4NTXA

Structure of acid-sensing ion channel in complex with snake toxin and amiloride
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
412
structure length
410
Chain Sequence
b'VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
total genus 113
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntxA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntxA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntxA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntxA02
1WP7A 4FZ1A 4NTYA 3S3XA 3IJ4A 2FB5A 2QTSA 1WP8A 4NTWA 2L35A 4NYKA 4FZ0A 3N27A 4NTXA 3S3WA
chains in the Genus database with same CATH superfamily
1XL4A 1PNKA 3EXAA 2QM4A 4X65O 3ASOC 4BW9A 4UB6Z 5EYPB 1IBLO 2XASA 2UUCO 1IBKO 4UCOA 4ZOLB 4WCEV 2QWRB 3U10A 2ITCC 4GCZA 1XEQA 1Q6HA 2EULA 3D36C 3G80A 4X1IA 4FMTA 2ZM6B 1PV0A 3L75H 3G6EV 2P22C 1XILA 1ZL8B 4HNAB 5IDJA 1US6A 2IU0A 2GDSA 4LF7O 1IBMO 4JTAB 4DUYB 4YY3O 5FLXN 1B6QA 3HPLC 4FLUA 3CMAV 1D5NA 4DV2B 3FB7C 3B77A 1B3QA 5B3SB 4P9OA 1UJWB 4GX2A 2YICA 4TOIA 4OPHA 4X64B 1OCZB 1K73W 2RCVA 4KHPB 2OCCB 4JYAB 4LR3A 2LGWA 4UCTA 1QLEB 2EBOA 3MAQA 3CX5F 1LNQA 4PJ0Z 3ZHQA 2VWKA 2ZQMA 1MSWD 3ZRWB 5LA6B 1ZLZA 4B3RB 1FD9A 1I7FA 3E22B 3N27A 4K8ZA 2JS5A 1MNGA 2ILMA 3QNEA 2CTPA 1VQOV 2MW2B 1K97A 5B5EZ 3CJHA 2XOKG 5GONA 4DRXA 4HBNA 2QWPB 3J81N 1UFIA 4PELA 1OJHA 4X62B 4O4IA 1CXZB 1Q90D 4J10A 3CRMA 5KA5A 3SYAA 4R7CA 2FB5A 4QE7A 2QR4A 4OXSA 1QCEA 3OMNB 4DR3O 1YJNV 2QTSA 3BRCA 3OW2U 3AG1C 2AXTZ 2FTKA 3ZMTA 3RVZA 4FK5C 1AJNA 3EHBB 2WLJA 1XNQB 1I94O 2WLLB 3WB0A 3K5MA 5B1AC 2CDYA 4KHPO 2ZDIA 1EN5A 2HFEC 3E86A 2HKOA 4DV5O 1S72V 3TGUH 3UT5B 1GN2A 3JCUZ 1IXBA 2DYRB 4TWKA 3P30A 2XAJA 1YVWA 2E5LB 1OCOC 4PHZA 3CEIA 3T1YO 2CUGA 5EBMC 1S0VA 3OR6C 4LC1A 3RW0A 1R3JC 2AZ2A 2XAHA 4B7KA 4QPKA 4I50A 1YITV 3TK1A 1BGYH 4DV6B 2BOBC 1AP5A 2VWJA 4FIPC 5LMNO 5JVDA 4DR2B 4YIPA 4TT3G 3SJAC 1UPGA 4L8JA 3K0GA 4BAYA 2WLIA 3P3PA 1BL8A 1SA0A 3CYOA 2JEUA 1JCHA 4B08A 4MW3A 5ITZB 2ITDC 4YJ3B 3CCVV 3GVMA 4K8XA 5JJEB 1URFA 3H1JH 5J2TB 3CMEV 4Q6GA 1K4DC 4ZHQB 1B06A 1LUWA 4B3SO 5LMUO 3OEEG 4KFMA 1HNWB 5EC1C 4J41A 1Z2GA 4TV8A 1NI8A 1OCRC 3K9AA 2NNUA 4O2BB 1XUQA 5LHIA 3FAVB 1Y67A 4JI5O 2F95B 2X7RB 2IH3C 4CC5A 3B8MA 1VF6C 4YXWG 1K34A 3RWRD 1NR7A 2Y48A 1M56B 4MSWC 4DV1O 4DV0O 4DR1O 1BSMA 3BHPA 2HJFC 5B1NA 2LO1A 4UFZA 3D3IA 2JGUA 3OR7C 4NXMB 1SRYA 3OD4A 2Q69A 1DF5A 3RYFA 1YJWV 2OIEA 3JYCA 3WU2Z 3CRQA 2LFSA 4JYYA 2P7TC 3SPIA 1AJQA 4PA7A 3WG7C 1L8DA 2BTOA 1EM1A 4GKKB 4H33A 4LF4O 4BWAA 1HDJA 5DM6V 4BR6A 3K04A 4UVCA 4G2KA 2ADQB 1M9NA 4CH6A 1GM9A 1XHXA 3OUSA 4NTWA 2EJRA 4DW1A 2X6CA 2HVJC 3MHHC 5IYZB 1OCCC 5LGTA 2QSAA 2ZE8A 4FZ0A 4I0XB 1XHZA 1YDXA 1KP3A 4BIZA 3RYHB 1BHBA 4L87A 1W0JG 4QIWF 1THZA 3RYIB 2F4VB 1VQPV 1XDCA 2YSUB 1QQCA 4FM2A 1XNRB 3CCSV 2UXCO 2EIMC 4DUZB 4JI2O 3KKYA 2EILB 4DV3B 5KHKA 3TXSA 1V55C 5IJ0B 2K1EA 4GUNA 5KMGB 4TV9A 1WP7A 3JD1A 2ARHA 5BR8B 1YEWA 5JH7B 2YEVA 4FLZA 3H1LH 2Y4TA 2BTQA 1YTFD 4JTCB 3Q4HB 2R9AA 4O4HB 4EFEA 3CCEV 2CE4A 3TJTA 5LP6A 1GN6A 3FD9A 3C3SA 4XBFA 3VOUA 4LF9B 1AI4A 4DR7O 5IYBO 5HFLA 2Y69C 3BAAA 2VQEO 4CS3A 1FKAO 1BS3A 1MG1A 1M90W 3JAKB 3CD6V 4UCRA 1H8EG 5IYCO 3L71H 3BVOA 1FS0G 2Q73A 3JD3A 5GW7A 5C8YA 1S5HC 1SQPH 2G38A 2Z5UA 3LSUA 1YIJV 5EIBD 1PP9H 5LHHA 4RQFA 5B1OA 1KKDA 5CBGA 2YXYA 3JATB 2B1GA 2GV9A 1SQGA 3QF7A 3GWOA 1GN3A 5EC2C 3THOA 4JI6O 3ICXA 4QE9A 3OGCC 2UXBO 3HKCB 4WFGA 4DUZO 2V4DA 1TGOA 5LHGA 1FJGB 1KQSU 4H0LB 1IURA 4DV3O 2WAMA 3KCYA 5KHIA 5JQGB 1TA8A 4KUMA 2XTAA 3IJ4A 4GYCB 4WBNB 4X20B 3OGIB 1A32A 1NH2B 2CH7A 1K5QA 3F7YC 1GKFA 3A0RA 2UXNA 2FKXA 3F7VC 3G71V 3HKDA 2LFRA 1H2NA 3OTOB 4LBEC 5IT9N 3AK3A 4PA3A 2R9IA 2YIAA 3EVKA 2QDOA 1PNLA 4O2AA 3GB7C 3ZN1A 4I55A 4O4JB 1YSCA 2RMKB 1W0KG 3ABKC 4JV5O 4ASUG 1SETA 3K08A 1IXMA 3UKMA 2C2AA 4JYBA 1XL6A 