2NN4A

Crystal structure of bacillus subtilis yqgq, pfam duf910
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
b'LNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqgQ
publication title Structure of YqgQ protein from Bacillus subtilis, a conserved hypothetical protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.760 Mainly Alpha Orthogonal Bundle Helix Hairpins YqgQ-like 2nn4A00
2NN4A
chains in the Genus database with same CATH superfamily
5A9GA 3B4SA 1KQSU 1EFRG 3E35A 4GKKO 1NS1A 4UCRA 4NKGB 5CBGA 1SESA 2NNUA 1VF6C 5KMGB 2B1IA 3KKYA 1YDXA 2OIEA 2EINB 3SJQC 3K5MA 4HZ3A 1V54C 1WPXA 3TK1A 5KA6A 3HKBB 3D8CA 4O4HA 4NVPA 1MMMA 3JALB 4FLZA 4LNUA 2AGAA 1THZA 2B5UA 1ORQC 1KMIZ 5JWPA 3W7TA 4CBCA 4EB6B 4PDVA 2XAFA 3JARA 2XASA 1IBMO 4J9ZB 2DYRB 5LOVB 2XAJA 3F7VC 5LHGA 1PNKA 1NI8A 4LF8B 4I4TB 1OCCB 2Z0AA 1LUWA 4KUMA 3CMEV 1AILA 3F5TA 4OX9B 2CGNA 1ZTEA 3ASNC 1XDCA 2CE4A 3E8FA 1QLEC 3CMAV 3JCZA 4DR1B 2R9IA 3JAWB 1I7FA 2Z3YA 2B1GA 2EZOA 2AW9A 5IJ0A 5CA3A 2W0FC 2NLJC 3K5OA 3LDDA 3EXAA 2IBZH 4ZIBA 1VQ4V 4E4EA 2RN9A 3AEIA 2PI5A 4FK5C 4NTYA 3T4DA 4I0XA 4O2AB 4DR3O 5LBQA 4ZHQB 1V55B 3CWBH 3RYIB 3ZRSA 5LP6A 3A2FA 2IU3A 5FNVB 2KG7B 2Q73A 1HDJA 4LF7O 4FLUA 4LFAO 3B2EE 2JRIA 2JGDB 2X7RB 4DYLA 3MDSA 1GM9A 1ZL8B 4LFCB 5H6RA 3HPLC 4ASUG 1SC5B 1QQCA 1MSDA 1DF4A 4RQFA 5BZBA 4LCUC 5AG2A 2N05A 3K59A 1MG1A 4PDMA 5JQGB 4LFBO 2XAHA 4X65B 1TVKA 3RYCA 1GN2A 1EN4A 1AR5A 2GUZB 4W4LA 2WLKA 4RWUA 3K9AA 2Y4TA 4B3TB 3U0ZA 4JI2B 3N2KB 2WLIB 2O57A 3S3XA 3J7AU 3RYHA 4ICGA 2Y69B 1N4CA 2BSKB 1KC8W 1ZAUA 2YXHA 3ZS8C 3GB7C 1P49A 4FJCC 3OW2U 4Q20A 2QDOA 1NR7A 3JD2A 4FPPA 4ZOLB 3E22B 4RO2A 4FFBA 3AG7A 4FLWA 5EBLC 2BCCH 1UJWB 1DK1A 4YY3B 3JD4A 5JJEB 3M7MX 4YIOA 3HKDA 1SQFA 4DV1B 4LC1A 1N36O 4F6EA 1P7GA 3AG4B 1FFXB 1M4UA 3KCYA 4PI0A 1EM1A 2FYUH 1XMOB 3W7SA 2FKXA 3JAKA 1YJNV 3VQVA 3EFFK 3SPHA 5CN0A 1K92A 2QKAA 3W7WA 1J95A 1LNQA 2ZXWB 4UCOA 2XAGA 2Q68A 4FZ1A 4DR5B 4NYKA 3ZHSA 5LMUB 1K33A 1Q6HA 2YDEA 2VWJA 5IYZB 2LFSA 2LP7A 2GTAA 4PA6A 1VF6A 4ZI7A 2RJZA 1KU9A 1YZBA 2W6IG 4FLTA 3SJCC 3CRRA 5LYJB 4CH5A 4EKWA 1N34B 1AVMA 2QM8A 4IIJA 4DUZO 1IBKO 4J42A 1R6TA 4O2BA 5CBFA 4UXNA 3TGUH 1W0JG 2F23A 4J9YB 5BY1A 2HHHO 4TQFA 3RVYA 1HR0O 3AK3A 1R73A 2PUSA 3TXQA 3IJ4A 5EIBD 3R65A 3VQXA 1F4NA 3ABKB 3RT3C 2HJDA 3FAVB 1VF7A 3W7XA 1JJ2U 1AR4A 3JSLA 4TV9A 3C3TA 1HW7A 3DGEA 1QU7A 2V7QG 4JI4B 2DYSB 3K08A 4HBNA 4UVBA 5KX5B 2YIBA 4LWSA 3JD0A 1IZ3A 4JI0O 4I9WA 3SYCA 3OFNG 4RQEA 4YJ3A 4FM2A 3ZRVA 5CB4B 3K06A 1G4YB 1NT2B 5TISZ 2JDIG 2EILB 3ZMTA 1N8RW 1T5EA 3I55V 4DV6B 5JCOA 3JATB 4UCVA 4JI7B 1SQPH 5IE9A 5K1XA 1H2SB 1H8HG 1SZTA 3G80A 2OWOA 3M8AA 1Z5WA 3ZIAG 3E86A 5H5NA 1TUBA 3WB1A 3F7YC 5KAFZ 1Y66A 4TUYA 2ETNA 1CXZB 4AILC 3ML0A 3N27A 4H33A 1HP8A 4WFHA 1FJGO 3CSXA 2CUGA 5F2VO 3AG2B 1AP6A 4J7KA 1I08A 3HKEA 2PYLA 1Q86W 2WLNA 5GTHZ 3A0HZ 4WFGA 4JI6B 3K57A 3L72H 1Q7YW 1F23A 1KP2A 1SQGA 4DR4O 1BS3A 4DR2O 5DEDA 3SYOA 1XL4A 2OIGA 4NXNO 3ZMZA 2P4KA 2VQEO 2WWWA 2UUAO 3FB5C 1N33B 4BIOA 4U3FH 3OMNB 4HAMA 4X1YB 4BR6A 1WP8A 3CC4V 4FLVA 3J81N 3BHPA 1BSMA 3CCEV 3F5WC 4YJ2B 4KHPB 2K1EA 2OT5A 4LH7A 1PP9H 3U10A 4HYOA 2YXLA 1F4MA 1MZEA 2IJKA 2Q69A 4CS3A 1PNMA 2ZM6B 4UV9A 5K1PA 4JI3B 1JVMA 2FTKA 1P84F 4DV5B 4NXMB 5CA0B 2UXDB 3OMAB 4MT8A 3OUSA 2X0LA 4I9QA 3HKCB 2M6YA 3ZEDA 1QR9A 1AJNA 4O4LA 5EZYA 4O4JB 2K9PA 3JASB 2Q7EA 1Y74B 3LNNA 5B1BC 3B77A 4AI8A 1GMGA 3ICXA 1PL0A 4OPAA 3B8NA 2YI8A 1H2GA 3A0RA 1LUVA 4U3JB 4LF8O 1BL8A 1K5SA 3T2MA 5JH7B 3ZN0A 1JX9A 2Y48A 1XL6A 2F43G 4IHJB 4QNHB 4C7UA 4GX2A 4DR1O 4FLYA 3BY6A 4KP4A 2UUCB 3CRCA 1M90W 4AQYO 3IGAC 4E2LA 1Y6XA 1H2NA 5GTIZ 4MTOA 4MVUA 2KQXA 3BCCH 2IH3C 4LF5B 1K97A 1QVFU 4LF6B 3DTUB 3B09A 4FFKA 4U7OA 3KG2A 3BFRA 2QSAA 