3CMEV

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cmeV00
1S72V 1YHQV 1YITV 3CCSV 3G4SV 1QVGU 3CCJV 1N8RW 1VQKV 4WCEV 3I55V 1VQOV 1W2BU 1VQ5V 2QEXV 3CC4V 2OTJV 5DM6V 1VQ8V 3CCMV 3CMAV 1M90W 1NJIW 1KD1W 3CCUV 1VQ4V 3CMEV 1Q7YW 1VQ7V 1Q82W 1Q81W 1YJWV 2OTLV 3CC2V 1VQNV 4WF9V 1YI2V 1VQ6V 3I56V 4WFBV 3OW2U 1QVFU 3CC7V 1KQSU 3CPWU 3CD6V 3CCRV 1YJNV 3G6EV 1VQLV 3CXCU 1YJ9V 4WFAV 1KC8W 2QA4V 1JJ2U 1VQ9V 1M1KW 3CCLV 1R73A 1YIJV 1K73W 3G71V 1Q86W 1VQMV 1K9MW 3CCVV 1K8AW 3CCEV 1VQPV 2D3OW 3CCQV
chains in the Genus database with same CATH superfamily
3ASOB 1XI1A 3SJCC 3ZIAG 4KFMA 4LFBO 3RBZA 5LMUO 4FM0A 2UU9B 3E8GA 4B7KA 2IJJA 4IHJA 3E2EA 4OPAA 4I4TB 3SJAC 3MHSC 3NR7A 4LF4B 4CH6A 1PD3A 1THZA 5LYJA 2KQXA 2EJRA 2LFRA 1R73A 2FKXA 1AI6A 3OMIB 3AK2A 3VQWA 1MMMA 4MTOA 5L3GA 3KZIZ 1YHQV 3C90A 2DYSC 1N36B 2IM9A 2WA4A 2RDCA 5J2UA 5EC1C 1HR0O 1BL8A 2EILC 1N4CA 1GM7A 4UB6Z 3U11A 3W7XA 1S3JA 2R70A 2JIZG 1P84F 2CH7B 3Q4HB 5DN6G 2ODMA 2GBOA 3C3SA 4I4TA 5CA1A 4OPHA 4RWUA 3VQVA 2GSMB 5CBGA 3T1YB 2OTJV 4F6RB 1NI8A 2B5UA 1XILA 4O2AA 3SPCA 3M7MX 2CTWA 4WFBV 1TUBA 4GX2A 4AQYB 2A7WA 2JEXA 1HR0B 1CPYA 1OCRB 4G2KA 2Z3YA 2BOBC 4J7JA 4MVRA 3FFQA 5EYPA 1Q86W 1K4DC 4XDJA 2CH7A 5B1NA 1PL0A 5FLXN 1BQZA 2OCHA 1W2BU 1Y74B 2JS3A 2ETNA 5KMGA 4X62O 2YXHA 3ABMB 1FYJA 2CAZC 4W4LA 3C3TA 3AG1B 2L35A 5EBWC 1XBLA 5EBMC 5LP6B 2A79B 4UVAA 4ASUG 4AQYO 3P30A 3OEEG 1VF6A 1QU7A 1DF4A 2ZE6A 2HG5C 1M4UA 1N0JA 2QSAA 3OE7G 1L8DA 1SZTA 3LDDA 3W7SA 2A9HA 2PZSA 1AR4A 1OCCB 5J9PC 5H5NA 4DV2O 3VOUA 4DUZO 5IYBO 4TWKA 2QDOA 1TVKA 3CYOA 1VQ8V 1J5EB 3B2EE 1WLEA 2WLLB 2ZT9B 4JTCB 1H38A 5CN0A 4K8XA 4RQFA 4K0KO 3SPJA 1TA8A 4NTXA 5LA6A 3JCUZ 4R50A 1H2KA 2IJKA 3UT5A 5JJJB 5LBQA 5GONB 3F7VC 2ZCEA 3ZHRA 3X2QC 3CMAV 3LDCA 4JI2O 3J81N 1Q81W 3K79A 1Q90D 5GW7A 4TV9B 1IBKB 2RN9A 3ASNB 2CTRA 4MSWC 1YXBA 2YEVA 4FFBA 3SJBC 3P3PA 3CEIA 1YCIA 1AI4A 2Y0IA 4IT5A 3CCLV 1KYOF 4YJ2A 2AZ2A 1EFRG 1VF7A 4I9WA 2UUAO 4JASA 1QVGU 1GAXA 1GRJA 2Q6AA 1Q8IA 4U3JA 2AZ0A 1ZUQA 4UFZA 3U0ZA 5H2FZ 1S0VA 2OIGA 1ORQC 5BR8B 4DR7B 2GDSA 5ITZB 2F23A 4X89A 1YF2A 2D2CB 4DR5O 1AI5A 2BE3A 3H1JH 2UUAB 2BCCH 4PDLA 3G4SV 3R65A 1JVMA 2DMXA 2XNDG 4JAUA 4H13B 2Q67A 4FPPA 4DV1B 1KMIZ 4X1IB 5B1OA 3FB7C 1BS3A 1NTMH 1E1RG 1Q43A 3RYCB 4TT3G 3ZN0A 1EN6A 3RT3C 2VQFO 4LR3A 1PNKA 2QA4V 4JGSA 4FIPC 2ITDC 3TCUA 3JALA 1Q6HA 4DK0A 1VQKV 3JAKB 4N23A 1K7DA 3CHXA 5ITZA 1D2DA 1SA0A 2NNUA 4QPJA 4GYCB 4X20B 4LWSA 3I56V 5EIBD 2C2AA 2DYRC 3DC6A 2QKSA 4B7EA 3ZJZA 2BTQA 2EZOA 3A8TA 2XOKG 4JI1B 3K5NA 1Y66A 3ML0A 2UXBO 3K04A 3E22B 3R66A 5JH7B 4FLWA 2HLDG 5HFMA 2ZDIC 4MS2A 4CH3A 3B8NA 3I55V 2ZXWB 1DK1A 3H1IH 4TV8B 4TQDA 3E86A 4DV4B 4L8JA 4YIOA 1EBOA 2W0FC 5FNVB 2EZPA 2VWKA 2XASA 1L0NH 3E83A 4J7KA 4NXMB 3K08A 4WCEV 3U10A 3QG5A 3TETA 5AG2A 3H9VA 3UQ8A 2WLLA 4LFAB 1Y4MA 1R3KC 2A0LA 5FL7G 2R9AA 4DV6O 1VARA 4O4HB 1HNWB 3SYOA 2YXYA 4DR1O 3LNMB 5KHGA 1EN5A 1B3QA 3T1HO 3ZHQA 4FK5C 4ZI7B 4JI3B 2CUGA 5KHHA 1N8RW 3H1LH 5BY1A 2CTQA 2PY5A 3OD4A 3CE2A 3ABKC 3D3QA 2XHBA 4IYHA 4YJ3B 4DV0O 3L73H 1MA1A 1WN7A 3ZRXA 4DV5B 3T4DA 1ZSPA 2LO1A 1BQ0A 1E1QG 4RAIA 2UXDB 4LFCO 5J2TA 1IBKO 3T1YO 1OCOC 3L70H 3D36C 5GONA 4I9QA 1R3IC 2QEXV 3HKEA 2EIJB 5H6RA 3ZRSA 2QWPB 2ZE5A 4JI0B 3TGUH 1P4RA 3OR7C 2EULA 1XNQO 4YIPA 3NXSA 3OTOB 2ZM6O 1COWG 5LXTB 3A0RA 3ABLC 3CC4V 5TISZ 5B5EZ 4X62B 2Q7HA 2MK3A 4BWAA 4L87A 4DR2O 5B3SC 4GX0A 4HNAB 1XHXA 3N27A 1IDSA 1W59A 2A3QA 2Q69A 2ATKC 5LMUB 4CH4A 1HWYA 4Q20A 1JCHA 4FM1A 4FLYA 4B08A 1S77D 5B1BC 3M99B 4HZ3A 2LGQA 5LXTA 2HFEC 1MOFA 5IYCO 1Z5VA 1NZ6A 5C8YB 3ABLB 2Y69C 2ZINA 3K58A 1KECA 4MVQA 3RW0A 1N33B 4DR4O 1VQMV 2ZE8A 3AG3B 3KKYA 3TXQA 2L6LA 1B6QA 3O9OA 4GX5A 3K3WA 3HKEB 2XAQA 3RVYA 2HVJC 3CJHB 4CC6A 4FM2A 1UFIA 5L3BA 2E76B 2EX3A 2WLIA 3ZMUA 1P7GA 4LP8A 3JATA 3MHHC 1IBMB 4PJ0Z 5CA3A 4O2AB 3S3XA 1XDCA 1H2SB 4EFBA 4YJ3A 2QM7A 2F95B 2F4VB 4DR3B 4DR4B 4JAAA 5EK0A 4JTDB 1XNQB 1VQ7V 3QF7A 5KHJA 3Q4HA 3M8AA 4DR5B 3J80N 1K5QA 1VEWA 1YJ9V 4QGPA 3QVNA 5J2UB 1M1KW 5IYZA 4I5SA 4CS2A 2LGWA 2KG7A 3CCQV 1N34B 2QWQB 4FJCC 1XUQA 4P30A 2P4KA 1WB7A 1XREA 2YXLA 4E2LA 1NJIW 4PD4F 5HFLA 3UM7A 2AHZA 2X0LA 4X66O 1NTKH 1GN6A 4X64B 1FXKC 3CXCU 2NLJC 2DQ0A 2V7QG 2OYQA 4DUYB 1ZL8A 2YICA 3TJTA 4EFEA 2ZXWC 3ABUA 2BOCC 3RYHB 3ASOC 4NB5A 3K06A 5JH7A 1MABG 1H8EG 1IBLO 3JD3A 2BSKB 3E89A 3FX7A 3DC5A 1J95A 3AG3C 4J11A 4JZ2A 2R9RB 4OXSA 3EFFK 4CZZA 4DUYO 2RMKB 1SA0B 3BAAA 5BZBA 1E79G 2ZNIA 4JI5B 1PKXA 2Z5UA 1YZBA 4RUFA 3LNNA 1VIBA 4D7TA 2XAGA 4TOIA 5EZYB 4JI7O 3RYCA 3RN4A 2JGDA 4I55B 5LHHA 1SQGA 2UUBO 4AILC 2OCCB 4O4IA 3GWKC 1K97A 4RUEA 1IXBA 1N32O 1H2GA 2P06A 3JD4A 4K35A 2ZNJA 3K5LA 3OTFA 5KX5B 1VQ9V 4GKKB 4WFGA 3ZHTA 3DGEA 3QNEA 1H8HG 2F4VO 2RQ6A 1WJZA 1NH2D 4Z2WA 2PI5A 4X8AA 2OIEA 5KX5A 4KUMA 2GV9A 4JI8B 5IJ0B 3N2KA 1S5LZ 1K34A 1PP9H 3HKCB 1KKCA 4YY3O 1UPGA 4ZHQA 1M57B 1XEQA 4I0XB 3K9AA 1DLBA 2B9ZA 1WA8B 2YEVB 4LC1A 1QLNA 4JI5O 2GHYA 2DYSB 3ZX6A 3BCCH 3JSLA 3CCJV 3QO8A 4EB6B 4JAVA 5BMVA 2CGNA 2HR3A 2LP7A 5CB4B 4QNHB 4I7ZB 5DECA 2KB1A 1JJ2U 1QR9A 1JFFB 4LBEC 1SKVA 1NTZH 2EINC 4MVOA 4IYIA 4X65O 2VQEO 3IC9A 3ABTA 4X65B 3HR0A 1ZLZA 3APQA 3OUSA 2QM4A 2XUMA 4JYCA 2WSSG 5LGTA 3A0BZ 2QGNA 5A2QN 1WP8A 5LOVB 1FXHA 4LFAO 4NTYA 4WFAV 4ZKIA 1URFA 5IJ9A 1ZL8B 3ZRWA 2HKOA 5CMUA 1FXKB 2ZM6B 2DN9A 4BIUA 3HPLC 