1JOYA

Solution structure of the homodimeric domain of envz from escherichia coli by multi-dimensional nmr.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
MAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PROTEIN (ENVZ_ECOLI)
publication title Solution structure of the homodimeric core domain of Escherichia coli histidine kinase EnvZ.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 1998-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1joyA00
3DGEA 4JAVA 2P67A 1JOYA 4U7OA 2QM7A 4MTXA 2QM8A 3ZCCA 2LFRA 5IDJA 4ZKIA 4GCZA 3A0RA 4FPPA 5B1OA 4LC1A 5B1NA 4I5SA 4BIUA 5C93A 4QPKA 4U7NA 2FTKA 3ZRXA 2LFSA 3D36A 3TK1A 4QPJA 1F51A 2WWWA 3NXSA 4FMTA 4JAUA 3P32A 4JYBA 2C2AA 4GT1A 4BIZA 3ZRVA 4JASA 4Q20A 4KP4A 4MT8A 3MD0A 4JYCA 3ZRWB 1IXMA 3ZRWA
chains in the Genus database with same CATH superfamily
3DGEA 3T4DA 2IH1C 4NVPA 4LF8B 5H5NA 4O4LA 3WG7B 4UCUA 2OYQA 5LMNO 1VMGA 4IL6Z 4OXSA 3FYEB 4QJFB 5LYJB 3JARB 3ASNB 3E22B 2W0XA 1QR9A 2LW7A 5L3FA 4UFZA 2EJRA 4YXWG 5FPRA 2L35A 1H8EG 1NS1A 3CJHB 3RYIA 4DR4B 5LOVB 2Y48A 3K9AA 4WFAV 1YTFB 4LC1A 3CCMV 1P7BA 1RSOA 4U3JB 1W0JG 4ZBMA 4B3RO 3WB0A 4F6RB 1VQPV 1JJ2U 1PNKA 3MHSC 3PN1A 3ETDA 3CCUV 5IYZA 3HKBB 1W59A 4MVOA 2P4KA 4AQYB 4LF5B 2HR3A 1HR0O 3RYHB 3ZRXA 4JPRA 4LFAO 3K08A 4FLZA 4IT5A 4R7CA 1VQMV 3HKCA 5F2VO 5A2QN 1YJWV 5KHHA 1S77D 1OCRC 4GZRB 1WP7A 4FM1A 3QF7A 3W7TA 4PDMA 1VQ4V 1WA8B 3KKYA 4QGPA 5H6RA 1I94B 1JFFA 4UCRA 4UB6Z 1U96A 4X62O 1XMQB 4PA9A 4I55B 3BVOA 1N32O 1H2NA 1K73W 1V54B 2NLJC 2Q73A 4F6EA 5K1XA 2ZM6O 1EN4A 3VQYA 3HR0A 3RWRD 2P22C 1GK9A 4WFEA 3UQ8A 3K57A 1Q81W 4Z2WA 2W6JG 4JI4O 1FXVA 1NJIW 3QNEA 3CMEV 5BXZA 5FLXN 4P2ZA 2JVDA 4TOIA 3K58A 1GTOA 3T2MA 2Y0IA 1XNQB 4O2BA 1VF5B 3SYAA 5BMVB 1SA0B 1PV0A 5EBLC 3L74H 4W4LA 3M7MX 1YZBA 2G38A 2KSDA 4DV6O 1H2KA 5H9CA 3A2FA 1FYJA 4E4EA 2CGOA 2V4DA 3FX7A 1MZFA 3R65A 4JYBA 2ZD9A 2PYLA 3UKMA 1Q8IA 4O4JA 3E8HA 4JI1O 3MHHC 2H94A 2X7RB 3ZMSA 4B3MO 3ZRWB 3B4SA 2R9AA 1MSDA 4FLYA 2XHBA 1OHHG 4CZZA 5IT9N 2GTAA 4U7OA 2IJJA 3ZHTA 1VEWA 4DV3B 2XT9A 3VQVA 1OV9A 2UUAO 4NR1A 4TV8B 4BIZA 1XEQA 2Q7GA 4FIPC 3K3WA 4DW1A 1NI8A 1FXKB 4WF9V 4FJCC 3D3QA 1LUVA 4TWKA 2ZE6A 4OX9B 4I0XB 2DWEC 3E2EA 4LWSB 4LF9B 1VP7A 1A32A 1AR1B 2JS5A 4I50A 2HP8A 4JZGA 3D8CA 1R1BA 4RO2A 1COWG 5LA6B 5BR8O 2M7WA 3SYQA 2ZR3A 4DR7O 1Z5VA 1QR8A 2WA3A 1NVPD 2OCCC 3AG2C 4JI0O 1SQBH 3GWOA 4MVRA 1YITV 1WAZA 2IJKA 2CK3G 3CD6V 5B3SB 5JH7A 1ZUQA 1F4MA 2YI9A 4TQFA 2LP7A 1H2MA 3RW0A 1HWYA 1P7GA 4MS2A 4CC6A 1SERA 4L8JA 1WNSA 2QWPB 3BY6A 4YY3O 1KD1W 5B1OA 4AHCA 1BT8A 4JYYA 3FD9A 1GRJA 3JASB 4Z1VA 2EZPA 3CCEV 2OTJV 4D7SA 4JTAB 1KKDA 1VQNV 3CRCA 1QLEB 1TGOA 1BL8A 3HB3B 4JI6O 2EJ7A 2CE4A 2Q67A 4DV1B 3SJCC 2HEPA 3OMIB 1BZKA 2ZE5A 3EXAA 2XNDG 3N2GB 5HFLA 2UXCO 2M6YA 4G28B 4DUYB 4R50A 3BA8A 1N34B 1QU7A 2WPDG 3R66A 1MSWD 3N2KB 1SQXH 4K0KO 4MVUA 4X1KA 4ASUG 4IHJA 2X6AA 1V55B 4DR5O 5IJ9B 4MTFA 4LFBO 3SPJA 1ZLZA 4ZHQB 4N21A 3G71V 4LF4B 4DW0A 1H2GA 2VQEB 3ETQA 3BHPA 1SF9A 1YEWA 4GUNA 5LXTA 3JD3A 5E1AC 5LGTA 4YIPA 2CAZC 3WU2Z 3E35A 5FL7G 1X4TA 5EIBC 2Q5ZA 3OUSA 4CS4A 1G6UA 4JI7O 4PI2A 3B40A 4HBNA 3SPCA 4EB6A 5CMUA 5AG2A 4MSWC 1VQ9V 3DC6A 1ZTEA 2BTQB 4DK0A 3OUFA 4JYAB 1M57C 2EULA 4NTWA 3SR2C 1S76D 3CXHF 1Y74A 2H8PC 4LF6O 3K5LA 1G1XB 2YUAA 3AG1C 4MW3A 4NTYA 3ABKC 4X20B 2UUBB 2UXXA 2Q68A 5GW7A 5KHKA 4CH5A 2VS0A 1KYOF 2PZSA 3L72H 4X1YA 1HNWB 2Q7HA 5JQGA 3RYCA 3WG7C 5JVDB 1G8MA 3G4SV 1FFTB 5ITZB 3OFNG 4DRXB 1TUBB 3J81N 3ETEA 4HYOA 4B3SB 5DEDA 3OAAG 2UXNA 1XNRB 4I4TA 4TQDA 1R3JC 1NTZH 1JMKC 2BSKB 4XDKA 3MDSA 4GKKB 1T5EA 2XTAA 2ATKC 1YVWA 4TV9B 3S3WA 2R9IA 3HKDB 3F5TA 4JV5O 3CHXA 1JQ0A 4HNAA 1Q6UA 3OD4A 3N27A 4ABMA 4LF7B 3S3XA 3JALA 1IBKB 4DUZO 4ZOLA 2HG5C 5IJ0A 5LP6C 4X66O 2ADPA 2A3QA 4OGQB 1NR7A 3G6EV 2XUMA 2P90A 1K4CC 1CP9A 5C93A 1GH6A 1VQ6V 2V1DA 2Y69B 2YDEA 3SPHA 2ZE7A 2AZ2A 3MAQA 2AHYA 5JJJB 3UM7A 2ADQB 4MTGA 4JZ2A 2QDOA 3BPZA 3KZIZ 4FZ1A 1JJOA 5EYPA 5DM6V 4J7KA 4FLUA 4DV2B 5L3BA 1VQ5V 2JK5C 1MA1A 4LH6A 2DMXA 4PA7A 3ETGA 5CBGA 2Y4UA 4YJ3B 3FB7C 1F23A 1HNXO 3NR7A 4RUEA 1ORQC 3AG7A 1MNGA 2Y0PA 1V54C 1N36B 1FD9A 3ZN1A 5LHGA 4JI5B 4R6ZA 4A5UB 3L70H 2KG7A 1PNLA 1IXMA 2Q8VA 2Z5UA 3RGBA 4GKJB 2CH7A 1OCOB 2IW5A 2LGWA 2QTOA 3E89A 1M56B 2OWOA 4ICGA 4U7NA 3AK1A 3JYCA 3Q4HB 3X2QB 4KXRA 1KUQA 2EIJB 1NT2B 2HVJC 3OEEG 5IWAB 1M4UA 1DF4A 2XAJA 3ZHQA 1US6A 4K3AA 2ZXWC 4K8XA 2BOBC 5KX5B 4X88A 5GTIZ 5H2FZ 1LR1A 1GN3A 1B3QA 4X1IA 3LSUA 2E74B 2UXBB 5B1AB 4DR3B 1D2DA 4O4IA 2UUCB 2GV9A 4DR1B 3E8GA 1IBLB 5D5QA 4ZI7B 2E3CA 4O4LB 3JSLA 3BCCH 4GX0A 3KCXA 4LR3A 2UXDB 2LJ2A 4YJ2A 3AK2A 4MVMA 1JX9A 5C8YA 1FXKC 3ZHUA 5E79Z 2CTQA 2LO1A 4CS3A 5EIBD 2EIMC 2EINB 3UT5A 4WBNA 1RSOB 3G80A 3K06A 4YIOA 2K9PA 4D7TA 2RDCA 2N05A 2D2CB 3T1HO 1N33O 2F23A 1OCCB 1HW7A 2R9RB 4GX1A 2QTSA 3CWBH 1J5EO 3KG2A 4XDLA 3SYPA 1K3EA 3JD2A 4NB5A 5KLVH 5B3SC 5LHHA 1BMFG 3HKEB 3JSNA 1TA8A 4J9YB 1IDSA 3QG5A 4TUYA 3I5DA 3JAMN 5JCOC 4B3RB 5DECA 1GAXA 2CUGA 4I7ZB 1HNZB 3RT3C 4ZKIA 1ZL8B 3JAKA 1KU9A 3RYFB 3ZMVA 5LMUO 5LYJA 3JARA 2E5LO 1AP5A 1TVKB 3OW2U 4J7ZA 3E22A 4I9WA 3CRRA 1M90W 3IJ4A 5LGNA 3UO3A 2XASA 3C3SA 2KB1A 1AJQA 2A79B 4AQYO 1BS3A 2F66C 3APOA 2WAMA 1RFYA 3SPIA 2EX3A 3P30A 4BAYA 1VIBA 1DGSA 2QR4A 2YXLA 2R72A 4U3JA 2IBZH 1YJNV 2QKCA 3AEIA 1UFIA 4JI8O 1PP9H 2ODMA 1YJ9V 