3E8HA

Crystal structure of the the open nak channel-k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8hA00
1ORQC 2R9RB 4X88A 3RW0A 4H37A 2WLLB 1OCRC 4MVQA 4MW3A 5EBLC 3K0GA 3SPHA 1XL6A 3X2QC 2NLJC 3K04A 3TCUA 4BW5A 4P9OA 2YEVA 2WLLA 2IH3C 4P9PA 3STZC 4MTOA 3UM7A 5B1AC 5J9PC 4F4LA 3IGAC 1LNQA 2HFEC 1S5HC 4WFFA 4UUJC 3F5WC 2P7TC 2IH1C 2ATKC 4XDKA 4WFEA 4MVSA 2EIKC 3LNMB 3SJQC 1R3IC 1JVMA 4TWKA 1ZWIC 3K06A 1XL4A 2BOBC 4J9YB 1V54C 3AG1C 5EC1C 4R8CA 2DWEC 2DWDC 2Q67A 2WLMA 4GX1A 3JYCA 3LDEA 5KUMA 3AG2C 4R7CA 3RVYA 2JK5C 4JTAB 4PDMA 2WLNA 3AG3C 1R3JC 2H8PC 2WLIB 2HG5C 2HVKC 3E89A 3ASNC 5E1AC 1K4CC 3K0DA 1OCZC 3OR7C 3PJSK 4I9WA 4MS2A 2AHYA 2WLIA 3F7VC 4R6ZA 4XDJA 1KKDA 3FB7C 3K08A 2A79B 2K1EA 3ABMC 2HVJC 4QE9A 5EK0A 2QTOA 2WLHA 2X6CA 3HPLC 3E86A 5B1BC 1OCCC 4J9ZB 1QLEC 4QE7A 3OGCC 1M56C 4PA4A 2X6AA 2BOCC 4G28B 3F7YC 3IFXA 3OUSA 5EBWC 2KB1A 2EIJC 1BL8A 3ASOC 3OR6C 4PA7A 3OUFA 4JTDB 4QNHB 3EFFK 3E8BA 5EBMC 5KUKA 2ITDC 4MVZA 2ZD9A 3E8GA 4KFMA 4MVUA 3T1CA 4JTCB 2OCCC 4HYOA 5B3SC 3ZRSA 2WLKA 3SPGA 3FB6C 4PDVA 4MVMA 2WLJA 4X8AA 4PDRA 4RO2A 4LBEC 4LCUC 3SPIA 1OCOC 2HJFC 3KG2A 4RAIA 1J95A 2EINC 2QKSA 2W0FC 3T4DA 3VOUA 3AG4C 5CBHA 2Y69C 4HZ3A 3SYQA 3E83A 3STLC 4ZBMA 4MVOA 2ZXWC 4X89A 5BZBA 5CBFA 4WFHA 3GB7C 2EIMC 4PA9A 3TETA 4MTGA 1G4YB 3RBZA 1V55C 2EILC 2DYRC 3SYPA 3RVZA 3UKMA 4P2ZA 4MTFA 2A0LA 2A9HA 3E8HA 4PA3A 3LDDA 3SYAA 4PDLA 2Q68A 3ZJZA 3BEHA 3SPJA 3WG7C 2AHZA 4RUEA 3R65A 5EC2C 5IY5C 1M57C 4GX0A 4GX5A 1P7BA 2Q6AA 3T4ZA 4RUFA 4XDLA 3FB8C 3LUTB 1K4DC 2DYSC 4LP8A 2X6BA 4GX2A 4G27B 3FB5C 4OXSA 3K03A 4MVRA 4R50A 4WFGA 3SYCA 3ABKC 4H33A 4DXWA 2Q69A 3E8FA 3ABLC 3SYOA 2ITCC 4CBCA 5CBGA 4MSWC 3T2MA 4MW8A 4EKWA 4P30A 3SPCA 1R3KC 1R3LC 3LDCA 4PA6A
chains in the Genus database with same CATH superfamily
3ZN0A 1K5SA 4RWUA 1XL6A 2ZINA 5CB4B 2P90A 2PI4A 1W0JG 5CB4A 5BR8O 3ZMZA 1XMOB 3F5WC 2IH1C 1JX9A 2KKWA 1ROPA 3K5LA 2QWQB 1N36O 2Y4TA 1P49A 3M99B 3JATB 1VQ7V 1N34B 4J10A 3JATA 2Q0AA 1Q81W 3CEIA 3PJSK 5KHJA 4UB8Z 4QPJA 3OTFA 3OTOO 3G6BA 3DXRB 4QIWF 4UCSA 2LO1A 4DK0A 1YVWA 1RSOB 3DXRA 2PUSA 3F7YC 3JALB 1RSOA 3OR6C 1Q5OA 3JSLA 1MNGA 3JALA 5KUKA 1M4UA 2QM7A 1K5QA 1U96A 1OCZB 4YY3O 1VQPV 1YJ9V 2XAJA 4X65O 1V9PA 3JD4A 4DYLA 5FPOA 2Y0IA 3VBBA 5HFMA 1GN4A 1SS3A 3OMAB 2YXYA 2EIMC 2XAFA 1XNRB 2KQXA 4I55B 4MTFA 5EYPB 1AB3A 1WA8B 1KC8W 2BCCH 4RUEA 1R6KA 1Z5WA 4DV1O 4I55A 5EYPA 2Q6AA 4GZRB 5J2TB 2NNUA 4CH5A 4E2LA 5J2TA 4FM1A 1GM7A 2F1MA 5LHGA 1WPXA 3JCZA 4TOIA 4I50B 1DF5A 3WG7B 1BGYH 1LNQA 1S5HC 3BFRA 4I50A 3N2GB 1OV9A 1BZKA 5B66Z 3SR2C 4YIOA 4NXMB 3N2GA 2OIGA 3ZX6A 5GTHZ 4LH7A 1N4CA 2JK5C 3AK1A 4FPPA 4JTAB 1KP3A 1GN6A 3L75H 3SJBC 3KCYA 2CE4A 5LYJB 4R6ZA 1SESA 4DR1B 4CZZA 1JA8A 5KHIA 3J80N 2OTJV 2EZPA 2KB1A 1VQ5V 3HKEB 1GN2A 1H2KA 5B1OA 3CCJV 4OPHA 3CSXA 4NTWA 1FPOA 1CEZA 1Y4MA 4D6TH 2ZM6O 1YF2A 1SERA 1EN6A 2HJDA 3ZN1A 1NTKH 3ZMTA 3HKCB 3KKYA 4ZBMA 3H1JH 2PTMA 2GTAA 4FK5C 5L3DA 3OE7G 2Y4UA 3ZHUA 4P2ZA 2YICA 4LFAB 1Q6UA 3O9OA 3DTUB 2HR3A 5LOVB 2CTRA 1KYOF 4YHHO 3ETGA 5LOVA 4LH6A 4XDLA 3QO7A 3L72H 2NN4A 2WA4A 2YSUB 5HFLA 3DC6A 2ITCC 4Z2WA 1QR8A 1VEWA 3SPCA 2IJHA 3RW0A 1OCRC 4X1IB 4PJ0Z 2OWOA 4X1IA 1GN3A 2VQEB 1DGSA 5B1AC 3RN4A 3D3IA 2ATKC 3KZIZ 3UCSC 3EHBB 4D7SA 4DV7O 2A7WA 1XILA 3AG3C 4ZHQA 2WLIB 3X2QB 1K4CC 1H2NA 2FB5A 3B4SA 2WLIA 4LNUA 5EIBD 2HVJC 1QLEC 4NXNB 1W0KG 3OUSA 3J7AU 2L6LA 4U3JB 1KD1W 3CE2A 1OJHA 1S77D 2ZDIA 2ZD9A 1PL4A 2OCCC 2R9AA 4LC1A 4U3JA 4DR7B 2JIZG 2LFSA 1SQXH 3A8TA 1NR1A 3ZHVA 3HB3B 1VIBA 3CCMV 2K9PA 2Z0AA 1FYJA 4LFCB 1YJNV 1PP9H 1RM1B 5CBFA 1RPOA 2ZE6A 4LFBO 2LP7A 2O57A 3GWOA 4JI8B 2B5UA 1AJQA 3LDDA 4DV6B 3ZJZA 2FYUH 3CCVV 2UUCB 1K33A 3R65A 4IHJB 4GX0A 3FX7A 2N74A 1ZSPA 1VQ9V 4IHJA 1XBLA 4LP8A 2V4DA 1YEWA 3B77A 3MDSA 2QTSA 3FYIB 3QNEA 3RT3C 3CWBH 4ZIBA 3ZRWA 4LF5B 2ZXWB 4F6RB 3BRCA 1H2LA 4F6RA 1ORQC 2HLDG 1U97A 4X66B 1EFRG 2E76B 1AROP 4DR3B 4JI2O 5KX5B 4DUYB 2Y0PA 4TQDA 4K0KB 1NTZH 2CUGA 1XNQO 4WFEA 5KX5A 3LNMB 1FXVA 2PF4E 4UFZA 4UV8A 2Z5UA 3RYHB 2EX3A 3D36A 1PKXA 2ILMA 1HNXB 5IWAO 2UXDO 4N21A 3RYHA 1R3JC 1HR0O 1N0NA 4FJCC 2IW5A 4B3RO 3CMEV 2XAHA 1Q90D 4CC6A 4WF9V 3RWRD 2WAMA 4WFAV 3U0ZA 2Q7GA 2QDOA 1F7YA 2FL4A 4MTXA 4UCOA 3H01A 4AQYB 1HNWO 2XAQA 4ZOLB 4JYBA 1XQ8A 1N32O 5CA1B 4RQEA 1GM8A 2CAZC 3B8MA 4JGSA 4ZOLA 5EBMC 3PN1A 2JJ2G 2KG7B 5CA1A 4HYOA 5H9CA 2KG7A 4L8JA 2OYQA 2EZOA 4O4LB 2WLJA 2HJFC 1J95A 4X1KB 1KECA 4DV5B 1K34A 2AGAA 2EINC 4O4LA 4LF9O 2Y69C 4ASUG 1VQ4V 1NI8A 3K58A 3WFVA 3TETA 2E3CA 3RBZA 3UKMA 2UU9B 1OZ0A 1Y67A 2YUAA 3BEHA 3AEIA 1VQKV 1QCEA 4JZ2A 1IBMB 1B06A 2GV9A 1QBZA 3LSSA 4IYHA 4RUFA 3FB8C 1NKDA 3LNNA 4FFKA 3L73H 1BQZA 4H33A 5LGNA 1R3KC 4JI3B 1H38A 2Q9LA 1SRYA 2XT9A 2X7RB 4GKKO 2IH3C 1IBLB 5FNVA 3W7SA 1ZX3A 1YSCA 2DYSB 2EIKC 1AI7A 3SJQC 4DV1B 2RDCA 1GM9A 2DWEC 2DWDC 3ABKB 3RVYA 4UVAA 4K8ZA 4NTYA 3R66A 2B1IA 5IJ0B 4KHPO 5IJ0A 3OR7C 1E79G 2D3OW 1VQOV 1KUQA 3SGIA 2FMLA 3GVMA 2JEXA 1IXBA 2YXLA 5GONB 4B3MO 2YC0A 1FJGO 3IC7A 4G28B 5GONA 2XHBA 2BTOA 1NZ6A 5IJ9B 1S3JA 1GK9A 4I7ZB 3P3PA 3RGBA 1VQNV 2OIEA 5DEDA 5IJ9A 3FKSG 4YJ3B 3E8GA 1NS1A 2ZNJA 2R70A 4YJ3A 1NVPD 1FD9A 1H8EG 5H5NA 1I5XA 4RO2A 5L3EA 4TV8B 2RNBA 3ICXA 2QKSA 4ZI7B 4TV8A 4FM2A 3I55V 1FS0G 4JPRA 1MABG 2HHHO 4X89A 4ZI7A 1YTFD 1K7DA 1CP9A 1H2SB 3CD6V 5K1PA 4UXNA 1AP5A 3RVZA 2QWNB 2AHZA 1WJZA 4NR1A 3L74H 3IAYA 5CBGA 1R3LC 5KMGA 2QE7G 3K59A 1V55B 1XEQA 2RN9A 3OMNB 1N0JA 2EJ7A 1QVGU 4OX9O 3D3QA 1S76D 1LR1A 3IJ4A 4LF6O 2F95B 5CA0B 1DLBA 1XMQO 4YHHB 5CA0A 2UUAO 4J41A 1F4NA 1WP7A 2Q67A 1Q6HA 2WLMA 5D5PA 2F4VO 3OAAG 2DQ3A 3DGEA 5JJJB 1XI1A 4CS2A 2AHYA 5EZYB 2P67A 1HW7A 5IYCO 1MSWD 1D2DA 1KKDA 2UUBB 2JGUA 3K5OA 5EZYA 4WFBV 