4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
1QR9A 1SZTA 4FIPC 1ENVA 1K34A 1Y66A 1Y4MA 3CYOA 5HFLA 2M7WA 1I5YA 3CP1A 1K33A 5CMUA 4FK5C 5HFMA 3B77A 3GWOA 2P6JA 3P30A 5KA5A 1F23A 1QCEA 3WFVA 2LP7A 2MK3A 1MOFA 1MG1A 2EBOA 4N21A 4JGSA 2EZPA 4JPRA 1DF5A 3B8NA 1DLBA 2X7RB 3K9AA 3M99B 5H9CA 2OT5A 5KA6A 1QBZA 1JPXA 4FJCC 1JQ0A 4E2LA 1QR8A 3H01A 4G2KA 3MHSC 3MHHC 2EZOA 4JF3A 1EBOA 5CN0A 4N23A 1I5XA 3B8MA 1DF4A
chains in the Genus database with same CATH superfamily
1KUQA 3CRCA 4FLZA 1Q82W 4UXNA 4AI8A 4G28B 3I5DA 1OCRB 2IJJA 4MT8A 1Q6IA 1TUBB 2IJIA 2JGDB 4NXMB 1MSWD 4JYCA 2MW2B 3BA9A 2OIGA 3F7VC 1V54B 4QJFB 1JFFB 3K5NA 5L3BA 3RVZA 5JWPA 1RM1B 5B66Z 1AVMA 2QWRB 1URFA 3CC4V 2NNUA 5E1AC 2WLLB 2F43G 5EBMC 5GTHZ 2ZT9B 2AGAA 5CBGA 4LH7A 2LP7A 2WAMA 4X20B 3TCUA 1P7BA 3ZIAG 5FNVB 3BY6A 3OMIB 3OEEG 2A0LA 1KKCA 3HKCB 2UUBB 1H2MA 1FXKC 5LMNO 3T2MA 4DR3O 3JAKA 2ZQMA 3E8HA 1JA8A 2RJZA 4YIPA 5CA1A 1XNQB 1ROPA 3LSSA 5LA6B 1VF7A 1Y76B 3WB2A 4NXNB 1UPGA 4DR2O 1HNWO 1X59A 3BAAA 2QWQB 1MNGA 1YHQV 4B7KA 4MVMA 5J2TB 1NH2D 3FB7C 4O4LA 4QPKA 3O65A 1EBOA 4PA7A 4MVRA 2DJVA 5CB4B 3E2EA 4J7JA 5LHHA 2HKOA 1YEWA 5EIBC 1CEZA 3QTCA 3ABKB 4U3JB 3CPWU 1XMQO 2EJ7A 5F2VO 4J7ZA 1VQOV 1KKDA 3ABTA 2X6BA 3JALA 1ZL8A 3FYIB 2CDYA 2YIBD 2DN9A 4LFBB 3ZEDA 3UO2A 4KL1A 4RWUA 4X8AA 1XUQA 1U96A 1J95A 1OCCB 1AP6A 3RYFA 2H8PC 4HZ3A 4Q6GA 4QPJA 5KAIZ 1WA8B 1ZTEA 1QVFU 4L87A 1F51A 3VOUA 1QVGU 3O9OA 3OT7A 2JRIA 1PKXA 4O4JB 4DUYB 5JQGB 1IBMB 3ZHRA 2ZR2A 4OGQB 1GKFA 1KP3A 2EIKB 5CA0A 1XILA 1J5EO 2ZR3A 3G4SV 3KKYA 1NR7A 5LXTA 4EB6A 2YS8A 2XHBA 5B1AC 4LF5B 3ASOC 1GM9A 2RMKB 1KU9A 4UVAA 5DM6V 4DW0A 2E76B 1HDJA 1Z5WA 4GKKB 3U11A 3ZRWB 1YIJV 3ZMZA 3D8CA 5IT9N 3OUFA 2XAFA 4FLWA 3ZHSA 4WBNA 2ZKOA 3JD2A 1SQVH 4FFBA 3RWRD 1SZXA 1GO3F 3JAWB 3SYQA 2ZIMA 2ETNA 1EN6A 3RT3C 1WNSA 4H44B 5LMUB 1W0JG 1KP2A 5LHGA 2OCCB 1VIBA 5H5NA 2FL4A 3SPHA 4DR4B 2PI5A 1TAEA 3T4DA 1SQXH 5KHIA 5FL7G 2P90A 3CHXA 1M93A 2MK3A 3N2GB 4CC6A 1LUVA 4C7UA 5IJ9A 2QSAA 1OCRC 2KQXA 3R65A 5J2UA 4LH6A 4KHPB 4H0LB 1V54C 3F7YC 3SJQC 2AZ0A 2ZINA 2M7WA 4H33A 5EBLC 1RSOA 4LFCB 2B5UA 3APQA 1B06A 5JJEB 1BQZA 3M8AA 4FM0A 2GUZA 3RYIA 3F5WC 3ZRVA 1IBLO 5IYCO 2WLNA 4F6RB 2ADQB 2GTAA 4PDVA 4ZOLB 1P49A 5LP6B 1YCIA 1AI7A 3QF7A 2AXTZ 3W7WA 3AG1B 2A3QA 1BHBA 3OTFA 1ZWIC 3FFQA 4FMTA 3SPCA 5BXZA 4WFBV 3B8NA 4TV9B 4J7KA 3IC7A 1BE3H 3BVOA 5L3DA 3X2QB 3PJSK 5JVDA 5LOVA 4DR6B 4PHZA 5JCOC 4UCTA 1YTFD 1WAZA 3E8GA 3CX5F 3OD4A 2IM9A 4TOIA 4U7NA 1NU1H 3ABUA 3WFVA 4E4EA 2P7TC 4ABMA 2XAHA 3ABKC 4JI6O 3SPGA 2X6AA 1M56C 3RBZA 2DWEC 5LBQA 4DV0B 4WF9V 4X65O 1MZEA 1HR0O 3C3TA 1WB8A 1OCZC 2YC0A 3TETA 5FPOA 2ZCEA 2UU9B 2B1GA 3BA8A 1WN7A 2Z5UA 3HB3B 2RQ6A 4O4IA 1ZLZA 2HR3A 1G6UA 1XHXA 3OE7G 4TT3G 4WFGA 1RFYA 1VQMV 3IGAC 4K0KB 1H2GA 3Q4HA 4F6EA 5B1NA 3SDLA 4DR1B 1SQGA 3QO5A 4JZ2A 5L3GA 2Q6AA 4I55A 1L0NH 1K5QA 2GV9A 2EX3A 4YIOA 1FFTB 3RYCA 5DN6G 3EVKA 4BW9A 4J10A 4UVCA 1NS1A 2LO1A 4JF3A 4DV2O 1GTOA 3AG3C 3AK1A 4DR5B 4NXMO 3JARB 3FB8C 2CTQA 2ADPA 5KHKA 1B3QA 1JJOA 1VQ5V 2L6LA 3CMEV 1B04A 2CK3G 4TUYA 2JGUA 4LF8O 1Q43A 3B8MA 5DEDA 4X66B 3CCEV 3B09A 4NYKA 3D3IA 3FAVA 