2NN4A

Crystal structure of bacillus subtilis yqgq, pfam duf910
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
LNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of YqgQ protein from Bacillus subtilis, a conserved hypothetical protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqgQ
total genus 23
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.760 Mainly Alpha Orthogonal Bundle Helix Hairpins YqgQ-like 2nn4A00
2NN4A
chains in the Genus database with same CATH superfamily
2FYUH 1KB9F 3EFFK 3C3TA 3ZRWB 2VQEB 1I5XA 2VWKA 2QKSA 4TQDA 4DR4O 2EIKB 5L3EA 3RYHB 1M1KW 2C2AA 1XMQB 1P84F 3AG2C 1AP6A 1L0NH 1PPJH 5CA1B 5LHGA 5FPRA 3I56V 1VQKV 5LOVB 3M8AA 3T1HO 1X4TA 2YDEA 3ETQA 5LXTB 3ASNC 4JI6B 2PZSA 4LF5O 1Q43A 1VF6A 1WPXA 2HLDG 1HNXB 4I5SA 3U11A 1GTOA 3QF7A 5LP6B 1JFFA 4IIJB 5KUMA 3TCUA 4F6EA 4BIOA 4JAAA 1AP5A 4GX2A 3CEIA 4DR5B 2ZD9A 1NKDA 1VF5B 3CSXA 3VOUA 5EBWC 1YZBA 2WA3A 1SKVA 2WLLA 4FLUA 1GM7A 3QVNA 3LNMB 1HNWO 3B8MA 4XBFA 3I55V 2P06A 2BE3A 4YXWG 2ZNJA 2ZE8A 3JAMN 1OCCC 5DN6G 2XAGA 3ASNB 4IGGA 1H38A 2EILC 3FB7C 3DSQA 4CC5A 1ZSPA 4PI0A 3CHXA 1GM9A 4JF3A 5ITZB 3BHPA 3U10A 2F43G 3K9SA 2CTQA 4GCZA 1NVPB 4U3FH 1V54B 2Z3YA 3GVMA 4TQFA 4WF9V 2AZ0A 3TK1A 2E5LO 2A79B 3ASOB 3B8NA 3CD6V 4R7CA 1I94O 4JI8B 1OZ0A 3ZMTA 1FJGB 2YIDA 3W7SA 3KKYA 1CEZA 4X1KA 1MNGA 4JYBA 1R73A 1PNMA 1O9GA 1IZ3A 5E1AC 5EYPB 2PF4E 2DJVA 4W4KA 1XMOB 2Q7EA 1L8DA 3SJQC 5JJNB 3FAVA 5LBQA 4FM2A 3OUFA 2NR5A 2JJ2G 4DV5O 4MVUA 3ZMSA 4D7SA 3RYFB 1S5JA 3SPIA 5CB4B 2VS0A 5EZYA 3FAVB 3Q4HB 4I50B 4N23A 4RWUA 4I0XA 1EZJA 3G67A 5KA5A 2ZXWB 5IJ0A 3K0DA 2QWOB 1UPGA 3O65A 4MW8A 1KKDA 4FLXA 3RW0A 3GWKC 5KX5A 1AB3A 4NYKA 1HWYA 2VWJA 1SQFA 4QGPA 3K0GA 1N33B 4J11A 2CTWA 3OW2U 5BR8B 3KZIZ 1LR1A 1RPRA 1US6A 2VQFB 4FK5C 4DV2B 1I7FA 1ZTEA 5IYZB 2YIBD 4EFBA 2RDCA 5DECA 4DV1B 2A3QA 4H13B 4DR2O 1IBLB 4NVPA 4UXNA 4O4HB 2O57A 4N21A 3CCLV 3ZHRA 4QPJA 4TV9B 5EC1C 3FD9A 4I55A 3T1YO 1Q90D 3BPZA 4JAUA 4YY3O 4YHHO 4DUZO 3THOA 4I9QA 4B3TB 2F1MA 4UV8A 1R3IC 4WFGA 4LFBB 1KYOF 2UUBO 2P90A 3ZN0A 4DV5B 1VMGA 4PA9A 2HG5C 4GUNA 3SJAC 4X64B 1BCCH 4Z2WA 1KQSU 1EN4A 1XI1A 1WA8A 1XNRB 1FJGO 1VQ9V 4E2LA 5L3DA 1FXKB 1XEQA 4W4LA 3P30A 3AEIA 3RVZA 1VQ8V 2QJ1A 3JD3A 1VQ7V 2RJZA 4NR1A 4OPAA 4J7KA 4PV1B 2ZM6B 3P32A 3FB5C 4WFHA 3CMEV 1IDSA 1SETA 1XL4A 2EINC 1AJPA 1BQ0A 3ZN1A 4LF8B 3G80A 2QTOA 4UCUA 2UUAO 1K97A 2GDSA 3E8BA 3JSLA 2WLJA 1GMGA 1RP3B 4LCUC 2QSAA 1LUWA 5CBHA 3RYHA 3OMAB 3JCUZ 2QM8A 3BRCA 4TUYA 5GW7A 1XBLA 5JVDB 4HNAA 2XAQA 1IURA 2X6AA 1QR9A 1Q7YW 1JJOA 4MVOA 2BTOA 2LW1A 1JQ0A 4DR1O 2E3CA 3F5TA 1D2DA 5JH7A 4ICGA 1N34B 1IXMA 2YEVA 3DXRA 4GKKB 3OR6C 1EZVH 4C7UA 3RYIB 4DV2O 3IJ4A 1GRJA 2BSKA 2HVKC 3T4ZA 3K5NA 4BIZA 1RSOB 2Q68A 4LH7A 1HNZO 2HP8A 4GKJB 2WA4A 3JD4A 3RYCA 4F6RA 4LNUB 1M5IA 3PJSK 1VQNV 3ABKB 4J80A 5L3BA 1X59A 4KFMA 3RVYA 1FXHA 2RQ6A 2OYQA 2YUAA 3IC7A 5KAIZ 4KL1A 2RCVA 1GN4A 2QTSA 1N36B 2ZCEA 1WB7A 2JVDA 2ITDC 5KUKA 4WFFA 1TVKA 4R6ZA 4MTOA 2D3OW 1CPYA 2DYRC 2QKAA 3N2GA 5DM6V 3DTUB 3RWRD 4GLXA 4IL6Z 1RPOA 5GONB 1M57B 3RFRA 3CCSV 4MS2A 2MW2B 2AZ2A 1SZTA 4OX9B 1BZKA 3ZCCA 1LUVA 4X9QA 4UCOA 5GONA 2QWRB 3CRCA 5LXTA 4DV6O 5HFMA 1VF6C 2FL4A 2IBZH 4DV0O 3ABLB 2BTQB 1W2BU 2KQXA 4O4IB 2YICA 1N32O 3OT7A 5A9GA 3AK1A 4JTDB 2PI4A 1MG1A 1BHAA 3ETDA 3JSNA 4JI7O 1QLEC 1AI6A 1K3EA 4FZ1A 4HNAB 4NXMO 1OCRB 3O9OA 4PA7A 3SYOA 4UVBA 1E1QG 1Y76A 4JI4B 3N27A 1H2NA 5JQGA 2A7WA 3DC6A 2EIMC 5C8YA 4PDRA 3SPJA 2FMLA 1NI8A 4JI6O 3BAAA 5KHGA 4HYOA 1N4CA 3FYEB 2CGNA 5IE9A 1P4RA 4Q6GA 3SYPA 3ZRSA 1M56B 3E89A 5H5NA 2KSDA 1OCRC 4JPRA 2NN4A 5CBGA 1RFYA 3E22B 4YJ2A 1YJNV 3M99B 1M56C 4BW5A 2OCCC 4AQYB 1H8HG 4JI7B 1DF5A 1Y74B 2WAMA 1NJIW 4JI2O 3S3XA 1VIBA 4LF9O 3ZS8C 4QE9A 2Q4PA 