3CMEV

The structure of ca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3cmeV00
3CCJV 1YITV 1S72V 1KD1W 1VQOV 1YHQV 3CCVV 1Q82W 1KC8W 4WFAV 1VQMV 1YJ9V 1VQNV 1K9MW 1VQ6V 1QVFU 1Q7YW 1M90W 3CCUV 1K73W 3CCQV 1Q81W 1VQLV 1M1KW 1VQ4V 4WF9V 3CC4V 1K8AW 3I56V 3G71V 3CMEV 3CCRV 2OTLV 5DM6V 1R73A 3OW2U 1VQ9V 1NJIW 3CCSV 3CXCU 3G6EV 1YIJV 3CCMV 2QA4V 2D3OW 2QEXV 1VQPV 1N8RW 1KQSU 1YJWV 1JJ2U 1VQ8V 3CC7V 3CPWU 1YJNV 1W2BU 4WFBV 3I55V 3CCEV 1VQ5V 1QVGU 1VQ7V 3CC2V 2OTJV 3CCLV 1YI2V 3G4SV 3CD6V 1Q86W 3CMAV 1VQKV 4WCEV
chains in the Genus database with same CATH superfamily
3OMIB 2EILC 2ZE8A 4UXNA 1VQMV 4NTWA 2ZXWB 4AQYO 3E86A 2XAGA 1R73A 2ZDIC 1T5EA 2ZIOA 5C8YA 2O57A 3QO8A 3JASB 2HKOA 3WFVA 4GKJB 3L9DA 1E1QG 3K58A 4U7NA 2UUCO 4Q6GA 2BTQB 5LHGA 2QGNA 3AG1B 2N05A 1OCOB 3H9VA 5IY5B 3OEHG 5BR8O 4NXNO 4JI4B 4GCZA 4LWSB 2AHYA 4X88A 1XEQA 4JI1B 4DR6O 1PD3A 3ABMB 3KKYA 4UVCA 4JAUA 4WCEV 1NQTA 1H2SB 4J9ZB 2DYSC 4EB6B 4JI2O 5KHJA 2JS5A 4DR1O 1FFXB 1QHTA 1KB9F 2HVKC 3ZIAG 4P9PA 3CX5F 4BR6A 5LGTA 2UXDB 4TV9B 1ORQC 1VQ8V 4LF4O 4FLXA 3HKBB 4JZ2A 3WB1A 3UO2A 3BA9A 2YDEA 4BIUA 3STLC 5KHKA 1WP8A 4X1KA 5KHHA 3KCYA 2P90A 3ZCCA 5EYPB 5KUMA 2R9RB 2RQ6A 1NR7A 2ZE7A 3HKEA 5D5PA 1TUBB 4RUFA 1HNZO 5KUKA 4YY3O 4JTAB 4YJ2B 4DR5B 1IURA 3RYIB 2OWOA 2AHZA 3ZJZA 5IDJA 4JTCB 4ZOLB 3AG4B 4JTDB 1SA0A 4BW5A 4O2AB 1AROP 4CZZA 2ZDIA 4NR1A 3OMNB 3CXCU 4J10A 4O4JA 3AG3C 5KA5A 1OHHG 3W7WA 4U3JA 1N8RW 1KMIZ 3G80A 4TQFA 1QVGU 4QE9A 4CS4A 1I08A 2X7RB 4KXRA 4O4LA 2JS3A 3ABTA 3OM3B 1HW7A 2RJZA 3JD0A 4J9YB 5LA6A 1MZFA 2RNBA 2KKWA 4HNAB 1R6KA 3H01A 1K9MW 3TXQA 1K73W 1DF4A 4J11A 3THOA 4XDKA 2ZXWC 3CCRV 3K79A 2V7QG 2XHBA 1K34A 3MDSA 3H1IH 5FLXN 2AZ0A 1VQ5V 2GUZB 1GM9A 1SESA 1S0VA 1AR5A 5KMGB 4QPKA 4UV9A 4MTOA 4UFZA 5LBQA 4TOIA 4TUYB 1QVFU 3AG1C 1IZ3A 1OCOC 1SS3A 5IY5C 2R9IA 4AI8A 2CGNA 1TAEA 1AI6A 2LFRA 4D6TH 2G38A 4IGGA 4K35A 2OTJV 4LBEC 3CJHA 4WBNA 4CS3A 3ABMC 3AK1A 5LMUB 2ZCEA 4MTFA 4WFAV 1WA8A 3T4DA 3SPIA 4GKJO 4ABMA 1SQFA 4ZI7B 2JDIG 2HHHB 3QO7A 4YHHB 1RP3B 4JI4O 5JWPA 1AR4A 1KBHA 3B8NA 4AHCA 3OTOB 3OUSA 4UCOA 1WAZA 4X64B 4XDJA 5LYJA 5IJ0B 1R1BA 3BRCA 4JI1O 2Y48A 2EZOA 1RM1B 4RQFA 2UXNA 4CC6A 3MAQA 5IJ9B 1H2NA 3CRQA 3ZS8C 4BW9A 4EEQA 1RSOA 2BE3A 1UFIA 2NNUA 4GUNA 2Q0AA 1AVMA 3JAKB 2UXDO 3W7TA 4FJCC 2P67A 4DV3B 4LH7A 1Q90D 5J2TB 5IT9N 1A32A 4TSFG 2LQTA 2RN9A 1AB3A 5HFMA 1TGOA 1R6NA 4IYHA 2UUBB 4O2BA 1M5IA 2YXYA 3NR7A 1NR1A 1SERA 4CC5A 3ZN0A 1WNSA 1SQVH 2GV9A 3J7AU 5LGUA 1BHBA 3JATB 4DR5O 1PL0A 3VQVA 5CA1A 5FNVB 4Q20A 3F5WC 3APOA 4F6RA 4I50B 1L1FA 4W4LA 2Q7HA 1IX9A 1CEZA 2AW9A 3N27A 3OE7G 2UXBO 1Q8IA 3ZHVA 5GONA 5ITZA 2X6CA 2P5OA 2BTOA 1JPXA 4CH3A 2XAHA 1ZWIC 1GN2A 4DR2B 5B1BB 3FD9A 1M57B 4QNHB 1Q6UA 4ZBMA 1K7DA 1XMOB 2QKAA 2HR3A 3RYHB 4WF9V 3LSSA 5GW7A 4QIWF 1K33A 3HKCB 4AILC 5CA3A 3UKMA 3FAVB 2QM8A 3CCLV 2WPDG 1FXHA 3H1LH 2QKCA 1EN6A 4B3SB 4NVPA 1YEWA 2NR5A 5LMNB 1VEWA 4L87A 4OGQB 5LMUO 1RM1C 4JI6B 2VQFB 3CCMV 5F2VO 4I4TA 4JI3B 2F1MA 2YIDA 4UV8A 4KL1A 2HHHO 4HAMA 3E35A 4UUJC 3BEHA 4RQEA 2FMLA 4YHHO 4X8AA 4DR4B 1Q81W 3OTOO 4X64O 3CEIA 3ZRWA 4D7TA 2X6BA 2DN9A 1NTMH 4RUEA 3K06A 4FZ1A 4C7UA 2HJFC 1VF6C 1EM1A 3LDCA 4RAIA 4U7OA 4J7KA 1JFFA 1QR8A 5IYZB 1G6UA 1QBZA 5J2UB 4LF8O 3WB2A 2UU9B 2PUSA 3A8TA 4DV3O 4JYAB 1FAFA 1GO3F 4RO2A 4DV7B 3E22B 2C2AA 4FLVA 3JD3A 4IYIA 5TISZ 4LNUB 1WPBA 1VQ7V 2IJHA 1EBOA 2QKSA 2QWOB 4X1KB 2JGUA 3ZHQA 1MOFA 4IHJB 2UUBO 1SF9A 3LSUA 3HKDB 2WLLA 4FLUA 1FXKA 1HR0B 3ZMSA 1LUVA 4FM2A 2Q67A 3ZMZA 2ZIMA 4K0KB 2OCHA 3DXRB 1KUQA 4JGSA 2CTQA 1Q3EA 4KFMA 3STZC 5B1BC 2LW7A 1M57C 1CXZB 1ZSPA 2WA4A 2LJ2A 1JJOA 5B1AC 1NVPB 3SJQC 3CP1A 4O4JB 3PN1A 4TWKA 1MA1A 2E5LO 2JGDA 5LHHA 5KA6A 1YSCA 3D3IA 3RYFA 5EIBC 3ETDA 3BABA 5BXZA 3CSXA 4LFCO 1IXMA 3K08A 1Y76B 2QWNB 2UXXA 5CA0B 3DC5A 4PA7A 4DR2O 3IC9A 4MVQA 1Q7YW 4FZ0A 4X1YA 1K5SA 3MHHC 4UB6Z 1XMOO 3DGEA 1M56B 4U3FH 4PHZA 2EIJB 3B2EE 5B5EZ 3SJAC 4DV2B 1B6QA 2IW5A 1E1RG 4P2ZA 5LP6A 3M7MX 1NTKH 3CMAV 4BAYA 5IYDO 4WFHA 4MTGA 1N36B 2HFEC 5IYCO 5BMVB 4ZHQB 1EN4A 4LF9B 2Y0IA 1M9NA 2IJKA 1TVKB 2WLIA 1U97A 3BPZA 3K5MA 2BSKB 3GVMA 3MHSC 4WBNB 5L3FA 4JI6O 1Z5VA 2A3QA 2YXLA 1NZ6A 1THZA 1MNGA 4JI3O 4PA6A 2LFSA 3GWOA 2PZSA 2VRZA 5HFLA 1LR1A 1U96A 2VQEB 4GX1A 2MK3A 1WPXA 4X66B 3CRMA 3ETEA 5LXTB 3EHBB 4DR4O 1TA8A 2QA4V 5JJJB 3JAWB 3FB6C 1NT2B 3J81N 4I0XA 5LYJB 3I55V 2E74B 3CCEV 3G4SV 4I7ZB 1EZVH 3SYAA 1FFTB 1N4CA 4J41A 3WG7B 2ETNA 2R70A 2KG7B 3JALB 4JI0O 3K57A 3SPCA 2UU9O 4JYAO 1OCRB 4FFBA 2CTRA 2OT5A 3T2MA 5H5NA 4DV7O 2ODMA 2HVJC 4Z1VA 1BS3A 1VQNV 1D5NA 5EZYA 4NTYA 3ZBHA 5DEDA 5EBMC 3RGBA 1OCZB 3QG5A 4X1IA 2CDYA 3W7UA 1HR0O 3W7XA 3OD4A 2CAZC 4PA4A 3U11A 1KYOF 5BZBA 4K0KO 4MVSA 1WJZA 4DV1B 2K9PA 3E8FA 4PDMA 4X9QA 1SQQH 4JASA 2CH7B 2DE0X 2HEPA 1P7GA 1Q6IA 2FTKA 2B1IA 4JI8B 2PY5A 1G4YB 2PYLA 4HYOA 3ZHTA 1F7YA 5KAIZ 4R7CA 5ITZB 1GM8A 2W6IG 2YEVA 2F95B 4PD4F 1IVSA 3B4SA 5JCOA 1KKCA 2WLJA 4UB8Z 4DR3B 4GKKB 3MD0A 1OZ0A 2RCVA 4LFAO 3L71H 4CH6A 3DC6A 1ZTEA 3WB0A 4X20A 3LSQA 1SQPH 3EFFK 4H44B 3N2GB 4JF3A 5EBWC 1K92A 4EFBA 1BE3H 4B7EA 3IC7A 3SYQA 4DV2O 1P49A 2KQXA 3ABUA 2FYUH 4MVMA 1PV0A 2F93B 3EVKA 1DK1A 1Q43A 1ZL8A 2Q73A 4X65B 1NJIW 2V4DA 1IBKB 4LF9O 3E83A 4ASUG 3T1HB 4MSWC 5KAFZ 2QTSA 3CYOA 1W0JG 3E2EA 3T4ZA 2EJ7A 2W0FC 1VMGA 3CHXA 1ZLZA 2ZNJA 3RYCB 