4JGSA

Crystal structure of the xmrv tm retroviral fusion core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
82
structure length
82
Chain Sequence
b'FEQLQAAIHTDLGALEKSVSALEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECSFYADHTGVVRDSMAKLRERLNQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MLV-related proviral Env polyprotein
publication title Crystal structures of Beta- and gammaretrovirus fusion proteins reveal a role for electrostatic stapling in viral entry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein
total genus 33
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2013-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jgsA00
3WFVA 3B8NA 1EBOA 3K9AA 1DLBA 3M99B 3P30A 1DF5A 1MG1A 3B8MA 3CP1A 1QBZA 1JQ0A 4JPRA 1QCEA 1K33A 2MK3A 1I5XA 4FIPC 5CMUA 3B77A 2OT5A 4G2KA 5KA6A 1JPXA 1F23A 5H9CA 1I5YA 1Y66A 5HFLA 1QR9A 1K34A 5HFMA 2LP7A 2M7WA 3GWOA 1QR8A 5KA5A 4N23A 4FK5C 1MOFA 3MHSC 4N21A 1DF4A 3H01A 5CN0A 4FJCC 2X7RB 3CYOA 2EZPA 1ENVA 2P6JA 3MHHC 4JF3A 4JGSA 4E2LA 1SZTA 2EBOA 2EZOA 1Y4MA
chains in the Genus database with same CATH superfamily
4DUZB 2FKXA 5GTHZ 5BZBA 2F4VB 1W0KG 4X20B 5IJ0B 1K73W 4DR4B 1RP3B 5AG2A 1AILA 3BFRA 3UQ8A 2QA4V 1I5XA 1MNGA 4C7UA 1F4MA 2QKAA 3D36C 1B6QA 3I5DA 1DF4A 3WB0A 2YS8A 1XNRB 5J2TB 2ADQB 2WLNA 1NTKH 1ROPA 2JGUA 3CC7V 3WB1A 5KAIZ 4X65B 4LR3A 2BE3A 4UVCA 5BMVA 4MVSA 3ZIAG 4O4IA 1D5NA 1N0NA 3ABMB 3K5NA 3CPWU 1MZFA 1CP9A 1ZLZA 2ZQMA 3QVNA 2X0LA 3K08A 4DR5O 1ZTEA 3CHXA 4Q6GA 5IWAB 3RBZA 3CRQA 4R6ZA 3CP1A 5EBMC 5IYZB 2NR5A 3MAQA 1AJPA 1SF9A 3LDEA 3FYEB 1KP3A 3OTFA 2AGAA 1JJ2U 1RPRA 2JJ1G 4DR7B 4K8ZA 3ZMZA 4X1KB 2QM4A 2KB1A 4AQYO 1CEZA 3CYOA 3DGEA 2ZNJA 1VQ8V 4DW1A 5BMVB 2XAJA 1Z2GA 4JV5O 4LCUC 4O2BB 5FNVA 4I7ZB 3LUTB 2PI5A 1HR0O 4TSFG 5EK0A 4JI5O 1TAEA 1B04A 3K59A 2F23A 2BTOA 1Q7YW 5B3SC 4RQEA 2DYSC 4D6TH 5B1AC 3ZHQA 3LSQA 1PNMA 1JQ0A 1OV9A 2Q73A 3A0RA 3DXRA 2R9IA 2F93B 2HKOA 5JJJB 2ZXWB 3FAVB 1IBKO 3RYCA 4LWSA 3SYCA 2W0FC 1S0VA 1YZBA 2DE0X 2P06A 2UXNA 3CRCA 3N2GA 4H44B 3F5WC 4JI2B 2P67A 2JGDA 1P4RA 2LGQA 1ZUQA 1M57C 4LF7B 5LOVB 4OGQB 1KQSU 1S77D 5KHKA 1LUVA 2EX3A 1R1BA 5K1PA 4WFBV 2RN9A 1VF6A 3TETA 5LP6A 2XUMA 1GM8A 5IJ9A 2QEXV 5CA0A 3VQXA 1XOUA 4FPPA 2Q68A 1JR9A 3LNNA 1VARA 3RN4A 5IYCO 1PPJH 1UFIA 1VQNV 4MTXA 4DR6B 3DXRB 1KYOF 3FX7A 3BAAA 1HWYA 1EZJA 2HJDA 4FFKA 5DEDA 4LWSB 4R50A 1VQ5V 5D5QA 4FLVA 2GDSA 5JQGB 2X6CA 2EINC 3JAMN 1ORQC 2WPDG 3C3SA 2UUBB 3OR7C 4IYHA 2ZM6B 5EBWC 4GKJO 1OCOC 3U10A 4PDVA 3U11A 3QG5A 2DYSB 1SQPH 2UUCO 3B8MA 2GTSA 5LGNA 4TV9A 1NBMG 3CJHA 2CTQA 4OX9B 1N34B 1WP7A 3AG2C 1EZVH 2EIMC 3OE7G 2UXXA 1R3JC 3ABLC 4MT8A 1BHBA 2Q69A 2V4DA 1IBMB 5BY1A 1LNQA 1XREA 4JF3A 5CA3A 1LUWA 3I55V 1FXKC 4O2AB 4LNUA 4LFBO 4LH7A 1M57B 4AILC 1I7FA 2AHZA 4B7EA 5LMUB 1S72V 2BSKA 4O4JB 3UO3A 1TA8A 2YI8A 2UUAB 4W4LA 4PELA 3TK1A 1XUQA 4BIUA 1XNQO 4DRXB 2ZCEA 3M99B 1NH2B 3K5MA 3CJHB 1QBZA 3LDDA 4JPRA 1K33A 3OD4A 4TT3G 2ZE5A 2ZR2A 1PV0A 5DECA 2IM9A 2XAHA 4B3RO 3P3NA 1D5AA 2N04A 2WA4A 4X88A 1RM1C 1VMGA 4UVBA 1YSCA 2GTAA 1DTOA 1SETA 3SJQC 2EULA 5J2UA 3EVKA 3I56V 3GB7C 1Z5VA 2IJKA 2OIGA 2A79B 4JTAB 5KA5A 2YEVA 4CS3A 3BCCH 4DV1O 5IDJA 1M5IA 4JI1O 1ENVA 4MW3A 4DR5B 3NR7A 2Z3YA 5LA6A 4BIZA 2FL4A 4P9OA 5LYJA 2F43G 5L3CA 3CWBH 2IJIA 4NTWA 2QM7A 2A7WA 2YXYA 4N23A 4NTYA 1YHQV 3ETEA 4GLXA 1ZWIC 3IC7A 4AQYB 3P3PA 1BQZA 5J2UB 1I94O 4LF4O 1K5QA 5ITZA 4JV5B 3CXCU 1URFA 4GUNA 2JJ2G 2YEVB 3JASA 1K34A 3J7AU 1US6A 4TV8B 2YC0A 4I0XB 1V9PA 4LF8O 2N05A 1HR0B 1KC8W 1AB3A 4PDLA 4IIJA 3B8NA 3OMAB 5CB4B 5LYJB 4FZ0A 2PGGA 1AP6A 3ASOC 4B3MO 2VWJA 1AJNA 2Y0PA 3IJ4A 3ZN0A 4AI8A 2CE4A 3TGUH 4CH6A 1IBKB 3UT5A 3LSUA 2PTMA 4JYYA 2KSDA 3Q4HA 4I50B 3H9VA 1OZ0A 1IXMA 1VQMV 4TOIA 3CRMA 3KKYA 2QWNB 1GN4A 4I4TB 4KHPO 2AXTZ 4XDJA 3IAYA 3E35A 1T5EA 4CBCA 4F4LA 2HP8A 4PI2A 2M6YA 4PJ0Z 2ETNA 4X1YA 3M8AA 3ZX6A 3HR0A 3RYIB 2H94A 1BMFG 2EILB 4Q20A 2BOCC 5B1BC 1BL8A 1PNKA 3JSLA 3CE2A 3E22B 4X62O 3GWKC 1Q6UA 4FM1A 4QPKA 1SQQH 3OM3B 3T2MA 1U96A 4CH4A 5HFMA 3SYPA 3Q4HB 3G80A 1EM1A 3BA8A 2A0LA 4GKJB 2OYQA 1M56C 1HNWO 3CRAA 5A9GA 3CC4V 3K57A 1QCEA 3E86A 3VQWA 5JH7B 3ASOB 5FPRA 3SPHA 4MVOA 2QJ1A 3E2EA 1SESA 3OTOO 1KD1W 3OGIB 1WN7A 3ZJZA 1BE3H 2R9AA 3SR2C 2DW4A 1UJWB 1DLBA 1HNZO 1XDCA 4LFBB 3K5LA 5IE9A 2OCCC 2ZE8A 4DXWA 1OCRC 1F23A 2R70A 4JTDB 3JAWB 1FFTB 1MOFA 1WB8A 2PUSA 3E8HA 4TQFA 1XNQB 4NB5A 3F7YC 1R3IC 1YCIA 5B1BB 4DV3O 2BCCH 3RYHA 4UB6Z 2OTJV 3BPZA 1S5LZ 2DJVA 1PD3A 4G28B 3ZRVA 4GZRB 5K1XA 4WF9V 4PD4F 2RCVA 4WBNA 1R3KC 4B3RB 1Q43A 3G4SV 5LHIA 2F1MA 4WFHA 2Q0OC 2KG7A 1GAXA 1F7YA 3J80N 3CB2A 2LO1A 4J42A 4U3JB 4NTXA 1F51A 3FB8C 2YIAA 1Q8IA 3K9SA 4BAYA 3K03A 1M9NA 1R6TA 4DV5B 3T1HO 2NNUA 4RUEA 1RPOA 4AHCA 4KP4A 3L75H 1FXVA 4DV1B 4JI1B 3RYHB 3ETGA 3CXHF 4B08A 5GONB 5B5EZ 5J2TA 3ABKC 3L70H 4RO2A 5H5NA 3E8BA 2OCCB 1TGOA 3E89A 4F6RB 2Y69C 4TQDA 4DW0A 2N74A 4NR1A 3DSQA 5LHGA 1PP9H 2ZE7A 4K0KO 2E74B 3OW2U 1YITV 2Y0IA 2EZPA 1QU7A 2OCHA 3H1KH 4Z2WA 1S76D 3LDCA 1WNSA 2YUAA 4X9QA 4I55B 1I94B 4LF4B 1R73A 1N36O 4UCRA 5IYZA 1WAZA 3CCRV 1E1RG 1XILA 1HNXO 1OCCC 1OHHG 4LF8B 4O4HB 4X1KA 4DUYO 3JD4A 2GUZA 5BR8O 4B3MB 3OUSA 2WLIB 3AG4C 3RYFB 4H13B 4JAVA 1TUEB 4O2BA 4OPHA 4D7TA 4N21A 1I08A 4IGGA 1SKVA 1R3LC 4U3FH 3D36A 3K06A 4ZKIA 2PYLA 1K97A 2QWRB 5EIBD 3JARB 4U7OA 2RJZA 2QWOB 4J80A 4DR2O 4KHPB 