4XDLA 2DE0X 4WFBV 1Q86W 3L9DA 2HJFC 1KC8W 1OCOC 2CAZC 2WWWA 3OFNG 1KUQA 1Y4MA 4AHCA 5D5PA 4NXNB 5JVDA 4FMTA 2Q6AA 2NLJC 1NU1H 2PY5A 3ETEA 4LF6O 3CWBH 4XDJA 2RN9A 2WLNA 1U97A 1MMMA 4X8AA 2AXTZ 4PA6A 3K57A 3DXRB 4X1YB 4UB8Z 2QA4V 2IH3C 1OCZC 1P7GA 2DQ3A 3OM3B 4JZGA 1JFFB 3CXCU 4UV9A 3F5WC 3FFQA 1KMIZ 3EXAA 3BA9A 3JD1A 2P6JA 4DO2A 3JALB 1WLEA 2ZE6A 4TUYB 4BAYA 1FD9A 2PTMA 4B3MB 2XT9A 4B3RB 3JASB 2GTSA 3T1CA 1M90W 5BY1A 5KHKA 1SC5B 3R65A 4IIJA 1DGSA 3K08A 4CH6A 3D3IA 1P49A 2UXDB 5H2FZ 3RYCB 4KHPO 2IJHA 4LFCO 5IDJA 5LMNB 1HP8A 2UXCO 3SDLA 1D5NA 1QVGU 1K33A 2P67A 3DGEA 3CE2A 3BABA 4LR3A 4J41A 1PM9A 2NNUA 4MVQA 5KMGB 3ZHVA 3D36C 4DRXA 3UO2A 4LWSB 4JYAO 2E76B 2YC0A 1YCIA 4JI1B 4FM1A 3IGAC 3SYCA 2OTLV 2ARHA 3CCRV 1VQ6V 4GX5A 3E86A 3ZIAG 1F4MA 2DYRB 4I50A 1NS1A 4DW1A 4QJFB 2HEPA 3R66A 1XMOO 4GKKO 2F95B 1KBHA 3UM7A 5B3SC 4X65B 1GAXA 1Q8IA 2KG7B 3HKBA 3CC2V 2E75B 2KG7A 3WG7B 1SA0B 2JS5A 3W7TA 5EYPA 1UFIA 2GSMB 4WFAV 2UXXA 1T5EA 1NTKH 4GT1A 3AG3B 4X1IA 4TSFG 1GKFA 3MDSA 3RGBA 3ZHUA 2ZQMA 4U7OA 3OGIB 1GN3A 1YF2A 4JI3B 5KHHA 1OHHG 4MVMA 3HKDA 3MHHC 3F7VC 4ZHQB 1HNXO 1DF4A 3K58A 1IXBA 1GH6A 4B3SO 2G38A 2ZR3A 4WFEA 3X2QC 3J80N 1OCCB 3QG5A 2IW5A 4LF4O 2FB5A 5C93A 4O4LA 5B1NA 3ZMVA 4JI1O 1KKCA 1TA8A 2UUCO 1XNRO 5LYJA 3FB8C 3B77A 1XILA 4O2AB 5IJ9B 4X62O 4LF5B 5BMVB 1JPXA 2EIJB 5BXZA 1YXBA 5KHIA 4O2AA 3CB2A 3TXSA 5LA6A 2ZE5A 3K03A 4JI3O 2EIKC 3AK2A 4QNHB 1L0LH 3SYAA 1K5QA 4EEQA 4BR6A 3J81N 2WLMA 1Q6IA 1XNQO 3CRAA 2P22C 3SJCC 4GYCB 4JI4O 4ZIBA 4DR7O 3AG4B 3L73H 1N0NA 2XASA 1MOFA 3W7WA 3GB7C 2H94A 1KU9A 1NH2B 3WB1A 2YS8A 3OAAG 1V54C 4JI0O 1S77D 2QWQB 4F4LA 3E8GA 1S72V 2QM7A 5D5QA 3L74H 2ZM6O 3T2MA 2UU9O 2W6IG 1R6TA 2N74A 3CYOA 3OE7G 1QU7A 3PN1A 4I4TA 4JI2B 3ZRWA 3OEEG 2WLIB 4NB5A 4WCEV 1XUQA 4GZRB 3HKEA 5JJEB 5JQGB 1B3QA 2QGNA 2KB1A 3OEHG 2F66C 2ZKOA 4ZHQA 4KXRA 5LOVA 3UT5A 4EB6A 3A0BZ 1R3KC 2VQEO 4E4EA 4JGSA 5IY5C 2B1GA 5IYDO 1XREA 4J10A 2DWEC 4B7EA 2JGUA 4YJ2B 3G71V 1R1BA 1TUEB 2WLKA 3CS5A 2BTQA 2OTJV 4OX9O 1BMFG 1Q81W 3E83A 1Q5OA 2RMKB 3SJBC 1QLEB 1SA0A 1XL6A 4UVCA 5EBMC 3JD0A 3HKCB 1WB8A 1QCEA 1YIJV 1MSWD 5IT9N 1Z5WA 2JGDA 5EZYB 5CB4A 3RT3C 1HDJA 3NXSA 1PL0A 3T4DA 1TAEA 4X64O 3ABMC 2K1EA 3W7UA 3QO8A 4U7NA 1ZL8B 1O9HA 2Q7GA 3CCMV 3E8FA 4RO2A 5AG2A 4CC6A 1I5YA 1ROPA 2DMXA 4NTYA 1QLNA 3G6BA 1A32A 2W0XA 2ZIOA 2A0LA 1YI2V 3HKDB 1G8MA 1GM8A 3AG4C 5KX5B 5H9CA 1QBZA 2CK3G 3JATA 1ZUQA 2XAFA 4DXWA 2ZDIC 1MZFA 3CRRA 2DQ0A 4WBNA 1S0VA 4JV5B 5LGTA 2YIAA 1AR1B 2UXNA 3AG7A 3LDEA 1JJ2U 1NZ6A 2H3OA 2Q0OC 4DV0B 4TV9A 5DEDA 3E2EA 2Q7HA 4G2KA 1P7BA 3K9AA 4MTFA 4AQYO 4R50A 2QWPB 1SQXH 4PDVA 2BOCC 1K34A 1QQCA 1LNQA 2M7WA 1VQPV 2EX3A 1YITV 3VBBA 4P9PA 3CXHF 4QE7A 1F4NA 1AI7A 3W7XA 1VP7A 5LMUO 1WJZA 3AG3C 3E8HA 4X66B 1YJ9V 2BCCH 2Q69A 2PUSA 1PD3A 4UCVA 1Q82W 4PHZA 1WP7A 1FFTB 3KG2A 4FPPA 4EB6B 4GKJO 1B6QA 3JCZA 3H01A 5E79Z 3FB6C 3ZMUA 3ETGA 5JCOC 4ZI7A 1YSCA 3BEHA 3C90A 3P3NA 1H2MA 4I0XB 1YTFD 1VF7A 2ITCC 5CMUA 1JA8A 1N34O 3LSSA 3SR2C 5B5EZ 4JAVA 5J2TB 3SPGA 5FL7G 1KECA 1M93A 1N8RW 2QR4A 4KUMA 3GWOA 4U3JB 3LDDA 3ZRVA 1JMKC 2EZOA 1HNZB 2P4KA 3HR0A 2Q0AA 2JEUA 3K5MA 3CP1A 1VARA 4RAIA 3AG1B 2V7QG 4BIUA 5LYJB 4U3JA 2E74B 3ABKC 4YJ3A 5JCOA 4LF9B 4YIOA 4UCSA 3K79A 1UJWB 4ASUG 2X7RB 1S3JA 4RQFA 1OV9A 4LFAO 3K59A 5L3FA 1PL4A 4CH5A 1MA1A 3OD4A 1NT2B 2UXBB 1PKXA 1FFXA 4FVMA 2UUBB 2R9AA 3CCVV 4DK1A 2Y0IA 1OJHA 2GTAA 4ABMA 2H8PC 4XDKA 4DYLA 3ABMB 1V55B 1RM1C 3CRMA 1AR4A 2CH7B 5CA0B 3CRQA 4JI5O 5B1BB 2R9IA 4PDMA 3H1IH 1EN5A 1AI5A 2KKWA 4L8JA 1F51A 1XMQO 1DTOA 4JYAB 3UKMA 4LF7B 4DR2B 4DUYO 1IBLO 2XAJA 4TV8A 1FXKC 5EC2C 4HBNA 4B3SB 5LMNO 3VQVA 5IJ0B 1PNLA 4FFKA 5J2UB 1MZEA 2X0LA 1W59A 4H37A 1E79G 4R8CA 1B06A 3K3WA 1VQOV 3WB2A 3BA8A 