3ZHUA 3CC7V 2OIGA 4DO2A 1JX9A 4J42A 1Q86W 4MTOA 2BOCC 1EZVH 5EYPA 2ZR2A 4LF5B 2PY5A 4ZOLA 2OWOA 1N34B 3S3WA 4IT5A 1ZSPA 3OMIB 1N4CA 4UXNA 3BABA 1CP9A 1BHAA 4OX9B 1ZL8A 2Y4UA 2FL4A 4HNAA 2IJIA 3JSLA 4DR6B 4LF6O 2IJKA 3H1IH 4ZI7B 3AG2C 1XMQO 5GTHZ 4FM0A 1P7BA 1WLEA 5CB4B 4LFBB 1GM8A 2PI5A 1R6KA 2QKAA 5IWAO 4IHJB 3HB3B 3AG1B 4JI1B 2A7WA 3FB8C 1K4CC 1HR0B 4X66B 4DW0A 1HNXB 1ZX3A 3FKSG 4AILC 4MVUA 4RUFA 5B1AB 5D5PA 4CS4A 1E1RG 2XNDG 3FX7A 3ZRWA 5JCOA 2X0LA 2HHHB 3CRCA 5FNVB 2ZNJA 2XAQA 3E22A 3UQ8A 4QPJA 1G6UA 5KX5B 3HKBB 3CP1A 3H9VA 3U11A 1VF7A 1OCOB 3H01A 3BY6A 5AG2A 3SJQC 5KUKA 2Z0AA 2Q0AA 4OGQB 2QWNB 3ABLC 4DV7O 1E79G 3SJCC 1RPRA 1FXVA 1FXKA 1L0NH 4I5SA 2XAGA 1PL4A 3ZRXA 1JR9A 1VQLV 1R6TA 2H3OA 2KB1A 3ZRSA 4RUEA 4Q20A 1XMOB 1JMKC 2WLLA 4JI4O 2UUAO 3CCQV 4AQYO 4FLVA 4X1YA 1COWG 1GN4A 5EIBC 3ZBHA 4J9YB 2P4VA 1HR0O 5FL7G 5E79Z 5L3BA 1DF4A 1V54C 4JZ2A 3UT5A 2PYLA 4D7SA 2F43G 1QR9A 3UO3A 1WA8B 1K5SA 4IYIA 4LNUB 2DN9A 2ZE7A 1ZWIC 1WNSA 2UUBB 4X1KB 4FLXA 1Y76B 3HR0A 1QU7A 1AR1B 3E2EA 3RYCB 3ASNC 1JOYA 4DR4O 1NU1H 1SQBH 5B1BB 2EINC 4JI7B 4UVAA 4U3JA 4EEQA 1VQ5V 2QTOA 2PTMA 1G8MA 5L3GA 2DJVA 4PDMA 1YXBA 4J9ZB 3LDEA 3OAAG 4JI0B 1CPYA 2YI8A 4JYCA 3UM7A 2UU9B 3RN4A 1AR4A 5BY1A 1J5EO 1AROP 3LDCA 1Q81W 4J7KA 3ZN0A 1VQNV 1QLNA 4YHHB 1F51A 1FYJA 5ITZA 4YJ3A 5DECA 1GH6A 4E4EA 4F4LA 1TUBB 1CEZA 5HFMA 1DGSA 5J2TA 2JIZG 4LFAB 4ZHQA 1OHHG 2DQ0A 2ZM6O 5CA0A 2YIDA 2ZKOA 5E1AC 3LUTB 3L74H 4G28B 1TVKB 3HKEB 2R9RB 3WG7B 1HWYA 4DUYO 1JPXA 1NTZH 4O2BA 2EIKC 4JI8B 1E1QG 1ROPA 2DMXA 3FAVA 3QTCA 1FFTB 2E74B 3X2QC 4DV2O 3BEHA 5L3DA 1GMGA 3CRRA 3K3WA 4X64O 1FFXB 4LWSB 3S3XA 2DW4A 2ODMA 1L0LH 1OCCB 4D6TH 4JYAO 2DWEC 2YC0A 1F23A 2ZE5A 2JGDB 1DTOA 4YJ2B 3F5WC 2PGGA 4GKJB 1U97A 5CA1B 2LW1A 2BSKB 2W0XA 1ZUQA 3CWBH 2EIMB 4B3RO 2CGNA 5LXTB 2YS8A 5IJ9B 3DXRB 4DV4B 3SYQA 1Y74B 1KBHA 1X59A 4U3FH 1WB8A 1QHTA 1EN6A 4LH6A 3BCCH 4MTFA 5KLVH 1IDSA 4AI8A 4X62O 1RPOA 2A3QA 3VQVA 2WWWA 4ZKIA 2YIBA 4PA4A 1YF2A 3DTUB 1JFFB 2P4KA 3QO8A 5DEDA 5IYZA 2Z3YA 2Y69B 1H2GA 1XNQO 2KQXA 3L70H 3O65A 3RYHA 4IL6Z 1MOFA 3RYIA 4NXNB 3DC5A 5D5QA 4J80A 1PL0A 3SPHA 5IYDO 1P84F 4PDVA 4MVOA 3SPGA 2KSDA 2FYUH 1NKDA 5IJ0A 1FXHA 5KMGA 2BCCH 2JK5C 5BMVB 2E5LO 4DYLA 3L73H 3WB1A 5JH7A 3B40A 1K7DA 1SESA 3SYOA 4LF8B 2Q4PA 1Q7YW 2ZCEA 2RN9A 3NR7A 3Q4HA 1DK1A 4O4HA 1OCZC 4UB8Z 2VRZA 2ZIOA 3PJSK 1ZAUA 1LR1A 3QVNA 3MD0A 1WP8A 5KHJA 1S77D 4OPAA 4H44B 4DV6O 2IJJA 1R3IC 3K59A 4FVMA 4HAMA 2WLKA 4UCVA 3SJBC 1NS1A 1VF5B 4TUYA 4JF3A 4DR2O 5KAIZ 4JPRA 4WFAV 3ZJZA 3JAKA 3K5NA 2OTJV 3ZMUA 4FZ1A 4X8AA 3ABKB 2GBOA 1N8RW 3CPWU 4GX5A 3JATA 1AR5A 1PNMA 1JJOA 1M5IA 4IIJB 3CHXA 4K0KB 4GZRB 1TAEA 1S3JA 1AVMA 4ZBMA 4EB6A 1HNWO 2IM9A 1FXKC 4KP4A 3AG4B 2B5UA 5JQGA 2QWQB 4WBNA 4B3TB 4PDLA 3ZCCA 2B1IA 2YXHA 1GTOA 1EN4A 3SYPA 3D36A 1W2BU 4EFBA 2WLIB 2ZT9B 3CCJV 4FM1A 3W7WA 2GUZA 3ZHRA 3K57A 5LYJB 5H2FZ 3AG2B 4O4JA 1HP8A 1KU9A 3MDSA 2DYRC 1TUEB 2VQFB 5JWPA 4NXMO 4NTXA 4F6RA 3W7SA 1YZBA 1BT8A 1O9HA 1EZJA 2RQ6A 2RJZA 2AZ0A 2ZD9A 3E8GA 1NR1A 5KA6A 4GKKO 2GHYA 5J2UB 1VEWA 3LSSA 2W6JG 3E83A 3CCRV 4K0KO 1Z5WA 1H8HG 2OTLV 1KP2A 3CE2A 4RQEA 3JD0A 4U7OA 3AG3C 5LOVB 3N2KB 4I4TA 1Q3EA 2HP8A 1M93A 1GM7A 3T4DA 2O57A 1YTFB 1F4MA 5KHGA 3JARB 4ZI7A 1SQVH 2K9PA 1M4UA 3ABLB 2F4VO 4JI3B 1V9PA 5K1PA 1XNRO 2WA3A 4WFEA 5CB4A 4R6ZA 1R6NA 3ASOB 1NQTA 4IHJA 3APOA 4XDJA 3SPCA 3T1HB 3ZIAG 1N32B 3VQYA 3ZMSA 1QNMA 4LCUC 4WFHA 2EIJC 5BR8O 3C3TA 3CXCU 4NTYA 1SS3A 3B8NA 1MMMA 5FNVA 1AILA 5KAFZ 3JD2A 4FFBA 3UCSC 2ZDIC 1ORQC 4JTDB 3JAWB 2ZNIA 4LF9O 5A9GA 3HKBA 5KX5A 3ML0A 1RM1C 5EBWC 1ENVA 1S76D 4Z1VA 1NVPD 3N2GB 1QVGU 2GTSA 1MSDA 2EZPA 4WF9V 2EINB 1GAXA 2DYSC 3K79A 1R3LC 3K0DA 3ETEA 3B09A 2WPDG 3VQWA 2JJ2G 1NZ6A 1EBOA 2WLHA 1FAFA 4DR5B 2DQ3A 1BMFG 4HZ3A 2QM8A 4LFCB 1KD1W 1VIBA 