5KA5A 4WBNA 5IYDO 3CJHA 1Q7YW 3JASA 5F2VO 4U7OA 2B1IA 2UXXA 2ZE7A 5LP6C 2Y4UA 2IH3C 4JI1O 3JSNA 5LP6A 4OX9O 3AG1C 3BPZA 2K9PA 1NS1A 2JS5A 4U7NA 3JCZA 1H2LA 1RSOA 1PV0A 1R6KA 3FD9A 3WB0A 2AGAA 1Y76A 4DUZB 2VWJA 1YJWV 3HKBA 4HYOA 4I50B 4X1YA 3P3NA 3UO3A 3D8CA 1K73W 2FL4A 4DR6O 3OAAG 1SQVH 3W7UA 3BY6A 4DV1O 1SQBH 3CCMV 4DXWA 4DK1A 1OCRC 2WLIB 2LJ2A 1IX9A 3MD0A 1JJOA 1XNRB 1W0JG 4JYAB 3CRCA 2H3OA 5JJEB 3BFRA 2Q0AA 4HBNA 5E1AC 1LR1A 1PNMA 2WAMA 2UUBB 1BE3H 1M93A 3T4ZA 4Z1VA 1K5SA 1SQQH 2E5LB 2ZD9A 1TUEB 3L71H 3ZS8C 3FB6C 4J7ZA 3RYIB 1QLEB 2PYJA 1I5XA 4F4LA 4LF6O 2ILMA 4F6EA 3VQXA 1S72V 3CCSV 5B3SB 1WPXA 2DOSA 4HNAA 4ZIBA 1VQ4V 1SETA 2BTOA 2IW5A 3JYCA 4ZI7A 3FYEB 2W6IG 1GKFA 2WLKA 4FZ1A 1M56C 4DV0B 3HKDB 5KUMA 2CK3G 1NBMG 4NTWA 4B3TO 3FB5C 3WG7C 4DYLA 3SPIA 3AG4C 2YI8A 3CS5A 3CSXA 2QM8A 1YEWA 2IJHA 4J41A 3D3IA 4MTGA 3CC7V 5B66Z 3CCRV 3DSQA 1EZJA 1DF5A 4MW3A 1M5IA 1KC8W 4JYBA 4WBNB 2OT5A 1KP3A 2UU9O 3AG2C 2ZQMA 1FXKA 1SERA 1SQXH 4LNUB 4LF8B 5B1AB 4MW8A 2Q73A 4G28B 2HP8A 4UVCA 2YUAA 3LDEA 2Y4TA 3QTCA 3H1HH 1Z5WA 2X6AA 4X66B 1OJHA 4K8ZA 3A0HZ 2BTQB 1T5EA 2H94A 2Z0AA 1EN4A 1R6TA 4NR1A 1O9HA 5JWPA 4PHZA 4DR3O 1KP2A 1JOYA 4UVBA 3JAWB 1JMKC 4MVZA 3N2GA 1F4NA 4DV6B 4O2BB 4GKKO 1WPBA 3VQYA 3K03A 5B1AC 2M6YA 2WWWA 1X59A 2PYLA 1Q6IA 4JI0O 1G4YB 1JPXA 1MZFA 3IGAC 1DGSA 3STZC 4CS4A 1OV9A 3JD0A 2AW9A 1M90W 2DJVA 1R3JC 5CA0B 4B3MB 2AXTZ 4DV7O 2R72A 1FD9A 1W0KG 1KBHA 3IJ4A 5IJ0A 1MSWD 4IL6Z 1J5EO 3BVOA 4IGGA 3SPHA 1VMGA 2Q0OC 1VQOV 1N36O 4MTXA 2GTAA 2QR4A 2NN4A 1VQNV 4LWSB 1CP9A 1V55C 1SS3A 3B40A 4DV7B 2HEPA 1GN3A 3G6BA 1MG1A 4UCVA 3JAKA 1P49A 2Q5ZA 4TUYA 1IVSA 4I55A 2F93B 4GKJB 1ZX3A 1QLEC 5JJNB 3OT7A 4UCOA 2GUZA 3ASNC 2JGUA 1M57C 1F23A 3STLC 3CXHF 1M56B 1JR9A 3CB2A 1BHBA 1I94B 1PL4A 5KUKA 4NVPA 5KLVH 3GWOA 5L3EA 1KKDA 5L3FA 5JCOC 4RQEA 1QQCA 3B77A 2CE4A 3B09A 1BSMA 1NKDA 3FYIB 1NR1A 3JAWA 1R1BA 2BSKA 3OW2U 1GN2A 2HJDA 3HKDA 1I94O 5FPOA 4U3JB 3ZEDA 2W6JG 3F7YC 2EILB 4H33A 1NU1H 4JI2B 5IWAO 5LMNO 1NVPB 1BZKA 1DTOA 4GT1A 5KHKA 2ZR2A 4UXNA 2N04A 1XMQB 3OM3B 1X4TA 1YDXA 5GTHZ 3CPWU 3QO5A 4K3AA 4LNUA 1SQPH 4FLVA 4FLUA 3LSSA 2DWEC 3ZRVA 3GVMA 1FXVA 5JQGB 1FFTB 3UT5B 3ZHSA 1R3LC 5D5QA 2OCCC 2CDYA 2Y0PA 5K1PA 4MTFA 3GB7C 4NXMO 2JRIA 5CBFA 5IWAB 5LMNB 1RM1C 4QJFB 2UXBB 4PA3A 3EVKA 4U3FH 4FLTA 4GUNA 3FAVB 2G38A 1CXZB 1YIJV 1FJGO 4DV4O 5LL6Y 1B06A 1UJWB 4FLXA 3WB1A 2YIDA 1CEZA 5E79Z 4JI7B 3J7AU 4F6RA 1OCZB 3CP1A 2QWOB 3AG7A 4MVUA 4I50A 3OR6C 4X1YB 3WG7B 5LHIA 2V1DA 1NR7A 3K59A 1RM1B 3G80A 1GTOA 5KA6A 4JTAB 4PV1B 5IY5B 4LF8O 5B1BB 5D5PA 4IIJB 4JYAO 1GK9A 4OX9B 1TAEA 3K57A 4PA4A 2KSDA 3G6EV 1SZXA 4IIJA 3CRAA 2E3CA 4DR7O 1Y74A 1K4CC 1GH6A 5LYJB 5IT9N 2Q4PA 2YIAA 1AP6A 4H44B 1Q5OA 5EYPB 2RCVA 3L74H 3ICXA 2EIKC 2YS8A 4IHJB 4PDVA 1I08A 3ETQA 1TUBB 4UV8A 2EBOA 4PA7A 4CC5A 3K0DA 5LOVA 2ZIOA 2ADQB 1F4MA 1IZ3A 4P9PA 3UO2A 4BAYA 4JPRA 4MVMA 2P4VA 1VP7A 5CA1B 4FVMA 1V9PA 3OMAB 3FAVA 3HKBB 1XQ8A 1RPOA 4Q6GA 4EKWA 4LF5B 2YC0A 2KKWA 1GM9A 2JK5C 4PI0A 5H6QA 3OMNB 3ABMC 3CRMA 4JV5O 3CWBH 4KXRA 1Y6XA 1BGYH 1HP8A 5JQGA 1FPOA 1A32A 3RYFB 4B3SB 3DXRB 4EB6A 3JD2A 4LFBB 5J2TB 3PJSK 3OEHG 3HB3B 5JVDB 4BW5A 3CMEV 4QIWF 1OCOB 5IY5C 3ETEA 2UUCB 4CS3A 3ZCCA 4JI6O 4H37A 4UV9A 2JJ2G 4CH5A 1L1FA 1YI2V 1F51A 1KQSU 3WB2A 2XAHA 4I0XA 1HNXB 4DRXB 1LUVA 1Q6UA 5CBHA 5IJ9B 3K0GA 4NXNO 1US6A 1YTFD 4LH6A 2PUSA 3K5OA 2YDEA 3X2QB 4PDMA 3H1KH 1JQ0A 3JD1A 1Y67A 4P2ZA 1I0HA 2WLJA 2E5LO 1JX9A 4DW1A 4BIOA 3T1CA 4N21A 3WFVA 4O4JB 1Q3EA 4X9QA 3DTUB 3E35A 4WFHA 2YSUB 1H2NA 1YTFB 2GTSA 2N05A 5CB4A 4H0LB 2JGDB 1SESA 5BMVB 5BXZA 5FNVA 1FKAO 2VQFB 1XHZA 4B3MO 1SQFA 4TV8A 2LQTA 3CCVV 1B04A 2UXNA 2D3OW 3WU2Z 1RP3B 3KG2A 4JI4O 3BA9A 2IU0A 2OWOA 3OTOO 4DR6B 4J9YB 2EIMB 1Q82W 1BT8A 1I5YA 1XNRO 1QHTA 1EM1A 4YXWG 3T2MA 1WB8A 3IC7A 2Q7EA 2F66C 1O9GA 2YIBD 1OCCC 4J10A 1KB9F 1QVFU 2CTPA 1BMFG 3ZMTA 3RGBA 1R6NA 2XTAA 1GMGA 4GCZA 1V54B 2CGOA 4G27B 4BIZA 2ZKOA 1QBZA 3BA8A 4LF6B 3UKMA 4KHPB 4Z1MG 4LF4O 5JCOA 3AK3A 3OFNG 4PELA 5C93A 1K92A 3E8BA 3UCSC 4R6ZA 1Z2GA 1ROPA 4TQFA 2QTOA 3CX5F 3VBBA 5IE9A 4W4KA 2E75B 4GKJO 2LFSA 4TUYB 2QWRB 3AG2B 4GZRB 2M7WA 1V54C 1ZWIC 4LF7O 4J42A 2P22C 3B4SA 2R9IA 3K9SA 1BHAA 1JA8A 4UUJC 4QE7A 2P67A 4YHHB 1ENVA 2ADPA 4WFFA 4A5UB 3RYHA 3LUTB 2YI9A 3AG4B 4X1KB 2EINB 4TV9A 4C7UA 2IH1C 4DRXA 3SJQC 2QKCA 5DEDA 4BW9A 1EZVH 1K9MW 2H8PC 3JAMN 4UCSA 3KCXA 1RPRA 2JJ1G 5JVDA 1K33A 4YHHO 2QE7G 3D36A 1NQTA 1G6UA 2F1MA 2IU3A 2MW2B 2FB5A 1AR1B 2X6CA 2ARHA 3PN1A 2KG7B 4O2BA 3N2GB 1I7FA 2LW7A 1N32B 3A2FA 4UCTA 3G71V 2ITCC 2UXCB 3ZMVA 2NR5A 5IDJA 2XAFA 4XDKA 1YITV 2DQ3A 4ABMA 4XBFA 2QJ1A 3IAYA 4LF7B 3RVZA 3CC2V 1KU9A 5LGNA 1S5HC 4ZOLA 3ZMZA 2ZIMA 3QO7A 2DYRB 4X64O 2Q68A 4KP4A 3SGIA 3JATB 4PI2A 3RYIA 4NYKA 1H2MA 4B3RO 3I5DA 3APOA 1S5JA 4LF9B 3ZHVA 1KD1W 2VQEB 4BR6A 1GO3F 2VS0A 2A06H 3S3WA 4KHPO 4LH7A 1G1XB 1AJPA 1K3EA 2P5OA 1HNZO 3ETGA 2X7RB 1TGOA 1WAZA 2Q9LA 4LF5O 5C8YA 2IBZH 4JI8O 4LF9O 3AK1A 1ZAUA 4B3RB 4B3TB 1AJQA 1F7YA 4NKGB 2WLNA 1AJNA 2X6BA 1XL6A 4WFEA 1IBMO 4HAMA 3E8FA 3BABA 1OCZC 2P7TC 3L9DA 3F5WC 2DW4A 2FTKA 1IURA 3H01A 1AR5A 4B3SO 1GM8A 1NVPD 3CCUV 4AHCA 4WF9V 4CBCA 4JZGA 3CD6V 3B8MA 2E74B 2FMLA 4QE9A 4LCUC 1Y76B 3KCYA 4MVSA 4DO2A 3CRQA 1K8AW 1BCCH 3ZBHA 1N34O 2P6JA 5KAIZ 4D7SA 2O57A 2PTMA 4GLXA 3P32A 