3CMEV

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cmeV00
1K9MW 1VQ4V 3CCQV 1K8AW 3I56V 1VQMV 3CPWU 1YITV 1NJIW 3CCSV 1Q81W 1N8RW 3G6EV 3CC4V 1VQOV 3OW2U 3G4SV 2QA4V 1VQ5V 1Q82W 1YI2V 3CC2V 3CCLV 1Q86W 1M1KW 1VQ8V 3CC7V 3CCJV 1VQNV 1YJWV 1R73A 1YJNV 3CCVV 1Q7YW 1M90W 5DM6V 3CD6V 1K73W 4WF9V 3CXCU 3CCRV 1JJ2U 1QVGU 4WFBV 4WCEV 3CCUV 1VQLV 1YIJV 1KC8W 1VQ7V 3CCEV 4WFAV 3CCMV 1KQSU 3I55V 1VQPV 1VQ9V 2QEXV 1S72V 1QVFU 2OTJV 1VQKV 2D3OW 2OTLV 1VQ6V 3CMAV 3G71V 3CMEV 1YHQV 1KD1W 1YJ9V 1W2BU
chains in the Genus database with same CATH superfamily
1TUBB 1FFXA 4YJ2B 3HKCB 1GKFA 3JARA 1EZJA 3E8GA 3A2FA 5IDJA 4IGGA 4UV8A 3WB2A 2EINB 1Q7YW 3AK2A 2VQEO 5B1AC 3CE2A 1VIBA 3ZRWB 4O4HA 4DV1O 4PHZA 1I08A 4UCTA 4YY3O 3MAQA 3BRCA 2HFEC 5IE9A 1GN6A 2LW7A 3CC4V 1IBLO 3JAMN 2QA4V 1FS0G 2R72A 2A7WA 4KP4A 1QNMA 4G28B 2XOKG 4WFEA 3B40A 3LDDA 1VP7A 3APQA 3I5DA 1S72V 4EEQA 1Y74A 1NTMH 3C3TA 1WA8A 4PDMA 3D36C 1EFRG 4IHJA 1NBMG 3D3IA 3ASOC 1M1KW 1PD3A 4R7CA 3ZHTA 3LDCA 4AQYB 4X1IB 3ZRXA 2IU0A 3ZX6A 1OJHA 1FKAO 1YEWA 1WN7A 1SC5B 1MSWD 1AI5A 2QWRB 3K03A 2IH3C 1LNQA 1P4RA 3E8BA 5B3SC 1SETA 1D2DA 2LQTA 1K8AW 2A06H 4JI1O 4O2AB 2VQEB 3DXRB 4CH4A 1OCZC 1QR8A 2UXBO 2WAMA 5D5QA 3UCSC 3CCJV 3HKDA 4DV1B 4FVMA 4DYLA 3AG2C 4NYKA 1MOFA 1ZSPA 4O4LA 4YY3B 3EXAA 3E86A 1S5HC 4MW8A 3KKYA 2UUCO 1AP6A 1IBLB 1Q90D 4GLXA 2GHYA 4OGQB 2CTQA 2GUZB 2G38A 3QO7A 1NKDA 3WG7B 3QO5A 1G8MA 5K1PA 4FIPC 4NXNO 1WP7A 4X8AA 3RWRD 1L1FA 4O2BA 4NXMO 4TT3G 2QEXV 1M5IA 2YSUB 2JVDA 4MTFA 2ZINA 4W4LA 3WFVA 1K33A 3SJQC 2P5OA 3CXHF 4JGSA 4XDLA 5JQGA 1KKCA 5LBQA 3JD2A 3CXCU 4KFMA 3RYFB 4QE7A 4LF7O 3G80A 4JI1B 4DR5O 4H44B 2IJJA 3D8CA 2UXBB 2XUMA 3T1CA 3K0DA 1R3KC 2X6CA 4CZZA 3T4ZA 3CRMA 5IJ0A 4LNUB 5BZBA 3K79A 3CRAA 5KUMA 2EX3A 3SPIA 1TGOA 1FXHA 2UUCB 1H2LA 3RVYA 1BQZA 4GKJO 5JCOA 1GRJA 1ZLZA 3THOA 2KG7A 3OAAG 2AHZA 2NLJC 2YICA 1VQ4V 1NQTA 2XAQA 3KCXA 3TXSA 3ETGA 1SF9A 4NXNB 2RJZA 5CB4B 3MHHC 2D2CB 2RMKB 4NXMB 1T5EA 5J2TB 1W0JG 2MK3A 2WLMA 1K4DC 3L70H 2VWJA 1YXBA 3HKCA 3BVOA 4U7NA 4DV5O 2FB5A 1THZA 1XUQA 2YEVA 3AG2B 2QSAA 1NTKH 3P32A 2ZQMA 4LF7B 3VBBA 4DR5B 2AXTZ 3FB8C 5LYJB 4B3RB 4D7SA 3CRCA 4MTXA 1OHHG 1KB9F 1BHAA 2JEUA 5JWPA 4B3TO 3SJCC 1QU7A 1NVPD 3G6EV 4HYOA 4ZOLB 1JQ0A 4GKJB 2RN9A 4CH3A 4TQFA 3IFXA 2HKOA 5EZYA 2IU3A 2BOBC 3A0HZ 1OCCC 3VOUA 1FD9A 4RO2A 2DQ0A 4RQFA 2LFSA 1R3LC 1KYOF 2OCCC 2XASA 2JIZG 1Z2GA 2DW4A 2ZXWB 1L8DA 4BR6A 4B7KA 2BTQA 4MTGA 2XNDG 4WFAV 2P06A 3J80N 2K1EA 3CWBH 3MD0A 4LCUC 1RM1C 1VF6A 2UU9O 1NVPB 3EFFK 2UXCO 4CS4A 1NTZH 5AG2A 4KHPO 1GH6A 3Q4HB 2Q67A 2VWKA 1CPYA 2IJKA 1R73A 3X2QC 2PF4E 2GTSA 3QF7A 4RUFA 4X1KB 4B3TB 3ASNB 4FLWA 3B09A 4O4JB 4TV9A 4JI6O 2Q7GA 4UCSA 2QM7A 2RCVA 2GUZA 4QE9A 4AILC 2CTRA 1QHTA 5IYDO 2CAZC 1NH2D 4IL6Z 4FLTA 4Z2WA 4B7EA 4K8ZA 1DGSA 4NTXA 2ODMA 2Y69C 4DK0A 4B3MO 3CCSV 2YI8A 3OMNB 2Q73A 1Q82W 3ZHRA 1I7FA 1VQ8V 4FLXA 1OCOB 4YJ3A 1ZWIC 5A9GA 3E35A 1Y6XA 1GTOA 3FB5C 3K9SA 2UU9B 1X59A 2CTPA 4Z1MG 4J7KA 1TAEA 5KHHA 4MTOA 3BA8A 4DR6O 4KHPB 1N4CA 3OT7A 4B3SO 5BR8O 1XILA 3M8AA 2DQ3A 1YITV 1XREA 2DYSC 4X20A 5KHIA 1SQGA 3SGIA 4MS2A 1SKVA 4JYYA 4MVMA 1JR9A 4WCEV 1H2MA 3J7AU 1S3JA 1IBKB 5IWAO 4JI6B 4I55B 4MVZA 3H1HH 3SYQA 4BWAA 3D36A 1P49A 2ADPA 4EB6B 4W4KA 3HR0A 3L73H 3JASA 1H2KA 3OR7C 4YHHO 1N36O 4JAUA 5IJ9B 3FAVA 4HAMA 5IYCO 5IY5C 3ZMSA 4FZ1A 3DC5A 2XAJA 1AR4A 2P4KA 5EBMC 5A2QN 1RM1B 1FXKB 1AROP 2H94A 1KMIZ 4B3MB 2KKWA 3AEIA 4XDJA 4PA7A 3HKEB 2MW2B 1XQ8A 3TK1A 3K0GA 2XHBA 5J2UB 4DV7O 3SPJA 4JI2O 4MVUA 4IYHA 2WLIB 4JF3A 4X1YA 2EZOA 3QG5A 4DR6B 3EHBB 1AI4A 2ITCC 2EINC 3SJAC 4B3SB 5BR8B 3FFQA 1B06A 3ZMUA 2Q69A 3RW0A 1ZL8B 4GX5A 4IYIA 1Y67A 1JX9A 4OPHA 2QWNB 1R1BA 1FPOA 5KLVH 5LHGA 5IWAB 3E22B 1JMKC 3SYAA 2ZKOA 2ARHA 1NZ6A 5CN0A 1AJNA 3O65A 4LF4O 1L0NH 1O9GA 2Y69B 2OTLV 1QVFU 2YS8A 4YHHB 2OYQA 1SZXA 1Q6UA 5KMGB 1H2NA 1ZX3A 4QJFB 1I94O 1VARA 4LH6A 4I4TA 1IVSA 4I50A 1SESA 5EBLC 3OTOO 1XNQO 1VQLV 4F6RB 2QGNA 2UUAO 1GN3A 4CS2A 4MVQA 4NKGB 4EFEA 1SRYA 1AB3A 4DV7B 5IYBO 4JI2B 4FFBA 3H9VA 1D5AA 4EFBA 4OPAA 3LDEA 3ABKB 4LWSB 3E83A 5B1NA 1I0HA 2K9PA 3N2GA 4UCVA 3SR2C 4WBNB 2ZE5A 3EVKA 1SQXH 1H8HG 4PJ0Z 5BMVB 4JZGA 1DF5A 2ILMA 4JYAO 3H1JH 4BIUA 2YIBA 4UXNA 4X65O 1UPGA 3P30A 2BSKB 1WLEA 2JGDB 3CMAV 3ZRSA 3K9AA 4O4JA 5IY5B 3UO3A 4ZHQB 2IBZH 4O4IB 1YJWV 3JD4A 4LF4B 3CD6V 3ICXA 1PM9A 1JCHA 5F2VO 3FKSG 3WG7C 2VQFO 2XAFA 5H9CA 1I94B 3OTFA 3K3WA 2DN9A 3FYIB 5K1XA 3H1IH 1XI1A 2Z3YA 3OTOB 1XNQB 4LH7A 5GW7A 2UUAB 3ZHSA 2QWQB 4JYCA 3A8TA 5HFLA 1GN2A 1XDCA 1M56C 2QTOA 1XHXA 1JOYA 2WLLB 3WB1A 1E1RG 4GT1A 2RNBA 3CEIA 4DV6O 3ZJZA 4JYAB 1XBLA 5GONA 1I5YA 4X65B 2ETNA 3B77A 2ZIMA 3UKMA 1J95A 3JAKA 3BCCH 3RYCA 4K0KO 2PYLA 4JI0O 2EJ7A 5C8YB 3HPLC 2ADQB 1PPJH 1FXVA 2PI5A 3UM7A 3K57A 3DC6A 4DR4O 2EZPA 1B6QA 3RN4A 4EB6A 3K04A 4I0XA 2HP8A 1GN4A 1SERA 4G27B 4KUMA 3O9OA 4R6ZA 4ZI7A 1FAFA 1US6A 1YI2V 2VQFB 5CA0B 1L0LH 3CCVV 5DM6V 5BY1A 4J11A 5LGUA 3IC7A 1KQSU 2D3OW 3W7WA 4YIOA 3HKBB 1QLEC 1Q5OA 3CCQV 3W7TA 3K58A 4UB6Z 3SJBC 2HLDG 4MVOA 3E8FA 2E74B 2WLIA 2YDEA 4DUZO 4QGPA 2YI9A 3CP1A 2P90A 1P7GA 2X0LA 4DV6B 4PA6A 3UO2A 3G71V 1BSMA 5KAIZ 1GM8A 2KQXA 4YIPA 2KSDA 5FL7G 2QM8A 5EC2C 3ABMB 4PI2A 5JVDB 3OGIB 4K0KB 4J9ZB 4JI0B 4DR7O 3OMAB 2JS5A 4LF6O 2LFRA 3OUSA 1BS3A 4DR4B 4TV8B 1YIJV 5FPRA 1BZKA 1K92A 