1NU1H

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1nu1H00
1BCCH 1NTZH 3L74H 1SQVH 2IBZH 1SQBH 1PP9H 4U3FH 1SQXH 1KYOF 1EZVH 1KB9F 3L72H 2A06H 3L75H 3CWBH 3BCCH 4PD4F 5KLVH 1NTMH 3H1HH 1L0NH 4D6TH 1L0LH 3CXHF 1SQQH 2BCCH 3H1KH 1PPJH 1NU1H 3L70H 3L73H 1NTKH 1BGYH 1SQPH 3L71H 3H1IH 3TGUH 3H1LH 1P84F 1BE3H 2FYUH 3CX5F 3H1JH
chains in the Genus database with same CATH superfamily
2ZIOA 1B3QA 4UV8A 5DEDA 3I5DA 1VQPV 2IBZH 3K9AA 3BEHA 1PNLA 2ZIMA 2UXDB 2R9IA 5TISZ 5BR8O 2GTAA 1WPBA 4G2KA 4JI0O 4DR4O 1I94O 4DK1A 5EZYA 3J7AU 4JI3B 3D36C 3T4DA 2WLHA 4ASUG 1K34A 3MD0A 4IHJB 4RAIA 2UXCO 1FXKA 3UO2A 1IXMA 3LSUA 1LNQA 3ZMTA 3CJHA 5GTHZ 2VQEO 5EK0A 2QKAA 3UQ8A 4P9OA 1FFXB 2EX3A 1BSMA 4DR1B 2BTQB 4UCTA 1ZL8B 2QSAA 1FS0G 2KSDA 1K4CC 2WLIB 5CBFA 1IVSA 2XTAA 1H2SB 2Q0AA 1FKAO 3BA8A 4KFMA 4F6RA 2A7WA 2WLNA 4O4JA 4BWAA 4DRXB 3CCMV 1MSDA 4X1YB 2F1MA 3JD1A 2VRZA 1KP2A 1PV0A 5FNVB 2YXHA 2E5LB 1G8MA 2WA3A 4DR7B 1AILA 1YZBA 4DW0A 1SQQH 2YEVA 3ZMVA 3CCJV 2GUZB 1THZA 5LGTA 2QKCA 3MHHC 1OCRB 3HB3B 4UXNA 4PA7A 1VQOV 3OMNB 2CK3G 3LDDA 3W7UA 2R72A 2BSKA 1MMMA 3SPGA 4BW9A 1AI4A 1S5HC 1ZWIC 2UUBB 4FVMA 2Q7EA 4GYCB 4E4EA 4CS4A 4JI2O 3KKYA 4L8JA 4IL6Z 1Q81W 2KG7A 3CYOA 4LF8O 2F4VO 1LUWA 4DR5B 3RWRD 1NTMH 1AP5A 1NKDA 2YIBD 1YXBA 4JV5O 1XOUA 1WJZA 3QTCA 2RCVA 1VARA 1GN4A 4O4IB 2EILC 1QHTA 3BABA 2YS8A 1R3KC 4P30A 4FK5C 4X20B 3OUFA 2YUAA 3GWOA 4FLUA 5B3SB 1N36B 1OCCC 1P7BA 4DV2O 1VMGA 3WU2Z 4NXNO 4X1IB 1S5LZ 3F7VC 3ZMZA 3K59A 5A9GA 1FJGB 4LFAB 4TSFG 4KL1A 2RN9A 4ICGA 1K5QA 2JGUA 1PNMA 2V1DA 5KAFZ 3FB6C 1EZVH 1KBHA 2UXBO 4DV4B 2VWJA 3GVMA 4I55B 2EZOA 2AZ0A 3Q4HA 1TUBB 3QO5A 4LCUC 1UPGA 3K58A 1XMQO 1BGYH 4DR6B 2LW1A 3K79A 1ZTEA 1Y66A 3ZRXA 3OMAB 1K97A 2QTSA 4UCSA 4GUNA 1OCZC 4DR3B 5EIBC 1OJHA 4PA4A 1E79G 1Z5WA 1XMOB 2WLJA 4DR2B 4BIUA 1SZXA 5D5QA 4Z1VA 4PA9A 4E2LA 3P30A 3CRMA 5IWAO 1E1RG 4OX9O 3HKCB 1JJ2U 1YEWA 3ABLC 4B7KA 1V54B 5EBWC 1G1XB 1EZJA 5CB4B 2ILMA 5CA0A 4IYHA 4AI8A 4WFHA 1N4CA 3ICXA 3WB0A 1DTOA 4JYAB 5B1AC 2Q7HA 2B9ZA 5KAIZ 4YJ3B 1JOYA 4NTYA 2UUCB 3G67A 1DK1A 1JCHA 3H1LH 3K9SA 4WCEV 2WLMA 1WB8A 3W7XA 2CTPA 1PP9H 2UU9O 4MVUA 1IXBA 4JAAA 1J95A 2RDCA 4PA3A 3VBBA 3ZHVA 4GZRB 1VQ6V 4PI2A 4MVQA 4J9YB 4WFBV 1NR1A 1R6KA 2P4VA 3AEIA 2NN4A 3CEIA 2XAHA 3K5MA 4D7TA 1QQCA 2Z0AA 3CCVV 5C8YB 3E2EA 4I5SA 4EB6B 1JVMA 4PD4F 3CRRA 4P9PA 3ZJZA 3JATA 4A5UB 4K35A 3DSQA 1XNRO 1AR4A 1R1BA 5GONB 4X89A 4I0XA 5KUMA 2RMKB 1RSOB 4BIOA 3T4ZA 1RPOA 4YY3O 2ZXWC 1BE3H 4UVBA 3FX7A 3GB7C 1JFFA 2QEXV 2DE0X 2ETNA 2HFEC 2X0LA 4F6EA 2C2AA 2IU3A 4U3JB 2EIJC 3A2FA 1RM1B 2KKWA 2DQ3A 1W59A 4GX0A 5IYZA 1ZLZA 3RN4A 3OTOO 1P4RA 4FLVA 3X2QB 5EC1C 3ABKB 3D36A 1KYOF 4JZ2A 1F4NA 2RJZA 4JTDB 5LMUB 2WWWA 1DGSA 5LBQA 3TGUH 5BR8B 5EZYB 3BPZA 4JI0B 4DR4B 3UM7A 1I94B 1COWG 3CE2A 3E22A 1FXVA 1SETA 3ZMSA 2ADPA 4QPKA 4QGPA 1R3IC 1FXKB 3ZMUA 4WFEA 3BVOA 5JWPA 4LWSA 2UXCB 5J9PC 1W2BU 1L0LH 5D5PA 4B3MO 2X6AA 2V4DA 3OEEG 2XT9A 1W0KG 4ABMA 3UT5A 4R50A 3ML0A 2CTRA 3ZS8C 3B2EE 2GHYA 2N04A 3D3IA 4X1KA 3A8TA 4RQFA 2W0FC 3P3PA 4F6RB 3SR2C 5ITZA 2ZR3A 4O4HA 2HVKC 5IYDO 3L73H 3VQYA 2QE7G 3ZHQA 2RQ6A 2H8PC 2RNBA 1SC5B 1YSCA 4JAUA 1QCEA 2YEVB 2XAJA 2EIMB 3S3WA 2B5UA 2A79B 4OPHA 4EEQA 5L3DA 3ZBHA 3B4SA 4ZHQA 2LP7A 3ZCCA 2QR4A 3BA9A 4FPPA 1QLEC 2Q9LA 2D3OW 3SPCA 2HR3A 3K0DA 4MS2A 1IBLO 5KUKA 3QF7A 3UKMA 2Q0OC 3SYCA 2Q6AA 2QDOA 3IJ4A 2ZQMA 1EFRG 3L75H 3SYQA 3AK2A 1FAFA 1PL4A 2N05A 3CSXA 2ATKC 3PN1A 4JI2B 2KG7B 3WFVA 4YIPA 1XHXA 2Z5UA 3BY6A 1ORQC 2FB5A 4LF8B 2F4VB 1SZTA 5JQGB 1XEQA 4MW8A 4FFKA 4LH7A 2GV9A 4JV5B 1X59A 1IBKB 4N23A 2F95B 3QG5A 1S3JA 2DYRB 3IC7A 4MT8A 5IJ9B 1BQ0A 5KHGA 2XUMA 3ZRWA 5B1BB 1SQPH 3HKBA 4U7NA 5LMUO 5IYCO 5CBGA 5CA1A 4DV2B 3L74H 2O57A 4NXNB 1XHZA 4LF4O 4LF9O 2CE4A 1AB3A 3RVYA 1BL8A 3SYPA 1JQ0A 3QO8A 1Y76A 4O4LA 2PI4A 1YDXA 3H9VA 5EYPA 3LDEA 1FPOA 2OCCC 5L3GA 1Q7YW 