4NTXA

Structure of acid-sensing ion channel in complex with snake toxin and amiloride
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
412
structure length
410
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
total genus 113
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntxA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntxA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntxA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntxA02
4NTWA 3S3WA 2FB5A 1WP7A 3S3XA 3IJ4A 4FZ1A 4FZ0A 4NTXA 3N27A 4NTYA 4NYKA 2L35A 1WP8A 2QTSA
chains in the Genus database with same CATH superfamily
5GTIZ 1WAZA 3RGBA 2WLMA 3SYOA 1Y66A 1YXBA 2QM4A 4FLZA 3G67A 3OTOB 1OCRC 1BMFG 4IT5A 2O57A 5EYPB 5B1BC 2ADQB 3CMAV 1K5QA 3QF7A 3AG3C 1H38A 5F2VO 2IJJA 3HPLC 1NT2B 1KYOF 2QJ1A 5GTHZ 4DV5B 1K9MW 4UUJC 3IC7A 2Z5UA 2WLIA 5JJJB 4O4HB 5KX5B 2FYUH 2Q67A 1F7YA 1UFIA 3CRMA 3GB7C 3SPHA 1AI6A 3ZRXA 2YDEA 3J81N 1UPGA 4JI4O 1EN4A 4WFHA 1VP7A 1M57B 2F43G 3ABLC 4LF5O 2EJRA 3ZMUA 3ABUA 2LW1A 2Q9LA 1IVSA 4JV5O 2EULA 4X1KA 3AG7A 1VMGA 3CP1A 3WG7B 2DWEC 1AJQA 1EBOA 1ZSPA 2VRZA 2X0LA 4DR6B 1JVMA 1NS1A 5KMGA 4X20A 5CA0B 4OX9O 1G4YB 4G2KA 1U96A 1AVMA 5LOVA 2PGGA 2D3OW 2BTQB 3SYPA 2QWPB 3IFXA 3NR7A 1KMIZ 1Q8IA 1AR4A 4R8CA 1WA8A 4ICGA 5J2UA 3BY6A 1KKDA 4JV5B 2Y69C 4LC1A 4B7EA 1THZA 1KP2A 3HKCA 2XAJA 1NH2B 4FFBA 3H1IH 2HG5C 3SYAA 2P90A 1IXBA 3BVOA 3QO8A 4MVZA 4RUEA 1AJNA 5J9PC 1QLEB 1I0HA 3LDCA 5BZBA 3HKEA 2ZE5A 4UVBA 3CPWU 1XI1A 4DR7B 4JI0O 2A79B 1EN6A 3K9AA 1ENVA 1DLBA 3KKYA 3K04A 2YEVA 2VQFB 4D7TA 4X66B 1SKVA 4UCSA 1AR1B 2WWWA 1K73W 5KMGB 3OGCC 1TGOA 3L9DA 5B1NA 4UCVA 2RMKB 2X6CA 1FPOA 4MW8A 3PN1A 3K59A 3TGUH 2VWKA 5L3EA 3K9SA 3B40A 1Q82W 2YXYA 4HAMA 4JI0B 3B8NA 2EIMC 4TWKA 3I5DA 1SC5B 3K58A 2YI9A 4EFEA 1DTOA 5H6RA 3ZBHA 4FLUA 1W0JG 3RBZA 4TV8A 3U10A 3H1KH 2BSKB 5IY5C 1VQMV 2ITCC 2JEXA 1VEWA 1NJIW 2LW7A 1IBMO 1S0VA 1SA0B 3JASA 1US6A 4NTXA 3RFRA 1KQSU 2VS0A 1IURA 5B3SC 2LQTA 1QVGU 1PL4A 2JGDB 4TQDA 5IJ9B 1VQ8V 4PELA 3JSLA 2ZNIA 2FMLA 1GK9A 4LWSA 4WF9V 4H44B 2YEVB 4JYYA 3VOUA 3CCEV 4JI8O 1V54C 2R72A 3CCRV 4MTXA 4W4KA 3ICXA 3EXAA 4MTFA 2CTRA 4K3AA 5IJ0B 5L3DA 4F4LA 1B3QA 1H2MA 1OJHA 3ZRWB 3K0GA 1ZAUA 1N0JA 3MD0A 1Q7YW 1M56C 4JI1B 3ZMSA 1NBMG 3L72H 4TV8B 3JYCA 1XBLA 4O2AA 2H94A 2Q73A 2XOKG 4H13B 1VQPV 1BZKA 3JCUZ 1FYJA 1SQPH 1Z5VA 2W0FC 4JI8B 1DF4A 3W7TA 4JI2B 1QQCA 2EZOA 2P4VA 1YF2A 3WB2A 1Q6IA 4IIJA 5BY1A 4EFBA 5BMVA 5EC2C 4IYHA 5JJNB 3JCZA 1MNGA 2GHYA 4LWSB 3ASOB 2RNBA 5JCOA 1GN4A 3M99B 3OGIB 1IBKB 5KA6A 2XNDG 2IJIA 2KB1A 1QNMA 4CS3A 5J2TB 4J7ZA 2QGNA 5IDJA 2W0XA 4R50A 3QO7A 1SQFA 5IYBO 3FKSG 3ZRVA 3AG2C 3UT5B 4I55A 3WU2Z 5C8YA 3UKMA 1OCOB 3CCSV 2WLNA 4JAAA 3DC6A 3ABKB 3J7AU 5A9GA 4Z1VA 1Q3EA 2HHHO 1D5NA 5CBFA 5BXZA 1O9HA 3HKBA 1JOYA 1AP5A 3MHHC 5D5QA 3D3IA 2G38A 3ABTA 2X6AA 3BHPA 2RJZA 2WLLA 1JCHA 4GKJO 3SYQA 4LF4O 4EEQA 2Y0IA 2QWQB 3QVNA 4FLWA 4MVOA 2RDCA 2VQEO 2ODMA 3I56V 2QWNB 5KHJA 1N0NA 3HKDA 1MMMA 1PL0A 5FPRA 3K5MA 4OGQB 4X9QA 1K5SA 4NTYA 1QU7A 1H2NA 4FLVA 1GN2A 1R6KA 5LYJA 4F6EA 2E3CA 1N4CA 3T1HO 4GX2A 3JAWB 4GKJB 1AROP 1I08A 5LHIA 2ZR2A 3B8MA 2EIKB 2Q8VA 4UCRA 3BFRA 2F4VB 4PI2A 3BA9A 4G27B 5LP6C 5C93A 3TK1A 4K0KO 4XDJA 1BS3A 3SJQC 2LP7A 4B3TB 5LHHA 2E75B 1SQVH 3I55V 3ZRSA 4JASA 4YXWG 3AG4B 3T1HB 4U3JB 2UUAO 1J95A 3CHXA 2ZIMA 1I5XA 2P5OA 3N27A 2F95B 3JD4A 3VQWA 2DWDC 3EVKA 5GONB 4Q20A 1R3KC 3X2QB 5IYZA 4NXNB 3N2GA 1HR0B 3JALB 1NTZH 1TUBA 5EC1C 4CH4A 1JJOA 5L3FA 4WFEA 4K0KB 3DSQA 1K97A 4ABMA 1K4DC 3AG1C 3B77A 3L75H 3OMIB 1QR9A 3N2KA 3E8BA 4J9YB 3SYCA 1VQ6V 2EILC 2UUAB 5KHIA 3FYEB 3KCXA 3OUSA 3ETDA 5DECA 3ASNB 4DO2A 3F7YC 2GSMB 4PA7A 3OFNG 4GT1A 4PDVA 4F6RB 2DYSC 4GZRB 3UCSC 4ZBMA 3CRAA 3AG3B 4LF8O 2IJHA 3K0DA 1H2LA 2CH7A 1XMQO 1L1FA 1KU9A 4EKWA 4LFBO 