PC 4RO2A 2WLLA 3ABLC 4JTDB 4GX2A 4PA9A 2DWDC 1K4DC 4MW8A 1OCZC 1XL4A 3WG7C 3AG2C 3ABKC 3F7YC 3HPLC 3SYCA 3UM7A 3FB7C 3SPGA 4X8AA 3T2MA 4QNHB 1V55C 5BZBA 2IH1C 2WLIB 4LBEC 4MTGA 5EBLC 3RW0A 3SPCA 3TCUA 2HVKC 1M57C 1ORQC 2K1EA 2W0FC 3E83A 1R3LC 4MTOA 3ASOC 4PDVA 2A9HA 4PDMA 4R6ZA 4RAIA 3STLC 4QE9A 4XDKA 4UUJC 3EFFK 2A0LA 5B1BC 5CBGA 3F7VC 4XDLA 3LDDA 2KB1A 4H37A 5EBWC 4MVRA 4MVQA 1J95A 3E86A 4P9OA 1OCCC 4X88A 4P30A 2EIMC 2JK5C 3T1CA 2ITCC 2QTOA 5EBMC 2DYSC 3OGCC 2A79B 4HZ3A 5EK0A 4PDLA 1R3IC 3SPIA 3OR7C 3ZJZA 4MVOA 3K04A 4G28B 4I9WA 3E89A 4PA4A 4XDJA 3T4DA 3SJQC 3SPJA 1ZWIC 3FB5C 3E8BA 2QKSA 4TWKA 2Q67A 2WLMA 4PA7A 3VOUA 4R7CA 2HVJC 2WLIA 4R8CA 4MVSA 2BOCC 3E8FA 3FB6C 3R65A 2X6CA 4P9PA 4MTFA 5IY5C 1G4YB 1OCRC 2ITDC 4LCUC 4MW3A 4MVMA 5E1AC 4MS2A 4WFEA 3LUTB 2EINC 4MSWC 3AG4C 3K06A 2EILC 4GX0A 3PJSK 4MVZA 2OCCC 3ASNC 3JYCA 4BW5A 2HFEC 4WFFA 2WLNA 2HJFC 4JTAB 3UKMA 4PA6A 2NLJC 5J9PC 5KUKA 1R3KC 3ABMC 4JTCB 3SYAA 3GB7C 3AG3C 4QE7A 3RBZA 4RUFA 4OXSA 3K0DA 2ZXWC 2Q69A 2WLKA 3F5WC 2WLJA 4MVUA 4X89A 3LDEA 2EIJC 4J9ZB 2AHZA 3SYQA 5CBHA 4R50A 2AHYA 3ZRSA 3RVZA 4F4LA 4H33A 3K0GA 3T4ZA 3K03A 4HYOA 2Q6AA 3E8GA 4J9YB 4GX1A 1S5HC 4P2ZA 3SPHA 2X6BA 1OCOC 4PDRA 4ZBMA 3LDCA 4RUEA 4WFHA 3SYOA 2DWEC 2Y69C 2IH3C 2Q68A 4CBCA 2YEVA 3IGAC 1V54C 5B1AC 2BOBC 3AG1C 3LNMB 5CBFA 3TETA 4EKWA 4DXWA 5EC1C 2WLLB 1LNQA 1XL6A 2R9RB 4PA3A 1JVMA 4KFMA 2X6AA 1M56C
chains in the Genus database with same CATH superfamily
4PI0A 1M90W 1NU1H 4JI2O 2CH7A 5F2VO 1UPGA 4TUYA 4YY3B 4IL6Z 3ZX6A 4YXWG 4NTXA 1PD3A 1ZL8B 1AI7A 2VWKA 3ABLC 3ASOB 3D8CA 1FPOA 1PV0A 5GTIZ 3T2MA 5LOVA 1G8MA 5LMUO 1JCHA 1VQ5V 2IH1C 1NZ6A 3TK1A 4JI4B 4FZ0A 3ZRXA 2YIBD 2QR4A 4CC6A 3UT5A 5AG2A 3J80N 5CB4B 2Q7GA 1KQSU 5LMUB 4JI6O 4LWSB 4B3RO 1ZX3A 1M57B 4EB6A 1NS1A 4YJ3B 2EIMC 3M7MX 3ETDA 2BE3A 4FLYA 2DE0X 3CCQV 3SGIA 2A3QA 5KHKA 1EM1A 4X1KA 2F95B 3CCRV 4X66O 4PA7A 5GW7A 2QWQB 3R65A 4I0XB 4DR2O 2LGWA 1KC8W 5EZYB 3MHHC 5LBQA 3N2KB 2DW4A 2DN9A 3A0BZ 1SETA 3CCEV 3ABUA 3NXSA 3OT7A 3CCLV 1PP9H 4NTWA 4JYBA 4UVBA 1JQ0A 4BW9A 4UCRA 3O65A 4O4JA 5FL7G 2Q0OC 2BTQA 4D7SA 4P2ZA 3G4SV 4ZI7B 1SQFA 3OTOO 4GYCB 1N34O 4DV5O 3W7SA 3MHSC 4DR3B 4DO2A 5GTHZ 3AG7A 1VQ7V 4I55B 3RYIA 1I08A 1UJWB 1XMOO 3BAAA 1R3JC 5LGNA 1K33A 1I0HA 4HBNA 2ZT9B 3P3NA 3L72H 1VF7A 4UV9A 4K35A 1XL4A 3AG2C 3CCMV 2AXTZ 3CWBH 2ZINA 3ICXA 4DR7B 1ORQC 1Y74B 3GWOA 4KUMA 2RJZA 5D5PA 2QE7G 5CBGA 2HEPA 3CPWU 2QWOB 3DC6A 5EBWC 1N32B 3LSQA 3RT3C 3N2KA 5JJJB 1F4NA 1WLEA 3R66A 4X62O 4JYYA 4B3SO 2UUCO 1PM9A 4CH6A 3OE7G 4JI8O 4UVAA 3H1LH 4WF9V 2YXYA 2QJ1A 1OHHG 1K9MW 3LUTB 2ZE7A 3AG4C 1XQ8A 4DV3O 1XHZA 4PELA 5D5QA 2HJFC 4LF4B 4PA6A 5J9PC 3ABKB 3CEIA 4B3RB 4JTCB 3ABMB 4FPPA 5JVDB 1N0JA 1PKXA 1VQ4V 4CS4A 2ZXWC 1H2NA 2WLKA 2ZR3A 2AHZA 4DK0A 3JATB 3JCUZ 1S5LZ 4U3FH 3H1KH 5LYJA 1Q3EA 2B1GA 1DF4A 1Z2GA 3LDCA 1Q90D 3ZHSA 2D3OW 5IWAO 4QGPA 4J41A 2UXCO 4HAMA 3X2QC 4FLZA 4LF7B 3B09A 1H2SB 1B04A 3ZMZA 5CMUA 1M56B 3OGIB 1BGYH 1AI6A 2F1MA 2P7TC 1WJZA 2EZOA 3OR6C 4Q6GA 1GN2A 3CD6V 2R9AA 3BRCA 3WG7C 1WP7A 1NR7A 1RFYA 2O57A 1JR9A 3CX5F 1XUQA 5K1PA 2LP7A 1N8RW 2WSSG 4TSFG 2EILB 4BIOA 3L9DA 3TCUA 3CJHB 4O4JB 4AQYO 2VRZA 2ZIOA 1R3LC 3O9OA 3OTOB 2WA3A 4J10A 3JD1A 1CXZB 2JGUA 3F5TA 3ZMTA 3HKBB 3QVNA 2UU9O 4JAUA 2NN4A 3D3QA 3OR7C 5JQGA 3E89A 1OJHA 1CP9A 1IBKB 2LO1A 1BQ0A 4DW1A 2B5UA 1X59A 5FNVA 3SJBC 4UVCA 1R6NA 5LL6Y 1NT2B 4GLXA 4MSWC 3RFRA 4BW5A 3H1JH 1GMGA 5LXTA 1R3KC 4FM1A 1VQPV 4LFAO 4X1KB 3SYQA 4C7UA 4F4LA 3H01A 3T4ZA 1GO3F 5L3CA 1WNSA 1A32A 1SZXA 2DWEC 1Q81W 1YITV 2EX3A 4PA3A 3SYPA 1BL8A 1BE3H 3JAWA 2ZQMA 4U7OA 3K08A 3ETGA 4X20A 5J2UB 3JAMN 2UXCB 5EC2C 1GM8A 4KL1A 2JEXA 3WFVA 3PN1A 1Q7YW 3G80A 4I0XA 3HPLC 4FFBA 3CXHF 4NVPA 3BHPA 2JJ2G 4DUZB 4YJ2B 3FD9A 5EBLC 1S0VA 4U3JB 1H2GA 5HFLA 1MA1A 1AR1B 5H2FZ 4FVMA 1MMMA 5EBMC 1HNZO 3B2EE 1GH6A 3HKBA 1IX9A 2G38A 1GN4A 2PYJA 4DV0B 4PJ0Z 1Z5VA 4R8CA 2LJ2A 1IBLB 3VQXA 1TVKB 4MVMA 1XNRB 2FTKA 1UFIA 4DV6O 1N4CA 2Q4PA 3I5DA 1XNQO 1AP5A 2XUMA 3CHXA 1VF6A 3HKEB 3SDLA 1TUEB 4DK1A 1IURA 3TXSA 4LH6A 2Q69A 2OTJV 1N33B 3LDEA 4KXRA 5CBHA 3ZEDA 5EYPB 3K03A 3JAWB 1EFRG 4DR5O 3TJTA 3ZHTA 2RDCA 2XNDG 2YXHA 2DOSA 5LGTA 4NXNB 1Q86W 4FLUA 1NTMH 4JYAO 4OX9O 3ZMVA 4I55A 3RYIB 1AJNA 4WFBV 4ZKIA 1R1BA 5GONA 2ZE5A 5CA0A 3CRQA 2OCCB 1BS3A 4I5SA 1S72V 1K8AW 4DUYB 1LUWA 2QEXV 4JZGA 1K7DA 5L3GA 3ZHQA 5L3FA 4FMTA 4PA9A 1K4DC 3GWKC 4TOIA 3F7YC 5BXZA 3UM7A 4X8AA 3S3XA 3BVOA 4EEQA 5IYCO 2EULA 2LW1A 3CE2A 1K73W 2W0FC 3WG7B 4O4LB 4DR6B 3ASOC 4U7NA 1EZJA 1E79G 3FAVB 2L6LA 2QM8A 3EFFK 3CCSV 1LUVA 3JCZA 1Y4MA 4X1YB 4P9OA 5IE9A 4AI8A 2V7QG 3ZRWA 2WPDG 3Q4HA 4BAYA 4X20B 5J2TA 1BHBA 3WB0A 1K97A 1YI2V 2YXLA 2PTMA 3U11A 5B3SB 1YVWA 3FX7A 5H6RA 3J7AU 4JYCA 5KX5B 5LA6B 4Z2WA 3K79A 5IT9N 2Z5UA 3ABMC 2E5LB 5H5NA 3RBZA 3K0DA 1CEZA 2QGNA 2UUBB 2WLJA 3CB2A 2ETNA 3MDSA 2F43G 1I94O 3G6EV 4H44B 3J81N 1KBHA 3H9VA 3BABA 2QWRB 2X6BA 3W7UA 1M93A 1JA8A 4DR1O 2IH3C 1MSDA 4DV3B 1V9PA 4LR3A 2Q5ZA 1QLEB 4CZZA 2OTLV 1MZFA 4WFGA 5LHIA 2F4VB 4GX5A 2Q7EA 4GT1A 4DR7O 2C2AA 4LFAB 2D2CB 1QLEC 1ENVA 4I7ZB 5CN0A 4LP8A 4X65B 3HKEA 1KU9A 3AK1A 4N23A 1I7FA 4JGSA 1N33O 1AB3A 2Q7HA 3ABKC 1Z5WA 2XHBA 3FYIB 4B7KA 1XMOB 2IM9A 1I5XA 3OMAB 1M9NA 1YF2A 1E1RG 4WBNA 2YC0A 3KKYA 2UU9B 2UXNA 3U0ZA 3B77A 4XDLA 2M7WA 4J42A 3E2EA 3JD4A 1J95A 4DV5B 4FJCC 1QVGU 2AZ0A 4LFCO 3T1CA 1N34B 4CH3A 4NXMB 2DYRB 4UB6Z 2LQTA 1VEWA 3CCUV 4PA4A 4DV0O 2P06A 3SPJA 3ZRWB 1ZWIC 3E8BA 3CJHA 3T1HO 3P32A 1U97A 3ASNB 3FB6C 4LF8O 5A2QN 2VQFO 5E1AC 3OTFA 2AW9A 1M5IA 1YZBA 4QJFB 3JSLA 3JD2A 4GX0A 2YSUB 3PJSK 1NVPD 4MVZA 1MSWD 3ASNC 1YXBA 3K57A 1SESA 4DV4B 5K1XA 