3E8HA

Crystal structure of the the open nak channel-k+ complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
91
structure length
91
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGDGNFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title Structural analysis of ion selectivity in the NaK channel
pubmed doi rcsb
source organism Bacillus cereus
total genus 31
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3e8hA00
4R50A 5B1BC 4PA3A 2BOCC 3SPCA 4WFEA 3X2QC 5B1AC 2EILC 1R3IC 4P9PA 4X89A 3OUFA 2Q69A 4QE9A 3T4DA 1ZWIC 2EIKC 3ABLC 2EIJC 3IFXA 4DXWA 2A79B 4H33A 3TCUA 3SJQC 2HVJC 2DYSC 3RW0A 4HYOA 4LBEC 1P7BA 4X88A 3E86A 2ATKC 3EFFK 2Q6AA 4P2ZA 3AG3C 5BZBA 4WFGA 2EIMC 5EC2C 4J9YB 4R8CA 4RO2A 2WLNA 4P30A 2ZD9A 2BOBC 4J9ZB 1K4CC 3TETA 3E8FA 3ABMC 4P9OA 4PDRA 1V54C 2IH3C 5E1AC 2X6BA 3K0GA 3BEHA 4EKWA 2DYRC 4PA4A 3T4ZA 1R3KC 2HG5C 1OCRC 4I9WA 2AHYA 4G27B 2R9RB 4R7CA 2WLKA 3AG2C 4PDVA 3K08A 4MVMA 3F7YC 2X6AA 3E89A 5EBMC 2K1EA 4MVQA 4BW5A 4GX1A 4MW8A 4XDJA 4MVRA 4XDKA 2HVKC 3SYCA 1KKDA 3KG2A 4OXSA 2EINC 3R65A 3HPLC 3PJSK 3T1CA 3STZC 4H37A 4HZ3A 4QE7A 1R3LC 4PA7A 4GX5A 2DWDC 3F5WC 2WLIB 4LCUC 4UUJC 1R3JC 5KUMA 2QKSA 3FB6C 3ASOC 5IY5C 4X8AA 2JK5C 2WLIA 3K04A 3FB5C 5B3SC 1OCCC 3VOUA 3OUSA 4RAIA 2WLLB 4R6ZA 1K4DC 3K03A 4WFFA 4RUFA 4WFHA 1G4YB 2IH1C 3UKMA 4PDMA 3RVZA 3SYAA 3F7VC 3LDDA 4QNHB 4MVSA 5CBHA 3OR6C 2KB1A 4RUEA 3K06A 5EC1C 2HJFC 1OCOC 2H8PC 3STLC 2QTOA 1M57C 3LNMB 2HFEC 2X6CA 1XL4A 2W0FC 4MS2A 3UM7A 2Q67A 3SYPA 4GX2A 3AG1C 4MTGA 4TWKA 5EK0A 3LDEA 4F4LA 3SPIA 5CBFA 5CBGA 3E83A 3SPHA 4PA6A 1J95A 1S5HC 4GX0A 3WG7C 3ZRSA 2WLJA 2A0LA 2AHZA 3E8GA 4MVUA 3OR7C 5EBLC 2WLHA 3SPGA 3LUTB 3GB7C 1V55C 3ASNC 4KFMA 4MW3A 4PA9A 4XDLA 4MTOA 3FB7C 4MVZA 2A9HA 3E8BA 4JTAB 4ZBMA 3RBZA 5J9PC 1BL8A 4MSWC 3AG4C 2WLMA 3SYOA 5EBWC 3FB8C 3T2MA 2DWEC 2ITCC 3K0DA 3RVYA 3ZJZA 3JYCA 5KUKA 2OCCC 4MVOA 4G28B 2ITDC 2WLLA 4LP8A 2Y69C 2ZXWC 1QLEC 1JVMA 2Q68A 1LNQA 4MTFA 3ABKC 2P7TC 3OGCC 1XL6A 1ORQC 4JTCB 4JTDB 4PDLA 3IGAC 3SYQA 4CBCA 1OCZC 3SPJA 2YEVA 3LDCA 1M56C 3E8HA 2NLJC
chains in the Genus database with same CATH superfamily
2XHBA 3OGIB 2BOCC 3WB1A 3SJBC 1FFTB 1AI7A 2YSUB 4EEQA 2EIKC 1FFXB 4J80A 2A79B 4AQYO 1S76D 1NZ6A 1XBLA 1H2SB 2F23A 4NB5A 3A0BZ 3ZHQA 1B06A 4JV5O 2JRIA 2QJ1A 4LF4B 5B3SB 2XAJA 4YIPA 2F4VB 4ICGA 4L87A 1S5JA 5D5QA 5L3BA 4MVMA 1GRJA 1AI5A 1XILA 3RYCA 3R66A 4XDKA 5BMVB 3KG2A 1VQLV 2AZ2A 5KA6A 3SGIA 4UFZA 1IXBA 4LF8O 2VQEO 2M7WA 5EZYB 2QKCA 2UU9B 4B3RB 2C2AA 2OCCB 1XHZA 3G6EV 5B5EZ 1QLEB 4HNAA 1DLBA 3FAVA 1PM9A 3W7TA 1NQTA 1NTZH 4LNUB 5CBFA 2P5OA 1PKXA 3SPHA 4NYKA 3N2KB 2GSMB 2P22C 1Q8IA 3IJ4A 1K7DA 4MT8A 2W6JG 3BFRA 5A2QN 4DV4B 1MMMA 4K8XA 3FB7C 5L3CA 5LHGA 3RBZA 1AP5A 4GT1A 3TGUH 4UV9A 3HKEA 4KUMA 4K3AA 3Q4HB 3OM3B 5JH7B 2WSSG 3IGAC 4BAYA 1SA0A 1K73W 3E8HA 4R50A 4JGSA 1NBMG 1HNXO 1FJGB 5LBQA 4C7UA 2BTQA 2Q69A 4QE9A 1SS3A 1BQZA 4B3SO 1XDCA 1DF4A 1V54B 2HHHB 4LF9B 1N33O 4J9YB 2QSAA 2Y0IA 4P9OA 2M6YA 2F66C 3KZIZ 1VF5B 1JX9A 3RYCB 2WLKA 3CXHF 4BW5A 3EHBB 4RQEA 3SYCA 4LFCB 1OHHG 3WU2Z 2ILMA 1VF6C 4DYLA 2P67A 2QM7A 3CC7V 1YSCA 4PELA 1P49A 3M8AA 2ADPA 4TSFG 4HNAB 1GN6A 5JWPA 2IJJA 3ETQA 2L35A 4GKJB 3UKMA 3DSQA 2K9PA 1GTOA 1OCZB 4YIOA 1EZVH 4LC1A 3OFNG 2A06H 2LP7A 4I5SA 4D6TH 1WPBA 2QM8A 5L3DA 2GV9A 4X64B 4FM1A 4JI7O 3TXQA 2UXXA 1FXVA 4MSWC 3HKEB 3OT7A 3K0DA 1QLNA 3JYCA 2Y0PA 4MVOA 5LGNA 2MK3A 1SA0B 1AROP 3K9AA 3X2QB 1VQOV 1K5SA 1L1FA 2QKAA 4H0LB 3U10A 2L6LA 1F51A 1S72V 5IT9N 4BWAA 2EINB 4UCOA 3T4DA 2LW1A 4NTWA 1N36B 1Q82W 4LF5B 3HKCA 3ZN0A 1HDJA 4I0XA 1X4TA 5LP6B 3VQVA 4P30A 4O4JB 1RP3B 2HR3A 4UCVA 4DR6B 4I9WA 4BIZA 1PV0A 2HEPA 3W7SA 2JEUA 2Q5ZA 1VQPV 4MVRA 2ZIOA 1W2BU 2PI5A 5JCOC 4DV5B 4BW9A 5IE9A 4H37A 1TUEB 1R3LC 4GX5A 3TK1A 3QO7A 1Q43A 1SQQH 3D3QA 1A32A 1YIJV 2JS5A 3O65A 4ZI7A 4F6EA 3AG1B 3SYAA 3RYFB 4DUZO 3APOA 4BIOA 1MZFA 2HFEC 4FLYA 1XMQO 4YHHB 3H9VA 3E8GA 2EIJB 2YIBD 2WA3A 4LFAB 1CPYA 4MW3A 1RSOB 3CE2A 2NNUA 3GWKC 3SYOA 1D5AA 2ADQB 2EZOA 2EJRA 4TUYA 2WLLA 3ZCCA 4BIUA 5KAFZ 4ZOLA 5FL7G 2ZDIA 1RPOA 4PA3A 1BT8A 3ZHSA 1MSWD 3E35A 2R9IA 5B1AC 1GN3A 3HKCB 4X89A 3U11A 2E5LB 4I0XB 1RM1B 4JI5B 1JA8A 2LJ2A 3CJHA 4KHPB 2RN9A 3RGBA 5BZBA 4CH5A 1VQ7V 2UUBB 4J11A 4LR3A 3L74H 4JI8O 1R3KC 3SR2C 4WBNB 1H2KA 1VQKV 3CMEV 2AW9A 1NTMH 4R7CA 1N34B 2JGDB 5CB4B 1BE3H 3K08A 2QA4V 2QR4A 5KX5A 4JI6O 4X1IA 3JATA 4B7EA 4DR1B 1KKDA 4OXSA 3ZN1A 4W4KA 3T1CA 1PL4A 4HZ3A 1NT2B 2R72A 5EIBC 1I5XA 3S3WA 2D2CB 2YI9A 1TUBA 2CGNA 4B3TB 4ZI7B 3EVKA 1OCCC 3OUSA 3ML0A 2E75B 4JI1O 4OGQB 1DK1A 3L73H 3H01A 4K0KB 4I50A 2F93B 1ZTEA 2G38A 1GM8A 3STLC 1M57C 2FMLA 4Q20A 1KP3A 1AR5A 4F4LA 3BAAA 5JQGA 4DW1A 4GX0A 2A0LA 1YTFD 4CH3A 1BHAA 1XMOO 5LYJA 4DV7O 1HNZO 3DC6A 4NR1A 4MTOA 5JJJB 4TUYB 4DV1O 4DR4B 1M5IA 2WLMA 2QGNA 1HWYA 2HJDA 4N21A 5H6RA 4GKKB 1JVMA 3M7MX 1FKAO 1H2NA 1NTKH 2RQ6A 3BPZA 5GTHZ 5LGTA 3SYQA 1WP7A 3W7UA 4X66B 2VQFO 3LSUA 1VQ6V 3O9OA 4YY3B 3K79A 2UXBO 1N0NA 3JD2A 3H1KH 2HP8A 2Y48A 1GM7A 3HB3B 4UCRA 3EFFK 2YICA 2DYRB 2IJIA 3CB2A 4J9ZB 3CMAV 2OWOA 1CP9A 4AQYB 5E1AC 3OEEG 4UCSA 3RT3C 3ZRXA 1GO3F 2CUGA 4JV5B 1G6UA 1OCOB 3OTOO 5KX5B 2R9RB 3JATB 1Y76A 5LMNO 1Y4MA 2ZQMA 3I55V 2YUAA 1EBOA 2Z5UA 4B7KA 2EZPA 2DWDC 1AVMA 1TUBB 1PL0A 2KKWA 3FD9A 2ARHA 5IY5C 1SQPH 4Q6GA 5IJ9B 2W6IG 2UXDO 3K03A 4WFFA 3BABA 4LF8B 2VQEB 2IH1C 3FKSG 4CH4A 1PD3A 4OPAA 3ZHTA 3W7XA 2PTMA 2ODMA 3QNEA 5JQGB 3JSLA 2E74B 3B4SA 1OZ0A 5B1BB 3UM7A 4MS2A 4DRXB 3ASNB 4GX2A 4J7JA 5LYJB 5BMVA 4I9QA 4DV0O 4AI8A 3K57A 5CN0A 1QHTA 3OR7C 4X1YA 4XDLA 3D36A 3DXRB 2A9HA 2YXHA 1BZKA 3VQWA 4DR2O 1BGYH 1WN7A 4WCEV 2Q68A 4MTFA 1OCRB 2ZCEA 4JTCB 4Z1MG 2OTJV 1KU9A 4RUEA 1KP2A 4J10A 2GUZA 1EFRG 5HFLA 2WPDG 4UVBA 