2Q67A 5KA6A 5JCOC 3ZHSA 1SS3A 3U0ZA 4DV6O 4UCVA 4ZI7B 2HR3A 3FAVA 1MA1A 3F5TA 5LXTB 1RFYA 2ITDC 1O9HA 2GUZB 2RMKB 1JFFA 3OGCC 1IVSA 3D8CA 2VWKA 4X62B 2LW7A 4ZHQA 1V55C 5LOVA 4MVQA 1K5SA 2VRZA 2CTPA 2HVKC 1COWG 1VIBA 3MHHC 2CGNA 1L0LH 5EBLC 2XAQA 3JD3A 1DF5A 1HNWB 4K3AA 3H1HH 1YI2V 1WPBA 4FIPC 2DN9A 4JI4O 1I5YA 4X1IB 1NR1A 2W6IG 2E75B 3K0DA 3JSNA 4MTFA 2PZSA 3OTOB 1THZA 5JQGA 1SQBH 2Y48A 4CZZA 2AZ0A 1NVPB 1VQ6V 4JI7O 1JFFB 3BHPA 1BSMA 4PHZA 2K9PA 1HNZB 2P22C 4ZHQB 4LF6O 4DV0O 5LBQA 3CCLV 3KCYA 3OEHG 2CDYA 3SPGA 3APOA 5EZYA 1QR8A 1NJIW 2UXDO 3CCVV 3BY6A 1H2LA 4GT1A 2WA3A 1V54C 3RFRA 2XAFA 1Y4MA 3KG2A 4L8JA 5KLVH 4NXMO 4UCUA 3AK3A 1YDXA 4DV3B 2H3OA 1H2KA 4O2AA 2XASA 3ETDA 1XHZA 2WLMA 1K4CC 5L3BA 5FPOA 1Y66A 1V55B 2HVJC 1BHAA 1K4DC 4DK1A 1N4CA 1NTMH 1H2MA 1WB7A 3ZMSA 4O4JA 3OMNB 5B3SB 1Y67A 3K5OA 3N27A 4DRXA 5B1AB 2XTAA 3IFXA 5EZYB 4PA9A 1H8EG 2ODMA 1EFRG 2FB5A 4DR3O 2DWEC 3GWOA 4ZOLA 3T1HB 2R72A 5CBGA 1NS1A 2ADPA 1TUBB 4XDKA 3QO5A 4HZ3A 4YY3O 3A0HZ 4XBFA 1WA8A 4YIOA 1JJOA 1YJNV 1YF2A 2DMXA 2Q8VA 1AP5A 3A8TA 2WLLA 3AG1C 4QJFB 1D2DA 1R6KA 4LF5O 4GCZA 1XBLA 1NH2D 2L35A 2UU9O 2C2AA 3S3XA 4B3TO 4K0KB 4WFAV 1KKDA 3BRCA 3KCXA 3JD0A 2QGNA 3SYAA 1SRYA 2YI9A 2E3CA 3ZRWB 1OCZC 2B9ZA 3A2FA 3L9DA 1YTFD 2YSUB 1FXKA 2XOKG 2HHHO 3ZS8C 4ZOLB 3CS5A 1N36B 1HDJA 3TCUA 2UXBO 1P49A 1QVFU 2WWWA 4B3SO 4GYCB 2EINB 1HNXB 3X2QC 4PDRA 1SC5B 2QSAA 1VQLV 1WA8B 1GMGA 4R8CA 2VQEB 1Q3EA 3CMEV 3ABUA 4DUYB 1Q82W 4KL1A 3CCJV 1OCOB 2WLLB 1U97A 3JAKB 1LR1A 1NU1H 3WB2A 4YXWG 5BR8B 2EJ7A 2FYUH 1G6UA 4JAAA 4DV5O 3AG2B 2XHBA 4IHJB 2EIMB 3JATB 5L3GA 3ABLB 4TV8A 4CS4A 2XT9A 3S3WA 2F66C 4I0XA 1X4TA 2CH7B 2EJRA 2ATKC 4MVZA 2YXLA 1FXKB 2GBOA 2E76B 5CB4A 2VQFO 3E8FA 4FFBA 3J81N 4ABMA 1FJGO 2JS5A 1AJQA 2Q9LA 4DR2B 3QO7A 1BCCH 4DV7O 4ZIBA 4JI0O 4DV6B 4ZBMA 3W7WA 3ASNC 1NQTA 4JYAO 5KUKA 1N32O 2A9HA 4I50A 4Z1MG 4H33A 1Y74A 2JIZG 4JI3O 5LGUA 2ZR3A 2PF4E 5BXZA 2JS3A 2ITCC 2KKWA 4H0LB 2FTKA 2JEUA 4I4TA 4MVMA 4JI8O 1Q81W 1AI7A 2CTWA 1XL6A 3ZN1A 3OEEG 2P6JA 4IT5A 3HKDB 4X64O 3X2QB 4YJ3A 4E2LA 1RM1B 1FS0G 3RYIA 4FM2A 3ICXA 1NT2B 4FFBB 3ZHUA 3SJCC 5IY5C 4L87A 3UCSC 4H37A 1H2GA 3E22A 3THOA 2DYRC 4JI4B 1IURA 1IX9A 3CCEV 4I5SA 4FLUA 4DK0A 4HYOA 1Y74B 5JWPA 4JI7B 2LW1A 2QTSA 1HW7A 2LFSA 1JOYA 4LF6B 3BABA 4DV0B 4GKKO 1FFXA 1H8HG 2MW2B 1TVKA 4J11A 5JH7A 4X66O 1AI4A 5GW7A 4KFMA 2UXDB 4YJ3B 4YHHO 3ASNB 1AVMA 2F95B 3GVMA 1L1FA 3W7XA 2IJHA 2EIKC 3P30A 4NXMB 1KP2A 4R7CA 3L73H 2K1EA 3AG7A 2GSMB 2BTQB 3W7SA 1XEQA 3ZMUA 5KX5B 2CGOA 1L0NH 4NKGB 1QVGU 4D7SA 2LP7A 2YIBA 3JAWA 2ZT9B 3ZMTA 4FM0A 3WG7C 3H1JH 4IYIA 2FMLA 4HNAB 4O4LB 1DK1A 2JDIG 3B40A 1FFXB 3ML0A 1YVWA 2JK5C 2ZDIC 2YICA 1S3JA 5JJEB 1TVKB 2DYRB 1CXZB 4DR3B 3K79A 3STZC 2Z0AA 4CC6A 1BZKA 2LFRA 3QNEA 5DN6G 2IBZH 2NN4A 4YY3B 3SJBC 4QNHB 1SA0A 2OIEA 1P7BA 1DGSA 2WLKA 2DQ3A 5CMUA 4U3JA 3UO2A 4PV1B 4LF5B 1IBLO 2UU9B 3FB5C 1G4YB 2JRIA 4IL6Z 3LNMB 4B3TB 2D3OW 3CC2V 4EB6A 3B4SA 1SQXH 3D3IA 1RSOA 3HKEA 4UUJC 2LJ2A 1PNLA 2EIKB 1VP7A 3HKBA 5GONA 4HAMA 2HHHB 4FLYA 2HLDG 4ICGA 2QR4A 3T4DA 2JVDA 2UXCO 2ZNIA 2UXBB 1KKCA 4F6RA 1VQ4V 2E5LO 4B3SB 1AI6A 3WG7B 2B1IA 4MVRA 3VQVA 1QNMA 1SA0B 1PL4A 5KHIA 4J41A 1M56B 3OFNG 1EN6A 4PA6A 2W0XA 3FFQA 3AK1A 1YJWV 4I55A 5EYPA 3B2EE 1Q5OA 4X89A 1E1QG 4EB6B 4P30A 1RSOB 2EBOA 4EEQA 3HKEB 3H1LH 2PI4A 3WFVA 5E79Z 4O4HA 1N33O 3HKBB 2VQFB 3EFFK 4ASUG 3SPCA 1FJGB 3ABMC 2Y4TA 1GH6A 1OCRB 4OPAA 4LH6A 1ZSPA 4DV7B 2WLIA 3RYFA 2BOBC 4EKWA 1JCHA 4JI0B 3WU2Z 4JAUA 2EIJC 1XMQO 2CAZC 3N2KA 4JYAB 1N32B 2P5OA 1GM7A 3W7TA 2LGWA 3RWRD 2AHYA 4JI3B 1N0JA 4DV4O 1SQVH 2CTRA 4KXRA 5EYPB 3JARA 4CS2A 1WJZA 3G67A 1YJ9V 1Q90D 4JI8B 3CX5F 3SYQA 2AW9A 3OT7A 4LC1A 5IYDO 5EIBC 1IDSA 4ZI7A 4JYCA 2VQEO 4X64B 5LXTA 5E1AC 4GX2A 4YJ2B 5LGTA 2HFEC 2V1DA 5LHHA 2DWDC 1VF7A 1J95A 3N2KB 5CA1B 2VS0A 4UVAA 3SGIA 4FZ1A 5KHJA 2RQ6A 3JD1A 2IU0A 4LFCO 3ABKB 3AG3C 4UB8Z 1SQFA 4RWUA 2ZXWC 1WPXA 4GKKB 5H6RA 2Q4PA 4X66B 1MSWD 2X6BA 2Y69B 4JZ2A 4RQFA 4X1IA 2Q0AA 4LF9O 1ZAUA 2EIJB 3ETQA 1VQPV 2G38A 4JGSA 4YHHB 3NXSA 3UKMA 1YEWA 3EXAA 3E83A 5B66Z 1GN6A 3G71V 4MSWC 1XL4A 5TISZ 3LSSA 2M7WA 5KHGA 3RVYA 5JCOA 1IZ3A 3BEHA 3OR6C 2ZIOA 1VEWA 1OCCB 4UV9A 2EZOA 2X6AA 1BQ0A 5C8YA 1M90W 1Q6HA 5JVDA 1AI5A 4P9PA 3APQA 3H1IH 4O4IB 1GK9A 2IW5A 1NVPD 2HJFC 2OT5A 4CH5A 3AG4B 4I9WA 5LL6Y 1QLEC 1H2NA 3MDSA 1P7GA 1EN4A 2W6JG 4BIOA 4EFEA 1EBOA 1EN5A 1XHXA 4FMTA 4PI0A 3SYOA 1QLNA 3AG3B 4QE7A 1I0HA 1VF6C 5LP6C 1JPXA 1YXBA 1QHTA 3TXSA 4QIWF 3T1YO 3CSXA 4W4KA 1IBLB 1NKDA 2ZD9A 5C8YB 4MW8A 5JVDB 3CRRA 3O65A 1TUBA 5D5PA 3L74H 4JZGA 5FNVB 5DM6V 4U7NA 4BW5A 2UXCB 2P4VA 4FK5C 1VQ9V 3H01A 4DV2O 2E5LB 3QF7A 4FLZA 4G27B 3VOUA 3G6BA 3ZRWA 2Y4UA 5H2FZ 2XAGA 3JCUZ 4JASA 3B77A 3RYCB 5HFLA 2B5UA 4JTCB 3CCQV 2ZIMA 1G1XB 1QLEB 2IH3C 3IC9A 4FJCC 3N2GB 2Q7EA 1KMIZ 2JGDB 1E79G 3TXQA 4F6EA 1N33B 2ZINA 3AK2A 2RDCA 1K3EA 3JAKA 2WLJA 4PA7A 3L72H 4P2ZA 4UFZA 5LP6B 3PN1A 5IJ9B 2QTOA 5CA0B 5L3FA 4J7KA 5LMNO 4JI6O 3C90A 1N8RW 4UCTA 4IHJA 2GHYA 3JATA 2RNBA 2YIDA 1XMQB 2AZ2A 1J5EO 1V54B 3ZCCA 1XMOO 3ZBHA 3ZHVA 4CC5A 2CH7A 5B1OA 1JVMA 2HEPA 3SDLA 3JALA 4DV4B 4UXNA 5L3EA 4UCOA 5H9CA 2O57A 2P90A 2P4KA 5JJNB 3CD6V 1WP8A 2DQ0A 1L8DA 1QQCA 4YIPA 2X7RB 1SERA 2LQTA 3O9OA 3RGBA 3W7UA 4NXNO 4TV9B 1BGYH 3CMAV 4LFAO 4QE9A 3VQYA 1K9MW 4HBNA 3DTUB 2Q7GA 4DR1O 2KQXA 1FPOA 3FB7C 2DOSA 2IU3A 1YTFB 