2NN4A

Crystal structure of bacillus subtilis yqgq, pfam duf910
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
LNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqgQ
publication title Structure of YqgQ protein from Bacillus subtilis, a conserved hypothetical protein.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.760 Mainly Alpha Orthogonal Bundle Helix Hairpins YqgQ-like 2nn4A00
2NN4A
chains in the Genus database with same CATH superfamily
1VF6A 3JALB 4FLUA 1ZX3A 4NXMB 5B1AB 5LOVA 3IGAC 2E76B 2P7TC 1JPXA 4I50A 3CXCU 4O2AA 4EEQA 3TETA 4L8JA 1XMOO 3U10A 1GTOA 1BMFG 1M56B 1NQTA 2QKCA 4N23A 2Q73A 2JGDA 1G1XB 3LUTB 1YIJV 1T5EA 4FFKA 3ZJZA 1D5NA 1GKFA 4XDJA 4NTXA 5C8YA 2LW1A 3AG3B 3H1LH 4DV3B 5FPRA 1MSWD 1IBLB 1M9NA 4JI5B 1MABG 1V54B 5LGTA 5LP6C 3CCEV 3RYFB 1WAZA 3B4SA 1XHXA 3E2EA 1FXKA 1LUVA 4P9PA 3FKSG 2B1GA 1K73W 1QLEB 3H1KH 1XL4A 4O4HB 4QE7A 4K3AA 1AI7A 3QO7A 2C2AA 5LMNO 1ZL8B 1ZWIC 5JQGB 1NI8A 2UUBO 3SPHA 2JDIG 4JAUA 1Y67A 4BAYA 1AI5A 2IH3C 4R7CA 1OCRC 4OGQB 1Q82W 2GSMB 4GX5A 4LWSB 2Y0PA 3T2MA 4X8AA 1BHBA 3JATA 1NTZH 3L74H 4PDMA 1V55C 4JAVA 4I55A 3K9SA 3ZHSA 1URFA 1BCCH 4Z1MG 5JH7B 5LXTA 4X88A 4YY3B 3CPWU 2BOBC 4GLXA 1TUBA 5JJJB 1F4NA 3OM3B 5CA0A 2EBOA 5LYJB 1VQLV 1WA8A 2QTSA 2B5UA 3O65A 1AI6A 5D5QA 3NXSA 2JGUA 1YDXA 5AG2A 2IU3A 1IURA 4UVBA 1O9GA 4YHHB 4IHJA 4DW0A 4LF5B 2GUZB 5L3CA 2DYRB 2Q8VA 3Q4HA 3BA9A 2IW5A 5LGUA 3TJTA 4GKJO 2QGNA 1S72V 1B06A 1J5EO 5H2FZ 1LR1A 4LFAO 4WCEV 1PNKA 2GTAA 3KCXA 3CE2A 2IH1C 1AROP 2CE4A 4X1YA 2Y69C 1I7FA 1WJZA 1N4CA 4JI0O 1JFFA 3ZN1A 2PF4E 5CBGA 1S76D 1L1FA 1VF5B 3AG2B 1YZBA 1P7GA 3RYHB 3RVZA 3OT7A 1EZJA 3ICXA 5BR8B 5J2UA 5J2TB 4DR5B 2JJ2G 4B3SB 1EBOA 3CXHF 3JD4A 4B08A 2IJKA 1WB7A 2DW4A 3OR6C 3CHXA 3CCSV 4RWUA 2KG7A 5F2VO 2Q4PA 2ZIMA 4IL6Z 1OCOB 5KUKA 1NJIW 3ZHUA 2BSKA 4AQYB 2HHHO 3KZIZ 4WBNB 3X2QB 4D7SA 4DV1O 3D36A 3N2GB 2OYQA 1IXBA 4YIOA 4DYLA 4IIJB 1FAFA 3BA8A 4TV8B 1K8AW 3ETQA 3B09A 1PM9A 1Y76B 2H94A 4GX2A 3O9OA 5B3SC 4XBFA 2UXBO 2WA3A 3E8BA 3JSNA 2EIMC 4YJ3B 1AI4A 3APQA 1OJHA 3P3PA 4F4LA 3T1HB 1Q6UA 4F6RA 4LF6B 4K8XA 4LF9B 4DR3B 3D3QA 2VQEO 4J7JA 1Q8IA 4LNUB 3F5WC 4KL1A 2N04A 1BSMA 3OTFA 3HKEA 2QEXV 5EBWC 3AEIA 1I94B 1S77D 1FFTB 4J41A 3H9VA 1JR9A 1M4UA 2DYSC 2VWJA 5A2QN 2ZNJA 3L72H 1N32O 1BS3A 2OIGA 1VIBA 4F6EA 3K5MA 4DR2O 1K3EA 3CB2A 3G71V 2ITCC 1QR9A 3RW0A 2H8PC 2DWEC 1N34B 5EIBC 2GBOA 4PA3A 2BTQB 5BMVB 2ZCEA 4YJ2B 2OT5A 2QE7G 1ZSPA 3AG4B 5LA6B 1MA1A 2W6IG 3DSQA 4DR1O 1KECA 2NR5A 5CA1A 1PNLA 4NTWA 2F4VB 1P7BA 1H38A 4B3RO 3SYQA 1XILA 5DN6G 3ZRSA 3RGBA 4FFBA 1YITV 1JA8A 4O4IA 2JIZG 5B1AC 3OW2U 1YTFD 2YXYA 1NBMG 4MSWC 3JAMN 4JYAB 3B8NA 2E3CA 3SJCC 1RM1B 1PP9H 1M56C 1W59A 4TQFA 4LF7B 2PI5A 3ZRVA 2ADPA 4GUNA 1WPBA 3AG3C 4B3TB 4G28B 4MVZA 4XDLA 5IE9A 1W0JG 4X1IB 3SYOA 5BXZA 1V54C 1PKXA 3U0ZA 4DK0A 3ABUA 1TVKB 5IJ9A 2VRZA 3B2EE 3CCMV 2Q0AA 5HFLA 5ITZA 3BEHA 2GTSA 4DUYO 4RUEA 2UU9O 3K5OA 1YXBA 2ZT9B 4JI7B 4J80A 5IJ0B 1L0LH 1R6NA 1SRYA 4MTXA 1WN7A 4PI2A 4EB6A 3LSSA 2Z3YA 4AHCA 2LGQA 3JYCA 3CMEV 1KKCA 3BY6A 1M93A 2ZM6O 4G2KA 1IX9A 2KSDA 1R1BA 5B66Z 2QM8A 1WLEA 4I0XA 2CGOA 3SR2C 4CC6A 1K5QA 3N2KB 4U3JA 3NR7A 3SDLA 3FFQA 2WLNA 1HR0B 2YI8A 3DTUB 1XMQO 3W7WA 1YTFB 5BZBA 4P30A 1EFRG 2LW7A 3K06A 4TT3G 1U96A 4WFBV 1SC5B 1H2SB 4LH6A 3K5NA 3JD0A 2P6JA 4DV4B 1G6UA 1SQFA 2AW9A 2YIAA 5KMGB 1K9MW 3UQ8A 4FLZA 4JYCA 1VQ7V 4JI1O 1WPXA 4U7OA 2R70A 2DYRC 3E89A 3S3XA 1KQSU 1KBHA 1N33B 3R66A 4D7TA 4CS3A 3MDSA 4X89A 3ZMVA 4X64B 3JARA 1PPJH 3TGUH 5J9PC 2EIJB 5KA6A 3F7VC 3CCLV 4DR7O 3PJSK 2JEUA 5EBMC 3AG2C 4LF4B 1JCHA 2RCVA 4ZIBA 2OTLV 2CUGA 3ZRWB 1UPGA 3SPJA 4ZI7B 4CBCA 3LNMB 5LHGA 2DN9A 2RN9A 2XAJA 3UM7A 4NR1A 4UCTA 4JI3O 4X20B 2A3QA 2E74B 1GN6A 1US6A 