4RWUA 5H5NA 4QGPA 5B66Z 3WFVA 1FJGO 4MVMA 3IFXA 1Q43A 1SQFA 3CS5A 3T1CA 3DGEA 1N32O 2KG7B 3E8BA 4FLYA 1HNZB 3SDLA 1BQZA 2UXDB 3E8FA 1WN7A 3K5OA 1WA8A 3OEHG 4LNUA 1N0JA 1YHQV 1N33B 1MZEA 1QBZA 3BPZA 4X1KA 3OTOO 4MVQA 1Y76A 2DWDC 2ZIMA 1AI7A 2IU3A 2XAFA 4P2ZA 2F66C 3RYCA 4X65B 4PDRA 2LJ2A 2CTWA 4P30A 2EIKB 3DC6A 2N74A 1IBLB 2ATKC 2YI9A 2UUCB 3L9DA 4FLWA 1IBKB 4QJFB 1VQ7V 5DN6G 4MVRA 4TSFG 3SPJA 3X2QB 1K3EA 3B2EE 3ZHTA 1PD3A 1M1KW 4LH7A 1VF6A 5LA6A 3GWKC 4J11A 4BIOA 1JQ0A 5H9CA 3LSQA 1SF9A 4BIUA 4PI0A 3CB2A 1LUVA 1SKVA 4MW8A 2HJDA 4BW5A 2A0LA 4PV1B 4LF7B 2M6YA 4LF5O 2JEXA 4LFCO 4YY3B 1RP3B 5H6RA 2P06A 4K3AA 4X88A 1VP7A 1N34O 3T2MA 2QM7A 1TUBA 2ZE6A 3W7XA 2NN4A 3ZRVA 1KKCA 4O2AB 3TCUA 1TVKA 2LGQA 4OX9O 1VQKV 1RSOB 4DR6O 1KB9F 4I9WA 4KL1A 1K9MW 2ZR3A 1BZKA 4JAUA 3MHSC 3TETA 4AHCA 2A79B 3PN1A 4LFBO 4NYKA 4N21A 5CBHA 5CA3A 1FFXA 2CAZC 4JI1O 4LWSA 4QNHB 1G4YB 2UXXA 4X66O 3A0HZ 1IVSA 5IE9A 1HNXO 1WPBA 3FYIB 1NJIW 2JGDA 3RVYA 4YJ2A 2LQTA 4FPPA 3JCZA 1VMGA 3ABTA 3FB5C 2L35A 1EFRG 1H2KA 5CA1A 1M57C 3STLC 2BSKA 2H94A 2HHHO 2Y0PA 3IAYA 1SC5B 3OMAB 3JD4A 4CH3A 3RFRA 1Y66A 2E3CA 4DR3B 3E35A 1OCRB 3RT3C 5LXTA 5IJ9A 2JS3A 3DXRA 3CCMV 1Y74A 2ZXWC 3JALB 2QKSA 3OM3B 3G4SV 4NB5A 4PI2A 3D8CA 4R8CA 5LL6Y 4R50A 4IYHA 1OV9A 1I94B 3ZMZA 1D2DA 3H1HH 3B4SA 4UV9A 2JVDA 4GX1A 5C93A 4CH5A 3ZHSA 5LP6C 2RDCA 5TISZ 4DV5B 4GX0A 1JFFA 1H2LA 4KXRA 2EX3A 1KC8W 2Q7HA 4O4LB 4PD4F 1XMOO 1AI6A 1Q6UA 1F7YA 5EBLC 1B04A 3VQXA 3VBBA 4F6EA 3T1YB 1MZFA 2XT9A 1MA1A 1AI5A 3WB2A 3OTFA 4JGSA 4LP8A 3JASB 1F4NA 5BXZA 1Z5VA 1VQ4V 4MS2A 5EZYB 2Q67A 4X89A 3ZS8C 5LBQA 2EZOA 1I5YA 2P90A 2QJ1A 4YIOA 5BMVA 5JJJB 2UUBO 3OT7A 1OZ0A 2NR5A 5LMNB 5GTIZ 1AP6A 1FXKB 4CS2A 3P32A 5FPOA 5CMUA 2A9HA 3KCXA 3E8HA 4JI7O 1N36B 4FFKA 4JZGA 5IY5C 4FLTA 3CSXA 1KUQA 4IGGA 4JI0O 1U96A 2ADPA 4X1IB 4X1YB 2UU9O 4U7NA 2VS0A 3CC4V 5K1XA 4B3SB 5LMUB 5LGNA 1H2SB 2OT5A 4RAIA 1V55B 4YHHO 4MT8A 3J80N 1XQ8A 2IW5A 3G6BA 4MVZA 1WB7A 4JI5B 3LNNA 3W7TA 1YCIA 4WFFA 3BA9A 1I0HA 3LDDA 4IIJA 1KYOF 2W0FC 4J7JA 3K58A 1QR8A 2HVKC 1WPXA 4LFAO 2GSMB 2HLDG 2R72A 4U3JB 3ABMC 5L3CA 2R70A 1YJ9V 1N0NA 3DSQA 4DV1B 4DV0B 3CCUV 4DR1B 4CZZA 4JI8O 2Q9LA 4I0XA 1L1FA 5FPRA 1W59A 2L6LA 2DOSA 3AG3B 1Y4MA 1K92A 1GRJA 5BZBA 1N36O 2CK3G 3J7AU 3OFNG 1Q6IA 4MTGA 1FPOA 1SZXA 1YI2V 1ZTEA 3CRAA 5LYJA 3CJHB 5GONB 4DRXB 2Q7EA 4GKJO 2QKCA 4O4IB 4A5UB 2CTRA 4LF4B 3ETQA 1IZ3A 2Q0OC 5CA0B 2AGAA 1O9GA 5J9PC 5B3SC 3P3NA 5A2QN 2PI4A 1NBMG 2M7WA 4DV4O 1XOUA 5B1BC 1VQ8V 1PPJH 1Q5OA 2P5OA 2PF4E 3RBZA 2YUAA 1PKXA 2DE0X 2OCCC 1VARA 2YDEA 2EIJB 2E76B 3SR2C 1QLEC 1KECA 3C90A 3M7MX 1BCCH 2Q7GA 2V7QG 5J2UA 2OYQA 3QO5A 4P9PA 4PA9A 5JCOC 1NTMH 4B7EA 2UXCB 2Q5ZA 4FJCC 2Y0IA 2RNBA 1IX9A 4JI2B 2YIBD 3A0BZ 5LOVA 2D3OW 3N2KA 2PZSA 1RM1B 3K5LA 2KKWA 4WFBV 2WA4A 3M8AA 3JARA 4B3MB 4NXNO 2Q6AA 4W4KA 2DYSB 3I56V 3K9SA 3HKCA 1JJ2U 3W7UA 4I50B 2B9ZA 5CBFA 2D2CB 4Z1MG 3T4ZA 4DR7B 5EK0A 4X20A 2CGOA 3E89A 2IH1C 2VQEB 3OUFA 4NVPA 5JVDB 4LF8O 3CCLV 2V1DA 2AHYA 4E2LA 1SA0B 2N05A 3BA8A 2WLNA 4CH4A 4TQFA 2Q68A 2PYJA 4G27B 2IJHA 2P6JA 3JAWA 4RO2A 1GO3F 2HR3A 3K06A 1AB3A 1H2MA 1H38A 2HEPA 4CBCA 3N2GA 4JI6B 4PA6A 4XDKA 2UXBB 4JAVA 1J95A 4TV8B 1VQ6V 1I5XA 2QWOB 1AJPA 2F23A 3ZHVA 2P67A 1GK9A 2F1MA 3ETDA 2WLMA 3SYCA 3BFRA 4B3MO 1SQXH 3SGIA 1S5LZ 5CN0A 4UV8A 3AG7A 1NTKH 1S5JA 3ZX6A 1Q8IA 1RFYA 4XDLA 2KG7A 2W6IG 4B3TO 2AW9A 5L3EA 4JV5B 2N04A 3K03A 4TUYB 2QGNA 3ETGA 4K35A 1NH2D 4I7ZB 3STZC 3RYFB 3QG5A 1R1BA 3CC2V 2JRIA 1BQ0A 3IGAC 3FYEB 4MTXA 1WAZA 4GT1A 1T5EA 3UO2A 4H13B 2VQFO 1VQ9V 1K8AW 3OE7G 2XUMA 4EB6B 4ZIBA 2XHBA 4NKGB 3LNMB 2FMLA 1HW7A 2CTQA 2LW7A 1V54B 3F5TA 5LGUA 1M56C 2LP7A 4UUJC 4EKWA 4H37A 3H1KH 4LF6B 1M57B 1XBLA 1XMQB 1VQMV 2QA4V 3ASNB 3CXHF 2F93B 5IWAB 2GUZB 4GLXA 2ZXWB 3FB6C 1DLBA 1XREA 2X6AA 4I9QA 