2EILB 4F6EA 1RPOA 1V55B 5DN6G 4J80A 5EC1C 1JFFA 3E2EA 4IT5A 4PDVA 2LO1A 4HZ3A 5JH7A 1MSDA 1JVMA 4PELA 4H37A 2CH7A 1M56B 5C93A 5ITZB 2DJVA 4FLZA 4WFBV 1K34A 2ZXWC 2N05A 4LFBO 1AJQA 1IXMA 4UVBA 5LGTA 5FNVA 3JSLA 3JAWB 4AI8A 3AG7A 4JI5O 2E3CA 1H2SB 2CDYA 3K08A 5H5NA 4DUZB 3BHPA 3CC2V 1GMGA 3SPGA 2O57A 4MVRA 1FYJA 5CA1B 1J5EO 1AI6A 5IYZA 2UXXA 5L3EA 1XEQA 2YUAA 4YXWG 4DR3O 1VQ9V 4L8JA 4TUYA 2ZDIC 3RYHA 1XHZA 1JJ2U 3QVNA 4DR7B 2WSSG 3F7YC 1ROPA 3ASNC 1GAXA 4LF6B 1EN5A 1SZTA 2KB1A 5EYPB 3FB7C 2F66C 1CP9A 3QNEA 4O4IA 3OM3B 5L3CA 2ZE8A 5LMUO 1Y4MA 4KXRA 1PNMA 1QLEB 3ZHVA 1SQFA 1K5QA 4JAAA 1S5LZ 2OT5A 1TUBA 4YJ2A 3SPCA 4LFBB 1MA1A 2JJ1G 1ENVA 4J41A 1B3QA 4CH6A 4JI5B 2C2AA 3B4SA 2A3QA 1OCOC 3K59A 3ZRWA 1G1XB 1ORQC 1CEZA 2F23A 3L74H 4CS3A 1SQQH 2L35A 5H6QA 3L72H 1VQMV 1J5EB 3T4DA 1Q81W 3RFRA 1AVMA 2W0FC 1SQVH 2JEXA 1B04A 4LR3A 3UT5B 4JTDB 4DR3B 1VF5B 3IAYA 4BAYA 5H2FZ 1R6NA 3ETEA 1HNWO 2WA3A 4DO2A 1VQ7V 1COWG 2Y4TA 1Q3EA 1RSOB 4DXWA 4CC5A 3AG4C 2PGGA 1YJ9V 5CMUA 4NVPA 3F5WC 4NTWA 5LMUB 5DEDA 4H13B 3OD4A 3PJSK 3CC7V 4I9WA 5CA0A 3K5OA 3W7UA 4X1IA 1WJZA 2EBOA 1MNGA 1AILA 2OTJV 4DV5B 3SYOA 1FXKC 4IIJB 1K9MW 3ZN0A 3TETA 1O9HA 2JDIG 4DR2O 1XMQO 1N34O 1KKDA 4O2AA 4JAVA 3DXRA 5B5EZ 5EIBC 3ZRVA 1YTFD 4I9QA 2DWEC 2V7QG 1ZAUA 1A32A 3IC9A 2Q8VA 2EIMB 2OWOA 1YZBA 1Y66A 2P7TC 3G6BA 2CGNA 1RP3B 3H01A 2V1DA 2OIGA 4ASUG 2JJ2G 2HJFC 3TJTA 3TGUH 2LW1A 5LOVB 3FD9A 5LXTB 1DK1A 3DTUB 1BCCH 2VS0A 2E5LO 3AG3C 1JJOA 2W0XA 4WFFA 3P3NA 2W6JG 1N8RW 3ABLC 1M57B 1F7YA 2Q0OC 1NU1H 3AG1C 2DMXA 4LF9O 3R66A 3FYEB 3E89A 3CJHB 1N0NA 1AP5A 1IXBA 2VRZA 3LSSA 1PL4A 1PV0A 1TVKB 4JTCB 2A0LA 4DR2B 1XMQB 3RYFA 2UXCB 3ZHQA 1R6TA 1Z5WA 5GTIZ 3OFNG 4PDRA 1AJPA 3JARB 2YXYA 2ATKC 5KX5B 2QDOA 4LNUA 3ABKC 3IJ4A 2QKCA 1NH2B 2UXDO 4O4HB 2IM9A 1ZTEA 3AG4B 5B1OA 3LSQA 2P67A 3LUTB 5CBGA 4TOIA 4RQEA 4X88A 1FJGO 2Q68A 3C3SA 1UFIA 5CB4A 2X7RB 4UCOA 2XAHA 2HR3A 4J7ZA 3RYIB 3GWOA 3N2KB 5J2TA 2HJDA 5JJJB 3BPZA 4QPJA 3CRRA 1MZFA 1Y74B 2HEPA 3S3XA 4BIZA 4RUEA 1WA8B 4IHJB 2EIJB 4LF9B 4I7ZB 4UVAA 4TWKA 3LNNA 3B8NA 1EZVH 1FFTB 2LP7A 4DUYO 2WLHA 4DV2O 1W0KG 3T2MA 5LYJA 2YIAA 1BQ0A 2PYJA 4JI8O 2DOSA 1MZEA 5L3FA 5B1BB 2UXDB 1AI7A 3ZS8C 3H1KH 2BOCC 1HDJA 4H0LB 3HKDB 4ZOLA 4BW5A 1TUEB 1XL6A 2F1MA 4O4LB 4D6TH 1QCEA 2PZSA 4MT8A 5EK0A 3OEEG 1YVWA 1FJGB 3AG3B 1YCIA 1YF2A 1VQ6V 1YHQV 1N36B 1KD1W 2XTAA 3ABLB 3AK1A 2ZM6O 1VEWA 4KL1A 4B08A 3AG1B 2ZD9A 2RDCA 3QO8A 3OGCC 1LUVA 3ABUA 1SA0B 1AR5A 3JALB 1F4MA 3VQVA 5IT9N 1E79G 2FTKA 4O2BB 3ZEDA 3T1YO 4P9PA 1RPRA 2NR5A 1EN4A 3OUFA 2N04A 4NTYA 4MW3A 2AZ0A 5LHIA 1K5SA 4DUYB 2GDSA 4DV2B 2QTSA 4J10A 1QLNA 2WWWA 3Q4HA 3UQ8A 2LGQA 1S0VA 4CC6A 2EJRA 4JI8B 2DYRB 2WLKA 1Z5VA 4FPPA 2BE3A 2ZDIA 4JI3O 2JRIA 4X1KA 3N27A 4P30A 2HG5C 4MSWC 1GM9A 2PI4A 2HVJC 1VF6C 1NT2B 2PTMA 1DLBA 5IJ0B 1OCRC 2Y0IA 1VMGA 4P9OA 3ABMC 3OMIB 5LL6Y 4X66O 4DRXB 1K73W 2ZM6B 4H33A 3FX7A 2WA4A 2KG7B 3CCMV 3T1HO 4GX0A 4RWUA 4JI7O 2P4VA 2EILC 4WFHA 1EN6A 4DR1O 3I56V 1V55C 1H8EG 3NR7A 3ZBHA 5B66Z 3T1YB 5BXZA 3A0BZ 1PNKA 2F95B 1NI8A 4ZBMA 3E8HA 3H1LH 3CJHA 2E75B 3VQYA 3ZMZA 2R9IA 1BMFG 1KECA 1N0JA 2Q4PA 2Q5ZA 3SDLA 2YEVB 5KX5A 1F51A 3CCLV 3BAAA 4JI3B 4LFCO 3CS5A 4PD4F 3CCRV 2AZ2A 1PNLA 1IX9A 4E4EA 1R6KA 1M9NA 3SYPA 2B5UA 4I55A 2FYUH 4LC1A 1IURA 1RFYA 1Y76B 4X66B 3LSUA 3BY6A 3AK3A 1VF7A 1M4UA 1LR1A 4DK1A 2UUBO 2NNUA 3RBZA 1PKXA 2A9HA 4UB8Z 4N23A 5EZYB 2IW5A 5IJ9A 4PA9A 4JYBA 2DE0X 3F7VC 3T1HB 3RYIA 3N2KA 4JI7B 3WU2Z 3FB6C 4DR1B 3LNMB 3GVMA 2NN4A 1FXKA 3BEHA 1R3IC 2CE4A 3HKEA 4UCRA 2P6JA 1CXZB 1GM7A 5J2UA 2YC0A 1X4TA 4PV1B 2BTQB 2EIKC 3ZCCA 3L71H 1HP8A 3B2EE 3MDSA 4X64O 1KC8W 3KZIZ 3CYOA 2B9ZA 3JD3A 1Q8IA 2M7WA 2ZR3A 1SQBH 3JATB 4UVCA 1OCRB 1ZL8A 1I5XA 4LFCB 1MMMA 4I5SA 5LHHA 1QR9A 1Q6IA 4LP8A 4F4LA 4E2LA 3E22A 2DWDC 5KHKA 3CCEV 1GK9A 2YXLA 3STLC 2UUBB 4ABMA 3W7SA 3W7XA 1HW7A 4Q6GA 4AHCA 4TV9B 5KMGA 1K7DA 1YDXA 2WLNA 3IGAC 3QTCA 2QWPB 1SA0A 2F4VO 3JALA 2H8PC 5H6RA 2P22C 3SPHA 4WF9V 3C90A 1U96A 1XNRO 4F6RA 4GX1A 1F23A 5L3GA 3ZMVA 1WB7A 1PP9H 2Z5UA 2AHYA 3SYCA 2F93B 4FMTA 4X89A 4LWSA 4X64B 3HB3B 1S5JA 5B1AB 3K06A 2F43G 1SQPH 2PY5A 4YJ3B 4UUJC 2ZIOA 4WBNA 5BMVA 3GB7C 1KP2A 3ML0A 4B3RO 4J9YB 4U3JB 2HVKC 2ZE7A 3ETQA 2BSKA 2JGDA 2Y48A 4GX2A 4QIWF 4X20B 1D5NA 1W59A 1JA8A 2EIMC 4U7OA 1BGYH 1P7BA 2QE7G 4DV4O 1F4NA 2IH1C 4ZHQA 3G67A 3P3PA 1S77D 4RAIA 2N74A 2GTAA 5LP6C 4DRXA 3CX5F 5J9PC 4JZ2A 4HNAB 1MG1A 3ASOB 2B1GA 2Q0AA 2F4VB 1HWYA 3JASB 4JI4O 4FFKA 4OXSA 3FAVB 2EIKB 1N33O 5EBWC 1XNRB 3MHSC 1M57C 4X62O 3J81N 2IJHA 2QM4A 4C7UA 5B3SB 1HNZO 1VQPV 4DV0O 2Q7HA 1OCZB 2YXHA 2WLLA 1NJIW 4X1YB 5KA5A 1VQNV 5D5PA 4Q20A 3BABA 3K5MA 3ETDA 2H3OA 1K97A 5C8YA 2QR4A 4DV3O 5GTHZ 3OEHG 3M99B 5CBHA 1E1QG 2ZCEA 4DV4B 1Y76A 3WB0A 2UXNA 1WB8A 2BCCH 1NS1A 3JSNA 1NR7A 1XOUA 3CHXA 4FZ0A 3DGEA 3GWKC 4CH5A 1WP8A 1KU9A 1AR1B 3KCYA 3CRQA 2YIBD 2WPDG 3ZIAG 1XMOO 1PL0A 1IBMO 4JI4B 1N33B 3HKBA 3JCUZ 3DSQA 1WPXA 2L6LA 3L9DA 4X62B 1K3EA 4Z1VA 4I4TB 2GSMB 4I50B 2EIJC 4FM2A 2OCHA 4K35A 1N32O 4LFAO 1HNZB 2Z0AA 4DV0B 5FLXN 4GZRB 4EKWA 4CBCA 2R9RB 5E1AC 4FFBB 2OIEA 3JATA 1QBZA 4X9QA 3TCUA 2AW9A 2LGWA 5L3DA 4FLUA 1KUQA 3N2GB 5LA6B 5JVDA 5B1BC 1NR1A 5LP6B 4N21A 1HNWB 4DV3B 1M90W 4P2ZA 1R3JC 4JPRA 3M7MX 5KUKA 3VQWA 4ZIBA 4TV8A 1V54C 1EM1A 2FMLA 2JK5C 1Q6HA 1EBOA 