3E8HA

Crystal structure of the the open nak channel-k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8hA00
3K04A 3KG2A 4MTOA 4G28B 2HVJC 2W0FC 2Q69A 3JYCA 3LDCA 2ITDC 4MS2A 4MTFA 3AG4C 1BL8A 5J9PC 4XDKA 4X8AA 3E8FA 5CBHA 2A0LA 2IH1C 3T1CA 4KFMA 3ASOC 2P7TC 3TCUA 3K03A 2WLKA 4F4LA 1K4DC 5CBFA 2X6AA 3BEHA 3OGCC 3FB6C 2AHZA 2AHYA 4R6ZA 5E1AC 2H8PC 2HVKC 2WLIB 1JVMA 4MVRA 3LDEA 4MVMA 2BOBC 3E89A 2R9RB 3EFFK 4PA6A 5EC1C 2NLJC 2WLMA 4OXSA 3RVYA 3SPJA 2K1EA 3SYQA 4MVUA 3AG2C 4MSWC 4RAIA 4XDLA 4MW8A 5BZBA 3WG7C 2WLLA 2WLJA 1OCRC 1ZWIC 3K06A 3K0DA 4I9WA 4J9YB 1V55C 2HFEC 4WFGA 2Y69C 3ABKC 4MVQA 4R8CA 3E8BA 1XL4A 1KKDA 2HG5C 5EK0A 2BOCC 4PA9A 3SYCA 2DYSC 2X6BA 4XDJA 4QE9A 3IFXA 3SYAA 2ITCC 5B1BC 2KB1A 3T2MA 4GX2A 1OCZC 3HPLC 4PDLA 4RUFA 4MVSA 4JTAB 2Q68A 4MVOA 2WLNA 3FB8C 3OUSA 5EBLC 4QNHB 3SJQC 3E8GA 4GX0A 5IY5C 2DYRC 4JTDB 1QLEC 3SPIA 3UM7A 4TWKA 5B3SC 4R50A 3ABLC 4X88A 3OUFA 4PA7A 3STLC 2HJFC 1ORQC 4GX1A 1V54C 1S5HC 2A79B 3LNMB 4P9OA 4R7CA 4X89A 3ZJZA 4HYOA 2WLIA 4G27B 3E86A 5EC2C 3SPCA 4PA3A 4P30A 4BW5A 1XL6A 2WLLB 3ASNC 3FB7C 4PA4A 4EKWA 2EIKC 3RW0A 1J95A 4UUJC 1R3KC 3K0GA 1OCOC 4MVZA 3RVZA 3OR6C 3ZRSA 3AG1C 3AG3C 3F5WC 4RUEA 2OCCC 3RBZA 4MTGA 3FB5C 4H33A 4LBEC 3E8HA 3SYPA 3LDDA 2EIMC 2Q67A 3LUTB 2JK5C 1M57C 2QKSA 2EIJC 3OR7C 4H37A 4HZ3A 3F7VC 4PDVA 4QE7A 3SYOA 5KUKA 2YEVA 4GX5A 1M56C 2EILC 3PJSK 3UKMA 4JTCB 2DWEC 1R3LC 3K08A 4P9PA 4CBCA 1R3JC 4ZBMA 4LP8A 3VOUA 3IGAC 1K4CC 3SPGA 4DXWA 1R3IC 2DWDC 2X6CA 3STZC 4WFFA 3T4DA 2Q6AA 3X2QC 1OCCC 2QTOA 2WLHA 4WFHA 2IH3C 3E83A 1LNQA 5EBMC 5CBGA 4LCUC 4PDMA 3GB7C 4RO2A 3TETA 4J9ZB 1G4YB 2ZD9A 4MW3A 4WFEA 3T4ZA 4P2ZA 1P7BA 2A9HA 2ZXWC 3F7YC 5EBWC 5B1AC 5KUMA 3SPHA 2EINC 3R65A 3ABMC 2ATKC 4PDRA
chains in the Genus database with same CATH superfamily
1K3EA 4LF8O 1WLEA 2QGNA 1NTKH 2ZE7A 3K5OA 4JZ2A 5CBHA 2OIEA 2IH1C 2F66C 1QVGU 1N0JA 4B3MB 3CCLV 4DV2O 4KUMA 1SQXH 4OX9B 1XOUA 5EC1C 3SPJA 2ZR2A 4TV9B 4K0KB 1QBZA 5GONB 4JYYA 2W0XA 3U11A 5LGUA 5LOVA 4IL6Z 4J11A 4FLWA 2QWNB 4F6RB 3CC4V 1Y74B 2M7WA 4F6RA 3RGBA 4TV9A 2GTAA 1U96A 5IE9A 5IWAO 1DLBA 1NJIW 1Z2GA 1NTMH 5BMVB 1H2NA 2F4VO 3WG7B 4FMTA 1PM9A 1PPJH 2B1GA 2D2CB 3HR0A 2JEUA 2HJDA 4E4EA 4QGPA 3F5WC 1BMFG 5BY1A 3UQ8A 3O65A 4JI1O 3CXHF 4FLZA 2XAHA 1QVFU 1GM8A 5DM6V 1Z5VA 3O9OA 2Q67A 4YY3B 1KD1W 4NXNO 2Q73A 4EB6B 4CBCA 3WB0A 1JQ0A 2PYLA 3CPWU 1Q43A 2HLDG 2ILMA 3RYIB 4RO2A 1XMQO 4GUNA 1YVWA 1JJ2U 1H8HG 3THOA 1TUBB 1N4CA 4ZHQA 1HNXO 1GN4A 1FKAO 2Q9LA 2F43G 2HKOA 4F6EA 1JFFA 2RN9A 4FLUA 1WA8B 3ZBHA 1W2BU 1FPOA 2WLKA 2X6AA 3BEHA 2OTLV 2X0LA 5JJJB 2Y4TA 2RQ6A 1PP9H 2FYUH 3A8TA 4YJ2A 4JI2O 1MSWD 4G2KA 3I56V 1ENVA 2GTSA 2E74B 2B5UA 1Q5OA 4PV1B 3CYOA 4UCRA 4DV0B 4OPAA 5IYZA 2UUBO 3T2MA 4FPPA 1IVSA 1OZ0A 1HNWB 4QNHB 2E76B 3SJQC 1HDJA 2Q7GA 1HWYA 5B3SC 3M99B 5KLVH 4LR3A 3APQA 3EXAA 2LJ2A 1N34O 1WB7A 3D36C 3OMAB 4GKJO 3RW0A 4DV7B 3DSQA 2LFSA 5HFMA 4RUEA 5JJEB 1I08A 4UCTA 3VQWA 2GV9A 4ICGA 4DR7B 4Z1VA 1GK9A 2E3CA 2EZOA 2EIJC 4QE7A 1AI7A 1NR1A 3UT5B 1GMGA 4WFAV 2P22C 4X1IB 1N36B 2DE0X 2JGDA 3W7TA 3SPGA 2CH7A 2QTOA 2PUSA 2RMKB 2ZT9B 1ZTEA 1YJ9V 1IXBA 4UB8Z 2DQ3A 4WFEA 1NVPD 4H44B 5FL7G 5E79Z 1R6TA 1BE3H 3ABMC 1FAFA 3ZMTA 1VQ9V 1VQLV 2BCCH 3JAWA 3LDCA 4MS2A 4ZI7A 4QPKA 5J9PC 1H38A 3TXQA 3JASB 3I5DA 1EN5A 2QKCA 5EZYB 4K35A 1AVMA 2P7TC 4C7UA 4ABMA 3N2GB 4JAAA 4MVRA 4PD4F 2BOBC 1W0KG 5LYJB 5L3CA 5CA1A 1ZWIC 4O4IA 2GUZB 4JYCA 2FB5A 2ZQMA 2HFEC 2BTQA 4H0LB 3Q4HB 1GKFA 2V7QG 1GN2A 2YI8A 4UCVA 1SETA 2CTPA 1YSCA 1AILA 4JAUA 4QPJA 3E22B 5EBLC 3ZMVA 3OAAG 2D3OW 4O2AA 1OCOB 1ZUQA 2IJJA 5LMUB 4JI7B 1DF4A 1L0LH 1XL6A 2ZNJA 4NB5A 4DR1O 2EIKC 4D7TA 5LYJA 3HKBB 3LUTB 1OJHA 3FX7A 1Q6HA 4FM2A 3DTUB 3T1HB 3ABTA 1K9MW 5IDJA 5L3FA 1FFTB 3KCXA 2XUMA 2W6IG 2HEPA 1KYOF 4DW0A 2YEVB 2QWOB 4X66B 4LF4O 4LC1A 4WFHA 1VQOV 1M56B 5EBMC 3E22A 4FLXA 1NBMG 1XMOB 1Q81W 3CMAV 2P67A 1G6UA 2RDCA 2JS5A 1B06A 4CS2A 2W0FC 4GKKB 2CDYA 5DECA 2VRZA 3RN4A 1PNKA 5J2UA 2P4VA 1D5NA 3KZIZ 1DTOA 3HKBA 3OE7G 4R6ZA 5D5QA 1SF9A 1JVMA 2XNDG 2R9RB 5BZBA 5L3GA 3K5MA 1NI8A 2LP7A 2QTSA 4A5UB 4EFBA 1SQGA 3D36A 3OT7A 3M7MX 2PY5A 3ABKC 4B7KA 1L0NH 2JGUA 1RSOA 3MD0A 3CMEV 1OCZB 5IYZB 4WBNB 1FJGO 4D6TH 4GZRB 1KMIZ 4TT3G 3B09A 1JJOA 4KP4A 4ASUG 2UXBO 4IYHA 4ZI7B 3H1KH 2LGWA 3ICXA 1O9HA 5B66Z 3MHSC 4JI6O 1K8AW 3QTCA 1JOYA 3LSSA 4X66O 1ZAUA 5EC2C 3E86A 1OV9A 1MZEA 1NS1A 3K0GA 1E1QG 1QLEB 1P7GA 1WA8A 4JAVA 4ZKIA 5IY5B 4DV6B 4UFZA 1IBKO 4BAYA 3PN1A 3QG5A 3RYIA 5C93A 1AR5A 2KG7A 3JAMN 3AK1A 4YIPA 2YEVA 2EILC 5IJ0B 4P9PA 4LH6A 2B1IA 4B3MO 4FJCC 2JJ1G 2EIJB 2XOKG 2ODMA 4GKJB 4KXRA 4UCSA 5JH7A 3ZHQA 4O2BA 1I94O 2EZPA 1TUBA 3BABA 4LFAB 2CAZC 2CH7B 2CTRA 4KHPO 3K9SA 3CSXA 3DGEA 3FD9A 4X1IA 3QO8A 2UXXA 2AW9A 3TCUA 5L3DA 3CRMA 5L3EA 1CXZB 1F4MA 2EIKB 2YIDA 2JJ2G 2A3QA 1YF2A 4HAMA 5IYBO 3N2KB 4JYAO 4BR6A 1V55C 1BHBA 3S3WA 2XAQA 2QJ1A 5TISZ 2GSMB 3E8BA 2IU3A 2XT9A 4DR1B 2WAMA 4ZHQB 4UVAA 1GH6A 2OIGA 4TV8A 1XDCA 3IJ4A 3JD4A 3JAKA 5EYPB 5GONA 2ZIMA 5EZYA 1YTFD 4JF3A 3LNMB 3JCZA 4NR1A 3WB2A 3WB1A 4P30A 2DN9A 4B3RB 4LF4B 1J95A 1THZA 4RWUA 3OTFA 4MTGA 1I5YA 4YHHO 1R73A 3ETEA 1S76D 3JD1A 3OD4A 1K33A 3OR7C 3ZCCA 4FZ0A 5LMNO 3AEIA 5BR8O 3UKMA 1RM1B 2DWEC 1S3JA 3J81N 2MK3A 4MTXA 4PI0A 5LA6B 4FFBA 3IGAC 4OGQB 2DWDC 3STZC 3CC7V 3E83A 1SS3A 2YIBA 3GB7C 3TETA 1VF6C 5B1AC 1BT8A 2VS0A 3S3XA 4W4KA 1WNSA 3OMNB 1BS3A 2DOSA 3K04A 4DV3B 1WJZA 1M93A 3RYHA 1JA8A 1RPOA 4X20B 1COWG 2IBZH 3CCUV 1IBLO 1VF6A 1BL8A 2QM8A 4UVCA 2F95B 2A0LA 3H1LH 1K92A 5CBFA 2A7WA 4JASA 5KX5B 4O4LB 4EFEA 2IW5A 4PA6A 3E89A 2WLMA 4E2LA 4PI2A 4Q20A 1AJQA 2AZ0A 4UB6Z 4JI3O 4DR3O 2UXDB 2VWJA 2RCVA 5BXZA 5BMVA 1Y76A 4I7ZB 2ZM6O 2HG5C 