3AK3A 2QE7G 1VF7A 4NVPA 4D6TH 1HW7A 2YI8A 3CJHA 5ITZA 4I9QA 4DV6O 4ZI7A 4DR5B 4OPAA 1HP8A 4WBNA 2WPDG 1CXZB 3VQVA 2JIZG 2JVDA 2BOBC 5KA5A 1I94B 3ABLB 3MHSC 4R6ZA 2CTWA 4RAIA 5BR8O 2Q5ZA 1YITV 5KHHA 2P06A 3E86A 4PI0A 4LF8B 1JQ0A 2JJ1G 1NR1A 2DW4A 2FTKA 1OCZC 2NNUA 2PYJA 3TETA 4X64O 4DV6B 1SZTA 2GBOA 2Q6AA 3KZIZ 1VQ5V 2AXTZ 5EYPA 4UCUA 1Q81W 4X89A 2ZNJA 4JTAB 2Y4UA 1AI5A 1ROPA 3CXHF 2ADPA 1KP3A 2KQXA 5BR8B 4O4LA 4DR2O 3T4DA 2XAGA 5JVDA 2JDIG 5LBQA 3ABMB 4AQYO 1LR1A 4O4HA 4TSFG 3JD2A 5KX5A 2FB5A 3BPZA 4DV1B 3Q4HA 4ZI7B 1I7FA 1NR7A 3ZHTA 3A0RA 3SPGA 4H37A 4X64B 1I5YA 2HLDG 5FNVA 1K34A 2QA4V 4LR3A 1IX9A 3EHBB 1SERA 1W2BU 3EFFK 4OPHA 1WP7A 1XL6A 4DR2B 1P4RA 4NB5A 3OR6C 2HP8A 1EZVH 4MVSA 3ZMVA 4FJCC 5CA0A 3JD0A 2R9RB 4TQFA 3ZN0A 3K79A 4TUYB 1Y76B 2JGUA 2IU3A 4DXWA 2GTAA 3OT7A 2BTQA 3A0BZ 1TUEB 1S77D 3JAMN 3RVZA 4MVMA 4O4LB 1HNXO 4CZZA 5JVDB 3TJTA 3H1HH 2EIMB 3E35A 4DUZO 2F66C 1ZL8A 2UUBO 1BE3H 3L70H 1F51A 5B1AC 4GX5A 1XNQO 5IY5B 4J10A 3Q4HB 5L3CA 1XQ8A 3OTFA 5FNVB 2ZE7A 2VWJA 1H8EG 5B3SB 3APOA 4FZ0A 4UVAA 1Q6UA 1PPJH 2EZPA 1D5AA 1HNXB 2XUMA 1P49A 2EIJB 2QM8A 1FKAO 2ITDC 4BWAA 4DUZB 4K35A 4YIPA 3MDSA 2UUBB 4FLXA 1WJZA 2QWRB 1XUQA 3T4ZA 4PA4A 3QTCA 4FVMA 3BABA 3ZHVA 4QJFB 3ZEDA 2HVJC 3O65A 1RM1C 4JI4B 2B1GA 2LFRA 1FS0G 4LF5B 3SJBC 3G80A 1XNRO 3CRQA 1ZX3A 2IH1C 3GWOA 4O2BA 4QGPA 1ZL8B 3H1JH 2BSKA 1FFXA 3CE2A 1SF9A 4CC6A 3K57A 1QHTA 4OX9B 1TVKB 1SA0A 1XHZA 2YSUB 3O9OA 1AI7A 4HNAB 2IH3C 1BSMA 1N8RW 1HDJA 2IM9A 5EIBD 2PI5A 2A06H 4O4IB 5L3BA 2JGDA 4GLXA 5IJ9A 1RSOB 1Q43A 1VF5B 5LL6Y 5LMUO 2IBZH 2ZQMA 2ZIOA 2XAHA 2OTLV 4IYIA 4BIUA 4JPRA 2E5LO 2DQ3A 1BHBA 2ILMA 3CS5A 2WSSG 2JRIA 1KB9F 4LF7O 3ZHQA 5IJ0A 4X8AA 4WFFA 4QPKA 1YEWA 3P32A 3L73H 4GX0A 4J11A 3ZRWA 5CA3A 2ZE6A 4DV2O 3T1CA 1K3EA 4K8XA 1XOUA 1L8DA 1GKFA 4O2BB 5LMUB 1Y67A 3P30A 3B09A 3CCJV 2HKOA 1FFXB 3CC2V 4ASUG 1W59A 4MS2A 1R3LC 5IYDO 4DV0O 5EIBC 2Q0AA 2E5LB 3CC4V 5HFLA 3CRRA 3DXRA 1VQNV 4LF7B 3H1LH 1NTMH 1SQXH 1PKXA 1YSCA 3LSQA 4RQEA 3K5NA 4E4EA 3LDDA 4E2LA 1ORQC 4EB6B 4LNUB 2AGAA 1MA1A 4AILC 5IE9A 1FXKC 4AI8A 1SQBH 2YICA 4DV0B 4UCOA 2WLJA 1MZFA 1IBMB 4QPJA 5CB4B 2QWOB 4LBEC 2JJ2G 3F7VC 4IHJB 1VQKV 4JYAO 4O4JB 5J2TA 4N23A 3G6BA 2PUSA 4FK5C 1EFRG 4PDMA 3DTUB 2P67A 4I50B 3APQA 1H8HG 4I4TB 2YIBA 2XHBA 3JATB 2DN9A 1M5IA 1OZ0A 4RWUA 3UT5A 3SJAC 4H33A 3DXRB 2IU0A 1NVPD 3RT3C 1IZ3A 1K8AW 2LJ2A 4CH6A 1XMOO 5LP6B 4FZ1A 4JI5O 1BGYH 4LP8A 3FFQA 5DN6G 5JWPA 4JI3O 4NYKA 1JPXA 3JAKB 1JX9A 1K7DA 5AG2A 4DV7O 3THOA 3CMEV 4YJ3B 3QNEA 4NXMO 2WAMA 4G28B 4H0LB 3QG5A 1Z2GA 4J80A 1Y74B 5E79Z 4J7JA 2EINB 1M4UA 4YJ2A 3OMAB 4JI5B 4B3RO 2OWOA 4FM0A 4YIOA 1LUVA 3CXCU 3AG1B 4JTCB 4JI3B 4P9PA 3B2EE 3STLC 3JAWA 1Z5WA 2LGQA 2WLHA 4B3MO 3SGIA 4DV7B 1IXMA 4L8JA 3LSUA 4NXMB 3FAVB 1GM8A 1PP9H 5FPOA 2Y4TA 1R6TA 4BIOA 2DYSB 1RP3B 3R66A 1OCCC 2Q68A 1OV9A 2CDYA 2EX3A 4U3JA 2CE4A 3VQYA 3FB5C 1GMGA 1YTFB 5GONA 4P2ZA 1J5EO 1CEZA 2EBOA 2ZE8A 4GX1A 3FB6C 2OCCC 1VQ4V 3D36A 3JALA 2HHHB 4YJ2B 1ZLZA 4WFBV 3ZHRA 1URFA 4UFZA 3RYFA 1X59A 2GUZA 1K33A 2Q7EA 1F23A 1P84F 1FXHA 3IGAC 3ZX6A 4LF4B 1HNWO 3A0HZ 2B9ZA 2N04A 3FB8C 2CGNA 5EZYB 1J5EB 2VQEB 4XDLA 4DV4O 5EBLC 3ZIAG 1OCZB 1K4CC 2UXNA 4F6RA 1QLNA 4MTGA 3M7MX 1JA8A 3K5LA 3RYHA 1E1QG 2QSAA 3C3SA 4YHHO 5IT9N 3CCLV 2Q7GA 4P30A 3W7XA 4MVRA 1PNLA 4DV4B 4J9ZB 1WN7A 2KSDA 3CCMV 4JYBA 3JD3A 1QVFU 5FL7G 4MSWC 3CC7V 1F4MA 2DYRC 4B7KA 3RYFB 2GUZB 4K8ZA 1B04A 4UV8A 3OR7C 3CEIA 2K1EA 3LUTB 4X65O 1FD9A 4YHHB 2B5UA 1N32O 4Z1MG 5DM6V 1AI4A 1XILA 4JI7O 1JFFA 4ZIBA 4B3SO 2M6YA 4FM1A 5CN0A 1OCOC 5B5EZ 2AHZA 3ZMTA 5FLXN 1OCRB 2ZM6O 3ZHSA 3ABKC 4FLTA 5B1BB 1Q90D 3RYCB 2MW2B 1N36O 2W6IG 2HJDA 3K03A 3RYHB 5LMNO 4DR3O 2YC0A 4LF9O 4KHPO 1MOFA 1FJGO 2RQ6A 4X65B 2Q7HA 1N32B 5JCOC 2F23A 4JI7B 5B1AB 4PDRA 5CBGA 3CWBH 5LGNA 