4R7CA 4DV2B 1S76D 1AILA 1U97A 1AB3A 3JASB 5GTIZ 3OUFA 3BRCA 1LNQA 3L75H 1LUWA 2WLHA 3SYQA 4YY3B 1VQPV 4X1KA 2UUCO 5LGUA 3RFRA 1D5NA 3T1HB 3ZMSA 1P7BA 2EJ7A 1FJGB 1M9NA 5A9GA 2VRZA 2OTLV 3E22A 1VQ6V 4ZOLB 2RJZA 2K1EA 4DV3B 3E8HA 2Y48A 4JI6B 3JARB 1MNGA 1JFFA 1FFXA 2ZR3A 5EBLC 4P9OA 4O4HA 3O65A 3TXSA 4ICGA 2PF4E 4FLZA 4JI4B 1U96A 3W7WA 1RSOB 3ZHUA 2B1GA 3FKSG 2WPDG 3SYCA 1WP7A 4NXNB 2WA3A 3RWRD 1AI7A 3TK1A 2HHHB 4MT8A 4DV3O 1MSDA 4FFKA 4O4LA 2QWNB 3LSQA 4DR2B 1NH2B 4DV5O 5EC2C 1D5AA 2Y69B 4DW0A 4FZ0A 2Q7GA 1AROP 2EIKB 3THOA 3SYAA 3ZRWB 2GUZB 1SRYA 2QKAA 4D6TH 4X88A 3HKCA 2V4DA 5KAFZ 2QTSA 3FB8C 4R8CA 2F43G 3CRRA 1HNWO 1IXMA 4PA9A 1AP5A 3ABKB 4E4EA 4J9ZB 2FYUH 3ETDA 1VQ5V 1WNSA 3AEIA 4FMTA 1YSCA 5DM6V 4X20A 1SF9A 4ZBMA 4PDRA 3OGIB 1XOUA 2HJFC 4YJ2B 2JEUA 2UXCO 2UXDO 5EIBC 3JALB 1YJNV 4O4IB 4JYYA 1PM9A 2PGGA 4OGQB 2PI4A 1FAFA 4AI8A 2DWDC 2JDIG 2LW1A 5CA0A 5KHIA 2ZDIA 1VF5B 3SPGA 2RNBA 1FS0G 4X1IA 1HW7A 1WA8A 2EIJC 5L3DA 3BEHA 3MAQA 3IFXA 4ZHQB 3MDSA 4RO2A 5LA6B 3SDLA 1QCEA 1VF6C 4GX1A 3N2KB 2P90A 2HHHO 3F5TA 1YVWA 4QPKA 4JI3O 4J80A 1RFYA 2W0XA 1ZTEA 5L3CA 3EXAA 1NT2B 1HNZB 4EEQA 1AVMA 2AHYA 2EIMC 4KL1A 3OGCC 3SR2C 2DE0X 4XDLA 1XMOB 1KUQA 1QR8A 1VQLV 2HVKC 1SC5B 3LSUA 5FPRA 4UCUA 1L0LH 3SYPA 1XMQO 4FFBB 5EZYA 4K0KB 1HNXO 1OHHG 1N33O 4O4LB 3DXRA 2JVDA 3RYFA 2N74A 2XAJA 1XMOO 1G8MA 1QNMA 3W7TA 2XT9A 5BR8O 5H9CA 3K5MA 1HDJA 2IJIA 4PA6A 5IYZB 4O4JA 1V55B 1FFXB 4TSFG 5KMGB 3JARA 1XL4A 5LHGA 4JF3A 2Q8VA 1OZ0A 1GN4A 1PNLA 3EHBB 4JV5B 1TVKB 4DR1B 5K1XA 4LFCB 3G67A 1PPJH 3BHPA 4UCRA 1IBLB 2YIBA 3ZN1A 1MZEA 3L72H 3CCEV 1N0NA 2WLMA 4UB8Z
chains in the Genus database with same CATH topology
3ASOB 1B6QA 3ZIAG 4KFMA 2QTOA 3RBZA 3VBBA 4GX5A 3K3WA 1KP2A 2XAQA 1JOYA 3RVYA 2HVJC 4UVBA 3E8GA 2IJJA 2LFSA 3E2EA 4MVZA 5L3BA 1F4NA 2WLIA 3ZMUA 3MHSC 3AG2B 3K03A 5B1AC 4LP8A 3MHHC 1PD3A 1THZA 2WWWA 2EJRA 2LFRA 1R73A 2M7WA 5CA3A 1V54C 1ZWIC 1AI6A 1G4YB 1JPXA 2R9IA 3OMIB 2QM7A 3IGAC 4MTOA 5L3GA 1YHQV 1BHAA 4UUJC 3STZC 4QE7A 2DYSC 3JD0A 5EK0A 2P67A 4JTDB 1M90W 1ENVA 4WFFA 1VQ7V 1R3JC 3LUTB 5EC1C 1BL8A 2EILC 1GM7A 3AG4B 3W7XA 1S3JA 1W0KG 2EINB 2IH1C 2JIZG 1K5QA 1YJ9V 1MSWD 5DN6G 3SJQC 1M1KW 4I5SA 1K9MW 2H8PC 3CCQV 3SPHA 1RPRA 2JJ1G 4FJCC 1VQOV 2GSMB 5CBGA 1K33A 4P30A 2OTJV 4MTXA 2QE7G 4E2LA 2B5UA 3D36A 1NJIW 1NQTA 5HFLA 3UM7A 3SPCA 1VQNV 2AHZA 2X0LA 2IU3A 4WFBV 1CP9A 1V55C 4GX2A 1AR1B 2X6CA 2JEXA 1CPYA 1OCRB 4G2KA 1FXKC 2Z3YA 3CXCU 2NLJC 1MG1A 2BOBC 2DQ0A 4MVRA 3G71V 2V7QG 1K4DC 2ITCC 1Q86W 4XDJA 5B1NA 3ZMVA 5IDJA 2ZXWC 1PL0A 2XAFA 4XDKA 1YITV 2DQ3A 1QLEC 1W2BU 3ABUA 4XBFA 2BOCC 3ASNC 1M57C 1F23A 3RVZA 3CC2V 3STLC 3ABMB 3ASOC 5LGNA 3AG1B 1S5HC 3K06A 5EBWC 1M56B 1MABG 1H8EG 1BHBA 3JD3A 3ZMZA 3E89A 5EBMC 2A79B 3QO7A 2DYRB 5KUKA 1J95A 4UVAA 3AG3C 4ASUG 2Q68A 2R9RB 3GWOA 4KP4A 3P30A 5L3EA 4OXSA 3OEEG 1KKDA 5L3FA 1DF4A 4RQEA 3EFFK 2HG5C 3B77A 4CZZA 1NKDA 3FYIB 1KD1W 1NR1A 5BZBA 1GO3F 3OE7G 1E79G 3OW2U 1PKXA 1SZTA 2Z5UA 3LDDA 3W7SA 4RUFA 2A9HA 1AJPA 1K3EA 1OCCB 5J9PC 2W6JG 3ETGA 2X7RB 2EILB 3F7YC 2XAGA 4H33A 3VOUA 5IYBO 4TWKA 5LHHA 1NVPB 1DTOA 4GT1A 2OCCB 2ZR2A 3CYOA 4UXNA 1VQ8V 1AJQA 1WLEA 2WLLB 1H38A 3OM3B 4JTCB 2WLNA 5CN0A 1K97A 4RUEA 3CPWU 3QO5A 4RQFA 1AJNA 1H2GA 2X6BA 1XL6A 3JD4A 3SPJA 4WFEA 3LSSA 2DWEC 3ZRVA 1VQ9V 4HAMA 4WFGA 3E8FA 1FXVA 1OCZC 2P7TC 4R50A 3DGEA 3QNEA 1H8HG 3F5WC 2IJKA 1FFTB 2DW4A 2FTKA 1R3LC 5LBQA 1NH2D 2OCCC 3F7VC 3H01A 2PI5A 1GM8A 4MTFA 4X8AA 4KUMA 3GB7C 3X2QC 3CMAV 1NVPD 3CCUV 3LDCA 5CBFA 1Q81W 4WF9V 3K79A 1K34A 1RM1C 4CBCA 5GW7A 4QJFB 4PA3A 3CD6V 3B8MA 3ASNB 4QE9A 4LCUC 4MSWC 2YEVA 1M57B 4MVSA 2H94A 3K9AA 1DLBA 1AI4A 2YEVB 4LC1A 1QLNA 3CCLV 1YIJV 4DO2A 2GHYA 1K8AW 2DYSB 1EFRG 1UJWB 2P6JA 4I9WA 4JASA 1QVGU 3CCJV 3QO8A 1CEZA 2Q6AA 4JAVA 3P32A 4R7CA 1S76D 2HR3A 1S0VA 1OCZB 3CP1A 1ORQC 2LP7A 4QNHB 3OUFA 1LNQA 2WLHA 3SYQA 4MVUA 3OR6C 4X89A 3WG7B 2KB1A 5LHIA 1JJ2U 2V1DA 1NR7A 1QR9A 1RM1B 1AI5A 1GTOA 4LBEC 4JTAB 5KA6A 4MVOA 1VQPV 2EINC 5IY5B 4PDLA 5LGUA 3G4SV 3R65A 5B1BB 1JVMA 3ZMSA 1P7BA 3ABTA 2XNDG 4JAUA 1M9NA 2Q67A 4FPPA 3OUSA 2OTLV 4JYCA 1GK9A 5B1OA 3FB7C 2WSSG 1VQ6V 5LGTA 1E1RG 4PA4A 4TT3G 3ZN0A 2K1EA 3G6EV 3E8HA 1FXHA 2Y48A 4WFAV 1PNKA 2QA4V 1K4CC 4ZKIA 4JGSA 4FIPC 2ITDC 2ZR3A 5EBLC 4P9OA 2HKOA 3TCUA 5CMUA 3ZRWA 1FXKB 1VQKV 2EIKC 4N23A 3HPLC 1K7DA 4BIUA 5KA5A 3W7WA 2NNUA 5IYDO 4QPJA 4PDVA 2B1GA 3FKSG 1Q7YW 2WPDG 3SYCA 4U7OA 1AI7A 3I56V 3TK1A 2B1IA 4UV8A 2EBOA 2UXXA 4MT8A 4PA7A 2IH3C 2C2AA 2DYRC 3K0DA 3LSQA 2QKSA 3ZJZA 1NH2B 1F4MA 4P9PA 3AG1C 2EZOA 2XOKG 4BAYA 5EC2C 1Y66A 3ML0A 4JPRA 3K04A 4MVMA 2Y69B 4U7NA 1AROP 3JCZA 2HLDG 1R6KA 2EIKB 3OMAB 5HFMA 2ZDIC 4MS2A 3SYAA 3B8NA 3I55V 3ZRWB 1RPOA 4EKWA 2ZXWB 1SRYA 3E86A 4X88A 1YJWV 1GM9A 2JK5C 5H6QA 3OMNB 3ABMC 1EBOA 2W0FC 3FB8C 4HYOA 4R8CA 2F43G 1IXMA 2EZPA 4PA9A 1K73W 3ABKB 3OAAG 4J9ZB 2XASA 3W7UA 3BY6A 3E83A 3ETDA 1VQ5V 3K08A 4WCEV 3AEIA 4FMTA 1YSCA 3JD2A 5DM6V 3CCMV 3PJSK 3OEHG 3TETA 3HB3B 4BW5A 3CMEV 4QIWF 4DXWA 1OCOB 5IY5C 3ETEA 4ZBMA 2WLLA 4PDRA 3ZCCA 4H37A 1OCRC 2JJ2G 2HJFC 2WLIB 4UV9A 1L1FA 1YI2V 1F51A 1Y4MA 1R3KC 2JEUA 1KQSU 2A0LA 5FL7G 3MD0A 1YJNV 2XAHA 1W0JG 2PI4A 5CBHA 3SYOA 3K0GA 3LNMB 2DWDC 2JDIG 1YTFD 4FK5C 3X2QB 4PDMA 1N8RW 2ZDIA 5E1AC 1JQ0A 1PNMA 2WAMA 3JD1A 3SPGA 1FS0G 3T4ZA 