4QE7A 4PA4A 3T1HB 4JZGA 2EIJC 4G2KA 1SQBH 3OUFA 2XUMA 4GCZA 4UB6Z 3L9DA 3EFFK 1Z5VA 1JMKC 4I4TB 3K5NA 4X20B 4X64O 3L71H 4X20A 5LHHA 4X8AA 2GUZB 2WA3A 5BMVB 4OPAA 1Z2GA 1A32A 3LSUA 4UCRA 2GUZA 3VQYA 1ZUQA 4LF4O 1H2MA 2AW9A 2H3OA 4O4IB 1I94O 4IGGA 4O4IA 3SYAA 1GMGA 1M57C 2DQ0A 5JVDB 1P7BA 2UXBB 4GUNA 5JVDA 2QKAA 1NU1H 3ABTA 2JGDB 3JD0A 3CC7V 4JYAO 2EIMB 2QWOB 4X62B 2JGDA 3LDCA 4FLVA 1WLEA 4JI4B 5DN6G 4EEQA 2QM8A 3ML0A 3P3NA 1PD3A 3TGUH 2IJJA 5KAIZ 1HNZB 1FFXB 3UQ8A 4JI6O 1WA8A 1BQ0A 2AXTZ 1FFXA 4LF7O 3MAQA 1KP2A 4H13B 3LDEA 2XAGA 4MT8A 2WLNA 5IE9A 2HVKC 1MZFA 1SQVH 2ODMA 2M6YA 4YJ2B 3K0DA 4MS2A 3CPWU 4JI7B 4CC5A 1AR1B 4AHCA 3JAKB 4B3TB 4JAAA 4UVBA 4YJ2A 4NKGB 2GDSA 5KA6A 3ETDA 3JAKA 2QSAA 2VQFO 3CHXA 4JI0B 4LR3A 3IFXA 5LMNB 4O2BB 3ASOC 1H8HG 4O4HB 1M5IA 4JASA 1TA8A 4O2BA 4O4HA 1LUWA 4LF8B 5B3SC 2W0XA 4JYCA 3ETQA 3K57A 5LYJA 4K8XA 5EIBC 4DV2B 2ZE5A 4MVOA 4GKJO 3QG5A 1NTMH 3ZMSA 2HEPA 3A0BZ 3HKEA 4JF3A 4BIOA 3G6EV 5LMUO 2ADQB 1ZLZA 1VQMV 4GX5A 1WPBA 1JJ2U 4EFBA 3MD0A 3JARB 1L1FA 3K5MA 4ICGA 5TISZ 4NVPA 3ZRXA 2RJZA 1IZ3A 4OXSA 3JARA 4PV1B 3E8FA 2ARHA 4EKWA 3HKCA 4P30A 1GAXA 2ZE8A 1FXKC 1VMGA 4DR5B 4H37A 1PPJH 4GT1A 3TCUA 4DV4O 1M9NA 1R73A 2N04A 5JJEB 5L3GA 1W2BU 2DW4A 4GLXA 5FLXN 4DR2B 3G71V 4JV5B 4HAMA 4WCEV 3K3WA 1F4MA 4FLWA 3K06A 1XL4A 4N23A 1SA0B 1X4TA 1VF6C 1OCRB 4JI5O 1SA0A 2UXCB 3TJTA 3RYFB 1DTOA 5B1AB 3ABMC 1SKVA 4DR6O 2W6IG 3RYFA 4DUZB 1KMIZ 5BXZA 3K9AA 2GBOA 3OM3B 3OGCC 1M56C 4FMTA 1J5EB 1XHZA 2BTQB 1MSDA 1F51A 3FYEB 2B1GA 3NXSA 5JCOC 3AG3B 3E8BA 4DW0A 1IBKB 2LGWA 1XMOO 3T1YB 3ZRSA 2F93B 5CN0A 1O9HA 5A9GA 2IM9A 4YIPA 2MK3A 4LBEC 4LCUC 3KG2A 4TSFG 2QA4V 1QLEB 1N34O 4HZ3A 3JD2A 5K1XA 3GB7C 2OCHA 1PNMA 3A0HZ 1G8MA 3BABA 2OCCB 1N33B 2Q68A 3OMIB 2WPDG 1I08A 4B7KA 4PELA 1TUEB 2Q5ZA 2X6BA 4UCTA 2E5LB 3P32A 3CCLV 3BA8A 3CJHB 5LBQA 3QTCA 2A06H 2ZE7A 5LP6C 3ZS8C 3BA9A 1Q6IA 1SQGA 3C3TA 4UUJC 1S0VA 2P7TC 1S5LZ 2G38A 4UVCA 1XNRO 2Q7EA 1ZWIC 1KBHA 4J9YB 1V54C 3AG1C 5EC1C 3JYCA 2VWKA 3I5DA 4IYIA 1JQ0A 3U10A 5H6RA 4JI1B 1YI2V 3AG7A 3ASNC 5BY1A 4B3SB 2CTQA 2WSSG 2YS8A 2Q8VA 2A79B 3HPLC 3E86A 1WN7A 2A3QA 2E75B 1BCCH 3CCRV 1K3EA 2ITDC 1PM9A 4NTXA 1UPGA 1X59A 2H94A 2XNDG 1WP8A 1E1QG 2VS0A 1OCOC 5DM6V 4Z1VA 1FKAO 3FFQA 3E83A 5BR8B 3P30A 1QHTA 5BZBA 4PA9A 4DR1O 4DV0O 1AI4A 5KHKA 1EM1A 1N36B 3ZIAG 4FZ1A 4CH6A 5KAFZ 5EC2C 5IY5C 1NVPB 1JJOA 1Q7YW 2EINB 3I56V 2Y69B 4X9QA 4G27B 3TK1A 4X1KA 3OTOB 3ABLC 3WB1A 4CBCA 5IYBO 2ZT9B 4MSWC 1YTFB 3KCXA 1RFYA 1I0HA 4PA6A 4E4EA 2YIBD 3FD9A 4BW5A 1EZJA 4P9PA 1I94B 3H1KH 2HFEC 1YJWV 4WFFA 2PZSA 5DECA 4YY3B 2AZ2A 3K79A 4X65B 4LFAO 4PDMA 4RQFA 3QO8A 1VP7A 4L87A 5E1AC 1VQ8V 4I0XB 3FB7C 4QPKA 2NR5A 4I0XA 4QE9A 2X6CA 3CB2A 5B1BC 1YHQV 2EIKB 1GO3F 3BPZA 1SC5B 4AI8A 1BHBA 2F23A 1HP8A 2VQEO 5KA5A 2DJVA 2JS5A 5KHGA 3ZMVA 4MVZA 1GTOA 1BHAA 3K9SA 3ZMUA 1VF7A 2L35A 3SPGA 4PDVA 3TXQA 2P06A 2FTKA 4Q6GA 4RAIA 5JQGB 3CRCA 1TAEA 3AG4C 2Q7HA 2JJ1G 5JQGA 2E74B 3E22B 1CPYA 1D5AA 3L70H 3E22A 1QNMA 1K8AW 5IYDO 2EILC 2DYRC 1VQLV 5H2FZ 4DK1A 3N27A 2A9HA 4PA3A 1G1XB 4PDLA 4J7JA 4NXNO 5JH7B 1Q3EA 3H9VA 2ZQMA 1ZL8B 5JH7A 4DO2A 4C7UA 3LUTB 1ZL8A 3QF7A 3SYCA 4KUMA 4KL1A 5GTIZ 1IXMA 5LL6Y 2IJIA 4DR7O 1WNSA 1NH2D 1ZAUA 4MW3A 1AP6A 2DOSA 1O9GA 3K04A 5L3CA 4MTOA 4LFCO 3HKDB 4FM0A 2IJKA 1JOYA 4FLZA 4I9QA 4BAYA 1R1BA 2ZM6B 1JVMA 1JPXA 1R6NA 1P84F 5KUMA 4R8CA 1GH6A 1AJNA 4JI8O 3AG2C 4KP4A 4R7CA 4DV6O 3RFRA 3ZHQA 2UUCO 2LW1A 3RYCB 5L3FA 2HG5C 2GHYA 4BIUA 3CCUV 4NYKA 1UJWB 4FZ0A 3RYCA 2X0LA 4XDJA 1AJPA 1AVMA 2K1EA 1BE3H 4LF5O 2OTLV 5EK0A 2QTOA 2WLHA 4DV4B 1OCCC 4DV3O 1US6A 3OEEG 1JCHA 4J7KA 3CRAA 4H44B 1TUBB 4X66O 1GKFA 5EBWC 2MW2B 4PHZA 1TUBA 2IU3A 4DR3O 5L3BA 4DUYO 4K0KO 4F6EA 3UT5B 2JRIA 3UT5A 1AILA 4FLYA 4JI5B 4XBFA 1HNXO 3T4DA 5CBHA 4I5SA 2EIJB 2ZR2A 4WFHA 4MTGA 2BSKB 2PY5A 2RQ6A 1XUQA 4U3FH 4DV7B 1KB9F 2BSKA 5AG2A 3OD4A 1B04A 2A0LA 1H2GA 2VRZA 4AQYO 2M7WA 2Q4PA 3O65A 3OGIB 1YCIA 4I4TA 1HWYA 3F5TA 1URFA 1K4DC 2LGQA 3UO2A 4GX2A 1IVSA 1IURA 3JD3A 1BT8A 5BMVA 5IYZB 3M8AA 3W7UA 1AR4A 2XASA 3A0RA 5IYZA 5B1NA 2PGGA 4X88A 3NR7A 1Q43A 5EBLC 3APQA 4MVQA 3SPHA 4DV5O 1W59A 1SETA 4FLUA 1QVFU 4DR4O 1RPRA 3UM7A 1M57B 3CRMA 4BWAA 1G6UA 4X1YB 4O4JB 1XREA 4X1YA 2UU9O 4O4JA 4A5UB 3CYOA 3U11A 1IBMO 4O2AB 1OCZC 4O2AA 1QLNA 2ZIMA 3C3SA 4LFBB 3W7TA 1QQCA 3G80A 4W4LA 3E35A 1UFIA 4JI3O 4KXRA 2BOCC 1AI5A 2HP8A 4UV9A 4PA7A 4JAUA 1TVKB 2LFRA 3ZHSA 1IBLO 2QWPB 3Q4HB 1TVKA 1F23A 1P4RA 5JJNB 3Q4HA 1SF9A 2CTPA 2P22C 1T5EA 3TXSA 3SJCC 4J42A 5IT9N 3VOUA 1YIJV 4CH3A 3JAMN 3BVOA 4J7ZA 4JI2B 3HKBB 3W7WA 3ASOB 1XNQB 1I7FA 2D2CB 3HKBA 1KKCA 5F2VO 3WB0A 1AI6A 5B3SB 3ABUA 1M1KW 4FLXA 1MOFA 5D5QA 3WG7C 5IWAB 4IIJB 2UXDB 1HR0B 4JAVA 4AILC 3GWKC 2QGNA 4IIJA 4B3RB 4OGQB 4TQFA 1MA1A 2Q73A 3FB5C 1L0NH 2EULA 4DXWA 3SYOA 3T2MA 3DSQA 3H1HH 2R9RB 2YEVB 5LHIA 1E1RG 1HNWB 3K0GA 1N32B 2YEVA 3JSNA 3N2KB 4DV0B 4K3AA 3B40A 1L8DA 5J9PC 3WU2Z 3N2KA 4XDKA 5KHHA 5LXTB 1FAFA 1R3IC 4TWKA 4PD4F 1SZTA 4GX1A 5LXTA 3DC5A 1CXZB 1S5JA 2YXHA 4LF9B 1FXKB 1FXKA 2RCVA 3K08A 1WAZA 4FVMA 3E2EA 1COWG 4PI0A 4FIPC 4J9ZB 2CGNA 2ZNIA 2N05A 1WB7A 2CTWA 4ZKIA 1SQQH 1K73W 1AR5A 3APOA 4BW9A 3CC4V 1VF6A 2PYLA 1XHXA 3JASB 4LWSB 3ABMB 3ZEDA 1LUVA 3JASA 4LWSA 4QGPA 4U7NA 5LGTA 2DN9A 2W0FC 4GKKB 1M56B 2QKCA 1Y74B 3SYQA 3BAAA 3STLC 4HNAB 2YI8A 1NBMG 2HKOA 2UUBO 1Y74A 1G4YB 2V1DA 4HNAA 1BS3A 2BTQA 5JCOA 3SYPA 2AZ0A 3IC9A 3E8HA 2P6JA 2GSMB 3QVNA 1K97A 4YXWG 3T1HO 4QJFB 2LW7A 4PI2A 4KHPB 4B08A 2JVDA 2DE0X 3B2EE 4J80A 3OW2U 3ZBHA 2VWJA 4K35A 2Z3YA 4CS3A 4TV9B 4ZHQB 4IT5A 3OEHG 4TV9A 4B3MB 2R72A 1FJGB 3CRRA 2RMKB 1KQSU 3CMAV 3X2QC 4LNUB 1WB8A 2PYJA 3RYIB 4TUYB 5JWPA 2YI9A 4MVSA 