4B3SB 3W7SA 1PNMA 4W4LA 1GH6A 5HFMA 3BRCA 3OM3B 3FD9A 2ZM6B 3CCQV 1TAEA 1SS3A 2ZXWC 5B66Z 3BEHA 3J80N 1N36B 4LF6O 1N34O 5LMNB 1PV0A 4DR3B 4LF9B 1XMQB 4KHPB 4LFBB 2NR5A 1O9GA 1JFFB 5JJEB 1L0NH 4CC5A 3W7WA 5IWAO 2Z0AA 4JGSA 1M1KW 4X88A 3R65A 3JARB 4DRXB 4GKKO 4TUYA 3LNMB 4DR1O 1Y76A 2YS8A 3BAAA 2P22C 4RQFA 2AZ2A 4UXNA 2N05A 5JQGB 2BCCH 2JS3A 4PD4F 4X1YB 5JH7B 3OUFA 1VARA 5GW7A 1N34B 4X1IB 5KUKA 3G71V 4BW5A 1ZTEA 3GWKC 2DMXA 2Y69B 4ZOLA 3P3PA 2ZDIA 1SQQH 1M90W 2BE3A 5IWAB 1BQZA 1CPYA 4L87A 1YZBA 1KKCA 3ZS8C 4BIZA 1R6NA 4GKKB 4I9WA 3ZJZA 1E1RG 1W0KG 4DR1B 3OEEG 2GV9A 2Y48A 3K3WA 4QE7A 3X2QC 2CGOA 4GUNA 2QKAA 3OTOO 2PYLA 3STZC 2JEUA 2P7TC 1GO3F 3OW2U 2XAQA 1SETA 4PDLA 3L74H 4AQYB 5CA1B 2KG7B 2C2AA 5B1OA 1FXVA 4DV5O 2OTJV 2XAFA 4AHCA 4DK0A 1M93A 3ASNC 3RN4A 2ETNA 3DGEA 2RCVA 3JD1A 3HR0A 2LGWA 2QEXV 1R3JC 3TXSA 4TT3G 4FMTA 4MTOA 1G6UA 4UVCA 1BHAA 4ZOLB 4HZ3A 5CBHA 3BCCH 5KAIZ 2UXDO 3G4SV 3BA8A 2L6LA 2P6JA 3D3QA 4YY3O 1TVKA 1KUQA 3TCUA 4HNAA 3GVMA 2OYQA 2A9HA 4O4IA 1VF6A 4DR6O 2OIGA 1RSOA 1QBZA 3C3TA 1YDXA 3T2MA 3RYIB 1QCEA 3E22B 3OMNB 3RVYA 1XNQB 5EBWC 2PF4E 5K1PA 1FXKB 1V54B 2UXDB 2UU9O 2NLJC 3ZHUA 1BCCH 4PA6A 4YY3B 2H8PC 1WPXA 2HJFC 2QTOA 4BW9A 2AW9A 4I0XB 1AR5A 5E1AC 3RW0A 3K08A 3C90A 1DGSA 1VQOV 5EK0A 1SQGA 2X6BA 4KP4A 1YJWV 3ETEA 3SPCA 1M56B 2OIEA 4KL1A 1WLEA 4DR7O 3IJ4A 2UU9B 1S76D 4U7NA 4JTDB 2PY5A 2D2CB 1PNKA 3E8HA 1S5JA 3QO5A 3ABMC 4IGGA 3G6EV 2WLIB 2VQFO 4X66O 1M9NA 3LSSA 5DEDA 1V55C 3E2EA 4FM2A 1XNRB 1GAXA 2JK5C 1BT8A 4EB6A 5TISZ 4LNUA 2LO1A 1JR9A 3H9VA 4MVUA 1NI8A 1YJNV 3M8AA 1X4TA 1JJ2U 1S5HC 1Q6HA 5CB4A 3LNNA 3UQ8A 1D2DA 4X1KB 1AP6A 5KAFZ 4IHJA 4O4JA 4PA3A 1L0LH 2Q0OC 2PI4A 2YXLA 4GYCB 4J42A 4X20B 1PM9A 1WP8A 1YJ9V 2YIAA 4QNHB 5LOVB 4I50A 1KECA 2IJKA 3H01A 4IL6Z 4I4TA 1NVPB 2CTPA 3JATA 1AILA 2H3OA 1BQ0A 3AG2B 1XDCA 1NZ6A 1VQ7V 4JI6O 1JMKC 4LH7A 2XT9A 1WA8B 2YUAA 5H6QA 5J2UB 4JAVA 1SZXA 1E79G 2ZDIC 1DK1A 1B06A 3TXQA 3ML0A 3W7UA 3HKCB 3KCYA 4KFMA 1VQ9V 3OE7G 1MSDA 4C7UA 3E8FA 4QIWF 3CB2A 4DV2B 4FFBB 2ZR3A 2AZ0A 1V9PA 5LP6A 3UO2A 1M57C 3ZCCA 2EJ7A 2OCHA 1NH2D 4BR6A 2Y0PA 4J7KA 2F1MA 3HKEB 2DJVA 1OCCB 2A3QA 3JAKA 4B08A 4JI6B 3KG2A 3SPIA 2EIJC 4YJ3A 1S5LZ 4JI1O 3CSXA 3WB1A 3WG7C 4XBFA 5D5PA 4Z2WA 5LA6A 1Y74A 1YCIA 1XEQA 4X62O 4R7CA 4JI2O 2OCCB 1PD3A 4HBNA 2X7RB 3S3WA 4RO2A 1UJWB 5K1XA 5LXTA 2R9AA 2GTSA 4MT8A 2ZCEA 4NKGB 3WFVA 3AK2A 4UCTA 1EM1A 2BOCC 5KLVH 2HFEC 2V4DA 3VQXA 3FAVA 1DF5A 4DW1A 1CP9A 1KD1W 4LCUC 4WFGA 4DV3O 4JYAB 2HEPA 1IBKO 4LFCO 4X62B 4U3FH 1S3JA 4QE9A 1WPBA 3JASB 2K9PA 4UB8Z 1QLEC 4KXRA 2UXBO 1VF6C 5LGTA 2CK3G 4DYLA 3CRCA 1GN3A 3WB0A 1K92A 5LA6B 1FFTB 4DV3B 4U7OA 2DE0X 1XMOB 4LFCB 4P9OA 1B6QA 1GM7A 5LXTB 2QKSA 1AJPA 2DYRB 1NQTA 1H2KA 4DUYO 2UXBB 1EZJA 5LHGA 1R73A 4MVQA 2EILB 4ZHQA 5EZYA 1N33O 1KBHA 2Z3YA 4O2AB 2W6JG 4I5SA 4JZGA 1SESA 1IBLO 2ZKOA 2ZT9B 3CCUV 1MG1A 4RUFA 3OD4A 4DR4O 1A32A 1R1BA 4B3RB 4IIJB 5H2FZ 4CH5A 2E74B 3IAYA 5BMVB 1F4NA 4DUYB 3U11A 3RWRD 3CD6V 1WB7A 1IDSA 2UUCO 4B3MB 1YVWA 1ZWIC 1YHQV 1N33B 4JYCA 3F5WC 1U97A 3K5OA 5A2QN 3CX5F 1IBLB 4PHZA 2ARHA 1SRYA 4UV9A 1HWYA 2FL4A 3ZMZA 1XREA 4DR4B 2E76B 1R3IC 2ZXWB 2F93B 1OHHG 2F4VO 2V7QG 1G1XB 4XDKA 1FAFA 1RPOA 5CMUA 1BL8A 3ETQA 4ZHQB 3CYOA 2UUCB 1ZUQA 1WB8A 4B3TO 2KKWA 4JF3A 1KC8W 1GTOA 3SPJA 1HNZO 4LH6A 2OT5A 2WA3A 1MZEA 3AK1A 4J41A 4I55B 5C8YB 1RPRA 1GN6A 3PJSK 3FB7C 1Q5OA 2MK3A 2YIBD 1RFYA 3RYCA 1NTKH 5KHKA 3NXSA 4NXNO 2YIDA 2R9IA 1HR0O 5EBMC 3SJCC 4TOIA 1HNWB 3ASOC 2NN4A 5H9CA 3HKBB 2JS5A 2IW5A 4JZ2A 1HNZB 2QTSA 3SDLA 4FIPC 2WLLB 3FYIB 4FPPA 2UXCO 5H5NA 1XHXA 1YIJV 2V1DA 4FFKA 4GCZA 1QR8A 3E83A 1NKDA 2EINC 3HKDB 4I7ZB 2UXXA 2WLKA 4CS4A 1YTFD 4JAUA 4CBCA 4HYOA 4BAYA 4TV9A 2M7WA 4PJ0Z 2PZSA 5LYJB 3JARA 2QDOA 1Y6XA 4DRXA 3ETGA 1P7GA 4LFAO 1H2GA 1LUWA 3P3NA 