3TXQA 1WAZA 1IBKO 2JS3A 1HR0O 4UFZA 5KAFZ 3G4SV 1YTFB 4J7JA 4FLYA 1XMOB 1IBMB 4NR1A 1DF4A 5LGNA 5ITZA 3CCUV 2YIDA 2V4DA 1K4CC 2ZT9B 4BW9A 3I55V 1BT8A 3JAWA 1TA8A 1N34B 3BA9A 1FFXB 2GV9A 4JV5O 4U3FH 1N32B 4LFAB 2EULA 4FM0A 3CSXA 2X6AA 3APOA 1UJWB 1BL8A 4XDKA 4LF5O 1YJNV 3K5LA 2QWOB 2Y4UA 2HHHO 4D7TA 5CA1A 3JD0A 4J42A 2ZE6A 2Q7EA 5CA3A 4JTAB 2DYRC 4QPKA 4TSFG 4U3JA 2RQ6A 4HBNA 3A0RA 3ZN1A 2Q9LA 5EIBD 3OR6C 4R50A 5GONB 2CUGA 2FKXA 5EYPA 3VQXA 5KHJA 3JAKB 1BHBA 3F5TA 3RYCB 1IZ3A 3R65A 1OCCB 3JD1A 2E5LB 2W6IG 1HR0B 2CGOA 4HNAA 4OX9O 5JCOC 2OCCB 3ZMTA 4I0XB 4K8XA 1H2GA 4ZI7B 5LMNO 3U10A 1HNXO 5L3BA 1Q86W 4GKKO 3NXSA 2FL4A 2Y0PA 1V9PA 4MVSA 4JV5B 2AGAA 4WFGA 1G6UA 4GCZA 2QKAA 1ZUQA 3CB2A 4LF5B 3CPWU 2HHHB 2ZNIA 3D3QA 3X2QB 3JYCA 3UT5A 5E79Z 1V54B 1U97A 2R70A 4DW0A 4G2KA 3L75H 4JASA 5KA6A 3K5NA 5FPOA 4PA3A 1RSOA 3ABTA 1W2BU 1MABG 4R8CA 2ZNJA 3OE7G 5DECA 1WNSA 4LF8O 3RT3C 2ZR2A 1WPBA 5CBFA 1JPXA 1IDSA 1URFA 4OX9B 2IJIA 4UCUA 2XT9A 1QVGU 3S3WA 3PN1A 2CTWA 5HFMA 5LMNB 1HNXB 1JFFB 4GUNA 4PDLA 1BE3H 1LUWA 4BIOA 4FM1A 4GKKB 2E76B 5JH7B 4IIJA 4PI0A 4FJCC 1QQCA 4ICGA 2X6BA 2CH7B 5JQGB 1GO3F 5KHGA 2JGUA 4XBFA 5JJEB 4FLVA 4A5UB 3U11A 5FNVB 1SS3A 2GBOA 1Q43A 2WLJA 2B1IA 2DYSB 1S76D 4FK5C 3U0ZA 4K3AA 1VQOV 5LA6A 2Q6AA 2CK3G 3RVZA 2R9AA 1DTOA 4DW1A 5LP6A 5IYZB 2LJ2A 1OV9A 3B8MA 2ITDC 4QNHB 4GYCB 2PUSA 3KG2A 4PA4A 2XAGA 1KBHA 3JCZA 4TUYB 1H38A 3RGBA 5LOVA 3RYHB 4LF8B 1VQKV 5LXTA 3BFRA 4ZKIA 1P84F 2QJ1A 3STZC 3OW2U 2A79B 1VQ5V 4L87A 4TQDA 2QKSA 4UV9A 2M6YA 1XL4A 4NB5A 1M93A 1KP3A 5TISZ 1OZ0A 1TVKA 4AQYO 1G4YB 2BTOA 3ZHUA 3CMEV 4LBEC 5JJNB 1YSCA
chains in the Genus database with same CATH topology
1K9MW 2AHYA 3K0GA 3ZN0A 3TETA 2JDIG 3SYCA 1GKFA 4FMTA 1KKDA 4X89A 3SPJA 4JAVA 4MVUA 1EZJA 3E8GA 3HB3B 5B1AB 3K06A 5IDJA 2F43G 4UV8A 2WLIB 3ZRVA 1YTFD 4JF3A 4UUJC 2EINB 1Q7YW 2DWEC 5B1AC 2EZOA 2V7QG 3GB7C 3EHBB 1AI4A 2ITCC 2EINC 3ZRWB 1KP2A 3ML0A 3ZMUA 4J9YB 2Q69A 3RW0A 2HVKC 2EIMB 2Y48A 4GX5A 4GX2A 4QIWF 1Y66A 2HFEC 2P7TC 1JX9A 3CC4V 2EIMC 4U7OA 2QA4V 3H01A 1FS0G 1P7BA 2QE7G 2V1DA 1F4NA 2IH1C 5LHGA 4ASUG 3SYAA 4KP4A 2JJ2G 4RAIA 1S77D 2HJFC 4G28B 2XOKG 4WFEA 5CN0A 3LDDA 5J9PC 1AJNA 1S72V 1QVFU 3DTUB 2Y69B 2OTLV 1MG1A 3ASOB 1M90W 2B1GA 3AG3C 4WFFA 1HWYA 4PDMA 2W6JG 1EFRG 4QJFB 1NBMG 1N8RW 3ABLC 3D3IA 4OXSA 1M57B 3ASOC 2EIKB 3AG1C 1M1KW 5EBWC 1PD3A 4R7CA 1SESA 3MHSC 5EBLC 3LDCA 3TK1A 1M57C 3FYEB 3E89A 3ZRXA 2IJHA 2IU0A 1VQLV 3LSSA 5B3SB 4JTCB 2A0LA 4MVQA 1MSWD 1VQPV 1AI5A 1SRYA 3K03A 2IH3C 1LNQA 5IYBO 1P4RA 3E8BA 5B3SC 1SETA 1OCZB 1K8AW 3LDEA 3OFNG 3ABKB 4PDRA 1AJPA 2WLLA 1NJIW 2ATKC 3E83A 5B1NA 1OCZC 1QR8A 2WAMA 3ABKC 5KA5A 3CCJV 1VQNV 1H8HG 1NH2B 4Q20A 1DF5A 3AG2C 3ETDA 1K97A 1MOFA 4BIUA 3AG4B 1S5HC 3E86A 4UXNA 4MW8A 5B1OA 3LSQA 3P30A 2P67A 1WLEA 3OEHG 3LUTB 3M99B 3CMAV 5CBGA 5CBHA 1E1QG 4RQEA 3ZRSA 2GHYA 3K9AA 4X88A 5IY5B 2Q68A 2UXNA 3QO7A 2X7RB 1NKDA 3WG7B 3QO5A 1YJWV 1G8MA 2XAHA 3JD4A 1NR7A 2HR3A 3CD6V 4FIPC 3DGEA 1JCHA 3GWOA 3FKSG 4QPJA 4X8AA 1L1FA 3WG7C 1AR1B 2XAFA 5H9CA 2WPDG 4TT3G 2QEXV 3ZIAG 1PL0A 4BIZA 4RUEA 2YSUB 4MTFA 3K3WA 3FYIB 2EIJB 1WPXA 3WFVA 1K33A 4UVAA 3SJQC 2Z3YA 1K3EA 4TWKA 2GSMB 3B8NA 5GW7A 1FFTB 2EIJC 2LP7A 4JGSA 4XDLA 4JYCA 5HFLA 5LBQA 2WLHA 3JD2A 3CXCU 4KFMA 1W0KG 3T2MA 4EKWA 1M56C 4CBCA 2R9RB 4QE7A 2QTOA 5E1AC 2IJJA 1JOYA 3T1CA 5L3FA 1QBZA 3TCUA 2WLLB 5B1BB 3K0DA 1R3KC 1E1RG 2X6CA 5L3DA 4CZZA 1AI7A 4GT1A 3T4ZA 3ZJZA 2BOCC 5BZBA 3K79A 5B1BC 1NR1A 4N21A 5KUMA 1I5YA 4BW5A 3B77A 4P2ZA 1R3JC 1TUEB 1FXHA 1XL6A 4JPRA 3SPIA 3UKMA 5KUKA 1QCEA 1J95A 4MT8A 3RVYA 5EK0A 3OEEG 1V54C 3HPLC 3AG3B 1FXVA 3OAAG 2PI5A 2AHZA 1VQ6V 2JK5C 2NLJC 3UM7A 1YHQV 1KD1W 1EBOA 2EZPA 1B6QA 3ABLB 1VQ4V 3K04A 1NQTA 2XAQA 3AG1B 1SERA 2ZD9A 4G27B 3ETGA 4KUMA 3QO8A 3OGCC 4R6ZA 3G4SV 3MHHC 1YI2V 3ABUA 1YTFB 1F4MA 3CCVV 5DM6V 1E79G 1DF4A 1W0JG 5LGNA 2FTKA 2MK3A 3CCUV 2WLMA 5LGUA 1K4CC 3IC7A 1RPRA 4P9PA 1K4DC 3OUFA 1KQSU 3I55V 2D3OW 3W7WA 1QLEC 4MW3A 3CCQV 3W7TA 5LHIA 1K5SA 2X6AA 4U7NA 1THZA 1UJWB 2HLDG 1BL8A 4MVOA 2YEVA 3AG2B 3E8FA 4XDKA 3P32A 1QLNA 2WWWA 2ZQMA 2WLIA 3VBBA 1YJNV 3FB8C 1S0VA 2EJRA 2DYRB 2WLKA 3JD0A 4FPPA 3CP1A 2ZDIA 4MTXA 2P90A 5CA3A 1OHHG 2X0LA 4JTAB 2DYRC 2HG5C 4P30A 4QPKA 4PA6A 4TSFG 3G71V 1BHAA 2JEUA 3A0RA 4MSWC 3ZN1A 1GM9A 1GM8A 2PI4A 2HVJC 5FL7G 2QM8A 5EC2C 1NVPD 1DLBA 3ABMB 1OCRC 3G6EV 4HYOA 3OR6C 4R50A 4J9ZB 1JQ0A 4P9OA 3ABMC 3OMIB 3OMAB 3IFXA 2HKOA 1BHBA 2LFRA 3OUSA 3R65A 1K73W 2IU3A 1OCCB 1YIJV 3JD1A 4H33A 1K92A 2EILB 2W6IG 2BOBC 3CCMV 1RPOA 1V55B 1OCCC 5DN6G 5EC1C 3VOUA 2OCCB 4GX0A 4RO2A 2DQ0A 3ZMTA 4RQFA 2LFSA 1R3LC 2EILC 4WFHA 3E2EA 1H2GA 4PDVA 4HZ3A 1V55C 3I56V 1H8EG 2OCCC 1JVMA 4PELA 5L3BA 2XASA 2JIZG 1Q86W 2DW4A 2ZXWB 3NXSA 4H37A 1M56B 1PNKA 5C93A 4ZBMA 3E8HA 4WFBV 1K34A 4MVSA 2ZXWC 4MTGA 3ZMZA 1AJQA 1IXMA 2R9IA 4UVBA 5LGTA 1BMFG 2XNDG 4WFAV 1KECA 2K1EA 4WFGA 3MD0A 4LCUC 1RM1C 4GCZA 1NVPB 3EFFK 3K08A 3CPWU 2YEVB 3X2QB 1F51A 1GMGA 3CC2V 3JYCA 3SPGA 3CCLV 4MVRA 2Q67A 1CPYA 2IJKA 1R73A 1AI6A 5L3EA 1V54B 2UXXA 3X2QC 3CCRV 4YXWG 4RUFA 1PNLA 4G2KA 1R6KA 1M9NA 4JASA 5KA6A 1VQ9V 3ASNB 3SYPA 4PA3A 2ZDIC 2B5UA 1JJ2U 3ABTA 1W2BU 1MABG 4R8CA 4LC1A 2WSSG 3F7YC 1ROPA 3ASNC 3OE7G 3BY6A 2ZR2A 2QM7A 1SZTA 2KB1A 4QE9A 2NNUA 3RBZA 1PKXA 5CBFA 3FB7C 2A9HA 