1BZKA 4HNAB 2QTSA 4UB8Z 1R3IC 2EINC 5CBHA 4DO2A 1NVPB 3O9OA 1FD9A 4MVZA 4JI8O 3BABA 1AB3A 4QE7A 5BR8B 1VQ9V 1H2LA 1N0NA 4WBNA 5E1AC 2CH7A 3VQWA 5JVDA 4LF4B 3PJSK 4LFCO 3DXRB 3T1HB 4PJ0Z 4DR7B 3CJHA 3QVNA 4LF9B 1UFIA 5LGUA 4J10A 5IWAB 3A0BZ 3L71H 3JYCA 5BMVB 1YHQV 3SJBC 4U7NA 2Q0AA 4PA7A 4DV7O 1FXKB 1SA0B 2DYRC 1GRJA 1BMFG 4WFAV 5LXTA 1OCCC 2BTQA 3OUFA 1OCOB 4J80A 1PD3A 3ZRWB 1R6KA 3ZMSA 4IL6Z 1AP5A 1QLNA 4UB6Z 5ITZB 1XREA 3K0DA 1VQNV 1SS3A 2QKSA 4JAVA 1XMQO 3RGBA 4WFFA 5GONB 1K9MW 4BWAA 3GWKC 1H2MA 4GZRB 1FPOA 4YXWG 3T1CA 3STZC 2RMKB 3L9DA 3ZMVA 1JJOA 4G2KA 1XHZA 2UU9O 2QWOB 4I5SA 1OCZB 2YEVA 4LBEC 4XDJA 1NU1H 4YY3O 3T1YO 5IJ9A 4CH3A 3OTOB 2ZE5A 1COWG 3IC9A 4DV1O 1V55C 3GVMA 3K5LA 2E5LO 4D6TH 2QA4V 4EFBA 4JI1B 4OGQB 1Z2GA 1IBLO 4R7CA 2IJHA 1H2KA 4B08A 1EZJA 1XQ8A 3ZX6A 4DR5O 5EIBC 2WSSG 5LMUO 1O9HA 3RWRD 3EHBB 4PA3A 4GT1A 4DUYB 2F4VO 2DJVA 1I5YA 3ABLB 4DR6B 2QTOA 2IJJA 4Z1MG 4W4KA 3AK1A 4PA9A 1XNRB 2ZQMA 1JFFA 3TETA 4JYAB 1BT8A 5LHIA 4IYIA 5LMNB 2L6LA 3LSUA 3H1KH 2CK3G 2DOSA 2R9AA 1XEQA 1Q90D 1K3EA 2Y69C 4X1IA 2P5OA 4DV3B 4FM0A 1R3KC 1NVPD 1XBLA 5LGNA 2MK3A 4MTFA 1IDSA 4LP8A 2BTOA 4I50B 4X62B 3H1JH 1L1FA 3AK2A 4AHCA 1Q5OA 1MOFA 1MZFA 3G4SV 3HB3B 4O4IA 1HNZB 4DXWA 3AG4C 2QWPB 4RUFA 4PI2A 1I94O 2CTPA 3G67A 3JD3A 2F95B 1L8DA 4DK0A 4JI4O 1SRYA 1ZLZA 3THOA 2BOBC 3X2QB 2QGNA 2ZXWC 3QG5A 2IJIA 2UXBO 3FD9A 4MTGA 2N74A 4KFMA 3SYAA 4X20B 5H2FZ 5JCOC 3KCXA 1JMKC 4DV0B 2RDCA 5KMGA 2ZIMA 3H9VA 1M56B 4QGPA 2WLHA 4JI5B 2ZE8A 2EBOA 4BW9A 4XDLA 2YUAA 3I5DA 4RAIA 3K58A 3HKBA 4JYCA 1ROPA 3N2GB 2ATKC 3JALA 1AROP 2HVKC 1IURA 4OXSA 2CTRA 1W0KG 2LQTA 2W0XA 4EB6A 4JV5O 3AG3B 2OTJV 2L35A 2ODMA 4MVQA 5IYBO 5LOVA 1XOUA 4DW0A 2D2CB 3DSQA 3ABKC 4I4TA 2YSUB 3VBBA 1PM9A 4Q6GA 5L3FA 1Y4MA 2GTSA 4CZZA 3SJAC 3OM3B 5KHKA 3CXCU 4JI6O 1FXVA 2B9ZA 3JAWA 2DYSC 3PN1A 1GN3A 2ZD9A 3K0GA 3ZMUA 2WPDG 5B1OA 4P2ZA 2LGWA 1CEZA 4X66B 1TA8A 3ASOB 4F4LA 4IYHA 1QCEA 2F66C 1AI5A 4O2AA 2H3OA 1N33O 3G71V 1IVSA 1WB8A 4ZHQA 1Z5VA 2A79B 2JS3A 4J11A 2EILC 4DRXB 3RYIA 2V4DA 1QLEB 4JTDB 1YF2A 2A9HA 2XOKG 5FNVA 2KG7A 1CP9A 2QJ1A 3D3IA 2JGDA 1RP3B 3SR2C 5JJJB 1ZL8A 5FPOA 2DN9A 2ZM6O 2QM4A 1YJ9V 4DV5O 3ETQA 2HKOA 2UXCO 1MA1A 4TOIA 5CA1B 2QWQB 4Z2WA 3SPCA 1US6A 5JQGA 2XUMA 4JYYA 2EIMB 2WLLB 4YHHO 3AG2C 2ZNJA 1Q82W 2GUZA 3RYFB 1NTKH 2QE7G 1NTZH 1B04A 3WB0A 1JCHA 4J41A 5H9CA 2CDYA 2WLIA 3N2KA 4K8XA 3CCRV 3BA8A 1SETA 2OCCB 3P3NA 3QO7A 2BSKA 3LSSA 4TV8B 1ZSPA 2Q6AA 4I7ZB 1KUQA 5KA5A 3UT5B 1K4CC 3NR7A 3UM7A 4X64B 5IY5B 3JCUZ 4ZOLA 3E22A 1IBMB 1N32O 1YITV 1SF9A 1VARA 2OTLV 1PKXA 2H94A 2V1DA 4MS2A 1M1KW 2FL4A 1J5EO 1FFXA 3GWOA 5EBWC 3CYOA 3ETGA 1E1QG 1KECA 2Q4PA 3RBZA 4DV2O 2DQ0A 1KB9F 4N21A 1YEWA 4D7TA 4P30A 3H01A 4TWKA 1X4TA 4GLXA 4DR3B 2DE0X 5IYZA 2GV9A 3UQ8A 1MABG 1I5XA 3CC7V 3CCMV 2IW5A 5BR8O 1R1BA 1K7DA 4FVMA 1AI7A 4LF4O 4LF7B 1L0LH 4LFAB 4B3SO 3T1HO 3JSNA 4DR7O 2Y0PA 1IXBA 1XUQA 2X6AA 5C8YB 1YI2V 5KHHA 2AZ2A 1HWYA 3CCSV 5LYJA 1M9NA 1U97A 4WFBV 2XT9A 4RUEA 4MW8A 5J2UB 3OAAG 2A7WA 3SYQA 3CS5A 3CHXA 2YI9A 3D36C 4X1KB 2OYQA 3OMIB 1X59A 1DGSA 1EZVH 1GM7A 2P7TC 2JIZG 1S3JA 2PZSA 1S5JA 3FAVA 4GYCB 3OR6C 1YJWV 1KD1W 2CAZC 3J80N 2UUBO 4X88A 4KXRA 1WA8B 1NBMG 3D3QA 2HEPA 4GX1A 4UVAA 3P32A 3RVZA 5J2TB 1DF5A 5A2QN 5KX5A 3OTOO 1NZ6A 5KUMA 4PHZA 4JYBA 3E8BA 3UCSC 4JGSA 2F93B 3CB2A 5IT9N 5B1AB 4NB5A 3QO5A 5CB4A 1N36B 4MTXA 3H1LH 3Q4HB 3IC7A 3UKMA 2UXXA 1GM8A 4QJFB 3LNMB 2FB5A 1BGYH 3FYIB 2Q67A 3JATA 5J9PC 1UPGA 1H8EG 3ZCCA 5KHIA 3RN4A 1SQVH 2KB1A 3SYPA 1HNXB 2Q0OC 4DV4B 4DUYO 1FXKC 2QWRB 4B7EA 1M5IA 5EC1C 1YTFB 1XNRO 4JYAO 5EK0A 4D7SA 4UFZA 1OCOC 5EYPB 3L74H 1QHTA 3ZHRA 1B6QA 1G8MA 3JD1A 2HR3A 3CE2A 4XDKA 2XNDG 4DV3O 1AI6A 3G6EV 4K0KB 3HR0A 3CEIA 2ZR3A 