1Y6XA 4JF3A 4PA7A 1SQGA 1G4YB 1HNXO 4IGGA 3P32A 3RYIA 3RWRD 1J95A 5IWAB 4BR6A 5L3GA 2XOKG 2OCCB 1GRJA 3MHSC 3BHPA 3CYOA 3APOA 4P9OA 4K0KO 2QTOA 3X2QC 3ABLB 3H1JH 1CPYA 2ARHA 1NS1A 2JS3A 4LF8O 2QKAA 2Q7EA 4NKGB 5KAFZ 3M7MX 3T1YO 1VQKV 4ZOLB 4UCRA 4J10A 4TSFG 1H2NA 5K1XA 4LFBB 3EVKA 4PD4F 1EN4A 1K5SA 1HWYA 1ENVA 1AP5A 3CWBH 4FVMA 4PI0A 1Y74B 5CA3A 1RSOB 3OTOB 3OEEG 1X4TA 2YEVA 1ZTEA 2GV9A 1NZ6A 5A9GA 1KYOF 4UCUA 1SQBH 1EM1A 3UT5B 2ZDIA 4RO2A 4O2BB 2ZE7A 2JRIA 1XMOB 3RYCA 3L75H 4U7NA 4JI4O 1JQ0A 3STLC 1N36B 4TUYB 3OR7C 3VQYA 3CMAV 4JV5B 4RAIA 2X6BA 1ZLZA 5EYPA 5JVDB 2YSUB 1GO3F 3LSUA 2ZNIA 1Z2GA 4DV7O 5CB4B 1Q5OA 1AR5A 3SPGA 2QR4A 3F7YC 1S0VA 1F23A 1YJWV 4ASUG 2Q0OC 4J9ZB 2A0LA 2HG5C 1SKVA 5LMNB 4CH5A 2XAHA 4JI2O 3AG4C 2E5LO 2FL4A 4OX9O 4K8ZA 3JAKB 2Q5ZA 3CRAA 3ZIAG 3JAWA 2VWKA 3K79A 3VQXA 4R6ZA 3VOUA 2ETNA 2HKOA 1IBMB 5GONA 4KUMA 2QWQB 1XNRO 5DM6V 1RM1C 3S3WA 3WFVA 2L6LA 1Y66A 5JJNB 4MW3A 4X1KB 1FJGO 4MVMA 3STZC 5KLVH 1JMKC 3T4DA 3WB2A 4JZGA 2QDOA 4GKKO 2NLJC 1XDCA 4UV8A 4UXNA 1KB9F 1IBKO 1M90W 2HEPA 1J5EB 5L3DA 2UXCO 3J80N 4UV9A 2PUSA 3TCUA 1HNZB 1K4CC 4LH7A 4KFMA 3RBZA 4JI0B 2RJZA 5LOVB 1XOUA 2Q69A 4I50B 1Z5WA 2CDYA 3G80A 4FZ1A 4O2AB 2CTPA 1XNQB 3HKCA 3K03A 3EFFK 2IU0A 4PHZA 1A32A 4TQDA 1CXZB 4FMTA 3C3TA 2WLIA 4UVAA 3OMNB 1OV9A 4FLTA 1MOFA 4DV2O 1LNQA 1N0JA 1RPOA 5C8YB 3JASA 2KQXA 4CH4A 1XBLA 4CH3A 1NT2B 3J7AU 3D3IA 2HHHB 4QGPA 2Q9LA 2OTJV 2LQTA 5IT9N 3RN4A 3LDDA 1FXKB 4DV1B 2V4DA 4PA9A 4X65O 3HPLC 4DUZO 3T1CA 1WB8A 5GW7A 1GK9A 4B7KA 1TGOA 2VS0A 2WWWA 4TV9A 5GTHZ 1NU1H 4Q6GA 5TISZ 3E8GA 3HKBA 4W4KA 4K35A 5LHIA 4LFCO 2UXBB 2A06H 3ZCCA 3LDCA 3JATB 3MAQA 2E75B 1Q7YW 4I55B 4GCZA 1E79G 3QG5A 2EIJC 2DQ0A 2BE3A 5LXTB 2IM9A 3ZMSA 2XNDG 1K97A 1TUBB 3SYPA 4UCVA 5CA0B 3SGIA 2VQEB 5E79Z 3HR0A 2Z0AA 5KHGA 1ROPA 1WA8B 4J11A 1QU7A 4DW1A 3CCVV 3AK2A 2A9HA 2P4KA 2WLJA 4NXNO 3JD2A 1F4MA 3GWOA 4FM2A 1M5IA 2A7WA 1Q43A 1NTMH 1GN3A 4IHJB 1THZA 4L87A 3BVOA 5CMUA 3Q4HB 3VQWA 3ASNC 2BCCH 1N32B 4YJ2A 1SS3A 4DR2B 2OCCC 1VQ9V 4O4JA 4X1YB 5IYZA 3ABLC 1R3JC 2R72A 2XT9A 1JFFB 2B1IA 2D3OW 4NVPA 4I9WA 4JTAB 1JX9A 3ZMZA 4JZ2A 5LP6A 3IFXA 1Y4MA 4KHPO 5LL6Y 2YS8A 1Q3EA 4I4TA 4FK5C 1Q86W 1PL0A 5J2UB 4DR1B 3GWKC 2FKXA 4I7ZB 1VQ5V 4X66O 3G6BA 1GH6A 4UVCA 1AJQA 4B3RB 2WLLA 2GDSA 2IJHA 4ZKIA 2F95B 3U11A 1DTOA 1XREA 2QWNB 2YIBA 5H9CA 2BSKB 2QSAA 5KHJA 4RQEA 3AG1B 2DOSA 1M57B 3ASOC 1VQMV 4G27B 4BWAA 2X7RB 2XAQA 3OD4A 5L3BA 2VQFO 3JSLA 2EINB 2OCHA 1R6TA 1V9PA 3CD6V 3HKDA 4MVUA 5IYDO 5LGNA 3T1HO 2Q6AA 3H01A 4PA6A 2A79B 1Q90D 4H37A 2DWDC 3F5TA 5KUMA 3CP1A 1BQ0A 3W7XA 4LBEC 1PD3A 4UB6Z 1VMGA 4DV5O 2UUCB 2H3OA 4DUYB 2XAFA 3ZHQA 5B1NA 3CRRA 4FM0A 3FAVA 3N27A 4F6RB 1JVMA 3HB3B 1SQPH 2HVJC 1SZTA 2P67A 3CRMA 3ML0A 1F7YA 2ZM6B 3OAAG 3HKEB 3K9AA 2W0FC 1P84F 1BQZA 5KX5A 3CCJV 2FTKA 1P49A 2NNUA 5C93A 1CEZA 3KKYA 2F23A 4FLYA 4O4LA 2P22C 1HW7A 1NTKH 2LFSA 2YC0A 2X6AA 1XMQB 5CBHA 1BT8A 1VQ8V 1QLEC 4PELA 3ZS8C 1SQVH 5EBLC 1SA0A 2XHBA 2FMLA 2XASA 4CZZA 4HNAA 2WSSG 4H13B 1VP7A 1VQOV 1DF5A 1QLNA 4JI1B 2AHZA 1RP3B 4ZHQA 3CJHB 2YUAA 1GM8A 4CS2A 4ICGA 4UB8Z 1SQXH 4DV6O 4JASA 2QWOB 3I56V 5CA1B 1XI1A 2F66C 3RT3C 4TOIA 4DR6O 1FFXA 2OIEA 3CSXA 4O4IB 1GAXA 3E86A 5D5PA 3MD0A 4B3TO 5FNVA 1SQQH 5JCOC 3ABTA 1DGSA 2K1EA 2XAGA 5H6QA 5DEDA 3WU2Z 3ETEA 1BGYH 4AILC 2HLDG 1HDJA 3QNEA 4YIPA 2P5OA 1YJ9V 4JI3B 3TXQA 4WFFA 1Z5VA 3R65A 2CH7B 1QVGU 5LHHA 4JI6O 1HNXB 2CTRA 2PTMA 3FB6C 4X62O 1VQ4V 3PN1A 1SF9A 5IJ9B 1XHZA 3KCYA 1AB3A 4MT8A 3RVYA 2HJFC 4C7UA 5ITZB 4CS4A 4QIWF 1NKDA 4B3MO 4UCOA 4LF8B 4JPRA 1HNWO 3T1YB 2RQ6A 2QM4A 4EB6B 1UJWB 2V7QG 1MMMA 1MZFA 3JCZA 1WP7A 3EXAA 1NR1A 3L73H 4BIOA 5JWPA 3FD9A 4FZ0A 2RNBA 3CS5A 5HFMA 3DXRA 5EIBD 1HR0O 2EILB 2R9IA 3ABMB 