1MABG 2QE7G 1SERA 4TV9B 1RSOA 2YEVB 1Q82W 4F6RB 1JVMA 2BTQB 3KG2A 5KHHA 3ZEDA 1PM9A 4JI3O 2ETNA 3AK1A 3RGBA 1Y6XA 3U0ZA 3I5DA 5LP6B 3JSNA 4DK0A 2X6BA 3ABUA 1R3KC 3AG4C 3I55V 3T1HO 1BE3H 4J7ZA 1NVPB 1D5AA 2GTAA 3NXSA 4ABMA 1I08A 3TXQA 5JJNB 4D7TA 2OCHA 2JJ1G 4DV7B 3O9OA 4NR1A 5C8YB 4TQDA 2IBZH 4I4TB 3IC7A 3A2FA 3APQA 1NT2B 2EILC 3JALA 4ICGA 4UCSA 5F2VO 4UCUA 3EFFK 3AK2A 1X4TA 2E75B 1K33A 2A06H 4JI4B 2UUAB 1P4RA 1P7GA 3FFQA 4AQYB 1G1XB 3R65A 4N23A 2AHZA 3KZIZ 5IY5B 3ZMVA 5L3FA 1SQQH 3G67A 4X9QA 2PUSA 3L72H 3IC9A 1QVFU 1KMIZ 4DR5O 4HYOA 2BE3A 2ZINA 1IBMB 2CH7B 5H6QA 2YXLA 2QEXV 4O4LA 1SZTA 4UVBA 4C7UA 1P49A 3HKDB 4CC6A 2NLJC 4DXWA 3JAMN 4FFBB 3R66A 4JAAA 2WSSG 4Z2WA 1JA8A 3D3QA 2HG5C 5KUMA 4DR4B 2H8PC 2Q8VA 1XI1A 1R73A 3JASA 3HKEA 3AEIA 4I55B 4DK1A 1HNZO 3A8TA 1WJZA 4MVSA 5EZYA 2EJ7A 2MK3A 2UXDO 3M99B 3QO7A 1N33O 3ABMB 4JASA 2JDIG 4W4LA 1J5EB
chains in the Genus database with same CATH topology
1WP7A 4FZ1A 4NTYA 3S3XA 3IJ4A 2FB5A 2QTSA 1WP8A 4NTWA 2L35A 4NYKA 4FZ0A 3N27A 4NTXA 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP7 A;  4FZ1 A;  4NTY A;  3S3X A;  3IJ4 A;  2FB5 A;  2QTS A;  1WP8 A;  4NTW A;  2L35 A;  4NYK A;  4FZ0 A;  3N27 A;  4NTX A;  3S3W A; 
#chains in the Genus database with same CATH topology
 1XL4 A;  1PNK A;  3EXA A;  2QM4 A;  4X65 O;  3ASO C;  4BW9 A;  4UB6 Z;  5EYP B;  1IBL O;  2XAS A;  2UUC O;  1IBK O;  4UCO A;  4ZOL B;  4WCE V;  2QWR B;  3U10 A;  2ITC C;  4GCZ A;  1XEQ A;  1Q6H A;  2EUL A;  3D36 C;  3G80 A;  4X1I A;  4FMT A;  2ZM6 B;  1PV0 A;  3L75 H;  3G6E V;  2P22 C;  1XIL A;  1ZL8 B;  4HNA B;  5IDJ A;  1US6 A;  2IU0 A;  2GDS A;  4LF7 O;  1IBM O;  4JTA B;  4DUY B;  4YY3 O;  5FLX N;  1B6Q A;  3HPL C;  4FLU A;  3CMA V;  1D5N A;  4DV2 B;  3FB7 C;  3B77 A;  1B3Q A;  5B3S B;  4P9O A;  1UJW B;  4GX2 A;  2YIC A;  4TOI A;  4OPH A;  4X64 B;  1OCZ B;  1K73 W;  2RCV A;  4KHP B;  2OCC B;  4JYA B;  4LR3 A;  2LGW A;  4UCT A;  1QLE B;  2EBO A;  3MAQ A;  3CX5 F;  1LNQ A;  4PJ0 Z;  3ZHQ A;  2VWK A;  2ZQM A;  1MSW D;  3ZRW B;  5LA6 B;  1ZLZ A;  4B3R B;  1FD9 A;  1I7F A;  3E22 B;  3N27 A;  4K8Z A;  2JS5 A;  1MNG A;  2ILM A;  3QNE A;  2CTP A;  1VQO V;  2MW2 B;  1K97 A;  5B5E Z;  3CJH A;  2XOK G;  5GON A;  4DRX A;  4HBN A;  2QWP B;  3J81 N;  1UFI A;  4PEL A;  1OJH A;  4X62 B;  4O4I A;  1CXZ B;  1Q90 D;  4J10 A;  3CRM A;  5KA5 A;  3SYA A;  4R7C A;  2FB5 A;  4QE7 A;  2QR4 A;  4OXS A;  1QCE A;  3OMN B;  4DR3 O;  1YJN V;  2QTS A;  3BRC A;  3OW2 U;  3AG1 C;  2AXT Z;  2FTK A;  3ZMT A;  3RVZ A;  4FK5 C;  1AJN A;  3EHB B;  2WLJ A;  1XNQ B;  1I94 O;  2WLL B;  3WB0 A;  3K5M A;  5B1A C;  2CDY A;  4KHP O;  2ZDI A;  1EN5 A;  2HFE C;  3E86 A;  2HKO A;  4DV5 O;  1S72 V;  3TGU H;  3UT5 B;  1GN2 A;  3JCU Z;  1IXB A;  2DYR B;  4TWK A;  3P30 A;  2XAJ A;  1YVW A;  2E5L B;  1OCO C;  4PHZ A;  3CEI A;  3T1Y O;  2CUG A;  5EBM C;  1S0V A;  3OR6 C;  4LC1 A;  3RW0 A;  1R3J C;  2AZ2 A;  2XAH A;  4B7K A;  4QPK A;  4I50 A;  1YIT V;  3TK1 A;  1BGY H;  4DV6 B;  2BOB C;  1AP5 A;  2VWJ A;  4FIP C;  5LMN O;  5JVD A;  4DR2 B;  4YIP A;  4TT3 G;  3SJA C;  1UPG A;  4L8J A;  3K0G A;  4BAY A;  2WLI A;  3P3P A;  1BL8 A;  1SA0 A;  3CYO A;  2JEU A;  1JCH A;  4B08 A;  4MW3 A;  5ITZ B;  2ITD C;  4YJ3 B;  3CCV V;  3GVM A;  4K8X A;  5JJE B;  1URF A;  3H1J H;  5J2T B;  3CME V;  4Q6G A;  1K4D C;  4ZHQ B;  1B06 A;  1LUW A;  4B3S O;  5LMU O;  3OEE G;  4KFM A;  1HNW B;  5EC1 C;  4J41 A;  1Z2G A;  4TV8 A;  1NI8 A;  1OCR C;  3K9A A;  2NNU A;  4O2B B;  1XUQ A;  5LHI A;  3FAV B;  1Y67 A;  4JI5 O;  2F95 B;  2X7R B;  2IH3 C;  4CC5 A;  3B8M A;  1VF6 C;  4YXW G;  1K34 A;  3RWR D;  1NR7 A;  2Y48 A;  1M56 B;  4MSW C;  4DV1 O;  4DV0 O;  4DR1 O;  1BSM A;  3BHP A;  2HJF C;  5B1N A;  2LO1 A;  