4JAUA 1Y76B 1IX9A 1RSOB 4J7JA 2EIJB 3JAMN 1IBKB 2N04A 1QR8A 1ZUQA 4R50A 2QWNB 1Q81W 1K34A 4OX9O 3ZHUA 3H1IH 2JVDA 5B66Z 2HHHB 4WF9V 2GHYA 2AZ0A 1HR0B 2YS8A 3L73H 1XILA 3BA9A 1HNZO 4B3MB 3K04A 4B7KA 1URFA 2WAMA 5LGTA 3CCVV 4X1YA 2CGOA 5L3EA 2EIKB 2IU0A 4J7ZA 4JF3A 1VEWA 1HNWB 4I55B 4K35A 4JAAA 3OTFA 4F6RB 1K5QA 2P6JA 5B1NA 1A32A 4DV0O 3ABLC 5LA6B 4OPHA 2ADPA 1Q8IA 4JI5O 1YVWA 1L0NH 4NR1A 2Q7GA 2JJ2G 5CA0A 3ZBHA 1M57B 1GN6A 4TQDA 1OJHA 2EZPA 3HKCA 1VQLV 1AJQA 2C2AA 4X65O 1OHHG 1Q43A 1GAXA 2RCVA 1BHAA 4O4JA 1WNSA 4CC5A 2VQFB 2GSMB 3JASA 1GKFA 1Y74A 3BPZA 4PDLA 4B3TO 1FYJA 4O4HB 4JI2O 1NKDA 3MHSC 4P9OA 3QNEA 2VWKA 3CCUV 4LNUB 5L3CA 4U3JA 2JJ1G 3D36A 3P30A 1D5NA 5JH7A 1FJGB 1XI1A 2YIAA 1WAZA 1BCCH 4IHJA 3JARB 1Y67A 3ETDA 3TXSA 1YTFD 3X2QC 2PGGA 5D5PA 4B3RB 1YXBA 3EVKA 5B1BB 1JA8A 1SQQH 3C3SA 4DR4B 1VQMV 4MVMA 4DR2B 1RM1B 4H13B 1R3LC 2X6BA 4HNAA 1XMOO 1F7YA 2VQEB 1M56C 5IJ0B 3CXHF 2LW1A 1O9GA 3E8GA 3OE7G 2HJFC 1OZ0A 4PD4F 4I0XB 3SDLA 3LDCA 4NTWA 1NTMH 2R72A 3DXRA 3OGIB 1SQXH 1DTOA 5LP6B 3CCQV 4JZ2A 5DECA 4JTAB 4QIWF 5FL7G 3AG1B 5BMVA 1FFTB 5KHJA 4H37A 3AG3C 1GN4A 3VQYA 1FXKA 4EFEA 1SA0A 1OCRB 1N34O 2AXTZ 4DW1A 3I56V 3ZRWA 5L3DA 4K3AA 2Q9LA 1TGOA 1TVKB 5ITZA 3RYCB 4UCSA 5B3SB 5GONA 4R6ZA 4QPKA 4X64O 2QEXV 3MAQA 3LSQA 3ABMB 3ASOC 2LW7A 1G6UA 4MSWC 3RYHB 5B5EZ 3TJTA 2ZE6A 1GK9A 2ZDIC 2Q5ZA 1I0HA 1Q6IA 3DC5A 4MW3A 1WN7A 1VQ8V 5LHHA 5D5QA 3FKSG 1WB7A 4KL1A 1P7BA 5KLVH 4FFBB 2WLMA 4P9PA 1GH6A 3WB2A 2LJ2A 1WPBA 4AQYB 1MSWD 4WFEA 3HKDB 1VQ7V 5GW7A 2GBOA 1VQPV 1JPXA 2DWDC 4GKJB 2UXNA 3WG7B 1D5AA 4DV6O 4JI7O 3JAKB 2EJ7A 1DLBA 2DMXA 2QKCA 2YXYA 2A0LA 4CS4A 3OEEG 2EIMC 3LUTB 3APQA 3MD0A 4JI8B 3P3PA 2EX3A 3SPJA 5DN6G 1VQ5V 2M7WA 2YC0A 2F1MA 1XNQB 1KYOF 2WA3A 2KKWA 1ENVA 1XHXA 2BOCC 1NR1A 4IT5A 4ZI7B 1VQOV 1RPRA 2ZINA 3R66A 1YSCA 1B3QA 3QTCA 2OCCC 2VRZA 5IYDO 2BE3A 3OT7A 3E83A 5H6QA 3QF7A 5IY5C 1V54B 4I50A 3APOA 2DQ3A 3WU2Z 4DV7B 4NTXA 2YIDA 2WA4A 1EN5A 2A06H 3OR7C 4CS2A 4IIJB 4YIPA 4BIZA 4O2BB 1S72V 3O65A 4UV8A 4JPRA 3OGCC 1SERA 1KKDA 1JOYA 1KKCA 1XMQB 4H0LB 2ZKOA 3K9SA 3FX7A 4Z1VA 2G38A 1W59A 4CH4A 2UU9B 4TV9B 3ASNB 1B06A 1VP7A 3T1YB 4X20A 3ABTA 4FIPC 2IH1C 4TT3G 2HVJC 3L70H 2Q8VA 4KHPO 3BEHA 4LWSB 2VS0A 2E5LB 4FLXA 1IBLB 1FAFA 4GKKB 3CRAA 4JI3O 4YJ3B 2P67A 4IGGA 4QPJA 3CRQA 4LR3A 4NXMO 1HNXO 1RFYA 1BQ0A 4DV4O 2ITDC 3N2GA 2UXDO 4H44B 1CPYA 1PL4A 2P4VA 1SKVA 2Y4UA 5EBMC 5CMUA 4LH6A 4DK1A 3ZN1A 2F4VB 1FXHA 3C90A 1NQTA 2PTMA 1S0VA 3OEHG 2ZR2A 3W7UA 2D3OW 2PF4E 4GX0A 1G1XB 2PY5A 3B8MA 1V9PA 1TUBB 2YICA 2P90A 4K0KO 4TUYB 1EN6A 3FFQA 1SZXA 2E76B 4K8ZA 2DWEC 1R6NA 3RW0A 1M93A 1MNGA 3U11A 3FB8C 3HKEB 3ZHVA 3SPGA 4QE9A 2UUCO 2PI4A 1EBOA 1YIJV 4B3MO 2CTWA 5B1AC 2LFRA 4PA4A 4MVOA 4X9QA 4LF5O 2QR4A 2ZDIA 4UCUA 2HP8A 4LF6O 3LDEA 1QBZA 1F51A 4DRXA 1I94B 1HNWO 2A3QA 2HLDG 4UCTA 2JEUA 3CC2V 5LL6Y 2UXBB 1KP3A 5DM6V 2EJRA 1D2DA 1S5HC 4BIUA 2IM9A 3E2EA 1VQ6V 1K8AW 1VQKV 4GCZA 5KAIZ 3CX5F 1NH2B 4LF9O 5CA1A 4PELA 5IYCO 4JTCB 5IWAO 2P22C 2WLLA 2E3CA 5C93A 3OD4A 3RYFA 4N23A 4EEQA 4X89A 2EIJC 1TAEA 2VQFO 4LFBB 2MW2B 2JEXA 2P06A 2YIBD 5FPRA 1AJPA 4TV8A 2ZNIA 3UT5A 4JV5B 2RNBA 5HFLA 4O4LB 5EZYB 2GDSA 1ZX3A 1TUEB 2QM7A 3K5NA 2NN4A 1R3JC 3T4ZA 2EIKC 1U96A 2ZE7A 4B3RO 1VMGA 1WP7A 5KUKA 2KSDA 1GTOA 1Q3EA 2X6CA 2Q7HA 1PNLA 4JI1O 2PYJA 2HG5C 1WLEA 1K4DC 1QNMA 2FMLA 3M99B 1WJZA 3ZJZA 5IDJA 3FB6C 4JZGA 1M57C 4BAYA 3B40A 2AHZA 2R70A 2HFEC 2WLJA 2ZCEA 5L3GA 2XAQA 3NXSA 1RPOA 4MVSA 2XTAA 1SQBH 3TCUA 2RQ6A 4DR6O 4FM1A 5C8YA 2OCHA 2ZIOA 4UUJC 5BXZA 2JS5A 1PPJH 4WBNB 5LMNO 1AI4A 5L3BA 2CH7B 5JVDB 3DC6A 4G28B 5J2UA 3RFRA 2H8PC 2UXCB 3CJHB 2R9RB 4X1KA 3QO8A 2XHBA 4A5UB 2LO1A 4YHHB 4X62O 2Z5UA 3E8HA 3KZIZ 1E1RG 3MHHC 1AR1B 1S77D 3STLC 