1NU1H

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1nu1H00
3CXHF 1NTZH 1EZVH 1BCCH 1NTKH 1PP9H 3CX5F 1KB9F 3L72H 1NU1H 5KLVH 1P84F 3H1LH 3CWBH 2IBZH 3H1IH 3L73H 3H1HH 1L0NH 3H1KH 4U3FH 3TGUH 1BE3H 1SQXH 3BCCH 1KYOF 1SQBH 2FYUH 2BCCH 3H1JH 3L71H 1SQQH 3L74H 1BGYH 3L70H 1L0LH 1SQVH 2A06H 4D6TH 3L75H 1SQPH 1PPJH 4PD4F 1NTMH
chains in the Genus database with same CATH superfamily
3T1YB 1KMIZ 3ZHQA 3A0HZ 2GTSA 3O9OA 2YXYA 4O4LB 4MTOA 3CCMV 3RYIA 2HP8A 3H1KH 3MHHC 1I0HA 4GLXA 4P30A 3E89A 4TWKA 3RFRA 1FAFA 1SZXA 1MSWD 4HNAA 4B7EA 1R1BA 5BY1A 1SETA 4MTFA 2VQFB 3QO5A 4DR7B 2D2CB 1I94B 2UXBB 3JD4A 4JI1O 5LMNB 2QDOA 3CPWU 4XDLA 3EVKA 1BGYH 2ZM6B 4OX9B 2JS3A 4LFBB 4PDVA 1YEWA 1K4DC 2RN9A 2P4KA 3JSNA 4MVQA 2GTAA 3K57A 4JI5O 2YI9A 4K3AA 4QNHB 3HKEB 5EC2C 2YIDA 3QNEA 4MTXA 2F1MA 2ZINA 4CS4A 1NQTA 2N74A 4UCRA 2F43G 4GCZA 4YXWG 1GM9A 4GYCB 1IBMB 3E22B 2WA3A 1YTFB 3AG2B 3RVZA 4XDJA 3OTOB 3CE2A 4ZI7A 3SPHA 3OT7A 2XAJA 2LQTA 1ZWIC 4TUYA 1L8DA 3RBZA 4NXMB 3TXSA 5LP6B 4FJCC 4QPJA 3PN1A 5LHIA 4NYKA 4J41A 4MS2A 1URFA 2YIBD 1RSOB 2MW2B 1Q7YW 3FX7A 1Y67A 4YIOA 4KXRA 1N4CA 4NTYA 3ZHUA 4FPPA 4QE7A 2UXDO 4I50A 5C8YB 4O2AA 4FLUA 2DMXA 4PELA 4L8JA 3T1CA 1LUVA 1XBLA 3OGCC 2F93B 5EIBC 4JI7O 1M4UA 4NR1A 3OFNG 1MNGA 3CP1A 3SYCA 2XASA 5AG2A 2OIGA 1MG1A 3E35A 3VQWA 1ZUQA 5CB4A 3L9DA 4K8XA 2B1GA 4KHPB 3K5NA 3CXHF 2CH7B 1WP8A 4GX1A 3D8CA 2Z5UA 5DM6V 2PGGA 3JALB 1WP7A 1GH6A 1N0JA 1YXBA 3ICXA 1EN6A 4JI3B 2HJFC 2Q5ZA 4GKKO 4GX0A 1OJHA 3CCEV 1J95A 2A0LA 2E5LB 2AGAA 2CGOA 1SA0B 2RJZA 3OM3B 3F5WC 4CC5A 2NN4A 3BA9A 1E1RG 3TK1A 4R50A 2R9RB 4FFBA 4R7CA 5IE9A 1ORQC 1S5HC 2W0XA 5KA5A 2Y0IA 4YY3O 1R6KA 1AR4A 4X1KB 1JOYA 2LFSA 1I7FA 2ZXWC 5KUMA 1HNZB 4NXNB 1VEWA 3UT5B 1PP9H 1Q6UA 4LF4B 5B3SC 1RM1C 4B7KA 3ETDA 2BTQB 1K92A 1Y4MA 1KYOF 3ZX6A 1NH2B 5B66Z 3ABUA 5KAFZ 4P9PA 1B6QA 4PI0A 3LSUA 4DV7O 5BMVA 1AJQA 5HFMA 1PNLA 1GKFA 4F6RB 3F5TA 4O4IA 2QKAA 2JEXA 1OHHG 4J9ZB 2QJ1A 3WB1A 2IH3C 1YVWA 1NVPD 3CCVV 2ETNA 4QIWF 2OCHA 3CRMA 3EFFK 4DUZB 4CS2A 3P30A 1JR9A 2D3OW 2EIJB 2WAMA 4I4TA 4ZHQA 2G38A 3JD3A 1Q81W 1KKCA 3D3IA 3E8BA 3CC2V 1N32O 4LFAB 4HYOA 1GO3F 3BPZA 5CA0A 4K0KB 2JJ2G 2ZNIA 2KG7B 4U3JB 3FB5C 2ODMA 3KZIZ 3RVYA 3JATB 3K08A 1WNSA 1P49A 2B9ZA 1B06A 1JPXA 3H1JH 3SYQA 4JI1B 3SJQC 3K9SA 3WG7B 2YXHA 4RWUA 5IYCO 2ARHA 1TVKB 2W6IG 3ZMSA 2YEVB 1EBOA 1VQMV 5KMGA 4JI5B 4DW1A 2HG5C 3CC7V 3RYHB 2ATKC 4LWSA 5IJ9A 1H2NA 3BY6A 3DSQA 2BTOA 2Y69C 4QJFB 5F2VO 2WSSG 1ZL8A 3VQVA 1QR9A 1NS1A 2Y48A 3CB2A 1NBMG 4FMTA 4D7SA 3ZRWA 1KB9F 5E79Z 1MABG 4CH6A 1EN4A 3X2QC 4GT1A 4K35A 5DN6G 4X65O 2YUAA 5KA6A 2IJIA 2NNUA 4TV9B 3CC4V 4EEQA 4FLXA 3AG1B 1FJGO 2XAQA 2Y0PA 1HP8A 3JD0A 1J5EO 1DGSA 5LBQA 4B3MB 1DLBA 4IL6Z 3BAAA 4DV6O 2UXDB 3IC9A 5L3FA 2FKXA 2EIKB 2XAFA 1G4YB 2Q8VA 2ZCEA 4O4LA 1YZBA 4JI7B 1IX9A 1SF9A 3VQXA 2GUZB 1XNQO 1E1QG 4AI8A 4YHHO 2YDEA 2UXCO 1WLEA 4AHCA 3DGEA 1VF6C 4JYYA 4LF5B 1VF6A 3M7MX 2A7WA 1VQ9V 1Y6XA 5JJEB 3ZMZA 3NR7A 5LA6B 1XMQO 3CXCU 2QWNB 2HR3A 2Q7EA 4DR4B 4GKKB 4LF6O 2WLJA 1JX9A 3AK2A 1CEZA 3MDSA 3ABKB 4X20B 1FS0G 1Q6HA 2AHYA 3LNNA 2WLLB 3K3WA 1M56B 3DC6A 1N8RW 3F7YC 1VQ7V 3HKEA 4L87A 1IZ3A 3ETQA 2O57A 4DV0O 2YIAA 3ZBHA 2XAGA 4FLYA 2Q0OC 1GN4A 1UJWB 1AVMA 1QNMA 2IJHA 1PM9A 5L3BA 3IAYA 4DR6O 2HHHO 3CCSV 3CMEV 4JZ2A 4PD4F 3RYFB 4P9OA 4YY3B 3E22A 3J81N 3AG2C 4GZRB 3HKDB 4PJ0Z 1TUEB 3H9VA 1H2LA 3ZMVA 5LMUO 2JIZG 4YJ2B 2EBOA 5L3DA 4LNUB 4X66O 5B5EZ 4RO2A 1ROPA 2RDCA 2BCCH 1K9MW 5LP6C 3WFVA 5LP6A 3J80N 3CCRV 4G28B 4DV7B 4JF3A 3UQ8A 4O4HB 3BRCA 1RSOA 3HKCB 1RM1B 4DO2A 3CRRA 2HLDG 3LNMB 1BMFG 4PDLA 1AROP 4BWAA 1U96A 1YSCA 3FD9A 1B3QA 5C8YA 4DUYO 1XNRB 2DJVA 2LGQA 3EHBB 1YIJV 2P6JA 2CTWA 4B3SO 1N32B 3QO7A 2CDYA 2B1IA 4WFHA 3ZHTA 1XEQA 4DV1O 3R66A 1AI7A 2CH7A 4JZGA 3I5DA 2JEUA 2QTSA 4DR5O 3JALA 2QE7G 1X4TA 1N34O 2MK3A 3LDDA 5CA0B 4BIOA 2JRIA 5KLVH 1SA0A 