1NU1H

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1nu1H00
3H1KH 4PD4F 1SQBH 1NTMH 3L74H 3H1JH 1SQVH 1L0LH 3L71H 1BCCH 1PP9H 1BGYH 5KLVH 3CX5F 3L75H 1SQQH 1NTZH 1NU1H 1BE3H 1PPJH 2FYUH 3CXHF 1P84F 3L73H 4D6TH 2IBZH 1KYOF 3L70H 3H1IH 3CWBH 2BCCH 1KB9F 1NTKH 3L72H 1EZVH 3TGUH 2A06H 1SQXH 1L0NH 1SQPH 3BCCH 4U3FH 3H1HH 3H1LH
chains in the Genus database with same CATH superfamily
3D36A 4RQFA 1NTMH 1VQ5V 4JAUA 4PDRA 1Q5OA 3ZHVA 3F5WC 4E2LA 2FKXA 3ZN0A 1S5HC 5CB4A 2FMLA 4Z2WA 2F66C 5BMVB 3WG7C 2XOKG 2D3OW 1EM1A 1KECA 4O2BA 4PA6A 3B4SA 4JTDB 4MVQA 3DSQA 3CX5F 2BTOA 1K9MW 1LR1A 1Q81W 3SYOA 3HKBA 3P3PA 2UUCB 1FXKC 1UFIA 2NR5A 4H13B 1Q90D 3IJ4A 4TSFG 1XMOB 2B1GA 4I55B 1YTFD 4BIOA 3APQA 5DEDA 3JD1A 3EVKA 1CEZA 4X1YB 2RN9A 1SF9A 3RYCB 3JD0A 1ROPA 3AG4C 4JYAB 4PA4A 1SS3A 3DC5A 1S3JA 1BT8A 2N74A 2QDOA 3Q4HA 4JI3O 1QLNA 1MA1A 2AGAA 4EFEA 1I5YA 4DUYO 1BMFG 4O2AB 1U97A 5JWPA 2KSDA 4NR1A 3CMAV 2A7WA 3A0BZ 4FFBB 2YIBA 5LYJB 1AI5A 4IL6Z 4DUZO 4I50B 5J2UB 4RUFA 3B09A 2CH7B 4DR4O 1DK1A 4AQYO 4X65O 4DRXB 3G6EV 2CDYA 4ZOLB 4DR2B 5BZBA 3B8NA 2R9RB 3RVZA 1UPGA 3I55V 4MVZA 1F4MA 4LF5O 4EFBA 2VQFB 2MW2B 3FX7A 4L87A 4CC5A 1R3JC 3QO8A 1AP5A 5B1BC 3CRQA 2JEUA 1KU9A 1Y74A 1F4NA 1RFYA 5LP6C 4PDVA 2E75B 3W7TA 2PGGA 2EIJC 3AG2B 3CSXA 2ADQB 3SGIA 2CGNA 2YIAA 2WLIB 2ZDIA 3BA9A 2LO1A 5EBWC 5JJNB 3X2QB 3CWBH 2BCCH 1XNRB 2EIKB 3CEIA 5LGUA 2F1MA 1FPOA 1U96A 4XDJA 3ZCCA 2WLMA 1EN4A 3SJBC 2KG7B 1MABG 1FD9A 3MDSA 5L3GA 4GCZA 5C8YB 4BIZA 1GM9A 2PF4E 5ITZB 4UXNA 4JZ2A 4IYIA 3BABA 4TV8B 3ZBHA 3JCZA 4LF7O 1SA0B 3UT5B 2AHYA 4B3SB 3N2KB 2R72A 2HP8A 3T1YO 4DV7O 5DN6G 1LNQA 1THZA 2Q69A 3H1JH 3SJAC 3T1HO 2PI5A 2QR4A 2F4VO 4YJ2B 2IJKA 4G27B 4IHJA 5B3SC 1S5JA 2V7QG 2YEVB 3K5MA 1VF7A 3JD2A 3ZMVA 5BY1A 4DV5B 3BFRA 4E4EA 3OT7A 1CPYA 4PD4F 1VP7A 2X6AA 1Z5VA 1YHQV 4OX9O 2ZR3A 3WB1A 5HFLA 1JQ0A 1VMGA 4MVSA 2EINC 1PV0A 4Q6GA 5LMUO 1DGSA 2LW7A 1SC5B 1NR7A 3RW0A 5EBLC 1IBKO 3K9AA 4N23A 2ZIMA 1S77D 1MNGA 1YEWA 2DYRB 3TCUA 2BSKA 1F23A 4MVOA 2WAMA 1PL0A 1N33O 1YVWA 1KD1W 4UVBA 3STLC 3IGAC 3NR7A 1F7YA 4B3MB 2OTLV 1KC8W 1K92A 4JI1B 2L6LA 2XAHA 2DQ3A 2GDSA 3CRCA 2Z0AA 4A5UB 5CA1A 3L9DA 5CB4B 2JGDA 4JI2O 1YDXA 4JF3A 1ZTEA 1J5EO 2YDEA 4LF8B 3H1KH 2GTAA 4O2BB 4QJFB 2CTRA 3A8TA 5LGTA 3OGCC 1S72V 4FLUA 4K35A 1XNQO 1KBHA 1R3IC 4DK0A 1GRJA 1NU1H 2VRZA 2Q9LA 4PI0A 1M56B 3ZMUA 1N8RW 4QGPA 2KQXA 2Q7EA 3HKBB 2ZXWC 1H38A 4D7SA 1SQFA 2GV9A 1L1FA 5CA3A 3ZS8C 2A06H 5BR8B 2XTAA 2ZM6O 1YIJV 1VQ8V 4Q20A 1TVKA 4O4HA 3K59A 3K08A 4WBNA 1YTFB 5K1PA 3A0RA 3LDDA 2EULA 2UXCO 2RCVA 5LOVA 3AG1B 1XOUA 3Q4HB 1D5AA 4WFGA 3TK1A 3OEEG 4ZKIA 2JS5A 1K73W 4K0KO 3VQXA 4YIOA 1EBOA 1S5LZ 2Q0OC 1SRYA 1HDJA 1WP7A 4U3JA 3CC4V 5EYPA 2IM9A 3JCUZ 4DR5O 2CUGA 1Z2GA 4JI5O 1MZEA 2PI4A 4X62O 2IJJA 1SQXH 2L35A 4DV6B 5JVDA 5IJ0A 4ZI7A 1S0VA 3JATA 2KKWA 3SPGA 2R9IA 2ZIOA 1NR1A 2H3OA 2Y4UA 3LSSA 3ZX6A 1FJGB 3SPCA 5B1NA 4EEQA 4B3RO 2DN9A 1IXBA 5L3BA 1IDSA 4JTAB 1S76D 1Y74B 4GKKB 3H9VA 4HAMA 2E5LO 2DQ0A 1JX9A 1ZX3A 1B3QA 1AJPA 2WPDG 4B3TB 1TGOA 4UUJC 1NJIW 1Q7YW 3B8MA 3SYAA 2VWJA 2LGQA 1LUWA 1Q3EA 2LP7A 4X1KA 4DR6O 1G8MA 1PNKA 4YY3O 3L75H 1BS3A 3M7MX 1WA8A 4P9PA 4HNAA 3CRAA 5DECA 1SQPH 1AJNA 3TJTA 4LF4O 1SQBH 2HHHB 1BQZA 1G6UA 3F7VC 5B1AB 5LHGA 4QIWF 3DTUB 4IHJB 4DV4O 4LH7A 3CPWU 4NXMO 2ILMA 1FYJA 5KHIA 2RNBA 3JAMN 5IY5B 2EILB 1P4RA 2EZOA 2QM7A 3ZN1A 4QE9A 1NH2D 4LWSA 2Q8VA 2EBOA 4D7TA 5GTIZ 4WFBV 5EZYA 1OZ0A 2QA4V 3ZHUA 3CCQV 2HJFC 1M4UA 4DV0B 3T1CA 5H2FZ 4NTWA 1NTKH 2B1IA 1YXBA 1EZVH 3AK2A 4DXWA 1M9NA 1L0NH 1QR9A 5LMNB 3K5NA 1FFXA 3BVOA 4JASA 2JEXA 1TA8A 3STZC 4MS2A 3X2QC 1BCCH 4JYYA 4NTXA 1VF6C 3SJCC 1JOYA 4LFBO 3ZHSA 5H6RA 2Y4TA 4FK5C 1XEQA 3N2GA 3WB2A 5IYDO 1L8DA 1XL4A 5CA1B 2JGDB 4LC1A 3GB7C 2XAFA 4RWUA 2UXBB 2LQTA 2YXHA 1K8AW 4J41A 3WB0A 2IH3C 5EIBC 2IW5A 3VQWA 1SKVA 4GX2A 1UJWB 2UXDO 3G4SV 2EX3A 