4DUZB 4MVRA 1OCZC 3SPIA 5LXTB 4TSFG 3ABUA 1NH2D 2BTQB 1IXMA 3UO3A 4GX5A 5JJNB 4UVCA 1WA8A 1RM1C 2LGQA 2ITCC 1E79G 5J2TA 1BQZA 1N32B 2EULA 1BHBA 5EC2C 3FYEB 3CD6V 1KBHA 1NJIW 1FS0G 1BE3H 3ZHQA 4ZKIA 2NR5A 3BVOA 4ZBMA 2JK5C 2YEVB 2DW4A 4ABMA 4YJ2A 4G27B 5IJ9B 3Q4HA 2ADQB 1J5EB 4CH6A 3WFVA 4JI0B 1PV0A 5LP6C 1K73W 4GKJO 4DV2B 4FZ0A 3VOUA 4FMTA 5E79Z 1H38A 3AG1C 2E75B 3ZHTA 2Y0IA 2JGUA 3H1HH 1OCRC 3BRCA 3K03A 3CCLV 3UO2A 2ZT9B 1YCIA 1N0JA 1XNQO 3K79A 1ZWIC 4GUNA 5EYPA 4BW5A 4CC6A 1LR1A 1VF5B 5KHGA 2ARHA 4B3SB 3ZRXA 1JQ0A 2AHYA 3CP1A 1P4RA 5B3SC 2ILMA 4PDRA 1JFFB 1W2BU 1Y76A 4R8CA 1FKAO 1RSOA 3CPWU 1GO3F 3ABMC 4JASA 3IFXA 3E89A 4X1IB 4L87A 3CCJV 2W6JG 4PV1B 1QVGU 3IAYA 3L75H 3ETEA 1Q6UA 4X66O 4WCEV 4L8JA 4XBFA 4X8AA 2UUBB 3SGIA 1JR9A 3BAAA 3G6BA 2CTQA 3K3WA 4O4IB 4NXNB 1S76D 3S3WA 4I55A 1VIBA 2E74B 2UUAB 5HFMA 1OV9A 3WG7C 5FLXN 4F6RA 1S5LZ 3FB7C 3A8TA 3CRMA 5LA6A
chains in the Genus database with same CATH topology
2NN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN4 A; 
#chains in the Genus database with same CATH topology
 5A9G A;  3B4S A;  1KQS U;  1EFR G;  3E35 A;  4GKK O;  1NS1 A;  4UCR A;  4NKG B;  5CBG A;  1SES A;  2NNU A;  1VF6 C;  5KMG B;  2B1I A;  3KKY A;  1YDX A;  2OIE A;  2EIN B;  3SJQ C;  3K5M A;  4HZ3 A;  1V54 C;  1WPX A;  3TK1 A;  5KA6 A;  3HKB B;  3D8C A;  4O4H A;  4NVP A;  1MMM A;  3JAL B;  4FLZ A;  4LNU A;  2AGA A;  1THZ A;  2B5U A;  1ORQ C;  1KMI Z;  5JWP A;  3W7T A;  4CBC A;  4EB6 B;  4PDV A;  2XAF A;  3JAR A;  2XAS A;  1IBM O;  4J9Z B;  2DYR B;  5LOV B;  2XAJ A;  3F7V C;  5LHG A;  1PNK A;  1NI8 A;  4LF8 B;  4I4T B;  1OCC B;  2Z0A A;  1LUW A;  4KUM A;  3CME V;  1AIL A;  3F5T A;  4OX9 B;  2CGN A;  1ZTE A;  3ASN C;  1XDC A;  2CE4 A;  3E8F A;  1QLE C;  3CMA V;  3JCZ A;  4DR1 B;  2R9I A;  3JAW B;  1I7F A;  2Z3Y A;  2B1G A;  2EZO A;  2AW9 A;  5IJ0 A;  5CA3 A;  2W0F C;  2NLJ C;  3K5O A;  3LDD A;  3EXA A;  2IBZ H;  4ZIB A;  1VQ4 V;  4E4E A;  2RN9 A;  3AEI A;  2PI5 A;  4FK5 C;  4NTY A;  3T4D A;  4I0X A;  4O2A B;  4DR3 O;  5LBQ A;  4ZHQ B;  1V55 B;  3CWB H;  3RYI B;  3ZRS A;  5LP6 A;  3A2F A;  2IU3 A;  5FNV B;  2KG7 B;  2Q73 A;  1HDJ A;  4LF7 O;  4FLU A;  4LFA O;  3B2E E;  2JRI A;  2JGD B;  2X7R B;  4DYL A;  3MDS A;  1GM9 A;  1ZL8 B;  4LFC B;  5H6R A;  3HPL C;  4ASU G;  1SC5 B;  1QQC A;  1MSD A;  1DF4 A;  4RQF A;  5BZB A;  4LCU C;  5AG2 A;  2N05 A;  3K59 A;  1MG1 A;  4PDM A;  5JQG B;  4LFB O;  2XAH A;  4X65 B;  1TVK A;  3RYC A;  1GN2 A;  1EN4 A;  1AR5 A;  2GUZ B;  4W4L A;  2WLK A;  4RWU A;  3K9A A;  2Y4T A;  4B3T B;  3U0Z A;  4JI2 B;  3N2K B;  2WLI B;  2O57 A;  3S3X A;  3J7A U;  3RYH A;  4ICG A;  2Y69 B;  1N4C A;  2BSK B;  1KC8 W;  1ZAU A;  2YXH A;  3ZS8 C;  3GB7 C;  1P49 A;  4FJC C;  3OW2 U;  4Q20 A;  2QDO A;  1NR7 A;  3JD2 A;  4FPP A;  4ZOL B;  3E22 B;  4RO2 A;  4FFB A;  3AG7 A;  4FLW A;  5EBL C;  2BCC H;  1UJW B;  1DK1 A;  4YY3 B;  3JD4 A;  5JJE B;  3M7M X;  4YIO A;  3HKD A;  1SQF A;  4DV1 B;  4LC1 A;  1N36 O;  4F6E A;  1P7G A;  3AG4 B;  1FFX B;  1M4U A;  3KCY A;  4PI0 A;  1EM1 A;  2FYU H;  1XMO B;  3W7S A;  2FKX A;  3JAK A;  1YJN V;  3VQV A;  3EFF K;  3SPH A;  5CN0 A;  1K92 A;  2QKA A;  3W7W A;  1J95 A;  1LNQ A;  2ZXW B;  4UCO A;  2XAG A;  2Q68 A;  4FZ1 A;  4DR5 B;  4NYK A;  3ZHS A;  5LMU B;  1K33 A;  1Q6H A;  2YDE A;  2VWJ A;  5IYZ B;  2LFS A;  2LP7 A;  2GTA A;  4PA6 A;  1VF6 A;  4ZI7 A;  2RJZ A;  1KU9 A;  1YZB A;  2W6I G;  4FLT A;  3SJC C;  3CRR A;  5LYJ B;  4CH5 A;  4EKW A;  1N34 B;  1AVM A;  2QM8 A;  4IIJ A;  4DUZ O;  1IBK O;  4J42 A;  1R6T A;  4O2B A;  5CBF A;  4UXN A;  3TGU H;  1W0J G;  2F23 A;  4J9Y B;  5BY1 A;  2HHH O;  4TQF A;  3RVY A;  1HR0 O;  3AK3 