4J7JA 2CE4A 3ASOB 3KG2A 1GN6A 3M99B 2N04A 4JI0O 3M8AA 4X1KA 4HBNA 2NR5A 3RW0A 5CMUA 2Y69B 4K8ZA 3UT5A 1I08A 3ZHSA 1SZTA 2K9PA 3J7AU 2H94A 3GVMA 2BTQA 3SYPA 3OEHG 1TGOA 2AZ0A 5B1OA 2VQEO 4BW9A 1HNXB 1ZSPA 2C2AA 1FJGB 1RFYA 4F6RA 2UUBO 3KCYA 3UCSC 3ZCCA 4EB6B 3W7TA 1PL0A 4WF9V 1JA8A 1XILA 3B09A 4O2BB 1PV0A 1NZ6A 5EZYB 2EIJC 2FTKA 1YF2A 4W4LA 3PJSK 1D5NA 3BVOA 5D5QA 2XNDG 4X9QA 3A0RA 2F23A 2KG7A 4ZIBA 4U3JA 2A9HA 4FFKA 3N2GB 2WPDG 2EULA 2A3QA 4NKGB 3JATA 3SR2C 1XMQB 2R9IA 3FFQA 3P3NA 2DQ0A 3TJTA 2IU3A 3WG7C 3D36C 5EC1C 2Q7HA 3D36A 2QM4A 1TVKA 2W0FC 1EFRG 1IXBA 2YEVA 1GK9A 1SESA 3RYHA 5KX5B 1OCZB 5H6QA 4CC6A 3RYCB 3OD4A 1AI5A 2ZE8A 4UB6Z 5GTHZ 4DV0B 3K9AA 4B3RO 4D6TH 5LHGA 1IBLO 1F51A 3HB3B 1HW7A 4DV2O 4DR6B 2BOBC 2IBZH 2DE0X 4E2LA 2ZE6A 1MSDA 3FYEB 3OMIB 4X66B 3L71H 2FB5A 3K5LA 2ZQMA 2P06A 3JASB 3QF7A 4O4JB 2CAZC 2KKWA 4TV9A 1YJNV 1SRYA 1GTOA 1HNWO 4CH5A 3AG1C 4WBNA 1VMGA 2PYLA 1XUQA 2LO1A 3KCXA 1PD3A 3MD0A 3G67A 4OPAA 4X1YB 1SQFA 4JI2O 3SYAA 2EIKC 1VF7A 2PI4A 3ETEA 4IHJB 4JAUA 1SC5B 5FL7G 3E2EA 2XTAA 4JYCA 4I9WA 4ASUG 1K7DA 2GUZA 1BCCH 1F4MA 1Y66A 1Q86W 5EIBD 4XBFA 4I55B 3FB8C 5J2TB 2YC0A 4LR3A 3ZRSA 2QSAA 4PV1B 4DR5B 5LA6A 4LH6A 2UUCB 1Q5OA 4W4KA 4JYAO 1IURA 5IJ0B 1N34B 1NTZH 4MVUA 3CX5F 1K97A 1TUBB 1NU1H 3B4SA 3ABKC 4X20A 1TAEA 3N2KB 1M56C 2WLLA 3AEIA 1PNKA 2B5UA 1NT2B 4LC1A 2EIMB 1BZKA 3ZMUA 1V54C 1XL4A 1XI1A 3H01A 2XUMA 1KD1W 4B3TO 1KKDA 1BSMA 2HVKC 3RYFA 3ZIAG 5CA1B 3CCLV 4D7TA 5IDJA 3HKDA 3ASNB 3HKBB 4YJ2A 2Q68A 2ZD9A 3BABA 4QPKA 4LNUA 5IYDO 5KHGA 4JTAB 3U10A 4PHZA 3B8NA 4OGQB 1G1XB 1PPJH 2QGNA 2DWEC 3LSQA 1QR8A 4O4HA 4DYLA 1IXMA 2JDIG 4LBEC 2UUBB 3HKCA 2ADPA 3K03A 4IYHA 2ZE5A 5H6RA 5E1AC 2F4VO 2BE3A 5IWAO 1AR5A 3MHSC 2VRZA 2OIEA 2YICA 3CJHB 1U97A 3B2EE 1ZAUA 1M93A 3RT3C 1FXHA 1R3LC 1F23A 3K06A 1ZX3A 3UKMA 2P4VA 5JCOC 5JCOA 3U11A 1OCOB 1BHBA 1XOUA 2BSKB 3AK3A 1G6UA 3G6EV 5A9GA 1DTOA 3CRQA 1FXKB 3DXRB 3L75H 1N33O 2JGDB 2OWOA 1CPYA 1R73A 4A5UB 3K58A 4IGGA 3S3XA 1Q90D 3IJ4A 1R6NA 4Q6GA 1BE3H 1TA8A 4H0LB 5IT9N 3ASOC 4FVMA 3ZHVA 3JYCA 5CBFA 1XMOO 4X89A 2GV9A 4FLVA 3ZS8C 1E79G 2ADQB 1VIBA 3JAMN 3FB6C 1G8MA 3FAVB 4X64O 1QVFU 4CH4A 1WAZA 1OCRB 1Q3EA 1UFIA 5B1AB 2H3OA 2ITCC 4QGPA 1H2SB 4GKJO 4CH3A 2E74B 1HNWB 1AI4A 3C90A 5CBHA 2M7WA 3TGUH 4PA9A 4EB6A 4DV3O 4TQFA 4UUJC 4O2BA 4JI2B 3JCZA 3ABLB 4WBNB 1AP6A 5GONB 5EZYA 5LGNA 4TOIA 2RMKB 4FM1A 3NXSA 1H38A 3C3SA 1JVMA 1PKXA 3K59A 4J7ZA 2EINB 3H1IH 4WFAV 1Y76B 1VARA 1W59A 2GDSA 2R9AA 4Q20A 1H2GA 1Y74A 2IH1C 3N2GA 1N0NA 4MVRA 1S3JA 5JVDB 1JMKC 1FFXB 2JGUA 3SJAC 3E8GA 4RQFA 1RPRA 4IT5A 5FPOA 1LUWA 4J11A 2K1EA 3ZHRA 5LL6Y 4PDMA 1P7BA 4JV5O 4H44B 2PZSA 1P7GA 3ZEDA 1Z5VA 2UUAO 2EZOA 4EFBA 1THZA 2IM9A 1OCZC 4F4LA 2LGWA 3OMAB 3LSSA 4HAMA 5KX5A 2YS8A 4WFEA 2ZNJA 3RYCA 1NR1A 3O65A 2M6YA 4UCVA 4BAYA 1HDJA 2ZKOA 2ILMA 2V1DA 3HR0A 1QLEB 3H1LH 4B3TB 2Q4PA 3W7WA 4PA7A 2HFEC 2CK3G 1BT8A 1V54B 2OCCB 2ZR3A 1JJ2U 1WB8A 1YTFD 2YI8A 2VQFO 2A79B 5J2UB 1BQ0A 3GWOA 1YCIA 4CZZA 3JASA 3OTFA 4O4JA 4I0XB 1CXZB 1QBZA 4FM0A 3RGBA 3C3TA 1DF5A 2ZM6O 4OX9O 2EZPA 4LFBO 5D5PA 4UFZA 4NTXA 3F7VC 2PI5A 2R72A 1V9PA 4X1YA 1SQVH 2F4VB 5IWAB 1YITV 3VQYA 5JJJB 2P22C 2DYRB 4IHJA 4FK5C 2HVJC 4KP4A 2QA4V 4ICGA 1GAXA 2F95B 3SJCC 2KSDA 1S77D 1W0JG 3AG7A 5EK0A 1IBMO 4I55A 3OEEG 4IIJB 2FYUH 5J2TA 1K73W 5DECA 1AJPA 3T4ZA 1AP5A 4DV5O 3CCQV 2QTOA 2XAHA 3APQA 1N33B 3K5MA 2AZ2A 1M9NA 1RPOA 2FL4A 3L72H 3TCUA 5IJ0A 3JD2A 2V4DA 1M1KW 4NXMO 5FNVB 1MZEA 3WB2A 1KUQA 2WLKA 1TUBA 1XQ8A 4TV8B 5JH7B 1FPOA 3N2KA 5LYJB 1K8AW 2WLIB 1S5JA 2UU9O 1GM7A 4LF8O 4UCTA 3K04A 2QR4A 1XMOB 2EIMC 4ABMA 1JJOA 2EJRA 4JTCB 1NVPB 5IY5B 4AILC 1QCEA 3SPIA 4LFCO 3ABMB 4DR2O 5CA1A 1KC8W 3ASNC 3RN4A 4X64B 3U0ZA 4FLTA 3VBBA 3HKBA 5CA3A 2PTMA 2EILC 3K5OA 1K33A 1IVSA 5B1BB 1AJNA 4JYBA 1Z5WA 4JAVA 1DK1A 2Y4UA 4N21A 2DYSB 2X0LA 4R8CA 3GB7C 5IYZB 