4N23A 1JPXA 2IW5A 1CP9A 3QNEA 5L3CA 3OM3B 4PA9A 5IYDO 2IJIA 3F7VC 4JYBA 1NH2D 1QVGU 3FB6C 1Y4MA 3LNMB 1PNMA 1QLEB 1FXKA 5HFMA 1K5QA 3BEHA 1R3IC 4PDLA 2Y69C 2OT5A 4FJCC 2P6JA 3CCSV 3OMNB 3SPCA 1Q82W 1GM7A 2X6BA 1VQ8V 1GO3F 2JJ1G 1ENVA 1OCOB 2EIKC 3ZCCA 4XBFA 1ZWIC 3E35A 1GTOA 3FB5C 1KC8W 2C2AA 1OCOC 3CYOA 4Z1MG 3JD3A 3ZRWA 2M7WA 1ORQC 2ZR3A 1CEZA 2WLJA 4MTOA 4UVCA 2B1IA 2DYSB 1OCRB 1S76D 1I5XA 4FK5C 5H6QA 1VQMV 3T4DA 2DQ3A 1YITV 1Q81W 2DYSC 4I5SA 5LHHA 1QR9A 1VQOV 2W0FC 2JEXA 2Q6AA 2CK3G 4JTDB 3RVZA 1DTOA 4MS2A 4QNHB 3B8MA 2ITDC 4LP8A 4F4LA 4BAYA 4E2LA 3KG2A 4MVMA 4WCEV 1R6NA 4PA4A 2XAGA 3ETEA 2DWDC 1VQ7V 1S3JA 4DO2A 1COWG 3CCEV 3JCZA 1GK9A 1H38A 4MVZA 4DXWA 3SYQA 3STLC 1VQKV 3W7SA 3AG4C 3D36A 3W7XA 4ZKIA 1YJ9V 5CMUA 3F5WC 1K7DA 2WLNA 3STZC 3OR7C 3OW2U 2A79B 1VQ5V 4JAUA 3IGAC 4HAMA 4L87A 5IY5C 5IYCO 2QKSA 3PJSK 4UV9A 3CC7V 3ZMSA 2H8PC 4I9WA 1XL4A 5H6RA 2XAJA 3SPHA 4WF9V 3W7UA 5EBMC 1KP3A 1RM1B 2EBOA 1FXKB 1AROP 1F23A 1OZ0A 2H94A 4GX1A 5L3GA 3AEIA 4XDJA 2OTJV 3ZMVA 1G4YB 4PA7A 3SYOA 3CMEV 4LBEC 1YSCA 1FXKC 2Z5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M W;  1VQ4 V;  3CCQ V;  1K8A W;  3I56 V;  1VQM V;  3CPW U;  1YIT V;  1NJI W;  3CCS V;  1Q81 W;  1N8R W;  3G6E V;  3CC4 V;  1VQO V;  3OW2 U;  3G4S V;  2QA4 V;  1VQ5 V;  1Q82 W;  1YI2 V;  3CC2 V;  3CCL V;  1Q86 W;  1M1K W;  1VQ8 V;  3CC7 V;  3CCJ V;  1VQN V;  1YJW V;  1R73 A;  1YJN V;  3CCV V;  1Q7Y W;  1M90 W;  5DM6 V;  3CD6 V;  1K73 W;  4WF9 V;  3CXC U;  3CCR V;  1JJ2 U;  1QVG U;  4WFB V;  4WCE V;  3CCU V;  1VQL V;  1YIJ V;  1KC8 W;  1VQ7 V;  3CCE V;  4WFA V;  3CCM V;  1KQS U;  3I55 V;  1VQP V;  1VQ9 V;  2QEX V;  1S72 V;  1QVF U;  2OTJ V;  1VQK V;  2D3O W;  2OTL V;  1VQ6 V;  3CMA V;  3G71 V;  3CME V;  1YHQ V;  1KD1 W;  1YJ9 V;  1W2B U; 
#chains in the Genus database with same CATH topology
 1TUB B;  1FFX A;  4YJ2 B;  3HKC B;  1GKF A;  3JAR A;  1EZJ A;  3E8G A;  3A2F A;  5IDJ A;  4IGG A;  4UV8 A;  3WB2 A;  2EIN B;  1Q7Y W;  3AK2 A;  2VQE O;  5B1A C;  3CE2 A;  1VIB A;  3ZRW B;  4O4H A;  4DV1 O;  4PHZ A;  1I08 A;  4UCT A;  4YY3 O;  3MAQ A;  3BRC A;  2HFE C;  5IE9 A;  1GN6 A;  2LW7 A;  3CC4 V;  1IBL O;  3JAM N;  2QA4 V;  1FS0 G;  2R72 A;  2A7W A;  4KP4 A;  1QNM A;  4G28 B;  2XOK G;  4WFE A;  3B40 A;  3LDD A;  1VP7 A;  3APQ A;  3I5D A;  1S72 V;  4EEQ A;  1Y74 A;  1NTM H;  3C3T A;  1WA8 A;  4PDM A;  3D36 C;  1EFR G;  4IHJ A;  1NBM G;  3D3I A;  3ASO C;  1M1K W;  1PD3 A;  4R7C A;  3ZHT A;  3LDC A;  4AQY B;  4X1I B;  3ZRX A;  2IU0 A;  3ZX6 A;  1OJH A;  1FKA O;  1YEW A;  1WN7 A;  1SC5 B;  1MSW D;  1AI5 A;  2QWR B;  3K03 A;  2IH3 C;  1LNQ A;  1P4R A;  3E8B A;  5B3S C;  1SET A;  1D2D A;  2LQT A;  1K8A W;  2A06 H;  4JI1 O;  4O2A B;  2VQE B;  3DXR B;  4CH4 A;  1OCZ C;  1QR8 A;  2UXB O;  2WAM A;  5D5Q A;  3UCS C;  3CCJ V;  3HKD A;  4DV1 B;  4FVM A;  4DYL A;  3AG2 C;  4NYK A;  1MOF A;  1ZSP A;  4O4L A;  4YY3 B;  3EXA A;  3E86 A;  1S5H C;  4MW8 A;  3KKY A;  2UUC O;  1AP6 A;  1IBL B;  1Q90 D;  4GLX A;  2GHY A;  4OGQ B;  2CTQ A;  2GUZ B;  2G38 A;  3QO7 A;  1NKD A;  3WG7 B;  3QO5 A;  1G8M A;  5K1P A;  4FIP C;  4NXN O;  1WP7 A;  4X8A A;  3RWR D;  1L1F A;  4O2B A;  4NXM O;  4TT3 G;  2QEX V;  1M5I A;  2YSU B;  2JVD A;  4MTF A;  2ZIN A;  4W4L A;  3WFV A;  1K33 A;  3SJQ C;  2P5O A;  3CXH F;  4JGS A;  4XDL A;  5JQG A;  1KKC A;  5LBQ A;  3JD2 A;  3CXC U;  4KFM A;  3RYF B;  4QE7 A;  4LF7 O;  3G80 A;  4JI1 B;  4DR5 O;  4H44 B;  2IJJ A;  3D8C A;  2UXB B;  2XUM A;  3T1C A;  3K0D A;  1R3K C;  2X6C A;  4CZZ A;  3T4Z A;  3CRM A;  5IJ0 A;  4LNU B;  5BZB A;  3K79 A;  3CRA A;  5KUM A;  2EX3 A;  3SPI A;  1TGO A;  1FXH A;  2UUC B;  1H2L A;  3RVY A;  1BQZ A;  4GKJ O;  5JCO A;  1GRJ A;  1ZLZ A;  3THO A;  2KG7 A;  3OAA G;  2AHZ A;  2NLJ C;  2YIC A;  1VQ4 V;  1NQT A;  2XAQ A;  3KCX A;  3TXS A;  3ETG A;  1SF9 A;  4NXN B;  2RJZ A;  5CB4 B;  3MHH C;  2D2C B;  2RMK B;  4NXM B;  1T5E A;  5J2T B;  1W0J G;  2MK3 A;  2WLM A;  1K4D C;  3L70 H;  2VWJ A;  1YXB A;  3HKC A;  3BVO A;  4U7N A;  4DV5 O;  2FB5 A;  1THZ A;  1XUQ A;  2YEV A;  3AG2 B;  2QSA A;  1NTK H;  3P32 A;  2ZQM A;  4LF7 B;  3VBB A;  4DR5 B;  2AXT Z;  3FB8 C;  5LYJ B;  4B3R B;  4D7S A;  3CRC A;  4MTX A;  1OHH G;  1KB9 F;  1BHA A;  2JEU A;  5JWP A;  4B3T O;  3SJC C;  1QU7 A;  1NVP D;  3G6E V;  4HYO A;  4ZOL B;  1JQ0 A;  4GKJ B;  2RN9 A;  4CH3 A;  4TQF A;  3IFX A;  2HKO A;  5EZY A;  2IU3 A;  2BOB C;  3A0H Z;  1OCC C;  3VOU A;  1FD9 A;  4RO2 A;  2DQ0 A;  4RQF A;  2LFS A;  1R3L C;  1KYO F;  2OCC C;  2XAS A;  2JIZ G;  1Z2G A;  2DW4 A;  2ZXW B;  1L8D A;  4BR6 A;  4B7K A;  2BTQ A;  4MTG A;  2XND G;  4WFA V;  2P06 A;  3J80 N;  2K1E A;  3CWB H;  3MD0 A;  4LCU C;  1RM1 C;  1VF6 A;  2UU9 O;  1NVP B;  3EFF K;  2UXC O;  4CS4 A;  1NTZ H;  5AG2 A;  4KHP O;  1GH6 A;  3Q4H B;  2Q67 A;  2VWK A;  1CPY A;  2IJK A;  1R73 A;  3X2Q C;  2PF4 E;  2GTS A;  3QF7 A;  4RUF A;  4X1K B;  4B3T B;  3ASN B;  4FLW A;  3B09 A;  4O4J B;  4TV9 A;  4JI6 O;  2Q7G A;  4UCS A;  2QM7 A;  2RCV A;  2GUZ A;  4QE9 A;  4AIL C;  2CTR A;  1QHT A;  5IYD O;  2CAZ C;  1NH2 D;  4IL6 Z;  4FLT A;  4Z2W A;  4B7E A;  4K8Z A;  1DGS A;  4NTX A;  2ODM A;  2Y69 C;  4DK0 A;  4B3M O;  3CCS V;  2YI8 A;  3OMN B;  2Q73 A;  