4NTXA

Structure of acid-sensing ion channel in complex with snake toxin and amiloride
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
412
structure length
410
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
total genus 113
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntxA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntxA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntxA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntxA02
4NTYA 4NTXA 3S3XA 2QTSA 4FZ1A 3S3WA 2L35A 4NTWA 3IJ4A 4NYKA 1WP7A 4FZ0A 2FB5A 3N27A 1WP8A
chains in the Genus database with same CATH superfamily
4FM0A 1GM9A 2YICA 1DF4A 3FFQA 3HKDA 1FS0G 5H6QA 1GAXA 4X65B 1Y76A 5FNVB 5ITZB 1Y67A 1E1RG 3BA9A 2E3CA 2MK3A 4PHZA 2DQ3A 1H2KA 4NYKA 2A79B 1HNWB 2CAZC 4NTWA 5IJ9A 3B2EE 3KCYA 2QA4V 4PELA 2XAHA 4CBCA 2FB5A 5JH7A 3UM7A 1M90W 3B4SA 2Y4UA 1R3KC 3RVZA 3K79A 3T1YO 4EFEA 1WP8A 1Q90D 1XUQA 3SPIA 2PYJA 2PY5A 5E1AC 4I4TA 2AGAA 3T4ZA 2B1IA 3APQA 5CBGA 1F7YA 1K4CC 3P30A 1PPJH 4DR6O 3SPJA 2WLIA 4AILC 1XNQO 2F93B 1BZKA 1IBKB 1D5AA 1SQQH 1K33A 3ZHVA 1XNRO 1YCIA 1JCHA 3DXRB 3OGCC 3VBBA 4PDVA 3X2QB 4ZI7B 5EBLC 1SS3A 1RSOB 1U97A 4FLZA 4JI0O 4DR1O 4YY3B 2PGGA 3QO8A 1VQNV 2RDCA 2BSKA 2XAGA 3STZC 4GUNA 3EXAA 2ZCEA 1OCOB 4LNUB 3JD1A 2ZD9A 3CCVV 4TV8B 4J42A 2XHBA 3ZCCA 1MMMA 3ZS8C 1Y4MA 1R6TA 1U96A 4O4LB 1E1QG 1A32A 2YEVB 3RFRA 1M56C 1NBMG 4K0KB 3ABTA 3JALA 4UV8A 3OMNB 3WB2A 4CH5A 4DR3O 3D3IA 3SYQA 4ABMA 2Q69A 2YC0A 3JSLA 1W0KG 2XT9A 1K92A 4BW5A 4B3SO 3DGEA 3KZIZ 4YJ3B 3AG2B 3UO2A 5KHGA 1XOUA 4DV6O 4FFBA 1BQ0A 4LF6O 3BAAA 2GHYA 1H8HG 5IY5C 5J2UA 4KP4A 4BAYA 3ZHTA 4LCUC 4UVAA 5LMUO 1JFFB 2QSAA 1HNXO 2X7RB 5D5QA 2F66C 4TT3G 3RGBA 3JASB 3F5WC 4IIJB 4JI7B 1RFYA 1G6UA 2NLJC 2ADQB 1VEWA 4LBEC 2QR4A 5EIBD 4HNAB 4I0XB 1IBLB 3CJHB 2FKXA 5LGTA 2NN4A 1QLEC 1BHBA 3BHPA 2P5OA 2WLLB 3AK2A 4AHCA 3AG4B 4FZ0A 4PA9A 4E4EA 3QO7A 3JD2A 3WU2Z 4OX9O 4FIPC 4LFBB 4LH6A 1SZTA 3ZMUA 4DV0O 3W7WA 2IU3A 2H3OA 1F51A 3CCMV 2R70A 3IAYA 1RP3B 2AHYA 1XHXA 3QNEA 4UCUA 4KHPB 2Q73A 4IL6Z 5JJEB 1MABG 5HFLA 4FLTA 3K04A 3FAVA 1XEQA 1H2NA 2QKAA 1N4CA 2OIGA 3O65A 4Z2WA 1OZ0A 3C90A 2EIMB 3F7VC 5DECA 1KECA 2A06H 3C3SA 4FJCC 4FLUA 1AJNA 4JYBA 1R1BA 4DW1A 4FLVA 3T1YB 2W6JG 3LSUA 1FXVA 2XNDG 3ABLC 3K0GA 3I5DA 5KX5B 2RQ6A 2ADPA 4X62O 3VQVA 2CUGA 2FL4A 2D3OW 2LP7A 4WBNA 3RYFA 5K1XA 4G2KA 4EB6B 1YZBA 1ROPA 5LBQA 4DR6B 2QWOB 1T5EA 4D6TH 1XNQB 1GK9A 4WFHA 4O4HB 4LF9O 3CCEV 3ABKC 4YHHO 4LWSB 3CXHF 1XNRB 1EFRG 2IJJA 4K8XA 3TCUA 1OCZC 1VQOV 4PA7A 2DN9A 4JI0B 4DR1B 3I56V 1QBZA 3GVMA 4CS3A 1NH2B 2O57A 3B8MA 4QE7A 1K97A 2ITCC 4X1KA 3AEIA 3UCSC 5KA5A 3VOUA 3F5TA 2IH1C 2UUAO 1M57B 1O9GA 4LF4O 1AILA 5KLVH 3D8CA 3BY6A 1QVGU 3P3NA 1YHQV 5EZYA 3E22B 1VF7A 3AG3C 2EJ7A 1S5JA 3J80N 2CTWA 3ETDA 3CCUV 1PNKA 4O4JB 2KG7B 2ZE7A 2VQFO 4DR3B 4R6ZA 3E89A 4RWUA 1NU1H 5H6RA 4ZIBA 4QJFB 4B7EA 2X6CA 2F23A 4MVUA 4B3SB 3BABA 5CA1A 2Q7HA 1FXKC 4Q20A 5H2FZ 5KHHA 4DV6B 4LF6B 5LMUB 3JD0A 1HNXB 4WFFA 1FXKA 4I5SA 1XMOO 3ZHRA 3OM3B 4BIUA 1VF6C 4MTFA 1JJ2U 3ABMB 2UXNA 3RWRD 3LDCA 3FYEB 1K5SA 5IJ0A 4NKGB 3UO3A 1ORQC 1NKDA 4X20A 3HKBA 2JJ1G 2YIBD 2CH7B 3K57A 3ASOC 1F4NA 4DYLA 1ENVA 2DOSA 1R73A 1R6NA 2RMKB 1Q5OA 3L73H 4UB8Z 4I55B 4LF8O 3JAWB 3HKCB 4DV1O 3ASNC 1X59A 4OX9B 1YDXA 3RYIA 1KC8W 1LR1A 2ZDIA 3AG1C 4DV0B 3W7SA 1JR9A 1Q81W 3QG5A 4UCOA 4U7NA 4LFCO 1W59A 5J2TB 4J7KA 1H8EG 4FLXA 4UCTA 4DRXA 2R72A 1XL4A 1CPYA 1TGOA 4JI5O 3CRMA 4DV2O 4ASUG 1KB9F 2IU0A 3SPHA 3TK1A 3SPCA 2ATKC 1YI2V 5B1BB 1UJWB 3CPWU 2P4KA 4J9YB 2WPDG 4N23A 3CC4V 4MVOA 1VQ9V 1SQBH 3A2FA 4UXNA 4YJ2A 3JD3A 4WF9V 4JF3A 2BOCC 1HWYA 2QWQB 4JASA 3SJCC 1N34O 2EIKB 3CS5A 1SQVH 4LR3A 5FPRA 1VIBA 3THOA 1M1KW 3CYOA 4X1YB 5LP6C 4J80A 2Q4PA 5IE9A 4L8JA 2W6IG 3CCLV 1KQSU 3OGIB 2AW9A 4PDLA 3E35A 