3OW2U 1AROP 3AG3C 4QE7A 4RUFA 2QKAA 2VQEO 2CTQA 3T1YB 1FJGB 5CA3A 1BSMA 5JCOC 4LF4O 2F4VO 2EIJB 5EIBD 4MVUA 5KHIA 3ZRSA 1FYJA 4QPKA 4JV5B 5LHGA 2DMXA 3K9SA 1YJ9V 3AK3A 2GV9A 5B1NA 2DYSB 1N0NA 5B1AC 3AG1C 4EKWA 2X0LA 1M56C 1F51A 4EFBA 4ZI7A 1W0KG 4FIPC 3HKDA 4ABMA 2ZD9A 5KAFZ 5IY5B 3X2QB 4BIUA 2FYUH 3CRCA 4TQFA 1YHQV 1ZAUA 3BA8A 3L75H 1XDCA 2ZNIA 1FJGO 2P90A 1W0JG 4QIWF 2R70A 1VIBA 1GAXA 1KP3A 4MTOA 5EZYA 1GK9A 3QNEA 4MVRA 3ZCCA 1OCCC 4X88A 1OCOB 2ITCC 4FZ1A 3JAKA 3M8AA 2A79B 2IBZH 2MW2B 3RYHA 1SQPH 3H1IH 1JFFA 5HFMA 1SF9A 4B3TO 3QO7A 4J7ZA 3QTCA 5B5EZ 2HHHO 1BHAA 2VQEB 1PNKA 3T1YO 2PY5A 5KHGA 2UUAO 2IU3A 4NR1A 2P67A 1IXBA 2UXDB 4CH4A 1OCRB 4IHJB 1IBKO 1FXKA 1L0LH 2CAZC 1ZL8A 4O4HA 4HNAA 3F5WC 1OCZB 2UXDO 5IYZB 2M6YA 4IHJA 3JALA 4Q20A 4GZRB 1MABG 1VMGA 3SPHA 2W0XA 4ZBMA 4RUEA 1D5NA 1S3JA 4O2AB 2UXBB 2K9PA 1K5QA 1V54B 5LGUA 2YS8A 3WB2A 2RMKB 2B9ZA 4J11A 5LP6C 3RGBA 3KG2A 4QPJA 5KUMA 2HHHB 1BT8A 1URFA 3E8HA 5JH7A 4E4EA 5TISZ 5IJ9B 2ADQB 3BEHA 2H8PC 1DTOA 3HB3B 3B8NA 2OIEA 3CRAA 2PUSA 2QM7A 2UXXA 5JQGB 2CGOA 3BFRA 1THZA 3EXAA 1HWYA 4H13B 4JI5B 4IIJA 4UCVA 1TAEA 2K1EA 1FXVA 3STLC 4JI0B 1NQTA 2FL4A 2UUBO 3W7WA 5C8YB 2JDIG 3LDDA 5BY1A 5LMNO 4AILC 4OGQB 1NI8A 4JI0O 2PGGA 4UV8A 4HZ3A 2R9IA 4PDLA 5EIBC 3ZJZA 1GTOA 5JWPA 3E22A 3CC4V 1Q82W 3T4DA 3SJQC 3FAVA 1EZVH 4BR6A 4O4LA 3WB1A 1I5YA 5DEDA 2XT9A 1SERA 3E8FA 3JALB 4JAVA 4P9PA 1QQCA 3JARB 5IY5C 5LMNB 3TXQA 1XILA 2E5LO 3N2GB 3ZN1A 3JYCA 4JTAB 4GKJO 2BCCH 2EINB 2HLDG 5CA1B 2LFRA 4K3AA 1NH2B 4ICGA 2NR5A 2Y48A 1HR0O 4DR6O 5H6QA 2GDSA 2Y0PA 4LFBO 5KX5A 3RYCA 2GBOA 1ZSPA 4YHHO 1S5HC 1AI5A 1OCOC 3BPZA 4NB5A 4WFHA 3SJAC 2V4DA 3LNMB 1NKDA 1O9GA 1QBZA 4FFBB 2BSKA 4X1IA 4FM0A 3CMAV 2HJDA 1FXKC 1P49A 5IYDO 5C8YA 2Y4UA 5KA5A 4KHPB 4OX9B 1YIJV 1NBMG 1N36B 4YIPA 2HR3A 4LF6B 1JJOA 4MW8A 1Q5OA 3K59A 3FB7C 4DUYO 4WBNB 1FS0G 1V55C 2VQFB 2WLIB 2HVKC 1M57C 2ZXWB 4PD4F 2Q0AA 3E83A 1WPBA 1TVKA 2Y69B 3CYOA 2JS5A 5B1BB 3ETQA 4WCEV 3JASA 2KB1A 4H37A 3BCCH 2HKOA 3VQWA 5IYBO 4IYIA 5E79Z 2OT5A 4I9WA 4LNUA 5H9CA 2IJKA 2Q67A 2HVJC 3ZRVA 1FFTB 1HNZB 4FLVA 4AQYB 2XAFA 3LSSA 3D36C 1H8HG 5J2TB 5KAIZ 1SRYA 4LFBB 1FXHA 3P30A 4JZ2A 2HP8A 2WLNA 3UKMA 4RQEA 2NLJC 3BY6A 5KUKA 4I4TB 3H1HH 4F6RB 3B40A 4DV7B 1TUBB 2BSKB 1H2KA 2PYLA 3C3TA 1ROPA 4I4TA 3QG5A 2Q6AA 5FNVB 1TA8A 4J7KA 3CRMA 1F23A 3SYOA 2CGNA 2B1IA 5CBFA 3AG1B 2EJRA 1QR8A 3EVKA 4DV7O 3SPGA 5LXTB 4NTYA 5KMGB 3L71H 2ZR2A 5CB4A 4ZHQA 4EB6B 2YICA 2F23A 4X1YA 2FMLA 1VQ6V 1WB8A 2N05A 3CCJV 3UQ8A 4Z1VA 3RYFB 3SYCA 1H38A 2W6IG 1YTFB 2FKXA 2VWJA 5BZBA 5B66Z 3RW0A 4TV8B 3SPCA 4DV1B 3IAYA 4PDVA 4UUJC 3MAQA 3F7VC 1L0NH 5JCOA 2UUCB 1Y76B 3K5OA 1MOFA 2E74B 3SR2C 1VQ9V 4TUYB 3HR0A 4W4LA 4DW0A 1N32O 1WP8A 3FB5C 1RP3B 3OM3B 1PNMA 4R7CA 2Q8VA 3D3IA 4LF5O 3RWRD 1IXMA 2ITDC 3AG2B 1PL0A 1JPXA 2EINC 2OCCC 2YDEA 4JI3B 5IJ9A 4LF5B 4AHCA 1KD1W 1W2BU 2N74A 4ZOLB 1SA0B 1R6KA 4ASUG 4LC1A 3GB7C 2GUZB 3OAAG 4E2LA 2PZSA 1P4RA 2JS3A 3L74H 3FKSG 3U10A 1HW7A 1EN6A 3K9AA 4O2AA 1M1KW 4YHHB 3THOA 3ZHRA 1DLBA 4X65O 3LSUA 2YIAA 4NYKA 2XASA 3E35A 1V54C 2BOBC 3TETA 3GVMA 4DXWA 3JD3A 2XAJA 3M99B 5EC1C 1K92A 1LNQA 1XL6A 3QO8A 1O9HA 1SQXH 2ZM6O 3P3PA 2P6JA 3K5NA 1ZUQA 2AZ2A 4N21A 1U96A 3DGEA 5FLXN 1Y74A 3STZC 3FB8C 3Q4HB 1D2DA 4MTXA 4D6TH 4GX2A 3RYCB 4ZHQB 4CC5A 4OPAA 1QLNA 4K0KO 2LGQA 1BCCH 4QNHB 4JAAA 1BMFG 3G6BA 3WU2Z 4GKKO 2WWWA 1SQQH 1SC5B 2A0LA 1GKFA 3A0RA 2CTWA 2N04A 2V1DA 1VQMV 1JOYA 3C90A 1W59A 4RWUA 3KZIZ 2NNUA 4DR4O 3W7XA 4X64B 1M4UA 3K04A 3VQVA 2FB5A 1YJWV 4YJ2A 4JI8B 2CK3G 2X7RB 2BOCC 4IYHA 5LOVB 4JI7O 1NJIW 1HNWB 3DTUB 1BQZA 1KYOF 3K06A 1WPXA 4O4HB 3S3WA 2Y4TA 2R72A 5LYJB 1XOUA 1MG1A 3VQYA 1B06A 2H3OA 5DN6G 3E22B 4DV2B 4OXSA 1AP6A 3AEIA 2RQ6A 3L73H 5LP6A 4GKKB 3N27A 4NXMO 3ZHVA 3ZS8C 1NR1A 1AR4A 3HKCB 2F66C 2KQXA 1VQLV 4LF9O 2GSMB 1H2MA 4CBCA 1OCCB 2DJVA 2GTAA 5CA1A 3CXCU 3G71V 1OZ0A 2X6AA 4DRXB 4YJ3A 2KG7A 3LNNA 1RM1C 1G6UA 1XHXA 2KSDA 4JF3A 2RNBA 4B3MB 1S5JA 5FPRA 1P7BA 3L70H 5B3SC 1TGOA 2PI5A 4JPRA 1Q43A 1GN6A 3UCSC 4JYAB 2YI8A 1IVSA 2IJHA 4NXNO 2ZCEA 3A0HZ 2ARHA 2ADPA 1KECA 4X1IB 2LFSA 4PI2A 2E76B 2QWNB 1RPRA 4QE9A 4XDKA 4DR3O 2Q73A 5JJEB 1F7YA 4LF9B 1J5EO 1SQVH 1XNRO 1I94B 4EFEA 3OGCC 1RM1B 2GUZA 1R3IC 1GRJA 3BA9A 2Y0IA 1S77D 3UT5B 2EIKB 4UB8Z 1YSCA 3JASB 4LCUC 5LHHA 2H94A 4OPHA 1NTZH 5IWAB 2P22C 5KHHA 1GN3A 3HKCA 2HFEC 5EYPA 2P4VA 1FKAO 3JD0A 4I9QA 4DRXA 4A5UB 4DR2B 3APOA 2QKCA 5JH7B 5BR8O 4R50A 3RYFA 4H33A 1AJQA 3E8GA 4NKGB 1SZTA 2AGAA 3MD0A 4X64O 4FK5C 4BWAA 2XAHA 3QO5A 4J80A 1FFXB 1QCEA 3CCVV 1IDSA 4IIJB 2EIKC 5L3BA 1KMIZ 4DV4O 1K4CC 1SQBH 2WLHA 3K5LA 1Q6HA 2P5OA 2ZDIA 3IC9A 4U3JA 4ZIBA 2ZE6A 3AG3B 4DR4B 1Y67A 4CS3A 1QR9A 3OD4A 2JIZG 3VBBA 3KCXA 5BMVB 3AK2A 2YUAA 4MTGA 4JI1O 1NTKH 1EBOA 1K34A 2A9HA 2Q9LA 3JARA 4I50B 4JI5O 2CDYA 2ZM6B 4GUNA 5JJNB 2JGDA 1VF5B 1RPOA 1YTFD 2OIGA 4L87A 2QTOA 4B08A 3CRRA 3OMIB 2QWPB 1X4TA 1HDJA 4G28B 3G67A 5IYZA 4K8XA 1KB9F 2ZNJA 1PPJH 2JGDB 4LF8B 2WLMA 3IC7A 3EHBB 4TV8A 2LW7A 4MVSA 1YCIA 2BTOA 5KLVH 1XREA 1CPYA 2X6CA 2XAGA 1G4YB 1OCRC 4UCTA 3UO2A 2EJ7A 3IJ4A 3DXRB 3AG4B 1B3QA 3HKDB 2EILC 1QHTA 2E75B 2YIBA 1IBLO 1BZKA 3ZBHA 4LF7O 1WA8A 3QF7A 3SYAA 3JATA 5DECA 1YJNV 2RN9A 5GONB 2EIMB 4J9ZB 1HNWO 1TUBA 4LF6O 4WFAV 2ZE8A 1VARA 4TQDA 1Q6IA 1N36O 5L3DA 1KP2A 1K5SA 3W7TA 4Z1MG 1LR1A 1KKDA 1FXKB 2PF4E 3RVYA 4DV1O 4DR1B 4JI1B 5DM6V 3OUSA 2IU0A 3OUFA 2ATKC 4G27B 3OEHG 3CP1A 3JSNA 4RO2A 4JTDB 3UO3A 1YDXA 3CMEV 1OCZC 1XMQO 5A9GA 2CTPA 3FYEB 1COWG 2OCHA 1QNMA 1XBLA 2RCVA 3OFNG 4LBEC 2QSAA 3OMNB 2EZPA 4PDMA 4R6ZA 2L35A 3KCYA 5B1BC 3B8MA 2CE4A 2XTAA 3K3WA 1AR5A 1DF5A 4P30A 1SQGA 