2Q69A 2QM7A 3T1YO 2UXCB 4NR1A 5JQGA 2RN9A 1Q86W 2XTAA 4X1YA 3IC9A 2CUGA 3CCVV 2BTOA 5JH7A 2A7WA 3B4SA 4PV1B 3FX7A 4X1IA 4DR5O 1S72V 1NU1H 5KHGA 4MW3A 4OXSA 1I94O 1P7BA 4DW0A 1GM9A 4LFAB 2Q4PA 3S3XA 1AB3A 2N74A 3T1YB 3F5TA 3JSNA 3SR2C 2B1IA 1TA8A 5IYZB 2QR4A 3N2GB 4UB6Z 3ZN1A 3AEIA 1TUBB 1FJGB 4N21A 1YI2V 4WFAV 1VIBA 1Y4MA 5CA1A 1G8MA 4TV9B 3DC5A 2YXHA 2KG7A 3N2KB 3VBBA 2CTQA 3HB3B 1LNQA 2HR3A 3U0ZA 3OAAG 1RM1B 4ZKIA 3A2FA 1VQLV 2EIKC 5L3GA 2ZINA 2WA4A 2ATKC 5KUMA 4KUMA 2R70A 4DV1O 4CS2A 4LF6B 1T5EA 4CH3A 3OEHG 2DOSA 3E8GA 2P4KA 1XL4A 1EN5A 3A8TA 3D8CA 4D7SA 5LGUA 3AG4C 3K06A 4DK1A 3LDEA 2CH7B 3MAQA 1WNSA 3L71H 2PTMA 2ZD9A 2FKXA 1MABG 1MSWD 3CJHB 4WCEV 5ITZB 2LFSA 1V55B 3D36C 3UM7A 4Q6GA 3RYIA 3UO3A 2AHYA 3E22A 4WBNB 2DQ0A 4NTWA 4PA9A 2CAZC 2GDSA 3E89A 1H2SB 2L35A 1FXKA 2A0LA 2XASA 4A5UB 5IYCO 2QKCA 2HVKC 4FLYA 1COWG 4I0XA 1GRJA
chains in the Genus database with same CATH topology
4NTWA 3S3WA 2FB5A 1WP7A 3S3XA 3IJ4A 4FZ1A 4FZ0A 4NTXA 3N27A 4NTYA 4NYKA 2L35A 1WP8A 2QTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTW A;  3S3W A;  2FB5 A;  1WP7 A;  3S3X A;  3IJ4 A;  4FZ1 A;  4FZ0 A;  4NTX A;  3N27 A;  4NTY A;  4NYK A;  2L35 A;  1WP8 A;  2QTS A; 
#chains in the Genus database with same CATH topology
 5GTI Z;  1WAZ A;  3RGB A;  2WLM A;  3SYO A;  1Y66 A;  1YXB A;  2QM4 A;  4FLZ A;  3G67 A;  3OTO B;  1OCR C;  1BMF G;  4IT5 A;  2O57 A;  5EYP B;  5B1B C;  2ADQ B;  3CMA V;  1K5Q A;  3QF7 A;  3AG3 C;  1H38 A;  5F2V O;  2IJJ A;  3HPL C;  1NT2 B;  1KYO F;  2QJ1 A;  5GTH Z;  4DV5 B;  1K9M W;  4UUJ C;  3IC7 A;  2Z5U A;  2WLI A;  5JJJ B;  4O4H B;  5KX5 B;  2FYU H;  2Q67 A;  1F7Y A;  1UFI A;  3CRM A;  3GB7 C;  3SPH A;  1AI6 A;  3ZRX A;  2YDE A;  3J81 N;  1UPG A;  4JI4 O;  1EN4 A;  4WFH A;  1VP7 A;  1M57 B;  2F43 G;  3ABL C;  4LF5 O;  2EJR A;  3ZMU A;  3ABU A;  2LW1 A;  2Q9L A;  1IVS A;  4JV5 O;  2EUL A;  4X1K A;  3AG7 A;  1VMG A;  3CP1 A;  3WG7 B;  2DWE C;  1AJQ A;  1EBO A;  1ZSP A;  2VRZ A;  2X0L A;  4DR6 B;  1JVM A;  1NS1 A;  5KMG A;  4X20 A;  5CA0 B;  4OX9 O;  1G4Y B;  4G2K A;  1U96 A;  1AVM A;  5LOV A;  2PGG A;  2D3O W;  2BTQ B;  3SYP A;  2QWP B;  3IFX A;  3NR7 A;  1KMI Z;  1Q8I A;  1AR4 A;  4R8C A;  1WA8 A;  4ICG A;  5J2U A;  3BY6 A;  1KKD A;  4JV5 B;  2Y69 C;  4LC1 A;  4B7E A;  1THZ A;  1KP2 A;  3HKC A;  2XAJ A;  1NH2 B;  4FFB A;  3H1I H;  2HG5 C;  3SYA A;  2P90 A;  1IXB A;  3BVO A;  3QO8 A;  4MVZ A;  4RUE A;  1AJN A;  5J9P C;  1QLE B;  1I0H A;  3LDC A;  5BZB A;  3HKE A;  2ZE5 A;  4UVB A;  3CPW U;  1XI1 A;  4DR7 B;  4JI0 O;  2A79 B;  1EN6 A;  3K9A A;  1ENV A;  1DLB A;  3KKY A;  3K04 A;  2YEV A;  2VQF B;  4D7T A;  4X66 B;  1SKV A;  4UCS A;  1AR1 B;  2WWW A;  1K73 W;  5KMG B;  3OGC C;  1TGO A;  3L9D A;  5B1N A;  4UCV A;  2RMK B;  2X6C A;  1FPO A;  4MW8 A;  3PN1 A;  3K59 A;  3TGU H;  2VWK A;  5L3E A;  3K9S A;  3B40 A;  1Q82 W;  2YXY A;  4HAM A;  4JI0 B;  3B8N A;  2EIM C;  4TWK A;  3I5D A;  1SC5 B;  3K58 A;  2YI9 A;  4EFE A;  1DTO A;  5H6R A;  3ZBH A;  4FLU A;  1W0J G;  3RBZ A;  4TV8 A;  3U10 A;  3H1K H;  2BSK B;  5IY5 C;  1VQM V;  2ITC C;  2JEX A;  1VEW A;  1NJI W;  2LW7 A;  1IBM O;  1S0V A;  1SA0 B;  3JAS A;  1US6 A;  4NTX A;  3RFR A;  1KQS U;  2VS0 A;  1IUR A;  5B3S C;  2LQT A;  1QVG U;  1PL4 A;  2JGD B;  4TQD A;  5IJ9 B;  1VQ8 V;  4PEL A;  3JSL A;  2ZNI A;  2FML A;  1GK9 A;  4LWS A;  4WF9 V;  4H44 B;  2YEV B;  4JYY A;  3VOU A;  3CCE V;  4JI8 O;  1V54 C;  2R72 A;  3CCR V;  4MTX A;  4W4K A;  3ICX A;  3EXA A;  4MTF A;  2CTR A;  4K3A A;  5IJ0 B;  5L3D A;  4F4L A;  1B3Q A;  1H2M A;  1OJH A;  3ZRW B;  3K0G A;  1ZAU A;  1N0J A;  3MD0 A;  1Q7Y W;  1M56 C;  4JI1 B;  3ZMS A;  1NBM G;  3L72 H;  4TV8 B;  3JYC A;  1XBL A;  4O2A A;  2H94 A;  2Q73 A;  2XOK