3IFXA 3SYAA 1FFXA 2ZKOA 4DV5B 4TV8B 1NTZH 4O4LA 1UFIA 4JTDB 4N23A 4X88A 4DV1B 1ORQC 2NR5A 2LQTA 1Q6UA 4TQDA 3FYIB 1XNQB 1VQ7V 1B6QA 4U7NA 4YJ3A 2NN4A 1YTFB 3AG3C 2WA4A 1AJPA 3EHBB 2IU0A 2FKXA 4TOIA 2Q7EA 4OX9O 4DO2A 1VP7A 4LF5B 4PDVA 2M6YA 3C3SA 1L1FA 4O4JB 3EVKA 4ZBMA 4EB6A 1A32A 4DR2O 2F23A 1S5JA 1OCCC 3AK3A 1G8MA 1QR9A 4JI8O 1LNQA 5CBGA 1QLNA 3ABKB 1XHXA 1SESA 1Z5WA 2VQFO 1OHHG 4B3TO 1IBLB 5KAFZ 3U0ZA 3R65A 1SZTA 4UXNA 2ATKC 1J5EO 4B3SB 1N32O 4X1YA 2Y0PA 2OCCB 4NKGB 3CRQA 5EIBD 2R9IA 4PELA 4JPRA 3NR7A 2BSKA 4X8AA 3ZEDA 1R1BA 3FFQA 1KKCA 2G38A 4O4HB 3GWOA 4I55B 3ZMSA 5ITZA 2AHYA 4LWSB 4D7SA 4DR6O 2R70A 3CRAA 4X64B 4O4JA 3WG7C 1MG1A 2Z5UA 4J9YB 4X62B 4I9QA 4JI4B 4GKKO 1NU1H 2WSSG 3B8MA 3W7UA 2DYSC 4XDJA 1AP6A 3QF7A 1CP9A 1QQCA 1LUVA 1E1RG 1XNRB 2WLNA 3N27A 1WAZA 1N33O 1KQSU 2AZ2A 1RSOB 2JRIA 4GX1A 2YC0A 3ZN1A 4IHJB 4N21A 4JI3B 4PHZA 1P84F 4DUYB 2GDSA 3ZRXA 5IJ0A 2OCCC 4CH4A 3N2KA 3ZHUA 1H2KA 4H13B 1QHTA 3SYOA 3DXRA 2UU9O 1VQPV 4DR5O 1XILA 3VOUA 1YEWA 3IC9A 4DXWA 2QSAA 5JH7B 1H8EG 4CH3A 3P3PA 3CCMV 1D5AA 3ZMUA 4DRXA 2Q7HA 4B3RO 5IWAB 2UUBB 5IJ9A 4UV9A 2ZXWC 5KUMA 5LXTB 2WWWA 3ZRWB 4FLVA 3AG2B 4MTOA 4BIZA 3CCRV 1Y66A 1SQVH 5IYDO 2ITDC 4FLTA 2GUZA 4DR5B 1Y67A 3ASOC 5JCOC 4FFKA 4F4LA 1FXKA 3FAVB 2N74A 3CXCU 5CMUA 4MVMA 3RVYA 2YXLA 5D5PA 5H5NA 5L3BA 4MVUA 3ETDA 2WLJA 3VQXA 3OTOB 3K0DA 2Z0AA 4DUYO 4JV5O 3QVNA 1V9PA 2VWKA 2UUCO 1D2DA 3G71V 1WP7A 5H2FZ 5EYPA 1VQKV 1M4UA 3K3WA 1FJGB 1YCIA 1SQBH 1GO3F 3G6BA 4DK0A 2V1DA 1TA8A 4GX0A 2NNUA 2PYJA 2QE7G 1JCHA 2OYQA 3W7XA 1KECA 4DW1A 3RVZA 1E79G 4I0XA 4DR3B 3CRRA 1PL0A 1R6NA 3FB5C 4H33A 1CPYA 3ZHRA 2RJZA 1XREA 2GHYA 4LF7B 3JARB 1MNGA 5LXTA 4YIOA 5LMUO 3LSUA 1X59A 1RPRA 3CRCA 2X6CA 3BPZA 2ADQB 3HB3B 1Q6IA 2WLHA 4IYIA 3H01A 1XNQO 2JDIG 1NT2B 3CEIA 1BZKA 3ZMZA 1XUQA 5H6RA 3ETGA 4NYKA 1SQQH 4YXWG 2EIMB 1VQNV 4JI5B 5FLXN 3KG2A 3CCSV 2WA3A 3AG7A 5KA5A 3D3QA 2ZE6A 3SJAC 1H2SB 5A2QN 3K03A 2ZR3A 1YITV 3HKEA 1K7DA 3SGIA 2DW4A 1GM9A 1QR8A 3ASNB 1VQ8V 1NH2B 4JV5B 1FXKB 1K5QA 1TAEA 3P32A 5JWPA 1ZSPA 3K59A 1VF5B 1R6KA 3OGIB 2Z3YA 1XEQA 2UXBB 3JD2A 3OEHG 1S72V 1HNWO 1YXBA 3JD3A 2Q68A 2XAGA 2ARHA 3CJHA 5JQGA 1RFYA 1SQFA 1EN4A 3JASA 1FD9A 3IAYA 2WLIA 4G27B 3SPCA 3W7SA 1SZXA 4EKWA 4J10A 2JGDB 1Q8IA 3L72H 3Q4HA 4K8ZA 2XASA 3RBZA 2UXNA 5CA3A 3T1HO 5GTIZ 4X1KA 1V54B 3E8HA 4JI4O 2EIMC 3RYCA 2P6JA 2VQEO 4NXNB 3QO5A 4J7ZA 1N36O 5KUKA 1DF5A 1M56C 4JI6B 3UO2A 4UV8A 2ZXWB 1R3LC 3K08A 2UUAB 3OFNG 4UVBA 4AHCA 2HHHB 4NXMB 2LW7A 4WFFA 1QNMA 2IH3C 2CGOA 2FMLA 3K5NA 1EBOA 5J2UB 1M1KW 2MW2B 3BY6A 4CZZA 2B9ZA 4JI0O 1BQZA 1NQTA 2Q0OC 1NH2D 1WB8A 1F23A 4X65B 1DK1A 1N34B 2HVJC 4W4LA 2UUCB 3JYCA 3B8NA 3C3TA 5IJ9B 4B08A 1PV0A 5KHJA 2HP8A 3B2EE 3T1CA 2XHBA 2L6LA 2QWRB 2UUAO 2OTJV 4WFBV 1VQMV 2AHZA 1AI5A 2JS3A 3LDEA 2LW1A 2NLJC 2QM4A 1I5XA 5HFLA 1JX9A 2P06A 4XDLA 3WFVA 1H2LA 3OM3B 4NTYA 5LOVB 3T1YO 1OCRC 4DYLA 1KU9A 1Q82W 1MMMA 3G80A 4O2AB 2YI9A 4Q6GA 1XL4A 4JI2B 2X7RB 4UCUA 1IXMA 1JFFB 1QU7A 3JCUZ 5KA6A 2KB1A 4X20A 1SQPH 4JI7O 2P90A 1XMQB 2ZDIA 3L75H 4IHJA 1NVPB 3SJBC 3SPIA 4CH5A 4TWKA 3ABLC 1HNZO 5EIBC 3CJHB 1HNXB 4X89A 1KP3A 4BW5A 3FAVA 3ZRSA 1PKXA 5LMNB 5KHKA 4LBEC 4L8JA 3ABMB 3AG4B 2QEXV 4LH7A 4O4HA 4I4TA 2UXCB 1JPXA 3DC5A 3F7VC 3G6EV 1AR1B 3TXSA 2ZIOA 4ZOLA 4LP8A 4CS4A 4LF9O 3OW2U 3GWKC 3JALB 4JI5O 3N2GA 2C2AA 4DK1A 2LFRA 3CS5A 1IBMB 1XNRO 1G4YB 2ZD9A 4XBFA 5IYCO 1TVKB 1X4TA 2A9HA 4TUYA 3W7WA 5CA0A 1AR4A 4DUZB 3ZX6A 4Z1MG 1GN6A 1AP5A 4DV3O 5LP6B 4XDKA 3B4SA 3CX5F 5FPOA 3BA8A 4K0KO 2LO1A 1K34A 2AXTZ 1AI4A 2YSUB 3BA9A 5DEDA 1NZ6A 1RP3B 2YIBD 2ZDIC 3ASOB 1B3QA 3MAQA 3VQVA 2PF4E 3WU2Z 1L8DA 3ML0A 3K06A 5C8YA 2XAFA 1CEZA 2O57A 1V55B 3CC2V 1N0NA 5FNVA 5FPRA 4PA9A 2IJKA 4LNUA 4DV4B 5K1PA 4GX2A 3TJTA 1FFXB 2QWPB 1W0JG 4MVSA 3OUSA 1PL4A 2CK3G 4DV5O 2KQXA 3SJCC 3RYFB 5J2TA 2H3OA 1ZLZA 2QA4V 4TQFA 1OCRB 2HJFC 1I0HA 2A79B 2HR3A 3JATA 2UXDO 1YIJV 4UUJC 4GLXA 4MVZA 1UJWB 3G4SV 3LSQA 3FKSG 3ABUA 1YZBA 3LDDA 2EBOA 1W59A 2KKWA 3HKDA 3X2QB 5KMGB 2QKSA 1EZJA 3F5TA 1XBLA 3JALA 4DR4O 2PZSA 1YDXA 3PJSK 4I50B 4NTXA 5CB4B 1AJNA 1R3IC 2CUGA 3JSLA 3X2QC 5LGTA 5JCOA 2YUAA 2CTQA 3CWBH 3K58A 3CCJV 4BIUA 3AK2A 4FLYA 1VMGA 5CA0B 4CC6A 3SPHA 4LFBB 4LF9B 4QJFB 4NTWA 3CHXA 4J42A 1IBMO 2Q69A 3KCYA 4MTFA 4OPHA 2Y48A 3D3IA 2EJ7A 3BCCH 5DN6G 3JAKB 3ZHTA 3E8FA 3ZHVA 1XI1A 1K4DC 5LP6C 2H8PC 3CP1A 3EFFK 4X9QA 3HKCA 4OXSA 4LF6B 1T5EA 2ZNIA 3SYQA 5IT9N 4YY3O 4RAIA 4MW8A 2EULA 4UCOA 4JZGA 4I9WA 5JJNB 3FYEB 1XQ8A 5CN0A 4R8CA 4ZIBA 5AG2A 3H9VA 3J7AU 2YXHA 5B1BB 2YDEA 1JMKC 4TUYB 1N33B 1Y76B 1SA0A 5B1BC 4LFAO 2PGGA 4O2BB 5LP6A 3L71H 5KX5A 3ZS8C 2YS8A 1RM1C 2YXYA 1PNLA 1S5HC 3ABLB 4P9OA 1Q90D 5K1XA 3ZJZA 2QM7A 3ASNC 3UO3A 1BCCH 4FVMA 3RYHB 1IX9A 3MHHC 2ZCEA 5FNVB 1PD3A 3LNNA 3SYPA 1YI2V 4I0XB 4DV6O 1SERA 1EZVH 1S0VA 4BWAA 1R3JC 4I4TB 1TUEB 1GRJA 1M9NA 4JI0B 3IC7A 2F93B 4U7OA 4I55A 4L87A 1HR0B 5H6QA 3M8AA 4B3SO 2BSKB 3A2FA 3J80N 2YICA 4P2ZA 1M57B 3MDSA 5EBWC 1K5SA 1I7FA 2XTAA 4PDRA 3A0HZ 4G28B 4J80A 4IIJA 1TVKA 3A0RA 4WF9V 1TGOA 2PI4A 5LA6A 5KHGA 4KFMA 4X64O 2HHHO 4NXMO 4KL1A 2E5LB 5JQGB 1WPBA 2WLIB 3A0BZ 5CA1B 1IBKB 2WLLA 4K3AA 4RQFA 1EM1A 3L9DA 1F7YA 3BAAA 4JYAB 2PI5A 1FXHA 1IZ3A 1J5EB 1OCCB 1N8RW 5EK0A 5C8YB 2IJIA 4QE9A 1Q86W 2P4KA 3APOA 4DV1O 4CS3A 2N05A 1OCZC 3HPLC 1I94B 1XHZA 2BTQB 3FB8C 3E8GA 5IY5C 3ZIAG 3UM7A 3BFRA 1V54C 4LNUB 1HR0O 4R7CA 1EN6A 1EFRG 1VEWA 3C90A 4PA3A 1GTOA 1SKVA 3H1IH 4LF5O 1R3KC 1OCOC 5LBQA 3OR6C 3DC6A 3RYCB 3QNEA 3CCVV 1AB3A 1BSMA 1ZL8B 2KG7B 4FIPC 2KSDA 2N04A 1Q3EA 1M57C 1Y6XA 4DR2B 3BHPA 4H37A 4HZ3A 5KAIZ 3JSNA 1YHQV 1SRYA 5A9GA 4JTCB 3CB2A 2Q8VA 3CE2A 1ZL8A 4J9ZB 1VARA 1P4RA 5LHIA 3UT5A 