2NN4A

Crystal structure of bacillus subtilis yqgq, pfam duf910
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
LNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqgQ
publication title Structure of YqgQ protein from Bacillus subtilis, a conserved hypothetical protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.760 Mainly Alpha Orthogonal Bundle Helix Hairpins YqgQ-like 2nn4A00
2NN4A
chains in the Genus database with same CATH superfamily
3CCQV 4FLTA 5KHHA 5EBWC 1AR5A 1VQOV 1OCRC 3BABA 2CTWA 1K33A 3AG2C 3G6BA 3JCZA 3C3SA 1PNMA 2A9HA 3QVNA 2Q5ZA 3SYPA 4J7ZA 1SF9A 3RW0A 3HKBA 1RSOA 3LNNA 4X64B 4LFAB 3DC6A 5BXZA 1FPOA 3WU2Z 1GN3A 1AVMA 3E8BA 4JI3B 2Y4TA 2VRZA 5LMNB 4X9QA 4BWAA 4AI8A 3JD4A 2YC0A 2YIBA 3K9SA 4DR3B 2Q0AA 4JI0O 4B08A 4OGQB 4A5UB 4YY3B 1EZVH 3ZCCA 1AR1B 2JVDA 1I94O 1K97A 5CBFA 1LR1A 4TSFG 3DTUB 3B2EE 3UT5B 2LQTA 4PA4A 2PYLA 4MVSA 4LFBB 4LF7O 1D2DA 4JYBA 3FB7C 2CK3G 1TGOA 2VQFB 3QO7A 4ASUG 4I9QA 2Z0AA 2LW7A 1XBLA 1Q3EA 2N74A 4J11A 5KHKA 2C2AA 2F4VO 2AZ2A 4LF8O 3AG1C 1N32O 3L74H 4GYCB 3STZC 5GONB 4B3MB 3AG4C 4NXNO 4PA9A 1MZEA 3FX7A 4MT8A 4DV2O 1H2SB 2NLJC 2QWQB 3LDEA 3EVKA 2QWOB 1Q6UA 4O2AA 1PNKA 3JD3A 3UT5A 5B5EZ 2ZE6A 4RAIA 2KB1A 1JPXA 3R66A 3ZRXA 1P4RA 1M4UA 4TQFA 4X64O 4LFAO 3E86A 1YF2A 4O4IA 4UXNA 4UVBA 1RM1B 1BL8A 4JI3O 4PA7A 5B1OA 1YI2V 5LMNO 3RYCB 1VF7A 2W6IG 3OEHG 2X7RB 4DUZB 1QR9A 4DR3O 3JD0A 4HBNA 3KZIZ 4YY3O 1HNXB 1KP2A 4X8AA 2QDOA 1Q82W 5FL7G 3OTFA 1RM1C 1XL4A 2R72A 1ZL8B 2EULA 3CRAA 1U97A 2DE0X 2PF4E 5BR8O 1NQTA 5CB4A 5LBQA 1P84F 1H2KA 4DR1O 5KA5A 1M90W 4YIOA 1MZFA 5LOVB 4O4HB 3RBZA 3ZMUA 4LNUA 4CC6A 3HKEB 5E79Z 1JJ2U 5B1NA 3CMEV 2IU0A 1SA0B 5KUKA 4GKKB 4FJCC 4B3MO 5IT9N 4N21A 3B09A 5JVDA 2DQ3A 2QA4V 1XREA 3QG5A 2UXDB 1K5QA 1GMGA 2CH7B 1E79G 1NTZH 3B77A 5JH7B 1SETA 5J9PC 1AJPA 3I56V 2UUCB 2ADPA 1S3JA 4DV4B 5B1AB 3CRQA 1ZL8A 1NBMG 4BAYA 2HEPA 3U0ZA 3VQWA 1L0LH 2X6CA 3BEHA 5LP6A 4JI1B 2Y0IA 2L6LA 1XOUA 1X59A 5CBGA 1IZ3A 1HR0B 3TK1A 3I5DA 3E8FA 3SYCA 3B40A 2CTPA 5CA1B 4QJFB 2YUAA 3K06A 1BQZA 1R6KA 3HKEA 3DC5A 1WB7A 3AK2A 5JJJB 5B1AC 1VQ8V 3IC7A 4ZIBA 1NR7A 3CC4V 3FB6C 4DUZO 5LYJB 1XNRO 1RP3B 3RT3C 2JEXA 3BPZA 1YJ9V 3J80N 1U96A 1XEQA 3DSQA 3OTOO 1H2NA 2WLMA 2CDYA 4JASA 3LSSA 4O2BA 3CCSV 1KUQA 3W7UA 5HFLA 2XTAA 1JA8A 3E8GA 3G71V 1M9NA 1JVMA 3BCCH 5H2FZ 4Z1VA 3CCRV 4RQFA 2Q4PA 5JQGA 1GK9A 2JK5C 4GUNA 3ZHSA 1K7DA 4UV9A 3D3QA 1R1BA 5KA6A 3BFRA 3Q4HB 4CH3A 2BOCC 1B3QA 5C93A 4DR6B 3SYQA 2XAHA 4CH5A 1GN6A 2ZCEA 1ZX3A 3W7WA 3ASOC 3STLC 2ZNJA 3QF7A 5KLVH 4RUFA 1OHHG 3ZN1A 2UXDO 3RYIB 1RPOA 1SQVH 2UUCO 2BCCH 4W4KA 2DYSC 1Q8IA 4DV4O 5BMVB 4QE7A 2HHHB 3R65A 2W0FC 4DYLA 1FXHA 2QE7G 3ABLB 1VQ4V 4JI1O 1FYJA 1VEWA 4KFMA 5JCOC 1HR0O 3OT7A 4JZ2A 4WFHA 3ZS8C 4DV7B 3JASB 4X1IB 2Q7EA 4EFEA 4TV9B 4J9ZB 5EBLC 1FKAO 1SESA 2EJRA 4D6TH 1URFA 3CD6V 1GH6A 4ZHQA 4EFBA 4WBNA 5F2VO 2XT9A 1Q90D 1JR9A 1Y67A 3EXAA 3ZHRA 2EZPA 3ABLC 4X1YB 4OXSA 4LF6O 1NZ6A 1AI6A 3CPWU 4UCTA 5DN6G 3H1HH 2KQXA 1IDSA 1YJWV 2E76B 1EM1A 1VP7A 3SPHA 3BRCA 2EBOA 3ETDA 5AG2A 1PNLA 2M7WA 4H0LB 1FFTB 4JAVA 3HKCB 2H94A 3OR7C 1KP3A 4J7JA 3ETGA 5IJ0B 4AQYB 2WLLB 1ZWIC 4ZI7B 4NYKA 1WA8A 1BHAA 3BHPA 1VQ7V 2QKAA 2ZR3A 3JASA 1AJNA 1JMKC 4TV9A 1M93A 2OCCC 4DR7O 4DV5B 1PPJH 2P90A 2JIZG 3LDCA 4CH4A 1O9HA 2AW9A 2R9RB 4HNAB 4XDKA 2FTKA 2WPDG 3F5TA 5FNVB 1SKVA 3ZIAG 2V7QG 3KKYA 4DR6O 4B3TB 2P67A 4JPRA 2CAZC 2E3CA 2OT5A 3H9VA 4I9WA 2DW4A 1Q6HA 4CS2A 3APOA 4GX2A 3SYAA 4CBCA 4RQEA 4LF9B 1Y74A 4X65B 2HHHO 4PDLA 1YXBA 3IGAC 4MTXA 1I5YA 1P49A 4X66O 2UUAB 4FZ1A 3N27A 5EK0A 3OE7G 4DV7O 4MVUA 3T4ZA 3UQ8A 5IJ9A 1Z2GA 2DYRC 1V9PA 3OMNB 5B1BC 2ZM6B 4WCEV 1MOFA 4YXWG 1HNZB 3BA8A 1H2MA 1MABG 3K9AA 3T1YB 4GKJB 1Y76B 3CRRA 1Q43A 4HZ3A 