3ZBHA 4I0XB 4TUYA 3E22A 3M99B 1OCOC 4JI8O 5EZYB 2BOCC 3A0HZ 2WLHA 5IY5B 4LC1A 1IDSA 4U3JB 4DXWA 4H44B 2F93B 4DR4O 4X9QA 4JI4B 3OMIB 2D2CB 3TK1A 1VQPV 4DRXA 1N8RW 2CTQA 3BABA 4TWKA 3JALA 2NN4A 5L3FA 1O9HA 1ORQC 1E1RG 4QPJA 3SYCA 1BZKA 1PNMA 2QKSA 2L35A 4DV7B 3IC9A 4IT5A 4LP8A 4A5UB 2ZQMA 2PGGA 2G38A 1S3JA 5KHHA 5IYCO 5DECA 3JARB 3CRQA 3SJQC 5LBQA 4JAAA 3T4ZA 3CC7V 4J7ZA 2EZOA 5BY1A 1R3LC 1IZ3A 5CBFA 3UKMA 1GMGA 1W2BU 4JI2B 3RYFA 2W0XA 1XUQA 5LMUO 1COWG 3QVNA 1QHTA 5KAIZ 1FKAO 1IXMA 2MW2B 5KHKA 3LSQA 4PV1B 2RMKB 2HVKC 4O4HA 1ZL8A 5JQGA 3J81N 2EULA 3LNNA 1VEWA 1AVMA 1H2LA 2DJVA 3B40A 4UFZA 3RYIB 4LWSA 4R50A 1XNRB 2N05A 4N21A 3JD1A 1VF7A 3AG1C 4E2LA 4MVOA 2CK3G 3WG7B 1I5XA 2B9ZA 2LGWA 1FJGB 3D36C 2R9RB 5EC1C 3KG2A 2UUBB 4W4LA 1KKDA 3C90A 4AI8A 1L8DA 3L71H 5JH7A 4DV0O 3ZN0A 2Q67A 4GKKB 2YXLA 2LO1A 4GYCB 2DMXA 5LYJA 1IBKB 5JCOA 3FYIB 1EN6A 1NVPD 4MTGA 2ZD9A 4PJ0Z 2UXCB 3SJAC 3E83A 2YEVB 1QBZA 1QNMA 2UUAO 4DK1A 3D8CA 1N36O 4KXRA 4JV5O 1MSDA 5JJEB 2GUZA 4JYYA 2N74A 4MS2A 1JJ2U 2UXDO 2IBZH 1H8EG 3GVMA 3RYCB 1LUWA 2F43G 2YXHA 2HR3A 1GN4A 2QWRB 1R6KA 4EFBA 3K5LA 4DV2B 4WFAV 1SESA 3OUFA 1X59A 4MVRA 4HYOA 1WP8A 1IVSA 5EYPB 4GZRB 2EIKB 4NXMO 5H6RA 2Y48A 3ZMUA 2PYJA 3L70H 2UXXA 4GKJB 3RFRA 3RYHA 4B7EA 4LFAB 2JJ1G 1KU9A 2PI4A 1UFIA 2ZIOA 3IJ4A 5GTIZ 5J2TA 3H1IH 2CAZC 3DC5A 1Q6IA 1K92A 4PDRA 1U97A 4X65B 4DUZB 1K34A 4DV3O 1IBLO 1S5JA 4JI5O 1OZ0A 2BTOA 2FB5A 2JS5A 4U3FH 4GX1A 2JGDB 4H33A 3BPZA 3G67A 1KD1W 1IBMO 2P4VA 1BHAA 3M8AA 4LFCB 4WBNA 4RQFA 4Z2WA 3K0DA 1FXHA 3N2GA 3JAWB 2DE0X 1I5YA 1MG1A 1NVPB 2YI9A 4IIJA 4BIZA 2ZXWB 4D6TH 5GONB 2Q7HA 4TV8A 1Y76A 3OFNG 3THOA 1OCZB 1YVWA 4NTYA 3EHBB 2EJ7A 2WA4A 4WFEA 3P3NA 1B3QA 4CH6A 3BCCH 4UCSA 4NXNB 2YIDA 4YJ3A 2QJ1A 2LJ2A 1PV0A 1TUEB 3K58A 4YY3O 2HP8A 3FB8C 1HNZO 4PDLA 2ZINA 4XDKA 1H2MA 3ZEDA 3OGIB 4I5SA 5B5EZ 4LNUA 3IAYA 1SETA 1XNQO 3WB1A 1S5HC 3OE7G 5B1BB 3CRCA 2XUMA 1OCCB 3WB0A 3SPCA 3E8HA 4YHHO 1AP6A 4LF5O 3A0RA 2O57A 2WPDG 4QPKA 5IDJA 4KHPB 3HKCB 2KKWA 4MTOA 3ZHVA 3FB5C 2AHYA 2JVDA 3QO8A 1PL4A 4P2ZA 2W6JG 4LR3A 2FYUH 3ZRXA 4X66B 2WLIB 2ADQB 1DF4A 3SJBC 2EILC 3JASB 3ZHRA 3ABMC 5H5NA 1G8MA 5L3EA 2BTQA 3GB7C 1VQ6V 5BMVA 3A8TA 1Q81W 1MNGA 5LA6A 5IY5C 1Q6HA 5BR8O 1OHHG 1YI2V 4RUFA 4DR5O 4FIPC 3AK1A 2Q68A 1L0NH 4B3SO 4UUJC 2VQFB 4FLWA 2XTAA 3ZMTA 5EK0A 3W7UA 4TV9B 2EX3A 3H1HH 4AQYO 3HKBB 3TXSA 4I9QA 3K0GA 2ZR2A 2KG7B 4GT1A 3K59A 4DV5B 3BFRA 2YIBD 1B04A 3ABKB 3ZX6A 1M1KW 4ZBMA 4X1IA 3I55V 2P06A 3W7SA 3IC7A 1TVKA 3K04A 3BRCA 2IJJA 4WF9V 3OMAB 4FPPA 1NR7A 2EZPA 2AXTZ 1GM9A 1R3KC 4WFHA 3A2FA 5IJ0A 2ATKC 4LF6O 4FLVA 4LF9O 1AR4A 4DR3O 2M7WA 1HP8A 1K4DC 3CJHA 4JTCB 4FJCC 4O4JB 2JK5C 2UU9B 3WG7C 5IYZB 1DK1A 1FS0G 4JYBA 4DO2A 4GX0A 1I94O 3FYEB 1FYJA 2RDCA 4CC5A 3SYAA 1AR1B 5LP6B 3N2KA 1VARA 1K7DA 3LDEA 1YSCA 3I5DA 4I4TB 1MZEA 1TAEA 2AZ0A 2KB1A 4DV6B 1KP3A 2Y4TA 2ZE5A 1N34O 2WLLB 3OUSA 4DR6B 4MTFA 2Y0IA 1I0HA 2LP7A 2HJDA 5KMGA 3MHHC 1AILA 1CP9A 2ZDIC 1JOYA 1ZAUA 1OCRB 2CH7A 2YICA 1FD9A 1XEQA 4J9YB 5IYBO 1I08A 1D5AA 3B8MA 1V55B 4PDVA 1QQCA 2IJIA 2QWPB 1QR8A 4NYKA 2F4VO 1KC8W 4YXWG 3W7TA 1WNSA 1DLBA 4ABMA 3HKDB 3DGEA 4HBNA 4Q20A 4JI6B 2UUCO 2EIKC 3AG7A 4MW8A 3CC2V 1KUQA 4JYAO 5FL7G 2JEXA 2UXNA 5FPOA 5FLXN 4X62B 3ZRWA 1YCIA 2YDEA 1GN2A 4ZI7A 2V1DA 3UCSC 1VF6C 2CTWA 4FFBB 4DR7B 3FB7C 4LF7O 1FPOA 4E4EA 4B3MB 2Y4UA 4X20A 1XL6A 4HAMA 4R8CA 1YHQV 1HNWB 3FAVB 4QNHB 1BE3H 2ZR3A 4BW5A 4LCUC 5K1PA 5EZYA 3ETDA 2MK3A 3CX5F 4KP4A 1ZUQA 4HZ3A 4EKWA 3ZHTA 1FXVA 1H2KA 2Q7GA 2Y69B 2QA4V 5KX5B 2WLKA 2PY5A 1NH2D 1QCEA 4JI7O 4JI8B 4ZOLA 2ZXWC 4O4LB 1TA8A 2X0LA 4K0KB 4QE9A 4DR4B 2X6CA 1W0KG 1FXKC 2F1MA 1OCZC 1B6QA 2HFEC 1Y74A 1RSOA 1SA0B 3AK3A 3A0BZ 1H2GA 5B1OA 2EJRA 4HNAB 1BL8A 1SZXA 