A;  1R73 A;  2PUS A;  3TXQ A;  3IJ4 A;  5EIB D;  3R65 A;  3VQX A;  1F4N A;  3ABK B;  3RT3 C;  2HJD A;  3FAV B;  1VF7 A;  3W7X A;  1JJ2 U;  1AR4 A;  3JSL A;  4TV9 A;  3C3T A;  1HW7 A;  3DGE A;  1QU7 A;  2V7Q G;  4JI4 B;  2DYS B;  3K08 A;  4HBN A;  4UVB A;  5KX5 B;  2YIB A;  4LWS A;  3JD0 A;  1IZ3 A;  4JI0 O;  4I9W A;  3SYC A;  3OFN G;  4RQE A;  4YJ3 A;  4FM2 A;  3ZRV A;  5CB4 B;  3K06 A;  1G4Y B;  1NT2 B;  5TIS Z;  2JDI G;  2EIL B;  3ZMT A;  1N8R W;  1T5E A;  3I55 V;  4DV6 B;  5JCO A;  3JAT B;  4UCV A;  4JI7 B;  1SQP H;  5IE9 A;  5K1X A;  1H2S B;  1H8H G;  1SZT A;  3G80 A;  2OWO A;  3M8A A;  1Z5W A;  3ZIA G;  3E86 A;  5H5N A;  1TUB A;  3WB1 A;  3F7Y C;  5KAF Z;  1Y66 A;  4TUY A;  2ETN A;  1CXZ B;  4AIL C;  3ML0 A;  3N27 A;  4H33 A;  1HP8 A;  4WFH A;  1FJG O;  3CSX A;  2CUG A;  5F2V O;  3AG2 B;  1AP6 A;  4J7K A;  1I08 A;  3HKE A;  2PYL A;  1Q86 W;  2WLN A;  5GTH Z;  3A0H Z;  4WFG A;  4JI6 B;  3K57 A;  3L72 H;  1Q7Y W;  1F23 A;  1KP2 A;  1SQG A;  4DR4 O;  1BS3 A;  4DR2 O;  5DED A;  3SYO A;  1XL4 A;  2OIG A;  4NXN O;  3ZMZ A;  2P4K A;  2VQE O;  2WWW A;  2UUA O;  3FB5 C;  1N33 B;  4BIO A;  4U3F H;  3OMN B;  4HAM A;  4X1Y B;  4BR6 A;  1WP8 A;  3CC4 V;  4FLV A;  3J81 N;  3BHP A;  1BSM A;  3CCE V;  3F5W C;  4YJ2 B;  4KHP B;  2K1E A;  2OT5 A;  4LH7 A;  1PP9 H;  3U10 A;  4HYO A;  2YXL A;  1F4M A;  1MZE A;  2IJK A;  2Q69 A;  4CS3 A;  1PNM A;  2ZM6 B;  4UV9 A;  5K1P A;  4JI3 B;  1JVM A;  2FTK A;  1P84 F;  4DV5 B;  4NXM B;  5CA0 B;  2UXD B;  3OMA B;  4MT8 A;  3OUS A;  2X0L A;  4I9Q A;  3HKC B;  2M6Y A;  3ZED A;  1QR9 A;  1AJN A;  4O4L A;  5EZY A;  4O4J B;  2K9P A;  3JAS B;  2Q7E A;  1Y74 B;  3LNN A;  5B1B C;  3B77 A;  4AI8 A;  1GMG A;  3ICX A;  1PL0 A;  4OPA A;  3B8N A;  2YI8 A;  1H2G A;  3A0R A;  1LUV A;  4U3J B;  4LF8 O;  1BL8 A;  1K5S A;  3T2M A;  5JH7 B;  3ZN0 A;  1JX9 A;  2Y48 A;  1XL6 A;  2F43 G;  4IHJ B;  4QNH B;  4C7U A;  4GX2 A;  4DR1 O;  4FLY A;  3BY6 A;  4KP4 A;  2UUC B;  3CRC A;  1M90 W;  4AQY O;  3IGA C;  4E2L A;  1Y6X A;  1H2N A;  5GTI Z;  4MTO A;  4MVU A;  2KQX A;  3BCC H;  2IH3 C;  4LF5 B;  1K97 A;  1QVF U;  4LF6 B;  3DTU B;  3B09 A;  4FFK A;  4U7O A;  3KG2 A;  3BFR A;  2QSA A;  1BZK A;  4HNA B;  2QTS A;  4UB8 Z;  1R3I C;  2EIN C;  5CBH A;  4DO2 A;  1NVP B;  3O9O A;  1FD9 A;  4MVZ A;  4JI8 O;  3BAB A;  1AB3 A;  4QE7 A;  5BR8 B;  1VQ9 V;  1H2L A;  1N0N A;  4WBN A;  5E1A C;  2CH7 A;  3VQW A;  5JVD A;  4LF4 B;  3PJS K;  4LFC O;  3DXR B;  3T1H B;  4PJ0 Z;  4DR7 B;  3CJH A;  3QVN A;  4LF9 B;  1UFI A;  5LGU A;  4J10 A;  5IWA B;  3A0B Z;  3L71 H;  3JYC A;  5BMV B;  1YHQ V;  3SJB C;  4U7N A;  2Q0A A;  4PA7 A;  4DV7 O;  1FXK B;  1SA0 B;  2DYR C;  1GRJ A;  1BMF G;  4WFA V;  5LXT A;  1OCC C;  2BTQ A;  3OUF A;  1OCO B;  4J80 A;  1PD3 A;  3ZRW B;  1R6K A;  3ZMS A;  4IL6 Z;  1AP5 A;  1QLN A;  4UB6 Z;  5ITZ B;  1XRE A;  3K0D A;  1VQN V;  1SS3 A;  2QKS A;  4JAV A;  1XMQ O;  3RGB A;  4WFF A;  5GON B;  1K9M W;  4BWA A;  3GWK C;  1H2M A;  4GZR B;  1FPO A;  4YXW G;  3T1C A;  3STZ C;  2RMK B;  3L9D A;  3ZMV A;  1JJO A;  4G2K A;  1XHZ A;  2UU9 O;  2QWO B;  4I5S A;  1OCZ B;  2YEV A;  4LBE C;  4XDJ A;  1NU1 H;  4YY3 O;  3T1Y O;  5IJ9 A;  4CH3 A;  3OTO B;  2ZE5 A;  1COW G;  3IC9 A;  4DV1 O;  1V55 C;  3GVM A;  3K5L A;  2E5L O;  4D6T H;  2QA4 V;  4EFB A;  4JI1 B;  4OGQ B;  1Z2G A;  1IBL O;  4R7C A;  2IJH A;  1H2K A;  4B08 A;  1EZJ A;  1XQ8 A;  3ZX6 A;  4DR5 O;  5EIB C;  2WSS G;  5LMU O;  1O9H A;  3RWR D;  3EHB B;  4PA3 A;  4GT1 A;  4DUY B;  2F4V O;  2DJV A;  1I5Y A;  3ABL B;  4DR6 B;  2QTO A;  2IJJ A;  4Z1M G;  4W4K A;  3AK1 A;  4PA9 A;  1XNR B;  2ZQM A;  1JFF A;  3TET A;  4JYA B;  1BT8 A;  5LHI A;  