G;  4H13 B;  1VQP V;  1BZK A;  3JCU Z;  1FYJ A;  1SQP H;  1Z5V A;  2W0F C;  4JI8 B;  1DF4 A;  3W7T A;  4JI2 B;  1QQC A;  2EZO A;  2P4V A;  1YF2 A;  3WB2 A;  1Q6I A;  4IIJ A;  5BY1 A;  4EFB A;  5BMV A;  5EC2 C;  4IYH A;  5JJN B;  3JCZ A;  1MNG A;  2GHY A;  4LWS B;  3ASO B;  2RNB A;  5JCO A;  1GN4 A;  3M99 B;  3OGI B;  1IBK B;  5KA6 A;  2XND G;  2IJI A;  2KB1 A;  1QNM A;  4CS3 A;  5J2T B;  4J7Z A;  2QGN A;  5IDJ A;  2W0X A;  4R50 A;  3QO7 A;  1SQF A;  5IYB O;  3FKS G;  3ZRV A;  3AG2 C;  3UT5 B;  4I55 A;  3WU2 Z;  5C8Y A;  3UKM A;  1OCO B;  3CCS V;  2WLN A;  4JAA A;  3DC6 A;  3ABK B;  3J7A U;  5A9G A;  4Z1V A;  1Q3E A;  2HHH O;  1D5N A;  5CBF A;  5BXZ A;  1O9H A;  3HKB A;  1JOY A;  1AP5 A;  3MHH C;  5D5Q A;  3D3I A;  2G38 A;  3ABT A;  2X6A A;  3BHP A;  2RJZ A;  2WLL A;  1JCH A;  4GKJ O;  3SYQ A;  4LF4 O;  4EEQ A;  2Y0I A;  2QWQ B;  3QVN A;  4FLW A;  4MVO A;  2RDC A;  2VQE O;  2ODM A;  3I56 V;  2QWN B;  5KHJ A;  1N0N A;  3HKD A;  1MMM A;  1PL0 A;  5FPR A;  3K5M A;  4OGQ B;  4X9Q A;  1K5S A;  4NTY A;  1QU7 A;  1H2N A;  4FLV A;  1GN2 A;  1R6K A;  5LYJ A;  4F6E A;  2E3C A;  1N4C A;  3T1H O;  4GX2 A;  3JAW B;  4GKJ B;  1ARO P;  1I08 A;  5LHI A;  2ZR2 A;  3B8M A;  2EIK B;  2Q8V A;  4UCR A;  3BFR A;  2F4V B;  4PI2 A;  3BA9 A;  4G27 B;  5LP6 C;  5C93 A;  3TK1 A;  4K0K O;  4XDJ A;  1BS3 A;  3SJQ C;  2LP7 A;  4B3T B;  5LHH A;  2E75 B;  1SQV H;  3I55 V;  3ZRS A;  4JAS A;  4YXW G;  3AG4 B;  3T1H B;  4U3J B;  2UUA O;  1J95 A;  3CHX A;  2ZIM A;  1I5X A;  2P5O A;  3N27 A;  2F95 B;  3JD4 A;  3VQW A;  2DWD C;  3EVK A;  5GON B;  4Q20 A;  1R3K C;  3X2Q B;  5IYZ A;  4NXN B;  3N2G A;  1HR0 B;  3JAL B;  1NTZ H;  1TUB A;  5EC1 C;  4CH4 A;  1JJO A;  5L3F A;  4WFE A;  4K0K B;  3DSQ A;  1K97 A;  4ABM A;  1K4D C;  3AG1 C;  3B77 A;  3L75 H;  3OMI B;  1QR9 A;  3N2K A;  3E8B A;  4J9Y B;  3SYC A;  1VQ6 V;  2EIL C;  2UUA B;  5KHI A;  3FYE B;  3KCX A;  3OUS A;  3ETD A;  5DEC A;  3ASN B;  4DO2 A;  3F7Y C;  2GSM B;  4PA7 A;  3OFN G;  4GT1 A;  4PDV A;  4F6R B;  2DYS C;  4GZR B;  3UCS C;  4ZBM A;  3CRA A;  3AG3 B;  4LF8 O;  2IJH A;  3K0D A;  1H2L A;  2CH7 A;  1XMQ O;  1L1F A;  1KU9 A;  4EKW A;  4LFB O;  3AK3 A;  2QE7 G;  1VF7 A;  4NVP A;  4D6T H;  1HW7 A;  2YI8 A;  3CJH A;  5ITZ A;  4I9Q A;  4DV6 O;  4ZI7 A;  4DR5 B;  4OPA A;  1HP8 A;  4WBN A;  2WPD G;  1CXZ B;  3VQV A;  2JIZ G;  2JVD A;  2BOB C;  5KA5 A;  1I94 B;  3ABL B;  3MHS C;  4R6Z A;  2CTW A;  4RAI A;  5BR8 O;  2Q5Z A;  1YIT V;  5KHH A;  2P06 A;  3E86 A;  4PI0 A;  4LF8 B;  1JQ0 A;  2JJ1 G;  1NR1 A;  2DW4 A;  2FTK A;  1OCZ C;  2NNU A;  2PYJ A;  3TET A;  4X64 O;  4DV6 B;  1SZT A;  2GBO A;  2Q6A A;  3KZI Z;  1VQ5 V;  2AXT Z;  5EYP A;  4UCU A;  1Q81 W;  4X89 A;  2ZNJ A;  4JTA B;  2Y4U A;  1AI5 A;  1ROP A;  3CXH F;  2ADP A;  1KP3 A;  2KQX A;  5BR8 B;  4O4L A;  4DR2 O;  3T4D A;  2XAG A;  5JVD A;  2JDI G;  5LBQ A;  3ABM B;  4AQY O;  1LR1 A;  4O4H A;  4TSF G;  3JD2 A;  5KX5 A;  2FB5 A;  3BPZ A;  4DV1 B;  3Q4H A;  4ZI7 B;  1I7F A;  1NR7 A;  3ZHT A;  3A0R A;  3SPG A;  4H37 A;  4X64 B;  1I5Y A;  2HLD G;  5FNV A;  1K34 A;  2QA4 V;  4LR3 A;  1IX9 A;  3EHB B;  1SER A;  1W2B U;  3EFF K;  4OPH A;  1WP7 A;  1XL6 A;  4DR2 B;  1P4R A;  4NB5 A;  3OR6 C;  2HP8 A;  1EZV H;  4MVS A;  3ZMV A;  4FJC C;  5CA0 A;  3JD0 A;  2R9R B;  4TQF A;  3ZN0 A;  3K79 A;  4TUY B;  1Y76 B;  2JGU A;  2IU3 A;  4DXW A;  2GTA A;  3OT7 A;  2BTQ A;  3A0B Z;  1TUE B;  1S77 D;  3JAM N;  3RVZ A;  4MVM A;  4O4L B;  1HNX O;  4CZZ A;  5JVD B;  3TJT A;  3H1H H;  2EIM B;  3E35 A;  4DUZ O;  2F66 C;  1ZL8 A;  2UUB O;  1BE3 H;  3L70 H;  1F51 A;  5B1A C;  4GX5 A;  1XNQ O;  5IY5 B;  4J10 A;  3Q4H B;  5L3C A;  1XQ8 A;  3OTF A;  5FNV B;  2ZE7 A;  2VWJ A;  1H8E G;  5B3S B;  3APO