1M90W 3K3WA 3ZMTA 1K8AW 3WG7C 4MW3A 2VQEO 2ILMA 5CB4A 4FVMA 4GZRB 1WB7A 2IH1C 3ZHSA 4X66O 3ASOB 3UT5B 3ZN1A 4LP8A 4DUYB 2L35A 3AK3A 3Q4HB 2L6LA 1NBMG 1YITV 2WLKA 4UCSA 2Y0PA 5E1AC 1KKDA 2DW4A 1F51A 4IIJA 4ZIBA 1CP9A 3N2KB 3ZX6A 2Q4PA 3SYCA 4KUMA 3LUTB 3B77A 5JQGA 1YJNV 1VF7A 4B3MB 1BL8A 2DQ3A 3CE2A 1QQCA 2Z0AA 4NTXA 4YIOA 1R3IC 1OJHA 1G8MA 4JAAA 1Y74B 2WLNA 1I7FA 5JH7B 1XMQB 1H2GA 4CS2A 4I9WA 3RVYA 1GRJA 2UUAB 2NLJC 1QLEB 3HB3B 1X4TA 1B06A 1NI8A 1WB8A 5D5QA 2D2CB 4KHPB 1S3JA 1PM9A 1PL4A 2ARHA 1MZEA 4DV1O 1PNKA 4JI5B 1VP7A 3JARA 5JVDA 2XNDG 5EK0A 5H2FZ 4OXSA 4DRXA 4DYLA 3FX7A 1BHAA 4JYYA 3TK1A 2IJIA 4JI8O 3BCCH 1ENVA 3K03A 3X2QB 4GT1A 5KHIA 5C93A 2IU3A 2OIGA 5FPRA 1WP7A 2OTLV 4F6EA 2W0XA 3AG4C 4NB5A 4CH5A 1YIJV 1GH6A 4OPHA 4DR3O 4GKKO 1VIBA 3E8HA 4FLYA 4UCRA 3ABKB 4I55B 4O4HA 1FXVA 2B9ZA 4ICGA 4PDLA 1QNMA 3B40A 4E4EA 1VQKV 1KECA 3P30A 3JASA 3F7VC 2HG5C 4PDRA 1N0JA 2BTQA 2CK3G 2YS8A 1NH2D 3DSQA 3G6EV 2P6JA 2IBZH 2XAFA 2JRIA 4LWSA 1AILA 1IBKO 1SKVA 3K5NA 3ASOC 5BY1A 1URFA 3T1HO 2UXCB 4DV0B 4LF6B 2ATKC 4YJ3A 1VQ4V 1D5AA 1YF2A 4EB6A 2PYJA 3C3TA 3AG2B 4UCTA 1FFXA 2DYRB 3QVNA 2ZQMA 1H2LA 3LDEA 4OPAA 3VBBA 3RBZA 3RT3C 1B3QA 2EIMB 2YUAA 1PNMA 2E3CA 1H2MA 1JQ0A 1US6A 1F4MA 1XHZA 5L3BA 1KD1W 2M7WA 1VQOV 2GSMB 3FB8C 1Y67A 2VWKA 3HKBA 5IYBO 3E8BA 2P22C 1SQXH 2XT9A 1VQ9V 3FYIB 3ABLB 2ADPA 1L8DA 1I94B 1JJ2U 2E76B 5EYPA 1W2BU 1ROPA 2HP8A 3JD1A 4N23A 4WFBV 1XL6A 3TGUH 1XHXA 4JPRA 1TUBA 2LP7A 1QLEC 2BOBC 4B3MO 3H1JH 4YJ2A 3CS5A 3D36C 1RPOA 5C8YB 3RYIA 4ZOLA 5B1OA 3ZHRA 2PI5A 4N21A 4JZGA 2Q68A 4O2AA 2Z5UA 4D7SA 1M93A 3GWKC 3D3QA 1XMQO 1YI2V 1N0NA 2UUAO 2ITCC 3IFXA 4DR7B 3X2QC 4KHPO 3K04A 4HNAA 3F7YC 1DGSA 2QEXV 2DWDC 1N32B 4NYKA 1NKDA 4JI5O 2B5UA 5FL7G 3ABKC 2ZR3A 1F23A 1HP8A 1XNQB 2WSSG 1S5LZ 4R50A 4CH4A 4DV6B 3U10A 1B04A 2Z3YA 4GLXA 1YHQV 1CPYA 3BA8A 1JCHA 5KMGA 1M1KW 4OX9B 4H33A 2ZR2A 1PP9H 4X62B 3E8GA 2QE7G 4TUYA 1BZKA 4DK1A 1GMGA 4H13B 1K4DC 1S5HC 4UVAA 3H1HH 3SYOA 1H2KA 3QO5A 2IM9A 2XTAA 2CE4A 5DN6G 1PPJH 5GTIZ 1W59A 2JK5C 2YC0A 2YIBA 2R9AA 2P4VA 2PF4E 5IWAB 2LGQA 5DM6V 1XBLA 3HKEB 2YICA 3AG2C 2ZINA 4ZI7A 1VQPV 1YJWV 1JR9A 2A79B 3SPJA 1GM7A 3OAAG 1V9PA 3OT7A 3L70H 2ZE6A 1Y6XA 2GDSA 3E89A 1X59A 2EIMC 1SA0B 3BAAA 3RFRA 4K8ZA 3B8MA 1PKXA 1GN4A 2EIKB 2X6AA 2Q7GA 3CRCA 1HNWB 2UXCO 2H3OA 3A2FA 4DV0O 2YSUB 4LF6O 1O9HA 2EULA 4U3JB 2Y4TA 2F66C 2FL4A 2ITDC 4LR3A 3K5OA 4QGPA 4O4LB 1AR1B 2R72A 4FK5C 4JI2B 5LA6B 2LO1A 3L72H 4O4IA 3CCVV 3D8CA 3K9AA 1RPRA 4G27B 4FLZA 3JAKA 2YI9A 1AP5A 2EX3A 5A2QN 2QDOA 1W0KG 2XASA 1AJPA 2DMXA 1SC5B 2DWEC 5J2TA 3J80N 2QTOA 4KP4A 3GB7C 1P84F 5AG2A 4RWUA 1XILA 2ZD9A 3A0BZ 2DYSB 3ETGA 1GK9A 1VF6A 1IXBA 1V54B 3SPHA 2HJDA 2Y69B 2BCCH 3ZRXA 4MVOA 3UM7A 1N33B 3W7SA 5L3EA 4CBCA 3OGCC 4B3SO 1DLBA 3T1CA 1I0HA 5LMNO 2Q6AA 3CJHB 5FNVA 5A9GA 5GTHZ 4I50A 5DECA 4UCVA 2VQFO 1WA8B 4FLTA 1QU7A 1JX9A 4DO2A 4DR7O 2ZE5A 3ASNB 1SQBH 1D2DA 1BGYH 3JSLA 1S5JA 5H9CA 2AGAA 2KB1A 1NTZH 1SZXA 2IJJA 1N32O 3K59A 1IBLB 2AXTZ 2NN4A 4DV6O 2RDCA 2XAQA 5B66Z 3WU2Z 5E79Z 1KU9A 4DV5B 1RSOB 3RYHA 2ZM6B 3RWRD 3M8AA 4OX9O 2IH3C 3HPLC 4X62O 3L74H 1KP2A 1NU1H 3ZHUA 3G67A 3HKCA 3K9SA 3SPGA 1JVMA 1N34B 3FAVA 4YXWG 1GN6A 1VQ6V 3CCQV 3ML0A 2WLMA 4HZ3A 4Z1MG 2LW1A 2EIKC 4X89A 4O4HB 4PA3A 4B3RB 5IWAO 3PJSK 4O2BB 3OMAB 1MMMA 3CPWU 2GTSA 3K0GA 5EBLC 2QWRB 2CGOA 1GTOA 4H0LB 4DW0A 5CA1B 1MSDA 2GHYA 3FB5C 4F6RB 2F43G 5LGNA 3TCUA 2Q7EA 3G71V 4IT5A 4B3TB 5LOVA 1QR9A 2YIAA 5H6QA 1HNWO 1M56C 3ICXA 3OTFA 4A5UB 2EIJC 4P9OA 4YJ3B 2XAJA 5GONB 3VOUA 1WLEA 1AI7A 3S3XA 1K3EA 3T1YB 1YJ9V 1V54C 3VQXA 5L3CA 1O9GA 2JJ1G 2Y69C 4MT8A 1SZTA 5CBFA 4WFGA 5IYZA 1V55B 1YVWA 2E75B 1FYJA 3OGIB 1UJWB 5J2UA 1I5XA 3ZMUA 1BCCH 1DTOA 1QLNA 1K5QA 1HWYA 2V1DA 1GKFA 3E22A 2H94A 4LNUA 1S72V 1XQ8A 4QJFB 2WA3A 3ZMVA 4LCUC 4IHJA 1N36O 4DK0A 3HKDA 3C3SA 1N33O 3ASNC 2QSAA 4ZKIA 1HNXB 1KQSU 2K1EA 1YXBA 2EJRA 3CD6V 2A7WA 3DXRA 4FM0A 3F5TA 5CBHA 1FJGB 4GX0A 3LDDA 3I56V 4I4TB 3SJBC 2M6YA 3OW2U 2DOSA 2LGWA 3VQWA 2UXBB 3R65A 1XI1A 1IDSA 3OUFA 2A9HA 2N04A 4TV8A 1OCRC 3AEIA 3S3WA 1JOYA 3CCJV 3KZIZ 3M99B 3OEEG 1Q82W 3ZRWB 2F4VB 1Y76A 5CA0A 4FM1A 1IBLO 2YIBD 3FFQA 4NXMB 1JFFB 4DXWA 1OCZC 4DV5O 1WN7A 1GN3A 2ZM6O 3BFRA 2QM7A 2ADQB 3UCSC 4UVBA 5K1PA 1VF5B 1KC8W 1YCIA 5CN0A 3CCUV 1N34O 2A0LA 2P06A 1J5EB 2VS0A 3R66A 4ZHQA 5BMVA 1XNRB 4L8JA 1Z2GA 4LF7B 1TVKA 1FKAO 4B3RO 2BSKA 4H37A 3JSNA 2WLLB 3I5DA 4MVZA 4MW8A 1FPOA 1FXKB 3JD2A 1AI4A 1KP3A 5KX5A 1TUEB 1OV9A 1V55C 5B3SB 3EXAA 1Z5WA 4B3TO 3ZEDA 5LXTA 3JAWA 4TT3G 2PI4A 1YTFD 4WFFA 4LH6A 4F4LA 1M4UA 2JGDB 3JCUZ 1FS0G 2HLDG 1J95A 2JIZG 3RYFB 3T1YO 4I9QA 3JYCA 5CBGA 1G1XB 2YXHA 2IU0A 5EC1C 4O4IB 5JJEB 2QWQB 1P4RA 2KG7A 2Y4UA 3BVOA 3JALA 4MS2A 1Q86W 4WFEA 4BWAA 4DUZB 4LF8B 1QCEA 4X1YB 1L0LH 2EZPA 4JI7B 4HBNA 3CB2A 1S77D 4JV5B 3G6BA 1YTFB 2PTMA 2RMKB 3BY6A 2QR4A 5LP6B 1Q5OA 3IJ4A 4JAVA 4MVUA 4MTXA 3KCXA 4X65O 1SQGA 1HNXO 1ZAUA 3CCSV 4W4KA 3SJCC 4DW1A 4J7ZA 4G28B 3P3NA 2QJ1A 4K8XA 4EFEA 4PDVA 3IGAC 3QTCA 2WLIB 2CTPA 3B09A 2ZNIA 3SDLA 1FJGO 4TQDA 2CH7A 2A06H 2WLHA 3CRRA 3RVZA 3A0RA 2Q9LA 1LNQA 1YZBA 2Q69A 5LHIA 5K1XA 2GTAA 4GYCB 4TV9A 2QWPB 1NH2B 4DV4B 4J80A 5EIBD 2DQ0A 1SRYA 2E5LB 3L73H 4LFBB 4DUYO 1XDCA 1VQLV 4PI2A 4YIPA 1BQ0A 2F4VO 4MVRA 3OR7C 4Z2WA 4LFCB 4FPPA 4I0XB 2OYQA 3H1KH 