1R6TA 1WAZA 1MABG 3AG3B 3E22A 2GDSA 3OE7G 1FXKC 2P4KA 2YS8A 4HYOA 1SC5B 1P7BA 1P7GA 4Z1VA 1HNXB 3U0ZA 5EC2C 1K5QA 2WA4A 4B3SB 3T4ZA 4FZ0A 1Y76B 2W0XA 4FLXA 2AHYA 2KSDA 5B1NA 5A9GA 2ZE8A 3CPWU 4JAAA 1N33B 3ZIAG 2DJVA 1L0LH 4NTXA 2K1EA 4EFBA 3C3TA 4CS3A 1IDSA 3DC5A 4FLVA 2P90A 4NXNO 2OIEA 1YEWA 4DUYO 3CC2V 4UUJC 1IZ3A 1R3JC 3RFRA 2R9AA 3GWOA 2ZKOA 1FAFA 2CDYA 3GVMA 3JCUZ 1K4DC 1F7YA 1R6NA 4U3JB 4IGGA 5IYCO 3FYIB 1Y74A 2KG7B 3ZRWA 4PV1B 2X6CA 1XL4A 1Q6UA 2AXTZ 1D2DA 1ZSPA 4X1YB 3JALA 4JI0O 3WG7C 2EIKB 5IYDO 4KFMA 1PNKA 4PA9A 5CMUA 1K3EA 3JARA 4DR3O 4L8JA 3IAYA 1FXHA 5IWAO 1TGOA 2F95B 4CS2A 4JI3O 1O9GA 4I4TA 4JI7B 1R1BA 1VQNV 1LNQA 5JVDB 2ZR2A 3B2EE 3I56V 3W7WA 5L3EA 5LA6A 2GUZB 3JAKB 1RFYA 2OCHA 2Q4PA 4B3MO 4MTGA 1NH2D 2F1MA 4G2KA 3H1LH 3E22B 1R3IC 4IYIA 3CSXA 3QO8A 4ZHQA 3ABLC 1Q6HA 1F23A 4LF6O 1YI2V 1E79G 1SKVA 3CEIA 2Y4UA 1Q6IA 4GUNA 5K1XA 3TETA 3BA9A 4FM2A 3MHHC 1GH6A 1V54C 5H6QA 1ZLZA 4U7NA 3K0GA 3CCUV 1SQBH 1WPXA 3H1HH 1URFA 4G27B 2FL4A 3B40A 4LH7A 5KMGA 4RWUA 2Q7HA 3SJCC 4ZKIA 4CS4A 2V4DA 2JIZG 2IU0A 1H8HG 1N4CA 1E1QG 1XNQO 2ZNJA 3STZC 4O4IA 4JYAO 5LMUO 1BMFG 3G4SV 1EN6A 5LP6A 5BR8O 4O4JA 4D7TA 4YJ2A 2B5UA 1Y74B 1SERA 2JEXA 5L3GA 3ZRWB 3OAAG 3K06A 4PI0A 2QWNB 3JALB 1Y67A 1IBMO 4DK1A 1AI6A 3BRCA 5CBGA 1RPRA 1B3QA 4B08A 3AG4B 3JARB 4UXNA 1N32O 3CS5A 4DUZB 3N2GA 2JDIG 4QJFB 2XT9A 4JTAB 1XMQB 5IYBO 3CRMA 4I4TB 3ETDA 3RVYA 3T1HO 4FPPA 1JPXA 3CHXA 2VRZA 2Y69C 5LA6B 3G6BA 1BQ0A 5EYPB 2CTQA 3L9DA 2HKOA 4UB6Z 4X65O 1E1RG 1K97A 2P7TC 1ORQC 4TV8B 3RYFA 2BTOA 3K5LA 5L3FA 3P3NA 4ZHQB 2RNBA 3X2QC 2GBOA 4H44B 1B04A 1MA1A 1ZWIC 4JZ2A 2EIMB 1BCCH 5JCOA 1RSOA 3RW0A 2YC0A 3WB0A 3ZHUA 4X88A 1MOFA 1Q7YW 4DV6O 2RDCA 5GONA 1YXBA 2EULA 2IH3C 4EKWA 2FYUH 3UQ8A 5GW7A 5DECA 1IURA 5KMGB 1AJPA 5JJEB 4JZGA 4TQDA 3H1JH 4O4IB 4TOIA 4JI8B 3RN4A 1GM9A 3HPLC 1H2GA 3JAMN 2EX3A 4YJ2B 4JI6B 2JK5C 1IXMA 1PNMA 3ZMUA 1COWG 3VOUA 3QG5A 3A0HZ 1K33A 4WBNA 1HR0O 2JGDA 4X62O 5CB4A 2DOSA 4DR7O 3AG1C 4JI1B 3LDEA 3N2GB 1SQVH 1SZXA 2AHZA 3C3SA 1OV9A 1V55C 5B66Z 2ZE7A 3CCLV 5K1PA 4ZBMA 5C8YB 2XAFA 4CZZA 1PNLA 2KQXA 1ZAUA 3ZJZA 1GAXA 2QEXV 4J7KA 1XMOB 4DV7B 1QR8A 1GN2A 1HNZB 3CRQA 2OIGA 3JCZA 3ABKC 4DV1B 2X7RB 4K35A 1KB9F 3SPJA 3DGEA 1M56C 1KD1W 4LWSA 1PPJH 2RJZA 1VMGA 1NJIW 1DGSA 4X1KA 1NVPB 1SQFA 5LOVA 4E2LA 2VQFB 2DYSC 1M90W 5GONB 5KA5A 3CCJV 4WFAV 2UXBB 1QNMA 3ABMC 3A0RA 1K9MW 3G71V 1NR1A 1W0KG 1VARA 2QWRB 3AG2C 2X6AA 4DV3O 5EBMC 1UJWB 4Z2WA 4XDJA 5TISZ 1CEZA 2ZM6O 1QU7A 1ZUQA 4XBFA 3ASOB 4ZIBA 3OTOB 1KC8W 2LW7A 3T1YO 5KUMA 5LMNB 3UCSC 1G8MA 3QF7A 4FFKA 4HBNA 4WFHA 4RUFA 1R73A 1YJNV 2PY5A 4YXWG 2OT5A 3F7VC 5CBHA 2GTSA 2F43G 2YXLA 3HKBB 1JQ0A 1SRYA 2EBOA 2YEVB 2UXDB 4TWKA 5B1AB 1Q90D 2LFRA 2E3CA 2DMXA 2PGGA 1BSMA 1VP7A 4J7ZA 3N27A 2UUAO 3JD4A 3J81N 3SJAC 3UT5A 3CRCA 1QVGU 5FPRA 2YI8A 2V1DA 3HR0A 3CCEV 3MAQA 5IJ9A 4DV0B 3T2MA 3ZX6A 5IJ0A 1JFFA 1AJNA 4G28B 1BHBA 4JAUA 3RYIA 1AJQA 1XL6A 3CRRA 4LWSB 3CCRV 4DR2B 3JD0A 4CBCA 4DRXA 1QVFU 3K5OA 2ZDIC 2GTAA 4X1KB 2EILC 3VQYA 5LOVB 2FTKA 2Q7GA 4H33A 3F5TA 3DXRA 3KCYA 3TCUA 3LSQA 2FKXA 1D5NA 2PF4E 2WAMA 3MHSC 3CD6V 1K4CC 2OTLV 4UV8A 2DYRC 3ABTA 4RQFA 1Y66A 2JVDA 5D5PA 1M57B 4PDVA 3L70H 4MVQA 2CK3G 4DO2A 4ABMA 4GYCB 3ZEDA 1EZJA 2ZIMA 1ZL8B 4KXRA 2YDEA 2QKSA 4J42A 3FFQA 3CCMV 4X8AA 1JR9A 1JOYA 1HW7A 3HKDB 4NXNB 1XREA 4DUYB 2UUCO 4DW0A 3ICXA 4PDMA 2ZR3A 2B1GA 4F6RA 3G80A 1IBKO 4JF3A 2Q0OC 1AB3A 1MNGA 4YJ3A 4FLWA 3UT5B 3ZRSA 2WLJA 5B1OA 4MVUA 4D7SA 1BS3A 3ASNC 1IBLO 1S77D 5IJ0B 1AR4A 1JFFB 1XUQA 2NR5A 1M9NA 2QE7G 4JI0B 1NR7A 4E4EA 4OPHA 3RYIB 4DV2O 4FM0A 2JGUA 1FS0G 4U3JA 3BA8A 4DR3B 2QWQB 4BR6A 2X0LA 4JTDB 1H8EG 2KG7A 1AI4A 1SZTA 5IWAB 1J5EO 4JI3B 3K59A 3L72H 3SPCA 1YITV 4ASUG 5H2FZ 1L8DA 3BHPA 5IDJA 4TT3G 4O2BA 3IFXA 3TJTA 4B3MB 5KHJA 1P4RA 3LNNA 3D8CA 4P2ZA 3AG3C 1QCEA 4H13B 4AILC 2QWPB 4OX9O 3ABUA 2WLNA 5LGUA 3G67A 5J2TB 5JVDA 4LF6B 3BEHA 3NXSA 1PP9H 2HG5C 1YVWA 3JAKA 4O4HB 1XOUA 4IYHA 1T5EA 1LR1A 4GX1A 3K5NA 1FPOA 1IX9A 5KAIZ 2IBZH 3CXCU 4QE7A 1I94O 4PA7A 4LCUC 4CC6A 4JI4O 2B1IA 1XNQB 5B3SC 3K3WA 4R6ZA 4JYAB 4I55A 5LMUB 2CAZC 4F6RB 3D3IA 3L75H 2Z3YA 2PYLA 2AZ0A 4MVSA 5KHGA 2LGWA 4U7OA 2YXYA 5EC1C 4JI2O 1B6QA 4YJ3B 5BR8B 1NKDA 1SESA 1WB8A 4LFBO 2AGAA 3E83A 2CTPA 1W59A 3I5DA 4N23A 1WP8A 4PD4F 3SPGA 1FXKB 3LUTB 4JASA 3ZRVA 4X20A 1IBMB 3E8BA 3CX5F 2ZXWB 4QIWF 3D36C 1QR9A 1XNRO 3FB8C 1DTOA 2OCCC 1JJOA 5J2UB 1N32B 1KMIZ 1F4MA 1QLEC 4PJ0Z 2JJ2G 3OGCC 3JSNA 3J7AU 1OJHA 1NS1A 5F2VO 3T1HB 1YCIA 1YZBA 3ETEA 1VIBA 4O2BB 1TVKA 4WFEA 3IC9A 2DQ0A 4X65B 2Q8VA 4FZ1A 3SDLA 4DR5O 4O4LA 4QPKA 2ZE6A 3K5MA 5LHHA 2A7WA 1HNWO 1L0NH 1ENVA 3TXSA 2YIBA 1GK9A 2ZD9A 3E8FA 2OYQA 5EYPA 2RCVA 4PDRA 2IJKA 2X6BA 3KKYA 4JYCA 2XASA 2ZINA 4TV8A 1YJ9V 3UO2A 4DV6B 1WLEA 1Z5VA 1H38A 3FX7A 3WG7B 3OMIB 3LSSA 3CCSV 1VF6A 3J80N 4NXMO 3P30A 1P84F 3F5WC 1KYOF 2QDOA 1YJWV 1WJZA 2UXCO 1FYJA 4I55B 3B77A 5LXTA 5H5NA 3S3XA 2A3QA 2D3OW 4IHJA 5KHKA 3E2EA 4KL1A 3H1IH 4QNHB 2KB1A 1S0VA 1I0HA 2Q67A 1HP8A 3SYPA 1Z2GA 2LFSA 2QWOB 4X20B 3ABLB 1HR0B 4GZRB 4X62B 5ITZA 4DR7B 5IYZA 3RYHA 1SETA 3AG4C 4LF7O 2PZSA 3OTFA 1VQ5V 1S3JA 3OW2U 2ITDC 5DM6V 1TA8A 1H2MA 3QTCA 2PYJA 1OCZC 1TVKB 3APQA 3CWBH 4EFEA 3EXAA 4W4LA 1ZX3A 3NR7A 4X9QA 4LF4O 2R70A 4O4LB 2E76B 1TAEA 2F4VO 3ZS8C 1VQ4V 3SJQC 5C8YA 2HVJC 2YIDA 2EIMC 4RO2A 2DW4A 3OEHG 3MDSA 4I7ZB 3FAVB 4KP4A 4UVAA 2UXNA 2P4VA 3E89A 1XHXA 2UU9O 4MW8A 4B3RO 2EINC 3ZMVA 5LHIA 4FJCC 1AP6A 4LH6A 4DV3B 2BCCH 5LXTB 3FB6C 5H9CA 4UVCA 2ZM6B 4IHJB 2WLIA 5LP6C 2CE4A 2Y69B 1Z5WA 4RAIA 3T1YB 4DV4O 4NTYA 2MW2B 3OD4A 2N74A 4IT5A 5ITZB 1K34A 2BTQB 1UPGA 3B09A 3RYHB 5IYZB 2IU3A 4NKGB 3BY6A 4IIJA 4JAVA 5EBWC 1JCHA 2UUAB 1QQCA 2IW5A 3B8MA 1Q81W 1FJGO 1GN4A 