4MVUA 1SZXA 4FLWA 1VQOV 1SZTA 4LNUB 3ABTA 2GV9A 1VQ7V 3K9AA 3HKCA 3HKDA 4WFGA 3FYIB 1NZ6A 2QKCA 4MTGA 1MG1A 3JALB 1F4NA 4LFCB 4XDLA 1BS3A 2BSKB 3AG1B 4TUYA 2CK3G 2IH1C 2B1GA 1FKAO 3M7MX 4LF9B 1XQ8A 1KUQA 2PYJA 1JX9A 1X59A 3VBBA 4FLXA 1OCZB 1W2BU 4JYBA 2QWPB 3T4ZA 3G6EV 4DO2A 1VQKV 2H8PC 3L71H 4B7KA 2Q5ZA 4K35A 1KBHA 2YXHA 1B3QA 1GM9A 4LP8A 2EILC 4J9YB 2A06H 4DUZO 3HKCB 3A0BZ 3ZRXA 2F4VO 3OUFA 1AR4A 4DR4O 1JMKC 4TUYB 3DC5A 1M93A 4BR6A 2BTQA 1KU9A 4J7JA 5KMGA 1W59A 5KX5A 3BA9A 5H6QA 1A32A 1XNRO 1O9GA 4OXSA 4JI5B 3F7VC 4QPJA 3SPJA 4J7ZA 5LA6B 5L3DA 2PY5A 1UPGA 2CUGA 3EHBB 4UCSA 2ARHA 4HNAA 4O4LA 4CH3A 4X65O 1VF5B 4WFEA 5FL7G 1H2SB 5F2VO 2P7TC 1M4UA 1W0JG 4GX1A 3CCMV 1Q86W 1NI8A 3BVOA 1MABG 5J9PC 1BT8A 3T1YB 5CN0A 1M1KW 2WLHA 3RT3C 3DC6A 3QO8A 1KB9F 1WLEA 5CBFA 4BW9A 5EC2C 3K58A 4FLTA 5IWAO 3P32A 3CCUV 1FYJA 1MZEA 5ITZB 5IT9N 1AR5A 3RVZA 3ZEDA 1K92A 1MSDA 3JASB 2MK3A 1HP8A 1FXHA 5KMGB 4RUFA 4DR7O 1GRJA 3K04A 4J9ZB 1GKFA 5KAFZ 1FD9A 1Q6IA 4IIJB 4MS2A 1PKXA 4UV8A 2A3QA 4RAIA 4DV2B 1FAFA 1Z5WA 3OMIB 1AR1B 2XNDG 4TWKA 1CPYA 2ILMA 5IYBO 5IY5B 2Z5UA 3UT5B 3ZRSA 2JEXA 3IGAC 4GX5A 2WAMA 3JYCA 2ZKOA 2YIBD 5C93A 3D3QA 1G8MA 2QM8A 3ZHRA 2ZE6A 2QE7G 1YIJV 2UUCB 4K8XA 2V7QG 1GN2A 3KZIZ 1GTOA 4WCEV 2IJJA 5GTIZ 1OJHA 4X1YB 2ZDIA 3FD9A 3R66A 5LMNB 1IXBA 4JI6B 1PL0A 1XI1A 2L6LA 2Q6AA 1SQGA 5KUMA 4JI2O 1ZL8A 1J5EB 3K3WA 4X8AA 1XMOB 4LF7O 3QTCA 2QDOA 1MMMA 3SJAC 1K7DA 3CEIA 4KUMA 3MD0A 1QR9A 1KECA 5EC1C 5A2QN 4A5UB 2OWOA 1H38A 2WSSG 1P84F 1K8AW 4NXNB 2OTLV 3T1CA 4DR6O 3HPLC 3RW0A 1PM9A 3ZHTA 4NYKA 4PA3A 1JA8A 4LFAB 4FVMA 2D2CB 1ZX3A 3E8GA 4DR1B 4PA4A 3B09A 3FB6C 2QWQB 3OAAG 5FLXN 1R6NA 3R65A 2QKSA 4E4EA 3K0GA 4DYLA 1NR7A 4WFFA 3FKSG 2UUBO 2YDEA 1ZL8B 2ZM6O 5KHHA 1Y76A 3SPIA 1NTZH 2R9RB 3JCZA 2HG5C 5CBHA 4Z1VA 3CCSV 3TJTA 4OX9O 1N34O 4YJ2A 4X20A 5IJ0A 4I9QA 4J10A 1AROP 4EFBA 1GN3A 3JD2A 1IBMO 2NLJC 3PJSK 4PDMA 4QGPA 1S5JA 1GO3F 3AEIA 4NVPA 3ZMVA 5CA1A 4MTOA 4BWAA 3STLC 3C3TA 3UM7A 1B06A 4WBNB 5LMUO 5B1NA 4G2KA 4LBEC 4GX0A 3HB3B 2UUAO 1S5HC 2KG7B 2Q7HA 1Y76B 3MHSC 1Y6XA
chains in the Genus database with same CATH topology
2ATKC 4MVZA 2A0LA 1M56C 1FXKB 5BZBA 1W0KG 3CC4V 1K73W 1QCEA 3E8FA 3E86A 2QA4V 3ASOB 3SPHA 1I5XA 5DM6V 4MVOA 4U7NA 1AJQA 4BW5A 3QO7A 3E2EA 1F4MA 1SESA 4FK5C 4ZBMA 1B6QA 1DF4A 3H01A 1VQ9V 3W7WA 1KD1W 3ASNC 1NQTA 5KUKA 3ZJZA 2A9HA 2DW4A 2WLNA 1UJWB 1ROPA 4Z1MG 1DLBA 4G27B 4H33A 2JIZG 3VOUA 5LGUA 3CC7V 2ZR3A 3ZRWA 2OCCC 4DXWA 4UVCA 4MVSA 2ITCC 3ZIAG 2XAGA 4JASA 1OCRC 3B77A 1F23A 2FTKA 2JEUA 4JTDB 4MVMA 5HFLA 2B5UA 1Q81W 4JTCB 1AI7A 3ABMB 3CCQV 1XL6A 1FFTB 3CPWU 1MOFA 1QLEB 1CP9A 2IH3C 2ZQMA 4FJCC 3ZN1A 3OEEG 2P6JA 2X0LA 3K08A 3X2QB 4E2LA 1RM1B 3E8HA 1FS0G 1E79G 3F7YC 1R3IC 5B1BB 3RBZA 4R6ZA 5IY5C 4L87A 3CP1A 2OTJV 5EBMC 4H37A 4G28B 1K3EA 1AJPA 1H2GA 1PD3A 2WLJA 3ZRVA 4WF9V 3LDEA 2DYRC 3FYEB 4PA7A 4P2ZA 1KP3A 1JJ2U 1R3KC 1RPRA 2JJ1G 2QTOA 3ZMZA 5L3FA 3G4SV 5LHIA 2KB1A 3CCEV 1CEZA 4I5SA 3CYOA 4WFHA 1N8RW 2GHYA 4HYOA 1V54B 3DGEA 3ZCCA 1VQ8V 5B1OA 1JVMA 2LFSA 1JOYA 1F51A 2XAJA 3FB8C 4LCUC 4UXNA 4BAYA 5L3EA 1H8HG 3K03A 5H9CA 1M9NA 2P90A 3LUTB 2PI5A 2NNUA 3CD6V 1AI4A 5GW7A 2DQ0A 4KFMA 4RUEA 1RPOA 4TSFG 4KP4A 5EK0A 2X7RB 1SERA 1FXVA 3ASNB 3W7UA 5B3SC 1Q7YW 4RQEA 3ETGA 1L1FA 3W7XA 2IJHA 2DYSC 2EIKC 3ABKC 3P30A 1KP2A 5B1AC 3LSQA 4R7CA 2K1EA 1PNMA 4RO2A 1JQ0A 3CMAV 4QE9A 1K9MW 2GSMB 3E8BA 3DTUB 3W7SA 2OCCB 3A0RA 2R9IA 3ZMUA 3E89A 2HKOA 1QVGU 2Y69C 3FB7C 2ZXWB 2LP7A 2IU3A 5LHGA 3ZMTA 1YTFB 4MVUA 3SYCA 2W0FC 3OW2U 1YITV 1S0VA 2EZPA 3WG7C 1VQOV 1SZTA 2UXNA 3ABTA 1VQ7V 3F5WC 3K9AA 2P67A 1P4RA 2JDIG 4WFGA 1S76D 3FYIB 3LDCA 1M57C 4MTGA 1MG1A 1F4NA 3ML0A 2JK5C 2ZDIC 1S3JA 1KQSU 1S77D 4XDLA 1R73A 3AG1B 2DYRB 4WFBV 2CK3G 2IH1C 2B1GA 3K79A 1E1RG 3TETA 3CCRV 3STZC 1GM8A 1OCCC 1OHHG 2QEXV 4FPPA 2LFRA 2Q68A 3QNEA 1JX9A 5DN6G 4QNHB 5IYCO 3JD4A 3VBBA 1VQNV 1OCZB 4MTXA 1P7BA 1W2BU 4JYBA 3T4ZA 3G6EV 2WLKA 2DQ3A 4DO2A 5CMUA 1HWYA 1VQKV 3OUSA 2H8PC 2WLIB 1EZJA 3AG4C 4R50A 1VQ5V 4JAVA 1TUEB 2X6CA 2EINC 3FB5C 4N21A 1G4YB 1ORQC 1GM9A 1R3LC 2WPDG 3OR7C 4LP8A 3D36A 2EILC 3K06A 3LNMB 2D3OW 4J9YB 3CC2V 3ZRXA 5EBWC 4ZKIA 3D3IA 1OCOC 4PDVA 3OUFA 2DYSB 4UUJC 1PNLA 2EIKB 3B8MA 5LGNA 1K97A 1NBMG 4U7OA 4HAMA 2HLDG 2Q67A 5KA6A 3AG2C 3T4DA 2EIMC 3OE7G 2UXXA 1R3JC 1VQ4V 3ABLC 2HR3A 4MT8A 5H6QA 1BHBA 2Q69A 4OXSA 1LNQA 1AI6A 3F7VC 4QPJA 4JF3A 3SPJA 5L3DA 3WG7B 5CA3A 2B1IA 4MVRA 2ITDC 3I55V 3EHBB 1FXKC 1M56B 1M57B 3OFNG 4WFEA 3OGCC 5FL7G 4PA6A 2AHZA 2P7TC 1YJWV 1V55C 1W0JG 4GX1A 3CCMV 1Q86W 4MVQA 1K5SA 1S72V 1MABG 2HVKC 5J9PC 4X89A 5CN0A 1M1KW 2WLHA 1COWG 1E1QG 4PELA 4P30A 3QO8A 3MHHC 3TK1A 2EBOA 1WLEA 4BIUA 5CBFA 2PI4A 5EBLC 5EC2C 3WFVA 3P32A 2XAQA 3CCUV 3M99B 3JD3A 1DF5A 1NH2B 1QBZA 3LDDA 4JPRA 3RVZA 1K33A 1YI2V 1K92A 3EFFK 2ZR2A 4TT3G 2MK3A 4ASUG 4FIPC 3SPCA 1FXHA 4MW8A 4RUFA 2XAHA 1I5YA 3ABMC 1OCRB 1NR1A 3K04A 2W6IG 3K0DA 2WLIA 2BOBC 4MTFA 1JCHA 4EKWA 4J9ZB 4X88A 1GKFA 4JAUA 2EIJC 4MS2A 1PKXA 4UV8A 1THZA 1RM1C 4RAIA 2Y48A 4CZZA 1NVPB 1VQ6V 1GM7A 3OMIB 4UVBA 1AR1B 2XNDG 4TWKA 1YSCA 3W7TA 1DTOA 1CPYA 1SETA 3SJQC 2AHYA 5IYBO 5IY5B 5LBQA 3CCLV 2Z5UA 3I56V 3GB7C 2IJKA 3OEHG 3SPGA 3ZRSA 1YJ9V 2A79B 4JTAB 1QR8A 2JEXA 5KA5A 3SYQA 1NJIW 2YEVA 3IGAC 4LC1A 5IYDO 3CCVV 4GX5A 3BY6A 5IDJA 2WAMA 4GT1A 1ENVA 4JYCA 1V54C 3JYCA 2XAFA 4MW3A 1Y4MA 3KG2A 