1Q82 W;  3ZHR A;  1I7F A;  1VQ8 V;  4FLX A;  1OCO B;  4YJ3 A;  1ZWI C;  5A9G A;  3E35 A;  1Y6X A;  1GTO A;  3FB5 C;  3K9S A;  2UU9 B;  1X59 A;  2CTP A;  4Z1M G;  4J7K A;  1TAE A;  5KHH A;  4MTO A;  3BA8 A;  4DR6 O;  4KHP B;  1N4C A;  3OT7 A;  4B3S O;  5BR8 O;  1XIL A;  3M8A A;  2DQ3 A;  1YIT V;  1XRE A;  2DYS C;  4X20 A;  5KHI A;  1SQG A;  3SGI A;  4MS2 A;  1SKV A;  4JYY A;  4MVM A;  1JR9 A;  4WCE V;  1H2M A;  3J7A U;  1S3J A;  1IBK B;  5IWA O;  4JI6 B;  4I55 B;  4MVZ A;  3H1H H;  3SYQ A;  4BWA A;  3D36 A;  1P49 A;  2ADP A;  4EB6 B;  4W4K A;  3HR0 A;  3L73 H;  3JAS A;  1H2K A;  3OR7 C;  4YHH O;  1N36 O;  4JAU A;  5IJ9 B;  3FAV A;  4HAM A;  5IYC O;  5IY5 C;  3ZMS A;  4FZ1 A;  3DC5 A;  2XAJ A;  1AR4 A;  2P4K A;  5EBM C;  5A2Q N;  1RM1 B;  1FXK B;  1ARO P;  2H94 A;  1KMI Z;  4B3M B;  2KKW A;  3AEI A;  4XDJ A;  4PA7 A;  3HKE B;  2MW2 B;  1XQ8 A;  3TK1 A;  3K0G A;  2XHB A;  5J2U B;  4DV7 O;  3SPJ A;  4JI2 O;  4MVU A;  4IYH A;  2WLI B;  4JF3 A;  4X1Y A;  2EZO A;  3QG5 A;  4DR6 B;  3EHB B;  1AI4 A;  2ITC C;  2EIN C;  3SJA C;  4B3S B;  5BR8 B;  3FFQ A;  1B06 A;  3ZMU A;  2Q69 A;  3RW0 A;  1ZL8 B;  4GX5 A;  4IYI A;  1Y67 A;  1JX9 A;  4OPH A;  2QWN B;  1R1B A;  1FPO A;  5KLV H;  5LHG A;  5IWA B;  3E22 B;  1JMK C;  3SYA A;  2ZKO A;  2ARH A;  1NZ6 A;  5CN0 A;  1AJN A;  3O65 A;  4LF4 O;  1L0N H;  1O9G A;  2Y69 B;  2OTL V;  1QVF U;  2YS8 A;  4YHH B;  2OYQ A;  1SZX A;  1Q6U A;  5KMG B;  1H2N A;  1ZX3 A;  4QJF B;  1I94 O;  1VAR A;  4LH6 A;  4I4T A;  1IVS A;  4I50 A;  1SES A;  5EBL C;  3OTO O;  1XNQ O;  1VQL V;  4F6R B;  2QGN A;  2UUA O;  1GN3 A;  4CS2 A;  4MVQ A;  4NKG B;  4EFE A;  1SRY A;  1AB3 A;  4DV7 B;  5IYB O;  4JI2 B;  4FFB A;  3H9V A;  1D5A A;  4EFB A;  4OPA A;  3LDE A;  3ABK B;  4LWS B;  3E83 A;  5B1N A;  1I0H A;  2K9P A;  3N2G A;  4UCV A;  3SR2 C;  4WBN B;  2ZE5 A;  3EVK A;  1SQX H;  1H8H G;  4PJ0 Z;  5BMV B;  4JZG A;  1DF5 A;  2ILM A;  4JYA O;  3H1J H;  4BIU A;  2YIB A;  4UXN A;  4X65 O;  1UPG A;  3P30 A;  2BSK B;  1WLE A;  2JGD B;  3CMA V;  3ZRS A;  3K9A A;  4O4J A;  5IY5 B;  3UO3 A;  4ZHQ B;  2IBZ H;  4O4I B;  1YJW V;  3JD4 A;  4LF4 B;  3CD6 V;  3ICX A;  1PM9 A;  1JCH A;  5F2V O;  3FKS G;  3WG7 C;  2VQF O;  2XAF A;  5H9C A;  1I94 B;  3OTF A;  3K3W A;  2DN9 A;  3FYI B;  5K1X A;  3H1I H;  1XI1 A;  2Z3Y A;  3OTO B;  1XNQ B;  4LH7 A;  5GW7 A;  2UUA B;  3ZHS A;  2QWQ B;  4JYC A;  3A8T A;  5HFL A;  1GN2 A;  1XDC A;  1M56 C;  2QTO A;  1XHX A;  1JOY A;  2WLL B;  3WB1 A;  1E1R G;  4GT1 A;  2RNB A;  3CEI A;  4DV6 O;  3ZJZ A;  4JYA B;  1XBL A;  5GON A;  1I5Y A;  4X65 B;  2ETN A;  3B77 A;  2ZIM A;  3UKM A;  1J95 A;  3JAK A;  3BCC H;  3RYC A;  4K0K O;  2PYL A;  4JI0 O;  2EJ7 A;  5C8Y B;  3HPL C;  2ADQ B;  1PPJ H;  1FXV A;  2PI5 A;  3UM7 A;  3K57 A;  3DC6 A;  4DR4 O;  2EZP A;  1B6Q A;  3RN4 A;  4EB6 A;  3K04 A;  4I0X A;  2HP8 A;  1GN4 A;  1SER A;  4G27 B;  4KUM A;  3O9O A;  4R6Z A;  4ZI7 A;  1FAF A;  1US6 A;  1YI2 V;  2VQF B;  5CA0 B;  1L0L H;  3CCV V;  5DM6 V;  5BY1 A;  4J11 A;  5LGU A;  3IC7 A;  1KQS U;  2D3O W;  3W7W A;  4YIO A;  3HKB B;  1QLE C;  1Q5O A;  3CCQ V;  3W7T A;  3K58 A;  4UB6 Z;  3SJB C;  2HLD G;  4MVO A;  3E8F A;  2E74 B;  2WLI A;  2YDE A;  4DUZ O;  4QGP A;  2YI9 A;  3CP1 A;  2P90 A;  1P7G A;  2X0L A;  4DV6 B;  4PA6 A;  3UO2 A;  3G71 V;  1BSM A;  5KAI Z;  1GM8 A;  2KQX A;  4YIP A;  2KSD A;  5FL7 G;  2QM8 A;  5EC2 C;  3ABM B;  4PI2 A;  5JVD B;  3OGI B;  4K0K B;  4J9Z B;  4JI0 B;  4DR7 O;  3OMA B;  2JS5 A;  4LF6 O;  2LFR A;  3OUS A;  1BS3 A;  4DR4 B;  4TV8 B;  1YIJ V;  5FPR A;  1BZK A;  1K92 A;  2EIL B;  4F6E A;  1RPO A;  1V55 B;  5DN6 G;  4J80 A;  5EC1 C;  1JFF A;  3E2E A;  4IT5 A;  4PDV A;  2LO1 A;  4HZ3 A;  5JH7 A;  1MSD A;  1JVM A;  4PEL A;  4H37 A;  2CH7 A;  1M56 B;  5C93 A;  5ITZ B;  2DJV A;  4FLZ A;  4WFB V;  1K34 A;  2ZXW C;  2N05 A;  4LFB O;  1AJQ A;  1IXM A;  4UVB A;  5LGT A;  5FNV A;  3JSL A;  3JAW B;  4AI8 A;  3AG7 A;  4JI5 O;  2E3C A;  1H2S B;  2CDY A;  3K08 A;  5H5N A;  4DUZ B;  3BHP A;  3CC2 V;  1GMG A;  3SPG A;  2O57 A;  4MVR A;  1FYJ A;  5CA1 B;  1J5E O;  1AI6 A;  5IYZ A;  2UXX A;  5L3E A;  1XEQ A;  2YUA A;  4YXW G;  4DR3 O;  1VQ9 V;  4L8J A;  4TUY A;  2ZDI C;  3RYH A;  1XHZ A;  1JJ2 U;  3QVN A;  4DR7 B;  2WSS G;  3F7Y C;  1ROP A;  3ASN C;  1GAX A;  4LF6 B;  1EN5 A;  1SZT A;  2KB1 A;  5EYP B;  3FB7 C;  2F66 C;  1CP9 A;  3QNE A;  4O4I A;  3OM3 B;  5L3C A;  2ZE8 A;  5LMU O;  1Y4M A;  4KXR A;  1PNM A;  1QLE B;  3ZHV A;  1SQF A;  1K5Q A;  4JAA A;  1S5L Z;  2OT5 A;  1TUB A;  4YJ2 A;  3SPC A;  4LFB B;  1MA1 A;  2JJ1 G;  1ENV A;  4J41 A;  1B3Q A;  4CH6 A;  4JI5 B;  2C2A A;  3B4S A;  2A3Q A;  1OCO C;  3K59 A;  3ZRW A;  1G1X B;  1ORQ C;  1CEZ A;  2F23 A;  3L74 H;  4CS3 A;  1SQQ H;  2L35 A;  5H6Q A;  3L72 H;  1VQM V;  1J5E B;  3T4D A;  1Q81 W;  3RFR A;  1AVM A;  2W0F C;  1SQV H;  2JEX A;  1B04 A;  4LR3 A;  3UT5 B;  4JTD B;  4DR3 B;  1VF5 B;  3IAY A;  4BAY A;  5H2F Z;  1R6N A;  3ETE A;  1HNW O;  2WA3 A;  4DO2 A;  1VQ7 V;  1COW G;  2Y4T A;  1Q3E A;  1RSO B;  4DXW A;  4CC5 A;  3AG4 C;  2PGG A;  1YJ9 V;  5CMU A;  4NVP A;  3F5W C;  4NTW A;  5LMU B;  5DED A;  4H13 B;  3OD4 A;  3PJS K;  3CC7 V;  4I9W A;  5CA0 A;  3K5O A;  3W7U