3RYIA 4TUYA 1Q82W 1YDXA 2BOBC 1M93A 4B7EA 1RP3B 2ZDIC 3H1IH 2H8PC 1QR9A 3E89A 5LP6B 2HHHB 2UXBO 3CJHA 1B3QA 3F7VC 5B5EZ 2IBZH 5LP6A 3S3XA 1Q8IA 4W4KA 2YIBA 2F66C 4X62O 3ZHRA 3W7XA 2QM4A 3BHPA 4H0LB 4JI4O 2X6AA 4NB5A 1V54B 3AG1B 3CC2V 1RM1C 4CH4A 1HNZO 4JTDB 1PNKA 3JD1A 3JCUZ 3ASNB 4MVUA 2UXXA 4JTCB 5C93A 3JAWB 2P4KA 2LQTA 1R6TA 3AK3A 2WWWA 3JAWA 4U7OA 4CS4A 3ZRWB 2JEUA 4OX9B 2DMXA 3CCSV 1N8RW 2ZIOA 1MG1A 1VF5B 1MZEA 4JI7O 2ZXWC 3CX5F 4LF6B 4B3TO 1EN4A 4DV3B 1XMQB 2JS3A 2EJRA 5KLVH 1DF4A 3EVKA 2UUAB 2F4VB 4JI0O 4NXMO 5LMNO 1OCOB 3T4ZA 1XDCA 3D36C 3K03A 4WFGA 4DW1A 1GRJA 1DK1A 1BSMA 4LF8O 2ZR3A 2OT5A 2XOKG 1NJIW 2WLLB 3FAVB 4P9OA 3MHSC 2WLLA 4DV2O 3STZC 3FAVA 5IY5B 4FFBB 3IGAC 3SJAC 2R9IA 3VQXA 1BMFG 4FFBA 4X64B 4BIZA 1PL0A 3ABLB 1IX9A 1YITV 2C2AA 3ZRVA 1Y66A 1NH2B 4IL6Z 4I9WA 4UCUA 1I5YA 3BCCH 4LF4B 2YIAA 2Y48A 2CH7B 2ZCEA 3B09A 2CH7A 2CDYA 1JR9A 3ZHTA 4DR5O 4DR4B 1OHHG 5C8YB 5FPRA 3HR0A 3M7MX 2KSDA 1JFFB 5CA3A 5A2QN 1IDSA 2QR4A 2V7QG 5C8YA 4WBNB 1JFFA 3H1LH 4QNHB 1EBOA 1PV0A 1Y76B 1NT2B 4WBNA 4DR2O 3T1CA 3QO5A 4JYYA 4JV5O 1SZXA 4JYAB 3WB2A 1Y76A 2WLKA 1FXHA 3FB6C 1YXBA 4PDRA 3SPIA 1S72V 3CXHF 3G67A 3CS5A 5ITZB 3VQVA 4BR6A 5B1BB 1Q86W 5ITZA 5CMUA 3ETEA 2UXCO 5FL7G 3D8CA 2YDEA 3AK2A 3LSQA 4JI6B 4FLTA 2CGOA 1VARA 2CK3G 4EFEA 4UCVA 4ABMA 1M90W 4LF7B 2P5OA 4DUZO 5FNVB 1B6QA 3CRQA 1SQPH 3SPJA 1NQTA 1J5EO 3CP1A 4HBNA 3THOA 4DRXB 3J81N 2DYSC 4DRXA 3AG4B 1IBKO 4R50A 3ABKC 2Q69A 3T1YO 2ETNA 2VQFB 2GTSA 3G4SV 2EILB 2DYRB 2XTAA 2NLJC 2QJ1A 2JDIG 4F4LA 3UO3A 1QU7A 1L0LH 2EBOA 1THZA 1PNLA 2LJ2A 3A2FA 1FFTB 1N33O 1NR7A 1K9MW 3EXAA 1Y6XA 2Q0OC 4GKJB 3S3WA 3C90A 3VQWA 5LGUA 2B9ZA 2E5LO 1EN5A 1VQ6V 3CXCU 5LMUB 3HKDA 1MMMA 2FKXA 2IU0A 4TT3G 1EZVH 1BL8A 3AG2B 2W6JG 3OFNG 1K92A 2YIDA 3BY6A 4KFMA 1HDJA 1YZBA 4MVMA 4Q20A 4GYCB 5LA6B 1ENVA 1TGOA 5J2UB 1OCCB 4JI1O 5LA6A 4Z1MG 3ZCCA 5J2UA 2BE3A 2P4VA 5KMGB 4B3SO 1SQFA 1KU9A 5H6QA 3CCEV 5IDJA 2UXNA 5E79Z 1V55C 2PI5A 1D5NA 1P7GA 1XOUA 3MHHC 5GW7A 2QWRB 2ADPA 4J11A 3SDLA 4D7TA 2QEXV 2F43G 4MVRA 1ZTEA 4EB6B 3CCQV 2ZKOA 3OT7A 4DR6B 3B8NA 4MW8A 4EB6A
chains in the Genus database with same CATH topology
2R9RB 2YEVB 3ZN0A 5LHIA 1E1RG 1SRYA 1K5SA 3K0GA 1XL6A 2X7RB 2YEVA 2P90A 2IH3C 2PI4A 1W0JG 5J9PC 3ZMZA 4UUJC 3F5WC 2P7TC 2IH1C 1JX9A 4XDKA 3W7SA 1S0VA 1ROPA 1YSCA 2DYSB 4UVCA 2EIKC 1AI7A 3SJQC 1R3IC 4TWKA 1ZWIC 4J9YB 3AG1C 1V54C 1SZTA 1GM9A 2DWEC 2DWDC 3ABKB 4GX1A 4UVAA 3JYCA 3RVYA 3M99B 1JQ0A 2B1IA 5H6RA 1VQ7V 1FXKB 1YI2V 1Q81W 3ASNC 3PJSK 3OR7C 1E79G 2D3OW 1FXKA 1VQOV 2WSSG 4QPJA 3K08A 2A79B 2JEXA 4QIWF 1COWG 3E2EA 3HPLC 3E86A 4FIPC 4J9ZB 3IC7A 4G28B 3F7YC 1S3JA 3OR6C 4ZKIA 1GK9A 1K73W 1VQNV 5KUKA 3FKSG 1K3EA 3CCRV 2ITDC 2QM7A 1K5QA 3E8GA 1OCZB 3CC4V 2H94A 2XNDG 1VQPV 1NVPD 1YJ9V 1H8EG 2XAJA 3ABMB 1I5XA 4RO2A 5L3EA 1E1QG 1OCOC 5DM6V 3JD4A 2QKSA 4U7NA 5LGTA 2W0FC 5EC1C 1M56B 3I55V 1FS0G 4JPRA 3VBBA 1MABG 3E83A 3STLC 3P30A 3SYQA 5HFMA 4X89A 3OMAB 5BZBA 1YTFD 1K7DA 1CP9A 1NBMG 2EIMC 2HKOA 4PA9A 3CD6V 1AI4A 1G4YB 2XAFA 4UXNA 2V1DA 3SYPA 3ZIAG 3RVZA 4MTFA 3E8HA 2P6JA 2GSMB 1KC8W 1K97A 4YXWG 4QJFB 2AHZA 4RUEA 1R6KA 5EC2C 5IY5C 1NVPB 5B1NA 1Q7YW 2Q6AA 3OW2U 2EINB 2Z3YA 3I56V 2Y69B 4G27B 2NNUA 3TK1A 4E2LA 3ABLC 3OEHG 4CBCA 5CBGA 5IYBO 4MSWC 1YTFB 1R3LC 2QE7G 1GM7A 4PA6A 1V55B 3OMNB 5LHGA 1KQSU 1WPXA 3JCZA 3CMAV 3X2QC 4BW5A 1QVGU 1EZJA 1DF5A 1S76D 4P9PA 3WG7B 1LNQA 2HFEC 1S5HC 1YJWV 4WFFA 1DLBA 4MVSA 3K79A 1Q82W 2BOBC 1F4NA 2Q67A 2WLMA 4FPPA 2JK5C 3OAAG 2ZDIC 4JTAB 4PDMA 4RQFA 1KP3A 2DQ3A 3QO8A 2H8PC 4L87A 3DGEA 1QR9A 3E89A 5E1AC 2AHYA 3F7VC 2P67A 4R6ZA 5IYCO 1VQ8V 1SESA 1MSWD 1KKDA 3FB7C 4QPKA 4CZZA 4QE9A 2X6CA 4WFBV 3W7XA 5B1BC 1YHQV 2EIKB 2OTJV 2EZPA 4QE7A 4PA4A 1GO3F 2X6AA 1V54B 3AG1B 2KB1A 1VQ5V 3CC2V 2EIJC 4G2KA 1RM1C 1BHBA 3OUFA 5B1OA 4GCZA 5KA5A 3CCJV 4JTDB 3EFFK 1PNKA 1CEZA 3JD1A 3ZMVA 4MVZA 1GTOA 1Y4MA 3ASNB 4MVUA 1BHAA 2UXXA 4JTCB 5C93A 3ZMUA 3SPGA 5LHHA 4PDVA 2WWWA 4X8AA 2FTKA 4RAIA 4U7OA 1SERA 3ZRWB 3ZN1A 2JEUA 3AG4C 3CCSV 1N8RW 2JJ1G 3ZMTA 1MG1A 4ZBMA 1CPYA 2ZXWC 4FK5C 5L3DA 2EJRA 1K8AW 1DF4A 5IYDO 2EILC 3OE7G 2DYRC 1VQLV 4P2ZA 2A9HA 4PA3A 3SYAA 3DTUB 4PDLA 2HR3A 1GMGA 1M57C 2DQ0A 2ZQMA 1OCOB 1P7BA 3ETGA 4DO2A 3T4ZA 4XDLA 3LUTB 3QO7A 3K03A 2YSUB 4WFGA 3SYCA 3ABTA 4KUMA 5HFLA 2ZR3A 1IXMA 3JD0A 2ITCC 3CC7V 2IJIA 2EIMB 1QR8A 2OT5A 1NH2D 2XOKG 3SPCA 3LDCA 1NJIW 2IJHA 3RW0A 1WLEA 1OCRC 2WLLB 4MW3A 5DN6G 2QM8A 3K04A 3ML0A 1PD3A 4P9OA 3MHSC 2WLLA 3STZC 2IJJA 5L3CA 4MTOA 5IY5B 5B1AC 3IGAC 3D3IA 2ATKC 2IJKA 2R9IA 1BMFG 1JOYA 3EHBB 4BIZA 4BAYA 1JVMA 1JPXA 1R6NA 5KUMA 1PL0A 4R8CA 1KP2A 1AJNA 3ABLB 3LDEA 3AG2C 2XAGA 4KP4A 4R7CA 1YITV 2C2AA 4MT8A 2WLNA 3ZRVA 3AG3C 1Y66A 5L3FA 1NH2B 2WLIB 2HG5C 2HVKC 2GHYA 4BIUA 3CCUV 3X2QB 1UJWB 1K4CC 3K0DA 1I5YA 4I9WA 4MS2A 3CPWU 2X0LA 4XDJA 2WLIA 2Y48A 1AJPA 1AR1B 4UVBA 2K1EA 5KA6A 2HVJC 3ETDA 2OTLV 5EK0A 2QTOA 2WLHA 1OCCC 1QLEC 3OEEG 1OHHG 1JCHA 1W0KG 3IFXA 1GKFA 3OUSA 5EBWC 5CA3A 3ASOC 1H8HG 2V7QG 4JASA 2IU3A 4QNHB 1EBOA 5L3BA 1KD1W 1S77D 2ZDIA 2ZD9A 3T1CA 3QO5A 2OCCC 4LC1A 5B3SC 4JYCA 2WLKA 2JIZG 1FXHA 2LFSA 3FB6C 4PDRA 4XBFA 1NR1A 3SPIA 1S72V 3HB3B 5B1BB 1Q86W 3CCMV 3T4DA 5CBHA 4I5SA 5CMUA 3ETEA 1YJNV 2EIJB 4MVOA 2ZR2A 5FL7G 5CBFA 3LSQA 1RM1B 1RPOA 4WFHA 3ZMSA 4MTGA 2CK3G 1M90W 2LP7A 3GWOA 4JF3A 3G6EV 2A0LA 1B6QA 2B5UA 1AJQA 1H2GA 3LDDA 3ZJZA 2M7WA 3SPJA 3CCVV 1K33A 1NQTA 3R65A 1HWYA 1VQMV 3CP1A 4GX0A 4GX5A 1JJ2U 3MD0A 1L1FA 1VQ9V 4LP8A 1K4DC 2DYSC 3AG4B 3B77A 3ZRXA 4GX2A 4OXSA 3FYIB 3QNEA 4R50A 3JD3A 3ABKC 3ZRWA 2Q69A 2ZXWB 3E8FA 3W7UA 4EKWA 4P30A 2XASA 3A0RA 1FXKC 1ORQC 2HLDG 2EILB 4H37A 2DYRB 4MVQA 4X88A 4GT1A 5EBLC 3SPHA 