3E8HA

Crystal structure of the the open nak channel-k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
b'EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8hA00
4DXWA 4EKWA 2EIJC 2WLIA 3FB6C 3T4ZA 1M56C 4MTFA 2WLIB 4MS2A 2P7TC 3LDEA 4HYOA 4MTGA 5EC2C 4RUFA 1V54C 1JVMA 5B1AC 3WG7C 2WLHA 2AHZA 4X88A 5EBMC 2A9HA 4PDLA 2OCCC 3FB8C 4ZBMA 4WFHA 1R3LC 1V55C 2QKSA 5KUKA 2WLKA 2Y69C 2IH3C 4CBCA 4JTDB 3UKMA 2HFEC 1G4YB 3SJQC 3LDCA 3K03A 1ORQC 3E8FA 4H33A 2BOCC 3K0GA 1P7BA 3SYQA 4HZ3A 3SPCA 4GX1A 3SPGA 2H8PC 4R50A 2X6CA 2X6BA 5E1AC 3PJSK 4KFMA 3LNMB 3ABKC 3E8BA 2NLJC 4PDRA 4LP8A 3VOUA 3ZRSA 1K4CC 3LDDA 2WLNA 3LUTB 4G28B 3K06A 4PA7A 5B1BC 2EIKC 5EK0A 2ZXWC 3IGAC 4GX5A 3ASOC 4PDVA 2Q69A 1M57C 3AG3C 4P9OA 1LNQA 1OCZC 2W0FC 1ZWIC 2DWDC 4QE7A 3ABMC 3SPJA 4P2ZA 5B3SC 4PA3A 3BEHA 2JK5C 4GX0A 3X2QC 2Q6AA 2X6AA 4JTAB 3STZC 4P30A 4G27B 5CBHA 4MVRA 3RBZA 4MVZA 2Q67A 5CBGA 4J9ZB 3K0DA 4QNHB 2HG5C 4PDMA 3ASNC 4WFEA 3RVZA 2WLMA 4MVQA 3OUFA 1QLEC 1XL4A 3E8GA 2IH1C 3SPIA 1KKDA 4MW3A 1OCRC 4RUEA 4H37A 4R7CA 3T1CA 4BW5A 1S5HC 3SYOA 3IFXA 4MVSA 3SPHA 4LBEC 1BL8A 4P9PA 4QE9A 3TCUA 3RVYA 1XL6A 4R6ZA 4XDLA 5KUMA 4F4LA 5IY5C 3E8HA 4MTOA 3F7VC 2KB1A 2EILC 3FB7C 3OR6C 4JTCB 4GX2A 4RO2A 2DWEC 3OR7C 2ITCC 4WFFA 5EBLC 3STLC 2WLLA 2QTOA 1OCOC 3OGCC 2WLLB 1OCCC 3SYCA 3T4DA 2BOBC 4MVUA 3UM7A 1J95A 1K4DC 2HJFC 5EC1C 3TETA 4RAIA 2YEVA 2ITDC 3EFFK 3RW0A 3F5WC 3SYPA 3T2MA 4PA9A 2A0LA 4MVOA 3E89A 3GB7C 5J9PC 3FB5C 2DYRC 4TWKA 4MW8A 3F7YC 3E86A 4PA6A 1R3JC 4I9WA 2K1EA 3ABLC 2AHYA 2EINC 2HVKC 4XDKA 3E83A 4J9YB 2ATKC 3HPLC 2EIMC 3JYCA 3K04A 4X89A 4WFGA 3SYAA 2DYSC 3OUSA 3ZJZA 3AG1C 3AG2C 1R3IC 2HVJC 4LCUC 4PA4A 2A79B 2WLJA 1R3KC 4OXSA 3AG4C 5CBFA 4UUJC 4MVMA 4R8CA 3R65A 3KG2A 5EBWC 2ZD9A 4XDJA 5BZBA 4MSWC 4X8AA 2Q68A 3K08A 2R9RB
chains in the Genus database with same CATH superfamily
2CTWA 1V54C 1YXBA 4I9QA 5CA1B 1XNQO 2JJ2G 1KB9F 2A3QA 1VQ4V 4X88A 1Q82W 1YF2A 2DJVA 2KG7A 3CWBH 4LF9O 1V54B 4Z1MG 2Y0IA 3D3QA 4BIOA 2Y4UA 5FPRA 3UO2A 3C3SA 4XBFA 5LP6A 4K8XA 4DW0A 1BSMA 1AP6A 5CMUA 3SJBC 1KYOF 1YEWA 5HFLA 4E4EA 2DWDC 4PI2A 1IVSA 1B06A 3L72H 2QM8A 2M6YA 5CBHA 1Y74A 5B66Z 1YZBA 2OIEA 3CCLV 2UU9B 2QGNA 1BZKA 4RUEA 1SERA 4BIUA 3TXQA 1O9GA 2LJ2A 5IWAB 1L0LH 4GKJB 2QJ1A 5FNVA 4NXNB 3RYHA 3HKCB 2WLLB 3TGUH 3D36C 4J42A 3K5LA 3RYFB 4DV1O 4I55A 5EC1C 1LUWA 5TISZ 3HKEB 3MD0A 1AB3A 1AR4A 1VQ7V 1NZ6A 1FJGO 3GB7C 2Q7EA 4B3SB 1Q43A 1MG1A 3W7WA 2EBOA 3JATA 1HP8A 2V7QG 4JPRA 2GSMB 4DR6O 2AHYA 4ZOLB 4XDKA 3RN4A 2ADPA 2ATKC 3K79A 5ITZB 1PP9H 4JAVA 1NI8A 1R3IC 1Y4MA 1GRJA 3G67A 2RNBA 4GLXA 5CBFA 3CXCU 1EM1A 4MVMA 2FB5A 4FFKA 5KX5A 2QM4A 4NR1A 3MHHC 4X20B 1SQVH 2R9RB 2YUAA 5AG2A 5DM6V 2WLIB 3FAVA 4HBNA 2ZM6B 3K57A 1F7YA 3RYCA 2XAHA 4TQDA 1QQCA 4EFBA 2UUAB 3FB8C 2P6JA 3BA8A 5EYPA 2JJ1G 1G4YB 1DLBA 4J7JA 2QA4V 3E8FA 4H33A 5K1XA 3I55V 3JD2A 1P7BA 4DV3O 3ZN1A 2CH7B 3VOUA 1I94B 2CUGA 2E75B 2CTRA 3T1YO 4PDVA 1G6UA 4CH5A 3QO8A 3DC6A 3JSLA 4AQYB 1SC5B 3ZBHA 5CA0A 1J5EO 4IIJA 5IYZA 3K5MA 4GT1A 2Q6AA 2R9AA 4JZ2A 1SZTA 5KHJA 5F2VO 4QNHB 2HG5C 1QBZA 1SESA 2OCCB 1QHTA 5L3DA 3SPIA 4O2BB 3SPHA 4LBEC 2UUCO 1GN3A 3ZS8C 3JD1A 1SF9A 3LSUA 1XMOB 1I7FA 1M57B 2ZIMA 3F5WC 1N32O 1WB7A 4FJCC 4DV7O 5B3SB 5J9PC 4MTXA 5L3GA 3CCEV 1WA8A 1JJ2U 1H2LA 5B1OA 2UXDO 1S76D 2AZ2A 4CC6A 3K9SA 1OCRB 1M4UA 2L6LA 3VQVA 4LF4O 1YJNV 3AG4C 2Y0PA 1E1QG 3R65A 4X66O 2VQFB 4MSWC 4X8AA 1NS1A 3T1HO 3AG4B 4DR3O 4TQFA 4UVAA 4F6RB 1SKVA 1YI2V 4CZZA 4YJ2A 2P06A 1BHBA 3S3WA 2CE4A 5KUKA 4DV4B 1GH6A 2HFEC 1N36O 3LDCA 4JGSA 2EX3A 3K0GA 1SRYA 1G8MA 1TGOA 2LP7A 1FXVA 3VQYA 1XHZA 3CJHB 5KA5A 3AG1B 4LP8A 4DV5B 2B9ZA 2Y4TA 3K06A 2ARHA 2ZR3A 2PTMA 2ZXWC 3OTOO 3OW2U 1KU9A 4BR6A 1F4NA 2OCHA 4TV8B 1IBKB 4X1IB 1K5QA 4DK0A 4F6EA 2F1MA 2N05A 4LFCO 1URFA 5K1PA 3UQ8A 4MVZA 5EIBD 2ZNJA 5LGUA 2WA4A 1WP7A 3TCUA 4R6ZA 5KHIA 2ADQB 1TUBA 4Q20A 2WPDG 3ICXA 1JJOA 3ETGA 1JX9A 1H2KA 1QLNA 5BR8O 4UVCA 4JI4O 4LF5O 1GM9A 2PI5A 1OCCC 3SYCA 5EIBC 3CMEV 1S0VA 2ITDC 3JD4A 3O65A 1EBOA 2DYRC 4KL1A 3WB0A 1K97A 4KXRA 1RSOA 3JAWB 2DYRB 3J7AU 1OJHA 3HPLC 4X89A 4NTXA 1H8EG 3EXAA 2RN9A 2EZPA 3CEIA 5J2UB 3A0RA 2XUMA 4O2AA 3P3NA 1HW7A 2W0XA 2GTSA 3ABUA 4LF6B 4UB6Z 2CAZC 4MS2A 5LA6A 2ZE5A 2QWRB 3OTFA 5EBMC 4HNAA 2RJZA 4FLWA 3D3IA 4X1KA 1FPOA 1HDJA 3UT5B 3JALB 4JV5B 2GUZA 5H6RA 2EIMB 3GVMA 1E1RG 4JI1B 4PA7A 2IJJA 1VQKV 3HKCA 5HFMA 1H2NA 3ZHQA 3BPZA 3LSSA 2Q67A 3CHXA 1I08A 4ZHQB 1MA1A 1VF7A 3JASB 1GM8A 1N0JA 3T1CA 4FIPC 2PUSA 4X1YB 1XL6A 4I0XA 3JAKB 5LMNB 2YDEA 4DR4B 5ITZA 4Q6GA 1NBMG 1M90W 1P4RA 4X20A 3S3XA 1SQGA 2Q7HA 4AILC 4GKKB 1EFRG 4MVOA 2PI4A 4K8ZA 1VQ6V 3H1JH 2YXLA 2VQEO 3FYIB 1V9PA 1T5EA 4PA6A 1R3JC 3L74H 2K1EA 2R70A 5JCOC 4UCSA 4K35A 4I5SA 1ZL8A 4RQFA 3BRCA 5BXZA 2DQ3A 2UXBO 2Z3YA 1HNWO 2LO1A 1FXKB 2WLJA 4U7NA 1NVPD 4DV0O 1YTFD 2OTJV 4U7OA 2IJKA 4DXWA 2CTPA 2Q8VA 1JVMA 1NQTA 1M5IA 2PZSA 2MW2B 4JF3A 2A9HA 3OMAB 2ZR2A 1DF4A 1QVGU 1ZTEA 4O4JA 1IBLB 2ZT9B 1XUQA 2EINB 4HZ3A 4IYHA 4DR5O 4O2BA 4DR7O 4FPPA 3ABKC 1NVPB 3ETQA 4YIPA 1YTFB 3P3PA 1KC8W 3KZIZ 3LUTB 1PNMA 2QKCA 3E2EA 3MDSA 4GX5A 2L35A 2XAQA 3ABKB 1Q81W 5H9CA 1HNXB 2NN4A 1N4CA 2JK5C 2EJRA 2X6AA 4LFBB 4J7KA 2ZQMA 2ODMA 1KP3A 1A32A 2Q7GA 4NB5A 3RVZA 2JIZG 4H37A 4JI3O 4LH6A 4OX9O 1M9NA 3O9OA 5C8YB 4GX2A 4PELA 3CB2A 3BHPA 4FZ1A 2QTOA 3ZRVA 3P30A 5C93A 2UXNA 3KCXA 4IHJB 4FLVA 1XMQO 1K5SA 3SYPA 3K5OA 1XNQB 1XNRO 2AXTZ 1F23A 4TWKA 1YJWV 4LF9B 1ENVA 3CRMA 3AG7A 1AJNA 1Q6IA 2GDSA 1GMGA 4CH3A 1AI7A 3AK1A 3FFQA 4WFGA 3OD4A 4UCUA 1XI1A 1W0KG 2ZE8A 1E79G 1IZ3A 2YIDA 5BZBA 5IJ9B 2NR5A 2EIJC 1X4TA 4H44B 4MTFA 1VQ8V 4QGPA 2PYLA 4RUFA 3WG7C 4YJ3B 2HHHO 2CK3G 3K5NA 3FX7A 4FM0A 4YXWG 3A2FA 5FLXN 1R73A 