3JARA 2EIKB 4GX0A 4NVPA 2QKSA 1CEZA 4LWSB 3RVZA 1MMMA 2Q67A 5EC2C 3LSQA 4E2LA 4F6RA 2LFSA 5ITZB 2JEUA 1R6NA 1VF5B 3ASNB 2HG5C 1XMQB 4AQYO 1FXKA 4U7NA 4YJ3B 2A0LA 2GV9A 3ZMZA 1ZTEA 1XMOB 2VWKA 4EB6B 3E83A 2QTSA 5GTIZ 1W59A 2AHYA 4DV5O 3TXSA 4GT1A 4EEQA 2WLKA 3ASNC 2BSKA 3B8NA 4IHJB 2JS3A 3ZX6A 1SRYA 4TQDA 5IDJA 1Y76A 4B3TO 2PYJA 1S5JA 3WFVA 2DWEC 3L71H 1FS0G 5LMUB 2EJ7A 1YHQV 3D36C 4P9PA 4JTCB 2ZIOA 4TV8A 5KHIA 5IYCO 3HB3B 4PA6A 4LF9O 4KP4A 3UO2A 4F4LA 4JYCA 4X65O 3K0GA 4UVAA 1FJGB 4RUEA 3K3WA 5EIBD 2UUAO 3JALB 5KHGA 3CCEV 2OIEA 2HFEC 2VQEO 2ZM6O 3SJAC 4O4JB 5L3DA 2B1IA 1HNZO 5BY1A 5DECA 4IIJA 1Q86W 5TISZ 2DJVA 2JJ1G 1W0KG 4GKJO 1VQ6V 2DWDC 2K1EA 1ZUQA 4JYAB 2XOKG 1QVGU 4LF5O 1VQ5V 5CN0A 3O65A 1TUBA 3OMIB 5LGNA 2Q73A 3GWOA 3ZHTA 4MVOA 1I0HA 1SQGA 3F7YC 2Q9LA 2ILMA 3OD4A 2OTLV 3A0BZ 3OGIB 2YEVB 3AK1A 1YCIA 4XDJA 1N0JA 4ZKIA 1VF6C 4FVMA 1KB9F 3B4SA 1OCCC 3ICXA 4FK5C 3JALA 1YEWA 3UM7A 1IX9A 4BIOA 5K1PA 1GN2A 1PL0A 5B3SB 1NJIW 4IYIA 4NB5A 5EIBC 3E22A 1VQPV 4X62B 1Y6XA 5LGUA 1QVFU 5KAIZ 1UPGA 4JTAB 1FFXB 2PI5A 1W2BU 3AG1B 3L9DA 3ABMB 4PD4F 1S76D 5K1XA 3AG4B 5LMUO 1BZKA 4XDLA 5B3SC 4UCOA 2YEVA 4NTYA 2ZR2A 2Q8VA 2OWOA 5E1AC 4BW5A 1SQBH 1YITV 1JX9A 4LFCB 1FJGO 3ABMC 3K03A 3OW2U 3OEEG 3JAMN 4GZRB 3CP1A 4JV5B 1D5AA 3JD2A 4U7OA 2OYQA 3CJHB 3ZRWB 2D3OW 2LO1A 4ZBMA 3ETQA 2X6AA 3E35A 1FFXA 4PDVA 4JYAO 1FD9A 1H8HG 1BQ0A 1IBLB 4FFBB 2D2CB 4NR1A 4X1KB 1AP5A 2LW1A 3AK3A 2A7WA 3ML0A 1LNQA 4GX1A 4MVZA 1L8DA 2XAQA 2ITCC 2X0LA 4I50B 2WLIB 3M7MX 2HR3A 2B5UA 1HWYA 1NR1A 5IYZB 1NTKH 3CCMV 5GONA 3OGCC 4PJ0Z 1GN4A 4JI8B 1WNSA 1QHTA 1DLBA 4X62O 3ZRWA 4GX5A 3VQVA 3LSUA 1WPBA 2AZ0A 4QIWF 4LFBO 4Z2WA 1NTMH 2VQFO 3U11A 1N34B 2H8PC 4FFBA 1Y4MA 2Y48A 1SQXH 3IC9A 1I08A 3ZHUA 5LHIA 3W7TA 2Q7HA 3ZMVA 2EINC 3SR2C 4WFFA 4I50A 3OFNG 4LFCO 3ABTA 3RYCA 3RYHB 5B66Z 3BAAA 3L73H 2WLNA 3CXCU 2YDEA 1US6A 4IL6Z 4JV5O 3S3XA 4TUYB 4JI6B 3VQXA 3M99B 1KKCA 2QWNB 2P4KA 3G80A 5EC1C 3CCVV 3CEIA 1IBLO 2IJJA 1AR4A 3CYOA 1VQLV 2JGDB 3MHSC 4FM2A 5LOVA 4N23A 4KXRA 4O4HA 3RVYA 5D5QA 4FM0A 4MVQA 1SQFA 2IM9A 5EZYB 4WFAV 2F66C 1A32A 3CCLV 2EIMB 1NKDA 3U10A 4X20B 3CC2V 4J10A 1SA0A 4PI2A 2Q69A 5IWAB 4Q6GA 2PZSA 4UFZA 4B3RB 2E75B 4J80A 3WB1A 1HNXO 4JI8O 1YSCA 4I55B 2FB5A 2UXBB 1WP8A 2CH7A 1P7GA 1CP9A 3LUTB 5JH7A 2JGUA 1YTFD 2YI9A 2E5LB 4I0XB 2EIMC 2PTMA 3JAKB 3SJCC 1E1RG 3DGEA 3ZJZA 3HPLC 4OPAA 1ROPA 3QO5A 3ABKB 1N34O 3ASOB 1SQPH 3FYIB 2KSDA 3IFXA 1G6UA 1XUQA 2GUZB 2JGDA 1K5SA 2Q6AA 3B8MA 5CA1A 1VMGA 5EZYA 1QNMA 2BOBC 4KHPB 3TETA 2DYSB 4D7SA 4WF9V 2BTOA 4H33A 1K8AW 4GKKO 4TOIA 1GRJA 2IU3A 5IE9A 2VS0A 3ABKC 4JI5B 1YTFB 1AILA 2JS5A 5LYJA 5L3GA 4JI2B 1H2GA 5CA0B 3ETEA 3RN4A 2PI4A 1THZA 2A06H 3P30A 2NR5A 2B9ZA 1M57B 4UCRA 3TGUH 1B04A 4DV3B 1OCZB 1M1KW 1S5HC 1K73W 1PD3A 3FB5C 2IW5A 4KL1A 1IBMB 4G27B 2R9AA 4O4LB 1KBHA 4OX9B 1CXZB 4R8CA 5KX5B 5J2TB 2XUMA 3J81N 1B06A 3M8AA 4DK1A 1FAFA 1IVSA 2GUZA 4FZ0A 2QKCA 2QGNA 1TAEA 1M57C 3RYFB 4GLXA 5H6RA 2DQ0A 1OCZC 3Q4HA 5A9GA 3SGIA 4UUJC 4JI4B 5KAFZ 3AEIA 3ABUA 2RN9A 1L0NH 3LDDA 5CA0A 5JCOA 4B3RO 2FMLA 3SPGA 2UXBO 2GTSA 2OCCB 3E8HA 3SJBC 4MW8A 3RYIA 1QU7A 4MW3A 1JFFB 3H1JH 3EFFK 4ZOLB 1BHBA 4W4LA 2BTQB 3LNMB 1VQMV 3JSLA 3UKMA 5BMVA 4R6ZA 3H1LH 1XI1A 3P3NA 2PUSA 5H9CA 3ZMSA 1XHZA 3AG7A 5LA6B 2YICA 3P3PA 5KX5A 5J2TA 2ZIMA 2RCVA 3D3IA 2ZNIA 2WLJA 4X1IA 3FFQA 4E4EA 3QTCA 5J2UB 1Q81W 4LC1A 5GTHZ 3APQA 4KHPO 3SDLA 2XASA 3A0RA 5JWPA 1GM8A 3MD0A 1M5IA 2FKXA 4X1YA 1XQ8A 3T1HB 4JI2O 3JATB 4YJ2B 3JAWB 1VIBA 2UXNA 3ZRVA 1VQKV 2YXLA 5D5PA 2ZQMA 2HP8A 3GVMA 2DYRB 5B1BB 4AHCA 3SJQC 2RQ6A 2Z3YA 1JOYA 4BW9A 1JJOA 2DN9A 1Q7YW 2CTQA 2OCHA 3TJTA 4G28B 2UU9B 1DF5A 4MVMA 3HKCA 1BS3A 3G67A 2Q68A 1UFIA 4AILC 1IBMO 2ZDIC 5IJ0A 