A;  4X1I A;  1WJZ A;  2EBO A;  1MNG A;  1AIL A;  2OTJ V;  4DV5 B;  3SYO A;  1FXK C;  4IIJ B;  1K9M W;  3ZN0 A;  3TET A;  1O9H A;  2JDI G;  4DR2 O;  1XMQ O;  1N34 O;  1KKD A;  4O2A A;  4JAV A;  3DXR A;  5B5E Z;  5EIB C;  3ZRV A;  1YTF D;  4I9Q A;  2DWE C;  2V7Q G;  1ZAU A;  1A32 A;  3IC9 A;  2Q8V A;  2EIM B;  2OWO A;  1YZB A;  1Y66 A;  2P7T C;  3G6B A;  2CGN A;  1RP3 B;  3H01 A;  2V1D A;  2OIG A;  4ASU G;  2JJ2 G;  2HJF C;  3TJT A;  3TGU H;  2LW1 A;  5LOV B;  3FD9 A;  5LXT B;  1DK1 A;  3DTU B;  1BCC H;  2VS0 A;  2E5L O;  3AG3 C;  1JJO A;  2W0X A;  4WFF A;  3P3N A;  2W6J G;  1N8R W;  3ABL C;  1M57 B;  1F7Y A;  2Q0O C;  1NU1 H;  3AG1 C;  2DMX A;  4LF9 O;  3R66 A;  3FYE B;  3E89 A;  3CJH B;  1N0N A;  1AP5 A;  1IXB A;  2VRZ A;  3LSS A;  1PL4 A;  1PV0 A;  1TVK B;  4JTC B;  2A0L A;  4DR2 B;  1XMQ B;  3RYF A;  2UXC B;  3ZHQ A;  1R6T A;  1Z5W A;  5GTI Z;  3OFN G;  4PDR A;  1AJP A;  3JAR B;  2YXY A;  2ATK C;  5KX5 B;  2QDO A;  4LNU A;  3ABK C;  3IJ4 A;  2QKC A;  1NH2 B;  2UXD O;  4O4H B;  2IM9 A;  1ZTE A;  3AG4 B;  5B1O A;  3LSQ A;  2P67 A;  3LUT B;  5CBG A;  4TOI A;  4RQE A;  4X88 A;  1FJG O;  2Q68 A;  3C3S A;  1UFI A;  5CB4 A;  2X7R B;  4UCO A;  2XAH A;  2HR3 A;  4J7Z A;  3RYI B;  3GWO A;  3N2K B;  5J2T A;  2HJD A;  5JJJ B;  3BPZ A;  4QPJ A;  3CRR A;  1MZF A;  1Y74 B;  2HEP A;  3S3X A;  4BIZ A;  4RUE A;  1WA8 B;  4IHJ B;  2EIJ B;  4LF9 B;  4I7Z B;  4UVA A;  4TWK A;  3LNN A;  3B8N A;  1EZV H;  1FFT B;  2LP7 A;  4DUY O;  2WLH A;  4DV2 O;  1W0K G;  3T2M A;  5LYJ A;  2YIA A;  1BQ0 A;  2PYJ A;  4JI8 O;  2DOS A;  1MZE A;  5L3F A;  5B1B B;  2UXD B;  1AI7 A;  3ZS8 C;  3H1K H;  2BOC C;  1HDJ A;  4H0L B;  3HKD B;  4ZOL A;  4BW5 A;  1TUE B;  1XL6 A;  2F1M A;  4O4L B;  4D6T H;  1QCE A;  2PZS A;  4MT8 A;  5EK0 A;  3OEE G;  1YVW A;  1FJG B;  3AG3 B;  1YCI A;  1YF2 A;  1VQ6 V;  1YHQ V;  1N36 B;  1KD1 W;  2XTA A;  3ABL B;  3AK1 A;  2ZM6 O;  1VEW A;  4KL1 A;  4B08 A;  3AG1 B;  2ZD9 A;  2RDC A;  3QO8 A;  3OGC C;  1LUV A;  3ABU A;  1SA0 B;  1AR5 A;  3JAL B;  1F4M A;  3VQV A;  5IT9 N;  1E79 G;  2FTK A;  4O2B B;  3ZED A;  3T1Y O;  4P9P A;  1RPR A;  2NR5 A;  1EN4 A;  3OUF A;  2N04 A;  4NTY A;  4MW3 A;  2AZ0 A;  5LHI A;  1K5S A;  4DUY B;  2GDS A;  4DV2 B;  2QTS A;  4J10 A;  1QLN A;  2WWW A;  3Q4H A;  3UQ8 A;  2LGQ A;  1S0V A;  4CC6 A;  2EJR A;  4JI8 B;  2DYR B;  2WLK A;  1Z5V A;  4FPP A;  2BE3 A;  2ZDI A;  4JI3 O;  2JRI A;  4X1K A;  3N27 A;  4P30 A;  2HG5 C;  4MSW C;  1GM9 A;  2PI4 A;  2HVJ C;  1VF6 C;  1NT2 B;  2PTM A;  1DLB A;  5IJ0 B;  1OCR C;  2Y0I A;  1VMG A;  4P9O A;  3ABM C;  3OMI B;  5LL6 Y;  4X66 O;  4DRX B;  1K73 W;  2ZM6 B;  4H33 A;  3FX7 A;  2WA4 A;  2KG7 B;  3CCM V;  3T1H O;  4GX0 A;  4RWU A;  4JI7 O;  2P4V A;  2EIL C;  4WFH A;  1EN6 A;  4DR1 O;  3I56 V;  1V55 C;  1H8E G;  3NR7 A;  3ZBH A;  5B66 Z;  3T1Y B;  5BXZ A;  3A0B Z;  1PNK A;  2F95 B;  1NI8 A;  4ZBM A;  3E8H A;  3H1L H;  3CJH A;  2E75 B;  3VQY A;  3ZMZ A;  2R9I A;  1BMF G;  1KEC A;  1N0J A;  2Q4P A;  2Q5Z A;  3SDL A;  2YEV B;  5KX5 A;  1F51 A;  3CCL V;  3BAA A;  4JI3 B;  4LFC O;  3CS5 A;  4PD4 F;  3CCR V;  2AZ2 A;  1PNL A;  1IX9 A;  4E4E A;  1R6K A;  1M9N A;  3SYP A;  2B5U A;  4I55 A;  2FYU H;  4LC1 A;  1IUR A;  1RFY A;  1Y76 B;  4X66 B;  3LSU A;  3BY6 A;  3AK3 A;  1VF7 A;  1M4U A;  1LR1 A;  4DK1 A;  2UUB O;  2NNU A;  3RBZ A;  1PKX A;  2A9H A;  4UB8 Z;  4N23 A;  5EZY B;  2IW5 A;  5IJ9 A;  4PA9 A;  4JYB A;  2DE0 X;  3F7V C;  3T1H B;  3RYI A;  3N2K A;  4JI7 B;  3WU2 Z;  3FB6 C;  4DR1 B;  3LNM B;  3GVM A;  2NN4 A;  1FXK A;  3BEH A;  1R3I C;  2CE4 A;  3HKE A;  4UCR A;  2P6J A;  1CXZ B;  1GM7 A;  5J2U A;  2YC0 A;  1X4T A;  4PV1 B;  2BTQ B;  2EIK C;  3ZCC A;  3L71 H;  1HP8 A;  3B2E E;  3MDS A;  4X64 O;  1KC8 W;  3KZI Z;  3CYO A;  2B9Z A;  3JD3 A;  1Q8I A;  2M7W A;  2ZR3 A;  1SQB H;  3JAT B;  4UVC A;  1OCR B;  1ZL8 A;  1I5X A;  4LFC B;  1MMM A;  4I5S A;  5LHH A;  1QR9 A;  1Q6I A;  4LP8 A;  4F4L A;  4E2L A;  3E22 A;  2DWD C;  5KHK A;  3CCE V;  1GK9 A;  2YXL A;  3STL C;  2UUB B;  4ABM A;  3W7S A;  3W7X A;  1HW7 A;  4Q6G A;  4AHC A;  4TV9 B;  5KMG A;  1K7D A;  1YDX A;  2WLN A;  3IGA C;  3QTC A;  2QWP B;  1SA0 A;  2F4V O;  3JAL A;  2H8P C;  5H6R A;  2P22 C;  3SPH A;  4WF9 V;  3C90 A;  1U96 A;  1XNR O;  4F6R A;  4GX1 A;  1F23 A;  5L3G A;  3ZMV A;  1WB7 A;  1PP9 H;  2Z5U A;  2AHY A;  3SYC A;  2F93 B;  4FMT A;  4X89 A;  4LWS A;  4X64 B;  3HB3 B;  1S5J A;  5B1A B;  3K06 A;  2F43 G;  1SQP H;  2PY5 A;  4YJ3 B;  4UUJ C;  2ZIO A;  4WBN A;  5BMV A;  3GB7 C;  1KP2 A;  3ML0 A;  4B3R O;  4J9Y B;  4U3J B;  2HVK C;  2ZE7 A;  3ETQ A;  2BSK A;  2JGD A;  2Y48 A;  4GX2 A;  4QIW F;  4X20 B;  1D5N A;  1W59 A;  1JA8 A;  2EIM C;  4U7O A;  1BGY H;  1P7B A;  2QE7 G;  4DV4 O;  1F4N A;  2IH1 C;  4ZHQ A;  3G67 A;  3P3P A;  1S77 D;  4RAI A;  2N74 A;  2GTA A;  5LP6 C;  4DRX A;  3CX5 F;  5J9P C;  4JZ2 A;  4HNA B;  1MG1 A;  3ASO B;  2B1G A;  2Q0A A;  2F4V B;  1HWY A;  3JAS B;  4JI4 O;  4FFK A;  4OXS A;  3FAV B;  2EIK B;  1N33 O;  5EBW C;  1XNR B;  3MHS C;  1M57 C;  4X62 O;  3J81 N;  2IJH A;  2QM4 A;  4C7U A;  5B3S B;  1HNZ O;  1VQP V;  4DV0 O;  2Q7H A;  1OCZ B;  2YXH A;  2WLL A;  1NJI W;  4X1Y B;  5KA5 A;  1VQN V;  5D5P A;  