4R8CA 1YDXA 1R6TA 1JA8A 3AK2A 4LF5B 4B7KA 5B1AB 4NXMO 1BT8A 3SYPA 3N2GA 3CXHF 2OCCB 3AG7A 2XOKG 1FXKC 2WWWA 3CWBH 4FFBB 4IL6Z 5B1NA 5FPOA 2JJ2G 3TJTA 5B3SC 1J5EO 2EINB 3JCZA 3SR2C 1MSWD 1XNRO 3FKSG 1OCCB 3SGIA 2GBOA 5EZYB 3P3PA 4LF7O 1F4NA 4NKGB 2CTWA 1XL4A 3OFNG 2EBOA 1IBMB 2JVDA 3L75H 5KLVH 2JEXA 3APQA 2BOCC 3RYCA 2JEUA 4X1IB 3RN4A 4UCUA 3ZRVA 1Q6HA 5EC2C 1BMFG 3UT5A 5LOVB 5L3DA 2GUZA 2PGGA 4B08A 3CRAA 3QF7A 3Q4HA 1DF5A 1SETA 4PELA 4J42A 3ETQA 3DTUB 2FB5A 2W6JG 2CUGA 4PA9A 5LP6C 5LL6Y 1AJNA 3A0HZ 3N2KA 3FYEB 3CC7V 2YEVB 2H8PC 4AQYB 1H38A 1XUQA 1ZUQA 4JI0B 1P7BA 1AJQA 4DUZO 4PJ0Z 3JAMN 4X20B 1K97A 4JI7O 2MW2B 2D3OW 1NVPD 2UUCB 3TETA 4JV5O 2DYRC 1R3LC 1Y74A 1Y66A 5JH7A 3CC2V 2EILB 3OR6C 5BR8B 4XDLA 4QE7A 4EKWA 4NXNB 1ZL8B 2YI8A 4K3AA 2X0LA 5IE9A 3P32A 3D36A 5IJ0A 2Q8VA 5L3GA 4DR6B 3UO3A 1MABG 3O9OA 3ABLC 2XUMA 2B1GA 1UPGA 5IJ9A 1R3KC 1GAXA 4DR1B 4GX2A 2AZ2A 2QM4A 3VQYA 3UQ8A 1I5YA 1EFRG 4BIZA 2Q0OC 5CB4B 1E79G 1VARA 1H8HG 4DV4O 2DJVA 2OCCC 3CC4V 1AP6A 4LFBO 1R3JC 1RFYA 1HDJA 1XOUA 4LF4B 3LNNA 1L0NH 4TV8B 3ZRSA 3FB7C 1JMKC 2WAMA 2EINC 4PI0A 1H8EG 1ZX3A 4I55A 3JD4A 2ZKOA 3LNMB 5H6RA 1OCCC 1I94O 4IIJB 4LFAB 2Q5ZA 1BSMA 4LF5O 4R6ZA 3IAYA 4FMTA 5JJNB 4FIPC 3CMEV 1COWG 2N74A 3NXSA 5JQGB 1HNZB 3K0DA 3JATA 4YY3B 3C90A 4E2LA 2KSDA 1AI5A 2OIEA 3KG2A 4JYBA 4GX5A 4JYCA 2P7TC 1EZJA 3K5LA 1BQZA 4FFKA 4G2KA 4LC1A 1K4CC 3RW0A 1IBMO 1LUWA 4FLWA 2P4KA 1MG1A 2ZT9B 4J7JA 3BHPA 2VWJA 3QNEA 4P30A 5J9PC 4I5SA 3O65A 1S76D 4BIOA 5KX5B 4QPJA 4PV1B 5JCOC 5KHGA 3U0ZA 1XNQO 3JARB 5JVDB 1XREA 3TXSA 2FKXA 3AG3B 5CMUA 4DRXB 1Y4MA 1FD9A 1NS1A 1EN5A 1PNLA 4XBFA 3HR0A 2F23A
chains in the Genus database with same CATH topology
1JOYA 3OMIB 3CCJV 2EILC 2ATKC 3M99B 3OEEG 1Q82W 4UXNA 1VQMV 3ZRWB 1MOFA 2ZXWB 1VQ4V 2WLLA 3E86A 2XAGA 1R73A 1FXKA 2ZDIC 3AG2B 3ZMSA 2DYRB 2Q67A 2ZQMA 3LDEA 3ZMZA 3VBBA 3RBZA 3QO8A 1OCZC 4JGSA 4DXWA 2HKOA 4KFMA 3WFVA 3STZC 2EIMB 1PNMA 1E1QG 5B1BC 1JQ0A 4U7NA 1F4MA 1M57C 5L3BA 2QM7A 1KD1W 2M7WA 1VQOV 4UVBA 2GSMB 3FB8C 1KC8W 5B1AC 5IYBO 5CN0A 5LHGA 3E8BA 1NVPB 3AG1B 1OCOB 5IY5B 3SJQC 3CP1A 3CCUV 2A0LA 3OEHG 4TWKA 5LHHA 1VQ9V 5KA6A 4GCZA 3FYIB 3ABLB 1YSCA 2AHYA 3D3IA 3ETDA 1JJ2U 1W2BU 1ROPA 3JD1A 4N23A 4X88A 4WFBV 1XL6A 1IXMA 1PD3A 3ABMB 3K08A 4UVCA 2UXXA 4JAUA 4JPRA 4WCEV 1NQTA 4J9ZB 2DYSC 4H37A 2LP7A 1QLEC 4PA7A 2WLLB 4MVZA 4MW8A 2BOBC 4MVQA 1FXKB 3JD2A 1AI4A 1Q7YW 1KP3A 1K5SA 1RPOA 3MHHC 2HVKC 3DGEA 3ZIAG 1TUEB 4P9PA 1M56B 1V55C 5B1OA 5B3SB 2EIJB 2PI5A 4N21A 5LGTA 2Q68A 2Z5UA 1B6QA 2IW5A 1ORQC 1VQ8V 1E1RG 4P2ZA 1YI2V 4TT3G 3CMAV 2PI4A 1YTFD 2ITCC 4WFFA 4BAYA 4WFHA 4MTGA 5IYDO 4BIUA 4F4LA 3IFXA 3STLC 2HFEC 1FS0G 5IYCO 3X2QC 1M9NA 2HLDG 1J95A 2JIZG 2IJKA 2P90A 3K04A 3ZCCA 3JYCA 3F7YC 5KUMA 2R9RB 5CBGA 2WLIA 1NR7A 2IU0A 2QEXV 5EC1C 2DWDC 3MHSC 5L3FA 1P4RA 1NKDA 4RUFA 2B5UA 5FL7G 3ABKC 5KUKA 4MS2A 2ZR3A 1F23A 1THZA 2WSSG 4R50A 1Q86W 4WFEA 4JTAB 4PA6A 1QCEA 2LFSA 2Z3YA 3GWOA 5HFLA 1YHQV 2AHZA 3ZJZA 5IDJA 4JTCB 4GX1A 2EZPA 1CPYA 1JCHA 2MK3A 1M1KW 1S77D 3AG4B 4JTDB 1WPXA 4H33A 2ZR2A 4BW5A 1AROP 3E8GA 2QE7G 1YTFB 1GMGA 4CZZA 3ETEA 1K4DC 2ZDIA 3EHBB 3OMNB 3CXCU 3BY6A 1S5HC 2QA4V 3FB6C 3AG3C 5KA5A 1OHHG 3W7WA 4UVAA 1N8RW 4JAVA 4MVUA 4MTXA 3I55V 3SYOA 3CCEV 1QVGU 4QE9A 3QO5A 3G4SV 2X7RB 3ABTA 3CCSV 3OM3B 4J9YB 5DN6G 3JD0A 4G28B 3SYAA 1FFTB 1K9MW 1R6KA 2JK5C 3H01A 4PDVA 3IGAC 3WG7B 1K73W 1DF4A 2WLIB 4XDKA 2ZXWC 3CCRV 5DM6V 3K79A 2V7QG 3AG2C 3SPCA 2WLHA 3RVZA 1VQPV 1K34A 3A0RA 1YJWV 1LNQA 1OCRB 2A79B 2Q69A 3SPJA 2OT5A 3T2MA 1VQ5V 5LHIA 1GM7A 1GM9A 1SESA 3OAAG 1S0VA 1NH2B 2HVJC 4QPKA 3E89A 4UV9A 2DQ0A 1SRYA 2EIMC 4MTOA 3B8MA 1PKXA 5LBQA 1VQNV 2EIKB 1QVFU 2X6AA 1VQLV 2YSUB 3AG1C 1OCOC 5IY5C 2R9IA 4MVRA 3OR7C 5EBMC 4FPPA 1OCZB 2ITDC 1AI6A 2LFRA 4R8CA 1AR1B 4FK5C 3W7UA 2OTJV 3W7XA 4LBEC 4PA4A 5B1AB 3CCVV 3SYPA 5BZBA 4MVSA 3ABMC 3K9AA 1RPRA 4G27B 3E8FA 4MTFA 4PDMA 2OCCB 4WFAV 3T4DA 3SPIA 4JASA 2XOKG 1FXKC 2WWWA 1W0KG 2XASA 1AJPA 2JDIG 2DWEC 2FTKA 2B1IA 2QTOA 4KP4A 3GB7C 1G4YB 2JJ2G 3QO7A 5B1NA 4HYOA 5B3SC 2EINB 3JCZA 1MSWD 2ZD9A 4R7CA 2DYSB 3ETGA 3FKSG 1GM8A 1GK9A 1OCCB 2W6IG 3B8NA 1V54B 3OUSA 2YEVA 3SPHA 1F4NA 2Y69B 4XDJA 1XL4A 3OFNG 2EBOA 2Y48A 3ZRXA 4MVOA 3UM7A 2WLJA 2EZOA 1RM1B 3W7SA 2JEXA 3MD0A 5L3EA 1OZ0A 4CBCA 2BOCC 4RQFA 2UXNA 3OGCC 2JEUA 1DLBA 3T1CA 2Q6AA 3LSQA 3EFFK 3ZRVA 4JF3A 5EBWC 1K92A 2NNUA 5EC2C 3IC7A 1BMFG 3SYQA 3W7TA 4FJCC 2P67A 5L3DA 3ABUA 1DF5A 4MVMA 1JX9A 1SETA 4DO2A 4PELA 3ASNB 1NJIW 4TSFG 3DTUB 3E83A 2W6JG 4ASUG 4PA9A 4MSWC 5H9CA 1AJNA 3FYEB 3CC7V 3CYOA 1W0JG 2YEVB 2H8PC 3E2EA 5HFMA 3T4ZA 1R6NA 2KB1A 2W0FC 2IJJA 1H38A 1NR1A 1SERA 3ZN0A 1P7BA 1AJQA 1M90W 3K3WA 5LGUA 1BHBA 2XAQA 3ZMTA 1K8AW 1PL0A 3WG7C 4MW3A 4Q20A 3F5WC 1K97A 1L1FA 2D3OW 2IH3C 2IH1C 1NVPD 3TETA 3HPLC 1CEZA 2DYRC 1R3LC 3ASOB 1KP2A 1Y66A 3ZN1A 4LP8A 3CC2V 3SPGA 2EILB 3OE7G 1JVMA 3OR6C 4YXWG 1NBMG 4XDLA 2WLKA 4QE7A 1YITV 4EKWA 5E1AC 1KKDA 1VQ6V 2DW4A 2X6CA 1F51A 3CCQV 3ML0A 2WLMA 4HZ3A 4Z1MG 2EIKC 1CP9A 2X0LA 4X89A 3P32A 3D36A 1JPXA 5L3GA 4PA3A 3SYCA 2XAHA 4KUMA 1MABG 1ZWIC 3LUTB 3PJSK 3OMAB 3B77A 3ABLC 2B1GA 3CPWU 1YJNV 5B1BB 3K0GA 1M57B 4QNHB 1R3KC 4GX2A 4ZBMA 5EBLC 1K7DA 1BL8A 1I5YA 2DQ3A 1GTOA 1EFRG 4BIZA 2GHYA 3FB5C 1E79G 2HR3A 1H8HG 1R3IC 2F43G 2OCCC 5LGNA 4WF9V 1G8MA 