1NJIW 1YVWA 3CP1A 5KHJA 4YHHB 4JTCB 2N05A 3VQWA 3TXSA 4PA3A 3HPLC 2DOSA 2P06A 3QO7A 3JD3A 4MTXA 3E8BA 3ABLB 4O4LB 3SYPA 1IZ3A 1OCOC 1E1QG 4FVMA 1NZ6A 3FYEB 2RDCA 2EIJB 4FPPA 4R6ZA 2LW7A 3SPIA 2QE7G 3OTOB 4DV6O 1H2KA 3UQ8A 1NQTA 1VQ7V 4RAIA 4DV5B 1R6KA 1BQ0A 3CXCU 3CWBH 2V4DA 4PA4A 3ZBHA 4DV7O 3THOA 4TQDA 4MTGA 5JJJB 4B3RO 3ASNB 4LF6O 4OPHA 3E8FA 3P32A 4YJ3A 2VQEB 4P9PA 2P4VA 4G2KA 4NB5A 3MHHC 4N23A 2GTSA 4DXWA 2CH7A 4JV5O 4CS4A 5LP6C 2VQFB 1Q6UA 4LNUA 4IHJA 4H13B 2CTRA 4FK5C 1K3EA 5KMGB 3JASB 2K9PA 3N2KB 2VS0A 2ZE6A 1JVMA 2R9RB 3K5MA 4LFBO 2QM4A 1GMGA 3J7AU 2LFRA 2JS3A 2UUCB 4ICGA 2PY5A 3CMAV 2PF4E 4J11A 2HJFC 3LDCA 3SJAC 4BIZA 5ITZA 5H2FZ 3CC2V 4DV4O 1S76D 3CC7V 3UT5A 4DUZB 3B40A 1BHAA 2QA4V 5IY5B 4OPAA 1BMFG 4MW3A 1IBMO 4EB6B 4YJ2A 1L1FA 2Q0OC 1E79G 4CH6A 2Q7HA 1VQ6V 4CH3A 3L73H 2PZSA 1MSDA 2Y0IA 3LDDA 2DYRB 2E3CA 2HVKC 4LWSB 2W6IG 4LF5O 3U10A 4NKGB 4Z1MG 1VQNV 1BCCH 1SS3A 3J80N 4X1YA 4WBNB 4GKKO 4JGSA 4FFBB 3CCMV 4EFBA 3K9SA 3QG5A 3L72H 4O2AA 2Z0AA 2Y4UA 1EN5A 1JCHA 2ZM6O 2FYUH 1AI6A 4MVOA 2H3OA 3PN1A 1YJNV 3EFFK 3NR7A 5LMUO 5IJ9B 5D5QA 2RN9A 2KG7A 4ZBMA 3E83A 1IXMA 1RPOA 2CAZC 5J2UB 2CUGA 2QEXV 2QR4A 3M7MX 2QWNB 2WLKA 1VQ8V 3CCLV 4D7TA 1ENVA 1JMKC 5HFLA 1Y4MA 4Z2WA 4CZZA 1VQ4V 2QKCA 3ZRXA 1RSOB 2P4KA 3OGCC 3CCVV 1CXZB 1H8EG 5FLXN 2JS5A 1NI8A 4YXWG 4IYIA 2GUZB 3RYIB 1DF5A 2Y69B 1XEQA 1XOUA 2DW4A 1YITV 4MW8A 4TV8A 2EIMB 1RP3B 1EM1A 4I9WA 4QIWF 1T5EA 1H2LA 2JEXA 5CMUA 2Q7GA 4IIJA 1IX9A 1D5AA 1SF9A 2YIDA 2ZIOA 4B7EA 1DK1A 4OXSA 2NN4A 1Q86W 2N04A 4YY3O 2ZXWC 3BRCA 1THZA 4LF7O 3K06A 2XAGA 4P2ZA 3ABLC 4RO2A 4EKWA 1N32B 1LR1A 3CS5A 3OGIB 4JI8O 3FKSG 4JYAO 3L74H 4XBFA 2DYSB 4DR6O 1U97A 4O2BA 1Q8IA 4ZI7B 3CCJV 1NTZH 2XASA 1N36O 3ASNC 4AHCA 2WLIA 4X1IB 2IJHA 2GBOA 1O9GA 1QR9A 3JATA 3F5TA 2QTSA 4JI2B 4LFAB 2F1MA 2DE0X 3JD1A 1VQ9V 4JI1B 2BSKB 1EN4A 4O4IB 3LNNA 2ZD9A 1FAFA 2F93B 1YXBA 1OV9A 1D5NA 1TVKA 2WWWA 3DC6A 4MVZA 3LSUA 5CA3A 4AQYO 2BOCC 1PNLA 1GN2A 4JASA 4BR6A 4NTYA 3B77A 5H6QA 5IY5C 1EFRG 2Y4TA 3K0GA 5BR8B 4JAUA 5B1BB 4Z1VA 4DV3O 1OHHG 4HBNA 4DR1O 2QJ1A 1Z2GA 1GN6A 1W0KG 2F4VB 1SZTA 3JAMN 4DW1A 1YI2V 4OX9O 3CEIA 4KUMA 5KA5A 2UXCO 5KHHA 2Q7EA 3I56V 2JK5C 4TUYB 1FXKA 2OT5A 3G80A 2UXBB 2UUAO 5L3CA 2ATKC 4PDMA 5CN0A 2CGNA 3L9DA 4WFAV 4GUNA 1JR9A 4R8CA 4JTDB 5LGNA 3FAVB 4WCEV 2QGNA 4ZHQB 3UO3A 3WG7B 2C2AA 1HNXB 3C90A 2DQ0A 1QLEB 3K9AA 1YZBA 1IBKO 3EXAA 4MVUA 1XMOB 1H2SB 3NXSA 5L3FA 4LF4O 3MDSA 2YEVA 2E5LB 3ABMC 3BPZA 3ZN1A 2A06H 1Q3EA 2XT9A 1V9PA 5KX5A 4GKJB 2WLJA 3GB7C 5LHIA 2ZE7A 1E1RG 4UV9A 4EEQA 4JI0B 2Y69C 1FFXA 4DV5O 1I94B 3ZMSA 1YJWV 3CYOA 2QWOB 4GX0A 3S3XA 1FPOA 4IHJB 4ZKIA 1M4UA 1Y74B 1IXBA 5DECA 3KG2A 4I0XA 3T1CA 2EBOA 2HJDA 2CGOA 3M99B 2HHHO 3H1IH 3BCCH 3DGEA 3CRAA 5K1XA 2BTQA 3C3SA 3UT5B 3G6EV 3ZN0A 1K34A 5C93A 4UUJC 3CB2A 1RM1C 1SQQH 3RW0A 4QE7A 4FLVA 4JI5O 3K79A 1SESA 1Q81W 4YJ2B 3ZX6A 5KUKA 2AZ2A 5EYPA 3ZCCA 1XL4A 4U3FH 1FJGB 5CBFA 2DYSC 2QTOA 3OUSA 4JYYA 1L8DA 2YSUB 5IYBO 3T1YO 4IYHA 4R50A 1I5XA 2R9AA 2YICA 4LF9B 1AP5A 1I7FA 1JJ2U 5JH7A 4JI4O 3IFXA 1A32A 3B4SA 2UXDO 5BMVA 3G6BA 4X1YB 1IURA 3ZS8C 4W4KA 2KB1A 1XREA 5BY1A 