3SYQA 2P5OA 5BMVA 5CB4B 5D5QA 1K8AW 3GWOA 1DTOA 4ZKIA 3AG2B 2UUBO 2E5LO 3BA9A 3SJAC 4DV1B 4O4LA 1FFTB 2R9IA 4DUZO 5KMGA 1K92A 1NKDA 4NVPA 1WJZA 4G27B 2Q0OC 2RDCA 4X64B 2WLMA 2UXCO 1KKDA 1MSWD 5LXTA 4R7CA 3B40A 4XDLA 1ZAUA 1D5NA 3JAWA 4DV2O 3CRQA 3HKDB 3JD3A 3ZHRA 4BW9A 2OTLV 4KP4A 1R6TA 1EN6A 4LF7O 1VEWA 5GTIZ 3T4DA 3N2GB 1Y76B 2YEVA 4EB6A 3QNEA 4O4HB 2A0LA 1F4MA 1VQOV 3KKYA 3ZCCA 4NYKA 4X62B 3CCJV 4DV3B 2FMLA 1WAZA 1Y6XA 1ZSPA 1HR0B 1TA8A 1R3KC 4OXSA 3T1YB 5EBWC 3ZMSA 4EEQA 2B5UA 3FB6C 1R1BA 1J5EB 4DRXB 1FS0G 2EJ7A 4HYOA 1S5JA 1MABG 4DUYB 1Y66A 4J7ZA 2CTQA 4B3RO 4WFHA 2QKSA 3LSQA 5B5EZ 1NR7A 2WLKA 1TVKB 2QWOB 4YHHB 1JQ0A 4FFBA 4W4KA 4KHPO 3HB3B 5GTHZ 3ZX6A 1VP7A 5E1AC 3H1LH 4X1YA 1W59A 2F66C 2PF4E 2WLNA 5EZYA 2WWWA 4JYBA 1LNQA 2W0FC 1N32B 3ABMC 1UPGA 1VQPV 3EVKA 4DV7B 3BEHA 4ZIBA 3W7TA 3N2KA 2WA3A 3HKBA 4FM2A 4FVMA 3NXSA 4WBNA 2UU9O 2HEPA 5IY5C 4I4TA 2ZCEA 3OR6C 2RCVA 1FFXB 1N8RW 1QR8A 5IWAO 4JI5O 3CS5A 5FL7G 5IY5B 1Q90D 5JJJB 3ZN0A 3CE2A 3T1HB 4DR3B 2HJFC 1W0JG 4NXNO 3DXRA 4UCTA 2VWKA 3AK3A 3OAAG 2F4VO 3E86A 2ZDIA 2OT5A 1MSDA 2HVKC 1MZFA 1VF6C 2YICA 3ZJZA 3OUSA 5L3EA 3DTUB 1WLEA 1HNZB 4LCUC 3KG2A 2V1DA 2XAGA 3PN1A 4YY3B 4DR2B 2VRZA 1SA0B 1Q7YW 1TUEB 5J2TB 1M56C 4LFCB 4YIOA 5IYBO 2WLHA 1L1FA 1OHHG 4CH6A 1JA8A 2P4VA 1EZVH 4JTDB 3WB1A 2F23A 4B7KA 5GONA 4JI8B 4LFAB 4ICGA 2YS8A 1KQSU 4A5UB 1XBLA 1K9MW 2V4DA 3ZRSA 2VWJA 4LF5B 4JI4B 5C8YA 4G28B 3ETEA 2BTQB 5IDJA 4LNUB 3B8NA 1I94O 2A06H 4QE7A 5KLVH 1B04A 3CX5F 1N33O 4I50A 4O4IA 4IHJA 4DV6B 4MVQA 1AJPA 2YIBD 1HWYA 4BWAA 3ETDA 1K73W 1QNMA 3E22B 1ZX3A 1PNLA 4MTOA 1BMFG 3OR7C 4UVBA 3OGCC 4AI8A 2MK3A 2ZXWB 3I56V 1VQLV 4FK5C 1J95A 1K4DC 3EFFK 4NKGB 5IT9N 4TV9A 2JGDB 5JVDB 1XMOO 1H2GA 4MW8A 1BHAA 2QE7G 1Q5OA 4J10A 5LYJA 1GN2A 1Z5VA 4U3JB 2JVDA 4TUYB 2XNDG 2YC0A 1VQ5V 1CXZB 2Q5ZA 3Q4HA 4TOIA 2A79B 2DOSA 4ZI7B 3CRRA 2AZ0A 2BSKA 4D7SA 5L3BA 1SS3A 3K08A 2P22C 1R6NA 1OCCB 1N0NA 1THZA 2DMXA 2VQFO 5CA1A 3LDEA 3SJCC 5B1AC 4X65B 1K7DA 3GWKC 2YXYA 4ZBMA 2KG7B 1V55C 1QVFU 2ZNIA 3BABA 2QEXV 5L3FA 3OE7G 3FYEB 1JR9A 5LP6C 1V55B 4DV4O 1NH2D 3TJTA 4CH4A 4U3FH 3E8BA 4PDRA 2YXHA 2IW5A 1N34O 1Q3EA 5LP6B 3HKDA 3B8MA 1WPXA 4DV5O 2D3OW 4UCVA 4JI0B 4DK1A 5LHHA 1KD1W 4JTAB 1IBKO 5IJ0B 1AVMA 4JZGA 3ASNC 4LF8O 2Q9LA 4BW5A 1Q86W 1S5HC 1MMMA 5DN6G 5JJEB 5FNVB 1YVWA 2JS5A 3CC4V 2WLLA 1SETA 3G71V 1RFYA 3RYFA 1OZ0A 1EN5A 4DR1O 3HKEA 4FLTA 1COWG 3CRAA 4I55B 4B3TO 3ML0A 1K33A 5LGNA 1BGYH 2CGNA 1TAEA 4ZOLA 3THOA 3JATB 4ABMA 2ZKOA 1GAXA 3K04A 1AJQA 3JYCA 4DR7B 4JAUA 3BY6A 2DYSC 3TK1A 4C7UA 4RQEA 1SQBH 4B3MB 1KECA 5LMUO 4Z2WA 4XDJA 2QM7A 2Q68A 5KX5B 2QSAA 1BT8A 1FYJA 4EKWA 4OGQB 2WLIA 1MOFA 1WPBA 1NR1A 1VQ9V 3FAVB 3ZIAG 3RYCB 1IBMO 4K0KB 4JI3B 1D5AA 4JI2O 3SPGA 2CH7A 4IT5A 3ZMVA 3C90A 3QF7A 4JV5O 3APQA 4FLXA 1AR1B 3U0ZA 2N74A 2JEUA 4JI1O 1AILA 4QIWF 5CA0B 1BCCH 4IIJB 2XOKG 3K0DA 5LBQA 4WFEA 2IU0A 5LL6Y 2YIAA 2ZDIC 4MW3A 3U10A 2LW1A 4UV8A 2E76B 1UJWB 3ZHUA 3RVYA 4F4LA 3E8HA 3B77A 2EILC 3FB7C 4LWSB 4JYAO 5D5PA 1XQ8A 3STLC 2FTKA 1F51A 1RM1C 1ZUQA 4KUMA 4RAIA 3RW0A 4DR4O 3K58A 3B2EE 3D8CA 1RM1B 4JAAA 2PY5A 1S72V 4JASA 1Q6HA 3L70H 4I9WA 1Q8IA 3ABLC 1VQMV 2IM9A 3QO7A 4RWUA 3ABLB 2E5LB 1IDSA 1NTMH 4DW1A 2Q0AA 3OGIB 4F6RA 2LGWA 4DUZB 3R66A 4LNUA 1M93A 2X0LA 4MTGA 1YITV 3IJ4A 2AHZA 4ASUG 1H2MA 4YJ2B 2UXCB 3ABTA 2IH3C 1XHXA 3OMIB 2W6JG 3SDLA 4D7TA 3SPCA 4H0LB 2ETNA 3CCRV 3CJHA 4DV2B 3JCUZ 3CCSV 2CGOA 2A7WA 2XAFA 4LF7B 2QTSA 4TV8A 1YJ9V 4X1IA 1WP8A 2EIJB 2KSDA 1VF5B 4JI7O 2QDOA 3STZC 2AGAA 3WG7B 2KKWA 3FD9A 1L8DA 2ILMA 3WFVA 4LFBO 3H9VA 3DSQA 3IFXA 4UFZA 3B4SA 1EN4A 5CN0A 3IC9A 3ZEDA 3W7XA 4TUYA 2R72A 2F93B 1TUBB 1GKFA 4IYIA 2ZIOA 1OCOC 1FJGB 2DW4A 4W4LA 3JAMN 2B1GA 2NNUA 2QKAA 4DR6B 4UV9A 4D6TH 1MNGA 1Q6UA 4CS3A 1X59A 4B3RB 4QJFB 2C2AA 4IL6Z 1QU7A 1B3QA 3CCQV 4JI6O 3JARB 1RSOB 4KHPB 4WFBV 1AI5A 3SYAA 5J2UA 2HVJC 4LC1A 1H2SB 3VQXA 2G38A 2EULA 1PV0A 4O2AB 3K59A 2KQXA 2JEXA 1XILA 2WAMA 5L3CA 2GV9A 5KHHA 4J80A 5LA6B 4BIZA 1FAFA 2B1IA 3M7MX 2VS0A 5IJ0A 4HNAB 4OPAA 5GW7A 5H5NA 1Z5WA 4FLZA 3UT5A 1PL0A 1SQQH 4NXMO 3JALA 4X1KB 4GX1A 2X6CA 3AEIA 5LOVB 1IX9A 2GUZB 3CRCA 1H38A 1AI6A 3BFRA 3JD0A 1K4CC 4JI5B 4GYCB 4PD4F 1Y67A 3AG3C 4DO2A 1ZWIC 2DQ0A 3SPJA 1OV9A 4P2ZA 2W6IG 1DF5A 5IYDO 5KA6A 3AG3B 4MVRA 4FMTA 4FLYA 2F4VB 4ZHQA 3H1HH 4NTWA 3JASA 2UUCB 1XL4A 1KBHA 1G1XB 1JCHA 4MVSA 3JAKA 4QE9A 4X64O 3ZRWB 1GTOA 3F7VC 4I0XB 2BE3A 2GBOA 2DWEC 3UO3A 3EHBB 4WFFA 1VARA 3RFRA 5KAIZ 3CC7V 2BOBC 4GUNA 2O57A 2XASA 1YIJV 3W7UA 3T2MA 3ABMB 4PV1B 2UXDB 2XHBA 3FB5C 3J80N 3P32A 4LF4B 2BTOA 1ZLZA 3BVOA 3L73H 4CS2A 1PNKA 4WCEV 1UFIA 4X66B 2QR4A 1ZL8B 5LGTA 4X62O 4TSFG 5JCOA 1AI4A 1FXKA 4GKJO 1ROPA 4J41A 4H13B 1HR0O 3H01A 2IU3A 1YHQV 1PD3A 5KHKA 2EZOA 1KUQA 2Z0AA 4HAMA 1N33B 4DYLA 1JFFB 1NTZH 1N36B 4CC5A 4IGGA 3M99B 3G80A 2OCCC 4B3SO 1KKCA 2PYJA 4CBCA 3CXHF 1SQFA 4DUYO 4UXNA 3FKSG 3WB2A 1VQNV 1ORQC 1DGSA 4O4JB 3WU2Z 3OTOB 3G6BA 1BE3H 1CEZA 3LNMB 4YHHO 2LFRA 2H3OA 3AK2A 3A0BZ 3E35A 3JSNA 3OFNG 1QCEA 3RT3C 4LWSA 5EK0A 3OT7A 1M57C 2JDIG 3H1KH 1PPJH 5IE9A 3G6EV 4PHZA 4OPHA 2JS3A 5B3SC 4PA3A 1M56B 5JQGB 4P30A 2ZM6O 5JH7B 5CBGA 2UUAO 1JOYA 4NTYA 1VIBA 1QLEC 1P7GA 1WNSA 2FL4A 1OCRC 2HR3A 2OYQA 1AROP 3F5TA 5BR8B 4P9PA 1FD9A 5KUMA 1QLEB 2IJIA 4N21A 5A9GA 4RO2A 3DGEA 1U96A 2DN9A 2N04A 3ZMTA 5H6QA 3RYIB 3QG5A 4AQYO 4UB8Z 3IAYA 5FPOA 3K9AA 1YSCA 2JRIA 1O9HA 1K34A 2IBZH 3HR0A 2YSUB 1M1KW 1AR5A 3C3TA 1QR9A 3AG1C 1YCIA 1N34B 5IJ9A 2ZD9A 4UCOA 5E79Z 2P67A 1XOUA 3OEHG 1XEQA 4LR3A 1HNZO 2LW7A 2H94A 3T4ZA 4L87A 1XDCA 4B7EA 3MAQA 2LGQA 4G2KA 4YJ3A 4YY3O 4DR2O 3QVNA 3SGIA 1RPRA 3BAAA 1S77D 4LF8B 3TXSA 2ZINA 3CYOA 4L8JA 3SJQC 5CB4A 2BOCC 