3ABTA 2IJIA 3A2FA 4JI2B 3SPIA 1VQNV 3D36A 1K3EA 2IJJA 5IJ0B 4XDJA 4K0KB 4UFZA 4K8ZA 1FAFA 5BR8B 3SJCC 3FFQA 1S76D 1E1QG 2XOKG 2CUGA 4MW3A 2P4KA 2A7WA 4H0LB 4JASA 2KG7B 4X62B 2JVDA 2ILMA 1AVMA 2EBOA 1QU7A 1DK1A 3ZHUA 1XEQA 2CH7B 1IBMB 1SKVA 2ZKOA 4IT5A 3RVZA 2CTRA 1SA0A 3K0GA 4HYOA 5KMGA 4FLWA 4LH7A 4O2BA 4PDRA 2Q68A 4UXNA 4G2KA 4TV9B 1Q6UA 2BTQB 2E3CA 4DYLA 1J5EB 4KFMA 2ODMA 4L8JA 2MK3A 5LP6B 4D7TA 1NVPB 5B1AB 4LWSA 3IFXA 1AJPA 1AILA 1Y6XA 1GM9A 1D5AA 2HG5C 1P7GA 2WLLA 2UXBO 2DWDC 4FFKA 5IJ0A 4PHZA 4X66B 4DR5B 1IBMO 1FD9A 3ZN0A 3APQA 1MNGA 4TT3G 4B3TB 4O4IA 4X9QA 1JJ2U 2GHYA 4FM2A 1HNXB 1VP7A 4JI6B 3E86A 3K58A 2JK5C 2DYSC 1P84F 2YIDA 2DQ0A 4MVOA 1JMKC 1GM7A 4KHPO 1B6QA 1WB7A 3TGUH 5KA6A 1L1FA 4TWKA 3VOUA 1KUQA 1Y66A 4GCZA 4UCSA 2PI4A 2WAMA 1T5EA 4MTFA 1ZTEA 3CC7V 4MS2A 1XI1A 2ZIMA 5CA0B 1JX9A 4O2BB 4YY3O 1VQOV 4RQFA 2A06H 4JI7B 4WFFA 1PL4A 3RN4A 3ABLB 1PNLA 1OV9A 3A8TA 1V55B 4FLTA 5B1OA 2KKWA 1HR0B 1Y76A 2EIJC 3DC5A 2W6JG 1VF6C 4JI4O 4DUZO 1KKCA 5FPOA 2QM4A 3B4SA 5ITZA 1NH2D 3N2GA 1G1XB 4XBFA 4HNAB 1AI4A 2GTSA 3OEEG 4FLXA 1ZLZA 4J7JA 5J2UA 2WLLB 4UCUA 2R9RB 4IGGA 1VQKV 3ML0A 4F6EA 3ZIAG 2DYRC 4F6RA 3I56V 4CH5A 2Z3YA 1F4MA 3CC2V 4ZOLA 1HNXO 2YEVB 4B3SB 2YI9A 1IZ3A 1XMQB 5JVDA 2IW5A 3T1HB 1JFFB 2XAQA 3RYHB 1R6TA 4JV5O 3DXRA 2Z0AA 1SS3A 1EN4A 4RAIA 4JI3O 3NR7A 2JEUA 3CS5A 4TV9A 2QTSA 4W4KA 2F93B 1H2LA 4B7EA 1R73A 4MVQA 1US6A 1HP8A 2WA4A 5BMVA 5IDJA 4O4IB 4LFCB 5C93A 5EK0A 1H8EG 1VQ8V 4YIOA 1QVFU 2QDOA 2QKSA 4MT8A 1DGSA 2DQ3A 5L3EA 2WLIA 3K5MA 4I50A 2QA4V 1XNQB 4KP4A 4WFEA 4BIZA 3DSQA 2VS0A 4UCOA 3ETEA 2OWOA 3ZMUA 2ZDIC 1L8DA 4CS2A 4LNUB 4DV6B 3I55V 2UUAB 1WAZA 4DV2O 3ZMSA 1RSOA 1WN7A 2JJ1G 3C3SA 4B3MO 4GKJB 4X89A 2AHYA 1FFXA 3JAKB 4J9YB 2OYQA 4PV1B 4GX1A 1MZEA 1Q8IA 1RSOB 3CSXA 5LA6A 5KHJA 2Y69C 1YEWA 2YEVA 3IGAC 5ITZB 1WA8B 2JRIA 1EN5A 1JVMA
chains in the Genus database with same CATH topology
1M90W 2EIKC 3CMAV 5L3BA 1K4CC 1FXKC 2OCCB 2WLHA 4I5SA 4WFBV 1S72V 5IYDO 2ZDIA 1K8AW 5KA5A 2QEXV 4YXWG 1YIJV 1PD3A 1K7DA 3AG3B 1NBMG 5L3GA 1AI7A 5L3FA 2HR3A 3ABLC 4FMTA 4PA9A 4MW8A 1K4DC 1QR9A 3ASOB 2JIZG 3F7YC 3VBBA 3UM7A 3FB7C 4X8AA 3T2MA 1FS0G 1G8MA 1V55C 1JCHA 5IYCO 1VQ5V 2IH1C 2WLIB 4MTGA 3TK1A 2HVKC 1M57C 2W0FC 1EBOA 2ZXWB 3E83A 1K34A 3WG7B 3ZRXA 1K73W 3ASOC 4U7NA 1EZJA 1E79G 2A9HA 2Y69B 2QM8A 3CYOA 3EFFK 5B1BB 3CCSV 4WCEV 1KQSU 3JCZA 2KB1A 4H37A 2HKOA 1M57B 1Y4MA 4P9OA 2EIMC 5IYBO 1RPOA 2V7QG 4L87A 3ZRWA 1YTFD 2WPDG 2QTOA 3ETDA 3OMIB 4BAYA 3CCQV 2OT5A 4G28B 4I9WA 5H9CA 1BHBA 3CCRV 2IJKA 2Q67A 2WLMA 3IC7A 4PA7A 5GW7A 1K97A 2HVJC 3ZRVA 1YI2V 3EHBB 4MVSA 1FFTB 1CPYA 3R65A 5B3SB 2X6CA 2XAFA 2XAGA 3LSSA 1G4YB 1OCRC 5H6RA 1KC8W 1H8HG 4JYCA 3MHHC 3AG4B 1SRYA 2EILC 1FXHA 5LBQA 3P30A 2DW4A 1SETA 3K79A 2WLNA 3UKMA 4RQEA 2NLJC 3BY6A 5KUKA 2Z5UA 3CCEV 3ABMC 3SYAA 1YJNV 3RBZA 3ABUA 3NXSA 3K0DA 3CCLV 1CEZA 4JYBA 4UVBA 2WLJA 1JQ0A 2EIMB 2F43G 4J9ZB 3G6EV 1ROPA 2Q6AA 5FL7G 4P2ZA 3G4SV 2X6BA 3W7UA 1F23A 3SYOA 2IH3C 4WFAV 2B1IA 5CBFA 3AG1B 5L3DA 1KP2A 1QR8A 2EJRA 1K5SA 1QLEB 3W7TA 4CZZA 3SPGA 2OTLV 3W7SA 3MHSC 4DO2A 4Z1MG 1KKDA 4WFGA 1FXKB 5LHIA 4GX5A 1VQ7V 4GT1A 3RVYA 2C2AA 1QLEC 1ENVA 2ZR2A 5DM6V 1UJWB 1R3JC 3OUSA 5CN0A 5LGNA 1K33A 4LP8A 2IU0A 3OUFA 2ATKC 4G27B 3OEHG 3CP1A 4N23A 1VQ6V 4RO2A 4JTDB 4JGSA 4UV9A 3CMEV 1OCZC 1XL4A 3CCJV 3AG2C 3ABKC 3CCMV 3FYEB 1COWG 3FYIB 3SYCA 1H38A 2W6IG 1YTFB 3OFNG 5BZBA 1I5XA 3OMAB 4LBEC 3RW0A 1M9NA 3SPCA 1ORQC 1E1RG 3OMNB 4PDVA 2EZPA 4PDMA 4R6ZA 3GWOA 4KUMA 4UUJC 2UXNA 2QE7G 5B1BC 5CBGA 3B8MA 3B77A 3F7VC 4XDLA 3CPWU 2M7WA 5EBWC 3K3WA 3E2EA 3LSQA 1DF5A 1J95A 3JD4A 4FJCC 1QVGU 1F4NA 1MOFA 1WLEA 4P30A 3T1CA 3ABTA 2IJIA 2DYRB 1VQ9V 3SPIA 1VQNV 3D36A 1K3EA 2IJJA 3CCUV 4PA4A 3OE7G 4XDJA 3SPJA 3ZRWB 1ZWIC 3FB5C 3E8BA 4UVAA 3OM3B 1PNMA 4R7CA 4WF9V 3P32A 1S76D 3D3IA 1E1QG 3ASNB 3FB6C 2XOKG 1OHHG 1IXMA 2ITDC 3AG2B 1PL0A 4MW3A 5E1AC 1K9MW 1JPXA 3LUTB 4QJFB 2EINC 3AG4C 3JD2A 4JASA 4GX0A 2YSUB 3PJSK 1NVPD 4MVZA 1MSWD 2OCCC 3ASNC 1KD1W 4PELA 1SESA 2HJFC 2EBOA 4PA6A 1W2BU 5J9PC 3ABKB 1R6KA 3OW2U 4LC1A 4ASUG 4JTCB 3ABMB 1AROP 4FPPA 3GB7C 3AG3C 3OAAG 4QE7A 4RUFA 4E2LA 1PKXA 1VQ4V 1P4RA 2ZXWC 5CA3A 2WLKA 2EIJB 4MVUA 2ZR3A 3FKSG 2AHZA 3ZRSA 3RVZA 1M1KW 3K9AA 3K0GA 4QPKA 4HYOA 1DLBA 2B1GA 1DF4A 5LHGA 1YJ9V 4PDRA 3LDCA 5B1NA 2Q68A 2DYSB 2XASA 3E35A 4UXNA 1V54C 4G2KA 5B1AC 2BOBC 3AG1C 3TETA 2D3OW 4EKWA 4DXWA 3JD3A 2X0LA 2XAJA 3M99B 5EC1C 1K92A 1LNQA 1XL6A 3QO8A 4KFMA 1M56C 1F51A 1W0KG 4FIPC 4HAMA 3X2QC 2P6JA 2MK3A 1NVPB 4N21A 5B1AB 2ZD9A 3IFXA 3ZMZA 1AJPA 3DGEA 5CMUA 1M56B 5IY5B 1AI6A 2P7TC 1GM9A 3X2QB 4BIUA 3STZC 2EZOA 3FB8C 2HG5C 3OR6C 3CD6V 1YHQV 2WLLA 4MTXA 4GX2A 2DWDC 3WG7C 1NR7A 2P90A 1W0JG 2LP7A 3ZN0A 4QIWF 1N8RW 2WSSG 4TSFG 4QNHB 2EILB 1QLNA 3TCUA 1KP3A 1R3LC 4MTOA 1BMFG 2WWWA 1GK9A 4TT3G 2A0LA 1GKFA 3JD1A 3A0RA 3QNEA 3ZMTA 1JJ2U 2GHYA 4MVRA 3ZCCA 2V1DA 3E86A 1VQMV 1JOYA 1OCCC 4JAUA 4X88A 1OCOB 2JK5C 2ITCC 2DYSC 2A79B 2NNUA 3W7XA 3OR7C 2DQ0A 4MVOA 1GM7A 3K04A 5HFMA 1B6QA 3E89A 1YJWV 5KA6A 1CP9A 2CK3G 3QO7A 4TWKA 2X7RB 1L1FA 3VOUA 1Y66A 2B5UA 2BOCC 4GCZA 2PI4A 2WAMA 4UVCA 1R6NA 1BHAA 1PNKA 4MTFA 1NJIW 3CC7V 4MS2A 2IU3A 3DTUB 1JX9A 4MSWC 3K06A 1WPXA 1VQOV 2P67A 4RQFA 4BW5A 1MG1A 4WFFA 1GMGA 3ABLB 1OCRB 1PNLA 1R3KC 5DN6G 1FXKA 1VQPV 4OXSA 1V55B 3AEIA 3F5WC 5B1OA 1OCZB 2EIJC 2W6JG 3SYQA 1NR1A 4F4LA 3H01A 3T4ZA 1GO3F 4Q20A 5L3CA 1NH2D 1VQLV 1MABG 2GSMB 3SPHA 4XBFA 1AI4A 4ZBMA 4RUEA 1OCCB 4CBCA 1S3JA 2DWEC 3CXCU 1Q81W 1YITV 1K5QA 3OEEG 1V54B 3G71V 5LGUA 2WLLB 1OZ0A 4PA3A 2R9RB 3SYPA 2X6AA 1VQKV 1BL8A 3ML0A 3ZIAG 2DYRC 3KG2A 4QPJA 5KUMA 4JF3A 