1B04A 4IYIA 3H1HH 4CS3A 1BL8A 1EM1A 4U3FH 4ZOLB 3ZRXA 3ZN0A 1WN7A 3ZN1A 1NH2D 4MVZA 3CS5A 4J9YB 3JAWB 2E5LO 1Q6IA 1AR1B 4X65B 1KBHA 4TSFG 4WCEV 2Q9LA 4MSWC 1IDSA 2KB1A 3CJHA 5EBLC 1MOFA 3W7SA 1OCOC 1J5EB 3QTCA 3K79A 2BSKA 1OCCB 4DV6B 4UVAA 3S3WA 2KQXA 3K0GA 5L3GA 4DR1O 1R6TA 2AXTZ 4BIZA 1KP2A 1ZTEA 1L1FA 1KP3A 4LF4O 2ZIOA 1FXKC 2QEXV 2IJKA 1FXKA 5KHIA 3DXRA 1XNQB 1H8EG 4JAAA 4RAIA 3I56V 2JGDA 1EZJA 4UCSA 4YHHB 1KU9A 2UXCB 2LW7A 5J9PC 2JS5A 4P2ZA 2DQ3A 3AK1A 1LNQA 4JI6O 1K3EA 1Y74B 3AG4B 2IW5A 2VWKA 1P4RA 4JI4O 3JARB 4ZBMA 5BZBA 2UUAB 2IU0A 1XL6A 5IYBO 4UCOA 4H13B 3HPLC 1W0KG 1DF4A 2OTJV 4DUZO 4FIPC 1S76D 4LF6B 4OPHA 1X59A 1MMMA 5HFLA 5EYPB 4MW8A 3BCCH 4LFAO 5C93A 3FAVA 5ITZB 1OCRC 3EXAA 4AQYO 5B1AC 3UO2A 1SERA 4K0KO 2OYQA 4X1IB 1D2DA 2VS0A 3E83A 4JGSA 2HHHB 4MTGA 2UXNA 3I55V 3CWBH 1H2MA 1S5LZ 3T1HO 2DWDC 5LMUB 3ML0A 4PA3A 1K5QA 1JFFB 4GX2A 5CN0A 4Z1VA 4FLZA 2WWWA 4LCUC 3G4SV 2DOSA 2JJ1G 4PDRA 1VF5B 3ABLC 5JJNB 3CCJV 5LXTB 5GONA 4MVMA 5GW7A 1P84F 4UXNA 3SPCA 3JAKB 4DW0A 1VQOV 1SKVA 2Q73A 2Q7GA 2EINC 1HR0O 3K0DA 4J10A 1A32A 3Q4HA 4DUYB 4I9QA 1BHAA 1Y76A 4J7KA 4F6EA 2W6JG 4DK1A 3OE7G 1NTKH 5JVDA 4DV5B 1FFXA 4B3SB 4WFFA 2CGNA 4LF9O 4DV4O 4B08A 1M57B 2GHYA 1QU7A 4KUMA 1XREA 1KECA 4DV1B 1K34A 2V7QG 1CP9A 4UVBA 3L74H 2YSUB 1FD9A 3QO8A 3ZJZA 1GRJA 4B3MO 2UU9B 4LF8B 2YIBA 3BEHA 4NTWA 3JCUZ 1YHQV 1YI2V 3CD6V 4FZ0A 1QLEC 4LFCB 1GN2A 2HKOA 1QVGU 4G2KA 4DR2B 3LDEA 4N23A 1WA8B 2P7TC 2Q67A 4UV8A 1FFTB 5JQGA 3T2MA 2OCCC 1YDXA 4LF5O 2NLJC 1ENVA 4JI0B 1S72V 3UM7A 4CBCA 1YJ9V 3W7UA 3OUSA 1T5EA 1BS3A 5J2UA 1Q43A 3CEIA 4I0XA 1VQPV 5LGUA 2EILB 5KAIZ 4DR4O 2JK5C 4E4EA 3CMAV 1VP7A 2A06H 4OXSA 4ZKIA 5L3CA 5B1NA 4DRXB 2VQEB 2DYRC 4TQDA 1JQ0A 3CRAA 4NVPA 2R70A 5LOVB 1AB3A 3OUFA 2LP7A 2EX3A 3KKYA 1WPBA 3APOA 2VWJA 4FLWA 3L70H 1L0LH 1NR7A 4DR1B 3A8TA 4IIJA 4LH7A 2Z3YA 1NTMH 1Q8IA 3TETA 1V55B 2DN9A 4X62O 1SQGA 5DEDA 3ABTA 1FKAO 5BR8O 2QKCA 4FZ1A 4UV9A 5FNVA 1R3IC 5A2QN 2OT5A 4JI6B 1N36O 2RNBA 4TV8A 5JH7A 2ZT9B 4KL1A 1R3KC 4YJ3B 4JI4B 4H37A 5LYJA 1PL4A 2WLIA 3E8HA 4JI8O 5H5NA 1R3JC 3QG5A 2EJ7A 4I5SA 1F4NA 4BIUA 1OV9A 4DR3O 4MW3A 2JVDA 5IY5C 3CYOA 1XNRO 3L73H 3CRCA 3BFRA 2ITDC 3ABMC 3AG3B 4HZ3A 1SQQH 4EFEA 1GM8A 4FM2A 2QWRB 2P5OA 4AQYB 1NKDA 5B1BC 4B3RB 4DK0A 2PY5A 3RYIB 1IBLB 4TT3G 3SPJA 3IC7A 2DYSC 4Z1MG 4DV2B 5IYZA 1QQCA 2IJJA 2RCVA 3T1HB 1SQBH 1D5AA 4HNAB 4ZOLA 2RQ6A 1H2KA 4PA6A 3BHPA 3JAWA 2L35A 5GTIZ 1COWG 2QWQB 3P3PA 5FLXN 5L3EA 3IFXA 4RQEA 1VQLV 2H8PC 2OTLV 2L6LA 1XDCA 3ZMTA 3WU2Z 1OCCC 2LJ2A 2HEPA 4UVCA 1HR0B 4UCUA 3TXQA 1IBKO 5KHHA 2X6AA 5H2FZ 1WPXA 2BOCC 4LF9B 4DV4B 4UB8Z 4MT8A 1SQXH 2HJDA 3Q4HB 2GBOA 4J80A 1JCHA 2QM7A 1HNXO 2E3CA 2ZR2A 3AG4C 1K5SA 5KUKA 4ZI7B 5BXZA 3D3QA 4JTDB 3W7XA 1YJWV 3OR7C 3JARA 4JYAB 4TUYB 1EZVH 4LF7O 4X88A 1L0NH 3A2FA 2CTQA 1GN3A 3FYIB 1VQ5V 3BA8A 5EYPA 1VQ8V 4RUFA 2CUGA 2PF4E 3T1YO 4H33A 2AW9A 4I50B 5ITZA 1O9HA 2CTRA 4O2AB 3G80A 2XT9A 4I7ZB 2Y4TA 4R6ZA 4X1IA 1LR1A 4JPRA 1M90W 4RUEA 2X7RB 2ZE7A 3IGAC 1S0VA 5CB4B 3E86A 2XOKG 3FKSG 5EBMC 4Z2WA 5JQGB 3WB0A 3T4DA 4EKWA 1JFFA 2Z0AA 3STZC 1SQPH 4PA4A 1PNMA 4LP8A 3A0BZ 2F66C 4DR7O 1I94O 2UXBO 2LFRA 3CCUV 2ZIMA 2P90A 4BR6A 3OMNB 5LMNO 3SJBC 5LXTA 2QWPB 2AHZA 3LDCA 2Q69A 3JAKA 3CSXA 4G27B 1I5XA 1HWYA 1FXVA 4KFMA 1NI8A 4GUNA 5KHKA 5K1PA 3DC5A 2YXLA 3GWKC 5K1XA 3LUTB 1K4CC 1QLNA 4FFBB 2XHBA 3ETGA 1Q82W 4X62B 1M57C 4DXWA 5BR8B 1XHZA 5LGTA 1H8HG 3OTOO 4MVSA 2ZXWB 4BW5A 1N36B 3SPGA 5B3SB 5JWPA 3RWRD 3P32A 3SYOA 2WA4A 4JI8B 3THOA 4WFBV 1ZLZA 2QM8A 3OW2U 3FB7C 5EBWC 3JSLA 4DR3B 5BMVB 1BQZA 4O4IB 1OZ0A 5LHHA 3OGIB 4C7UA 5KHJA 2N05A 3OR6C 1NJIW 1WA8A 1UPGA 4XDKA 4U7NA 4WFGA 4I4TB 4ZHQB 2Q0AA 3SGIA 5TISZ 4J42A 2PYJA 2UUCO 1WJZA 3CHXA 3R65A 2QWOB 4X8AA 2FMLA 2E76B 1US6A 2E75B 4KHPO 2QKSA 2X6CA 5FPRA 1F7YA 1MA1A 4MVOA 4JASA 1M5IA 4QE9A 5H9CA 2PUSA 1QHTA 3MAQA 3UO3A 1VQNV 3G71V 4GKJB 4JI3O 4DRXA 1Z2GA 4NB5A 1EN5A 3B8MA 2Q6AA 2CTPA 3B40A 5LOVA 2WLHA 3JD1A 3QVNA 4DV3B 4PI2A 5KMGB 1AILA 1I5YA 4LWSB 4GX5A 5IJ9B 1SS3A 1IBKB 1AI6A 1VQ6V 1VQ4V 3SDLA 2WLNA 1W2BU 1V55C 3B77A 2X6BA 4U7OA 2LW1A 2DW4A 3STLC 1ZL8B 1GMGA 3ZRWB 4NXNO 1HNZO 3E8FA 1MZFA 3OAAG 1WB7A 2GSMB 1VQKV 1XHXA 2UXXA 4YJ3A 3G6BA 2ZDIC 3X2QB 2WLMA 2ZDIA 5CBGA 4LF7B 3VOUA 1RP3B 2P67A 4JV5B 1KQSU 1O9GA 3AG3C 3ZRVA 3DTUB 3N27A 1FYJA 4YIPA