5J9PC 2BOBC 4JV5O 1Q6UA 1M57C 3SYCA 1AB3A 1H2GA 1XMQO 1HR0B 2YXLA 5A2QN 2W6IG 4FLWA 4JGSA 1Y67A 1MSDA 4YXWG 5KUMA 1JCHA 4LFCB 2K1EA 3W7SA 1TVKB 2JJ1G 2YIDA 4O4HB 4PELA 2YICA 4OGQB 4X1IA 3APOA 4WBNB 1OCOB 1NT2B 2ODMA 2UUBO 3H1IH 5DM6V 1ZWIC 5LOVB 1XUQA 1VF5B 4WCEV 2Y69C 2ZT9B 5K1XA 5KA6A 1HWYA 3GWOA 3CCSV 4ICGA 4JI0O 1SQGA 4JZGA 4U3JB 2XASA 3ZHQA 5EYPB 1YZBA 2R70A 4B7EA 1BZKA 3CC7V 1E79G 4KP4A 1VQMV 2Q67A 3IC9A 3QG5A 3RWRD 3RYHA 2QKAA 2XNDG 4HZ3A 4UB6Z 5JVDB 5IJ0B 1Y76A 4ZI7B 1K97A 3JATB 4LFAO 2QKSA 4TV9A 3K0DA 1IZ3A 3UM7A 1D2DA 1IVSA 3W7XA 3BA8A 1V55B 1QU7A 1YF2A 3S3XA 3HR0A 4QPKA 2RMKB 4FLZA 3AG3B 4ZIBA 2XHBA 3ETGA 4LH6A 2QE7G 1M56C 3P32A 2P4KA 4ZHQA 1VQ7V 2LGWA 3SYQA 1I5XA 1JVMA 5KUKA 3CCLV 2CGOA 4NKGB 4JI8O 4YJ3A 3CD6V 4J7ZA 2HEPA 1G1XB 5B1OA 1K5SA 3E8HA 1CXZB 2P67A 5KA5A 4JPRA 3ABTA 4F4LA 1Z5WA 3C3TA 2B5UA 3AG1C 1ZL8A 4X1KB 5EBMC 1IX9A 2HFEC 1YJNV 3OTOO 3D3IA 1K7DA 1B6QA 3ZRSA 5JCOA 4PDLA 4CH3A 1GMGA 1WA8B 1IBMB 4J42A 2VS0A 2X7RB 3RN4A 3VBBA 4HNAB 3ZRWA 4NXNO 1BHBA 4GX5A 4R50A 4FFKA 5D5QA 2LJ2A 4L8JA 3ZMTA 1HNZO 3ABMB 1P7BA 1PNLA 5KHJA 4LF6O 5LGNA 4DV1O 4FMTA 4BW9A 1N0NA 2VWKA 2IJHA 5KAIZ 2NN4A 1QVFU 3JAKA 3OGIB 4CH5A 2EJ7A 4MSWC 1US6A 3JD3A 2Q73A 4TQDA 2YC0A 2A9HA 4JAAA 1N34O 3BAAA 1DF5A 1X4TA 4LWSB 4JI3B 1W0JG 4MW3A 3WU2Z 4FLTA 5EZYB 3CXHF 2HVJC 2UU9O 4DUYB 5KHGA 3ZMSA 1NH2B 3JAWA 3TXQA 3G67A 4FPPA 5AG2A 3VQYA 3JARA 4FM2A 5GTHZ 2PUSA 4DUZB 1FFXB 5KAFZ 4DR4B 4MVUA 2FB5A 2Q7GA 3L71H 4AQYB 4X65B 1GAXA 3R66A 1Q82W 1WAZA 2WSSG 2ITCC 4BW5A 2XAJA 4JI7O 3N2GB 1M93A 4I7ZB 2BTQA 3H1LH 3ABLB 1WN7A 4JI6O 4LF5B 3GVMA 4GYCB 5IWAO 4IIJA 2Q4PA 5CBGA 4K3AA 2W6JG 2Z3YA 1AJQA 4H33A 1NQTA 5KHKA 2EZPA 4DR7O 4I9WA 5E1AC 5B1AC 2OYQA 1GM7A 2JGUA 3K03A 4K8XA 1W2BU 3FAVA 3G80A 3T4ZA 5L3CA 4O4IA 1R1BA 4TWKA 5KX5B 3OFNG 1OCCB 4CC6A 1WP8A 4X1IB 3K79A 3OEHG 3SDLA 2EILC 2G38A 3K06A 4TQFA 3TETA 2QM4A 3K04A 5CN0A 4X66O 3HB3B 3ASNC 1I7FA 2M7WA 3CC2V 1ORQC 4LF7B 2AZ2A 5LHHA 1DF4A 3LSQA 1KYOF 3T1YB 2RQ6A 4DV7B 1IXMA 5JJJB 3JSLA 1WNSA 4IT5A 1XDCA 2DMXA 2QWPB 2WLLA 2F4VB 4UFZA 2DW4A 3RYHB 2F93B 3FFQA 4MT8A 4PDMA 1Y76B 3QF7A 1HNXO 4P30A 4JI4O 4DV3O 3T4DA 4TV9B 1VARA 2PTMA 4RUEA 3LNMB 4I4TA 1VQOV 3B2EE 4X64O 4GLXA 1QHTA 2NLJC 1OJHA 3OUFA 4LCUC 4OX9B 3VQVA 2LW1A 3C3SA 4X20A 3G71V 2ZE6A 1BL8A 3CS5A 4WFAV 4ZHQB 3K5LA 1R3LC 3KCXA 2XAQA 1IBKB 5H6QA 2JIZG 4LNUA 1IBLO 2N05A 2ZR2A 4LP8A 2UXXA 4YJ3B 2QSAA 1N33B 3P30A 1K4CC 3M99B 3IAYA 2ZCEA 1XREA 1K5QA 4KHPO 1ZL8B 2QTOA 1SQQH 3E35A 3KKYA 4MVMA 1BE3H 2FYUH 4GKKO 5TISZ 2CTWA 1JA8A 4JI2B 3LDEA 4J11A 1WJZA 1J5EB 1KB9F 3AG7A 3RGBA 1OCRB 4B3TO 4NVPA 2PYLA 1XNQB 1B06A 5FPRA 2ZKOA 2HLDG 1N32O 2OIGA 2YUAA 4G2KA 3CP1A 2QWOB 1I94O 2ATKC 3B77A 1OHHG 2CE4A 1VQKV 2ZM6B 1VQ9V 5BMVA 4PV1B 2YSUB 3S3WA 1AI6A 2Q68A 4LBEC 3JAKB 3RT3C 4O4JA 1RP3B 2V4DA 3ZRXA 4F6RA 1XL6A 2UXCB 1BGYH 4UVCA 1M90W 1V55C 3ZIAG 1PM9A 3JALA 3RYFA 5B1BB 1MOFA 3UO2A 1OCZB 3AG3C 2FTKA 1FXHA 1V54B 2EIJB 4K0KB 1E1QG 3E8BA 3E22A 4J7JA 2ZD9A 1R6NA 1PD3A 1WB8A 3JAWB 3L72H 4DR1O 4YHHO 3JARB 2WA4A 4XBFA 1R6TA 2WLKA 1TAEA 3OTFA 3NXSA 3ASOB 5F2VO 4G28B 3SPHA 1GK9A 4DR5B 3G6BA 2V1DA 4JI5B 4W4KA 4AI8A 4X62B 2E3CA 2ZQMA 4MW8A 1FKAO 3M8AA 4DV0O 2P6JA 3U0ZA 2VQEO 1N36O 1YITV 2W0FC 3FYEB 4B7KA 1MZFA 3DC6A 1COWG 5LHIA 3OAAG 3A2FA 1NVPD 1MG1A 2EJRA 3ETEA 2BTQB 4I50A 4UB8Z 1RM1B 1L0LH 1YJ9V 2HR3A 3CJHA 4O4LA 5LA6A 1AP6A 4IIJB 4B3RB 4FLVA 5A9GA 1AVMA 2Q6AA 4NYKA 1GN6A 3OMIB 1TUEB 4ASUG 2ETNA 5B3SB 4DV2O 2B9ZA 1I08A 4FM1A 4GX0A 3ABMC 1D5NA 2E5LB 3CXCU 3SPJA 2H8PC 3FAVB 5JJEB 2IJIA 4O4IB 1Q8IA 1TUBA 3HKCA 4UV8A 3FKSG 4Z1MG 1AR1B 3CE2A 3CCRV 4OPHA 4LF9O 3SPIA 3ZJZA 4CBCA 2WLJA 1K4DC 3AG2C 4DR6B 2BSKB 1O9HA 2UUAO 4UCUA 2DJVA 4ABMA 2P5OA 3CRMA 5FL7G 5B66Z 2EIKC 4P9OA 3OW2U 2XT9A 3QO7A 4PJ0Z 4DR3B 3AK1A 4GKJO 2OCHA 1YI2V 4LF4B 3AK3A 2BE3A 2WLLB 2JVDA 4GT1A 