3CC4V 3TCUA 3G71V 1R3JC 1QR9A 3LSSA 5GW7A 4QIWF 2WLNA 5H6QA 1K33A 1M56C 1H2GA 5CA3A 3UKMA 3ZRSA 4I9WA 3FB7C 3RVYA 2EIJC 4P9OA 2QM8A 2NLJC 2WAMA 2EINC 2XAJA 1H8EG 3CCLV 1QLEB 3HB3B 1WLEA 3VOUA 2WPDG 3JD4A 1FXHA 1AI7A 3LNMB 5H6RA 1OCCC 1K3EA 1YJ9V 1V54C 5L3CA 1S3JA 2JJ1G 2Y69C 4MT8A 1SZTA 4R6ZA 5CBFA 4WFGA 1V55B 4L87A 4FMTA 4FIPC 3CMEV 1UJWB 1COWG 1PNKA 1RM1C 3NXSA 1I5XA 3ZMUA 1DTOA 1QLNA 2XNDG 3K0DA 3CCMV 1K5QA 5EK0A 1HWYA 4OXSA 4UV8A 4E2LA 1AI5A 4HAMA 2V1DA 1BHAA 3KG2A 1GKFA 3E35A 2H94A 4JYBA 4GX5A 4JYCA 2IJIA 4UUJC 3TK1A 3BEHA 4RQEA 1ENVA 2P7TC 3K03A 1S72V 1EZJA 3X2QB 4GT1A 4QJFB 5C93A 2IU3A 4X8AA 3ZMVA 4G2KA 1Q81W 4LCUC 3ZRWA 2OTLV 4LC1A 1K4CC 3RW0A 3AG4C 1MG1A 2X6BA 1YIJV 3ASNC 3E8HA 4ZKIA 4RUEA 1KQSU 3ABKB 3K06A 1FXVA 2K1EA 4PDLA 2HJFC 3QNEA 3LDCA 4P30A 2EJRA 4RAIA 5J9PC 4I5SA 3CD6V 4U7OA 1VQKV 1S76D 1QR8A 1KECA 3P30A 4QPJA 3F7VC 5CBHA 1QBZA 2HG5C 4PDRA 4GX0A 3LDDA 3I56V 2CK3G 1NH2D 3OW2U 1GO3F 3AG3B 5CMUA 3G6EV 4RO2A 2P6JA 1Y4MA 2C2AA 3JD3A 3R65A 3OUFA 2A9HA 2XAFA 1VQ7V 1PNLA 4XBFA 2IJHA 1EBOA 1OCRC 3ASOC 3AEIA 2QKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ V;  1YIT V;  1S72 V;  1KD1 W;  1VQO V;  1YHQ V;  3CCV V;  1Q82 W;  1KC8 W;  4WFA V;  1VQM V;  1YJ9 V;  1VQN V;  1K9M W;  1VQ6 V;  1QVF U;  1Q7Y W;  1M90 W;  3CCU V;  1K73 W;  3CCQ V;  1Q81 W;  1VQL V;  1M1K W;  1VQ4 V;  4WF9 V;  3CC4 V;  1K8A W;  3I56 V;  3G71 V;  3CME V;  3CCR V;  2OTL V;  5DM6 V;  1R73 A;  3OW2 U;  1VQ9 V;  1NJI W;  3CCS V;  3CXC U;  3G6E V;  1YIJ V;  3CCM V;  2QA4 V;  2D3O W;  2QEX V;  1VQP V;  1N8R W;  1KQS U;  1YJW V;  1JJ2 U;  1VQ8 V;  3CC7 V;  3CPW U;  1YJN V;  1W2B U;  4WFB V;  3I55 V;  3CCE V;  1VQ5 V;  1QVG U;  1VQ7 V;  3CC2 V;  2OTJ V;  3CCL V;  1YI2 V;  3G4S V;  3CD6 V;  1Q86 W;  3CMA V;  1VQK V;  4WCE V; 
#chains in the Genus database with same CATH topology
 3OMI B;  2EIL C;  2ZE8 A;  4UXN A;  1VQM V;  4NTW A;  2ZXW B;  4AQY O;  3E86 A;  2XAG A;  1R73 A;  2ZDI C;  1T5E A;  2ZIO A;  5C8Y A;  2O57 A;  3QO8 A;  3JAS B;  2HKO A;  3WFV A;  4GKJ B;  3L9D A;  1E1Q G;  3K58 A;  4U7N A;  2UUC O;  4Q6G A;  2BTQ B;  5LHG A;  2QGN A;  3AG1 B;  2N05 A;  1OCO B;  3H9V A;  5IY5 B;  3OEH G;  5BR8 O;  4NXN O;  4JI4 B;  4GCZ A;  4LWS B;  2AHY A;  4X88 A;  1XEQ A;  4JI1 B;  4DR6 O;  1PD3 A;  3ABM B;  3KKY A;  4UVC A;  4JAU A;  4WCE V;  1NQT A;  1H2S B;  4J9Z B;  2DYS C;  4EB6 B;  4JI2 O;  5KHJ A;  2JS5 A;  4DR1 O;  1FFX B;  1QHT A;  1KB9 F;  2HVK C;  3ZIA G;  4P9P A;  3CX5 F;  4BR6 A;  5LGT A;  2UXD B;  4TV9 B;  1ORQ C;  1VQ8 V;  4LF4 O;  4FLX A;  3HKB B;  4JZ2 A;  3WB1 A;  3UO2 A;  3BA9 A;  2YDE A;  4BIU A;  3STL C;  5KHK A;  1WP8 A;  4X1K A;  5KHH A;  3KCY A;  2P90 A;  3ZCC A;  5EYP B;  5KUM A;  2R9R B;  2RQ6 A;  1NR7 A;  2ZE7 A;  3HKE A;  5D5P A;  1TUB B;  4RUF A;  1HNZ O;  5KUK A;  4YY3 O;  4JTA B;  4YJ2 B;  4DR5 B;  1IUR A;  3RYI B;  2OWO A;  2AHZ A;  3ZJZ A;  5IDJ A;  4JTC B;  4ZOL B;  3AG4 B;  4JTD B;  1SA0 A;  4BW5 A;  4O2A B;  1ARO P;  4CZZ A;  2ZDI A;  4NR1 A;  3OMN B;  3CXC U;  4J10 A;  4O4J A;  3AG3 C;  5KA5 A;  1OHH G;  3W7W A;  4U3J A;  1N8R W;  1KMI Z;  3G80 A;  4TQF A;  1QVG U;  4QE9 A;  4CS4 A;  1I08 A;  2X7R B;  4KXR A;  4O4L A;  2JS3 A;  3ABT A;  3OM3 B;  1HW7 A;  2RJZ A;  3JD0 A;  4J9Y B;  5LA6 A;  1MZF A;  2RNB A;  2KKW A;  4HNA B;  1R6K A;  3H01 A;  1K9M W;  3TXQ A;  1K73 W;  1DF4 A;  4J11 A;  3THO A;  4XDK A;  2ZXW C;  3CCR V;  3K79 A;  2V7Q G;  2XHB A;  1K34 A;  3MDS A;  3H1I H;  5FLX N;  2AZ0 A;  1VQ5 V;  2GUZ B;  1GM9 A;  1SES A;  1S0V A;  1AR5 A;  5KMG B;  4QPK A;  4UV9 A;  4MTO A;  4UFZ A;  5LBQ A;  4TOI A;  4TUY B;  1QVF U;  3AG1 C;  1IZ3 A;  1OCO C;  1SS3 A;  5IY5 C;  2R9I A;  4AI8 A;  2CGN A;  1TAE A;  1AI6 A;  2LFR A;  4D6T H;  2G38 A;  4IGG A;  4K35 A;  2OTJ V;  4LBE C;  3CJH A;  4WBN A;  4CS3 A;  3ABM C;  3AK1 A;  5LMU B;  2ZCE A;  4MTF A;  4WFA V;  1WA8 A;  3T4D A;  3SPI A;  4GKJ O;  4ABM A;  1SQF A;  4ZI7 B;  2JDI G;  2HHH B;  3QO7 A;  4YHH B;  1RP3 B;  4JI4 O;  5JWP A;  1AR4 A;  1KBH A;  3B8N A;  4AHC A;  3OTO B;  3OUS A;  4UCO A;  1WAZ A;  4X64 B;  4XDJ A;  5LYJ A;  5IJ0 B;  1R1B A;  3BRC A;  4JI1 O;  2Y48 A;  2EZO A;  1RM1 B;  4RQF A;  2UXN A;  4CC6 A;  3MAQ A;  5IJ9 B;  1H2N A;  3CRQ A;  3ZS8 C;  4BW9 A;  4EEQ A;  1RSO A;  2BE3 A;  1UFI A;  2NNU A;  4GUN A;  2Q0A A;  1AVM A;  3JAK B;  2UXD O;  3W7T A;  4FJC C;  2P67 A;  4DV3 B;  4LH7 A;  1Q90 D;  5J2T B;  5IT9 N;  1A32 A;  4TSF G;  2LQT A;  2RN9 A;  1AB3 A;  5HFM A;  1TGO A;  1R6N A;  4IYH A;  2UUB B;  4O2B A;  1M5I A;  2YXY A;  3NR7 A;  1NR1 A;  1SER A;  4CC5 A;  3ZN0 A;  1WNS A;  1SQV H;  2GV9 A;  3J7A U;  5LGU A;  1BHB A;  3JAT B;  4DR5 O;  1PL0 A;  3VQV A;  5CA1 A;  5FNV B;  4Q20 A;  3F5W C;  3APO A;  4F6R A;  4I50 B;  1L1F A;  4W4L A;  2Q7H A;  1IX9 A;  1CEZ A;  2AW9 A;  3N27 A;  3OE7 G;  2UXB O;  1Q8I A;  3ZHV A;  5GON A;  5ITZ A;  2X6C A;  2P5O A;  2BTO A;  1JPX A;  4CH3 A;  2XAH A;  1ZWI C;  1GN2 A;  4DR2 B;  5B1B B;  3FD9 A;  1M57 B;  4QNH B;  1Q6U A;  4ZBM A;  1K7D A;  1XMO B;  2QKA A;  2HR3 A;  3RYH B;  4WF9 V;  3LSS A;  5GW7 A;  4QIW F;  1K33 A;  3HKC B;  4AIL C;  5CA3 A;  3UKM A;  3FAV B;  2QM8 A;  3CCL V;  2WPD G;  1FXH A;  3H1L H;  2QKC A;  