4UFZ A;  3D3I A;  2JGU A;  3OR7 C;  4NXM B;  1SRY A;  3OD4 A;  2Q69 A;  1DF5 A;  3RYF A;  1YJW V;  2OIE A;  3JYC A;  3WU2 Z;  3CRQ A;  2LFS A;  4JYY A;  2P7T C;  3SPI A;  1AJQ A;  4PA7 A;  3WG7 C;  1L8D A;  2BTO A;  1EM1 A;  4GKK B;  4H33 A;  4LF4 O;  4BWA A;  1HDJ A;  5DM6 V;  4BR6 A;  3K04 A;  4UVC A;  4G2K A;  2ADQ B;  1M9N A;  4CH6 A;  1GM9 A;  1XHX A;  3OUS A;  4NTW A;  2EJR A;  4DW1 A;  2X6C A;  2HVJ C;  3MHH C;  5IYZ B;  1OCC C;  5LGT A;  2QSA A;  2ZE8 A;  4FZ0 A;  4I0X B;  1XHZ A;  1YDX A;  1KP3 A;  4BIZ A;  3RYH B;  1BHB A;  4L87 A;  1W0J G;  4QIW F;  1THZ A;  3RYI B;  2F4V B;  1VQP V;  1XDC A;  2YSU B;  1QQC A;  4FM2 A;  1XNR B;  3CCS V;  2UXC O;  2EIM C;  4DUZ B;  4JI2 O;  3KKY A;  2EIL B;  4DV3 B;  5KHK A;  3TXS A;  1V55 C;  5IJ0 B;  2K1E A;  4GUN A;  5KMG B;  4TV9 A;  1WP7 A;  3JD1 A;  2ARH A;  5BR8 B;  1YEW A;  5JH7 B;  2YEV A;  4FLZ A;  3H1L H;  2Y4T A;  2BTQ A;  1YTF D;  4JTC B;  3Q4H B;  2R9A A;  4O4H B;  4EFE A;  3CCE V;  2CE4 A;  3TJT A;  5LP6 A;  1GN6 A;  3FD9 A;  3C3S A;  4XBF A;  3VOU A;  4LF9 B;  1AI4 A;  4DR7 O;  5IYB O;  5HFL A;  2Y69 C;  3BAA A;  2VQE O;  4CS3 A;  1FKA O;  1BS3 A;  1MG1 A;  1M90 W;  3JAK B;  3CD6 V;  4UCR A;  1H8E G;  5IYC O;  3L71 H;  3BVO A;  1FS0 G;  2Q73 A;  3JD3 A;  5GW7 A;  5C8Y A;  1S5H C;  1SQP H;  2G38 A;  2Z5U A;  3LSU A;  1YIJ V;  5EIB D;  1PP9 H;  5LHH A;  4RQF A;  5B1O A;  1KKD A;  5CBG A;  2YXY A;  3JAT B;  2B1G A;  2GV9 A;  1SQG A;  3QF7 A;  3GWO A;  1GN3 A;  5EC2 C;  3THO A;  4JI6 O;  3ICX A;  4QE9 A;  3OGC C;  2UXB O;  3HKC B;  4WFG A;  4DUZ O;  2V4D A;  1TGO A;  5LHG A;  1FJG B;  1KQS U;  4H0L B;  1IUR A;  4DV3 O;  2WAM A;  3KCY A;  5KHI A;  5JQG B;  1TA8 A;  4KUM A;  2XTA A;  3IJ4 A;  4GYC B;  4WBN B;  4X20 B;  3OGI B;  1A32 A;  1NH2 B;  2CH7 A;  1K5Q A;  3F7Y C;  1GKF A;  3A0R A;  2UXN A;  2FKX A;  3F7V C;  3G71 V;  3HKD A;  2LFR A;  1H2N A;  3OTO B;  4LBE C;  5IT9 N;  3AK3 A;  4PA3 A;  2R9I A;  2YIA A;  3EVK A;  2QDO A;  1PNL A;  4O2A A;  3GB7 C;  3ZN1 A;  4I55 A;  4O4J B;  1YSC A;  2RMK B;  1W0K G;  3ABK C;  4JV5 O;  4ASU G;  1SET A;  3K08 A;  1IXM A;  3UKM A;  2C2A A;  4JYB A;  1XL6 A;  3ZHU A;  3CC7 V;  2OIG A;  4DO2 A;  1JX9 A;  4J42 A;  1Q86 W;  4MTO A;  2BOC C;  1EZV H;  5EYP A;  2ZR2 A;  4LF5 B;  2PY5 A;  4ZOL A;  2OWO A;  1N34 B;  3S3W A;  4IT5 A;  1ZSP A;  3OMI B;  1N4C A;  4UXN A;  3BAB A;  1CP9 A;  1BHA A;  4OX9 B;  1ZL8 A;  2Y4U A;  2FL4 A;  4HNA A;  2IJI A;  3JSL A;  4DR6 B;  4LF6 O;  2IJK A;  3H1I H;  4ZI7 B;  3AG2 C;  1XMQ O;  5GTH Z;  4FM0 A;  1P7B A;  1WLE A;  5CB4 B;  4LFB B;  1GM8 A;  2PI5 A;  1R6K A;  2QKA A;  5IWA O;  4IHJ B;  3HB3 B;  3AG1 B;  4JI1 B;  2A7W A;  3FB8 C;  1K4C C;  1HR0 B;  4X66 B;  4DW0 A;  1HNX B;  1ZX3 A;  3FKS G;  4AIL C;  4MVU A;  4RUF A;  5B1A B;  5D5P A;  4CS4 A;  1E1R G;  2XND G;  3FX7 A;  3ZRW A;  5JCO A;  2X0L A;  2HHH B;  3CRC A;  5FNV B;  2ZNJ A;  2XAQ A;  3E22 A;  3UQ8 A;  4QPJ A;  1G6U A;  5KX5 B;  3HKB B;  3CP1 A;  3H9V A;  3U11 A;  1VF7 A;  1OCO B;  3H01 A;  3BY6 A;  5AG2 A;  3SJQ C;  5KUK A;  2Z0A A;  2Q0A A;  4OGQ B;  2QWN B;  3ABL C;  4DV7 O;  1E79 G;  3SJC C;  1RPR A;  1FXV A;  1FXK A;  1L0N H;  4I5S A;  2XAG A;  1PL4 A;  3ZRX A;  1JR9 A;  1VQL V;  1R6T A;  2H3O A;  2KB1 A;  3ZRS A;  4RUE A;  4Q20 A;  1XMO B;  1JMK C;  2WLL A;  4JI4 O;  2UUA O;  3CCQ V;  4AQY O;  4FLV A;  4X1Y A;  1COW G;  1GN4 A;  5EIB C;  3ZBH A;  4J9Y B;  2P4V A;  1HR0 O;  5FL7 G;  5E79 Z;  5L3B A;  1DF4 A;  1V54 C;  4JZ2 A;  3UT5 A;  2PYL A;  4D7S A;  2F43 G;  1QR9 A;  3UO3 A;  1WA8 B;  1K5S A;  4IYI A;  4LNU B;  2DN9 A;  2ZE7 A;  1ZWI C;  1WNS A;  2UUB B;  4X1K B;  4FLX A;  1Y76 B;  3HR0 A;  1QU7 A;  1AR1 B;  3E2E A;  3RYC B;  3ASN C;  1JOY A;  4DR4 