3CX5F 2UXBB 1K9MW 3SDLA 1R3LC 1TVKB 1YI2V 2Y0PA 3HKDA 5DN6G 4B3RB 1SA0A 2VWKA 1UFIA 1XMQB 3ZX6A 1U96A 3CB2A 1DF5A 1XUQA 1CPYA 4PDLA 1N34O 3B40A 1F7YA 3SGIA 2Y48A 5IJ0B 1YJWV 2EJRA 4AQYO 3TCUA 1KB9F 3TK1A 3BHPA 3AG3B 5DECA 5LHHA 3CMAV 2DOSA 3RYIA 1N0NA 4O2AA 5IWAB 1WLEA 5H6RA 4OX9B 1U97A 5BXZA 4WF9V 2FMLA 2PI5A 5CA0B 5HFLA 2CH7B 3OUSA 1URFA 5LHIA 2QM8A 2Q8VA 4KP4A 4H37A 1MSWD 1KUQA 2PYJA 4JI4O 4NR1A 2MW2B 4NXMO 2M6YA 1TGOA 5L3CA 1H8HG 4HNAA 1QVFU 4FM2A 2DN9A 3ABTA 1AP6A 1QR9A 2UU9B 5KMGA 3G6BA 3JSNA 1Y74B 2LQTA 2ZE5A 4R8CA 1SF9A 1Q5OA 4TT3G 5LA6A 4J7ZA 1S76D 4X64O 2PYLA 2R9AA 3RBZA 3ETQA 3T2MA 3MAQA 4JAVA 3KG2A 4NVPA 3U11A 1PM9A 3T1HO 2ITCC 2IJIA 1HDJA 5CMUA 1FYJA 2JVDA 3L70H 4ZIBA 3VOUA 1ZUQA 1MZEA 1K5SA 3SYOA 1N32O 1D5AA 2YC0A 4I0XB 4C7UA 2HEPA 1XNRB 1VQMV 3B09A 3D8CA 1WPXA 3DXRA 4DV0O 3O65A 4GX5A 1G6UA 4YY3B 1JFFB 4DW1A 3APQA 3M7MX 1UJWB 5B1NA 2PY5A 5B66Z 1VQ8V 4UVAA 2HP8A 5B3SC 4ZI7A 3E8BA 1SERA 3CCSV 3LSSA 5IYZB 5BY1A 1SQXH 2OTLV 1Q86W 3A0RA 3OE7G 3MDSA 1N0JA 5E79Z 3TJTA 3OTOB 3SJCC 2QWRB 3C3SA 3BRCA 2IM9A 4CC6A 1RFYA 3IFXA 4LFBO 2IH3C 3K3WA 1I5YA 1Q6IA 2E75B 1IZ3A 3DC6A 1M57B 2WA4A 4U3FH 3C3TA 5J2TA 3K57A 4CH4A 4DV1B 3K0GA 2K9PA 3CXHF 4JGSA 5B5EZ 3E22B 3CC4V 3SJAC 1PPJH 4TUYA 2X6CA 3VQXA 5GTIZ 4LWSB 4RUEA 1AI5A 3E8GA 5KA6A 5H6QA 1GMGA 1TA8A 5IDJA 2UXXA 4I50B 3RGBA 2AW9A 2Y0IA 4B3MB 2ZM6O 3AG1B 2YXYA 2FTKA 2WPDG 1BS3A 4X1KB 3ABMB 4TV8A 2IJHA 5JJNB 1AI7A 1V54C 2HJDA 1BCCH 4F4LA 3JALB 4K0KO 1GM7A 5ITZB 4O4HB 4RUFA 4UB8Z 3AG2B 5LXTA 3JAWA 5IY5B 4IIJA 1Q6HA 1H2LA 5KA5A 2P6JA 1SS3A 4W4LA 1MG1A 5BMVA 3AK1A 1K92A 4CZZA 2LFRA 3R65A 1VP7A 1N33O 2DJVA 4XDJA 1JPXA 3K08A 3OAAG 1O9GA 1XDCA 1WN7A 1NVPB 3G4SV 1NH2D 1V55C 4B3TB 4FM1A 2JS3A 2JS5A 2E3CA 5LP6A 5H2FZ 3FAVA 1IBLB 4RQEA 4WFAV 1KD1W 3JAKB 4FLZA 3JASA 4I4TA 2IH1C 5JJJB 3SYAA 2JJ2G 1WA8A 4XBFA 5KHKA 2A0LA 3JD2A 1HR0O 3CCEV 1P49A 3UO3A 4GKJO 4QIWF 1ZSPA 4JI5O 3H1KH 2DQ0A 2H3OA 5FPOA 5KX5A 4GKKO 2A9HA 2AXTZ 5J2UB 3DGEA 4X66O 1M56B 2IW5A 4TQDA 2B1IA 3ZRWB 2VQFO 2A06H 3FD9A 1GH6A 4ZOLA 3HKBB 1RM1C 2P5OA 5CA3A 4WBNB 4OGQB 1VF6A 2F93B 4PJ0Z 2YIBA 4LF4B 4LF9B 3X2QC 1M5IA 2YICA 3ABKC 4MVOA 3SPJA 4O4LB 1Y76B 3ZRVA 5EYPB 2Q7GA 2P90A 2JRIA 1F51A 4YJ2A 5IE9A 1KMIZ 3T1CA 4CH5A 4GLXA 2QM4A 1IBMO 2JEUA 2PGGA 2OT5A 3TXSA 4IGGA 1OCZB 1QU7A 3P3NA 3ZHUA 1OZ0A 2XAFA 1Q82W 2QWPB 4BW5A 1Q90D 3CHXA 2NLJC 3I56V 2P67A 1AVMA 3E89A 1L8DA 5HFMA 4JTCB 1IX9A 1KC8W 2DW4A 1FXKC 2XASA 3AG4C 3MHSC 4IYIA 4NTXA 2QJ1A 4K3AA 4DV3O 2CGNA 5JH7A 1N34B 1NVPD 4H0LB 1R73A 2ZD9A 1K7DA 2IU0A 1CEZA 2XAGA 1QVGU 5FL7G 4HZ3A 1XNQO 3ZHSA 3W7TA 3JD0A 4DV5O 4O2AB 5B1AB 2YIDA 4JI7O 4GX2A 1YIJV 1KU9A 4DXWA 1VIBA 3IAYA 1SQVH 1PD3A 1A32A 2X7RB 1SQFA 3IGAC 4FZ1A 3J80N 3CRAA 3SJQC 4FJCC 2EIMC 4JI4B 4NXMB 1AJNA 1WB7A 2VS0A 4O2BA 1Q3EA 4HNAB 1EN5A 3UCSC 4R7CA 3ASNC 3RW0A 1M93A 5KMGB 1GTOA 2QWQB 5C93A 3H1HH 3E86A 3ZEDA 4X88A 3CJHB 2OTJV 5LA6B 4MTOA 2OIGA 2VQEB 3OD4A 4MSWC 2N74A 4X64B 4R6ZA 5LGNA 2DMXA 2A3QA 3T1HB 2E74B 1Q6UA 2GSMB 2Y69B 5EIBD 4O4JB 1N36O 2EIJB 3CP1A 1LUVA 5LGUA 4PA6A 1CXZB 4JTAB 4DV0B 4FLTA 3E8FA 3CCUV 1QLNA 3KCXA 2HVJC 2DYRC 2QGNA 1GM9A 1D5NA 1I7FA 1GN3A 3L9DA 1GK9A 3K5LA 5H9CA 3CC7V 2OYQA 5B1BC 4ZI7B 4JF3A 5FLXN 1MZFA 2ZT9B 4UCOA 4LP8A 4X9QA 1QNMA 4I55A 1WAZA 4FFBA 1JJOA 2B1GA 4MTFA 1YITV 2BSKB 3M99B 2EINB 2CGOA 4DR6O 4LF6O 4DO2A 1H2KA 4LFBB 1PL0A 3AK3A 4EFEA 3VQWA 4I9WA 4OXSA 4PHZA 5JJEB 4MVRA 5L3FA 5LHGA 3CRCA 3SPHA 3LNNA 3WB2A 1Z2GA 3B8NA 2K1EA 1FFTB 3OEHG 1HW7A 2DYSB 1MA1A 2QKSA 5EBMC 4TUYB 3D3QA 3N2KA 1B6QA 4JI8O 1VQNV 1MABG 3HKCA 2IJKA 4J41A 4U7OA 4PI0A 5E1AC 5L3BA 4YIOA 2ADQB 1OV9A 1I0HA 4YHHO 1R6TA 2CUGA 1H2NA 1ZAUA 4WFGA 3JD3A 1QR8A 4JYAO 3AG3C 2GDSA 2KB1A 2UUCO 2EULA 4B7EA 4YJ3A 4N21A 4DV6O 4TV8B 1CP9A 1S72V 3CWBH 3F5WC 1YJ9V 4ZBMA 3ZHRA 4FLYA 3FYIB 3HKEA 3TETA 3DC5A 3F7YC 2JEXA 