5EC2C 1N33B 3IAYA 4UCOA 5GONA 3RGBA 1WP7A 2R9IA 4CH5A 1K92A 4I5SA 2IBZH 2E74B 3ETEA 4X1KA 1XHZA 2Q67A 1YF2A 2KG7B 1MA1A 3E22A 4DYLA 1F4MA 2FTKA 1X4TA 3K5LA 1KQSU 5IE9A 3FX7A 3P3NA 2OIEA 3A0HZ 3DXRB 3ETQA 1OZ0A 4PV1B 3ZMVA 5LMNB 4DR3B 3ZHQA 2WLHA 2AHYA 2P5OA 3QVNA 4X20A 4I7ZB 1OCCC 3OR7C 2AHZA 4XDKA 4JI3O 2JJ2G 2PTMA 1JQ0A 5IYZA 5JJNB 1HNWB 4MTOA 4XDJA 4X62B 4TV8B 4UCSA 2QWPB 1HWYA 1K5SA 5LL6Y 2LGWA 5LA6A 4U7OA 3MAQA 1DTOA 1Y76A 1TGOA 2CTWA 3IC9A 3ZRSA 1QLNA 4DV1B 3BHPA 1NKDA 2EIKC 4NTWA 2W0FC 2JDIG 2CTPA 3K3WA 3VQYA 3AK2A 5J2TA 1XI1A 1N8RW 1XMQB 3LNMB 5JCOA 4I9QA 2XOKG 3MHSC 4LBEC 4PDLA 1K97A 1NVPB 1PPJH 3ZHVA 2WSSG 1S0VA 2WPDG 4PA6A 1IDSA 1HP8A 2Y0PA 3SJCC 1AI5A 1TUEB 1R3LC 2EINB 4O2BB 2X0LA 3UKMA 4P9OA 3K04A 4X64B 4UFZA 2WLIB 3JAKB 2EULA 3CRRA 3A0RA 1H2NA 3TGUH 3HR0A 5CA1B 3RFRA 4JI7B 5LYJA 2OCCC 4DRXA 4B08A 3K58A 1F23A 1V55B 2UUBO 2YIAA 4RUFA 2BCCH 1J5EB 1M57B 2D2CB 2Q5ZA 2LGQA 2Z3YA 1UFIA 1WPXA 1XNQO 5JQGA 4DK1A 4LFAO 4JAAA 4HYOA 4NXNO 3G67A 4CBCA 4JI1O 4PI0A 1S5JA 4I4TA 2IH1C 3JCZA 2B9ZA 4LCUC 3LUTB 3JALB 1ZL8B 4JTAB 3ZRWA 2ZDIA 5BR8O 2WLMA 3AG1C 4B3MB 5HFMA 3CCSV 1KB9F 3RYFB 4RUEA 1ZSPA 4LP8A 2PYLA 4G27B 4JPRA 3JAWA 3CRMA 1VQLV 2PI4A 3D3QA 3H01A 4I50A 3K0DA 2JEUA 1WPBA 3D36C 1AJQA 3OR6C 2Y48A 4KXRA 3X2QC 4KP4A 3K03A 4BIUA 5CA0B 1WB7A 3G71V 3DC5A 3OMAB 3W7XA 5LXTB 4DUYO 1S5HC 4UB8Z 1BL8A 4NTXA 1D2DA 2V1DA 3QO8A 1HNXO 3ETGA 3CRQA 3CCUV 1TA8A 1LUWA 2YUAA 1H38A 1FD9A 2YIBA 1S72V 2E5LO 5LGTA 5TISZ 1NTMH 3CJHA 2LJ2A 2Q8VA 5LP6A 5GTIZ 2W0XA 1FFXB 2IU3A 2QM7A 2W6JG 3JD4A 5H6RA 3EHBB 1ZAUA 1Y6XA 4CS2A 1VF6C 4GCZA 3K59A 4I0XB 4HAMA 1DLBA 4RQFA 3SGIA 1Q90D 3HKEA 2BTQB 4DR4O 4JI6B 5B5EZ 1M1KW 2F66C 3T1HB 3DSQA 4WFEA 1YSCA 2N74A 5B1AB 1R3JC 5J9PC 3J81N 4X65B 3HKBA 4K35A 4LR3A 2OTLV 4KHPO 2JVDA 2XAQA 1G8MA 3U0ZA 4DR7B 3I55V 1XDCA 3CE2A 4LFCO 5EBWC 2Q4PA 3JSLA 4FIPC 3BEHA 1FJGO 3QNEA 3ICXA 4IGGA 3TK1A 4HNAA 5IJ0A 3AG2B 5BMVB 1PNMA 3JSNA 2GSMB 1HNZB 4O4HA 2L35A 4LF9O 3MD0A 4CH4A 5GONB 1AB3A 2Q69A 5JVDB 1M57C 1DGSA 5LOVB 2B1IA 1KC8W 2NLJC 1K73W 2ODMA 2LW1A 1VF5B 2X6CA 4GT1A 4X1KB 3RVYA 2EIJC 1N33O 4DV2B 2LFSA 4D7SA 3E22B 3OW2U 2ARHA 2ITCC 3GVMA 2XUMA 2R70A 3GWKC 3JARA 2H94A 4L8JA 4LF8B 3FB5C 4DV0O 4R7CA 1XQ8A 1BZKA 2X7RB 1R3IC 3BABA 1NT2B 4QGPA 2FKXA 5A2QN 3OAAG 5IYZB 3RYHA 1VQKV 2UU9O 3VBBA 1COWG 2OYQA 2A7WA 4Q20A 1Y66A 4PELA 1L0LH 3Q4HB 2XTAA 4PJ0Z 4JYBA 4KFMA 4QE9A 4I55B 4J42A 4X62O 1MZFA 1SA0A 3SJBC 4ASUG 2HG5C 4DV6B 1PL0A 4K0KO 5KA6A 1K7DA 1FKAO 1JPXA 3RYCB 1YDXA 1N34B 1VMGA 1QR8A 4DV7B 3AG7A 4DV1O 4B3RB 5IWAB 4LF6B 1PD3A 4K3AA 4GYCB 1QQCA 2DYRC 4GX5A 3ZMUA 3HKDA 4JV5B 1M56B 1PNKA 2NR5A 1RPRA 3K08A 4FZ0A 3LDEA 4FFKA 3RN4A 4DR5O 1NR1A 3L71H 1S77D 4BAYA 3CCRV 1OCZB 1GK9A 4P30A 2FB5A 1R73A 2VWJA 5BZBA 2EILB 2M6YA 2GDSA 4PDRA 5LYJB 1WP8A 1SQPH 4DRXB 5KMGA 3JASA 4B3SB 2YXHA 4IT5A 3N2KA 3TXQA 4X64O 4DV4B 1VQPV 1UJWB 3AG4B 5KLVH 3H1HH 4X66O 3SR2C 1WJZA 3OMNB 1BSMA 3K57A 4JI7O 1HW7A 1K4DC 4UB6Z 1BT8A 1GRJA 2QM8A 2WA4A 4YHHO 1KMIZ 1NBMG 2OTJV 3E89A 4UCRA 3JD0A 3H1LH 5EK0A 4I4TB 4BIOA 1ZUQA 5C8YA 1AR5A 3FB6C 5H9CA 1AR4A 3AG3B 3OTOO 4YJ3B 