3ABKC 2EIJC 1K5SA 4P2ZA 5L3DA 2ZD9A 1TUEB 3BEHA 3IFXA 3ZRXA 2WLJA 3T4DA 4RO2A 3FB6C 1JX9A 1E1QG 1QCEA 4GX1A 1QLEB 1I5XA 4RAIA 4F4LA 2P90A 4N21A 3T1CA 3WFVA 1OCOC 4QPKA 3DTUB 3E35A 1S72V 3CCSV 4WFHA 5B3SB 2YSUB 1R3IC 1WPXA 2QEXV 1YTFB 5L3CA 1VQ4V 2EIJB 5H6RA 3ZRSA 1SETA 1SESA 2AHYA 2EIMC 3OGCC 4XDLA 2IW5A 1P4RA 3JYCA 3FYEB 2W6IG 1GKFA 1QR8A 3OR7C 2WLKA 1VQLV 2HVKC 1M56C 5KUMA 2CK3G 1NBMG 3SYPA 3CCVV 3NXSA 2UXNA 1COWG 2D3OW 3A0RA 3KG2A 3FB5C 3WG7C 2IU0A 3ABLC 3CC4V 3SPIA 3AG4C 2QM8A 4J9YB 2EIMB 2MK3A 2IJHA 1Q82W 1I5YA 3D3IA 4MTGA 4YXWG 3T2MA 3CC7V 1OHHG 3CCRV 4L87A 3IC7A 1EZJA 1DF5A 5B3SC 4GX0A 2XAJA 4MW3A 1G8MA 1KC8W 4JYBA 3W7TA 2Q69A 1OCCC 2ATKC 2OT5A 5H9CA 2IJIA 4PA6A 1HWYA 1KP3A 4Q20A 1JCHA 2ZQMA 3AG2C 1FXKA 1QVFU 1BMFG 3ZMTA 1SERA 1V55B 4TSFG 5B1AB 1R6NA 4MW8A 1S77D 4G28B 5B1BC 3M99B 4UVCA 1GMGA 3LDEA 1XL4A 4GCZA 4HZ3A 1V54B 5LHGA 4G27B 2HFEC 4JF3A 1OZ0A 4BIZA 1MOFA 1PNLA 3EHBB 5IYCO 1QBZA 2X6AA 3UKMA 3ABLB 4Z1MG 2Y69C 1KECA 4MVQA 3RW0A 3OFNG 3ZN1A 1VQMV 4PELA 3AG3B 1K92A 3E8BA 4R6ZA 2WLMA 5C93A 3CCEV 1ROPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 V;  1YHQ V;  1YIT V;  3CCS V;  3G4S V;  1QVG U;  3CCJ V;  1N8R W;  1VQK V;  4WCE V;  3I55 V;  1VQO V;  1W2B U;  1VQ5 V;  2QEX V;  3CC4 V;  2OTJ V;  5DM6 V;  1VQ8 V;  3CCM V;  3CMA V;  1M90 W;  1NJI W;  1KD1 W;  3CCU V;  1VQ4 V;  3CME V;  1Q7Y W;  1VQ7 V;  1Q82 W;  1Q81 W;  1YJW V;  2OTL V;  3CC2 V;  1VQN V;  4WF9 V;  1YI2 V;  1VQ6 V;  3I56 V;  4WFB V;  3OW2 U;  1QVF U;  3CC7 V;  1KQS U;  3CPW U;  3CD6 V;  3CCR V;  1YJN V;  3G6E V;  1VQL V;  3CXC U;  1YJ9 V;  4WFA V;  1KC8 W;  2QA4 V;  1JJ2 U;  1VQ9 V;  1M1K W;  3CCL V;  1R73 A;  1YIJ V;  1K73 W;  3G71 V;  1Q86 W;  1VQM V;  1K9M W;  3CCV V;  1K8A W;  3CCE V;  1VQP V;  2D3O W;  3CCQ V; 
#chains in the Genus database with same CATH topology
 3ASO B;  1XI1 A;  3SJC C;  3ZIA G;  4KFM A;  4LFB O;  3RBZ A;  5LMU O;  4FM0 A;  2UU9 B;  3E8G A;  4B7K A;  2IJJ A;  4IHJ A;  3E2E A;  4OPA A;  4I4T B;  3SJA C;  3MHS C;  3NR7 A;  4LF4 B;  4CH6 A;  1PD3 A;  1THZ A;  5LYJ A;  2KQX A;  2EJR A;  2LFR A;  1R73 A;  2FKX A;  1AI6 A;  3OMI B;  3AK2 A;  3VQW A;  1MMM A;  4MTO A;  5L3G A;  3KZI Z;  1YHQ V;  3C90 A;  2DYS C;  1N36 B;  2IM9 A;  2WA4 A;  2RDC A;  5J2U A;  5EC1 C;  1HR0 O;  1BL8 A;  2EIL C;  1N4C A;  1GM7 A;  4UB6 Z;  3U11 A;  3W7X A;  1S3J A;  2R70 A;  2JIZ G;  1P84 F;  2CH7 B;  3Q4H B;  5DN6 G;  2ODM A;  2GBO A;  3C3S A;  4I4T A;  5CA1 A;  4OPH A;  4RWU A;  3VQV A;  2GSM B;  5CBG A;  3T1Y B;  2OTJ V;  4F6R B;  1NI8 A;  2B5U A;  1XIL A;  4O2A A;  3SPC A;  3M7M X;  2CTW A;  4WFB V;  1TUB A;  4GX2 A;  4AQY B;  2A7W A;  2JEX A;  1HR0 B;  1CPY A;  1OCR B;  4G2K A;  2Z3Y A;  2BOB C;  4J7J A;  4MVR A;  3FFQ A;  5EYP A;  1Q86 W;  1K4D C;  4XDJ A;  2CH7 A;  5B1N A;  1PL0 A;  5FLX N;  1BQZ A;  2OCH A;  1W2B U;  1Y74 B;  2JS3 A;  2ETN A;  5KMG A;  4X62 O;  2YXH A;  3ABM B;  1FYJ A;  2CAZ C;  4W4L A;  3C3T A;  3AG1 B;  2L35 A;  5EBW C;  1XBL A;  5EBM C;  5LP6 B;  2A79 B;  4UVA A;  4ASU G;  4AQY O;  3P30 A;  3OEE G;  1VF6 A;  1QU7 A;  1DF4 A;  2ZE6 A;  2HG5 C;  1M4U A;  1N0J A;  2QSA A;  3OE7 G;  1L8D A;  1SZT A;  3LDD A;  3W7S A;  2A9H A;  2PZS A;  1AR4 A;  1OCC B;  5J9P C;  5H5N A;  4DV2 O;  3VOU A;  4DUZ O;  5IYB O;  4TWK A;  2QDO A;  1TVK A;  3CYO A;  1VQ8 V;  1J5E B;  3B2E E;  1WLE A;  2WLL B;  2ZT9 B;  4JTC B;  1H38 A;  5CN0 A;  4K8X A;  4RQF A;  4K0K O;  3SPJ A;  1TA8 A;  4NTX A;  5LA6 A;  3JCU Z;  4R50 A;  1H2K A;  2IJK A;  3UT5 A;  5JJJ B;  5LBQ A;  5GON B;  3F7V C;  2ZCE A;  3ZHR A;  3X2Q C;  3CMA V;  3LDC A;  4JI2 O;  3J81 N;  1Q81 W;  3K79 A;  1Q90 D;  5GW7 A;  4TV9 B;  1IBK B;  2RN9 A;  3ASN B;  2CTR A;  4MSW C;  1YXB A;  2YEV A;  4FFB A;  3SJB C;  3P3P A;  3CEI A;  1YCI A;  1AI4 A;  2Y0I A;  4IT5 A;  3CCL V;  1KYO F;  4YJ2 A;  2AZ2 A;  1EFR G;  1VF7 A;  4I9W A;  2UUA O;  4JAS A;  1QVG U;  1GAX A;  1GRJ A;  2Q6A A;  1Q8I A;  4U3J A;  2AZ0 A;  1ZUQ A;  4UFZ A;  3U0Z A;  5H2F Z;  1S0V A;  2OIG A;  1ORQ C;  5BR8 B;  4DR7 B;  2GDS A;  5ITZ B;  2F23 A;  4X89 A;  1YF2 A;  2D2C B;  4DR5 O;  1AI5 A;  2BE3 A;  3H1J H;  2UUA B;  2BCC H;  4PDL A;  3G4S V;  3R65 A;  1JVM A;  2DMX A;  2XND G;  4JAU A;  4H13 B;  2Q67 A;  4FPP A;  4DV1 B;  1KMI Z;  4X1I B;  5B1O A;  3FB7 C;  1BS3 A;  1NTM H;  1E1R G;  1Q43 A;  3RYC B;  4TT3 G;  3ZN0 A;  1EN6 A;  3RT3 C;  2VQF O;  4LR3 A;  1PNK A;  2QA4 V;  4JGS A;  4FIP C;  2ITD C;  3TCU A;  3JAL A;  1Q6H A;  4DK0 A;  1VQK V;  3JAK B;  4N23 A;  1K7D A;  3CHX A;  5ITZ A;  1D2D A;  1SA0 A;  2NNU A;  4QPJ A;  4GYC B;  4X20 B;  4LWS A;  3I56 V;  5EIB D;  2C2A A;  2DYR C;  3DC6 A;  2QKS A;  4B7E A;  3ZJZ A;  2BTQ A;  2EZO A;  3A8T A;  2XOK G;  4JI1 B;  3K5N A;  1Y66 A;  3ML0 A;  2UXB O;  3K04 A;  3E22 B;  3R66 A;  5JH7 B;  4FLW A;  2HLD G;  5HFM A;  2ZDI C;  4MS2 A;  4CH3 A;  3B8N A;  3I55 V;  2ZXW B;  1DK1 A;  3H1I H;  4TV8 B;  4TQD A;  3E86 A;  4DV4 B;  4L8J A;  4YIO A;  1EBO A;  2W0F C;  5FNV B;  2EZP A;  2VWK A;  2XAS A;  1L0N H;  3E83 A;  4J7K A;  4NXM B;  3K08 A;  4WCE V;  3U10 A;  3QG5 A;  3TET A;  5AG2 A;  3H9V A;  3UQ8 A;  2WLL A;  4LFA B;  1Y4M A;  1R3K C;  2A0L A;  5FL7 G;  2R9A A;  4DV6 O;  1VAR A;  