1GMGA 4WFBV 4PDLA 3HKBA 3WFVA 2DQ3A 2DN9A 2YEVA 3JAWA 4FFBA 1WB7A 2NLJC 4O2AA 2HHHO 4LF9O 5KHIA 4EB6A 2EIJC 1I5YA 2CTWA 1YTFB 1MSDA 4FMTA 4LBEC 2ATKC 1NU1H 1YDXA 3ZMTA 5DEDA 1Q86W 3CP1A 2BSKA 1NI8A 4LFCO 3ZBHA 1YHQV 2CH7A 1Q5OA 3A2FA 2V7QG 3OMNB 5E79Z 3AEIA 1V55B 1RM1C 2DE0X 4UCUA 2N05A 4GKJO 2ETNA 2WLIB 1S5LZ 3ASOC 3VBBA 4CC5A 2FB5A 1IVSA 5DN6G 1W0JG 3K58A 2QTSA 1JJ2U 2QM4A 3AG7A 1VEWA 2P6JA 2XTAA 3ABKB 4DK0A 1VQ9V 1ROPA 3RVZA 3A8TA 1MZEA 2GHYA 2ZT9B 3OR6C 4X64O 3JD1A 2H8PC 1M56B 2YIAA 3M99B 5EK0A 4JYBA 3SPIA 2UUCB 1WA8A 2LO1A 1J95A 4UCTA 2JS3A 1S5HC 1M1KW 2WLHA 4IIJB 2CGOA 1ZL8A 1N0JA 1K92A 3RWRD 1IBKB 1EM1A 2DYSB 1AR1B 2N04A 2DWEC 3ZHRA 5AG2A 2Q0AA 3HKDA 1XI1A 3ABMB 4LP8A 1I08A 4TV9A 1IBLB 1KKCA 3CRAA 2ZE5A 2HLDG 3JAWB 4FFBB 2XAGA 4O2AB 1N36O 2Q9LA 3AG2B 1QBZA 3IC7A 4LF5O 1V9PA 4DV2B 3JD3A 4EB6B 2XAHA 3OUFA 2LQTA 4FLTA 4DXWA 5JJNB 5CA0A 3ZHVA 5KHHA 1J5EB 3QO5A 4J41A 4DR6O 4WFGA 4R8CA 1H2LA 2BSKB 1Q3EA 1KUQA 1YF2A 4JPRA 4PA4A 2CH7B 1U97A 4DV5O 3WB2A 1LUVA 1US6A 5CA1A 4OX9B 1U96A 5C93A 2P06A 2PI4A 4HAMA 1SF9A 1SQXH 3ZMZA 2HVKC 3PJSK 1GKFA 2WWWA 2BE3A 1LUWA 1EN5A 1M4UA 1OCCB 1VQ8V 3DTUB 2Q73A 3K04A 3K9SA 3FB5C 4K8ZA 3BVOA 5J2TA 1XQ8A 2WLLB 4YHHO 1KQSU 1I94B 1VQMV 4AHCA 4O4HA 1EN4A 4JI4B 1R6KA 4GCZA 4LFAO 1OCOC 4ZOLB 1WA8B 3LNMB 3P32A 2EILB 1NVPD 3ETGA 4WF9V 4TQFA 4PA6A 5EBLC 2XOKG 3GB7C 4PI2A 2VWKA 4JI2B 4QPJA 1Y6XA 4MVZA 5FNVA 3CJHB 1BL8A 4LFBB 4PHZA 3B8NA 4TV9B 4UB8Z 1CXZB 1SQGA 4NVPA 1FD9A 2ITCC 3PN1A 3L71H 4QGPA 5FLXN 2H3OA 5LL6Y 1M93A 3C90A 4A5UB 4FK5C 3JASA 3ZMSA 2E5LO 1XNRB 4JI5O 5B1BC 2EJ7A 4FLUA 4KHPO 4FIPC 4P9PA 4X1IB 1I7FA 4CH6A 3P3PA 2UUBO 5CA0B 1AILA 3FYEB 1FXKA 3VQXA 1XEQA 4FLZA 1FFXA 3E86A 2Q6AA 1N34O 3CCQV 1WNSA 2XUMA 2Y4TA 2VWJA 5J2UA 2BOBC 4DR5B 1K8AW 5CA1B 1THZA 4DR1O 5BXZA 2Q7EA 1OCRC 5BY1A 2IM9A 4I50B 3MD0A 1HNWB 3F7YC 5CA3A 2H94A 5FPOA 1KECA 1DF5A 4MTXA 3CYOA 1NH2B 3R65A 4B3TO 5IY5B 1F4NA 4K0KO 3BCCH 1X59A 3AK2A 5EZYA 4NXMB 4FVMA 3UO3A 2NN4A 1G4YB 2LGQA 3KCXA 3LDDA 4IL6Z 2UXCB 1N8RW 2PUSA 2HJFC 5KLVH 3CC4V 2QTOA 2W0FC 2CTRA 1MG1A 1JMKC 4DR4O 4LNUA 5EIBD 2B9ZA 2JJ1G 5FNVB 3AK3A 2VS0A 3N2KA 4GKKO 3OMAB 5J9PC 2ZNIA 1VF7A 1KBHA 2O57A 4X66O 4U3FH 3QVNA 5KUKA 3JASB 4JYYA 1G1XB 2ZXWC 5GTIZ 1O9HA 4GLXA 2XAQA 4YY3O 1UFIA 2XNDG 2RMKB 4LF7B 3THOA 3Q4HA 2Z0AA 3AK1A 2IJHA 3CCVV 3LDCA 5HFMA 5JH7A
chains in the Genus database with same CATH topology
1KD1W 2BOCC 1VQ6V 1FFTB 1AI7A 3K79A 2YSUB 1NJIW 2EIKC 1NVPB 3JD2A 2A79B 2Y48A 1GM7A 3HB3B 1VQ4V 1S76D 4E2LA 3SJQC 2HVJC 2DYSC 1M90W 3EFFK 5KA5A 3CCJV 2DYRB 2EIMC 2IJIA 4RO2A 4WFAV 5B3SB 2XAJA 4J9ZB 2DW4A 3CMAV 3OEHG 3ABMC 4L87A 1CP9A 3A0RA 5E1AC 3OEEG 1K9MW 3G71V 1NR1A 1W0KG 3ZRXA 1GO3F 4KP4A 5L3BA 1OCOB 2R9RB 4UVAA 2UXNA 3AG2C 4MVMA 2X6AA 3E89A 5EBMC 1AI5A 1UJWB 1Y4MA 2ZQMA 4MW8A 4XDJA 3I55V 1CEZA 4XDKA 1EBOA 2Z5UA 3KG2A 1VQLV 2EINC 4XBFA 3ASOB 5KA6A 3ZMVA 2EZPA 1KC8W 5LHIA 4FJCC 2DWDC 2M7WA 5KUMA 1PL0A 3FB6C 5H9CA 5IY5C 2C2AA 4UVCA 2WLIA 1G8MA 2OCCB 3G6EV 2W6IG 2Y69B 1QLEB 4RAIA 3K03A 4WFHA 4WFFA 4RUFA 1DLBA 2IH1C 1R73A 3FKSG 1YJNV 4YXWG 1PD3A 2OT5A 3F7VC 3W7XA 3W7TA 5CBHA 1NQTA 2F43G 3QNEA 1JQ0A 1SRYA 2EBOA 1OZ0A 2YEVB 5B1BB 3UM7A 4MS2A 3ASNB 4GX2A 4TWKA 5B1AB 2LFRA 5CBFA 1PKXA 3SPHA 2GSMB 1K34A 5CN0A 3OR7C 3JD4A 1K7DA 4MT8A 2W6JG 2IU3A 1QVGU 4XDLA 3BY6A 3D36A 2V1DA 3FB7C 5L3CA 2A9HA 3RBZA 5LHGA 3CCEV 4JAVA 5EBWC 4GT1A 3T2MA 1JCHA 1AJNA 4UV9A 2IW5A 4G28B 1BHBA 3B8MA 1Q81W 4KUMA 4WCEV 4JAUA 2Q68A 4MTFA 1OCRB 3OM3B 1AJQA 1GMGA 4WFBV 1XL6A 4PDLA 4JTCB 2WSSG 3IGAC 3WFVA 4BAYA 4Z1MG 3CCRV 3JD0A 4CBCA 2DQ3A 2YEVA 1K73W 2OTJV 1QVFU 3E8HA 4RUEA 2NLJC 4R50A 1KP2A 4JGSA 1EFRG 1NBMG 2WPDG 2ZDIC 5HFLA 5LBQA 2EILC 4UVBA 2FTKA 2Q69A 4QE9A 1MABG 3AG3B 2EIJC 3OE7G 4H33A 1FXKC 1I5YA 3TCUA 1YTFB 1DF4A 3LSQA 4FMTA 4HYOA 4LBEC 1P7BA 2ATKC 1V54B 3ZMTA 2WAMA 3MHSC 5EC2C 4J9YB 1K5QA 3CD6V 1Q86W 1K4CC 2OTLV 4P9OA 3CP1A 4UV8A 2DYRC 3T4ZA 3ABTA 4RQFA 2AHYA 5B1NA 1Y66A 1JX9A 3CPWU 1M57B 2WLKA 1YHQV 4PDVA 3ZIAG 2K1EA 2CK3G 4MVQA 4BW5A 4DO2A 3EHBB 4RQEA 3SYCA 2V7QG 3OMNB 1OHHG 3AEIA 1V55B 2P90A 1RM1C 1EZJA 2P67A 2QM7A 3CC7V 3CC2V 1YSCA 4UUJC 2WLIB 4PELA 1R3JC 2QKSA 4TSFG 3GWOA 3ASOC 3VBBA 3CCMV 4X8AA 5DN6G 1W0JG 2IJJA 1JJ2U 1JOYA 1K4DC 2P6JA 3ABKB 3UKMA 1VQ9V 1R6NA 4PDMA 1ROPA 3RVZA 2ZR3A 2B1GA 2GHYA 1GTOA 3FYIB 3OR6C 5IYCO 1OCZB 3JD1A 2H8PC 1M56B 3ZRWA 4LC1A 2X6CA 1XL4A 3M99B 3OFNG 5EK0A 4JF3A 2LP7A 4JYBA 3SPIA 4I5SA 1M1KW 1J95A 1S5HC 3WG7C 2EIKB 3ZRSA 2WLJA 5B1OA 2QM8A 4MVUA 5IYDO 5L3DA 2WLHA 3ASNC 4KFMA 1K92A 1PNKA 4PA9A 5CMUA 1S77D 2DYSB 1AR1B 2UXXA 1K3EA 1FXVA 4MSWC 1M9NA 2QE7G 2DWEC 3K0DA 1NR7A 1FXHA 1QLNA 3JYCA 4MVOA 3ABMB 4LP8A 5LGNA 1VQNV 1LNQA 1FS0G 2MK3A 1AROP 2HLDG 2ZR2A 3K9AA 3I56V 3W7WA 5L3EA 3X2QB 2X0LA 4JTDB 2XAGA 1VQOV 1K5SA 1L1FA 1H8EG 3AG2B 1QBZA 3IC7A 1AI4A 1SZTA 1F51A 4MTGA 1NH2D 3JD3A 1S72V 4G2KA 3SPCA 1YITV 4ASUG 1R3IC 2EINB 2XAHA 3OUFA 3QO8A 3T4DA 5IDJA 3ABLC 4TT3G 3IFXA 4DXWA 1F23A 1Q82W 3ZN0A 1YI2V 1E79G 1P4RA 3QO5A 4P2ZA 3AG3C 1QCEA 4WFGA 4R8CA 3ABUA 2WLNA 4P30A 5LGUA 3TETA 3MHHC 1V54C 5H6QA 3K0GA 4U7NA 2HR3A 3BEHA 4JPRA 3CCUV 3NXSA 4PA4A 2HG5C 4I9WA 1WPXA 4BIZA 3W7SA 4G27B 5C93A 2PI4A 4HAMA 2JEUA 4GX1A 4ZKIA 1VQPV 3ZMZA 4MVRA 2HVKC 1W2BU 2PI5A 2JIZG 2IU0A 1H8HG 1E1QG 3PJSK 1GKFA 3STZC 3CXCU 4H37A 1TUEB 4QE7A 1R3LC 2WWWA 4PA7A 4GX5A 4LCUC 1BMFG 1OCCB 3G4SV 1VQ8V 3TK1A 3QO7A 3DTUB 2B1IA 3K04A 3FB5C 1YIJV 5B3SC 3K3WA 2WLLB 2B5UA 4R6ZA 1KQSU 1SERA 2JEXA 5L3GA 3ZRWB 3D3IA 1VQMV 3AG1B 2Z3YA 3SYAA 4MVSA 1R6KA 4GCZA 4U7OA 3OAAG 3K06A 5EC1C 1OCOC 1B6QA 1NKDA 3LNMB 2HFEC 3P32A 1SESA 1AI6A 2EILB 1NVPD 3ETGA 5CBGA 4WF9V 3E83A 1RPRA 4PA6A 4N23A 3E8GA 3AG4B 2EIJB 5EBLC 