A;  4FZ0 A;  4UVA A;  1Q6U A;  1PPJ H;  2EZP A;  1D5A A;  1HNX B;  2XUM A;  1P49 A;  2EIJ B;  2QM8 A;  1FKA O;  2ITD C;  4BWA A;  4DUZ B;  4K35 A;  4YIP A;  3MDS A;  2UUB B;  4FLX A;  1WJZ A;  2QWR B;  1XUQ A;  3T4Z A;  4PA4 A;  3QTC A;  4FVM A;  3BAB A;  3ZHV A;  4QJF B;  3ZED A;  2HVJ C;  3O65 A;  1RM1 C;  4JI4 B;  2B1G A;  2LFR A;  1FS0 G;  4LF5 B;  3SJB C;  3G80 A;  1XNR O;  3CRQ A;  1ZX3 A;  2IH1 C;  3GWO A;  4O2B A;  4QGP A;  1ZL8 B;  3H1J H;  2BSK A;  1FFX A;  3CE2 A;  1SF9 A;  4CC6 A;  3K57 A;  1QHT A;  4OX9 B;  1TVK B;  1SA0 A;  1XHZ A;  2YSU B;  3O9O A;  1AI7 A;  4HNA B;  2IH3 C;  1BSM A;  1N8R W;  1HDJ A;  2IM9 A;  5EIB D;  2PI5 A;  2A06 H;  4O4I B;  5L3B A;  2JGD A;  4GLX A;  5IJ9 A;  1RSO B;  1Q43 A;  1VF5 B;  5LL6 Y;  5LMU O;  2IBZ H;  2ZQM A;  2ZIO A;  2XAH A;  2OTL V;  4IYI A;  4BIU A;  4JPR A;  2E5L O;  2DQ3 A;  1BHB A;  2ILM A;  3CS5 A;  2WSS G;  2JRI A;  1KB9 F;  4LF7 O;  3ZHQ A;  5IJ0 A;  4X8A A;  4WFF A;  4QPK A;  1YEW A;  3P32 A;  3L73 H;  4GX0 A;  4J11 A;  3ZRW A;  5CA3 A;  2ZE6 A;  4DV2 O;  3T1C A;  1K3E A;  4K8X A;  1XOU A;  1L8D A;  1GKF A;  4O2B B;  5LMU B;  1Y67 A;  3P30 A;  3B09 A;  3CCJ V;  2HKO A;  1FFX B;  3CC2 V;  4ASU G;  1W59 A;  4MS2 A;  1R3L C;  5IYD O;  4DV0 O;  5EIB C;  2Q0A A;  2E5L B;  3CC4 V;  5HFL A;  3CRR A;  3DXR A;  1VQN V;  4LF7 B;  3H1L H;  1NTM H;  1SQX H;  1PKX A;  1YSC A;  3LSQ A;  4RQE A;  3K5N A;  4E4E A;  3LDD A;  4E2L A;  1ORQ C;  4EB6 B;  4LNU B;  2AGA A;  1MA1 A;  4AIL C;  5IE9 A;  1FXK C;  4AI8 A;  1SQB H;  2YIC A;  4DV0 B;  4UCO A;  2WLJ A;  1MZF A;  1IBM B;  4QPJ A;  5CB4 B;  2QWO B;  4LBE C;  2JJ2 G;  3F7V C;  4IHJ B;  1VQK V;  4JYA O;  4O4J B;  5J2T A;  4N23 A;  3G6B A;  2PUS A;  4FK5 C;  1EFR G;  4PDM A;  3DTU B;  2P67 A;  4I50 B;  3APQ A;  1H8H G;  4I4T B;  2YIB A;  2XHB A;  3JAT B;  2DN9 A;  1M5I A;  1OZ0 A;  4RWU A;  3UT5 A;  3SJA C;  4H33 A;  3DXR B;  2IU0 A;  1NVP D;  3RT3 C;  1IZ3 A;  1K8A W;  2LJ2 A;  4CH6 A;  1XMO O;  5LP6 B;  4FZ1 A;  4JI5 O;  1BGY H;  4LP8 A;  3FFQ A;  5DN6 G;  5JWP A;  4JI3 O;  4NYK A;  1JPX A;  3JAK B;  1JX9 A;  1K7D A;  5AG2 A;  4DV7 O;  3THO A;  3CME V;  4YJ3 B;  3QNE A;  4NXM O;  2WAM A;  4G28 B;  4H0L B;  3QG5 A;  1Z2G A;  4J80 A;  1Y74 B;  5E79 Z;  4J7J A;  2EIN B;  1M4U A;  4YJ2 A;  3OMA B;  4JI5 B;  4B3R O;  2OWO A;  4FM0 A;  4YIO A;  1LUV A;  3CXC U;  3AG1 B;  4JTC B;  4JI3 B;  4P9P A;  3B2E E;  3STL C;  3JAW A;  1Z5W A;  2LGQ A;  2WLH A;  4B3M O;  3SGI A;  4DV7 B;  1IXM A;  4L8J A;  3LSU A;  4NXM B;  3FAV B;  1GM8 A;  1PP9 H;  5FPO A;  2Y4T A;  1R6T A;  4BIO A;  2DYS B;  1RP3 B;  3R66 A;  1OCC C;  2Q68 A;  1OV9 A;  2CDY A;  2EX3 A;  4U3J A;  2CE4 A;  3VQY A;  3FB5 C;  1GMG A;  1YTF B;  5GON A;  4P2Z A;  1J5E O;  1CEZ A;  2EBO A;  2ZE8 A;  4GX1 A;  3FB6 C;  2OCC C;  1VQ4 V;  3D36 A;  3JAL A;  2HHH B;  4YJ2 B;  1ZLZ A;  4WFB V;  3ZHR A;  1URF A;  4UFZ A;  3RYF A;  1X59 A;  2GUZ A;  1K33 A;  2Q7E A;  1F23 A;  1P84 F;  1FXH A;  3IGA C;  3ZX6 A;  4LF4 B;  1HNW O;  3A0H Z;  2B9Z A;  2N04 A;  3FB8 C;  2CGN A;  5EZY B;  1J5E B;  2VQE B;  4XDL A;  4DV4 O;  5EBL C;  3ZIA G;  1OCZ B;  1K4C C;  2UXN A;  4F6R A;  1QLN A;  4MTG A;  3M7M X;  1JA8 A;  3K5L A;  3RYH A;  1E1Q G;  2QSA A;  3C3S A;  4YHH O;  5IT9 N;  3CCL V;  2Q7G A;  4P30 A;  3W7X A;  4MVR A;  1PNL A;  4DV4 B;  4J9Z B;  1WN7 A;  2KSD A;  3CCM V;  4JYB A;  3JD3 A;  1QVF U;  5FL7 G;  4MSW C;  3CC7 V;  1F4M A;  2DYR C;  4B7K A;  3RYF B;  2GUZ B;  4K8Z A;  1B04 A;  4UV8 A;  3OR7 C;  3CEI A;  2K1E A;  3LUT B;  4X65 O;  1FD9 A;  4YHH B;  2B5U A;  1N32 O;  4Z1M G;  5DM6 V;  1AI4 A;  1XIL A;  4JI7 O;  1JFF A;  4ZIB A;  4B3S O;  2M6Y A;  4FM1 A;  5CN0 A;  1OCO C;  5B5E Z;  2AHZ A;  3ZMT A;  5FLX