4Q20 A;  3BAB A;  3K5M A;  3ETD A;  2H3O A;  1K97 A;  5C8Y A;  2QR4 A;  4DV3 O;  5GTH Z;  3OEH G;  3M99 B;  5CBH A;  1E1Q G;  2ZCE A;  4DV4 B;  1Y76 A;  3WB0 A;  2UXN A;  1WB8 A;  2BCC H;  1NS1 A;  3JSN A;  1NR7 A;  1XOU A;  3CHX A;  4FZ0 A;  3DGE A;  3GWK C;  4CH5 A;  1WP8 A;  1KU9 A;  1AR1 B;  3KCY A;  3CRQ A;  2YIB D;  2WPD G;  3ZIA G;  1XMO O;  1PL0 A;  1IBM O;  4JI4 B;  1N33 B;  3HKB A;  3JCU Z;  3DSQ A;  1WPX A;  2L6L A;  3L9D A;  4X62 B;  1K3E A;  4Z1V A;  4I4T B;  2GSM B;  4I50 B;  2EIJ C;  4FM2 A;  2OCH A;  4K35 A;  1N32 O;  4LFA O;  1HNZ B;  2Z0A A;  4DV0 B;  5FLX N;  4GZR B;  4EKW A;  4CBC A;  2R9R B;  5E1A C;  4FFB B;  2OIE A;  3JAT A;  1QBZ A;  4X9Q A;  3TCU A;  2AW9 A;  2LGW A;  5L3D A;  4FLU A;  1KUQ A;  3N2G B;  5LA6 B;  5JVD A;  5B1B C;  1NR1 A;  5LP6 B;  4N21 A;  1HNW B;  4DV3 B;  1M90 W;  4P2Z A;  1R3J C;  4JPR A;  3M7M X;  5KUK A;  3VQW A;  4ZIB A;  4TV8 A;  1V54 C;  1EM1 A;  2FML A;  2JK5 C;  1Q6H A;  1EBO A;  3TXQ A;  1WAZ A;  1IBK O;  2JS3 A;  1HR0 O;  4UFZ A;  5KAF Z;  3G4S V;  1YTF B;  4J7J A;  4FLY A;  1XMO B;  1IBM B;  4NR1 A;  1DF4 A;  5LGN A;  5ITZ A;  3CCU V;  2YID A;  2V4D A;  1K4C C;  2ZT9 B;  4BW9 A;  3I55 V;  1BT8 A;  3JAW A;  1TA8 A;  1N34 B;  3BA9 A;  1FFX B;  2GV9 A;  4JV5 O;  4U3F H;  1N32 B;  4LFA B;  2EUL A;  4FM0 A;  3CSX A;  2X6A A;  3APO A;  1UJW B;  1BL8 A;  4XDK A;  4LF5 O;  1YJN V;  3K5L A;  2QWO B;  2Y4U A;  2HHH O;  4D7T A;  5CA1 A;  3JD0 A;  4J42 A;  2ZE6 A;  2Q7E A;  5CA3 A;  4JTA B;  2DYR C;  4QPK A;  4TSF G;  4U3J A;  2RQ6 A;  4HBN A;  3A0R A;  3ZN1 A;  2Q9L A;  5EIB D;  3OR6 C;  4R50 A;  5GON B;  2CUG A;  2FKX A;  5EYP A;  3VQX A;  5KHJ A;  3JAK B;  1BHB A;  3F5T A;  3RYC B;  1IZ3 A;  3R65 A;  1OCC B;  3JD1 A;  2E5L B;  2W6I G;  1HR0 B;  2CGO A;  4HNA A;  4OX9 O;  5JCO C;  2OCC B;  3ZMT A;  4I0X B;  4K8X A;  1H2G A;  4ZI7 B;  5LMN O;  3U10 A;  1HNX O;  5L3B A;  1Q86 W;  4GKK O;  3NXS A;  2FL4 A;  2Y0P A;  1V9P A;  4MVS A;  4JV5 B;  2AGA A;  4WFG A;  1G6U A;  4GCZ A;  2QKA A;  1ZUQ A;  3CB2 A;  4LF5 B;  3CPW U;  2HHH B;  2ZNI A;  3D3Q A;  3X2Q B;  3JYC A;  3UT5 A;  5E79 Z;  1V54 B;  1U97 A;  2R70 A;  4DW0 A;  4G2K A;  3L75 H;  4JAS A;  5KA6 A;  3K5N A;  5FPO A;  4PA3 A;  1RSO A;  3ABT A;  1W2B U;  1MAB G;  4R8C A;  2ZNJ A;  3OE7 G;  5DEC A;  1WNS A;  4LF8 O;  3RT3 C;  2ZR2 A;  1WPB A;  5CBF A;  1JPX A;  1IDS A;  1URF A;  4OX9 B;  2IJI A;  4UCU A;  2XT9 A;  1QVG U;  3S3W A;  3PN1 A;  2CTW A;  5HFM A;  5LMN B;  1HNX B;  1JFF B;  4GUN A;  4PDL A;  1BE3 H;  1LUW A;  4BIO A;  4FM1 A;  4GKK B;  2E76 B;  5JH7 B;  4IIJ A;  4PI0 A;  4FJC C;  1QQC A;  4ICG A;  2X6B A;  2CH7 B;  5JQG B;  1GO3 F;  5KHG A;  2JGU A;  4XBF A;  5JJE B;  4FLV A;  4A5U B;  3U11 A;  5FNV B;  1SS3 A;  2GBO A;  1Q43 A;  2WLJ A;  2B1I A;  2DYS B;  1S76 D;  4FK5 C;  3U0Z A;  4K3A A;  1VQO V;  5LA6 A;  2Q6A A;  2CK3 G;  3RVZ A;  2R9A A;  1DTO A;  4DW1 A;  5LP6 A;  5IYZ B;  2LJ2 A;  1OV9 A;  3B8M A;  2ITD C;  4QNH B;  4GYC B;  2PUS A;  3KG2 A;  4PA4 A;  2XAG A;  1KBH A;  3JCZ A;  4TUY B;  1H38 A;  3RGB A;  5LOV A;  3RYH B;  4LF8 B;  1VQK V;  5LXT A;  3BFR A;  4ZKI A;  1P84 F;  2QJ1 A;  3STZ C;  3OW2 U;  2A79 B;  1VQ5 V;  4L87 A;  4TQD A;  2QKS A;  4UV9 A;  2M6Y A;  1XL4 A;  4NB5 A;  1M93 A;  1KP3 A;  5TIS Z;  1OZ0 A;  1TVK A;  4AQY O;  1G4Y B;  2BTO A;  3ZHU A;  3CME V;  4LBE C;  5JJN B;  1YSC A; 
#chains in the Genus database with same CATH homology
 1K9M W;  2AHY A;  3K0G A;  3ZN0 A;  3TET A;  2JDI G;  3SYC A;  1GKF A;  4FMT A;  1KKD A;  4X89 A;  3SPJ A;  4JAV A;  4MVU A;  1EZJ A;  3E8G A;  3HB3 B;  5B1A B;  3K06 A;  5IDJ A;  2F43 G;  4UV8 A;  2WLI B;  3ZRV A;  1YTF D;  4JF3 A;  4UUJ C;  2EIN B;  1Q7Y W;  2DWE C;  5B1A C;  2EZO A;  2V7Q G;  3GB7 C;  3EHB B;  1AI4 A;  2ITC C;  2EIN C;  3ZRW B;  1KP2 A;  3ML0 A;  3ZMU A;  4J9Y B;  2Q69 A;  3RW0 A;  2HVK C;  2EIM B;  2Y48 A;  4GX5 A;  4GX2 A;  4QIW F;  1Y66 A;  2HFE C;  2P7T C;  1JX9 A;  3CC4 V;  2EIM C;  4U7O A;  2QA4 V;  3H01 A;  1FS0 G;  1P7B A;  2QE7 G;  2V1D A;  1F4N A;  2IH1 C;  5LHG A;  4ASU G;  3SYA A;  4KP4 A;  2JJ2 G;  4RAI A;  1S77 D;  2HJF C;  4G28 B;  2XOK G;  4WFE A;  5CN0 A;  3LDD A;  5J9P C;  1AJN A;  1S72 V;  1QVF U;  3DTU B;  2Y69 B;  2OTL V;  1MG1 A;  3ASO B;  1M90 W;  2B1G A;  3AG3 C;  4WFF A;  1HWY A;  4PDM A;  2W6J G;  1EFR G;  4QJF B;  1NBM G;  1N8R W;  3ABL C;  3D3I A;  4OXS A;  1M57 B;  3ASO C;  2EIK B;  3AG1 C;  1M1K W;  5EBW C;  1PD3 A;  4R7C A;  1SES A;  3MHS C;  5EBL C;  3LDC A;  3TK1 A;  1M57 C;  3FYE B;  3E89 A;  3ZRX A;  2IJH A;  2IU0 A;  1VQL V;  3LSS A;  5B3S B;  4JTC B;  2A0L A;  4MVQ A;  1MSW D;  1VQP V;  1AI5 A;  1SRY A;  3K03 A;  2IH3 C;  1LNQ A;  5IYB O;  1P4R A;  3E8B A;  5B3S C;  1SET A;  1OCZ B;  1K8A W;  3LDE A;  3OFN G;  3ABK B;  4PDR A;  1AJP A;  2WLL A;  1NJI W;  2ATK C;  3E83 A;  5B1N A;  1OCZ C;  1QR8 A;  2WAM A;  3ABK C;  5KA5 A;  3CCJ V;  1VQN V;  1H8H G;  1NH2 B;  4Q20 A;  1DF5 A;  3AG2 C;  3ETD A;  1K97 A;  1MOF A;  4BIU A;  3AG4 B;  1S5H C;  3E86 A;  4UXN A;  4MW8 A;  5B1O A;  3LSQ A;  3P30 A;  2P67 A;  1WLE A;  3OEH G;  3LUT B;  3M99 B;  3CMA V;  5CBG A;  5CBH A;  1E1Q G;  4RQE A;  3ZRS A;  2GHY A;  3K9A A;  