4BWAA 4X62B 4NTYA 5L3FA 5H9CA 5LP6A 4I9QA 1NR1A 3N2KA 4IHJB 4MT8A 2EIJB 2EX3A 4O2AB 2DYRC 4DXWA 4LF9B 1WB8A 4J7ZA 4DO2A 4FK5C 4YHHB 3EVKA 1KUQA 2B5UA 4C7UA 5IT9N 2OCHA 3G71V 1DF5A 5JVDA 2IJKA 2BTQB 5JCOA 2A0LA 3U11A 3SJBC 2HKOA 1YIJV 1QCEA 4CH6A 3A0HZ 1P4RA 1W2BU 1OCZB 2N04A 2EILB 5L3EA 4LP8A 2OTLV 2UUAB 4OPHA 1H2SB 1PNLA 4LF4B 4PA3A 5JQGB 2IH3C 3IFXA 1YXBA 4KFMA 1HDJA 4B3TO 4BIOA 1Q3EA 2OWOA 4F6EA 2GUZA 3JCZA 4IIJA 4B7KA 4LF5O 4JAVA 4MW8A 2HG5C 1CEZA 2CDYA 3WG7B 5BMVB 3B8NA 3ZN0A 5HFMA 2VQFB 3VQXA 2JK5C 1TAEA 1I7FA 3G80A 4MVQA 1JOYA 4PJ0Z 1L0NH 3U0ZA 3CE2A 4MS2A 3B77A 5BZBA 1QNMA 3RYCA 3K58A 2P67A 3FYIB 4N21A 3JAMN 2WSSG 1S77D 4JYYA 2XTAA 4R50A 1YSCA 1OJHA 2WLHA 3J81N 2VS0A 4HAMA 1VF5B 2DWEC 1FKAO 1XMOB 4AQYB 2DE0X 3K06A 1SKVA 3ZMSA 2GDSA 4JYAB 1JA8A 3WB1A 5IWAO 2Y0IA 3CCJV 2ZINA 5LXTB 1FPOA 2QTOA 3BVOA 3W7XA 3ICXA 1V55C 2ETNA 4QGPA 5EYPA 2DYSC 1NVPB 4X1IB 3CCSV 4FFKA 2AXTZ 1S72V 3U10A 5LYJB 4GZRB 5BY1A 4LF8B 4DV1B 2F1MA 4H0LB 4MVMA 4DV7O 3RBZA 3RYHB 4GCZA 4O2BB 2Q0OC 4TUYB 5DEDA 3OAAG 5CA3A 3JYCA 2PI4A 3TXSA 3A8TA 4LFCB 5KX5A 4X9QA 4FM2A 2BE3A 4FLYA 4JI5B 1XMQO 2ZXWC 1N8RW 1CXZB 4P9OA 4DV2B 4PI0A 1AI5A 2A3QA 3EHBB 2LO1A 5EK0A 4GT1A 3H1HH 3K0DA 1IDSA 3ZN1A 1YJNV 3E83A 4GKJO 4JI8B 1GM7A 1VQ4V 2OCCB 3ZX6A 3STLC 4IGGA 3L72H 1SQGA 1TVKB 1N34B 3ZRXA 5JWPA 1PM9A 1RPOA 2YIBA 3DTUB 4F6RA 1S0VA 1OCCC 2HR3A 5CB4B 4MTXA 2BCCH 2JGDA 4D7SA 4EEQA 3IC9A 1Q6UA 3O9OA 2ZR3A 1AVMA 5LMNO 5C8YB 4J11A 4NTXA 4UFZA 2P6JA 4UV9A 2UXBO 1AJPA 2ZIOA 1Q82W 1HR0O 3OMAB 2AZ2A 3C3TA 3H1LH 1P7GA 2Q7EA 3T4DA 2DWDC 3E8BA 2DQ0A 1H2GA 2KG7A 3ABUA 1SF9A 2XUMA 3A0RA 4WFEA 3S3XA 1Q86W 1RM1B 2PZSA 2EZPA 5FPOA 5B1AB 1SQFA 1DK1A 4E2LA 5L3BA 3T1CA 2OTJV 4R8CA 1V9PA 3L75H 3D36A 1NZ6A 3MHSC 5KAFZ 1G8MA 4EKWA 3CRAA 4PDMA 4MVZA 4LF7O 5IYBO 2XASA 4IYHA 1Q6IA 3HKEB 2EINB 2E5LO 4U3JA 4B3TB 3JAKA 1Y74B 1GRJA 1OCRC 4LF5B 3CX5F 3RN4A 3I55V 3DC5A 4JAAA 5FL7G 1VQLV 2ARHA 5GW7A 5LOVB 3ZRWA 3NXSA 4TQFA 1HP8A 1URFA 5B3SC 3HKDB 4UVBA 2ZM6O 1JJOA 4JI6O 4CZZA 1Y66A 1TUEB 2A7WA 2DW4A 2JS3A 1IXBA 1LNQA 5CA0A 3JCUZ 1WA8A 4ZOLA 5IJ9B 2V4DA 4H44B 2Y69C 1SERA 1PL4A 3LSSA 2CE4A 3OMIB 5JH7B 4YIOA 3SDLA 4WCEV 3BCCH 3VQYA 1V54C 3CEIA 3BPZA 4PV1B 5BR8O 5IWAB 1SQPH 1YF2A 1PNMA 4HBNA 3OD4A 4JI3O 1NTMH 3FB5C 2ZT9B 4I4TB 4QPKA 2CK3G 5IYDO 1N36O 1BL8A 1JMKC 1XL6A 3ZHUA 3WFVA 2ZNJA 1AB3A 5A2QN 4ZHQA 1ZAUA 1AJQA 5GTIZ 3CP1A 4KL1A 2KB1A 2WLIB 1QHTA 2YSUB 1MZFA 4TOIA 2Q68A 5GONA 1J95A 3SYPA 4DV7B 3H01A 5LHHA 3UT5B 1K73W 1QLNA 3HB3B 1NTZH 2JGUA 4JZ2A 3JATA 4TSFG 2YXHA 3CRQA 3OUFA 1SETA 4TV9B 5IYZA 2BSKB 4BIZA 2F95B 4NXMO 4J41A 4OPAA 2L6LA 2NR5A 4PI2A 2IM9A 1FFXA 1MOFA 3M7MX 4MSWC 3TETA 4GKJB 5KMGA 2Y48A 1N32O 2F4VO 1SQXH 1US6A 1H38A 5JJJB 4DV5O 1VQMV 2W0FC 2QDOA 1D2DA 1TUBA 4J10A 1SZXA 3Q4HA 4O4IA 2H94A 3JALB 1SA0A 4GX0A 4JYCA 1M93A 1M5IA 2BTOA 1M56B 1N0JA 1Q43A 4JV5O 2VWKA 5LMNB 3A0BZ 1Y6XA 3QO5A 3MAQA 3QF7A 1ZLZA 4UVCA 4LH7A 2LGQA 2UXBB 4P9PA 4UCVA 1HR0B 3JARA 4PD4F 2LQTA 3G6EV 4MTGA 4FFBB 2UXCO 1ZL8A 4HYOA 1AR5A 1YTFB 3UKMA 4UUJC 2LFRA 1DTOA 1J5EO 5IY5B 4XDLA 4RQFA 1PP9H 3HR0A 3T1HO 3CSXA 5FNVA 5ITZA 4Z1VA 4OGQB 1B06A 1TA8A 1NH2D 4EFBA 1LUWA 5EBWC 2ZDIC 4DR5O 2E5LB 1QLEB 1UPGA 3FX7A 4HZ3A 1ZTEA 2KKWA 4QNHB 5LXTA 5KUKA 4W4KA 1YITV 1IZ3A 3CMEV 2ZE5A 1FJGO 3OTOO 1DGSA 2ITDC 3K59A 4RQEA 1GH6A 1JX9A 1FAFA 4KXRA 1I0HA 2ZM6B 1FYJA 1GKFA 1VQ6V 1MNGA 1WJZA 4JI6B 3SYAA 1VQPV 1F23A 3LUTB 3FAVB 3X2QC 2E74B 2JJ2G 4CH3A 1WPXA 1K4DC 2CTRA 3BA8A 5EIBC 4BR6A 3K5MA 1I94O 4X66O 5KHKA 4TUYA 2QEXV 3DXRA 4ZI7A 2OYQA 5KHIA 2FTKA 1GM8A 1S5LZ 1RSOA 3G6BA 1IURA 4H37A 2CGNA 2Y69B 5B66Z 5J9PC 5BR8B 1OCOC 4JTCB 2XAJA 3K5OA 1DLBA 4RAIA 4JI3B 1WN7A 1GO3F 4CC6A 1G4YB 4DR2O 4NR1A 4R7CA 1N36B 2R9RB 3IC7A 3L74H 4FVMA 1G1XB 4LNUA 4WBNB 3RYFB 1ZSPA 