1EN6 A;  4B3S B;  4NVP A;  1YEW A;  2NR5 A;  5LMN B;  1VEW A;  4L87 A;  4OGQ B;  5LMU O;  1RM1 C;  4JI6 B;  2VQF B;  3CCM V;  5F2V O;  4I4T A;  4JI3 B;  2F1M A;  2YID A;  4UV8 A;  4KL1 A;  2HHH O;  4HAM A;  3E35 A;  4UUJ C;  3BEH A;  4RQE A;  2FML A;  4YHH O;  4X8A A;  4DR4 B;  1Q81 W;  3OTO O;  4X64 O;  3CEI A;  3ZRW A;  4D7T A;  2X6B A;  2DN9 A;  1NTM H;  4RUE A;  3K06 A;  4FZ1 A;  4C7U A;  2HJF C;  1VF6 C;  1EM1 A;  3LDC A;  4RAI A;  4U7O A;  4J7K A;  1JFF A;  1QR8 A;  5IYZ B;  1G6U A;  1QBZ A;  5J2U B;  4LF8 O;  3WB2 A;  2UU9 B;  2PUS A;  3A8T A;  4DV3 O;  4JYA B;  1FAF A;  1GO3 F;  4RO2 A;  4DV7 B;  3E22 B;  2C2A A;  4FLV A;  3JD3 A;  4IYI A;  5TIS Z;  4LNU B;  1WPB A;  1VQ7 V;  2IJH A;  1EBO A;  2QKS A;  2QWO B;  4X1K B;  2JGU A;  3ZHQ A;  1MOF A;  4IHJ B;  2UUB O;  1SF9 A;  3LSU A;  3HKD B;  2WLL A;  4FLU A;  1FXK A;  1HR0 B;  3ZMS A;  1LUV A;  4FM2 A;  2Q67 A;  3ZMZ A;  2ZIM A;  4K0K B;  2OCH A;  3DXR B;  1KUQ A;  4JGS A;  2CTQ A;  1Q3E A;  4KFM A;  3STZ C;  5B1B C;  2LW7 A;  1M57 C;  1CXZ B;  1ZSP A;  2WA4 A;  2LJ2 A;  1JJO A;  5B1A C;  1NVP B;  3SJQ C;  3CP1 A;  4O4J B;  3PN1 A;  4TWK A;  1MA1 A;  2E5L O;  2JGD A;  5LHH A;  5KA6 A;  1YSC A;  3D3I A;  3RYF A;  5EIB C;  3ETD A;  3BAB A;  5BXZ A;  3CSX A;  4LFC O;  1IXM A;  3K08 A;  1Y76 B;  2QWN B;  2UXX A;  5CA0 B;  3DC5 A;  4PA7 A;  4DR2 O;  3IC9 A;  4MVQ A;  1Q7Y W;  4FZ0 A;  4X1Y A;  1K5S A;  3MHH C;  4UB6 Z;  1XMO O;  3DGE A;  1M56 B;  4U3F H;  4PHZ A;  2EIJ B;  3B2E E;  5B5E Z;  3SJA C;  4DV2 B;  1B6Q A;  2IW5 A;  1E1R G;  4P2Z A;  5LP6 A;  3M7M X;  1NTK H;  3CMA V;  4BAY A;  5IYD O;  4WFH A;  4MTG A;  1N36 B;  2HFE C;  5IYC O;  5BMV B;  4ZHQ B;  1EN4 A;  4LF9 B;  2Y0I A;  1M9N A;  2IJK A;  1TVK B;  2WLI A;  1U97 A;  3BPZ A;  3K5M A;  2BSK B;  3GVM A;  3MHS C;  4WBN B;  5L3F A;  4JI6 O;  1Z5V A;  2A3Q A;  2YXL A;  1NZ6 A;  1THZ A;  1MNG A;  4JI3 O;  4PA6 A;  2LFS A;  3GWO A;  2PZS A;  2VRZ A;  5HFL A;  1LR1 A;  1U96 A;  2VQE B;  4GX1 A;  2MK3 A;  1WPX A;  4X66 B;  3CRM A;  3ETE A;  5LXT B;  3EHB B;  4DR4 O;  1TA8 A;  2QA4 V;  5JJJ B;  3JAW B;  3FB6 C;  1NT2 B;  3J81 N;  4I0X A;  5LYJ B;  3I55 V;  2E74 B;  3CCE V;  3G4S V;  4I7Z B;  1EZV H;  3SYA A;  1FFT B;  1N4C A;  4J41 A;  3WG7 B;  2ETN A;  2R70 A;  2KG7 B;  3JAL B;  4JI0 O;  3K57 A;  3SPC A;  2UU9 O;  4JYA O;  1OCR B;  4FFB A;  2CTR A;  2OT5 A;  3T2M A;  5H5N A;  4DV7 O;  2ODM A;  2HVJ C;  4Z1V A;  1BS3 A;  1VQN V;  1D5N A;  5EZY A;  4NTY A;  3ZBH A;  5DED A;  5EBM C;  3RGB A;  1OCZ B;  3QG5 A;  4X1I A;  2CDY A;  3W7U A;  1HR0 O;  3W7X A;  3OD4 A;  2CAZ C;  4PA4 A;  3U11 A;  1KYO F;  5BZB A;  4K0K O;  4MVS A;  1WJZ A;  4DV1 B;  2K9P A;  3E8F A;  4PDM A;  4X9Q A;  1SQQ H;  4JAS A;  2CH7 B;  2DE0 X;  2HEP A;  1P7G A;  1Q6I A;  2FTK A;  2B1I A;  4JI8 B;  2PY5 A;  1G4Y B;  2PYL A;  4HYO A;  3ZHT A;  1F7Y A;  5KAI Z;  4R7C A;  5ITZ B;  1GM8 A;  2W6I G;  2YEV A;  2F95 B;  4PD4 F;  1IVS A;  3B4S A;  5JCO A;  1KKC A;  2WLJ A;  4UB8 Z;  4DR3 B;  4GKK B;  3MD0 A;  1OZ0 A;  2RCV A;  4LFA O;  3L71 H;  4CH6 A;  3DC6 A;  1ZTE A;  3WB0 A;  4X20 A;  3LSQ A;  1SQP H;  3EFF K;  4H44 B;  3N2G B;  4JF3 A;  5EBW C;  1K92 A;  4EFB A;  1BE3 H;  4B7E A;  3IC7 A;  3SYQ A;  4DV2 O;  1P49 A;  2KQX A;  3ABU A;  2FYU H;  4MVM A;  1PV0 A;  2F93 B;  3EVK A;  1DK1 A;  1Q43 A;  1ZL8 A;  2Q73 A;  4X65 B;  1NJI W;  2V4D A;  1IBK B;  4LF9 O;  3E83 A;  4ASU G;  3T1H B;  4MSW C;  5KAF Z;  2QTS A;  3CYO A;  1W0J G;  3E2E A;  3T4Z A;  2EJ7 A;  2W0F C;  1VMG A;  3CHX A;  1ZLZ A;  2ZNJ A;  3RYC B;  1M90 W;  3K3W A;  3ZMT A;  1K8A W;  3WG7 C;  4MW3 A;  2VQE O;  2ILM A;  5CB4 A;  4FVM A;  4GZR B;  1WB7 A;  2IH1 C;  3ZHS A;  4X66 O;  3ASO B;  3UT5 B;  3ZN1 A;  4LP8 A;  4DUY B;  2L35 A;  3AK3 A;  3Q4H B;  2L6L A;  1NBM G;  1YIT V;  2WLK A;  4UCS A;  2Y0P A;  5E1A C;  1KKD A;  2DW4 A;  1F51 A;  4IIJ A;  4ZIB A;  1CP9 A;  3N2K B;  3ZX6 A;  2Q4P A;  3SYC A;  4KUM A;  3LUT B;  3B77 A;  5JQG A;  1YJN V;  1VF7 A;  4B3M B;  1BL8 A;  2DQ3 A;  3CE2 A;  1QQC A;  2Z0A A;  4NTX A;  4YIO A;  1R3I C;  1OJH A;  1G8M A;  4JAA A;  1Y74 B;  2WLN A;  1I7F A;  5JH7 B;  1XMQ B;  1H2G A;  4CS2 A;  4I9W A;  3RVY A;  1GRJ A;  2UUA B;  2NLJ C;  1QLE B;  3HB3 B;  1X4T A;  1B06 A;  1NI8 A;  1WB8 A;  5D5Q A;  2D2C B;  4KHP B;  1S3J A;  1PM9 A;  1PL4 A;  2ARH A;  1MZE A;  4DV1 O;  1PNK A;  4JI5 B;  1VP7 A;  3JAR A;  5JVD A;  2XND G;  5EK0 A;  5H2F Z;  4OXS A;  4DRX A;  4DYL A;  3FX7 A;  1BHA A;  4JYY A;  3TK1 A;  2IJI A;  4JI8 O;  3BCC H;  1ENV A;  3K03 A;  3X2Q B;  4GT1 A;  5KHI A;  5C93 A;  2IU3 A;  2OIG A;  5FPR A;  1WP7 A;  2OTL V;  4F6E A;  2W0X A;  3AG4 C;  4NB5 A;  4CH5 A;  1YIJ V;  1GH6 A;  4OPH A;  4DR3 O;  4GKK O;  1VIB A;  3E8H A;  4FLY A;  4UCR A;  3ABK B;  4I55 B;  4O4H A;  1FXV A;  2B9Z A;  4ICG A;  4PDL A;  1QNM A;  3B40 A;  4E4E A;  1VQK V;  1KEC A;  3P30 A;  3JAS A;  3F7V C;  2HG5 C;  4PDR A;  1N0J A;  2BTQ A;  2CK3 G;  2YS8 A;  1NH2 D;  3DSQ A;  3G6E V;  2P6J A;  2IBZ H;  2XAF A;  2JRI A;  4LWS A;  1AIL A;  1IBK O;  1SKV A;  3K5N A;  3ASO C;  5BY1 A;  1URF A;  3T1H O;  2UXC B;  4DV0 B;  4LF6 B;  2ATK C;  4YJ3 A;  1VQ4 V;  1D5A A;  1YF2 A;  4EB6 A;  2PYJ A;  3C3T