2XOKG 3SPGA 1CPYA 1FXKB 3GB7C 3LUTB 4JASA 4UXNA 4MW3A 3ZRVA 4QPJA 2JDIG 4QJFB 4MVZA 2NNUA 3E8BA 4JTAB 2ZXWB 4QIWF 1BL8A 5IYBO 1QR9A 3B8NA 3SYOA 3ETDA 3FB8C 2ITCC 2EZOA 3RVYA 1DTOA 2EJRA 4FPPA 2OCCC 1JPXA 2WLLA 3ZCCA 2Y69C 1F4MA 1QLEC 4BIUA 4FK5C 2HKOA 2JJ2G 1E1RG 1K97A 2P7TC 3ZMSA 3OGCC 1ORQC 5FL7G 2ZDIA 5L3FA 1RPOA 5B1BC 4PA3A 3ETEA 1MSWD 3E35A 4WFEA 3X2QC 2R9IA 4FIPC 5B1AC 4P9PA 2DQ0A 4X89A 1ZWIC 3FYEB 1FXKA 1RM1B 2EIMB 4QPKA 3RW0A 5LHHA 4X88A 3E86A 1MOFA 1Q7YW 2Q6AA 5BZBA 1VQ7V 1ENVA 3CCQV 1GK9A 2ZD9A 2BOBC 3E8FA 4PDRA 1K8AW 2IH3C 1THZA 2IJKA 2X6BA 4EKWA 5GW7A 1R3KC 4JYCA 1OCRC 2XASA 1YJ9V 1VQKV 3CMEV 1AJPA 4R7CA 3MD0A 1WLEA 3K08A 3F7YC 5CA3A 2H94A 2QA4V 1H38A 1KECA 3WG7B 1DF5A 3OMIB 1KKDA 3LSSA 4MTXA 3CYOA 4OXSA 3ZN1A 3R65A 3CCSV 1NH2B 1GM9A 3HPLC 5IY5B 3P30A 3T1CA 1H2GA 4HZ3A 3F5WC 1F4NA 1YJWV 1I5XA 2JK5C 1IXMA 3B77A 1PNMA 3ZMUA 1COWG 1OCCC 3VOUA 3OUSA 3ML0A 2D3OW 1K33A 1G4YB 3E2EA 3H01A 3LDDA 4QNHB 2KB1A 1N8RW 1GM8A 1S0VA 2HJFC 3CC4V 3STLC 2QTOA 1M57C 4Q20A 2W0FC 1KP3A 2Q67A 3SYPA 3AG1C 2LFSA 1MG1A 3LDEA 4F4LA 4GX0A 2A0LA 2AHZA 3ABLB 1YTFD 2JJ1G 1BHAA 1V55C 3OMAB 3CCLV 4MTOA 4ZBMA 5J9PC 1SETA 3AG4C 2WLMA 1HWYA 2XAFA 4CZZA 1PNLA 3ZJZA 1VQ5V 2QEXV 1S3JA 5KUKA 3OW2U 2ITDC 4N21A 5DM6V 1QR8A 2ZXWC 5H6RA 1JVMA 2XAQA 3JCZA 3ABKC 2XNDG 2X7RB 5LGTA 3SYQA 3W7UA 1OCZC 2IJHA 3SPJA 3CCVV 3LDCA 3DGEA 1M56C 5HFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R50 A;  5B1B C;  4PA3 A;  2BOC C;  3SPC A;  4WFE A;  3X2Q C;  5B1A C;  2EIL C;  1R3I C;  4P9P A;  4X89 A;  3OUF A;  2Q69 A;  4QE9 A;  3T4D A;  1ZWI C;  2EIK C;  3ABL C;  2EIJ C;  3IFX A;  4DXW A;  2A79 B;  4H33 A;  3TCU A;  3SJQ C;  2HVJ C;  2DYS C;  3RW0 A;  4HYO A;  4LBE C;  1P7B A;  4X88 A;  3E86 A;  2ATK C;  3EFF K;  2Q6A A;  4P2Z A;  3AG3 C;  5BZB A;  4WFG A;  2EIM C;  5EC2 C;  4J9Y B;  4R8C A;  4RO2 A;  2WLN A;  4P30 A;  2ZD9 A;  2BOB C;  4J9Z B;  1K4C C;  3TET A;  3E8F A;  3ABM C;  4P9O A;  4PDR A;  1V54 C;  2IH3 C;  5E1A C;  2X6B A;  3K0G A;  3BEH A;  4EKW A;  2DYR C;  4PA4 A;  3T4Z A;  1R3K C;  2HG5 C;  1OCR C;  4I9W A;  2AHY A;  4G27 B;  2R9R B;  4R7C A;  2WLK A;  3AG2 C;  4PDV A;  3K08 A;  4MVM A;  3F7Y C;  2X6A A;  3E89 A;  5EBM C;  2K1E A;  4MVQ A;  4BW5 A;  4GX1 A;  4MW8 A;  4XDJ A;  4MVR A;  4XDK A;  2HVK C;  3SYC A;  1KKD A;  3KG2 A;  4OXS A;  2EIN C;  3R65 A;  3HPL C;  3PJS K;  3T1C A;  3STZ C;  4H37 A;  4HZ3 A;  4QE7 A;  1R3L C;  4PA7 A;  4GX5 A;  2DWD C;  3F5W C;  2WLI B;  4LCU C;  4UUJ C;  1R3J C;  5KUM A;  2QKS A;  3FB6 C;  3ASO C;  5IY5 C;  4X8A A;  2JK5 C;  2WLI A;  3K04 A;  3FB5 C;  5B3S C;  1OCC C;  3VOU A;  3OUS A;  4RAI A;  2WLL B;  4R6Z A;  1K4D C;  3K03 A;  4WFF A;  4RUF A;  4WFH A;  1G4Y B;  2IH1 C;  3UKM A;  4PDM A;  3RVZ A;  3SYA A;  3F7V C;  3LDD A;  4QNH B;  4MVS A;  5CBH A;  3OR6 C;  2KB1 A;  4RUE A;  3K06 A;  5EC1 C;  2HJF C;  1OCO C;  2H8P C;  3STL C;  2QTO A;  1M57 C;  3LNM B;  2HFE C;  2X6C A;  1XL4 A;  2W0F C;  4MS2 A;  3UM7 A;  2Q67 A;  3SYP A;  4GX2 A;  3AG1 C;  4MTG A;  4TWK A;  5EK0 A;  3LDE A;  4F4L A;  3SPI A;  5CBF A;  5CBG A;  3E83 A;  3SPH A;  4PA6 A;  1J95 A;  1S5H C;  4GX0 A;  3WG7 C;  3ZRS A;  2WLJ A;  2A0L A;  2AHZ A;  3E8G A;  4MVU A;  3OR7 C;  5EBL C;  2WLH A;  3SPG A;  3LUT B;  3GB7 C;  1V55 C;  3ASN C;  4KFM A;  4MW3 A;  4PA9 A;  4XDL A;  4MTO A;  3FB7 C;  4MVZ A;  2A9H A;  3E8B A;  4JTA B;  4ZBM A;  3RBZ A;  5J9P C;  1BL8 A;  4MSW C;  3AG4 C;  2WLM A;  3SYO A;  5EBW C;  3FB8 C;  3T2M A;  2DWE C;  2ITC C;  3K0D A;  3RVY A;  3ZJZ A;  3JYC A;  5KUK A;  2OCC C;  4MVO A;  4G28 B;  2ITD C;  2WLL A;  4LP8 A;  2Y69 C;  2ZXW C;  1QLE C;  1JVM A;  2Q68 A;  1LNQ A;  4MTF A;  3ABK C;  2P7T C;  3OGC C;  1XL6 A;  1ORQ C;  4JTC B;  4JTD B;  4PDL A;  3IGA C;  3SYQ A;  4CBC A;  1OCZ C;  3SPJ A;  2YEV A;  3LDC A;  1M56 C;  3E8H A;  2NLJ C; 
#chains in the Genus database with same CATH topology
 2XHB A;  3OGI B;  2BOC C;  3WB1 A;  3SJB C;  1FFT B;  1AI7 A;  2YSU B;  4EEQ A;  2EIK C;  1FFX B;  4J80 A;  2A79 B;  4AQY O;  1S76 D;  1NZ6 A;  1XBL A;  1H2S B;  2F23 A;  4NB5 A;  3A0B Z;  3ZHQ A;  1B06 A;  4JV5 O;  2JRI A;  2QJ1 A;  4LF4 B;  5B3S B;  2XAJ A;  4YIP A;  2F4V B;  4ICG A;  4L87 A;  1S5J A;  5D5Q A;  5L3B A;  4MVM A;  1GRJ A;  1AI5 A;  1XIL A;  3RYC A;  3R66 A;  4XDK A;  5BMV B;  3KG2 A;  1VQL V;  2AZ2 A;  5KA6 A;  3SGI A;  4UFZ A;  1IXB A;  4LF8 O;  2VQE O;  2M7W A;  5EZY B;  2QKC A;  2UU9 B;  4B3R B;  2C2A A;  2OCC B;  1XHZ A;  3G6E V;  5B5E Z;  1QLE B;  4HNA A;  1DLB A;  3FAV A;  1PM9 A;  3W7T A;  1NQT A;  1NTZ H;  4LNU B;  5CBF A;  2P5O A;  1PKX A;  3SPH A;  4NYK A;  3N2K B;  2GSM B;  2P22 C;  1Q8I A;  3IJ4 A;  1K7D A;  4MT8 A;  2W6J G;  3BFR A;  5A2Q N;  4DV4 B;  1MMM A;  4K8X A;  3FB7 C;  5L3C A;  5LHG A;  3RBZ A;  1AP5 A;  4GT1 A;  3TGU H;  4UV9 A;  3HKE A;  4KUM A;  4K3A A;  3Q4H B;  3OM3 B;  5JH7 B;  2WSS G;  3IGA C;  4BAY A;  1SA0 A;  1K73 W;  3E8H A;  4R50 A;  4JGS A;  1NBM G;  1HNX O;  1FJG B;  5LBQ A;  4C7U A;  2BTQ A;  2Q69 A;  4QE9 A;  1SS3 A;  1BQZ A;  4B3S O;  1XDC A;  1DF4 A;  1V54 B;  2HHH B;  4LF9 B;  1N33 O;  4J9Y B;  2QSA A;  2Y0I A;  4P9O A;  2M6Y A;  2F66 C;  3KZI Z;  1VF5 B;  1JX9 A;  3RYC B;  2WLK A;  3CXH F;  4BW5 A;  3EHB B;  4RQE A;  3SYC A;  4LFC B;  1OHH G;  3WU2 Z;  2ILM A;  1VF6 C;  4DYL A;  2P67 A;  2QM7 A;  3CC7 V;  1YSC A;  4PEL A;  1P49 A;  3M8A A;  2ADP A;  4TSF G;  4HNA B;  1GN6 A;  5JWP A;  2IJJ A;  3ETQ A;  2L35 A;  4GKJ B;  3UKM A;  3DSQ A;  2K9P A;  1GTO A;  1OCZ B;  4YIO A;  1EZV H;  4LC1 A;  3OFN G;  2A06 H;  2LP7 A;  4I5S A;  4D6T H;  1WPB A;  2QM8 A;  5L3D A;  2GV9 A;  4X64 