4TV8A 3WB0A 3ABLB 1I5XA 2R9AA 4O4LA 4QE9A 1I08A 2F43G 2XAFA 2YEVA 1NR7A 5JCOC 3PJSK 4GKKO 3CMAV 1YJ9V 5CMUA 4U3FH 1L8DA 5LHIA 3IJ4A 3AG2C 4ICGA 1EBOA 5D5PA 3ZRVA 2IJIA 3AK3A 3ABKB 3L71H 5EBMC 2ZKOA 1D5NA 5CBHA 4X1KB 1COWG 3EFFK 4NXMB 4YJ3A 3AK1A 3LDDA 5KA6A 4Q6GA 1MA1A 3L70H 3QVNA 4QIWF 4NVPA 2QWRB 5AG2A 4DUYO 2W0XA 1NQTA 1N32B 2F4VB 1IX9A 1JFFA 4DV5B 3OW2U 4DR4O 1EZJA 1QR9A 5EZYB 4JI7O 2ZQMA 3JASA 1M4UA 3AG4C 1K9MW 3LNNA 1SRYA 4HNAA 4I0XA 4J7JA 2YXLA 3CJHA 5KHJA 1BHAA 4DR7O 4H13B 1BE3H 3AG3B 2WLLA 2Q9LA 4JV5B 2Y4TA 4K3AA 3RW0A 3H9VA 3CCRV 3ZMTA 3CCQV 2X6BA 2XAQA 5CA1B 3RVYA 1NI8A 4A5UB 3BRCA 2VQEO 1THZA 1AI4A 2UXCB 2Z3YA 4K8ZA 2WLNA 3K5NA 1VP7A 3R65A 3M8AA 2UUBO 1AP5A 5IDJA 1FXKB 4KHPO 1R3IC 4RUEA 1J5EB 4X8AA 4G28B 2CTQA 3T1HB 4FLWA 4DUZO 5KUMA 2EIMC 5IJ0B 3CB2A 5H5NA 3ETEA 3OTFA 4X20B 3SYOA 3HKBB 2K9PA 2EULA 3ZRSA 3H1IH 2RNBA 2OIEA 4JTDB 4LC1A 2PYLA 4DR5B 2VRZA 3E8GA 1KMIZ 3E86A 2HP8A 3B09A 1XREA 3ASOB 3RYIB 2PF4E 4DK0A 1H2LA 4RO2A 5B1OA 1QVFU 2ODMA 2JS5A 4PA6A 1K7DA 1FJGB 5B5EZ 3OTOB 4JI2O 1RPRA 3G4SV 4I50B 3ASNB 2N05A 3AG1B 3DC6A 4GYCB 4DRXB 4EB6A 4L87A 1WB7A 1B04A 3ETGA 2EBOA 3ML0A 1NJIW 2QKCA 4O4HA 3UT5A 1I94B 4X66B 2YIAA 2A9HA 4LWSA 1YJWV 4YJ2B 3LSQA 3OFNG 1KP3A 2YUAA 2WAMA 1L1FA 4MVRA 3KCXA 1M57C 2EJRA 4TV9A 3CRRA 2Q6AA 1F4MA 4F4LA 3FB7C 4B3RO 3SGIA 2WLJA 4DR2B 2IJHA 1E79G 4WFGA 1M9NA 2CGOA 2LW1A 1MZEA 4GX2A 1P7BA 4JGSA 5LP6B 3N2KB 5A9GA 1K3EA 2QM7A 3JD4A 4BW9A 2KQXA 1GN4A 3ZHQA 5LA6B 2Q5ZA 3E22A 1NVPD 3MD0A 2AHZA 3D3QA 2YDEA 4GKKB 3S3WA 2ZE6A 4PDRA 1S76D 1PKXA 2V1DA 2JEUA 3FB8C 5E79Z 4O4JA 5JVDB 2JRIA 2N74A 2DYRB 3D36C 1EZVH 3SYCA 2GTSA 4DV3O 2QM4A 1NTKH 1AP6A 1GN3A 2M6YA 1R6KA 2AZ0A 3ZIAG 4CS2A 2DJVA 4FM1A 3LNMB 3ABMC 2ZIMA 4P30A 4DUYB 3CD6V 5TISZ 2Q67A 1IVSA 2UXDO 3K9SA 2QTSA 3MDSA 3N2GB 4DR4B 3ZEDA 2RCVA 4CC5A 4JI4O 2GUZB 2YXYA 2L35A 3SJQC 1O9HA 2Z5UA 3K08A 4K35A 1Z2GA 3G67A 4FMTA 4DR7B 4DV4O 1Z5VA 1BSMA 3CXCU 4MTOA 2CH7A 1AR4A 1KYOF 5K1PA 2LJ2A 1GN2A 1EN6A 3ZMZA 1IBMO 1JQ0A 1Y76B 3RYCB 5L3DA 2HFEC 4I55A 3JAWA 4LFAO 3HKCA 1KBHA 2VQEB 4RUFA 4B3MO 2ZR2A 3OEEG 3OR6C 2D2CB 3QTCA 2X0LA 3PN1A 4XBFA 2E75B 3OUSA 2UUBB 4X88A 1XBLA 1CP9A 4MVSA 3UQ8A 1IXMA 1PL0A 5J2TA 3GB7C 2UUCO 5B1BC 1R3LC 3LDEA 3VQWA 1H2MA 2ZE8A 4DUZB 3IGAC 3R66A 2WLMA 4QPJA 1OHHG 2HVKC 4I7ZB 4FPPA 5EYPB 2EIKC 3CHXA 2WA3A 2QWNB 2V7QG 4OXSA 1VQ5V 3E2EA 2Z0AA 3K9AA 1QQCA 1V55B 3W7UA 2PUSA 2DYSB 1WAZA 3HPLC 4UCRA 2QM8A 4X1YA 3CC7V 3OR7C 4TQDA 2P90A 4TWKA 1XQ8A 4JI2B 1FXHA 2B1GA 2OT5A 2ILMA 2EIJC 4GLXA 1XILA 1AR1B 3SPGA 3E8FA 2GBOA 1Z5WA 4AI8A 2UU9O 4JZGA 4X64O 3TXQA 1XMQB 2HLDG 1P84F 4IHJA 1XDCA 4O2AA 3TGUH 2BOBC 4NB5A 4JI1O 2R9IA 1BCCH 3ETQA 1ZUQA 3P3PA 2B9ZA 3P32A 2ZXWB 3K3WA 2LFSA 4NXNO 2EILC 1VMGA 2BTQA 1NS1A 5LGUA 4YIPA 2YI8A 2CTPA 4UB6Z 1BT8A 4F6RB 1HNZO 1WP7A 3ZBHA 2NNUA 2JGDB 4B3RB 1BGYH 5CBFA 2PI5A 4B08A 1MSDA 4IT5A 1OCCB 1VQ8V 5JQGA 5DM6V 3M99B 1FD9A 1W0JG 4CH4A 5B1NA 1Q6HA 3WG7C 3GWKC 1MSWD 1B3QA 2HHHO 1R3JC 2WWWA 3APOA 3L9DA 1KP2A 4YXWG 1N33O 1FFTB 2RJZA 1LUVA 3B40A 2FYUH 5J2UB 5BMVA 1ZX3A 4DW0A 3MHHC 4G27B 3OEHG 3ZHSA 5LHGA 4X65O 4DV3B 1ZWIC 3FKSG 2Y0PA 2P06A 2FMLA 1HNWO 3BFRA 1KD1W 3OE7G 4ZBMA 4LF7B 1VQ7V 4AQYO 2UXDB 2JIZG 4U3JB 2M7WA 3JAKB 3KKYA 2YS8A 4JI4B 1L0LH 5LGNA 2EZOA 4JYAO 5L3CA 3CRCA 2XOKG 1N0NA 2QJ1A 4DK1A 2QKSA 1JVMA 2Q8VA 3ZRWB 3T2MA 4W4LA 1VF6A 5JJNB 4DV4B 3K03A 3DSQA 5C93A 1UFIA 1OCRB 5FLXN 3OT7A 1VARA 2H8PC 2DMXA 1GMGA 1HW7A 4X1IA 4JAUA 2IW5A 3TJTA 2RN9A 1IBMB 5LYJA 3CWBH 1KU9A 5B3SB 1XHZA 2JEXA 2P7TC 4LFAB 5CA0B 1Q7YW 2LGWA 4B3MB 4ZKIA 5KAIZ 3FD9A 3KG2A 2P22C 1EN5A 3NR7A 1IBKO 3CC2V 3RYHA 1WLEA 1WA8B 4ZOLB 3J7AU 1JPXA 1OV9A 4O2BA 4I50A 1K34A 2HEPA 4UCSA 2Q0AA 3AG7A 4KUMA 4XDKA 2UUCB 4WFBV 2G38A 1I5YA 3H1JH 3N27A 1YTFD 4YY3O 3GWOA 1BS3A 