4IYI A;  5LMN B;  2L6L A;  3LSU A;  3H1K H;  2CK3 G;  2DOS A;  2R9A A;  1XEQ A;  1Q90 D;  1K3E A;  2Y69 C;  4X1I A;  2P5O A;  4DV3 B;  4FM0 A;  1R3K C;  1NVP D;  1XBL A;  5LGN A;  2MK3 A;  4MTF A;  1IDS A;  4LP8 A;  2BTO A;  4I50 B;  4X62 B;  3H1J H;  1L1F A;  3AK2 A;  4AHC A;  1Q5O A;  1MOF A;  1MZF A;  3G4S V;  3HB3 B;  4O4I A;  1HNZ B;  4DXW A;  3AG4 C;  2QWP B;  4RUF A;  4PI2 A;  1I94 O;  2CTP A;  3G67 A;  3JD3 A;  2F95 B;  1L8D A;  4DK0 A;  4JI4 O;  1SRY A;  1ZLZ A;  3THO A;  2BOB C;  3X2Q B;  2QGN A;  2ZXW C;  3QG5 A;  2IJI A;  2UXB O;  3FD9 A;  4MTG A;  2N74 A;  4KFM A;  3SYA A;  4X20 B;  5H2F Z;  5JCO C;  3KCX A;  1JMK C;  4DV0 B;  2RDC A;  5KMG A;  2ZIM A;  3H9V A;  1M56 B;  4QGP A;  2WLH A;  4JI5 B;  2ZE8 A;  2EBO A;  4BW9 A;  4XDL A;  2YUA A;  3I5D A;  4RAI A;  3K58 A;  3HKB A;  4JYC A;  1ROP A;  3N2G B;  2ATK C;  3JAL A;  1ARO P;  2HVK C;  1IUR A;  4OXS A;  2CTR A;  1W0K G;  2LQT A;  2W0X A;  4EB6 A;  4JV5 O;  3AG3 B;  2OTJ V;  2L35 A;  2ODM A;  4MVQ A;  5IYB O;  5LOV A;  1XOU A;  4DW0 A;  2D2C B;  3DSQ A;  3ABK C;  4I4T A;  2YSU B;  3VBB A;  1PM9 A;  4Q6G A;  5L3F A;  1Y4M A;  2GTS A;  4CZZ A;  3SJA C;  3OM3 B;  5KHK A;  3CXC U;  4JI6 O;  1FXV A;  2B9Z A;  3JAW A;  2DYS C;  3PN1 A;  1GN3 A;  2ZD9 A;  3K0G A;  3ZMU A;  2WPD G;  5B1O A;  4P2Z A;  2LGW A;  1CEZ A;  4X66 B;  1TA8 A;  3ASO B;  4F4L A;  4IYH A;  1QCE A;  2F66 C;  1AI5 A;  4O2A A;  2H3O A;  1N33 O;  3G71 V;  1IVS A;  1WB8 A;  4ZHQ A;  1Z5V A;  2A79 B;  2JS3 A;  4J11 A;  2EIL C;  4DRX B;  3RYI A;  2V4D A;  1QLE B;  4JTD B;  1YF2 A;  2A9H A;  2XOK G;  5FNV A;  2KG7 A;  1CP9 A;  2QJ1 A;  3D3I A;  2JGD A;  1RP3 B;  3SR2 C;  5JJJ B;  1ZL8 A;  5FPO A;  2DN9 A;  2ZM6 O;  2QM4 A;  1YJ9 V;  4DV5 O;  3ETQ A;  2HKO A;  2UXC O;  1MA1 A;  4TOI A;  5CA1 B;  2QWQ B;  4Z2W A;  3SPC A;  1US6 A;  5JQG A;  2XUM A;  4JYY A;  2EIM B;  2WLL B;  4YHH O;  3AG2 C;  2ZNJ A;  1Q82 W;  2GUZ A;  3RYF B;  1NTK H;  2QE7 G;  1NTZ H;  1B04 A;  3WB0 A;  1JCH A;  4J41 A;  5H9C A;  2CDY A;  2WLI A;  3N2K A;  4K8X A;  3CCR V;  3BA8 A;  1SET A;  2OCC B;  3P3N A;  3QO7 A;  2BSK A;  3LSS A;  4TV8 B;  1ZSP A;  2Q6A A;  4I7Z B;  1KUQ A;  5KA5 A;  3UT5 B;  1K4C C;  3NR7 A;  3UM7 A;  4X64 B;  5IY5 B;  3JCU Z;  4ZOL A;  3E22 A;  1IBM B;  1N32 O;  1YIT V;  1SF9 A;  1VAR A;  2OTL V;  1PKX A;  2H94 A;  2V1D A;  4MS2 A;  1M1K W;  2FL4 A;  1J5E O;  1FFX A;  3GWO A;  5EBW C;  3CYO A;  3ETG A;  1E1Q G;  1KEC A;  2Q4P A;  3RBZ A;  4DV2 O;  2DQ0 A;  1KB9 F;  4N21 A;  1YEW A;  4D7T A;  4P30 A;  3H01 A;  4TWK A;  1X4T A;  4GLX A;  4DR3 B;  2DE0 X;  5IYZ A;  2GV9 A;  3UQ8 A;  1MAB G;  1I5X A;  3CC7 V;  3CCM V;  2IW5 A;  5BR8 O;  1R1B A;  1K7D A;  4FVM A;  1AI7 A;  4LF4 O;  4LF7 B;  1L0L H;  4LFA B;  4B3S O;  3T1H O;  3JSN A;  4DR7 O;  2Y0P A;  1IXB A;  1XUQ A;  2X6A A;  5C8Y B;  1YI2 V;  5KHH A;  2AZ2 A;  1HWY A;  3CCS V;  5LYJ A;  1M9N A;  1U97 A;  4WFB V;  2XT9 A;  4RUE A;  4MW8 A;  5J2U B;  3OAA G;  2A7W A;  3SYQ A;  3CS5 A;  3CHX A;  2YI9 A;  3D36 C;  4X1K B;  2OYQ A;  3OMI B;  1X59 A;  1DGS A;  1EZV H;  1GM7 A;  2P7T C;  2JIZ G;  1S3J A;  2PZS A;  1S5J A;  3FAV A;  4GYC B;  3OR6 C;  1YJW V;  1KD1 W;  2CAZ C;  3J80 N;  2UUB O;  4X88 A;  4KXR A;  1WA8 B;  1NBM G;  3D3Q A;  2HEP A;  4GX1 A;  4UVA A;  3P32 A;  3RVZ A;  5J2T B;  1DF5 A;  5A2Q N;  5KX5 A;  3OTO O;  1NZ6 A;  5KUM A;  4PHZ A;  4JYB A;  3E8B A;  3UCS C;  4JGS A;  2F93 B;  3CB2 A;  5IT9 N;  5B1A B;  4NB5 A;  3QO5 A;  5CB4 A;  1N36 B;  4MTX A;  3H1L H;  3Q4H B;  3IC7 A;  3UKM A;  2UXX A;  1GM8 A;  4QJF B;  3LNM B;  2FB5 A;  1BGY H;  3FYI B;  2Q67 A;  3JAT A;  5J9P C;  1UPG A;  1H8E G;  3ZCC A;  