2QKCA 4X62B 4GX1A 2LFSA 4GX0A 3P3PA 2R72A 3STLC 2WLLB 3HB3B 1IBMO 1AILA 1U96A 3H1KH 4EFEA 2HKOA 5LGNA 2EZPA 1Q3EA 4LF6B 3FX7A 1AR5A 2QM4A 3LNNA 4QIWF 4TOIA 3CJHA 1HR0B 4NTXA 4X65O 3A8TA 2OIGA 2A06H 4LFAB 2EIMB 1G1XB 3VQWA 2GHYA 3HKEB 2LO1A 3OMNB 2ZDIA 2M6YA 1SF9A 2Q5ZA 1BE3H 4RUFA 2DW4A 1I94B 4O2BA 4LWSA 3B2EE 3ZBHA 4X1KB 2OCCB 4ZBMA 2ADPA 4JTAB 2YIBA 4O4JA 1WAZA 2D2CB 4DK0A 2IM9A 2YXHA 3L70H 3MD0A 3B09A 3IC9A 4FFBA 5H6RA 1VQMV 2YI9A 3J7AU 4LF4B 2UXCB 4YY3B 3WFVA 1Z5VA 2PI5A 5LP6A 5GTIZ 3RBZA 1W0KG 3HKCA 4LC1A 3D3QA 2CTPA 2EILB 4DV4B 5K1PA 1QR8A 4FFBB 4CBCA 1AI4A 3APOA 4JYYA 4PA3A 1NTMH 4UB6Z 5KHJA 1EN6A 2DWDC 3SYQA 1ZLZA 1Y66A 2Z5UA 1SZXA 3K5OA 1OCOB 4FLZA 4MW3A 5J9PC 1WP8A 3CCJV 4J42A 4KHPB 3STZC 1KP3A 3T1HB 4X1YA 3SPHA 3WG7C 4RUEA 5IWAO 2HJDA 2YSUB 2V1DA 5F2VO 5JJJB 2LJ2A 1CP9A 1IX9A 3S3WA 1AJNA 3TJTA 4FJCC 5CN0A 2LGWA 4B7KA 1R3JC 1B04A 2QEXV 3CMAV 3BCCH 1GN6A 3IFXA 3BFRA 4JASA 1H2SB 1NBMG 1NR7A 3ASOC 3K04A 4CH3A 4K8XA 1H2KA 3OTFA 5JWPA 3ML0A 4ZOLA 1YEWA 1Y67A 3ZHSA 4HAMA 3JARA 3CC4V 4MSWC 3AG2B 3A2FA 4IHJA 4P9OA 2ZINA 2Q67A 1Y74A 3BVOA 2CH7A 1ZWIC 4CH4A 5FLXN 5FPOA 1Y76B 3N2KB 1YVWA 3I5DA 5B1OA 2FTKA 2MK3A 2QDOA 1NVPD 2EIJC 5BZBA 1EM1A 1Q6HA 2CUGA 1AVMA 4LH6A 1SERA 1J5EB 1K4DC 1TUBA 3FYIB 3ICXA 2F4VB 1SQVH 2OT5A 1KD1W 3MAQA 3E35A 1K7DA 4L87A 4WBNB 2GBOA 2JJ1G 4FZ0A 2UXBO 4TWKA 4LP8A 3FKSG 4Z1VA 3BY6A 4X88A 1NH2D 1H8EG 1SQGA 2EJ7A 3EVKA 3LUTB 3APQA 2BOBC 5IJ9A 1FKAO 1XHZA 4J9YB 2RNBA 1XNQB 1THZA 4B3RO 1R6NA 2PGGA 4X20B 4A5UB 2WLIA 2DYSB 3QNEA 2P5OA 3AK3A 3ZMZA 3K06A 2AGAA 1J5EO 4I4TB 1W0JG 3JAKA 1DK1A 2BSKB 1SESA 5EBLC 3RYIA 3JAWB 1H2GA 2QE7G 2JK5C 3ZHTA 4BW9A 3K5LA 3JAKB 3H1HH 1Q6UA 3F7YC 2IJJA 4UFZA 3G6EV 5KMGA 1SQPH 4O4JB 5B1AB 1KP2A 3MHSC 1SQQH 4K35A 2N05A 4DR6O 3JATB 4X89A 1RSOA 4K0KO 2PYLA 3D36A 5B1AC 2UU9B 1IVSA 2P4VA 4AILC 3QO5A 5BMVA 1N33O 4UUJC 3KCYA 4YHHB 2YXYA 1S5LZ 4IHJB 2ZXWC 1CXZB 3VQXA 4KP4A 4B3TO 2HHHO 1DLBA 1NTZH 1SQBH 2GV9A 2HVJC 2ILMA 2IJIA 3OUSA 2ADQB 4JI0B 4PDLA 1FS0G 1G6UA 1YJWV 2VRZA 1FPOA 4MVZA 4TV8B 2Y69C 5FNVA 3CJHB 1L1FA 1XQ8A 4ZI7B 1K92A 2WSSG 1EFRG 3CX5F 3ZJZA 4CZZA 5HFLA 2ZE7A 2L35A 1BGYH 2OCHA 4LFBO 1S5HC 4OPHA 4CS2A 2Z0AA 4J7ZA 1XHXA 1V9PA 4B08A 2LW7A 2Q73A 3E22A 4DR5O 4FLWA 1G4YB 4PA4A 1VEWA 5LL6Y 1PNKA 2GUZA 5LGUA 3CC7V 1TGOA 4PI2A 4TT3G 2JS3A 4DR3B 1COWG 4DR6B 2N04A 4MTXA 1VQ4V 4CS3A 4NTWA 5IYZA 2UUCB 1S76D 1I08A 4I9WA 2GUZB 1K9MW 3JD2A 2DN9A 2Q8VA 5H6QA 1JVMA 4I55B 1R3LC 4X1IB 3X2QB 4FLVA 4JI5B 3NR7A 2YXLA 4DV4O 4NKGB 1NR1A 2XTAA 5B66Z 3L75H 1FXVA 1QHTA 1M9NA 4PJ0Z 5BR8O 1MSDA 1WA8B 4O2BB 4FM0A 3ZEDA 1MABG 4Z1MG 1AJQA 4IT5A 4DR1B 1URFA 4OXSA 3UO3A 4JYCA 4J7JA 3TGUH 4PELA 3D8CA 2IU0A 2ZNIA 1WNSA 4DR7B 2IJKA 5IY5B 1OCZB 1QNMA 2XOKG 4O4HA 3ZX6A 5EK0A 3LDCA 3H1LH 2B5UA 2HR3A 3Q4HA 5GTHZ 2EINB 4JV5O 3G4SV 1N0JA 3OR7C 4G28B 5KAFZ 1K5SA 1TVKB 4MVRA 2Y69B 1D5AA 4DV3B 1XOUA 2EBOA 1ZL8A 2AHYA 2CDYA 1PP9H 4LFCB 2YEVB 4Q20A 2LQTA 3KCXA 4QPKA 5JH7B 1F23A 5A2QN 4DRXB 4IYIA 4X66O 5LHHA 2K9PA 3CCUV 3B4SA 5EIBD 2JIZG 2CGOA 5J2UA 1WPBA 1JOYA 3JASA 3CCQV 4LNUA 3ABTA 4MT8A 4DR3O 5ITZA 4DV1O 2AW9A 4MVSA 4FLTA 1FFXB 4H33A 1HR0O 3RN4A 3UCSC 3A0RA 4DV7B 3OTOO 1IBKO 1BT8A 4OGQB 4YIPA 2ATKC 2ETNA 2W0FC 3IAYA 1F7YA 1IBMB 1BS3A 5CBFA 1YTFB 4G27B 5CA0A 1AROP 4J9ZB 2X6BA 1N32B 2UUAB 5B3SB 5FNVB 3ZRXA 3QO7A 4P2ZA 2Y4UA 4YJ3B 2Q9LA 3ABUA 3WU2Z 3OGCC 2ZT9B 3M7MX 3T1YB 4JTCB 3CCEV 4ZKIA 4DUZB 1XDCA 2E5LB 2EJRA 4UVAA 1FAFA 2CE4A 1QVFU 2V4DA 2WLHA 1ORQC 5B1BC 5CA1A 1K73W 5KLVH 3H9VA 2AHZA 2HFEC 4CS4A 4HZ3A 4AI8A 5J2TA 2L6LA 4JZ2A 3UQ8A 4UCTA 1JX9A 4DV7O 1IBKB 1Y6XA 2HHHB 2A9HA 2YI8A 2JRIA 3JALA 2JEXA 2DOSA 4MTGA 2R70A 2LGQA 1GK9A 1VQ5V 2ZR2A 3AG1C 4JI8O 3HPLC 1E1RG 2Y0PA 2IU3A 