4UCVA 3APOA 4K0KB 3OR6C 2EIKB 3JAWB 4J80A 3ZRSA 2Z3YA 4IIJB 3VQVA 5JCOC 4LFCO 5BMVB 3Q4HB 4B3SO 3K5OA 2G38A 3A0HZ 2YIAA 1N33B 3JARA 5C8YA 2BTOA 3CMEV 1I5XA 3RYFA 4MVMA 2XAQA 5GONA 3SJBC 5LP6B 1RSOA 3JASB 3WG7B 4CH3A 1EN6A 1HP8A 2ZDIC 3WB1A 4LBEC 1VF5B 1WA8B 1XQ8A 4LF5O 4BAYA 4EKWA 1P84F 4LC1A 2LJ2A 4TQFA 1H2MA 4AILC 1HR0B 5KHHA 4GKJB 3E83A 5KX5B 4JI5B 3K04A 4JYBA 4GKKB 1VQ7V 4HAMA 3JCUZ 1OCOB 2QWNB 1NQTA 2HG5C 4X66B 2BOBC 1OCRC 2L35A 4ZOLB 3RYHA 3ASOB 2Q5ZA 3QO7A 2VQFB 1L1FA 4X65O 4MTGA 2Q67A 4UUJC 4KHPO 4Z1MG 2QTOA 4CC5A 4JI1O 4LF7O 5KLVH 4DUZO 3O9OA 3ETEA 1S77D 4RO2A 3OM3B 4JYCA 4YJ2B 4NKGB 2F23A 1GAXA 4BR6A 1M90W 1BQZA 1M57C 5LOVA 4J42A 3JATB 1IBMB 2P06A 3FFQA 3RVZA 1GN2A 3CS5A 5FPRA 2WAMA 3EHBB 3K5NA 3FB8C 1YJNV 2WLLA 1KKCA 3ZHTA 4D6TH 1VEWA 2PTMA 1XL4A 2JJ1G 3RT3C 3OMIB 2JGDA 2LGWA 5JH7B 1RPRA 4DV3B 4CS2A 3AG1C 2ZR2A 3NR7A 1F23A 1NH2B 2LO1A 2Y4UA 3CCLV 3ETGA 1XNQB 3OW2U 3ABMC 4H33A 4DV5B 4JI7B 3CD6V 2GTSA 5KHIA 2Q69A 2OCHA 5IYBO 4RWUA 2QA4V 2YSUB 3JD4A 1ENVA 1OHHG 2CAZC 4PELA 3AG2C 3ABUA 4GX1A 3P32A 4YXWG 2W6JG 2Y4TA 5IY5C 5LMNO 2HHHO 5F2VO 2CDYA 4LNUA 3U10A 3RYCA 1K3EA 3A0BZ 1J5EO 4QE7A 1HNXO 4IT5A 2XNDG 1AROP 4BIZA 4O2BB 2X6BA 4XDKA 2ZCEA 3ZN1A 3IC9A 2AHZA 1JMKC 4CBCA 2BE3A 1K73W 1H38A 5EC2C 1BHBA 3UT5B 2H94A 5JQGA 1R6NA 4K8XA 3FB7C 4LR3A 1IBKO 2BCCH 3G6EV 2UUAO 3LNMB 2LFSA 2AGAA 2Q73A 5IJ9A 3ZIAG 3LUTB 1XL6A 3JAMN 5JVDA 4P2ZA 4PDVA 2EZPA 1Z5VA 4JI6O 4JZGA 1KKDA 4GT1A 1N8RW 2ZNJA 1EM1A 1M56C 2NNUA 1BT8A 1S5JA 2FYUH 4X62O 3RFRA 4Q6GA 5L3EA 3FKSG 4ZHQB 1SQBH 3C90A 3TXQA 2R70A 4TV9A 4MVSA 1SQGA 1TVKA 4FFBB 1S0VA 4B3RO 1R3JC 4KUMA 4FIPC 3J81N 2PF4E 4J7JA 4NTWA 1KQSU 1VQ9V 4H13B 2QWOB 2UXNA 3OGCC 2CTWA 3H1IH 4LF6B 5LYJA 1GRJA 4J10A 3JCZA 2IJJA 3T1YO 4J11A 4LH6A 2EILB 1QBZA 4I9QA 4DV7O 1LR1A 3OT7A 2HKOA 4TOIA 2YI9A 4I7ZB 4MW3A 1M1KW 1L0NH 1M4UA 4DYLA 5IJ0A 1OCCB 4DUYO 2YDEA 1B06A 3BFRA 3N2KB 1HNZO 3H01A 4CS3A 2ZE7A 3QVNA 4ZKIA 4JI8B 1WP8A 1HNWO 4J9ZB 3N2GA 4UCRA 1EBOA 4UFZA 5CBHA 1FXHA 1NBMG 1IURA 1AI6A 2CH7A 4UCUA 4YHHB 3B8MA 1VF7A 5CA1B 1Y4MA 1T5EA 1NZ6A 2UXDO 3CPWU 5JCOA 3CCRV 4DV6B 3L71H 4JI3O 2F43G 2HLDG 2P4KA 3HKEB 3E35A 3N27A 2JDIG 4IHJA 1NS1A 3HR0A 1V55B 1Y74A 4NB5A 1YVWA 3HKDB 4LFCB 1SA0B 1NI8A 1NTKH 3CRQA 1FFXA 1F4MA 4CH6A 5EBLC 4B3SB 4DR1O 4EFBA 1VQKV 2BTQA 3JARB 4OPAA 1ZL8A 3L72H 1XREA 2WLIA 3RYFB 2ZNIA 3ABLB 3BCCH 2ZDIA 4NYKA 2W6IG 2ITDC 2AZ2A 2LGQA 5DM6V 2GBOA 1XBLA 4DRXA 3E8HA 4QPJA 3K03A 1M9NA 4X1YA 1AR1B 2E5LO 4DR7O 4W4KA 2JIZG 3RYIB 4AQYB 5FNVA 3EXAA 2ARHA 2PZSA 1ROPA 1NTZH 1Q43A 4L87A 1ZX3A 2FL4A 3LDCA 2GUZA 2WLKA 2Y69C 4LF5B 2R9RB 2Q4PA 2KQXA 4UVCA 1X4TA 4G27B 4D7SA 5BZBA 1NT2B 3W7WA 2UUBO 3G80A 1US6A 3RYHB 1SRYA 1K8AW 5GW7A 4FMTA 2JK5C 1VQ4V 5IT9N 1W0JG 4JPRA 4X65B 4UB6Z 1JR9A 4J7KA 4DV1O 4FLWA 4DR5O 4KHPB 1V9PA 3NXSA 2EINC 1TUEB 4XDLA 3KCYA 4JI1B 4LF7B 3DTUB 4DUZB 1BMFG 1Q8IA 2ZXWB 3STLC 3AG4B 4O4IA 5LOVB 1K33A 1GO3F 3CXCU 5LL6Y 1BHAA 4I50A 4X20A 3OGIB 3U0ZA 1N32B 5A2QN 3STZC 3DXRB 4PDMA 1HWYA 2DYSC 4FZ0A 2CTQA 2WLLB 1O9HA 1IDSA 2ZKOA 2ZE6A 4LFAO 1FJGO 4X1IA 2WSSG 1RP3B 4AHCA 4PV1B 2XHBA 2JGDB 3THOA 2L6LA 5CN0A 1Y6XA 3HPLC 1EN4A 3OFNG 3JALA 1DLBA 5AG2A 1YTFB 4DV4O 1NR7A 5KHJA 1DF4A 4PDRA 4Z2WA 2ZE8A 5B1OA 3EFFK 2P22C 2QM7A 3F5TA 1TUBA 1D2DA 1I08A 1G4YB 4MTXA 2NR5A 5K1PA 1TAEA 1AJPA 3ASNB 2EIKC 1YF2A 4B3TO 4HBNA 4DR3O 5LMNB 5J2TB 4LNUB 1XMOO 2HHHB 3RYCB 3LSQA 4G28B 4DK0A 4DR2O 3H1JH 1J5EB 1GN6A 3SPIA 3JSLA 4FM0A 1HNXB 3CCQV 3M8AA 2EBOA 5K1XA 3JAKA 1H2GA 4JYYA 4UV9A 2DWEC 3FYEB 1GM8A 4FLXA 1GKFA 1MNGA 3ETDA 1NU1H 5LP6C 3G71V 5CB4A 2ZM6B 4Q20A 1AJQA 1YCIA 4B08A 1WP7A 3WG7C 2UUAB 1SKVA 2D2CB 5H5NA 3S3XA 1FD9A 5J2UA 1P7GA 2MK3A 1E1QG 1XI1A 2ZINA 5JVDB 4KXRA 4WBNA 5LXTB 1QLEB 2BOCC 4K8ZA 1OCOC 2Q68A 4JI6B 4QNHB 3W7SA 2E76B 2M7WA 3B77A 1KECA 4QE9A 4X62B 1NJIW 3ASOC 3BAAA 4EB6A 1VF6C 1KP3A 2OWOA 1H8EG 4WFFA 2PUSA 4TV9B 2XOKG 1YTFD 1JX9A 2FKXA 4QJFB 3JYCA 1VQLV 1BZKA 3OTFA 1JA8A 1SESA 2V7QG 1K4DC 3FAVB 4TWKA 3CC2V 1YHQV 5LYJB 1XILA 4I4TB 1B04A 3I55V 4GCZA 1WNSA 3ZN0A 3T1YB 2YI8A 1PKXA 1VQ5V 4DV7B 2HJFC 3FB5C 4U3JA 3R66A 1AR5A 2YXLA 4H44B 4HYOA 3K06A 4DUYB 3GWKC 2LW7A 2EJ7A 4JASA 1PNKA 1HNZB 2P7TC 4MVZA 2F66C 3QNEA 2OIEA 3OR7C 3N2GB 4X8AA 1HNWB 2W0XA 3AG7A 2DWDC 2AHYA 3EVKA 2OCCB 3KZIZ 3PJSK 2ODMA 1Y67A 1MOFA