A;  3AG2 B;  4UCT A;  1FFX A;  2DYR B;  3QVN A;  2ZQM A;  1H2L A;  3LDE A;  4OPA A;  3VBB A;  3RBZ A;  3RT3 C;  1B3Q A;  2EIM B;  2YUA A;  1PNM A;  2E3C A;  1H2M A;  1JQ0 A;  1US6 A;  1F4M A;  1XHZ A;  5L3B A;  1KD1 W;  2M7W A;  1VQO V;  2GSM B;  3FB8 C;  1Y67 A;  2VWK A;  3HKB A;  5IYB O;  3E8B A;  2P22 C;  1SQX H;  2XT9 A;  1VQ9 V;  3FYI B;  3ABL B;  2ADP A;  1L8D A;  1I94 B;  1JJ2 U;  2E76 B;  5EYP A;  1W2B U;  1ROP A;  2HP8 A;  3JD1 A;  4N23 A;  4WFB V;  1XL6 A;  3TGU H;  1XHX A;  4JPR A;  1TUB A;  2LP7 A;  1QLE C;  2BOB C;  4B3M O;  3H1J H;  4YJ2 A;  3CS5 A;  3D36 C;  1RPO A;  5C8Y B;  3RYI A;  4ZOL A;  5B1O A;  3ZHR A;  2PI5 A;  4N21 A;  4JZG A;  2Q68 A;  4O2A A;  2Z5U A;  4D7S A;  1M93 A;  3GWK C;  3D3Q A;  1XMQ O;  1YI2 V;  1N0N A;  2UUA O;  2ITC C;  3IFX A;  4DR7 B;  3X2Q C;  4KHP O;  3K04 A;  4HNA A;  3F7Y C;  1DGS A;  2QEX V;  2DWD C;  1N32 B;  4NYK A;  1NKD A;  4JI5 O;  2B5U A;  5FL7 G;  3ABK C;  2ZR3 A;  1F23 A;  1HP8 A;  1XNQ B;  2WSS G;  1S5L Z;  4R50 A;  4CH4 A;  4DV6 B;  3U10 A;  1B04 A;  2Z3Y A;  4GLX A;  1YHQ V;  1CPY A;  3BA8 A;  1JCH A;  5KMG A;  1M1K W;  4OX9 B;  4H33 A;  2ZR2 A;  1PP9 H;  4X62 B;  3E8G A;  2QE7 G;  4TUY A;  1BZK A;  4DK1 A;  1GMG A;  4H13 B;  1K4D C;  1S5H C;  4UVA A;  3H1H H;  3SYO A;  1H2K A;  3QO5 A;  2IM9 A;  2XTA A;  2CE4 A;  5DN6 G;  1PPJ H;  5GTI Z;  1W59 A;  2JK5 C;  2YC0 A;  2YIB A;  2R9A A;  2P4V A;  2PF4 E;  5IWA B;  2LGQ A;  5DM6 V;  1XBL A;  3HKE B;  2YIC A;  3AG2 C;  2ZIN A;  4ZI7 A;  1VQP V;  1YJW V;  1JR9 A;  2A79 B;  3SPJ A;  1GM7 A;  3OAA G;  1V9P A;  3OT7 A;  3L70 H;  2ZE6 A;  1Y6X A;  2GDS A;  3E89 A;  1X59 A;  2EIM C;  1SA0 B;  3BAA A;  3RFR A;  4K8Z A;  3B8M A;  1PKX A;  1GN4 A;  2EIK B;  2X6A A;  2Q7G A;  3CRC A;  1HNW B;  2UXC O;  2H3O A;  3A2F A;  4DV0 O;  2YSU B;  4LF6 O;  1O9H A;  2EUL A;  4U3J B;  2Y4T A;  2F66 C;  2FL4 A;  2ITD C;  4LR3 A;  3K5O A;  4QGP A;  4O4L B;  1AR1 B;  2R72 A;  4FK5 C;  4JI2 B;  5LA6 B;  2LO1 A;  3L72 H;  4O4I A;  3CCV V;  3D8C A;  3K9A A;  1RPR A;  4G27 B;  4FLZ A;  3JAK A;  2YI9 A;  1AP5 A;  2EX3 A;  5A2Q N;  2QDO A;  1W0K G;  2XAS A;  1AJP A;  2DMX A;  1SC5 B;  2DWE C;  5J2T A;  3J80 N;  2QTO A;  4KP4 A;  3GB7 C;  1P84 F;  5AG2 A;  4RWU A;  1XIL A;  2ZD9 A;  3A0B Z;  2DYS B;  3ETG A;  1GK9 A;  1VF6 A;  1IXB A;  1V54 B;  3SPH A;  2HJD A;  2Y69 B;  2BCC H;  3ZRX A;  4MVO A;  3UM7 A;  1N33 B;  3W7S A;  5L3E A;  4CBC A;  3OGC C;  4B3S O;  1DLB A;  3T1C A;  1I0H A;  5LMN O;  2Q6A A;  3CJH B;  5FNV A;  5A9G A;  5GTH Z;  4I50 A;  5DEC A;  4UCV A;  2VQF O;  1WA8 B;  4FLT A;  1QU7 A;  1JX9 A;  4DO2 A;  4DR7 O;  2ZE5 A;  3ASN B;  1SQB H;  1D2D A;  1BGY H;  3JSL A;  1S5J A;  5H9C A;  2AGA A;  2KB1 A;  1NTZ H;  1SZX A;  2IJJ A;  1N32 O;  3K59 A;  1IBL B;  2AXT Z;  2NN4 A;  4DV6 O;  2RDC A;  2XAQ A;  5B66 Z;  3WU2 Z;  5E79 Z;  1KU9 A;  4DV5 B;  1RSO B;  3RYH A;  2ZM6 B;  3RWR D;  3M8A A;  4OX9 O;  2IH3 C;  3HPL C;  4X62 O;  3L74 H;  1KP2 A;  1NU1 H;  3ZHU A;  3G67 A;  3HKC A;  3K9S A;  3SPG A;  1JVM A;  1N34 B;  3FAV A;  4YXW G;  1GN6 A;  1VQ6 V;  3CCQ V;  3ML0 A;  2WLM A;  4HZ3 A;  4Z1M G;  2LW1 A;  2EIK C;  4X89 A;  4O4H B;  4PA3 A;  4B3R B;  5IWA O;  3PJS K;  4O2B B;  3OMA B;  1MMM A;  3CPW U;  2GTS A;  3K0G A;  5EBL C;  2QWR B;  2CGO A;  1GTO A;  4H0L B;  4DW0 A;  5CA1 B;  1MSD A;  2GHY A;  3FB5 C;  4F6R B;  2F43 G;  5LGN A;  3TCU A;  2Q7E A;  3G71 V;  4IT5 A;  4B3T B;  5LOV A;  1QR9 A;  2YIA A;  5H6Q A;  1HNW O;  1M56 C;  3ICX A;  3OTF A;  4A5U B;  2EIJ C;  4P9O A;  4YJ3 B;  2XAJ A;  5GON B;  3VOU A;  1WLE A;  1AI7 A;  3S3X A;  1K3E A;  3T1Y B;  1YJ9 V;  1V54 C;  3VQX A;  5L3C A;  1O9G A;  2JJ1 G;  2Y69 C;  4MT8 A;  1SZT A;  5CBF A;  4WFG A;  5IYZ A;  1V55 B;  1YVW A;  2E75 B;  1FYJ A;  3OGI B;  1UJW B;  5J2U A;  1I5X A;  3ZMU A;  1BCC H;  1DTO A;  1QLN A;  1K5Q A;  1HWY A;  2V1D A;  1GKF A;  3E22 A;  2H94 A;  4LNU A;  1S72 V;  1XQ8 A;  4QJF B;  2WA3 A;  3ZMV A;  4LCU C;  4IHJ A;  1N36 O;  4DK0 A;  3HKD A;  3C3S A;  1N33 O;  3ASN C;  2QSA A;  4ZKI A;  1HNX B;  1KQS U;  2K1E A;  1YXB A;  2EJR A;  3CD6 V;  2A7W A;  3DXR A;  4FM0 A;  3F5T A;  5CBH A;  1FJG B;  4GX0 A;  3LDD A;  3I56 V;  4I4T B;  3SJB C;  2M6Y A;  3OW2 U;  2DOS A;  2LGW A;  3VQW A;  2UXB B;  3R65 A;  1XI1 A;  1IDS A;  3OUF A;  2A9H A;  2N04 A;  4TV8 A;  1OCR C;  3AEI A;  3S3W A;  1JOY A;  3CCJ V;  3KZI Z;  3M99 B;  3OEE G;  1Q82 W;  3ZRW B;  2F4V B;  1Y76 A;  5CA0 A;  4FM1 A;  1IBL O;  2YIB D;  3FFQ A;  4NXM B;  1JFF B;  4DXW A;  1OCZ C;  4DV5 O;  1WN7 A;  1GN3 A;  2ZM6 O;  3BFR A;  2QM7 A;  2ADQ B;  3UCS C;  4UVB A;  5K1P A;  1VF5 B;  1KC8 W;  1YCI A;  5CN0 A;  3CCU V;  1N34 O;  2A0L A;  2P06 A;  1J5E B;  2VS0 A;  3R66 A;  4ZHQ A;  5BMV A;  1XNR B;  4L8J A;  1Z2G A;  4LF7 B;  1TVK A;  1FKA O;  4B3R O;  2BSK A;  4H37 A;  3JSN A;  2WLL B;  3I5D A;  4MVZ A;  4MW8 A;  1FPO A;  1FXK B;  3JD2 A;  1AI4 A;  1KP3 A;  5KX5 A;  1TUE B;  1OV9 A;  1V55 C;  5B3S B;  3EXA A;  1Z5W A;  4B3T O;  3ZED A;  5LXT A;  3JAW A;  4TT3 G;  2PI4 A;  1YTF D;  4WFF A;  4LH6 A;  4F4L A;  1M4U A;  2JGD B;  3JCU Z;  1FS0 G;  2HLD G;  1J95 A;  2JIZ G;  3RYF B;  3T1Y O;  4I9Q A;  3JYC A;  5CBG A;  1G1X B;  2YXH