4J7JA 1H2GA 3OMIB 1BGYH 3GVMA 3K79A 3AG1B 4NVPA 3UCSC 3AG4C 3H1HH 1VQ6V 2Y0IA 4DR4B 1YJWV 1MZFA 2FL4A 4JGSA 1Q7YW 1NKDA 1VQ5V 3D8CA 2UXCO 2K1EA 4FK5C 4TSFG 4J7KA 2R72A 4RQEA 4X62O 1KBHA 2IM9A 1M5IA 1KC8W 2ADPA 2LGQA 2Y69C 4U3JA 3OEEG 4X1YB 4U3JB 3L74H 2DMXA 3VBBA 1KKDA 1S77D 2BOCC 2JEXA 4EEQA 2W6JG 2CE4A 3U10A 2ZINA 4PDLA 5LHGA 4JTAB 4B7EA 3ZRWA 5B1OA 3JAWB 1N32B 3AG3B 1MA1A 3STLC 4QIWF 4Z2WA 4DRXB 1LR1A 3I55V 3H1JH 1H2MA 4GT1A 4WCEV 4AQYB 3TGUH 2Y4UA 2WLLB 3FB7C 3ETQA 1UPGA 1G1XB 4LFCB 1XMOO 4HNAB 1S5LZ 3ZHSA 5LGNA 3JD0A 4BW9A 1FYJA 1WPXA 2EJRA 2JK5C 4CC5A 2JVDA 1URFA 2QDOA 3ZN0A 2EILB 2ETNA 5KHHA 2GBOA 2V4DA 2Q6AA 3HKEB 4AQYO 4KHPB 4IGGA 2PTMA 4PJ0Z 2VQFB 4PDMA 4DUZO 4X65O 2DYSB 4MW3A 2Q0AA 1KP2A 2EINC 3DXRB 1FS0G 2OT5A 1GM7A 4U3FH 4B3TB 3CD6V 1DGSA 5B1NA 1Y4MA 2F1MA 1B04A 5LL6Y 1KB9F 1M90W 1HW7A 3JARA 2XAJA 2DQ0A 1K97A 4O4IB 2DYRB 3OTOO 3RFRA 3AG2C 4MSWC 3B40A 3RT3C 4X1KB 4DV2B 1K73W 1JR9A 3BRCA 4DV7O 3G67A 4YJ2B 4LFCO 1MABG 3R66A 4HNAA 1VQ4V 2X6BA 1F51A 2ITCC 2EX3A 3CCQV 2RNBA 4RUFA 5GW7A 2E75B 3SR2C 4R50A 1P49A 4DV0O 4MT8A 3E35A 1PNMA 4PA4A 1U97A 5H9CA 1ROPA 1AI6A 1MSDA 5BR8B 2UU9B 5B5EZ 1MOFA 4DR6B 1VIBA 2FTKA 4JYBA 3K9AA 1BHAA 3B77A 3JATB 2P5OA 4GX5A 1GAXA 1HP8A 3K57A 5B1AB 4JI1B 5KMGA 4YHHB 1K4CC 1YJNV 2Y69B 2L35A 5J2TB 2OWOA 2YIAA 1KUQA 4LFBO 4IIJB 3K5LA 4LCUC 1LUWA 1P7BA 2WPDG 2BE3A 2OCHA 4YJ3B 4GYCB 3RYFA 5KHIA 1SA0B 5GTHZ 1HNZB 1VF7A 1O9GA 2BTOA 3HKDB 3T1YB 2ZE8A 4BIOA 1F4NA 3OGCC 4LF6O 3FB6C 5E1AC 2HVKC 1Y74A 3T4DA 3E2EA 3RWRD 5ITZB 3SDLA 3KKYA 1SC5B 4IT5A 1QCEA 2H94A 4WFGA 1AROP 2CGNA 4MVQA 1GN3A 2AGAA 2EINB 4DR7O 4LF8B 3SYCA 4J41A 2F4VB 3CCEV 2QKAA 3L73H 5F2VO 4CH6A 3TK1A 4DV4O 2QWQB 4MVOA 2ZM6B 1FXKC 3P3NA 2DYRC 1NR7A 1QLEC 3L70H 3OUFA 4PA7A 5LHHA 5JVDA 4ZOLB 2DJVA 3HKCB 1IDSA 5B3SB 2K9PA 4HYOA 4FM0A 3VQYA 3AG1C 4LF7O 2VQEB 4FZ1A 4K8XA 4GCZA 2QR4A 1IURA 2JIZG 1BQ0A 1US6A 4AILC 2Q5ZA 4FFBB 2Q4PA 1ZX3A 2A06H 5JVDB 2R9AA 2E5LO 4LWSA 4HBNA 3BVOA 4AI8A 2CTWA 3QO7A 3NXSA 3P30A 1WP8A 3T4ZA 4I50A 5CB4A 4WBNA 4FM1A 1FXVA 1WN7A 3F7YC 2ZE5A 2IJHA 3ZRVA 4I5SA 4JI8B
chains in the Genus database with same CATH topology
3KG2A 4G28B 3CCSV 1K3EA 3DGEA 3QO8A 1WLEA 5KA5A 3A0RA 2UXXA 4WF9V 2PI4A 5CBHA 2IH1C 4KFMA 3TCUA 3K03A 2ZR3A 1YITV 5L3DA 1QVGU 3CCLV 5L3EA 1F4MA 1K7DA 2EIKB 2WLIB 2DW4A 1GM9A 1QR8A 3ASNB 1VQ8V 4KUMA 1NH2B 5EC1C 2JJ2G 1FXKB 1K5QA 3SPJA 4HAMA 2ZR2A 3P32A 1QBZA 5IYBO 2WLLA 4RQFA 1V55C 1BHBA 5LGUA 2XAQA 2GSMB 3E8BA 2IU3A 1FXHA 2PI5A 2WAMA 4UVAA 1OCCB 1R6KA 1N8RW 5EK0A 3CC4V 2Z3YA 2M7WA 3JD2A 2IJIA 3OEHG 4QE9A 1S72V 1Q86W 1OCZC 3HPLC 3JD4A 3JD3A 2Q68A 2XAGA 3FB8C 1DLBA 1NJIW 3E8GA 5IY5C 3ZIAG 3UM7A 1V54C 1YTFD 3WG7B 4JF3A 4FMTA 3LNMB 3JCZA 4R7CA 1EFRG 2WLIA 4G27B 3SPCA 3W7SA 4PA3A 4P30A 1GTOA 2B1GA 2JEUA 4EKWA 1J95A 1THZA 1R3KC 1OCOC 5LBQA 3OR6C 2XASA 3F5WC 1BMFG 3RBZA 3QNEA 4MTGA 2UXNA 5CA3A 3CCVV 2XAHA 1QVFU 1GM8A 4FIPC 5DM6V 1I5YA 1V54B 3E8HA 1R73A 2EIMC 3ETEA 1S76D 2Q67A 1M57C 2P6JA 3JD1A 3QO5A 1K33A 3OR7C 4H37A 4HZ3A 3ZCCA 1YHQV 5KUKA 1DF5A 3AEIA 1KD1W 1SRYA 1M56C 3UKMA 4JTCB 1RM1B 4UV8A 2DWEC 1R3LC 1S3JA 2ZXWB 2MK3A 3K08A 3OFNG 4MTXA 4UVBA 4CBCA 3IGAC 1JQ0A 2DWDC 3STZC 3CPWU 4WFFA 3CC7V 2HLDG 2IH3C 3E83A 3TETA 3GB7C 4RO2A 4J9ZB 1EBOA 1JJ2U 1M1KW 1P4RA 5LHIA 3BY6A 1H8HG 5B1AC 4CZZA 1NQTA 3OMNB 3K04A 1NH2D 1F23A 1H2GA 1RPOA 2HVJC 1COWG 3OMIB 3CCUV 3JYCA 3B8NA 3K79A 2F43G 2HKOA 3AG1B 3AG4C 1BL8A 2QM8A 4UVCA 1VQ6V 2A0LA 3T1CA 1W2BU 1YJWV 2WLKA 2OTJV 1K92A 5CBFA 4WFBV 1VQMV 2X6AA 3BEHA 4JASA 2AHZA 2OTLV 1AI5A 4JGSA 2X0LA 1Q7YW 2IW5A 3LDEA 4PA6A 3E89A 1NKDA 1VQ5V 2NLJC 2WLMA 1I5XA 5HFLA 4E2LA 1JX9A 2K1EA 4FK5C 4TSFG 3WFVA 4XDLA 3OM3B 4RQEA 1MSWD 1OCRC 4Q20A 4G2KA 1AJQA 3I56V 1ENVA 1Q82W 1KC8W 2Y69C 3OEEG 1XL4A 2B5UA 2X7RB 3VBBA 1KKDA 2HG5C 1S77D 3CYOA 2BOCC 1IXMA 2JEXA 2W6JG 5KA6A 3IFXA 3SYAA 2KB1A 3T2MA 4FPPA 4PDLA 2P90A 5LHGA 4JTAB 1OZ0A 2ZDIA 4QNHB 3ZRWA 3SJQC 5B1OA 1NVPB 4JTDB 3SPIA 1HWYA 4TWKA 3AG3B 3M99B 4N23A 5B3SC 3STLC 3ABLC 4QIWF 4X88A 1ORQC 3I55V 3FYIB 4X89A 4GT1A 4WCEV 1KP3A 1VQ7V 4BW5A 1B6QA 2WLLB 3FB7C 4U7NA 3OMAB 3RW0A 3ZRSA 2LFSA 5HFMA 1YTFB 3AG3C 4RUEA 1AJPA 1PKXA 3EHBB 4LBEC 3ABMB 2IU0A 5LGNA 3AG4B 3JD0A 2QEXV 1GK9A 4DO2A 1WPXA 2EJRA 2JK5C 2EZOA 1JPXA 2EIJC 4QE7A 4PDVA 1AI7A 3F7VC 1NR1A 3G6EV 1AR1B 1GMGA 1L1FA 4WFAV 3ZN0A 2EILB 4ZBMA 4LP8A 3W7TA 3OW2U 3SPGA 2Q6AA 2C2AA 1OCCC 2QTOA 1G8MA 1QR9A 2LFRA 1LNQA 5CBGA 4PDMA 1YJ9V 1QLNA 3ABKB 1G4YB 2ZD9A 4XBFA 2DYSB 2DQ3A 4MW3A 4WFEA 1SESA 1NVPD 5IYCO 1OHHG 2A9HA 5FL7G 1KP2A 2EINC 3W7WA 1FS0G 2OT5A 1SZTA 3ABMC 3R65A 4UXNA 2ATKC 1GM7A 3CD6V 3ZMTA 1VQ9V 5B1NA 1VQLV 4Z1MG 2OCCB 1Y4MA 3LDCA 4MS2A 2R9IA 4PELA 4JPRA 1M90W 4QPKA 5J9PC 1H38A 4XDKA 2XAJA 4X8AA 2P7TC 1K34A 3GWOA 3ZMSA 1AI4A 2YSUB 2AHYA 2DQ0A 1K97A 4MVRA 2BOBC 1W0KG 2ZDIC 3ASOB 2DYRB 3AG2C 4MSWC 3WG7C 1MG1A 5L3CA 2Z5UA 1ZWIC 3ML0A 3K06A 4JYCA 2ZQMA 2XAFA 2HFEC 4J9YB 1CEZA 1K73W 1GKFA 1V55B 3CC2V 2V7QG 1MABG 4PDRA 2WSSG 3B8MA 3W7UA 4PA9A 1VQ4V 2DYSC 2IJKA 2X6BA 4XDJA 1F51A 1SETA 1CP9A 2ITCC 1YSCA 3CCQV 4GX2A 1E1RG 4JAUA 1W0JG 4MVSA 4QPJA 4RUFA 5GW7A 5EBLC 2WLNA 3OUSA 2CK3G 3ZMVA 3OAAG 1KQSU 4R50A 2QA4V 2D3OW 1OCOB 1OCRB 2HJFC 4GX1A 2IJJA 2A79B 3ZN1A 1DF4A 2HR3A 4MT8A 4N21A 3E35A 1PNMA 1XL6A 4PA4A 2EIKC 5H9CA 1YIJV 4UUJC 1ROPA 4MVZA 3ZRXA 1AI6A 2OCCC 1UJWB 3G4SV 3LSQA 3FKSG 3ABUA 3LDDA 1MOFA 2EBOA 3LUTB 3X2QB 2FTKA 4JYBA 2QKSA 3SYOA 1EZJA 3DTUB 3K9AA 1BHAA 1VQPV 3B77A 4GX5A 3ABTA 3PJSK 1K9MW 5IDJA 5B1AB 5L3FA 1FFTB 3VOUA 1K4CC 2W6IG 1YJNV 2Y69B 1AJNA 1R3IC 2YEVB 4DXWA 5LGTA 3X2QC 1H8EG 4LC1A 4WFHA 1VQOV 3CCJV 1M56B 5EBMC 4BIUA 3CCMV 1NBMG 4LCUC 3ZMUA 