5KHI A;  3RN4 A;  1SQV H;  2KB1 A;  3SYP A;  1HNX B;  2Q0O C;  4DV4 B;  4DUY O;  1FXK C;  2QWR B;  4B7E A;  1M5I A;  5EC1 C;  1YTF B;  1XNR O;  4JYA O;  5EK0 A;  4D7S A;  4UFZ A;  1OCO C;  5EYP B;  3L74 H;  1QHT A;  3ZHR A;  1B6Q A;  1G8M A;  3JD1 A;  2HR3 A;  3CE2 A;  4XDK A;  2XND G;  4DV3 O;  1AI6 A;  3G6E V;  4K0K B;  3HR0 A;  3CEI A;  2ZR3 A;  4JAU A;  1Y76 B;  1IX9 A;  1RSO B;  4J7J A;  2EIJ B;  3JAM N;  1IBK B;  2N04 A;  1QR8 A;  1ZUQ A;  4R50 A;  2QWN B;  1Q81 W;  1K34 A;  4OX9 O;  3ZHU A;  3H1I H;  2JVD A;  5B66 Z;  2HHH B;  4WF9 V;  2GHY A;  2AZ0 A;  1HR0 B;  2YS8 A;  3L73 H;  1XIL A;  3BA9 A;  1HNZ O;  4B3M B;  3K04 A;  4B7K A;  1URF A;  2WAM A;  5LGT A;  3CCV V;  4X1Y A;  2CGO A;  5L3E A;  2EIK B;  2IU0 A;  4J7Z A;  4JF3 A;  1VEW A;  1HNW B;  4I55 B;  4K35 A;  4JAA A;  3OTF A;  4F6R B;  1K5Q A;  2P6J A;  5B1N A;  1A32 A;  4DV0 O;  3ABL C;  5LA6 B;  4OPH A;  2ADP A;  1Q8I A;  4JI5 O;  1YVW A;  1L0N H;  4NR1 A;  2Q7G A;  2JJ2 G;  5CA0 A;  3ZBH A;  1M57 B;  1GN6 A;  4TQD A;  1OJH A;  2EZP A;  3HKC A;  1VQL V;  1AJQ A;  2C2A A;  4X65 O;  1OHH G;  1Q43 A;  1GAX A;  2RCV A;  1BHA A;  4O4J A;  1WNS A;  4CC5 A;  2VQF B;  2GSM B;  3JAS A;  1GKF A;  1Y74 A;  3BPZ A;  4PDL A;  4B3T O;  1FYJ A;  4O4H B;  4JI2 O;  1NKD A;  3MHS C;  4P9O A;  3QNE A;  2VWK A;  3CCU V;  4LNU B;  5L3C A;  4U3J A;  2JJ1 G;  3D36 A;  3P30 A;  1D5N A;  5JH7 A;  1FJG B;  1XI1 A;  2YIA A;  1WAZ A;  1BCC H;  4IHJ A;  3JAR B;  1Y67 A;  3ETD A;  3TXS A;  1YTF D;  3X2Q C;  2PGG A;  5D5P A;  4B3R B;  1YXB A;  3EVK A;  5B1B B;  1JA8 A;  1SQQ H;  3C3S A;  4DR4 B;  1VQM V;  4MVM A;  4DR2 B;  1RM1 B;  4H13 B;  1R3L C;  2X6B A;  4HNA A;  1XMO O;  1F7Y A;  2VQE B;  1M56 C;  5IJ0 B;  3CXH F;  2LW1 A;  1O9G A;  3E8G A;  3OE7 G;  2HJF C;  1OZ0 A;  4PD4 F;  4I0X B;  3SDL A;  3LDC A;  4NTW A;  1NTM H;  2R72 A;  3DXR A;  3OGI B;  1SQX H;  1DTO A;  5LP6 B;  3CCQ V;  4JZ2 A;  5DEC A;  4JTA B;  4QIW F;  5FL7 G;  3AG1 B;  5BMV A;  1FFT B;  5KHJ A;  4H37 A;  3AG3 C;  1GN4 A;  3VQY A;  1FXK A;  4EFE A;  1SA0 A;  1OCR B;  1N34 O;  2AXT Z;  4DW1 A;  3I56 V;  3ZRW A;  5L3D A;  4K3A A;  2Q9L A;  1TGO A;  1TVK B;  5ITZ A;  3RYC B;  4UCS A;  5B3S B;  5GON A;  4R6Z A;  4QPK A;  4X64 O;  2QEX V;  3MAQ A;  3LSQ A;  3ABM B;  3ASO C;  2LW7 A;  1G6U A;  4MSW C;  3RYH B;  5B5E Z;  3TJT A;  2ZE6 A;  1GK9 A;  2ZDI C;  2Q5Z A;  1I0H A;  1Q6I A;  3DC5 A;  4MW3 A;  1WN7 A;  1VQ8 V;  5LHH A;  5D5Q A;  3FKS G;  1WB7 A;  4KL1 A;  1P7B A;  5KLV H;  4FFB B;  2WLM A;  4P9P A;  1GH6 A;  3WB2 A;  2LJ2 A;  1WPB A;  4AQY B;  1MSW D;  4WFE A;  3HKD B;  1VQ7 V;  5GW7 A;  2GBO A;  1VQP V;  1JPX A;  2DWD C;  4GKJ B;  2UXN A;  3WG7 B;  1D5A A;  4DV6 O;  4JI7 O;  3JAK B;  2EJ7 A;  1DLB A;  2DMX A;  2QKC A;  2YXY A;  2A0L A;  4CS4 A;  3OEE G;  2EIM C;  3LUT B;  3APQ A;  3MD0 A;  4JI8 B;  3P3P A;  2EX3 A;  3SPJ A;  5DN6 G;  1VQ5 V;  2M7W A;  2YC0 A;  2F1M A;  1XNQ B;  1KYO F;  2WA3 A;  2KKW A;  1ENV A;  1XHX A;  2BOC C;  1NR1 A;  4IT5 A;  4ZI7 B;  1VQO V;  1RPR A;  2ZIN A;  3R66 A;  1YSC A;  1B3Q A;  3QTC A;  2OCC C;  2VRZ A;  5IYD O;  2BE3 A;  3OT7 A;  3E83 A;  5H6Q A;  3QF7 A;  5IY5 C;  1V54 B;  4I50 A;  3APO A;  2DQ3 A;  3WU2 Z;  4DV7 B;  4NTX A;  2YID A;  2WA4 A;  1EN5 A;  2A06 H;  3OR7 C;  4CS2 A;  4IIJ B;  4YIP A;  4BIZ A;  4O2B B;  1S72 V;  3O65 A;  4UV8 A;  4JPR A;  3OGC C;  1SER A;  1KKD A;  1JOY A;  1KKC A;  1XMQ B;  4H0L B;  2ZKO A;  3K9S A;  3FX7 A;  4Z1V A;  2G38 A;  1W59 A;  4CH4 A;  2UU9 B;  4TV9 B;  3ASN B;  1B06 A;  1VP7 A;  3T1Y B;  4X20 A;  3ABT A;  4FIP C;  2IH1 C;  4TT3 G;  2HVJ C;  3L70 H;  2Q8V A;  4KHP O;  3BEH A;  4LWS B;  2VS0 A;  2E5L