5KAFZ 2KKWA 4NVPA 2ITDC 4F4LA 3ZHUA 4LWSA 2CH7B 2OWOA 4FZ1A 4LNUB 4H37A 1P4RA 1PV0A 2EIMC 3SYOA 3CCQV 1PM9A 2VQEO 3SPJA 2ZM6B 1MG1A 3AG2C 3T4ZA 1ORQC 2VQFO 4GX1A 1VARA 4LC1A 4FLYA 4BW5A 4I50B 4B3MO 2KSDA 5ITZB 2XAJA 2PUSA 3A0BZ 1IVSA 1NH2B 2PYJA 2UUCO 3DTUB 3OEHG 4RQEA 1S5LZ 4B3TB 5EZYA 1NVPD 1OCOB 4DUZO 3JYCA 4X88A 3UCSC 2HLDG 1K8AW 4FLUA 1N0NA 1XNRB 4UV8A 1I0HA 1S3JA 1FYJA 2Q68A 2UXNA 3L75H 1BS3A 2YI8A 1F7YA 3ML0A 5AG2A 1AROP 2ZE8A 3ZHTA 3CJHB 2HEPA 2DWDC 4O2AB 3FD9A 1PL4A 2YDEA 4FLXA 4W4LA 4YY3B 1P7GA 4LF7B 4J80A 4UVBA 1QCEA 1TUBA 5B3SB 2JGDA 4JI8B 1SKVA 1CP9A 4JYAB 1AJPA 2BE3A 2E75B 1JX9A 4DO2A 1JFFA 2HP8A 3HKEB 4XDLA 5B1BC 1FS0G 3E35A 3CD6V 1SRYA 4FLTA 1N36B 1MABG 2WLLA 3SYCA 1M5IA 3E86A 2F23A 4MSWC 2P6JA 3APOA 3HKBB 2BOBC 2AW9A 2VRZA 4TWKA 2EJRA 3T1HO 2LQTA 4JZGA 4ZI7A 1SETA 5FNVA 4DR2B 2HFEC 3KCYA 3HKCA 3A8TA 1KBHA 1G4YB 1GM8A 4X1IA 1Y67A 2IW5A 4QNHB 2EILC 4DR7O 2ZE5A 4HNAB 5IJ0B 4UCUA 4IIJB 4J41A 1KECA 1MOFA 3WG7C 4AQYB 2BSKA 1N4CA 4O4HB 4CC5A 1GM7A 1B6QA 4UCVA 3L70H 3AG4C 5KUMA 1QLEC 2EZOA 2V7QG 2JJ1G 5CB4A 1CPYA 4DV3B 1SC5B 1HNZO 1R1BA 4EFEA 2P67A 3IJ4A 5D5PA 4U3JA 1G1XB 3K5OA 4GX2A 5A9GA 5CBHA 2ZNJA 2FMLA 5EIBD 4OX9B 1QHTA 1N32O 1Q6HA 1P84F 1PP9H 2UXCB 1O9HA 3LSQA 2YXYA 2UUAB 3JATB 2BTOA 3VQXA 2YXLA 3H1JH 1AILA 2ZDIC 1XBLA 2RNBA 1WA8A 2YI9A 3W7UA 3H9VA 2GHYA 2D3OW 3SYAA 1JOYA 4AILC 1LNQA 4O4JA 4JI2O 3RYHB 3WU2Z 4PD4F 1IBKB 1TVKB 2O57A 4BWAA 3S3WA 4TSFG 5FPRA 2R72A 4ZHQA 2CE4A 5IYDO 4A5UB 2IU0A 2HVJC 5GW7A 5B1OA 4LF4B 1BGYH 1YTFB 1EZJA 1SA0B 2ZXWB 3JCUZ 5IDJA 4DK0A 1OJHA 1W59A 4FM1A 1XL6A 1NTKH 1N0JA 4MS2A 3AK3A 3STZC 3W7SA 1AI4A 4PA9A 2K1EA 4J9ZB 4FM2A 3HKDB 1N34O 3P30A 4MVQA 4X89A 3KCXA 2EZPA 5LGUA 2JIZG 5IWAO 2F4VO 1KYOF 4GZRB 1FXKB 1EZVH 1GN4A 1R3KC 4WFHA 2QKSA 2OCHA 2HHHB 4K8XA 2QKAA 1FXVA 1M9NA 1ZX3A 1Q7YW 1Y74A 1K33A 2UXBO 1Z5VA 4IL6Z 3N2GA 4N21A 1SQBH 1WLEA 1I08A 5B3SC 4D6TH 3H1KH 1VP7A 4JI5B 4B3SO 1M90W 2Q0AA 2YEVB 1IBLB 1F4NA 3WB1A 3T1YB 2VWKA 2IH3C 3OM3B 2DMXA 2QDOA 3GWOA 1XMOO 4MTFA 1FXHA 5C8YB 1AJNA 3UM7A 3CSXA 5KX5B 1K4CC 4JAVA 4JI4B 3W7TA 1MMMA 2UXDB 1KD1W 4F6RA 3AEIA 2A9HA 4ZOLA 1US6A 2UXXA 5E79Z 1GH6A 3B2EE 2P22C 4GKJO 2PGGA 1I5YA 2IJKA 2A79B 1H8HG 2Q9LA 4JI0O 3BFRA 1W2BU 1I94O 4TQFA 3KZIZ 4TV9A 4WFFA 4CS3A 3D36A 1QBZA 5KHGA 5L3EA 2Q73A 1Q5OA 2ZNIA 1R6TA 1R6NA 4X9QA 2DQ3A 3WB0A 3ZJZA 2ILMA 3ASOB 1HR0B 5EZYB 4K8ZA 5EC1C 5EYPB 2XNDG 2EINC 4FJCC 1AR1B 3R66A 3ABMB 3A2FA 3P3PA 3CXHF 4ZIBA 1K9MW 1DF4A 4JI3B 2RCVA 4B3TO 1VEWA 3DXRA 3ETDA 1QU7A 1QNMA 3N27A 5JH7B 5K1PA 4PI2A 4J9YB 4NR1A 1SERA 3VQVA 1GAXA 3STLC 1GN3A 1XNRO 1YJ9V 2F95B 1V55C 3OFNG 4GLXA 4E2LA 2G38A 1SQFA 2WA3A 4MVSA 3TJTA 1VF6A 3ZMTA
chains in the Genus database with same CATH topology