2WLLA 4ZI7A 1Y66A 4I4TB 4X89A 3L70H 2OIGA 1AI5A 3AG3B 4NTWA 1GM7A 5J2UA 3HKDB 3MDSA 3IJ4A 2P4VA 4JF3A 4MTGA 3JSNA 3IAYA 2QM7A 3S3WA 4HNAA 5FNVA 4JI4O 1EZJA 1OJHA 2YIAA 2ZDIA 3JATA 4FLVA 2P5OA 1IURA 4DR2B 1N8RW 1G4YB 3TCUA 4PI0A 3AG3C 4UB8Z 2H3OA 4B7EA 2JDIG 5IY5C 2X6BA 3FAVB 1S72V 2P7TC 4LCUC 3ZRSA 1NS1A 2Y69B 4GCZA 2IJHA 1AJQA 4I4TA 5C8YB 2G38A 4Q20A 4L87A 4WFEA 3PN1A 2M6YA 1GM9A 1R3JC 3K5MA 3T2MA 3X2QB 2MK3A 2PGGA 2Y69C 3QNEA 2ZINA 1NI8A 2KKWA 3K0DA 1WN7A 1K3EA 4JAAA 1MSDA 3JYCA 2RJZA 1PP9H 1NVPD 4LP8A 1I94B 4K0KB 1M56C 4LWSA 4PHZA 1R3LC 3X2QC 2HLDG 4DV1B 3FAVA 2YSUB 4DRXB 4EKWA 1S77D 1DK1A 4K3AA 3K58A 5ITZA 1EN6A 2UU9O 3CC7V 3THOA 4MS2A 1J5EB 2Q0OC 2YS8A 3L75H 4TT3G 4JYYA 1RFYA 1LUWA 4YJ3A 3HKBB 4U3JB 2ZD9A 3D36A 5FPRA 2LGWA 4EB6A 5A2QN 2QWPB 2F4VB 4DV6B 1Z5WA 2GBOA 4LF8B 1NVPB 1VARA 3T1YO 4IHJA 4JZGA 4TWKA 2AGAA 4F6EA 1OCCB 4DW1A 2UXCB 1LUVA 1J95A 4R50A 5LGTA 3W7SA 2JJ2G 1AI7A 5FPOA 3PJSK 1IBKB 3FD9A 3E2EA 4DRXA 1FXVA 1XHXA 2WA3A 1XMQO 3A8TA 1RPRA 3CS5A 3OMAB 2YI8A 1F51A 2R70A 4L8JA 3K5NA 2HJFC 1GO3F 1XMOO 2UUBB 4U3JA 3H1IH 1HNWB 4O4JA 4NXMB 2WAMA 3WG7B 4WFGA 1AB3A 2ADQB 2WWWA 3RWRD 1VF6A 2YXHA 3H01A 1ORQC 2P06A 1KC8W 2QR4A 2HVJC 5IYDO 1DF4A 5IYBO 1DGSA 1MG1A 4K0KO 2IJKA 1MSWD 1NH2D 4O2AB 2W0XA 2EILB 4UVCA 3WG7C 4DV1O 2ARHA 3CSXA 2NN4A 1Q5OA 5KMGB 2V4DA 1QLNA 2ZE5A 1HW7A 5BR8B 1J5EO 5LHHA 2HKOA 2LP7A 3CMAV 5JJEB 4DR1B 4FPPA 1MNGA 1PM9A 2YIDA 1EBOA 2Q7GA 3K08A 4O4IB 1N36B 4UCSA 1K4DC 2YXYA 4DV6O 2EILC 5L3CA 4CH6A 4H13B 2NNUA 4UB6Z 1YVWA 2AXTZ 1NH2B 2EX3A 5DM6V 2UXCO 3MAQA 1ZAUA 4BIZA 4LF4B 4LH7A 4HAMA 1QR8A 1Z5VA 4DV0B 3SYOA 4UV8A 3CCJV 1MA1A 1QQCA 2A3QA 1IBKO 1JCHA 1SERA 5KHJA 1BGYH 2BE3A 5KMGA 5CB4B 4CZZA 2ODMA 2A79B 4FLYA 1WPXA 5CBHA 3BA9A 3CRCA 3H1KH 1XNQB 2UUBO 4LNUB 1HNWO 1F4MA 2QM4A 2RNBA 2IJIA 4DR5B 2DMXA 4NXMO 4LBEC 3CJHA 5GW7A 1ZLZA 2VWJA 2EINB 1KD1W 2GTAA 1XNRB 1EFRG 5JVDB 3SPIA 1KQSU 5LXTB 4G2KA 1BE3H 3OM3B 4X1KA 3OTOB 3KCYA 1E1QG 1WB8A 4HYOA 3KCXA 2CUGA 4PELA 4QPKA 1YJNV 1SZXA 4MTOA 2WLIA 4UCUA 5LP6B 5IYZA 5BZBA 1HDJA 2ZKOA 3SPCA 4D7TA 1AI4A 4PDMA 1N36O 3K5LA 1IXBA 4FLWA 2B1GA 4H37A 2ZE7A 4J7KA 1BMFG 5LP6C 2V1DA 3G4SV 3ZN0A 3UCSC 3JCUZ 4MVRA 4B3SB 5LXTA 1NT2B 5L3FA 4LF4O 3ZMTA 4U3FH 1WP7A 3VBBA 4DV0O 4O2BB 3CHXA 1WAZA 4B7KA 2FL4A 4RO2A 1WLEA 3F7VC 2WSSG 2EIJB 4JTDB 4P2ZA 3RFRA 4JGSA 1GKFA 3RYHA 4FM1A 4BIUA 2IH3C 4DXWA 5JQGB 1XNQO 4IYHA 5DEDA 3ZHQA 3NR7A 4TUYA 2CGOA 3CXHF 2HJDA 4K35A 1PL4A 2P6JA 2QJ1A 1QBZA 1JQ0A 4DR5O 1DTOA 2QTOA 1R73A 2R9IA 1TA8A 3NXSA 2EIJC 3K59A 3EHBB 1QLEB 1BT8A 5H6QA 1I7FA 4LF6B 2KG7B 1ZSPA 4PV1B 5L3EA 2P22C 1F23A 4K8ZA 1G1XB 3G6EV 2XAFA 3WB2A 1SC5B 4FLZA 2CTRA 2MW2B 1QLEC 1GTOA 3BVOA 4OPHA 4X20A 3JD1A 2ETNA 4LR3A 4FIPC 1CPYA 3DXRB 1YZBA 5LHGA 4DR7B 4X88A 2IBZH 4JI6O 1KU9A 2F1MA 4I55A 1YIJV 4ZHQB 5EYPB 4WBNB 2XNDG 4I5SA 3C90A 3A0HZ 2N05A 3E89A 4QPJA 4I0XA 4UCVA 2Z5UA 3JAKA 2CE4A 1KKDA 1SZTA 1ENVA 3ZBHA 2DOSA 4DUYB 2KG7A 3OAAG 4B3SO 3CWBH 3CRMA 1R3IC 2JRIA 1IXMA 5KUMA 3ZEDA 3ZHVA 2N04A 2XAJA 3J7AU 3FKSG 2LGQA 3HR0A 4LH6A 2AHZA 3KG2A 4IGGA 1OV9A 1SQQH 4MTFA 4YHHB 4IT5A 4XBFA 4ICGA 1WA8B 4X66B 2QM8A 4CS3A 1K9MW 1F4NA 5IWAO 2LFRA 1B6QA 2PY5A 3DXRA 2XHBA 5EYPA 3SPJA 3TXQA 1UJWB 1HP8A 1N0NA 3OUFA 1BSMA 1XDCA 2E5LO 2O57A 3GB7C 3RGBA 3UO3A 4QNHB 4J9YB 4K8XA 1WJZA 5HFMA 2IH1C 4O4LA 1AP6A 1AROP 1OCOB 1COWG 1TUEB 3FYEB 3T4DA 4P9OA 3BY6A 1H38A 1EN5A 1Y74B 4C7UA 1VQNV 4WFBV 2WLHA 4JAUA 3RYFA 1L1FA 3A2FA 4QE9A 1K34A 2L35A 1EN4A 3F5WC 4P30A 1OCOC 4JI5O 3CX5F 5IJ9B 2ITDC 3L72H 2ZT9B 3P32A 4YIPA 4NTXA 4FLXA 4PA3A 4FFKA 1N33B 2QEXV 2XAGA 4ABMA 3VQYA 3CCUV 1JFFA 4ZOLA 2BTQA 3O9OA 4DV3O 1YDXA 1V55B 1XILA 4QGPA 4FMTA 1K92A 1H2LA 3T1CA 2F43G 3CB2A 2RMKB 4DUYO 