2YIDA 1X4TA 5GTHZ 2MW2B 1QR8A 2OCCC 2PTMA 4PA4A 2YI9A 2X6AA 2C2AA 5F2VO 2JVDA 1V54B 2QE7G 5IYCO 1SESA 1K8AW 2UXXA 4JI8O 4JPRA 4WFAV 4ZHQB 2VWJA 1K5QA 1BMFG 2IBZH 3JSNA 3SR2C 5LL6Y 1TVKA 1WPBA 2WLKA 1EM1A 3FB6C 4JTAB 5GONB 3ZMVA 5EC2C 4K0KO 2GTAA 4GX5A 3E8HA 4D7TA 2JDIG 5CB4A 4J9ZB 1Q8IA 1B6QA 2QWPB 2K1EA 3JATB 1KKCA 2LW7A 1QU7A 5C8YA 5IYZB 2GSMB 2UU9B 1YVWA 2KSDA 4X64B 5LA6A 2HJFC 4I9WA 4JI1B 1FFXB 4Z1MG 1RM1C 1XI1A 1P49A 2HVJC 5B1AC 1MG1A 1AI6A 1NT2B 4U7OA 4MW3A 5BXZA 5KMGB 1S5HC 4XDJA 4NXNB 3W7TA 3F7YC 3SJAC 2Q7GA 1TUBB 1S3JA 1AROP 1PD3A 4IYIA 1GTOA 3Q4HB 3BEHA 4GX1A 4O4IB 1HNZB 1VQKV 1SC5B 3K5LA 1KKDA 1BQZA 4CS4A 1IBLO 2EINC 1SA0B 2QGNA 4FZ1A 5L3GA 2WA4A 1EN4A 1GN6A 3H1KH 2ZNIA 1AI7A 4P2ZA 5DN6G 2P4VA 3HKEA 3N2GA 3ZJZA 4X89A 2HHHB 5EC1C 2GV9A 3JARB 4H33A 1Y74A 1N33B 2HJDA 3RT3C 1ZL8B 4LFBO 1PV0A 1WNSA 5CN0A 5LOVA 2E76B 1YEWA
chains in the Genus database with same CATH topology
4NTYA 4NTXA 3S3XA 2QTSA 4FZ1A 3S3WA 2L35A 4NTWA 3IJ4A 4NYKA 1WP7A 4FZ0A 2FB5A 3N27A 1WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTY A;  4NTX A;  3S3X A;  2QTS A;  4FZ1 A;  3S3W A;  2L35 A;  4NTW A;  3IJ4 A;  4NYK A;  1WP7 A;  4FZ0 A;  2FB5 A;  3N27 A;  1WP8 A; 
#chains in the Genus database with same CATH topology
 4FM0 A;  1GM9 A;  2YIC A;  1DF4 A;  3FFQ A;  3HKD A;  1FS0 G;  5H6Q A;  1GAX A;  4X65 B;  1Y76 A;  5FNV B;  5ITZ B;  1Y67 A;  1E1R G;  3BA9 A;  2E3C A;  2MK3 A;  4PHZ A;  2DQ3 A;  1H2K A;  4NYK A;  2A79 B;  1HNW B;  2CAZ C;  4NTW A;  5IJ9 A;  3B2E E;  3KCY A;  2QA4 V;  4PEL A;  2XAH A;  4CBC A;  2FB5 A;  5JH7 A;  3UM7 A;  1M90 W;  3B4S A;  2Y4U A;  1R3K C;  3RVZ A;  3K79 A;  3T1Y O;  4EFE A;  1WP8 A;  1Q90 D;  1XUQ A;  3SPI A;  2PYJ A;  2PY5 A;  5E1A C;  4I4T A;  2AGA A;  3T4Z A;  2B1I A;  3APQ A;  5CBG A;  1F7Y A;  1K4C C;  3P30 A;  1PPJ H;  4DR6 O;  3SPJ A;  2WLI A;  4AIL C;  1XNQ O;  2F93 B;  1BZK A;  1IBK B;  1D5A A;  1SQQ H;  1K33 A;  3ZHV A;  1XNR O;  1YCI A;  1JCH A;  3DXR B;  3OGC C;  3VBB A;  4PDV A;  3X2Q B;  4ZI7 B;  5EBL C;  1SS3 A;  1RSO B;  1U97 A;  4FLZ A;  4JI0 O;  4DR1 O;  4YY3 B;  2PGG A;  3QO8 A;  1VQN V;  2RDC A;  2BSK A;  2XAG A;  3STZ C;  4GUN A;  3EXA A;  2ZCE A;  1OCO B;  4LNU B;  3JD1 A;  2ZD9 A;  3CCV V;  4TV8 B;  4J42 A;  2XHB A;  3ZCC A;  1MMM A;  3ZS8 C;  1Y4M A;  1R6T A;  1U96 A;  4O4L B;  1E1Q G;  1A32 A;  2YEV B;  3RFR A;  1M56 C;  1NBM G;  4K0K B;  3ABT A;  3JAL A;  4UV8 A;  3OMN B;  3WB2 A;  4CH5 A;  4DR3 O;  3D3I A;  3SYQ A;  4ABM A;  2Q69 A;  2YC0 A;  3JSL A;  1W0K G;  2XT9 A;  1K92 A;  4BW5 A;  4B3S O;  3DGE A;  3KZI Z;  4YJ3 B;  3AG2 B;  3UO2 A;  5KHG A;  1XOU A;  4DV6 O;  4FFB A;  1BQ0 A;  4LF6 O;  3BAA A;  2GHY A;  1H8H G;  5IY5 C;  5J2U A;  4KP4 A;  4BAY A;  3ZHT A;  4LCU C;  4UVA A;  5LMU O;  1JFF B;  2QSA A;  1HNX O;  2X7R B;  5D5Q A;  2F66 C;  4TT3 G;  3RGB A;  3JAS B;  3F5W C;  4IIJ B;  4JI7 B;  1RFY A;  1G6U A;  2NLJ C;  2ADQ B;  1VEW A;  4LBE C;  2QR4 A;  5EIB D;  4HNA B;  4I0X B;  1IBL B;  3CJH B;  2FKX A;  5LGT A;  2NN4 A;  1QLE C;  1BHB A;  3BHP A;  2P5O A;  2WLL B;  3AK2 A;  4AHC A;  3AG4 B;  4FZ0 A;  4PA9 A;  4E4E A;  3QO7 A;  3JD2 A;  3WU2 Z;  4OX9 O;  4FIP C;  4LFB B;  4LH6 A;  1SZT A;  3ZMU A;  4DV0 O;  3W7W A;  2IU3 A;  2H3O A;  1F51 A;  3CCM V;  2R70 A;  3IAY A;  1RP3 B;  2AHY A;  1XHX A;  3QNE A;  4UCU A;  4KHP B;  2Q73 A;  4IL6 Z;  5JJE B;  1MAB G;  5HFL A;  4FLT A;  3K04 A;  3FAV A;  1XEQ A;  1H2N A;  2QKA A;  1N4C A;  2OIG A;  3O65 A;  4Z2W A;  1OZ0 A;  3C90 A;  2EIM B;  3F7V C;  5DEC A;  1KEC A;  2A06 H;  3C3S A;  4FJC C;  4FLU A;  1AJN A;  4JYB A;  1R1B A;  4DW1 A;  4FLV A;  3T1Y B;  2W6J G;  3LSU A;  1FXV A;  2XND G;  3ABL C;  3K0G A;  3I5D A;  5KX5 B;  2RQ6 A;  2ADP A;  4X62 