O;  1NU1 H;  1SQB H;  5B1B B;  2EIN C;  4JI7 B;  4UVA A;  4U3J A;  4EEQ A;  1VQ5 V;  2QTO A;  2PTM A;  1G8M A;  5L3G A;  2DJV A;  4PDM A;  1YXB A;  4J9Z B;  3LDE A;  3OAA G;  4JI0 B;  1CPY A;  2YI8 A;  4JYC A;  3UM7 A;  2UU9 B;  3RN4 A;  1AR4 A;  5BY1 A;  1J5E O;  1ARO P;  3LDC A;  1Q81 W;  4J7K A;  3ZN0 A;  1VQN V;  1QLN A;  4YHH B;  1F51 A;  1FYJ A;  5ITZ A;  4YJ3 A;  5DEC A;  1GH6 A;  4E4E A;  4F4L A;  1TUB B;  1CEZ A;  5HFM A;  1DGS A;  5J2T A;  2JIZ G;  4LFA B;  4ZHQ A;  1OHH G;  2DQ0 A;  2ZM6 O;  5CA0 A;  2YID A;  2ZKO A;  5E1A C;  3LUT B;  3L74 H;  4G28 B;  1TVK B;  3HKE B;  2R9R B;  3WG7 B;  1HWY A;  4DUY O;  1JPX A;  1NTZ H;  4O2B A;  2EIK C;  4JI8 B;  1E1Q G;  1ROP A;  2DMX A;  3FAV A;  3QTC A;  1FFT B;  2E74 B;  3X2Q C;  4DV2 O;  3BEH A;  5L3D A;  1GMG A;  3CRR A;  3K3W A;  4X64 O;  1FFX B;  4LWS B;  3S3X A;  2DW4 A;  2ODM A;  1L0L H;  1OCC B;  4D6T H;  4JYA O;  2DWE C;  2YC0 A;  1F23 A;  2ZE5 A;  2JGD B;  1DTO A;  4YJ2 B;  3F5W C;  2PGG A;  4GKJ B;  1U97 A;  5CA1 B;  2LW1 A;  2BSK B;  2W0X A;  1ZUQ A;  3CWB H;  2EIM B;  4B3R O;  2CGN A;  5LXT B;  2YS8 A;  5IJ9 B;  3DXR B;  4DV4 B;  3SYQ A;  1Y74 B;  1KBH A;  1X59 A;  4U3F H;  1WB8 A;  1QHT A;  1EN6 A;  4LH6 A;  3BCC H;  4MTF A;  5KLV H;  1IDS A;  4AI8 A;  4X62 O;  1RPO A;  2A3Q A;  3VQV A;  2WWW A;  4ZKI A;  2YIB A;  4PA4 A;  1YF2 A;  3DTU B;  1JFF B;  2P4K A;  3QO8 A;  5DED A;  5IYZ A;  2Z3Y A;  2Y69 B;  1H2G A;  1XNQ O;  2KQX A;  3L70 H;  3O65 A;  3RYH A;  4IL6 Z;  1MOF A;  3RYI A;  4NXN B;  3DC5 A;  5D5Q A;  4J80 A;  1PL0 A;  3SPH A;  5IYD O;  1P84 F;  4PDV A;  4MVO A;  3SPG A;  2KSD A;  2FYU H;  1NKD A;  5IJ0 A;  1FXH A;  5KMG A;  2BCC H;  2JK5 C;  5BMV B;  2E5L O;  4DYL A;  3L73 H;  3WB1 A;  5JH7 A;  3B40 A;  1K7D A;  1SES A;  3SYO A;  4LF8 B;  2Q4P A;  1Q7Y W;  2ZCE A;  2RN9 A;  3NR7 A;  3Q4H A;  1DK1 A;  4O4H A;  1OCZ C;  4UB8 Z;  2VRZ A;  2ZIO A;  3PJS K;  1ZAU A;  1LR1 A;  3QVN A;  3MD0 A;  1WP8 A;  5KHJ A;  1S77 D;  4OPA A;  4H44 B;  4DV6 O;  2IJJ A;  1R3I C;  3K59 A;  4FVM A;  4HAM A;  2WLK A;  4UCV A;  3SJB C;  1NS1 A;  1VF5 B;  4TUY A;  4JF3 A;  4DR2 O;  5KAI Z;  4JPR A;  4WFA V;  3ZJZ A;  3JAK A;  3K5N A;  2OTJ V;  3ZMU A;  4FZ1 A;  4X8A A;  3ABK B;  2GBO A;  1N8R W;  3CPW U;  4GX5 A;  3JAT A;  1AR5 A;  1PNM A;  1JJO A;  1M5I A;  4IIJ B;  3CHX A;  4K0K B;  4GZR B;  1TAE A;  1S3J A;  1AVM A;  4ZBM A;  4EB6 A;  1HNW O;  2IM9 A;  1FXK C;  4KP4 A;  3AG4 B;  2B5U A;  5JQG A;  2QWQ B;  4WBN A;  4B3T B;  4PDL A;  3ZCC A;  2B1I A;  2YXH A;  1GTO A;  1EN4 A;  3SYP A;  3D36 A;  1W2B U;  4EFB A;  2WLI B;  2ZT9 B;  3CCJ V;  4FM1 A;  3W7W A;  2GUZ A;  3ZHR A;  3K57 A;  5LYJ B;  5H2F Z;  3AG2 B;  4O4J A;  1HP8 A;  1KU9 A;  3MDS A;  2DYR C;  1TUE B;  2VQF B;  5JWP A;  4NXM O;  4NTX A;  4F6R A;  3W7S A;  1YZB A;  1BT8 A;  1O9H A;  1EZJ A;  2RQ6 A;  2RJZ A;  2AZ0 A;  2ZD9 A;  3E8G A;  1NR1 A;  5KA6 A;  4GKK O;  2GHY A;  5J2U B;  1VEW A;  3LSS A;  2W6J G;  3E83 A;  3CCR V;  4K0K O;  1Z5W A;  1H8H G;  2OTL V;  1KP2 A;  3CE2 A;  4RQE A;  3JD0 A;  4U7O A;  3AG3 C;  5LOV B;  3N2K B;  4I4T A;  1Q3E A;  2HP8 A;  1M93 A;  1GM7 A;  3T4D A;  2O57 A;  1YTF B;  1F4M A;  5KHG A;  3JAR B;  4ZI7 A;  1SQV H;  2K9P A;  1M4U A;  3ABL B;  2F4V O;  4JI3 B;  1V9P A;  5K1P A;  1XNR O;  2WA3 A;  4WFE A;  5CB4 A;  4R6Z A;  1R6N A;  3ASO B;  1NQT A;  4IHJ A;  3APO A;  4XDJ A;  3SPC A;  3T1H B;  3ZIA G;  1N32 B;  3VQY A;  3ZMS A;  1QNM A;  4LCU C;  4WFH A;  2EIJ C;  5BR8 O;  3C3T A;  3CXC U;  4NTY A;  1SS3 A;  3B8N A;  1MMM A;  5FNV A;  1AIL A;  5KAF Z;  3JD2 A;  4FFB A;  3UCS C;  2ZDI C;  1ORQ C;  4JTD B;  3JAW B;  2ZNI A;  4LF9 O;  5A9G A;  3HKB A;  5KX5 A;  3ML0 A;  1RM1 C;  5EBW C;  1ENV A;  1S76 