B;  4FM1 A;  4JI7 O;  3TXQ A;  2UXX A;  1FXV A;  4MSW C;  3HKE B;  3OT7 A;  3K0D A;  1QLN A;  3JYC A;  2Y0P A;  4MVO A;  5LGN A;  2MK3 A;  1SA0 B;  1ARO P;  3K9A A;  3X2Q B;  1VQO V;  1K5S A;  1L1F A;  2QKA A;  4H0L B;  3U10 A;  2L6L A;  1F51 A;  1S72 V;  5IT9 N;  4BWA A;  2EIN B;  4UCO A;  3T4D A;  2LW1 A;  4NTW A;  1N36 B;  1Q82 W;  4LF5 B;  3HKC A;  3ZN0 A;  1HDJ A;  4I0X A;  1X4T A;  5LP6 B;  3VQV A;  4P30 A;  4O4J B;  1RP3 B;  2HR3 A;  4UCV A;  4DR6 B;  4I9W A;  4BIZ A;  1PV0 A;  2HEP A;  3W7S A;  2JEU A;  2Q5Z A;  1VQP V;  4MVR A;  2ZIO A;  1W2B U;  2PI5 A;  5JCO C;  4DV5 B;  4BW9 A;  5IE9 A;  4H37 A;  1TUE B;  1R3L C;  4GX5 A;  3TK1 A;  3QO7 A;  1Q43 A;  1SQQ H;  3D3Q A;  1A32 A;  1YIJ V;  2JS5 A;  3O65 A;  4ZI7 A;  4F6E A;  3AG1 B;  3SYA A;  3RYF B;  4DUZ O;  3APO A;  4BIO A;  1MZF A;  2HFE C;  4FLY A;  1XMQ O;  4YHH B;  3H9V A;  3E8G A;  2EIJ B;  2YIB D;  2WA3 A;  4LFA B;  1CPY A;  4MW3 A;  1RSO B;  3CE2 A;  2NNU A;  3GWK C;  3SYO A;  1D5A A;  2ADQ B;  2EZO A;  2EJR A;  4TUY A;  2WLL A;  3ZCC A;  4BIU A;  5KAF Z;  4ZOL A;  5FL7 G;  2ZDI A;  1RPO A;  4PA3 A;  1BT8 A;  3ZHS A;  1MSW D;  3E35 A;  2R9I A;  5B1A C;  1GN3 A;  3HKC B;  4X89 A;  3U11 A;  2E5L B;  4I0X B;  1RM1 B;  4JI5 B;  1JA8 A;  2LJ2 A;  3CJH A;  4KHP B;  2RN9 A;  3RGB A;  5BZB A;  4CH5 A;  1VQ7 V;  2UUB B;  4J11 A;  4LR3 A;  3L74 H;  4JI8 O;  1R3K C;  3SR2 C;  4WBN B;  1H2K A;  1VQK V;  3CME V;  2AW9 A;  1NTM H;  4R7C A;  1N34 B;  2JGD B;  5CB4 B;  1BE3 H;  3K08 A;  2QA4 V;  2QR4 A;  5KX5 A;  4JI6 O;  4X1I A;  3JAT A;  4B7E A;  4DR1 B;  1KKD A;  4OXS A;  3ZN1 A;  4W4K A;  3T1C A;  1PL4 A;  4HZ3 A;  1NT2 B;  2R72 A;  5EIB C;  1I5X A;  3S3W A;  2D2C B;  2YI9 A;  1TUB A;  2CGN A;  4B3T B;  4ZI7 B;  3EVK A;  1OCC C;  3OUS A;  3ML0 A;  2E75 B;  4JI1 O;  4OGQ B;  1DK1 A;  3L73 H;  3H01 A;  4K0K B;  4I50 A;  2F93 B;  1ZTE A;  2G38 A;  1GM8 A;  3STL C;  1M57 C;  2FML A;  4Q20 A;  1KP3 A;  1AR5 A;  4F4L A;  3BAA A;  5JQG A;  4DW1 A;  4GX0 A;  2A0L A;  1YTF D;  4CH3 A;  1BHA A;  1XMO O;  5LYJ A;  4DV7 O;  1HNZ O;  3DC6 A;  4NR1 A;  4MTO A;  5JJJ B;  4TUY B;  4DV1 O;  4DR4 B;  1M5I A;  2WLM A;  2QGN A;  1HWY A;  2HJD A;  4N21 A;  5H6R A;  4GKK B;  1JVM A;  3M7M X;  1FKA O;  1H2N A;  1NTK H;  2RQ6 A;  3BPZ A;  5GTH Z;  5LGT A;  3SYQ A;  1WP7 A;  3W7U A;  4X66 B;  2VQF O;  3LSU A;  1VQ6 V;  3O9O A;  4YY3 B;  3K79 A;  2UXB O;  1N0N A;  3JD2 A;  3H1K H;  2HP8 A;  2Y48 A;  1GM7 A;  3HB3 B;  4UCR A;  3EFF K;  2YIC A;  2DYR B;  2IJI A;  3CB2 A;  4J9Z B;  3CMA V;  2OWO A;  1CP9 A;  4AQY B;  5E1A C;  3OEE G;  4UCS A;  3RT3 C;  3ZRX A;  1GO3 F;  2CUG A;  4JV5 B;  1G6U A;  1OCO B;  3OTO O;  5KX5 B;  2R9R B;  3JAT B;  1Y76 A;  5LMN O;  1Y4M A;  2ZQM A;  3I55 V;  2YUA A;  1EBO A;  2Z5U A;  4B7K A;  2EZP A;  2DWD C;  1AVM A;  1TUB B;  1PL0 A;  2KKW A;  3FD9 A;  2ARH A;  5IY5 C;  1SQP H;  4Q6G A;  5IJ9 B;  2W6I G;  2UXD O;  3K03 A;  4WFF A;  3BAB A;  4LF8 B;  2VQE B;  2IH1 C;  3FKS G;  4CH4 A;  1PD3 A;  4OPA A;  3ZHT A;  3W7X A;  2PTM A;  2ODM A;  3QNE A;  5JQG B;  3JSL A;  2E74 B;  3B4S A;  1OZ0 A;  5B1B B;  3UM7 A;  4MS2 A;  4DRX B;  3ASN B;  4GX2 A;  4J7J A;  5LYJ B;  5BMV A;  4I9Q A;  4DV0 O;  4AI8 A;  3K57 A;  5CN0 A;  1QHT A;  3OR7 C;  4X1Y A;  4XDL A;  3D36 A;  3DXR B;  2A9H A;  2YXH A;  1BZK A;  3VQW A;  4DR2 O;  1BGY H;  1WN7 A;  4WCE V;  2Q68 A;  4MTF A;  1OCR B;  2ZCE A;  4JTC B;  4Z1M G;  2OTJ V;  1KU9 A;  4RUE A;  1KP2 A;  4J10 A;  2GUZ A;  1EFR G;  5HFL A;  2WPD G;  4UVB A;  1R6T A;  1WAZ A;  1MAB G;  3AG3 B;  3E22 A;  2GDS A;  3OE7 G;  1FXK C;  2P4K A;  2YS8 A;  4HYO A;  1SC5 B;  1P7B A;  1P7G A;  4Z1V A;  1HNX B;  3U0Z A;  5EC2 C;  1K5Q A;  2WA4 A;  4B3S B;  3T4Z A;  4FZ0 A;  1Y76 B;  2W0X A;  4FLX A;  2AHY A;  2KSD A;  5B1N A;  5A9G A;  2ZE8 A;  3CPW U;  4JAA A;  1N33 B;  3ZIA G;  2DJV A;  1L0L H;  4NTX A;  2K1E A;  4EFB A;  3C3T A;  4CS3 A;  1IDS A;  3DC5 A;  4FLV A;  2P90 A;  4NXN O;  2OIE A;  1YEW A;  4DUY O;  3CC2 V;  4UUJ C;  1IZ3 A;  1R3J C;  3RFR A;  2R9A A;  3GWO A;  2ZKO A;  1FAF A;  2CDY A;  3GVM A;  3JCU Z;  1K4D C;  1F7Y A;  1R6N A;  4U3J B;  4IGG A;  5IYC O;  3FYI B;  1Y74 A;  2KG7 B;  3ZRW A;  4PV1 B;  2X6C A;  1XL4 A;  1Q6U A;  2AXT Z;  1D2D A;  1ZSP A;  4X1Y B;  3JAL A;  4JI0 O;  3WG7 C;  2EIK B;  5IYD O;  4KFM A;  1PNK A;  4PA9 A;  5CMU A;  1K3E A;  3JAR A;  4DR3 O;  4L8J A;  3IAY A;  1FXH A;  5IWA O;  1TGO A;  2F95 B;  4CS2 A;  4JI3 O;  1O9G A;  4I4T A;  4JI7 B;  1R1B A;  1VQN V;  1LNQ A;  5JVD B;  2ZR2 A;  3B2E E;  3I56 V;  3W7W A;  5L3E A;  5LA6 A;  2GUZ B;  3JAK B;  1RFY A;  2OCH A;  2Q4P A;  4B3M O;  4MTG A;  1NH2 D;  2F1M A;  4G2K A;  3H1L H;  3E22 B;  1R3I C;  4IYI A;  3CSX A;  3QO8 A;  4ZHQ A;  3ABL C;  1Q6H A;  1F23 A;  4LF6 O;  1YI2 V;  1E79 G;  1SKV A;  3CEI A;  2Y4U A;  1Q6I A;  4GUN A;  5K1X A;  3TET A;  3BA9 A;  4FM2 A;  3MHH C;  1GH6 A;  1V54 C;  5H6Q A;  1ZLZ A;  4U7N A;  3K0G A;  3CCU V;  1SQB H;  1WPX A;  3H1H H;  1URF A;  4G27 B;  2FL4 A;  3B40 A;  4LH7 A;  5KMG A;  4RWU A;  2Q7H A;  3SJC C;  4ZKI A;  4CS4 A;  2V4D A;  2JIZ G;  2IU0 A;  1H8H G;  1N4C A;  1E1Q G;  1XNQ O;  2ZNJ A;  3STZ C;  4O4I A;  4JYA O;  5LMU O;  1BMF G;  3G4S V;  1EN6 A;  5LP6 A;  5BR8 O;  4O4J A;  4D7T A;  4YJ2 A;  2B5U A;  1Y74 B;  1SER A;  2JEX A;  5L3G A;  3ZRW B;  3OAA G;  3K06 A;  4PI0 A;  2QWN B;  3JAL B;  1Y67 A;  1IBM O;  4DK1 A;  1AI6 A;  3BRC A;  5CBG A;  1RPR A;  1B3Q A;  4B08 A;  3AG4 B;  3JAR B;  4UXN A;  1N32 O;  3CS5 A;  4DUZ B;  3N2G A;  2JDI G;  4QJF B;  2XT9 A;  4JTA B;  1XMQ B;  5IYB O;  3CRM A;  4I4T B;  3ETD A;  3RVY