1Q81W 3CMAV 1P7BA 2WPDG 4UV9A 2ZXWC 5KUMA 2P67A 3SPHA 2WWWA 3ZRWB 3AG2B 4QJFB 4MTOA 4BIZA 2W0FC 3CCRV 1Y66A 2Q69A 5IYDO 2ITDC 4MTFA 2Y48A 3D3IA 1PNKA 5DN6G 3E8FA 3ASOC 4F4LA 1K4DC 1DTOA 1F4NA 3OE7G 3OGCC 1FXKA 3FB6C 4R6ZA 5E1AC 2H8PC 2HVKC 1JVMA 3CP1A 5CMUA 3CXCU 2XNDG 4MVMA 3T4DA 3E2EA 2R9RB 3EFFK 3RVYA 4OXSA 3SYQA 5L3BA 4MVUA 5BZBA 4RAIA 4MW8A 3ETDA 5L3GA 2LP7A 2WLJA 3K0DA 4I9WA 1QCEA 3D36A 2H94A 3FYEB 4WFGA 1AROP 3ABKC 4MVQA 5CN0A 4R8CA 3MD0A 2EINB 1OCZB 3CMEV 3G71V 5B1BB 1VQKV 3K3WA 3SYCA 1GO3F 3CCEV 5B1BC 3TK1A 2V1DA 4MVOA 4TT3G 4KP4A 4ASUG 4GX0A 1FXKC 2DYRC 2NNUA 1NR7A 1QLEC 2QE7G 1JCHA 3MHSC 3OUFA 4PA7A 5LHHA 1RM1C 1K8AW 1PNLA 1S5HC 3W7XA 3ABLB 1JOYA 5B3SB 4P9OA 3LSSA 3ZJZA 4HYOA 5EC2C 3E86A 1KECA 2QM7A 3ASNC 3K0GA 3RVZA 1E1QG 1E79G 3AG1C 1PL0A 1QLEB 1R6NA 4JAVA 4ZKIA 3MHHC 3FB5C 4H33A 5IY5B 1PD3A 1CPYA 3SYPA 4BAYA 1YI2V 4GCZA 2GHYA 1SERA 5C93A 2JIZG 1S0VA 2YEVA 2EILC 4P9PA 1R3JC 1TUEB 1RPRA 2B1IA 1M9NA 3IC7A 4FJCC 2JJ1G 2X6CA 2EIJB 2XOKG 3HB3B 4U7OA 3QO7A 4L87A 2WLHA 3NXSA 3H01A 2JDIG 5H6QA 3ZMZA 3P30A 5H6RA 2EZPA 3ETGA 3T4ZA 4P2ZA 1M57B 1FXVA 3F7YC 4YXWG 5EBWC 1K5SA 2IJHA 2EIMB 1VQNV 3ZRVA 4I5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K04 A;  3KG2 A;  4MTO A;  4G28 B;  2HVJ C;  2W0F C;  2Q69 A;  3JYC A;  3LDC A;  2ITD C;  4MS2 A;  4MTF A;  3AG4 C;  1BL8 A;  5J9P C;  4XDK A;  4X8A A;  3E8F A;  5CBH A;  2A0L A;  2IH1 C;  3T1C A;  4KFM A;  3ASO C;  2P7T C;  3TCU A;  3K03 A;  2WLK A;  4F4L A;  1K4D C;  5CBF A;  2X6A A;  3BEH A;  3OGC C;  3FB6 C;  2AHZ A;  2AHY A;  4R6Z A;  5E1A C;  2H8P C;  2HVK C;  2WLI B;  1JVM A;  4MVR A;  3LDE A;  4MVM A;  2BOB C;  3E89 A;  2R9R B;  3EFF K;  4PA6 A;  5EC1 C;  2NLJ C;  2WLM A;  4OXS A;  3RVY A;  3SPJ A;  2K1E A;  3SYQ A;  4MVU A;  3AG2 C;  4MSW C;  4RAI A;  4XDL A;  4MW8 A;  5BZB A;  3WG7 C;  2WLL A;  2WLJ A;  1OCR C;  1ZWI C;  3K06 A;  3K0D A;  4I9W A;  4J9Y B;  1V55 C;  2HFE C;  4WFG A;  2Y69 C;  3ABK C;  4MVQ A;  4R8C A;  3E8B A;  1XL4 A;  1KKD A;  2HG5 C;  5EK0 A;  2BOC C;  4PA9 A;  3SYC A;  2DYS C;  2X6B A;  4XDJ A;  4QE9 A;  3IFX A;  3SYA A;  2ITC C;  5B1B C;  2KB1 A;  3T2M A;  4GX2 A;  1OCZ C;  3HPL C;  4PDL A;  4RUF A;  4MVS A;  4JTA B;  2Q68 A;  4MVO A;  2WLN A;  3FB8 C;  3OUS A;  5EBL C;  4QNH B;  3SJQ C;  3E8G A;  4GX0 A;  5IY5 C;  2DYR C;  4JTD B;  1QLE C;  3SPI A;  3UM7 A;  4TWK A;  5B3S C;  4R50 A;  3ABL C;  4X88 A;  3OUF A;  4PA7 A;  3STL C;  2HJF C;  1ORQ C;  4GX1 A;  1V54 C;  1S5H C;  2A79 B;  3LNM B;  4P9O A;  4R7C A;  4X89 A;  3ZJZ A;  4HYO A;  2WLI A;  4G27 B;  3E86 A;  5EC2 C;  3SPC A;  4PA3 A;  4P30 A;  4BW5 A;  1XL6 A;  2WLL B;  3ASN C;  3FB7 C;  4PA4 A;  4EKW A;  2EIK C;  3RW0 A;  1J95 A;  4UUJ C;  1R3K C;  3K0G A;  1OCO C;  4MVZ A;  3RVZ A;  3OR6 C;  3ZRS A;  3AG1 C;  3AG3 C;  3F5W C;  4RUE A;  2OCC C;  3RBZ A;  4MTG A;  3FB5 C;  4H33 A;  4LBE C;  3E8H A;  3SYP A;  3LDD A;  2EIM C;  2Q67 A;  3LUT B;  2JK5 C;  1M57 C;  2QKS A;  2EIJ C;  3OR7 C;  4H37 A;  4HZ3 A;  3F7V C;  4PDV A;  4QE7 A;  3SYO A;  5KUK A;  2YEV A;  4GX5 A;  1M56 C;  2EIL C;  3PJS K;  3UKM A;  4JTC B;  2DWE C;  1R3L C;  3K08 A;  4P9P A;  4CBC A;  1R3J C;  4ZBM A;  4LP8 A;  3VOU A;  3IGA C;  1K4C C;  3SPG A;  4DXW A;  1R3I C;  2DWD C;  2X6C A;  3STZ C;  4WFF A;  3T4D A;  2Q6A A;  3X2Q C;  1OCC C;  2QTO A;  2WLH A;  4WFH A;  2IH3 C;  3E83 A;  1LNQ A;  5EBM C;  5CBG A;  4LCU C;  4PDM A;  3GB7 C;  4RO2 A;  3TET A;  4J9Z B;  1G4Y B;  2ZD9 A;  4MW3 A;  4WFE A;  3T4Z A;  4P2Z A;  1P7B A;  2A9H A;  2ZXW C;  3F7Y C;  5EBW C;  5B1A C;  5KUM A;  3SPH A;  2EIN C;  3R65 A;  3ABM C;  2ATK C;  4PDR A; 
#chains in the Genus database with same CATH topology
 1K3E A;  4LF8 O;  1WLE A;  2QGN A;  1NTK H;  2ZE7 A;  3K5O A;  4JZ2 A;  5CBH A;  2OIE A;  2IH1 C;  2F66 C;  1QVG U;  1N0J A;  4B3M B;  3CCL V;  4DV2 O;  4KUM A;  1SQX H;  4OX9 B;  1XOU A;  5EC1 C;  3SPJ A;  2ZR2 A;  4TV9 B;  4K0K B;  1QBZ A;  5GON B;  4JYY A;  2W0X A;  3U11 A;  5LGU A;  5LOV A;  4IL6 Z;  4J11 A;  4FLW A;  2QWN B;  4F6R B;  3CC4 V;  1Y74 B;  2M7W A;  4F6R A;  3RGB A;  4TV9 A;  2GTA A;  1U96 A;  5IE9 A;  5IWA O;  1DLB A;  1NJI W;  1Z2G A;  1NTM H;  5BMV B;  1H2N A;  2F4V O;  3WG7 B;  4FMT A;  1PM9 A;  1PPJ H;  2B1G A;  2D2C B;  3HR0 A;  2JEU A;  2HJD A;  4E4E A;  4QGP A;  3F5W C;  1BMF G;  5BY1 A;  3UQ8 A;  3O65 A;  4JI1 O;  3CXH F;  4FLZ A;  2XAH A;  1QVF U;  1GM8 A;  5DM6 V;  1Z5V A;  3O9O A;  2Q67 A;  4YY3 B;  1KD1 W;  4NXN O;  2Q73 A;  4EB6 B;  4CBC A;  3WB0 A;  1JQ0 A;  2PYL A;  3CPW U;  1Q43 A;  2HLD G;  2ILM A;  3RYI B;  4RO2 A;  1XMQ O;  4GUN A;  1YVW A;  1JJ2 U;  1H8H G;  3THO A;  1TUB B;  1N4C A;  4ZHQ A;  1HNX O;  1GN4 A;  1FKA O;  2Q9L A;  2F43 G;  2HKO A;  4F6E A;  1JFF A;  2RN9 A;  4FLU A;  1WA8 B;  3ZBH A;  1W2B U;  1FPO A;  2WLK A;  2X6A A;  3BEH A;  2OTL V;  2X0L A;  5JJJ B;  2Y4T A;  2RQ6 A;  1PP9 H;  2FYU H;  3A8T A;  4YJ2 A;  4JI2 O;  1MSW D;  4G2K A;  3I56 V;  1ENV A;  2GTS A;  2E74 B;  2B5U A;  1Q5O A;  4PV1 B;  3CYO A;  4UCR A;  4DV0 B;  4OPA A;  5IYZ A;  2UUB O;  3T2M A;  4FPP A;  1IVS A;  1OZ0 A;  1HNW B;  4QNH B;  2E76 B;  3SJQ C;  1HDJ A;  2Q7G A;  1HWY A;  5B3S C;  3M99 B;  5KLV H;  4LR3 A;  3APQ A;  3EXA A;  2LJ2 A;  1N34 O;  1WB7 A;  3D36 C;  3OMA B;  4GKJ O;  3RW0 A;  4DV7 B;  3DSQ A;  2LFS A;  5HFM A;  4RUE A;  5JJE B;  1I08 A;  4UCT A;  3VQW A;  2GV9 A;  4ICG A;  4DR7 B;  4Z1V A;  1GK9 A;  2E3C A;  2EZO A;  2EIJ C;  4QE7 A;  1AI7 A;  1NR1 A;  3UT5 B;  1GMG A;  4WFA V;  2P22 C;  4X1I B;  1N36 B;  2DE0 X;  2JGD A;  3W7T A;  3SPG A;  2CH7 A;  2QTO