3HKBB 2LP7A 4BWAA 1K8AW 4K3AA 1ZAUA 5C8YB 2XAHA 3OTOB 1I0HA 2ZIMA 5IWAB 4D6TH 3ZHQA 3A0HZ 3LSUA 2B9ZA 2WPDG 4FLYA 5LA6B 4NXNO 4DUYB 3JAWA 2OIEA 2F4VO 1K4CC 1H2LA 5TISZ 4I7ZB 3VQYA 4LF7O 3SGIA 4B3MO 2CTRA 3N2GB 3OMIB 4DR4B 1VQLV 3U0ZA 1V55C 3L72H 2F93B 5CA3A 2OWOA 4FIPC 4H44B 4DW0A 4K8ZA 4P30A 4O4LB 2QWNB 2XNDG 1WN7A 3H1JH 4D7TA 2R9RB 4UCRA 4PD4F 2P7TC 5LP6C 5LMUB 3WB0A 2VQFO 1RM1B 2W6JG 3LSQA 4O4IA 5IYBO 1JR9A 2LFRA 1GO3F 3DC5A 2JDIG 3C3SA 2JGDB 1GN2A 1EBOA 2XHBA 3RYFA 1BSMA 1PV0A 2ODMA 4X20A 2B1IA 5EIBC 1N36O 1ENVA 3N2KA 2FKXA 1TUBB 3L71H 2UXDO 1SRYA 5LHIA 3EHBB 1R6KA 1FXKA 5KA6A 2Y4TA 3B40A 2F23A 4NXMB 4IYHA 1HNWB 1M57C 1M4UA 2XUMA 3UT5B 2EULA 2IH1C 1BHBA 4H0LB 2X6CA 1SS3A 1JCHA 5L3CA 4LF8O 5K1XA 2DYSC 1HW7A 1BQZA 3ABLC 4F6RB 4LBEC 4EKWA 1J95A 1YDXA 3JARB 3SPCA 3QTCA 5L3GA 4DV6B 4RQEA 3TETA 1BL8A 1ZX3A 4ZOLB 4DV3O 4K0KB 3TXQA 3CPWU 1NQTA 2PYJA 1FYJA 1Z2GA 3JYCA 1YHQV 5IYCO 2Y48A
chains in the Genus database with same CATH topology
2NN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN4 A; 
#chains in the Genus database with same CATH topology
 2FYU H;  1KB9 F;  3EFF K;  3C3T A;  3ZRW B;  2VQE B;  1I5X A;  2VWK A;  2QKS A;  4TQD A;  4DR4 O;  2EIK B;  5L3E A;  3RYH B;  1M1K W;  2C2A A;  1XMQ B;  1P84 F;  3AG2 C;  1AP6 A;  1L0N H;  1PPJ H;  5CA1 B;  5LHG A;  5FPR A;  3I56 V;  1VQK V;  5LOV B;  3M8A A;  3T1H O;  1X4T A;  2YDE A;  3ETQ A;  5LXT B;  3ASN C;  4JI6 B;  2PZS A;  4LF5 O;  1Q43 A;  1VF6 A;  1WPX A;  2HLD G;  1HNX B;  4I5S A;  3U11 A;  1GTO A;  3QF7 A;  5LP6 B;  1JFF A;  4IIJ B;  5KUM A;  3TCU A;  4F6E A;  4BIO A;  4JAA A;  1AP5 A;  4GX2 A;  3CEI A;  4DR5 B;  2ZD9 A;  1NKD A;  1VF5 B;  3CSX A;  3VOU A;  5EBW C;  1YZB A;  2WA3 A;  1SKV A;  2WLL A;  4FLU A;  1GM7 A;  3QVN A;  3LNM B;  1HNW O;  3B8M A;  4XBF A;  3I55 V;  2P06 A;  2BE3 A;  4YXW G;  2ZNJ A;  2ZE8 A;  3JAM N;  1OCC C;  5DN6 G;  2XAG A;  3ASN B;  4IGG A;  1H38 A;  2EIL C;  3FB7 C;  3DSQ A;  4CC5 A;  1ZSP A;  4PI0 A;  3CHX A;  1GM9 A;  4JF3 A;  5ITZ B;  3BHP A;  3U10 A;  2F43 G;  3K9S A;  2CTQ A;  4GCZ A;  1NVP B;  4U3F H;  1V54 B;  2Z3Y A;  3GVM A;  4TQF A;  4WF9 V;  2AZ0 A;  3TK1 A;  2E5L O;  2A79 B;  3ASO B;  3B8N A;  3CD6 V;  4R7C A;  1I94 O;  4JI8 B;  1OZ0 A;  3ZMT A;  1FJG B;  2YID A;  3W7S A;  3KKY A;  1CEZ A;  4X1K A;  1MNG A;  4JYB A;  1R73 A;  1PNM A;  1O9G A;  1IZ3 A;  5E1A C;  5EYP B;  2PF4 E;  2DJV A;  4W4K A;  1XMO B;  2Q7E A;  1L8D A;  3SJQ C;  5JJN B;  3FAV A;  5LBQ A;  4FM2 A;  3OUF A;  2NR5 A;  2JJ2 G;  4DV5 O;  4MVU A;  3ZMS A;  4D7S A;  3RYF B;  1S5J A;  3SPI A;  5CB4 B;  2VS0 A;  5EZY A;  3FAV B;  3Q4H B;  4I50 B;  4N23 A;  4RWU A;  4I0X A;  1EZJ A;  3G67 A;  5KA5 A;  2ZXW B;  5IJ0 A;  3K0D A;  2QWO B;  1UPG A;  3O65 A;  4MW8 A;  1KKD A;  4FLX A;  3RW0 A;  3GWK C;  5KX5 A;  1AB3 A;  4NYK A;  1HWY A;  2VWJ A;  1SQF A;  4QGP A;  3K0G A;  1N33 B;  4J11 A;  2CTW A;  3OW2 U;  5BR8 B;  3KZI Z;  1LR1 A;  1RPR A;  1US6 A;  2VQF B;  4FK5 C;  4DV2 B;  1I7F A;  1ZTE A;  5IYZ B;  2YIB D;  4EFB A;  2RDC A;  5DEC A;  4DV1 B;  2A3Q A;  4H13 B;  4DR2 O;  1IBL B;  4NVP A;  4UXN A;  4O4H B;  2O57 A;  4N21 A;  3CCL V;  3ZHR A;  4QPJ A;  4TV9 B;  5EC1 C;  3FD9 A;  4I55 A;  3T1Y O;  1Q90 D;  3BPZ A;  4JAU A;  4YY3 O;  4YHH O;  4DUZ O;  3THO A;  4I9Q A;  4B3T B;  2F1M A;  4UV8 A;  1R3I C;  4WFG A;  4LFB B;  1KYO F;  2UUB O;  2P90 A;  3ZN0 A;  4DV5 B;  1VMG A;  4PA9 A;  2HG5 C;  4GUN A;  3SJA C;  4X64 B;  1BCC H;  4Z2W A;  1KQS U;  1EN4 A;  1XI1 A;  1WA8 A;  1XNR B;  1FJG O;  1VQ9 V;  4E2L A;  5L3D A;  1FXK B;  1XEQ A;  4W4L A;  3P30 A;  3AEI A;  3RVZ A;  1VQ8 V;  2QJ1 A;  3JD3 A;  1VQ7 V;  2RJZ A;  4NR1 A;  4OPA