3ZEDA 1GN2A 4I5SA 3K0GA 1Q86W 3RYIA 1JR9A 1QCEA 1GTOA 3RBZA 4DV4B 5CMUA 3KCYA 4J80A 1F51A 2ZNJA 3ABLC 3DGEA 3JSNA 3JASA 4I4TB 2H94A 2DWEC 3OR7C 4XDKA 5EK0A 1FXVA 1ZLZA 4H37A 3CB2A 4X20B 2GUZA 4UCSA 4J9YB 3OUSA 2PZSA 2XAGA 4CS3A 1H2MA 4N21A 4LNUB 3FYIB 3SR2C 1E1RG 3UCSC 2UUCO 3OMNB 1V9PA 1OCCC 1PL4A 4PHZA 4B08A 3ZHRA 4FJCC 1XMOO 2OT5A 4LFBB 3VOUA 2DYRC 1QNMA 1P84F 2O57A 1PKXA 4BR6A 3FB7C 3K3WA 4BWAA 4HBNA 3THOA 1KMIZ 4JYAO 3FB5C 3OMAB 3D36C 5E79Z 5IYBO 3BCCH 1ZAUA 3W7UA 2QGNA 1OV9A 4PI2A 2HKOA 2UXDB 1XILA 1KKDA 1XI1A 1SESA 4JV5B 1AI4A 1AR4A 2QEXV 3BPZA 3D3QA 3CCJV 1XMQB 4CZZA 1QLEB 3KZIZ 1ENVA 5C93A 2Z5UA 4ZBMA 2IU0A 1FXKA 1IBMO 4PA3A 3R65A 4YIPA 4FLYA 2A79B 4X88A 4O4JB 4DR2O 2UUBB 4F6RB 4FM0A 3RYFB 3JALB 4K8ZA 3L73H 4CS4A 1W0KG 2OIEA 1HNWB 1H2NA 4FVMA 2YS8A 3E22B 4BIUA 1J95A 3E86A 1AROP 2VQFO 1FFTB 4JI0B 2HVKC 4U7NA 2IH1C 4DW1A 2ADPA 1RSOA 5IJ9A 3CMEV 2EIMB 4J7KA 3OE7G 3UKMA 3ABKB 5J2TA 3EXAA 1DTOA 2LFSA 3E89A 2ZNIA 2YIBD 3F5TA 2JJ2G 3J80N 2NNUA 3K57A 1AILA 1FS0G 2PY5A 4FZ1A 3FB6C 1XNRO 1XHXA 4UCVA 2X0LA 4LFAB 2OTJV 2E74B 2F43G 5D5PA 5JCOC 1RPRA 4OPAA 1WPBA 1OCRC 1N0JA 3CJHB 1H8HG 4I0XA 4O4LB 5LA6B 1NVPB 2MK3A 4UCOA 5IDJA 1GKFA 3RVYA 4U3FH 4EB6A 5B5EZ 3BEHA 1VEWA 1T5EA 4BAYA 4B3SO 3HKDA 1ZSPA 4W4LA 1H8EG 3DXRA 4JI8B 3SYPA 1URFA 1TUBB 3HKCB 4MVRA 1LUVA 4WFFA 5LP6A 4NB5A 2F23A 5H5NA 2E76B 1KP2A 3K5OA 3HKEA 1QBZA 1KP3A 4RQEA 4UCTA 4HYOA 3OTOB 1OCZC 1V54C 4DK1A 4DV5O 2YI9A 2ZDIC 2OCCB 3CHXA 1EN5A 1MSWD 3UO3A 1YSCA 3A0HZ 4WFHA 4NXNB 2Y0PA 3ICXA 2DOSA 1EFRG 3ASOC 2Q5ZA 1JMKC 3ZRVA 2X6BA 2JDIG 3IC7A 1HNZB 1KKCA 2JRIA 4U7OA 1EN6A 3BHPA 2P7TC 2RDCA 4LF6B 1K3EA 4DV1B 3RYIB 2A3QA 5FNVA 2QWRB 1GM8A 2QWNB 4IYHA 4TUYA 5CBFA 4B3MO 3E8FA 3W7WA 3ABUA 3L70H 2FL4A 1VQLV 4JI1O 4J10A 3ZMZA 3CCMV 4Z1VA 1RM1C 3CCEV 3JASB 3P3NA 5LXTA 1N34B 4FZ0A 3BY6A 2CAZC 5CBHA 4KL1A 1M57B 4H0LB 2RJZA 2UU9B 4PA7A 3QTCA 4F6EA 1Y6XA 2GUZB 4TOIA 5L3FA 2QJ1A 4LF8O 3E2EA 1BSMA 2YI8A 1KUQA 2A0LA 1WPXA 5IY5C 3E8GA 2PYJA 1VQ6V 4DYLA 1DLBA 4EKWA 1XHZA 1M1KW 2HJDA 3KG2A 2DYSB 3O65A 3J7AU 5BR8O 3QNEA 5KMGA 1HP8A 1PNMA 2Y69B 2OWOA 4UV9A 4I9QA 3EHBB 1R3KC 4JI7B 1N4CA 4OXSA 4JTCB 5FPOA 4KFMA 4JI6B 5IYZA 3T1HB 5IWAB 4WFEA 1GN4A 4AHCA 3UQ8A 4CH4A 5GONA 5JH7A 4RAIA 3WG7B 3B40A 5H9CA 4DR7B 5LL6Y 4XDLA 1Q6HA 3BRCA 3FB8C 3K58A 1Q6IA 1Y66A 3TXSA 4UVAA 1FXKB 1M5IA 3GWKC 4CH6A 2F95B 4DV6O 2LFRA 5LMUB 2JS3A 5CA0A 1JFFA 5JQGA 5KLVH 3CCUV 5HFMA 5KHHA 2UXNA 4QE7A 4GZRB 1JJOA 3JYCA 2AXTZ 4X66B 1RPOA 2ZE8A 3AG4B 4H44B 5EC2C 1FJGO 2AW9A 1NS1A 4MTGA 3QVNA 4WF9V 3QO5A 1OCOC 1R73A 1QVGU 2YXYA 1RSOB 5IJ9B 3F7YC 2P4VA 2IBZH 1O9GA 5EC1C 5J2TB 3N27A 4X9QA 2ITDC 2GHYA 2P22C 3ETQA 4RO2A 1ZUQA 3ZRWB 1BQ0A 3C90A 2QWQB 1HNXB 4JI4B 4DV3B 2WLNA 3LSUA 5L3DA 2Q0AA 4X64B 4I0XB 3OM3B 2P90A 1AR5A 1I0HA 2AHZA 5FLXN 4EB6B 2D2CB 4CS2A 2BOCC 3HKDB 1IBLB 3ML0A 1QLEC 3DXRB 1SZXA 2WA3A 4QNHB 3T2MA 1PPJH 4DO2A 2HHHO 4FIPC 4P2ZA 1JPXA 1EZJA 4MTFA 5LP6B 4X89A 4JAVA 2IU3A 5BXZA 4I55A 2QKCA 4MTOA 3H01A 1FAFA 3HKEB 2HG5C 3I5DA 2DE0X 4KHPB 4R7CA 4X1YA 2QTSA 1H2LA 3RYCA 3OR6C 1MMMA 1PP9H 4IGGA 4X8AA 5IYCO 4DW0A 1G4YB 1XBLA 2Q7HA 2C2AA 3U11A 2EIMC 4O2AA 3WFVA 3RFRA 1N32B 3ABKC 4KXRA 4C7UA 1K33A 3H1HH 4FFBA 5LYJA 3AEIA 1I94B 5LMNO 5J2UA 3LDCA 1IURA 1NZ6A 2CH7A 2WLHA 3I56V 3HPLC 5FNVB 4DRXA 2CTPA 4TUYB 4ZOLA 2JK5C 3EFFK 2Y0IA 4MTXA 4DR3O 3FD9A 3TGUH 1H2KA 1Q43A 2CK3G 5LXTB 5L3EA 1NBMG 1P7GA 2W0XA 1GO3F 1QQCA 1SETA 3K9SA 1VQPV 2UXBO 5IE9A 4TT3G 1K34A 2ZE7A 4FLXA 3CYOA 4D6TH 4DR1B 4YHHB 3PJSK 3U10A 3MAQA 2X6CA 1GH6A 2N04A 2EINB 1BHAA 4AILC 4YY3B 1NKDA 2XUMA 1YCIA 4GX1A 2M6YA 1X59A 2GTSA 1HR0O 3ZHTA 2CTQA 2DWDC 2K9PA 1B04A 2P06A 5KMGB 2WLIA 3ASNB 1Y4MA 4KUMA 1YJWV 2VQEB 1AI7A 4LFCO 5LBQA 1CP9A 1N36B 3MD0A 1VIBA 1VF6A 2AZ0A 1W59A 2OCCC 4JYBA 4J9ZB 3CRRA 5IT9N 5IYZB 2KG7A 5C8YA 4R6ZA 1H2SB 3SJQC 1SZTA 5ITZA 1WLEA 5EIBD 3ETDA 4NXMB 4PA9A 5GONB 5JH7B 3J81N 1GN3A 4JYCA 1NI8A 2WWWA 4TV8A 3MHSC 4DV2B 3MHHC 1JJ2U 1SA0A 3UT5A 4QPJA 4LR3A 3N2KA 3LUTB 2ZXWB 1XQ8A 3OD4A 3PN1A 4R8CA 2Y48A 3L74H 4YJ2A 4LF9B 2GBOA 2ARHA 5CA0B 1JFFB 5GW7A 5JQGB 3E83A 4NTYA 3CCVV 2YEVA 1KQSU 1R6KA 2UUAB 3LNNA 3JD4A 1HW7A 1VQ4V 2R9AA 5KX5A 3O9OA 3D8CA 4UCRA 1SQVH 2GSMB 2ZE5A 4GKJB 1WB7A 2ZINA 1NTZH 2QM8A 1A32A 4GUNA 3IFXA 2DYSC 1P49A 1SERA 1QR8A 1VQNV 2KB1A 1HNWO