A;  2PUS A;  2RMK B;  2ZT9 B;  1ZTE A;  1YJ9 V;  1IXB A;  4UB8 Z;  2DQ3 A;  4WFE A;  1NVP D;  4H44 B;  5FL7 G;  5E79 Z;  1R6T A;  1BE3 H;  3ABM C;  1FAF A;  3ZMT A;  1VQ9 V;  1VQL V;  2BCC H;  3JAW A;  3LDC A;  4MS2 A;  4ZI7 A;  4QPK A;  5J9P C;  1H38 A;  3TXQ A;  3JAS B;  3I5D A;  1EN5 A;  2QKC A;  5EZY B;  4K35 A;  1AVM A;  2P7T C;  4C7U A;  4ABM A;  3N2G B;  4JAA A;  4MVR A;  4PD4 F;  2BOB C;  1W0K G;  5LYJ B;  5L3C A;  5CA1 A;  1ZWI C;  4O4I A;  2GUZ B;  4JYC A;  2FB5 A;  2ZQM A;  2HFE C;  2BTQ A;  4H0L B;  3Q4H B;  1GKF A;  2V7Q G;  1GN2 A;  2YI8 A;  4UCV A;  1SET A;  2CTP A;  1YSC A;  1AIL A;  4JAU A;  4QPJ A;  3E22 B;  5EBL C;  3ZMV A;  3OAA G;  2D3O W;  4O2A A;  1OCO B;  1ZUQ A;  2IJJ A;  5LMU B;  4JI7 B;  1DF4 A;  1L0L H;  1XL6 A;  2ZNJ A;  4NB5 A;  4DR1 O;  2EIK C;  4D7T A;  5LYJ A;  3HKB B;  3LUT B;  1OJH A;  3FX7 A;  1Q6H A;  4FM2 A;  3DTU B;  3T1H B;  3ABT A;  1K9M W;  5IDJ A;  5L3F A;  1FFT B;  3KCX A;  2XUM A;  2W6I G;  2HEP A;  1KYO F;  4DW0 A;  2YEV B;  2QWO B;  4X66 B;  4LF4 O;  4LC1 A;  4WFH A;  1VQO V;  1M56 B;  5EBM C;  3E22 A;  4FLX A;  1NBM G;  1XMO B;  1Q81 W;  3CMA V;  2P67 A;  1G6U A;  2RDC A;  2JS5 A;  1B06 A;  4CS2 A;  2W0F C;  4GKK B;  2CDY A;  5DEC A;  2VRZ A;  3RN4 A;  1PNK A;  5J2U A;  2P4V A;  1D5N A;  3KZI Z;  1DTO A;  3HKB A;  3OE7 G;  4R6Z A;  5D5Q A;  1SF9 A;  1JVM A;  2XND G;  2R9R B;  5BZB A;  5L3G A;  3K5M A;  1NI8 A;  2LP7 A;  2QTS A;  4A5U B;  4EFB A;  1SQG A;  3D36 A;  3OT7 A;  3M7M X;  2PY5 A;  3ABK C;  4B7K A;  1L0N H;  2JGU A;  1RSO A;  3MD0 A;  3CME V;  1OCZ B;  5IYZ B;  4WBN B;  1FJG O;  4D6T H;  4GZR B;  1KMI Z;  4TT3 G;  3B09 A;  1JJO A;  4KP4 A;  4ASU G;  2UXB O;  4IYH A;  4ZI7 B;  3H1K H;  2LGW A;  3ICX A;  1O9H A;  5B66 Z;  3MHS C;  4JI6 O;  1K8A W;  3QTC A;  1JOY A;  3LSS A;  4X66 O;  1ZAU A;  5EC2 C;  3E86 A;  1OV9 A;  1MZE A;  1NS1 A;  3K0G A;  1E1Q G;  1QLE B;  1P7G A;  1WA8 A;  4JAV A;  4ZKI A;  5IY5 B;  4DV6 B;  4UFZ A;  1IBK O;  4BAY A;  3PN1 A;  3QG5 A;  3RYI A;  5C93 A;  1AR5 A;  2KG7 A;  3JAM N;  3AK1 A;  4YIP A;  2YEV A;  2EIL C;  5IJ0 B;  4P9P A;  4LH6 A;  2B1I A;  4B3M O;  4FJC C;  2JJ1 G;  2EIJ B;  2XOK G;  2ODM A;  4GKJ B;  4KXR A;  4UCS A;  5JH7 A;  3ZHQ A;  4O2B A;  1I94 O;  2EZP A;  1TUB A;  3BAB A;  4LFA B;  2CAZ C;  2CH7 B;  2CTR A;  4KHP O;  3K9S A;  3CSX A;  3DGE A;  3FD9 A;  4X1I A;  3QO8 A;  2UXX A;  2AW9 A;  3TCU A;  5L3D A;  3CRM A;  5L3E A;  1CXZ B;  1F4M A;  2EIK B;  2YID A;  2JJ2 G;  2A3Q A;  1YF2 A;  4HAM A;  5IYB O;  3N2K B;  4JYA O;  4BR6 A;  1V55 C;  1BHB A;  3S3W A;  2XAQ A;  2QJ1 A;  5TIS Z;  2GSM B;  3E8B A;  2IU3 A;  2XT9 A;  4DR1 B;  2WAM A;  4ZHQ B;  4UVA A;  1GH6 A;  2OIG A;  4TV8 A;  1XDC A;  3IJ4 A;  3JD4 A;  3JAK A;  5EYP B;  5GON A;  2ZIM A;  5EZY A;  1YTF D;  4JF3 A;  3LNM B;  3JCZ A;  4NR1 A;  3WB2 A;  3WB1 A;  4P30 A;  2DN9 A;  4B3R B;  4LF4 B;  1J95 A;  1THZ A;  4RWU A;  3OTF A;  4MTG A;  1I5Y A;  4YHH O;  1R73 A;  3ETE A;  1S76 D;  3JD1 A;  3OD4 A;  1K33 A;  3OR7 C;  3ZCC A;  4FZ0 A;  5LMN O;  3AEI A;  5BR8 O;  3UKM A;  1RM1 B;  2DWE C;  1S3J A;  3J81 N;  2MK3 A;  4MTX A;  4PI0 A;  5LA6 B;  4FFB A;  3IGA C;  4OGQ B;  2DWD C;  3STZ C;  3CC7 V;  3E83 A;  1SS3 A;  2YIB A;  3GB7 C;  3TET A;  1VF6 C;  5B1A C;  1BT8 A;  2VS0 A;  3S3X A;  4W4K A;  1WNS A;  3OMN B;  1BS3 A;  2DOS A;  3K04 A;  4DV3 B;  1WJZ A;  1M93 A;  3RYH A;  1JA8 A;  1RPO A;  4X20 B;  1COW G;  2IBZ H;  3CCU V;  1IBL O;  1VF6 A;  1BL8 A;  2QM8 A;  4UVC A;  2F95 B;  2A0L A;  3H1L H;  1K92 A;  5CBF A;  2A7W A;  4JAS A;  5KX5 B;  4O4L B;  4EFE A;  2IW5 A;  4PA6 A;  3E89 A;  2WLM A;  4E2L A;  4PI2 A;  4Q20 A;  1AJQ A;  2AZ0 A;  4UB6 Z;  4JI3 O;  4DR3 O;  2UXD B;  2VWJ A;  2RCV A;  5BXZ A;  5BMV A;  1Y76 A;  4I7Z B;  2ZM6 O;  2HG5 C;  3IFX A;  3SYA A;  1FFX A;  2ZKO A;  4DV5 B;  4TV8 B;  1NTZ H;  4O4L A;  1UFI A;  4JTD B;  4N23 A;  4X88 A;  4DV1 B;  1ORQ C;  2NR5 A;  2LQT A;  1Q6U A;  4TQD A;  3FYI B;  1XNQ B;  1VQ7 V;  1B6Q A;  4U7N A;  4YJ3 A;  2NN4 A;  1YTF B;  3AG3 C;  2WA4 A;  1AJP A;  3EHB B;  2IU0 A;  2FKX A;  4TOI A;  2Q7E A;  4OX9 O;  4DO2 A;  1VP7 A;  4LF5 B;  4PDV A;  2M6Y A;  3C3S A;  1L1F A;  4O4J B;  3EVK A;  4ZBM A;  4EB6 A;  1A32 A;  4DR2 O;  2F23 A;  1S5J A;  1OCC C;  3AK3 A;  1G8M A;  1QR9 A;  4JI8 O;  1LNQ A;  5CBG A;  1QLN A;  3ABK B;  1XHX A;  1SES A;  1Z5W A;  2VQF O;  1OHH G;  4B3T O;  1IBL B;  5KAF Z;  3U0Z A;  3R65 A;  1SZT A;  4UXN A;  2ATK C;  1J5E O;  4B3S B;  1N32 O;  4X1Y A;  2Y0P A;  2OCC B;  4NKG B;  3CRQ A;  5EIB D;  2R9I A;  4PEL A;  4JPR A;  3NR7 A;  2BSK A;  4X8A A;  3ZED A;  1R1B A;  3FFQ A;  1KKC A;  2G38 A;  4O4H B;  3GWO A;  4I55 B;  3ZMS A;  5ITZ A;  2AHY A;  4LWS B;  4D7S A;  4DR6 O;  2R70 A;  3CRA A;  4X64 B;  4O4J A;  3WG7 C;  1MG1 A;  2Z5U A;  4J9Y B;  4X62 B;  4I9Q A;  4JI4 B;  4GKK O;  1NU1 H;  2WSS G;  3B8M A;  3W7U A;  2DYS C;  4XDJ A;  1AP6 A;  3QF7 A;  1CP9 A;  1QQC A;  1LUV A;  1E1R G;  1XNR B;  2WLN A;  3N27 A;  1WAZ A;  1N33 O;  1KQS U;  2AZ2 A;  1RSO B;  2JRI A;  4GX1 A;  2YC0 A;  3ZN1 A;  4IHJ B;  4N21 A;  4JI3 B;  4PHZ A;  1P84 F;  4DUY B;  2GDS A;  3ZRX A;  5IJ0 A;  2OCC C;  4CH4 A;  3N2K A;  3ZHU A;  1H2K A;  4H13 B;  1QHT A;  3SYO A;  3DXR A;  2UU9 O;  1VQP V;  4DR5 O;  1XIL A;  3VOU A;  1YEW A;  3IC9 A;  4DXW A;  2QSA A;  5JH7 B;  1H8E G;  4CH3 A;  3P3P A;  3CCM V;  1D5A A;  3ZMU A;  4DRX A;  2Q7H A;  4B3R O;  5IWA B;  2UUB B;  5IJ9 A;  4UV9 A;  2ZXW C;  5KUM A;  5LXT B;  2WWW A;  3ZRW B;  4FLV A;  3AG2 B;  4MTO A;  4BIZ A;  3CCR V;  1Y66 A;  1SQV H;  