3VQWA 4F6RA 4DR6B 1R6TA 2IU0A 4Z1MG 2YXYA 2P7TC 2W6IG 1V55C 3FYIB 4JF3A 4DXWA 2Q0AA 2L6LA 1JOYA 5LP6A 3HKBA 3JD1A 3CC7V 3ZCCA 2QKSA 2N04A 2V7QG 5J2UB 4IIJB 1F7YA 3RYHA 5HFMA 3EHBB 1XL6A 1H2LA 1KP3A 4JI4B 3DC5A 2ZINA 2GUZB 1KQSU 2WWWA 3ZBHA 1SZXA 4UXNA 3K9SA 1PNMA 2X0LA 4X64O 1FS0G 2FMLA 3AG4B 4MVZA 1W0KG 1IVSA 1XL4A 3ABMC 3TGUH 4DV5O 2Q0OC 2ZNJA 1WA8A 1K5QA 3OR6C 2GHYA 2E76B 4H37A 1Q6IA 2DN9A 4WFFA 2WSSG 2YIBA 2Y4TA 2VWJA 1XNQO 2YIBD 4I55A 4CH3A 4DV6B 3TXQA 4UVBA 2IH3C 4MT8A 2HJDA 3W7XA 4K35A 4JI1B 1QBZA 4B3MB 1N8RW 2CTRA 3I56V 4OPHA 2DYRB 5IYDO 3T1YO 1E1QG 2X6CA 3OR7C 1X59A 1GM9A 4I50B 4LBEC 4UV9A 4JTCB 2UUAB 2A06H 3CX5F 1NVPB 5EZYB 5BMVA 2LW1A 1MMMA 3RVYA 1AROP 3JATB 3CS5A 1Q6HA 1IURA 4HAMA 3GWKC 2WLMA 1M5IA 3NXSA 1Q43A 1Y67A 1JR9A 3VBBA 5IY5B 2EILB 3ZS8C 1K7DA 4NXMB 4JI3O 2E75B 4BWAA 5BR8B 1ZSPA 4J10A 2EIKB 4LF9O 4PDLA 1QCEA 3ZMZA 1NU1H 3BA9A 3QTCA 3TJTA 2NNUA 3OMAB 1RP3B 2GBOA 4JI0B 3QO8A 2CGNA 4C7UA 4TV8A 3ZHRA 1F4NA 4P30A 1H38A 1GN6A 2QKAA 3QO5A 4G27B 1FXKA 5EBMC 2Q6AA 1FFXB 4FLTA 4UCTA 1SZTA 3O9OA 1PD3A 2F4VO 1JCHA 4I0XA 3A0RA 1SQVH 4B08A 4X65O 2Y69C 2O57A 4LWSA 5LL6Y 3ZRSA 3CRAA 1D5NA 5IYCO 4B7KA 4PA3A 2JJ2G 2R70A 2OIGA 1NZ6A 5L3CA 3I55V 5L3GA 5LA6A 1MZEA 4DK1A 3RFRA 3MD0A 1FXHA 2EBOA 3W7SA 1CPYA 1KMIZ 4LNUB 2YIAA 1Q86W 3D3IA 5GONB 3AG3B 2YEVB 3OE7G 1XHZA 4R8CA 1N0NA 4JI6B 2DJVA 4FFBB 1GMGA 1OZ0A 1I5YA 1S72V 2JS3A 2LGQA 2CDYA 3K0DA 3A8TA 2UU9O 5CBFA 1Y4MA 2UXCB 2QJ1A 5JCOA 1OCOC 2ZQMA 1R3LC 3OGCC 2QEXV 1M56C 4K0KB 1Q90D 4H33A 3IGAC 4DR5B 4DUYO 2XAGA 5LGUA 2XAHA 3LDCA 4DR2O 1WB7A 1WP8A 3K5MA 3JASA 4LFBB 4I9QA 4G2KA 1GM8A 3H1LH 2C2AA 2EIJC 1S5JA 3STLC 5LHIA 4JI2B 3CC2V 4CS2A 1IBMO 1WJZA 2ZDIC 1QLNA 2VQEO 1SS3A 1NTKH 1NH2D 4JI7B 1RPRA 3N2GA 4RUFA 5B1AC 1XBLA 4OPAA 4LP8A 2PY5A 5J2TB 5CA1B 4DV0O 5JQGB 4NYKA 1PKXA 5IJ9A 3BFRA 4LF6B 4ZHQA 1OJHA 1MABG 4QNHB 2WLLA 4JYAO 3SGIA 5CA3A 4WCEV 2Q4PA 5KMGB 5B1BB 3ZN0A 2FKXA 3A0BZ 4PDVA 1BGYH 2P06A 4EFBA 5CA0B 2IJHA 4XBFA 2D3OW 4JAAA 2Q7EA 4FLWA 2EINC 2A7WA 4QIWF 5CB4B 2Q9LA 2JGDB 4LFCO 2BTQA 3ASNC 4B3TO 1HNWO 4O4HB 3OTFA 3ZRVA 4JASA 3ZEDA 4KHPO 2QWNB 1KC8W 3JCUZ 3FFQA 2NR5A 2A0LA 3CYOA 5KHIA 2Q69A 4FK5C 4X20A 2RQ6A 1K5SA 2QSAA 3ZIAG 1BSMA 2PTMA 5J9PC 4JV5B 1Q3EA 3JAWB 2FB5A 1NKDA 1VQOV 3OTOB 4JYCA 4YHHO 2NN4A 4DUZB 2BCCH 4ZIBA 4PV1B 1VQ8V 1ENVA 4UCVA 5JVDA 1GN4A 3B8MA 4X66B 4XDJA 1SETA 1IBKO 5L3DA 5ITZA 4DRXA 1TUBA 3OM3B 2HJFC 1XMOO 1P84F 4GX5A 1BE3H 3C90A 1I0HA 3ZMUA 3SJAC 3U10A 4BW9A 4WFHA 1CEZA 4BW5A 3C3TA 3WB2A 4DO2A 2MW2B 4TV9A 1VF6C 2YIDA 3HKDA 3DXRB 1J95A 1E79G 3FAVB 5GTHZ 4BIUA 5B66Z 1Z2GA 3SDLA 3G67A 3LUTB 1L1FA 1FJGO 5B5EZ 3H1JH 4NXNO 1M1KW 3CCLV 5KA5A 3P32A 4PI0A 3E8FA 4DV2O 1HNXB 2HLDG 4FFKA 2YS8A 2RN9A 1Y76B 1VQLV 2AW9A 3FB8C 4FM2A 4FPPA 3F7YC 1KKCA 2VQFO 3ZHVA 5KHJA 2WLIB 1QHTA 2ZR2A 4GKJO 4X89A 3AG4C 5KAFZ 1FKAO 3E83A 1YCIA 4DV4O 5FNVB 1GO3F 3O65A 1O9HA 4J11A 1THZA 1B06A 4GX2A 1SKVA 1EZVH 4YJ3A 1DK1A 1NBMG 1FPOA 2ZNIA 4U3FH 1Y6XA 5IWAO 5A9GA 4O2AB 5KUMA 4KP4A 2DQ3A 2WLHA 1P49A 3ICXA 3EFFK 2QM8A 3KCYA 5EBWC 4TT3G 2BE3A 2N74A 2DYRC 1E1RG 5KA6A 3K0GA 3UT5B 4MVQA 3CCVV 4DV7O 4DR3O 5KAIZ 3ASOB 3CPWU 1KECA 4GT1A 3FB5C 2OTLV 3DTUB 2HFEC 3BEHA 3THOA 4EEQA 2JDIG 2HHHO 1Y66A 1Q5OA 3CCRV 1YIJV 2ZDIA 3RYIB 5KX5A 3CMAV 3L75H 1I7FA 4AILC 2PI4A 3LNNA 2QWOB 2DYSB 3D36C 3ABLB 2ZIMA 1VF7A 1BCCH 3UCSC 5LMNB 5IY5C 1WPBA 2EILC 5DN6G 4KL1A 4LF8O 1K8AW 4J42A 1K9MW 3JD4A 2EIKC 4ZI7A 5IYZB 3T1HB 1N33B 4DYLA 4RQFA 2P6JA 3JAKB 1WN7A 4I5SA 2YC0A 3L71H 1ZWIC 3AK3A 2PUSA 3GB7C 3H1KH 1J5EB 3J80N 3TETA 1XHXA 4F4LA 2KQXA 3HKCB 1XILA 1GM7A 1RM1B 4K8ZA 1PL4A 4MVSA 4DR4O 4WFBV 3LNMB 1CXZB 5K1PA 4NTXA 5CN0A 3ABTA 2F43G 1I08A 3SYOA 4UVAA 1VARA 1EN6A 5B1NA 2RJZA 1JFFB 3LSQA 2LFSA 3K03A 1RPOA 1H2SB 2PYJA 1ZAUA 5EC2C 1ROPA 5LMUB 1AI7A 1HR0B 2E5LB 4W4KA 1VQKV 2JEXA 2AXTZ 2GDSA 4CH4A 1N4CA 5TISZ 4LFAB 3QO7A 1HNZO 4L87A 1XQ8A 4LF5O 1QLEC 5LP6B 1WB8A 3QVNA 2QM7A 3CJHA 3UO2A 2ITDC 5LOVA 2XAQA 3AG3C 3U0ZA 2AZ0A 4FVMA 4QPKA 3SJQC 1YTFD 4UUJC 5LBQA 3DSQA 4UCOA 3HKEA 1JA8A 2YXHA 3P3NA 4X62B 4JI8B 4O2BB 1TUEB 1N32B 2DE0X 5JJNB 2BTOA 1I94O 1K97A 4J7JA 2ZM6B 1ZL8A 3ZX6A 1M9NA 3RYFA 1XMQO 2IJIA 3IFXA 4DR6O 1TVKA 4IGGA 3CSXA 1AI5A 3BRCA 3RVZA 4CH6A 2RCVA 3CB2A 3B2EE 2JIZG 4J80A 4O4JB 1IXBA 1NR1A 1YSCA 4PHZA 4X64B 4JTDB 4H44B 2P67A 4RQEA 1G4YB 1VQ7V 1VF6A 4PD4F 2W0FC 1DF5A 4DV5B 1URFA 5H6QA 3H1HH 4BIOA 1EM1A 1OCZB 1UJWB 4KFMA 2ZE8A 1TAEA 2DOSA 2WLJA 3W7UA 1U97A 2QWRB 3L73H 3VQXA 3T1CA 4P9PA 1S3JA 1GKFA 4UV8A 5J2UA 4IIJA 1L0LH 2ZXWB 2QGNA 4GYCB 3B8NA 3CCQV 2GUZA 1Q82W 1AI6A 5B1BC 4J41A 3T1YB 2B9ZA 1YDXA 1ZX3A 1YF2A 2QE7G 2GSMB 5EC1C 1R73A 1DLBA 4EKWA 3K5OA 1SA0A 2B1GA 4QE7A 1SQFA 4DV3O 1IX9A 1XOUA 3TCUA 3ZMTA 4FZ0A 5IYBO 2VWKA 5JH7B 4PELA 2ILMA 2VRZA 2A9HA 2P5OA 1WLEA 2JJ1G 3IAYA 4OX9O 3ZRWA 3BABA 1R6KA 4FLVA 1K33A 3RN4A 2BOCC 4DR7B 4JI3B 2EIMB 2FTKA 2HKOA 4NXMO 2YSUB 3FKSG 5EZYA 3LSSA 1BQ0A 1V9PA 3JATA 1AI4A 2RNBA 1R3IC 1SESA 4CC5A 2F4VB 1UPGA 3OT7A 5FPOA 4AI8A 3D36A 4YY3B 4BR6A 4X65B 4FMTA 1HDJA 1B6QA 2ETNA 2FYUH 2XAFA 3JCZA 1MG1A 3B77A 3OMNB 3EVKA 1LNQA 4JAVA 1QVFU 4X1KB 4IHJB 2LFRA 1BHBA 4FM0A 1S5LZ 3J7AU 1EZJA 3A0HZ 2H3OA 1SC5B 5LXTB 3K59A 1OCRB 1FFXA 1EFRG 3B09A 4UCSA 4DV1O 1IZ3A 2YI8A 3E86A 2B1IA 2UU9B 1NQTA 1XREA 2KKWA 