chains in the Genus database with same CATH topology
3CXHF 1NTZH 1EZVH 1BCCH 1NTKH 1PP9H 3CX5F 1KB9F 3L72H 1NU1H 5KLVH 1P84F 3H1LH 3CWBH 2IBZH 3H1IH 3L73H 3H1HH 1L0NH 3H1KH 4U3FH 3TGUH 1BE3H 1SQXH 3BCCH 1KYOF 1SQBH 2FYUH 2BCCH 3H1JH 3L71H 1SQQH 3L74H 1BGYH 3L70H 1L0LH 1SQVH 2A06H 4D6TH 3L75H 1SQPH 1PPJH 4PD4F 1NTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH F;  1NTZ H;  1EZV H;  1BCC H;  1NTK H;  1PP9 H;  3CX5 F;  1KB9 F;  3L72 H;  1NU1 H;  5KLV H;  1P84 F;  3H1L H;  3CWB H;  2IBZ H;  3H1I H;  3L73 H;  3H1H H;  1L0N H;  3H1K H;  4U3F H;  3TGU H;  1BE3 H;  1SQX H;  3BCC H;  1KYO F;  1SQB H;  2FYU H;  2BCC H;  3H1J H;  3L71 H;  1SQQ H;  3L74 H;  1BGY H;  3L70 H;  1L0L H;  1SQV H;  2A06 H;  4D6T H;  3L75 H;  1SQP H;  1PPJ H;  4PD4 F;  1NTM H; 
#chains in the Genus database with same CATH topology
 3T1Y B;  1KMI Z;  3ZHQ A;  3A0H Z;  2GTS A;  3O9O A;  2YXY A;  4O4L B;  4MTO A;  3CCM V;  3RYI A;  2HP8 A;  3H1K H;  3MHH C;  1I0H A;  4GLX A;  4P30 A;  3E89 A;  4TWK A;  3RFR A;  1FAF A;  1SZX A;  1MSW D;  4HNA A;  4B7E A;  1R1B A;  5BY1 A;  1SET A;  4MTF A;  2VQF B;  3QO5 A;  4DR7 B;  2D2C B;  1I94 B;  2UXB B;  3JD4 A;  4JI1 O;  5LMN B;  2QDO A;  3CPW U;  4XDL A;  3EVK A;  1BGY H;  2ZM6 B;  4OX9 B;  2JS3 A;  4LFB B;  4PDV A;  1YEW A;  1K4D C;  2RN9 A;  2P4K A;  3JSN A;  4MVQ A;  2GTA A;  3K57 A;  4JI5 O;  2YI9 A;  4K3A A;  4QNH B;  3HKE B;  5EC2 C;  2YID A;  3QNE A;  4MTX A;  2F1M A;  2ZIN A;  4CS4 A;  1NQT A;  2N74 A;  4UCR A;  2F43 G;  4GCZ A;  4YXW G;  1GM9 A;  4GYC B;  1IBM B;  3E22 B;  2WA3 A;  1YTF B;  3AG2 B;  3RVZ A;  4XDJ A;  3OTO B;  3CE2 A;  4ZI7 A;  3SPH A;  3OT7 A;  2XAJ A;  2LQT A;  1ZWI C;  4TUY A;  1L8D A;  3RBZ A;  4NXM B;  3TXS A;  5LP6 B;  4FJC C;  4QPJ A;  3PN1 A;  5LHI A;  4NYK A;  4J41 A;  4MS2 A;  1URF A;  2YIB D;  1RSO B;  2MW2 B;  1Q7Y W;  3FX7 A;  1Y67 A;  4YIO A;  4KXR A;  1N4C A;  4NTY A;  3ZHU A;  4FPP A;  4QE7 A;  2UXD O;  4I50 A;  5C8Y B;  4O2A A;  4FLU A;  2DMX A;  4PEL A;  4L8J A;  3T1C A;  1LUV A;  1XBL A;  3OGC C;  2F93 B;  5EIB C;  4JI7 O;  1M4U A;  4NR1 A;  3OFN G;  1MNG A;  3CP1 A;  3SYC A;  2XAS A;  5AG2 A;  2OIG A;  1MG1 A;  3E35 A;  3VQW A;  1ZUQ A;  5CB4 A;  3L9D A;  4K8X A;  2B1G A;  4KHP B;  3K5N A;  3CXH F;  2CH7 B;  1WP8 A;  4GX1 A;  3D8C A;  2Z5U A;  5DM6 V;  2PGG A;  3JAL B;  1WP7 A;  1GH6 A;  1N0J A;  1YXB A;  3ICX A;  1EN6 A;  4JI3 B;  2HJF C;  2Q5Z A;  4GKK O;  4GX0 A;  1OJH A;  3CCE V;  1J95 A;  2A0L A;  2E5L B;  2AGA A;  2CGO A;  1SA0 B;  2RJZ A;  3OM3 B;  3F5W C;  4CC5 A;  2NN4 A;  3BA9 A;  1E1R G;  3TK1 A;  4R50 A;  2R9R B;  4FFB A;  4R7C A;  5IE9 A;  1ORQ C;  1S5H C;  2W0X A;  5KA5 A;  2Y0I A;  4YY3 O;  1R6K A;  1AR4 A;  4X1K B;  1JOY A;  2LFS A;  1I7F A;  2ZXW C;  5KUM A;  1HNZ B;  4NXN B;  1VEW A;  3UT5 B;  1PP9 H;  1Q6U A;  4LF4 B;  5B3S C;  1RM1 C;  4B7K A;  3ETD A;  2BTQ B;  1K92 A;  1Y4M A;  1KYO F;  3ZX6 A;  1NH2 B;  5B66 Z;  3ABU A;  5KAF Z;  4P9P A;  1B6Q A;  4PI0 A;  3LSU A;  4DV7 O;  5BMV A;  1AJQ A;  5HFM A;  1PNL A;  1GKF A;  4F6R B;  3F5T A;  4O4I A;  2QKA A;  2JEX A;  1OHH G;  4J9Z B;  2QJ1 A;  3WB1 A;  2IH3 C;  1YVW A;  1NVP D;  3CCV V;  2ETN A;  4QIW F;  2OCH A;  3CRM A;  3EFF K;  4DUZ B;  4CS2 A;  3P30 A;  1JR9 A;  2D3O W;  2EIJ B;  2WAM A;  4I4T A;  4ZHQ A;  2G38 A;  3JD3 A;  1Q81 W;  1KKC