4DW0A 4OX9O 3I55V 5LA6A 3JARB 4KUMA 2F23A 1X4TA 2OTJV 5CA3A 1QCEA 1KMIZ 1PKXA 5H5NA 1D5NA 4F6RB 2Y4UA 5IY5B 4DK0A 3GWKC 4YHHO 1FXKB 1V55C 1H8EG 4DR4B 4JI7B 2QWRB 3FB8C 3N2KB 3WB0A 2UXXA 1W0JG 1K4CC 4YJ2A 2VQEB 3K57A 3JAWA 3K04A 1XL6A 5LL6Y 4J41A 3MHHC 3CE2A 1KECA 4I7ZB 2ATKC 3C3TA 3OUSA 5L3BA 3D8CA 2BSKB 3OR6C 5EBMC 1F7YA 1FXKC 4BR6A 2EZOA 2ZXWB 1NU1H 4LF5B 1S0VA 2WA4A 4H44B 4FLUA 3N2GB 4CC5A 1T5EA 4TV8B 4DO2A 1BCCH 5JJNB 4MSWC 2CGNA 1Q6IA 2HVKC 4RWUA 1M56B 3HKDA 2GHYA 1V54B 2ZXWC 1SS3A 3N2KA 1PV0A 3QO8A 4JI0B 1O9GA 2EIKC 1TVKB 3T1HO 2QSAA 5FLXN 3K79A 1N33O 4IIJB 2YIBD 1S5LZ 2E74B 4CS4A 5CMUA 2FYUH 1GAXA 1V54C 4J42A 4LF7B 2GDSA 3W7XA 1TUBB 3VOUA 1VQ9V 3N2GA 1G8MA 2F93B 5C8YA 1RSOB 2Y0PA 1R6TA 4NKGB 1OCRB 1N32B 3AG2B 4DR4O 4JI7O 2RDCA 2F95B 4NXNB 2LJ2A 2ZE8A 4R7CA 1KYOF 1OZ0A 2GSMB 1TVKA 4PDRA 4Z1MG 1N4CA 1P7BA 4DV2B 4DR2O 3E22B 1I5XA 2K9PA 1R3KC 3K5OA 2W6JG
chains in the Genus database with same CATH topology
2NN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN4 A; 
#chains in the Genus database with same CATH topology
 3CCQ V;  4FLT A;  5KHH A;  5EBW C;  1AR5 A;  1VQO V;  1OCR C;  3BAB A;  2CTW A;  1K33 A;  3AG2 C;  3G6B A;  3JCZ A;  3C3S A;  1PNM A;  2A9H A;  3QVN A;  2Q5Z A;  3SYP A;  4J7Z A;  1SF9 A;  3RW0 A;  3HKB A;  1RSO A;  3LNN A;  4X64 B;  4LFA B;  3DC6 A;  5BXZ A;  1FPO A;  3WU2 Z;  1GN3 A;  1AVM A;  3E8B A;  4JI3 B;  2Y4T A;  2VRZ A;  5LMN B;  4X9Q A;  4BWA A;  4AI8 A;  3JD4 A;  2YC0 A;  2YIB A;  3K9S A;  4DR3 B;  2Q0A A;  4JI0 O;  4B08 A;  4OGQ B;  4A5U B;  4YY3 B;  1EZV H;  3ZCC A;  1AR1 B;  2JVD A;  1I94 O;  1K97 A;  5CBF A;  1LR1 A;  4TSF G;  3DTU B;  3B2E E;  3UT5 B;  2LQT A;  4PA4 A;  2PYL A;  4MVS A;  4LFB B;  4LF7 O;  1D2D A;  4JYB A;  3FB7 C;  2CK3 G;  1TGO A;  2VQF B;  3QO7 A;  4ASU G;  4I9Q A;  2Z0A A;  2LW7 A;  1XBL A;  1Q3E A;  2N74 A;  4J11 A;  5KHK A;  2C2A A;  2F4V O;  2AZ2 A;  4LF8 O;  3AG1 C;  1N32 O;  3L74 H;  4GYC B;  3STZ C;  5GON B;  4B3M B;  3AG4 C;  4NXN O;  4PA9 A;  1MZE A;  3FX7 A;  4MT8 A;  4DV2 O;  1H2S B;  2NLJ C;  2QWQ B;  3LDE A;  3EVK A;  2QWO B;  1Q6U A;  4O2A A;  1PNK A;  3JD3 A;  3UT5 A;  5B5E Z;  2ZE6 A;  4RAI A;  2KB1 A;  1JPX A;  3R66 A;  3ZRX A;  1P4R A;  1M4U A;  4TQF A;  4X64 O;  4LFA O;  3E86 A;  1YF2 A;  4O4I A;  4UXN A;  4UVB A;  1RM1 B;  1BL8 A;  4JI3 O;  4PA7 A;  5B1O A;  1YI2 V;  5LMN O;  3RYC B;  1VF7 A;  2W6I G;  3OEH G;  2X7R B;  4DUZ B;  1QR9 A;  4DR3 O;  3JD0 A;  4HBN A;  3KZI Z;  4YY3 O;  1HNX B;  1KP2 A;  4X8A A;  2QDO A;  1Q82 W;  5FL7 G;  3OTF A;  1RM1 C;  1XL4 A;  2R72 A;  1ZL8 B;  2EUL A;  3CRA A;  1U97 A;  2DE0 X;  2PF4 E;  5BR8 O;  1NQT A;  5CB4 A;  5LBQ A;  1P84 F;  1H2K A;  4DR1 O;  5KA5 A;  1M90 W;  4YIO A;  1MZF A;  5LOV B;  4O4H B;  3RBZ A;  3ZMU A;  4LNU A;  4CC6 A;  3HKE B;  5E79 Z;  1JJ2 U;  5B1N A;  3CME V;  2IU0 A;  1SA0 B;  5KUK A;  4GKK B;  4FJC C;  4B3M O;  5IT9 N;  4N21 A;  3B09 A;  5JVD A;  2DQ3 A;  2QA4 V;  1XRE A;  3QG5 A;  2UXD B;  1K5Q A;  1GMG A;  2CH7 B;  1E79 G;  1NTZ H;  3B77 A;  5JH7 B;  1SET A;  5J9P C;  1AJP A;  3I56 V;  2UUC B;  2ADP A;  1S3J A;  4DV4 B;  5B1A B;  3CRQ A;  1ZL8 A;  1NBM G;  4BAY A;  2HEP A;  3U0Z A;  3VQW A;  1L0L H;  2X6C A;  3BEH A;  5LP6 A;  4JI1 B;  2Y0I A;  2L6L A;  1XOU A;  1X59 A;  5CBG A;  1IZ3 A;  1HR0 B;  3TK1 A;  3I5D A;  3E8F A;  3SYC A;  3B40 A;  2CTP A;  5CA1 B;  4QJF B;  2YUA A;  3K06 A;  1BQZ A;  1R6K A;  3HKE A;  3DC5 A;  1WB7 A;  3AK2 A;  5JJJ B;  5B1A C;  1VQ8 V;  3IC7 A;  4ZIB A;  1NR7 A;  3CC4 V;  3FB6 C;  4DUZ O;  5LYJ B;  1XNR O;  1RP3 B;  3RT3 C;  2JEX A;  3BPZ A;  1YJ9 V;  3J80 N;  1U96 A;  1XEQ A;  3DSQ A;  3OTO O;  1H2N A;  2WLM