3ZHSA 1NH2B 2EZOA 1QNMA 4Q6GA 3IC9A 5BY1A 4EB6B 1Z5WA 1KB9F 2DWDC 2JEUA 1N34O 2ARHA 3BAAA 3X2QC 4DR2B 3TXSA 1P4RA 3OGIB 1K4DC 1Y74B 3CP1A 1AB3A 4LNUA 1B04A 3CCSV 4LF4O 1SRYA 2DW4A 2YICA 1IBMB 1R6NA 2LQTA 5GONA 5JJEB 1JPXA 2YEVA 1XUQA 3IC7A 1BQZA 1AR4A 2WLLB 4JI2O 1L8DA 4FFBA 1KP2A 3SPGA 1YXBA 2AHZA 3OEHG 2XOKG 2QA4V 1EN5A 1WPXA 3GVMA 3W7WA 1S5HC 5KHGA 2ZT9B 3N2KA 4X1YB 3ABMB 4MW8A 4PJ0Z 4MTXA 3P3PA 3RYCB 3STZC 2PF4E 2PGGA 4IYIA 3RBZA 4DV0B 3ASOC 1XDCA 4B7EA 4HZ3A 2JGUA 3WB1A 1LUWA 3CEIA 4JGSA 4I4TB 1NTMH 2JRIA 2ZKOA 2WA4A 2UUBO 1AJPA 1SQQH 2X6BA 1Q7YW 1MOFA 2DYSC 3ABLC 3F5WC 4HNAB 2K1EA 4EFEA 1AP6A 5EK0A 4GLXA 1BHAA 4JAUA 3JALB 4E2LA 3CE2A 4LFCB 3HPLC 1FAFA 4B3TB 4ZOLB 5J2TA 4H13B 1OCCC 5CA1A 4UVCA 1S0VA 5IJ0B 3SJBC 4KHPB 1I5XA 3VOUA 3M99B 2OIEA 3H01A 3F7VC 4B3SO 2ZCEA 5BZBA 1XNRO 1K92A 1SQGA 1AR5A 2P4VA 1DTOA 2QWQB 5KMGA 1XI1A 1RM1C 3K79A 4P9OA 2F1MA 4GKKO 2F95B 3T4ZA 4RWUA 5KUKA 5CA0A 4NKGB 3SYCA 1W2BU 5EYPB 2B5UA 2OCHA 2OCCB 4YHHB 4TSFG 5CB4A 3LDDA 2CTWA 3AG2B 4LF7O 3ML0A 1M93A 1AJNA 2JGDA 4RAIA 5D5PA 3M8AA 3OTOO 4O4HA 2DQ0A 2MK3A 1AVMA 1XMOB 2OT5A 4IYHA 2KG7B 2BSKA 4PDRA 2RMKB 2CTPA 3H1IH 2PI5A 2CH7B 4H0LB 3E8BA 5IDJA 3CXCU 4FLXA 4QE9A 4KUMA 4N23A 5CBHA 3ABUA 4X9QA 1F51A 3JAWA 1KBHA 3U11A 3CRQA 4Q20A 3WFVA 3CRMA 3ZJZA 1FJGB 4NXNB 4PA4A 2IM9A 1GN2A 2FL4A 4LH7A 4CBCA 5JWPA 4GCZA 1R3KC 1SQPH 3LDEA 2QM4A 1YHQV 1N36O 3H9VA 3TK1A 4D6TH 4JI5O 4X1IB 4WFGA 2VQFB 1HP8A 3K04A 4O4IB 1PM9A 1QQCA 1L0NH 1N0JA 2HVKC 5IE9A 1K34A 3DXRA 3FAVA 4DV4B 2WLNA 4YJ2B 4UB8Z 1OCZC 3L9DA 3CC4V 2IU3A 3CCJV 5C8YB 2GTSA 1AILA 1Y76A 4LCUC 1D5AA 2WLKA 1EBOA 4WBNB 1H8HG 2WLIA 2UXBO 1O9GA 4QPJA 2UUCO 3FB6C 4DR1O 3Q4HA 3JD0A 4DV7B 1IBLO 3APQA 2ZIOA 1M57B 3K5NA 1JVMA 3G6BA 4X8AA 5FNVA 2Z3YA 2UXDO 1YI2V 2AGAA 2HHHB 3AG1B 1QVGU 3ABKB 1PPJH 2ITCC 5L3EA 2Z0AA 4PA6A 4O2AA 3PJSK 4MTOA 4J9ZB 1PL0A 2F93B 4TUYB
chains in the Genus database with same CATH topology
3T1CA 1OCOC 3DGEA 3T4DA 2ZQMA 1R3LC 2IH1C 3OGCC 2QEXV 1M56C 4P9PA 1S3JA 1GKFA 1NR7A 3G6EV 4UV8A 3WG7B 4H33A 2P90A 2ZXWB 1K4CC 1CP9A 5C93A 3B8NA 3IGAC 3FYEB 2V1DA 2Y69B 4OXSA 3SPHA 4QJFB 1VQ6V 2XAGA 5LGUA 2XAHA 3LDCA 3CCQV 1Q82W 1AI6A 5B1BC 3ASNB 4G2KA 1GM8A 2AHYA 1QR9A 2C2AA 3UM7A 2EIJC 3STLC 4MTGA 5L3FA 5LHIA 3CC2V 2EJRA 2QE7G 4YXWG 2GSMB 5DM6V 1H8EG 1R73A 5EC1C 1DLBA 4EKWA 2ZDIC 2B1GA 4QE7A 5L3BA 1QLNA 1VQ5V 2Y48A 3K9AA 4WFAV 1YTFB 2JK5C 4LC1A 4PA7A 3ETGA 5CBGA 3CCMV 1P7BA 3TCUA 3FB7C 1F23A 3ZMTA 1NH2D 1RPRA 4RUEA 5IYBO 1ORQC 1W0JG 4RUFA 4ZBMA 5B1AC 4PELA 1V54C 3ZN1A 5LHGA 1VQPV 1JJ2U 1PNKA 2A9HA 3MHSC 4R6ZA 4LP8A 1WLEA 1PNLA 2JJ1G 1IXMA 3ETDA 3ZRWA 2Z5UA 3CCUV 2IW5A 1OCOB 1PKXA 1R6KA 4MVOA 1K33A 2BOCC 2QTOA 3E89A 1M56B 2EIMB 2HR3A 1MABG 4U7NA 2FTKA 2WLLA 3ZRXA 4JPRA 4QNHB 5CA3A 2HKOA 3K08A 4WCEV 4R7CA 5B1BB 3ZN0A 1VQMV 3JYCA 1YJWV 3X2QB 2EIJB 1S77D 1OCRC 4PDVA 2YSUB 3FKSG 3LSSA 2HVJC 2IJHA 3OEEG 3W7TA 2XAJA 1DF4A 4XBFA 4PDMA 1AI4A 2D3OW 1R3IC 1VQ4V 2EINC 1SESA 2ZXWC 2BOBC 4QIWF 5H6RA 4X88A 3D36A 3ASNC 4FMTA 1B6QA 4PA9A 5B1AB 3ZRVA 4JASA 1K73W 2XAFA 3JCZA 1V54B 2NLJC 1MG1A 1KC8W 3B77A 3OMNB 3E8GA 1LNQA 2A0LA 4JAVA 1QVFU 3CYOA 1GK9A 4WFEA 2Q69A 4FK5C 1Q81W 2W6JG 2LFRA 1FXVA 1BHBA 4GX0A 1EZJA 1NJIW 3QNEA 1K5SA 3CMEV 3ZIAG 5J9PC 4P2ZA 4MVMA 1GTOA 1JX9A 3T2MA 1NKDA 1VQOV 1FXKC 1OCRB 1EFRG 4JYCA 3SYAA 1VQ8V 3E86A 2B1IA 1NQTA 5EBLC 1ENVA 2EIMC 3B8MA 4XDJA 2EZOA 1NH2B 2EINB 1SETA 5L3DA 3K06A 3OM3B 5H9CA 2HJFC 2DWDC 2JEUA 4GX5A 3ZMUA 3R65A 4JYBA 2ZD9A 3X2QC 3UKMA 1P4RA 3E8HA 4WFHA 1CEZA 3MHHC 1K4DC 2H94A 2X7RB 4BW5A 3ZMSA 3ZRWB 1OCCB 3CP1A 1OHHG 4CZZA 3CCSV 1SRYA 4DO2A 4U7OA 2R9RB 4GX1A 2DW4A 1R6NA 3KG2A 1J95A 4XDLA 2IJJA 1JPXA 1E79G 2YEVA 3SYPA 4BIUA 3IC7A 1K3EA 3JD2A 2WLLB 3LUTB 1KP2A 1L1FA 5B3SC 5LHHA 1BMFG 3SPGA 1M1KW 2AHZA 5KA5A 3P32A 3CCLV 3OEHG 2XOKG 2QA4V 4BIZA 1WPXA 3E8FA 4J9YB 2HLDG 4FIPC 3W7WA 3K3WA 1S5HC 1FXKB 4WF9V 4FJCC 1VQLV 3ABMB 4MW8A 4MTXA 4TWKA 3STZC 3FB8C 4ZKIA 2DWEC 4FPPA 3F7YC 3RBZA 3E2EA 3ZMVA 3ASOC 2WLIB 1AR1B 4HZ3A 3OW2U 4I9WA 2ZR2A 4RO2A 4X89A 1M90W 4JGSA 1COWG 5LGNA 2XASA 3AG4C 2KB1A 2M7WA 3SYQA 2ZR3A 3E83A 1AJQA 2A79B 2WAMA 1GO3F 1QR8A 3SPIA 3P30A 1NVPD 2OCCC 1AJPA 4BAYA 1THZA 2X6BA 1Q7YW 3AG2C 4GX2A 1MOFA 3GWOA 4MVRA 2DYSC 3ABLC 3F5WC 2K1EA 1YITV 1YJNV 3AEIA 1NBMG 2IJKA 5EK0A 1BHAA 2CK3G 4JAUA 3CD6V 5B3SB 1F4MA 1YJ9V 4E2LA 5KUMA 2LP7A 3HPLC 4KP4A 2IU0A 3RW0A 1HWYA 2P7TC 4Z1MG 2DQ3A 2W6IG 2WLHA 4MS2A 1OCCC 3EFFK 1SERA 1V55C 3FYIB 4JF3A 4DXWA 4UVCA 1S0VA 1JOYA 3JD1A 1I5XA 3CC7V 2QM8A 5EBWC 2QKSA 3BY6A 3H01A 3M99B 3VOUA 4TT3G 3ZCCA 2DYRC 1E1RG 2V7QG 5KA6A 1KD1W 3F7VC 3K0GA 5B1OA 5BZBA 5HFMA 4MVQA 3EHBB 1XL6A 3CCVV 1KP3A 1K92A 1DTOA 3ASOB 1KQSU 2WWWA 3CPWU 1KECA 4UXNA 1RM1C 2EZPA 4GT1A 3CCEV 1PNMA 3FB5C 2X0LA 3K79A 4P9OA 2OTJV 1FS0G 2OTLV 3AG4B 3T4ZA 4MVZA 3DTUB 5KUKA 2HFEC 1W0KG 3BEHA 4JTAB 2JDIG 3SYCA 1KKDA 1VQNV 1W2BU 2B5UA 1XL4A 3ABMC 1QLEB 1Y66A 1BL8A 3CCRV 2ZDIA 3HB3B 1YIJV 2OCCB 1K5QA 4TSFG 3LDDA 3AG2B 2Q67A 2GHYA 3OR6C 3CMAV 4H37A 4WFFA 3ML0A 2PI4A 1AJNA 2DYSB 2WSSG 3ABLB 4RAIA 3OMIB 2XNDG 5HFLA 4UVBA 4G28B 2DQ0A 5IY5C 2MK3A 4R50A 2EILC 5DN6G 2IH3C 2OT5A 4MT8A 1MSWD 2WPDG 1K8AW 3W7XA 4MVUA 1K9MW 3JD4A 4PDRA 2EIKC 4ASUG 2X6AA 1V55B 2PI5A 1QBZA 1N8RW 3E8BA 5IDJA 3CXCU 4MTFA 4RQFA 4QE9A 