2Z3YA 5E1AC 5C93A 4GX2A 4BIZA 4P9OA 1G8MA 2QM8A 5LGTA 1YIJV 2QE7G 2HFEC 2F43G 2XASA 2V7QG 3ETDA 1GTOA 5L3CA 2IJIA 4WCEV 2WLMA 2V1DA 1K4CC 5L3BA 2IJJA 1Y66A 1V55B 2QM7A 2HVJC 2ZDIA 5LHHA 2DWDC 1BHAA 4N23A 1J95A 1K4DC 1YHQV 3ETEA 1ZWIC 4UVAA 1PL0A 3IC7A 3ZMSA 3OMNB 2Q6AA 5KUMA 5B3SB 3JD1A 3K3WA 4X8AA 2IU0A 3ABKB 5B1AB 3AG3C 1K7DA 1K5QA 3CXCU 3IFXA 4KUMA 4PA9A 2ZXWC 1WPXA 1H8EG 2JJ2G 1EFRG 3MD0A 5H6RA 2YEVB 1QR9A 2DWEC 1K34A 1KECA 3GWOA 5EC1C 1MSWD 2X6BA 2Y69B 5CBGA 4RQFA 1H38A 2WSSG 2EIJB 1K8AW 1VQPV 1KC8W 4JGSA 4XDKA 3QO5A 4HZ3A 4PDLA 3B8NA 4XBFA 3OMAB 2OTLV 3T1CA 3HPLC 3NXSA 3UKMA 1YJNV 3RW0A 3E83A 3ASOC 2WLLA 4PA3A 1AJNA 3AG1C 4QJFB 1R6KA 3ZN0A 3E8GA 4MSWC 3G71V 4PA4A 1XL4A 4GCZA 3LSSA 3FB6C 1NH2D 2M7WA 3OAAG 1R6NA 3R65A 2QKSA 3K0GA 1NR7A 2C2AA 3BEHA 3OR6C 3FKSG 4WFFA 3RVYA 4WFAV 1KKDA 1OCCB 4UV9A 1OZ0A 1IXMA 2EZOA 3JD0A 2X6AA 1VQMV 3SYAA 1SRYA 3SPIA 3ZRWB 1OCZC 2R9RB 1M90W 3JCZA 2HG5C 1YTFD 2YSUB 1AI5A 4P9PA 1FXKA 2XOKG 5CBHA 3CCSV 1GK9A 2IW5A 4XDJA 1NVPD 2HJFC 2OT5A 1AROP 3E35A 3TCUA 3AG4B 4CBCA 4F4LA 1QVFU 4I9WA 1QLEC 3JD2A 2WWWA 2NLJC 3PJSK 4PDMA 2EINB 3X2QC 4PDRA 1VQLV 2H94A 1BMFG 1GO3F 1GMGA 3AEIA 4R8CA 2EILB 2W6JG 3CMEV 3ABUA 3ZMVA 4MTOA 1EBOA 2BOCC 4Q20A 1Q82W 5B1BC 3STLC 1BL8A 3CCJV 1PNKA 1OCOB 2WLLB 4FMTA 3UM7A 3SYOA 1QLNA 4QPKA 4YXWG 3AG3B 3OM3B 4QE7A 3T2MA 5B1NA 4G2KA 4LBEC 1JPXA 4GX0A 5HFMA 3AG2B 3HB3B 4QIWF 3SYPA 1S5HC 2EIMB 5L3GA 3ABLB 1NKDA 2ZD9A 3MHSC 2EJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WFV A;  3B8N A;  1EBO A;  3K9A A;  1DLB A;  3M99 B;  3P30 A;  1DF5 A;  1MG1 A;  3B8M A;  3CP1 A;  1QBZ A;  1JQ0 A;  4JPR A;  1QCE A;  1K33 A;  2MK3 A;  1I5X A;  4FIP C;  5CMU A;  3B77 A;  2OT5 A;  4G2K A;  5KA6 A;  1JPX A;  1F23 A;  5H9C A;  1I5Y A;  1Y66 A;  5HFL A;  1QR9 A;  1K34 A;  5HFM A;  2LP7 A;  2M7W A;  3GWO A;  1QR8 A;  5KA5 A;  4N23 A;  4FK5 C;  1MOF A;  3MHS C;  4N21 A;  1DF4 A;  3H01 A;  5CN0 A;  4FJC C;  2X7R B;  3CYO A;  2EZP A;  1ENV A;  2P6J A;  3MHH C;  4JF3 A;  4JGS A;  4E2L A;  1SZT A;  2EBO A;  2EZO A;  1Y4M A; 
#chains in the Genus database with same CATH topology
 4DUZ B;  2FKX A;  5GTH Z;  5BZB A;  2F4V B;  1W0K G;  4X20 B;  5IJ0 B;  1K73 W;  4DR4 B;  1RP3 B;  5AG2 A;  1AIL A;  3BFR A;  3UQ8 A;  2QA4 V;  1I5X A;  1MNG A;  4C7U A;  1F4M A;  2QKA A;  3D36 C;  1B6Q A;  3I5D A;  1DF4 A;  3WB0 A;  2YS8 A;  1XNR B;  5J2T B;  2ADQ B;  2WLN A;  1NTK H;  1ROP A;  2JGU A;  3CC7 V;  3WB1 A;  5KAI Z;  4X65 B;  4LR3 A;  2BE3 A;  4UVC A;  5BMV A;  4MVS A;  3ZIA G;  4O4I A;  1D5N A;  1N0N A;  3ABM B;  3K5N A;  3CPW U;  1MZF A;  1CP9 A;  1ZLZ A;  2ZQM A;  3QVN A;  2X0L A;  3K08 A;  4DR5 O;  1ZTE A;  3CHX A;  4Q6G A;  5IWA B;  3RBZ A;  3CRQ A;  4R6Z A;  3CP1 A;  5EBM C;  5IYZ B;  2NR5 A;  3MAQ A;  1AJP A;  1SF9 A;  3LDE A;  3FYE B;  1KP3 A;  3OTF A;  2AGA A;  1JJ2 U;  1RPR A;  2JJ1 G;  4DR7 B;  4K8Z A;  3ZMZ A;  4X1K B;  2QM4 A;  2KB1 A;  4AQY O;  1CEZ A;  3CYO A;  3DGE A;  2ZNJ A;  1VQ8 V;  4DW1 A;  5BMV B;  2XAJ A;  1Z2G A;  4JV5 O;  4LCU C;  4O2B B;  5FNV A;  4I7Z B;  3LUT B;  2PI5 A;  1HR0 O;  4TSF G;  5EK0 A;  4JI5 O;  1TAE A;  1B04 A;  3K59 A;  2F23 A;  2BTO A;  1Q7Y W;  5B3S C;  4RQE A;  2DYS C;  4D6T H;  5B1A C;  3ZHQ A;  3LSQ A;  1PNM A;  1JQ0 A;  1OV9 A;  2Q73 A;  3A0R A;  3DXR A;  2R9I A;  2F93 B;  2HKO A;  5JJJ B;  2ZXW B;  3FAV B;  1IBK O;  3RYC A;  4LWS A;  3SYC A;  2W0F C;  1S0V A;  1YZB A;  2DE0 X;  2P06 A;  2UXN A;  3CRC A;  3N2G A;  4H44 B;  3F5W C;  4JI2 B;  2P67 A;  2JGD A;  1P4R A;  2LGQ A;  1ZUQ A;  1M57 C;  4LF7 B;  5LOV B;  4OGQ B;  1KQS U;  1S77 D;  5KHK A;  1LUV A;  2EX3 A;  1R1B A;  5K1P A;  4WFB V;  2RN9 A;  1VF6 A;  3TET A;  5LP6 A;  2XUM A;  1GM8 A;  5IJ9 A;  2QEX V;  5CA0 A;  3VQX A;  1XOU A;  4FPP A;  2Q68 A;  1JR9 A;  3LNN A;  1VAR A;  3RN4 A;  5IYC O;  1PPJ H;  1UFI A;  1VQN V;  4MTX A;  4DR6 B;  3DXR B;  1KYO F;  3FX7 A;  3BAA A;  1HWY A;  1EZJ A;  2HJD A;  4FFK A;  5DED A;  4LWS B;  4R50 A;  1VQ5 V;  5D5Q A;  4FLV A;  2GDS A;  5JQG B;  2X6C A;  2EIN C;  3JAM N;  1ORQ C;  2WPD G;  3C3S A;  2UUB B;  3OR7 C;  4IYH A;  2ZM6 B;  5EBW C;  4GKJ O;  1OCO C;  3U10 A;  4PDV A;  3U11 A;  3QG5 A;  2DYS B;  1SQP H;  2UUC O;  3B8M A;  2GTS A;  5LGN A;  4TV9 A;  1NBM G;  3CJH A;  2CTQ A;  4OX9 B;  1N34 B;  1WP7 A;  3AG2 C;  1EZV H;  2EIM C;  3OE7 G;  2UXX A;  1R3J C;  3ABL C;  4MT8 A;  1BHB A;  2Q69 A;  2V4D A;  1IBM B;  5BY1 A;  1LNQ A;  1XRE A;  4JF3 A;  5CA3 A;  1LUW A;  3I55 V;  1FXK C;  4O2A B;  4LNU A;  4LFB O;  4LH7 A;  1M57 B;  4AIL C;  1I7F A;  2AHZ A;  4B7E A;  5LMU B;  1S72 V;  2BSK A;  4O4J B;  3UO3 A;  1TA8 A;  2YI8 A;  2UUA B;  4W4L A;  4PEL A;  3TK1 A;  1XUQ A;  4BIU A;  1XNQ O;  4DRX B;  2ZCE A;  3M99 B;  1NH2 B;  3K5M A;  3CJH B;  1QBZ A;  3LDD A;  4JPR A;  1K33 A;  3OD4 A;  4TT3 G;  2ZE5 A;  2ZR2 A;  1PV0 A;  5DEC A;  2IM9 A;  2XAH A;  4B3R O;  3P3N A;  1D5A A;  2N04 A;  2WA4 A;  4X88 A;  1RM1 C;  1VMG A;  4UVB A;  1YSC A;  2GTA A;  1DTO A;  1SET A;  3SJQ C;  2EUL A;  5J2U A;  3EVK A;  3I56 V;  3GB7 C;  1Z5V A;  2IJK A;  2OIG A;  2A79 B;  4JTA B;  5KA5 A;  2YEV A;  4CS3 A;  3BCC H;  4DV1 O;  5IDJ A;  1M5I A;  4JI1 O;  1ENV A;  4MW3 A;  4DR5 B;  3NR7 A;  2Z3Y A;  5LA6 A;  4BIZ A;  2FL4 A;  4P9O A;  5LYJ A;  