1H8HG 3NR7A 5BMVB 4FZ0A 2QWQB 4QPKA 5CA3A 4JI8O 2YI9A 4LFAO 5B1BC 3CMAV 4BAYA 3IGAC 3ASOC 3N27A 4DR1B 3ZMUA 4P9OA 2YI8A 1OCZC 3ZHTA 1VMGA 4B3TB 4O4LB 2HKOA 5B1BB 2HP8A 1KMIZ 5KMGB 2F43G 4GX0A 3ASOB 3X2QC 5B1AB 1OCZB 1AP5A 1MZEA 4J9ZB 1NJIW 2ZE7A 3OUFA 2IH1C 3X2QB 1WB8A 1I5YA 5LXTB 3JARA 3H1IH 4DV6O 3VQWA 3OMNB 3B09A 5LHGA 5LMUB 2D2CB 5EBLC 2Y48A 2ZE6A 3N2GA 1Y76A 2VQEB 3UM7A 2XAJA 4O4HA 2GHYA 3QTCA 2YEVB 4EB6B 1Y74B 4EFEA 5A2QN 1IBMB 2OWOA 2UXBB 1NH2B 2RMKB 4B08A 3ASNB 4MT8A 3LNNA 1JMKC 5DEDA 1HNWB 4JI2B 5JJNB 4J9YB 1IXMA 3CCVV 4DV0B 2EIMC 4PJ0Z 4CS4A 4PA4A 3RYHB 5LOVA 2OIGA 4GCZA 1JPXA 3A0HZ 4FLUA 1SZXA 3D36A 1DK1A 4DRXA 3G4SV 2HJDA 2P90A 1GN4A 1IURA 2QWPB 5EC2C 2Z5UA 4PDLA 4DR5B 1TVKA 1WN7A 1P84F 4X65O 4JYYA 2BCCH 3I5DA 4FFBB 4R50A 3ZHSA 2X6BA 3OM3B 3PJSK 4JYAB 2DYSB 3K3WA 3ZRWA 5BY1A 1GM7A 5KHGA 5B1NA 5EZYB 2X7RB 2K9PA 3CSXA 2FKXA 3OEEG 3VBBA 4N23A 3U11A 4LF6O 1GK9A 1W2BU 1BQ0A 2GTAA 4GZRB 5EYPB 3MHSC 3IC7A 1PL4A 4OX9B 3N2KB 4JI0O 3E8GA 3CC2V 2Q73A 3HKBB 2Q4PA 3SYOA 4E2LA 4PI0A 4WBNB 2HLDG 1CPYA 3ZRXA 4K3AA 1GN6A 3CPWU 4JTCB 2KB1A 1FXKC 1FFXA 3A8TA 4I4TB 1R6KA 1Z2GA 1XMQB 2E3CA 3L75H 1K3EA 1NT2B 1L0NH 1XNRB 2WSSG 4MVUA 5IYZB 1YDXA 1CP9A 1XREA 1SQXH 2XTAA 2PGGA 4AHCA 3BCCH 3E89A 3ZHVA 2IJHA 4LH7A 5JWPA 1JFFA 3DXRB 5DECA 3RGBA 2F95B 3CP1A 2CDYA 5H2FZ 1GO3F 2EINC 1US6A 4I7ZB 4QPJA 5LMNO 2EILB 1VF6A 3APOA 2DE0X 2RQ6A 3W7SA 1SA0A 5LHIA 2M7WA 4B3MO 1PM9A 2HHHB 5J2TA 1LR1A 3RWRD 1FKAO 1BQZA 4JI7B 2P7TC 1WA8B 4J11A 4GKKO 4JYCA 3M8AA 1IXBA 1NU1H 2P4KA 5JQGA 1R3LC 2Y69C 5JH7A 1NTKH 3UKMA 3K03A 2UUBB 1P49A 1LUVA 4X9QA 2H8PC 5GONB 4K0KO 2Y69B 4KFMA 1PKXA 1RPOA 2NLJC 3LDDA 1D2DA 1RP3B 2BTQA 2EIKC 1I5XA 2Q69A 2JGUA 5KAFZ 3RYIA 2EIKB 3KCYA 4Z1VA 4I50B 4O4IB 3CCMV 3RBZA 2UXXA 3JCZA 1SQPH 4PDMA 4JI6B 1B6QA 1S5LZ 4TT3G 3L9DA 4WF9V 3CCUV 1S3JA 3E22A 1IBLO 1BL8A 1FXHA 3J81N 3UCSC 2QWNB 2ITCC 1KP2A 2FYUH 1BS3A 3TETA 2JGDA 5JVDA 1HNXO 4PA9A 5IYCO 4TV9B 4WFAV 2YIBA 3F7YC 2AW9A 4U3JA 4NXMB 5LYJB 1U97A 2E74B 4FM1A 3E83A 4UCRA 2XT9A 2LQTA 3CD6V 1EZJA 3AG2C 3DC5A 3L71H 3QO5A 4ZI7A 3Q4HB 4UUJC 4R8CA 3SR2C 1I0HA 2BSKB 3ZMZA 2LFSA 1OCOB
chains in the Genus database with same CATH topology
4DXWA 1OCCB 2EZOA 4HAMA 1THZA 3LDEA 1V54C 1JVMA 1NQTA 5B1AC 2JJ2G 1K7DA 3M99B 1VQ4V 4X88A 4JF3A 2A9HA 3OMAB 2ZR2A 1Q82W 2OCCC 1DF4A 4ZBMA 1QVGU 1V55C 1QVFU 4CBCA 2QEXV 1V54B 3OE7G 5L3FA 4UXNA 3FKSG 4Z1MG 3FYEB 1ORQC 1VQNV 4HZ3A 2EINB 1V55B 1NH2D 1CEZA 4FPPA 3LNMB 3ABKC 3E8BA 1NVPB 2LFRA 4PDRA 1YTFB 2IW5A 3E35A 4XBFA 1KC8W 3LUTB 1PNMA 3OFNG 1QCEA 5EK0A 3E2EA 5CMUA 4GX5A 1M57C 2JDIG 2XAQA 3ABKB 1Q81W 5HFLA 5H9CA 3B8MA 1WPXA 3G6EV 2D3OW 2DWDC 5LHHA 5B3SC 2QM8A 4PA3A 1M56B 1KD1W 2JK5C 2EJRA 2X6AA 4JTAB 5CBHA 4P30A 2ZQMA 5CBGA 1KP3A 3ASNC 3CCLV 3RVZA 1JOYA 1QLEC 2JIZG 1OCRC 2HR3A 4H37A 4RUEA 4BW5A 1Q86W 1S5HC 1SERA 1AROP 4BIUA 4P9PA 5DN6G 5KUMA 1M9NA 1QLEB 2IJIA 4N21A 4GX2A 4PELA 4RO2A 3DGEA 3CC4V 2WLLA 1SETA 3ZMTA 3G71V 2QTOA 3ZRVA 5H6QA 2WLLB 1OZ0A 3P30A 5C93A 2UXNA 1COWG 5EC1C 3MD0A 1K5SA 3K9AA 3SYPA 1YSCA 1VQ7V 3GB7C 3ML0A 1F23A 4TWKA 1K34A 1YJWV 1ENVA 1K33A 1MG1A 5LGNA 3W7WA 2EBOA 1AJNA 2V7QG 4JPRA 2GSMB 2YSUB 2AHYA 1M1KW 4XDKA 1GMGA 1AI7A 2ATKC 3K04A 1AJQA 3JYCA 3K79A 4JAUA 3BY6A 4WFGA 1QR9A 2DYSC 3TK1A 4RQEA 3AG1C 4JAVA 1W0KG 1R3IC 1Y4MA 1E79G 5CBFA 3CXCU 1KECA 4MVMA 2ZD9A 4XDJA 5BZBA 2QM7A 2P67A 2Q68A 3MHHC 3OEHG 2R9RB 4EKWA 2H94A 2EIJC 2WLIA 1MOFA 4L87A 3T4ZA 5DM6V 1NR1A 4G2KA 4MTFA 2WLIB 1VQ8V 4RUFA 3WG7C 1VQ9V 1RPRA 3ZIAG 2XAHA 2CK3G 1S77D 3FB8C 2P6JA 4YXWG 2JJ1G 3CYOA 1G4YB 1DLBA 3SJQC 2QA4V 1R73A 3E8FA 4H33A 2BOCC 3I55V 3JD2A 1P7BA 1H8HG 3SYQA 3SPGA 3ZN1A 1K8AW 3ZMVA 3GWOA 1DTOA 4QPKA 4ZKIA 3AG2B 3VOUA 5CA3A 5B1BC 3CMAV 4BAYA 3IGAC 1YHQV 3ASOC 4PDVA 3QO8A 3ZMUA 4P9OA 1AR1B 1OCZC 1FFTB 2JEUA 2R9IA 2HKOA 1K92A 5B1BB 1NKDA 4QIWF 2F43G 4GT1A 3ASOB 4GX0A 2Q6AA 3X2QC 2XOKG 4G27B 5B1AB 1OCZB 1SZTA 4J9ZB 3K0DA 4QNHB 2HG5C 5LBQA 1QBZA 1SESA 4WFEA 1NJIW 2IU0A 2OCCB 2WLMA 3OUFA 2IH1C 5L3DA 3SPIA 3X2QB 2ZDIC 4MW3A 1MSWD 1KKDA 4R7CA 4UV8A 1I5YA 3SPHA 4LBEC 1UJWB 3RVYA 4F4LA 4XDLA 3E8HA 3B77A 2EILC 3FB7C 3OMNB 3JD3A 5LHGA 5EBLC 3STLC 3JD1A 4KP4A 2OTLV 2Y48A 2FTKA 1F51A 1RM1C 3T4DA 1M57B 3UM7A 2XAJA 4KUMA 4RAIA 2YEVA 3RW0A 2GHYA 3F5WC 3QNEA 4FJCC 2YEVB 2A0LA 5B3SB 1RM1B 5J9PC 4MTXA 1F4MA 5L3GA 3CCEV 1VQOV 1JJ2U 1NH2B 3ZCCA 1S72V 4JASA 5B1OA 3ASNB 4MT8A 4I9WA 1S76D 3CCJV 3ABLC 1VQMV 1OCRB 4J9YB 1IXMA 3QO7A 3CCVV 2EIMC 4PA4A 3ABLB 1YJNV 1R3KC 4OXSA 3AG4C 1E1QG 3R65A 5EBWC 4GCZA 3ZMSA 4MSWC 4X8AA 1JPXA 3D36A 2B5UA 3AG4B 3G4SV 3FB6C 4UVAA 2P90A 1FS0G 2X0LA 4MTGA 4HYOA 5EC2C 1YI2V 1MABG 1YITV 1Y66A 2AHZA 4ASUG 2Z5UA 4CZZA 1BHBA 4PDLA 3ABTA 4WFHA 2QKSA 3LSQA 5KUKA 1NR7A 2WLKA 2IH3C 3OMIB 2HFEC 2W6JG 3LDCA 4JGSA 1JQ0A 3K0GA 1SRYA 1G8MA 3SPCA 3HB3B 3CCRV 4R50A 2LP7A 2X6BA 5E1AC 3OM3B 1FXVA 3PJSK 5KA5A 2DYSB 3K3WA 3AG1B 3ZRWA 4LP8A 1GM7A 2WLNA 3CCSV 2XAFA 5B1NA 3K06A 2ZR3A 2ZXWC 2X7RB 1YJ9V 3OW2U 2WWWA 4JYBA 1F4NA 1LNQA 1K5QA 2W0FC 3OEEG 3ABMC 3VBBA 4N23A 2EIJB 1VQPV 3BEHA 1GK9A 1W2BU 3STZC 3WG7B 3W7TA 3MHSC 4MVZA 3IC7A 3WFVA 5LGUA 3E8GA 3CC2V 3NXSA 3SYOA 3IFXA 4E2LA 2HLDG 3TCUA 1CPYA 3ZRXA 4R6ZA 5CN0A 5IY5C 3CPWU 4Q20A 3OR6C 2KB1A 2WPDG 4JTCB 1FXKC 3W7XA 3ETGA 1JX9A 1R6KA 1N8RW 1GKFA 1QLNA 4UVCA 1QR8A 5FL7G 5IY5B 1GM9A 1OCOC 1K3EA 2PI5A 3ZN0A 1OCCC 3SYCA 2WSSG 4MVUA 3CMEV 1S0VA 2DW4A 2HJFC 1CP9A 2ITDC 1W0JG 2B1GA 2NNUA 3JD4A 3E89A 2IJHA 4UV9A 1EBOA 2DYRC 4QJFB 3OAAG 2C2AA 3CP1A 1K97A 3E86A 1GO3F 3CCQV 2ZDIA 2OT5A 2HVKC 2EINC 2DYRB 4WFBV 3HPLC 4X89A 1AI5A 1H8EG 3SYAA 3OUSA 3ZJZA 4QPJA 5L3EA 3DTUB 1WLEA 2EZPA 2HVJC 4LCUC 2EILB 4LC1A 3A0RA 