3I56V 2P6JA 3SPJA 2DYRB 4KUMA 4I5SA 4N21A 3G71V 1ZWIC 3GB7C 1H2GA 4N23A 5IYDO 5CBHA 3TETA 1E1QG 2X6CA 3ABUA 3OR7C 4F4LA 1F51A 1GM9A 4LBEC 4UV9A 1GM7A 1RM1B 4Q20A 3WFVA 4JTCB 3JD3A 3ZJZA 4MVSA 5E1AC 4PA4A 4WFBV 3LNMB 5LGTA 1NVPB 3E35A 5FL7G 3RVYA 1AROP 5CN0A 4CBCA 3ABTA 3OUSA 2F43G 3SYOA 4UVAA 4GCZA 4HAMA 1R3KC 5B1NA 3SPCA 3LDEA 3LSQA 1YHQV 2LFSA 3K03A 5CMUA 1RPOA 3TK1A 2WLMA 4MSWC 1VQ9V 5EC2C 1ROPA 3NXSA 4WFGA 1AI7A 3OUFA 1VQKV 1M57C 2JEXA 3VBBA 3K04A 5IY5B 1S76D 2EILB 3QO7A 1K7DA 4L87A 2H8PC 1QLEC 2EIKB 2HVKC 1QCEA 2QM7A 4PDLA 3ZMZA 1K34A 2ITDC 2XAQA 3AG3C 3AG1C 4MW3A 3ABKC 2NNUA 3OMAB 4QPKA 2UXXA 2Q68A 5GW7A 2WLNA 3SJQC 1YTFD 4UUJC 5LBQA 1OCZC 3QO8A 3CC4V 1F4NA 2IU3A 3CCJV 4P30A 1H38A 3QO5A 4G27B 1FXKA 5EBMC 2Q6AA 1TUEB 1SZTA 4LCUC 1PD3A 2WLKA 1K97A 1JCHA 3WG7C 3G4SV 1G8MA 3A0RA 1M9NA 1FFTB 2Y69C 1EBOA 3ZRSA 2IJIA 1H8HG 3IFXA 3OFNG 5IYCO 2WLIA 4PA3A 2JJ2G 3ETEA 4QPJA 4HYOA 1AI5A 3OAAG 2UXNA 3FB6C 5L3CA 3I55V 5L3GA 3JD0A 3RVZA 1R3JC 2JIZG 1M57B 3MD0A 1JVMA 1NR1A 1YSCA 1FXHA 4XDKA 4JTDB 4X8AA 2EBOA 2P67A 3W7SA 1CPYA 4RQEA 2ATKC 2Z3YA 1G4YB 1VQ7V 2R9IA 1YI2V 1Q86W 2W0FC 3D3IA 1DF5A 3AG1B 3AG3B 2YEVB 3OE7G 1QVGU 3ABKB 4R8CA 1JQ0A 5H6QA 2ITCC 5L3EA 1GMGA 1OZ0A 1I5YA 1OCZB 1S72V 1UJWB 4PA6A 4KFMA 3PJSK 3K0DA 4MTOA 2WLJA 4J9ZB 1PL0A 3W7UA 2HG5C 5CBFA 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DGE A;  4JAV A;  2P67 A;  1JOY A;  4U7O A;  2QM7 A;  4MTX A;  2QM8 A;  3ZCC A;  2LFR A;  5IDJ A;  4ZKI A;  4GCZ A;  3A0R A;  4FPP A;  5B1O A;  4LC1 A;  5B1N A;  4I5S A;  4BIU A;  5C93 A;  4QPK A;  4U7N A;  2FTK A;  3ZRX A;  2LFS A;  3D36 A;  3TK1 A;  4QPJ A;  1F51 A;  2WWW A;  3NXS A;  4FMT A;  4JAU A;  3P32 A;  4JYB A;  2C2A A;  4GT1 A;  4BIZ A;  3ZRV A;  4JAS A;  4Q20 A;  4KP4 A;  4MT8 A;  3MD0 A;  4JYC A;  3ZRW B;  1IXM A;  3ZRW A; 
#chains in the Genus database with same CATH topology
 3DGE A;  3T4D A;  2IH1 C;  4NVP A;  4LF8 B;  5H5N A;  4O4L A;  3WG7 B;  4UCU A;  2OYQ A;  5LMN O;  1VMG A;  4IL6 Z;  4OXS A;  3FYE B;  4QJF B;  5LYJ B;  3JAR B;  3ASN B;  3E22 B;  2W0X A;  1QR9 A;  2LW7 A;  5L3F A;  4UFZ A;  2EJR A;  4YXW G;  5FPR A;  2L35 A;  1H8E G;  1NS1 A;  3CJH B;  3RYI A;  4DR4 B;  5LOV B;  2Y48 A;  3K9A A;  4WFA V;  1YTF B;  4LC1 A;  3CCM V;  1P7B A;  1RSO A;  4U3J B;  1W0J G;  4ZBM A;  4B3R O;  3WB0 A;  4F6R B;  1VQP V;  1JJ2 U;  1PNK A;  3MHS C;  3PN1 A;  3ETD A;  3CCU V;  5IYZ A;  3HKB B;  1W59 A;  4MVO A;  2P4K A;  4AQY B;  4LF5 B;  2HR3 A;  1HR0 O;  3RYH B;  3ZRX A;  4JPR A;  4LFA O;  3K08 A;  4FLZ A;  4IT5 A;  4R7C A;  1VQM V;  3HKC A;  5F2V O;  5A2Q N;  1YJW V;  5KHH A;  1S77 D;  1OCR C;  4GZR B;  1WP7 A;  4FM1 A;  3QF7 A;  3W7T A;  4PDM A;  1VQ4 V;  1WA8 B;  3KKY A;  4QGP A;  5H6R A;  1I94 B;  1JFF A;  4UCR A;  4UB6 Z;  1U96 A;  4X62 O;  1XMQ B;  4PA9 A;  4I55 B;  3BVO A;  1N32 O;  1H2N A;  1K73 W;  1V54 B;  2NLJ C;  2Q73 A;  4F6E A;  5K1X A;  2ZM6 O;  1EN4 A;  3VQY A;  3HR0 A;  3RWR D;  2P22 C;  1GK9 A;  4WFE A;  3UQ8 A;  3K57 A;  1Q81 W;  4Z2W A;  2W6J G;  4JI4 O;  1FXV A;  1NJI W;  3QNE A;  3CME V;  5BXZ A;  5FLX N;  4P2Z A;  2JVD A;  4TOI A;  3K58 A;  1GTO A;  3T2M A;  2Y0I A;  1XNQ B;  4O2B A;  1VF5 B;  3SYA A;  5BMV B;  1SA0 B;  1PV0 A;  5EBL C;  3L74 H;  4W4L A;  3M7M X;  1YZB A;  2G38 A;  2KSD A;  4DV6 O;  1H2K A;  5H9C A;  3A2F A;  1FYJ A;  4E4E A;  2CGO A;  2V4D A;  3FX7 A;  1MZF A;  3R65 A;  4JYB A;  2ZD9 A;  2PYL A;  3UKM A;  1Q8I A;  4O4J A;  3E8H A;  4JI1 O;  3MHH C;  2H94 A;  2X7R B;  3ZMS A;  4B3M O;  3ZRW B;  3B4S A;  2R9A A;  1MSD A;  4FLY A;  2XHB A;  1OHH G;  4CZZ A;  5IT9 N;  2GTA A;  4U7O A;  2IJJ A;  3ZHT A;  1VEW A;  4DV3 B;  2XT9 A;  3VQV A;  1OV9 A;  2UUA O;  4NR1 A;  4TV8 B;  4BIZ A;  1XEQ A;  2Q7G A;  4FIP C;  3K3W A;  4DW1 A;  1NI8 A;  1FXK B;  4WF9 V;  4FJC C;  3D3Q A;  1LUV A;  4TWK A;  2ZE6 A;  4OX9 B;  4I0X B;  2DWE C;  3E2E A;  4LWS B;  4LF9 B;  1VP7 A;  1A32 A;  1AR1 B;  2JS5 A;  4I50 A;  2HP8 A;  4JZG A;  3D8C A;  1R1B A;  4RO2 A;  1COW G;  5LA6 B;  5BR8 O;  2M7W A;  3SYQ A;  2ZR3 A;  4DR7 O;  1Z5V A;  1QR8 A;  2WA3 A;  1NVP D;  2OCC C;  3AG2 C;  4JI0 O;  1SQB H;  3GWO A;  4MVR A;  1YIT V;  1WAZ A;  2IJK A;  2CK3 G;  3CD6 V;  5B3S B;  5JH7 A;  1ZUQ A;  1F4M A;  2YI9 A;  4TQF A;  2LP7 A;  1H2M A;  3RW0 A;  1HWY A;  1P7G A;  4MS2 A;  4CC6 A;  1SER A;  4L8J A;  1WNS A;  2QWP B;  3BY6 A;  4YY3 O;  1KD1 W;  5B1O A;  4AHC A;  1BT8 A;  4JYY A;  3FD9 A;  1GRJ A;  3JAS B;  4Z1V A;  2EZP A;  3CCE V;  2OTJ V;  4D7S A;  4JTA B;  1KKD A;  1VQN V;  3CRC A;  1QLE B;  1TGO A;  1BL8 A;  3HB3 B;  4JI6 O;  2EJ7 A;  2CE4 A;  2Q67 A;  4DV1 B;  3SJC C;  2HEP A;  3OMI B;  1BZK A;  2ZE5 A;  3EXA A;  2XND G;  3N2G B;  5HFL A;  2UXC O;  2M6Y A;  4G28 B;  4DUY B;  4R50 A;  3BA8 A;  1N34 B;  1QU7 A;  2WPD G;  3R66 A;  1MSW D;  3N2K B;  1SQX H;  4K0K O;  4MVU A;  4X1K A;  4ASU G;  4IHJ A;  2X6A A;  1V55 B;  4DR5 O;  5IJ9 B;  4MTF A;  4LFB O;  3SPJ A;  1ZLZ A;  4ZHQ B;  4N21 A;  3G71 V;  4LF4 B;  4DW0 A;  1H2G A;  2VQE B;  3ETQ A;  3BHP A;  1SF9 A;  1YEW A;  4GUN A;  5LXT A;  3JD3 A;  5E1A C;  5LGT A;  4YIP A;  2CAZ C;  3WU2 Z;  3E35 A;  5FL7 G;  1X4T A;  5EIB C;  2Q5Z A;  3OUS A;  4CS4 A;  1G6U A;  4JI7 O;  4PI2 