4X88 A;  5IY5 B;  2Q68 A;  2UXN A;  3QO7 A;  2X7R B;  1NKD A;  3WG7 B;  3QO5 A;  1YJW V;  1G8M A;  2XAH A;  3JD4 A;  1NR7 A;  2HR3 A;  3CD6 V;  4FIP C;  3DGE A;  1JCH A;  3GWO A;  3FKS G;  4QPJ A;  4X8A A;  1L1F A;  3WG7 C;  1AR1 B;  2XAF A;  5H9C A;  2WPD G;  4TT3 G;  2QEX V;  3ZIA G;  1PL0 A;  4BIZ A;  4RUE A;  2YSU B;  4MTF A;  3K3W A;  3FYI B;  2EIJ B;  1WPX A;  3WFV A;  1K33 A;  4UVA A;  3SJQ C;  2Z3Y A;  1K3E A;  4TWK A;  2GSM B;  3B8N A;  5GW7 A;  1FFT B;  2EIJ C;  2LP7 A;  4JGS A;  4XDL A;  4JYC A;  5HFL A;  5LBQ A;  2WLH A;  3JD2 A;  3CXC U;  4KFM A;  1W0K G;  3T2M A;  4EKW A;  1M56 C;  4CBC A;  2R9R B;  4QE7 A;  2QTO A;  5E1A C;  2IJJ A;  1JOY A;  3T1C A;  5L3F A;  1QBZ A;  3TCU A;  2WLL B;  5B1B B;  3K0D A;  1R3K C;  1E1R G;  2X6C A;  5L3D A;  4CZZ A;  1AI7 A;  4GT1 A;  3T4Z A;  3ZJZ A;  2BOC C;  5BZB A;  3K79 A;  5B1B C;  1NR1 A;  4N21 A;  5KUM A;  1I5Y A;  4BW5 A;  3B77 A;  4P2Z A;  1R3J C;  1TUE B;  1FXH A;  1XL6 A;  4JPR A;  3SPI A;  3UKM A;  5KUK A;  1QCE A;  1J95 A;  4MT8 A;  3RVY A;  5EK0 A;  3OEE G;  1V54 C;  3HPL C;  3AG3 B;  1FXV A;  3OAA G;  2PI5 A;  2AHZ A;  1VQ6 V;  2JK5 C;  2NLJ C;  3UM7 A;  1YHQ V;  1KD1 W;  1EBO A;  2EZP A;  1B6Q A;  3ABL B;  1VQ4 V;  3K04 A;  1NQT A;  2XAQ A;  3AG1 B;  1SER A;  2ZD9 A;  4G27 B;  3ETG A;  4KUM A;  3QO8 A;  3OGC C;  4R6Z A;  3G4S V;  3MHH C;  1YI2 V;  3ABU A;  1YTF B;  1F4M A;  3CCV V;  5DM6 V;  1E79 G;  1DF4 A;  1W0J G;  5LGN A;  2FTK A;  2MK3 A;  3CCU V;  2WLM A;  5LGU A;  1K4C C;  3IC7 A;  1RPR A;  4P9P A;  1K4D C;  3OUF A;  1KQS U;  3I55 V;  2D3O W;  3W7W A;  1QLE C;  4MW3 A;  3CCQ V;  3W7T A;  5LHI A;  1K5S A;  2X6A A;  4U7N A;  1THZ A;  1UJW B;  2HLD G;  1BL8 A;  4MVO A;  2YEV A;  3AG2 B;  3E8F A;  4XDK A;  3P32 A;  1QLN A;  2WWW A;  2ZQM A;  2WLI A;  3VBB A;  1YJN V;  3FB8 C;  1S0V A;  2EJR A;  2DYR B;  2WLK A;  3JD0 A;  4FPP A;  3CP1 A;  2ZDI A;  4MTX A;  2P90 A;  5CA3 A;  1OHH G;  2X0L A;  4JTA B;  2DYR C;  2HG5 C;  4P30 A;  4QPK A;  4PA6 A;  4TSF G;  3G71 V;  1BHA A;  2JEU A;  3A0R A;  4MSW C;  3ZN1 A;  1GM9 A;  1GM8 A;  2PI4 A;  2HVJ C;  5FL7 G;  2QM8 A;  5EC2 C;  1NVP D;  1DLB A;  3ABM B;  1OCR C;  3G6E V;  4HYO A;  3OR6 C;  4R50 A;  4J9Z B;  1JQ0 A;  4P9O A;  3ABM C;  3OMI B;  3OMA B;  3IFX A;  2HKO A;  1BHB A;  2LFR A;  3OUS A;  3R65 A;  1K73 W;  2IU3 A;  1OCC B;  1YIJ V;  3JD1 A;  4H33 A;  1K92 A;  2EIL B;  2W6I G;  2BOB C;  3CCM V;  1RPO A;  1V55 B;  1OCC C;  5DN6 G;  5EC1 C;  3VOU A;  2OCC B;  4GX0 A;  4RO2 A;  2DQ0 A;  3ZMT A;  4RQF A;  2LFS A;  1R3L C;  2EIL C;  4WFH A;  3E2E A;  1H2G A;  4PDV A;  4HZ3 A;  1V55 C;  3I56 V;  1H8E G;  2OCC C;  1JVM A;  4PEL A;  5L3B A;  2XAS A;  2JIZ G;  1Q86 W;  2DW4 A;  2ZXW B;  3NXS A;  4H37 A;  1M56 B;  1PNK A;  5C93 A;  4ZBM A;  3E8H A;  4WFB V;  1K34 A;  4MVS A;  2ZXW C;  4MTG A;  3ZMZ A;  1AJQ A;  1IXM A;  2R9I A;  4UVB A;  5LGT A;  1BMF G;  2XND G;  4WFA V;  1KEC A;  2K1E A;  4WFG A;  3MD0 A;  4LCU C;  1RM1 C;  4GCZ A;  1NVP B;  3EFF K;  3K08 A;  3CPW U;  2YEV B;  3X2Q B;  1F51 A;  1GMG A;  3CC2 V;  3JYC A;  3SPG A;  3CCL V;  4MVR A;  2Q67 A;  1CPY A;  2IJK A;  1R73 A;  1AI6 A;  5L3E A;  1V54 B;  2UXX A;  3X2Q C;  3CCR V;  4YXW G;  4RUF A;  1PNL A;  4G2K A;  1R6K A;  1M9N A;  4JAS A;  5KA6 A;  1VQ9 V;  3ASN B;  3SYP A;  4PA3 A;  2ZDI C;  2B5U A;  1JJ2 U;  3ABT A;  1W2B U;  1MAB G;  4R8C A;  4LC1 A;  2WSS G;  3F7Y C;  1ROP A;  3ASN C;  3OE7 G;  3BY6 A;  2ZR2 A;  2QM7 A;  1SZT A;  2KB1 A;  4QE9 A;  2NNU A;  3RBZ A;  1PKX A;  5CBF A;  3FB7 C;  2A9H A;  4N23 A;  1JPX A;  2IW5 A;  1CP9 A;  3QNE A;  5L3C A;  3OM3 B;  4PA9 A;  5IYD O;  2IJI A;  3F7V C;  4JYB A;  1NH2 D;  1QVG U;  3FB6 C;  1Y4M A;  3LNM B;  1PNM A;  1QLE B;  1FXK A;  5HFM A;  1K5Q A;  3BEH A;  1R3I C;  4PDL A;  2Y69 C;  2OT5 A;  4FJC C;  2P6J A;  3CCS V;  3OMN B;  3SPC A;  1Q82 W;  1GM7 A;  2X6B A;  1VQ8 V;  1GO3 F;  2JJ1 G;  1ENV A;  1OCO B;  2EIK C;  3ZCC A;  4XBF A;  1ZWI C;  3E35 A;  1GTO A;  3FB5 C;  1KC8 W;  2C2A A;  1OCO C;  3CYO A;  4Z1M G;  3JD3 A;  3ZRW A;  2M7W A;  1ORQ C;  2ZR3 A;  1CEZ A;  2WLJ A;  4MTO A;  4UVC A;  2B1I A;  2DYS B;  1OCR B;  1S76 D;  1I5X A;  4FK5 C;  5H6Q A;  1VQM V;  3T4D A;  2DQ3 A;  1YIT V;  1Q81 W;  2DYS C;  4I5S A;  5LHH A;  1QR9 A;  1VQO V;  2W0F C;  2JEX A;  2Q6A A;  2CK3 G;  4JTD B;  3RVZ A;  1DTO A;  4MS2 A;  4QNH B;  3B8M A;  2ITD C;  4LP8 A;  4F4L A;  4BAY A;  4E2L A;  3KG2 A;  4MVM A;  4WCE V;  1R6N A;  4PA4 A;  2XAG A;  3ETE A;  2DWD C;  1VQ7 V;  1S3J A;  4DO2 A;  1COW G;  3CCE V;  3JCZ A;  1GK9 A;  1H38 A;  4MVZ A;  4DXW A;  3SYQ A;  3STL C;  1VQK V;  3W7S A;  3AG4 C;  3D36 A;  3W7X A;  4ZKI A;  1YJ9 V;  5CMU A;  3F5W C;  1K7D A;  2WLN A;  3STZ C;  3OR7 C;  3OW2 U;  2A79 B;  1VQ5 V;  4JAU A;  3IGA C;  4HAM A;  4L87 A;  5IY5 C;  5IYC O;  2QKS A;  3PJS K;  4UV9 A;  3CC7 V;  3ZMS A;  2H8P C;  4I9W A;  1XL4 A;  5H6R A;  2XAJ A;  3SPH A;  4WF9 V;  3W7U A;  5EBM C;  1KP3 A;  1RM1 B;  2EBO A;  1FXK B;  1ARO P;  1F23 A;  1OZ0 A;  2H94 A;  4GX1 A;  5L3G A;  3AEI A;  4XDJ A;  2OTJ V;  3ZMV A;  1G4Y B;  4PA7 A;  3SYO A;  3CME V;  4LBE C;  1YSC A;  1FXK C;  2Z5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...