5IYD O;  2ITD C;  4FLT A;  2GUZ A;  4DR5 B;  1Y67 A;  3ASO C;  5JCO C;  4FFK A;  4F4L A;  1FXK A;  3FAV B;  2N74 A;  3CXC U;  5CMU A;  4MVM A;  3RVY A;  2YXL A;  5D5P A;  5H5N A;  5L3B A;  4MVU A;  3ETD A;  2WLJ A;  3VQX A;  3OTO B;  3K0D A;  2Z0A A;  4DUY O;  4JV5 O;  3QVN A;  1V9P A;  2VWK A;  2UUC O;  1D2D A;  3G71 V;  1WP7 A;  5H2F Z;  5EYP A;  1VQK V;  1M4U A;  3K3W A;  1FJG B;  1YCI A;  1SQB H;  1GO3 F;  3G6B A;  4DK0 A;  2V1D A;  1TA8 A;  4GX0 A;  2NNU A;  2PYJ A;  2QE7 G;  1JCH A;  2OYQ A;  3W7X A;  1KEC A;  4DW1 A;  3RVZ A;  1E79 G;  4I0X A;  4DR3 B;  3CRR A;  1PL0 A;  1R6N A;  3FB5 C;  4H33 A;  1CPY A;  3ZHR A;  2RJZ A;  1XRE A;  2GHY A;  4LF7 B;  3JAR B;  1MNG A;  5LXT A;  4YIO A;  5LMU O;  3LSU A;  1X59 A;  1RPR A;  3CRC A;  2X6C A;  3BPZ A;  2ADQ B;  3HB3 B;  1Q6I A;  2WLH A;  4IYI A;  3H01 A;  1XNQ O;  2JDI G;  1NT2 B;  3CEI A;  1BZK A;  3ZMZ A;  1XUQ A;  5H6R A;  3ETG A;  4NYK A;  1SQQ H;  4YXW G;  2EIM B;  1VQN V;  4JI5 B;  5FLX N;  3KG2 A;  3CCS V;  2WA3 A;  3AG7 A;  5KA5 A;  3D3Q A;  2ZE6 A;  3SJA C;  1H2S B;  5A2Q N;  3K03 A;  2ZR3 A;  1YIT V;  3HKE A;  1K7D A;  3SGI A;  2DW4 A;  1GM9 A;  1QR8 A;  3ASN B;  1VQ8 V;  1NH2 B;  4JV5 B;  1FXK B;  1K5Q A;  1TAE A;  3P32 A;  5JWP A;  1ZSP A;  3K59 A;  1VF5 B;  1R6K A;  3OGI B;  2Z3Y A;  1XEQ A;  2UXB B;  3JD2 A;  3OEH G;  1S72 V;  1HNW O;  1YXB A;  3JD3 A;  2Q68 A;  2XAG A;  2ARH A;  3CJH A;  5JQG A;  1RFY A;  1SQF A;  1EN4 A;  3JAS A;  1FD9 A;  3IAY A;  2WLI A;  4G27 B;  3SPC A;  3W7S A;  1SZX A;  4EKW A;  4J10 A;  2JGD B;  1Q8I A;  3L72 H;  3Q4H A;  4K8Z A;  2XAS A;  3RBZ A;  2UXN A;  5CA3 A;  3T1H O;  5GTI Z;  4X1K A;  1V54 B;  3E8H A;  4JI4 O;  2EIM C;  3RYC A;  2P6J A;  2VQE O;  4NXN B;  3QO5 A;  4J7Z A;  1N36 O;  5KUK A;  1DF5 A;  1M56 C;  4JI6 B;  3UO2 A;  4UV8 A;  2ZXW B;  1R3L C;  3K08 A;  2UUA B;  3OFN G;  4UVB A;  4AHC A;  2HHH B;  4NXM B;  2LW7 A;  4WFF A;  1QNM A;  2IH3 C;  2CGO A;  2FML A;  3K5N A;  1EBO A;  5J2U B;  1M1K W;  2MW2 B;  3BY6 A;  4CZZ A;  2B9Z A;  4JI0 O;  1BQZ A;  1NQT A;  2Q0O C;  1NH2 D;  1WB8 A;  1F23 A;  4X65 B;  1DK1 A;  1N34 B;  2HVJ C;  4W4L A;  2UUC B;  3JYC A;  3B8N A;  3C3T A;  5IJ9 B;  4B08 A;  1PV0 A;  5KHJ A;  2HP8 A;  3B2E E;  3T1C A;  2XHB A;  2L6L A;  2QWR B;  2UUA O;  2OTJ V;  4WFB V;  1VQM V;  2AHZ A;  1AI5 A;  2JS3 A;  3LDE A;  2LW1 A;  2NLJ C;  2QM4 A;  1I5X A;  5HFL A;  1JX9 A;  2P06 A;  4XDL A;  3WFV A;  1H2L A;  3OM3 B;  4NTY A;  5LOV B;  3T1Y O;  1OCR C;  4DYL A;  1KU9 A;  1Q82 W;  1MMM A;  3G80 A;  4O2A B;  2YI9 A;  4Q6G A;  1XL4 A;  4JI2 B;  2X7R B;  4UCU A;  1IXM A;  1JFF B;  1QU7 A;  3JCU Z;  5KA6 A;  2KB1 A;  4X20 A;  1SQP H;  4JI7 O;  2P90 A;  1XMQ B;  2ZDI A;  3L75 H;  4IHJ A;  1NVP B;  3SJB C;  3SPI A;  4CH5 A;  4TWK A;  3ABL C;  1HNZ O;  5EIB C;  3CJH B;  1HNX B;  4X89 A;  1KP3 A;  4BW5 A;  3FAV A;  3ZRS A;  1PKX A;  5LMN B;  5KHK A;  4LBE C;  4L8J A;  3ABM B;  3AG4 B;  2QEX V;  4LH7 A;  4O4H A;  4I4T A;  2UXC B;  1JPX A;  3DC5 A;  3F7V C;  3G6E V;  1AR1 B;  3TXS A;  2ZIO A;  4ZOL A;  4LP8 A;  4CS4 A;  4LF9 O;  3OW2 U;  3GWK C;  3JAL B;  4JI5 O;  3N2G A;  2C2A A;  4DK1 A;  2LFR A;  3CS5 A;  1IBM B;  1XNR O;  1G4Y B;  2ZD9 A;  4XBF A;  5IYC O;  1TVK B;  1X4T A;  2A9H A;  4TUY A;  3W7W A;  5CA0 A;  1AR4 A;  4DUZ B;  3ZX6 A;  4Z1M G;  1GN6 A;  1AP5 A;  4DV3 O;  5LP6 B;  4XDK A;  3B4S A;  3CX5 F;  5FPO A;  3BA8 A;  4K0K O;  2LO1 A;  1K34 A;  2AXT Z;  1AI4 A;  2YSU B;  3BA9 A;  5DED A;  1NZ6 A;  1RP3 B;  2YIB D;  2ZDI C;  3ASO B;  1B3Q A;  3MAQ A;  3VQV A;  2PF4 E;  3WU2 Z;  1L8D A;  3ML0 A;  3K06 A;  5C8Y A;  2XAF A;  1CEZ A;  2O57 A;  1V55 B;  3CC2 V;  1N0N A;  5FNV A;  5FPR A;  4PA9 A;  2IJK A;  4LNU A;  4DV4 B;  5K1P A;  4GX2 A;  3TJT A;  1FFX B;  2QWP B;  1W0J G;  4MVS A;  3OUS A;  1PL4 A;  2CK3 G;  4DV5 O;  2KQX A;  3SJC C;  3RYF B;  5J2T A;  2H3O A;  1ZLZ A;  2QA4 V;  4TQF A;  1OCR B;  2HJF C;  1I0H A;  2A79 B;  2HR3 A;  3JAT A;  2UXD O;  1YIJ V;  4UUJ C;  4GLX A;  4MVZ A;  1UJW B;  3G4S V;  3LSQ A;  3FKS G;  3ABU A;  1YZB A;  3LDD A;  2EBO A;  1W59 A;  2KKW A;  3HKD A;  3X2Q B;  5KMG B;  2QKS A;  1EZJ A;  3F5T A;  1XBL A;  3JAL A;  4DR4 O;  2PZS A;  1YDX A;  3PJS K;  4I50 B;  4NTX A;  5CB4 B;  1AJN A;  1R3I C;  2CUG A;  3JSL A;  3X2Q C;  5LGT A;  5JCO A;  2YUA A;  2CTQ A;  3CWB H;  3K58 A;  3CCJ V;  4BIU A;  3AK2 A;  4FLY A;  1VMG A;  5CA0 B;  4CC6 A;  3SPH A;  4LFB B;  4LF9 B;  4QJF B;  4NTW A;  3CHX A;  4J42 A;  1IBM O;  2Q69 A;  3KCY A;  4MTF A;  4OPH A;  2Y48 A;  3D3I A;  2EJ7 A;  3BCC H;  5DN6 G;  3JAK B;  3ZHT A;  3E8F A;  3ZHV A;  1XI1 A;  1K4D C;  5LP6 C;  2H8P C;  3CP1 A;  3EFF K;  4X9Q A;  3HKC A;  4OXS A;  4LF6 B;  1T5E A;  2ZNI A;  3SYQ A;  5IT9 N;  4YY3 O;  4RAI A;  4MW8 A;  2EUL A;  4UCO A;  4JZG A;  4I9W A;  5JJN B;  3FYE B;  1XQ8 A;  5CN0 A;  4R8C A;  4ZIB A;  5AG2 A;  3H9V A;  3J7A U;  2YXH A;  5B1B B;  2YDE A;  1JMK C;  4TUY B;  1N33 B;  1Y76 B;  1SA0 A;  5B1B C;  4LFA O;  2PGG A;  4O2B B;  5LP6 A;  3L71 H;  5KX5 A;  3ZS8 C;  2YS8 A;  1RM1 C;  2YXY A;  1PNL A;  1S5H C;  3ABL B;  4P9O A;  1Q90 D;  5K1X A;  3ZJZ A;  2QM7 A;  3ASN C;  3UO3 A;  1BCC H;  4FVM A;  3RYH B;  1IX9 A;  3MHH C;  2ZCE A;  5FNV B;  1PD3 A;  3LNN A;  3SYP A;  1YI2 V;  4I0X B;  4DV6 O;  1SER A;  1EZV H;  1S0V A;  4BWA A;  1R3J C;  4I4T B;  1TUE B;  1GRJ A;  1M9N A;  4JI0 B;  3IC7 A;  2F93 B;  4U7O A;  4I55 A;  4L87 A;  1HR0 B;  5H6Q A;  3M8A A;  4B3S O;  2BSK B;  3A2F A;  3J80 N;  2YIC A;  4P2Z A;  1M57 B;  3MDS A;  5EBW C;  1K5S A;  1I7F A;  2XTA A;  4PDR A;  