4O4H B;  1HNW B;  3SYO A;  2YXY A;  4DR1 O;  3LNM B;  5KHG A;  1EN5 A;  1B3Q A;  3T1H O;  3ZHQ A;  4FK5 C;  4ZI7 B;  4JI3 B;  2CUG A;  5KHH A;  1N8R W;  3H1L H;  5BY1 A;  2CTQ A;  2PY5 A;  3OD4 A;  3CE2 A;  3ABK C;  3D3Q A;  2XHB A;  4IYH A;  4YJ3 B;  4DV0 O;  3L73 H;  1MA1 A;  1WN7 A;  3ZRX A;  4DV5 B;  3T4D A;  1ZSP A;  2LO1 A;  1BQ0 A;  1E1Q G;  4RAI A;  2UXD B;  4LFC O;  5J2T A;  1IBK O;  3T1Y O;  1OCO C;  3L70 H;  3D36 C;  5GON A;  4I9Q A;  1R3I C;  2QEX V;  3HKE A;  2EIJ B;  5H6R A;  3ZRS A;  2QWP B;  2ZE5 A;  4JI0 B;  3TGU H;  1P4R A;  3OR7 C;  2EUL A;  1XNQ O;  4YIP A;  3NXS A;  3OTO B;  2ZM6 O;  1COW G;  5LXT B;  3A0R A;  3ABL C;  3CC4 V;  5TIS Z;  5B5E Z;  4X62 B;  2Q7H A;  2MK3 A;  4BWA A;  4L87 A;  4DR2 O;  5B3S C;  4GX0 A;  4HNA B;  1XHX A;  3N27 A;  1IDS A;  1W59 A;  2A3Q A;  2Q69 A;  2ATK C;  5LMU B;  4CH4 A;  1HWY A;  4Q20 A;  1JCH A;  4FM1 A;  4FLY A;  4B08 A;  1S77 D;  5B1B C;  3M99 B;  4HZ3 A;  2LGQ A;  5LXT A;  2HFE C;  1MOF A;  5IYC O;  1Z5V A;  1NZ6 A;  5C8Y B;  3ABL B;  2Y69 C;  2ZIN A;  3K58 A;  1KEC A;  4MVQ A;  3RW0 A;  1N33 B;  4DR4 O;  1VQM V;  2ZE8 A;  3AG3 B;  3KKY A;  3TXQ A;  2L6L A;  1B6Q A;  3O9O A;  4GX5 A;  3K3W A;  3HKE B;  2XAQ A;  3RVY A;  2HVJ C;  3CJH B;  4CC6 A;  4FM2 A;  1UFI A;  5L3B A;  2E76 B;  2EX3 A;  2WLI A;  3ZMU A;  1P7G A;  4LP8 A;  3JAT A;  3MHH C;  1IBM B;  4PJ0 Z;  5CA3 A;  4O2A B;  3S3X A;  1XDC A;  1H2S B;  4EFB A;  4YJ3 A;  2QM7 A;  2F95 B;  2F4V B;  4DR3 B;  4DR4 B;  4JAA A;  5EK0 A;  4JTD B;  1XNQ B;  1VQ7 V;  3QF7 A;  5KHJ A;  3Q4H A;  3M8A A;  4DR5 B;  3J80 N;  1K5Q A;  1VEW A;  1YJ9 V;  4QGP A;  3QVN A;  5J2U B;  1M1K W;  5IYZ A;  4I5S A;  4CS2 A;  2LGW A;  2KG7 A;  3CCQ V;  1N34 B;  2QWQ B;  4FJC C;  1XUQ A;  4P30 A;  2P4K A;  1WB7 A;  1XRE A;  2YXL A;  4E2L A;  1NJI W;  4PD4 F;  5HFL A;  3UM7 A;  2AHZ A;  2X0L A;  4X66 O;  1NTK H;  1GN6 A;  4X64 B;  1FXK C;  3CXC U;  2NLJ C;  2DQ0 A;  2V7Q G;  2OYQ A;  4DUY B;  1ZL8 A;  2YIC A;  3TJT A;  4EFE A;  2ZXW C;  3ABU A;  2BOC C;  3RYH B;  3ASO C;  4NB5 A;  3K06 A;  5JH7 A;  1MAB G;  1H8E G;  1IBL O;  3JD3 A;  2BSK B;  3E89 A;  3FX7 A;  3DC5 A;  1J95 A;  3AG3 C;  4J11 A;  4JZ2 A;  2R9R B;  4OXS A;  3EFF K;  4CZZ A;  4DUY O;  2RMK B;  1SA0 B;  3BAA A;  5BZB A;  1E79 G;  2ZNI A;  4JI5 B;  1PKX A;  2Z5U A;  1YZB A;  4RUF A;  3LNN A;  1VIB A;  4D7T A;  2XAG A;  4TOI A;  5EZY B;  4JI7 O;  3RYC A;  3RN4 A;  2JGD A;  4I55 B;  5LHH A;  1SQG A;  2UUB O;  4AIL C;  2OCC B;  4O4I A;  3GWK C;  1K97 A;  4RUE A;  1IXB A;  1N32 O;  1H2G A;  2P06 A;  3JD4 A;  4K35 A;  2ZNJ A;  3K5L A;  3OTF A;  5KX5 B;  1VQ9 V;  4GKK B;  4WFG A;  3ZHT A;  3DGE A;  3QNE A;  1H8H G;  2F4V O;  2RQ6 A;  1WJZ A;  1NH2 D;  4Z2W A;  2PI5 A;  4X8A A;  2OIE A;  5KX5 A;  4KUM A;  2GV9 A;  4JI8 B;  5IJ0 B;  3N2K A;  1S5L Z;  1K34 A;  1PP9 H;  3HKC B;  1KKC A;  4YY3 O;  1UPG A;  4ZHQ A;  1M57 B;  1XEQ A;  4I0X B;  3K9A A;  1DLB A;  2B9Z A;  1WA8 B;  2YEV B;  4LC1 A;  1QLN A;  4JI5 O;  2GHY A;  2DYS B;  3ZX6 A;  3BCC H;  3JSL A;  3CCJ V;  3QO8 A;  4EB6 B;  4JAV A;  5BMV A;  2CGN A;  2HR3 A;  2LP7 A;  5CB4 B;  4QNH B;  4I7Z B;  5DEC A;  2KB1 A;  1JJ2 U;  1QR9 A;  1JFF B;  4LBE C;  1SKV A;  1NTZ H;  2EIN C;  4MVO A;  4IYI A;  4X65 O;  2VQE O;  3IC9 A;  3ABT A;  4X65 B;  3HR0 A;  1ZLZ A;  3APQ A;  3OUS A;  2QM4 A;  2XUM A;  4JYC A;  2WSS G;  5LGT A;  3A0B Z;  2QGN A;  5A2Q N;  1WP8 A;  5LOV B;  1FXH A;  4LFA O;  4NTY A;  4WFA V;  4ZKI A;  1URF A;  5IJ9 A;  1ZL8 B;  3ZRW A;  2HKO A;  5CMU A;  1FXK B;  2ZM6 B;  2DN9 A;  4BIU A;  3HPL C;  5KA5 A;  4WBN A;  5IYD O;  3CJH A;  1Q7Y W;  3JAS A;  5F2V O;  4U7O A;  2B1I A;  2UXX A;  2ZE7 A;  5LP6 C;  2Y4U A;  2IH3 C;  4JI1 O;  3JSN A;  5LP6 A;  4OX9 O;  3AG1 C;  3BPZ A;  2K9P A;  1NS1 A;  2JS5 A;  4U7N A;  3JCZ A;  1H2L A;  1RSO A;  1PV0 A;  1R6K A;  3FD9 A;  3WB0 A;  2AGA A;  1Y76 A;  4DUZ B;  2VWJ A;  1YJW V;  3HKB A;  4HYO A;  4I50 B;  4X1Y A;  3P3N A;  3UO3 A;  3D8C A;  1K73 W;  2FL4 A;  4DR6 O;  3OAA G;  1SQV H;  3W7U A;  3BY6 A;  4DV1 O;  1SQB H;  3CCM V;  4DXW A;  4DK1 A;  1OCR C;  2WLI B;  2LJ2 A;  1IX9 A;  3MD0 A;  1JJO A;  1XNR B;  1W0J G;  4JYA B;  3CRC A;  2H3O A;  5JJE B;  3BFR A;  2Q0A A;  4HBN A;  5E1A C;  1LR1 A;  1PNM A;  2WAM A;  2UUB B;  1BE3 H;  1M93 A;  3T4Z A;  4Z1V A;  1K5S A;  1SQQ H;  2E5L B;  2ZD9 A;  1TUE B;  3L71 H;  3ZS8 C;  3FB6 C;  4J7Z A;  3RYI B;  1QLE B;  2PYJ A;  1I5X A;  4F4L A;  4LF6 O;  2ILM A;  4F6E A;  3VQX A;  1S72 V;  3CCS V;  5B3S B;  1WPX A;  2DOS A;  4HNA A;  4ZIB A;  1VQ4 V;  1SET A;  2BTO A;  2IW5 A;  3JYC A;  4ZI7 A;  3FYE B;  2W6I G;  1GKF A;  2WLK A;  4FZ1 A;  1M56 C;  4DV0 B;  3HKD B;  5KUM A;  2CK3 G;  1NBM G;  4NTW A;  4B3T O;  3FB5 C;  3WG7 C;  4DYL A;  3SPI A;  3AG4 C;  2YI8 A;  3CS5 A;  3CSX A;  2QM8 A;  1YEW A;  2IJH A;  4J41 A;  3D3I A;  4MTG A;  3CC7 V;  5B66 Z;  3CCR V;  3DSQ A;  1EZJ A;  1DF5 A;  4MW3 A;  1M5I A;  1KC8 W;  4JYB A;  4WBN B;  2OT5 A;  1KP3 A;  2UU9 O;  3AG2 C;  2ZQM A;  1FXK A;  1SER A;  1SQX H;  4LNU B;  4LF8 B;  5B1A B;  4MW8 A;  2Q73 A;  4G28 B;  2HP8 A;  4UVC A;  2YUA A;  3LDE A;  2Y4T A;  3QTC A;  3H1H H;  1Z5W A;  2X6A A;  4X66 B;  1OJH A;  4K8Z