3KG2A 3W7SA 2V1DA 2XAGA 5LHIA 2M7WA 2JEXA 1Q7YW 1TUEB 3ABUA 2WAMA 5L3CA 1M56C 4MS2A 2P7TC 5IYBO 2WLHA 1L1FA 4BIZA 4JYCA 5EBMC 1OHHG 2B1IA 1R3LC 2Y69C 4JTDB 5GW7A 3D3IA 3UKMA 1PL0A 3K03A 4GX1A 2H8PC 2X6CA 3AEIA 2EIMB 2Y69B 4KFMA 5H6RA 1PKXA 1KQSU 1RPOA 1H38A 2NLJC 1AI6A 1K9MW 3ZRSA 1E1RG 1K4CC 3JD0A 3LDDA 4G28B 4PA7A 2EIKC 2IJJA 1I5XA 3ETEA 5IDJA 2Q69A 3AG3C 4DO2A 3B8NA 1VQKV 1ZWIC 4QE7A 5HFMA 2DQ0A 3SPJA 2EIKB 4P2ZA 2W6IG 1DF5A 5IYDO 5KA6A 3AG3B 3LSSA 3CCMV 4MVRA 3RBZA 4FMTA 2Q67A 2UXXA 3JCZA 4PDMA 4MVQA 1B6QA 1AJPA 1XL4A 4TT3G 1HWYA 4WF9V 1GM8A 3CCUV 1S3JA 3T1CA 3ETDA 1K73W 1JCHA 4FIPC 4MVSA 1BL8A 4QE9A 1FXHA 3ZRWB 1GTOA 1XL6A 1PNLA 4MTOA 1BMFG 3F7VC 2DWEC 3OR7C 3EHBB 2ITCC 4WFFA 1NBMG 4UVBA 1M90W 3OGCC 1KP2A 2MK3A 2ZXWB 3I56V 3CC7V 2BOBC 1VQLV 4FK5C 1P4RA 1J95A 1K4DC 3TETA 1YIJV 2XASA 3EFFK 3W7UA 3T2MA 3ABMB 4PA9A 5IYCO 1EFRG 4MVOA 2PI4A 4WFAV 1VQ6V 3FB5C 1H2GA 3FYIB 3P32A 4MW8A 1BHAA 2QE7G 3F7YC 4PA6A 1R3JC 2K1EA 1PNKA 4WCEV 4I5SA 4RQFA 3E83A 2XNDG 2DQ3A 1VQ5V 5LGTA 4TSFG 3CD6V 2Z3YA 1AI4A 1EZJA 3AG2C 1FXKA 3QO5A 1ROPA 2A79B 1FXKB 2WLJA 4U7NA 4UUJC 4R8CA 1NVPD 5L3BA 1YTFD 3ZMZA 3H01A 2OTJV 2IU3A 2LFSA 2IJKA 1OCOB 3K08A 4U7OA 1R6NA 1PD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXW A;  4EKW A;  2EIJ C;  2WLI A;  3FB6 C;  3T4Z A;  1M56 C;  4MTF A;  2WLI B;  4MS2 A;  2P7T C;  3LDE A;  4HYO A;  4MTG A;  5EC2 C;  4RUF A;  1V54 C;  1JVM A;  5B1A C;  3WG7 C;  2WLH A;  2AHZ A;  4X88 A;  5EBM C;  2A9H A;  4PDL A;  2OCC C;  3FB8 C;  4ZBM A;  4WFH A;  1R3L C;  1V55 C;  2QKS A;  5KUK A;  2WLK A;  2Y69 C;  2IH3 C;  4CBC A;  4JTD B;  3UKM A;  2HFE C;  1G4Y B;  3SJQ C;  3LDC A;  3K03 A;  1ORQ C;  3E8F A;  4H33 A;  2BOC C;  3K0G A;  1P7B A;  3SYQ A;  4HZ3 A;  3SPC A;  4GX1 A;  3SPG A;  2H8P C;  4R50 A;  2X6C A;  2X6B A;  5E1A C;  3PJS K;  4KFM A;  3LNM B;  3ABK C;  3E8B A;  2NLJ C;  4PDR A;  4LP8 A;  3VOU A;  3ZRS A;  1K4C C;  3LDD A;  2WLN A;  3LUT B;  4G28 B;  3K06 A;  4PA7 A;  5B1B C;  2EIK C;  5EK0 A;  2ZXW C;  3IGA C;  4GX5 A;  3ASO C;  4PDV A;  2Q69 A;  1M57 C;  3AG3 C;  4P9O A;  1LNQ A;  1OCZ C;  2W0F C;  1ZWI C;  2DWD C;  4QE7 A;  3ABM C;  3SPJ A;  4P2Z A;  5B3S C;  4PA3 A;  3BEH A;  2JK5 C;  4GX0 A;  3X2Q C;  2Q6A A;  2X6A A;  4JTA B;  3STZ C;  4P30 A;  4G27 B;  5CBH A;  4MVR A;  3RBZ A;  4MVZ A;  2Q67 A;  5CBG A;  4J9Z B;  3K0D A;  4QNH B;  2HG5 C;  4PDM A;  3ASN C;  4WFE A;  3RVZ A;  2WLM A;  4MVQ A;  3OUF A;  1QLE C;  1XL4 A;  3E8G A;  2IH1 C;  3SPI A;  1KKD A;  4MW3 A;  1OCR C;  4RUE A;  4H37 A;  4R7C A;  3T1C A;  4BW5 A;  1S5H C;  3SYO A;  3IFX A;  4MVS A;  3SPH A;  4LBE C;  1BL8 A;  4P9P A;  4QE9 A;  3TCU A;  3RVY A;  1XL6 A;  4R6Z A;  4XDL A;  5KUM A;  4F4L A;  5IY5 C;  3E8H A;  4MTO A;  3F7V C;  2KB1 A;  2EIL C;  3FB7 C;  3OR6 C;  4JTC B;  4GX2 A;  4RO2 A;  2DWE C;  3OR7 C;  2ITC C;  4WFF A;  5EBL C;  3STL C;  2WLL A;  2QTO A;  1OCO C;  3OGC C;  2WLL B;  1OCC C;  3SYC A;  3T4D A;  2BOB C;  4MVU A;  3UM7 A;  1J95 A;  1K4D C;  2HJF C;  5EC1 C;  3TET A;  4RAI A;  2YEV A;  2ITD C;  3EFF K;  3RW0 A;  3F5W C;  3SYP A;  3T2M A;  4PA9 A;  2A0L A;  4MVO A;  3E89 A;  3GB7 C;  5J9P C;  3FB5 C;  2DYR C;  4TWK A;  4MW8 A;  3F7Y C;  3E86 A;  4PA6 A;  1R3J C;  4I9W A;  2K1E A;  3ABL C;  2AHY A;  2EIN C;  2HVK C;  4XDK A;  3E83 A;  4J9Y B;  2ATK C;  3HPL C;  2EIM C;  3JYC A;  3K04 A;  4X89 A;  4WFG A;  3SYA A;  2DYS C;  3OUS A;  3ZJZ A;  3AG1 C;  3AG2 C;  1R3I C;  2HVJ C;  4LCU C;  4PA4 A;  2A79 B;  2WLJ A;  1R3K C;  4OXS A;  3AG4 C;  5CBF A;  4UUJ C;  4MVM A;  4R8C A;  3R65 A;  3KG2 A;  5EBW C;  2ZD9 A;  4XDJ A;  5BZB A;  4MSW C;  4X8A A;  2Q68 A;  3K08 A;  2R9R B; 
#chains in the Genus database with same CATH topology
 2CTW A;  1V54 C;  1YXB A;  4I9Q A;  5CA1 B;  1XNQ O;  2JJ2 G;  1KB9 F;  2A3Q A;  1VQ4 V;  4X88 A;  1Q82 W;  1YF2 A;  2DJV A;  2KG7 A;  3CWB H;  4LF9 O;  1V54 B;  4Z1M G;  2Y0I A;  3D3Q A;  4BIO A;  2Y4U A;  5FPR A;  3UO2 A;  3C3S A;  4XBF A;  5LP6 A;  4K8X A;  4DW0 A;  1BSM A;  1AP6 A;  5CMU A;  3SJB C;  1KYO F;  1YEW A;  5HFL A;  4E4E A;  2DWD C;  4PI2 A;  1IVS A;  1B06 A;  3L72 H;  2QM8 A;  2M6Y A;  5CBH A;  1Y74 A;  5B66 Z;  1YZB A;  2OIE A;  3CCL V;  2UU9 B;  2QGN A;  1BZK A;  4RUE A;  1SER A;  4BIU A;  3TXQ A;  1O9G A;  2LJ2 A;  5IWA B;  1L0L H;  4GKJ B;  2QJ1 A;  5FNV A;  4NXN B;  3RYH A;  3HKC B;  2WLL B;  3TGU H;  3D36 C;  4J42 A;  3K5L A;  3RYF B;  4DV1 O;  4I55 A;  5EC1 C;  1LUW A;  5TIS Z;  3HKE B;  3MD0 A;  1AB3 A;  1AR4 A;  1VQ7 V;  1NZ6 A;  1FJG O;  3GB7 C;  2Q7E A;  4B3S B;  1Q43 A;  1MG1 A;  3W7W A;  2EBO A;  3JAT A;  1HP8 A;  2V7Q G;  4JPR A;  2GSM B;  4DR6 O;  2AHY A;  4ZOL B;  4XDK A;  3RN4 A;  2ADP A;  2ATK C;  3K79 A;  5ITZ B;  1PP9 H;  4JAV A;  1NI8 A;  1R3I C;  1Y4M A;  1GRJ A;  3G67 A;  2RNB A;  4GLX A;  5CBF A;  3CXC U;  1EM1 A;  4MVM A;  2FB5 A;  4FFK A;  5KX5 A;  2QM4 A;  4NR1 A;  3MHH C;  4X20 B;  1SQV H;  2R9R B;  2YUA A;  5AG2 A;  5DM6 V;  2WLI B;  3FAV A;  4HBN A;  2ZM6 B;  3K57 A;  1F7Y A;  3RYC A;  2XAH A;  4TQD A;  1QQC A;  4EFB A;  2UUA B;  3FB8 C;  2P6J A;  3BA8 A;  5EYP A;  2JJ1 G;  1G4Y B;  1DLB A;  4J7J A;  2QA4 V;  3E8F A;  4H33 A;  5K1X A;  3I55 V;  3JD2 A;  1P7B A;  4DV3 O;  3ZN1 A;  2CH7 B;  3VOU A;  1I94 B;  2CUG A;  2E75 B;  2CTR A;  3T1Y O;  4PDV A;  1G6U A;  4CH5 A;  3QO8 A;  3DC6 A;  3JSL A;  4AQY B;  1SC5 B;  3ZBH A;  5CA0 A;  1J5E O;  4IIJ A;  5IYZ A;  3K5M A;  4GT1 A;  2Q6A A;  2R9A A;  4JZ2 A;  1SZT A;  5KHJ A;  5F2V O;  4QNH B;  2HG5 C;  1QBZ A;  1SES A;  2OCC B;  1QHT A;  5L3D A;  3SPI A;  4O2B B;  3SPH A;  