A;  2IU0 A;  5EC1 C;  4O4I B;  5JJE B;  2QWQ B;  1P4R A;  2KG7 A;  2Y4U A;  3BVO A;  3JAL A;  4MS2 A;  1Q86 W;  4WFE A;  4BWA A;  4DUZ B;  4LF8 B;  1QCE A;  4X1Y B;  1L0L H;  2EZP A;  4JI7 B;  4HBN A;  3CB2 A;  1S77 D;  4JV5 B;  3G6B A;  1YTF B;  2PTM A;  2RMK B;  3BY6 A;  2QR4 A;  5LP6 B;  1Q5O A;  3IJ4 A;  4JAV A;  4MVU A;  4MTX A;  3KCX A;  4X65 O;  1SQG A;  1HNX O;  1ZAU A;  3CCS V;  4W4K A;  3SJC C;  4DW1 A;  4J7Z A;  4G28 B;  3P3N A;  2QJ1 A;  4K8X A;  4EFE A;  4PDV A;  3IGA C;  3QTC A;  2WLI B;  2CTP A;  3B09 A;  2ZNI A;  3SDL A;  1FJG O;  4TQD A;  2CH7 A;  2A06 H;  2WLH A;  3CRR A;  3RVZ A;  3A0R A;  2Q9L A;  1LNQ A;  1YZB A;  2Q69 A;  5LHI A;  5K1X A;  2GTA A;  4GYC B;  4TV9 A;  2QWP B;  1NH2 B;  4DV4 B;  4J80 A;  5EIB D;  2DQ0 A;  1SRY A;  2E5L B;  3L73 H;  4LFB B;  4DUY O;  1XDC A;  1VQL V;  4PI2 A;  4YIP A;  1BQ0 A;  2F4V O;  4MVR A;  3OR7 C;  4Z2W A;  4LFC B;  4FPP A;  4I0X B;  2OYQ A;  3H1K H;  4R8C A;  1YDX A;  1R6T A;  1JA8 A;  3AK2 A;  4LF5 B;  4B7K A;  5B1A B;  4NXM O;  1BT8 A;  3SYP A;  3N2G A;  3CXH F;  2OCC B;  3AG7 A;  2XOK G;  1FXK C;  2WWW A;  3CWB H;  4FFB B;  4IL6 Z;  5B1N A;  5FPO A;  2JJ2 G;  3TJT A;  5B3S C;  1J5E O;  2EIN B;  3JCZ A;  3SR2 C;  1MSW D;  1XNR O;  3FKS G;  1OCC B;  3SGI A;  2GBO A;  5EZY B;  3P3P A;  4LF7 O;  1F4N A;  4NKG B;  2CTW A;  1XL4 A;  3OFN G;  2EBO A;  1IBM B;  2JVD A;  3L75 H;  5KLV H;  2JEX A;  3APQ A;  2BOC C;  3RYC A;  2JEU A;  4X1I B;  3RN4 A;  4UCU A;  3ZRV A;  1Q6H A;  5EC2 C;  1BMF G;  3UT5 A;  5LOV B;  5L3D A;  2GUZ A;  2PGG A;  4B08 A;  3CRA A;  3QF7 A;  3Q4H A;  1DF5 A;  1SET A;  4PEL A;  4J42 A;  3ETQ A;  3DTU B;  2FB5 A;  2W6J G;  2CUG A;  4PA9 A;  5LP6 C;  5LL6 Y;  1AJN A;  3A0H Z;  3N2K A;  3FYE B;  3CC7 V;  2YEV B;  2H8P C;  4AQY B;  1H38 A;  1XUQ A;  1ZUQ A;  4JI0 B;  1P7B A;  1AJQ A;  4DUZ O;  4PJ0 Z;  3JAM N;  4X20 B;  1K97 A;  4JI7 O;  2MW2 B;  2D3O W;  1NVP D;  2UUC B;  3TET A;  4JV5 O;  2DYR C;  1R3L C;  1Y74 A;  1Y66 A;  5JH7 A;  3CC2 V;  2EIL B;  3OR6 C;  5BR8 B;  4XDL A;  4QE7 A;  4EKW A;  4NXN B;  1ZL8 B;  2YI8 A;  4K3A A;  2X0L A;  5IE9 A;  3P32 A;  3D36 A;  5IJ0 A;  2Q8V A;  5L3G A;  4DR6 B;  3UO3 A;  1MAB G;  3O9O A;  3ABL C;  2XUM A;  2B1G A;  1UPG A;  5IJ9 A;  1R3K C;  1GAX A;  4DR1 B;  4GX2 A;  2AZ2 A;  2QM4 A;  3VQY A;  3UQ8 A;  1I5Y A;  1EFR G;  4BIZ A;  2Q0O C;  5CB4 B;  1E79 G;  1VAR A;  1H8H G;  4DV4 O;  2DJV A;  2OCC C;  3CC4 V;  1AP6 A;  4LFB O;  1R3J C;  1RFY A;  1HDJ A;  1XOU A;  4LF4 B;  3LNN A;  1L0N H;  4TV8 B;  3ZRS A;  3FB7 C;  1JMK C;  2WAM A;  2EIN C;  4PI0 A;  1H8E G;  1ZX3 A;  4I55 A;  3JD4 A;  2ZKO A;  3LNM B;  5H6R A;  1OCC C;  1I94 O;  4IIJ B;  4LFA B;  2Q5Z A;  1BSM A;  4LF5 O;  4R6Z A;  3IAY A;  4FMT A;  5JJN B;  4FIP C;  3CME V;  1COW G;  2N74 A;  3NXS A;  5JQG B;  1HNZ B;  3K0D A;  3JAT A;  4YY3 B;  3C90 A;  4E2L A;  2KSD A;  1AI5 A;  2OIE A;  3KG2 A;  4JYB A;  4GX5 A;  4JYC A;  2P7T C;  1EZJ A;  3K5L A;  1BQZ A;  4FFK A;  4G2K A;  4LC1 A;  1K4C C;  3RW0 A;  1IBM O;  1LUW A;  4FLW A;  2P4K A;  1MG1 A;  2ZT9 B;  4J7J A;  3BHP A;  2VWJ A;  3QNE A;  4P30 A;  5J9P C;  4I5S A;  3O65 A;  1S76 D;  4BIO A;  5KX5 B;  4QPJ A;  4PV1 B;  5JCO C;  5KHG A;  3U0Z A;  1XNQ O;  3JAR B;  5JVD B;  1XRE A;  3TXS A;  2FKX A;  3AG3 B;  5CMU A;  4DRX B;  1Y4M A;  1FD9 A;  1NS1 A;  1EN5 A;  1PNL A;  4XBF A;  3HR0 A;  2F23 A; 
#chains in the Genus database with same CATH homology
 1JOY A;  3OMI B;  3CCJ V;  2EIL C;  2ATK C;  3M99 B;  3OEE G;  1Q82 W;  4UXN A;  1VQM V;  3ZRW B;  1MOF A;  2ZXW B;  1VQ4 V;  2WLL A;  3E86 A;  2XAG A;  1R73 A;  1FXK A;  2ZDI C;  3AG2 B;  3ZMS A;  2DYR B;  2Q67 A;  2ZQM A;  3LDE A;  3ZMZ A;  3VBB A;  3RBZ A;  3QO8 A;  1OCZ C;  4JGS A;  4DXW A;  2HKO A;  4KFM A;  3WFV A;  3STZ C;  2EIM B;  1PNM A;  1E1Q G;  5B1B C;  1JQ0 A;  4U7N A;  1F4M A;  1M57 C;  5L3B A;  2QM7 A;  1KD1 W;  2M7W A;  1VQO V;  4UVB A;  2GSM B;  3FB8 C;  1KC8 W;  5B1A C;  5IYB O;  5CN0 A;  5LHG A;  3E8B A;  1NVP B;  3AG1 B;  1OCO B;  5IY5 B;  3SJQ C;  3CP1 A;  3CCU V;  2A0L A;  3OEH G;  4TWK A;  5LHH A;  1VQ9 V;  5KA6 A;  4GCZ A;  3FYI B;  3ABL B;  1YSC A;  2AHY A;  3D3I A;  3ETD A;  1JJ2 U;  1W2B U;  1ROP A;  3JD1 A;  4N23 A;  4X88 A;  4WFB V;  1XL6 A;  1IXM A;  1PD3 A;  3ABM B;  3K08 A;  4UVC A;  2UXX A;  4JAU A;  4JPR A;  4WCE V;  1NQT A;  4J9Z B;  2DYS C;  4H37 A;  2LP7 A;  1QLE C;  4PA7 A;  2WLL B;  4MVZ A;  4MW8 A;  2BOB C;  4MVQ A;  1FXK B;  3JD2 A;  1AI4 A;  1Q7Y W;  1KP3 A;  1K5S A;  1RPO A;  3MHH C;  2HVK C;  3DGE A;  3ZIA G;  1TUE B;  4P9P A;  1M56 B;  1V55 C;  5B1O A;  5B3S B;  2EIJ B;  2PI5 A;  4N21 A;  5LGT A;  2Q68 A;  2Z5U A;  1B6Q A;  2IW5 A;  1ORQ C;  1VQ8 V;  1E1R G;  4P2Z A;  1YI2 V;  4TT3 G;  3CMA V;  2PI4 A;  1YTF D;  2ITC C;  4WFF A;  4BAY A;  4WFH A;  4MTG A;  5IYD O;  4BIU A;  4F4L A;  3IFX A;  3STL C;  2HFE C;  1FS0 G;  5IYC O;  3X2Q C;  1M9N A;  2HLD G;  1J95 A;  2JIZ G;  2IJK A;  2P90 A;  3K04 A;  3ZCC A;  3JYC A;  3F7Y C;  5KUM A;  2R9R B;  5CBG A;  2WLI A;  1NR7 A;  2IU0 A;  2QEX V;  5EC1 C;  2DWD C;  3MHS C;  5L3F A;  1P4R A;  1NKD A;  4RUF A;  2B5U A;  5FL7 G;  3ABK C;  5KUK A;  4MS2 A;  2ZR3 A;  1F23 A;  1THZ A;  