A;  4J7K A;  4PV1 B;  2ZM6 B;  3P32 A;  3FB5 C;  4WFH A;  3CME V;  1IDS A;  1SET A;  1XL4 A;  2EIN C;  1AJP A;  1BQ0 A;  3ZN1 A;  4LF8 B;  3G80 A;  2QTO A;  4UCU A;  2UUA O;  1K97 A;  2GDS A;  3E8B A;  3JSL A;  2WLJ A;  1GMG A;  1RP3 B;  4LCU C;  2QSA A;  1LUW A;  5CBH A;  3RYH A;  3OMA B;  3JCU Z;  2QM8 A;  3BRC A;  4TUY A;  5GW7 A;  1XBL A;  5JVD B;  4HNA A;  2XAQ A;  1IUR A;  2X6A A;  1QR9 A;  1Q7Y W;  1JJO A;  4MVO A;  2BTO A;  2LW1 A;  1JQ0 A;  4DR1 O;  2E3C A;  3F5T A;  1D2D A;  5JH7 A;  4ICG A;  1N34 B;  1IXM A;  2YEV A;  3DXR A;  4GKK B;  3OR6 C;  1EZV H;  4C7U A;  3RYI B;  4DV2 O;  3IJ4 A;  1GRJ A;  2BSK A;  2HVK C;  3T4Z A;  3K5N A;  4BIZ A;  1RSO B;  2Q68 A;  4LH7 A;  1HNZ O;  2HP8 A;  4GKJ B;  2WA4 A;  3JD4 A;  3RYC A;  4F6R A;  4LNU B;  1M5I A;  3PJS K;  1VQN V;  3ABK B;  4J80 A;  5L3B A;  1X59 A;  4KFM A;  3RVY A;  1FXH A;  2RQ6 A;  2OYQ A;  2YUA A;  3IC7 A;  5KAI Z;  4KL1 A;  2RCV A;  1GN4 A;  2QTS A;  1N36 B;  2ZCE A;  1WB7 A;  2JVD A;  2ITD C;  5KUK A;  4WFF A;  1TVK A;  4R6Z A;  4MTO A;  2D3O W;  1CPY A;  2DYR C;  2QKA A;  3N2G A;  5DM6 V;  3DTU B;  3RWR D;  4GLX A;  4IL6 Z;  1RPO A;  5GON B;  1M57 B;  3RFR A;  3CCS V;  4MS2 A;  2MW2 B;  2AZ2 A;  1SZT A;  4OX9 B;  1BZK A;  3ZCC A;  1LUV A;  4X9Q A;  4UCO A;  5GON A;  2QWR B;  3CRC A;  5LXT A;  4DV6 O;  5HFM A;  1VF6 C;  2FL4 A;  2IBZ H;  4DV0 O;  3ABL B;  2BTQ B;  1W2B U;  2KQX A;  4O4I B;  2YIC A;  1N32 O;  3OT7 A;  5A9G A;  3AK1 A;  4JTD B;  2PI4 A;  1MG1 A;  1BHA A;  3ETD A;  3JSN A;  4JI7 O;  1QLE C;  1AI6 A;  1K3E A;  4FZ1 A;  4HNA B;  4NXM O;  1OCR B;  3O9O A;  4PA7 A;  3SYO A;  4UVB A;  1E1Q G;  1Y76 A;  4JI4 B;  3N27 A;  1H2N A;  5JQG A;  2A7W A;  3DC6 A;  2EIM C;  5C8Y A;  4PDR A;  3SPJ A;  2FML A;  1NI8 A;  4JI6 O;  3BAA A;  5KHG A;  4HYO A;  1N4C A;  3FYE B;  2CGN A;  5IE9 A;  1P4R A;  4Q6G A;  3SYP A;  3ZRS A;  1M56 B;  3E89 A;  5H5N A;  2KSD A;  1OCR C;  4JPR A;  2NN4 A;  5CBG A;  1RFY A;  3E22 B;  4YJ2 A;  1YJN V;  3M99 B;  1M56 C;  4BW5 A;  2OCC C;  4AQY B;  1H8H G;  4JI7 B;  1DF5 A;  1Y74 B;  2WAM A;  1NJI W;  4JI2 O;  3S3X A;  1VIB A;  4LF9 O;  3ZS8 C;  4QE9 A;  2Q4P A;  4XDL A;  2DE0 X;  4WFB V;  1Q86 W;  3L9D A;  2HJF C;  1KC8 W;  1OCO C;  2CAZ C;  2WWW A;  3OFN G;  1KUQ A;  1Y4M A;  4AHC A;  5D5P A;  4NXN B;  5JVD A;  4FMT A;  2Q6A A;  2NLJ C;  1NU1 H;  2PY5 A;  3ETE A;  4LF6 O;  3CWB H;  4XDJ A;  2RN9 A;  2WLN A;  1U97 A;  1MMM A;  4X8A A;  2AXT Z;  4PA6 A;  3K57 A;  3DXR B;  4X1Y B;  4UB8 Z;  2QA4 V;  2IH3 C;  1OCZ C;  1P7G A;  2DQ3 A;  3OM3 B;  4JZG A;  1JFF B;  3CXC U;  4UV9 A;  3F5W C;  3FFQ A;  1KMI Z;  3EXA A;  3BA9 A;  3JD1 A;  2P6J A;  4DO2 A;  3JAL B;  1WLE A;  2ZE6 A;  4TUY B;  4BAY A;  1FD9 A;  2PTM A;  4B3M B;  2XT9 A;  4B3R B;  3JAS B;  2GTS A;  3T1C A;  1M90 W;  5BY1 A;  5KHK A;  1SC5 B;  3R65 A;  4IIJ A;  1DGS A;  3K08 A;  4CH6 A;  3D3I A;  1P49 A;  2UXD B;  5H2F Z;  3RYC B;  4KHP O;  2IJH A;  4LFC O;  5IDJ A;  5LMN B;  1HP8 A;  2UXC O;  3SDL A;  1D5N A;  1QVG U;  1K33 A;  2P67 A;  3DGE A;  3CE2 A;  3BAB A;  4LR3 A;  4J41 A;  1PM9 A;  2NNU A;  4MVQ A;  5KMG B;  3ZHV A;  3D36 C;  4DRX A;  3UO2 A;  4LWS B;  4JYA O;  2E76 B;  2YC0 A;  1YCI A;  4JI1 B;  4FM1 A;  3IGA C;  3SYC A;  2OTL V;  2ARH A;  3CCR V;  1VQ6 V;  4GX5 A;  3E86 A;  3ZIA G;  1F4M A;  2DYR B;  4I50 A;  1NS1 A;  4DW1 A;  4QJF B;  2HEP A;  3R66 A;  1XMO O;  4GKK O;  2F95 B;  1KBH A;  3UM7 A;  5B3S C;  4X65 B;  1GAX A;  1Q8I A;  2KG7 B;  3HKB A;  3CC2 V;  2E75 B;  2KG7 A;  3WG7 B;  1SA0 B;  2JS5 A;  3W7T A;  5EYP A;  1UFI A;  2GSM B;  4WFA V;  2UXX A;  1T5E A;  1NTK H;  4GT1 A;  3AG3 B;  4X1I A;  4TSF G;  1GKF A;  3MDS