3G4SV 2NLJC 1EFRG 1SETA 3TCUA 1M9NA 1QVFU 1AROP 1R73A 5L3GA 1RPRA 3UM7A 2JDIG 1W2BU 1M57B 2DW4A 4F4LA 2EBOA 3G71V 4WFEA 1THZA 3LNMB 4HAMA 3K3WA 1FXVA 1F4MA 1PNLA 4WCEV 4UV8A 3K06A 1XL4A 2Z5UA 4N23A 1FFTB 3D36A 3CYOA 1PKXA 1NR7A 4N21A 1K9MW 1R3JC 4FJCC 1OCRB 2IW5A 1OCZC 3CMEV 2XAHA 1DTOA 5LGUA 5B1AB 4WF9V 1QLNA 3ABMC 2WAMA 4WFAV 3W7TA 2W6IG 1VQ6V 3CXCU 3E35A 4MTXA 3K9AA 3OM3B 3H01A 3OGCC 1M56C 2BOCC 4FMTA 2IU0A 1AI5A 2XAQA 4TT3G 4UV9A 4JYBA 1BL8A 1F51A 2W6JG 3AG2B 3FYEB 2B1GA 3NXSA 4PA7A 4RQEA 4JAUA 3AG3B 1GM8A 3B8MA 3OFNG 4JGSA 3E8BA 5EBMC 2JJ2G 1K92A 2LFRA 3BY6A 4KFMA 1F23A 4HYOA 1P4RA 5H9CA 3ZRSA 2EZOA 5CN0A 4MVMA 2WLJA 4Q20A 2MK3A 4LBEC 4LCUC 2HJFC 3KG2A 1ENVA 1J95A 1KECA 1K34A 4TSFG 2EINC 2QA4V 1OCCB 1QLEB 3VOUA 1YIJV 4Z1MG 2Y69C 4HZ3A 3ZCCA 4ASUG 3JD2A 3W7WA 1VQ4V 3ASOB 3GB7C 3WFVA 3TETA 5H6QA 3CCEV 5IDJA 3RBZA 1PNMA 2UXNA 1V55C 3UKMA 1G8MA 1AI6A 2OCCB 5B3SB 1OZ0A 3ABUA 1M1KW 2PI5A 2Q68A 1MOFA 3BEHA 3AEIA 3MHHC 3OMIB 3WG7C 1VQKV 5GW7A 1QCEA 2WPDG 3LSSA 4JAVA 1QBZA 4PELA 4RUFA 3FB8C 1NKDA 2QEXV 1TUEB 2X6BA 3FB5C 2F43G 4MVRA 4H33A 4DXWA 3CCQV 3SYOA 3B8NA 3P32A 4MW8A 3T2MA 5LGNA 5LBQA 3CCLV 1R3KC 1H38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORQ C;  2R9R B;  4X88 A;  3RW0 A;  4H37 A;  2WLL B;  1OCR C;  4MVQ A;  4MW3 A;  5EBL C;  3K0G A;  3SPH A;  1XL6 A;  3X2Q C;  2NLJ C;  3K04 A;  3TCU A;  4BW5 A;  4P9O A;  2YEV A;  2WLL A;  2IH3 C;  4P9P A;  3STZ C;  4MTO A;  3UM7 A;  5B1A C;  5J9P C;  4F4L A;  3IGA C;  1LNQ A;  2HFE C;  1S5H C;  4WFF A;  4UUJ C;  3F5W C;  2P7T C;  2IH1 C;  2ATK C;  4XDK A;  4WFE A;  4MVS A;  2EIK C;  3LNM B;  3SJQ C;  1R3I C;  1JVM A;  4TWK A;  1ZWI C;  3K06 A;  1XL4 A;  2BOB C;  4J9Y B;  1V54 C;  3AG1 C;  5EC1 C;  4R8C A;  2DWE C;  2DWD C;  2Q67 A;  2WLM A;  4GX1 A;  3JYC A;  3LDE A;  5KUM A;  3AG2 C;  4R7C A;  3RVY A;  2JK5 C;  4JTA B;  4PDM A;  2WLN A;  3AG3 C;  1R3J C;  2H8P C;  2WLI B;  2HG5 C;  2HVK C;  3E89 A;  3ASN C;  5E1A C;  1K4C C;  3K0D A;  1OCZ C;  3OR7 C;  3PJS K;  4I9W A;  4MS2 A;  2AHY A;  2WLI A;  3F7V C;  4R6Z A;  4XDJ A;  1KKD A;  3FB7 C;  3K08 A;  2A79 B;  2K1E A;  3ABM C;  2HVJ C;  4QE9 A;  5EK0 A;  2QTO A;  2WLH A;  2X6C A;  3HPL C;  3E86 A;  5B1B C;  1OCC C;  4J9Z B;  1QLE C;  4QE7 A;  3OGC C;  1M56 C;  4PA4 A;  2X6A A;  2BOC C;  4G28 B;  3F7Y C;  3IFX A;  3OUS A;  5EBW C;  2KB1 A;  2EIJ C;  1BL8 A;  3ASO C;  3OR6 C;  4PA7 A;  3OUF A;  4JTD B;  4QNH B;  3EFF K;  3E8B A;  5EBM C;  5KUK A;  2ITD C;  4MVZ A;  2ZD9 A;  3E8G A;  4KFM A;  4MVU A;  3T1C A;  4JTC B;  2OCC C;  4HYO A;  5B3S C;  3ZRS A;  2WLK A;  3SPG A;  3FB6 C;  4PDV A;  4MVM A;  2WLJ A;  4X8A A;  4PDR A;  4RO2 A;  4LBE C;  4LCU C;  3SPI A;  1OCO C;  2HJF C;  3KG2 A;  4RAI A;  1J95 A;  2EIN C;  2QKS A;  2W0F C;  3T4D A;  3VOU A;  3AG4 C;  5CBH A;  2Y69 C;  4HZ3 A;  3SYQ A;  3E83 A;  3STL C;  4ZBM A;  4MVO A;  2ZXW C;  4X89 A;  5BZB A;  5CBF A;  4WFH A;  3GB7 C;  2EIM C;  4PA9 A;  3TET A;  4MTG A;  1G4Y B;  3RBZ A;  1V55 C;  2EIL C;  2DYR C;  3SYP A;  3RVZ A;  3UKM A;  4P2Z A;  4MTF A;  2A0L A;  2A9H A;  3E8H A;  4PA3 A;  3LDD A;  3SYA A;  4PDL A;  2Q68 A;  3ZJZ A;  3BEH A;  3SPJ A;  3WG7 C;  2AHZ A;  4RUE A;  3R65 A;  5EC2 C;  5IY5 C;  1M57 C;  4GX0 A;  4GX5 A;  1P7B A;  2Q6A A;  3T4Z A;  4RUF A;  4XDL A;  3FB8 C;  3LUT B;  1K4D C;  2DYS C;  4LP8 A;  2X6B A;  4GX2 A;  4G27 B;  3FB5 C;  4OXS A;  3K03 A;  4MVR A;  4R50 A;  4WFG A;  3SYC A;  3ABK C;  4H33 A;  4DXW A;  2Q69 A;  3E8F A;  3ABL C;  3SYO A;  2ITC C;  4CBC A;  5CBG A;  4MSW C;  3T2M A;  4MW8 A;  4EKW A;  4P30 A;  3SPC A;  1R3K C;  1R3L C;  3LDC A;  4PA6 A; 
#chains in the Genus database with same CATH topology
 3ZN0 A;  1K5S A;  4RWU A;  1XL6 A;  2ZIN A;  5CB4 B;  2P90 A;  2PI4 A;  1W0J G;  5CB4 A;  5BR8 O;  3ZMZ A;  1XMO B;  3F5W C;  2IH1 C;  1JX9 A;  2KKW A;  1ROP A;  3K5L A;  2QWQ B;  1N36 O;  2Y4T A;  1P49 A;  3M99 B;  3JAT B;  1VQ7 V;  1N34 B;  4J10 A;  3JAT A;  2Q0A A;  1Q81 W;  3CEI A;  3PJS K;  5KHJ A;  4UB8 Z;  4QPJ A;  3OTF A;  3OTO O;  3G6B A;  3DXR B;  4QIW F;  4UCS A;  2LO1 A;  4DK0 A;  1YVW A;  1RSO B;  3DXR A;  2PUS A;  3F7Y C;  3JAL B;  1RSO A;  3OR6 C;  1Q5O A;  3JSL A;  1MNG A;  3JAL A;  5KUK A;  1M4U A;  2QM7 A;  1K5Q A;  1U96 A;  1OCZ B;  4YY3 O;  1VQP V;  1YJ9 V;  2XAJ A;  4X65 O;  1V9P A;  3JD4 A;  4DYL A;  5FPO A;  2Y0I A;  3VBB A;  5HFM A;  1GN4 A;  1SS3 A;  3OMA B;  2YXY A;  2EIM C;  2XAF A;  1XNR B;  2KQX A;  4I55 B;  4MTF A;  5EYP B;  1AB3 A;  1WA8 B;  1KC8 W;  2BCC H;  4RUE A;  1R6K A;  1Z5W A;  4DV1 O;  4I55 A;  5EYP A;  2Q6A A;  4GZR B;  5J2T B;  2NNU A;  4CH5 A;  4E2L A;  5J2T A;  4FM1 A;  1GM7 A;  2F1M A;  5LHG A;  1WPX A;  3JCZ A;  4TOI A;  4I50 B;  1DF5 A;  3WG7 B;  1BGY H;  1LNQ A;  1S5H C;  3BFR A;  4I50 A;  3N2G B;  1OV9 A;  1BZK A;  5B66 Z;  3SR2 C;  4YIO A;  4NXM B;  3N2G A;  2OIG A;  3ZX6 A;  5GTH Z;  4LH7 A;  1N4C A;  2JK5 C;  3AK1 A;  4FPP A;  4JTA B;  1KP3 A;  1GN6 A;  3L75 H;  3SJB C;  3KCY A;  2CE4 A;  5LYJ B;  4R6Z A;  1SES A;  4DR1 B;  4CZZ A;  1JA8 A;  5KHI A;  3J80 N;  2OTJ V;  2EZP A;  2KB1 A;  1VQ5 V;  3HKE B;  1GN2 A;  1H2K A;  5B1O A;  3CCJ V;  4OPH A;  3CSX A;  4NTW A;  1FPO A;  1CEZ A;  1Y4M A;  4D6T H;  2ZM6 O;  1YF2 A;  1SER A;  1EN6 A;  2HJD A;  3ZN1 A;  1NTK H;  3ZMT A;  3HKC B;  3KKY A;  4ZBM A;  3H1J H;  2PTM A;  2GTA A;  4FK5 C;  5L3D A;  3OE7 G;  2Y4U A;  3ZHU A;  4P2Z A;  2YIC A;  4LFA B;  1Q6U A;  3O9O A;  3DTU B;  2HR3 A;  5LOV B;  2CTR A;  1KYO F;  4YHH O;  3ETG A;  5LOV A;  4LH6 A;  4XDL A;  3QO7 A;  3L72 H;  2NN4 A;  2WA4 A;  2YSU