A;  2CDY A;  4JAS A;  3LSS A;  4O2B A;  3CCS V;  1KUQ A;  3W7U A;  5HFL A;  2XTA A;  1JA8 A;  3E8G A;  3G71 V;  1M9N A;  1JVM A;  3BCC H;  5H2F Z;  4Z1V A;  3CCR V;  4RQF A;  2Q4P A;  5JQG A;  1GK9 A;  2JK5 C;  4GUN A;  3ZHS A;  1K7D A;  4UV9 A;  3D3Q A;  1R1B A;  5KA6 A;  3BFR A;  3Q4H B;  4CH3 A;  2BOC C;  1B3Q A;  5C93 A;  4DR6 B;  3SYQ A;  2XAH A;  4CH5 A;  1GN6 A;  2ZCE A;  1ZX3 A;  3W7W A;  3ASO C;  3STL C;  2ZNJ A;  3QF7 A;  5KLV H;  4RUF A;  1OHH G;  3ZN1 A;  2UXD O;  3RYI B;  1RPO A;  1SQV H;  2UUC O;  2BCC H;  4W4K A;  2DYS C;  1Q8I A;  4DV4 O;  5BMV B;  4QE7 A;  2HHH B;  3R65 A;  2W0F C;  4DYL A;  1FXH A;  2QE7 G;  3ABL B;  1VQ4 V;  4JI1 O;  1FYJ A;  1VEW A;  4KFM A;  5JCO C;  1HR0 O;  3OT7 A;  4JZ2 A;  4WFH A;  3ZS8 C;  4DV7 B;  3JAS B;  4X1I B;  2Q7E A;  4EFE A;  4TV9 B;  4J9Z B;  5EBL C;  1FKA O;  1SES A;  2EJR A;  4D6T H;  1URF A;  3CD6 V;  1GH6 A;  4ZHQ A;  4EFB A;  4WBN A;  5F2V O;  2XT9 A;  1Q90 D;  1JR9 A;  1Y67 A;  3EXA A;  3ZHR A;  2EZP A;  3ABL C;  4X1Y B;  4OXS A;  4LF6 O;  1NZ6 A;  1AI6 A;  3CPW U;  4UCT A;  5DN6 G;  3H1H H;  2KQX A;  1IDS A;  1YJW V;  2E76 B;  1EM1 A;  1VP7 A;  3SPH A;  3BRC A;  2EBO A;  3ETD A;  5AG2 A;  1PNL A;  2M7W A;  4H0L B;  1FFT B;  4JAV A;  3HKC B;  2H94 A;  3OR7 C;  1KP3 A;  4J7J A;  3ETG A;  5IJ0 B;  4AQY B;  2WLL B;  1ZWI C;  4ZI7 B;  4NYK A;  1WA8 A;  1BHA A;  3BHP A;  1VQ7 V;  2QKA A;  2ZR3 A;  3JAS A;  1AJN A;  1JMK C;  4TV9 A;  1M93 A;  2OCC C;  4DR7 O;  4DV5 B;  1PPJ H;  2P90 A;  2JIZ G;  3LDC A;  4CH4 A;  1O9H A;  2AW9 A;  2R9R B;  4HNA B;  4XDK A;  2FTK A;  2WPD G;  3F5T A;  5FNV B;  1SKV A;  3ZIA G;  2V7Q G;  3KKY A;  4DR6 O;  4B3T B;  2P67 A;  4JPR A;  2CAZ C;  2E3C A;  2OT5 A;  3H9V A;  4I9W A;  2DW4 A;  1Q6H A;  4CS2 A;  3APO A;  4GX2 A;  3SYA A;  4CBC A;  4RQE A;  4LF9 B;  1Y74 A;  4X65 B;  2HHH O;  4PDL A;  1YXB A;  3IGA C;  4MTX A;  1I5Y A;  1P49 A;  4X66 O;  2UUA B;  4FZ1 A;  3N27 A;  5EK0 A;  3OE7 G;  4DV7 O;  4MVU A;  3T4Z A;  3UQ8 A;  5IJ9 A;  1Z2G A;  2DYR C;  1V9P A;  3OMN B;  5B1B C;  2ZM6 B;  4WCE V;  1MOF A;  4YXW G;  1HNZ B;  3BA8 A;  1H2M A;  1MAB G;  3K9A A;  3T1Y B;  4GKJ B;  1Y76 B;  3CRR A;  1Q43 A;  4HZ3 A;  3JAR A;  2EIK B;  4GX0 A;  4NVP A;  2QKS A;  1CEZ A;  4LWS B;  3RVZ A;  1MMM A;  2Q67 A;  5EC2 C;  3LSQ A;  4E2L A;  4F6R A;  2LFS A;  5ITZ B;  2JEU A;  1R6N A;  1VF5 B;  3ASN B;  2HG5 C;  1XMQ B;  4AQY O;  1FXK A;  4U7N A;  4YJ3 B;  2A0L A;  2GV9 A;  3ZMZ A;  1ZTE A;  1XMO B;  2VWK A;  4EB6 B;  3E83 A;  2QTS A;  5GTI Z;  1W59 A;  2AHY A;  4DV5 O;  3TXS A;  4GT1 A;  4EEQ A;  2WLK A;  3ASN C;  2BSK A;  3B8N A;  4IHJ B;  2JS3 A;  3ZX6 A;  1SRY A;  4TQD A;  5IDJ A;  1Y76 A;  4B3T O;  2PYJ A;  1S5J A;  3WFV A;  2DWE C;  3L71 H;  1FS0 G;  5LMU B;  2EJ7 A;  1YHQ V;  3D36 C;  4P9P A;  4JTC B;  2ZIO A;  4TV8 A;  5KHI A;  5IYC O;  3HB3 B;  4PA6 A;  4LF9 O;  4KP4 A;  3UO2 A;  4F4L A;  4JYC A;  4X65 O;  3K0G A;  4UVA A;  1FJG B;  4RUE A;  3K3W A;  5EIB D;  2UUA O;  3JAL B;  5KHG A;  3CCE V;  2OIE A;  2HFE C;  2VQE O;  2ZM6 O;  3SJA C;  4O4J B;  5L3D A;  2B1I A;  1HNZ O;  5BY1 A;  5DEC A;  4IIJ A;  1Q86 W;  5TIS Z;  2DJV A;  2JJ1 G;  1W0K G;  4GKJ O;  1VQ6 V;  2DWD C;  2K1E A;  1ZUQ A;  4JYA B;  2XOK G;  1QVG U;  4LF5 O;  1VQ5 V;  5CN0 A;  3O65 A;  1TUB A;  3OMI B;  5LGN A;  2Q73 A;  3GWO A;  3ZHT A;  4MVO A;  1I0H A;  1SQG A;  3F7Y C;  2Q9L A;  2ILM A;  3OD4 A;  2OTL V;  3A0B Z;  3OGI B;  2YEV B;  3AK1 A;  1YCI A;  4XDJ A;  1N0J A;  4ZKI A;  1VF6 C;  4FVM A;  1KB9 F;  3B4S A;  1OCC C;  3ICX A;  4FK5 C;  3JAL A;  1YEW A;  3UM7 A;  1IX9 A;  4BIO A;  5K1P A;  1GN2 A;  1PL0 A;  5B3S B;  1NJI W;  4IYI A;  