B;  4FLX A;  1IBL B;  1FAF A;  4GKK B;  3CRA A;  4JI3 O;  4YJ3 B;  2P67 A;  4IGG A;  4QPJ A;  3CRQ A;  4LR3 A;  4NXM O;  1HNX O;  1RFY A;  1BQ0 A;  4DV4 O;  2ITD C;  3N2G A;  2UXD O;  4H44 B;  1CPY A;  1PL4 A;  2P4V A;  1SKV A;  2Y4U A;  5EBM C;  5CMU A;  4LH6 A;  4DK1 A;  3ZN1 A;  2F4V B;  1FXH A;  3C90 A;  1NQT A;  2PTM A;  1S0V A;  3OEH G;  2ZR2 A;  3W7U A;  2D3O W;  2PF4 E;  4GX0 A;  1G1X B;  2PY5 A;  3B8M A;  1V9P A;  1TUB B;  2YIC A;  2P90 A;  4K0K O;  4TUY B;  1EN6 A;  3FFQ A;  1SZX A;  2E76 B;  4K8Z A;  2DWE C;  1R6N A;  3RW0 A;  1M93 A;  1MNG A;  3U11 A;  3FB8 C;  3HKE B;  3ZHV A;  3SPG A;  4QE9 A;  2UUC O;  2PI4 A;  1EBO A;  1YIJ V;  4B3M O;  2CTW A;  5B1A C;  2LFR A;  4PA4 A;  4MVO A;  4X9Q A;  4LF5 O;  2QR4 A;  2ZDI A;  4UCU A;  2HP8 A;  4LF6 O;  3LDE A;  1QBZ A;  1F51 A;  4DRX A;  1I94 B;  1HNW O;  2A3Q A;  2HLD G;  4UCT A;  2JEU A;  3CC2 V;  5LL6 Y;  2UXB B;  1KP3 A;  5DM6 V;  2EJR A;  1D2D A;  1S5H C;  4BIU A;  2IM9 A;  3E2E A;  1VQ6 V;  1K8A W;  1VQK V;  4GCZ A;  5KAI Z;  3CX5 F;  1NH2 B;  4LF9 O;  5CA1 A;  4PEL A;  5IYC O;  4JTC B;  5IWA O;  2P22 C;  2WLL A;  2E3C A;  5C93 A;  3OD4 A;  3RYF A;  4N23 A;  4EEQ A;  4X89 A;  2EIJ C;  1TAE A;  2VQF O;  4LFB B;  2MW2 B;  2JEX A;  2P06 A;  2YIB D;  5FPR A;  1AJP A;  4TV8 A;  2ZNI A;  3UT5 A;  4JV5 B;  2RNB A;  5HFL A;  4O4L B;  5EZY B;  2GDS A;  1ZX3 A;  1TUE B;  2QM7 A;  3K5N A;  2NN4 A;  1R3J C;  3T4Z A;  2EIK C;  1U96 A;  2ZE7 A;  4B3R O;  1VMG A;  1WP7 A;  5KUK A;  2KSD A;  1GTO A;  1Q3E A;  2X6C A;  2Q7H A;  1PNL A;  4JI1 O;  2PYJ A;  2HG5 C;  1WLE A;  1K4D C;  1QNM A;  2FML A;  3M99 B;  1WJZ A;  3ZJZ A;  5IDJ A;  3FB6 C;  4JZG A;  1M57 C;  4BAY A;  3B40 A;  2AHZ A;  2R70 A;  2HFE C;  2WLJ A;  2ZCE A;  5L3G A;  2XAQ A;  3NXS A;  1RPO A;  4MVS A;  2XTA A;  1SQB H;  3TCU A;  2RQ6 A;  4DR6 O;  4FM1 A;  5C8Y A;  2OCH A;  2ZIO A;  4UUJ C;  5BXZ A;  2JS5 A;  1PPJ H;  4WBN B;  5LMN O;  1AI4 A;  5L3B A;  2CH7 B;  5JVD B;  3DC6 A;  4G28 B;  5J2U A;  3RFR A;  2H8P C;  2UXC B;  3CJH B;  2R9R B;  4X1K A;  3QO8 A;  2XHB A;  4A5U B;  2LO1 A;  4YHH B;  4X62 O;  2Z5U A;  3E8H A;  3KZI Z;  1E1R G;  3MHH C;  1AR1 B;  1S77 D;  3STL C;  4DUZ B;  4MVR A;  1OCZ C;  3SPI A;  5LXT B;  4TSF G;  3ABU A;  1NH2 D;  2BTQ B;  1IXM A;  3UO3 A;  4GX5 A;  5JJN B;  4UVC A;  1WA8 A;  1RM1 C;  2LGQ A;  2ITC C;  1E79 G;  5J2T A;  1BQZ A;  1N32 B;  2EUL A;  1BHB A;  5EC2 C;  3FYE B;  3CD6 V;  1KBH A;  1NJI W;  1FS0 G;  1BE3 H;  3ZHQ A;  4ZKI A;  2NR5 A;  3BVO A;  4ZBM A;  2JK5 C;  2YEV B;  2DW4 A;  4ABM A;  4YJ2 A;  4G27 B;  5IJ9 B;  3Q4H A;  2ADQ B;  1J5E B;  4CH6 A;  3WFV A;  4JI0 B;  1PV0 A;  5LP6 C;  1K73 W;  4GKJ O;  4DV2 B;  4FZ0 A;  3VOU A;  4FMT A;  5E79 Z;  1H38 A;  3AG1 C;  2E75 B;  3ZHT A;  2Y0I A;  2JGU A;  3H1H H;  1OCR C;  3BRC A;  3K03 A;  3CCL V;  3UO2 A;  2ZT9 B;  1YCI A;  1N0J A;  1XNQ O;  3K79 A;  1ZWI C;  4GUN A;  5EYP A;  4BW5 A;  4CC6 A;  1LR1 A;  1VF5 B;  5KHG A;  2ARH A;  4B3S B;  3ZRX A;  1JQ0 A;  2AHY A;  3CP1 A;  1P4R A;  5B3S C;  2ILM A;  4PDR A;  1JFF B;  1W2B U;  1Y76 A;  4R8C A;  1FKA O;  1RSO A;  3CPW U;  1GO3 F;  3ABM C;  4JAS A;  3IFX A;  3E89 A;  4X1I B;  4L87 A;  3CCJ V;  2W6J G;  4PV1 B;  1QVG U;  3IAY A;  3L75 H;  3ETE A;  1Q6U A;  4X66 O;  4WCE V;  4L8J A;  4XBF A;  4X8A A;  2UUB B;  3SGI A;  1JR9 A;  3BAA A;  3G6B A;  2CTQ A;  3K3W A;  4O4I B;  4NXN B;  1S76 D;  3S3W A;  4I55 A;  1VIB A;  2E74 B;  2UUA B;  5HFM A;  1OV9 A;  3WG7 C;  5FLX N;  4F6R A;  1S5L Z;  3FB7 C;  3A8T A;  3CRM A;  5LA6 A; 
#chains in the Genus database with same CATH homology
 2NN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...