A;  3RGB A;  3ZHU A;  2ZQM A;  4U7O A;  3OGI B;  1GN3 A;  1YF2 A;  4JI3 B;  5KHH A;  1OHH G;  4MVM A;  3HKD A;  3MHH C;  3F7V C;  4ZHQ B;  1HNX O;  1DF4 A;  3K58 A;  1IXB A;  1GH6 A;  4B3S O;  2G38 A;  2ZR3 A;  4WFE A;  3X2Q C;  3J80 N;  1OCC B;  3QG5 A;  2IW5 A;  4LF4 O;  2FB5 A;  5C93 A;  4O4L A;  5B1N A;  3ZMV A;  4JI1 O;  1KKC A;  1TA8 A;  2UUC O;  1XNR O;  5LYJ A;  3FB8 C;  3B77 A;  1XIL A;  4O2A B;  5IJ9 B;  4X62 O;  4LF5 B;  5BMV B;  1JPX A;  2EIJ B;  5BXZ A;  1YXB A;  5KHI A;  4O2A A;  3CB2 A;  3TXS A;  5LA6 A;  2ZE5 A;  3K03 A;  4JI3 O;  2EIK C;  3AK2 A;  4QNH B;  1L0L H;  3SYA A;  1K5Q A;  4EEQ A;  4BR6 A;  3J81 N;  2WLM A;  1Q6I A;  1XNQ O;  3CRA A;  2P22 C;  3SJC C;  4GYC B;  4JI4 O;  4ZIB A;  4DR7 O;  3AG4 B;  3L73 H;  1N0N A;  2XAS A;  1MOF A;  3W7W A;  3GB7 C;  2H94 A;  1KU9 A;  1NH2 B;  3WB1 A;  2YS8 A;  3OAA G;  1V54 C;  4JI0 O;  1S77 D;  2QWQ B;  4F4L A;  3E8G A;  1S72 V;  2QM7 A;  5D5Q A;  3L74 H;  2ZM6 O;  3T2M A;  2UU9 O;  2W6I G;  1R6T A;  2N74 A;  3CYO A;  3OE7 G;  1QU7 A;  3PN1 A;  4I4T A;  4JI2 B;  3ZRW A;  3OEE G;  2WLI B;  4NB5 A;  4WCE V;  1XUQ A;  4GZR B;  3HKE A;  5JJE B;  5JQG B;  1B3Q A;  2QGN A;  2KB1 A;  3OEH G;  2F66 C;  2ZKO A;  4ZHQ A;  4KXR A;  5LOV A;  3UT5 A;  4EB6 A;  3A0B Z;  1R3K C;  2VQE O;  4E4E A;  4JGS A;  5IY5 C;  2B1G A;  5IYD O;  1XRE A;  4J10 A;  2DWE C;  4B7E A;  2JGU A;  4YJ2 B;  3G71 V;  1R1B A;  1TUE B;  2WLK A;  3CS5 A;  2BTQ A;  2OTJ V;  4OX9 O;  1BMF G;  1Q81 W;  3E83 A;  1Q5O A;  2RMK B;  3SJB C;  1QLE B;  1SA0 A;  1XL6 A;  4UVC A;  5EBM C;  3JD0 A;  3HKC B;  1WB8 A;  1QCE A;  1YIJ V;  1MSW D;  5IT9 N;  1Z5W A;  2JGD A;  5EZY B;  5CB4 A;  3RT3 C;  1HDJ A;  3NXS A;  1PL0 A;  3T4D A;  1TAE A;  4X64 O;  3ABM C;  2K1E A;  3W7U A;  3QO8 A;  4U7N A;  1ZL8 B;  1O9H A;  2Q7G A;  3CCM V;  3E8F A;  4RO2 A;  5AG2 A;  4CC6 A;  1I5Y A;  1ROP A;  2DMX A;  4NTY A;  1QLN A;  3G6B A;  1A32 A;  2W0X A;  2ZIO A;  2A0L A;  1YI2 V;  3HKD B;  1G8M A;  1GM8 A;  3AG4 C;  5KX5 B;  5H9C A;  1QBZ A;  2CK3 G;  3JAT A;  1ZUQ A;  2XAF A;  4DXW A;  2ZDI C;  1MZF A;  3CRR A;  2DQ0 A;  4WBN A;  1S0V A;  4JV5 B;  5LGT A;  2YIA A;  1AR1 B;  2UXN A;  3AG7 A;  3LDE A;  1JJ2 U;  1NZ6 A;  2H3O A;  2Q0O C;  4DV0 B;  4TV9 A;  5DED A;  3E2E A;  2Q7H A;  4G2K A;  1P7B A;  3K9A A;  4MTF A;  4AQY O;  4R50 A;  2QWP B;  1SQX H;  4PDV A;  2BOC C;  1K34 A;  1QQC A;  1LNQ A;  2M7W A;  1VQP V;  2EX3 A;  1YIT V;  3VBB A;  4P9P A;  3CXH F;  4QE7 A;  1F4N A;  1AI7 A;  3W7X A;  1VP7 A;  5LMU O;  1WJZ A;  3AG3 C;  3E8H A;  4X66 B;  1YJ9 V;  2BCC H;  2Q69 A;  2PUS A;  1PD3 A;  4UCV A;  1Q82 W;  4PHZ A;  1WP7 A;  1FFT B;  3KG2 A;  4FPP A;  4EB6 B;  4GKJ O;  1B6Q A;  3JCZ A;  3H01 A;  5E79 Z;  3FB6 C;  3ZMU A;  3ETG A;  5JCO C;  4ZI7 A;  1YSC A;  3BEH A;  3C90 A;  3P3N A;  1H2M A;  4I0X B;  1YTF D;  1VF7 A;  2ITC C;  5CMU A;  1JA8 A;  1N34 O;  3LSS A;  3SR2 C;  5B5E Z;  4JAV A;  5J2T B;  3SPG A;  5FL7 G;  1KEC A;  1M93 A;  1N8R W;  2QR4 A;  4KUM A;  3GWO A;  4U3J B;  3LDD A;  3ZRV A;  1JMK C;  2EZO A;  1HNZ B;  2P4K A;  3HR0 A;  2Q0A A;  2JEU A;  3K5M A;  3CP1 A;  1VAR A;  4RAI A;  3AG1 B;  2V7Q G;  4BIU A;  5LYJ B;  4U3J A;  2E74 B;  3ABK C;  4YJ3 A;  5JCO A;  4LF9 B;  4YIO A;  4UCS A;  3K79 A;  1UJW B;  4ASU G;  2X7R B;  1S3J A;  4RQF A;  1OV9 A;  4LFA O;  3K59 A;  5L3F A;  1PL4 A;  4CH5 A;  1MA1 A;  3OD4 A;  1NT2 B;  2UXB B;  1PKX A;  1FFX A;  4FVM A;  2UUB B;  2R9A A;  3CCV V;  4DK1 A;  2Y0I A;  1OJH A;  2GTA A;  4ABM A;  2H8P C;  4XDK A;  4DYL A;  3ABM B;  1V55 B;  1RM1 C;  3CRM A;  1AR4 A;  2CH7 B;  5CA0 B;  3CRQ A;  4JI5 O;  5B1B B;  2R9I A;  4PDM A;  3H1I H;  1EN5 A;  