1K33A 3OGCC 3UT5A 3G4SV 4O2BA 1GM7A 1KP2A 4ZHQB 5KHIA 1SERA 1S5LZ 4FLXA 2AGAA 3CEIA 3ETGA 3JCUZ 5B1BC 2ZE6A 4OPAA 4DV4O 2PZSA 4NB5A 1OCCC 1FFXB 5JVDA 4EFEA 3K08A 5E1AC 2ODMA 5KA5A 5FNVB 3JD3A 3B77A 3G6EV 5B3SB 5CB4A 5LMUB 2QM7A 4MVQA 1VQNV 3ASNB 1N33O 2EIMB 1XQ8A 3CCUV 2Z5UA 3E35A 1F51A 1YF2A 3QO5A 3SPIA 4J42A 1D2DA 4X64O 3BAAA 4QJFB 1EN5A 4H0LB 3QF7A 1AJPA 4OPHA 5CN0A 2WLMA 4JGSA 2ZKOA 4LF4O 1YJNV 1JJOA 4Z1VA 3CC4V 2WAMA 4WFGA 2CGNA 1NH2B 2GHYA 3VQVA 3K3WA 1RPRA 3JAKA 1RFYA 1AJNA 3FX7A 4FM1A 3K57A 5EC2C 1N0NA 1R3IC 4MVSA 2DYSB 3VBBA 1R73A 4DV0B 2E5LB 3UO2A 4OX9B 2K9PA 2OWOA 4IYIA 2DQ3A 3E8FA 1E1QG 5IWAO 1KMIZ 2LFRA 3QTCA 2AZ2A 4X1KA 3L9DA 4BW9A 3CCQV 3DXRB 3ASOB 1H8HG 3P30A 2UUAB 4JTDB 1QVFU 2M6YA 3E22B 3ABKC 4IYHA 4PA4A 1YEWA 3C3SA 2P90A 3UO3A 1EZVH 2R9AA 4LFBO 1P4RA 2UXDB 1M57C 2ZE8A 3DC6A 2ILMA 3OTOO 4OXSA 4DRXB 3OEHG 2PYLA 4J7KA 2EINC 4BIUA 3CCRV 2ITDC
chains in the Genus database with same CATH topology
2NN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN4 A; 
#chains in the Genus database with same CATH topology
 1VF6 A;  3JAL B;  4FLU A;  1ZX3 A;  4NXM B;  5B1A B;  5LOV A;  3IGA C;  2E76 B;  2P7T C;  1JPX A;  4I50 A;  3CXC U;  4O2A A;  4EEQ A;  3TET A;  4L8J A;  1XMO O;  3U10 A;  1GTO A;  1BMF G;  1M56 B;  1NQT A;  2QKC A;  4N23 A;  2Q73 A;  2JGD A;  1G1X B;  3LUT B;  1YIJ V;  1T5E A;  4FFK A;  3ZJZ A;  1D5N A;  1GKF A;  4XDJ A;  4NTX A;  5C8Y A;  2LW1 A;  3AG3 B;  3H1L H;  4DV3 B;  5FPR A;  1MSW D;  1IBL B;  1M9N A;  4JI5 B;  1MAB G;  1V54 B;  5LGT A;  5LP6 C;  3CCE V;  3RYF B;  1WAZ A;  3B4S A;  1XHX A;  3E2E A;  1FXK A;  1LUV A;  4P9P A;  3FKS G;  2B1G A;  1K73 W;  1QLE B;  3H1K H;  1XL4 A;  4O4H B;  4QE7 A;  4K3A A;  1AI7 A;  3QO7 A;  2C2A A;  5LMN O;  1ZL8 B;  1ZWI C;  5JQG B;  1NI8 A;  2UUB O;  3SPH A;  2JDI G;  4JAU A;  1Y67 A;  4BAY A;  1AI5 A;  2IH3 C;  4R7C A;  1OCR C;  4OGQ B;  1Q82 W;  2GSM B;  4GX5 A;  4LWS B;  2Y0P A;  3T2M A;  4X8A A;  1BHB A;  3JAT A;  1NTZ H;  3L74 H;  4PDM A;  1V55 C;  4JAV A;  4I55 A;  3K9S A;  3ZHS A;  1URF A;  1BCC H;  4Z1M G;  5JH7 B;  5LXT A;  4X88 A;  4YY3 B;  3CPW U;  2BOB C;  4GLX A;  1TUB A;  5JJJ B;  1F4N A;  3OM3 B;  5CA0 A;  2EBO A;  5LYJ B;  1VQL V;  1WA8 A;  2QTS A;  2B5U A;  3O65 A;  1AI6 A;  5D5Q A;  3NXS A;  2JGU A;  1YDX A;  5AG2 A;  2IU3 A;  1IUR A;  4UVB A;  1O9G A;  4YHH B;  4IHJ A;  4DW0 A;  4LF5 B;  2GUZ B;  5L3C A;  2DYR B;  2Q8V A;  3Q4H A;  3BA9 A;  2IW5 A;  5LGU A;  3TJT A;  4GKJ O;  2QGN A;  1S72 V;  1B06 A;  1J5E O;  5H2F Z;  1LR1 A;  4LFA O;  4WCE V;  1PNK A;  2GTA A;  3KCX A;  3CE2 A;  2IH1 C;  1ARO P;  2CE4 A;  4X1Y A;  2Y69 C;  1I7F A;  1WJZ A;  1N4C A;  4JI0 O;  1JFF A;  3ZN1 A;  2PF4 E;  5CBG A;  1S76 D;  1L1F A;  1VF5 B;  3AG2 B;  1YZB A;  1P7G A;  3RYH B;  3RVZ A;  3OT7 A;  1EZJ A;  3ICX A;  5BR8 B;  5J2U A;  5J2T B;  4DR5 B;  2JJ2 G;  4B3S B;  1EBO A;  3CXH F;  3JD4 A;  4B08 A;  2IJK A;  1WB7 A;  2DW4 A;  3OR6 C;  3CHX A;  3CCS V;  4RWU A;  2KG7 A;  5F2V O;  2Q4P A;  2ZIM A;  4IL6 Z;  1OCO B;  5KUK A;  1NJI W;  3ZHU A;  2BSK A;  4AQY B;  2HHH O;  3KZI Z;  4WBN B;  3X2Q B;  4D7S A;  4DV1 O;  3D36 A;  3N2G B;  2OYQ A;  1IXB A;  4YIO A;  4DYL A;  4IIJ B;  1FAF A;  3BA8 A;  4TV8 B;  1K8A W;  3ETQ A;  3B09 A;  1PM9 A;  1Y76 B;  2H94 A;  4GX2 A;  3O9O A;  5B3S C;  4XBF A;  2UXB O;  2WA3 A;  3E8B A;  3JSN A;  2EIM C;  4YJ3 B;  1AI4 A;  3APQ A;  1OJH A;  3P3P A;  4F4L A;  3T1H B;  1Q6U A;  4F6R A;  4LF6 B;  4K8X A;  4LF9 B;  4DR3 B;  3D3Q A;  2VQE O;  4J7J A;  1Q8I A;  4LNU B;  3F5W C;  4KL1 A;  2N04 A;  1BSM A;  3OTF A;  3HKE A;  2QEX V;  5EBW C;  3AEI A;  1I94 B;  1S77 D;  1FFT B;  4J41 A;  3H9V