2F43 G;  5L3C A;  3CWB H;  2IJI A;  4NTW A;  2QM7 A;  2A7W A;  2YXY A;  4N23 A;  4NTY A;  1YHQ V;  3ETE A;  4GLX A;  1ZWI C;  3IC7 A;  4AQY B;  3P3P A;  1BQZ A;  5J2U B;  1I94 O;  4LF4 O;  1K5Q A;  5ITZ A;  4JV5 B;  3CXC U;  1URF A;  4GUN A;  2JJ2 G;  2YEV B;  3JAS A;  1K34 A;  3J7A U;  1US6 A;  4TV8 B;  2YC0 A;  4I0X B;  1V9P A;  4LF8 O;  2N05 A;  1HR0 B;  1KC8 W;  1AB3 A;  4PDL A;  4IIJ A;  3B8N A;  3OMA B;  5CB4 B;  5LYJ B;  4FZ0 A;  2PGG A;  1AP6 A;  3ASO C;  4B3M O;  2VWJ A;  1AJN A;  2Y0P A;  3IJ4 A;  3ZN0 A;  4AI8 A;  2CE4 A;  3TGU H;  4CH6 A;  1IBK B;  3UT5 A;  3LSU A;  2PTM A;  4JYY A;  2KSD A;  3Q4H A;  4I50 B;  3H9V A;  1OZ0 A;  1IXM A;  1VQM V;  4TOI A;  3CRM A;  3KKY A;  2QWN B;  1GN4 A;  4I4T B;  4KHP O;  2AXT Z;  4XDJ A;  3IAY A;  3E35 A;  1T5E A;  4CBC A;  4F4L A;  2HP8 A;  4PI2 A;  2M6Y A;  4PJ0 Z;  2ETN A;  4X1Y A;  3M8A A;  3ZX6 A;  3HR0 A;  3RYI B;  2H94 A;  1BMF G;  2EIL B;  4Q20 A;  2BOC C;  5B1B C;  1BL8 A;  1PNK A;  3JSL A;  3CE2 A;  3E22 B;  4X62 O;  3GWK C;  1Q6U A;  4FM1 A;  4QPK A;  1SQQ H;  3OM3 B;  3T2M A;  1U96 A;  4CH4 A;  5HFM A;  3SYP A;  3Q4H B;  3G80 A;  1EM1 A;  3BA8 A;  2A0L A;  4GKJ B;  2OYQ A;  1M56 C;  1HNW O;  3CRA A;  5A9G A;  3CC4 V;  3K57 A;  1QCE A;  3E86 A;  3VQW A;  5JH7 B;  3ASO B;  5FPR A;  3SPH A;  4MVO A;  2QJ1 A;  3E2E A;  1SES A;  3OTO O;  1KD1 W;  3OGI B;  1WN7 A;  3ZJZ A;  1BE3 H;  2R9A A;  3SR2 C;  2DW4 A;  1UJW B;  1DLB A;  1HNZ O;  1XDC A;  4LFB B;  3K5L A;  5IE9 A;  2OCC C;  2ZE8 A;  4DXW A;  1OCR C;  1F23 A;  2R70 A;  4JTD B;  3JAW B;  1FFT B;  1MOF A;  1WB8 A;  2PUS A;  3E8H A;  4TQF A;  1XNQ B;  4NB5 A;  3F7Y C;  1R3I C;  1YCI A;  5B1B B;  4DV3 O;  2BCC H;  3RYH A;  4UB6 Z;  2OTJ V;  3BPZ A;  1S5L Z;  2DJV A;  1PD3 A;  4G28 B;  3ZRV A;  4GZR B;  5K1X A;  4WF9 V;  4PD4 F;  2RCV A;  4WBN A;  1R3K C;  4B3R B;  1Q43 A;  3G4S V;  5LHI A;  2F1M A;  4WFH A;  2Q0O C;  2KG7 A;  1GAX A;  1F7Y A;  3J80 N;  3CB2 A;  2LO1 A;  4J42 A;  4U3J B;  4NTX A;  1F51 A;  3FB8 C;  2YIA A;  1Q8I A;  3K9S A;  4BAY A;  3K03 A;  1M9N A;  1R6T A;  4DV5 B;  3T1H O;  2NNU A;  4RUE A;  1RPO A;  4AHC A;  4KP4 A;  3L75 H;  1FXV A;  4DV1 B;  4JI1 B;  3RYH B;  3ETG A;  3CXH F;  4B08 A;  5GON B;  5B5E Z;  5J2T A;  3ABK C;  3L70 H;  4RO2 A;  5H5N A;  3E8B A;  2OCC B;  1TGO A;  3E89 A;  4F6R B;  2Y69 C;  4TQD A;  4DW0 A;  2N74 A;  4NR1 A;  3DSQ A;  5LHG A;  1PP9 H;  2ZE7 A;  4K0K O;  2E74 B;  3OW2 U;  1YIT V;  2Y0I A;  2EZP A;  1QU7 A;  2OCH A;  3H1K H;  4Z2W A;  1S76 D;  3LDC A;  1WNS A;  2YUA A;  4X9Q A;  4I55 B;  1I94 B;  4LF4 B;  1R73 A;  1N36 O;  4UCR A;  5IYZ A;  1WAZ A;  3CCR V;  1E1R G;  1XIL A;  1HNX O;  1OCC C;  1OHH G;  4LF8 B;  4O4H B;  4X1K A;  4DUY O;  3JD4 A;  2GUZ A;  5BR8 O;  4B3M B;  3OUS A;  2WLI B;  3AG4 C;  3RYF B;  4H13 B;  4JAV A;  1TUE B;  4O2B A;  4OPH A;  4D7T A;  4N21 A;  1I08 A;  4IGG A;  1SKV A;  1R3L C;  4U3F H;  3D36 A;  3K06 A;  4ZKI A;  2PYL A;  1K97 A;  2QWR B;  5EIB D;  3JAR B;  4U7O A;  2RJZ A;  2QWO B;  4J80 A;  4DR2 O;  4KHP B;  2Q67 A;  5KA6 A;  5JCO C;  3ZHS A;  1SS3 A;  3U0Z A;  4DV6 O;  4UCV A;  4ZI7 B;  2HR3 A;  3FAV A;  1MA1 A;  3F5T A;  5LXT B;  1RFY A;  2ITD C;  1O9H A;  2GUZ B;  2RMK B;  1JFF A;  3OGC C;  1IVS A;  3D8C A;  2VWK A;  4X62 B;  2LW7 A;  4ZHQ A;  1V55 C;  5LOV A;  4MVQ A;  1K5S A;  2VRZ A;  2CTP A;  2HVK C;  1COW G;  1VIB A;  3MHH C;  2CGN A;  1L0L H;  5EBL C;  2XAQ A;  3JD3 A;  1DF5 A;  1HNW B;  4K3A A;  3H1H H;  1YI2 V;  1WPB A;  4FIP C;  2DN9 A;  4JI4 O;  1I5Y A;  4X1I B;  1NR1 A;  2W6I G;  2E75 B;  3K0D A;  3JSN A;  4MTF A;  2PZS A;  3OTO B;  1THZ A;  5JQG A;  1SQB H;  2Y48 A;  4CZZ A;  2AZ0 A;  1NVP B;  1VQ6 V;  4JI7 O;  1JFF B;  3BHP A;  1BSM A;  4PHZ A;  2K9P A;  1HNZ B;  2P22 C;  4ZHQ B;  4LF6 O;  4DV0 O;  5LBQ A;  3CCL V;  3KCY A;  3OEH G;  2CDY A;  3SPG A;  3APO A;  5EZY A;  1QR8 A;  1NJI W;  2UXD O;  3CCV V;  3BY6 A;  1H2L A;  4GT1 A;  2WA3 A;  1V54 C;  3RFR A;  2XAF A;  1Y4M A;  3KG2 A;  4L8J A;  5KLV H;  4NXM O;  4UCU A;  3AK3 A;  1YDX A;  4DV3 B;  2H3O A;  1H2K A;  4O2A A;  2XAS A;  3ETD A;  1XHZ A;  2WLM A;  1K4C C;  5L3B A;  5FPO A;  1Y66 A;  1V55 B;  2HVJ C;  1BHA A;  1K4D C;  4DK1 A;  1N4C A;  1NTM H;  1H2M A;  1WB7 A;  3ZMS A;  4O4J A;  3OMN B;  5B3S B;  1Y67 A;  3K5O A;  3N27 A;  4DRX A;  5B1A B;  2XTA A;  3IFX A;  5EZY B;  4PA9 A;  1H8E G;  2ODM A;  1EFR G;  2FB5 A;  4DR3 O;  2DWE C;  3GWO A;  4ZOL A;  3T1H B;  2R72 A;  5CBG A;  1NS1 A;  2ADP A;  1TUB B;  4XDK A;  3QO5 A;  4HZ3 A;  4YY3 O;  3A0H Z;  4XBF A;  1WA8 A;  4YIO A;  1JJO A;  1YJN V;  1YF2 A;  2DMX A;  2Q8V A;  1AP5 A;  3A8T A;  2WLL A;  3AG1 C;  4QJF B;  1D2D A;  1R6K A;  4LF5 O;  4GCZ A;  1XBL A;  1NH2 D;  2L35 A;  2UU9 O;  2C2A A;  3S3X A;  4B3T O;  4K0K B;  4WFA V;  1KKD A;  3BRC A;  3KCX A;  3JD0 A;  2QGN A;  3SYA A;  1SRY A;  2YI9 A;  2E3C A;  3ZRW B;  1OCZ C;  2B9Z A;  3A2F A;  3L9D A;  1YTF D;  2YSU B;  1FXK A;  2XOK G;  2HHH O;  3ZS8 C;  4ZOL B;  3CS5 A;  1N36 B;  1HDJ A;  3TCU A;  2UXB O;  1P49 A;  1QVF U;  2WWW A;  4B3S O;  4GYC B;  2EIN B;  1HNX B;  3X2Q C;  4PDR A;  1SC5 B;  2QSA A;  1VQL V;  1WA8 B;  1GMG A;  4R8C A;  2VQE B;  1Q3E A;  3CME V;  3ABU A;  4DUY B;  1Q82 W;  4KL1 A;  3CCJ V;  1OCO B;  2WLL