4LBE C;  2UUC O;  1GN3 A;  3ZS8 C;  3JD1 A;  1SF9 A;  3LSU A;  1XMO B;  1I7F A;  1M57 B;  2ZIM A;  3F5W C;  1N32 O;  1WB7 A;  4FJC C;  4DV7 O;  5B3S B;  5J9P C;  4MTX A;  5L3G A;  3CCE V;  1WA8 A;  1JJ2 U;  1H2L A;  5B1O A;  2UXD O;  1S76 D;  2AZ2 A;  4CC6 A;  3K9S A;  1OCR B;  1M4U A;  2L6L A;  3VQV A;  4LF4 O;  1YJN V;  3AG4 C;  2Y0P A;  1E1Q G;  3R65 A;  4X66 O;  2VQF B;  4MSW C;  4X8A A;  1NS1 A;  3T1H O;  3AG4 B;  4DR3 O;  4TQF A;  4UVA A;  4F6R B;  1SKV A;  1YI2 V;  4CZZ A;  4YJ2 A;  2P06 A;  1BHB A;  3S3W A;  2CE4 A;  5KUK A;  4DV4 B;  1GH6 A;  2HFE C;  1N36 O;  3LDC A;  4JGS A;  2EX3 A;  3K0G A;  1SRY A;  1G8M A;  1TGO A;  2LP7 A;  1FXV A;  3VQY A;  1XHZ A;  3CJH B;  5KA5 A;  3AG1 B;  4LP8 A;  4DV5 B;  2B9Z A;  2Y4T A;  3K06 A;  2ARH A;  2ZR3 A;  2PTM A;  2ZXW C;  3OTO O;  3OW2 U;  1KU9 A;  4BR6 A;  1F4N A;  2OCH A;  4TV8 B;  1IBK B;  4X1I B;  1K5Q A;  4DK0 A;  4F6E A;  2F1M A;  2N05 A;  4LFC O;  1URF A;  5K1P A;  3UQ8 A;  4MVZ A;  5EIB D;  2ZNJ A;  5LGU A;  2WA4 A;  1WP7 A;  3TCU A;  4R6Z A;  5KHI A;  2ADQ B;  1TUB A;  4Q20 A;  2WPD G;  3ICX A;  1JJO A;  3ETG A;  1JX9 A;  1H2K A;  1QLN A;  5BR8 O;  4UVC A;  4JI4 O;  4LF5 O;  1GM9 A;  2PI5 A;  1OCC C;  3SYC A;  5EIB C;  3CME V;  1S0V A;  2ITD C;  3JD4 A;  3O65 A;  1EBO A;  2DYR C;  4KL1 A;  3WB0 A;  1K97 A;  4KXR A;  1RSO A;  3JAW B;  2DYR B;  3J7A U;  1OJH A;  3HPL C;  4X89 A;  4NTX A;  1H8E G;  3EXA A;  2RN9 A;  2EZP A;  3CEI A;  5J2U B;  3A0R A;  2XUM A;  4O2A A;  3P3N A;  1HW7 A;  2W0X A;  2GTS A;  3ABU A;  4LF6 B;  4UB6 Z;  2CAZ C;  4MS2 A;  5LA6 A;  2ZE5 A;  2QWR B;  3OTF A;  5EBM C;  4HNA A;  2RJZ A;  4FLW A;  3D3I A;  4X1K A;  1FPO A;  1HDJ A;  3UT5 B;  3JAL B;  4JV5 B;  2GUZ A;  5H6R A;  2EIM B;  3GVM A;  1E1R G;  4JI1 B;  4PA7 A;  2IJJ A;  1VQK V;  3HKC A;  5HFM A;  1H2N A;  3ZHQ A;  3BPZ A;  3LSS A;  2Q67 A;  3CHX A;  1I08 A;  4ZHQ B;  1MA1 A;  1VF7 A;  3JAS B;  1GM8 A;  1N0J A;  3T1C A;  4FIP C;  2PUS A;  4X1Y B;  1XL6 A;  4I0X A;  3JAK B;  5LMN B;  2YDE A;  4DR4 B;  5ITZ A;  4Q6G A;  1NBM G;  1M90 W;  1P4R A;  4X20 A;  3S3X A;  1SQG A;  2Q7H A;  4AIL C;  4GKK B;  1EFR G;  4MVO A;  2PI4 A;  4K8Z A;  1VQ6 V;  3H1J H;  2YXL A;  2VQE O;  3FYI B;  1V9P A;  1T5E A;  4PA6 A;  1R3J C;  3L74 H;  2K1E A;  2R70 A;  5JCO C;  4UCS A;  4K35 A;  4I5S A;  1ZL8 A;  4RQF A;  3BRC A;  5BXZ A;  2DQ3 A;  2UXB O;  2Z3Y A;  1HNW O;  2LO1 A;  1FXK B;  2WLJ A;  4U7N A;  1NVP D;  4DV0 O;  1YTF D;  2OTJ V;  4U7O A;  2IJK A;  4DXW A;  2CTP A;  2Q8V A;  1JVM A;  1NQT A;  1M5I A;  2PZS A;  2MW2 B;  4JF3 A;  2A9H A;  3OMA B;  2ZR2 A;  1DF4 A;  1QVG U;  1ZTE A;  4O4J A;  1IBL B;  2ZT9 B;  1XUQ A;  2EIN B;  4HZ3 A;  4IYH A;  4DR5 O;  4O2B A;  4DR7 O;  4FPP A;  3ABK C;  1NVP B;  3ETQ A;  4YIP A;  1YTF B;  3P3P A;  1KC8 W;  3KZI Z;  3LUT B;  1PNM A;  2QKC A;  3E2E A;  3MDS A;  4GX5 A;  2L35 A;  2XAQ A;  3ABK B;  1Q81 W;  5H9C A;  1HNX B;  2NN4 A;  1N4C A;  2JK5 C;  2EJR A;  2X6A A;  4LFB B;  4J7K A;  2ZQM A;  2ODM A;  1KP3 A;  1A32 A;  2Q7G A;  4NB5 A;  3RVZ A;  2JIZ G;  4H37 A;  4JI3 O;  4LH6 A;  4OX9 O;  1M9N A;  3O9O A;  5C8Y B;  4GX2 A;  4PEL A;  3CB2 A;  3BHP A;  4FZ1 A;  2QTO A;  3ZRV A;  3P30 A;  5C93 A;  2UXN A;  3KCX A;  4IHJ B;  4FLV A;  1XMQ O;  1K5S A;  3SYP A;  3K5O A;  1XNQ B;  1XNR O;  2AXT Z;  1F23 A;  4TWK A;  1YJW V;  4LF9 B;  1ENV A;  3CRM A;  3AG7 A;  1AJN A;  1Q6I A;  2GDS A;  1GMG A;  4CH3 A;  1AI7 A;  3AK1 A;  3FFQ A;  4WFG A;  3OD4 A;  4UCU A;  1XI1 A;  1W0K G;  2ZE8 A;  1E79 G;  1IZ3 A;  2YID A;  5BZB A;  5IJ9 B;  2NR5 A;  2EIJ C;  1X4T A;  4H44 B;  4MTF A;  1VQ8 V;  4QGP A;  2PYL A;  4RUF A;  3WG7 C;  4YJ3 B;  2HHH O;  2CK3 G;  3K5N A;  3FX7 A;  4FM0 A;  4YXW G;  3A2F A;  5FLX N;  1R73 A;  3SYQ A;  2P5O A;  5BMV A;  5CB4 B;  5D5Q A;  1K8A W;  3GWO A;  1DTO A;  4ZKI A;  3AG2 B;  2UUB O;  2E5L O;  3BA9 A;  3SJA C;  4DV1 B;  4O4L A;  1FFT B;  2R9I A;  4DUZ O;  5KMG A;  1K92 A;  1NKD A;  4NVP A;  1WJZ A;  4G27 B;  2Q0O C;  2RDC A;  4X64 B;  2WLM A;  2UXC O;  1KKD A;  1MSW D;  5LXT A;  4R7C A;  3B40 A;  4XDL A;  1ZAU A;  1D5N A;  3JAW A;  4DV2 O;  3CRQ A;  3HKD B;  3JD3 A;  3ZHR A;  4BW9 A;  2OTL V;  4KP4 A;  1R6T A;  1EN6 A;  4LF7 O;  1VEW A;  5GTI Z;  3T4D A;  3N2G B;  1Y76 B;  2YEV A;  4EB6 A;  3QNE A;  4O4H B;  2A0L A;  1F4M A;  1VQO V;  3KKY A;  3ZCC A;  4NYK A;  4X62 B;  3CCJ V;  4DV3 B;  2FML A;  1WAZ A;  1Y6X A;  1ZSP A;  1HR0 B;  1TA8 A;  1R3K C;  4OXS A;  3T1Y B;  5EBW C;  3ZMS A;  4EEQ A;  2B5U A;  3FB6 C;  1R1B A;  1J5E B;  4DRX B;  1FS0 G;  2EJ7 A;  4HYO A;  1S5J A;  1MAB G;  4DUY B;  1Y66 A;  4J7Z A;  2CTQ A;  4B3R O;  4WFH A;  2QKS A;  3LSQ A;  5B5E Z;  1NR7 A;  2WLK A;  1TVK B;  2QWO B;  4YHH B;  1JQ0 A;  4FFB A;  4W4K A;  4KHP O;  3HB3 B;  5GTH Z;  3ZX6 A;  1VP7 A;  5E1A C;  3H1L H;  4X1Y A;  1W59 A;  2F66 C;  2PF4 E;  2WLN A;  5EZY A;  2WWW A;  4JYB A;  1LNQ A;  2W0F C;  1N32 B;  3ABM C;  1UPG A;  1VQP V;  3EVK A;  4DV7 B;  3BEH A;  4ZIB A;  3W7T A;  3N2K A;  2WA3 A;  3HKB A;  4FM2 A;  4FVM A;  3NXS A;  4WBN A;  2UU9 O;  2HEP A;  5IY5 C;  4I4T A;  2ZCE A;  3OR6 C;  2RCV A;  1FFX B;  1N8R W;  1QR8 A;  5IWA O;  4JI5 O;  3CS5 A;  5FL7 G;  5IY5 B;  1Q90 D;  5JJJ B;  3ZN0 A;  3CE2 A;  3T1H B;  4DR3 B;  2HJF C;  1W0J G;  4NXN O;  3DXR A;  4UCT A;  2VWK A;  3AK3 A;  3OAA G;  2F4V O;  3E86 A;  2ZDI A;  2OT5 A;  1MSD A;  2HVK C;  1MZF A;  1VF6 C;  2YIC A;  3ZJZ A;  3OUS A;  5L3E A;  3DTU B;  1WLE A;  1HNZ B;  4LCU C;  3KG2 A;  2V1D A;  2XAG A;  3PN1 A;  4YY3 B;  4DR2 B;  2VRZ A;  1SA0 B;  1Q7Y W;  1TUE B;  5J2T B;  