A;  1JR9 A;  1M4U A;  2DYS C;  2VWJ A;  5A2Q N;  2ZNJ A;  3L72 H;  1N32 O;  1BS3 A;  2OIG A;  1VIB A;  4F6E A;  3K5M A;  4DR2 O;  1K3E A;  3CB2 A;  3G71 V;  2ITC C;  1QR9 A;  3RW0 A;  2H8P C;  2DWE C;  1N34 B;  5EIB C;  2GBO A;  4PA3 A;  2BTQ B;  5BMV B;  2ZCE A;  4YJ2 B;  2OT5 A;  2QE7 G;  1ZSP A;  3AG4 B;  5LA6 B;  1MA1 A;  2W6I G;  3DSQ A;  4DR1 O;  1KEC A;  2NR5 A;  5CA1 A;  1PNL A;  4NTW A;  2F4V B;  1P7B A;  1H38 A;  4B3R O;  3SYQ A;  1XIL A;  5DN6 G;  3ZRS A;  3RGB A;  4FFB A;  1YIT V;  1JA8 A;  4O4I A;  2JIZ G;  5B1A C;  3OW2 U;  1YTF D;  2YXY A;  1NBM G;  4MSW C;  3JAM N;  4JYA B;  3B8N A;  2E3C A;  3SJC C;  1RM1 B;  1PP9 H;  1M56 C;  1W59 A;  4TQF A;  4LF7 B;  2PI5 A;  3ZRV A;  2ADP A;  4GUN A;  1WPB A;  3AG3 C;  4B3T B;  4G28 B;  4MVZ A;  4XDL A;  5IE9 A;  1W0J G;  4X1I B;  3SYO A;  5BXZ A;  1V54 C;  1PKX A;  3U0Z A;  4DK0 A;  3ABU A;  1TVK B;  5IJ9 A;  2VRZ A;  3B2E E;  3CCM V;  2Q0A A;  5HFL A;  5ITZ A;  3BEH A;  2GTS A;  4DUY O;  4RUE A;  2UU9 O;  3K5O A;  1YXB A;  2ZT9 B;  4JI7 B;  4J80 A;  5IJ0 B;  1L0L H;  1R6N A;  1SRY A;  4MTX A;  1WN7 A;  4PI2 A;  4EB6 A;  3LSS A;  2Z3Y A;  4AHC A;  2LGQ A;  3JYC A;  3CME V;  1KKC A;  3BY6 A;  1M93 A;  2ZM6 O;  4G2K A;  1IX9 A;  2KSD A;  1R1B A;  5B66 Z;  2QM8 A;  1WLE A;  4I0X A;  2CGO A;  3SR2 C;  4CC6 A;  1K5Q A;  3N2K B;  4U3J A;  3NR7 A;  3SDL A;  3FFQ A;  2WLN A;  1HR0 B;  2YI8 A;  3DTU B;  1XMQ O;  3W7W A;  1YTF B;  5BZB A;  4P30 A;  1EFR G;  2LW7 A;  3K06 A;  4TT3 G;  1U96 A;  4WFB V;  1SC5 B;  1H2S B;  4LH6 A;  3K5N A;  3JD0 A;  2P6J A;  4DV4 B;  1G6U A;  1SQF A;  2AW9 A;  2YIA A;  5KMG B;  1K9M W;  3UQ8 A;  4FLZ A;  4JYC A;  1VQ7 V;  4JI1 O;  1WPX A;  4U7O A;  2R70 A;  2DYR C;  3E89 A;  3S3X A;  1KQS U;  1KBH A;  1N33 B;  3R66 A;  4D7T A;  4CS3 A;  3MDS A;  4X89 A;  3ZMV A;  4X64 B;  3JAR A;  1PPJ H;  3TGU H;  5J9P C;  2EIJ B;  5KA6 A;  3F7V C;  3CCL V;  4DR7 O;  3PJS K;  2JEU A;  5EBM C;  3AG2 C;  4LF4 B;  1JCH A;  2RCV A;  4ZIB A;  2OTL V;  2CUG A;  3ZRW B;  1UPG A;  3SPJ A;  4ZI7 B;  4CBC A;  3LNM B;  5LHG A;  2DN9 A;  2RN9 A;  2XAJ A;  3UM7 A;  4NR1 A;  4UCT A;  4JI3 O;  4X20 B;  2A3Q A;  2E74 B;  1GN6 A;  1US6 A;  1Y6X A;  4JF3 A;  4PA7 A;  1SQG A;  1G4Y B;  1HNX O;  4IGG A;  3P32 A;  3RYI A;  3RWR D;  1J95 A;  5IWA B;  4BR6 A;  5L3G A;  2XOK G;  2OCC B;  1GRJ A;  3MHS C;  3BHP A;  3CYO A;  3APO A;  4P9O A;  4K0K O;  2QTO A;  3X2Q C;  3ABL B;  3H1J H;  1CPY A;  2ARH A;  1NS1 A;  2JS3 A;  4LF8 O;  2QKA A;  2Q7E A;  4NKG B;  5KAF Z;  3M7M X;  3T1Y O;  1VQK V;  4ZOL B;  4UCR A;  4J10 A;  4TSF G;  1H2N A;  5K1X A;  4LFB B;  3EVK A;  4PD4 F;  1EN4 A;  1K5S A;  1HWY A;  1ENV A;  1AP5 A;  3CWB H;  4FVM A;  4PI0 A;  1Y74 B;  5CA3 A;  1RSO B;  3OTO B;  3OEE G;  1X4T A;  2YEV A;  1ZTE A;  2GV9 A;  1NZ6 A;  5A9G A;  1KYO F;  4UCU A;  1SQB H;  1EM1 A;  3UT5 B;  2ZDI A;  4RO2 A;  4O2B B;  2ZE7 A;  2JRI A;  1XMO B;  3RYC A;  3L75 H;  4U7N A;  4JI4 O;  1JQ0 A;  3STL C;  1N36 B;  4TUY B;  3OR7 C;  3VQY A;  3CMA V;  4JV5 B;  4RAI A;  2X6B A;  1ZLZ A;  5EYP A;  5JVD B;  2YSU B;  1GO3 F;  3LSU A;  2ZNI A;  1Z2G A;  4DV7 O;  5CB4 B;  1Q5O A;  1AR5 A;  3SPG A;  2QR4 A;  3F7Y C;  1S0V A;  1F23 A;  1YJW V;  4ASU G;  2Q0O C;  4J9Z B;  2A0L A;  2HG5 C;  1SKV A;  5LMN B;  4CH5 A;  2XAH A;  4JI2 O;  3AG4 C;  2E5L O;  2FL4 A;  4OX9 O;  4K8Z A;  3JAK B;  2Q5Z A;  3CRA A;  3ZIA G;  3JAW A;  2VWK A;  3K79 A;  3VQX A;  4R6Z A;  3VOU A;  2ETN A;  2HKO A;  1IBM B;  5GON A;  4KUM A;  2QWQ B;  1XNR O;  5DM6 V;  1RM1 C;  3S3W A;  3WFV A;  2L6L A;  1Y66 A;  5JJN B;  4MW3 A;  4X1K B;  1FJG O;  4MVM A;  3STZ C;  5KLV H;  1JMK C;  3T4D A;  3WB2 A;  