A;  3D3I A;  3E8B A;  3CC2 V;  1N32 O;  4LFA B;  4HYO A;  1GO3 F;  3BPZ A;  5CA0 A;  4K0K B;  2JJ2 G;  2ZNI A;  2KG7 B;  4U3J B;  3FB5 C;  2ODM A;  3KZI Z;  3RVY A;  3JAT B;  3K08 A;  1WNS A;  1P49 A;  2B9Z A;  1B06 A;  1JPX A;  3H1J H;  3SYQ A;  4JI1 B;  3SJQ C;  3K9S A;  3WG7 B;  2YXH A;  4RWU A;  5IYC O;  2ARH A;  1TVK B;  2W6I G;  3ZMS A;  2YEV B;  1EBO A;  1VQM V;  5KMG A;  4JI5 B;  4DW1 A;  2HG5 C;  3CC7 V;  3RYH B;  2ATK C;  4LWS A;  5IJ9 A;  1H2N A;  3BY6 A;  3DSQ A;  2BTO A;  2Y69 C;  4QJF B;  5F2V O;  2WSS G;  1ZL8 A;  3VQV A;  1QR9 A;  1NS1 A;  2Y48 A;  3CB2 A;  1NBM G;  4FMT A;  4D7S A;  3ZRW A;  1KB9 F;  5E79 Z;  1MAB G;  4CH6 A;  1EN4 A;  3X2Q C;  4GT1 A;  4K35 A;  5DN6 G;  4X65 O;  2YUA A;  5KA6 A;  2IJI A;  2NNU A;  4TV9 B;  3CC4 V;  4EEQ A;  4FLX A;  3AG1 B;  1FJG O;  2XAQ A;  2Y0P A;  1HP8 A;  3JD0 A;  1J5E O;  1DGS A;  5LBQ A;  4B3M B;  1DLB A;  4IL6 Z;  3BAA A;  4DV6 O;  2UXD B;  3IC9 A;  5L3F A;  2FKX A;  2EIK B;  2XAF A;  1G4Y B;  2Q8V A;  2ZCE A;  4O4L A;  1YZB A;  4JI7 B;  1IX9 A;  1SF9 A;  3VQX A;  2GUZ B;  1XNQ O;  1E1Q G;  4AI8 A;  4YHH O;  2YDE A;  2UXC O;  1WLE A;  4AHC A;  3DGE A;  1VF6 C;  4JYY A;  4LF5 B;  1VF6 A;  3M7M X;  2A7W A;  1VQ9 V;  1Y6X A;  5JJE B;  3ZMZ A;  3NR7 A;  5LA6 B;  1XMQ O;  3CXC U;  2QWN B;  2HR3 A;  2Q7E A;  4DR4 B;  4GKK B;  4LF6 O;  2WLJ A;  1JX9 A;  3AK2 A;  1CEZ A;  3MDS A;  3ABK B;  4X20 B;  1FS0 G;  1Q6H A;  2AHY A;  3LNN A;  2WLL B;  3K3W A;  1M56 B;  3DC6 A;  1N8R W;  3F7Y C;  1VQ7 V;  3HKE A;  4L87 A;  1IZ3 A;  3ETQ A;  2O57 A;  4DV0 O;  2YIA A;  3ZBH A;  2XAG A;  4FLY A;  2Q0O C;  1GN4 A;  1UJW B;  1AVM A;  1QNM A;  2IJH A;  1PM9 A;  5L3B A;  3IAY A;  4DR6 O;  2HHH O;  3CCS V;  3CME V;  4JZ2 A;  4PD4 F;  3RYF B;  4P9O A;  4YY3 B;  3E22 A;  3J81 N;  3AG2 C;  4GZR B;  3HKD B;  4PJ0 Z;  1TUE B;  3H9V A;  1H2L A;  3ZMV A;  5LMU O;  2JIZ G;  4YJ2 B;  2EBO A;  5L3D A;  4LNU B;  4X66 O;  5B5E Z;  4RO2 A;  1ROP A;  2RDC A;  2BCC H;  1K9M W;  5LP6 C;  3WFV A;  5LP6 A;  3J80 N;  3CCR V;  4G28 B;  4DV7 B;  4JF3 A;  3UQ8 A;  4O4H B;  3BRC A;  1RSO A;  3HKC B;  1RM1 B;  4DO2 A;  3CRR A;  2HLD G;  3LNM B;  1BMF G;  4PDL A;  1ARO P;  4BWA A;  1U96 A;  1YSC A;  3FD9 A;  1B3Q A;  5C8Y A;  4DUY O;  1XNR B;  2DJV A;  2LGQ A;  3EHB B;  1YIJ V;  2P6J A;  2CTW A;  4B3S O;  1N32 B;  3QO7 A;  2CDY A;  2B1I A;  4WFH A;  3ZHT A;  1XEQ A;  4DV1 O;  3R66 A;  1AI7 A;  2CH7 A;  4JZG A;  3I5D A;  2JEU A;  2QTS A;  4DR5 O;  3JAL A;  2QE7 G;  1X4T A;  1N34 O;  2MK3 A;  3LDD A;  5CA0 B;  4BIO A;  2JRI A;  5KLV H;  1SA0 A;  4J7J A;  2CE4 A;  3ASO B;  3KG2 A;  1GN6 A;  3M99 B;  2N04 A;  4JI0 O;  3M8A A;  4X1K A;  4HBN A;  2NR5 A;  3RW0 A;  5CMU A;  2Y69 B;  4K8Z A;  3UT5 A;  1I08 A;  3ZHS A;  1SZT A;  2K9P A;  3J7A U;  2H94 A;  3GVM A;  2BTQ A;  3SYP A;  3OEH G;  1TGO A;  2AZ0 A;  5B1O A;  2VQE O;  4BW9 A;  1HNX B;  1ZSP A;  2C2A A;  1FJG B;  1RFY A;  4F6R A;  2UUB O;  3KCY A;  3UCS C;  3ZCC A;  4EB6 B;  3W7T A;  1PL0 A;  4WF9 V;  1JA8 A;  1XIL A;  3B09 A;  4O2B B;  1PV0 A;  1NZ6 A;  5EZY B;  2EIJ C;  2FTK A;  1YF2 A;  4W4L A;  3PJS K;  1D5N A;  3BVO A;  5D5Q A;  2XND G;  4X9Q A;  3A0R A;  2F23 A;  2KG7 A;  4ZIB A;  4U3J A;  2A9H A;  4FFK A;  3N2G B;  2WPD G;  2EUL A;  2A3Q A;  4NKG B;  3JAT A;  3SR2 C;  1XMQ B;  2R9I A;  3FFQ A;  3P3N A;  2DQ0 A;  3TJT A;  2IU3 A;  3WG7 C;  3D36 C;  5EC1 C;  2Q7H A;  3D36 A;  2QM4 A;  1TVK A;  2W0F C;  1EFR G;  1IXB A;  2YEV A;  1GK9 A;  1SES A;  3RYH A;  5KX5 B;  1OCZ B;  5H6Q A;  4CC6 A;  3RYC B;  3OD4 A;  1AI5 A;  2ZE8 A;  4UB6 Z;  5GTH Z;  4DV0 B;  3K9A A;  4B3R O;  4D6T H;  5LHG A;  1IBL O;  1F51 A;  3HB3 B;  1HW7 A;  4DV2 O;  4DR6 B;  2BOB C;  2IBZ H;  2DE0 X;  4E2L A;  2ZE6 A;  1MSD A;  3FYE B;  3OMI B;  4X66 B;  3L71 H;  