chains in the Genus database with same CATH topology
1BCCH 1NTZH 3L74H 1SQVH 2IBZH 1SQBH 1PP9H 4U3FH 1SQXH 1KYOF 1EZVH 1KB9F 3L72H 2A06H 3L75H 3CWBH 3BCCH 4PD4F 5KLVH 1NTMH 3H1HH 1L0NH 4D6TH 1L0LH 3CXHF 1SQQH 2BCCH 3H1KH 1PPJH 1NU1H 3L70H 3L73H 1NTKH 1BGYH 1SQPH 3L71H 3H1IH 3TGUH 3H1LH 1P84F 1BE3H 2FYUH 3CX5F 3H1JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC H;  1NTZ H;  3L74 H;  1SQV H;  2IBZ H;  1SQB H;  1PP9 H;  4U3F H;  1SQX H;  1KYO F;  1EZV H;  1KB9 F;  3L72 H;  2A06 H;  3L75 H;  3CWB H;  3BCC H;  4PD4 F;  5KLV H;  1NTM H;  3H1H H;  1L0N H;  4D6T H;  1L0L H;  3CXH F;  1SQQ H;  2BCC H;  3H1K H;  1PPJ H;  1NU1 H;  3L70 H;  3L73 H;  1NTK H;  1BGY H;  1SQP H;  3L71 H;  3H1I H;  3TGU H;  3H1L H;  1P84 F;  1BE3 H;  2FYU H;  3CX5 F;  3H1J H; 
#chains in the Genus database with same CATH topology
 2ZIO A;  1B3Q A;  4UV8 A;  5DED A;  3I5D A;  1VQP V;  2IBZ H;  3K9A A;  3BEH A;  1PNL A;  2ZIM A;  2UXD B;  2R9I A;  5TIS Z;  5BR8 O;  2GTA A;  1WPB A;  4G2K A;  4JI0 O;  4DR4 O;  1I94 O;  4DK1 A;  5EZY A;  3J7A U;  4JI3 B;  3D36 C;  3T4D A;  2WLH A;  4ASU G;  1K34 A;  3MD0 A;  4IHJ B;  4RAI A;  2UXC O;  1FXK A;  3UO2 A;  1IXM A;  3LSU A;  1LNQ A;  3ZMT A;  3CJH A;  5GTH Z;  2VQE O;  5EK0 A;  2QKA A;  3UQ8 A;  4P9O A;  1FFX B;  2EX3 A;  1BSM A;  4DR1 B;  2BTQ B;  4UCT A;  1ZL8 B;  2QSA A;  1FS0 G;  2KSD A;  1K4C C;  2WLI B;  5CBF A;  1IVS A;  2XTA A;  1H2S B;  2Q0A A;  1FKA O;  3BA8 A;  4KFM A;  4F6R A;  2A7W A;  2WLN A;  4O4J A;  4BWA A;  4DRX B;  3CCM V;  1MSD A;  4X1Y B;  2F1M A;  3JD1 A;  2VRZ A;  1KP2 A;  1PV0 A;  5FNV B;  2YXH A;  2E5L B;  1G8M A;  2WA3 A;  4DR7 B;  1AIL A;  1YZB A;  4DW0 A;  1SQQ H;  2YEV A;  3ZMV A;  3CCJ V;  2GUZ B;  1THZ A;  5LGT A;  2QKC A;  3MHH C;  1OCR B;  3HB3 B;  4UXN A;  4PA7 A;  1VQO V;  3OMN B;  2CK3 G;  3LDD A;  3W7U A;  2R72 A;  2BSK A;  1MMM A;  3SPG A;  4BW9 A;  1AI4 A;  1S5H C;  1ZWI C;  2UUB B;  4FVM A;  2Q7E A;  4GYC B;  4E4E A;  4CS4 A;  4JI2 O;  3KKY A;  4L8J A;  4IL6 Z;  1Q81 W;  2KG7 A;  3CYO A;  4LF8 O;  2F4V O;  1LUW A;  4DR5 B;  3RWR D;  1NTM H;  1AP5 A;  1NKD A;  2YIB D;  1YXB A;  4JV5 O;  1XOU A;  1WJZ A;  3QTC A;  2RCV A;  1VAR A;  1GN4 A;  4O4I B;  2EIL C;  1QHT A;  3BAB A;  2YS8 A;  1R3K C;  4P30 A;  4FK5 C;  4X20 B;  3OUF A;  2YUA A;  3GWO A;  4FLU A;  5B3S B;  1N36 B;  1OCC C;  1P7B A;  4DV2 O;  1VMG A;  3WU2 Z;  4NXN O;  4X1I B;  1S5L Z;  3F7V C;  3ZMZ A;  3K59 A;  5A9G A;  1FJG B;  4LFA B;  4TSF G;  4KL1 A;  2RN9 A;  4ICG A;  1K5Q A;  2JGU A;  1PNM A;  2V1D A;  5KAF Z;  3FB6 C;  1EZV H;  1KBH A;  2UXB O;  4DV4 B;  2VWJ A;  3GVM A;  4I55 B;  2EZO A;  2AZ0 A;  3Q4H A;  1TUB B;  3QO5 A;  4LCU C;  1UPG A;  3K58 A;  1XMQ O;  1BGY H;  4DR6 B;  2LW1 A;  3K79 A;  1ZTE A;  1Y66 A;  3ZRX A;  3OMA B;  1K97 A;  2QTS A;  4UCS A;  4GUN A;  1OCZ C;  4DR3 B;  5EIB C;  1OJH A;  4PA4 A;  1E79 G;  1Z5W A;  1XMO B;  2WLJ A;  4DR2 B;  4BIU A;  1SZX A;  5D5Q A;  4Z1V A;  4PA9 A;  4E2L A;  3P30 A;  3CRM A;  5IWA O;  1E1R G;  4OX9 O;  3HKC B;  1JJ2 U;  1YEW A;  3ABL C;  4B7K A;  1V54 B;  5EBW C;  1G1X B;  1EZJ A;  5CB4 B;  2ILM A;  5CA0 A;  4IYH A;  4AI8 A;  4WFH A;  1N4C A;  3ICX A;  3WB0 A;  1DTO A;  4JYA B;  5B1A C;  2Q7H A;  2B9Z A;  5KAI Z;  4YJ3 B;  1JOY A;  4NTY A;  2UUC B;  3G67 A;  1DK1 A;  1JCH A;  3H1L H;  3K9S A;  4WCE