D;  4Z1V A;  1NVP D;  3N2G B;  1QVG U;  2GTS A;  1MSD A;  2EZP A;  4WF9 V;  2EIN B;  1GAX A;  2DYS C;  3K79 A;  1R3L C;  3K0D A;  3ETE A;  3B09 A;  2WPD G;  3VQW A;  2JJ2 G;  1NZ6 A;  1EBO A;  2WLH A;  1FAF A;  4DR5 B;  2DQ3 A;  1BMF G;  4HZ3 A;  2QM8 A;  4LFC B;  1KD1 W;  1VIB A;  4RWU A;  5H5N A;  4QGP A;  5B66 Z;  3WFV A;  1FJG O;  4MVM A;  3IFX A;  1Q43 A;  1SQF A;  3CS5 A;  3T1C A;  3DGE A;  1N32 O;  2KG7 B;  3E8B A;  4FLY A;  1HNZ B;  3SDL A;  1BQZ A;  2UXD B;  3E8F A;  1WN7 A;  3K5O A;  1WA8 A;  3OEH G;  4LNU A;  1N0J A;  1YHQ V;  1N33 B;  1MZE A;  1QBZ A;  3BPZ A;  4X1K A;  3OTO O;  4MVQ A;  1Y76 A;  2DWD C;  2ZIM A;  1AI7 A;  2IU3 A;  2XAF A;  4P2Z A;  2F66 C;  3RYC A;  4X65 B;  4PDR A;  2LJ2 A;  2CTW A;  4P30 A;  2EIK B;  3DC6 A;  2N74 A;  1IBL B;  2ATK C;  2YI9 A;  2UUC B;  3L9D A;  4FLW A;  1IBK B;  4QJF B;  1VQ7 V;  5DN6 G;  4MVR A;  4TSF G;  3SPJ A;  3X2Q B;  1K3E A;  3B2E E;  3ZHT A;  1PD3 A;  1M1K W;  4LH7 A;  1VF6 A;  5LA6 A;  3GWK C;  4J11 A;  4BIO A;  1JQ0 A;  5H9C A;  3LSQ A;  1SF9 A;  4BIU A;  4PI0 A;  3CB2 A;  1LUV A;  1SKV A;  4MW8 A;  2HJD A;  4BW5 A;  2A0L A;  4PV1 B;  4LF7 B;  2M6Y A;  4LF5 O;  2JEX A;  4LFC O;  4YY3 B;  1RP3 B;  5H6R A;  2P06 A;  4K3A A;  4X88 A;  1VP7 A;  1N34 O;  3T2M A;  2QM7 A;  1TUB A;  2ZE6 A;  3W7X A;  2NN4 A;  3ZRV A;  1KKC A;  4O2A B;  3TCU A;  1TVK A;  2LGQ A;  4OX9 O;  1VQK V;  1RSO B;  4DR6 O;  1KB9 F;  4I9W A;  4KL1 A;  1K9M W;  2ZR3 A;  1BZK A;  4JAU A;  3MHS C;  3TET A;  4AHC A;  2A79 B;  3PN1 A;  4LFB O;  4NYK A;  4N21 A;  5CBH A;  5CA3 A;  1FFX A;  2CAZ C;  4JI1 O;  4LWS A;  4QNH B;  1G4Y B;  2UXX A;  4X66 O;  3A0H Z;  1IVS A;  5IE9 A;  1HNX O;  1WPB A;  3FYI B;  1NJI W;  2JGD A;  3RVY A;  4YJ2 A;  2LQT A;  4FPP A;  3JCZ A;  1VMG A;  3ABT A;  3FB5 C;  2L35 A;  1EFR G;  1H2K A;  5CA1 A;  1M57 C;  3STL C;  2BSK A;  2H94 A;  2HHH O;  2Y0P A;  3IAY A;  1SC5 B;  3OMA B;  3JD4 A;  4CH3 A;  3RFR A;  1Y66 A;  2E3C A;  4DR3 B;  3E35 A;  1OCR B;  3RT3 C;  5LXT A;  5IJ9 A;  2JS3 A;  3DXR A;  3CCM V;  1Y74 A;  2ZXW C;  3JAL B;  2QKS A;  3OM3 B;  3G4S V;  4NB5 A;  4PI2 A;  3D8C A;  4R8C A;  5LL6 Y;  4R50 A;  4IYH A;  1OV9 A;  1I94 B;  3ZMZ A;  1D2D A;  3H1H H;  3B4S A;  4UV9 A;  2JVD A;  4GX1 A;  5C93 A;  4CH5 A;  3ZHS A;  5LP6 C;  2RDC A;  5TIS Z;  4DV5 B;  4GX0 A;  1JFF A;  1H2L A;  4KXR A;  2EX3 A;  1KC8 W;  2Q7H A;  4O4L B;  4PD4 F;  1XMO O;  1AI6 A;  1Q6U A;  1F7Y A;  5EBL C;  1B04 A;  3VQX A;  3VBB A;  4F6E A;  3T1Y B;  1MZF A;  2XT9 A;  1MA1 A;  1AI5 A;  3WB2 A;  3OTF A;  4JGS A;  4LP8 A;  3JAS B;  1F4N A;  5BXZ A;  1Z5V A;  1VQ4 V;  4MS2 A;  5EZY B;  2Q67 A;  4X89 A;  3ZS8 C;  5LBQ A;  2EZO A;  1I5Y A;  2P90 A;  2QJ1 A;  4YIO A;  5BMV A;  5JJJ B;  2UUB O;  3OT7 A;  1OZ0 A;  2NR5 A;  5LMN B;  5GTI Z;  1AP6 A;  1FXK B;  4CS2 A;  3P32 A;  5FPO A;  5CMU A;  2A9H A;  3KCX A;  3E8H A;  4JI7 O;  1N36 B;  4FFK A;  4JZG A;  5IY5 C;  4FLT A;  3CSX A;  1KUQ A;  4IGG A;  4JI0 O;  1U96 A;  2ADP A;  4X1I B;  4X1Y B;  2UU9 O;  4U7N A;  2VS0 A;  3CC4 V;  5K1X A;  4B3S B;  5LMU B;  5LGN A;  1H2S B;  2OT5 A;  4RAI A;  1V55 B;  4YHH O;  4MT8 A;  3J80 N;  1XQ8 A;  2IW5 A;  3G6B A;  4MVZ A;  1WB7 A;  4JI5 B;  3LNN A;  3W7T A;  1YCI A;  4WFF A;  3BA9 A;  1I0H A;  3LDD A;  4IIJ A;  1KYO F;  2W0F C;  4J7J A;  3K58 A;  1QR8 A;  2HVK C;  1WPX A;  4LFA O;  2GSM B;  2HLD G;  2R72 A;  4U3J B;  3ABM C;  5L3C A;  2R70 A;  1YJ9 V;  1N0N A;  3DSQ A;  4DV1 B;  4DV0 B;  3CCU V;  4DR1 B;  4CZZ A;  4JI8 O;  2Q9L A;  4I0X A;  1L1F A;  5FPR A;  1W59 A;  2L6L A;  2DOS A;  3AG3 B;  1Y4M A;  1K92 A;  1GRJ A;  5BZB A;  1N36 O;  2CK3 G;  3J7A U;  3OFN G;  1Q6I A;  4MTG A;  1FPO A;  1SZX A;  1YI2 V;  1ZTE A;  3CRA A;  5LYJ A;  