3A0H Z;  4G28 B;  4J80 A;  4IIJ A;  1TVK A;  3A0R A;  4WF9 V;  1TGO A;  2PI4 A;  5LA6 A;  5KHG A;  4KFM A;  4X64 O;  2HHH O;  4NXM O;  4KL1 A;  2E5L B;  5JQG B;  1WPB A;  2WLI B;  3A0B Z;  5CA1 B;  1IBK B;  2WLL A;  4K3A A;  4RQF A;  1EM1 A;  3L9D A;  1F7Y A;  3BAA A;  4JYA B;  2PI5 A;  1FXH A;  1IZ3 A;  1J5E B;  1OCC B;  1N8R W;  5EK0 A;  5C8Y B;  2IJI A;  4QE9 A;  1Q86 W;  2P4K A;  3APO A;  4DV1 O;  4CS3 A;  2N05 A;  1OCZ C;  3HPL C;  1I94 B;  1XHZ A;  2BTQ B;  3FB8 C;  3E8G A;  5IY5 C;  3ZIA G;  3UM7 A;  3BFR A;  1V54 C;  4LNU B;  1HR0 O;  4R7C A;  1EN6 A;  1EFR G;  1VEW A;  3C90 A;  4PA3 A;  1GTO A;  1SKV A;  3H1I H;  4LF5 O;  1R3K C;  1OCO C;  5LBQ A;  3OR6 C;  3DC6 A;  3RYC B;  3QNE A;  3CCV V;  1AB3 A;  1BSM A;  1ZL8 B;  2KG7 B;  4FIP C;  2KSD A;  2N04 A;  1Q3E A;  1M57 C;  1Y6X A;  4DR2 B;  3BHP A;  4H37 A;  4HZ3 A;  5KAI Z;  3JSN A;  1YHQ V;  1SRY A;  5A9G A;  4JTC B;  3CB2 A;  2Q8V A;  3CE2 A;  1ZL8 A;  4J9Z B;  1VAR A;  1P4R A;  5LHI A;  3UT5 A;  4J7J A;  1H2G A;  3OMI B;  1BGY H;  3GVM A;  3K79 A;  3AG1 B;  4NVP A;  3UCS C;  3AG4 C;  3H1H H;  1VQ6 V;  2Y0I A;  4DR4 B;  1YJW V;  1MZF A;  2FL4 A;  4JGS A;  1Q7Y W;  1NKD A;  1VQ5 V;  3D8C A;  2UXC O;  2K1E A;  4FK5 C;  4TSF G;  4J7K A;  2R72 A;  4RQE A;  4X62 O;  1KBH A;  2IM9 A;  1M5I A;  1KC8 W;  2ADP A;  2LGQ A;  2Y69 C;  4U3J A;  3OEE G;  4X1Y B;  4U3J B;  3L74 H;  2DMX A;  3VBB A;  1KKD A;  1S77 D;  2BOC C;  2JEX A;  4EEQ A;  2W6J G;  2CE4 A;  3U10 A;  2ZIN A;  4PDL A;  5LHG A;  4JTA B;  4B7E A;  3ZRW A;  5B1O A;  3JAW B;  1N32 B;  3AG3 B;  1MA1 A;  3STL C;  4QIW F;  4Z2W A;  4DRX B;  1LR1 A;  3I55 V;  3H1J H;  1H2M A;  4GT1 A;  4WCE V;  4AQY B;  3TGU H;  2Y4U A;  2WLL B;  3FB7 C;  3ETQ A;  1UPG A;  1G1X B;  4LFC B;  1XMO O;  4HNA B;  1S5L Z;  3ZHS A;  5LGN A;  3JD0 A;  4BW9 A;  1FYJ A;  1WPX A;  2EJR A;  2JK5 C;  4CC5 A;  2JVD A;  1URF A;  2QDO A;  3ZN0 A;  2EIL B;  2ETN A;  5KHH A;  2GBO A;  2V4D A;  2Q6A A;  3HKE B;  4AQY O;  4KHP B;  4IGG A;  2PTM A;  4PJ0 Z;  2VQF B;  4PDM A;  4DUZ O;  4X65 O;  2DYS B;  4MW3 A;  2Q0A A;  1KP2 A;  2EIN C;  3DXR B;  1FS0 G;  2OT5 A;  1GM7 A;  4U3F H;  4B3T B;  3CD6 V;  1DGS A;  5B1N A;  1Y4M A;  2F1M A;  1B04 A;  5LL6 Y;  1KB9 F;  1M90 W;  1HW7 A;  3JAR A;  2XAJ A;  2DQ0 A;  1K97 A;  4O4I B;  2DYR B;  3OTO O;  3RFR A;  3AG2 C;  4MSW C;  3B40 A;  3RT3 C;  4X1K B;  4DV2 B;  1K73 W;  1JR9 A;  3BRC A;  4DV7 O;  3G67 A;  4YJ2 B;  4LFC O;  1MAB G;  3R66 A;  4HNA A;  1VQ4 V;  2X6B A;  1F51 A;  2ITC C;  2EX3 A;  3CCQ V;  2RNB A;  4RUF A;  5GW7 A;  2E75 B;  3SR2 C;  4R50 A;  1P49 A;  4DV0 O;  4MT8 A;  3E35 A;  1PNM A;  4PA4 A;  1U97 A;  5H9C A;  1ROP A;  1AI6 A;  1MSD A;  5BR8 B;  2UU9 B;  5B5E Z;  1MOF A;  4DR6 B;  1VIB A;  2FTK A;  4JYB A;  3K9A A;  1BHA A;  3B77 A;  3JAT B;  2P5O A;  4GX5 A;  1GAX A;  1HP8 A;  3K57 A;  5B1A B;  4JI1 B;  5KMG A;  4YHH B;  1K4C C;  1YJN V;  2Y69 B;  2L35 A;  5J2T B;  2OWO A;  2YIA A;  1KUQ A;  4LFB O;  4IIJ B;  3K5L A;  4LCU C;  1LUW A;  1P7B A;  2WPD G;  2BE3 A;  2OCH A;  4YJ3 B;  4GYC B;  3RYF A;  5KHI A;  1SA0 B;  5GTH Z;  1HNZ B;  1VF7 A;  1O9G A;  2BTO A;  3HKD B;  3T1Y B;  2ZE8 A;  4BIO A;  1F4N A;  3OGC C;  4LF6 O;  3FB6 C;  5E1A C;  2HVK C;  1Y74 A;  3T4D A;  3E2E A;  3RWR D;  5ITZ B;  3SDL A;  3KKY A;  1SC5 B;  4IT5 A;  1QCE A;  2H94 A;  4WFG A;  1ARO P;  2CGN A;  4MVQ A;  1GN3 A;  2AGA A;  2EIN B;  4DR7 O;  4LF8 B;  3SYC A;  4J41 A;  2F4V B;  3CCE V;  2QKA A;  3L73 H;  5F2V O;  4CH6 A;  3TK1 A;  4DV4 O;  2QWQ B;  4MVO A;  2ZM6 B;  1FXK C;  3P3N A;  2DYR C;  1NR7 A;  1QLE C;  3L70 H;  3OUF A;  4PA7 A;  5LHH A;  5JVD A;  4ZOL B;  2DJV A;  3HKC B;  1IDS A;  5B3S B;  2K9P A;  4HYO A;  4FM0 A;  3VQY A;  3AG1 C;  4LF7 O;  2VQE B;  4FZ1 A;  4K8X A;  4GCZ A;  2QR4 A;  1IUR A;  2JIZ G;  1BQ0 A;  1US6 A;  4AIL C;  2Q5Z A;  4FFB B;  2Q4P A;  1ZX3 A;  2A06 H;  5JVD B;  2R9A A;  2E5L O;  4LWS A;  4HBN A;  3BVO A;  4AI8 A;  2CTW A;  3QO7 A;  3NXS A;  3P30 A;  1WP8 A;  3T4Z A;  4I50 A;  5CB4 A;  4WBN A;  4FM1 A;  1FXV A;  1WN7 A;  3F7Y C;  2ZE5 A;  2IJH A;  3ZRV A;  4I5S A;  4JI8 B; 
#chains in the Genus database with same CATH homology
 3KG2 A;  4G28 B;  3CCS V;  1K3E A;  3DGE A;  3QO8 A;  1WLE A;  5KA5 A;  3A0R A;  2UXX A;  4WF9 V;  2PI4 A;  5CBH A;  2IH1 C;  4KFM A;  3TCU A;  3K03 A;  2ZR3 A;  1YIT V;  5L3D A;  1QVG U;  3CCL V;  5L3E A;  1F4M A;  1K7D A;  2EIK B;  2WLI B;  2DW4 A;  1GM9 A;  1QR8 A;  3ASN B;  1VQ8 V;  4KUM A;  1NH2 B;  5EC1 C;  2JJ2 G;  1FXK B;  1K5Q A;  3SPJ A;  4HAM A;  2ZR2 A;  3P32 A;  1QBZ A;  5IYB O;  2WLL A;  4RQF A;  1V55 C;  1BHB A;  5LGU A;  2XAQ A;  2GSM B;  3E8B A;  2IU3 A;  1FXH A;  2PI5 A;  2WAM A;  4UVA A;  1OCC B;  1R6K A;  1N8R W;  5EK0 A;  3CC4 V;  2Z3Y A;  2M7W A;  3JD2 A;  2IJI A;  3OEH G;  4QE9 A;  1S72 V;  1Q86 W;  1OCZ C;  3HPL C;  3JD4 A;  3JD3 A;  2Q68 A;  2XAG A;  3FB8 C;  1DLB A;  1NJI W;  3E8G A;  5IY5 C;  3ZIA G;  3UM7 A;  1V54 C;  1YTF D;  3WG7 B;  4JF3 A;  4FMT A;  3LNM B;  3JCZ A;  4R7C A;  1EFR G;  2WLI A;  4G27 B;  3SPC A;  3W7S A;  4PA3 A;  4P30 A;  1GTO A;  2B1G A;  2JEU A;  4EKW A;  1J95 A;  1THZ A;  1R3K C;  1OCO C;  5LBQ A;  3OR6 C;  2XAS A;  3F5W C;  1BMF G;  3RBZ A;  3QNE A;  4MTG A;  2UXN A;  5CA3 A;  3CCV V;  2XAH A;  1QVF U;  1GM8 A;  4FIP C;  5DM6 V;  1I5Y A;  1V54 B;  3E8H A;  1R73 A;  2EIM C;  3ETE A;  1S76 D;  2Q67 A;  1M57 C;  2P6J A;  3JD1 A;  3QO5 A;  1K33 A;  3OR7 C;  4H37 A;  4HZ3 A;  3ZCC A;  1YHQ V;  5KUK A;  1DF5 A;  3AEI A;  1KD1 W;  1SRY A;  1M56 C;  3UKM A;  4JTC B;  1RM1 