V;  2WLM A;  1WB8 A;  3W7X A;  2CTP A;  1PP9 H;  2UU9 O;  4MVU A;  1IXB A;  4JAA A;  1J95 A;  2RDC A;  4PA3 A;  3VBB A;  3ZHV A;  4GZR B;  1VQ6 V;  4PI2 A;  4MVQ A;  4J9Y B;  4WFB V;  1NR1 A;  1R6K A;  2P4V A;  3AEI A;  2NN4 A;  3CEI A;  2XAH A;  3K5M A;  4D7T A;  1QQC A;  2Z0A A;  3CCV V;  5C8Y B;  3E2E A;  4I5S A;  4EB6 B;  1JVM A;  4PD4 F;  3CRR A;  4P9P A;  3ZJZ A;  3JAT A;  4A5U B;  4K35 A;  3DSQ A;  1XNR O;  1AR4 A;  1R1B A;  5GON B;  4X89 A;  4I0X A;  5KUM A;  2RMK B;  1RSO B;  4BIO A;  3T4Z A;  1RPO A;  4YY3 O;  2ZXW C;  1BE3 H;  4UVB A;  3FX7 A;  3GB7 C;  1JFF A;  2QEX V;  2DE0 X;  2ETN A;  2HFE C;  2X0L A;  4F6E A;  2C2A A;  2IU3 A;  4U3J B;  2EIJ C;  3A2F A;  1RM1 B;  2KKW A;  2DQ3 A;  1W59 A;  4GX0 A;  5IYZ A;  1ZLZ A;  3RN4 A;  3OTO O;  1P4R A;  4FLV A;  3X2Q B;  5EC1 C;  3ABK B;  3D36 A;  1KYO F;  4JZ2 A;  1F4N A;  2RJZ A;  4JTD B;  5LMU B;  2WWW A;  1DGS A;  5LBQ A;  3TGU H;  5BR8 B;  5EZY B;  3BPZ A;  4JI0 B;  4DR4 B;  3UM7 A;  1I94 B;  1COW G;  3CE2 A;  3E22 A;  1FXV A;  1SET A;  3ZMS A;  2ADP A;  4QPK A;  4QGP A;  1R3I C;  1FXK B;  3ZMU A;  4WFE A;  3BVO A;  5JWP A;  4LWS A;  2UXC B;  5J9P C;  1W2B U;  1L0L H;  5D5P A;  4B3M O;  2X6A A;  2V4D A;  3OEE G;  2XT9 A;  1W0K G;  4ABM A;  3UT5 A;  4R50 A;  3ML0 A;  2CTR A;  3ZS8 C;  3B2E E;  2GHY A;  2N04 A;  3D3I A;  4X1K A;  3A8T A;  4RQF A;  2W0F C;  3P3P A;  4F6R B;  3SR2 C;  5ITZ A;  2ZR3 A;  4O4H A;  2HVK C;  5IYD O;  3L73 H;  3VQY A;  2QE7 G;  3ZHQ A;  2RQ6 A;  2H8P C;  2RNB A;  1SC5 B;  1YSC A;  4JAU A;  1QCE A;  2YEV B;  2XAJ A;  2EIM B;  3S3W A;  2B5U A;  2A79 B;  4OPH A;  4EEQ A;  5L3D A;  3ZBH A;  3B4S A;  4ZHQ A;  2LP7 A;  3ZCC A;  2QR4 A;  3BA9 A;  4FPP A;  1QLE C;  2Q9L A;  2D3O W;  3SPC A;  2HR3 A;  3K0D A;  4MS2 A;  1IBL O;  5KUK A;  3QF7 A;  3UKM A;  2Q0O C;  3SYC A;  2Q6A A;  2QDO A;  3IJ4 A;  2ZQM A;  1EFR G;  3L75 H;  3SYQ A;  3AK2 A;  1FAF A;  1PL4 A;  2N05 A;  3CSX A;  2ATK C;  3PN1 A;  4JI2 B;  2KG7 B;  3WFV A;  4YIP A;  1XHX A;  2Z5U A;  3BY6 A;  1ORQ C;  2FB5 A;  4LF8 B;  2F4V B;  1SZT A;  5JQG B;  1XEQ A;  4MW8 A;  4FFK A;  4LH7 A;  2GV9 A;  4JV5 B;  1X59 A;  1IBK B;  4N23 A;  2F95 B;  3QG5 A;  1S3J A;  2DYR B;  3IC7 A;  4MT8 A;  5IJ9 B;  1BQ0 A;  5KHG A;  2XUM A;  3ZRW A;  5B1B B;  1SQP H;  3HKB A;  4U7N A;  5LMU O;  5IYC O;  5CBG A;  5CA1 A;  4DV2 B;  3L74 H;  2O57 A;  4NXN B;  1XHZ A;  4LF4 O;  4LF9 O;  2CE4 A;  1AB3 A;  3RVY A;  1BL8 A;  3SYP A;  1JQ0 A;  3QO8 A;  1Y76 A;  4O4L A;  2PI4 A;  1YDX A;  3H9V A;  5EYP A;  3LDE A;  1FPO A;  2OCC C;  5L3G A;  1Q7Y W;  3CX5 F;  2UXB B;  1K9M W;  3SDL A;  1R3L C;  1TVK B;  1YI2 V;  2Y0P A;  3HKD A;  5DN6 G;  4B3R B;  1SA0 A;  2VWK A;  1UFI A;  1XMQ B;  3ZX6 A;  1U96 A;  3CB2 A;  1DF5 A;  1XUQ A;  1CPY A;  4PDL A;  1N34 O;  3B40 A;  1F7Y A;  3SGI A;  2Y48 A;  5IJ0 B;  1YJW V;  2EJR A;  4AQY O;  3TCU A;  1KB9 F;  3TK1 A;  3BHP A;  3AG3 B;  5DEC A;  5LHH A;  3CMA V;  2DOS A;  3RYI A;  1N0N A;  4O2A A;  5IWA B;  1WLE A;  5H6R A;  4OX9 B;  1U97 A;  5BXZ A;  4WF9 V;  2FML A;  2PI5 A;  5CA0 B;  5HFL A;  2CH7 B;  3OUS A;  1URF A;  5LHI A;  2QM8 A;  2Q8V A;  4KP4 A;  4H37 A;  1MSW D;  1KUQ A;  2PYJ A;  4JI4 O;  4NR1 A;  2MW2 B;  4NXM O;  2M6Y A;  1TGO A;  5L3C A;  1H8H G;  4HNA A;  1QVF U;  4FM2 A;  2DN9 A;  3ABT A;  1AP6 A;  1QR9 A;  2UU9 B;  5KMG A;  3G6B A;  3JSN A;  1Y74 B;  2LQT A;  2ZE5 A;  4R8C A;  1SF9 A;  1Q5O A;  4TT3 G;  5LA6 A;  4J7Z A;  1S76 D;  4X64 O;  2PYL A;  2R9A A;  3RBZ A;  3ETQ A;  3T2M A;  3MAQ A;  4JAV A;  3KG2 A;  4NVP A;  3U11 A;  1PM9 A;  3T1H O;  2ITC C;  2IJI A;  1HDJ A;  5CMU A;  1FYJ A;  2JVD A;  3L70 H;  4ZIB A;  3VOU A;  1ZUQ A;  1MZE A;  1K5S A;  3SYO A;  1N32 O;  1D5A A;  2YC0 A;  4I0X B;  4C7U A;  2HEP A;  1XNR B;  1VQM V;  3B09 A;  