3E89A 3JD0A 1OZ0A 1Q82W 4UXNA 5EK0A 4FK5C 4G28B 1K3EA 1OCRB 3ZMVA 2IJJA 4MT8A 2WLHA 2AHYA 2IJIA 1JVMA 1MSWD 2R9RB 4JYCA 3FB6C 1OCCC 3OR7C 2AHZA 1GMGA 4XDKA 5H9CA 2JJ2G 2LFRA 3AG3B 3F7VC 1V54B 3CMAV 4QJFB 2HJFC 1JQ0A 2ITDC 3LDCA 4F4LA 4BIZA 5L3BA 3RVZA 3CC2V 4MTOA 4XDJA 1RM1B 1S76D 3CC7V 1BHAA 2QA4V 1HWYA 1K5SA 3CC4V 2NNUA 1P4RA 4H37A 2EIMC 4U7OA 5E1AC 3SYOA 1DTOA 2WLLB 5IY5B 3CCQV 1BMFG 2F43G 5EBMC 3ZRSA 3SPJA 1QLNA 4MW3A 5CBGA 2LP7A 2WAMA 1MG1A 1NKDA 2EIKC 3TCUA 2W0FC 2JDIG 1L1FA 1P7BA 3AG2C 3K3WA 3T4ZA 1ORQC 1E79G 1N8RW 3ZIAG 4GX1A 3LNMB 1VQ6V 4LC1A 4BW5A 2XOKG 3BY6A 3OMIB 3MHSC 3OEEG 2A0LA 4LBEC 4PDLA 1FXKC 1K97A 3T2MA 1NVPB 3LDDA 2DYRB 2XAJA 2ZQMA 3E8HA 2HVKC 2W6IG 2WSSG 1S0VA 2WPDG 1NH2B 4PA6A 1ROPA 3LSSA 4Z1MG 1VQNV 3DTUB 3OEHG 1AI5A 1TUEB 1R3LC 4RQEA 2EINB 4JGSA 3CCMV 1NVPD 1OCOB 1YHQV 2X0LA 4MVMA 3UKMA 4P9OA 3K04A 3JYCA 1NH2D 3FB7C 4X88A 4QPKA 2HLDG 1EBOA 4PA7A 1K8AW 4MVRA 1JCHA 2WLIB 3E2EA 5LHHA 2HKOA 3A0RA 4UV8A 1S3JA 1CEZA 1AI6A 2OCCC 4MVOA 2Q68A 3ABKB 3CPWU 2UXNA 1YJNV 3EFFK 1F23A 3ML0A 1V55B 4ZBMA 3E83A 4RUFA 1AROP 1IXMA 1RPOA 1VQOV 2DWDC 1KKDA 1M57B 3ABTA 2X6BA 2Z3YA 1WPXA 3FYIB 2QEXV 4HYOA 2WLKA 1VQ8V 3CCLV 4CBCA 1ENVA 5HFLA 1Y4MA 4CZZA 1VQ4V 4X8AA 3ZRXA 1J95A 3OGCC 1OCCB 3CCVV 1H8EG 4UVBA 2H8PC 2IH1C 3JCZA 4HZ3A 1QCEA 5B3SB 4QPJA 4YXWG 1CP9A 1DF5A 3LUTB 4LCUC 1QVFU 4L87A 1AJPA 1F51A 3VOUA 2Y69B 1QVGU 1JX9A 4DO2A 1PKXA 2DW4A 4JTAB 1YITV 3ZRWA 4XDLA 4MW8A 5B1BC 2EIMB 1FS0G 3E35A 2ZR2A 3CD6V 1SRYA 2ZDIA 4I9WA 4QIWF 1GKFA 1KP3A 2WLMA 2EIKB 3AG1C 1MABG 2JEXA 2ZR3A 2WLLA 5CMUA 3SYCA 3G4SV 5HFMA 3E86A 4MSWC 2P6JA 3CCSV 1NR7A 2BOBC 4RUEA 4TWKA 2EJRA 4LP8A 5B1AC 4G27B 4JPRA 3ASOC 1GM9A 5DM6V 4UVAA 4OXSA 1VQLV 1SETA 2PI4A 3H01A 2HFEC 1Q86W 2ZXWC 3K0DA 1THZA 2JEUA 3K06A 2XAGA 1G4YB 1GM8A 4P2ZA 3ABLC 3ZRWB 4RO2A 1YIJV 4EKWA 1AJQA 3OR6C 2Y48A 3X2QC 3ZMZA 4KP4A 2IW5A 3K03A 4QNHB 2EILC 4BIUA 3FKSG 3OUFA 4XBFA 2XAFA 3G71V 3OMAB 1KECA 1MOFA 2DYSB 3W7XA 1S5HC 3JD2A 3WG7C 1BL8A 1GO3F 1GM7A 3SYQA 1B6QA 5KUMA 3AG4C 3CCJV 1QLEC 2V1DA 2XASA 3ASNC 1W0JG 2EZOA 1KP2A 3QO8A 2V7QG 5LHGA 2OCCB 2JJ1G 2WLIA 3ETGA 2IJHA 3CCUV 1CPYA 1QR9A 3SPHA 2P67A 1H38A 2PI5A 3T4DA 4GX2A 5CBHA 5FL7G 2P90A 2MK3A 1S72V 5LGTA 3JD1A 1OCRC 1VQ9V 3R65A 2ZD9A 2IU3A 2QM7A 3LSQA 1V54C 3F7YC 2WWWA 2W6JG 3SJQC 4MVZA 3JD4A 5H6RA 3EHBB 5CA3A 2BOCC 2M7WA 4H33A 5EBLC 1PNLA 4GCZA 4JASA 2ZDIC 3B77A 2B5UA 5H6QA 5IY5C 1EFRG 4HAMA 3K0GA 3F5WC 3ZRVA 1DLBA 3W7UA 4RQFA 4JAUA 5IYCO 2WLNA 5B1BB 1OHHG 2GHYA 3SYAA 2D3OW 1JOYA 1LNQA 4PDVA 1AI7A 1M1KW 1W0KG 3W7WA 3AG1B 4TSFG 1SZTA 4WFEA 1BHBA 1YSCA 5IYDO 1YI2V 2IU0A 2HVJC 5B1AB 5GW7A 5B1OA 1R3JC 5J9PC 4KUMA 5KA5A 1YTFB 1ZWIC 2OTLV 1EZJA 4FMTA 2XAQA 3SPCA 4WFBV 3B8NA 3I56V 2JK5C 2ZXWB 1G8MA 1FXKA 2OT5A 5IDJA 3IC7A 3I55V 5L3CA 2ATKC 5L3DA 3X2QB 3PJSK 4PDMA 1XL6A 5CN0A 4WFAV 5EBWC 4R8CA 4JTDB 4MS2A 3E8GA 1YTFD 4FIPC 3STZC 5LGNA 4WCEV 3W7SA 3BEHA 1AI4A 4PA9A 3QNEA 3WG7B 2K1EA 4J9ZB 3TK1A 2C2AA 3AG2B 3P30A 2DQ0A 4MVQA 4U7NA 3ABUA 3WFVA 4X89A 2P7TC 2XAHA 3ABKC 2EZPA 1PNMA 5LGUA 1QLEB 2GSMB 2JIZG 3K9AA 3SPGA 2X6AA 1M56C 3MD0A 4MVUA 1FXKB 3RBZA 3NXSA 1R3KC 4WFHA 5L3FA 2DWEC 2Q69A 5LBQA 2QKSA 1M57C 2YEVA 4WF9V 2B1IA 1KC8W 2NLJC 1K73W 1OCZC 3ABMC 1FXVA 1M9NA 1Q7YW 2X6CA 4GT1A 3RVYA 1K33A 2EIJC 3ZN1A 3TETA 2LFSA 2B1GA 2Z5UA 4N21A 2WLJA 3HB3B 3OW2U 3GB7C 5LHIA 1E1RG 1WLEA 5B3SC 4UV9A 2ITCC 2HR3A 3OE7G 2Y69C 4TT3G 4WFGA 1M90W 2YEVB 1VQMV 3IGAC 3ZMSA 2H94A 1YJWV 1H2GA 1F4NA 3CYOA 4GX0A 5B1NA 3FB5C 2IH3C 