B;  4UV8 A;  2DWE C;  1R3L C;  1S3J A;  2ZXW B;  2MK3 A;  3K08 A;  3OFN G;  4MTX A;  4UVB A;  4CBC A;  3IGA C;  1JQ0 A;  2DWD C;  3STZ C;  3CPW U;  4WFF A;  3CC7 V;  2HLD G;  2IH3 C;  3E83 A;  3TET A;  3GB7 C;  4RO2 A;  4J9Z B;  1EBO A;  1JJ2 U;  1M1K W;  1P4R A;  5LHI A;  3BY6 A;  1H8H G;  5B1A C;  4CZZ A;  1NQT A;  3OMN B;  3K04 A;  1NH2 D;  1F23 A;  1H2G A;  1RPO A;  2HVJ C;  1COW G;  3OMI B;  3CCU V;  3JYC A;  3B8N A;  3K79 A;  2F43 G;  2HKO A;  3AG1 B;  3AG4 C;  1BL8 A;  2QM8 A;  4UVC A;  1VQ6 V;  2A0L A;  3T1C A;  1W2B U;  1YJW V;  2WLK A;  2OTJ V;  1K92 A;  5CBF A;  4WFB V;  1VQM V;  2X6A A;  3BEH A;  4JAS A;  2AHZ A;  2OTL V;  1AI5 A;  4JGS A;  2X0L A;  1Q7Y W;  2IW5 A;  3LDE A;  4PA6 A;  3E89 A;  1NKD A;  1VQ5 V;  2NLJ C;  2WLM A;  1I5X A;  5HFL A;  4E2L A;  1JX9 A;  2K1E A;  4FK5 C;  4TSF G;  3WFV A;  4XDL A;  3OM3 B;  4RQE A;  1MSW D;  1OCR C;  4Q20 A;  4G2K A;  1AJQ A;  3I56 V;  1ENV A;  1Q82 W;  1KC8 W;  2Y69 C;  3OEE G;  1XL4 A;  2B5U A;  2X7R B;  3VBB A;  1KKD A;  2HG5 C;  1S77 D;  3CYO A;  2BOC C;  1IXM A;  2JEX A;  2W6J G;  5KA6 A;  3IFX A;  3SYA A;  2KB1 A;  3T2M A;  4FPP A;  4PDL A;  2P90 A;  5LHG A;  4JTA B;  1OZ0 A;  2ZDI A;  4QNH B;  3ZRW A;  3SJQ C;  5B1O A;  1NVP B;  4JTD B;  3SPI A;  1HWY A;  4TWK A;  3AG3 B;  3M99 B;  4N23 A;  5B3S C;  3STL C;  3ABL C;  4QIW F;  4X88 A;  1ORQ C;  3I55 V;  3FYI B;  4X89 A;  4GT1 A;  4WCE V;  1KP3 A;  1VQ7 V;  4BW5 A;  1B6Q A;  2WLL B;  3FB7 C;  4U7N A;  3OMA B;  3RW0 A;  3ZRS A;  2LFS A;  5HFM A;  1YTF B;  3AG3 C;  4RUE A;  1AJP A;  1PKX A;  3EHB B;  4LBE C;  3ABM B;  2IU0 A;  5LGN A;  3AG4 B;  3JD0 A;  2QEX V;  1GK9 A;  4DO2 A;  1WPX A;  2EJR A;  2JK5 C;  2EZO A;  1JPX A;  2EIJ C;  4QE7 A;  4PDV A;  1AI7 A;  3F7V C;  1NR1 A;  3G6E V;  1AR1 B;  1GMG A;  1L1F A;  4WFA V;  3ZN0 A;  2EIL B;  4ZBM A;  4LP8 A;  3W7T A;  3OW2 U;  3SPG A;  2Q6A A;  2C2A A;  1OCC C;  2QTO A;  1G8M A;  1QR9 A;  2LFR A;  1LNQ A;  5CBG A;  4PDM A;  1YJ9 V;  1QLN A;  3ABK B;  1G4Y B;  2ZD9 A;  4XBF A;  2DYS B;  2DQ3 A;  4MW3 A;  4WFE A;  1SES A;  1NVP D;  5IYC O;  1OHH G;  2A9H A;  5FL7 G;  1KP2 A;  2EIN C;  3W7W A;  1FS0 G;  2OT5 A;  1SZT A;  3ABM C;  3R65 A;  4UXN A;  2ATK C;  1GM7 A;  3CD6 V;  3ZMT A;  1VQ9 V;  5B1N A;  1VQL V;  4Z1M G;  2OCC B;  1Y4M A;  3LDC A;  4MS2 A;  2R9I A;  4PEL A;  4JPR A;  1M90 W;  4QPK A;  5J9P C;  1H38 A;  4XDK A;  2XAJ A;  4X8A A;  2P7T C;  1K34 A;  3GWO A;  3ZMS A;  1AI4 A;  2YSU B;  2AHY A;  2DQ0 A;  1K97 A;  4MVR A;  2BOB C;  1W0K G;  2ZDI C;  3ASO B;  2DYR B;  3AG2 C;  4MSW C;  3WG7 C;  1MG1 A;  5L3C A;  2Z5U A;  1ZWI C;  3ML0 A;  3K06 A;  4JYC A;  2ZQM A;  2XAF A;  2HFE C;  4J9Y B;  1CEZ A;  1K73 W;  1GKF A;  1V55 B;  3CC2 V;  2V7Q G;  1MAB G;  4PDR A;  2WSS G;  3B8M A;  3W7U A;  4PA9 A;  1VQ4 V;  2DYS C;  2IJK A;  2X6B A;  4XDJ A;  1F51 A;  1SET A;  1CP9 A;  2ITC C;  1YSC A;  3CCQ V;  4GX2 A;  1E1R G;  4JAU A;  1W0J G;  4MVS A;  4QPJ A;  4RUF A;  5GW7 A;  5EBL C;  2WLN A;  3OUS A;  2CK3 G;  3ZMV A;  3OAA G;  1KQS U;  4R50 A;  2QA4 V;  2D3O W;  1OCO B;  1OCR B;  2HJF C;  4GX1 A;  2IJJ A;  2A79 B;  3ZN1 A;  1DF4 A;  2HR3 A;  4MT8 A;  4N21 A;  3E35 A;  1PNM A;  1XL6 A;  4PA4 A;  2EIK C;  5H9C A;  1YIJ V;  4UUJ C;  1ROP A;  4MVZ A;  3ZRX A;  1AI6 A;  2OCC C;  1UJW B;  3G4S V;  3LSQ A;  3FKS G;  3ABU A;  3LDD A;  1MOF A;  2EBO A;  3LUT B;  3X2Q B;  2FTK A;  4JYB A;  2QKS A;  3SYO A;  1EZJ A;  3DTU B;  3K9A A;  1BHA A;  1VQP V;  3B77 A;  4GX5 A;  3ABT A;  3PJS K;  1K9M W;  5IDJ A;  5B1A B;  5L3F A;  1FFT B;  3VOU A;  1K4C C;  2W6I G;  1YJN V;  2Y69 B;  1AJN A;  1R3I C;  2YEV B;  4DXW A;  5LGT A;  3X2Q C;  1H8E G;  4LC1 A;  4WFH A;  1VQO V;  3CCJ V;  1M56 B;  5EBM C;  4BIU A;  3CCM V;  1NBM G;  4LCU C;  3ZMU A;  1Q81 W;  3CMA V;  1P7B A;  2WPD G;  4UV9 A;  2ZXW C;  5KUM A;  2P67 A;  3SPH A;  2WWW A;  3ZRW B;  3AG2 B;  4QJF B;  4MTO A;  4BIZ A;  2W0F C;  3CCR V;  1Y66 A;  2Q69 A;  5IYD O;  2ITD C;  4MTF A;  2Y48 A;  3D3I A;  1PNK A;  5DN6 G;  3E8F A;  3ASO C;  4F4L A;  1K4D C;  1DTO A;  1F4N A;  3OE7 G;  3OGC C;  1FXK A;  3FB6 C;  4R6Z A;  5E1A C;  2H8P C;  2HVK C;  1JVM A;  3CP1 A;  5CMU A;  3CXC U;  2XND G;  4MVM A;  3T4D A;  3E2E A;  2R9R B;  3EFF K;  3RVY A;  4OXS A;  3SYQ A;  5L3B A;  4MVU A;  5BZB A;  4RAI A;  4MW8 A;  3ETD A;  5L3G A;  2LP7 A;  2WLJ A;  3K0D A;  4I9W A;  1QCE A;  3D36 A;  2H94 A;  3FYE B;  4WFG A;  1ARO P;  3ABK C;  4MVQ A;  5CN0 A;  4R8C A;  3MD0 A;  2EIN B;  1OCZ B;  3CME V;  3G71 V;  5B1B B;  1VQK V;  3K3W A;  3SYC A;  1GO3 F;  3CCE V;  5B1B C;  3TK1 A;  2V1D A;  4MVO A;  4TT3 G;  4KP4 A;  4ASU G;  4GX0 A;  1FXK C;  2DYR C;  2NNU A;  1NR7 A;  1QLE C;  2QE7 G;  1JCH A;  3MHS C;  3OUF A;  4PA7 A;  5LHH A;  1RM1 C;  1K8A W;  1PNL A;  1S5H C;  3W7X A;  3ABL B;  1JOY A;  5B3S B;  4P9O A;  3LSS A;  3ZJZ A;  4HYO A;  5EC2 C;  3E86 A;  1KEC A;  2QM7 A;  3ASN C;  3K0G A;  3RVZ A;  1E1Q G;  1E79 G;  3AG1 C;  1PL0 A;  1QLE B;  1R6N A;  4JAV A;  4ZKI A;  3MHH C;  3FB5 C;  4H33 A;  5IY5 B;  1PD3 A;  1CPY A;  3SYP A;  4BAY A;  1YI2 V;  4GCZ A;  2GHY A;  1SER A;  5C93 A;  2JIZ G;  1S0V A;  2YEV A;  2EIL C;  4P9P A;  1R3J C;  1TUE B;  1RPR A;  2B1I A;  1M9N A;  3IC7 A;  4FJC C;  2JJ1 G;  2X6C A;  2EIJ B;  2XOK G;  3HB3 B;  4U7O A;  3QO7 A;  4L87 A;  2WLH A;  3NXS A;  3H01 A;  2JDI G;  5H6Q A;  3ZMZ A;  3P30 A;  5H6R A;  2EZP A;  3ETG A;  3T4Z A;  4P2Z A;  1M57 B;  1FXV A;  3F7Y C;  4YXW G;  5EBW C;  1K5S A;  2IJH A;  2EIM B;  1VQN V;  3ZRV A;  4I5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...