3D8C A;  1WPX A;  3DXR A;  4DV0 O;  3O65 A;  4GX5 A;  1G6U A;  4YY3 B;  1JFF B;  4DW1 A;  3APQ A;  3M7M X;  1UJW B;  5B1N A;  2PY5 A;  5B66 Z;  1VQ8 V;  4UVA A;  2HP8 A;  5B3S C;  4ZI7 A;  3E8B A;  1SER A;  3CCS V;  3LSS A;  5IYZ B;  5BY1 A;  1SQX H;  2OTL V;  1Q86 W;  3A0R A;  3OE7 G;  3MDS A;  1N0J A;  5E79 Z;  3TJT A;  3OTO B;  3SJC C;  2QWR B;  3C3S A;  3BRC A;  2IM9 A;  4CC6 A;  1RFY A;  3IFX A;  4LFB O;  2IH3 C;  3K3W A;  1I5Y A;  1Q6I A;  2E75 B;  1IZ3 A;  3DC6 A;  1M57 B;  2WA4 A;  4U3F H;  3C3T A;  5J2T A;  3K57 A;  4CH4 A;  4DV1 B;  3K0G A;  2K9P A;  3CXH F;  4JGS A;  5B5E Z;  3E22 B;  3CC4 V;  3SJA C;  1PPJ H;  4TUY A;  2X6C A;  3VQX A;  5GTI Z;  4LWS B;  4RUE A;  1AI5 A;  3E8G A;  5KA6 A;  5H6Q A;  1GMG A;  1TA8 A;  5IDJ A;  2UXX A;  4I50 B;  3RGB A;  2AW9 A;  2Y0I A;  4B3M B;  2ZM6 O;  3AG1 B;  2YXY A;  2FTK A;  2WPD G;  1BS3 A;  4X1K B;  3ABM B;  4TV8 A;  2IJH A;  5JJN B;  1AI7 A;  1V54 C;  2HJD A;  1BCC H;  4F4L A;  3JAL B;  4K0K O;  1GM7 A;  5ITZ B;  4O4H B;  4RUF A;  4UB8 Z;  3AG2 B;  5LXT A;  3JAW A;  5IY5 B;  4IIJ A;  1Q6H A;  1H2L A;  5KA5 A;  2P6J A;  1SS3 A;  4W4L A;  1MG1 A;  5BMV A;  3AK1 A;  1K92 A;  4CZZ A;  2LFR A;  3R65 A;  1VP7 A;  1N33 O;  2DJV A;  4XDJ A;  1JPX A;  3K08 A;  3OAA G;  1O9G A;  1XDC A;  1WN7 A;  1NVP B;  3G4S V;  1NH2 D;  1V55 C;  4B3T B;  4FM1 A;  2JS3 A;  2JS5 A;  2E3C A;  5LP6 A;  5H2F Z;  3FAV A;  1IBL B;  4RQE A;  4WFA V;  1KD1 W;  3JAK B;  4FLZ A;  3JAS A;  4I4T A;  2IH1 C;  5JJJ B;  3SYA A;  2JJ2 G;  1WA8 A;  4XBF A;  5KHK A;  2A0L A;  3JD2 A;  1HR0 O;  3CCE V;  1P49 A;  3UO3 A;  4GKJ O;  4QIW F;  1ZSP A;  4JI5 O;  3H1K H;  2DQ0 A;  2H3O A;  5FPO A;  5KX5 A;  4GKK O;  2A9H A;  2AXT Z;  5J2U B;  3DGE A;  4X66 O;  1M56 B;  2IW5 A;  4TQD A;  2B1I A;  3ZRW B;  2VQF O;  2A06 H;  3FD9 A;  1GH6 A;  4ZOL A;  3HKB B;  1RM1 C;  2P5O A;  5CA3 A;  4WBN B;  4OGQ B;  1VF6 A;  2F93 B;  4PJ0 Z;  2YIB A;  4LF4 B;  4LF9 B;  3X2Q C;  1M5I A;  2YIC A;  3ABK C;  4MVO A;  3SPJ A;  4O4L B;  1Y76 B;  3ZRV A;  5EYP B;  2Q7G A;  2P90 A;  2JRI A;  1F51 A;  4YJ2 A;  5IE9 A;  1KMI Z;  3T1C A;  4CH5 A;  4GLX A;  2QM4 A;  1IBM O;  2JEU A;  2PGG A;  2OT5 A;  3TXS A;  4IGG A;  1OCZ B;  1QU7 A;  3P3N A;  3ZHU A;  1OZ0 A;  2XAF A;  1Q82 W;  2QWP B;  4BW5 A;  1Q90 D;  3CHX A;  2NLJ C;  3I56 V;  2P67 A;  1AVM A;  3E89 A;  1L8D A;  5HFM A;  4JTC B;  1IX9 A;  1KC8 W;  2DW4 A;  1FXK C;  2XAS A;  3AG4 C;  3MHS C;  4IYI A;  4NTX A;  2QJ1 A;  4K3A A;  4DV3 O;  2CGN A;  5JH7 A;  1N34 B;  1NVP D;  4H0L B;  1R73 A;  2ZD9 A;  1K7D A;  2IU0 A;  1CEZ A;  2XAG A;  1QVG U;  5FL7 G;  4HZ3 A;  1XNQ O;  3ZHS A;  3W7T A;  3JD0 A;  4DV5 O;  4O2A B;  5B1A B;  2YID A;  4JI7 O;  4GX2 A;  1YIJ V;  1KU9 A;  4DXW A;  1VIB A;  3IAY A;  1SQV H;  1PD3 A;  1A32 A;  2X7R B;  1SQF A;  3IGA C;  4FZ1 A;  3J80 N;  3CRA A;  3SJQ C;  4FJC C;  2EIM C;  4JI4 B;  4NXM B;  1AJN A;  1WB7 A;  2VS0 A;  4O2B A;  1Q3E A;  4HNA B;  1EN5 A;  3UCS C;  4R7C A;  3ASN C;  3RW0 A;  1M93 A;  5KMG B;  1GTO A;  2QWQ B;  5C93 A;  3H1H H;  3E86 A;  3ZED A;  4X88 A;  3CJH B;  2OTJ V;  5LA6 B;  4MTO A;  2OIG A;  2VQE B;  3OD4 A;  4MSW C;  2N74 A;  4X64 B;  4R6Z A;  5LGN A;  2DMX A;  2A3Q A;  3T1H B;  2E74 B;  1Q6U A;  2GSM B;  2Y69 B;  5EIB D;  4O4J B;  1N36 O;  2EIJ B;  3CP1 A;  1LUV A;  5LGU A;  4PA6 A;  1CXZ B;  4JTA B;  4DV0 B;  4FLT A;  3E8F A;  3CCU V;  1QLN A;  3KCX A;  2HVJ C;  2DYR C;  2QGN A;  1GM9 A;  1D5N A;  1I7F A;  1GN3 A;  3L9D A;  1GK9 A;  3K5L A;  5H9C A;  3CC7 V;  2OYQ A;  5B1B C;  4ZI7 B;  4JF3 A;  5FLX N;  1MZF A;  2ZT9 B;  4UCO A;  4LP8 A;  4X9Q A;  1QNM A;  4I55 A;  1WAZ A;  4FFB A;  1JJO A;  2B1G A;  4MTF A;  1YIT V;  2BSK B;  3M99 B;  2EIN B;  2CGO A;  4DR6 O;  4LF6 O;  4DO2 A;  1H2K A;  4LFB B;  1PL0 A;  3AK3 