1M56 C;  4LFC B;  4YIO A;  5IYB O;  2WLH A;  1L1F A;  1OHH G;  4CH6 A;  1JA8 A;  2P4V A;  1EZV H;  4JTD B;  3WB1 A;  2F23 A;  4B7K A;  5GON A;  4JI8 B;  4LFA B;  4ICG A;  2YS8 A;  1KQS U;  4A5U B;  1XBL A;  1K9M W;  2V4D A;  3ZRS A;  2VWJ A;  4LF5 B;  4JI4 B;  5C8Y A;  4G28 B;  3ETE A;  2BTQ B;  5IDJ A;  4LNU B;  3B8N A;  1I94 O;  2A06 H;  4QE7 A;  5KLV H;  1B04 A;  3CX5 F;  1N33 O;  4I50 A;  4O4I A;  4IHJ A;  4DV6 B;  4MVQ A;  1AJP A;  2YIB D;  1HWY A;  4BWA A;  3ETD A;  1K73 W;  1QNM A;  3E22 B;  1ZX3 A;  1PNL A;  4MTO A;  1BMF G;  3OR7 C;  4UVB A;  3OGC C;  4AI8 A;  2MK3 A;  2ZXW B;  3I56 V;  1VQL V;  4FK5 C;  1J95 A;  1K4D C;  3EFF K;  4NKG B;  5IT9 N;  4TV9 A;  2JGD B;  5JVD B;  1XMO O;  1H2G A;  4MW8 A;  1BHA A;  2QE7 G;  1Q5O A;  4J10 A;  5LYJ A;  1GN2 A;  1Z5V A;  4U3J B;  2JVD A;  4TUY B;  2XND G;  2YC0 A;  1VQ5 V;  1CXZ B;  2Q5Z A;  3Q4H A;  4TOI A;  2A79 B;  2DOS A;  4ZI7 B;  3CRR A;  2AZ0 A;  2BSK A;  4D7S A;  5L3B A;  1SS3 A;  3K08 A;  2P22 C;  1R6N A;  1OCC B;  1N0N A;  1THZ A;  2DMX A;  2VQF O;  5CA1 A;  3LDE A;  3SJC C;  5B1A C;  4X65 B;  1K7D A;  3GWK C;  2YXY A;  4ZBM A;  2KG7 B;  1V55 C;  1QVF U;  2ZNI A;  3BAB A;  2QEX V;  5L3F A;  3OE7 G;  3FYE B;  1JR9 A;  5LP6 C;  1V55 B;  4DV4 O;  1NH2 D;  3TJT A;  4CH4 A;  4U3F H;  3E8B A;  4PDR A;  2YXH A;  2IW5 A;  1N34 O;  1Q3E A;  5LP6 B;  3HKD A;  3B8M A;  1WPX A;  4DV5 O;  2D3O W;  4UCV A;  4JI0 B;  4DK1 A;  5LHH A;  1KD1 W;  4JTA B;  1IBK O;  5IJ0 B;  1AVM A;  4JZG A;  3ASN C;  4LF8 O;  2Q9L A;  4BW5 A;  1Q86 W;  1S5H C;  1MMM A;  5DN6 G;  5JJE B;  5FNV B;  1YVW A;  2JS5 A;  3CC4 V;  2WLL A;  1SET A;  3G71 V;  1RFY A;  3RYF A;  1OZ0 A;  1EN5 A;  4DR1 O;  3HKE A;  4FLT A;  1COW G;  3CRA A;  4I55 B;  4B3T O;  3ML0 A;  1K33 A;  5LGN A;  1BGY H;  2CGN A;  1TAE A;  4ZOL A;  3THO A;  3JAT B;  4ABM A;  2ZKO A;  1GAX A;  3K04 A;  1AJQ A;  3JYC A;  4DR7 B;  4JAU A;  3BY6 A;  2DYS C;  3TK1 A;  4C7U A;  4RQE A;  1SQB H;  4B3M B;  1KEC A;  5LMU O;  4Z2W A;  4XDJ A;  2QM7 A;  2Q68 A;  5KX5 B;  2QSA A;  1BT8 A;  1FYJ A;  4EKW A;  4OGQ B;  2WLI A;  1MOF A;  1WPB A;  1NR1 A;  1VQ9 V;  3FAV B;  3ZIA G;  3RYC B;  1IBM O;  4K0K B;  4JI3 B;  1D5A A;  4JI2 O;  3SPG A;  2CH7 A;  4IT5 A;  3ZMV A;  3C90 A;  3QF7 A;  4JV5 O;  3APQ A;  4FLX A;  1AR1 B;  3U0Z A;  2N74 A;  2JEU A;  4JI1 O;  1AIL A;  4QIW F;  5CA0 B;  1BCC H;  4IIJ B;  2XOK G;  3K0D A;  5LBQ A;  4WFE A;  2IU0 A;  5LL6 Y;  2YIA A;  2ZDI C;  4MW3 A;  3U10 A;  2LW1 A;  4UV8 A;  2E76 B;  1UJW B;  3ZHU A;  3RVY A;  4F4L A;  3E8H A;  3B77 A;  2EIL C;  3FB7 C;  4LWS B;  4JYA O;  5D5P A;  1XQ8 A;  3STL C;  2FTK A;  1F51 A;  1RM1 C;  1ZUQ A;  4KUM A;  4RAI A;  3RW0 A;  4DR4 O;  3K58 A;  3B2E E;  3D8C A;  1RM1 B;  4JAA A;  2PY5 A;  1S72 V;  4JAS A;  1Q6H A;  3L70 H;  4I9W A;  1Q8I A;  3ABL C;  1VQM V;  2IM9 A;  3QO7 A;  4RWU A;  3ABL B;  2E5L B;  1IDS A;  1NTM H;  4DW1 A;  2Q0A A;  3OGI B;  4F6R A;  2LGW A;  4DUZ B;  3R66 A;  4LNU A;  1M93 A;  2X0L A;  4MTG A;  1YIT V;  3IJ4 A;  2AHZ A;  4ASU G;  1H2M A;  4YJ2 B;  2UXC B;  3ABT A;  2IH3 C;  1XHX A;  3OMI B;  2W6J G;  3SDL A;  4D7T A;  3SPC A;  4H0L B;  2ETN A;  3CCR V;  3CJH A;  4DV2 B;  3JCU Z;  3CCS V;  2CGO A;  2A7W A;  2XAF A;  4LF7 B;  2QTS A;  4TV8 A;  1YJ9 V;  4X1I A;  1WP8 A;  2EIJ B;  2KSD A;  1VF5 B;  4JI7 O;  2QDO A;  3STZ C;  2AGA A;  3WG7 B;  2KKW A;  3FD9 A;  1L8D A;  2ILM A;  3WFV A;  4LFB O;  3H9V A;  3DSQ A;  3IFX A;  4UFZ A;  3B4S A;  1EN4 A;  5CN0 A;  3IC9 A;  3ZED A;  3W7X A;  4TUY A;  2R72 A;  2F93 B;  1TUB B;  1GKF A;  4IYI A;  2ZIO A;  1OCO C;  1FJG B;  2DW4 A;  4W4L A;  3JAM N;  2B1G A;  2NNU A;  2QKA A;  4DR6 B;  4UV9 A;  4D6T H;  1MNG A;  1Q6U A;  4CS3 A;  1X59 A;  4B3R B;  4QJF B;  2C2A A;  4IL6 Z;  1QU7 A;  1B3Q A;  3CCQ V;  4JI6 O;  3JAR B;  1RSO B;  4KHP B;  4WFB V;  1AI5 A;  3SYA A;  5J2U A;  2HVJ C;  4LC1 A;  1H2S B;  3VQX A;  2G38 A;  2EUL A;  1PV0 A;  4O2A B;  3K59 A;  2KQX A;  2JEX A;  1XIL A;  2WAM A;  5L3C A;  2GV9 A;  5KHH A;  4J80 A;  5LA6 B;  4BIZ A;  1FAF A;  2B1I A;  3M7M X;  2VS0 A;  5IJ0 A;  4HNA B;  4OPA A;  5GW7 A;  5H5N A;  1Z5W A;  4FLZ A;  3UT5 A;  1PL0 A;  1SQQ H;  4NXM O;  3JAL A;  4X1K B;  4GX1 A;  2X6C A;  3AEI A;  5LOV B;  1IX9 A;  2GUZ B;  3CRC A;  1H38 A;  1AI6 A;  3BFR A;  3JD0 A;  1K4C C;  4JI5 B;  4GYC B;  4PD4 F;  1Y67 A;  3AG3 C;  4DO2 A;  1ZWI C;  2DQ0 A;  3SPJ A;  1OV9 A;  4P2Z A;  2W6I G;  1DF5 A;  5IYD O;  5KA6 A;  3AG3 B;  4MVR A;  4FMT A;  4FLY A;  2F4V B;  4ZHQ A;  3H1H H;  4NTW A;  3JAS A;  2UUC B;  1XL4 A;  1KBH A;  1G1X B;  1JCH A;  4MVS A;  3JAK A;  4QE9 A;  4X64 O;  3ZRW B;  1GTO A;  3F7V C;  4I0X B;  2BE3 A;  2GBO A;  2DWE C;  3UO3 A;  3EHB B;  4WFF A;  1VAR A;  3RFR A;  5KAI Z;  3CC7 V;  2BOB C;  4GUN A;  2O57 A;  2XAS A;  1YIJ V;  3W7U A;  3T2M A;  3ABM B;  4PV1 B;  2UXD B;  2XHB A;  3FB5 C;  3J80 N;  3P32 A;  4LF4 B;  2BTO A;  1ZLZ A;  3BVO A;  3L73 H;  4CS2 A;  1PNK A;  4WCE V;  1UFI A;  4X66 B;  2QR4 A;  1ZL8 B;  5LGT A;  4X62 O;  4TSF G;  5JCO A;  1AI4 A;  1FXK A;  4GKJ O;  1ROP A;  4J41 A;  4H13 B;  1HR0 O;  3H01 A;  2IU3 A;  1YHQ V;  1PD3 A;  5KHK A;  2EZO A;  1KUQ A;  2Z0A A;  4HAM A;  1N33 B;  4DYL A;  1JFF B;  1NTZ H;  1N36 B;  4CC5 A;  4IGG A;  3M99 B;  3G80 A;  2OCC C;  4B3S O;  1KKC A;  2PYJ A;  4CBC A;  3CXH F;  1SQF A;  4DUY O;  4UXN A;  3FKS G;  3WB2 A;  1VQN V;  1ORQ C;  1DGS A;  4O4J B;  3WU2 Z;  3OTO B;  3G6B A;  1BE3 H;  1CEZ A;  3LNM B;  4YHH O;  2LFR A;  2H3O A;  3AK2 A;  3A0B Z;  3E35 A;  3JSN A;  3OFN G;  1QCE A;  3RT3 C;  4LWS A;  5EK0 