chains in the Genus database with same CATH topology
3H1KH 4PD4F 1SQBH 1NTMH 3L74H 3H1JH 1SQVH 1L0LH 3L71H 1BCCH 1PP9H 1BGYH 5KLVH 3CX5F 3L75H 1SQQH 1NTZH 1NU1H 1BE3H 1PPJH 2FYUH 3CXHF 1P84F 3L73H 4D6TH 2IBZH 1KYOF 3L70H 3H1IH 3CWBH 2BCCH 1KB9F 1NTKH 3L72H 1EZVH 3TGUH 2A06H 1SQXH 1L0NH 1SQPH 3BCCH 4U3FH 3H1HH 3H1LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K H;  4PD4 F;  1SQB H;  1NTM H;  3L74 H;  3H1J H;  1SQV H;  1L0L H;  3L71 H;  1BCC H;  1PP9 H;  1BGY H;  5KLV H;  3CX5 F;  3L75 H;  1SQQ H;  1NTZ H;  1NU1 H;  1BE3 H;  1PPJ H;  2FYU H;  3CXH F;  1P84 F;  3L73 H;  4D6T H;  2IBZ H;  1KYO F;  3L70 H;  3H1I H;  3CWB H;  2BCC H;  1KB9 F;  1NTK H;  3L72 H;  1EZV H;  3TGU H;  2A06 H;  1SQX H;  1L0N H;  1SQP H;  3BCC H;  4U3F H;  3H1H H;  3H1L H; 
#chains in the Genus database with same CATH topology
 3D36 A;  4RQF A;  1NTM H;  1VQ5 V;  4JAU A;  4PDR A;  1Q5O A;  3ZHV A;  3F5W C;  4E2L A;  2FKX A;  3ZN0 A;  1S5H C;  5CB4 A;  2FML A;  4Z2W A;  2F66 C;  5BMV B;  3WG7 C;  2XOK G;  2D3O W;  1EM1 A;  1KEC A;  4O2B A;  4PA6 A;  3B4S A;  4JTD B;  4MVQ A;  3DSQ A;  3CX5 F;  2BTO A;  1K9M W;  1LR1 A;  1Q81 W;  3SYO A;  3HKB A;  3P3P A;  2UUC B;  1FXK C;  1UFI A;  2NR5 A;  4H13 B;  1Q90 D;  3IJ4 A;  4TSF G;  1XMO B;  2B1G A;  4I55 B;  1YTF D;  4BIO A;  3APQ A;  5DED A;  3JD1 A;  3EVK A;  1CEZ A;  4X1Y B;  2RN9 A;  1SF9 A;  3RYC B;  3JD0 A;  1ROP A;  3AG4 C;  4JYA B;  4PA4 A;  1SS3 A;  3DC5 A;  1S3J A;  1BT8 A;  2N74 A;  2QDO A;  3Q4H A;  4JI3 O;  1QLN A;  1MA1 A;  2AGA A;  4EFE A;  1I5Y A;  4DUY O;  1BMF G;  4O2A B;  1U97 A;  5JWP A;  2KSD A;  4NR1 A;  3CMA V;  2A7W A;  3A0B Z;  4FFB B;  2YIB A;  5LYJ B;  1AI5 A;  4IL6 Z;  4DUZ O;  4I50 B;  5J2U B;  4RUF A;  3B09 A;  2CH7 B;  4DR4 O;  1DK1 A;  4AQY O;  4X65 O;  4DRX B;  3G6E V;  2CDY A;  4ZOL B;  4DR2 B;  5BZB A;  3B8N A;  2R9R B;  3RVZ A;  1UPG A;  3I55 V;  4MVZ A;  1F4M A;  4LF5 O;  4EFB A;  2VQF B;  2MW2 B;  3FX7 A;  4L87 A;  4CC5 A;  1R3J C;  3QO8 A;  1AP5 A;  5B1B C;  3CRQ A;  2JEU A;  1KU9 A;  1Y74 A;  1F4N A;  1RFY A;  5LP6 C;  4PDV A;  2E75 B;  3W7T A;  2PGG A;  2EIJ C;  3AG2 B;  3CSX A;  2ADQ B;  3SGI A;  2CGN A;  2YIA A;  2WLI B;  2ZDI A;  3BA9 A;  2LO1 A;  5EBW C;  5JJN B;  3X2Q B;  3CWB H;  2BCC H;  1XNR B;  2EIK B;  3CEI A;  5LGU A;  2F1M A;  1FPO A;  1U96 A;  4XDJ A;  3ZCC A;  2WLM A;  1EN4 A;  3SJB C;  2KG7 B;  1MAB G;  1FD9 A;  3MDS A;  5L3G A;  4GCZ A;  5C8Y B;  4BIZ A;  1GM9 A;  2PF4 E;  5ITZ B;  4UXN A;  4JZ2 A;  4IYI A;  3BAB A;  4TV8 B;  3ZBH A;  3JCZ A;  4LF7 O;  1SA0 B;  3UT5 B;  2AHY A;  4B3S B;  3N2K B;  2R72 A;  2HP8 A;  3T1Y O;  4DV7 O;  5DN6 G;  1LNQ A;  1THZ A;  2Q69 A;  3H1J H;  3SJA C;  3T1H O;  2PI5 A;  2QR4 A;  2F4V O;  4YJ2 B;  2IJK A;  4G27 B;  4IHJ A;  5B3S C;  1S5J A;  2V7Q G;  2YEV B;  3K5M A;  1VF7 A;  3JD2 A;  3ZMV A;  5BY1 A;  4DV5 B;  3BFR A;  4E4E A;  3OT7 A;  1CPY A;  4PD4 F;  1VP7 A;  2X6A A;  1Z5V A;  1YHQ V;  4OX9 O;  2ZR3 A;  3WB1 A;  5HFL A;  1JQ0 A;  1VMG A;  4MVS A;  2EIN C;  1PV0 A;  4Q6G A;  5LMU O;  1DGS A;  2LW7 A;  1SC5 B;  1NR7 A;  3RW0 A;  5EBL C;  1IBK O;  3K9A A;  4N23 A;  2ZIM A;  1S77 D;  1MNG A;  1YEW A;  2DYR B;  3TCU A;  2BSK A;  1F23 A;  4MVO A;  2WAM A;  1PL0 A;  1N33 O;  1YVW A;  1KD1 W;  4UVB A;  3STL C;  3IGA C;  3NR7 A;  1F7Y A;  4B3M B;  2OTL V;  1KC8 