1RM1C 2ZQMA 3I56V 4U7OA 1P7BA 3E8HA 3ETGA 3K08A 2Z3YA 5B3SC 1F4MA 3CC2V 2PI5A 2YEVB 5EC2C 1GM8A 4JPRA 2JEXA 3WFVA 3BEHA 2H8PC 1Q7YW 1DTOA 3HB3B 2IJHA 2IW5A 3B8NA 2QM7A 2UXXA 2XAQA 3HPLC 1THZA 2JJ2G 1KECA 1HWYA 5EBLC 2LFSA 1S0VA 2K1EA 1FXVA 3STLC 4RAIA 1RPRA 1NQTA 4QE9A 4XDKA 3W7WA 2JEUA 1H2GA 5HFLA 1AR1B 2JDIG 3LDDA 1R73A 4MVQA 4UV8A 5EBMC 3OGCC 5IDJA 5C93A 1RM1B 4HZ3A 2R9IA 4PDLA 1R3IC 5EK0A 1GTOA 3ZJZA 1H8EG 1VQ8V 3CC4V 1Q82W 1QVFU 3T4DA 1S77D 3SJQC 2QKSA 2EIKB 4MT8A 2DQ3A 5L3EA 2WLIA 4R8CA 1YSCA 1I5YA 2QA4V 3E8FA 1SERA 4KP4A 4JAVA 4P9PA 5IY5C 4LCUC 4MVMA 5LHHA 2FTKA 4WFEA 4BIZA 2H94A 3ZN1A 3ETEA 3JYCA 2HFEC 4JTAB 3ZMUA 2ZDIC 2EINB 1TUEB 3JD0A 2HLDG 3I55V 2LFRA 3ZMSA 1NH2B 2Q69A 2OTJV 2JJ1G 2Y48A 4X89A 3LDEA 5H6QA 5CBHA 4R50A 2AHYA 4H33A 1AJQA 3K03A 3E8GA 1EFRG 4J9YB 1SZTA 4GX1A 3MD0A 1S5HC 1AI5A 4FK5C 1OCOC 2XNDG 4WFHA 5LGTA 2Y69C 1Q86W 2YEVA 3IGAC 2XAHA 3QO5A 3LNMB 1NKDA 1QBZA 1QCEA 3ZMVA 3CCVV 1JVMA 1AJNA 4ZKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL8 A;  3X2Q C;  1KKD A;  3SYP A;  2EIK C;  4WFG A;  2DYR C;  3KG2 A;  5KUM A;  1K4C C;  4GX5 A;  2ZD9 A;  3IFX A;  3RVY A;  1P7B A;  3E8H A;  2WLH A;  3K08 A;  1QLE C;  5B3S C;  1R3J C;  2P7T C;  3OUS A;  4LP8 A;  3OUF A;  5EC2 C;  3STZ C;  3FB8 C;  2ATK C;  2HG5 C;  3OR6 C;  4G27 B;  3BEH A;  2H8P C;  4RO2 A;  2WLL A;  3ABL C;  4JTD B;  4GX2 A;  4PA9 A;  2DWD C;  1K4D C;  4MW8 A;  1OCZ C;  1XL4 A;  3WG7 C;  3AG2 C;  3ABK C;  3F7Y C;  3HPL C;  3SYC A;  3UM7 A;  3FB7 C;  3SPG A;  4X8A A;  3T2M A;  4QNH B;  1V55 C;  5BZB A;  2IH1 C;  2WLI B;  4LBE C;  4MTG A;  5EBL C;  3RW0 A;  3SPC A;  3TCU A;  2HVK C;  1M57 C;  1ORQ C;  2K1E A;  2W0F C;  3E83 A;  1R3L C;  4MTO A;  3ASO C;  4PDV A;  2A9H A;  4PDM A;  4R6Z A;  4RAI A;  3STL C;  4QE9 A;  4XDK A;  4UUJ C;  3EFF K;  2A0L A;  5B1B C;  5CBG A;  3F7V C;  4XDL A;  3LDD A;  2KB1 A;  4H37 A;  5EBW C;  4MVR A;  4MVQ A;  1J95 A;  3E86 A;  4P9O A;  1OCC C;  4X88 A;  4P30 A;  2EIM C;  2JK5 C;  3T1C A;  2ITC C;  2QTO A;  5EBM C;  2DYS C;  3OGC C;  2A79 B;  4HZ3 A;  5EK0 A;  4PDL A;  1R3I C;  3SPI A;  3OR7 C;  3ZJZ A;  4MVO A;  3K04 A;  4G28 B;  4I9W A;  3E89 A;  4PA4 A;  4XDJ A;  3T4D A;  3SJQ C;  3SPJ A;  1ZWI C;  3FB5 C;  3E8B A;  2QKS A;  4TWK A;  2Q67 A;  2WLM A;  4PA7 A;  3VOU A;  4R7C A;  2HVJ C;  2WLI A;  4R8C A;  4MVS A;  2BOC C;  3E8F A;  3FB6 C;  3R65 A;  2X6C A;  4P9P A;  4MTF A;  5IY5 C;  1G4Y B;  1OCR C;  2ITD C;  4LCU C;  4MW3 A;  4MVM A;  5E1A C;  4MS2 A;  4WFE A;  3LUT B;  2EIN C;  4MSW C;  3AG4 C;  3K06 A;  2EIL C;  4GX0 A;  3PJS K;  4MVZ A;  2OCC C;  3ASN C;  3JYC A;  4BW5 A;  2HFE C;  4WFF A;  2WLN A;  2HJF C;  4JTA B;  3UKM A;  4PA6 A;  2NLJ C;  5J9P C;  5KUK A;  1R3K C;  3ABM C;  4JTC B;  3SYA A;  3GB7 C;  3AG3 C;  4QE7 A;  3RBZ A;  4RUF A;  4OXS A;  3K0D A;  2ZXW C;  2Q69 A;  2WLK A;  3F5W C;  2WLJ A;  4MVU A;  4X89 A;  3LDE A;  2EIJ C;  4J9Z B;  2AHZ A;  3SYQ A;  5CBH A;  4R50 A;  2AHY A;  3ZRS A;  3RVZ A;  4F4L A;  4H33 A;  3K0G A;  3T4Z A;  3K03 A;  4HYO A;  2Q6A A;  3E8G A;  4J9Y B;  4GX1 A;  1S5H C;  4P2Z A;  3SPH A;  2X6B A;  1OCO C;  4PDR A;  4ZBM A;  3LDC A;  4RUE A;  4WFH A;  3SYO A;  2DWE C;  2Y69 C;  2IH3 C;  2Q68 A;  4CBC A;  2YEV A;  3IGA C;  1V54 C;  5B1A C;  2BOB C;  3AG1 C;  3LNM B;  5CBF A;  3TET A;  4EKW A;  4DXW A;  5EC1 C;  2WLL B;  1LNQ A;  1XL6 A;  2R9R B;  4PA3 A;  1JVM A;  4KFM A;  2X6A A;  1M56 C; 
#chains in the Genus database with same CATH topology
 4PI0 A;  1M90 W;  1NU1 H;  4JI2 O;  2CH7 A;  5F2V O;  1UPG A;  4TUY A;  4YY3 B;  4IL6 Z;  3ZX6 A;  4YXW G;  4NTX A;  1PD3 A;  1ZL8 B;  1AI7 A;  2VWK A;  3ABL C;  3ASO B;  3D8C A;  1FPO A;  1PV0 A;  5GTI Z;  3T2M A;  5LOV A;  1G8M A;  5LMU O;  1JCH A;  1VQ5 V;  2IH1 C;  1NZ6 A;  3TK1 A;  4JI4 B;  4FZ0 A;  3ZRX A;  2YIB D;  2QR4 A;  4CC6 A;  3UT5 A;  5AG2 A;  3J80 N;  5CB4 B;  2Q7G A;  1KQS U;  5LMU B;  4JI6 O;  4LWS B;  4B3R O;  1ZX3 A;  1M57 B;  4EB6 A;  1NS1 A;  4YJ3 B;  2EIM C;  3M7M X;  3ETD A;  2BE3 A;  4FLY A;  2DE0 X;  3CCQ V;  3SGI A;  2A3Q A;  5KHK A;  1EM1 A;  4X1K A;  2F95 B;  3CCR V;  4X66 O;  4PA7 A;  5GW7 A;  2QWQ B;  3R65 A;  4I0X B;  4DR2 O;  2LGW A;  1KC8 W;  5EZY B;  3MHH C;  5LBQ A;  3N2K B;  2DW4 A;  2DN9 A;  3A0B Z;  1SET A;  3CCE V;  3ABU A;  3NXS A;  3OT7 A;  3CCL V;  1PP9 H;  4NTW A;  4JYB A;  4UVB A;  1JQ0 A;  4BW9 A;  4UCR A;  3O65 A;  4O4J A;  5FL7 G;  2Q0O C;  2BTQ A;  4D7S A;  4P2Z A;  3G4S V;  4ZI7 B;  1SQF A;  3OTO O;  4GYC B;  1N34 O;  4DV5 O;  3W7S A;  3MHS C;  4DR3 B;  4DO2 A;  5GTH Z;  3AG7 A;  1VQ7 V;  4I55 B;  3RYI A;  1I08 A;  1UJW B;  1XMO O;  3BAA A;  1R3J C;  5LGN A;  1K33 A;  1I0H A;  4HBN A;  2ZT9 B;  3P3N A;  3L72 H;  1VF7 A;  4UV9 A;  4K35 A;  1XL4 A;  3AG2 C;  3CCM V;  2AXT Z;  3CWB H;  2ZIN A;  3ICX A;  4DR7 B;  1ORQ C;  1Y74 B;  3GWO A;  4KUM A;  2RJZ A;  5D5P A;  2QE7 G;  5CBG A;  2HEP A;  3CPW U;  2QWO B;  3DC6 A;  5EBW C;  1N32 B;  3LSQ A;  3RT3 C;  3N2K A;  5JJJ B;  1F4N A;  1WLE A;  3R66 A;  4X62 O;  4JYY A;  4B3S O;  2UUC O;  1PM9 A;  4CH6 A;  3OE7 G;  4JI8 O;  4UVA A;  3H1L H;  4WF9 V;  2YXY A;  2QJ1 A;  1OHH G;  1K9M W;  3LUT B;  2ZE7 A;  3AG4 C;  1XQ8 A;  4DV3 O;  1XHZ A;  4PEL A;  5D5Q A;  2HJF C;  4LF4 B;  4PA6 A;  5J9P C;  3ABK B;  3CEI A;  4B3R B;  4JTC B;  3ABM B;  4FPP A;  5JVD B;  1N0J A;  1PKX A;  1VQ4 V;  4CS4 A;  2ZXW C;  1H2N A;  2WLK A;  2ZR3 A;  2AHZ A;  4DK0 A;  3JAT B;  3JCU Z;  1S5L Z;  4U3F H;  3H1K H;  5LYJ A;  1Q3E A;  2B1G A;  1DF4 A;  1Z2G A;  3LDC A;  1Q90 D;  3ZHS A;  