A;  3T1H O;  4FPP A;  1JPX A;  3CHX A;  2VRZ A;  2Y69 C;  5LA6 B;  3G6B A;  1BQ0 A;  5EYP B;  2CTQ A;  3L9D A;  2HKO A;  4UB6 Z;  4X65 O;  1E1R G;  1K97 A;  2P7T C;  1ORQ C;  4TV8 B;  3RYF A;  2BTO A;  3K5L A;  5L3F A;  3P3N A;  4ZHQ B;  2RNB A;  3X2Q C;  2GBO A;  4H44 B;  1B04 A;  1MA1 A;  1ZWI C;  4JZ2 A;  2EIM B;  1BCC H;  5JCO A;  1RSO A;  3RW0 A;  2YC0 A;  3WB0 A;  3ZHU A;  4X88 A;  1MOF A;  1Q7Y W;  4DV6 O;  2RDC A;  5GON A;  1YXB A;  2EUL A;  2IH3 C;  4EKW A;  2FYU H;  3UQ8 A;  5GW7 A;  5DEC A;  1IUR A;  5KMG B;  1AJP A;  5JJE B;  4JZG A;  4TQD A;  3H1J H;  4O4I B;  4TOI A;  4JI8 B;  3RN4 A;  1GM9 A;  3HPL C;  1H2G A;  3JAM N;  2EX3 A;  4YJ2 B;  4JI6 B;  2JK5 C;  1IXM A;  1PNM A;  3ZMU A;  1COW G;  3VOU A;  3QG5 A;  3A0H Z;  1K33 A;  4WBN A;  1HR0 O;  2JGD A;  4X62 O;  5CB4 A;  2DOS A;  4DR7 O;  3AG1 C;  4JI1 B;  3LDE A;  3N2G B;  1SQV H;  1SZX A;  2AHZ A;  3C3S A;  1OV9 A;  1V55 C;  5B66 Z;  2ZE7 A;  3CCL V;  5K1P A;  4ZBM A;  5C8Y B;  2XAF A;  4CZZ A;  1PNL A;  2KQX A;  1ZAU A;  3ZJZ A;  1GAX A;  2QEX V;  4J7K A;  1XMO B;  4DV7 B;  1QR8 A;  1GN2 A;  1HNZ B;  3CRQ A;  2OIG A;  3JCZ A;  3ABK C;  4DV1 B;  2X7R B;  4K35 A;  1KB9 F;  3SPJ A;  3DGE A;  1M56 C;  1KD1 W;  4LWS A;  1PPJ H;  2RJZ A;  1VMG A;  1NJI W;  1DGS A;  4X1K A;  1NVP B;  1SQF A;  5LOV A;  4E2L A;  2VQF B;  2DYS C;  1M90 W;  5GON B;  5KA5 A;  3CCJ V;  4WFA V;  2UXB B;  1QNM A;  3ABM C;  3A0R A;  1K9M W;  3G71 V;  1NR1 A;  1W0K G;  1VAR A;  2QWR B;  3AG2 C;  2X6A A;  4DV3 O;  5EBM C;  1UJW B;  4Z2W A;  4XDJ A;  5TIS Z;  1CEZ A;  2ZM6 O;  1QU7 A;  1ZUQ A;  4XBF A;  3ASO B;  4ZIB A;  3OTO B;  1KC8 W;  2LW7 A;  3T1Y O;  5KUM A;  5LMN B;  3UCS C;  1G8M A;  3QF7 A;  4FFK A;  4HBN A;  4WFH A;  4RUF A;  1R73 A;  1YJN V;  2PY5 A;  4YXW G;  2OT5 A;  3F7V C;  5CBH A;  2GTS A;  2F43 G;  2YXL A;  3HKB B;  1JQ0 A;  1SRY A;  2EBO A;  2YEV B;  2UXD B;  4TWK A;  5B1A B;  1Q90 D;  2LFR A;  2E3C A;  2DMX A;  2PGG A;  1BSM A;  1VP7 A;  4J7Z A;  3N27 A;  2UUA O;  3JD4 A;  3J81 N;  3SJA C;  3UT5 A;  3CRC A;  1QVG U;  5FPR A;  2YI8 A;  2V1D A;  3HR0 A;  3CCE V;  3MAQ A;  5IJ9 A;  4DV0 B;  3T2M A;  3ZX6 A;  5IJ0 A;  1JFF A;  1AJN A;  4G28 B;  1BHB A;  4JAU A;  3RYI A;  1AJQ A;  1XL6 A;  3CRR A;  4LWS B;  3CCR V;  4DR2 B;  3JD0 A;  4CBC A;  4DRX A;  1QVF U;  3K5O A;  2ZDI C;  2GTA A;  4X1K B;  2EIL C;  3VQY A;  5LOV B;  2FTK A;  2Q7G A;  4H33 A;  3F5T A;  3DXR A;  3KCY A;  3TCU A;  3LSQ A;  2FKX A;  1D5N A;  2PF4 E;  2WAM A;  3MHS C;  3CD6 V;  1K4C C;  2OTL V;  4UV8 A;  2DYR C;  3ABT A;  4RQF A;  1Y66 A;  2JVD A;  5D5P A;  1M57 B;  4PDV A;  3L70 H;  4MVQ A;  2CK3 G;  4DO2 A;  4ABM A;  4GYC B;  3ZED A;  1EZJ A;  2ZIM A;  1ZL8 B;  4KXR A;  2YDE A;  2QKS A;  4J42 A;  3FFQ A;  3CCM V;  4X8A A;  1JR9 A;  1JOY A;  1HW7 A;  3HKD B;  4NXN B;  1XRE A;  4DUY B;  2UUC O;  4DW0 A;  3ICX A;  4PDM A;  2ZR3 A;  2B1G A;  4F6R A;  3G80 A;  1IBK O;  4JF3 A;  2Q0O C;  1AB3 A;  1MNG A;  4YJ3 A;  4FLW A;  3UT5 B;  3ZRS A;  2WLJ A;  5B1O A;  4MVU A;  4D7S A;  1BS3 A;  3ASN C;  1IBL O;  1S77 D;  5IJ0 B;  1AR4 A;  1JFF B;  1XUQ A;  2NR5 A;  1M9N A;  2QE7 G;  4JI0 B;  1NR7 A;  4E4E A;  4OPH A;  3RYI B;  4DV2 O;  4FM0 A;  2JGU A;  1FS0 G;  4U3J A;  3BA8 A;  4DR3 B;  2QWQ B;  4BR6 A;  2X0L A;  4JTD B;  1H8E G;  2KG7 A;  1AI4 A;  1SZT A;  5IWA B;  1J5E O;  4JI3 B;  3K59 A;  3L72 H;  3SPC A;  1YIT V;  4ASU G;  5H2F Z;  1L8D A;  3BHP A;  5IDJ A;  4TT3 G;  4O2B A;  3IFX A;  3TJT A;  4B3M B;  5KHJ A;  1P4R A;  3LNN A;  3D8C A;  4P2Z A;  3AG3 C;  1QCE A;  4H13 B;  4AIL C;  2QWP B;  4OX9 O;  3ABU A;  2WLN A;  5LGU A;  3G67 A;  5J2T B;  5JVD A;  4LF6 B;  3BEH A;  3NXS A;  1PP9 H;  2HG5 C;  1YVW A;  3JAK A;  4O4H B;  1XOU A;  4IYH A;  1T5E A;  1LR1 A;  4GX1 A;  3K5N A;  1FPO A;  1IX9 A;  5KAI Z;  2IBZ H;  3CXC U;  4QE7 A;  1I94 O;  4PA7 A;  4LCU C;  4CC6 A;  4JI4 O;  2B1I A;  1XNQ B;  5B3S C;  3K3W A;  4R6Z A;  4JYA B;  4I55 A;  5LMU B;  2CAZ C;  4F6R B;  3D3I A;  3L75 H;  2Z3Y A;  2PYL A;  2AZ0 A;  4MVS A;  5KHG A;  2LGW A;  4U7O A;  2YXY A;  5EC1 C;  4JI2 O;  1B6Q A;  4YJ3 B;  5BR8 B;  1NKD A;  1SES A;  1WB8 A;  4LFB O;  2AGA A;  3E83 A;  2CTP A;  1W59 A;  3I5D A;  4N23 A;  1WP8 A;  4PD4 F;  3SPG A;  1FXK B;  3LUT B;  4JAS A;  3ZRV A;  4X20 A;  1IBM B;  3E8B A;  3CX5 F;  2ZXW B;  4QIW F;  3D36 C;  1QR9 A;  1XNR O;  3FB8 C;  1DTO A;  2OCC C;  1JJO A;  5J2U B;  1N32 B;  1KMI Z;  1F4M A;  1QLE C;  4PJ0 Z;  2JJ2 G;  3OGC C;  3JSN A;  3J7A U;  1OJH A;  1NS1 A;  5F2V O;  3T1H B;  1YCI A;  1YZB A;  3ETE A;  1VIB A;  4O2B B;  1TVK A;  4WFE A;  3IC9 A;  2DQ0 A;  4X65 B;  2Q8V A;  4FZ1 A;  3SDL A;  4DR5 O;  4O4L A;  4QPK A;  2ZE6 A;  3K5M A;  5LHH A;  2A7W A;  1HNW O;  1L0N H;  1ENV A;  3TXS A;  2YIB A;  1GK9 A;  2ZD9 A;  3E8F A;  2OYQ A;  5EYP A;  2RCV A;  4PDR A;  2IJK A;  2X6B A;  3KKY A;  4JYC A;  2XAS A;  2ZIN A;  4TV8 A;  1YJ9 V;  3UO2 A;  4DV6 B;  1WLE A;  1Z5V A;  1H38 A;  3FX7 A;  3WG7 B;  3OMI B;  3LSS A;  3CCS V;  1VF6 A;  3J80 N;  4NXM O;  3P30 A;  1P84 F;  3F5W C;  1KYO F;  2QDO A;  1YJW V;  1WJZ A;  2UXC O;  1FYJ A;  4I55 B;  3B77 A;  5LXT A;  5H5N A;  3S3X A;  2A3Q A;  2D3O W;  4IHJ A;  5KHK A;  3E2E A;  4KL1 A;  3H1I H;  4QNH B;  2KB1 A;  1S0V A;  1I0H A;  2Q67 A;  1HP8 A;  3SYP A;  1Z2G A;  2LFS A;  2QWO B;  4X20 B;  3ABL B;  1HR0 B;  4GZR B;  4X62 B;  5ITZ A;  4DR7 B;  5IYZ A;  3RYH A;  1SET A;  3AG4 C;  4LF7 O;  2PZS A;  3OTF A;  1VQ5 V;  1S3J A;  3OW2 U;  2ITD C;  5DM6 V;  1TA8 A;  1H2M A;  3QTC A;  2PYJ A;  1OCZ C;  1TVK B;  3APQ A;  3CWB H;  4EFE A;  3EXA A;  4W4L A;  1ZX3 A;  3NR7 A;  