O;  3VQV A;  2CUG A;  2FL4 A;  2D3O W;  2LP7 A;  4WBN A;  3RYF A;  5K1X A;  4G2K A;  4EB6 B;  1YZB A;  1ROP A;  5LBQ A;  4DR6 B;  2QWO B;  1T5E A;  4D6T H;  1XNQ B;  1GK9 A;  4WFH A;  4O4H B;  4LF9 O;  3CCE V;  3ABK C;  4YHH O;  4LWS B;  3CXH F;  1XNR B;  1EFR G;  2IJJ A;  4K8X A;  3TCU A;  1OCZ C;  1VQO V;  4PA7 A;  2DN9 A;  4JI0 B;  4DR1 B;  3I56 V;  1QBZ A;  3GVM A;  4CS3 A;  1NH2 B;  2O57 A;  3B8M A;  4QE7 A;  1K97 A;  2ITC C;  4X1K A;  3AEI A;  3UCS C;  5KA5 A;  3VOU A;  3F5T A;  2IH1 C;  2UUA O;  1M57 B;  1O9G A;  4LF4 O;  1AIL A;  5KLV H;  3D8C A;  3BY6 A;  1QVG U;  3P3N A;  1YHQ V;  5EZY A;  3E22 B;  1VF7 A;  3AG3 C;  2EJ7 A;  1S5J A;  3J80 N;  2CTW A;  3ETD A;  3CCU V;  1PNK A;  4O4J B;  2KG7 B;  2ZE7 A;  2VQF O;  4DR3 B;  4R6Z A;  3E89 A;  4RWU A;  1NU1 H;  5H6R A;  4ZIB A;  4QJF B;  4B7E A;  2X6C A;  2F23 A;  4MVU A;  4B3S B;  3BAB A;  5CA1 A;  2Q7H A;  1FXK C;  4Q20 A;  5H2F Z;  5KHH A;  4DV6 B;  4LF6 B;  5LMU B;  3JD0 A;  1HNX B;  4WFF A;  1FXK A;  4I5S A;  1XMO O;  3ZHR A;  3OM3 B;  4BIU A;  1VF6 C;  4MTF A;  1JJ2 U;  3ABM B;  2UXN A;  3RWR D;  3LDC A;  3FYE B;  1K5S A;  5IJ0 A;  4NKG B;  3UO3 A;  1ORQ C;  1NKD A;  4X20 A;  3HKB A;  2JJ1 G;  2YIB D;  2CH7 B;  3K57 A;  3ASO C;  1F4N A;  4DYL A;  1ENV A;  2DOS A;  1R73 A;  1R6N A;  2RMK B;  1Q5O A;  3L73 H;  4UB8 Z;  4I55 B;  4LF8 O;  3JAW B;  3HKC B;  4DV1 O;  3ASN C;  1X59 A;  4OX9 B;  1YDX A;  3RYI A;  1KC8 W;  1LR1 A;  2ZDI A;  3AG1 C;  4DV0 B;  3W7S A;  1JR9 A;  1Q81 W;  3QG5 A;  4UCO A;  4U7N A;  4LFC O;  1W59 A;  5J2T B;  4J7K A;  1H8E G;  4FLX A;  4UCT A;  4DRX A;  2R72 A;  1XL4 A;  1CPY A;  1TGO A;  4JI5 O;  3CRM A;  4DV2 O;  4ASU G;  1KB9 F;  2IU0 A;  3SPH A;  3TK1 A;  3SPC A;  2ATK C;  1YI2 V;  5B1B B;  1UJW B;  3CPW U;  2P4K A;  4J9Y B;  2WPD G;  4N23 A;  3CC4 V;  4MVO A;  1VQ9 V;  1SQB H;  3A2F A;  4UXN A;  4YJ2 A;  3JD3 A;  4WF9 V;  4JF3 A;  2BOC C;  1HWY A;  2QWQ B;  4JAS A;  3SJC C;  1N34 O;  2EIK B;  3CS5 A;  1SQV H;  4LR3 A;  5FPR A;  1VIB A;  3THO A;  1M1K W;  3CYO A;  4X1Y B;  5LP6 C;  4J80 A;  2Q4P A;  5IE9 A;  4L8J A;  2W6I G;  3CCL V;  1KQS U;  3OGI B;  2AW9 A;  4PDL A;  3E35 A;  4BWA A;  4X62 B;  4NTY A;  5L3F A;  5H9C A;  5LP6 A;  4I9Q A;  1NR1 A;  3N2K A;  4IHJ B;  4MT8 A;  2EIJ B;  2EX3 A;  4O2A B;  2DYR C;  4DXW A;  4LF9 B;  1WB8 A;  4J7Z A;  4DO2 A;  4FK5 C;  4YHH B;  3EVK A;  1KUQ A;  2B5U A;  4C7U A;  5IT9 N;  2OCH A;  3G71 V;  1DF5 A;  5JVD A;  2IJK A;  2BTQ B;  5JCO A;  2A0L A;  3U11 A;  3SJB C;  2HKO A;  1YIJ V;  1QCE A;  4CH6 A;  3A0H Z;  1P4R A;  1W2B U;  1OCZ B;  2N04 A;  2EIL B;  5L3E A;  4LP8 A;  2OTL V;  2UUA B;  4OPH A;  1H2S B;  1PNL A;  4LF4 B;  4PA3 A;  5JQG B;  2IH3 C;  3IFX A;  1YXB A;  4KFM A;  1HDJ A;  4B3T O;  4BIO A;  1Q3E A;  2OWO A;  4F6E A;  2GUZ A;  3JCZ A;  4IIJ A;  4B7K A;  4LF5 O;  4JAV A;  4MW8 A;  2HG5 C;  1CEZ A;  2CDY A;  3WG7 B;  5BMV B;  3B8N A;  3ZN0 A;  5HFM A;  2VQF B;  3VQX A;  2JK5 C;  1TAE A;  1I7F A;  3G80 A;  4MVQ A;  1JOY A;  4PJ0 Z;  1L0N H;  3U0Z A;  3CE2 A;  4MS2 A;  3B77 A;  5BZB A;  1QNM A;  3RYC A;  3K58 A;  2P67 A;  3FYI B;  4N21 A;  3JAM N;  2WSS G;  1S77 D;  4JYY A;  2XTA A;  4R50 A;  1YSC A;  1OJH A;  2WLH A;  3J81 N;  2VS0 A;  4HAM A;  1VF5 B;  2DWE C;  1FKA O;  1XMO B;  4AQY B;  2DE0 X;  3K06 A;  1SKV A;  3ZMS A;  2GDS A;  4JYA B;  1JA8 A;  3WB1 A;  5IWA O;  2Y0I A;  3CCJ V;  2ZIN A;  5LXT B;  1FPO A;  2QTO A;  3BVO A;  3W7X A;  3ICX A;  1V55 C;  2ETN A;  4QGP A;  5EYP A;  2DYS C;  1NVP B;  4X1I B;  3CCS V;  4FFK A;  2AXT Z;  1S72 V;  3U10 A;  5LYJ B;  4GZR B;  5BY1 A;  4LF8 B;  4DV1 B;  2F1M A;  4H0L B;  4MVM A;  4DV7 O;  3RBZ A;  3RYH B;  4GCZ A;  4O2B B;  2Q0O C;  4TUY B;  5DED A;  3OAA