A;  3B40 A;  4HBN A;  3SPC A;  4EB6 A;  5CMU A;  5AG2 A;  4MSW C;  1VQ9 V;  3DC6 A;  1ZTE A;  2BTQ B;  4DK0 A;  3OUF A;  4JYA B;  1M57 C;  2EUL A;  4NTW A;  3SR2 C;  1S76 D;  3CXH F;  1Y74 A;  2H8P C;  4LF6 O;  3K5L A;  1G1X B;  2YUA A;  3AG1 C;  4MW3 A;  4NTY A;  3ABK C;  4X20 B;  2UUB B;  2UXX A;  2Q68 A;  5GW7 A;  5KHK A;  4CH5 A;  2VS0 A;  1KYO F;  2PZS A;  3L72 H;  4X1Y A;  1HNW B;  2Q7H A;  5JQG A;  3RYC A;  3WG7 C;  5JVD B;  1G8M A;  3G4S V;  1FFT B;  5ITZ B;  3OFN G;  4DRX B;  1TUB B;  3J81 N;  3ETE A;  4HYO A;  4B3S B;  5DED A;  3OAA G;  2UXN A;  1XNR B;  4I4T A;  4TQD A;  1R3J C;  1NTZ H;  1JMK C;  2BSK B;  4XDK A;  3MDS A;  4GKK B;  1T5E A;  2XTA A;  2ATK C;  1YVW A;  4TV9 B;  3S3W A;  2R9I A;  3HKD B;  3F5T A;  4JV5 O;  3CHX A;  1JQ0 A;  4HNA A;  1Q6U A;  3OD4 A;  3N27 A;  4ABM A;  4LF7 B;  3S3X A;  3JAL A;  1IBK B;  4DUZ O;  4ZOL A;  2HG5 C;  5IJ0 A;  5LP6 C;  4X66 O;  2ADP A;  2A3Q A;  4OGQ B;  1NR7 A;  3G6E V;  2XUM A;  2P90 A;  1K4C C;  1CP9 A;  5C93 A;  1GH6 A;  1VQ6 V;  2V1D A;  2Y69 B;  2YDE A;  3SPH A;  2ZE7 A;  2AZ2 A;  3MAQ A;  2AHY A;  5JJJ B;  3UM7 A;  2ADQ B;  4MTG A;  4JZ2 A;  2QDO A;  3BPZ A;  3KZI Z;  4FZ1 A;  1JJO A;  5EYP A;  5DM6 V;  4J7K A;  4FLU A;  4DV2 B;  5L3B A;  1VQ5 V;  2JK5 C;  1MA1 A;  4LH6 A;  2DMX A;  4PA7 A;  3ETG A;  5CBG A;  2Y4U A;  4YJ3 B;  3FB7 C;  1F23 A;  1HNX O;  3NR7 A;  4RUE A;  1ORQ C;  3AG7 A;  1MNG A;  2Y0P A;  1V54 C;  1N36 B;  1FD9 A;  3ZN1 A;  5LHG A;  4JI5 B;  4R6Z A;  4A5U B;  3L70 H;  2KG7 A;  1PNL A;  1IXM A;  2Q8V A;  2Z5U A;  3RGB A;  4GKJ B;  2CH7 A;  1OCO B;  2IW5 A;  2LGW A;  2QTO A;  3E89 A;  1M56 B;  2OWO A;  4ICG A;  4U7N A;  3AK1 A;  3JYC A;  3Q4H B;  3X2Q B;  4KXR A;  1KUQ A;  2EIJ B;  1NT2 B;  2HVJ C;  3OEE G;  5IWA B;  1M4U A;  1DF4 A;  2XAJ A;  3ZHQ A;  1US6 A;  4K3A A;  2ZXW C;  4K8X A;  2BOB C;  5KX5 B;  4X88 A;  5GTI Z;  5H2F Z;  1LR1 A;  1GN3 A;  1B3Q A;  4X1I A;  3LSU A;  2E74 B;  2UXB B;  5B1A B;  4DR3 B;  1D2D A;  4O4I A;  2UUC B;  2GV9 A;  4DR1 B;  3E8G A;  1IBL B;  5D5Q A;  4ZI7 B;  2E3C A;  4O4L B;  3JSL A;  3BCC H;  4GX0 A;  3KCX A;  4LR3 A;  2UXD B;  2LJ2 A;  4YJ2 A;  3AK2 A;  4MVM A;  1JX9 A;  5C8Y A;  1FXK C;  3ZHU A;  5E79 Z;  2CTQ A;  2LO1 A;  4CS3 A;  5EIB D;  2EIM C;  2EIN B;  3UT5 A;  4WBN A;  1RSO B;  3G80 A;  3K06 A;  4YIO A;  2K9P A;  4D7T A;  2RDC A;  2N05 A;  2D2C B;  3T1H O;  1N33 O;  2F23 A;  1OCC B;  1HW7 A;  2R9R B;  4GX1 A;  2QTS A;  3CWB H;  1J5E O;  3KG2 A;  4XDL A;  3SYP A;  1K3E A;  3JD2 A;  4NB5 A;  5KLV H;  5B3S C;  5LHH A;  1BMF G;  3HKE B;  3JSN A;  1TA8 A;  4J9Y B;  1IDS A;  3QG5 A;  4TUY A;  3I5D A;  3JAM N;  5JCO C;  4B3R B;  5DEC A;  1GAX A;  2CUG A;  4I7Z B;  1HNZ B;  3RT3 C;  4ZKI A;  1ZL8 B;  3JAK A;  1KU9 A;  3RYF B;  3ZMV A;  5LMU O;  5LYJ A;  3JAR A;  2E5L O;  1AP5 A;  1TVK B;  3OW2 U;  4J7Z A;  3E22 A;  4I9W A;  3CRR A;  1M90 W;  3IJ4 A;  5LGN A;  3UO3 A;  2XAS A;  3C3S A;  2KB1 A;  1AJQ A;  2A79 B;  4AQY O;  1BS3 A;  2F66 C;  3APO A;  2WAM A;  1RFY A;  3SPI A;  2EX3 A;  3P30 A;  4BAY A;  1VIB A;  1DGS A;  2QR4 A;  2YXL A;  2R72 A;  4U3J A;  2IBZ H;  1YJN V;  2QKC A;  3AEI A;  1UFI A;  4JI8 O;  1PP9 H;  2ODM A;  1YJ9 V;  3VQW A;  4F6R A;  4DR6 B;  1R6T A;  2IU0 A;  4Z1M G;  2YXY A;  2P7T C;  2W6I G;  1V55 C;  3FYI B;  4JF3 A;  4DXW A;  2Q0A A;  2L6L A;  1JOY A;  5LP6 A;  3HKB A;  3JD1 A;  3CC7 V;  3ZCC A;  2QKS A;  2N04 A;  2V7Q G;  5J2U B;  4IIJ B;  1F7Y A;  3RYH A;  5HFM A;  3EHB B;  1XL6 A;  1H2L A;  1KP3 A;  4JI4 B;  3DC5 A;  2ZIN A;  2GUZ B;  1KQS U;  2WWW A;  3ZBH A;  1SZX A;  4UXN A;  3K9S A;  1PNM A;  2X0L A;  4X64 O;  1FS0 G;  2FML A;  3AG4 B;  4MVZ A;  1W0K G;  1IVS A;  1XL4 A;  3ABM C;  3TGU H;  4DV5 O;  2Q0O C;  2ZNJ A;  1WA8 A;  1K5Q A;  3OR6 C;  2GHY A;  2E76 B;  4H37 A;  1Q6I A;  2DN9 A;  4WFF A;  2WSS G;  2YIB A;  2Y4T A;  2VWJ A;  1XNQ O;  2YIB D;  4I55 A;  4CH3 A;  4DV6 B;  3TXQ A;  4UVB A;  2IH3 C;  4MT8 A;  2HJD A;  3W7X A;  4K35 A;  4JI1 B;  1QBZ A;  4B3M B;  1N8R W;  2CTR A;  3I56 V;  4OPH A;  2DYR B;  5IYD O;  3T1Y O;  1E1Q G;  2X6C A;  3OR7 C;  1X59 A;  1GM9 A;  4I50 B;  4LBE C;  4UV9 A;  4JTC B;  2UUA B;  2A06 H;  3CX5 F;  1NVP B;  5EZY B;  5BMV A;  2LW1 A;  1MMM A;  3RVY A;  1ARO P;  3JAT B;  3CS5 A;  1Q6H A;  1IUR A;  4HAM A;  3GWK C;  2WLM A;  1M5I A;  3NXS A;  1Q43 A;  1Y67 A;  1JR9 A;  3VBB A;  5IY5 B;  2EIL B;  3ZS8 C;  1K7D A;  4NXM B;  4JI3 O;  2E75 B;  4BWA A;  5BR8 B;  1ZSP A;  4J10 A;  2EIK B;  4LF9 O;  4PDL A;  1QCE A;  3ZMZ A;  1NU1 H;  3BA9 A;  3QTC A;  3TJT A;  2NNU A;  3OMA B;  1RP3 B;  2GBO A;  4JI0 B;  3QO8 A;  2CGN A;  4C7U A;  4TV8 A;  3ZHR A;  1F4N A;  4P30 A;  1H38 A;  1GN6 A;  2QKA A;  3QO5 A;  4G27 B;  1FXK A;  5EBM C;  2Q6A A;  1FFX B;  4FLT A;  4UCT A;  1SZT A;  3O9O A;  1PD3 A;  2F4V O;  1JCH A;  4I0X A;  3A0R A;  1SQV H;  4B08 A;  4X65 O;  2Y69 C;  2O57 A;  4LWS A;  5LL6 Y;  3ZRS A;  3CRA A;  1D5N A;  5IYC O;  4B7K A;  4PA3 A;  2JJ2 G;  2R70 A;  2OIG A;  1NZ6 A;  5L3C A;  3I55 V;  5L3G A;  5LA6 A;  1MZE A;  4DK1 A;  3RFR A;  3MD0 A;  1FXH A;  2EBO A;  3W7S A;  1CPY A;  1KMI Z;  4LNU B;  2YIA A;  1Q86 W;  3D3I A;  5GON B;  3AG3 B;  2YEV B;  3OE7 G;  1XHZ A;  4R8C A;  1N0N A;  4JI6 B;  2DJV A;  4FFB B;  1GMG A;  1OZ0 A;  1I5Y A;  1S72 V;  2JS3 A;  2LGQ A;  2CDY A;  3K0D A;  3A8T A;  2UU9 O;  5CBF A;  1Y4M A;  2UXC B;  2QJ1 A;  5JCO A;  1OCO C;  2ZQM A;  1R3L C;  3OGC C;  2QEX V;  1M56 C;  4K0K B;  1Q90 D;  4H33 A;  3IGA C;  4DR5 B;  4DUY O;  2XAG A;  5LGU A;  2XAH A;  3LDC A;  4DR2 O;  1WB7 A;  1WP8 A;  3K5M A;  3JAS A;  4LFB B;  4I9Q A;  4G2K A;  1GM8 A;  3H1L H;  2C2A A;  2EIJ C;  1S5J A;  3STL C;  5LHI A;  4JI2 B;  3CC2 V;  4CS2 A;  1IBM O;  1WJZ A;  2ZDI C;  1QLN A;  2VQE O;  1SS3 A;  1NTK H;  1NH2 D;  4JI7 B;  1RPR A;  3N2G A;  4RUF A;  5B1A C;  1XBL A;  4OPA A;  4LP8 A;  2PY5 A;  5J2T B;  5CA1 B;  4DV0 O;  5JQG B;  4NYK A;  1PKX A;  5IJ9 A;  3BFR A;  4LF6 B;  4ZHQ A;  1OJH A;  1MAB G;  4QNH B;  2WLL A;  4JYA O;  3SGI A;  5CA3 A;  4WCE V;  2Q4P A;  5KMG B;  5B1B B;  3ZN0 A;  2FKX A;  3A0B Z;  4PDV A;  1BGY H;  2P06 A;  4EFB A;  5CA0 B;  2IJH A;  4XBF A;  2D3O W;  4JAA A;  2Q7E A;  4FLW A;  2EIN C;  2A7W A;  4QIW F;  5CB4 B;  2Q9L A;  2JGD B;  4LFC O;  2BTQ A;  3ASN C;  4B3T O;  1HNW O;  4O4H B;  3OTF A;  3ZRV A;  4JAS A;  3ZED A;  4KHP O;  2QWN B;  1KC8 W;  3JCU Z;  3FFQ A;  2NR5 A;  2A0L A;  3CYO A;  5KHI A;  2Q69 A;  4FK5 C;  4X20 A;  2RQ6 A;  1K5S A;  2QSA A;  3ZIA G;  1BSM A;  2PTM A;  5J9P C;  4JV5 B;  1Q3E A;  3JAW B;  2FB5 A;  1NKD A;  1VQO V;  3OTO B;  4JYC A;  4YHH O;  2NN4 A;  4DUZ B;  2BCC H;  4ZIB A;  4PV1 B;  1VQ8 V;  1ENV A;  4UCV A;  5JVD A;  1GN4 A;  3B8M A;  4X66 B;  4XDJ A;  1SET A;  1IBK O;  5L3D A;  5ITZ A;  4DRX A;  1TUB A;  3OM3 B;  2HJF C;  1XMO O;  1P84 F;  4GX5 A;  1BE3 H;  3C90 A;  1I0H A;  3ZMU A;  3SJA C;  3U10 A;  4BW9 A;  4WFH A;  1CEZ A;  4BW5 A;  3C3T A;  3WB2 A;  4DO2 A;  2MW2 B;  4TV9 A;  1VF6 C;  2YID A;  3HKD A;  3DXR B;  1J95 A;  1E79 G;  3FAV B;  5GTH Z;  4BIU A;  5B66 Z;  1Z2G A;  3SDL A;  3G67 A;  3LUT B;  1L1F A;  1FJG O;  5B5E Z;  3H1J H;  4NXN O;  1M1K W;  3CCL V;  5KA5 A;  3P32 A;  4PI0 A;  3E8F A;  4DV2 O;  1HNX B;  2HLD G;  4FFK A;  2YS8 A;  2RN9 A;  1Y76 B;  1VQL V;  2AW9 A;  3FB8 C;  4FM2 A;  4FPP A;  3F7Y C;  1KKC A;  2VQF O;  3ZHV A;  5KHJ A;  2WLI B;  1QHT A;  2ZR2 A;  4GKJ O;  4X89 A;  3AG4 C;  5KAF Z;  1FKA O;  3E83 A;  1YCI A;  4DV4 O;  5FNV B;  1GO3 F;  3O65 A;  1O9H A;  4J11 A;  1THZ A;  1B06 A;  4GX2 A;  1SKV A;  1EZV H;  4YJ3 A;  1DK1 A;  1NBM G;  1FPO A;  2ZNI A;  4U3F H;  1Y6X A;  5IWA O;  5A9G A;  4O2A B;  5KUM A;  4KP4 A;  2DQ3 A;  2WLH A;  1P49 A;  3ICX A;  3EFF K;  2QM8 A;  3KCY A;  5EBW C;  4TT3 G;  2BE3 A;  2N74 A;  2DYR C;  1E1R G;  5KA6 A;  3K0G A;  3UT5 B;  4MVQ A;  3CCV V;  4DV7 O;  4DR3 O;  5KAI Z;  3ASO B;  3CPW U;  1KEC A;  4GT1 A;  3FB5 C;  2OTL V;  3DTU B;  2HFE C;  3BEH A;  3THO A;  4EEQ A;  2JDI G;  2HHH O;  1Y66 A;  1Q5O A;  3CCR V;  1YIJ V;  2ZDI A;  3RYI B;  5KX5 A;  3CMA V;  3L75 H;  1I7F A;  4AIL C;  2PI4 A;  3LNN A;  2QWO B;  2DYS B;  3D36 C;  3ABL B;  2ZIM A;  1VF7 A;  1BCC H;  3UCS C;  5LMN B;  5IY5 C;  1WPB A;  2EIL C;  5DN6 G;  4KL1 A;  4LF8 O;  1K8A W;  4J42 A;  1K9M W;  3JD4 A;  2EIK C;  4ZI7 A;  5IYZ B;  3T1H B;  1N33 B;  4DYL A;  4RQF A;  2P6J A;  3JAK B;  1WN7 A;  4I5S A;  2YC0 A;  3L71 H;  1ZWI C;  3AK3 A;  2PUS A;  3GB7 C;  3H1K H;  1J5E B;  3J80 N;  3TET A;  1XHX A;  4F4L A;  2KQX A;  3HKC B;  1XIL A;  1GM7 A;  1RM1 B;  4K8Z A;  1PL4 A;  4MVS A;  4DR4 O;  4WFB V;  3LNM B;  1CXZ B;  5K1P A;  4NTX A;  5CN0 A;  3ABT A;  2F43 G;  1I08 A;  3SYO A;  4UVA A;  1VAR A;  1EN6 A;  5B1N A;  2RJZ A;  1JFF B;  3LSQ A;  2LFS A;  3K03 A;  1RPO A;  1H2S B;  2PYJ A;  1ZAU A;  5EC2 C;  1ROP A;  5LMU B;  1AI7 A;  1HR0 B;  2E5L B;  4W4K A;  1VQK V;  2JEX A;  2AXT Z;  2GDS A;  4CH4 A;  1N4C A;  5TIS Z;  4LFA B;  3QO7 A;  1HNZ O;  4L87 A;  1XQ8 A;  4LF5 O;  1QLE C;  5LP6 B;  1WB8 A;  3QVN A;  2QM7 A;  3CJH A;  3UO2 A;  2ITD C;  5LOV A;  2XAQ A;  3AG3 C;  3U0Z A;  2AZ0 A;  4FVM A;  4QPK A;  3SJQ C;  1YTF D;  4UUJ C;  5LBQ A;  3DSQ A;  4UCO A;  3HKE A;  1JA8 A;  2YXH A;  3P3N A;  4X62 B;  4JI8 B;  4O2B B;  1TUE B;  1N32 B;  2DE0 X;  5JJN B;  2BTO A;  1I94 O;  1K97 A;  4J7J A;  2ZM6 B;  1ZL8 A;  3ZX6 A;  1M9N A;  3RYF A;  1XMQ O;  2IJI A;  3IFX A;  4DR6 O;  1TVK A;  4IGG A;  3CSX A;  1AI5 A;  3BRC A;  3RVZ A;  4CH6 A;  2RCV A;  3CB2 A;  3B2E E;  2JIZ G;  4J80 A;  4O4J B;  1IXB A;  1NR1 A;  1YSC A;  4PHZ A;  4X64 B;  4JTD B;  4H44 B;  2P67 A;  4RQE A;  1G4Y B;  1VQ7 V;  1VF6 A;  4PD4 F;  2W0F C;  1DF5 A;  4DV5 B;  1URF A;  5H6Q A;  3H1H H;  4BIO A;  1EM1 A;  1OCZ B;  1UJW B;  4KFM A;  2ZE8 A;  1TAE A;  2DOS A;  2WLJ A;  3W7U A;  1U97 A;  2QWR B;  3L73 H;  3VQX A;  3T1C A;  4P9P A;  1S3J A;  1GKF A;  4UV8 A;  5J2U A;  4IIJ A;  1L0L H;  2ZXW B;  2QGN A;  4GYC B;  3B8N A;  3CCQ V;  2GUZ A;  1Q82 W;  1AI6 A;  5B1B C;  4J41 A;  3T1Y B;  2B9Z A;  1YDX A;  1ZX3 A;  1YF2 A;  2QE7 G;  2GSM B;  5EC1 C;  1R73 A;  1DLB A;  4EKW A;  3K5O A;  1SA0 A;  2B1G A;  4QE7 A;  1SQF A;  4DV3 O;  1IX9 A;  1XOU A;  3TCU A;  3ZMT A;  4FZ0 A;  5IYB O;  2VWK A;  5JH7 B;  4PEL A;  2ILM A;  2VRZ A;  2A9H A;  2P5O A;  1WLE A;  2JJ1 G;  3IAY A;  4OX9 O;  3ZRW A;  3BAB A;  1R6K A;  4FLV A;  1K33 A;  3RN4 A;  2BOC C;  4DR7 B;  4JI3 B;  2EIM B;  