2D3O W;  5IWA O;  4QGP A;  4J41 A;  2UXC O;  4HAM A;  3X2Q C;  4FLZ A;  4LF7 B;  3B09 A;  1H2S B;  1B04 A;  3ZMZ A;  5CMU A;  1M56 B;  3OGI B;  1BGY H;  1AI6 A;  2F1M A;  2P7T C;  1WJZ A;  2EZO A;  3OR6 C;  4Q6G A;  1GN2 A;  3CD6 V;  2R9A A;  3BRC A;  3WG7 C;  1WP7 A;  1NR7 A;  1RFY A;  2O57 A;  1JR9 A;  3CX5 F;  1XUQ A;  5K1P A;  2LP7 A;  1N8R W;  2WSS G;  4TSF G;  2EIL B;  4BIO A;  3L9D A;  3TCU A;  3CJH B;  4O4J B;  4AQY O;  2VRZ A;  2ZIO A;  1R3L C;  3O9O A;  3OTO B;  2WA3 A;  4J10 A;  3JD1 A;  1CXZ B;  2JGU A;  3F5T A;  3ZMT A;  3HKB B;  3QVN A;  2UU9 O;  4JAU A;  2NN4 A;  3D3Q A;  3OR7 C;  5JQG A;  3E89 A;  1OJH A;  1CP9 A;  1IBK B;  2LO1 A;  1BQ0 A;  4DW1 A;  2B5U A;  1X59 A;  5FNV A;  3SJB C;  4UVC A;  1R6N A;  5LL6 Y;  1NT2 B;  4GLX A;  4MSW C;  3RFR A;  4BW5 A;  3H1J H;  1GMG A;  5LXT A;  1R3K C;  4FM1 A;  1VQP V;  4LFA O;  4X1K B;  3SYQ A;  4C7U A;  4F4L A;  3H01 A;  3T4Z A;  1GO3 F;  5L3C A;  1WNS A;  1A32 A;  1SZX A;  2DWE C;  1Q81 W;  1YIT V;  2EX3 A;  4PA3 A;  3SYP A;  1BL8 A;  1BE3 H;  3JAW A;  2ZQM A;  4U7O A;  3K08 A;  3ETG A;  4X20 A;  5J2U B;  3JAM N;  2UXC B;  5EC2 C;  1GM8 A;  4KL1 A;  2JEX A;  3WFV A;  3PN1 A;  1Q7Y W;  3G80 A;  4I0X A;  3HPL C;  4FFB A;  3CXH F;  4NVP A;  3BHP A;  2JJ2 G;  4DUZ B;  4YJ2 B;  3FD9 A;  5EBL C;  1S0V A;  4U3J B;  1H2G A;  5HFL A;  1MA1 A;  1AR1 B;  5H2F Z;  4FVM A;  1MMM A;  5EBM C;  1HNZ O;  3B2E E;  1GH6 A;  3HKB A;  1IX9 A;  2G38 A;  1GN4 A;  2PYJ A;  4DV0 B;  4PJ0 Z;  1Z5V A;  4R8C A;  2LJ2 A;  1IBL B;  3VQX A;  1TVK B;  4MVM A;  1XNR B;  2FTK A;  1UFI A;  4DV6 O;  1N4C A;  2Q4P A;  3I5D A;  1XNQ O;  1AP5 A;  2XUM A;  3CHX A;  1VF6 A;  3HKE B;  3SDL A;  1TUE B;  4DK1 A;  1IUR A;  3TXS A;  4LH6 A;  2Q69 A;  2OTJ V;  1N33 B;  3LDE A;  4KXR A;  5CBH A;  3ZED A;  5EYP B;  3K03 A;  3JAW B;  1EFR G;  4DR5 O;  3TJT A;  3ZHT A;  2RDC A;  2XND G;  2YXH A;  2DOS A;  5LGT A;  4NXN B;  1Q86 W;  4FLU A;  1NTM H;  4JYA O;  4OX9 O;  3ZMV A;  4I55 A;  3RYI B;  1AJN A;  4WFB V;  4ZKI A;  1R1B A;  5GON A;  2ZE5 A;  5CA0 A;  3CRQ A;  2OCC B;  1BS3 A;  4I5S A;  1S72 V;  1K8A W;  4DUY B;  1LUW A;  2QEX V;  4JZG A;  1K7D A;  5L3G A;  3ZHQ A;  5L3F A;  4FMT A;  4PA9 A;  1K4D C;  3GWK C;  4TOI A;  3F7Y C;  5BXZ A;  3UM7 A;  4X8A A;  3S3X A;  3BVO A;  4EEQ A;  5IYC O;  2EUL A;  2LW1 A;  3CE2 A;  1K73 W;  2W0F C;  3WG7 B;  4O4L B;  4DR6 B;  3ASO C;  4U7N A;  1EZJ A;  1E79 G;  3FAV B;  2L6L A;  2QM8 A;  3EFF K;  3CCS V;  1LUV A;  3JCZ A;  1Y4M A;  4X1Y B;  4P9O A;  5IE9 A;  4AI8 A;  2V7Q G;  3ZRW A;  2WPD G;  3Q4H A;  4BAY A;  4X20 B;  5J2T A;  1BHB A;  3WB0 A;  1K97 A;  1YI2 V;  2YXL A;  2PTM A;  3U11 A;  5B3S B;  1YVW A;  3FX7 A;  5H6R A;  3J7A U;  4JYC A;  5KX5 B;  5LA6 B;  4Z2W A;  3K79 A;  5IT9 N;  2Z5U A;  3ABM C;  2E5L B;  5H5N A;  3RBZ A;  3K0D A;  1CEZ A;  2QGN A;  2UUB B;  2WLJ A;  3CB2 A;  2ETN A;  3MDS A;  2F43 G;  1I94 O;  3G6E V;  4H44 B;  3J81 N;  1KBH A;  3H9V A;  3BAB A;  2QWR B;  2X6B A;  3W7U A;  1M93 A;  1JA8 A;  4DR1 O;  2IH3 C;  1MSD A;  4DV3 B;  1V9P A;  4LR3 A;  2Q5Z A;  1QLE B;  4CZZ A;  2OTL V;  1MZF A;  4WFG A;  5LHI A;  2F4V B;  4GX5 A;  2Q7E A;  4GT1 A;  4DR7 O;  2C2A A;  4LFA B;  2D2C B;  1QLE C;  1ENV A;  4I7Z B;  5CN0 A;  4LP8 A;  4X65 B;  3HKE A;  1KU9 A;  3AK1 A;  4N23 A;  1I7F A;  4JGS A;  1N33 O;  1AB3 A;  2Q7H A;  3ABK C;  1Z5W A;  2XHB A;  3FYI B;  4B7K A;  1XMO B;  2IM9 A;  1I5X A;  3OMA B;  1M9N A;  1YF2 A;  1E1R G;  4WBN A;  2YC0 A;  3KKY A;  2UU9 B;  2UXN A;  3U0Z A;  3B77 A;  4XDL A;  2M7W A;  4J42 A;  3E2E A;  3JD4 A;  1J95 A;  4DV5 B;  4FJC C;  1QVG U;  2AZ0 A;  4LFC O;  3T1C A;  1N34 B;  4CH3 A;  4NXM B;  2DYR B;  4UB6 Z;  2LQT A;  1VEW A;  3CCU V;  4PA4 A;  4DV0 O;  2P06 A;  3SPJ A;  3ZRW B;  1ZWI C;  3E8B A;  3CJH A;  3T1H O;  3P32 A;  1U97 A;  3ASN B;  3FB6 C;  4LF8 O;  5A2Q N;  2VQF O;  5E1A C;  3OTF A;  2AW9 A;  1M5I A;  1YZB A;  4QJF B;  3JSL A;  3JD2 A;  4GX0 A;  2YSU B;  3PJS K;  1NVP D;  4MVZ A;  1MSW D;  3ASN C;  1YXB A;  3K57 A;  1SES A;  4DV4 B;  5K1X A;  3OW2 U;  1ARO P;  3AG3 C;  4QE7 A;  4RUF A;  2QKA A;  2VQE O;  2CTQ A;  3T1Y B;  1FJG B;  5CA3 A;  1BSM A;  5JCO C;  4LF4 O;  2F4V O;  2EIJ B;  5EIB D;  4MVU A;  5KHI A;  3ZRS A;  1FYJ A;  4QPK A;  4JV5 B;  5LHG A;  2DMX A;  3K9S A;  1YJ9 V;  3AK3 A;  2GV9 A;  5B1N A;  2DYS B;  1N0N A;  5B1A C;  3AG1 C;  4EKW A;  2X0L A;  1M56 C;  1F51 A;  4EFB A;  4ZI7 A;  1W0K G;  4FIP C;  3HKD A;  4ABM A;  2ZD9 A;  5KAF Z;  5IY5 B;  3X2Q B;  4BIU A;  2FYU H;  3CRC A;  4TQF A;  1YHQ V;  1ZAU A;  3BA8 A;  3L75 H;  1XDC A;  2ZNI A;  1FJG O;  2P90 A;  1W0J G;  4QIW F;  2R70 A;  1VIB A;  1GAX A;  1KP3 A;  4MTO A;  5EZY A;  1GK9 A;  3QNE A;  4MVR A;  3ZCC A;  1OCC C;  4X88 A;  1OCO B;  2ITC C;  4FZ1 A;  3JAK A;  3M8A A;  2A79 B;  2IBZ H;  2MW2 B;  3RYH A;  1SQP H;  3H1I H;  1JFF A;  5HFM A;  1SF9 A;  4B3T O;  3QO7 A;  4J7Z A;  3QTC A;  5B5E Z;  2HHH O;  1BHA A;  2VQE B;  1PNK A;  3T1Y O;  2PY5 A;  5KHG A;  2UUA O;  2IU3 A;  4NR1 A;  2P67 A;  1IXB A;  2UXD B;  4CH4 A;  1OCR B;  4IHJ B;  1IBK O;  1FXK A;  1L0L H;  2CAZ C;  1ZL8 A;  4O4H A;  4HNA A;  3F5W C;  1OCZ B;  2UXD O;  5IYZ B;  2M6Y A;  4IHJ A;  3JAL A;  4Q20 A;  4GZR B;  1MAB G;  1VMG A;  3SPH A;  2W0X A;  4ZBM A;  4RUE A;  1D5N A;  1S3J A;  4O2A B;  2UXB B;  2K9P A;  1K5Q A;  1V54 B;  5LGU A;  2YS8 A;  3WB2 A;  2RMK B;  2B9Z A;  4J11 A;  5LP6 C;  3RGB A;  3KG2 A;  4QPJ A;  5KUM A;  2HHH B;  1BT8 A;  1URF A;  3E8H A;  5JH7 A;  4E4E A;  5TIS Z;  5IJ9 B;  2ADQ B;  3BEH A;  2H8P C;  1DTO A;  3HB3 B;  3B8N A;  2OIE A;  3CRA A;  2PUS A;  2QM7 A;  2UXX A;  5JQG B;  2CGO A;  3BFR A;  1THZ A;  3EXA A;  1HWY A;  4H13 B;  4JI5 B;  4IIJ A;  4UCV A;  1TAE A;  2K1E A;  1FXV A;  3STL C;  4JI0 B;  1NQT A;  2FL4 A;  2UUB O;  3W7W A;  5C8Y B;  2JDI G;  3LDD A;  5BY1 A;  5LMN O;  4AIL C;  4OGQ B;  1NI8 A;  4JI0 O;  2PGG A;  4UV8 A;  4HZ3 A;  2R9I A;  4PDL A;  5EIB C;  3ZJZ A;  1GTO A;  5JWP A;  3E22 A;  3CC4 V;  1Q82 W;  3T4D A;  3SJQ C;  3FAV A;  1EZV H;  4BR6 A;  4O4L A;  3WB1 A;  1I5Y A;  5DED A;  2XT9 A;  1SER A;  3E8F A;  3JAL B;  4JAV A;  4P9P A;  1QQC A;  3JAR B;  5IY5 C;  5LMN B;  3TXQ A;  1XIL A;  2E5L O;  3N2G B;  3ZN1 A;  3JYC A;  4JTA B;  4GKJ O;  2BCC H;  2EIN B;  2HLD G;  5CA1 B;  2LFR A;  4K3A A;  1NH2 B;  4ICG A;  2NR5 A;  2Y48 A;  1HR0 O;  4DR6 O;  5H6Q A;  2GDS A;  2Y0P A;  4LFB O;  5KX5 A;  3RYC A;  2GBO A;  1ZSP A;  4YHH O;  1S5H C;  1AI5 A;  1OCO C;  3BPZ A;  4NB5 A;  4WFH A;  3SJA C;  2V4D A;  3LNM B;  1NKD A;  1O9G A;  1QBZ A;  4FFB B;  2BSK A;  4X1I A;  4FM0 A;  3CMA V;  2HJD A;  1FXK C;  1P49 A;  5IYD O;  5C8Y A;  2Y4U A;  5KA5 A;  4KHP B;  4OX9 B;  1YIJ V;  1NBM G;  1N36 B;  4YIP A;  2HR3 A;  4LF6 B;  1JJO A;  4MW8 A;  1Q5O A;  3K59 A;  3FB7 C;  4DUY O;  4WBN B;  1FS0 G;  1V55 C;  2VQF B;  2WLI B;  2HVK C;  1M57 C;  2ZXW B;  4PD4 F;  2Q0A A;  3E83 A;  1WPB A;  1TVK A;  2Y69 B;  3CYO A;  2JS5 A;  5B1B B;  3ETQ A;  4WCE V;  3JAS A;  2KB1 A;  4H37 A;  3BCC H;  2HKO A;  3VQW A;  5IYB O;  4IYI A;  5E79 Z;  2OT5 A;  4I9W A;  4LNU A;  5H9C A;  2IJK A;  2Q67 A;  2HVJ C;  3ZRV A;  1FFT B;  1HNZ B;  4FLV A;  4AQY B;  2XAF A;  3LSS A;  3D36 C;  1H8H G;  5J2T B;  5KAI Z;  1SRY A;  4LFB B;  1FXH A;  3P30 A;  4JZ2 A;  2HP8 A;  2WLN A;  3UKM A;  4RQE A;  2NLJ C;  3BY6 A;  5KUK A;  4I4T B;  3H1H H;  4F6R B;  3B40 A;  4DV7 B;  1TUB B;  2BSK B;  1H2K A;  2PYL A;  3C3T A;  1ROP A;  4I4T A;  3QG5 A;  2Q6A A;  5FNV B;  1TA8 A;  4J7K A;  3CRM A;  1F23 A;  3SYO A;  2CGN A;  2B1I A;  5CBF A;  3AG1 B;  2EJR A;  1QR8 A;  3EVK A;  4DV7 O;  3SPG A;  5LXT B;  4NTY A;  5KMG B;  3L71 H;  2ZR2 A;  5CB4 A;  4ZHQ A;  4EB6 B;  2YIC A;  2F23 A;  4X1Y A;  2FML A;  1VQ6 V;  1WB8 A;  2N05 A;  3CCJ V;  3UQ8 A;  4Z1V A;  3RYF B;  3SYC A;  1H38 A;  2W6I G;  1YTF B;  2FKX A;  2VWJ A;  5BZB A;  5B66 Z;  3RW0 A;  4TV8 B;  3SPC A;  4DV1 B;  3IAY A;  4PDV A;  4UUJ C;  3MAQ A;  3F7V C;  1L0N H;  5JCO A;  2UUC B;  1Y76 B;  3K5O A;  1MOF A;  2E74 B;  3SR2 C;  1VQ9 V;  4TUY B;  3HR0 A;  4W4L A;  4DW0 A;  1N32 O;  1WP8 A;  3FB5 C;  1RP3 B;  3OM3 B;  1PNM A;  4R7C A;  2Q8V A;  3D3I A;  4LF5 O;  3RWR D;  1IXM A;  2ITD C;  3AG2 B;  1PL0 A;  1JPX A;  2EIN C;  2OCC C;  2YDE A;  4JI3 B;  5IJ9 A;  4LF5 B;  4AHC A;  1KD1 W;  1W2B U;  2N74 A;  4ZOL B;  1SA0 B;  1R6K A;  4ASU G;  4LC1 A;  3GB7 C;  2GUZ B;  3OAA G;  4E2L A;  2PZS A;  1P4R A;  2JS3 A;  3L74 H;  3FKS G;  3U10 A;  1HW7 A;  1EN6 A;  3K9A A;  4O2A A;  1M1K W;  4YHH B;  3THO A;  3ZHR A;  1DLB A;  4X65 O;  3LSU A;  2YIA A;  4NYK A;  2XAS A;  3E35 A;  1V54 C;  2BOB C;  3TET A;  3GVM A;  4DXW A;  3JD3 A;  2XAJ A;  3M99 B;  5EC1 C;  1K92 A;  1LNQ A;  1XL6 A;  3QO8 A;  1O9H A;  1SQX H;  2ZM6 O;  3P3P A;  2P6J A;  3K5N A;  1ZUQ A;  2AZ2 A;  4N21 A;  1U96 A;  3DGE A;  5FLX N;  1Y74 A;  3STZ C;  3FB8 C;  3Q4H B;  1D2D A;  4MTX A;  4D6T H;  4GX2 A;  3RYC B;  4ZHQ B;  4CC5 A;  4OPA A;  1QLN A;  4K0K O;  2LGQ A;  1BCC H;  4QNH B;  4JAA A;  1BMF G;  3G6B A;  3WU2 Z;  4GKK O;  2WWW A;  1SQQ H;  1SC5 B;  2A0L A;  1GKF A;  3A0R A;  2CTW A;  2N04 A;  2V1D A;  1VQM V;  1JOY A;  3C90 A;  1W59 A;  4RWU A;  3KZI Z;  2NNU A;  4DR4 O;  3W7X A;  4X64 B;  1M4U A;  3K04 A;  3VQV A;  2FB5 A;  1YJW V;  4YJ2 A;  4JI8 B;  2CK3 G;  2X7R B;  2BOC C;  4IYH A;  5LOV B;  4JI7 O;  1NJI W;  1HNW B;  3DTU B;  1BQZ A;  1KYO F;  3K06 A;  1WPX A;  4O4H B;  3S3W A;  2Y4T A;  2R72 A;  5LYJ B;  1XOU A;  1MG1 A;  3VQY A;  1B06 A;  2H3O A;  5DN6 G;  3E22 B;  4DV2 B;  4OXS A;  1AP6 A;  3AEI A;  2RQ6 A;  3L73 H;  5LP6 A;  4GKK B;  3N27 A;  4NXM O;  3ZHV A;  3ZS8 C;  1NR1 A;  1AR4 A;  3HKC B;  2F66 C;  2KQX A;  1VQL V;  4LF9 O;  2GSM B;  1H2M A;  4CBC A;  1OCC B;  2DJV A;  2GTA A;  5CA1 A;  3CXC U;  3G71 V;  1OZ0 A;  2X6A A;  4DRX B;  4YJ3 A;  2KG7 A;  3LNN A;  1RM1 C;  1G6U A;  1XHX A;  2KSD A;  4JF3 A;  2RNB A;  4B3M B;  1S5J A;  5FPR A;  1P7B A;  3L70 H;  5B3S C;  1TGO A;  2PI5 A;  4JPR A;  1Q43 A;  1GN6 A;  3UCS C;  4JYA B;  2YI8 A;  1IVS A;  2IJH A;  4NXN O;  2ZCE A;  3A0H Z;  2ARH A;  2ADP A;  1KEC A;  4X1I B;  2LFS A;  4PI2 A;  2E76 B;  2QWN B;  1RPR A;  4QE9 A;  4XDK A;  4DR3 O;  2Q73 A;  5JJE B;  1F7Y A;  4LF9 B;  1J5E O;  1SQV H;  1XNR O;  1I94 B;  4EFE A;  3OGC C;  1RM1 B;  2GUZ A;  1R3I C;  1GRJ A;  3BA9 A;  2Y0I A;  1S77 D;  3UT5 B;  2EIK B;  4UB8 Z;  1YSC A;  3JAS B;  4LCU C;  5LHH A;  2H94 A;  4OPH A;  1NTZ H;  5IWA B;  2P22 C;  5KHH A;  1GN3 A;  3HKC A;  2HFE C;  5EYP A;  2P4V A;  1FKA O;  3JD0 A;  4I9Q A;  4DRX A;  4A5U B;  4DR2 B;  3APO A;  2QKC A;  5JH7 B;  5BR8 O;  4R50 A;  3RYF A;  4H33 A;  1AJQ A;  3E8G A;  4NKG B;  1SZT A;  2AGA A;  3MD0 A;  4X64 O;  4FK5 C;  4BWA A;  2XAH A;  3QO5 A;  4J80 A;  1FFX B;  1QCE A;  3CCV V;  1IDS A;  4IIJ B;  2EIK C;  5L3B A;  1KMI Z;  4DV4 O;  1K4C C;  1SQB H;  2WLH A;  3K5L A;  1Q6H A;  2P5O A;  2ZDI A;  3IC9 A;  4U3J A;  4ZIB A;  2ZE6 A;  3AG3 B;  4DR4 B;  1Y67 A;  4CS3 A;  1QR9 A;  3OD4 A;  2JIZ G;  3VBB A;  3KCX A;  5BMV B;  3AK2 A;  2YUA A;  4MTG A;  4JI1 O;  1NTK