2FB5 A;  3K5L A;  2ZQM A;  2P06 A;  3JAS B;  3QF7 A;  4O4J B;  2CAZ C;  2KKW A;  4TV9 A;  1YJN V;  1SRY A;  1GTO A;  1HNW O;  4CH5 A;  3AG1 C;  4WBN A;  1VMG A;  2PYL A;  1XUQ A;  2LO1 A;  3KCX A;  1PD3 A;  3MD0 A;  3G67 A;  4OPA A;  4X1Y B;  1SQF A;  4JI2 O;  3SYA A;  2EIK C;  1VF7 A;  2PI4 A;  3ETE A;  4IHJ B;  4JAU A;  1SC5 B;  5FL7 G;  3E2E A;  2XTA A;  4JYC A;  4I9W A;  4ASU G;  1K7D A;  2GUZ A;  1BCC H;  1F4M A;  1Y66 A;  1Q86 W;  5EIB D;  4XBF A;  4I55 B;  3FB8 C;  5J2T B;  2YC0 A;  4LR3 A;  3ZRS A;  2QSA A;  4PV1 B;  4DR5 B;  5LA6 A;  4LH6 A;  2UUC B;  1Q5O A;  4W4K A;  4JYA O;  1IUR A;  5IJ0 B;  1N34 B;  1NTZ H;  4MVU A;  3CX5 F;  1K97 A;  1TUB B;  1NU1 H;  3B4S A;  3ABK C;  4X20 A;  1TAE A;  3N2K B;  1M56 C;  2WLL A;  3AEI A;  1PNK A;  2B5U A;  1NT2 B;  4LC1 A;  2EIM B;  1BZK A;  3ZMU A;  1V54 C;  1XL4 A;  1XI1 A;  3H01 A;  2XUM A;  1KD1 W;  4B3T O;  1KKD A;  1BSM A;  2HVK C;  3RYF A;  3ZIA G;  5CA1 B;  3CCL V;  4D7T A;  5IDJ A;  3HKD A;  3ASN B;  3HKB B;  4YJ2 A;  2Q68 A;  2ZD9 A;  3BAB A;  4QPK A;  4LNU A;  5IYD O;  5KHG A;  4JTA B;  3U10 A;  4PHZ A;  3B8N A;  4OGQ B;  1G1X B;  1PPJ H;  2QGN A;  2DWE C;  3LSQ A;  1QR8 A;  4O4H A;  4DYL A;  1IXM A;  2JDI G;  4LBE C;  2UUB B;  3HKC A;  2ADP A;  3K03 A;  4IYH A;  2ZE5 A;  5H6R A;  5E1A C;  2F4V O;  2BE3 A;  5IWA O;  1AR5 A;  3MHS C;  2VRZ A;  2OIE A;  2YIC A;  3CJH B;  1U97 A;  3B2E E;  1ZAU A;  1M93 A;  3RT3 C;  1FXH A;  1R3L C;  1F23 A;  3K06 A;  1ZX3 A;  3UKM A;  2P4V A;  5JCO C;  5JCO A;  3U11 A;  1OCO B;  1BHB A;  1XOU A;  2BSK B;  3AK3 A;  1G6U A;  3G6E V;  5A9G A;  1DTO A;  3CRQ A;  1FXK B;  3DXR B;  3L75 H;  1N33 O;  2JGD B;  2OWO A;  1CPY A;  1R73 A;  4A5U B;  3K58 A;  4IGG A;  3S3X A;  1Q90 D;  3IJ4 A;  1R6N A;  4Q6G A;  1BE3 H;  1TA8 A;  4H0L B;  5IT9 N;  3ASO C;  4FVM A;  3ZHV A;  3JYC A;  5CBF A;  1XMO O;  4X89 A;  2GV9 A;  4FLV A;  3ZS8 C;  1E79 G;  2ADQ B;  1VIB A;  3JAM N;  3FB6 C;  1G8M A;  3FAV B;  4X64 O;  1QVF U;  4CH4 A;  1WAZ A;  1OCR B;  1Q3E A;  1UFI A;  5B1A B;  2H3O A;  2ITC C;  4QGP A;  1H2S B;  4GKJ O;  4CH3 A;  2E74 B;  1HNW B;  1AI4 A;  3C90 A;  5CBH A;  2M7W A;  3TGU H;  4PA9 A;  4EB6 A;  4DV3 O;  4TQF A;  4UUJ C;  4O2B A;  4JI2 B;  3JCZ A;  3ABL B;  4WBN B;  1AP6 A;  5GON B;  5EZY A;  5LGN A;  4TOI A;  2RMK B;  4FM1 A;  3NXS A;  1H38 A;  3C3S A;  1JVM A;  1PKX A;  3K59 A;  4J7Z A;  2EIN B;  3H1I H;  4WFA V;  1Y76 B;  1VAR A;  1W59 A;  2GDS A;  2R9A A;  4Q20 A;  1H2G A;  1Y74 A;  2IH1 C;  3N2G A;  1N0N A;  4MVR A;  1S3J A;  5JVD B;  1JMK C;  1FFX B;  2JGU A;  3SJA C;  3E8G A;  4RQF A;  1RPR A;  4IT5 A;  5FPO A;  1LUW A;  4J11 A;  2K1E A;  3ZHR A;  5LL6 Y;  4PDM A;  1P7B A;  4JV5 O;  4H44 B;  2PZS A;  1P7G A;  3ZED A;  1Z5V A;  2UUA O;  2EZO A;  4EFB A;  1THZ A;  2IM9 A;  1OCZ C;  4F4L A;  2LGW A;  3OMA B;  3LSS A;  4HAM A;  5KX5 A;  2YS8 A;  4WFE A;  2ZNJ A;  3RYC A;  1NR1 A;  3O65 A;  2M6Y A;  4UCV A;  4BAY A;  1HDJ A;  2ZKO A;  2ILM A;  2V1D A;  3HR0 A;  1QLE B;  3H1L H;  4B3T B;  2Q4P A;  3W7W A;  4PA7 A;  2HFE C;  2CK3 G;  1BT8 A;  1V54 B;  2OCC B;  2ZR3 A;  1JJ2 U;  1WB8 A;  1YTF D;  2YI8 A;  2VQF O;  2A79 B;  5J2U B;  1BQ0 A;  3GWO A;  1YCI A;  4CZZ A;  3JAS A;  3OTF A;  4O4J A;  4I0X B;  1CXZ B;  1QBZ A;  4FM0 A;  3RGB A;  3C3T A;  1DF5 A;  2ZM6 O;  4OX9 O;  2EZP A;  4LFB O;  5D5P A;  4UFZ A;  4NTX A;  3F7V C;  2PI5 A;  2R72 A;  1V9P A;  4X1Y A;  1SQV H;  2F4V B;  5IWA B;  1YIT V;  3VQY A;  5JJJ B;  2P22 C;  2DYR B;  4IHJ A;  4FK5 C;  2HVJ C;  4KP4 A;  2QA4 V;  4ICG A;  1GAX A;  2F95 B;  3SJC C;  2KSD A;  1S77 D;  1W0J G;  3AG7 A;  5EK0 A;  1IBM O;  4I55 A;  3OEE G;  4IIJ B;  2FYU H;  5J2T A;  1K73 W;  5DEC A;  1AJP A;  3T4Z A;  1AP5 A;  4DV5 O;  3CCQ V;  2QTO A;  2XAH A;  3APQ A;  1N33 B;  3K5M