2FTK A;  2HKO A;  4NXM O;  2YSU B;  3FKS G;  5EZY A;  3LSS A;  1BQ0 A;  1V9P A;  3JAT A;  1AI4 A;  2RNB A;  1R3I C;  1SES A;  4CC5 A;  2F4V B;  1UPG A;  3OT7 A;  5FPO A;  4AI8 A;  3D36 A;  4YY3 B;  4BR6 A;  4X65 B;  4FMT A;  1HDJ A;  1B6Q A;  2ETN A;  2FYU H;  2XAF A;  3JCZ A;  1MG1 A;  3B77 A;  3OMN B;  3EVK A;  1LNQ A;  4JAV A;  1QVF U;  4X1K B;  4IHJ B;  2LFR A;  1BHB A;  4FM0 A;  1S5L Z;  3J7A U;  1EZJ A;  3A0H Z;  2H3O A;  1SC5 B;  5LXT B;  3K59 A;  1OCR B;  1FFX A;  1EFR G;  3B09 A;  4UCS A;  4DV1 O;  1IZ3 A;  2YI8 A;  3E86 A;  2B1I A;  2UU9 B;  1NQT A;  1XRE A;  2KKW A;  3ZHS A;  1NH2 B;  2EZO A;  1QNM A;  4Q6G A;  3IC9 A;  5BY1 A;  4EB6 B;  1Z5W A;  1KB9 F;  2DWD C;  2JEU A;  1N34 O;  2ARH A;  3BAA A;  3X2Q C;  4DR2 B;  3TXS A;  1P4R A;  3OGI B;  1K4D C;  1Y74 B;  3CP1 A;  1AB3 A;  4LNU A;  1B04 A;  3CCS V;  4LF4 O;  1SRY A;  2DW4 A;  2YIC A;  1IBM B;  1R6N A;  2LQT A;  5GON A;  5JJE B;  1JPX A;  2YEV A;  1XUQ A;  3IC7 A;  1BQZ A;  1AR4 A;  2WLL B;  4JI2 O;  1L8D A;  4FFB A;  1KP2 A;  3SPG A;  1YXB A;  2AHZ A;  3OEH G;  2XOK G;  2QA4 V;  1EN5 A;  1WPX A;  3GVM A;  3W7W A;  1S5H C;  5KHG A;  2ZT9 B;  3N2K A;  4X1Y B;  3ABM B;  4MW8 A;  4PJ0 Z;  4MTX A;  3P3P A;  3RYC B;  3STZ C;  2PF4 E;  2PGG A;  4IYI A;  3RBZ A;  4DV0 B;  3ASO C;  1XDC A;  4B7E A;  4HZ3 A;  2JGU A;  3WB1 A;  1LUW A;  3CEI A;  4JGS A;  4I4T B;  1NTM H;  2JRI A;  2ZKO A;  2WA4 A;  2UUB O;  1AJP A;  1SQQ H;  2X6B A;  1Q7Y W;  1MOF A;  2DYS C;  3ABL C;  3F5W C;  4HNA B;  2K1E A;  4EFE A;  1AP6 A;  5EK0 A;  4GLX A;  1BHA A;  4JAU A;  3JAL B;  4E2L A;  3CE2 A;  4LFC B;  3HPL C;  1FAF A;  4B3T B;  4ZOL B;  5J2T A;  4H13 B;  1OCC C;  5CA1 A;  4UVC A;  1S0V A;  5IJ0 B;  3SJB C;  4KHP B;  1I5X A;  3VOU A;  3M99 B;  2OIE A;  3H01 A;  3F7V C;  4B3S O;  2ZCE A;  5BZB A;  1XNR O;  1K92 A;  1SQG A;  1AR5 A;  2P4V A;  1DTO A;  2QWQ B;  5KMG A;  1XI1 A;  1RM1 C;  3K79 A;  4P9O A;  2F1M A;  4GKK O;  2F95 B;  3T4Z A;  4RWU A;  5KUK A;  5CA0 A;  4NKG B;  3SYC A;  1W2B U;  5EYP B;  2B5U A;  2OCH A;  2OCC B;  4YHH B;  4TSF G;  5CB4 A;  3LDD A;  2CTW A;  3AG2 B;  4LF7 O;  3ML0 A;  1M93 A;  1AJN A;  2JGD A;  4RAI A;  5D5P A;  3M8A A;  3OTO O;  4O4H A;  2DQ0 A;  2MK3 A;  1AVM A;  1XMO B;  2OT5 A;  4IYH A;  2KG7 B;  2BSK A;  4PDR A;  2RMK B;  2CTP A;  3H1I H;  2PI5 A;  2CH7 B;  4H0L B;  3E8B A;  5IDJ A;  3CXC U;  4FLX A;  4QE9 A;  4KUM A;  4N23 A;  5CBH A;  3ABU A;  4X9Q A;  1F51 A;  3JAW A;  1KBH A;  3U11 A;  3CRQ A;  4Q20 A;  3WFV A;  3CRM A;  3ZJZ A;  1FJG B;  4NXN B;  4PA4 A;  2IM9 A;  1GN2 A;  2FL4 A;  4LH7 A;  4CBC A;  5JWP A;  4GCZ A;  1R3K C;  1SQP H;  3LDE A;  2QM4 A;  1YHQ V;  1N36 O;  3H9V A;  3TK1 A;  4D6T H;  4JI5 O;  4X1I B;  4WFG A;  2VQF B;  1HP8 A;  3K04 A;  4O4I B;  1PM9 A;  1QQC A;  1L0N H;  1N0J A;  2HVK C;  5IE9 A;  1K34 A;  3DXR A;  3FAV A;  4DV4 B;  2WLN A;  4YJ2 B;  4UB8 Z;  1OCZ C;  3L9D A;  3CC4 V;  2IU3 A;  3CCJ V;  5C8Y B;  2GTS A;  1AIL A;  1Y76 A;  4LCU C;  1D5A A;  2WLK A;  1EBO A;  4WBN B;  1H8H G;  2WLI A;  2UXB O;  1O9G A;  4QPJ A;  2UUC O;  3FB6 C;  4DR1 O;  3Q4H A;  3JD0 A;  4DV7 B;  1IBL O;  3APQ A;  2ZIO A;  1M57 B;  3K5N A;  1JVM A;  3G6B A;  4X8A A;  5FNV A;  2Z3Y A;  2UXD O;  1YI2 V;  2AGA A;  2HHH B;  3AG1 B;  1QVG U;  3ABK B;  1PPJ H;  2ITC C;  5L3E A;  2Z0A A;  4PA6 A;  4O2A A;  3PJS K;  4MTO A;  4J9Z B;  1PL0 A;  2F93 B;  4TUY B; 
#chains in the Genus database with same CATH homology
 3T1C A;  1OCO C;  3DGE A;  3T4D A;  2ZQM A;  1R3L C;  2IH1 C;  3OGC C;  2QEX V;  1M56 C;  4P9P A;  1S3J A;  1GKF A;  1NR7 A;  3G6E V;  4UV8 A;  3WG7 B;  4H33 A;  2P90 A;  2ZXW B;  1K4C C;  1CP9 A;  5C93 A;  3B8N A;  3IGA C;  3FYE B;  2V1D A;  2Y69 B;  4OXS A;  3SPH A;  4QJF B;  1VQ6 V;  2XAG A;  5LGU A;  2XAH A;  3LDC A;  3CCQ V;  1Q82 W;  1AI6 A;  5B1B C;  3ASN B;  4G2K A;  1GM8 A;  2AHY A;  1QR9 A;  2C2A A;  3UM7 A;  2EIJ C;  3STL C;  4MTG A;  5L3F A;  5LHI A;  3CC2 V;  2EJR A;  2QE7 G;  4YXW G;  2GSM B;  5DM6 V;  1H8E G;  1R73 A;  5EC1 C;  1DLB A;  4EKW A;  2ZDI C;  2B1G A;  4QE7 A;  5L3B A;  1QLN A;  1VQ5 V;  2Y48 A;  3K9A A;  4WFA V;  1YTF B;  2JK5 C;  4LC1 A;  4PA7 A;  3ETG A;  5CBG A;  3CCM V;  1P7B A;  3TCU A;  3FB7 C;  1F23 A;  3ZMT A;  1NH2 D;  1RPR A;  4RUE A;  5IYB O;  1ORQ C;  1W0J G;  4RUF A;  4ZBM A;  5B1A C;  4PEL A;  1V54 C;  3ZN1 A;  5LHG A;  1VQP V;  1JJ2 U;  1PNK A;  2A9H A;  3MHS C;  4R6Z A;  4LP8 A;  1WLE A;  1PNL A;  2JJ1 G;  1IXM A;  3ETD A;  3ZRW A;  2Z5U A;  3CCU V;  2IW5 A;  1OCO B;  1PKX A;  1R6K A;  4MVO A;  1K33 A;  2BOC C;  2QTO A;  3E89 A;  1M56 B;  2EIM B;  2HR3 A;  1MAB G;  4U7N A;  2FTK A;  2WLL A;  3ZRX A;  4JPR A;  4QNH B;  5CA3 A;  2HKO A;  3K08 A;  4WCE V;  4R7C A;  5B1B B;  3ZN0 A;  1VQM V;  3JYC A;  1YJW V;  3X2Q B;  2EIJ B;  1S77 D;  1OCR C;  4PDV A;  2YSU B;  3FKS G;  3LSS A;  2HVJ C;  2IJH A;  3OEE G;  3W7T A;  2XAJ A;  1DF4 A;  4XBF A;  4PDM A;  1AI4 A;  2D3O W;  1R3I C;  1VQ4 V;  2EIN C;  1SES A;  2ZXW C;  2BOB C;  4QIW F;  5H6R A;  4X88 A;  3D36 A;  3ASN C;  4FMT A;  1B6Q A;  4PA9 A;  5B1A B;  3ZRV A;  4JAS A;  1K73 W;  2XAF A;  3JCZ A;  1V54 B;  2NLJ C;  1MG1 A;  1KC8 W;  3B77 A;  3OMN B;  3E8G A;  1LNQ A;  