W;  1K92 A;  4JI1 B;  2L6L A;  2XAH A;  2DQ3 A;  2GDS A;  3CRC A;  2Z0A A;  4A5U B;  5CA1 A;  3L9D A;  5CB4 B;  2JGD A;  4JI2 O;  1YDX A;  4JF3 A;  1ZTE A;  1J5E O;  2YDE A;  4LF8 B;  3H1K H;  2GTA A;  4O2B B;  4QJF B;  2CTR A;  3A8T A;  5LGT A;  3OGC C;  1S72 V;  4FLU A;  4K35 A;  1XNQ O;  1KBH A;  1R3I C;  4DK0 A;  1GRJ A;  1NU1 H;  2VRZ A;  2Q9L A;  4PI0 A;  1M56 B;  3ZMU A;  1N8R W;  4QGP A;  2KQX A;  2Q7E A;  3HKB B;  2ZXW C;  1H38 A;  4D7S A;  1SQF A;  2GV9 A;  1L1F A;  5CA3 A;  3ZS8 C;  2A06 H;  5BR8 B;  2XTA A;  2ZM6 O;  1YIJ V;  1VQ8 V;  4Q20 A;  1TVK A;  4O4H A;  3K59 A;  3K08 A;  4WBN A;  1YTF B;  5K1P A;  3A0R A;  3LDD A;  2EUL A;  2UXC O;  2RCV A;  5LOV A;  3AG1 B;  1XOU A;  3Q4H B;  1D5A A;  4WFG A;  3TK1 A;  3OEE G;  4ZKI A;  2JS5 A;  1K73 W;  4K0K O;  3VQX A;  4YIO A;  1EBO A;  1S5L Z;  2Q0O C;  1SRY A;  1HDJ A;  1WP7 A;  4U3J A;  3CC4 V;  5EYP A;  2IM9 A;  3JCU Z;  4DR5 O;  2CUG A;  1Z2G A;  4JI5 O;  1MZE A;  2PI4 A;  4X62 O;  2IJJ A;  1SQX H;  2L35 A;  4DV6 B;  5JVD A;  5IJ0 A;  4ZI7 A;  1S0V A;  3JAT A;  2KKW A;  3SPG A;  2R9I A;  2ZIO A;  1NR1 A;  2H3O A;  2Y4U A;  3LSS A;  3ZX6 A;  1FJG B;  3SPC A;  5B1N A;  4EEQ A;  4B3R O;  2DN9 A;  1IXB A;  5L3B A;  1IDS A;  4JTA B;  1S76 D;  1Y74 B;  4GKK B;  3H9V A;  4HAM A;  2E5L O;  2DQ0 A;  1JX9 A;  1ZX3 A;  1B3Q A;  1AJP A;  2WPD G;  4B3T B;  1TGO A;  4UUJ C;  1NJI W;  1Q7Y W;  3B8M A;  3SYA A;  2VWJ A;  2LGQ A;  1LUW A;  1Q3E A;  2LP7 A;  4X1K A;  4DR6 O;  1G8M A;  1PNK A;  4YY3 O;  3L75 H;  1BS3 A;  3M7M X;  1WA8 A;  4P9P A;  4HNA A;  3CRA A;  5DEC A;  1SQP H;  1AJN A;  3TJT A;  4LF4 O;  1SQB H;  2HHH B;  1BQZ A;  1G6U A;  3F7V C;  5B1A B;  5LHG A;  4QIW F;  3DTU B;  4IHJ B;  4DV4 O;  4LH7 A;  3CPW U;  4NXM O;  2ILM A;  1FYJ A;  5KHI A;  2RNB A;  3JAM N;  5IY5 B;  2EIL B;  1P4R A;  2EZO A;  2QM7 A;  3ZN1 A;  4QE9 A;  1NH2 D;  4LWS A;  2Q8V A;  2EBO A;  4D7T A;  5GTI Z;  4WFB V;  5EZY A;  1OZ0 A;  2QA4 V;  3ZHU A;  3CCQ V;  2HJF C;  1M4U A;  4DV0 B;  3T1C A;  5H2F Z;  4NTW A;  1NTK H;  2B1I A;  1YXB A;  1EZV H;  3AK2 A;  4DXW A;  1M9N A;  1L0N H;  1QR9 A;  5LMN B;  3K5N A;  1FFX A;  3BVO A;  4JAS A;  2JEX A;  1TA8 A;  3STZ C;  4MS2 A;  3X2Q C;  1BCC H;  4JYY A;  4NTX A;  1VF6 C;  3SJC C;  1JOY A;  4LFB O;  3ZHS A;  5H6R A;  2Y4T A;  4FK5 C;  1XEQ A;  3N2G A;  3WB2 A;  5IYD O;  1L8D A;  1XL4 A;  5CA1 B;  2JGD B;  4LC1 A;  3GB7 C;  2XAF A;  4RWU A;  2UXB B;  2LQT A;  2YXH A;  1K8A W;  4J41 A;  3WB0 A;  2IH3 C;  5EIB C;  2IW5 A;  3VQW A;  1SKV A;  4GX2 A;  1UJW B;  2UXD O;  3G4S V;  2EX3 A;  5J9P C;  2BOB C;  4JV5 O;  1Q6U A;  1M57 C;  3SYC A;  1AB3 A;  1H2G A;  1XMQ O;  1HR0 B;  2YXL A;  5A2Q N;  2W6I G;  4FLW A;  4JGS A;  1Y67 A;  1MSD A;  4YXW G;  5KUM A;  1JCH A;  4LFC B;  2K1E A;  3W7S A;  1TVK B;  2JJ1 G;  2YID A;  4O4H B;  4PEL A;  2YIC A;  4OGQ B;  4X1I A;  3APO A;  4WBN B;  1OCO B;  1NT2 B;  2ODM A;  2UUB O;  3H1I H;  5DM6 V;  1ZWI C;  5LOV B;  1XUQ A;  1VF5 B;  4WCE V;  2Y69 C;  2ZT9 B;  5K1X A;  5KA6 A;  1HWY A;  3GWO A;  3CCS V;  4ICG A;  4JI0 O;  1SQG A;  4JZG A;  4U3J B;  2XAS A;  3ZHQ A;  5EYP B;  1YZB A;  2R70 A;  4B7E A;  1BZK A;  3CC7 V;  1E79 G;  4KP4 A;  1VQM V;  2Q67 A;  3IC9 A;  3QG5 A;  3RWR D;  3RYH A;  2QKA A;  2XND G;  4HZ3 A;  4UB6 Z;  5JVD B;  5IJ0 B;  1Y76 A;  4ZI7 B;  1K97 A;  3JAT B;  4LFA O;  2QKS A;  4TV9 A;  3K0D A;  1IZ3 A;  3UM7 A;  1D2D A;  1IVS A;  3W7X A;  3BA8 A;  1V55 B;  1QU7 A;  1YF2 A;  3S3X A;  3HR0 A;  4QPK A;  2RMK B;  4FLZ A;  3AG3 B;  4ZIB A;  2XHB A;  3ETG A;  4LH6 A;  2QE7 G;  1M56 C;  3P32 A;  2P4K A;  4ZHQ A;  1VQ7 V;  2LGW A;  3SYQ A;  1I5X A;  1JVM A;  5KUK A;  3CCL V;  2CGO A;  4NKG B;  4JI8 O;  4YJ3 A;  3CD6 V;  4J7Z A;  2HEP A;  1G1X B;  5B1O A;  1K5S A;  3E8H A;  1CXZ B;  