A;  3OT7 A;  1M57 C;  2JDI G;  3H1K H;  1PPJ H;  5IE9 A;  3G6E V;  4PHZ A;  4OPH A;  2JS3 A;  5B3S C;  4PA3 A;  1M56 B;  5JQG B;  4P30 A;  2ZM6 O;  5JH7 B;  5CBG A;  2UUA O;  1JOY A;  4NTY A;  1VIB A;  1QLE C;  1P7G A;  1WNS A;  2FL4 A;  1OCR C;  2HR3 A;  2OYQ A;  1ARO P;  3F5T A;  5BR8 B;  4P9P A;  1FD9 A;  5KUM A;  1QLE B;  2IJI A;  4N21 A;  5A9G A;  4RO2 A;  3DGE A;  1U96 A;  2DN9 A;  2N04 A;  3ZMT A;  5H6Q A;  3RYI B;  3QG5 A;  4AQY O;  4UB8 Z;  3IAY A;  5FPO A;  3K9A A;  1YSC A;  2JRI A;  1O9H A;  1K34 A;  2IBZ H;  3HR0 A;  2YSU B;  1M1K W;  1AR5 A;  3C3T A;  1QR9 A;  3AG1 C;  1YCI A;  1N34 B;  5IJ9 A;  2ZD9 A;  4UCO A;  5E79 Z;  2P67 A;  1XOU A;  3OEH G;  1XEQ A;  4LR3 A;  1HNZ O;  2LW7 A;  2H94 A;  3T4Z A;  4L87 A;  1XDC A;  4B7E A;  3MAQ A;  2LGQ A;  4G2K A;  4YJ3 A;  4YY3 O;  4DR2 O;  3QVN A;  3SGI A;  1RPR A;  3BAA A;  1S77 D;  4LF8 B;  3TXS A;  2ZIN A;  3CYO A;  4L8J A;  3SJQ C;  5CB4 A;  2BOC C;  1H8H G;  3NR7 A;  5BMV B;  4FZ0 A;  2QWQ B;  4QPK A;  5CA3 A;  4JI8 O;  2YI9 A;  4LFA O;  5B1B C;  3CMA V;  4BAY A;  3IGA C;  3ASO C;  3N27 A;  4DR1 B;  3ZMU A;  4P9O A;  2YI8 A;  1OCZ C;  3ZHT A;  1VMG A;  4B3T B;  4O4L B;  2HKO A;  5B1B B;  2HP8 A;  1KMI Z;  5KMG B;  2F43 G;  4GX0 A;  3ASO B;  3X2Q C;  5B1A B;  1OCZ B;  1AP5 A;  1MZE A;  4J9Z B;  1NJI W;  2ZE7 A;  3OUF A;  2IH1 C;  3X2Q B;  1WB8 A;  1I5Y A;  5LXT B;  3JAR A;  3H1I H;  4DV6 O;  3VQW A;  3OMN B;  3B09 A;  5LHG A;  5LMU B;  2D2C B;  5EBL C;  2Y48 A;  2ZE6 A;  3N2G A;  1Y76 A;  2VQE B;  3UM7 A;  2XAJ A;  4O4H A;  2GHY A;  3QTC A;  2YEV B;  4EB6 B;  1Y74 B;  4EFE A;  5A2Q N;  1IBM B;  2OWO A;  2UXB B;  1NH2 B;  2RMK B;  4B08 A;  3ASN B;  4MT8 A;  3LNN A;  1JMK C;  5DED A;  1HNW B;  4JI2 B;  5JJN B;  4J9Y B;  1IXM A;  3CCV V;  4DV0 B;  2EIM C;  4PJ0 Z;  4CS4 A;  4PA4 A;  3RYH B;  5LOV A;  2OIG A;  4GCZ A;  1JPX A;  3A0H Z;  4FLU A;  1SZX A;  3D36 A;  1DK1 A;  4DRX A;  3G4S V;  2HJD A;  2P90 A;  1GN4 A;  1IUR A;  2QWP B;  5EC2 C;  2Z5U A;  4PDL A;  4DR5 B;  1TVK A;  1WN7 A;  1P84 F;  4X65 O;  4JYY A;  2BCC H;  3I5D A;  4FFB B;  4R50 A;  3ZHS A;  2X6B A;  3OM3 B;  3PJS K;  4JYA B;  2DYS B;  3K3W A;  3ZRW A;  5BY1 A;  1GM7 A;  5KHG A;  5B1N A;  5EZY B;  2X7R B;  2K9P A;  3CSX A;  2FKX A;  3OEE G;  3VBB A;  4N23 A;  3U11 A;  4LF6 O;  1GK9 A;  1W2B U;  1BQ0 A;  2GTA A;  4GZR B;  5EYP B;  3MHS C;  3IC7 A;  1PL4 A;  4OX9 B;  3N2K B;  4JI0 O;  3E8G A;  3CC2 V;  2Q73 A;  3HKB B;  2Q4P A;  3SYO A;  4E2L A;  4PI0 A;  4WBN B;  2HLD G;  1CPY A;  3ZRX A;  4K3A A;  1GN6 A;  3CPW U;  4JTC B;  2KB1 A;  1FXK C;  1FFX A;  3A8T A;  4I4T B;  1R6K A;  1Z2G A;  1XMQ B;  2E3C A;  3L75 H;  1K3E A;  1NT2 B;  1L0N H;  1XNR B;  2WSS G;  4MVU A;  5IYZ B;  1YDX A;  1CP9 A;  1XRE A;  1SQX H;  2XTA A;  2PGG A;  4AHC A;  3BCC H;  3E89 A;  3ZHV A;  2IJH A;  4LH7 A;  5JWP A;  1JFF A;  3DXR B;  5DEC A;  3RGB A;  2F95 B;  3CP1 A;  2CDY A;  5H2F Z;  1GO3 F;  2EIN C;  1US6 A;  4I7Z B;  4QPJ A;  5LMN O;  2EIL B;  1VF6 A;  3APO A;  2DE0 X;  2RQ6 A;  3W7S A;  1SA0 A;  5LHI A;  2M7W A;  4B3M O;  1PM9 A;  2HHH B;  5J2T A;  1LR1 A;  3RWR D;  1FKA O;  1BQZ A;  4JI7 B;  2P7T C;  1WA8 B;  4J11 A;  4GKK O;  4JYC A;  3M8A A;  1IXB A;  1NU1 H;  2P4K A;  5JQG A;  1R3L C;  2Y69 C;  5JH7 A;  1NTK H;  3UKM A;  3K03 A;  2UUB B;  1P49 A;  1LUV A;  4X9Q A;  2H8P C;  5GON B;  4K0K O;  2Y69 B;  4KFM A;  1PKX A;  1RPO A;  2NLJ C;  3LDD A;  1D2D A;  1RP3 B;  2BTQ A;  2EIK C;  1I5X A;  2Q69 A;  2JGU A;  5KAF Z;  3RYI A;  2EIK B;  3KCY A;  4Z1V A;  4I50 B;  4O4I B;  3CCM V;  3RBZ A;  2UXX A;  3JCZ A;  1SQP H;  4PDM A;  4JI6 B;  1B6Q A;  1S5L Z;  4TT3 G;  3L9D A;  4WF9 V;  3CCU V;  1S3J A;  3E22 A;  1IBL O;  1BL8 A;  1FXH A;  3J81 N;  3UCS C;  2QWN B;  2ITC C;  1KP2 A;  2FYU H;  1BS3 A;  3TET A;  2JGD A;  5JVD A;  1HNX O;  4PA9 A;  5IYC O;  4TV9 B;  4WFA V;  2YIB A;  3F7Y C;  2AW9 A;  4U3J A;  4NXM B;  5LYJ B;  1U97 A;  2E74 B;  4FM1 A;  3E83 A;  4UCR A;  2XT9 A;  2LQT A;  3CD6 V;  1EZJ A;  3AG2 C;  3DC5 A;  3L71 H;  3QO5 A;  4ZI7 A;  3Q4H B;  4UUJ C;  4R8C A;  3SR2 C;  1I0H A;  2BSK B;  3ZMZ A;  2LFS A;  1OCO B; 
#chains in the Genus database with same CATH homology
 4DXW A;  1OCC B;  2EZO A;  4HAM A;  1THZ A;  3LDE A;  1V54 C;  1JVM A;  1NQT A;  5B1A C;  2JJ2 G;  1K7D A;  3M99 B;  1VQ4 V;  4X88 A;  4JF3 A;  2A9H A;  3OMA B;  2ZR2 A;  1Q82 W;  2OCC C;  1DF4 A;  4ZBM A;  1QVG U;  1V55 C;  1QVF U;  4CBC A;  2QEX V;  1V54 B;  3OE7 G;  5L3F A;  4UXN A;  3FKS G;  4Z1M G;  3FYE B;  1ORQ C;  1VQN V;  4HZ3 A;  2EIN B;  1V55 B;  1NH2 D;  1CEZ A;  4FPP A;  3LNM B;  3ABK C;  3E8B A;  1NVP B;  2LFR A;  4PDR A;  1YTF B;  2IW5 A;  3E35 A;  4XBF A;  1KC8 W;  3LUT B;  1PNM A;  3OFN G;  1QCE A;  5EK0 A;  3E2E A;  5CMU A;  4GX5 A;  1M57 C;  2JDI G;  2XAQ A;  3ABK B;  1Q81 W;  5HFL A;  5H9C A;  3B8M A;  1WPX A;  3G6E V;  2D3O W;  2DWD C;  5LHH A;  5B3S C;  2QM8 A;  4PA3 A;  1M56 B;  1KD1 W;  2JK5 C;  2EJR A;  2X6A A;  4JTA B;  5CBH A;  4P30 A;  2ZQM A;  5CBG A;  1KP3 A;  3ASN C;  3CCL V;  3RVZ A;  1JOY A;  1QLE C;  2JIZ G;  1OCR C;  2HR3 A;  4H37 A;  4RUE A;  4BW5 A;  1Q86 W;  1S5H C;  1SER A;  1ARO P;  4BIU A;  4P9P A;  5DN6 G;  5KUM A;  1M9N A;  1QLE B;  2IJI A;  4N21 A;  4GX2 A;  4PEL A;  4RO2 A;  3DGE A;  3CC4 V;  2WLL A;  1SET A;  3ZMT A;  3G71 V;  2QTO A;  3ZRV A;  5H6Q A;  2WLL B;  1OZ0 A;  3P30 A;  5C93 A;  2UXN A;  1COW G;  5EC1 C;  3MD0 A;  1K5S A;  3K9A A;  3SYP A;  1YSC A;  1VQ7 V;  3GB7 C;  3ML0 A;  1F23 A;  4TWK A;  1K34 A;  1YJW V;  1ENV A;  1K33 A;  1MG1 A;  5LGN A;  3W7W A;  