A;  4EFE A;  3VQW A;  4I9W A;  4OXS A;  4PHZ A;  5JJE B;  4MVR A;  5L3F A;  5LHG A;  3CRC A;  3SPH A;  3LNN A;  3WB2 A;  1Z2G A;  3B8N A;  2K1E A;  1FFT B;  3OEH G;  1HW7 A;  2DYS B;  1MA1 A;  2QKS A;  5EBM C;  4TUY B;  3D3Q A;  3N2K A;  1B6Q A;  4JI8 O;  1VQN V;  1MAB G;  3HKC A;  2IJK A;  4J41 A;  4U7O A;  4PI0 A;  5E1A C;  5L3B A;  4YIO A;  2ADQ B;  1OV9 A;  1I0H A;  4YHH O;  1R6T A;  2CUG A;  1H2N A;  1ZAU A;  4WFG A;  3JD3 A;  1QR8 A;  4JYA O;  3AG3 C;  2GDS A;  2KB1 A;  2UUC O;  2EUL A;  4B7E A;  4YJ3 A;  4N21 A;  4DV6 O;  4TV8 B;  1CP9 A;  1S72 V;  3CWB H;  3F5W C;  1YJ9 V;  4ZBM A;  3ZHR A;  4FLY A;  3FYI B;  3HKE A;  3TET A;  3DC5 A;  3F7Y C;  2JEX A;  4UCV A;  3APO A;  4K0K B;  3OR6 C;  2EIK B;  3JAW B;  4J80 A;  3ZRS A;  2Z3Y A;  4IIJ B;  3VQV A;  5JCO C;  4LFC O;  5BMV B;  3Q4H B;  4B3S O;  3K5O A;  2G38 A;  3A0H Z;  2YIA A;  1N33 B;  3JAR A;  5C8Y A;  2BTO A;  3CME V;  1I5X A;  3RYF A;  4MVM A;  2XAQ A;  5GON A;  3SJB C;  5LP6 B;  1RSO A;  3JAS B;  3WG7 B;  4CH3 A;  1EN6 A;  1HP8 A;  2ZDI C;  3WB1 A;  4LBE C;  1VF5 B;  1WA8 B;  1XQ8 A;  4LF5 O;  4BAY A;  4EKW A;  1P84 F;  4LC1 A;  2LJ2 A;  4TQF A;  1H2M A;  4AIL C;  1HR0 B;  5KHH A;  4GKJ B;  3E83 A;  5KX5 B;  4JI5 B;  3K04 A;  4JYB A;  4GKK B;  1VQ7 V;  4HAM A;  3JCU Z;  1OCO B;  2QWN B;  1NQT A;  2HG5 C;  4X66 B;  2BOB C;  1OCR C;  2L35 A;  4ZOL B;  3RYH A;  3ASO B;  2Q5Z A;  3QO7 A;  2VQF B;  1L1F A;  4X65 O;  4MTG A;  2Q67 A;  4UUJ C;  4KHP O;  4Z1M G;  2QTO A;  4CC5 A;  4JI1 O;  4LF7 O;  5KLV H;  4DUZ O;  3O9O A;  3ETE A;  1S77 D;  4RO2 A;  3OM3 B;  4JYC A;  4YJ2 B;  4NKG B;  2F23 A;  1GAX A;  4BR6 A;  1M90 W;  1BQZ A;  1M57 C;  5LOV A;  4J42 A;  3JAT B;  1IBM B;  2P06 A;  3FFQ A;  3RVZ A;  1GN2 A;  3CS5 A;  5FPR A;  2WAM A;  3EHB B;  3K5N A;  3FB8 C;  1YJN V;  2WLL A;  1KKC A;  3ZHT A;  4D6T H;  1VEW A;  2PTM A;  1XL4 A;  2JJ1 G;  3RT3 C;  3OMI B;  2JGD A;  2LGW A;  5JH7 B;  1RPR A;  4DV3 B;  4CS2 A;  3AG1 C;  2ZR2 A;  3NR7 A;  1F23 A;  1NH2 B;  2LO1 A;  2Y4U A;  3CCL V;  3ETG A;  1XNQ B;  3OW2 U;  3ABM C;  4H33 A;  4DV5 B;  4JI7 B;  3CD6 V;  2GTS A;  5KHI A;  2Q69 A;  2OCH A;  5IYB O;  4RWU A;  2QA4 V;  2YSU B;  3JD4 A;  1ENV A;  1OHH G;  2CAZ C;  4PEL A;  3AG2 C;  3ABU A;  4GX1 A;  3P32 A;  4YXW G;  2W6J G;  2Y4T A;  5IY5 C;  5LMN O;  2HHH O;  5F2V O;  2CDY A;  4LNU A;  3U10 A;  3RYC A;  1K3E A;  3A0B Z;  1J5E O;  4QE7 A;  1HNX O;  4IT5 A;  2XND G;  1ARO P;  4BIZ A;  4O2B B;  2X6B A;  4XDK A;  2ZCE A;  3ZN1 A;  3IC9 A;  2AHZ A;  1JMK C;  4CBC A;  2BE3 A;  1K73 W;  1H38 A;  5EC2 C;  1BHB A;  3UT5 B;  2H94 A;  5JQG A;  1R6N A;  4K8X A;  3FB7 C;  4LR3 A;  1IBK O;  2BCC H;  3G6E V;  2UUA O;  3LNM B;  2LFS A;  2AGA A;  2Q73 A;  5IJ9 A;  3ZIA G;  3LUT B;  1XL6 A;  3JAM N;  5JVD A;  4P2Z A;  4PDV A;  2EZP A;  1Z5V A;  4JI6 O;  4JZG A;  1KKD A;  4GT1 A;  1N8R W;  2ZNJ A;  1EM1 A;  1M56 C;  2NNU A;  1BT8 A;  1S5J A;  2FYU H;  4X62 O;  3RFR A;  4Q6G A;  5L3E A;  3FKS G;  4ZHQ B;  1SQB H;  3C90 A;  3TXQ A;  2R70 A;  4TV9 A;  4MVS A;  1SQG A;  1TVK A;  4FFB B;  1S0V A;  4B3R O;  1R3J C;  4KUM A;  4FIP C;  3J81 N;  2PF4 E;  4J7J A;  4NTW A;  1KQS U;  1VQ9 V;  4H13 B;  2QWO B;  2UXN A;  3OGC C;  2CTW A;  3H1I H;  4LF6 B;  5LYJ A;  1GRJ A;  4J10 A;  3JCZ A;  2IJJ A;  3T1Y O;  4J11 A;  4LH6 A;  2EIL B;  1QBZ A;  4I9Q A;  4DV7 O;  1LR1 A;  3OT7 A;  2HKO A;  4TOI A;  2YI9 A;  4I7Z B;  4MW3 A;  1M1K W;  1L0N H;  1M4U A;  4DYL A;  5IJ0 A;  1OCC B;  4DUY O;  2YDE A;  1B06 A;  3BFR A;  3N2K B;  1HNZ O;  3H01 A;  4CS3 A;  2ZE7 A;  3QVN A;  4ZKI A;  4JI8 B;  1WP8 A;  1HNW O;  4J9Z B;  3N2G A;  4UCR A;  1EBO A;  4UFZ A;  5CBH A;  1FXH A;  1NBM G;  1IUR A;  1AI6 A;  2CH7 A;  4UCU A;  4YHH B;  3B8M A;  1VF7 A;  5CA1 B;  1Y4M A;  1T5E A;  1NZ6 A;  