3OM3B 4ZKIA 3QO5A 3GWOA 5L3GA 4MTFA 2Q6AA 1FXHA 3KG2A 1AJNA 3T1CA 2EBOA 3UM7A 1K5QA 1K4CC 4R7CA 4JAVA 2X7RB 1R3IC 3M99B 3W7TA 1FFTB 5DN6G 1KD1W 3DGEA 3AEIA 2A9HA 3OAAG 4UVCA 2UXXA 4JF3A 1GTOA 3AG3C 1VQKV 3VBBA 1COWG 3G6EV 3FB8C 4Q20A 1Y66A 1K34A 4PELA 3ZN0A 5C93A 4UUJC 1RM1C 1I5YA 4JYBA 4KFMA 3RW0A 4QE9A 4QE7A 2IJKA 3K79A 1SESA 1Q81W 2A79B 1VQ5V 1H8HG 5KUKA 4ASUG 2HG5C 1W2BU 3CMEV 3ZCCA 4WFFA 1XL4A 1PL0A 2CK3G 5CBFA 2DYSC 2QTOA 1QBZA 3D36A 1K7DA 3OUSA 1JPXA 5KA6A 5L3EA 2YSUB 5IYBO 1QR8A 4R50A 1I5XA 3B8MA 3CCEV 1PD3A 3D3IA 1JJ2U 1NJIW 3IFXA 1R6NA 3CP1A 2DYRC 2DQ3A 4GX5A 3ZJZA 3ZMUA 3ASOB 1M56B 4JTCB 1PNKA 1RPRA 3K08A 4PA3A 3HPLC 2KB1A 3LDEA 5EC1C 2XNDG 1NR1A 5EC2C 3QO7A 3JD3A 4MTXA 3E8BA 1S77D 2EINC 3ABLB 4FJCC 4BAYA 1AR1B 3CCRV 3SYPA 1OCZB 1OCOC 1GK9A 3ABMB 1E1QG 4P30A 2R9IA 1K9MW 1R73A 3FYEB 1DF4A 2EIJB 2EILB 5BZBA 1K92A 4FPPA 4R6ZA 4I5SA 2QE7G 3ETDA 3SPIA 4PDRA 3ETEA 4J9YB 1NQTA 1SERA 1VQ7V 2Q67A 4RAIA 1R6KA 1VQPV 3CXCU 1UJWB 4PA4A 3STLC 3AG4B 4MTGA 3OMNB 3ASNB 1F4MA 3E8FA 3P32A 1YJ9V 3OFNG 1V55C 4P9PA 4E2LA 1K4DC 2FTKA 4G2KA 3MHHC 2QM8A 1KQSU 4N23A 4MVSA 4DXWA 1NBMG 3ZMTA 2OTJV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QR9 A;  1SZT A;  4FIP C;  1ENV A;  1K34 A;  1Y66 A;  1Y4M A;  3CYO A;  5HFL A;  2M7W A;  1I5Y A;  3CP1 A;  1K33 A;  5CMU A;  4FK5 C;  5HFM A;  3B77 A;  3GWO A;  2P6J A;  3P30 A;  5KA5 A;  1F23 A;  1QCE A;  3WFV A;  2LP7 A;  2MK3 A;  1MOF A;  1MG1 A;  2EBO A;  4N21 A;  4JGS A;  2EZP A;  4JPR A;  1DF5 A;  3B8N A;  1DLB A;  2X7R B;  3K9A A;  3M99 B;  5H9C A;  2OT5 A;  5KA6 A;  1QBZ A;  1JPX A;  4FJC C;  1JQ0 A;  4E2L A;  1QR8 A;  3H01 A;  4G2K A;  3MHS C;  3MHH C;  2EZO A;  4JF3 A;  1EBO A;  5CN0 A;  4N23 A;  1I5X A;  3B8M A;  1DF4 A; 
#chains in the Genus database with same CATH topology
 1KUQ A;  3CRC A;  4FLZ A;  1Q82 W;  4UXN A;  4AI8 A;  4G28 B;  3I5D A;  1OCR B;  2IJJ A;  4MT8 A;  1Q6I A;  1TUB B;  2IJI A;  2JGD B;  4NXM B;  1MSW D;  4JYC A;  2MW2 B;  3BA9 A;  2OIG A;  3F7V C;  1V54 B;  4QJF B;  1JFF B;  3K5N A;  5L3B A;  3RVZ A;  5JWP A;  1RM1 B;  5B66 Z;  1AVM A;  2QWR B;  1URF A;  3CC4 V;  2NNU A;  5E1A C;  2WLL B;  2F43 G;  5EBM C;  5GTH Z;  2ZT9 B;  2AGA A;  5CBG A;  4LH7 A;  2LP7 A;  2WAM A;  4X20 B;  3TCU A;  1P7B A;  3ZIA G;  5FNV B;  3BY6 A;  3OMI B;  3OEE G;  2A0L A;  1KKC A;  3HKC B;  2UUB B;  1H2M A;  1FXK C;  5LMN O;  3T2M A;  4DR3 O;  3JAK A;  2ZQM A;  3E8H A;  1JA8 A;  2RJZ A;  4YIP A;  5CA1 A;  1XNQ B;  1ROP A;  3LSS A;  5LA6 B;  1VF7 A;  1Y76 B;  3WB2 A;  4NXN B;  1UPG A;  4DR2 O;  1HNW O;  1X59 A;  3BAA A;  2QWQ B;  1MNG A;  1YHQ V;  4B7K A;  4MVM A;  5J2T B;  1NH2 D;  3FB7 C;  4O4L A;  4QPK A;  3O65 A;  1EBO A;  4PA7 A;  4MVR A;  2DJV A;  5CB4 B;  3E2E A;  4J7J A;  5LHH A;  2HKO A;  1YEW A;  5EIB C;  1CEZ A;  3QTC A;  3ABK B;  4U3J B;  3CPW U;  1XMQ O;  2EJ7 A;  5F2V O;  4J7Z A;  1VQO V;  1KKD A;  3ABT A;  2X6B A;  3JAL A;  1ZL8 A;  3FYI B;  2CDY A;  2YIB D;  2DN9 A;  4LFB B;  3ZED A;  3UO2 A;  4KL1 A;  4RWU A;  4X8A A;  1XUQ A;  1U96 A;  1J95 A;  1OCC B;  1AP6 A;  3RYF A;  2H8P