2P67 A;  5KA5 A;  4JPR A;  3ABT A;  4F4L A;  1Z5W A;  3C3T A;  2B5U A;  3AG1 C;  1ZL8 A;  4X1K B;  5EBM C;  1IX9 A;  2HFE C;  1YJN V;  3OTO O;  3D3I A;  1K7D A;  1B6Q A;  3ZRS A;  5JCO A;  4PDL A;  4CH3 A;  1GMG A;  1WA8 B;  1IBM B;  4J42 A;  2VS0 A;  2X7R B;  3RN4 A;  3VBB A;  4HNA B;  3ZRW A;  4NXN O;  1BHB A;  4GX5 A;  4R50 A;  4FFK A;  5D5Q A;  2LJ2 A;  4L8J A;  3ZMT A;  1HNZ O;  3ABM B;  1P7B A;  1PNL A;  5KHJ A;  4LF6 O;  5LGN A;  4DV1 O;  4FMT A;  4BW9 A;  1N0N A;  2VWK A;  2IJH A;  5KAI Z;  2NN4 A;  1QVF U;  3JAK A;  3OGI B;  4CH5 A;  2EJ7 A;  4MSW C;  1US6 A;  3JD3 A;  2Q73 A;  4TQD A;  2YC0 A;  2A9H A;  4JAA A;  1N34 O;  3BAA A;  1DF5 A;  1X4T A;  4LWS B;  4JI3 B;  1W0J G;  4MW3 A;  3WU2 Z;  4FLT A;  5EZY B;  3CXH F;  2HVJ C;  2UU9 O;  4DUY B;  5KHG A;  3ZMS A;  1NH2 B;  3JAW A;  3TXQ A;  3G67 A;  4FPP A;  5AG2 A;  3VQY A;  3JAR A;  4FM2 A;  5GTH Z;  2PUS A;  4DUZ B;  1FFX B;  5KAF Z;  4DR4 B;  4MVU A;  2FB5 A;  2Q7G A;  3L71 H;  4AQY B;  4X65 B;  1GAX A;  3R66 A;  1Q82 W;  1WAZ A;  2WSS G;  2ITC C;  4BW5 A;  2XAJ A;  4JI7 O;  3N2G B;  1M93 A;  4I7Z B;  2BTQ A;  3H1L H;  3ABL B;  1WN7 A;  4JI6 O;  4LF5 B;  3GVM A;  4GYC B;  5IWA O;  4IIJ A;  2Q4P A;  5CBG A;  4K3A A;  2W6J G;  2Z3Y A;  1AJQ A;  4H33 A;  1NQT A;  5KHK A;  2EZP A;  4DR7 O;  4I9W A;  5E1A C;  5B1A C;  2OYQ A;  1GM7 A;  2JGU A;  3K03 A;  4K8X A;  1W2B U;  3FAV A;  3G80 A;  3T4Z A;  5L3C A;  4O4I A;  1R1B A;  4TWK A;  5KX5 B;  3OFN G;  1OCC B;  4CC6 A;  1WP8 A;  4X1I B;  3K79 A;  3OEH G;  3SDL A;  2EIL C;  2G38 A;  3K06 A;  4TQF A;  3TET A;  2QM4 A;  3K04 A;  5CN0 A;  4X66 O;  3HB3 B;  3ASN C;  1I7F A;  2M7W A;  3CC2 V;  1ORQ C;  4LF7 B;  2AZ2 A;  5LHH A;  1DF4 A;  3LSQ A;  1KYO F;  3T1Y B;  2RQ6 A;  4DV7 B;  1IXM A;  5JJJ B;  3JSL A;  1WNS A;  4IT5 A;  1XDC A;  2DMX A;  2QWP B;  2WLL A;  2F4V B;  4UFZ A;  2DW4 A;  3RYH B;  2F93 B;  3FFQ A;  4MT8 A;  4PDM A;  1Y76 B;  3QF7 A;  1HNX O;  4P30 A;  4JI4 O;  4DV3 O;  3T4D A;  4TV9 B;  1VAR A;  2PTM A;  4RUE A;  3LNM B;  4I4T A;  1VQO V;  3B2E E;  4X64 O;  4GLX A;  1QHT A;  2NLJ C;  1OJH A;  3OUF A;  4LCU C;  4OX9 B;  3VQV A;  2LW1 A;  3C3S A;  4X20 A;  3G71 V;  2ZE6 A;  1BL8 A;  3CS5 A;  4WFA V;  4ZHQ B;  3K5L A;  1R3L C;  3KCX A;  2XAQ A;  1IBK B;  5H6Q A;  2JIZ G;  4LNU A;  1IBL O;  2N05 A;  2ZR2 A;  4LP8 A;  2UXX A;  4YJ3 B;  2QSA A;  1N33 B;  3P30 A;  1K4C C;  3M99 B;  3IAY A;  2ZCE A;  1XRE A;  1K5Q A;  4KHP O;  1ZL8 B;  2QTO A;  1SQQ H;  3E35 A;  3KKY A;  4MVM A;  1BE3 H;  2FYU H;  4GKK O;  5TIS Z;  2CTW A;  1JA8 A;  4JI2 B;  3LDE A;  4J11 A;  1WJZ A;  1J5E B;  1KB9 F;  3AG7 A;  3RGB A;  1OCR B;  4B3T O;  4NVP A;  2PYL A;  1XNQ B;  1B06 A;  5FPR A;  2ZKO A;  2HLD G;  1N32 O;  2OIG A;  2YUA A;  4G2K A;  3CP1 A;  2QWO B;  1I94 O;  2ATK C;  3B77 A;  1OHH G;  2CE4 A;  1VQK V;  2ZM6 B;  1VQ9 V;  5BMV A;  4PV1 B;  2YSU B;  3S3W A;  1AI6 A;  2Q68 A;  4LBE C;  3JAK B;  3RT3 C;  4O4J A;  1RP3 B;  2V4D A;  3ZRX A;  4F6R A;  1XL6 A;  2UXC B;  1BGY H;  4UVC A;  1M90 W;  1V55 C;  3ZIA G;  1PM9 A;  3JAL A;  3RYF A;  5B1B B;  1MOF A;  3UO2 A;  1OCZ B;  3AG3 C;  2FTK A;  1FXH A;  1V54 B;  2EIJ B;  4K0K B;  1E1Q G;  3E8B A;  3E22 A;  4J7J A;  2ZD9 A;  1R6N A;  1PD3 A;  1WB8 A;  3JAW B;  3L72 H;  4DR1 O;  4YHH O;  3JAR B;  2WA4 A;  4XBF A;  1R6T A;  2WLK A;  1TAE A;  3OTF A;  3NXS A;  3ASO B;  5F2V O;  4G28 B;  3SPH A;  1GK9 A;  4DR5 B;  3G6B A;  2V1D A;  4JI5 B;  4W4K A;  4AI8 A;  4X62 B;  2E3C A;  2ZQM A;  4MW8 A;  1FKA O;  3M8A A;  4DV0 O;  2P6J A;  3U0Z A;  2VQE O;  1N36 O;  1YIT V;  2W0F C;  3FYE B;  4B7K A;  1MZF A;  3DC6 A;  1COW G;  5LHI A;  3OAA G;  3A2F A;  1NVP D;  1MG1 A;  2EJR A;  3ETE A;  2BTQ B;  4I50 A;  4UB8 Z;  1RM1 B;  1L0L H;  1YJ9 V;  2HR3 A;  3CJH A;  4O4L A;  5LA6 