1AI5 A;  2KKW A;  4L8J A;  1F51 A;  1XMQ O;  1DTO A;  4JYA B;  3UKM A;  4LF7 B;  4DR2 B;  4DUY O;  1IBL O;  2XAJ A;  4TV8 A;  1FXK C;  5EC2 C;  4HBN A;  4B3S B;  5LMN O;  3VQV A;  5IJ0 B;  1PNL A;  4FFK A;  5J2U B;  1MZE A;  2X0L A;  1W59 A;  4H37 A;  1E79 G;  4R8C A;  1B06 A;  3K3W A;  1VQO V;  3WB2 A;  3BA8 A;  2QKC A;  4X62 B;  4GX1 A;  2LFS A;  4GX0 A;  3P3P A;  2R72 A;  3STL C;  2WLL B;  3HB3 B;  1IBM O;  1AIL A;  1U96 A;  3H1K H;  4EFE A;  2HKO A;  5LGN A;  2EZP A;  1Q3E A;  4LF6 B;  3FX7 A;  1AR5 A;  2QM4 A;  3LNN A;  4QIW F;  4TOI A;  3CJH A;  1HR0 B;  4NTX A;  4X65 O;  3A8T A;  2OIG A;  2A06 H;  4LFA B;  2EIM B;  1G1X B;  3VQW A;  2GHY A;  3HKE B;  2LO1 A;  3OMN B;  2ZDI A;  2M6Y A;  1SF9 A;  2Q5Z A;  1BE3 H;  4RUF A;  2DW4 A;  1I94 B;  4O2B A;  4LWS A;  3B2E E;  3ZBH A;  4X1K B;  2OCC B;  4ZBM A;  2ADP A;  4JTA B;  2YIB A;  4O4J A;  1WAZ A;  2D2C B;  4DK0 A;  2IM9 A;  2YXH A;  3L70 H;  3MD0 A;  3B09 A;  3IC9 A;  4FFB A;  5H6R A;  1VQM V;  2YI9 A;  3J7A U;  4LF4 B;  2UXC B;  4YY3 B;  3WFV A;  1Z5V A;  2PI5 A;  5LP6 A;  5GTI Z;  3RBZ A;  1W0K G;  3HKC A;  4LC1 A;  3D3Q A;  2CTP A;  2EIL B;  4DV4 B;  5K1P A;  1QR8 A;  4FFB B;  4CBC A;  1AI4 A;  3APO A;  4JYY A;  4PA3 A;  1NTM H;  4UB6 Z;  5KHJ A;  1EN6 A;  2DWD C;  3SYQ A;  1ZLZ A;  1Y66 A;  2Z5U A;  1SZX A;  3K5O A;  1OCO B;  4FLZ A;  4MW3 A;  5J9P C;  1WP8 A;  3CCJ V;  4J42 A;  4KHP B;  3STZ C;  1KP3 A;  3T1H B;  4X1Y A;  3SPH A;  3WG7 C;  4RUE A;  5IWA O;  2HJD A;  2YSU B;  2V1D A;  5F2V O;  5JJJ B;  2LJ2 A;  1CP9 A;  1IX9 A;  3S3W A;  1AJN A;  3TJT A;  4FJC C;  5CN0 A;  2LGW A;  4B7K A;  1R3J C;  1B04 A;  2QEX V;  3CMA V;  3BCC H;  1GN6 A;  3IFX A;  3BFR A;  4JAS A;  1H2S B;  1NBM G;  1NR7 A;  3ASO C;  3K04 A;  4CH3 A;  4K8X A;  1H2K A;  3OTF A;  5JWP A;  3ML0 A;  4ZOL A;  1YEW A;  1Y67 A;  3ZHS A;  4HAM A;  3JAR A;  3CC4 V;  4MSW C;  3AG2 B;  3A2F A;  4IHJ A;  4P9O A;  2ZIN A;  2Q67 A;  1Y74 A;  3BVO A;  2CH7 A;  1ZWI C;  4CH4 A;  5FLX N;  5FPO A;  1Y76 B;  3N2K B;  1YVW A;  3I5D A;  5B1O A;  2FTK A;  2MK3 A;  2QDO A;  1NVP D;  2EIJ C;  5BZB A;  1EM1 A;  1Q6H A;  2CUG A;  1AVM A;  4LH6 A;  1SER A;  1J5E B;  1K4D C;  1TUB A;  3FYI B;  3ICX A;  2F4V B;  1SQV H;  2OT5 A;  1KD1 W;  3MAQ A;  3E35 A;  1K7D A;  4L87 A;  4WBN B;  2GBO A;  2JJ1 G;  4FZ0 A;  2UXB O;  4TWK A;  4LP8 A;  3FKS G;  4Z1V A;  3BY6 A;  4X88 A;  1NH2 D;  1H8E G;  1SQG A;  2EJ7 A;  3EVK A;  3LUT B;  3APQ A;  2BOB C;  5IJ9 A;  1FKA O;  1XHZ A;  4J9Y B;  2RNB A;  1XNQ B;  1THZ A;  4B3R O;  1R6N A;  2PGG A;  4X20 B;  4A5U B;  2WLI A;  2DYS B;  3QNE A;  2P5O A;  3AK3 A;  3ZMZ A;  3K06 A;  2AGA A;  1J5E O;  4I4T B;  1W0J G;  3JAK A;  1DK1 A;  2BSK B;  1SES A;  5EBL C;  3RYI A;  3JAW B;  1H2G A;  2QE7 G;  2JK5 C;  3ZHT A;  4BW9 A;  3K5L A;  3JAK B;  3H1H H;  1Q6U A;  3F7Y C;  2IJJ A;  4UFZ A;  3G6E V;  5KMG A;  1SQP H;  4O4J B;  5B1A B;  1KP2 A;  3MHS C;  1SQQ H;  4K35 A;  2N05 A;  4DR6 O;  3JAT B;  4X89 A;  1RSO A;  4K0K O;  2PYL A;  3D36 A;  5B1A C;  2UU9 B;  1IVS A;  2P4V A;  4AIL C;  3QO5 A;  5BMV A;  1N33 O;  4UUJ C;  3KCY A;  4YHH B;  2YXY A;  1S5L Z;  4IHJ B;  2ZXW C;  1CXZ B;  3VQX A;  4KP4 A;  4B3T O;  2HHH O;  1DLB A;  1NTZ H;  1SQB H;  2GV9 A;  2HVJ C;  2ILM A;  2IJI A;  3OUS A;  2ADQ B;  4JI0 B;  4PDL A;  1FS0 G;  1G6U A;  1YJW V;  2VRZ A;  1FPO A;  4MVZ A;  4TV8 B;  2Y69 C;  5FNV A;  3CJH B;  1L1F A;  1XQ8 A;  4ZI7 B;  1K92 A;  2WSS G;  1EFR G;  3CX5 F;  3ZJZ A;  4CZZ A;  5HFL A;  2ZE7 A;  2L35 A;  1BGY H;  2OCH A;  4LFB O;  1S5H C;  4OPH A;  4CS2 A;  2Z0A A;  4J7Z A;  1XHX A;  1V9P A;  4B08 A;  2LW7 A;  2Q73 A;  3E22 A;  4DR5 O;  4FLW A;  1G4Y B;  