4NB5 A;  5EIB C;  3E22 A;  1VQP V;  4X62 B;  1Y6X A;  5LGU A;  1QVF U;  5KAI Z;  1UPG A;  4JTA B;  1FFX B;  2PI5 A;  1W2B U;  3AG1 B;  3L9D A;  3ABM B;  4PD4 F;  1S76 D;  5K1X A;  3AG4 B;  5LMU O;  1BZK A;  4XDL A;  5B3S C;  4UCO A;  2YEV A;  4NTY A;  2ZR2 A;  2Q8V A;  2OWO A;  5E1A C;  4BW5 A;  1SQB H;  1YIT V;  1JX9 A;  4LFC B;  1FJG O;  3ABM C;  3K03 A;  3OW2 U;  3OEE G;  3JAM N;  4GZR B;  3CP1 A;  4JV5 B;  1D5A A;  3JD2 A;  4U7O A;  2OYQ A;  3CJH B;  3ZRW B;  2D3O W;  2LO1 A;  4ZBM A;  3ETQ A;  2X6A A;  3E35 A;  1FFX A;  4PDV A;  4JYA O;  1FD9 A;  1H8H G;  1BQ0 A;  1IBL B;  4FFB B;  2D2C B;  4NR1 A;  4X1K B;  1AP5 A;  2LW1 A;  3AK3 A;  2A7W A;  3ML0 A;  1LNQ A;  4GX1 A;  4MVZ A;  1L8D A;  2XAQ A;  2ITC C;  2X0L A;  4I50 B;  2WLI B;  3M7M X;  2HR3 A;  2B5U A;  1HWY A;  1NR1 A;  5IYZ B;  1NTK H;  3CCM V;  5GON A;  3OGC C;  4PJ0 Z;  1GN4 A;  4JI8 B;  1WNS A;  1QHT A;  1DLB A;  4X62 O;  3ZRW A;  4GX5 A;  3VQV A;  3LSU A;  1WPB A;  2AZ0 A;  4QIW F;  4LFB O;  4Z2W A;  1NTM H;  2VQF O;  3U11 A;  1N34 B;  2H8P C;  4FFB A;  1Y4M A;  2Y48 A;  1SQX H;  3IC9 A;  1I08 A;  3ZHU A;  5LHI A;  3W7T A;  2Q7H A;  3ZMV A;  2EIN C;  3SR2 C;  4WFF A;  4I50 A;  3OFN G;  4LFC O;  3ABT A;  3RYC A;  3RYH B;  5B66 Z;  3BAA A;  3L73 H;  2WLN A;  3CXC U;  2YDE A;  1US6 A;  4IL6 Z;  4JV5 O;  3S3X A;  4TUY B;  4JI6 B;  3VQX A;  3M99 B;  1KKC A;  2QWN B;  2P4K A;  3G80 A;  5EC1 C;  3CCV V;  3CEI A;  1IBL O;  2IJJ A;  1AR4 A;  3CYO A;  1VQL V;  2JGD B;  3MHS C;  4FM2 A;  5LOV A;  4N23 A;  4KXR A;  4O4H A;  3RVY A;  5D5Q A;  4FM0 A;  4MVQ A;  1SQF A;  2IM9 A;  5EZY B;  4WFA V;  2F66 C;  1A32 A;  3CCL V;  2EIM B;  1NKD A;  3U10 A;  4X20 B;  3CC2 V;  4J10 A;  1SA0 A;  4PI2 A;  2Q69 A;  5IWA B;  4Q6G A;  2PZS A;  4UFZ A;  4B3R B;  2E75 B;  4J80 A;  3WB1 A;  1HNX O;  4JI8 O;  1YSC A;  4I55 B;  2FB5 A;  2UXB B;  1WP8 A;  2CH7 A;  1P7G A;  1CP9 A;  3LUT B;  5JH7 A;  2JGU A;  1YTF D;  2YI9 A;  2E5L B;  4I0X B;  2EIM C;  2PTM A;  3JAK B;  3SJC C;  1E1R G;  3DGE A;  3ZJZ A;  3HPL C;  4OPA A;  1ROP A;  3QO5 A;  3ABK B;  1N34 O;  3ASO B;  1SQP H;  3FYI B;  2KSD A;  3IFX A;  1G6U A;  1XUQ A;  2GUZ B;  2JGD A;  1K5S A;  2Q6A A;  3B8M A;  5CA1 A;  1VMG A;  5EZY A;  1QNM A;  2BOB C;  4KHP B;  3TET A;  2DYS B;  4D7S A;  4WF9 V;  2BTO A;  4H33 A;  1K8A W;  4GKK O;  4TOI A;  1GRJ A;  2IU3 A;  5IE9 A;  2VS0 A;  3ABK C;  4JI5 B;  1YTF B;  1AIL A;  2JS5 A;  5LYJ A;  5L3G A;  4JI2 B;  1H2G A;  5CA0 B;  3ETE A;  3RN4 A;  2PI4 A;  1THZ A;  2A06 H;  3P30 A;  2NR5 A;  2B9Z A;  1M57 B;  4UCR A;  3TGU H;  1B04 A;  4DV3 B;  1OCZ B;  1M1K W;  1S5H C;  1K73 W;  1PD3 A;  3FB5 C;  2IW5 A;  4KL1 A;  1IBM B;  4G27 B;  2R9A A;  4O4L B;  1KBH A;  4OX9 B;  1CXZ B;  4R8C A;  5KX5 B;  5J2T B;  2XUM A;  3J81 N;  1B06 A;  3M8A A;  4DK1 A;  1FAF A;  1IVS A;  2GUZ A;  4FZ0 A;  2QKC A;  2QGN A;  1TAE A;  1M57 C;  3RYF B;  4GLX A;  5H6R A;  2DQ0 A;  1OCZ C;  3Q4H A;  5A9G A;  3SGI A;  4UUJ C;  4JI4 B;  5KAF Z;  3AEI A;  3ABU A;  2RN9 A;  1L0N H;  3LDD A;  5CA0 A;  5JCO A;  4B3R O;  2FML A;  3SPG A;  2UXB O;  2GTS A;  2OCC B;  3E8H A;  3SJB C;  4MW8 A;  3RYI A;  1QU7 A;  4MW3 A;  1JFF B;  3H1J H;  3EFF K;  4ZOL B;  1BHB A;  4W4L A;  2BTQ B;  3LNM B;  1VQM V;  3JSL A;  3UKM A;  5BMV A;  4R6Z A;  3H1L H;  1XI1 A;  3P3N A;  2PUS A;  5H9C A;  3ZMS A;  1XHZ A;  3AG7 A;  5LA6 B;  2YIC A;  3P3P A;  5KX5 A;  5J2T A;  2ZIM A;  2RCV A;  3D3I A;  2ZNI A;  2WLJ A;  4X1I A;  3FFQ A;  4E4E A;  3QTC A;  5J2U B;  1Q81 W;  4LC1 A;  5GTH Z;  3APQ A;  4KHP O;  3SDL A;  2XAS A;  3A0R A;  5JWP A;  1GM8 A;  3MD0 A;  1M5I A;  2FKX A;  4X1Y A;  1XQ8 A;  3T1H B;  4JI2 O;  