B;  5HFL A;  3DC6 A;  2ITC C;  4Z2W A;  1QR8 A;  1VEW A;  3SPC A;  2IJH A;  3RW0 A;  1OCR C;  4X1I B;  4PJ0 Z;  2OWO A;  4X1I A;  1GN3 A;  2VQE B;  1DGS A;  5B1A C;  3RN4 A;  3D3I A;  2ATK C;  3KZI Z;  3UCS C;  3EHB B;  4D7S A;  4DV7 O;  2A7W A;  1XIL A;  3AG3 C;  4ZHQ A;  2WLI B;  3X2Q B;  1K4C C;  1H2N A;  2FB5 A;  3B4S A;  2WLI A;  4LNU A;  5EIB D;  2HVJ C;  1QLE C;  4NXN B;  1W0K G;  3OUS A;  3J7A U;  2L6L A;  4U3J B;  1KD1 W;  3CE2 A;  1OJH A;  1S77 D;  2ZDI A;  2ZD9 A;  1PL4 A;  2OCC C;  2R9A A;  4LC1 A;  4U3J A;  4DR7 B;  2JIZ G;  2LFS A;  1SQX H;  3A8T A;  1NR1 A;  3ZHV A;  3HB3 B;  1VIB A;  3CCM V;  2K9P A;  2Z0A A;  1FYJ A;  4LFC B;  1YJN V;  1PP9 H;  1RM1 B;  5CBF A;  1RPO A;  2ZE6 A;  4LFB O;  2LP7 A;  2O57 A;  3GWO A;  4JI8 B;  2B5U A;  1AJQ A;  3LDD A;  4DV6 B;  3ZJZ A;  2FYU H;  3CCV V;  2UUC B;  1K33 A;  3R65 A;  4IHJ B;  4GX0 A;  3FX7 A;  2N74 A;  1ZSP A;  1VQ9 V;  4IHJ A;  1XBL A;  4LP8 A;  2V4D A;  1YEW A;  3B77 A;  3MDS A;  2QTS A;  3FYI B;  3QNE A;  3RT3 C;  3CWB H;  4ZIB A;  3ZRW A;  4LF5 B;  2ZXW B;  4F6R B;  3BRC A;  1H2L A;  4F6R A;  1ORQ C;  2HLD G;  1U97 A;  4X66 B;  1EFR G;  2E76 B;  1ARO P;  4DR3 B;  4JI2 O;  5KX5 B;  4DUY B;  2Y0P A;  4TQD A;  4K0K B;  1NTZ H;  2CUG A;  1XNQ O;  4WFE A;  5KX5 A;  3LNM B;  1FXV A;  2PF4 E;  4UFZ A;  4UV8 A;  2Z5U A;  3RYH B;  2EX3 A;  3D36 A;  1PKX A;  2ILM A;  1HNX B;  5IWA O;  2UXD O;  4N21 A;  3RYH A;  1R3J C;  1HR0 O;  1N0N A;  4FJC C;  2IW5 A;  4B3R O;  3CME V;  2XAH A;  1Q90 D;  4CC6 A;  4WF9 V;  3RWR D;  2WAM A;  4WFA V;  3U0Z A;  2Q7G A;  2QDO A;  1F7Y A;  2FL4 A;  4MTX A;  4UCO A;  3H01 A;  4AQY B;  1HNW O;  2XAQ A;  4ZOL B;  4JYB A;  1XQ8 A;  1N32 O;  5CA1 B;  4RQE A;  1GM8 A;  2CAZ C;  3B8M A;  4JGS A;  4ZOL A;  5EBM C;  3PN1 A;  2JJ2 G;  2KG7 B;  5CA1 A;  4HYO A;  5H9C A;  2KG7 A;  4L8J A;  2OYQ A;  2EZO A;  4O4L B;  2WLJ A;  2HJF C;  1J95 A;  4X1K B;  1KEC A;  4DV5 B;  1K34 A;  2AGA A;  2EIN C;  4O4L A;  4LF9 O;  2Y69 C;  4ASU G;  1VQ4 V;  1NI8 A;  3K58 A;  3WFV A;  3TET A;  2E3C A;  3RBZ A;  3UKM A;  2UU9 B;  1OZ0 A;  1Y67 A;  2YUA A;  3BEH A;  3AEI A;  1VQK V;  1QCE A;  4JZ2 A;  1IBM B;  1B06 A;  2GV9 A;  1QBZ A;  3LSS A;  4IYH A;  4RUF A;  3FB8 C;  1NKD A;  3LNN A;  4FFK A;  3L73 H;  1BQZ A;  4H33 A;  5LGN A;  1R3K C;  4JI3 B;  1H38 A;  2Q9L A;  1SRY A;  2XT9 A;  2X7R B;  4GKK O;  2IH3 C;  1IBL B;  5FNV A;  3W7S A;  1ZX3 A;  1YSC A;  2DYS B;  2EIK C;  1AI7 A;  3SJQ C;  4DV1 B;  2RDC A;  1GM9 A;  2DWE C;  2DWD C;  3ABK B;  3RVY A;  4UVA A;  4K8Z A;  4NTY A;  3R66 A;  2B1I A;  5IJ0 B;  4KHP O;  5IJ0 A;  3OR7 C;  1E79 G;  2D3O W;  1VQO V;  1KUQ A;  3SGI A;  2FML A;  3GVM A;  2JEX A;  1IXB A;  2YXL A;  5GON B;  4B3M O;  2YC0 A;  1FJG O;  3IC7 A;  4G28 B;  5GON A;  2XHB A;  2BTO A;  1NZ6 A;  5IJ9 B;  1S3J A;  1GK9 A;  4I7Z B;  3P3P A;  3RGB A;  1VQN V;  2OIE A;  5DED A;  5IJ9 A;  3FKS G;  4YJ3 B;  3E8G A;  1NS1 A;  2ZNJ A;  2R70 A;  4YJ3 A;  1NVP D;  1FD9 A;  1H8E G;  5H5N A;  1I5X A;  4RO2 A;  5L3E A;  4TV8 B;  2RNB A;  3ICX A;  2QKS A;  4ZI7 B;  4TV8 A;  4FM2 A;  3I55 V;  1FS0 G;  4JPR A;  1MAB G;  2HHH O;  4X89 A;  4ZI7 A;  1YTF D;  1K7D A;  1CP9 A;  1H2S B;  3CD6 V;  5K1P A;  4UXN A;  1AP5 A;  3RVZ A;  2QWN B;  2AHZ A;  1WJZ A;  4NR1 A;  3L74 H;  3IAY A;  5CBG A;  1R3L C;  5KMG A;  2QE7 G;  3K59 A;  1V55 B;  1XEQ A;  2RN9 A;  3OMN B;  1N0J A;  2EJ7 A;  1QVG U;  4OX9 O;  3D3Q A;  1S76 D;  1LR1 A;  3IJ4 A;  4LF6 O;  2F95 B;  5CA0 B;  1DLB A;  1XMQ O;  4YHH B;  5CA0 A;  2UUA O;  4J41 A;  1F4N A;  1WP7 A;  2Q67 A;  1Q6H A;  2WLM A;  5D5P A;  2F4V O;  3OAA G;  2DQ3 A;  3DGE A;  5JJJ B;  1XI1 A;  4CS2 A;  2AHY A;  5EZY B;  2P67 A;  1HW7 A;  5IYC O;  1MSW D;  1D2D A;  1KKD A;  2UUB B;  2JGU A;  3K5O A;  5EZY A;  4WFB V;  4QE7 A;  4PA4 A;  3T1H B;  4JZG A;  2EIJ C;  4G2K A;  1SQB H;  3OUF A;  2XUM A;  4GCZ A;  4UB6 Z;  3L9D A;  3EFF K;  1Z5V A;  1JMK C;  4I4T B;  3K5N A;  4X20 B;  4X64 O;  3L71 H;  4X20 A;  5LHH A;  4X8A A;  2GUZ B;  2WA3 A;  5BMV B;  4OPA A;  1Z2G A;  1A32 A;  3LSU A;  4UCR A;  2GUZ A;  3VQY A;  1ZUQ A;  4LF4 O;  1H2M A;  2AW9 A;  2H3O A;  4O4I B;  1I94 O;  4IGG A;  4O4I A;  3SYA A;  1GMG A;  1M57 C;  2DQ0 A;  5JVD B;  1P7B A;  2UXB B;  4GUN A;  5JVD A;  2QKA A;  1NU1 H;  3ABT A;  2JGD B;  3JD0 A;  3CC7 V;  4JYA O;  2EIM B;  2QWO B;  4X62 B;  2JGD A;  3LDC A;  4FLV A;  1WLE A;  4JI4 B;  5DN6 G;  4EEQ A;  2QM8 A;  3ML0 A;  3P3N A;  1PD3 A;  3TGU H;  2IJJ A;  5KAI Z;  1HNZ B;  1FFX B;  3UQ8 A;  4JI6 O;  1WA8 A;  1BQ0 A;  2AXT Z;  1FFX A;  4LF7 O;  3MAQ A;  1KP2 A;  4H13 B;  3LDE A;  2XAG A;  4MT8 A;  2WLN A;  5IE9 A;  2HVK C;  1MZF A;  1SQV H;  2ODM A;  2M6Y A;  4YJ2 B;  3K0D A;  4MS2 A;  3CPW U;  4JI7 B;  4CC5 A;  1AR1 B;  4AHC A;  3JAK B;  4B3T B;  4JAA A;  4UVB A;  4YJ2 A;  4NKG B;  2GDS A;  5KA6 A;  3ETD A;  3JAK A;  2QSA A;  2VQF O;  3CHX A;  4JI0 B;  4LR3 A;  3IFX A;  5LMN B;  4O2B B;  3ASO C;  1H8H G;  4O4H B;  1M5I A;  4JAS A;  1TA8 A;  4O2B A;  4O4H A;  1LUW A;  4LF8 B;  5B3S C;  2W0X A;  4JYC A;  3ETQ A;  3K57 A;  5LYJ A;  4K8X A;  5EIB C;  4DV2 B;  2ZE5 A;  4MVO A;  4GKJ O;  3QG5 A;  1NTM H;  3ZMS A;  2HEP A;  3A0B Z;  3HKE A;  4JF3 A;  4BIO A;  3G6E V;  5LMU O;  2ADQ B;  1ZLZ A;  1VQM V;  4GX5 A;  1WPB A;  1JJ2 U;  4EFB A;  3MD0 A;  3JAR B;  1L1F A;  3K5M A;  4ICG A;  5TIS Z;  4NVP A;  3ZRX A;  2RJZ A;  1IZ3 A;  4OXS A;  3JAR A;  4PV1 B;  3E8F A;  2ARH A;  4EKW A;  3HKC A;  4P30 A;  1GAX A;  2ZE8 A;  1FXK C;  1VMG A;  4DR5 B;  4H37 A;  1PPJ H;  4GT1 A;  3TCU A;  4DV4 O;  