4JZG A;  2QDO A;  4GKK O;  2NLJ C;  1XDC A;  4UV8 A;  4UXN A;  1KB9 F;  1IBK O;  1M90 W;  2HEP A;  1J5E B;  5L3D A;  2UXC O;  3J80 N;  4UV9 A;  2PUS A;  3TCU A;  1HNZ B;  1K4C C;  4LH7 A;  4KFM A;  3RBZ A;  4JI0 B;  2RJZ A;  5LOV B;  1XOU A;  2Q69 A;  4I50 B;  1Z5W A;  2CDY A;  3G80 A;  4FZ1 A;  4O2A B;  2CTP A;  1XNQ B;  3HKC A;  3K03 A;  3EFF K;  2IU0 A;  4PHZ A;  1A32 A;  4TQD A;  1CXZ B;  4FMT A;  3C3T A;  2WLI A;  4UVA A;  3OMN B;  1OV9 A;  4FLT A;  1MOF A;  4DV2 O;  1LNQ A;  1N0J A;  1RPO A;  5C8Y B;  3JAS A;  2KQX A;  4CH4 A;  1XBL A;  4CH3 A;  1NT2 B;  3J7A U;  3D3I A;  2HHH B;  4QGP A;  2Q9L A;  2OTJ V;  2LQT A;  5IT9 N;  3RN4 A;  3LDD A;  1FXK B;  4DV1 B;  2V4D A;  4PA9 A;  4X65 O;  3HPL C;  4DUZ O;  3T1C A;  1WB8 A;  5GW7 A;  1GK9 A;  4B7K A;  1TGO A;  2VS0 A;  2WWW A;  4TV9 A;  5GTH Z;  1NU1 H;  4Q6G A;  5TIS Z;  3E8G A;  3HKB A;  4W4K A;  4K35 A;  5LHI A;  4LFC O;  2UXB B;  2A06 H;  3ZCC A;  3LDC A;  3JAT B;  3MAQ A;  2E75 B;  1Q7Y W;  4I55 B;  4GCZ A;  1E79 G;  3QG5 A;  2EIJ C;  2DQ0 A;  2BE3 A;  5LXT B;  2IM9 A;  3ZMS A;  2XND G;  1K97 A;  1TUB B;  3SYP A;  4UCV A;  5CA0 B;  3SGI A;  2VQE B;  5E79 Z;  3HR0 A;  2Z0A A;  5KHG A;  1ROP A;  1WA8 B;  4J11 A;  1QU7 A;  4DW1 A;  3CCV V;  3AK2 A;  2A9H A;  2P4K A;  2WLJ A;  4NXN O;  3JD2 A;  1F4M A;  3GWO A;  4FM2 A;  1M5I A;  2A7W A;  1Q43 A;  1NTM H;  1GN3 A;  4IHJ B;  1THZ A;  4L87 A;  3BVO A;  5CMU A;  3Q4H B;  3VQW A;  3ASN C;  2BCC H;  1N32 B;  4YJ2 A;  1SS3 A;  4DR2 B;  2OCC C;  1VQ9 V;  4O4J A;  4X1Y B;  5IYZ A;  3ABL C;  1R3J C;  2R72 A;  2XT9 A;  1JFF B;  2B1I A;  2D3O W;  4NVP A;  4I9W A;  4JTA B;  1JX9 A;  3ZMZ A;  4JZ2 A;  5LP6 A;  3IFX A;  1Y4M A;  4KHP O;  5LL6 Y;  2YS8 A;  1Q3E A;  4I4T A;  4FK5 C;  1Q86 W;  1PL0 A;  5J2U B;  4DR1 B;  3GWK C;  2FKX A;  4I7Z B;  1VQ5 V;  4X66 O;  3G6B A;  1GH6 A;  4UVC A;  1AJQ A;  4B3R B;  2WLL A;  2GDS A;  2IJH A;  4ZKI A;  2F95 B;  3U11 A;  1DTO A;  1XRE A;  2QWN B;  2YIB A;  5H9C A;  2BSK B;  2QSA A;  5KHJ A;  4RQE A;  3AG1 B;  2DOS A;  1M57 B;  3ASO C;  1VQM V;  4G27 B;  4BWA A;  2X7R B;  2XAQ A;  3OD4 A;  5L3B A;  2VQF O;  3JSL A;  2EIN B;  2OCH A;  1R6T A;  1V9P A;  3CD6 V;  3HKD A;  4MVU A;  5IYD O;  5LGN A;  3T1H O;  2Q6A A;  3H01 A;  4PA6 A;  2A79 B;  1Q90 D;  4H37 A;  2DWD C;  3F5T A;  5KUM A;  3CP1 A;  1BQ0 A;  3W7X A;  4LBE C;  1PD3 A;  4UB6 Z;  1VMG A;  4DV5 O;  2UUC B;  2H3O A;  4DUY B;  2XAF A;  3ZHQ A;  5B1N A;  3CRR A;  4FM0 A;  3FAV A;  3N27 A;  4F6R B;  1JVM A;  3HB3 B;  1SQP H;  2HVJ C;  1SZT A;  2P67 A;  3CRM A;  3ML0 A;  1F7Y A;  2ZM6 B;  3OAA G;  3HKE B;  3K9A A;  2W0F C;  1P84 F;  1BQZ A;  5KX5 A;  3CCJ V;  2FTK A;  1P49 A;  2NNU A;  5C93 A;  1CEZ A;  3KKY A;  2F23 A;  4FLY A;  4O4L A;  2P22 C;  1HW7 A;  1NTK H;  2LFS A;  2YC0 A;  2X6A A;  1XMQ B;  5CBH A;  1BT8 A;  1VQ8 V;  1QLE C;  4PEL A;  3ZS8 C;  1SQV H;  5EBL C;  1SA0 A;  2XHB A;  2FML A;  2XAS A;  4CZZ A;  4HNA A;  2WSS G;  4H13 B;  1VP7 A;  1VQO V;  1DF5 A;  1QLN A;  4JI1 B;  2AHZ A;  1RP3 B;  4ZHQ A;  3CJH B;  2YUA A;  1GM8 A;  4CS2 A;  4ICG A;  4UB8 Z;  1SQX H;  4DV6 O;  4JAS A;  2QWO B;  3I56 V;  5CA1 B;  1XI1 A;  2F66 C;  3RT3 C;  4TOI A;  4DR6 O;  1FFX A;  2OIE A;  3CSX A;  4O4I B;  1GAX A;  3E86 A;  5D5P A;  3MD0 A;  4B3T O;  5FNV A;  1SQQ H;  5JCO C;  3ABT A;  1DGS A;  2K1E A;  2XAG A;  5H6Q A;  5DED A;  3WU2 Z;  3ETE A;  1BGY H;  4AIL C;  2HLD G;  1HDJ A;  3QNE A;  4YIP A;  2P5O A;  1YJ9 V;  4JI3 B;  3TXQ A;  4WFF A;  1Z5V A;  3R65 A;  2CH7 B;  1QVG U;  5LHH A;  4JI6 O;  1HNX B;  2CTR A;  2PTM A;  3FB6 C;  4X62 O;  1VQ4 V;  3PN1 A;  1SF9 A;  5IJ9 B;  1XHZ A;  3KCY A;  1AB3 A;  