B;  1U97 A;  3JAK B;  1LR1 A;  1NU1 H;  3WB2 A;  4YXW G;  5BR8 B;  2EJ7 A;  2FYU H;  1G6U A;  4JAA A;  4DV5 O;  3AG2 B;  2XHB A;  4IHJ B;  2EIM B;  3JAT B;  5L3G A;  3ABL B;  4TV8 A;  4CS4 A;  2XT9 A;  3S3W A;  2F66 C;  4I0X A;  1X4T A;  2CH7 B;  2EJR A;  2ATK C;  4MVZ A;  2YXL A;  1FXK B;  2GBO A;  2E76 B;  5CB4 A;  2VQF O;  3E8F A;  4FFB A;  3J81 N;  4ABM A;  1FJG O;  2JS5 A;  1AJQ A;  2Q9L A;  4DR2 B;  3QO7 A;  1BCC H;  4DV7 O;  4ZIB A;  4JI0 O;  4DV6 B;  4ZBM A;  3W7W A;  3ASN C;  1NQT A;  4JYA O;  5KUK A;  1N32 O;  2A9H A;  4I50 A;  4Z1M G;  4H33 A;  1Y74 A;  2JIZ G;  4JI3 O;  5LGU A;  2ZR3 A;  2PF4 E;  5BXZ A;  2JS3 A;  2ITC C;  2KKW A;  4H0L B;  2FTK A;  2JEU A;  4I4T A;  4MVM A;  4JI8 O;  1Q81 W;  1AI7 A;  2CTW A;  1XL6 A;  3ZN1 A;  3OEE G;  2P6J A;  4IT5 A;  3HKD B;  4X64 O;  3X2Q B;  4YJ3 A;  4E2L A;  1RM1 B;  1FS0 G;  3RYI A;  4FM2 A;  3ICX A;  1NT2 B;  4FFB B;  3ZHU A;  3SJC C;  5IY5 C;  4L87 A;  3UCS C;  4H37 A;  1H2G A;  3E22 A;  3THO A;  2DYR C;  4JI4 B;  1IUR A;  1IX9 A;  3CCE V;  4I5S A;  4FLU A;  4DK0 A;  4HYO A;  1Y74 B;  5JWP A;  4JI7 B;  2LW1 A;  2QTS A;  1HW7 A;  2LFS A;  1JOY A;  4LF6 B;  3BAB A;  4DV0 B;  4GKK O;  1FFX A;  1H8H G;  2MW2 B;  1TVK A;  4J11 A;  5JH7 A;  4X66 O;  1AI4 A;  5GW7 A;  4KFM A;  2UXD B;  4YJ3 B;  4YHH O;  3ASN B;  1AVM A;  2F95 B;  3GVM A;  1L1F A;  3W7X A;  2IJH A;  2EIK C;  3P30 A;  4NXM B;  1KP2 A;  4R7C A;  3L73 H;  2K1E A;  3AG7 A;  2GSM B;  2BTQ B;  3W7S A;  1XEQ A;  3ZMU A;  5KX5 B;  2CGO A;  1L0N H;  4NKG B;  1QVG U;  4D7S A;  2LP7 A;  2YIB A;  3JAW A;  2ZT9 B;  3ZMT A;  4FM0 A;  3WG7 C;  3H1J H;  4IYI A;  2FML A;  4HNA B;  4O4L B;  1DK1 A;  2JDI G;  3B40 A;  1FFX B;  3ML0 A;  1YVW A;  2JK5 C;  2ZDI C;  2YIC A;  1S3J A;  5JJE B;  1TVK B;  2DYR B;  1CXZ B;  4DR3 B;  3K79 A;  3STZ C;  2Z0A A;  4CC6 A;  1BZK A;  2LFR A;  3QNE A;  5DN6 G;  2IBZ H;  2NN4 A;  4YY3 B;  3SJB C;  4QNH B;  1SA0 A;  2OIE A;  1P7B A;  1DGS A;  2WLK A;  2DQ3 A;  5CMU A;  4U3J A;  3UO2 A;  4PV1 B;  4LF5 B;  1IBL O;  2UU9 B;  3FB5 C;  1G4Y B;  2JRI A;  4IL6 Z;  3LNM B;  4B3T B;  2D3O W;  3CC2 V;  4EB6 A;  3B4S A;  1SQX H;  3D3I A;  1RSO A;  3HKE A;  4UUJ C;  2LJ2 A;  1PNL A;  2EIK B;  1VP7 A;  3HKB A;  5GON A;  4HAM A;  2HHH B;  4FLY A;  2HLD G;  4ICG A;  2QR4 A;  3T4D A;  2JVD A;  2UXC O;  2ZNI A;  2UXB B;  1KKC A;  4F6R A;  1VQ4 V;  2E5L O;  4B3S B;  1AI6 A;  3WG7 B;  2B1I A;  4MVR A;  3VQV A;  1QNM A;  1SA0 B;  1PL4 A;  5KHI A;  4J41 A;  1M56 B;  3OFN G;  1EN6 A;  4PA6 A;  2W0X A;  3FFQ A;  3AK1 A;  1YJW V;  4I55 A;  5EYP A;  3B2E E;  1Q5O A;  4X89 A;  1E1Q G;  4EB6 B;  4P30 A;  1RSO B;  2EBO A;  4EEQ A;  3HKE B;  3H1L H;  2PI4 A;  3WFV A;  5E79 Z;  4O4H A;  1N33 O;  3HKB B;  2VQF B;  3EFF K;  4ASU G;  3SPC A;  1FJG B;  3ABM C;  2Y4T A;  1GH6 A;  1OCR B;  4OPA A;  4LH6 A;  1ZSP A;  4DV7 B;  2WLI A;  3RYF A;  2BOB C;  4EKW A;  1JCH A;  4JI0 B;  3WU2 Z;  4JAU A;  2EIJ C;  1XMQ O;  2CAZ C;  3N2K A;  4JYA B;  1N32 B;  2P5O A;  1GM7 A;  3W7T A;  2LGW A;  3RWR D;  2AHY A;  4JI3 B;  1N0J A;  4DV4 O;  1SQV H;  2CTR A;  4KXR A;  5EYP B;  3JAR A;  4CS2 A;  1WJZ A;  3G67 A;  1YJ9 V;  1Q90 D;  4JI8 B;  3CX5 F;  3SYQ A;  2AW9 A;  3OT7 A;  4LC1 A;  5IYD O;  5EIB C;  1IDS A;  4ZI7 A;  4JYC A;  2VQE O;  4X64 B;  5LXT A;  5E1A C;  4GX2 A;  4YJ2 B;  5LGT A;  2HFE C;  2V1D A;  5LHH A;  2DWD C;  1VF7 A;  1J95 A;  3N2K B;  5CA1 B;  2VS0 A;  4UVA A;  3SGI A;  4FZ1 A;  5KHJ A;  2RQ6 A;  3JD1 A;  2IU0 A;  4LFC O;  3ABK B;  3AG3 C;  4UB8 Z;  1SQF A;  4RWU A;  2ZXW C;  1WPX A;  4GKK B;  5H6R A;  2Q4P A;  4X66 B;  1MSW D;  2X6B A;  2Y69 B;  4JZ2 A;  4RQF A;  4X1I A;  2Q0A A;  4LF9 O;  1ZAU A;  2EIJ B;  3ETQ A;  1VQP V;  2G38 A;  4JGS A;  4YHH B;  3NXS A;  3UKM A;  1YEW A;  3EXA A;  3E83 A;  5B66 Z;  1GN6 A;  3G71 V;  4MSW C;  1XL4 A;  5TIS Z;  3LSS A;  2M7W A;  5KHG A;  3RVY A;  5JCO A;  1IZ3 A;  3BEH A;  3OR6 C;  2ZIO A;  1VEW A;  1OCC B;  4UV9 A;  2EZO A;  2X6A A;  1BQ0 A;  5C8Y A;  1M90 W;  1Q6H A;  5JVD A;  1AI5 A;  4P9P A;  3APQ A;  3H1I H;  4O4I B;  1GK9 A;  2IW5 A;  1NVP D;  2HJF C;  2OT5 A;  4CH5 A;  3AG4 B;  4I9W A;  5LL6 Y;  1QLE C;  1H2N A;  3MDS A;  1P7G A;  1EN4 A;  2W6J G;  4BIO A;  4EFE A;  1EBO A;  1EN5 A;  1XHX A;  4FMT A;  4PI0 A;  3SYO A;  1QLN A;  3AG3 B;  4QE7 A;  1I0H A;  1VF6 C;  5LP6 C;  1JPX A;  1YXB A;  1QHT A;  3TXS A;  4QIW F;  3T1Y O;  3CSX A;  4W4K A;  1IBL B;  1NKD A;  2ZD9 A;  5C8Y B;  4MW8 A;  5JVD B;  3CRR A;  3O65 A;  1TUB A;  5D5P A;  3L74 H;  4JZG A;  5FNV B;  5DM6 V;  4U7N A;  4BW5 A;  2UXC B;  2P4V A;  4FK5 C;  1VQ9 V;  3H01 A;  4DV2 O;  2E5L B;  3QF7 A;  4FLZ A;  4G27 B;  3VOU A;  3G6B A;  3ZRW A;  2Y4U A;  5H2F Z;  2XAG A;  3JCU Z;  4JAS A;  3B77 A;  3RYC B;  5HFL A;  2B5U A;  4JTC B;  3CCQ V;  2ZIM A;  1G1X B;  1QLE B;  2IH3 C;  3IC9 A;  4FJC C;  3N2G B;  2Q7E A;  1KMI Z;  2JGD B;  1E79 G;  3TXQ A;  4F6E A;  1N33 B;  2ZIN A;  3AK2 A;  2RDC A;  1K3E A;  3JAK A;  2WLJ A;  4PA7 A;  3L72 H;  4P2Z A;  4UFZ A;  5LP6 B;  3PN1 A;  5IJ9 B;  2QTO A;  5CA0 B;  5L3F A;  4J7K A;  5LMN O;  4JI6 O;  3C90 A;  1N8R W;  4UCT A;  4IHJ A;  2GHY A;  3JAT A;  2RNB A;  2YID A;  1XMQ B;  2AZ2 A;  1J5E O;  1V54 B;  3ZCC A;  1XMO O;  3ZBH A;  3ZHV A;  4CC5 A;  