A;  1AP6 A;  4IIJ B;  4B3R B;  4FLV A;  5A9G A;  1AVM A;  2Q6A A;  4NYK A;  1GN6 A;  3OMI B;  1TUE B;  4ASU G;  2ETN A;  5B3S B;  4DV2 O;  2B9Z A;  1I08 A;  4FM1 A;  4GX0 A;  3ABM C;  1D5N A;  2E5L B;  3CXC U;  3SPJ A;  2H8P C;  3FAV B;  5JJE B;  2IJI A;  4O4I B;  1Q8I A;  1TUB A;  3HKC A;  4UV8 A;  3FKS G;  4Z1M G;  1AR1 B;  3CE2 A;  3CCR V;  4OPH A;  4LF9 O;  3SPI A;  3ZJZ A;  4CBC A;  2WLJ A;  1K4D C;  3AG2 C;  4DR6 B;  2BSK B;  1O9H A;  2UUA O;  4UCU A;  2DJV A;  4ABM A;  2P5O A;  3CRM A;  5FL7 G;  5B66 Z;  2EIK C;  4P9O A;  3OW2 U;  2XT9 A;  3QO7 A;  4PJ0 Z;  4DR3 B;  3AK1 A;  4GKJ O;  2OCH A;  1YI2 V;  4LF4 B;  3AK3 A;  2BE3 A;  2WLL B;  2JVD A;  4GT1 A;  3ZED A;  1GN2 A;  4I5S A;  3K0G A;  1Q86 W;  3RYI A;  1JR9 A;  1QCE A;  1GTO A;  3RBZ A;  4DV4 B;  5CMU A;  3KCY A;  4J80 A;  1F51 A;  2ZNJ A;  3ABL C;  3DGE A;  3JSN A;  3JAS A;  4I4T B;  2H94 A;  2DWE C;  3OR7 C;  4XDK A;  5EK0 A;  1FXV A;  1ZLZ A;  4H37 A;  3CB2 A;  4X20 B;  2GUZ A;  4UCS A;  4J9Y B;  3OUS A;  2PZS A;  2XAG A;  4CS3 A;  1H2M A;  4N21 A;  4LNU B;  3FYI B;  3SR2 C;  1E1R G;  3UCS C;  2UUC O;  3OMN B;  1V9P A;  1OCC C;  1PL4 A;  4PHZ A;  4B08 A;  3ZHR A;  4FJC C;  1XMO O;  2OT5 A;  4LFB B;  3VOU A;  2DYR C;  1QNM A;  1P84 F;  2O57 A;  1PKX A;  4BR6 A;  3FB7 C;  3K3W A;  4BWA A;  4HBN A;  3THO A;  1KMI Z;  4JYA O;  3FB5 C;  3OMA B;  3D36 C;  5E79 Z;  5IYB O;  3BCC H;  1ZAU A;  3W7U A;  2QGN A;  1OV9 A;  4PI2 A;  2HKO A;  2UXD B;  1XIL A;  1KKD A;  1XI1 A;  1SES A;  4JV5 B;  1AI4 A;  1AR4 A;  2QEX V;  3BPZ A;  3D3Q A;  3CCJ V;  1XMQ B;  4CZZ A;  1QLE B;  3KZI Z;  1ENV A;  5C93 A;  2Z5U A;  4ZBM A;  2IU0 A;  1FXK A;  1IBM O;  4PA3 A;  3R65 A;  4YIP A;  4FLY A;  2A79 B;  4X88 A;  4O4J B;  4DR2 O;  2UUB B;  4F6R B;  4FM0 A;  3RYF B;  3JAL B;  4K8Z A;  3L73 H;  4CS4 A;  1W0K G;  2OIE A;  1HNW B;  1H2N A;  4FVM A;  2YS8 A;  3E22 B;  4BIU A;  1J95 A;  3E86 A;  1ARO P;  2VQF O;  1FFT B;  4JI0 B;  2HVK C;  4U7N A;  2IH1 C;  4DW1 A;  2ADP A;  1RSO A;  5IJ9 A;  3CME V;  2EIM B;  4J7K A;  3OE7 G;  3UKM A;  3ABK B;  5J2T A;  3EXA A;  1DTO A;  2LFS A;  3E89 A;  2ZNI A;  2YIB D;  3F5T A;  2JJ2 G;  3J80 N;  2NNU A;  3K57 A;  1AIL A;  1FS0 G;  2PY5 A;  4FZ1 A;  3FB6 C;  1XNR O;  1XHX A;  4UCV A;  2X0L A;  4LFA B;  2OTJ V;  2E74 B;  2F43 G;  5D5P A;  5JCO C;  1RPR A;  4OPA A;  1WPB A;  1OCR C;  1N0J A;  3CJH B;  1H8H G;  4I0X A;  4O4L B;  5LA6 B;  1NVP B;  2MK3 A;  4UCO A;  5IDJ A;  1GKF A;  3RVY A;  4U3F H;  4EB6 A;  5B5E Z;  3BEH A;  1VEW A;  1T5E A;  4BAY A;  4B3S O;  3HKD A;  1ZSP A;  4W4L A;  1H8E G;  3DXR A;  4JI8 B;  3SYP A;  1URF A;  1TUB B;  3HKC B;  4MVR A;  1LUV A;  4WFF A;  5LP6 A;  4NB5 A;  2F23 A;  5H5N A;  2E76 B;  1KP2 A;  3K5O A;  3HKE A;  1QBZ A;  1KP3 A;  4RQE A;  4UCT A;  4HYO A;  3OTO B;  1OCZ C;  1V54 C;  4DK1 A;  4DV5 O;  2YI9 A;  2ZDI C;  2OCC B;  3CHX A;  1EN5 A;  1MSW D;  3UO3 A;  1YSC A;  3A0H Z;  4WFH A;  4NXN B;  2Y0P A;  3ICX A;  2DOS A;  1EFR G;  3ASO C;  2Q5Z A;  1JMK C;  3ZRV A;  2X6B A;  2JDI G;  3IC7 A;  1HNZ B;  1KKC A;  2JRI A;  4U7O A;  1EN6 A;  3BHP A;  2P7T C;  2RDC A;  4LF6 B;  1K3E A;  4DV1 B;  3RYI B;  2A3Q A;  5FNV A;  2QWR B;  1GM8 A;  2QWN B;  4IYH A;  4TUY A;  5CBF A;  4B3M O;  3E8F A;  3W7W A;  3ABU A;  3L70 H;  2FL4 A;  1VQL V;  4JI1 O;  4J10 A;  3ZMZ A;  3CCM V;  4Z1V A;  1RM1 C;  3CCE V;  3JAS B;  3P3N A;  5LXT A;  1N34 B;  4FZ0 A;  3BY6 A;  2CAZ C;  5CBH A;  4KL1 A;  1M57 B;  4H0L B;  2RJZ A;  2UU9 B;  4PA7 A;  3QTC A;  4F6E A;  1Y6X A;  2GUZ B;  4TOI A;  5L3F A;  2QJ1 A;  4LF8 O;  3E2E A;  1BSM A;  2YI8 A;  1KUQ A;  2A0L A;  1WPX A;  5IY5 C;  3E8G A;  2PYJ A;  1VQ6 V;  4DYL A;  1DLB A;  4EKW A;  1XHZ A;  1M1K W;  2HJD A;  3KG2 A;  2DYS B;  3O65 A;  3J7A U;  5BR8 O;  3QNE A;  5KMG A;  