G;  5CA3 A;  3JYC A;  2PI4 A;  3TXS A;  3A8T A;  4LFC B;  5KX5 A;  4X9Q A;  4FM2 A;  2BE3 A;  4FLY A;  4JI5 B;  1XMQ O;  2ZXW C;  1N8R W;  1CXZ B;  4P9O A;  4DV2 B;  4PI0 A;  1AI5 A;  2A3Q A;  3EHB B;  2LO1 A;  5EK0 A;  4GT1 A;  3H1H H;  3K0D A;  1IDS A;  3ZN1 A;  1YJN V;  3E83 A;  4GKJ O;  4JI8 B;  1GM7 A;  1VQ4 V;  2OCC B;  3ZX6 A;  3STL C;  4IGG A;  3L72 H;  1SQG A;  1TVK B;  1N34 B;  3ZRX A;  5JWP A;  1PM9 A;  1RPO A;  2YIB A;  3DTU B;  4F6R A;  1S0V A;  1OCC C;  2HR3 A;  5CB4 B;  4MTX A;  2BCC H;  2JGD A;  4D7S A;  4EEQ A;  3IC9 A;  1Q6U A;  3O9O A;  2ZR3 A;  1AVM A;  5LMN O;  5C8Y B;  4J11 A;  4NTX A;  4UFZ A;  2P6J A;  4UV9 A;  2UXB O;  1AJP A;  2ZIO A;  1Q82 W;  1HR0 O;  3OMA B;  2AZ2 A;  3C3T A;  3H1L H;  1P7G A;  2Q7E A;  3T4D A;  2DWD C;  3E8B A;  2DQ0 A;  1H2G A;  2KG7 A;  3ABU A;  1SF9 A;  2XUM A;  3A0R A;  4WFE A;  3S3X A;  1Q86 W;  1RM1 B;  2PZS A;  2EZP A;  5FPO A;  5B1A B;  1SQF A;  1DK1 A;  4E2L A;  5L3B A;  3T1C A;  2OTJ V;  4R8C A;  1V9P A;  3L75 H;  3D36 A;  1NZ6 A;  3MHS C;  5KAF Z;  1G8M A;  4EKW A;  3CRA A;  4PDM A;  4MVZ A;  4LF7 O;  5IYB O;  2XAS A;  4IYH A;  1Q6I A;  3HKE B;  2EIN B;  2E5L O;  4U3J A;  4B3T B;  3JAK A;  1Y74 B;  1GRJ A;  1OCR C;  4LF5 B;  3CX5 F;  3RN4 A;  3I55 V;  3DC5 A;  4JAA A;  5FL7 G;  1VQL V;  2ARH A;  5GW7 A;  5LOV B;  3ZRW A;  3NXS A;  4TQF A;  1HP8 A;  1URF A;  5B3S C;  3HKD B;  4UVB A;  2ZM6 O;  1JJO A;  4JI6 O;  4CZZ A;  1Y66 A;  1TUE B;  2A7W A;  2DW4 A;  2JS3 A;  1IXB A;  1LNQ A;  5CA0 A;  3JCU Z;  1WA8 A;  4ZOL A;  5IJ9 B;  2V4D A;  4H44 B;  2Y69 C;  1SER A;  1PL4 A;  3LSS A;  2CE4 A;  3OMI B;  5JH7 B;  4YIO A;  3SDL A;  4WCE V;  3BCC H;  3VQY A;  1V54 C;  3CEI A;  3BPZ A;  4PV1 B;  5BR8 O;  5IWA B;  1SQP H;  1YF2 A;  1PNM A;  4HBN A;  3OD4 A;  4JI3 O;  1NTM H;  3FB5 C;  2ZT9 B;  4I4T B;  4QPK A;  2CK3 G;  5IYD O;  1N36 O;  1BL8 A;  1JMK C;  1XL6 A;  3ZHU A;  3WFV A;  2ZNJ A;  1AB3 A;  5A2Q N;  4ZHQ A;  1ZAU A;  1AJQ A;  5GTI Z;  3CP1 A;  4KL1 A;  2KB1 A;  2WLI B;  1QHT A;  2YSU B;  1MZF A;  4TOI A;  2Q68 A;  5GON A;  1J95 A;  3SYP A;  4DV7 B;  3H01 A;  5LHH A;  3UT5 B;  1K73 W;  1QLN A;  3HB3 B;  1NTZ H;  2JGU A;  4JZ2 A;  3JAT A;  4TSF G;  2YXH A;  3CRQ A;  3OUF A;  1SET A;  4TV9 B;  5IYZ A;  2BSK B;  4BIZ A;  2F95 B;  4NXM O;  4J41 A;  4OPA A;  2L6L A;  2NR5 A;  4PI2 A;  2IM9 A;  1FFX A;  1MOF A;  3M7M X;  4MSW C;  3TET A;  4GKJ B;  5KMG A;  2Y48 A;  1N32 O;  2F4V O;  1SQX H;  1US6 A;  1H38 A;  5JJJ B;  4DV5 O;  1VQM V;  2W0F C;  2QDO A;  1D2D A;  1TUB A;  4J10 A;  1SZX A;  3Q4H A;  4O4I A;  2H94 A;  3JAL B;  1SA0 A;  4GX0 A;  4JYC A;  1M93 A;  1M5I A;  2BTO A;  1M56 B;  1N0J A;  1Q43 A;  4JV5 O;  2VWK A;  5LMN B;  3A0B Z;  1Y6X A;  3QO5 A;  3MAQ A;  3QF7 A;  1ZLZ A;  4UVC A;  4LH7 A;  2LGQ A;  2UXB B;  4P9P A;  4UCV A;  1HR0 B;  3JAR A;  4PD4 F;  2LQT A;  3G6E V;  4MTG A;  4FFB B;  2UXC O;  1ZL8 A;  4HYO A;  1AR5 A;  1YTF B;  3UKM A;  4UUJ C;  2LFR A;  1DTO A;  1J5E O;  5IY5 B;  4XDL A;  4RQF A;  1PP9 H;  3HR0 A;  3T1H O;  3CSX A;  5FNV A;  5ITZ A;  4Z1V A;  4OGQ B;  1B06 A;  1TA8 A;  1NH2 D;  4EFB A;  1LUW A;  5EBW C;  2ZDI C;  4DR5 O;  2E5L B;  1QLE B;  1UPG A;  3FX7 A;  4HZ3 A;  1ZTE A;  2KKW A;  4QNH B;  5LXT A;  5KUK A;  4W4K A;  1YIT V;  1IZ3 A;  3CME V;  2ZE5 A;  1FJG O;  3OTO O;  1DGS A;  2ITD C;  3K59 A;  4RQE A;  1GH6 A;  1JX9 A;  1FAF A;  4KXR A;  1I0H A;  2ZM6 B;  1FYJ A;  1GKF A;  1VQ6 V;  1MNG A;  1WJZ A;  4JI6 B;  3SYA A;  1VQP V;  1F23 A;  3LUT B;  3FAV B;  3X2Q C;  2E74 B;  2JJ2 G;  4CH3 A;  1WPX A;  1K4D C;  2CTR A;  3BA8 A;  5EIB C;  4BR6 A;  3K5M A;  1I94 O;  4X66 O;  5KHK A;  4TUY A;  2QEX V;  3DXR A;  4ZI7 A;  2OYQ A;  5KHI A;  2FTK A;  1GM8 A;  1S5L