4MT8 A;  3RVY A;  2HJF C;  4C7U A;  5ITZ B;  4CS4 A;  4QIW F;  1NKD A;  4B3M O;  4UCO A;  4LF8 B;  4JPR A;  1HNW O;  3T1Y B;  2RQ6 A;  2QM4 A;  4EB6 B;  1UJW B;  2V7Q G;  1MMM A;  1MZF A;  3JCZ A;  1WP7 A;  3EXA A;  1NR1 A;  3L73 H;  4BIO A;  5JWP A;  3FD9 A;  4FZ0 A;  2RNB A;  3CS5 A;  5HFM A;  3DXR A;  5EIB D;  1HR0 O;  2EIL B;  2R9I A;  3ABM B;  3ZBH A;  4I0X B;  4TUY A;  3E22 A;  3M99 B;  1OCO C;  4JI8 O;  5EZY B;  2BOC C;  3A0H Z;  2WLH A;  5IY5 B;  4LC1 A;  1IDS A;  4U3J B;  4DXW A;  4H44 B;  2F93 B;  4DR4 O;  4X9Q A;  4JI4 B;  3OMI B;  2D2C B;  3TK1 A;  1VQP V;  4DRX A;  1N8R W;  2CTQ A;  3BAB A;  4TWK A;  3JAL A;  2NN4 A;  5L3F A;  1O9H A;  1ORQ C;  1E1R G;  4QPJ A;  3SYC A;  1BZK A;  1PNM A;  2QKS A;  2L35 A;  4DV7 B;  3IC9 A;  4IT5 A;  4LP8 A;  4A5U B;  2ZQM A;  2PGG A;  2G38 A;  1S3J A;  5KHH A;  5IYC O;  5DEC A;  3JAR B;  3CRQ A;  3SJQ C;  5LBQ A;  4JAA A;  3T4Z A;  3CC7 V;  4J7Z A;  2EZO A;  5BY1 A;  1R3L C;  1IZ3 A;  5CBF A;  3UKM A;  1GMG A;  1W2B U;  4JI2 B;  3RYF A;  2W0X A;  1XUQ A;  5LMU O;  1COW G;  3QVN A;  1QHT A;  5KAI Z;  1FKA O;  1IXM A;  2MW2 B;  5KHK A;  3LSQ A;  4PV1 B;  2RMK B;  2HVK C;  4O4H A;  1ZL8 A;  5JQG A;  3J81 N;  2EUL A;  3LNN A;  1VEW A;  1AVM A;  1H2L A;  2DJV A;  3B40 A;  4UFZ A;  3RYI B;  4LWS A;  4R50 A;  1XNR B;  2N05 A;  4N21 A;  3JD1 A;  1VF7 A;  3AG1 C;  4E2L A;  4MVO A;  2CK3 G;  3WG7 B;  1I5X A;  2B9Z A;  2LGW A;  1FJG B;  3D36 C;  2R9R B;  5EC1 C;  3KG2 A;  2UUB B;  4W4L A;  1KKD A;  3C90 A;  4AI8 A;  1L8D A;  3L71 H;  5JH7 A;  4DV0 O;  3ZN0 A;  2Q67 A;  4GKK B;  2YXL A;  2LO1 A;  4GYC B;  2DMX A;  5LYJ A;  1IBK B;  5JCO A;  3FYI B;  1EN6 A;  1NVP D;  4MTG A;  2ZD9 A;  4PJ0 Z;  2UXC B;  3SJA C;  3E83 A;  2YEV B;  1QBZ A;  1QNM A;  2UUA O;  4DK1 A;  3D8C A;  1N36 O;  4KXR A;  4JV5 O;  1MSD A;  5JJE B;  2GUZ A;  4JYY A;  2N74 A;  4MS2 A;  1JJ2 U;  2UXD O;  2IBZ H;  1H8E G;  3GVM A;  3RYC B;  1LUW A;  2F43 G;  2YXH A;  2HR3 A;  1GN4 A;  2QWR B;  1R6K A;  4EFB A;  3K5L A;  4DV2 B;  4WFA V;  1SES A;  3OUF A;  1X59 A;  4MVR A;  4HYO A;  1WP8 A;  1IVS A;  5EYP B;  4GZR B;  2EIK B;  4NXM O;  5H6R A;  2Y48 A;  3ZMU A;  2PYJ A;  3L70 H;  2UXX A;  4GKJ B;  3RFR A;  3RYH A;  4B7E A;  4LFA B;  2JJ1 G;  1KU9 A;  2PI4 A;  1UFI A;  2ZIO A;  3IJ4 A;  5GTI Z;  5J2T A;  3H1I H;  2CAZ C;  3DC5 A;  1Q6I A;  1K92 A;  4PDR A;  1U97 A;  4X65 B;  4DUZ B;  1K34 A;  4DV3 O;  1IBL O;  1S5J A;  4JI5 O;  1OZ0 A;  2BTO A;  2FB5 A;  2JS5 A;  4U3F H;  4GX1 A;  2JGD B;  4H33 A;  3BPZ A;  3G67 A;  1KD1 W;  1IBM O;  2P4V A;  1BHA A;  3M8A A;  4LFC B;  4WBN A;  4RQF A;  4Z2W A;  3K0D A;  1FXH A;  3N2G A;  3JAW B;  2DE0 X;  1I5Y A;  1MG1 A;  1NVP B;  2YI9 A;  4IIJ A;  4BIZ A;  2ZXW B;  4D6T H;  5GON B;  2Q7H A;  4TV8 A;  1Y76 A;  3OFN G;  3THO A;  1OCZ B;  1YVW A;  4NTY A;  3EHB B;  2EJ7 A;  2WA4 A;  4WFE A;  3P3N A;  1B3Q A;  4CH6 A;  3BCC H;  4UCS A;  4NXN B;  2YID A;  4YJ3 A;  2QJ1 A;  2LJ2 A;  1PV0 A;  1TUE B;  3K58 A;  4YY3 O;  2HP8 A;  3FB8 C;  1HNZ O;  4PDL A;  2ZIN A;  4XDK A;  1H2M A;  3ZED A;  3OGI B;  4I5S A;  5B5E Z;  4LNU A;  3IAY A;  1SET A;  1XNQ O;  3WB1 A;  1S5H C;  3OE7 G;  5B1B B;  3CRC A;  2XUM A;  1OCC B;  3WB0 A;  3SPC A;  3E8H A;  4YHH O;  1AP6 A;  4LF5 O;  3A0R A;  2O57 A;  2WPD G;  4QPK A;  5IDJ A;  4KHP B;  3HKC B;  2KKW A;  4MTO A;  3ZHV A;  3FB5 C;  2AHY A;  2JVD A;  3QO8 A;  1PL4 A;  4P2Z A;  2W6J G;  4LR3 A;  2FYU H;  3ZRX A;  4X66 B;  2WLI B;  2ADQ B;  1DF4 A;  3SJB C;  2EIL C;  3JAS B;  3ZHR A;  3ABM C;  5H5N A;  1G8M A;  5L3E A;  2BTQ A;  3GB7 C;  1VQ6 V;  5BMV A;  3A8T A;  1Q81 W;  1MNG A;  5LA6 A;  5IY5 C;  1Q6H A;  5BR8 O;  1OHH