C;  4HZ3 A;  4Q6G A;  4QPJ A;  5KAI Z;  1WA8 B;  1ZTE A;  1QVF U;  4L87 A;  1F51 A;  3VOU A;  1QVG U;  3O9O A;  3OT7 A;  2JRI A;  1PKX A;  4O4J B;  4DUY B;  5JQG B;  1IBM B;  3ZHR A;  2ZR2 A;  4OGQ B;  1GKF A;  1KP3 A;  2EIK B;  5CA0 A;  1XIL A;  1J5E O;  2ZR3 A;  3G4S V;  3KKY A;  1NR7 A;  5LXT A;  4EB6 A;  2YS8 A;  2XHB A;  5B1A C;  4LF5 B;  3ASO C;  1GM9 A;  2RMK B;  1KU9 A;  4UVA A;  5DM6 V;  4DW0 A;  2E76 B;  1HDJ A;  1Z5W A;  4GKK B;  3U11 A;  3ZRW B;  1YIJ V;  3ZMZ A;  3D8C A;  5IT9 N;  3OUF A;  2XAF A;  4FLW A;  3ZHS A;  4WBN A;  2ZKO A;  3JD2 A;  1SQV H;  4FFB A;  3RWR D;  1SZX A;  1GO3 F;  3JAW B;  3SYQ A;  2ZIM A;  2ETN A;  1EN6 A;  3RT3 C;  1WNS A;  4H44 B;  5LMU B;  1W0J G;  1KP2 A;  5LHG A;  2OCC B;  1VIB A;  5H5N A;  2FL4 A;  3SPH A;  4DR4 B;  2PI5 A;  1TAE A;  3T4D A;  1SQX H;  5KHI A;  5FL7 G;  2P90 A;  3CHX A;  1M93 A;  2MK3 A;  3N2G B;  4CC6 A;  1LUV A;  4C7U A;  5IJ9 A;  2QSA A;  1OCR C;  2KQX A;  3R65 A;  5J2U A;  4LH6 A;  4KHP B;  4H0L B;  1V54 C;  3F7Y C;  3SJQ C;  2AZ0 A;  2ZIN A;  2M7W A;  4H33 A;  5EBL C;  1RSO A;  4LFC B;  2B5U A;  3APQ A;  1B06 A;  5JJE B;  1BQZ A;  3M8A A;  4FM0 A;  2GUZ A;  3RYI A;  3F5W C;  3ZRV A;  1IBL O;  5IYC O;  2WLN A;  4F6R B;  2ADQ B;  2GTA A;  4PDV A;  4ZOL B;  1P49 A;  5LP6 B;  1YCI A;  1AI7 A;  3QF7 A;  2AXT Z;  3W7W A;  3AG1 B;  2A3Q A;  1BHB A;  3OTF A;  1ZWI C;  3FFQ A;  4FMT A;  3SPC A;  5BXZ A;  4WFB V;  3B8N A;  4TV9 B;  4J7K A;  3IC7 A;  1BE3 H;  3BVO A;  5L3D A;  3X2Q B;  3PJS K;  5JVD A;  5LOV A;  4DR6 B;  4PHZ A;  5JCO C;  4UCT A;  1YTF D;  1WAZ A;  3E8G A;  3CX5 F;  3OD4 A;  2IM9 A;  4TOI A;  4U7N A;  1NU1 H;  3ABU A;  3WFV A;  4E4E A;  2P7T C;  4ABM A;  2XAH A;  3ABK C;  4JI6 O;  3SPG A;  2X6A A;  1M56 C;  3RBZ A;  2DWE C;  5LBQ A;  4DV0 B;  4WF9 V;  4X65 O;  1MZE A;  1HR0 O;  3C3T A;  1WB8 A;  1OCZ C;  2YC0 A;  3TET A;  5FPO A;  2ZCE A;  2UU9 B;  2B1G A;  3BA8 A;  1WN7 A;  2Z5U A;  3HB3 B;  2RQ6 A;  4O4I A;  1ZLZ A;  2HR3 A;  1G6U A;  1XHX A;  3OE7 G;  4TT3 G;  4WFG A;  1RFY A;  1VQM V;  3IGA C;  4K0K B;  1H2G A;  3Q4H A;  4F6E A;  5B1N A;  3SDL A;  4DR1 B;  1SQG A;  3QO5 A;  4JZ2 A;  5L3G A;  2Q6A A;  4I55 A;  1L0N H;  1K5Q A;  2GV9 A;  2EX3 A;  4YIO A;  1FFT B;  3RYC A;  5DN6 G;  3EVK A;  4BW9 A;  4J10 A;  4UVC A;  1NS1 A;  2LO1 A;  4JF3 A;  4DV2 O;  1GTO A;  3AG3 C;  3AK1 A;  4DR5 B;  4NXM O;  3JAR B;  3FB8 C;  2CTQ A;  2ADP A;  5KHK A;  1B3Q A;  1JJO A;  1VQ5 V;  2L6L A;  3CME V;  1B04 A;  2CK3 G;  4TUY A;  2JGU A;  4LF8 O;  1Q43 A;  3B8M A;  5DED A;  4X66 B;  3CCE V;  3B09 A;  4NYK A;  3D3I A;  3FAV A;  1NJI W;  1YVW A;  3CP1 A;  5KHJ A;  4YHH B;  4JTC B;  2N05 A;  3VQW A;  3TXS A;  4PA3 A;  3HPL C;  2DOS A;  2P06 A;  3QO7 A;  3JD3 A;  4MTX A;  3E8B A;  3ABL B;  4O4L B;  3SYP A;  1IZ3 A;  1OCO C;  1E1Q G;  4FVM A;  1NZ6 A;  3FYE B;  2RDC A;  2EIJ B;  4FPP A;  4R6Z A;  2LW7 A;  3SPI A;  2QE7 G;  3OTO B;  4DV6 O;  1H2K A;  3UQ8 A;  1NQT A;  1VQ7 V;  4RAI A;  4DV5 B;  1R6K A;  1BQ0 A;  3CXC U;  3CWB H;  2V4D A;  4PA4 A;  3ZBH A;  4DV7 O;  3THO A;  4TQD