N;  1OCR B;  2ZM6 O;  3ZHS A;  3ABK C;  4FLT A;  5B1B B;  1Q90 D;  3RYC B;  2MW2 B;  1N36 O;  2W6I G;  2HJD A;  3K03 A;  3RYH B;  5LMN O;  4DR3 O;  2YC0 A;  4LF9 O;  4KHP O;  1MOF A;  1FJG O;  2RQ6 A;  4X65 B;  2Q7H A;  1N32 B;  5JCO C;  2F23 A;  4JI7 B;  5B1A B;  4PDR A;  5CBG A;  3CWB H;  5LGN A;  4B3S B;  3W7S A;  1PNM A;  4W4L A;  1GH6 A;  5HFM A;  3BRC A;  3OM3 B;  3FD9 A;  2ZM6 B;  3CCQ V;  1TAE A;  1SS3 A;  2ZXW C;  5B66 Z;  3BEH A;  3J80 N;  1N36 B;  4LF6 O;  1N34 O;  5LMN B;  1PV0 A;  4DR3 B;  4LF9 B;  1XMQ B;  4KHP B;  4LFB B;  2NR5 A;  1O9G A;  1JFF B;  5JJE B;  1L0N H;  4CC5 A;  3W7W A;  5IWA O;  2Z0A A;  4JGS A;  1M1K W;  4X88 A;  3R65 A;  3JAR B;  4DRX B;  4GKK O;  4TUY A;  3LNM B;  4DR1 O;  1Y76 A;  2YS8 A;  3BAA A;  2P22 C;  4RQF A;  2AZ2 A;  4UXN A;  2N05 A;  5JQG B;  2BCC H;  2JS3 A;  4PD4 F;  4X1Y B;  5JH7 B;  3OUF A;  1VAR A;  5GW7 A;  1N34 B;  4X1I B;  5KUK A;  3G71 V;  4BW5 A;  1ZTE A;  3GWK C;  2DMX A;  2Y69 B;  4ZOL A;  3P3P A;  2ZDI A;  1SQQ H;  1M90 W;  2BE3 A;  5IWA B;  1BQZ A;  1CPY A;  4L87 A;  1YZB A;  1KKC A;  3ZS8 C;  4BIZ A;  1R6N A;  4GKK B;  4I9W A;  3ZJZ A;  1E1R G;  1W0K G;  4DR1 B;  3OEE G;  2GV9 A;  2Y48 A;  3K3W A;  4QE7 A;  3X2Q C;  2CGO A;  4GUN A;  2QKA A;  3OTO O;  2PYL A;  3STZ C;  2JEU A;  2P7T C;  1GO3 F;  3OW2 U;  2XAQ A;  1SET A;  4PDL A;  3L74 H;  4AQY B;  5CA1 B;  2KG7 B;  2C2A A;  5B1O A;  1FXV A;  4DV5 O;  2OTJ V;  2XAF A;  4AHC A;  4DK0 A;  1M93 A;  3ASN C;  3RN4 A;  2ETN A;  3DGE A;  2RCV A;  3JD1 A;  3HR0 A;  2LGW A;  2QEX V;  1R3J C;  3TXS A;  4TT3 G;  4FMT A;  4MTO A;  1G6U A;  4UVC A;  1BHA A;  4ZOL B;  4HZ3 A;  5CBH A;  3BCC H;  5KAI Z;  2UXD O;  3G4S V;  3BA8 A;  2L6L A;  2P6J A;  3D3Q A;  4YY3 O;  1TVK A;  1KUQ A;  3TCU A;  4HNA A;  3GVM A;  2OYQ A;  2A9H A;  4O4I A;  1VF6 A;  4DR6 O;  2OIG A;  1RSO A;  1QBZ A;  3C3T A;  1YDX A;  3T2M A;  3RYI B;  1QCE A;  3E22 B;  3OMN B;  3RVY A;  1XNQ B;  5EBW C;  2PF4 E;  5K1P A;  1FXK B;  1V54 B;  2UXD B;  2UU9 O;  2NLJ C;  3ZHU A;  1BCC H;  4PA6 A;  4YY3 B;  2H8P C;  1WPX A;  2HJF C;  2QTO A;  4BW9 A;  2AW9 A;  4I0X B;  1AR5 A;  5E1A C;  3RW0 A;  3K08 A;  3C90 A;  1DGS A;  1VQO V;  5EK0 A;  1SQG A;  2X6B A;  4KP4 A;  1YJW V;  3ETE A;  3SPC A;  1M56 B;  2OIE A;  4KL1 A;  1WLE A;  4DR7 O;  3IJ4 A;  2UU9 B;  1S76 D;  4U7N A;  4JTD B;  2PY5 A;  2D2C B;  1PNK A;  3E8H A;  1S5J A;  3QO5 A;  3ABM C;  4IGG A;  3G6E V;  2WLI B;  2VQF O;  4X66 O;  1M9N A;  3LSS A;  5DED A;  1V55 C;  3E2E A;  4FM2 A;  1XNR B;  1GAX A;  2JK5 C;  1BT8 A;  4EB6 A;  5TIS Z;  4LNU A;  2LO1 A;  1JR9 A;  3H9V A;  4MVU A;  1NI8 A;  1YJN V;  3M8A A;  1X4T A;  1JJ2 U;  1S5H C;  1Q6H A;  5CB4 A;  3LNN A;  3UQ8 A;  1D2D A;  4X1K B;  1AP6 A;  5KAF Z;  4IHJ A;  4O4J A;  4PA3 A;  1L0L H;  2Q0O C;  2PI4 A;  2YXL A;  4GYC B;  4J42 A;  4X20 B;  1PM9 A;  1WP8 A;  1YJ9 V;  2YIA A;  4QNH B;  5LOV B;  4I50 A;  1KEC A;  2IJK A;  3H01 A;  4IL6 Z;  4I4T A;  1NVP B;  2CTP A;  3JAT A;  1AIL A;  2H3O A;  1BQ0 A;  3AG2 B;  1XDC A;  1NZ6 A;  1VQ7 V;  4JI6 O;  1JMK C;  4LH7 A;  2XT9 A;  1WA8 B;  2YUA A;  5H6Q A;  5J2U B;  4JAV A;  1SZX A;  1E79 G;  2ZDI C;  1DK1 A;  1B06 A;  3TXQ A;  3ML0 A;  3W7U A;  3HKC B;  3KCY A;  4KFM A;  1VQ9 V;  3OE7 G;  1MSD A;  4C7U A;  3E8F A;  4QIW F;  3CB2 A;  4DV2 B;  4FFB B;  2ZR3 A;  2AZ0 A;  1V9P A;  5LP6 A;  3UO2 A;  1M57 C;  3ZCC A;  2EJ7 A;  2OCH A;  1NH2 D;  4BR6 A;  2Y0P A;  4J7K A;  2F1M A;  3HKE B;  2DJV A;  1OCC B;  2A3Q A;  3JAK A;  4B08 A;  4JI6 B;  3KG2 A;  3SPI A;  2EIJ C;  4YJ3 A;  1S5L Z;  4JI1 O;  3CSX A;  3WB1 A;  3WG7 C;  4XBF A;  5D5P A;  4Z2W A;  5LA6 A;  1Y74 A;  1YCI A;  1XEQ A;  4X62 O;  4R7C A;  4JI2 O;  2OCC B;  1PD3 A;  4HBN A;  2X7R