Z;  1RSO A;  3G6B A;  1IUR A;  4H37 A;  2CGN A;  2Y69 B;  5B66 Z;  5J9P C;  5BR8 B;  1OCO C;  4JTC B;  2XAJ A;  3K5O A;  1DLB A;  4RAI A;  4JI3 B;  1WN7 A;  1GO3 F;  4CC6 A;  1G4Y B;  4DR2 O;  4NR1 A;  4R7C A;  1N36 B;  2R9R B;  3IC7 A;  3L74 H;  4FVM A;  1G1X B;  4LNU A;  4WBN B;  3RYF B;  1ZSP A;  4TV8 A;  3WB0 A;  3ABL B;  1I5X A;  2R9A A;  4O4L A;  4QE9 A;  1I08 A;  2F43 G;  2XAF A;  2YEV A;  1NR7 A;  5JCO C;  3PJS K;  4GKK O;  3CMA V;  1YJ9 V;  5CMU A;  4U3F H;  1L8D A;  5LHI A;  3IJ4 A;  3AG2 C;  4ICG A;  1EBO A;  5D5P A;  3ZRV A;  2IJI A;  3AK3 A;  3ABK B;  3L71 H;  5EBM C;  2ZKO A;  1D5N A;  5CBH A;  4X1K B;  1COW G;  3EFF K;  4NXM B;  4YJ3 A;  3AK1 A;  3LDD A;  5KA6 A;  4Q6G A;  1MA1 A;  3L70 H;  3QVN A;  4QIW F;  4NVP A;  2QWR B;  5AG2 A;  4DUY O;  2W0X A;  1NQT A;  1N32 B;  2F4V B;  1IX9 A;  1JFF A;  4DV5 B;  3OW2 U;  4DR4 O;  1EZJ A;  1QR9 A;  5EZY B;  4JI7 O;  2ZQM A;  3JAS A;  1M4U A;  3AG4 C;  1K9M W;  3LNN A;  1SRY A;  4HNA A;  4I0X A;  4J7J A;  2YXL A;  3CJH A;  5KHJ A;  1BHA A;  4DR7 O;  4H13 B;  1BE3 H;  3AG3 B;  2WLL A;  2Q9L A;  4JV5 B;  2Y4T A;  4K3A A;  3RW0 A;  3H9V A;  3CCR V;  3ZMT A;  3CCQ V;  2X6B A;  2XAQ A;  5CA1 B;  3RVY A;  1NI8 A;  4A5U B;  3BRC A;  2VQE O;  1THZ A;  1AI4 A;  2UXC B;  2Z3Y A;  4K8Z A;  2WLN A;  3K5N A;  1VP7 A;  3R65 A;  3M8A A;  2UUB O;  1AP5 A;  5IDJ A;  1FXK B;  4KHP O;  1R3I C;  4RUE A;  1J5E B;  4X8A A;  4G28 B;  2CTQ A;  3T1H B;  4FLW A;  4DUZ O;  5KUM A;  2EIM C;  5IJ0 B;  3CB2 A;  5H5N A;  3ETE A;  3OTF A;  4X20 B;  3SYO A;  3HKB B;  2K9P A;  2EUL A;  3ZRS A;  3H1I H;  2RNB A;  2OIE A;  4JTD B;  4LC1 A;  2PYL A;  4DR5 B;  2VRZ A;  3E8G A;  1KMI Z;  3E86 A;  2HP8 A;  3B09 A;  1XRE A;  3ASO B;  3RYI B;  2PF4 E;  4DK0 A;  1H2L A;  4RO2 A;  5B1O A;  1QVF U;  2ODM A;  2JS5 A;  4PA6 A;  1K7D A;  1FJG B;  5B5E Z;  3OTO B;  4JI2 O;  1RPR A;  3G4S V;  4I50 B;  3ASN B;  2N05 A;  3AG1 B;  3DC6 A;  4GYC B;  4DRX B;  4EB6 A;  4L87 A;  1WB7 A;  1B04 A;  3ETG A;  2EBO A;  3ML0 A;  1NJI W;  2QKC A;  4O4H A;  3UT5 A;  1I94 B;  4X66 B;  2YIA A;  2A9H A;  4LWS A;  1YJW V;  4YJ2 B;  3LSQ A;  3OFN G;  1KP3 A;  2YUA A;  2WAM A;  1L1F A;  4MVR A;  3KCX A;  1M57 C;  2EJR A;  4TV9 A;  3CRR A;  2Q6A A;  1F4M A;  4F4L A;  3FB7 C;  4B3R O;  3SGI A;  2WLJ A;  4DR2 B;  2IJH A;  1E79 G;  4WFG A;  1M9N A;  2CGO A;  2LW1 A;  1MZE A;  4GX2 A;  1P7B A;  4JGS A;  5LP6 B;  3N2K B;  5A9G A;  1K3E A;  2QM7 A;  3JD4 A;  4BW9 A;  2KQX A;  1GN4 A;  3ZHQ A;  5LA6 B;  2Q5Z A;  3E22 A;  1NVP D;  3MD0 A;  2AHZ A;  3D3Q A;  2YDE A;  4GKK B;  3S3W A;  2ZE6 A;  4PDR A;  1S76 D;  1PKX A;  2V1D A;  2JEU A;  3FB8 C;  5E79 Z;  4O4J A;  5JVD B;  2JRI A;  2N74 A;  2DYR B;  3D36 C;  1EZV H;  3SYC A;  2GTS A;  4DV3 O;  2QM4 A;  1NTK H;  1AP6 A;  1GN3 A;  2M6Y A;  1R6K A;  2AZ0 A;  3ZIA G;  4CS2 A;  2DJV A;  4FM1 A;  3LNM B;  3ABM C;  2ZIM A;  4P30 A;  4DUY B;  3CD6 V;  5TIS Z;  2Q67 A;  1IVS A;  2UXD O;  3K9S A;  2QTS A;  3MDS A;  3N2G B;  4DR4 B;  3ZED A;  2RCV A;  4CC5 A;  4JI4 O;  2GUZ B;  2YXY A;  2L35 A;  3SJQ C;  1O9H A;  2Z5U A;  3K08 A;  4K35 A;  1Z2G A;  3G67 A;  4FMT A;  4DR7 B;  4DV4 O;  1Z5V A;  1BSM A;  3CXC U;  4MTO A;  2CH7 A;  1AR4 A;  1KYO F;  5K1P A;  2LJ2 A;  1GN2 A;  1EN6 A;  3ZMZ A;  1IBM O;  1JQ0 A;  1Y76 B;  3RYC B;  5L3D A;  2HFE C;  4I55 A;  3JAW A;  4LFA O;  3HKC A;  1KBH A;  2VQE B;  4RUF A;  4B3M O;  2ZR2 A;  3OEE G;  3OR6 C;  2D2C B;  3QTC A;  2X0L A;  3PN1 A;  4XBF A;  2E75 B;  3OUS A;  2UUB B;  4X88 A;  1XBL A;  1CP9 A;  4MVS A;  3UQ8 A;  1IXM A;  1PL0 A;  5J2T A;  3GB7 C;  2UUC O;  5B1B C;  1R3L C;  3LDE A;  3VQW A;  1H2M A;  2ZE8 A;  4DUZ B;  3IGA C;  3R66 A;  2WLM A;  4QPJ A;  1OHH G;  2HVK C;  4I7Z