1M9N A;  1R73 A;  2N04 A;  5JJE B;  5L3G A;  1W2B U;  2DW4 A;  4GLX A;  5FLX N;  4DR2 B;  3G71 V;  4JV5 B;  4HAM A;  4WCE V;  3K3W A;  1F4M A;  4FLW A;  3K06 A;  1XL4 A;  4N23 A;  1SA0 B;  1X4T A;  1VF6 C;  1OCR B;  4JI5 O;  1SA0 A;  2UXC B;  3TJT A;  3RYF B;  1DTO A;  5B1A B;  3ABM C;  1SKV A;  4DR6 O;  2W6I G;  3RYF A;  4DUZ B;  1KMI Z;  5BXZ A;  3K9A A;  2GBO A;  3OM3 B;  3OGC C;  1M56 C;  4FMT A;  1J5E B;  1XHZ A;  2BTQ B;  1MSD A;  1F51 A;  3FYE B;  2B1G A;  3NXS A;  5JCO C;  3AG3 B;  3E8B A;  4DW0 A;  1IBK B;  2LGW A;  1XMO O;  3T1Y B;  3ZRS A;  2F93 B;  5CN0 A;  1O9H A;  5A9G A;  2IM9 A;  4YIP A;  2MK3 A;  4LBE C;  4LCU C;  3KG2 A;  4TSF G;  2QA4 V;  1QLE B;  1N34 O;  4HZ3 A;  3JD2 A;  5K1X A;  3GB7 C;  2OCH A;  1PNM A;  3A0H Z;  1G8M A;  3BAB A;  2OCC B;  1N33 B;  2Q68 A;  3OMI B;  2WPD G;  1I08 A;  4B7K A;  4PEL A;  1TUE B;  2Q5Z A;  2X6B A;  4UCT A;  2E5L B;  3P32 A;  3CCL V;  3BA8 A;  3CJH B;  5LBQ A;  3QTC A;  2A06 H;  2ZE7 A;  5LP6 C;  3ZS8 C;  3BA9 A;  1Q6I A;  1SQG A;  3C3T A;  4UUJ C;  1S0V A;  2P7T C;  1S5L Z;  2G38 A;  4UVC A;  1XNR O;  2Q7E A;  1ZWI C;  1KBH A;  4J9Y B;  1V54 C;  3AG1 C;  5EC1 C;  3JYC A;  2VWK A;  3I5D A;  4IYI A;  1JQ0 A;  3U10 A;  5H6R A;  4JI1 B;  1YI2 V;  3AG7 A;  3ASN C;  5BY1 A;  4B3S B;  2CTQ A;  2WSS G;  2YS8 A;  2Q8V A;  2A79 B;  3HPL C;  3E86 A;  1WN7 A;  2A3Q A;  2E75 B;  1BCC H;  3CCR V;  1K3E A;  2ITD C;  1PM9 A;  4NTX A;  1UPG A;  1X59 A;  2H94 A;  2XND G;  1WP8 A;  1E1Q G;  2VS0 A;  1OCO C;  5DM6 V;  4Z1V A;  1FKA O;  3FFQ A;  3E83 A;  5BR8 B;  3P30 A;  1QHT A;  5BZB A;  4PA9 A;  4DR1 O;  4DV0 O;  1AI4 A;  5KHK A;  1EM1 A;  1N36 B;  3ZIA G;  4FZ1 A;  4CH6 A;  5KAF Z;  5EC2 C;  5IY5 C;  1NVP B;  1JJO A;  1Q7Y W;  2EIN B;  3I56 V;  2Y69 B;  4X9Q A;  4G27 B;  3TK1 A;  4X1K A;  3OTO B;  3ABL C;  3WB1 A;  4CBC A;  5IYB O;  2ZT9 B;  4MSW C;  1YTF B;  3KCX A;  1RFY A;  1I0H A;  4PA6 A;  4E4E A;  2YIB D;  3FD9 A;  4BW5 A;  1EZJ A;  4P9P A;  1I94 B;  3H1K H;  2HFE C;  1YJW V;  4WFF A;  2PZS A;  5DEC A;  4YY3 B;  2AZ2 A;  3K79 A;  4X65 B;  4LFA O;  4PDM A;  4RQF A;  3QO8 A;  1VP7 A;  4L87 A;  5E1A C;  1VQ8 V;  4I0X B;  3FB7 C;  4QPK A;  2NR5 A;  4I0X A;  4QE9 A;  2X6C A;  3CB2 A;  5B1B C;  1YHQ V;  2EIK B;  1GO3 F;  3BPZ A;  1SC5 B;  4AI8 A;  1BHB A;  2F23 A;  1HP8 A;  2VQE O;  5KA5 A;  2DJV A;  2JS5 A;  5KHG A;  3ZMV A;  4MVZ A;  1GTO A;  1BHA A;  3K9S A;  3ZMU A;  1VF7 A;  2L35 A;  3SPG A;  4PDV A;  3TXQ A;  2P06 A;  2FTK A;  4Q6G A;  4RAI A;  5JQG B;  3CRC A;  1TAE A;  3AG4 C;  2Q7H A;  2JJ1 G;  5JQG A;  2E74 B;  3E22 B;  1CPY A;  1D5A A;  3L70 H;  3E22 A;  1QNM A;  1K8A W;  5IYD O;  2EIL C;  2DYR C;  1VQL V;  5H2F Z;  4DK1 A;  3N27 A;  2A9H A;  4PA3 A;  1G1X B;  4PDL A;  4J7J A;  4NXN O;  5JH7 B;  1Q3E A;  3H9V A;  2ZQM A;  1ZL8 B;  5JH7 A;  4DO2 A;  4C7U A;  3LUT B;  1ZL8 A;  3QF7 A;  3SYC A;  4KUM A;  4KL1 A;  5GTI Z;  1IXM A;  5LL6 Y;  2IJI A;  4DR7 O;  1WNS A;  1NH2 D;  1ZAU A;  4MW3 A;  1AP6 A;  2DOS A;  1O9G A;  3K04 A;  5L3C A;  4MTO A;  4LFC O;  3HKD B;  4FM0 A;  2IJK A;  1JOY A;  4FLZ A;  4I9Q A;  4BAY A;  1R1B A;  2ZM6 B;  1JVM A;  1JPX A;  1R6N A;  1P84 F;  5KUM A;  4R8C A;  1GH6 A;  1AJN A;  4JI8 O;  3AG2 C;  4KP4 A;  4R7C A;  4DV6 O;  3RFR A;  3ZHQ A;  2UUC O;  2LW1 A;  3RYC B;  5L3F A;  2HG5 C;  2GHY A;  4BIU A;  3CCU V;  4NYK A;  1UJW B;  4FZ0 A;  3RYC A;  2X0L A;  4XDJ A;  1AJP A;  1AVM A;  2K1E A;  1BE3 H;  4LF5 O;  2OTL V;  5EK0 A;  2QTO A;  2WLH A;  4DV4 B;  1OCC C;  4DV3 O;  1US6 A;  3OEE G;  1JCH A;  4J7K A;  3CRA A;  4H44 B;  1TUB B;  4X66 O;  1GKF A;  5EBW C;  2MW2 B;  4PHZ A;  1TUB A;  2IU3 A;  4DR3 O;  5L3B A;  4DUY O;  4K0K O;  4F6E A;  3UT5 B;  2JRI A;  3UT5 A;  1AIL A;  4FLY A;  4JI5 B;  4XBF A;  1HNX O;  3T4D A;  5CBH A;  4I5S A;  2EIJ B;  2ZR2 A;  4WFH A;  4MTG A;  2BSK B;  2PY5 A;  2RQ6 A;  1XUQ A;  4U3F H;  4DV7 B;  1KB9 F;  2BSK A;  5AG2 A;  3OD4 A;  1B04 A;  2A0L A;  1H2G A;  2VRZ A;  4AQY O;  2M7W A;  2Q4P A;  3O65 A;  3OGI B;  1YCI A;  4I4T A;  1HWY A;  3F5T A;  1URF A;  1K4D C;  2LGQ A;  3UO2 A;  4GX2 A;  1IVS A;  1IUR A;  3JD3 A;  1BT8 A;  5BMV A;  5IYZ B;  3M8A A;  3W7U A;  1AR4 A;  2XAS A;  3A0R A;  5IYZ A;  5B1N A;  2PGG A;  4X88 A;  3NR7 A;  1Q43 A;  5EBL C;  3APQ A;  4MVQ A;  3SPH A;  4DV5 O;  1W59 A;  1SET A;  4FLU A;  1QVF U;  4DR4 O;  1RPR A;  3UM7 A;  1M57 B;  3CRM A;  4BWA A;  1G6U A;  4X1Y B;  4O4J B;  1XRE A;  4X1Y A;  2UU9 O;  4O4J A;  4A5U B;  3CYO A;  3U11 A;  1IBM O;  4O2A B;  1OCZ C;  4O2A A;  1QLN A;  2ZIM A;  3C3S A;  4LFB B;  3W7T A;  1QQC A;  3G80 A;  4W4L A;  3E35 A;  1UFI A;  4JI3 O;  4KXR A;  2BOC C;  1AI5 A;  2HP8 A;  4UV9 A;  4PA7 A;  4JAU A;  1TVK B;  2LFR A;  3ZHS A;  1IBL O;  2QWP B;  3Q4H B;  1TVK A;  1F23 A;  1P4R A;  5JJN B;  3Q4H A;  1SF9 A;  2CTP A;  2P22 C;  1T5E A;  3TXS A;  3SJC C;  4J42 A;  5IT9 N;  3VOU A;  1YIJ V;  4CH3 A;  3JAM N;  3BVO A;  4J7Z A;  4JI2 B;  3HKB B;  3W7W A;  3ASO B;  1XNQ B;  1I7F A;  2D2C B;  3HKB A;  1KKC A;  5F2V O;  3WB0 A;  1AI6 A;  5B3S B;  3ABU A;  1M1K W;  4FLX A;  1MOF A;  5D5Q A;  3WG7 C;  5IWA B;  4IIJ B;  2UXD B;  1HR0 B;  4JAV A;  4AIL C;  3GWK C;  2QGN A;  4IIJ A;  4B3R B;  4OGQ B;  4TQF A;  1MA1 A;  2Q73 A;  3FB5 C;  1L0N H;  2EUL A;  4DXW A;  3SYO A;  3T2M A;  3DSQ A;  3H1H H;  2R9R B;  2YEV B;  5LHI A;  1E1R G;  1HNW B;  3K0G A;  1N32 B;  2YEV A;  3JSN A;  3N2K B;  4DV0 B;  4K3A A;  3B40 A;  1L8D A;  5J9P C;  3WU2 Z;  3N2K A;  4XDK A;  5KHH A;  5LXT B;  1FAF A;  1R3I C;  4TWK A;  4PD4 F;  1SZT A;  4GX1 A;  5LXT A;  