H;  1EBO A;  1K34 A;  2A9H A;  2Q9L A;  3JAR A;  4I50 B;  4JI5 O;  2CDY A;  2ZM6 B;  4GUN A;  5JJN B;  2JGD A;  1VF5 B;  1RPO A;  1YTF D;  2OIG A;  4L87 A;  2QTO A;  4B08 A;  3CRR A;  3OMI B;  2QWP B;  1X4T A;  1HDJ A;  4G28 B;  3G67 A;  5IYZ A;  4K8X A;  1KB9 F;  2ZNJ A;  1PPJ H;  2JGD B;  4LF8 B;  2WLM A;  3IC7 A;  3EHB B;  4TV8 A;  2LW7 A;  4MVS A;  1YCI A;  2BTO A;  5KLV H;  1XRE A;  1CPY A;  2X6C A;  2XAG A;  1G4Y B;  1OCR C;  4UCT A;  3UO2 A;  2EJ7 A;  3IJ4 A;  3DXR B;  3AG4 B;  1B3Q A;  3HKD B;  2EIL C;  1QHT A;  2E75 B;  2YIB A;  1IBL O;  1BZK A;  3ZBH A;  4LF7 O;  1WA8 A;  3QF7 A;  3SYA A;  3JAT A;  5DEC A;  1YJN V;  2RN9 A;  5GON B;  2EIM B;  4J9Z B;  1HNW O;  1TUB A;  4LF6 O;  4WFA V;  2ZE8 A;  1VAR A;  4TQD A;  1Q6I A;  1N36 O;  5L3D A;  1KP2 A;  1K5S A;  3W7T A;  4Z1M G;  1LR1 A;  1KKD A;  1FXK B;  2PF4 E;  3RVY A;  4DV1 O;  4DR1 B;  4JI1 B;  5DM6 V;  3OUS A;  2IU0 A;  3OUF A;  2ATK C;  4G27 B;  3OEH G;  3CP1 A;  3JSN A;  4RO2 A;  4JTD B;  3UO3 A;  1YDX A;  3CME V;  1OCZ C;  1XMQ O;  5A9G A;  2CTP A;  3FYE B;  1COW G;  2OCH A;  1QNM A;  1XBL A;  2RCV A;  3OFN G;  4LBE C;  2QSA A;  3OMN B;  2EZP A;  4PDM A;  4R6Z A;  2L35 A;  3KCY A;  5B1B C;  3B8M A;  2CE4 A;  2XTA A;  3K3W A;  1AR5 A;  1DF5 A;  4P30 A;  1SQG A;  3ABT A;  2IJI A;  3A2F A;  4JI2 B;  3SPI A;  1VQN V;  3D36 A;  1K3E A;  2IJJ A;  5IJ0 B;  4XDJ A;  4K0K B;  4UFZ A;  4K8Z A;  1FAF A;  5BR8 B;  3SJC C;  3FFQ A;  1S76 D;  1E1Q G;  2XOK G;  2CUG A;  4MW3 A;  2P4K A;  2A7W A;  4H0L B;  4JAS A;  2KG7 B;  4X62 B;  2JVD A;  2ILM A;  1AVM A;  2EBO A;  1QU7 A;  1DK1 A;  3ZHU A;  1XEQ A;  2CH7 B;  1IBM B;  1SKV A;  2ZKO A;  4IT5 A;  3RVZ A;  2CTR A;  1SA0 A;  3K0G A;  4HYO A;  5KMG A;  4FLW A;  4LH7 A;  4O2B A;  4PDR A;  2Q68 A;  4UXN A;  4G2K A;  4TV9 B;  1Q6U A;  2BTQ B;  2E3C A;  4DYL A;  1J5E B;  4KFM A;  2ODM A;  4L8J A;  2MK3 A;  5LP6 B;  4D7T A;  1NVP B;  5B1A B;  4LWS A;  3IFX A;  1AJP A;  1AIL A;  1Y6X A;  1GM9 A;  1D5A A;  2HG5 C;  1P7G A;  2WLL A;  2UXB O;  2DWD C;  4FFK A;  5IJ0 A;  4PHZ A;  4X66 B;  4DR5 B;  1IBM O;  1FD9 A;  3ZN0 A;  3APQ A;  1MNG A;  4TT3 G;  4B3T B;  4O4I A;  4X9Q A;  1JJ2 U;  2GHY A;  4FM2 A;  1HNX B;  1VP7 A;  4JI6 B;  3E86 A;  3K58 A;  2JK5 C;  2DYS C;  1P84 F;  2YID A;  2DQ0 A;  4MVO A;  1JMK C;  1GM7 A;  4KHP O;  1B6Q A;  1WB7 A;  3TGU H;  5KA6 A;  1L1F A;  4TWK A;  3VOU A;  1KUQ A;  1Y66 A;  4GCZ A;  4UCS A;  2PI4 A;  2WAM A;  1T5E A;  4MTF A;  1ZTE A;  3CC7 V;  4MS2 A;  1XI1 A;  2ZIM A;  5CA0 B;  1JX9 A;  4O2B B;  4YY3 O;  1VQO V;  4RQF A;  2A06 H;  4JI7 B;  4WFF A;  1PL4 A;  3RN4 A;  3ABL B;  1PNL A;  1OV9 A;  3A8T A;  1V55 B;  4FLT A;  5B1O A;  2KKW A;  1HR0 B;  1Y76 A;  2EIJ C;  3DC5 A;  2W6J G;  1VF6 C;  4JI4 O;  4DUZ O;  1KKC A;  5FPO A;  2QM4 A;  3B4S A;  5ITZ A;  1NH2 D;  3N2G A;  1G1X B;  4XBF A;  4HNA B;  1AI4 A;  2GTS A;  3OEE G;  4FLX A;  1ZLZ A;  4J7J A;  5J2U A;  2WLL B;  4UCU A;  2R9R B;  4IGG A;  1VQK V;  3ML0 A;  4F6E A;  3ZIA G;  2DYR C;  4F6R A;  3I56 V;  4CH5 A;  2Z3Y A;  1F4M A;  3CC2 V;  4ZOL A;  1HNX O;  2YEV B;  4B3S B;  2YI9 A;  1IZ3 A;  1XMQ B;  5JVD A;  2IW5 A;  3T1H B;  1JFF B;  2XAQ A;  3RYH B;  1R6T A;  4JV5 O;  3DXR A;  2Z0A A;  1SS3 A;  1EN4 A;  4RAI A;  4JI3 O;  3NR7 A;  2JEU A;  3CS5 A;  4TV9 A;  2QTS A;  4W4K A;  2F93 B;  1H2L A;  4B7E A;  1R73 A;  4MVQ A;  1US6 A;  1HP8 A;  2WA4 A;  5BMV A;  5IDJ A;  4O4I B;  4LFC B;  5C93 A;  5EK0 A;  1H8E G;  1VQ8 V;  4YIO A;  1QVF U;  2QDO A;  2QKS A;  4MT8 A;  1DGS A;  2DQ3 A;  5L3E A;  2WLI A;  3K5M A;  4I50 A;  2QA4 V;  1XNQ B;  4KP4 A;  4WFE A;  4BIZ A;  3DSQ A;  2VS0 A;  4UCO A;  3ETE A;  2OWO A;  3ZMU A;  2ZDI C;  1L8D A;  4CS2 A;  4LNU B;  4DV6 B;  3I55 V;  2UUA B;  1WAZ A;  4DV2 O;  3ZMS A;  1RSO A;  1WN7 A;  2JJ1 G;  3C3S A;  4B3M O;  4GKJ B;  4X89 A;  2AHY A;  1FFX A;  3JAK B;  4J9Y B;  2OYQ A;  4PV1 B;  4GX1 A;  1MZE A;  1Q8I A;  1RSO B;  3CSX A;  5LA6 A;  5KHJ A;  2Y69 C;  1YEW A;  2YEV A;  3IGA C;  5ITZ B;  1WA8 B;  2JRI A;  1EN5 A;  1JVM A; 
#chains in the Genus database with same CATH homology
 1M90 W;  2EIK C;  3CMA V;  5L3B A;  1K4C C;  1FXK C;  2OCC B;  2WLH A;  4I5S A;  4WFB V;  1S72 V;  5IYD O;  2ZDI A;  1K8A W;  5KA5 A;  2QEX V;  4YXW G;  1YIJ V;  1PD3 A;  1K7D A;  3AG3 B;  1NBM G;  5L3G A;  1AI7 A;  5L3F A;  2HR3 A;  3ABL C;  4FMT A;  4PA9 A;  4MW8 A;  1K4D C;  1QR9 A;  3ASO B;  2JIZ G;  3F7Y C;  3VBB A;  3UM7 A;  3FB7 C;  4X8A A;  3T2M A;  1FS0 G;  1G8M A;  1V55 C;  1JCH A;  5IYC O;  1VQ5 V;  2IH1 C;  2WLI B;  4MTG A;  3TK1 A;  2HVK C;  1M57 C;  2W0F C;  1EBO A;  2ZXW B;  3E83 A;  1K34 A;  3WG7 B;  3ZRX A;  1K73 W;  3ASO C;  4U7N A;  1EZJ A;  1E79 G;  2A9H A;  2Y69 B;  2QM8 A;  3CYO A;  3EFF K;  5B1B B;  3CCS V;  4WCE V;  1KQS U;  3JCZ A;  2KB1 A;  4H37 A;  2HKO A;  1M57 B;  1Y4M A;  4P9O A;  2EIM C;  5IYB O;  1RPO A;  2V7Q G;  4L87 A;  3ZRW A;  1YTF D;  2WPD G;  2QTO A;  3ETD A;  3OMI B;  4BAY A;  3CCQ V;  2OT5 A;  4G28 B;  4I9W A;  5H9C A;  1BHB A;  3CCR V;  2IJK A;  2Q67 A;  2WLM A;  3IC7 A;  4PA7 A;  5GW7 A;  1K97 A;  2HVJ C;  3ZRV A;  1YI2 V;  3EHB B;  4MVS A;  1FFT B;  1CPY A;  3R65 A;  5B3S B;  2X6C A;  2XAF A;  2XAG A;  3LSS A;  1G4Y B;  1OCR C;  5H6R A;  1KC8 W;  1H8H G;  4JYC A;  3MHH C;  3AG4 B;  1SRY A;  2EIL C;  1FXH A;  5LBQ A;  3P30 A;  2DW4 A;  1SET A;  3K79 A;  2WLN A;  3UKM A;  4RQE A;  2NLJ C;  3BY6 A;  5KUK A;  2Z5U A;  3CCE V;  3ABM C;  3SYA A;  1YJN V;  3RBZ A;  3ABU A;  3NXS A;  3K0D A;  3CCL V;  1CEZ A;  4JYB A;  