4PA4 A;  1VEW A;  5LL6 Y;  1PNK A;  2GUZ A;  5LGU A;  3CC7 V;  1TGO A;  4PI2 A;  4TT3 G;  2JS3 A;  4DR3 B;  1COW G;  4DR6 B;  2N04 A;  4MTX A;  1VQ4 V;  4CS3 A;  4NTW A;  5IYZ A;  2UUC B;  1S76 D;  1I08 A;  4I9W A;  2GUZ B;  1K9M W;  3JD2 A;  2DN9 A;  2Q8V A;  5H6Q A;  1JVM A;  4I55 B;  1R3L C;  4X1I B;  3X2Q B;  4FLV A;  4JI5 B;  3NR7 A;  2YXL A;  4DV4 O;  4NKG B;  1NR1 A;  2XTA A;  5B66 Z;  3L75 H;  1FXV A;  1QHT A;  1M9N A;  4PJ0 Z;  5BR8 O;  1MSD A;  1WA8 B;  4O2B B;  4FM0 A;  3ZED A;  1MAB G;  4Z1M G;  1AJQ A;  4IT5 A;  4DR1 B;  1URF A;  4OXS A;  3UO3 A;  4JYC A;  4J7J A;  3TGU H;  4PEL A;  3D8C A;  2IU0 A;  2ZNI A;  1WNS A;  4DR7 B;  2IJK A;  5IY5 B;  1OCZ B;  1QNM A;  2XOK G;  4O4H A;  3ZX6 A;  5EK0 A;  3LDC A;  3H1L H;  2B5U A;  2HR3 A;  3Q4H A;  5GTH Z;  2EIN B;  4JV5 O;  3G4S V;  1N0J A;  3OR7 C;  4G28 B;  5KAF Z;  1K5S A;  1TVK B;  4MVR A;  2Y69 B;  1D5A A;  4DV3 B;  1XOU A;  2EBO A;  1ZL8 A;  2AHY A;  2CDY A;  1PP9 H;  4LFC B;  2YEV B;  4Q20 A;  2LQT A;  3KCX A;  4QPK A;  5JH7 B;  1F23 A;  5A2Q N;  4DRX B;  4IYI A;  4X66 O;  5LHH A;  2K9P A;  3CCU V;  3B4S A;  5EIB D;  2JIZ G;  2CGO A;  5J2U A;  1WPB A;  1JOY A;  3JAS A;  3CCQ V;  4LNU A;  3ABT A;  4MT8 A;  4DR3 O;  5ITZ A;  4DV1 O;  2AW9 A;  4MVS A;  4FLT A;  1FFX B;  4H33 A;  1HR0 O;  3RN4 A;  3UCS C;  3A0R A;  4DV7 B;  3OTO O;  1IBK O;  1BT8 A;  4OGQ B;  4YIP A;  2ATK C;  2ETN A;  2W0F C;  3IAY A;  1F7Y A;  1IBM B;  1BS3 A;  5CBF A;  1YTF B;  4G27 B;  5CA0 A;  1ARO P;  4J9Z B;  2X6B A;  1N32 B;  2UUA B;  5B3S B;  5FNV B;  3ZRX A;  3QO7 A;  4P2Z A;  2Y4U A;  4YJ3 B;  2Q9L A;  3ABU A;  3WU2 Z;  3OGC C;  2ZT9 B;  3M7M X;  3T1Y B;  4JTC B;  3CCE V;  4ZKI A;  4DUZ B;  1XDC A;  2E5L B;  2EJR A;  4UVA A;  1FAF A;  2CE4 A;  1QVF U;  2V4D A;  2WLH A;  1ORQ C;  5B1B C;  5CA1 A;  1K73 W;  5KLV H;  3H9V A;  2AHZ A;  2HFE C;  4CS4 A;  4HZ3 A;  4AI8 A;  5J2T A;  2L6L A;  4JZ2 A;  3UQ8 A;  4UCT A;  1JX9 A;  4DV7 O;  1IBK B;  1Y6X A;  2HHH B;  2A9H A;  2YI8 A;  2JRI A;  3JAL A;  2JEX A;  2DOS A;  4MTG A;  2R70 A;  2LGQ A;  1GK9 A;  1VQ5 V;  2ZR2 A;  3AG1 C;  4JI8 O;  3HPL C;  1E1R G;  2Y0P A;  2IU3 A;  3HKB B;  2LP7 A;  4BWA A;  1K8A W;  4K3A A;  1ZAU A;  5C8Y B;  2XAH A;  3OTO B;  1I0H A;  2ZIM A;  5IWA B;  4D6T H;  3ZHQ A;  3A0H Z;  3LSU A;  2B9Z A;  2WPD G;  4FLY A;  5LA6 B;  4NXN O;  4DUY B;  3JAW A;  2OIE A;  2F4V O;  1K4C C;  1H2L A;  5TIS Z;  4I7Z B;  3VQY A;  4LF7 O;  3SGI A;  4B3M O;  2CTR A;  3N2G B;  3OMI B;  4DR4 B;  1VQL V;  3U0Z A;  1V55 C;  3L72 H;  2F93 B;  5CA3 A;  2OWO A;  4FIP C;  4H44 B;  4DW0 A;  4K8Z A;  4P30 A;  4O4L B;  2QWN B;  2XND G;  1WN7 A;  3H1J H;  4D7T A;  2R9R B;  4UCR A;  4PD4 F;  2P7T C;  5LP6 C;  5LMU B;  3WB0 A;  2VQF O;  1RM1 B;  2W6J G;  3LSQ A;  4O4I A;  5IYB O;  1JR9 A;  2LFR A;  1GO3 F;  3DC5 A;  2JDI G;  3C3S A;  2JGD B;  1GN2 A;  1EBO A;  2XHB A;  3RYF A;  1BSM A;  1PV0 A;  2ODM A;  4X20 A;  2B1I A;  5EIB C;  1N36 O;  1ENV A;  3N2K A;  2FKX A;  1TUB B;  3L71 H;  2UXD O;  1SRY A;  5LHI A;  3EHB B;  1R6K A;  1FXK A;  5KA6 A;  2Y4T A;  3B40 A;  2F23 A;  4NXM B;  4IYH A;  1HNW B;  1M57 C;  1M4U A;  2XUM A;  3UT5 B;  2EUL A;  2IH1 C;  1BHB A;  4H0L B;  2X6C A;  1SS3 A;  1JCH A;  5L3C A;  4LF8 O;  5K1X A;  2DYS C;  1HW7 A;  1BQZ A;  3ABL C;  4F6R B;  4LBE C;  4EKW A;  1J95 A;  1YDX A;  3JAR B;  3SPC A;  3QTC A;  5L3G A;  4DV6 B;  4RQE A;  3TET A;  1BL8 A;  1ZX3 A;  4ZOL B;  4DV3 O;  4K0K B;  3TXQ A;  3CPW U;  1NQT A;  2PYJ A;  1FYJ A;  1Z2G A;  3JYC A;  1YHQ V;  5IYC O;  2Y48 A; 
#chains in the Genus database with same CATH homology
 2NN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...