3DC5 A;  1CXZ B;  1S5J A;  2YXH A;  4LF9 B;  1FXK B;  1FXK A;  2RCV A;  3K08 A;  1WAZ A;  4FVM A;  3E2E A;  1COW G;  4PI0 A;  4FIP C;  4J9Z B;  2CGN A;  2ZNI A;  2N05 A;  1WB7 A;  2CTW A;  4ZKI A;  1SQQ H;  1K73 W;  1AR5 A;  3APO A;  4BW9 A;  3CC4 V;  1VF6 A;  2PYL A;  1XHX A;  3JAS B;  4LWS B;  3ABM B;  3ZED A;  1LUV A;  3JAS A;  4LWS A;  4QGP A;  4U7N A;  5LGT A;  2DN9 A;  2W0F C;  4GKK B;  1M56 B;  2QKC A;  1Y74 B;  3SYQ A;  3BAA A;  3STL C;  4HNA B;  2YI8 A;  1NBM G;  2HKO A;  2UUB O;  1Y74 A;  1G4Y B;  2V1D A;  4HNA A;  1BS3 A;  2BTQ A;  5JCO A;  3SYP A;  2AZ0 A;  3IC9 A;  3E8H A;  2P6J A;  2GSM B;  3QVN A;  1K97 A;  4YXW G;  3T1H O;  4QJF B;  2LW7 A;  4PI2 A;  4KHP B;  4B08 A;  2JVD A;  2DE0 X;  3B2E E;  4J80 A;  3OW2 U;  3ZBH A;  2VWJ A;  4K35 A;  2Z3Y A;  4CS3 A;  4TV9 B;  4ZHQ B;  4IT5 A;  3OEH G;  4TV9 A;  4B3M B;  2R72 A;  1FJG B;  3CRR A;  2RMK B;  1KQS U;  3CMA V;  3X2Q C;  4LNU B;  1WB8 A;  2PYJ A;  3RYI B;  4TUY B;  5JWP A;  2YI9 A;  4MVS A;  3RYI A;  4TUY A;  1Q82 W;  1YDX A;  2BOB C;  1M93 A;  4B7E A;  1RP3 B;  2ZDI C;  3H1I H;  2H8P C;  1QR9 A;  3E89 A;  5LP6 B;  2HHH B;  2UXB O;  3CJH A;  1B3Q A;  3F7V C;  5B5E Z;  2IBZ H;  5LP6 A;  3S3X A;  1Q8I A;  4W4K A;  2YIB A;  2F66 C;  4X62 O;  3ZHR A;  3W7X A;  2QM4 A;  3BHP A;  4H0L B;  4JI4 O;  2X6A A;  4NB5 A;  1V54 B;  3AG1 B;  3CC2 V;  1RM1 C;  4CH4 A;  1HNZ O;  4JTD B;  1PNK A;  3JD1 A;  3JCU Z;  3ASN B;  4MVU A;  2UXX A;  4JTC B;  5C93 A;  3JAW B;  2P4K A;  2LQT A;  1R6T A;  3AK3 A;  2WWW A;  3JAW A;  4U7O A;  4CS4 A;  3ZRW B;  2JEU A;  4OX9 B;  2DMX A;  3CCS V;  1N8R W;  2ZIO A;  1MG1 A;  1VF5 B;  1MZE A;  4JI7 O;  2ZXW C;  3CX5 F;  4LF6 B;  4B3T O;  1EN4 A;  4DV3 B;  1XMQ B;  2JS3 A;  2EJR A;  5KLV H;  1DF4 A;  3EVK A;  2UUA B;  2F4V B;  4JI0 O;  4NXM O;  5LMN O;  1OCO B;  3T4Z A;  1XDC A;  3D36 C;  3K03 A;  4WFG A;  4DW1 A;  1GRJ A;  1DK1 A;  1BSM A;  4LF8 O;  2ZR3 A;  2OT5 A;  2XOK G;  1NJI W;  2WLL B;  3FAV B;  4P9O A;  3MHS C;  2WLL A;  4DV2 O;  3STZ C;  3FAV A;  5IY5 B;  4FFB B;  3IGA C;  3SJA C;  2R9I A;  3VQX A;  1BMF G;  4FFB A;  4X64 B;  4BIZ A;  1PL0 A;  3ABL B;  1IX9 A;  1YIT V;  2C2A A;  3ZRV A;  1Y66 A;  1NH2 B;  4IL6 Z;  4I9W A;  4UCU A;  1I5Y A;  3BCC H;  4LF4 B;  2YIA A;  2Y48 A;  2CH7 B;  2ZCE A;  3B09 A;  2CH7 A;  2CDY A;  1JR9 A;  3ZHT A;  4DR5 O;  4DR4 B;  1OHH G;  5C8Y B;  5FPR A;  3HR0 A;  3M7M X;  2KSD A;  1JFF B;  5CA3 A;  5A2Q N;  1IDS A;  2QR4 A;  2V7Q G;  5C8Y A;  4WBN B;  1JFF A;  3H1L H;  4QNH B;  1EBO A;  1PV0 A;  1Y76 B;  1NT2 B;  4WBN A;  4DR2 O;  3T1C A;  3QO5 A;  4JYY A;  4JV5 O;  1SZX A;  4JYA B;  3WB2 A;  1Y76 A;  2WLK A;  1FXH A;  3FB6 C;  1YXB A;  4PDR A;  3SPI A;  1S72 V;  3CXH F;  3G67 A;  3CS5 A;  5ITZ B;  3VQV A;  4BR6 A;  5B1B B;  1Q86 W;  5ITZ A;  5CMU A;  3ETE A;  2UXC O;  5FL7 G;  3D8C A;  2YDE A;  3AK2 A;  3LSQ A;  4JI6 B;  4FLT A;  2CGO A;  1VAR A;  2CK3 G;  4EFE A;  4UCV A;  4ABM A;  1M90 W;  4LF7 B;  2P5O A;  4DUZ O;  5FNV B;  1B6Q A;  3CRQ A;  1SQP H;  3SPJ A;  1NQT A;  1J5E O;  3CP1 A;  4HBN A;  3THO A;  4DRX B;  3J81 N;  2DYS C;  4DRX A;  3AG4 B;  1IBK O;  4R50 A;  3ABK C;  2Q69 A;  3T1Y O;  2ETN A;  2VQF B;  2GTS A;  3G4S V;  2EIL B;  2DYR B;  2XTA A;  2NLJ C;  2QJ1 A;  2JDI G;  4F4L A;  3UO3 A;  1QU7 A;  1L0L H;  2EBO A;  1THZ A;  1PNL A;  2LJ2 A;  3A2F A;  1FFT B;  1N33 O;  1NR7 A;  1K9M W;  3EXA A;  1Y6X A;  2Q0O C;  4GKJ B;  3S3W A;  3C90 A;  3VQW A;  5LGU A;  2B9Z A;  2E5L O;  1EN5 A;  1VQ6 V;  3CXC U;  5LMU B;  3HKD A;  1MMM A;  2FKX A;  2IU0 A;  4TT3 G;  1EZV H;  1BL8 A;  3AG2 B;  2W6J G;  3OFN G;  1K92 A;  2YID A;  3BY6 A;  4KFM A;  1HDJ A;  1YZB A;  4MVM A;  4Q20 A;  4GYC B;  5LA6 B;  1ENV A;  1TGO A;  5J2U B;  1OCC B;  4JI1 O;  5LA6 A;  4Z1M G;  3ZCC A;  5J2U A;  2BE3 A;  2P4V A;  5KMG B;  4B3S O;  1SQF A;  1KU9 A;  5H6Q A;  3CCE V;  5IDJ A;  2UXN A;  5E79 Z;  1V55 C;  2PI5 A;  1D5N A;  1P7G A;  1XOU A;  3MHH C;  5GW7 A;  2QWR B;  2ADP A;  4J11 A;  3SDL A;  4D7T A;  2QEX V;  2F43 G;  4MVR A;  1ZTE A;  4EB6 B;  3CCQ V;  2ZKO A;  3OT7 A;  4DR6 B;  3B8N A;  4MW8 A;  4EB6 A; 
#chains in the Genus database with same CATH homology
 2R9R B;  2YEV B;  3ZN0 A;  5LHI A;  1E1R G;  1SRY A;  1K5S A;  3K0G A;  1XL6 A;  2X7R B;  2YEV A;  2P90 A;  2IH3 C;  2PI4 A;  1W0J G;  5J9P C;  3ZMZ A;  4UUJ C;  3F5W C;  2P7T C;  2IH1 C;  1JX9 A;  4XDK A;  3W7S A;  1S0V A;  1ROP A;  1YSC A;  2DYS B;  4UVC A;  2EIK C;  1AI7 A;  3SJQ C;  1R3I C;  4TWK A;  1ZWI C;  4J9Y B;  3AG1 C;  1V54 C;  1SZT A;  1GM9 A;  2DWE C;  2DWD C;  3ABK B;  4GX1 A;  4UVA A;  3JYC A;  3RVY A;  3M99 B;  1JQ0 A;  2B1I A;  5H6R A;  1VQ7 V;  1FXK B;  1YI2 V;  1Q81 W;  3ASN C;  3PJS K;  3OR7 C;  1E79 G;  2D3O W;  1FXK A;  1VQO V;  2WSS G;  4QPJ A;  3K08 A;  2A79 B;  2JEX A;  4QIW F;  1COW G;  3E2E A;  3HPL C;  3E86 A;  4FIP C;  4J9Z B;  3IC7 A;  4G28 B;  3F7Y C;  1S3J A;  3OR6 C;  4ZKI A;  1GK9 A;  1K73 W;  1VQN V;  5KUK A;  3FKS G;  1K3E A;  3CCR V;  2ITD C;  2QM7 A;  1K5Q A;  3E8G A;  1OCZ B;  3CC4 V;  2H94 A;  2XND G;  1VQP V;  1NVP D;  1YJ9 V;  1H8E G;  2XAJ A;  3ABM B;  1I5X A;  4RO2 A;  5L3E A;  1E1Q G;  1OCO C;  5DM6 V;  3JD4 A;  2QKS A;  4U7N A;  5LGT A;  2W0F C;  5EC1 C;  1M56 B;  3I55 V;  1FS0 G;  4JPR A;  3VBB A;  1MAB G;  3E83 A;  3STL C;  3P30 A;  3SYQ A;  5HFM A;  4X89 A;  3OMA B;  5BZB A;  1YTF D;  1K7D A;  1CP9 A;  1NBM G;  2EIM C;  2HKO A;  4PA9 A;  3CD6 V;  1AI4 A;  1G4Y B;  2XAF A;  4UXN A;  2V1D A;  3SYP A;  3ZIA G;  3RVZ A;  4MTF A;  3E8H A;  2P6J A;  2GSM B;  1KC8 W;  1K97 A;  