G;  1YI2 V;  4RUF A;  4DR5 O;  4FIP C;  3AK1 A;  2Q68 A;  1L0N H;  4B3S O;  4UUJ C;  2VQF B;  4FLW A;  2XTA A;  3ZMT A;  5EK0 A;  3W7U A;  4TV9 B;  2EX3 A;  3H1H H;  4AQY O;  3HKB B;  3TXS A;  4I9Q A;  3K0G A;  2ZR2 A;  2KG7 B;  4GT1 A;  3K59 A;  4DV5 B;  3BFR A;  2YIB D;  1B04 A;  3ABK B;  3ZX6 A;  1M1K W;  4ZBM A;  4X1I A;  3I55 V;  2P06 A;  3W7S A;  3IC7 A;  1TVK A;  3K04 A;  3BRC A;  2IJJ A;  4WF9 V;  3OMA B;  4FPP A;  1NR7 A;  2EZP A;  2AXT Z;  1GM9 A;  1R3K C;  4WFH A;  3A2F A;  5IJ0 A;  2ATK C;  4LF6 O;  4FLV A;  4LF9 O;  1AR4 A;  4DR3 O;  2M7W A;  1HP8 A;  1K4D C;  3CJH A;  4JTC B;  4FJC C;  4O4J B;  2JK5 C;  2UU9 B;  3WG7 C;  5IYZ B;  1DK1 A;  1FS0 G;  4JYB A;  4DO2 A;  4GX0 A;  1I94 O;  3FYE B;  1FYJ A;  2RDC A;  4CC5 A;  3SYA A;  1AR1 B;  5LP6 B;  3N2K A;  1VAR A;  1K7D A;  3LDE A;  1YSC A;  3I5D A;  4I4T B;  1MZE A;  1TAE A;  2AZ0 A;  2KB1 A;  4DV6 B;  1KP3 A;  2Y4T A;  2ZE5 A;  1N34 O;  2WLL B;  3OUS A;  4DR6 B;  4MTF A;  2Y0I A;  1I0H A;  2LP7 A;  2HJD A;  5KMG A;  3MHH C;  1AIL A;  1CP9 A;  2ZDI C;  1JOY A;  1ZAU A;  1OCR B;  2CH7 A;  2YIC A;  1FD9 A;  1XEQ A;  4J9Y B;  5IYB O;  1I08 A;  1D5A A;  3B8M A;  1V55 B;  4PDV A;  1QQC A;  2IJI A;  2QWP B;  1QR8 A;  4NYK A;  2F4V O;  1KC8 W;  4YXW G;  3W7T A;  1WNS A;  1DLB A;  4ABM A;  3HKD B;  3DGE A;  4HBN A;  4Q20 A;  4JI6 B;  2UUC O;  2EIK C;  3AG7 A;  4MW8 A;  3CC2 V;  1KUQ A;  4JYA O;  5FL7 G;  2JEX A;  2UXN A;  5FPO A;  5FLX N;  4X62 B;  3ZRW A;  1YCI A;  2YDE A;  1GN2 A;  4ZI7 A;  2V1D A;  3UCS C;  1VF6 C;  2CTW A;  4FFB B;  4DR7 B;  3FB7 C;  4LF7 O;  1FPO A;  4E4E A;  4B3M B;  2Y4U A;  4X20 A;  1XL6 A;  4HAM A;  4R8C A;  1YHQ V;  1HNW B;  3FAV B;  4QNH B;  1BE3 H;  2ZR3 A;  4BW5 A;  4LCU C;  5K1P A;  5EZY A;  3ETD A;  2MK3 A;  3CX5 F;  4KP4 A;  1ZUQ A;  4HZ3 A;  4EKW A;  3ZHT A;  1FXV A;  1H2K A;  2Q7G A;  2Y69 B;  2QA4 V;  5KX5 B;  2WLK A;  2PY5 A;  1NH2 D;  1QCE A;  4JI7 O;  4JI8 B;  4ZOL A;  2ZXW C;  4O4L B;  1TA8 A;  2X0L A;  4K0K B;  4QE9 A;  4DR4 B;  2X6C A;  1W0K G;  1FXK C;  2F1M A;  1OCZ C;  1B6Q A;  2HFE C;  1Y74 A;  1RSO A;  1SA0 B;  3AK3 A;  3A0B Z;  1H2G A;  5B1O A;  2EJR A;  4HNA B;  1BL8 A;  1SZX A;  1K33 A;  3OGC C;  3UT5 A;  3G4S V;  4O2B A;  1GM7 A;  1KP2 A;  4ZHQ B;  5KHI A;  1SER A;  1S5L Z;  4FLX A;  2AGA A;  3CEI A;  3ETG A;  3JCU Z;  5B1B C;  2ZE6 A;  4OPA A;  4DV4 O;  2PZS A;  4NB5 A;  1OCC C;  1FFX B;  5JVD A;  4EFE A;  3K08 A;  5E1A C;  2ODM A;  5KA5 A;  5FNV B;  3JD3 A;  3B77 A;  3G6E V;  5B3S B;  5CB4 A;  5LMU B;  2QM7 A;  4MVQ A;  1VQN V;  3ASN B;  1N33 O;  2EIM B;  1XQ8 A;  3CCU V;  2Z5U A;  3E35 A;  1F51 A;  1YF2 A;  3QO5 A;  3SPI A;  4J42 A;  1D2D A;  4X64 O;  3BAA A;  4QJF B;  1EN5 A;  4H0L B;  3QF7 A;  1AJP A;  4OPH A;  5CN0 A;  2WLM A;  4JGS A;  2ZKO A;  4LF4 O;  1YJN V;  1JJO A;  4Z1V A;  3CC4 V;  2WAM A;  4WFG A;  2CGN A;  1NH2 B;  2GHY A;  3VQV A;  3K3W A;  1RPR A;  3JAK A;  1RFY A;  1AJN A;  3FX7 A;  4FM1 A;  3K57 A;  5EC2 C;  1N0N A;  1R3I C;  4MVS A;  2DYS B;  3VBB A;  1R73 A;  4DV0 B;  2E5L B;  3UO2 A;  4OX9 B;  2K9P A;  2OWO A;  4IYI A;  2DQ3 A;  3E8F A;  1E1Q G;  5IWA O;  1KMI Z;  2LFR A;  3QTC A;  2AZ2 A;  4X1K A;  3L9D A;  4BW9 A;  3CCQ V;  3DXR B;  3ASO B;  1H8H G;  3P30 A;  2UUA B;  4JTD B;  1QVF U;  2M6Y A;  3E22 B;  3ABK C;  4IYH A;  4PA4 A;  1YEW A;  3C3S A;  2P90 A;  3UO3 A;  1EZV H;  2R9A A;  4LFB O;  1P4R A;  2UXD B;  1M57 C;  2ZE8 A;  3DC6 A;  2ILM A;  3OTO O;  4OXS A;  4DRX B;  3OEH G;  2PYL A;  4J7K A;  2EIN C;  4BIU A;  3CCR V;  2ITD C; 
#chains in the Genus database with same CATH homology
 2NN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...