3CJH B;  5GON B;  4DRX B;  2Q7E A;  4GKJ O;  2QKC A;  4O4I B;  4A5U B;  2CTR A;  4LF4 B;  3ETQ A;  1IZ3 A;  2Q0O C;  5CA0 B;  2AGA A;  1O9G A;  5J9P C;  5B3S C;  3P3N A;  5A2Q N;  2PI4 A;  1NBM G;  2M7W A;  4DV4 O;  1XOU A;  5B1B C;  1VQ8 V;  1PPJ H;  1Q5O A;  2P5O A;  2PF4 E;  3RBZ A;  2YUA A;  1PKX A;  2DE0 X;  2OCC C;  1VAR A;  2YDE A;  2EIJ B;  2E76 B;  3SR2 C;  1QLE C;  1KEC A;  3C90 A;  3M7M X;  1BCC H;  2Q7G A;  2V7Q G;  5J2U A;  2OYQ A;  3QO5 A;  4P9P A;  4PA9 A;  5JCO C;  1NTM H;  4B7E A;  2UXC B;  2Q5Z A;  4FJC C;  2Y0I A;  2RNB A;  1IX9 A;  4JI2 B;  2YIB D;  3A0B Z;  5LOV A;  2D3O W;  3N2K A;  2PZS A;  1RM1 B;  3K5L A;  2KKW A;  4WFB V;  2WA4 A;  3M8A A;  3JAR A;  4B3M B;  4NXN O;  2Q6A A;  4W4K A;  2DYS B;  3I56 V;  3K9S A;  3HKC A;  1JJ2 U;  3W7U A;  4I50 B;  2B9Z A;  5CBF A;  2D2C B;  4Z1M G;  3T4Z A;  4DR7 B;  5EK0 A;  4X20 A;  2CGO A;  3E89 A;  2IH1 C;  2VQE B;  3OUF A;  4NVP A;  5JVD B;  4LF8 O;  3CCL V;  2V1D A;  2AHY A;  4E2L A;  1SA0 B;  2N05 A;  3BA8 A;  2WLN A;  4CH4 A;  4TQF A;  2Q68 A;  2PYJ A;  4G27 B;  2IJH A;  2P6J A;  3JAW A;  4RO2 A;  1GO3 F;  2HR3 A;  3K06 A;  1AB3 A;  1H2M A;  1H38 A;  2HEP A;  4CBC A;  3N2G A;  4JI6 B;  4PA6 A;  4XDK A;  2UXB B;  4JAV A;  1J95 A;  4TV8 B;  1VQ6 V;  1I5X A;  2QWO B;  1AJP A;  2F23 A;  3ZHV A;  2P67 A;  1GK9 A;  2F1M A;  3ETD A;  2WLM A;  3SYC A;  3BFR A;  4B3M O;  1SQX H;  3SGI A;  1S5L Z;  5CN0 A;  4UV8 A;  3AG7 A;  1NTK H;  1S5J A;  3ZX6 A;  1Q8I A;  1RFY A;  4XDL A;  2KG7 A;  2W6I G;  4B3T O;  2AW9 A;  5L3E A;  4JV5 B;  2N04 A;  3K03 A;  4TUY B;  2QGN A;  3ETG A;  4K35 A;  1NH2 D;  4I7Z B;  3STZ C;  3RYF B;  3QG5 A;  1R1B A;  3CC2 V;  2JRI A;  1BQ0 A;  3IGA C;  3FYE B;  4MTX A;  1WAZ A;  4GT1 A;  1T5E A;  3UO2 A;  4H13 B;  2VQF O;  1VQ9 V;  1K8A W;  3OE7 G;  2XUM A;  4EB6 B;  4ZIB A;  2XHB A;  4NKG B;  3LNM B;  2FML A;  1HW7 A;  2CTQ A;  2LW7 A;  1V54 B;  3F5T A;  5LGU A;  1M56 C;  2LP7 A;  4UUJ C;  4EKW A;  4H37 A;  3H1K H;  4LF6 B;  1M57 B;  1XBL A;  1XMQ B;  1VQM V;  2QA4 V;  3ASN B;  3CXH F;  2F93 B;  5IWA B;  2GUZ B;  4GLX A;  2ZXW B;  3FB6 C;  1DLB A;  1XRE A;  2X6A A;  4I9Q A;  1MAB G;  2QE7 G;  1SER A;  4TV9 B;  1RSO A;  2YEV B;  1Q82 W;  4F6R B;  1JVM A;  2BTQ B;  3KG2 A;  5KHH A;  3ZED A;  1PM9 A;  4JI3 O;  2ETN A;  3AK1 A;  3RGB A;  1Y6X A;  3U0Z A;  3I5D A;  5LP6 B;  3JSN A;  4DK0 A;  2X6B A;  3ABU A;  1R3K C;  3AG4 C;  3I55 V;  3T1H O;  1BE3 H;  4J7Z A;  1NVP B;  1D5A A;  2GTA A;  3NXS A;  4ABM A;  1I08 A;  3TXQ A;  5JJN B;  4D7T A;  2OCH A;  2JJ1 G;  4DV7 B;  3O9O A;  4NR1 A;  5C8Y B;  4TQD A;  2IBZ H;  4I4T B;  3IC7 A;  3A2F A;  3APQ A;  1NT2 B;  2EIL C;  3JAL A;  4ICG A;  4UCS A;  5F2V O;  4UCU A;  3EFF K;  3AK2 A;  1X4T A;  2E75 B;  1K33 A;  2A06 H;  4JI4 B;  2UUA B;  1P4R A;  1P7G A;  3FFQ A;  4AQY B;  1G1X B;  3R65 A;  4N23 A;  2AHZ A;  3KZI Z;  5IY5 B;  3ZMV A;  5L3F A;  1SQQ H;  3G67 A;  4X9Q A;  2PUS A;  3L72 H;  3IC9 A;  1QVF U;  1KMI Z;  4DR5 O;  4HYO A;  2BE3 A;  2ZIN A;  1IBM B;  2CH7 B;  5H6Q A;  2YXL A;  2QEX V;  4O4L A;  1SZT A;  4UVB A;  4C7U A;  1P49 A;  3HKD B;  4CC6 A;  2NLJ C;  4DXW A;  3JAM N;  4FFB B;  3R66 A;  4JAA A;  2WSS G;  4Z2W A;  1JA8 A;  3D3Q A;  2HG5 C;  5KUM A;  4DR4 B;  2H8P C;  2Q8V A;  1XI1 A;  1R73 A;  3JAS A;  3HKE A;  3AEI A;  4I55 B;  4DK1 A;  1HNZ O;  3A8T A;  1WJZ A;  4MVS A;  5EZY A;  2EJ7 A;  2MK3 A;  2UXD O;  3M99 B;  3QO7 A;  1N33 O;  3ABM B;  4JAS A;  2JDI G;  4W4L A;  1J5E B; 
#chains in the Genus database with same CATH homology
 1WP7 A;  4FZ1 A;  4NTY A;  3S3X A;  3IJ4 A;  2FB5 A;  2QTS A;  1WP8 A;  4NTW A;  2L35 A;  4NYK A;  4FZ0 A;  3N27 A;  4NTX A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...