A;  2AZ2 A;  1M9N A;  1RPO A;  2FL4 A;  3L72 H;  3TCU A;  5IJ0 A;  3JD2 A;  2V4D A;  1M1K W;  4NXM O;  5FNV B;  1MZE A;  3WB2 A;  1KUQ A;  2WLK A;  1TUB A;  1XQ8 A;  4TV8 B;  5JH7 B;  1FPO A;  3N2K A;  5LYJ B;  1K8A W;  2WLI B;  1S5J A;  2UU9 O;  1GM7 A;  4LF8 O;  4UCT A;  3K04 A;  2QR4 A;  1XMO B;  2EIM C;  4ABM A;  1JJO A;  2EJR A;  4JTC B;  1NVP B;  5IY5 B;  4AIL C;  1QCE A;  3SPI A;  4LFC O;  3ABM B;  4DR2 O;  5CA1 A;  1KC8 W;  3ASN C;  3RN4 A;  4X64 B;  3U0Z A;  4FLT A;  3VBB A;  3HKB A;  5CA3 A;  2PTM A;  2EIL C;  3K5O A;  1K33 A;  1IVS A;  5B1B B;  1AJN A;  4JYB A;  1Z5W A;  4JAV A;  1DK1 A;  2Y4U A;  4N21 A;  2DYS B;  2X0L A;  4R8C A;  3GB7 C;  5IYZ B;  1B04 A;  4IYI A;  3H1H H;  4CS3 A;  1BL8 A;  1EM1 A;  4U3F H;  4ZOL B;  3ZRX A;  3ZN0 A;  1WN7 A;  3ZN1 A;  1NH2 D;  4MVZ A;  3CS5 A;  4J9Y B;  3JAW B;  2E5L O;  1Q6I A;  1AR1 B;  4X65 B;  1KBH A;  4TSF G;  4WCE V;  2Q9L A;  4MSW C;  1IDS A;  2KB1 A;  3CJH A;  5EBL C;  1MOF A;  3W7S A;  1OCO C;  1J5E B;  3QTC A;  3K79 A;  2BSK A;  1OCC B;  4DV6 B;  4UVA A;  3S3W A;  2KQX A;  3K0G A;  5L3G A;  4DR1 O;  1R6T A;  2AXT Z;  4BIZ A;  1KP2 A;  1ZTE A;  1L1F A;  1KP3 A;  4LF4 O;  2ZIO A;  1FXK C;  2QEX V;  2IJK A;  1FXK A;  5KHI A;  3DXR A;  1XNQ B;  1H8E G;  4JAA A;  4RAI A;  3I56 V;  2JGD A;  1EZJ A;  4UCS A;  4YHH B;  1KU9 A;  2UXC B;  2LW7 A;  5J9P C;  2JS5 A;  4P2Z A;  2DQ3 A;  3AK1 A;  1LNQ A;  4JI6 O;  1K3E A;  1Y74 B;  3AG4 B;  2IW5 A;  2VWK A;  1P4R A;  4JI4 O;  3JAR B;  4ZBM A;  5BZB A;  2UUA B;  2IU0 A;  1XL6 A;  5IYB O;  4UCO A;  4H13 B;  3HPL C;  1W0K G;  1DF4 A;  2OTJ V;  4DUZ O;  4FIP C;  1S76 D;  4LF6 B;  4OPH A;  1X59 A;  1MMM A;  5HFL A;  5EYP B;  4MW8 A;  3BCC H;  4LFA O;  5C93 A;  3FAV A;  5ITZ B;  1OCR C;  3EXA A;  4AQY O;  5B1A C;  3UO2 A;  1SER A;  4K0K O;  2OYQ A;  4X1I B;  1D2D A;  2VS0 A;  3E83 A;  4JGS A;  2HHH B;  4MTG A;  2UXN A;  3I55 V;  3CWB H;  1H2M A;  1S5L Z;  3T1H O;  2DWD C;  5LMU B;  3ML0 A;  4PA3 A;  1K5Q A;  1JFF B;  4GX2 A;  5CN0 A;  4Z1V A;  4FLZ A;  2WWW A;  4LCU C;  3G4S V;  2DOS A;  2JJ1 G;  4PDR A;  1VF5 B;  3ABL C;  5JJN B;  3CCJ V;  5LXT B;  5GON A;  4MVM A;  5GW7 A;  1P84 F;  4UXN A;  3SPC A;  3JAK B;  4DW0 A;  1VQO V;  1SKV A;  2Q73 A;  2Q7G A;  2EIN C;  1HR0 O;  3K0D A;  4J10 A;  1A32 A;  3Q4H A;  4DUY B;  4I9Q A;  1BHA A;  1Y76 A;  4J7K A;  4F6E A;  2W6J G;  4DK1 A;  3OE7 G;  1NTK H;  5JVD A;  4DV5 B;  1FFX A;  4B3S B;  4WFF A;  2CGN A;  4LF9 O;  4DV4 O;  4B08 A;  1M57 B;  2GHY A;  1QU7 A;  4KUM A;  1XRE A;  1KEC A;  4DV1 B;  1K34 A;  2V7Q G;  1CP9 A;  4UVB A;  3L74 H;  2YSU B;  1FD9 A;  3QO8 A;  3ZJZ A;  1GRJ A;  4B3M O;  2UU9 B;  4LF8 B;  2YIB A;  3BEH A;  4NTW A;  3JCU Z;  1YHQ V;  1YI2 V;  3CD6 V;  4FZ0 A;  1QLE C;  4LFC B;  1GN2 A;  2HKO A;  1QVG U;  4G2K A;  4DR2 B;  3LDE A;  4N23 A;  1WA8 B;  2P7T C;  2Q67 A;  4UV8 A;  1FFT B;  5JQG A;  3T2M A;  2OCC C;  1YDX A;  4LF5 O;  2NLJ C;  1ENV A;  4JI0 B;  1S72 V;  3UM7 A;  4CBC A;  1YJ9 V;  3W7U A;  3OUS A;  1T5E A;  1BS3 A;  5J2U A;  1Q43 A;  3CEI A;  4I0X A;  1VQP V;  5LGU A;  2EIL B;  5KAI Z;  4DR4 O;  2JK5 C;  4E4E A;  3CMA V;  1VP7 A;  2A06 H;  4OXS A;  4ZKI A;  5L3C A;  5B1N A;  4DRX B;  2VQE B;  2DYR C;  4TQD A;  1JQ0 A;  3CRA A;  4NVP A;  2R70 A;  5LOV B;  1AB3 A;  3OUF A;  2LP7 A;  2EX3 A;  3KKY A;  1WPB A;  3APO A;  2VWJ A;  4FLW A;  3L70 H;  1L0L H;  1NR7 A;  4DR1 B;  3A8T A;  4IIJ A;  4LH7 A;  2Z3Y A;  1NTM H;  1Q8I A;  3TET A;  1V55 B;  2DN9 A;  4X62 O;  1SQG A;  5DED A;  3ABT A;  1FKA O;  5BR8 O;  2QKC A;  4FZ1 A;  4UV9 A;  5FNV A;  1R3I C;  5A2Q N;  2OT5 A;  4JI6 B;  1N36 O;  2RNB A;  4TV8 A;  5JH7 A;  2ZT9 B;  4KL1 A;  1R3K C;  4YJ3 B;  4JI4 B;  4H37 A;  5LYJ A;  1PL4 A;  2WLI A;  3E8H A;  4JI8 O;  5H5N A;  1R3J C;  3QG5 A;  