4YXW G;  4QJF B;  2AHZ A;  4RUE A;  1R6K A;  5EC2 C;  5IY5 C;  1NVP B;  5B1N A;  1Q7Y W;  2Q6A A;  3OW2 U;  2EIN B;  2Z3Y A;  3I56 V;  2Y69 B;  4G27 B;  2NNU A;  3TK1 A;  4E2L A;  3ABL C;  3OEH G;  4CBC A;  5CBG A;  5IYB O;  4MSW C;  1YTF B;  1R3L C;  2QE7 G;  1GM7 A;  4PA6 A;  1V55 B;  3OMN B;  5LHG A;  1KQS U;  1WPX A;  3JCZ A;  3CMA V;  3X2Q C;  4BW5 A;  1QVG U;  1EZJ A;  1DF5 A;  1S76 D;  4P9P A;  3WG7 B;  1LNQ A;  2HFE C;  1S5H C;  1YJW V;  4WFF A;  1DLB A;  4MVS A;  3K79 A;  1Q82 W;  2BOB C;  1F4N A;  2Q67 A;  2WLM A;  4FPP A;  2JK5 C;  3OAA G;  2ZDI C;  4JTA B;  4PDM A;  4RQF A;  1KP3 A;  2DQ3 A;  3QO8 A;  2H8P C;  4L87 A;  3DGE A;  1QR9 A;  3E89 A;  5E1A C;  2AHY A;  3F7V C;  2P67 A;  4R6Z A;  5IYC O;  1VQ8 V;  1SES A;  1MSW D;  1KKD A;  3FB7 C;  4QPK A;  4CZZ A;  4QE9 A;  2X6C A;  4WFB V;  3W7X A;  5B1B C;  1YHQ V;  2EIK B;  2OTJ V;  2EZP A;  4QE7 A;  4PA4 A;  1GO3 F;  2X6A A;  1V54 B;  3AG1 B;  2KB1 A;  1VQ5 V;  3CC2 V;  2EIJ C;  4G2K A;  1RM1 C;  1BHB A;  3OUF A;  5B1O A;  4GCZ A;  5KA5 A;  3CCJ V;  4JTD B;  3EFF K;  1PNK A;  1CEZ A;  3JD1 A;  3ZMV A;  4MVZ A;  1GTO A;  1Y4M A;  3ASN B;  4MVU A;  1BHA A;  2UXX A;  4JTC B;  5C93 A;  3ZMU A;  3SPG A;  5LHH A;  4PDV A;  2WWW A;  4X8A A;  2FTK A;  4RAI A;  4U7O A;  1SER A;  3ZRW B;  3ZN1 A;  2JEU A;  3AG4 C;  3CCS V;  1N8R W;  2JJ1 G;  3ZMT A;  1MG1 A;  4ZBM A;  1CPY A;  2ZXW C;  4FK5 C;  5L3D A;  2EJR A;  1K8A W;  1DF4 A;  5IYD O;  2EIL C;  3OE7 G;  2DYR C;  1VQL V;  4P2Z A;  2A9H A;  4PA3 A;  3SYA A;  3DTU B;  4PDL A;  2HR3 A;  1GMG A;  1M57 C;  2DQ0 A;  2ZQM A;  1OCO B;  1P7B A;  3ETG A;  4DO2 A;  3T4Z A;  4XDL A;  3LUT B;  3QO7 A;  3K03 A;  2YSU B;  4WFG A;  3SYC A;  3ABT A;  4KUM A;  5HFL A;  2ZR3 A;  1IXM A;  3JD0 A;  2ITC C;  3CC7 V;  2IJI A;  2EIM B;  1QR8 A;  2OT5 A;  1NH2 D;  2XOK G;  3SPC A;  3LDC A;  1NJI W;  2IJH A;  3RW0 A;  1WLE A;  1OCR C;  2WLL B;  4MW3 A;  5DN6 G;  2QM8 A;  3K04 A;  3ML0 A;  1PD3 A;  4P9O A;  3MHS C;  2WLL A;  3STZ C;  2IJJ A;  5L3C A;  4MTO A;  5IY5 B;  5B1A C;  3IGA C;  3D3I A;  2ATK C;  2IJK A;  2R9I A;  1BMF G;  1JOY A;  3EHB B;  4BIZ A;  4BAY A;  1JVM A;  1JPX A;  1R6N A;  5KUM A;  1PL0 A;  4R8C A;  1KP2 A;  1AJN A;  3ABL B;  3LDE A;  3AG2 C;  2XAG A;  4KP4 A;  4R7C A;  1YIT V;  2C2A A;  4MT8 A;  2WLN A;  3ZRV A;  3AG3 C;  1Y66 A;  5L3F A;  1NH2 B;  2WLI B;  2HG5 C;  2HVK C;  2GHY A;  4BIU A;  3CCU V;  3X2Q B;  1UJW B;  1K4C C;  3K0D A;  1I5Y A;  4I9W A;  4MS2 A;  3CPW U;  2X0L A;  4XDJ A;  2WLI A;  2Y48 A;  1AJP A;  1AR1 B;  4UVB A;  2K1E A;  5KA6 A;  2HVJ C;  3ETD A;  2OTL V;  5EK0 A;  2QTO A;  2WLH A;  1OCC C;  1QLE C;  3OEE G;  1OHH G;  1JCH A;  1W0K G;  3IFX A;  1GKF A;  3OUS A;  5EBW C;  5CA3 A;  3ASO C;  1H8H G;  2V7Q G;  4JAS A;  2IU3 A;  4QNH B;  1EBO A;  5L3B A;  1KD1 W;  1S77 D;  2ZDI A;  2ZD9 A;  3T1C A;  3QO5 A;  2OCC C;  4LC1 A;  5B3S C;  4JYC A;  2WLK A;  2JIZ G;  1FXH A;  2LFS A;  3FB6 C;  4PDR A;  4XBF A;  1NR1 A;  3SPI A;  1S72 V;  3HB3 B;  5B1B B;  1Q86 W;  3CCM V;  3T4D A;  5CBH A;  4I5S A;  5CMU A;  3ETE A;  1YJN V;  2EIJ B;  4MVO A;  2ZR2 A;  5FL7 G;  5CBF A;  3LSQ A;  1RM1 B;  1RPO A;  4WFH A;  3ZMS A;  4MTG A;  2CK3 G;  1M90 W;  2LP7 A;  3GWO A;  4JF3 A;  3G6E V;  2A0L A;  1B6Q A;  2B5U A;  1AJQ A;  1H2G A;  3LDD A;  3ZJZ A;  2M7W A;  3SPJ A;  3CCV V;  1K33 A;  1NQT A;  3R65 A;  1HWY A;  1VQM V;  3CP1 A;  4GX0 A;  4GX5 A;  1JJ2 U;  3MD0 A;  1L1F A;  1VQ9 V;  4LP8 A;  1K4D C;  2DYS C;  3AG4 B;  3B77 A;  3ZRX A;  4GX2 A;  4OXS A;  3FYI B;  3QNE A;  4R50 A;  3JD3 A;  3ABK C;  3ZRW A;  2Q69 A;  2ZXW B;  3E8F A;  3W7U A;  4EKW A;  4P30 A;  2XAS A;  3A0R A;  1FXK C;  1ORQ C;  2HLD G;  2EIL B;  4H37 A;  2DYR B;  4MVQ A;  4X88 A;  4GT1 A;  5EBL C;  3SPH A;  3G4S V;  2NLJ C;  1EFR G;  1SET A;  3TCU A;  1M9N A;  1QVF U;  1ARO P;  1R73 A;  5L3G A;  1RPR A;  3UM7 A;  2JDI G;  1W2B U;  1M57 B;  2DW4 A;  4F4L A;  2EBO A;  3G71 V;  4WFE A;  1THZ A;  3LNM B;  4HAM A;  3K3W A;  1FXV A;  1F4M A;  1PNL A;  4WCE V;  4UV8 A;  3K06 A;  1XL4 A;  2Z5U A;  4N23 A;  1FFT B;  3D36 A;  3CYO A;  1PKX A;  1NR7 A;  4N21 A;  1K9M W;  1R3J C;  4FJC C;  1OCR B;  2IW5 A;  1OCZ C;  3CME V;  2XAH A;  1DTO A;  5LGU A;  5B1A B;  4WF9 V;  1QLN A;  3ABM C;  2WAM A;  4WFA V;  3W7T A;  2W6I G;  1VQ6 V;  3CXC U;  3E35 A;  4MTX A;  3K9A A;  3OM3 B;  3H01 A;  3OGC C;  1M56 C;  2BOC C;  4FMT A;  2IU0 A;  1AI5 A;  2XAQ A;  4TT3 G;  4UV9 A;  4JYB A;  1BL8 A;  1F51 A;  2W6J G;  3AG2 B;  3FYE B;  2B1G A;  3NXS A;  4PA7 A;  4RQE A;  4JAU A;  3AG3 B;  1GM8 A;  3B8M A;  3OFN G;  4JGS A;  3E8B A;  5EBM C;  2JJ2 G;  1K92 A;  2LFR A;  3BY6 A;  4KFM A;  1F23 A;  4HYO A;  1P4R A;  5H9C A;  3ZRS A;  2EZO A;  5CN0 A;  4MVM A;  2WLJ A;  4Q20 A;  2MK3 A;  4LBE C;  4LCU C;  2HJF C;  3KG2 A;  1ENV A;  1J95 A;  1KEC A;  1K34 A;  4TSF G;  2EIN C;  2QA4 V;  1OCC B;  1QLE B;  3VOU A;  1YIJ V;  4Z1M G;  2Y69 C;  4HZ3 A;  3ZCC A;  4ASU G;  3JD2 A;  3W7W A;  1VQ4 V;  3ASO B;  3GB7 C;  3WFV A;  3TET A;  5H6Q A;  3CCE V;  5IDJ A;  3RBZ A;  1PNM A;  2UXN A;  1V55 C;  3UKM A;  1G8M A;  1AI6 A;  2OCC B;  5B3S B;  1OZ0 A;  3ABU A;  1M1K W;  2PI5 A;  2Q68 A;  1MOF A;  3BEH A;  3AEI A;  3MHH C;  3OMI B;  3WG7 C;  1VQK V;  5GW7 A;  1QCE A;  2WPD G;  3LSS A;  4JAV A;  1QBZ A;  4PEL A;  4RUF A;  3FB8 C;  1NKD A;  2QEX V;  1TUE B;  2X6B A;  3FB5 C;  2F43 G;  4MVR A;  4H33 A;  4DXW A;  3CCQ V;  3SYO A;  3B8N A;  3P32 A;  4MW8 A;  3T2M A;  5LGN A;  5LBQ A;  3CCL V;  1R3K C;  1H38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...