A;  3A0H Z;  2BTQ B;  1T5E A;  2H94 A;  2Z0A A;  1EN4 A;  1R6T A;  4NR1 A;  1O9H A;  5JWP A;  4PHZ A;  4DR3 O;  1KP2 A;  1JOY A;  4UVB A;  3JAW B;  1JMK C;  4MVZ A;  3N2G A;  1F4N A;  4DV6 B;  4O2B B;  4GKK O;  1WPB A;  3VQY A;  3K03 A;  5B1A C;  2M6Y A;  2WWW A;  1X59 A;  2PYL A;  1Q6I A;  4JI0 O;  1G4Y B;  1JPX A;  1MZF A;  3IGA C;  1DGS A;  3STZ C;  4CS4 A;  1OV9 A;  3JD0 A;  2AW9 A;  1M90 W;  2DJV A;  1R3J C;  5CA0 B;  4B3M B;  2AXT Z;  4DV7 O;  2R72 A;  1FD9 A;  1W0K G;  1KBH A;  3IJ4 A;  5IJ0 A;  1MSW D;  4IL6 Z;  1J5E O;  3BVO A;  4IGG A;  3SPH A;  1VMG A;  2Q0O C;  1VQO V;  1N36 O;  4MTX A;  2GTA A;  2QR4 A;  2NN4 A;  1VQN V;  4LWS B;  1CP9 A;  1V55 C;  1SS3 A;  3B40 A;  4DV7 B;  2HEP A;  1GN3 A;  3G6B A;  1MG1 A;  4UCV A;  3JAK A;  1P49 A;  2Q5Z A;  4TUY A;  1IVS A;  4I55 A;  2F93 B;  4GKJ B;  1ZX3 A;  1QLE C;  5JJN B;  3OT7 A;  4UCO A;  2GUZ A;  3ASN C;  2JGU A;  1M57 C;  1F23 A;  3STL C;  3CXH F;  1M56 B;  1JR9 A;  3CB2 A;  1BHB A;  1I94 B;  1PL4 A;  5KUK A;  4NVP A;  5KLV H;  3GWO A;  5L3E A;  1KKD A;  5L3F A;  5JCO C;  4RQE A;  1QQC A;  3B77 A;  2CE4 A;  3B09 A;  1BSM A;  1NKD A;  3FYI B;  1NR1 A;  3JAW A;  1R1B A;  2BSK A;  3OW2 U;  1GN2 A;  2HJD A;  3HKD A;  1I94 O;  5FPO A;  4U3J B;  3ZED A;  2W6J G;  3F7Y C;  2EIL B;  4H33 A;  1NU1 H;  4JI2 B;  5IWA O;  5LMN O;  1NVP B;  1BZK A;  1DTO A;  4GT1 A;  5KHK A;  2ZR2 A;  4UXN A;  2N04 A;  1XMQ B;  3OM3 B;  1X4T A;  1YDX A;  5GTH Z;  3CPW U;  3QO5 A;  4K3A A;  4LNU A;  1SQP H;  4FLV A;  4FLU A;  3LSS A;  2DWE C;  3ZRV A;  3GVM A;  1FXV A;  5JQG B;  1FFT B;  3UT5 B;  3ZHS A;  1R3L C;  5D5Q A;  2OCC C;  2CDY A;  2Y0P A;  5K1P A;  4MTF A;  3GB7 C;  4NXM O;  2JRI A;  5CBF A;  5IWA B;  5LMN B;  1RM1 C;  4QJF B;  2UXB B;  4PA3 A;  3EVK A;  4U3F H;  4FLT A;  4GUN A;  3FAV B;  2G38 A;  1CXZ B;  1YIJ V;  1FJG O;  4DV4 O;  5LL6 Y;  1B06 A;  1UJW B;  4FLX A;  3WB1 A;  2YID A;  1CEZ A;  5E79 Z;  4JI7 B;  3J7A U;  4F6R A;  1OCZ B;  3CP1 A;  2QWO B;  3AG7 A;  4MVU A;  4I50 A;  3OR6 C;  4X1Y B;  3WG7 B;  5LHI A;  2V1D A;  1NR7 A;  3K59 A;  1RM1 B;  3G80 A;  1GTO A;  5KA6 A;  4JTA B;  4PV1 B;  5IY5 B;  4LF8 O;  5B1B B;  5D5P A;  4IIJ B;  4JYA O;  1GK9 A;  4OX9 B;  1TAE A;  3K57 A;  4PA4 A;  2KSD A;  3G6E V;  1SZX A;  4IIJ A;  3CRA A;  2E3C A;  4DR7 O;  1Y74 A;  1K4C C;  1GH6 A;  5LYJ B;  5IT9 N;  2Q4P A;  2YIA A;  1AP6 A;  4H44 B;  1Q5O A;  5EYP B;  2RCV A;  3L74 H;  3ICX A;  2EIK C;  2YS8 A;  4IHJ B;  4PDV A;  1I08 A;  3ETQ A;  1TUB B;  4UV8 A;  2EBO A;  4PA7 A;  4CC5 A;  3K0D A;  5LOV A;  2ZIO A;  2ADQ B;  1F4M A;  1IZ3 A;  4P9P A;  3UO2 A;  4BAY A;  4JPR A;  4MVM A;  2P4V A;  1VP7 A;  5CA1 B;  4FVM A;  1V9P A;  3OMA B;  3FAV A;  3HKB B;  1XQ8 A;  1RPO A;  4Q6G A;  4EKW A;  4LF5 B;  2YC0 A;  2KKW A;  1GM9 A;  2JK5 C;  4PI0 A;  5H6Q A;  3OMN B;  3ABM C;  3CRM A;  4JV5 O;  3CWB H;  4KXR A;  1Y6X A;  1BGY H;  1HP8 A;  5JQG A;  1FPO A;  1A32 A;  3RYF B;  4B3S B;  3DXR B;  4EB6 A;  3JD2 A;  4LFB B;  5J2T B;  3PJS K;  3OEH G;  3HB3 B;  5JVD B;  4BW5 A;  3CME V;  4QIW F;  1OCO B;  5IY5 C;  3ETE A;  2UUC B;  4CS3 A;  3ZCC A;  4JI6 O;  4H37 A;  4UV9 A;  2JJ2 G;  4CH5 A;  1L1F A;  1YI2 V;  1F51 A;  1KQS U;  3WB2 A;  2XAH A;  4I0X A;  1HNX B;  4DRX B;  1LUV A;  1Q6U A;  5CBH A;  5IJ9 B;  3K0G A;  4NXN O;  1US6 A;  1YTF D;  4LH6 A;  2PUS A;  3K5O A;  2YDE A;  3X2Q B;  4PDM A;  3H1K H;  1JQ0 A;  3JD1 A;  1Y67 A;  4P2Z A;  1I0H A;  2WLJ A;  2E5L O;  1JX9 A;  4DW1 A;  4BIO A;  3T1C A;  4N21 A;  3WFV A;  4O4J B;  1Q3E A;  4X9Q A;  3DTU B;  3E35 A;  4WFH A;  2YSU B;  1H2N A;  1YTF B;  2GTS A;  2N05 A;  5CB4 A;  4H0L B;  2JGD B;  1SES A;  5BMV B;  5BXZ A;  5FNV A;  1FKA O;  2VQF B;  1XHZ A;  4B3M O;  1SQF A;  4TV8 A;  2LQT A;  3CCV V;  1B04 A;  2UXN A;  2D3O W;  3WU2 Z;  1RP3 B;  3KG2 A;  4JI4 O;  3BA9 A;  2IU0 A;  2OWO A;  3OTO O;  4DR6 B;  4J9Y B;  2EIM B;  1Q82 W;  1BT8 A;  1I5Y A;  1XNR O;  1QHT A;  1EM1 A;  4YXW G;  3T2M A;  1WB8 A;  3IC7 A;  2Q7E A;  2F66 C;  1O9G A;  2YIB D;  1OCC C;  4J10 A;  1KB9 F;  1QVF U;  2CTP A;  1BMF G;  3ZMT A;  3RGB A;  1R6N A;  2XTA A;  1GMG A;  4GCZ A;  1V54 B;  2CGO A;  4G27 B;  4BIZ A;  2ZKO A;  1QBZ A;  3BA8 A;  4LF6 B;  3UKM A;  4KHP B;  4Z1M G;  4LF4 O;  5JCO A;  3AK3 A;  3OFN G;  4PEL A;  5C93 A;  1K92 A;  3E8B A;  3UCS C;  4R6Z A;  1Z2G A;  1ROP A;  4TQF A;  2QTO A;  3CX5 F;  3VBB A;  5IE9 A;  4W4K A;  2E75 B;  4GKJ O;  2LFS A;  4TUY B;  2QWR B;  3AG2 B;  4GZR B;  2M7W A;  1V54 C;  1ZWI C;  4LF7 O;  4J42 A;  2P22 C;  3B4S A;  2R9I A;  3K9S A;  1BHA A;  1JA8 A;  4UUJ C;  4QE7 A;  2P67 A;  4YHH B;  1ENV A;  2ADP A;  4WFF A;  4A5U B;  3RYH A;  3LUT B;  2YI9 A;  3AG4 B;  4X1K B;  2EIN B;  4TV9 A;  4C7U A;  2IH1 C;  4DRX A;  3SJQ C;  2QKC A;  5DED A;  4BW9 A;  1EZV H;  1K9M W;  2H8P C;  3JAM N;  4UCS A;  3KCX A;  1RPR A;  2JJ1 G;  5JVD A;  1K33 A;  4YHH O;  2QE7 G;  3D36 A;  1NQT A;  1G6U A;  2F1M A;  2IU3 A;  2MW2 B;  2FB5 A;  1AR1 B;  2X6C A;  2ARH A;  3PN1 A;  2KG7 B;  4O2B A;  3N2G B;  1I7F A;  2LW7 A;  1N32 B;  3A2F A;  4UCT A;  3G71 V;  2ITC C;  2UXC B;  3ZMV A;  2NR5 A;  5IDJ A;  2XAF A;  4XDK A;  1YIT V;  2DQ3 A;  4ABM A;  4XBF A;  2QJ1 A;  3IAY A;  