2WSS G;  4R50 A;  1Q86 W;  4WFE A;  4JTA B;  4PA6 A;  1QCE A;  2LFS A;  2Z3Y A;  3GWO A;  5HFL A;  1YHQ V;  2AHZ A;  3ZJZ A;  5IDJ A;  4JTC B;  4GX1 A;  2EZP A;  1CPY A;  1JCH A;  2MK3 A;  1M1K W;  1S77 D;  3AG4 B;  4JTD B;  1WPX A;  4H33 A;  2ZR2 A;  4BW5 A;  1ARO P;  3E8G A;  2QE7 G;  1YTF B;  1GMG A;  4CZZ A;  3ETE A;  1K4D C;  2ZDI A;  3EHB B;  3OMN B;  3CXC U;  3BY6 A;  1S5H C;  2QA4 V;  3FB6 C;  3AG3 C;  5KA5 A;  1OHH G;  3W7W A;  4UVA A;  1N8R W;  4JAV A;  4MVU A;  4MTX A;  3I55 V;  3SYO A;  3CCE V;  1QVG U;  4QE9 A;  3QO5 A;  3G4S V;  2X7R B;  3ABT A;  3CCS V;  3OM3 B;  4J9Y B;  5DN6 G;  3JD0 A;  4G28 B;  3SYA A;  1FFT B;  1K9M W;  1R6K A;  2JK5 C;  3H01 A;  4PDV A;  3IGA C;  3WG7 B;  1K73 W;  1DF4 A;  2WLI B;  4XDK A;  2ZXW C;  3CCR V;  5DM6 V;  3K79 A;  2V7Q G;  3AG2 C;  3SPC A;  2WLH A;  3RVZ A;  1VQP V;  1K34 A;  3A0R A;  1YJW V;  1LNQ A;  1OCR B;  2A79 B;  2Q69 A;  3SPJ A;  2OT5 A;  3T2M A;  1VQ5 V;  5LHI A;  1GM7 A;  1GM9 A;  1SES A;  3OAA G;  1S0V A;  1NH2 B;  2HVJ C;  4QPK A;  3E89 A;  4UV9 A;  2DQ0 A;  1SRY A;  2EIM C;  4MTO A;  3B8M A;  1PKX A;  5LBQ A;  1VQN V;  2EIK B;  1QVF U;  2X6A A;  1VQL V;  2YSU B;  3AG1 C;  1OCO C;  5IY5 C;  2R9I A;  4MVR A;  3OR7 C;  5EBM C;  4FPP A;  1OCZ B;  2ITD C;  1AI6 A;  2LFR A;  4R8C A;  1AR1 B;  4FK5 C;  3W7U A;  2OTJ V;  3W7X A;  4LBE C;  4PA4 A;  5B1A B;  3CCV V;  3SYP A;  5BZB A;  4MVS A;  3ABM C;  3K9A A;  1RPR A;  4G27 B;  3E8F A;  4MTF A;  4PDM A;  2OCC B;  4WFA V;  3T4D A;  3SPI A;  4JAS A;  2XOK G;  1FXK C;  2WWW A;  1W0K G;  2XAS A;  1AJP A;  2JDI G;  2DWE C;  2FTK A;  2B1I A;  2QTO A;  4KP4 A;  3GB7 C;  1G4Y B;  2JJ2 G;  3QO7 A;  5B1N A;  4HYO A;  5B3S C;  2EIN B;  3JCZ A;  1MSW D;  2ZD9 A;  4R7C A;  2DYS B;  3ETG A;  3FKS G;  1GM8 A;  1GK9 A;  1OCC B;  2W6I G;  3B8N A;  1V54 B;  3OUS A;  2YEV A;  3SPH A;  1F4N A;  2Y69 B;  4XDJ A;  1XL4 A;  3OFN G;  2EBO A;  2Y48 A;  3ZRX A;  4MVO A;  3UM7 A;  2WLJ A;  2EZO A;  1RM1 B;  3W7S A;  2JEX A;  3MD0 A;  5L3E A;  1OZ0 A;  4CBC A;  2BOC C;  4RQF A;  2UXN A;  3OGC C;  2JEU A;  1DLB A;  3T1C A;  2Q6A A;  3LSQ A;  3EFF K;  3ZRV A;  4JF3 A;  5EBW C;  1K92 A;  2NNU A;  5EC2 C;  3IC7 A;  1BMF G;  3SYQ A;  3W7T A;  4FJC C;  2P67 A;  5L3D A;  3ABU A;  1DF5 A;  4MVM A;  1JX9 A;  1SET A;  4DO2 A;  4PEL A;  3ASN B;  1NJI W;  4TSF G;  3DTU B;  3E83 A;  2W6J G;  4ASU G;  4PA9 A;  4MSW C;  5H9C A;  1AJN A;  3FYE B;  3CC7 V;  3CYO A;  1W0J G;  2YEV B;  2H8P C;  3E2E A;  5HFM A;  3T4Z A;  1R6N A;  2KB1 A;  2W0F C;  2IJJ A;  1H38 A;  1NR1 A;  1SER A;  3ZN0 A;  1P7B A;  1AJQ A;  1M90 W;  3K3W A;  5LGU A;  1BHB A;  2XAQ A;  3ZMT A;  1K8A W;  1PL0 A;  3WG7 C;  4MW3 A;  4Q20 A;  3F5W C;  1K97 A;  1L1F A;  2D3O W;  2IH3 C;  2IH1 C;  1NVP D;  3TET A;  3HPL C;  1CEZ A;  2DYR C;  1R3L C;  3ASO B;  1KP2 A;  1Y66 A;  3ZN1 A;  4LP8 A;  3CC2 V;  3SPG A;  2EIL B;  3OE7 G;  1JVM A;  3OR6 C;  4YXW G;  1NBM G;  4XDL A;  2WLK A;  4QE7 A;  1YIT V;  4EKW A;  5E1A C;  1KKD A;  1VQ6 V;  2DW4 A;  2X6C A;  1F51 A;  3CCQ V;  3ML0 A;  2WLM A;  4HZ3 A;  4Z1M G;  2EIK C;  1CP9 A;  2X0L A;  4X89 A;  3P32 A;  3D36 A;  1JPX A;  5L3G A;  4PA3 A;  3SYC A;  2XAH A;  4KUM A;  1MAB G;  1ZWI C;  3LUT B;  3PJS K;  3OMA B;  3B77 A;  3ABL C;  2B1G A;  3CPW U;  1YJN V;  5B1B B;  3K0G A;  1M57 B;  4QNH B;  1R3K C;  4GX2 A;  4ZBM A;  5EBL C;  1K7D A;  1BL8 A;  1I5Y A;  2DQ3 A;  1GTO A;  1EFR G;  4BIZ A;  2GHY A;  3FB5 C;  1E79 G;  2HR3 A;  1H8H G;  1R3I C;  2F43 G;  2OCC C;  5LGN A;  4WF9 V;  1G8M A;  3CC4 V;  3TCU A;  3G71 V;  1R3J C;  1QR9 A;  3LSS A;  5GW7 A;  4QIW F;  2WLN A;  5H6Q A;  1K33 A;  1M56 C;  1H2G A;  5CA3 A;  3UKM A;  3ZRS A;  4I9W A;  3FB7 C;  3RVY A;  2EIJ C;  4P9O A;  2QM8 A;  2NLJ C;  2WAM A;  2EIN C;  2XAJ A;  1H8E G;  3CCL V;  1QLE B;  3HB3 B;  1WLE A;  3VOU A;  2WPD G;  3JD4 A;  1FXH A;  1AI7 A;  3LNM B;  5H6R A;  1OCC C;  1K3E A;  1YJ9 V;  1V54 C;  5L3C A;  1S3J A;  2JJ1 G;  2Y69 C;  4MT8 A;  1SZT A;  4R6Z A;  5CBF A;  4WFG A;  1V55 B;  4L87 A;  4FMT A;  4FIP C;  3CME V;  1UJW B;  1COW G;  1PNK A;  1RM1 C;  3NXS A;  1I5X A;  3ZMU A;  1DTO A;  1QLN A;  2XND G;  3K0D A;  3CCM V;  1K5Q A;  5EK0 A;  1HWY A;  4OXS A;  4UV8 A;  4E2L A;  1AI5 A;  4HAM A;  2V1D A;  1BHA A;  3KG2 A;  1GKF A;  3E35 A;  2H94 A;  4JYB A;  4GX5 A;  4JYC A;  2IJI A;  4UUJ C;  3TK1 A;  3BEH A;  4RQE A;  1ENV A;  2P7T C;  3K03 A;  1S72 V;  1EZJ A;  3X2Q B;  4GT1 A;  4QJF B;  5C93 A;  2IU3 A;  4X8A A;  3ZMV A;  4G2K A;  1Q81 W;  4LCU C;  3ZRW A;  2OTL V;  4LC1 A;  1K4C C;  3RW0 A;  3AG4 C;  1MG1 A;  2X6B A;  1YIJ V;  3ASN C;  3E8H A;  4ZKI A;  4RUE A;  1KQS U;  3ABK B;  3K06 A;  1FXV A;  2K1E A;  4PDL A;  2HJF C;  3QNE A;  3LDC A;  4P30 A;  2EJR A;  4RAI A;  5J9P C;  4I5S A;  3CD6 V;  4U7O A;  1VQK V;  1S76 D;  1QR8 A;  1KEC A;  3P30 A;  4QPJ A;  3F7V C;  5CBH A;  1QBZ A;  2HG5 C;  4PDR A;  4GX0 A;  3LDD A;  3I56 V;  2CK3 G;  1NH2 D;  3OW2 U;  1GO3 F;  3AG3 B;  5CMU A;  3G6E V;  4RO2 A;  2P6J A;  1Y4M A;  2C2A A;  3JD3 A;  3R65 A;  3OUF A;  2A9H A;  2XAF A;  1VQ7 V;  1PNL A;  4XBF A;  2IJH A;  1EBO A;  1OCR C;  3ASO C;  3AEI A;  2QKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...