4X9Q A;  4LF4 O;  2R70 A;  4O4L B;  2E76 B;  1TAE A;  2F4V O;  3ZS8 C;  1VQ4 V;  3SJQ C;  5C8Y A;  2HVJ C;  2YID A;  2EIM C;  4RO2 A;  2DW4 A;  3OEH G;  3MDS A;  4I7Z B;  3FAV B;  4KP4 A;  4UVA A;  2UXN A;  2P4V A;  3E89 A;  1XHX A;  2UU9 O;  4MW8 A;  4B3R O;  2EIN C;  3ZMV A;  5LHI A;  4FJC C;  1AP6 A;  4LH6 A;  4DV3 B;  2BCC H;  5LXT B;  3FB6 C;  5H9C A;  4UVC A;  2ZM6 B;  4IHJ B;  2WLI A;  5LP6 C;  2CE4 A;  2Y69 B;  1Z5W A;  4RAI A;  3T1Y B;  4DV4 O;  4NTY A;  2MW2 B;  3OD4 A;  2N74 A;  4IT5 A;  5ITZ B;  1K34 A;  2BTQ B;  1UPG A;  3B09 A;  3RYH B;  5IYZ B;  2IU3 A;  4NKG B;  3BY6 A;  4IIJ A;  4JAV A;  5EBW C;  1JCH A;  2UUA B;  1QQC A;  2IW5 A;  3B8M A;  1Q81 W;  1FJG O;  1GN4 A;  1GMG A;  4WFB V;  4PDL A;  3HKB A;  3WFV A;  2DQ3 A;  2DN9 A;  2YEV A;  3JAW A;  4FFB A;  1WB7 A;  2NLJ C;  4O2A A;  2HHH O;  4LF9 O;  5KHI A;  4EB6 A;  2EIJ C;  1I5Y A;  2CTW A;  1YTF B;  1MSD A;  4FMT A;  4LBE C;  2ATK C;  1NU1 H;  1YDX A;  3ZMT A;  5DED A;  1Q86 W;  3CP1 A;  2BSK A;  1NI8 A;  4LFC O;  3ZBH A;  1YHQ V;  2CH7 A;  1Q5O A;  3A2F A;  2V7Q G;  3OMN B;  5E79 Z;  3AEI A;  1V55 B;  1RM1 C;  2DE0 X;  4UCU A;  2N05 A;  4GKJ O;  2ETN A;  2WLI B;  1S5L Z;  3ASO C;  3VBB A;  4CC5 A;  2FB5 A;  1IVS A;  5DN6 G;  1W0J G;  3K58 A;  2QTS A;  1JJ2 U;  2QM4 A;  3AG7 A;  1VEW A;  2P6J A;  2XTA A;  3ABK B;  4DK0 A;  1VQ9 V;  1ROP A;  3RVZ A;  3A8T A;  1MZE A;  2GHY A;  2ZT9 B;  3OR6 C;  4X64 O;  3JD1 A;  2H8P C;  1M56 B;  2YIA A;  3M99 B;  5EK0 A;  4JYB A;  3SPI A;  2UUC B;  1WA8 A;  2LO1 A;  1J95 A;  4UCT A;  2JS3 A;  1S5H C;  1M1K W;  2WLH A;  4IIJ B;  2CGO A;  1ZL8 A;  1N0J A;  1K92 A;  3RWR D;  1IBK B;  1EM1 A;  2DYS B;  1AR1 B;  2N04 A;  2DWE C;  3ZHR A;  5AG2 A;  2Q0A A;  3HKD A;  1XI1 A;  3ABM B;  4LP8 A;  1I08 A;  4TV9 A;  1IBL B;  1KKC A;  3CRA A;  2ZE5 A;  2HLD G;  3JAW B;  4FFB B;  2XAG A;  4O2A B;  1N36 O;  2Q9L A;  3AG2 B;  1QBZ A;  3IC7 A;  4LF5 O;  1V9P A;  4DV2 B;  3JD3 A;  4EB6 B;  2XAH A;  3OUF A;  2LQT A;  4FLT A;  4DXW A;  5JJN B;  5CA0 A;  3ZHV A;  5KHH A;  1J5E B;  3QO5 A;  4J41 A;  4DR6 O;  4WFG A;  4R8C A;  1H2L A;  2BSK B;  1Q3E A;  1KUQ A;  1YF2 A;  4JPR A;  4PA4 A;  2CH7 B;  1U97 A;  4DV5 O;  3WB2 A;  1LUV A;  1US6 A;  5CA1 A;  4OX9 B;  1U96 A;  5C93 A;  2P06 A;  2PI4 A;  4HAM A;  1SF9 A;  1SQX H;  3ZMZ A;  2HVK C;  3PJS K;  1GKF A;  2WWW A;  2BE3 A;  1LUW A;  1EN5 A;  1M4U A;  1OCC B;  1VQ8 V;  3DTU B;  2Q73 A;  3K04 A;  3K9S A;  3FB5 C;  4K8Z A;  3BVO A;  5J2T A;  1XQ8 A;  2WLL B;  4YHH O;  1KQS U;  1I94 B;  1VQM V;  4AHC A;  4O4H A;  1EN4 A;  4JI4 B;  1R6K A;  4GCZ A;  4LFA O;  1OCO C;  4ZOL B;  1WA8 B;  3LNM B;  3P32 A;  2EIL B;  1NVP D;  3ETG A;  4WF9 V;  4TQF A;  4PA6 A;  5EBL C;  2XOK G;  3GB7 C;  4PI2 A;  2VWK A;  4JI2 B;  4QPJ A;  1Y6X A;  4MVZ A;  5FNV A;  3CJH B;  1BL8 A;  4LFB B;  4PHZ A;  3B8N A;  4TV9 B;  4UB8 Z;  1CXZ B;  1SQG A;  4NVP A;  1FD9 A;  2ITC C;  3PN1 A;  3L71 H;  4QGP A;  5FLX N;  2H3O A;  5LL6 Y;  1M93 A;  3C90 A;  4A5U B;  4FK5 C;  3JAS A;  3ZMS A;  2E5L O;  1XNR B;  4JI5 O;  5B1B C;  2EJ7 A;  4FLU A;  4KHP O;  4FIP C;  4P9P A;  4X1I B;  1I7F A;  4CH6 A;  3P3P A;  2UUB O;  5CA0 B;  1AIL A;  3FYE B;  1FXK A;  3VQX A;  1XEQ A;  4FLZ A;  1FFX A;  3E86 A;  2Q6A A;  1N34 O;  3CCQ V;  1WNS A;  2XUM A;  2Y4T A;  2VWJ A;  5J2U A;  2BOB C;  4DR5 B;  1K8A W;  5CA1 B;  1THZ A;  4DR1 O;  5BXZ A;  2Q7E A;  1OCR C;  5BY1 A;  2IM9 A;  4I50 B;  3MD0 A;  1HNW B;  3F7Y C;  5CA3 A;  2H94 A;  5FPO A;  1KEC A;  1DF5 A;  4MTX A;  3CYO A;  1NH2 B;  3R65 A;  4B3T O;  5IY5 B;  1F4N A;  4K0K O;  3BCC H;  1X59 A;  3AK2 A;  5EZY A;  4NXM B;  4FVM A;  3UO3 A;  2NN4 A;  1G4Y B;  2LGQ A;  3KCX A;  3LDD A;  4IL6 Z;  2UXC B;  1N8R W;  2PUS A;  2HJF C;  5KLV H;  3CC4 V;  2QTO A;  2W0F C;  2CTR A;  1MG1 A;  1JMK C;  4DR4 O;  4LNU A;  5EIB D;  2B9Z A;  2JJ1 G;  5FNV B;  3AK3 A;  2VS0 A;  3N2K A;  4GKK O;  3OMA B;  5J9P C;  2ZNI A;  1VF7 A;  1KBH A;  2O57 A;  4X66 O;  4U3F H;  3QVN A;  5KUK A;  3JAS B;  4JYY A;  1G1X B;  2ZXW C;  5GTI Z;  1O9H A;  4GLX A;  2XAQ A;  4YY3 O;  1UFI A;  2XND G;  2RMK B;  4LF7 B;  3THO A;  3Q4H A;  2Z0A A;  3AK1 A;  2IJH A;  3CCV V;  3LDC A;  5HFM A;  5JH7 A; 
#chains in the Genus database with same CATH homology
 1KD1 W;  2BOC C;  1VQ6 V;  1FFT B;  1AI7 A;  3K79 A;  2YSU B;  1NJI W;  2EIK C;  1NVP B;  3JD2 A;  2A79 B;  2Y48 A;  1GM7 A;  3HB3 B;  1VQ4 V;  1S76 D;  4E2L A;  3SJQ C;  2HVJ C;  2DYS C;  1M90 W;  3EFF K;  5KA5 A;  3CCJ V;  2DYR B;  2EIM C;  2IJI A;  4RO2 A;  4WFA V;  5B3S B;  2XAJ A;  4J9Z B;  2DW4 A;  3CMA V;  3OEH G;  3ABM C;  4L87 A;  1CP9 A;  3A0R A;  5E1A C;  3OEE G;  1K9M W;  3G71 V;  1NR1 A;  1W0K G;  3ZRX A;  1GO3 F;  4KP4 A;  5L3B A;  1OCO B;  2R9R B;  4UVA A;  2UXN A;  3AG2 C;  4MVM A;  2X6A A;  3E89 A;  5EBM C;  1AI5 A;  1UJW B;  1Y4M A;  2ZQM A;  4MW8 A;  4XDJ A;  3I55 V;  1CEZ A;  4XDK A;  1EBO A;  2Z5U A;  3KG2 A;  1VQL V;  2EIN C;  4XBF A;  3ASO B;  5KA6 A;  3ZMV A;  2EZP A;  1KC8 W;  5LHI A;  4FJC C;  2DWD C;  2M7W A;  5KUM A;  1PL0 A;  3FB6 C;  5H9C A;  5IY5 C;  2C2A A;  4UVC A;  2WLI A;  1G8M A;  2OCC B;  3G6E V;  2W6I G;  2Y69 B;  1QLE B;  4RAI A;  3K03 A;  4WFH A;  4WFF A;  4RUF A;  1DLB A;  2IH1 C;  1R73 A;  3FKS G;  1YJN V;  4YXW G;  1PD3 A;  2OT5 A;  3F7V C;  3W7X A;  3W7T A;  5CBH A;  1NQT A;  2F43 G;  3QNE A;  1JQ0 A;  1SRY A;  2EBO A;  1OZ0 A;  2YEV B;  5B1B B;  3UM7 A;  4MS2 A;  3ASN B;  4GX2 A;  4TWK A;  5B1A B;  2LFR A;  5CBF A;  1PKX A;  3SPH A;  2GSM B;  1K34 A;  5CN0 A;  3OR7 C;  3JD4 A;  1K7D A;  4MT8 A;  2W6J G;  2IU3 A;  1QVG U;  4XDL A;  