2CH7 A;  5B1O A;  1JVM A;  2HEP A;  3SDL A;  3JAL A;  4DV4 B;  4UXN A;  5L3E A;  4UCO A;  5H9C A;  2O57 A;  2P90 A;  2P4K A;  5JJN B;  3CD6 V;  1WP8 A;  2DQ0 A;  1L8D A;  1QQC A;  4YIP A;  2X7R B;  1SER A;  2LQT A;  3O9O A;  3RGB A;  3W7U A;  4NXN O;  4TV9 B;  1BGY H;  3CMA V;  4LFA O;  4QE9 A;  3VQY A;  1K9M W;  4HBN A;  3DTU B;  2Q7G A;  4DR1 O;  2KQX A;  1FPO A;  3FB7 C;  2DOS A;  2IU3 A;  1YTF B;  4MVU A;  1SZX A;  4FLW A;  1VQO V;  1SZT A;  4LNU B;  3ABT A;  2GV9 A;  1VQ7 V;  3K9A A;  3HKC A;  3HKD A;  4WFG A;  3FYI B;  1NZ6 A;  2QKC A;  4MTG A;  1MG1 A;  3JAL B;  1F4N A;  4LFC B;  4XDL A;  1BS3 A;  2BSK B;  3AG1 B;  4TUY A;  2CK3 G;  2IH1 C;  2B1G A;  1FKA O;  3M7M X;  4LF9 B;  1XQ8 A;  1KUQ A;  2PYJ A;  1JX9 A;  1X59 A;  3VBB A;  4FLX A;  1OCZ B;  1W2B U;  4JYB A;  2QWP B;  3T4Z A;  3G6E V;  4DO2 A;  1VQK V;  2H8P C;  3L71 H;  4B7K A;  2Q5Z A;  4K35 A;  1KBH A;  2YXH A;  1B3Q A;  1GM9 A;  4LP8 A;  2EIL C;  4J9Y B;  2A06 H;  4DUZ O;  3HKC B;  3A0B Z;  3ZRX A;  2F4V O;  3OUF A;  1AR4 A;  4DR4 O;  1JMK C;  4TUY B;  3DC5 A;  1M93 A;  4BR6 A;  2BTQ A;  1KU9 A;  4J7J A;  5KMG A;  1W59 A;  5KX5 A;  3BA9 A;  5H6Q A;  1A32 A;  1XNR O;  1O9G A;  4OXS A;  4JI5 B;  3F7V C;  4QPJ A;  3SPJ A;  4J7Z A;  5LA6 B;  5L3D A;  2PY5 A;  1UPG A;  2CUG A;  3EHB B;  4UCS A;  2ARH A;  4HNA A;  4O4L A;  4CH3 A;  4X65 O;  1VF5 B;  4WFE A;  5FL7 G;  1H2S B;  5F2V O;  2P7T C;  1M4U A;  1W0J G;  4GX1 A;  3CCM V;  1Q86 W;  1NI8 A;  3BVO A;  1MAB G;  5J9P C;  1BT8 A;  3T1Y B;  5CN0 A;  1M1K W;  2WLH A;  3RT3 C;  3DC6 A;  3QO8 A;  1KB9 F;  1WLE A;  5CBF A;  4BW9 A;  5EC2 C;  3K58 A;  4FLT A;  5IWA O;  3P32 A;  3CCU V;  1FYJ A;  1MZE A;  5ITZ B;  5IT9 N;  1AR5 A;  3RVZ A;  3ZED A;  1K92 A;  1MSD A;  3JAS B;  2MK3 A;  1HP8 A;  1FXH A;  5KMG B;  4RUF A;  4DR7 O;  1GRJ A;  3K04 A;  4J9Z B;  1GKF A;  5KAF Z;  1FD9 A;  1Q6I A;  4IIJ B;  4MS2 A;  1PKX A;  4UV8 A;  2A3Q A;  4RAI A;  4DV2 B;  1FAF A;  1Z5W A;  3OMI B;  1AR1 B;  2XND G;  4TWK A;  1CPY A;  2ILM A;  5IYB O;  5IY5 B;  2Z5U A;  3UT5 B;  3ZRS A;  2JEX A;  3IGA C;  4GX5 A;  2WAM A;  3JYC A;  2ZKO A;  2YIB D;  5C93 A;  3D3Q A;  1G8M A;  2QM8 A;  3ZHR A;  2ZE6 A;  2QE7 G;  1YIJ V;  2UUC B;  4K8X A;  2V7Q G;  1GN2 A;  3KZI Z;  1GTO A;  4WCE V;  2IJJ A;  5GTI Z;  1OJH A;  4X1Y B;  2ZDI A;  3FD9 A;  3R66 A;  5LMN B;  1IXB A;  4JI6 B;  1PL0 A;  1XI1 A;  2L6L A;  2Q6A A;  1SQG A;  5KUM A;  4JI2 O;  1ZL8 A;  1J5E B;  3K3W A;  4X8A A;  1XMO B;  4LF7 O;  3QTC A;  2QDO A;  1MMM A;  3SJA C;  1K7D A;  3CEI A;  4KUM A;  3MD0 A;  1QR9 A;  1KEC A;  5EC1 C;  5A2Q N;  4A5U B;  2OWO A;  1H38 A;  2WSS G;  1P84 F;  1K8A W;  4NXN B;  2OTL V;  3T1C A;  4DR6 O;  3HPL C;  3RW0 A;  1PM9 A;  3ZHT A;  4NYK A;  4PA3 A;  1JA8 A;  4LFA B;  4FVM A;  2D2C B;  1ZX3 A;  3E8G A;  4DR1 B;  4PA4 A;  3B09 A;  3FB6 C;  2QWQ B;  3OAA G;  5FLX N;  1R6N A;  3R65 A;  2QKS A;  4E4E A;  3K0G A;  4DYL A;  1NR7 A;  4WFF A;  3FKS G;  2UUB O;  2YDE A;  1ZL8 B;  2ZM6 O;  5KHH A;  1Y76 A;  3SPI A;  1NTZ H;  2R9R B;  3JCZ A;  2HG5 C;  5CBH A;  4Z1V A;  3CCS V;  3TJT A;  4OX9 O;  1N34 O;  4YJ2 A;  4X20 A;  5IJ0 A;  4I9Q A;  4J10 A;  1ARO P;  4EFB A;  1GN3 A;  3JD2 A;  1IBM O;  2NLJ C;  3PJS K;  4PDM A;  4QGP A;  1S5J A;  1GO3 F;  3AEI A;  4NVP A;  3ZMV A;  5CA1 A;  4MTO A;  4BWA A;  3STL C;  3C3T A;  3UM7 A;  1B06 A;  4WBN B;  5LMU O;  5B1N A;  4G2K A;  4LBE C;  4GX0 A;  3HB3 B;  2UUA O;  1S5H C;  2KG7 B;  2Q7H A;  1Y76 B;  3MHS C;  1Y6X A; 
#chains in the Genus database with same CATH homology
 2ATK C;  4MVZ A;  2A0L A;  1M56 C;  1FXK B;  5BZB A;  1W0K G;  3CC4 V;  1K73 W;  1QCE A;  3E8F A;  3E86 A;  2QA4 V;  3ASO B;  3SPH A;  1I5X A;  5DM6 V;  4MVO A;  4U7N A;  1AJQ A;  4BW5 A;  3QO7 A;  3E2E A;  1F4M A;  1SES A;  4FK5 C;  4ZBM A;  1B6Q A;  1DF4 A;  3H01 A;  1VQ9 V;  3W7W A;  1KD1 W;  3ASN C;  1NQT A;  5KUK A;  3ZJZ A;  2A9H A;  2DW4 A;  2WLN A;  1UJW B;  1ROP A;  4Z1M G;  1DLB A;  4G27 B;  4H33 A;  2JIZ G;  3VOU A;  5LGU A;  3CC7 V;  2ZR3 A;  3ZRW A;  2OCC C;  4DXW A;  4UVC A;  4MVS A;  2ITC C;  3ZIA G;  2XAG A;  4JAS A;  1OCR C;  3B77 A;  1F23 A;  2FTK A;  2JEU A;  4JTD B;  4MVM A;  5HFL A;  2B5U A;  1Q81 W;  4JTC B;  1AI7 A;  3ABM B;  3CCQ V;  1XL6 A;  1FFT B;  3CPW U;  1MOF A;  1QLE B;  1CP9 A;  2IH3 C;  2ZQM A;  4FJC C;  3ZN1 A;  3OEE G;  2P6J A;  2X0L A;  3K08 A;  3X2Q B;  4E2L A;  1RM1 B;  3E8H A;  1FS0 G;  1E79 G;  3F7Y C;  1R3I C;  5B1B B;  3RBZ A;  4R6Z A;  5IY5 C;  4L87 A;  3CP1 A;  2OTJ V;  5EBM C;  4H37 A;  4G28 B;  1K3E A;  1AJP A;  1H2G A;  1PD3 A;  2WLJ A;  3ZRV A;  4WF9 V;  3LDE A;  2DYR C;  3FYE B;  4PA7 A;  4P2Z A;  1KP3 A;  1JJ2 U;  1R3K C;  1RPR A;  2JJ1 G;  2QTO A;  3ZMZ A;  5L3F A;  3G4S V;  5LHI A;  2KB1 A;  3CCE V;  1CEZ A;  4I5S A;  3CYO A;  4WFH A;  1N8R W;  2GHY A;  4HYO A;  1V54 B;  3DGE A;  3ZCC A;  1VQ8 V;  5B1O A;  1JVM A;  2LFS A;  1JOY A;  1F51 A;  2XAJ A;  3FB8 C;  4LCU C;  4UXN A;  4BAY A;  5L3E A;  1H8H G;  3K03 A;  5H9C A;  1M9N A;  2P90 A;  3LUT B;  2PI5 A;  2NNU A;  3CD6 V;  1AI4 A;  5GW7 A;  2DQ0 A;  4KFM A;  4RUE A;  1RPO A;  4TSF G;  4KP4 A;  5EK0 A;  2X7R B;  1SER A;  1FXV A;  3ASN B;  3W7U A;  5B3S C;  1Q7Y W;  4RQE A;  3ETG A;  1L1F A;  3W7X A;  2IJH A;  