4UVB A;  2WLJ A;  1JQ0 A;  2EIM B;  2F43 G;  4J9Z B;  3G6E V;  1ROP A;  2Q6A A;  5FL7 G;  4P2Z A;  3G4S V;  2X6B A;  3W7U A;  1F23 A;  3SYO A;  2IH3 C;  4WFA V;  2B1I A;  5CBF A;  3AG1 B;  5L3D A;  1KP2 A;  1QR8 A;  2EJR A;  1K5S A;  1QLE B;  3W7T A;  4CZZ A;  3SPG A;  2OTL V;  3W7S A;  3MHS C;  4DO2 A;  4Z1M G;  1KKD A;  4WFG A;  1FXK B;  5LHI A;  4GX5 A;  1VQ7 V;  4GT1 A;  3RVY A;  2C2A A;  1QLE C;  1ENV A;  2ZR2 A;  5DM6 V;  1UJW B;  1R3J C;  3OUS A;  5CN0 A;  5LGN A;  1K33 A;  4LP8 A;  2IU0 A;  3OUF A;  2ATK C;  4G27 B;  3OEH G;  3CP1 A;  4N23 A;  1VQ6 V;  4RO2 A;  4JTD B;  4JGS A;  4UV9 A;  3CME V;  1OCZ C;  1XL4 A;  3CCJ V;  3AG2 C;  3ABK C;  3CCM V;  3FYE B;  1COW G;  3FYI B;  3SYC A;  1H38 A;  2W6I G;  1YTF B;  3OFN G;  5BZB A;  1I5X A;  3OMA B;  4LBE C;  3RW0 A;  1M9N A;  3SPC A;  1ORQ C;  1E1R G;  3OMN B;  4PDV A;  2EZP A;  4PDM A;  4R6Z A;  3GWO A;  4KUM A;  4UUJ C;  2UXN A;  2QE7 G;  5B1B C;  5CBG A;  3B8M A;  3B77 A;  3F7V C;  4XDL A;  3CPW U;  2M7W A;  5EBW C;  3K3W A;  3E2E A;  3LSQ A;  1DF5 A;  1J95 A;  3JD4 A;  4FJC C;  1QVG U;  1F4N A;  1MOF A;  1WLE A;  4P30 A;  3T1C A;  3ABT A;  2IJI A;  2DYR B;  1VQ9 V;  3SPI A;  1VQN V;  3D36 A;  1K3E A;  2IJJ A;  3CCU V;  4PA4 A;  3OE7 G;  4XDJ A;  3SPJ A;  3ZRW B;  1ZWI C;  3FB5 C;  3E8B A;  4UVA A;  3OM3 B;  1PNM A;  4R7C A;  4WF9 V;  3P32 A;  1S76 D;  3D3I A;  1E1Q G;  3ASN B;  3FB6 C;  2XOK G;  1OHH G;  1IXM A;  2ITD C;  3AG2 B;  1PL0 A;  4MW3 A;  5E1A C;  1K9M W;  1JPX A;  3LUT B;  4QJF B;  2EIN C;  3AG4 C;  3JD2 A;  4JAS A;  4GX0 A;  2YSU B;  3PJS K;  1NVP D;  4MVZ A;  1MSW D;  2OCC C;  3ASN C;  1KD1 W;  4PEL A;  1SES A;  2HJF C;  2EBO A;  4PA6 A;  1W2B U;  5J9P C;  3ABK B;  1R6K A;  3OW2 U;  4LC1 A;  4ASU G;  4JTC B;  3ABM B;  1ARO P;  4FPP A;  3GB7 C;  3AG3 C;  3OAA G;  4QE7 A;  4RUF A;  4E2L A;  1PKX A;  1VQ4 V;  1P4R A;  2ZXW C;  5CA3 A;  2WLK A;  2EIJ B;  4MVU A;  2ZR3 A;  3FKS G;  2AHZ A;  3ZRS A;  3RVZ A;  1M1K W;  3K9A A;  3K0G A;  4QPK A;  4HYO A;  1DLB A;  2B1G A;  1DF4 A;  5LHG A;  1YJ9 V;  4PDR A;  3LDC A;  5B1N A;  2Q68 A;  2DYS B;  2XAS A;  3E35 A;  4UXN A;  1V54 C;  4G2K A;  5B1A C;  2BOB C;  3AG1 C;  3TET A;  2D3O W;  4EKW A;  4DXW A;  3JD3 A;  2X0L A;  2XAJ A;  3M99 B;  5EC1 C;  1K92 A;  1LNQ A;  1XL6 A;  3QO8 A;  4KFM A;  1M56 C;  1F51 A;  1W0K G;  4FIP C;  4HAM A;  3X2Q C;  2P6J A;  2MK3 A;  1NVP B;  4N21 A;  5B1A B;  2ZD9 A;  3IFX A;  3ZMZ A;  1AJP A;  3DGE A;  5CMU A;  1M56 B;  5IY5 B;  1AI6 A;  2P7T C;  1GM9 A;  3X2Q B;  4BIU A;  3STZ C;  2EZO A;  3FB8 C;  2HG5 C;  3OR6 C;  3CD6 V;  1YHQ V;  2WLL A;  4MTX A;  4GX2 A;  2DWD C;  3WG7 C;  1NR7 A;  2P90 A;  1W0J G;  2LP7 A;  3ZN0 A;  4QIW F;  1N8R W;  2WSS G;  4TSF G;  4QNH B;  2EIL B;  1QLN A;  3TCU A;  1KP3 A;  1R3L C;  4MTO A;  1BMF G;  2WWW A;  1GK9 A;  4TT3 G;  2A0L A;  1GKF A;  3JD1 A;  3A0R A;  3QNE A;  3ZMT A;  1JJ2 U;  2GHY A;  4MVR A;  3ZCC A;  2V1D A;  3E86 A;  1VQM V;  1JOY A;  1OCC C;  4JAU A;  4X88 A;  1OCO B;  2JK5 C;  2ITC C;  2DYS C;  2A79 B;  2NNU A;  3W7X A;  3OR7 C;  2DQ0 A;  4MVO A;  1GM7 A;  3K04 A;  5HFM A;  1B6Q A;  3E89 A;  1YJW V;  5KA6 A;  1CP9 A;  2CK3 G;  3QO7 A;  4TWK A;  2X7R B;  1L1F A;  3VOU A;  1Y66 A;  2B5U A;  2BOC C;  4GCZ A;  2PI4 A;  2WAM A;  4UVC A;  1R6N A;  1BHA A;  1PNK A;  4MTF A;  1NJI W;  3CC7 V;  4MS2 A;  2IU3 A;  3DTU B;  1JX9 A;  4MSW C;  3K06 A;  1WPX A;  1VQO V;  2P67 A;  4RQF A;  4BW5 A;  1MG1 A;  4WFF A;  1GMG A;  3ABL B;  1OCR B;  1PNL A;  1R3K C;  5DN6 G;  1FXK A;  1VQP V;  4OXS A;  1V55 B;  3AEI A;  3F5W C;  5B1O A;  1OCZ B;  2EIJ C;  2W6J G;  3SYQ A;  1NR1 A;  4F4L A;  3H01 A;  3T4Z A;  1GO3 F;  4Q20 A;  5L3C A;  1NH2 D;  1VQL V;  1MAB G;  2GSM B;  3SPH A;  4XBF A;  1AI4 A;  4ZBM A;  4RUE A;  1OCC B;  4CBC A;  1S3J A;  2DWE C;  3CXC U;  1Q81 W;  1YIT V;  1K5Q A;  3OEE G;  1V54 B;  3G71 V;  5LGU A;  2WLL B;  1OZ0 A;  4PA3 A;  2R9R B;  3SYP A;  2X6A A;  1VQK V;  1BL8 A;  3ML0 A;  3ZIA G;  2DYR C;  3KG2 A;  4QPJ A;  5KUM A;  4JF3 A;  1RM1 C;  2ZQM A;  3I56 V;  4U7O A;  1P7B A;  3E8H A;  3ETG A;  3K08 A;  2Z3Y A;  5B3S C;  1F4M A;  3CC2 V;  2PI5 A;  2YEV B;  5EC2 C;  1GM8 A;  4JPR A;  2JEX A;  3WFV A;  3BEH A;  2H8P C;  1Q7Y W;  1DTO A;  3HB3 B;  2IJH A;  2IW5 A;  3B8N A;  2QM7 A;  2UXX A;  2XAQ A;  3HPL C;  1THZ A;  2JJ2 G;  1KEC A;  1HWY A;  5EBL C;  2LFS A;  1S0V A;  2K1E A;  1FXV A;  3STL C;  4RAI A;  1RPR A;  1NQT A;  4QE9 A;  4XDK A;  3W7W A;  2JEU A;  1H2G A;  5HFL A;  1AR1 B;  2JDI G;  3LDD A;  1R73 A;  4MVQ A;  4UV8 A;  5EBM C;  3OGC C;  5IDJ A;  5C93 A;  1RM1 B;  4HZ3 A;  2R9I A;  4PDL A;  1R3I C;  5EK0 A;  1GTO A;  3ZJZ A;  1H8E G;  1VQ8 V;  3CC4 V;  1Q82 W;  1QVF U;  3T4D A;  1S77 D;  3SJQ C;  2QKS A;  2EIK B;  4MT8 A;  2DQ3 A;  5L3E A;  2WLI A;  4R8C A;  1YSC A;  1I5Y A;  2QA4 V;  3E8F A;  1SER A;  4KP4 A;  4JAV A;  4P9P A;  5IY5 C;  4LCU C;  4MVM A;  5LHH A;  2FTK A;  4WFE A;  4BIZ A;  2H94 A;  3ZN1 A;  3ETE A;  3JYC A;  2HFE C;  4JTA B;  3ZMU A;  2ZDI C;  2EIN B;  1TUE B;  3JD0 A;  2HLD G;  3I55 V;  2LFR A;  3ZMS A;  1NH2 B;  2Q69 A;  2OTJ V;  2JJ1 G;  2Y48 A;  4X89 A;  3LDE A;  5H6Q A;  5CBH A;  4R50 A;  2AHY A;  4H33 A;  1AJQ A;  3K03 A;  3E8G A;  1EFR G;  4J9Y B;  1SZT A;  4GX1 A;  3MD0 A;  1S5H C;  1AI5 A;  4FK5 C;  1OCO C;  2XND G;  4WFH A;  5LGT A;  2Y69 C;  1Q86 W;  2YEV A;  3IGA C;  2XAH A;  3QO5 A;  3LNM B;  1NKD A;  1QBZ A;  1QCE A;  3ZMV A;  3CCV V;  1JVM A;  1AJN A;  4ZKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...