4LF7 B;  3RVZ A;  3CC2 V;  1KU9 A;  5LGN A;  1S5H C;  4ZOL A;  3ZMZ A;  2ZIM A;  3QO7 A;  2DYR B;  4X64 O;  2Q68 A;  4KP4 A;  3SGI A;  3JAT B;  4PI2 A;  3RYI A;  4NYK A;  1H2M A;  4B3R O;  3I5D A;  3APO A;  1S5J A;  4LF9 B;  3ZHV A;  1KD1 W;  2VQE B;  4BR6 A;  1GO3 F;  2VS0 A;  2A06 H;  3S3W A;  4KHP O;  4LH7 A;  1G1X B;  1AJP A;  1K3E A;  2P5O A;  1HNZ O;  3ETG A;  2X7R B;  1TGO A;  1WAZ A;  2Q9L A;  4LF5 O;  5C8Y A;  2IBZ H;  4JI8 O;  4LF9 O;  3AK1 A;  1ZAU A;  4B3R B;  4B3T B;  1AJQ A;  1F7Y A;  4NKG B;  2WLN A;  1AJN A;  2X6B A;  1XL6 A;  4WFE A;  1IBM O;  4HAM A;  3E8F A;  3BAB A;  1OCZ C;  2P7T C;  3L9D A;  3F5W C;  2DW4 A;  2FTK A;  1IUR A;  3H01 A;  1AR5 A;  4B3S O;  1GM8 A;  1NVP D;  3CCU V;  4AHC A;  4WF9 V;  4CBC A;  4JZG A;  3CD6 V;  3B8M A;  2E74 B;  2FML A;  4QE9 A;  4LCU C;  1Y76 B;  3KCY A;  4MVS A;  4DO2 A;  3CRQ A;  1K8A W;  1BCC H;  3ZBH A;  1N34 O;  2P6J A;  5KAI Z;  4D7S A;  2O57 A;  2PTM A;  4GLX A;  3P32 A;  4R7C A;  4DV2 B;  1S76 D;  1AIL A;  1U97 A;  1AB3 A;  3JAS B;  5GTI Z;  3OUF A;  3BRC A;  1LNQ A;  3L75 H;  1LUW A;  2WLH A;  3SYQ A;  4YY3 B;  1VQP V;  4X1K A;  2UUC O;  5LGU A;  3RFR A;  1D5N A;  3T1H B;  3ZMS A;  1P7B A;  2EJ7 A;  1FJG B;  1M9N A;  5A9G A;  2VRZ A;  2OTL V;  3E22 A;  1VQ6 V;  4ZOL B;  2RJZ A;  2K1E A;  4DV3 B;  3E8H A;  2Y48 A;  4JI6 B;  3JAR B;  1MNG A;  1JFF A;  1FFX A;  2ZR3 A;  5EBL C;  4P9O A;  4O4H A;  3O65 A;  3TXS A;  4ICG A;  2PF4 E;  4FLZ A;  4JI4 B;  1U96 A;  3W7W A;  1RSO B;  3ZHU A;  2B1G A;  3FKS G;  2WPD G;  3SYC A;  1WP7 A;  4NXN B;  2WA3 A;  3RWR D;  1AI7 A;  3TK1 A;  2HHH B;  4MT8 A;  4DV3 O;  1MSD A;  4FFK A;  4O4L A;  2QWN B;  3LSQ A;  4DR2 B;  1NH2 B;  4DV5 O;  5EC2 C;  1D5A A;  2Y69 B;  4DW0 A;  4FZ0 A;  2Q7G A;  1ARO P;  2EIK B;  3THO A;  3SYA A;  3ZRW B;  2GUZ B;  1SRY A;  2QKA A;  4D6T H;  4X88 A;  3HKC A;  2V4D A;  5KAF Z;  2QTS A;  3FB8 C;  4R8C A;  2F43 G;  3CRR A;  1HNW O;  1IXM A;  4PA9 A;  1AP5 A;  3ABK B;  4E4E A;  4J9Z B;  2FYU H;  3ETD A;  1VQ5 V;  1WNS A;  3AEI A;  4FMT A;  1YSC A;  5DM6 V;  4X20 A;  1SF9 A;  4ZBM A;  4PDR A;  3OGI B;  1XOU A;  2HJF C;  4YJ2 B;  2JEU A;  2UXC O;  2UXD O;  5EIB C;  3JAL B;  1YJN V;  4O4I B;  4JYY A;  1PM9 A;  2PGG A;  4OGQ B;  2PI4 A;  1FAF A;  4AI8 A;  2DWD C;  2JDI G;  2LW1 A;  5CA0 A;  5KHI A;  2ZDI A;  1VF5 B;  3SPG A;  2RNB A;  1FS0 G;  4X1I A;  1HW7 A;  1WA8 A;  2EIJ C;  5L3D A;  3BEH A;  3MAQ A;  3IFX A;  4ZHQ B;  3MDS A;  4RO2 A;  5LA6 B;  3SDL A;  1QCE A;  1VF6 C;  4GX1 A;  3N2K B;  2P90 A;  2HHH O;  3F5T A;  1YVW A;  4QPK A;  4JI3 O;  4J80 A;  1RFY A;  2W0X A;  1ZTE A;  5L3C A;  3EXA A;  1NT2 B;  1HNZ B;  4EEQ A;  1AVM A;  2AHY A;  2EIM C;  4KL1 A;  3OGC C;  3SR2 C;  2DE0 X;  4XDL A;  1XMO B;  1KUQ A;  1QR8 A;  1VQL V;  2HVK C;  1SC5 B;  3LSU A;  5FPR A;  4UCU A;  1L0L H;  3SYP A;  1XMQ O;  4FFB B;  5EZY A;  4K0K B;  1HNX O;  1OHH G;  1N33 O;  4O4L B;  3DXR A;  2JVD A;  3RYF A;  2N74 A;  2XAJ A;  1XMO O;  1G8M A;  1QNM A;  3W7T A;  2XT9 A;  5BR8 O;  5H9C A;  3K5M A;  1HDJ A;  2IJI A;  4PA6 A;  5IYZ B;  4O4J A;  1V55 B;  1FFX B;  4TSF G;  5KMG B;  3JAR A;  1XL4 A;  5LHG A;  4JF3 A;  2Q8V A;  1OZ0 A;  1GN4 A;  1PNL A;  3EHB B;  4JV5 B;  1TVK B;  4DR1 B;  5K1X A;  4LFC B;  3G67 A;  1PPJ H;  3BHP A;  4UCR A;  1IBL B;  2YIB A;  3ZN1 A;  1MZE A;  3L72 H;  3CCE V;  1N0N A;  2WLM A;  4UB8 Z; 
#chains in the Genus database with same CATH homology
 3ASO B;  1B6Q A;  3ZIA G;  4KFM A;  2QTO A;  3RBZ A;  3VBB A;  4GX5 A;  3K3W A;  1KP2 A;  2XAQ A;  1JOY A;  3RVY A;  2HVJ C;  4UVB A;  3E8G A;  2IJJ A;  2LFS A;  3E2E A;  4MVZ A;  5L3B A;  1F4N A;  2WLI A;  3ZMU A;  3MHS C;  3AG2 B;  3K03 A;  5B1A C;  4LP8 A;  3MHH C;  1PD3 A;  1THZ A;  2WWW A;  2EJR A;  2LFR A;  1R73 A;  2M7W A;  5CA3 A;  1V54 C;  1ZWI C;  1AI6 A;  1G4Y B;  1JPX A;  2R9I A;  3OMI B;  2QM7 A;  3IGA C;  4MTO A;  5L3G A;  1YHQ V;  1BHA A;  4UUJ C;  3STZ C;  4QE7 A;  2DYS C;  3JD0 A;  5EK0 A;  2P67 A;  4JTD B;  1M90 W;  1ENV A;  4WFF A;  1VQ7 V;  1R3J C;  3LUT B;  5EC1 C;  1BL8 A;  2EIL C;  1GM7 A;  3AG4 B;  3W7X A;  1S3J A;  1W0K G;  2EIN B;  2IH1 C;  2JIZ G;  1K5Q A;  1YJ9 V;  1MSW D;  5DN6 G;  3SJQ C;  1M1K W;  4I5S A;  1K9M W;  2H8P C;  3CCQ V;  3SPH A;  1RPR A;  2JJ1 G;  4FJC C;  1VQO V;  2GSM B;  5CBG A;  1K33 A;  4P30 A;  2OTJ V;  4MTX A;  2QE7 G;  4E2L A;  2B5U A;  3D36 A;  1NJI W;  1NQT A;  5HFL A;  3UM7 A;  3SPC A;  1VQN V;  2AHZ A;  2X0L A;  2IU3 A;  4WFB V;  1CP9 A;  1V55 C;  4GX2 A;  1AR1 B;  2X6C A;  2JEX A;  1CPY A;  1OCR B;  4G2K A;  1FXK C;  2Z3Y A;  3CXC U;  2NLJ C;  1MG1 A;  2BOB C;  2DQ0 A;  4MVR A;  3G71 V;  2V7Q G;  1K4D C;  2ITC C;  1Q86 W;  4XDJ A;  5B1N A;  3ZMV A;  5IDJ A;  2ZXW C;  1PL0 A;  2XAF A;  4XDK A;  1YIT V;  2DQ3 A;  1QLE C;  1W2B U;  3ABU A;  4XBF A;  2BOC C;  3ASN C;  1M57 C;  1F23 A;  3RVZ A;  3CC2 V;  3STL C;  3ABM B;  3ASO C;  5LGN A;  3AG1 B;  1S5H C;  3K06 A;  5EBW C;  1M56 B;  1MAB G;  1H8E G;  1BHB A;  3JD3 A;  3ZMZ A;  3E89 A;  5EBM C;  2A79 B;  3QO7 A;  2DYR B;  5KUK A;  1J95 A;  4UVA A;  3AG3 C;  4ASU G;  2Q68 A;  2R9R B;  3GWO A;  4KP4 A;  3P30 A;  5L3E A;  4OXS A;  3OEE G;  1KKD A;  5L3F A;  1DF4 A;  