2EJ7 A;  4I5S A;  1F4N A;  4BIU A;  1OV9 A;  4DR3 O;  4MW3 A;  2JVD A;  5IY5 C;  3CYO A;  1XNR O;  3L73 H;  3CRC A;  3BFR A;  2ITD C;  3ABM C;  3AG3 B;  4HZ3 A;  1SQQ H;  4EFE A;  1GM8 A;  4FM2 A;  2QWR B;  2P5O A;  4AQY B;  1NKD A;  5B1B C;  4B3R B;  4DK0 A;  2PY5 A;  3RYI B;  1IBL B;  4TT3 G;  3SPJ A;  3IC7 A;  2DYS C;  4Z1M G;  4DV2 B;  5IYZ A;  1QQC A;  2IJJ A;  2RCV A;  3T1H B;  1SQB H;  1D5A A;  4HNA B;  4ZOL A;  2RQ6 A;  1H2K A;  4PA6 A;  3BHP A;  3JAW A;  2L35 A;  5GTI Z;  1COW G;  2QWQ B;  3P3P A;  5FLX N;  5L3E A;  3IFX A;  4RQE A;  1VQL V;  2H8P C;  2OTL V;  2L6L A;  1XDC A;  3ZMT A;  3WU2 Z;  1OCC C;  2LJ2 A;  2HEP A;  4UVC A;  1HR0 B;  4UCU A;  3TXQ A;  1IBK O;  5KHH A;  2X6A A;  5H2F Z;  1WPX A;  2BOC C;  4LF9 B;  4DV4 B;  4UB8 Z;  4MT8 A;  1SQX H;  2HJD A;  3Q4H B;  2GBO A;  4J80 A;  1JCH A;  2QM7 A;  1HNX O;  2E3C A;  2ZR2 A;  3AG4 C;  1K5S A;  5KUK A;  4ZI7 B;  5BXZ A;  3D3Q A;  4JTD B;  3W7X A;  1YJW V;  3OR7 C;  3JAR A;  4JYA B;  4TUY B;  1EZV H;  4LF7 O;  4X88 A;  1L0N H;  3A2F A;  2CTQ A;  1GN3 A;  3FYI B;  1VQ5 V;  3BA8 A;  5EYP A;  1VQ8 V;  4RUF A;  2CUG A;  2PF4 E;  3T1Y O;  4H33 A;  2AW9 A;  4I50 B;  5ITZ A;  1O9H A;  2CTR A;  4O2A B;  3G80 A;  2XT9 A;  4I7Z B;  2Y4T A;  4R6Z A;  4X1I A;  1LR1 A;  4JPR A;  1M90 W;  4RUE A;  2X7R B;  2ZE7 A;  3IGA C;  1S0V A;  5CB4 B;  3E86 A;  2XOK G;  3FKS G;  5EBM C;  4Z2W A;  5JQG B;  3WB0 A;  3T4D A;  4EKW A;  1JFF A;  2Z0A A;  3STZ C;  1SQP H;  4PA4 A;  1PNM A;  4LP8 A;  3A0B Z;  2F66 C;  4DR7 O;  1I94 O;  2UXB O;  2LFR A;  3CCU V;  2ZIM A;  2P90 A;  4BR6 A;  3OMN B;  5LMN O;  3SJB C;  5LXT A;  2QWP B;  2AHZ A;  3LDC A;  2Q69 A;  3JAK A;  3CSX A;  4G27 B;  1I5X A;  1HWY A;  1FXV A;  4KFM A;  1NI8 A;  4GUN A;  5KHK A;  5K1P A;  3DC5 A;  2YXL A;  3GWK C;  5K1X A;  3LUT B;  1K4C C;  1QLN A;  4FFB B;  2XHB A;  3ETG A;  1Q82 W;  4X62 B;  1M57 C;  4DXW A;  5BR8 B;  1XHZ A;  5LGT A;  1H8H G;  3OTO O;  4MVS A;  2ZXW B;  4BW5 A;  1N36 B;  3SPG A;  5B3S B;  5JWP A;  3RWR D;  3P32 A;  3SYO A;  2WA4 A;  4JI8 B;  3THO A;  4WFB V;  1ZLZ A;  2QM8 A;  3OW2 U;  3FB7 C;  5EBW C;  3JSL A;  4DR3 B;  5BMV B;  1BQZ A;  4O4I B;  1OZ0 A;  5LHH A;  3OGI B;  4C7U A;  5KHJ A;  2N05 A;  3OR6 C;  1NJI W;  1WA8 A;  1UPG A;  4XDK A;  4U7N A;  4WFG A;  4I4T B;  4ZHQ B;  2Q0A A;  3SGI A;  5TIS Z;  4J42 A;  2PYJ A;  2UUC O;  1WJZ A;  3CHX A;  3R65 A;  2QWO B;  4X8A A;  2FML A;  2E76 B;  1US6 A;  2E75 B;  4KHP O;  2QKS A;  2X6C A;  5FPR A;  1F7Y A;  1MA1 A;  4MVO A;  4JAS A;  1M5I A;  4QE9 A;  5H9C A;  2PUS A;  1QHT A;  3MAQ A;  3UO3 A;  1VQN V;  3G71 V;  4GKJ B;  4JI3 O;  4DRX A;  1Z2G A;  4NB5 A;  1EN5 A;  3B8M A;  2Q6A A;  2CTP A;  3B40 A;  5LOV A;  2WLH A;  3JD1 A;  3QVN A;  4DV3 B;  4PI2 A;  5KMG B;  1AIL A;  1I5Y A;  4LWS B;  4GX5 A;  5IJ9 B;  1SS3 A;  1IBK B;  1AI6 A;  1VQ6 V;  1VQ4 V;  3SDL A;  2WLN A;  1W2B U;  1V55 C;  3B77 A;  2X6B A;  4U7O A;  2LW1 A;  2DW4 A;  3STL C;  1ZL8 B;  1GMG A;  3ZRW B;  4NXN O;  1HNZ O;  3E8F A;  1MZF A;  3OAA G;  1WB7 A;  2GSM B;  1VQK V;  1XHX A;  2UXX A;  4YJ3 A;  3G6B A;  2ZDI C;  3X2Q B;  2WLM A;  2ZDI A;  5CBG A;  4LF7 B;  3VOU A;  1RP3 B;  2P67 A;  4JV5 B;  1KQS U;  1O9G A;  3AG3 C;  3ZRV A;  3DTU B;  3N27 A;  1FYJ A;  4YIP A; 
#chains in the Genus database with same CATH homology
 3CXH F;  1NTZ H;  1EZV H;  1BCC H;  1NTK H;  1PP9 H;  3CX5 F;  1KB9 F;  3L72 H;  1NU1 H;  5KLV H;  1P84 F;  3H1L H;  3CWB H;  2IBZ H;  3H1I H;  3L73 H;  3H1H H;  1L0N H;  3H1K H;  4U3F H;  3TGU H;  1BE3 H;  1SQX H;  3BCC H;  1KYO F;  1SQB H;  2FYU H;  2BCC H;  3H1J H;  3L71 H;  1SQQ H;  3L74 H;  1BGY H;  3L70 H;  1L0L H;  1SQV H;  2A06 H;  4D6T H;  3L75 H;  1SQP H;  1PPJ H;  4PD4 F;  1NTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...