3BY6 A;  3D36 A;  2V1D A;  3FB7 C;  5L3C A;  2A9H A;  3RBZ A;  5LHG A;  3CCE V;  4JAV A;  5EBW C;  4GT1 A;  3T2M A;  1JCH A;  1AJN A;  4UV9 A;  2IW5 A;  4G28 B;  1BHB A;  3B8M A;  1Q81 W;  4KUM A;  4WCE V;  4JAU A;  2Q68 A;  4MTF A;  1OCR B;  3OM3 B;  1AJQ A;  1GMG A;  4WFB V;  1XL6 A;  4PDL A;  4JTC B;  2WSS G;  3IGA C;  3WFV A;  4BAY A;  4Z1M G;  3CCR V;  3JD0 A;  4CBC A;  2DQ3 A;  2YEV A;  1K73 W;  2OTJ V;  1QVF U;  3E8H A;  4RUE A;  2NLJ C;  4R50 A;  1KP2 A;  4JGS A;  1EFR G;  1NBM G;  2WPD G;  2ZDI C;  5HFL A;  5LBQ A;  2EIL C;  4UVB A;  2FTK A;  2Q69 A;  4QE9 A;  1MAB G;  3AG3 B;  2EIJ C;  3OE7 G;  4H33 A;  1FXK C;  1I5Y A;  3TCU A;  1YTF B;  1DF4 A;  3LSQ A;  4FMT A;  4HYO A;  4LBE C;  1P7B A;  2ATK C;  1V54 B;  3ZMT A;  2WAM A;  3MHS C;  5EC2 C;  4J9Y B;  1K5Q A;  3CD6 V;  1Q86 W;  1K4C C;  2OTL V;  4P9O A;  3CP1 A;  4UV8 A;  2DYR C;  3T4Z A;  3ABT A;  4RQF A;  2AHY A;  5B1N A;  1Y66 A;  1JX9 A;  3CPW U;  1M57 B;  2WLK A;  1YHQ V;  4PDV A;  3ZIA G;  2K1E A;  2CK3 G;  4MVQ A;  4BW5 A;  4DO2 A;  3EHB B;  4RQE A;  3SYC A;  2V7Q G;  3OMN B;  1OHH G;  3AEI A;  1V55 B;  2P90 A;  1RM1 C;  1EZJ A;  2P67 A;  2QM7 A;  3CC7 V;  3CC2 V;  1YSC A;  4UUJ C;  2WLI B;  4PEL A;  1R3J C;  2QKS A;  4TSF G;  3GWO A;  3ASO C;  3VBB A;  3CCM V;  4X8A A;  5DN6 G;  1W0J G;  2IJJ A;  1JJ2 U;  1JOY A;  1K4D C;  2P6J A;  3ABK B;  3UKM A;  1VQ9 V;  1R6N A;  4PDM A;  1ROP A;  3RVZ A;  2ZR3 A;  2B1G A;  2GHY A;  1GTO A;  3FYI B;  3OR6 C;  5IYC O;  1OCZ B;  3JD1 A;  2H8P C;  1M56 B;  3ZRW A;  4LC1 A;  2X6C A;  1XL4 A;  3M99 B;  3OFN G;  5EK0 A;  4JF3 A;  2LP7 A;  4JYB A;  3SPI A;  4I5S A;  1M1K W;  1J95 A;  1S5H C;  3WG7 C;  2EIK B;  3ZRS A;  2WLJ A;  5B1O A;  2QM8 A;  4MVU A;  5IYD O;  5L3D A;  2WLH A;  3ASN C;  4KFM A;  1K92 A;  1PNK A;  4PA9 A;  5CMU A;  1S77 D;  2DYS B;  1AR1 B;  2UXX A;  1K3E A;  1FXV A;  4MSW C;  1M9N A;  2QE7 G;  2DWE C;  3K0D A;  1NR7 A;  1FXH A;  1QLN A;  3JYC A;  4MVO A;  3ABM B;  4LP8 A;  5LGN A;  1VQN V;  1LNQ A;  1FS0 G;  2MK3 A;  1ARO P;  2HLD G;  2ZR2 A;  3K9A A;  3I56 V;  3W7W A;  5L3E A;  3X2Q B;  2X0L A;  4JTD B;  2XAG A;  1VQO V;  1K5S A;  1L1F A;  1H8E G;  3AG2 B;  1QBZ A;  3IC7 A;  1AI4 A;  1SZT A;  1F51 A;  4MTG A;  1NH2 D;  3JD3 A;  1S72 V;  4G2K A;  3SPC A;  1YIT V;  4ASU G;  1R3I C;  2EIN B;  2XAH A;  3OUF A;  3QO8 A;  3T4D A;  5IDJ A;  3ABL C;  4TT3 G;  3IFX A;  4DXW A;  1F23 A;  1Q82 W;  3ZN0 A;  1YI2 V;  1E79 G;  1P4R A;  3QO5 A;  4P2Z A;  3AG3 C;  1QCE A;  4WFG A;  4R8C A;  3ABU A;  2WLN A;  4P30 A;  5LGU A;  3TET A;  3MHH C;  1V54 C;  5H6Q A;  3K0G A;  4U7N A;  2HR3 A;  3BEH A;  4JPR A;  3CCU V;  3NXS A;  4PA4 A;  2HG5 C;  4I9W A;  1WPX A;  4BIZ A;  3W7S A;  4G27 B;  5C93 A;  2PI4 A;  4HAM A;  2JEU A;  4GX1 A;  4ZKI A;  1VQP V;  3ZMZ A;  4MVR A;  2HVK C;  1W2B U;  2PI5 A;  2JIZ G;  2IU0 A;  1H8H G;  1E1Q G;  3PJS K;  1GKF A;  3STZ C;  3CXC U;  4H37 A;  1TUE B;  4QE7 A;  1R3L C;  2WWW A;  4PA7 A;  4GX5 A;  4LCU C;  1BMF G;  1OCC B;  3G4S V;  1VQ8 V;  3TK1 A;  3QO7 A;  3DTU B;  2B1I A;  3K04 A;  3FB5 C;  1YIJ V;  5B3S C;  3K3W A;  2WLL B;  2B5U A;  4R6Z A;  1KQS U;  1SER A;  2JEX A;  5L3G A;  3ZRW B;  3D3I A;  1VQM V;  3AG1 B;  2Z3Y A;  3SYA A;  4MVS A;  1R6K A;  4GCZ A;  4U7O A;  3OAA G;  3K06 A;  5EC1 C;  1OCO C;  1B6Q A;  1NKD A;  3LNM B;  2HFE C;  3P32 A;  1SES A;  1AI6 A;  2EIL B;  1NVP D;  3ETG A;  5CBG A;  4WF9 V;  3E83 A;  1RPR A;  4PA6 A;  4N23 A;  3E8G A;  3AG4 B;  2EIJ B;  5EBL C;  2XOK G;  3SPG A;  1CPY A;  1FXK B;  3GB7 C;  3LUT B;  4JAS A;  4UXN A;  4MW3 A;  3ZRV A;  4QPJ A;  2JDI G;  4QJF B;  4MVZ A;  2NNU A;  3E8B A;  4JTA B;  2ZXW B;  4QIW F;  1BL8 A;  5IYB O;  1QR9 A;  3B8N A;  3SYO A;  3ETD A;  3FB8 C;  2ITC C;  2EZO A;  3RVY A;  1DTO A;  2EJR A;  4FPP A;  2OCC C;  1JPX A;  2WLL A;  3ZCC A;  2Y69 C;  1F4M A;  1QLE C;  4BIU A;  4FK5 C;  2HKO A;  2JJ2 G;  1E1R G;  1K97 A;  2P7T C;  3ZMS A;  3OGC C;  1ORQ C;  5FL7 G;  2ZDI A;  5L3F A;  1RPO A;  5B1B C;  4PA3 A;  3ETE A;  1MSW D;  3E35 A;  4WFE A;  3X2Q C;  2R9I A;  4FIP C;  5B1A C;  4P9P A;  2DQ0 A;  4X89 A;  1ZWI C;  3FYE B;  1FXK A;  1RM1 B;  2EIM B;  4QPK A;  3RW0 A;  5LHH A;  4X88 A;  3E86 A;  1MOF A;  1Q7Y W;  2Q6A A;  5BZB A;  1VQ7 V;  1ENV A;  3CCQ V;  1GK9 A;  2ZD9 A;  2BOB C;  3E8F A;  4PDR A;  1K8A W;  2IH3 C;  1THZ A;  2IJK A;  2X6B A;  4EKW A;  5GW7 A;  1R3K C;  4JYC A;  1OCR C;  2XAS A;  1YJ9 V;  1VQK V;  3CME V;  1AJP A;  4R7C A;  3MD0 A;  1WLE A;  3K08 A;  3F7Y C;  5CA3 A;  2H94 A;  2QA4 V;  1H38 A;  1KEC A;  3WG7 B;  1DF5 A;  3OMI B;  1KKD A;  3LSS A;  4MTX A;  3CYO A;  4OXS A;  3ZN1 A;  3R65 A;  3CCS V;  1NH2 B;  1GM9 A;  3HPL C;  5IY5 B;  3P30 A;  3T1C A;  1H2G A;  4HZ3 A;  3F5W C;  1F4N A;  1YJW V;  1I5X A;  2JK5 C;  1IXM A;  3B77 A;  1PNM A;  3ZMU A;  1COW G;  1OCC C;  3VOU A;  3OUS A;  3ML0 A;  2D3O W;  1K33 A;  1G4Y B;  3E2E A;  3H01 A;  3LDD A;  4QNH B;  2KB1 A;  1N8R W;  1GM8 A;  1S0V A;  2HJF C;  3CC4 V;  3STL C;  2QTO A;  1M57 C;  4Q20 A;  2W0F C;  1KP3 A;  2Q67 A;  3SYP A;  3AG1 C;  2LFS A;  1MG1 A;  3LDE A;  4F4L A;  4GX0 A;  2A0L A;  2AHZ A;  3ABL B;  1YTF D;  2JJ1 G;  1BHA A;  1V55 C;  3OMA B;  3CCL V;  4MTO A;  4ZBM A;  5J9P C;  1SET A;  3AG4 C;  2WLM A;  1HWY A;  2XAF A;  4CZZ A;  1PNL A;  3ZJZ A;  1VQ5 V;  2QEX V;  1S3J A;  5KUK A;  3OW2 U;  2ITD C;  4N21 A;  5DM6 V;  1QR8 A;  2ZXW C;  5H6R A;  1JVM A;  2XAQ A;  3JCZ A;  3ABK C;  2XND G;  2X7R B;  5LGT A;  3SYQ A;  3W7U A;  1OCZ C;  2IJH A;  3SPJ A;  3CCV V;  3LDC A;  3DGE A;  1M56 C;  5HFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...