4RQE A;  3EFF K;  2HG5 C;  3B77 A;  4CZZ A;  1NKD A;  3FYI B;  1KD1 W;  1NR1 A;  5BZB A;  1GO3 F;  3OE7 G;  1E79 G;  3OW2 U;  1PKX A;  1SZT A;  2Z5U A;  3LDD A;  3W7S A;  4RUF A;  2A9H A;  1AJP A;  1K3E A;  1OCC B;  5J9P C;  2W6J G;  3ETG A;  2X7R B;  2EIL B;  3F7Y C;  2XAG A;  4H33 A;  3VOU A;  5IYB O;  4TWK A;  5LHH A;  1NVP B;  1DTO A;  4GT1 A;  2OCC B;  2ZR2 A;  3CYO A;  4UXN A;  1VQ8 V;  1AJQ A;  1WLE A;  2WLL B;  1H38 A;  3OM3 B;  4JTC B;  2WLN A;  5CN0 A;  1K97 A;  4RUE A;  3CPW U;  3QO5 A;  4RQF A;  1AJN A;  1H2G A;  2X6B A;  1XL6 A;  3JD4 A;  3SPJ A;  4WFE A;  3LSS A;  2DWE C;  3ZRV A;  1VQ9 V;  4HAM A;  4WFG A;  3E8F A;  1FXV A;  1OCZ C;  2P7T C;  4R50 A;  3DGE A;  3QNE A;  1H8H G;  3F5W C;  2IJK A;  1FFT B;  2DW4 A;  2FTK A;  1R3L C;  5LBQ A;  1NH2 D;  2OCC C;  3F7V C;  3H01 A;  2PI5 A;  1GM8 A;  4MTF A;  4X8A A;  4KUM A;  3GB7 C;  3X2Q C;  3CMA V;  1NVP D;  3CCU V;  3LDC A;  5CBF A;  1Q81 W;  4WF9 V;  3K79 A;  1K34 A;  1RM1 C;  4CBC A;  5GW7 A;  4QJF B;  4PA3 A;  3CD6 V;  3B8M A;  3ASN B;  4QE9 A;  4LCU C;  4MSW C;  2YEV A;  1M57 B;  4MVS A;  2H94 A;  3K9A A;  1DLB A;  1AI4 A;  2YEV B;  4LC1 A;  1QLN A;  3CCL V;  1YIJ V;  4DO2 A;  2GHY A;  1K8A W;  2DYS B;  1EFR G;  1UJW B;  2P6J A;  4I9W A;  4JAS A;  1QVG U;  3CCJ V;  3QO8 A;  1CEZ A;  2Q6A A;  4JAV A;  3P32 A;  4R7C A;  1S76 D;  2HR3 A;  1S0V A;  1OCZ B;  3CP1 A;  1ORQ C;  2LP7 A;  4QNH B;  3OUF A;  1LNQ A;  2WLH A;  3SYQ A;  4MVU A;  3OR6 C;  4X89 A;  3WG7 B;  2KB1 A;  5LHI A;  1JJ2 U;  2V1D A;  1NR7 A;  1QR9 A;  1RM1 B;  1AI5 A;  1GTO A;  4LBE C;  4JTA B;  5KA6 A;  4MVO A;  1VQP V;  2EIN C;  5IY5 B;  4PDL A;  5LGU A;  3G4S V;  3R65 A;  5B1B B;  1JVM A;  3ZMS A;  1P7B A;  3ABT A;  2XND G;  4JAU A;  1M9N A;  2Q67 A;  4FPP A;  3OUS A;  2OTL V;  4JYC A;  1GK9 A;  5B1O A;  3FB7 C;  2WSS G;  1VQ6 V;  5LGT A;  1E1R G;  4PA4 A;  4TT3 G;  3ZN0 A;  2K1E A;  3G6E V;  3E8H A;  1FXH A;  2Y48 A;  4WFA V;  1PNK A;  2QA4 V;  1K4C C;  4ZKI A;  4JGS A;  4FIP C;  2ITD C;  2ZR3 A;  5EBL C;  4P9O A;  2HKO A;  3TCU A;  5CMU A;  3ZRW A;  1FXK B;  1VQK V;  2EIK C;  4N23 A;  3HPL C;  1K7D A;  4BIU A;  5KA5 A;  3W7W A;  2NNU A;  5IYD O;  4QPJ A;  4PDV A;  2B1G A;  3FKS G;  1Q7Y W;  2WPD G;  3SYC A;  4U7O A;  1AI7 A;  3I56 V;  3TK1 A;  2B1I A;  4UV8 A;  2EBO A;  2UXX A;  4MT8 A;  4PA7 A;  2IH3 C;  2C2A A;  2DYR C;  3K0D A;  3LSQ A;  2QKS A;  3ZJZ A;  1NH2 B;  1F4M A;  4P9P A;  3AG1 C;  2EZO A;  2XOK G;  4BAY A;  5EC2 C;  1Y66 A;  3ML0 A;  4JPR A;  3K04 A;  4MVM A;  2Y69 B;  4U7N A;  1ARO P;  3JCZ A;  2HLD G;  1R6K A;  2EIK B;  3OMA B;  5HFM A;  2ZDI C;  4MS2 A;  3SYA A;  3B8N A;  3I55 V;  3ZRW B;  1RPO A;  4EKW A;  2ZXW B;  1SRY A;  3E86 A;  4X88 A;  1YJW V;  1GM9 A;  2JK5 C;  5H6Q A;  3OMN B;  3ABM C;  1EBO A;  2W0F C;  3FB8 C;  4HYO A;  4R8C A;  2F43 G;  1IXM A;  2EZP A;  4PA9 A;  1K73 W;  3ABK B;  3OAA G;  4J9Z B;  2XAS A;  3W7U A;  3BY6 A;  3E83 A;  3ETD A;  1VQ5 V;  3K08 A;  4WCE V;  3AEI A;  4FMT A;  1YSC A;  3JD2 A;  5DM6 V;  3CCM V;  3PJS K;  3OEH G;  3TET A;  3HB3 B;  4BW5 A;  3CME V;  4QIW F;  4DXW A;  1OCO B;  5IY5 C;  3ETE A;  4ZBM A;  2WLL A;  4PDR A;  3ZCC A;  4H37 A;  1OCR C;  2JJ2 G;  2HJF C;  2WLI B;  4UV9 A;  1L1F A;  1YI2 V;  1F51 A;  1Y4M A;  1R3K C;  2JEU A;  1KQS U;  2A0L A;  5FL7 G;  3MD0 A;  1YJN V;  2XAH A;  1W0J G;  2PI4 A;  5CBH A;  3SYO A;  3K0G A;  3LNM B;  2DWD C;  2JDI G;  1YTF D;  4FK5 C;  3X2Q B;  4PDM A;  1N8R W;  2ZDI A;  5E1A C;  1JQ0 A;  1PNM A;  2WAM A;  3JD1 A;  3SPG A;  1FS0 G;  3T4Z A;  3ABK C;  2EIJ C;  1K5S A;  4P2Z A;  5L3D A;  2ZD9 A;  1TUE B;  3BEH A;  3IFX A;  3ZRX A;  2WLJ A;  3T4D A;  4RO2 A;  3FB6 C;  1JX9 A;  1E1Q G;  1QCE A;  4GX1 A;  1QLE B;  1I5X A;  4RAI A;  4F4L A;  2P90 A;  4N21 A;  3T1C A;  3WFV A;  1OCO C;  4QPK A;  3DTU B;  3E35 A;  1S72 V;  3CCS V;  4WFH A;  5B3S B;  2YSU B;  1R3I C;  1WPX A;  2QEX V;  1YTF B;  5L3C A;  1VQ4 V;  2EIJ B;  5H6R A;  3ZRS A;  1SET A;  1SES A;  2AHY A;  2EIM C;  3OGC C;  4XDL A;  2IW5 A;  1P4R A;  3JYC A;  3FYE B;  2W6I G;  1GKF A;  1QR8 A;  3OR7 C;  2WLK A;  1VQL V;  2HVK C;  1M56 C;  5KUM A;  2CK3 G;  1NBM G;  3SYP A;  3CCV V;  3NXS A;  2UXN A;  1COW G;  2D3O W;  3A0R A;  3KG2 A;  3FB5 C;  3WG7 C;  2IU0 A;  3ABL C;  3CC4 V;  3SPI A;  3AG4 C;  2QM8 A;  4J9Y B;  2EIM B;  2MK3 A;  2IJH A;  1Q82 W;  1I5Y A;  3D3I A;  4MTG A;  4YXW G;  3T2M A;  3CC7 V;  1OHH G;  3CCR V;  4L87 A;  3IC7 A;  1EZJ A;  1DF5 A;  5B3S C;  4GX0 A;  2XAJ A;  4MW3 A;  1G8M A;  1KC8 W;  4JYB A;  3W7T A;  2Q69 A;  1OCC C;  2ATK C;  2OT5 A;  5H9C A;  2IJI A;  4PA6 A;  1HWY A;  1KP3 A;  4Q20 A;  1JCH A;  2ZQM A;  3AG2 C;  1FXK A;  1QVF U;  1BMF G;  3ZMT A;  1SER A;  1V55 B;  4TSF G;  5B1A B;  1R6N A;  4MW8 A;  1S77 D;  4G28 B;  5B1B C;  3M99 B;  4UVC A;  1GMG A;  3LDE A;  1XL4 A;  4GCZ A;  4HZ3 A;  1V54 B;  5LHG A;  4G27 B;  2HFE C;  4JF3 A;  1OZ0 A;  4BIZ A;  1MOF A;  1PNL A;  3EHB B;  5IYC O;  1QBZ A;  2X6A A;  3UKM A;  3ABL B;  4Z1M G;  2Y69 C;  1KEC A;  4MVQ A;  3RW0 A;  3OFN G;  3ZN1 A;  1VQM V;  4PEL A;  3AG3 B;  1K92 A;  3E8B A;  4R6Z A;  2WLM A;  5C93 A;  3CCE V;  1ROP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...