2DYS C;  2EIK C;  3ABK C;  3P30 A;  1KP2 A;  5B1A C;  3LSQ A;  4R7C A;  2K1E A;  1PNM A;  4RO2 A;  1JQ0 A;  3CMA V;  4QE9 A;  1K9M W;  2GSM B;  3E8B A;  3DTU B;  3W7S A;  2OCC B;  3A0R A;  2R9I A;  3ZMU A;  3E89 A;  2HKO A;  1QVG U;  2Y69 C;  3FB7 C;  2ZXW B;  2LP7 A;  2IU3 A;  5LHG A;  3ZMT A;  1YTF B;  4MVU A;  3SYC A;  2W0F C;  3OW2 U;  1YIT V;  1S0V A;  2EZP A;  3WG7 C;  1VQO V;  1SZT A;  2UXN A;  3ABT A;  1VQ7 V;  3F5W C;  3K9A A;  2P67 A;  1P4R A;  2JDI G;  4WFG A;  1S76 D;  3FYI B;  3LDC A;  1M57 C;  4MTG A;  1MG1 A;  1F4N A;  3ML0 A;  2JK5 C;  2ZDI C;  1S3J A;  1KQS U;  1S77 D;  4XDL A;  1R73 A;  3AG1 B;  2DYR B;  4WFB V;  2CK3 G;  2IH1 C;  2B1G A;  3K79 A;  1E1R G;  3TET A;  3CCR V;  3STZ C;  1GM8 A;  1OCC C;  1OHH G;  2QEX V;  4FPP A;  2LFR A;  2Q68 A;  3QNE A;  1JX9 A;  5DN6 G;  4QNH B;  5IYC O;  3JD4 A;  3VBB A;  1VQN V;  1OCZ B;  4MTX A;  1P7B A;  1W2B U;  4JYB A;  3T4Z A;  3G6E V;  2WLK A;  2DQ3 A;  4DO2 A;  5CMU A;  1HWY A;  1VQK V;  3OUS A;  2H8P C;  2WLI B;  1EZJ A;  3AG4 C;  4R50 A;  1VQ5 V;  4JAV A;  1TUE B;  2X6C A;  2EIN C;  3FB5 C;  4N21 A;  1G4Y B;  1ORQ C;  1GM9 A;  1R3L C;  2WPD G;  3OR7 C;  4LP8 A;  3D36 A;  2EIL C;  3K06 A;  3LNM B;  2D3O W;  4J9Y B;  3CC2 V;  3ZRX A;  5EBW C;  4ZKI A;  3D3I A;  1OCO C;  4PDV A;  3OUF A;  2DYS B;  4UUJ C;  1PNL A;  2EIK B;  3B8M A;  5LGN A;  1K97 A;  1NBM G;  4U7O A;  4HAM A;  2HLD G;  2Q67 A;  5KA6 A;  3AG2 C;  3T4D A;  2EIM C;  3OE7 G;  2UXX A;  1R3J C;  1VQ4 V;  3ABL C;  2HR3 A;  4MT8 A;  5H6Q A;  1BHB A;  2Q69 A;  4OXS A;  1LNQ A;  1AI6 A;  3F7V C;  4QPJ A;  4JF3 A;  3SPJ A;  5L3D A;  3WG7 B;  5CA3 A;  2B1I A;  4MVR A;  2ITD C;  3I55 V;  3EHB B;  1FXK C;  1M56 B;  1M57 B;  3OFN G;  4WFE A;  3OGC C;  5FL7 G;  4PA6 A;  2AHZ A;  2P7T C;  1YJW V;  1V55 C;  1W0J G;  4GX1 A;  3CCM V;  1Q86 W;  4MVQ A;  1K5S A;  1S72 V;  1MAB G;  2HVK C;  5J9P C;  4X89 A;  5CN0 A;  1M1K W;  2WLH A;  1COW G;  1E1Q G;  4PEL A;  4P30 A;  3QO8 A;  3MHH C;  3TK1 A;  2EBO A;  1WLE A;  4BIU A;  5CBF A;  2PI4 A;  5EBL C;  5EC2 C;  3WFV A;  3P32 A;  2XAQ A;  3CCU V;  3M99 B;  3JD3 A;  1DF5 A;  1NH2 B;  1QBZ A;  3LDD A;  4JPR A;  3RVZ A;  1K33 A;  1YI2 V;  1K92 A;  3EFF K;  2ZR2 A;  4TT3 G;  2MK3 A;  4ASU G;  4FIP C;  3SPC A;  1FXH A;  4MW8 A;  4RUF A;  2XAH A;  1I5Y A;  3ABM C;  1OCR B;  1NR1 A;  3K04 A;  2W6I G;  3K0D A;  2WLI A;  2BOB C;  4MTF A;  1JCH A;  4EKW A;  4J9Z B;  4X88 A;  1GKF A;  4JAU A;  2EIJ C;  4MS2 A;  1PKX A;  4UV8 A;  1THZ A;  1RM1 C;  4RAI A;  2Y48 A;  4CZZ A;  1NVP B;  1VQ6 V;  1GM7 A;  3OMI B;  4UVB A;  1AR1 B;  2XND G;  4TWK A;  1YSC A;  3W7T A;  1DTO A;  1CPY A;  1SET A;  3SJQ C;  2AHY A;  5IYB O;  5IY5 B;  5LBQ A;  3CCL V;  2Z5U A;  3I56 V;  3GB7 C;  2IJK A;  3OEH G;  3SPG A;  3ZRS A;  1YJ9 V;  2A79 B;  4JTA B;  1QR8 A;  2JEX A;  5KA5 A;  3SYQ A;  1NJI W;  2YEV A;  3IGA C;  4LC1 A;  5IYD O;  3CCV V;  4GX5 A;  3BY6 A;  5IDJ A;  2WAM A;  4GT1 A;  1ENV A;  4JYC A;  1V54 C;  3JYC A;  2XAF A;  4MW3 A;  1Y4M A;  3KG2 A;  2Z3Y A;  5E1A C;  5C93 A;  4GX2 A;  4BIZ A;  4P9O A;  1G8M A;  2QM8 A;  5LGT A;  1YIJ V;  2QE7 G;  2HFE C;  2F43 G;  2XAS A;  2V7Q G;  3ETD A;  1GTO A;  5L3C A;  2IJI A;  4WCE V;  2WLM A;  2V1D A;  1K4C C;  5L3B A;  2IJJ A;  1Y66 A;  1V55 B;  2QM7 A;  2HVJ C;  2ZDI A;  5LHH A;  2DWD C;  1BHA A;  4N23 A;  1J95 A;  1K4D C;  1YHQ V;  3ETE A;  1ZWI C;  4UVA A;  1PL0 A;  3IC7 A;  3ZMS A;  3OMN B;  2Q6A A;  5KUM A;  5B3S B;  3JD1 A;  3K3W A;  4X8A A;  2IU0 A;  3ABK B;  5B1A B;  3AG3 C;  1K7D A;  1K5Q A;  3CXC U;  3IFX A;  4KUM A;  4PA9 A;  2ZXW C;  1WPX A;  1H8E G;  2JJ2 G;  1EFR G;  3MD0 A;  5H6R A;  2YEV B;  1QR9 A;  2DWE C;  1K34 A;  1KEC A;  3GWO A;  5EC1 C;  1MSW D;  2X6B A;  2Y69 B;  5CBG A;  4RQF A;  1H38 A;  2WSS G;  2EIJ B;  1K8A W;  1VQP V;  1KC8 W;  4JGS A;  4XDK A;  3QO5 A;  4HZ3 A;  4PDL A;  3B8N A;  4XBF A;  3OMA B;  2OTL V;  3T1C A;  3HPL C;  3NXS A;  3UKM A;  1YJN V;  3RW0 A;  3E83 A;  3ASO C;  2WLL A;  4PA3 A;  1AJN A;  3AG1 C;  4QJF B;  1R6K A;  3ZN0 A;  3E8G A;  4MSW C;  3G71 V;  4PA4 A;  1XL4 A;  4GCZ A;  3LSS A;  3FB6 C;  1NH2 D;  2M7W A;  3OAA G;  1R6N A;  3R65 A;  2QKS A;  3K0G A;  1NR7 A;  2C2A A;  3BEH A;  3OR6 C;  3FKS G;  4WFF A;  3RVY A;  4WFA V;  1KKD A;  1OCC B;  4UV9 A;  1OZ0 A;  1IXM A;  2EZO A;  3JD0 A;  2X6A A;  1VQM V;  3SYA A;  1SRY A;  3SPI A;  3ZRW B;  1OCZ C;  2R9R B;  1M90 W;  3JCZ A;  2HG5 C;  1YTF D;  2YSU B;  1AI5 A;  4P9P A;  1FXK A;  2XOK G;  5CBH A;  3CCS V;  1GK9 A;  2IW5 A;  4XDJ A;  1NVP D;  2HJF C;  2OT5 A;  1ARO P;  3E35 A;  3TCU A;  3AG4 B;  4CBC A;  4F4L A;  1QVF U;  4I9W A;  1QLE C;  3JD2 A;  2WWW A;  2NLJ C;  3PJS K;  4PDM A;  2EIN B;  3X2Q C;  4PDR A;  1VQL V;  2H94 A;  1BMF G;  1GO3 F;  1GMG A;  3AEI A;  4R8C A;  2EIL B;  2W6J G;  3CME V;  3ABU A;  3ZMV A;  4MTO A;  1EBO A;  2BOC C;  4Q20 A;  1Q82 W;  5B1B C;  3STL C;  1BL8 A;  3CCJ V;  1PNK A;  1OCO B;  2WLL B;  4FMT A;  3UM7 A;  3SYO A;  1QLN A;  4QPK A;  4YXW G;  3AG3 B;  3OM3 B;  4QE7 A;  3T2M A;  5B1N A;  4G2K A;  4LBE C;  1JPX A;  4GX0 A;  5HFM A;  3AG2 B;  3HB3 B;  4QIW F;  3SYP A;  1S5H C;  2EIM B;  5L3G A;  3ABL B;  1NKD A;  2ZD9 A;  3MHS C;  2EJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...