2A0L A;  4JAV A;  1QVF U;  3CYO A;  1GK9 A;  4WFE A;  2Q69 A;  4FK5 C;  1Q81 W;  2W6J G;  2LFR A;  1FXV A;  1BHB A;  4GX0 A;  1EZJ A;  1NJI W;  3QNE A;  1K5S A;  3CME V;  3ZIA G;  5J9P C;  4P2Z A;  4MVM A;  1GTO A;  1JX9 A;  3T2M A;  1NKD A;  1VQO V;  1FXK C;  1OCR B;  1EFR G;  4JYC A;  3SYA A;  1VQ8 V;  3E86 A;  2B1I A;  1NQT A;  5EBL C;  1ENV A;  2EIM C;  3B8M A;  4XDJ A;  2EZO A;  1NH2 B;  2EIN B;  1SET A;  5L3D A;  3K06 A;  3OM3 B;  5H9C A;  2HJF C;  2DWD C;  2JEU A;  4GX5 A;  3ZMU A;  3R65 A;  4JYB A;  2ZD9 A;  3X2Q C;  3UKM A;  1P4R A;  3E8H A;  4WFH A;  1CEZ A;  3MHH C;  1K4D C;  2H94 A;  2X7R B;  4BW5 A;  3ZMS A;  3ZRW B;  1OCC B;  3CP1 A;  1OHH G;  4CZZ A;  3CCS V;  1SRY A;  4DO2 A;  4U7O A;  2R9R B;  4GX1 A;  2DW4 A;  1R6N A;  3KG2 A;  1J95 A;  4XDL A;  2IJJ A;  1JPX A;  1E79 G;  2YEV A;  3SYP A;  4BIU A;  3IC7 A;  1K3E A;  3JD2 A;  2WLL B;  3LUT B;  1KP2 A;  1L1F A;  5B3S C;  5LHH A;  1BMF G;  3SPG A;  1M1K W;  2AHZ A;  5KA5 A;  3P32 A;  3CCL V;  3OEH G;  2XOK G;  2QA4 V;  4BIZ A;  1WPX A;  3E8F A;  4J9Y B;  2HLD G;  4FIP C;  3W7W A;  3K3W A;  1S5H C;  1FXK B;  4WF9 V;  4FJC C;  1VQL V;  3ABM B;  4MW8 A;  4MTX A;  4TWK A;  3STZ C;  3FB8 C;  4ZKI A;  2DWE C;  4FPP A;  3F7Y C;  3RBZ A;  3E2E A;  3ZMV A;  3ASO C;  2WLI B;  1AR1 B;  4HZ3 A;  3OW2 U;  4I9W A;  2ZR2 A;  4RO2 A;  4X89 A;  1M90 W;  4JGS A;  1COW G;  5LGN A;  2XAS A;  3AG4 C;  2KB1 A;  2M7W A;  3SYQ A;  2ZR3 A;  3E83 A;  1AJQ A;  2A79 B;  2WAM A;  1GO3 F;  1QR8 A;  3SPI A;  3P30 A;  1NVP D;  2OCC C;  1AJP A;  4BAY A;  1THZ A;  2X6B A;  1Q7Y W;  3AG2 C;  4GX2 A;  1MOF A;  3GWO A;  4MVR A;  2DYS C;  3ABL C;  3F5W C;  2K1E A;  1YIT V;  1YJN V;  3AEI A;  1NBM G;  2IJK A;  5EK0 A;  1BHA A;  2CK3 G;  4JAU A;  3CD6 V;  5B3S B;  1F4M A;  1YJ9 V;  4E2L A;  5KUM A;  2LP7 A;  3HPL C;  4KP4 A;  2IU0 A;  3RW0 A;  1HWY A;  2P7T C;  4Z1M G;  2DQ3 A;  2W6I G;  2WLH A;  4MS2 A;  1OCC C;  3EFF K;  1SER A;  1V55 C;  3FYI B;  4JF3 A;  4DXW A;  4UVC A;  1S0V A;  1JOY A;  3JD1 A;  1I5X A;  3CC7 V;  2QM8 A;  5EBW C;  2QKS A;  3BY6 A;  3H01 A;  3M99 B;  3VOU A;  4TT3 G;  3ZCC A;  2DYR C;  1E1R G;  2V7Q G;  5KA6 A;  1KD1 W;  3F7V C;  3K0G A;  5B1O A;  5BZB A;  5HFM A;  4MVQ A;  3EHB B;  1XL6 A;  3CCV V;  1KP3 A;  1K92 A;  1DTO A;  3ASO B;  1KQS U;  2WWW A;  3CPW U;  1KEC A;  4UXN A;  1RM1 C;  2EZP A;  4GT1 A;  3CCE V;  1PNM A;  3FB5 C;  2X0L A;  3K79 A;  4P9O A;  2OTJ V;  1FS0 G;  2OTL V;  3AG4 B;  3T4Z A;  4MVZ A;  3DTU B;  5KUK A;  2HFE C;  1W0K G;  3BEH A;  4JTA B;  2JDI G;  3SYC A;  1KKD A;  1VQN V;  1W2B U;  2B5U A;  1XL4 A;  3ABM C;  1QLE B;  1Y66 A;  1BL8 A;  3CCR V;  2ZDI A;  3HB3 B;  1YIJ V;  2OCC B;  1K5Q A;  4TSF G;  3LDD A;  3AG2 B;  2Q67 A;  2GHY A;  3OR6 C;  3CMA V;  4H37 A;  4WFF A;  3ML0 A;  2PI4 A;  1AJN A;  2DYS B;  2WSS G;  3ABL B;  4RAI A;  3OMI B;  2XND G;  5HFL A;  4UVB A;  4G28 B;  2DQ0 A;  5IY5 C;  2MK3 A;  4R50 A;  2EIL C;  5DN6 G;  2IH3 C;  2OT5 A;  4MT8 A;  1MSW D;  2WPD G;  1K8A W;  3W7X A;  4MVU A;  1K9M W;  3JD4 A;  4PDR A;  2EIK C;  4ASU G;  2X6A A;  1V55 B;  2PI5 A;  1QBZ A;  1N8R W;  3E8B A;  5IDJ A;  3CXC U;  4MTF A;  4RQF A;  4QE9 A;  3I56 V;  2P6J A;  3SPJ A;  2DYR B;  4KUM A;  4I5S A;  4N21 A;  3G71 V;  1ZWI C;  3GB7 C;  1H2G A;  4N23 A;  5IYD O;  5CBH A;  3TET A;  1E1Q G;  2X6C A;  3ABU A;  3OR7 C;  4F4L A;  1F51 A;  1GM9 A;  4LBE C;  4UV9 A;  1GM7 A;  1RM1 B;  4Q20 A;  3WFV A;  4JTC B;  3JD3 A;  3ZJZ A;  4MVS A;  5E1A C;  4PA4 A;  4WFB V;  3LNM B;  5LGT A;  1NVP B;  3E35 A;  5FL7 G;  3RVY A;  1ARO P;  5CN0 A;  4CBC A;  3ABT A;  3OUS A;  2F43 G;  3SYO A;  4UVA A;  4GCZ A;  4HAM A;  1R3K C;  5B1N A;  3SPC A;  3LDE A;  3LSQ A;  1YHQ V;  2LFS A;  3K03 A;  5CMU A;  1RPO A;  3TK1 A;  2WLM A;  4MSW C;  1VQ9 V;  5EC2 C;  1ROP A;  3NXS A;  4WFG A;  1AI7 A;  3OUF A;  1VQK V;  1M57 C;  2JEX A;  3VBB A;  3K04 A;  5IY5 B;  1S76 D;  2EIL B;  3QO7 A;  1K7D A;  4L87 A;  2H8P C;  1QLE C;  2EIK B;  2HVK C;  1QCE A;  2QM7 A;  4PDL A;  3ZMZ A;  1K34 A;  2ITD C;  2XAQ A;  3AG3 C;  3AG1 C;  4MW3 A;  3ABK C;  2NNU A;  3OMA B;  4QPK A;  2UXX A;  2Q68 A;  5GW7 A;  2WLN A;  3SJQ C;  1YTF D;  4UUJ C;  5LBQ A;  1OCZ C;  3QO8 A;  3CC4 V;  1F4N A;  2IU3 A;  3CCJ V;  4P30 A;  1H38 A;  3QO5 A;  4G27 B;  1FXK A;  5EBM C;  2Q6A A;  1TUE B;  1SZT A;  4LCU C;  1PD3 A;  2WLK A;  1K97 A;  1JCH A;  3WG7 C;  3G4S V;  1G8M A;  3A0R A;  1M9N A;  1FFT B;  2Y69 C;  1EBO A;  3ZRS A;  2IJI A;  1H8H G;  3IFX A;  3OFN G;  5IYC O;  2WLI A;  4PA3 A;  2JJ2 G;  3ETE A;  4QPJ A;  4HYO A;  1AI5 A;  3OAA G;  2UXN A;  3FB6 C;  5L3C A;  3I55 V;  5L3G A;  3JD0 A;  3RVZ A;  1R3J C;  2JIZ G;  1M57 B;  3MD0 A;  1JVM A;  1NR1 A;  1YSC A;  1FXH A;  4XDK A;  4JTD B;  4X8A A;  2EBO A;  2P67 A;  3W7S A;  1CPY A;  4RQE A;  2ATK C;  2Z3Y A;  1G4Y B;  1VQ7 V;  2R9I A;  1YI2 V;  1Q86 W;  2W0F C;  3D3I A;  1DF5 A;  3AG1 B;  3AG3 B;  2YEV B;  3OE7 G;  1QVG U;  3ABK B;  4R8C A;  1JQ0 A;  5H6Q A;  2ITC C;  5L3E A;  1GMG A;  1OZ0 A;  1I5Y A;  1OCZ B;  1S72 V;  1UJW B;  4PA6 A;  4KFM A;  3PJS K;  3K0D A;  4MTO A;  2WLJ A;  4J9Z B;  1PL0 A;  3W7U A;  2HG5 C;  5CBF A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...