3JAT B;  4YJ2 B;  3JAW B;  1VIB A;  2UXN A;  3ZRV A;  1VQK V;  2YXL A;  5D5P A;  2ZQM A;  2HP8 A;  3GVM A;  2DYR B;  5B1B B;  4AHC A;  3SJQ C;  2RQ6 A;  2Z3Y A;  1JOY A;  4BW9 A;  1JJO A;  2DN9 A;  1Q7Y W;  2CTQ A;  2OCH A;  3TJT A;  4G28 B;  2UU9 B;  1DF5 A;  4MVM A;  3HKC A;  1BS3 A;  3G67 A;  2Q68 A;  1UFI A;  4AIL C;  1IBM O;  2ZDI C;  5IJ0 A;  2WLL A;  4ZI7 A;  1Y66 A;  4I4T B;  4X89 A;  3L70 H;  2OIG A;  1AI5 A;  3AG3 B;  4NTW A;  1GM7 A;  5J2U A;  3HKD B;  3MDS A;  3IJ4 A;  2P4V A;  4JF3 A;  4MTG A;  3JSN A;  3IAY A;  2QM7 A;  3S3W A;  4HNA A;  5FNV A;  4JI4 O;  1EZJ A;  1OJH A;  2YIA A;  2ZDI A;  3JAT A;  4FLV A;  2P5O A;  1IUR A;  4DR2 B;  1N8R W;  1G4Y B;  3TCU A;  4PI0 A;  3AG3 C;  4UB8 Z;  2H3O A;  4B7E A;  2JDI G;  5IY5 C;  2X6B A;  3FAV B;  1S72 V;  2P7T C;  4LCU C;  3ZRS A;  1NS1 A;  2Y69 B;  4GCZ A;  2IJH A;  1AJQ A;  4I4T A;  5C8Y B;  2G38 A;  4Q20 A;  4L87 A;  4WFE A;  3PN1 A;  2M6Y A;  1GM9 A;  1R3J C;  3K5M A;  3T2M A;  3X2Q B;  2MK3 A;  2PGG A;  2Y69 C;  3QNE A;  2ZIN A;  1NI8 A;  2KKW A;  3K0D A;  1WN7 A;  1K3E A;  4JAA A;  1MSD A;  3JYC A;  2RJZ A;  1PP9 H;  1NVP D;  4LP8 A;  1I94 B;  4K0K B;  1M56 C;  4LWS A;  4PHZ A;  1R3L C;  3X2Q C;  2HLD G;  4DV1 B;  3FAV A;  2YSU B;  4DRX B;  4EKW A;  1S77 D;  1DK1 A;  4K3A A;  3K58 A;  5ITZ A;  1EN6 A;  2UU9 O;  3CC7 V;  3THO A;  4MS2 A;  1J5E B;  2Q0O C;  2YS8 A;  3L75 H;  4TT3 G;  4JYY A;  1RFY A;  1LUW A;  4YJ3 A;  3HKB B;  4U3J B;  2ZD9 A;  3D36 A;  5FPR A;  2LGW A;  4EB6 A;  5A2Q N;  2QWP B;  2F4V B;  4DV6 B;  1Z5W A;  2GBO A;  4LF8 B;  1NVP B;  1VAR A;  3T1Y O;  4IHJ A;  4JZG A;  4TWK A;  2AGA A;  4F6E A;  1OCC B;  4DW1 A;  2UXC B;  1LUV A;  1J95 A;  4R50 A;  5LGT A;  3W7S A;  2JJ2 G;  1AI7 A;  5FPO A;  3PJS K;  1IBK B;  3FD9 A;  3E2E A;  4DRX A;  1FXV A;  1XHX A;  2WA3 A;  1XMQ O;  3A8T A;  1RPR A;  3CS5 A;  3OMA B;  2YI8 A;  1F51 A;  2R70 A;  4L8J A;  3K5N A;  2HJF C;  1GO3 F;  1XMO O;  2UUB B;  4U3J A;  3H1I H;  1HNW B;  4O4J A;  4NXM B;  2WAM A;  3WG7 B;  4WFG A;  1AB3 A;  2ADQ B;  2WWW A;  3RWR D;  1VF6 A;  2YXH A;  3H01 A;  1ORQ C;  2P06 A;  1KC8 W;  2QR4 A;  2HVJ C;  5IYD O;  1DF4 A;  5IYB O;  1DGS A;  1MG1 A;  4K0K O;  2IJK A;  1MSW D;  1NH2 D;  4O2A B;  2W0X A;  2EIL B;  4UVC A;  3WG7 C;  4DV1 O;  2ARH A;  3CSX A;  2NN4 A;  1Q5O A;  5KMG B;  2V4D A;  1QLN A;  2ZE5 A;  1HW7 A;  5BR8 B;  1J5E O;  5LHH A;  2HKO A;  2LP7 A;  3CMA V;  5JJE B;  4DR1 B;  4FPP A;  1MNG A;  1PM9 A;  2YID A;  1EBO A;  2Q7G A;  3K08 A;  4O4I B;  1N36 B;  4UCS A;  1K4D C;  2YXY A;  4DV6 O;  2EIL C;  5L3C A;  4CH6 A;  4H13 B;  2NNU A;  4UB6 Z;  1YVW A;  2AXT Z;  1NH2 B;  2EX3 A;  5DM6 V;  2UXC O;  3MAQ A;  1ZAU A;  4BIZ A;  4LF4 B;  4LH7 A;  4HAM A;  1QR8 A;  1Z5V A;  4DV0 B;  3SYO A;  4UV8 A;  3CCJ V;  1MA1 A;  1QQC A;  2A3Q A;  1IBK O;  1JCH A;  1SER A;  5KHJ A;  1BGY H;  2BE3 A;  5KMG A;  5CB4 B;  4CZZ A;  2ODM A;  2A79 B;  4FLY A;  1WPX A;  5CBH A;  3BA9 A;  3CRC A;  3H1K H;  1XNQ B;  2UUB O;  4LNU B;  1HNW O;  1F4M A;  2QM4 A;  2RNB A;  2IJI A;  4DR5 B;  2DMX A;  4NXM O;  4LBE C;  3CJH A;  5GW7 A;  1ZLZ A;  2VWJ A;  2EIN B;  1KD1 W;  2GTA A;  1XNR B;  1EFR G;  5JVD B;  3SPI A;  1KQS U;  5LXT B;  4G2K A;  1BE3 H;  3OM3 B;  4X1K A;  3OTO B;  3KCY A;  1E1Q G;  1WB8 A;  4HYO A;  3KCX A;  2CUG A;  4PEL A;  4QPK A;  1YJN V;  1SZX A;  4MTO A;  2WLI A;  4UCU A;  5LP6 B;  5IYZ A;  5BZB A;  1HDJ A;  2ZKO A;  3SPC A;  4D7T A;  1AI4 A;  4PDM A;  1N36 O;  3K5L A;  1IXB A;  4FLW A;  2B1G A;  4H37 A;  2ZE7 A;  4J7K A;  1BMF G;  5LP6 C;  2V1D A;  3G4S V;  3ZN0 A;  3UCS C;  3JCU Z;  4MVR A;  4B3S B;  5LXT A;  1NT2 B;  5L3F A;  4LF4 O;  3ZMT