B;  4FPP A;  5EYP B;  2EIK C;  3CHX A;  2WA3 A;  2QWN B;  2V7Q G;  4OXS A;  1VQ5 V;  3E2E A;  2Z0A A;  3K9A A;  1QQC A;  1V55 B;  3W7U A;  2PUS A;  2DYS B;  1WAZ A;  3HPL C;  4UCR A;  2QM8 A;  4X1Y A;  3CC7 V;  3OR7 C;  4TQD A;  2P90 A;  4TWK A;  1XQ8 A;  4JI2 B;  1FXH A;  2B1G A;  2OT5 A;  2ILM A;  2EIJ C;  4GLX A;  1XIL A;  1AR1 B;  3SPG A;  3E8F A;  2GBO A;  1Z5W A;  4AI8 A;  2UU9 O;  4JZG A;  4X64 O;  3TXQ A;  1XMQ B;  2HLD G;  1P84 F;  4IHJ A;  1XDC A;  4O2A A;  3TGU H;  2BOB C;  4NB5 A;  4JI1 O;  2R9I A;  1BCC H;  3ETQ A;  1ZUQ A;  3P3P A;  2B9Z A;  3P32 A;  2ZXW B;  3K3W A;  2LFS A;  4NXN O;  2EIL C;  1VMG A;  2BTQ A;  1NS1 A;  5LGU A;  4YIP A;  2YI8 A;  2CTP A;  4UB6 Z;  1BT8 A;  4F6R B;  1HNZ O;  1WP7 A;  3ZBH A;  2NNU A;  2JGD B;  4B3R B;  1BGY H;  5CBF A;  2PI5 A;  4B08 A;  1MSD A;  4IT5 A;  1OCC B;  1VQ8 V;  5JQG A;  5DM6 V;  3M99 B;  1FD9 A;  1W0J G;  4CH4 A;  5B1N A;  1Q6H A;  3WG7 C;  3GWK C;  1MSW D;  1B3Q A;  2HHH O;  1R3J C;  2WWW A;  3APO A;  3L9D A;  1KP2 A;  4YXW G;  1N33 O;  1FFT B;  2RJZ A;  1LUV A;  3B40 A;  2FYU H;  5J2U B;  5BMV A;  1ZX3 A;  4DW0 A;  3MHH C;  4G27 B;  3OEH G;  3ZHS A;  5LHG A;  4X65 O;  4DV3 B;  1ZWI C;  3FKS G;  2Y0P A;  2P06 A;  2FML A;  1HNW O;  3BFR A;  1KD1 W;  3OE7 G;  4ZBM A;  4LF7 B;  1VQ7 V;  4AQY O;  2UXD B;  2JIZ G;  4U3J B;  2M7W A;  3JAK B;  3KKY A;  2YS8 A;  4JI4 B;  1L0L H;  5LGN A;  2EZO A;  4JYA O;  5L3C A;  3CRC A;  2XOK G;  1N0N A;  2QJ1 A;  4DK1 A;  2QKS A;  1JVM A;  2Q8V A;  3ZRW B;  3T2M A;  4W4L A;  1VF6 A;  5JJN B;  4DV4 B;  3K03 A;  3DSQ A;  5C93 A;  1UFI A;  1OCR B;  5FLX N;  3OT7 A;  1VAR A;  2H8P C;  2DMX A;  1GMG A;  1HW7 A;  4X1I A;  4JAU A;  2IW5 A;  3TJT A;  2RN9 A;  1IBM B;  5LYJ A;  3CWB H;  1KU9 A;  5B3S B;  1XHZ A;  2JEX A;  2P7T C;  4LFA B;  5CA0 B;  1Q7Y W;  2LGW A;  4B3M B;  4ZKI A;  5KAI Z;  3FD9 A;  3KG2 A;  2P22 C;  1EN5 A;  3NR7 A;  1IBK O;  3CC2 V;  3RYH A;  1WLE A;  1WA8 B;  4ZOL B;  3J7A U;  1JPX A;  1OV9 A;  4O2B A;  4I50 A;  1K34 A;  2HEP A;  4UCS A;  2Q0A A;  3AG7 A;  4KUM A;  4XDK A;  2UUC B;  4WFB V;  2G38 A;  1I5Y A;  3H1J H;  3N27 A;  1YTF D;  4YY3 O;  3GWO A;  1BS3 A;  2YID A;  1X4T A;  5GTH Z;  2MW2 B;  1QR8 A;  2OCC C;  2PTM A;  4PA4 A;  2YI9 A;  2X6A A;  2C2A A;  5F2V O;  2JVD A;  1V54 B;  2QE7 G;  5IYC O;  1SES A;  1K8A W;  2UXX A;  4JI8 O;  4JPR A;  4WFA V;  4ZHQ B;  2VWJ A;  1K5Q A;  1BMF G;  2IBZ H;  3JSN A;  3SR2 C;  5LL6 Y;  1TVK A;  1WPB A;  2WLK A;  1EM1 A;  3FB6 C;  4JTA B;  5GON B;  3ZMV A;  5EC2 C;  4K0K O;  2GTA A;  4GX5 A;  3E8H A;  4D7T A;  2JDI G;  5CB4 A;  4J9Z B;  1Q8I A;  1B6Q A;  2QWP B;  2K1E A;  3JAT B;  1KKC A;  2LW7 A;  1QU7 A;  5C8Y A;  5IYZ B;  2GSM B;  2UU9 B;  1YVW A;  2KSD A;  4X64 B;  5LA6 A;  2HJF C;  4I9W A;  4JI1 B;  1FFX B;  4Z1M G;  1RM1 C;  1XI1 A;  1P49 A;  2HVJ C;  5B1A C;  1MG1 A;  1AI6 A;  1NT2 B;  4U7O A;  4MW3 A;  5BXZ A;  5KMG B;  1S5H C;  4XDJ A;  4NXN B;  3W7T A;  3F7Y C;  3SJA C;  2Q7G A;  1TUB B;  1S3J A;  1ARO P;  1PD3 A;  4IYI A;  1GTO A;  3Q4H B;  3BEH A;  4GX1 A;  4O4I B;  1HNZ B;  1VQK V;  1SC5 B;  3K5L A;  1KKD A;  1BQZ A;  4CS4 A;  1IBL O;  2EIN C;  1SA0 B;  2QGN A;  4FZ1 A;  5L3G A;  2WA4 A;  1EN4 A;  1GN6 A;  3H1K H;  2ZNI A;  1AI7 A;  4P2Z A;  5DN6 G;  2P4V A;  3HKE A;  3N2G A;  3ZJZ A;  4X89 A;  2HHH B;  5EC1 C;  2GV9 A;  3JAR B;  4H33 A;  1Y74 A;  1N33 B;  2HJD A;  3RT3 C;  1ZL8 B;  4LFB O;  1PV0 A;  1WNS A;  5CN0 A;  5LOV A;  2E76 B;  1YEW A; 
#chains in the Genus database with same CATH homology
 4NTY A;  4NTX A;  3S3X A;  2QTS A;  4FZ1 A;  3S3W A;  2L35 A;  4NTW A;  3IJ4 A;  4NYK A;  1WP7 A;  4FZ0 A;  2FB5 A;  3N27 A;  1WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...