2UXD O;  3CPW U;  5JCO A;  3CCR V;  4DV6 B;  3L71 H;  4JI3 O;  2F43 G;  2HLD G;  2P4K A;  3HKE B;  3E35 A;  3N27 A;  2JDI G;  4IHJ A;  1NS1 A;  3HR0 A;  1V55 B;  1Y74 A;  4NB5 A;  1YVW A;  3HKD B;  4LFC B;  1SA0 B;  1NI8 A;  1NTK H;  3CRQ A;  1FFX A;  1F4M A;  4CH6 A;  5EBL C;  4B3S B;  4DR1 O;  4EFB A;  1VQK V;  2BTQ A;  3JAR B;  4OPA A;  1ZL8 A;  3L72 H;  1XRE A;  2WLI A;  3RYF B;  2ZNI A;  3ABL B;  3BCC H;  2ZDI A;  4NYK A;  2W6I G;  2ITD C;  2AZ2 A;  2LGQ A;  5DM6 V;  2GBO A;  1XBL A;  4DRX A;  3E8H A;  4QPJ A;  3K03 A;  1M9N A;  4X1Y A;  1AR1 B;  2E5L O;  4DR7 O;  4W4K A;  2JIZ G;  3RYI B;  4AQY B;  5FNV A;  3EXA A;  2ARH A;  2PZS A;  1ROP A;  1NTZ H;  1Q43 A;  4L87 A;  1ZX3 A;  2FL4 A;  3LDC A;  2GUZ A;  2WLK A;  2Y69 C;  4LF5 B;  2R9R B;  2Q4P A;  2KQX A;  4UVC A;  1X4T A;  4G27 B;  4D7S A;  5BZB A;  1NT2 B;  3W7W A;  2UUB O;  3G80 A;  1US6 A;  3RYH B;  1SRY A;  1K8A W;  5GW7 A;  4FMT A;  2JK5 C;  1VQ4 V;  5IT9 N;  1W0J G;  4JPR A;  4X65 B;  4UB6 Z;  1JR9 A;  4J7K A;  4DV1 O;  4FLW A;  4DR5 O;  4KHP B;  1V9P A;  3NXS A;  2EIN C;  1TUE B;  4XDL A;  3KCY A;  4JI1 B;  4LF7 B;  3DTU B;  4DUZ B;  1BMF G;  1Q8I A;  2ZXW B;  3STL C;  3AG4 B;  4O4I A;  5LOV B;  1K33 A;  1GO3 F;  3CXC U;  5LL6 Y;  1BHA A;  4I50 A;  4X20 A;  3OGI B;  3U0Z A;  1N32 B;  5A2Q N;  3STZ C;  3DXR B;  4PDM A;  1HWY A;  2DYS C;  4FZ0 A;  2CTQ A;  2WLL B;  1O9H A;  1IDS A;  2ZKO A;  2ZE6 A;  4LFA O;  1FJG O;  4X1I A;  2WSS G;  1RP3 B;  4AHC A;  4PV1 B;  2XHB A;  2JGD B;  3THO A;  2L6L A;  5CN0 A;  1Y6X A;  3HPL C;  1EN4 A;  3OFN G;  3JAL A;  1DLB A;  5AG2 A;  1YTF B;  4DV4 O;  1NR7 A;  5KHJ A;  1DF4 A;  4PDR A;  4Z2W A;  2ZE8 A;  5B1O A;  3EFF K;  2P22 C;  2QM7 A;  3F5T A;  1TUB A;  1D2D A;  1I08 A;  1G4Y B;  4MTX A;  2NR5 A;  5K1P A;  1TAE A;  1AJP A;  3ASN B;  2EIK C;  1YF2 A;  4B3T O;  4HBN A;  4DR3 O;  5LMN B;  5J2T B;  4LNU B;  1XMO O;  2HHH B;  3RYC B;  3LSQ A;  4G28 B;  4DK0 A;  4DR2 O;  3H1J H;  1J5E B;  1GN6 A;  3SPI A;  3JSL A;  4FM0 A;  1HNX B;  3CCQ V;  3M8A A;  2EBO A;  5K1X A;  3JAK A;  1H2G A;  4JYY A;  4UV9 A;  2DWE C;  3FYE B;  1GM8 A;  4FLX A;  1GKF A;  1MNG A;  3ETD A;  1NU1 H;  5LP6 C;  3G71 V;  5CB4 A;  2ZM6 B;  4Q20 A;  1AJQ A;  1YCI A;  4B08 A;  1WP7 A;  3WG7 C;  2UUA B;  1SKV A;  2D2C B;  5H5N A;  3S3X A;  1FD9 A;  5J2U A;  1P7G A;  2MK3 A;  1E1Q G;  1XI1 A;  2ZIN A;  5JVD B;  4KXR A;  4WBN A;  5LXT B;  1QLE B;  2BOC C;  4K8Z A;  1OCO C;  2Q68 A;  4JI6 B;  4QNH B;  3W7S A;  2E76 B;  2M7W A;  3B77 A;  1KEC A;  4QE9 A;  4X62 B;  1NJI W;  3ASO C;  3BAA A;  4EB6 A;  1VF6 C;  1KP3 A;  2OWO A;  1H8E G;  4WFF A;  2PUS A;  4TV9 B;  2XOK G;  1YTF D;  1JX9 A;  2FKX A;  4QJF B;  3JYC A;  1VQL V;  1BZK A;  3OTF A;  1JA8 A;  1SES A;  2V7Q G;  1K4D C;  3FAV B;  4TWK A;  3CC2 V;  1YHQ V;  5LYJ B;  1XIL A;  4I4T B;  1B04 A;  3I55 V;  4GCZ A;  1WNS A;  3ZN0 A;  3T1Y B;  2YI8 A;  1PKX A;  1VQ5 V;  4DV7 B;  2HJF C;  3FB5 C;  4U3J A;  3R66 A;  1AR5 A;  2YXL A;  4H44 B;  4HYO A;  3K06 A;  4DUY B;  3GWK C;  2LW7 A;  2EJ7 A;  4JAS A;  1PNK A;  1HNZ B;  2P7T C;  4MVZ A;  2F66 C;  3QNE A;  2OIE A;  3OR7 C;  3N2G B;  4X8A A;  1HNW B;  2W0X A;  3AG7 A;  2DWD C;  2AHY A;  3EVK A;  2OCC B;  3KZI Z;  3PJS K;  2ODM A;  1Y67 A;  1MOF A; 
#chains in the Genus database with same CATH homology
 1BCC H;  1NTZ H;  3L74 H;  1SQV H;  2IBZ H;  1SQB H;  1PP9 H;  4U3F H;  1SQX H;  1KYO F;  1EZV H;  1KB9 F;  3L72 H;  2A06 H;  3L75 H;  3CWB H;  3BCC H;  4PD4 F;  5KLV H;  1NTM H;  3H1H H;  1L0N H;  4D6T H;  1L0L H;  3CXH F;  1SQQ H;  2BCC H;  3H1K H;  1PPJ H;  1NU1 H;  3L70 H;  3L73 H;  1NTK H;  1BGY H;  1SQP H;  3L71 H;  3H1I H;  3TGU H;  3H1L H;  1P84 F;  1BE3 H;  2FYU H;  3CX5 F;  3H1J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...