B;  3S3W A;  4RO2 A;  1UJW B;  5K1X A;  5LXT A;  2R9A A;  2GTS A;  4MT8 A;  2ZCE A;  4NKG B;  3WFV A;  3AK2 A;  4UCT A;  1EM1 A;  2BOC C;  5KLV H;  2HFE C;  2V4D A;  3VQX A;  3FAV A;  1DF5 A;  4DW1 A;  1CP9 A;  1KD1 W;  4LCU C;  4WFG A;  4DV3 O;  4JYA B;  2HEP A;  1IBK O;  4LFC O;  4X62 B;  4U3F H;  1S3J A;  4QE9 A;  1WPB A;  3JAS B;  2K9P A;  4UB8 Z;  1QLE C;  4KXR A;  2UXB O;  1VF6 C;  5LGT A;  2CK3 G;  4DYL A;  3CRC A;  1GN3 A;  3WB0 A;  1K92 A;  5LA6 B;  1FFT B;  4DV3 B;  4U7O A;  2DE0 X;  1XMO B;  4LFC B;  4P9O A;  1B6Q A;  1GM7 A;  5LXT B;  2QKS A;  1AJP A;  2DYR B;  1NQT A;  1H2K A;  4DUY O;  2UXB B;  1EZJ A;  5LHG A;  1R73 A;  4MVQ A;  2EIL B;  4ZHQ A;  5EZY A;  1N33 O;  1KBH A;  2Z3Y A;  4O2A B;  2W6J G;  4I5S A;  4JZG A;  1SES A;  1IBL O;  2ZKO A;  2ZT9 B;  3CCU V;  1MG1 A;  4RUF A;  3OD4 A;  4DR4 O;  1A32 A;  1R1B A;  4B3R B;  4IIJ B;  5H2F Z;  4CH5 A;  2E74 B;  3IAY A;  5BMV B;  1F4N A;  4DUY B;  3U11 A;  3RWR D;  3CD6 V;  1WB7 A;  1IDS A;  2UUC O;  4B3M B;  1YVW A;  1ZWI C;  1YHQ V;  1N33 B;  4JYC A;  3F5W C;  1U97 A;  3K5O A;  5A2Q N;  3CX5 F;  1IBL B;  4PHZ A;  2ARH A;  1SRY A;  4UV9 A;  1HWY A;  2FL4 A;  3ZMZ A;  1XRE A;  4DR4 B;  2E76 B;  1R3I C;  2ZXW B;  2F93 B;  1OHH G;  2F4V O;  2V7Q G;  1G1X B;  4XDK A;  1FAF A;  1RPO A;  5CMU A;  1BL8 A;  3ETQ A;  4ZHQ B;  3CYO A;  2UUC B;  1ZUQ A;  1WB8 A;  4B3T O;  2KKW A;  4JF3 A;  1KC8 W;  1GTO A;  3SPJ A;  1HNZ O;  4LH6 A;  2OT5 A;  2WA3 A;  1MZE A;  3AK1 A;  4J41 A;  4I55 B;  5C8Y B;  1RPR A;  1GN6 A;  3PJS K;  3FB7 C;  1Q5O A;  2MK3 A;  2YIB D;  1RFY A;  3RYC A;  1NTK H;  5KHK A;  3NXS A;  4NXN O;  2YID A;  2R9I A;  1HR0 O;  5EBM C;  3SJC C;  4TOI A;  1HNW B;  3ASO C;  2NN4 A;  5H9C A;  3HKB B;  2JS5 A;  2IW5 A;  4JZ2 A;  1HNZ B;  2QTS A;  3SDL A;  4FIP C;  2WLL B;  3FYI B;  4FPP A;  2UXC O;  5H5N A;  1XHX A;  1YIJ V;  2V1D A;  4FFK A;  4GCZ A;  1QR8 A;  3E83 A;  1NKD A;  2EIN C;  3HKD B;  4I7Z B;  2UXX A;  2WLK A;  4CS4 A;  1YTF D;  4JAU A;  4CBC A;  4HYO A;  4BAY A;  4TV9 A;  2M7W A;  4PJ0 Z;  2PZS A;  5LYJ B;  3JAR A;  2QDO A;  1Y6X A;  4DRX A;  3ETG A;  1P7G A;  4LFA O;  1H2G A;  1LUW A;  3P3N A;  2Q69 A;  2QM7 A;  3T1Y O;  2UXC B;  4NR1 A;  5JQG A;  2RN9 A;  1Q86 W;  2XTA A;  4X1Y A;  3IC9 A;  2CUG A;  3CCV V;  2BTO A;  5JH7 A;  2A7W A;  3B4S A;  4PV1 B;  3FX7 A;  4X1I A;  4DR5 O;  1S72 V;  1NU1 H;  5KHG A;  4MW3 A;  4OXS A;  1I94 O;  1P7B A;  4DW0 A;  1GM9 A;  4LFA B;  2Q4P A;  3S3X A;  1AB3 A;  2N74 A;  3T1Y B;  3F5T A;  3JSN A;  3SR2 C;  2B1I A;  1TA8 A;  5IYZ B;  2QR4 A;  3N2G B;  4UB6 Z;  3ZN1 A;  3AEI A;  1TUB B;  1FJG B;  4N21 A;  1YI2 V;  4WFA V;  1VIB A;  1Y4M A;  5CA1 A;  1G8M A;  4TV9 B;  3DC5 A;  2YXH A;  2KG7 A;  3N2K B;  3VBB A;  2CTQ A;  3HB3 B;  1LNQ A;  2HR3 A;  3U0Z A;  3OAA G;  1RM1 B;  4ZKI A;  3A2F A;  1VQL V;  2EIK C;  5L3G A;  2ZIN A;  2WA4 A;  2ATK C;  5KUM A;  4KUM A;  2R70 A;  4DV1 O;  4CS2 A;  4LF6 B;  1T5E A;  4CH3 A;  3OEH G;  2DOS A;  3E8G A;  2P4K A;  1XL4 A;  1EN5 A;  3A8T A;  3D8C A;  4D7S A;  5LGU A;  3AG4 C;  3K06 A;  4DK1 A;  3LDE A;  2CH7 B;  3MAQ A;  1WNS A;  3L71 H;  2PTM A;  2ZD9 A;  2FKX A;  1MAB G;  1MSW D;  3CJH B;  4WCE V;  5ITZ B;  2LFS A;  1V55 B;  3D36 C;  3UM7 A;  4Q6G A;  3RYI A;  3UO3 A;  2AHY A;  3E22 A;  4WBN B;  2DQ0 A;  4NTW A;  4PA9 A;  2CAZ C;  2GDS A;  3E89 A;  1H2S B;  2L35 A;  1FXK A;  2A0L A;  2XAS A;  4A5U B;  5IYC O;  2QKC A;  2HVK C;  4FLY A;  1COW G;  4I0X A;  1GRJ A; 
#chains in the Genus database with same CATH homology
 4NTW A;  3S3W A;  2FB5 A;  1WP7 A;  3S3X A;  3IJ4 A;  4FZ1 A;  4FZ0 A;  4NTX A;  3N27 A;  4NTY A;  4NYK A;  2L35 A;  1WP8 A;  2QTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...