A;  4U3F H;  1WP7 A;  3VBB A;  4DV0 O;  4O2B B;  3CHX A;  1WAZ A;  4B7K A;  2FL4 A;  4RO2 A;  1WLE A;  3F7V C;  2WSS G;  2EIJ B;  4JTD B;  4P2Z A;  3RFR A;  4JGS A;  1GKF A;  3RYH A;  4FM1 A;  4BIU A;  2IH3 C;  4DXW A;  5JQG B;  1XNQ O;  4IYH A;  5DED A;  3ZHQ A;  3NR7 A;  4TUY A;  2CGO A;  3CXH F;  2HJD A;  4K35 A;  1PL4 A;  2P6J A;  2QJ1 A;  1QBZ A;  1JQ0 A;  4DR5 O;  1DTO A;  2QTO A;  1R73 A;  2R9I A;  1TA8 A;  3NXS A;  2EIJ C;  3K59 A;  3EHB B;  1QLE B;  1BT8 A;  5H6Q A;  1I7F A;  4LF6 B;  2KG7 B;  1ZSP A;  4PV1 B;  5L3E A;  2P22 C;  1F23 A;  4K8Z A;  1G1X B;  3G6E V;  2XAF A;  3WB2 A;  1SC5 B;  4FLZ A;  2CTR A;  2MW2 B;  1QLE C;  1GTO A;  3BVO A;  4OPH A;  4X20 A;  3JD1 A;  2ETN A;  4LR3 A;  4FIP C;  1CPY A;  3DXR B;  1YZB A;  5LHG A;  4DR7 B;  4X88 A;  2IBZ H;  4JI6 O;  1KU9 A;  2F1M A;  4I55 A;  1YIJ V;  4ZHQ B;  5EYP B;  4WBN B;  2XND G;  4I5S A;  3C90 A;  3A0H Z;  2N05 A;  3E89 A;  4QPJ A;  4I0X A;  4UCV A;  2Z5U A;  3JAK A;  2CE4 A;  1KKD A;  1SZT A;  1ENV A;  3ZBH A;  2DOS A;  4DUY B;  2KG7 A;  3OAA G;  4B3S O;  3CWB H;  3CRM A;  1R3I C;  2JRI A;  1IXM A;  5KUM A;  3ZED A;  3ZHV A;  2N04 A;  2XAJ A;  3J7A U;  3FKS G;  2LGQ A;  3HR0 A;  4LH6 A;  2AHZ A;  3KG2 A;  4IGG A;  1OV9 A;  1SQQ H;  4MTF A;  4YHH B;  4IT5 A;  4XBF A;  4ICG A;  1WA8 B;  4X66 B;  2QM8 A;  4CS3 A;  1K9M W;  1F4N A;  5IWA O;  2LFR A;  1B6Q A;  2PY5 A;  3DXR A;  2XHB A;  5EYP A;  3SPJ A;  3TXQ A;  1UJW B;  1HP8 A;  1N0N A;  3OUF A;  1BSM A;  1XDC A;  2E5L O;  2O57 A;  3GB7 C;  3RGB A;  3UO3 A;  4QNH B;  4J9Y B;  4K8X A;  1WJZ A;  5HFM A;  2IH1 C;  4O4L A;  1AP6 A;  1ARO P;  1OCO B;  1COW G;  1TUE B;  3FYE B;  3T4D A;  4P9O A;  3BY6 A;  1H38 A;  1EN5 A;  1Y74 B;  4C7U A;  1VQN V;  4WFB V;  2WLH A;  4JAU A;  3RYF A;  1L1F A;  3A2F A;  4QE9 A;  1K34 A;  2L35 A;  1EN4 A;  3F5W C;  4P30 A;  1OCO C;  4JI5 O;  3CX5 F;  5IJ9 B;  2ITD C;  3L72 H;  2ZT9 B;  3P32 A;  4YIP A;  4NTX A;  4FLX A;  4PA3 A;  4FFK A;  1N33 B;  2QEX V;  2XAG A;  4ABM A;  3VQY A;  3CCU V;  1JFF A;  4ZOL A;  2BTQ A;  3O9O A;  4DV3 O;  1YDX A;  1V55 B;  1XIL A;  4QGP A;  4FMT A;  1K92 A;  1H2L A;  3T1C A;  2F43 G;  3CB2 A;  2RMK B;  4DUY O;  4DW0 A;  4OX9 O;  3I55 V;  5LA6 A;  3JAR B;  4KUM A;  2F23 A;  1X4T A;  2OTJ V;  5CA3 A;  1QCE A;  1KMI Z;  1PKX A;  5H5N A;  1D5N A;  4F6R B;  2Y4U A;  5IY5 B;  4DK0 A;  3GWK C;  4YHH O;  1FXK B;  1V55 C;  1H8E G;  4DR4 B;  4JI7 B;  2QWR B;  3FB8 C;  3N2K B;  3WB0 A;  2UXX A;  1W0J G;  1K4C C;  4YJ2 A;  2VQE B;  3K57 A;  3JAW A;  3K04 A;  1XL6 A;  5LL6 Y;  4J41 A;  3MHH C;  3CE2 A;  1KEC A;  4I7Z B;  2ATK C;  3C3T A;  3OUS A;  5L3B A;  3D8C A;  2BSK B;  3OR6 C;  5EBM C;  1F7Y A;  1FXK C;  4BR6 A;  2EZO A;  2ZXW B;  1NU1 H;  4LF5 B;  1S0V A;  2WA4 A;  4H44 B;  4FLU A;  3N2G B;  4CC5 A;  1T5E A;  4TV8 B;  4DO2 A;  1BCC H;  5JJN B;  4MSW C;  2CGN A;  1Q6I A;  2HVK C;  4RWU A;  1M56 B;  3HKD A;  2GHY A;  1V54 B;  2ZXW C;  1SS3 A;  3N2K A;  1PV0 A;  3QO8 A;  4JI0 B;  1O9G A;  2EIK C;  1TVK B;  3T1H O;  2QSA A;  5FLX N;  3K79 A;  1N33 O;  4IIJ B;  2YIB D;  1S5L Z;  2E74 B;  4CS4 A;  5CMU A;  2FYU H;  1GAX A;  1V54 C;  4J42 A;  4LF7 B;  2GDS A;  3W7X A;  1TUB B;  3VOU A;  1VQ9 V;  3N2G A;  1G8M A;  2F93 B;  5C8Y A;  1RSO B;  2Y0P A;  1R6T A;  4NKG B;  1OCR B;  1N32 B;  3AG2 B;  4DR4 O;  4JI7 O;  2RDC A;  2F95 B;  4NXN B;  2LJ2 A;  2ZE8 A;  4R7C A;  1KYO F;  1OZ0 A;  2GSM B;  1TVK A;  4PDR A;  4Z1M G;  1N4C A;  1P7B A;  4DV2 B;  4DR2 O;  3E22 B;  1I5X A;  2K9P A;  1R3K C;  3K5O A;  2W6J G; 
#chains in the Genus database with same CATH homology
 2NN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...