2EBO A;  1AJN A;  2V7Q G;  4JPR A;  2GSM B;  2YSU B;  2AHY A;  1M1K W;  4XDK A;  1GMG A;  1AI7 A;  2ATK C;  3K04 A;  1AJQ A;  3JYC A;  3K79 A;  4JAU A;  3BY6 A;  4WFG A;  1QR9 A;  2DYS C;  3TK1 A;  4RQE A;  3AG1 C;  4JAV A;  1W0K G;  1R3I C;  1Y4M A;  1E79 G;  5CBF A;  3CXC U;  1KEC A;  4MVM A;  2ZD9 A;  4XDJ A;  5BZB A;  2QM7 A;  2P67 A;  2Q68 A;  3MHH C;  3OEH G;  2R9R B;  4EKW A;  2H94 A;  2EIJ C;  2WLI A;  1MOF A;  4L87 A;  3T4Z A;  5DM6 V;  1NR1 A;  4G2K A;  4MTF A;  2WLI B;  1VQ8 V;  4RUF A;  3WG7 C;  1VQ9 V;  1RPR A;  3ZIA G;  2XAH A;  2CK3 G;  1S77 D;  3FB8 C;  2P6J A;  4YXW G;  2JJ1 G;  3CYO A;  1G4Y B;  1DLB A;  3SJQ C;  2QA4 V;  1R73 A;  3E8F A;  4H33 A;  2BOC C;  3I55 V;  3JD2 A;  1P7B A;  1H8H G;  3SYQ A;  3SPG A;  3ZN1 A;  1K8A W;  3ZMV A;  3GWO A;  1DTO A;  4QPK A;  4ZKI A;  3AG2 B;  3VOU A;  5CA3 A;  5B1B C;  3CMA V;  4BAY A;  3IGA C;  1YHQ V;  3ASO C;  4PDV A;  3QO8 A;  3ZMU A;  4P9O A;  1AR1 B;  1OCZ C;  1FFT B;  2JEU A;  2R9I A;  2HKO A;  1K92 A;  5B1B B;  1NKD A;  4QIW F;  2F43 G;  4GT1 A;  3ASO B;  4GX0 A;  2Q6A A;  3X2Q C;  2XOK G;  4G27 B;  5B1A B;  1OCZ B;  1SZT A;  4J9Z B;  3K0D A;  4QNH B;  2HG5 C;  5LBQ A;  1QBZ A;  1SES A;  4WFE A;  1NJI W;  2IU0 A;  2OCC B;  2WLM A;  3OUF A;  2IH1 C;  5L3D A;  3SPI A;  3X2Q B;  2ZDI C;  4MW3 A;  1MSW D;  1KKD A;  4R7C A;  4UV8 A;  1I5Y A;  3SPH A;  4LBE C;  1UJW B;  3RVY A;  4F4L A;  4XDL A;  3E8H A;  3B77 A;  2EIL C;  3FB7 C;  3OMN B;  3JD3 A;  5LHG A;  5EBL C;  3STL C;  3JD1 A;  4KP4 A;  2OTL V;  2Y48 A;  2FTK A;  1F51 A;  1RM1 C;  3T4D A;  1M57 B;  3UM7 A;  2XAJ A;  4KUM A;  4RAI A;  2YEV A;  3RW0 A;  2GHY A;  3F5W C;  3QNE A;  4FJC C;  2YEV B;  2A0L A;  5B3S B;  1RM1 B;  5J9P C;  4MTX A;  1F4M A;  5L3G A;  3CCE V;  1VQO V;  1JJ2 U;  1NH2 B;  3ZCC A;  1S72 V;  4JAS A;  5B1O A;  3ASN B;  4MT8 A;  4I9W A;  1S76 D;  3CCJ V;  3ABL C;  1VQM V;  1OCR B;  4J9Y B;  1IXM A;  3QO7 A;  3CCV V;  2EIM C;  4PA4 A;  3ABL B;  1YJN V;  1R3K C;  4OXS A;  3AG4 C;  1E1Q G;  3R65 A;  5EBW C;  4GCZ A;  3ZMS A;  4MSW C;  4X8A A;  1JPX A;  3D36 A;  2B5U A;  3AG4 B;  3G4S V;  3FB6 C;  4UVA A;  2P90 A;  1FS0 G;  2X0L A;  4MTG A;  4HYO A;  5EC2 C;  1YI2 V;  1MAB G;  1YIT V;  1Y66 A;  2AHZ A;  4ASU G;  2Z5U A;  4CZZ A;  1BHB A;  4PDL A;  3ABT A;  4WFH A;  2QKS A;  3LSQ A;  5KUK A;  1NR7 A;  2WLK A;  2IH3 C;  3OMI B;  2HFE C;  2W6J G;  3LDC A;  4JGS A;  1JQ0 A;  3K0G A;  1SRY A;  1G8M A;  3SPC A;  3HB3 B;  3CCR V;  4R50 A;  2LP7 A;  2X6B A;  5E1A C;  3OM3 B;  1FXV A;  3PJS K;  5KA5 A;  2DYS B;  3K3W A;  3AG1 B;  3ZRW A;  4LP8 A;  1GM7 A;  2WLN A;  3CCS V;  2XAF A;  5B1N A;  3K06 A;  2ZR3 A;  2ZXW C;  2X7R B;  1YJ9 V;  3OW2 U;  2WWW A;  4JYB A;  1F4N A;  1LNQ A;  1K5Q A;  2W0F C;  3OEE G;  3ABM C;  3VBB A;  4N23 A;  2EIJ B;  1VQP V;  3BEH A;  1GK9 A;  1W2B U;  3STZ C;  3WG7 B;  3W7T A;  3MHS C;  4MVZ A;  3IC7 A;  3WFV A;  5LGU A;  3E8G A;  3CC2 V;  3NXS A;  3SYO A;  3IFX A;  4E2L A;  2HLD G;  3TCU A;  1CPY A;  3ZRX A;  4R6Z A;  5CN0 A;  5IY5 C;  3CPW U;  4Q20 A;  3OR6 C;  2KB1 A;  2WPD G;  4JTC B;  1FXK C;  3W7X A;  3ETG A;  1JX9 A;  1R6K A;  1N8R W;  1GKF A;  1QLN A;  4UVC A;  1QR8 A;  5FL7 G;  5IY5 B;  1GM9 A;  1OCO C;  1K3E A;  2PI5 A;  3ZN0 A;  1OCC C;  3SYC A;  2WSS G;  4MVU A;  3CME V;  1S0V A;  2DW4 A;  2HJF C;  1CP9 A;  2ITD C;  1W0J G;  2B1G A;  2NNU A;  3JD4 A;  3E89 A;  2IJH A;  4UV9 A;  1EBO A;  2DYR C;  4QJF B;  3OAA G;  2C2A A;  3CP1 A;  1K97 A;  3E86 A;  1GO3 F;  3CCQ V;  2ZDI A;  2OT5 A;  2HVK C;  2EIN C;  2DYR B;  4WFB V;  3HPL C;  4X89 A;  1AI5 A;  1H8E G;  3SYA A;  3OUS A;  3ZJZ A;  4QPJ A;  5L3E A;  3DTU B;  1WLE A;  2EZP A;  2HVJ C;  4LCU C;  2EIL B;  4LC1 A;  3A0R A;  3KG2 A;  3W7S A;  2V1D A;  2XAG A;  5LHI A;  2M7W A;  2JEX A;  1Q7Y W;  1TUE B;  3ABU A;  2WAM A;  5L3C A;  1M56 C;  4MS2 A;  2P7T C;  5IYB O;  2WLH A;  1L1F A;  4BIZ A;  4JYC A;  5EBM C;  1OHH G;  2B1I A;  1R3L C;  2Y69 C;  4JTD B;  5GW7 A;  3D3I A;  3UKM A;  1PL0 A;  3K03 A;  4GX1 A;  2H8P C;  2X6C A;  3AEI A;  2EIM B;  2Y69 B;  4KFM A;  5H6R A;  1PKX A;  1KQS U;  1RPO A;  1H38 A;  2NLJ C;  1AI6 A;  1K9M W;  3ZRS A;  1E1R G;  1K4C C;  3JD0 A;  3LDD A;  4G28 B;  4PA7 A;  2EIK C;  2IJJ A;  1I5X A;  3ETE A;  5IDJ A;  2Q69 A;  3AG3 C;  4DO2 A;  3B8N A;  1VQK V;  1ZWI C;  4QE7 A;  5HFM A;  2DQ0 A;  3SPJ A;  2EIK B;  4P2Z A;  2W6I G;  1DF5 A;  5IYD O;  5KA6 A;  3AG3 B;  3LSS A;  3CCM V;  4MVR A;  3RBZ A;  4FMT A;  2Q67 A;  2UXX A;  3JCZ A;  4PDM A;  4MVQ A;  1B6Q A;  1AJP A;  1XL4 A;  4TT3 G;  1HWY A;  4WF9 V;  1GM8 A;  3CCU V;  1S3J A;  3T1C A;  3ETD A;  1K73 W;  1JCH A;  4FIP C;  4MVS A;  1BL8 A;  4QE9 A;  1FXH A;  3ZRW B;  1GTO A;  1XL6 A;  1PNL A;  4MTO A;  1BMF G;  3F7V C;  2DWE C;  3OR7 C;  3EHB B;  2ITC C;  4WFF A;  1NBM G;  4UVB A;  1M90 W;  3OGC C;  1KP2 A;  2MK3 A;  2ZXW B;  3I56 V;  3CC7 V;  2BOB C;  1VQL V;  4FK5 C;  1P4R A;  1J95 A;  1K4D C;  3TET A;  1YIJ V;  2XAS A;  3EFF K;  3W7U A;  3T2M A;  3ABM B;  4PA9 A;  5IYC O;  1EFR G;  4MVO A;  2PI4 A;  4WFA V;  1VQ6 V;  3FB5 C;  1H2G A;  3FYI B;  3P32 A;  4MW8 A;  1BHA A;  2QE7 G;  3F7Y C;  4PA6 A;  1R3J C;  2K1E A;  1PNK A;  4WCE V;  4I5S A;  4RQF A;  3E83 A;  2XND G;  2DQ3 A;  1VQ5 V;  5LGT A;  4TSF G;  3CD6 V;  2Z3Y A;  1AI4 A;  1EZJ A;  3AG2 C;  1FXK A;  3QO5 A;  1ROP A;  2A79 B;  1FXK B;  2WLJ A;  4U7N A;  4UUJ C;  4R8C A;  1NVP D;  5L3B A;  1YTF D;  3ZMZ A;  3H01 A;  2OTJ V;  2IU3 A;  2LFS A;  2IJK A;  1OCO B;  3K08 A;  4U7O A;  1R6N A;  1PD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...