1HP8 A;  1PNM A;  2Y69 B;  2OWO A;  4UV9 A;  4I9Q A;  3EHB B;  1R3K C;  4JI7 B;  1N4C A;  4OXS A;  4JTC B;  5FPO A;  4KFM A;  4JI6 B;  5IYZ A;  3T1H B;  5IWA B;  4WFE A;  1GN4 A;  4AHC A;  3UQ8 A;  4CH4 A;  5GON A;  5JH7 A;  4RAI A;  3WG7 B;  3B40 A;  5H9C A;  4DR7 B;  5LL6 Y;  4XDL A;  1Q6H A;  3BRC A;  3FB8 C;  3K58 A;  1Q6I A;  1Y66 A;  3TXS A;  4UVA A;  1FXK B;  1M5I A;  3GWK C;  4CH6 A;  2F95 B;  4DV6 O;  2LFR A;  5LMU B;  2JS3 A;  5CA0 A;  1JFF A;  5JQG A;  5KLV H;  3CCU V;  5HFM A;  5KHH A;  2UXN A;  4QE7 A;  4GZR B;  1JJO A;  3JYC A;  2AXT Z;  4X66 B;  1RPO A;  2ZE8 A;  3AG4 B;  4H44 B;  5EC2 C;  1FJG O;  2AW9 A;  1NS1 A;  4MTG A;  3QVN A;  4WF9 V;  3QO5 A;  1OCO C;  1R73 A;  1QVG U;  2YXY A;  1RSO B;  5IJ9 B;  3F7Y C;  2P4V A;  2IBZ H;  1O9G A;  5EC1 C;  5J2T B;  3N27 A;  4X9Q A;  2ITD C;  2GHY A;  2P22 C;  3ETQ A;  4RO2 A;  1ZUQ A;  3ZRW B;  1BQ0 A;  3C90 A;  2QWQ B;  1HNX B;  4JI4 B;  4DV3 B;  2WLN A;  3LSU A;  5L3D A;  2Q0A A;  4X64 B;  4I0X B;  3OM3 B;  2P90 A;  1AR5 A;  1I0H A;  2AHZ A;  5FLX N;  4EB6 B;  2D2C B;  4CS2 A;  2BOC C;  3HKD B;  1IBL B;  3ML0 A;  1QLE C;  3DXR B;  1SZX A;  2WA3 A;  4QNH B;  3T2M A;  1PPJ H;  4DO2 A;  2HHH O;  4FIP C;  4P2Z A;  1JPX A;  1EZJ A;  4MTF A;  5LP6 B;  4X89 A;  4JAV A;  2IU3 A;  5BXZ A;  4I55 A;  2QKC A;  4MTO A;  3H01 A;  1FAF A;  3HKE B;  2HG5 C;  3I5D A;  2DE0 X;  4KHP B;  4R7C A;  4X1Y A;  2QTS A;  1H2L A;  3RYC A;  3OR6 C;  1MMM A;  1PP9 H;  4IGG A;  4X8A A;  5IYC O;  4DW0 A;  1G4Y B;  1XBL A;  2Q7H A;  2C2A A;  3U11 A;  2EIM C;  4O2A A;  3WFV A;  3RFR A;  1N32 B;  3ABK C;  4KXR A;  4C7U A;  1K33 A;  3H1H H;  4FFB A;  5LYJ A;  3AEI A;  1I94 B;  5LMN O;  5J2U A;  3LDC A;  1IUR A;  1NZ6 A;  2CH7 A;  2WLH A;  3I56 V;  3HPL C;  5FNV B;  4DRX A;  2CTP A;  4TUY B;  4ZOL A;  2JK5 C;  3EFF K;  2Y0I A;  4MTX A;  4DR3 O;  3FD9 A;  3TGU H;  1H2K A;  1Q43 A;  2CK3 G;  5LXT B;  5L3E A;  1NBM G;  1P7G A;  2W0X A;  1GO3 F;  1QQC A;  1SET A;  3K9S A;  1VQP V;  2UXB O;  5IE9 A;  4TT3 G;  1K34 A;  2ZE7 A;  4FLX A;  3CYO A;  4D6T H;  4DR1 B;  4YHH B;  3PJS K;  3U10 A;  3MAQ A;  2X6C A;  1GH6 A;  2N04 A;  2EIN B;  1BHA A;  4AIL C;  4YY3 B;  1NKD A;  2XUM A;  1YCI A;  4GX1 A;  2M6Y A;  1X59 A;  2GTS A;  1HR0 O;  3ZHT A;  2CTQ A;  2DWD C;  2K9P A;  1B04 A;  2P06 A;  5KMG B;  2WLI A;  3ASN B;  1Y4M A;  4KUM A;  1YJW V;  2VQE B;  1AI7 A;  4LFC O;  5LBQ A;  1CP9 A;  1N36 B;  3MD0 A;  1VIB A;  1VF6 A;  2AZ0 A;  1W59 A;  2OCC C;  4JYB A;  4J9Z B;  3CRR A;  5IT9 N;  5IYZ B;  2KG7 A;  5C8Y A;  4R6Z A;  1H2S B;  3SJQ C;  1SZT A;  5ITZ A;  1WLE A;  5EIB D;  3ETD A;  4NXM B;  4PA9 A;  5GON B;  5JH7 B;  3J81 N;  1GN3 A;  4JYC A;  1NI8 A;  2WWW A;  4TV8 A;  3MHS C;  4DV2 B;  3MHH C;  1JJ2 U;  1SA0 A;  3UT5 A;  4QPJ A;  4LR3 A;  3N2K A;  3LUT B;  2ZXW B;  1XQ8 A;  3OD4 A;  3PN1 A;  4R8C A;  2Y48 A;  3L74 H;  4YJ2 A;  4LF9 B;  2GBO A;  2ARH A;  5CA0 B;  1JFF B;  5GW7 A;  5JQG B;  3E83 A;  4NTY A;  3CCV V;  2YEV A;  1KQS U;  1R6K A;  2UUA B;  3LNN A;  3JD4 A;  1HW7 A;  1VQ4 V;  2R9A A;  5KX5 A;  3O9O A;  3D8C A;  4UCR A;  1SQV H;  2GSM B;  2ZE5 A;  4GKJ B;  1WB7 A;  2ZIN A;  1NTZ H;  2QM8 A;  1A32 A;  4GUN A;  3IFX A;  2DYS C;  1P49 A;  1SER A;  1QR8 A;  1VQN V;  2KB1 A;  1HNW O; 
#chains in the Genus database with same CATH homology
 3H1K H;  4PD4 F;  1SQB H;  1NTM H;  3L74 H;  3H1J H;  1SQV H;  1L0L H;  3L71 H;  1BCC H;  1PP9 H;  1BGY H;  5KLV H;  3CX5 F;  3L75 H;  1SQQ H;  1NTZ H;  1NU1 H;  1BE3 H;  1PPJ H;  2FYU H;  3CXH F;  1P84 F;  3L73 H;  4D6T H;  2IBZ H;  1KYO F;  3L70 H;  3H1I H;  3CWB H;  2BCC H;  1KB9 F;  1NTK H;  3L72 H;  1EZV H;  3TGU H;  2A06 H;  1SQX H;  1L0N H;  1SQP H;  3BCC H;  4U3F H;  3H1H H;  3H1L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...