A;  4MTG A;  5JJJ B;  4B3R O;  3ASN B;  4LF6 O;  4OPH A;  3E8F A;  3P32 A;  4YJ3 A;  2VQE B;  4P9P A;  2P4V A;  4G2K A;  4NB5 A;  3MHH C;  4N23 A;  2GTS A;  4DXW A;  2CH7 A;  4JV5 O;  4CS4 A;  5LP6 C;  2VQF B;  1Q6U A;  4LNU A;  4IHJ A;  4H13 B;  2CTR A;  4FK5 C;  1K3E A;  5KMG B;  3JAS B;  2K9P A;  3N2K B;  2VS0 A;  2ZE6 A;  1JVM A;  2R9R B;  3K5M A;  4LFB O;  2QM4 A;  1GMG A;  3J7A U;  2LFR A;  2JS3 A;  2UUC B;  4ICG A;  2PY5 A;  3CMA V;  2PF4 E;  4J11 A;  2HJF C;  3LDC A;  3SJA C;  4BIZ A;  5ITZ A;  5H2F Z;  3CC2 V;  4DV4 O;  1S76 D;  3CC7 V;  3UT5 A;  4DUZ B;  3B40 A;  1BHA A;  2QA4 V;  5IY5 B;  4OPA A;  1BMF G;  4MW3 A;  1IBM O;  4EB6 B;  4YJ2 A;  1L1F A;  2Q0O C;  1E79 G;  4CH6 A;  2Q7H A;  1VQ6 V;  4CH3 A;  3L73 H;  2PZS A;  1MSD A;  2Y0I A;  3LDD A;  2DYR B;  2E3C A;  2HVK C;  4LWS B;  2W6I G;  4LF5 O;  3U10 A;  4NKG B;  4Z1M G;  1VQN V;  1BCC H;  1SS3 A;  3J80 N;  4X1Y A;  4WBN B;  4GKK O;  4JGS A;  4FFB B;  3CCM V;  4EFB A;  3K9S A;  3QG5 A;  3L72 H;  4O2A A;  2Z0A A;  2Y4U A;  1EN5 A;  1JCH A;  2ZM6 O;  2FYU H;  1AI6 A;  4MVO A;  2H3O A;  3PN1 A;  1YJN V;  3EFF K;  3NR7 A;  5LMU O;  5IJ9 B;  5D5Q A;  2RN9 A;  2KG7 A;  4ZBM A;  3E83 A;  1IXM A;  1RPO A;  2CAZ C;  5J2U B;  2CUG A;  2QEX V;  2QR4 A;  3M7M X;  2QWN B;  2WLK A;  1VQ8 V;  3CCL V;  4D7T A;  1ENV A;  1JMK C;  5HFL A;  1Y4M A;  4Z2W A;  4CZZ A;  1VQ4 V;  2QKC A;  3ZRX A;  1RSO B;  2P4K A;  3OGC C;  3CCV V;  1CXZ B;  1H8E G;  5FLX N;  2JS5 A;  1NI8 A;  4YXW G;  4IYI A;  2GUZ B;  3RYI B;  1DF5 A;  2Y69 B;  1XEQ A;  1XOU A;  2DW4 A;  1YIT V;  4MW8 A;  4TV8 A;  2EIM B;  1RP3 B;  1EM1 A;  4I9W A;  4QIW F;  1T5E A;  1H2L A;  2JEX A;  5CMU A;  2Q7G A;  4IIJ A;  1IX9 A;  1D5A A;  1SF9 A;  2YID A;  2ZIO A;  4B7E A;  1DK1 A;  4OXS A;  2NN4 A;  1Q86 W;  2N04 A;  4YY3 O;  2ZXW C;  3BRC A;  1THZ A;  4LF7 O;  3K06 A;  2XAG A;  4P2Z A;  3ABL C;  4RO2 A;  4EKW A;  1N32 B;  1LR1 A;  3CS5 A;  3OGI B;  4JI8 O;  3FKS G;  4JYA O;  3L74 H;  4XBF A;  2DYS B;  4DR6 O;  1U97 A;  4O2B A;  1Q8I A;  4ZI7 B;  3CCJ V;  1NTZ H;  2XAS A;  1N36 O;  3ASN C;  4AHC A;  2WLI A;  4X1I B;  2IJH A;  2GBO A;  1O9G A;  1QR9 A;  3JAT A;  3F5T A;  2QTS A;  4JI2 B;  4LFA B;  2F1M A;  2DE0 X;  3JD1 A;  1VQ9 V;  4JI1 B;  2BSK B;  1EN4 A;  4O4I B;  3LNN A;  2ZD9 A;  1FAF A;  2F93 B;  1YXB A;  1OV9 A;  1D5N A;  1TVK A;  2WWW A;  3DC6 A;  4MVZ A;  3LSU A;  5CA3 A;  4AQY O;  2BOC C;  1PNL A;  1GN2 A;  4JAS A;  4BR6 A;  4NTY A;  3B77 A;  5H6Q A;  5IY5 C;  1EFR G;  2Y4T A;  3K0G A;  5BR8 B;  4JAU A;  5B1B B;  4Z1V A;  4DV3 O;  1OHH G;  4HBN A;  4DR1 O;  2QJ1 A;  1Z2G A;  1GN6 A;  1W0K G;  2F4V B;  1SZT A;  3JAM N;  4DW1 A;  1YI2 V;  4OX9 O;  3CEI A;  4KUM A;  5KA5 A;  2UXC O;  5KHH A;  2Q7E A;  3I56 V;  2JK5 C;  4TUY B;  1FXK A;  2OT5 A;  3G80 A;  2UXB B;  2UUA O;  5L3C A;  2ATK C;  4PDM A;  5CN0 A;  2CGN A;  3L9D A;  4WFA V;  4GUN A;  1JR9 A;  4R8C A;  4JTD B;  5LGN A;  3FAV B;  4WCE V;  2QGN A;  4ZHQ B;  3UO3 A;  3WG7 B;  2C2A A;  1HNX B;  3C90 A;  2DQ0 A;  1QLE B;  3K9A A;  1YZB A;  1IBK O;  3EXA A;  4MVU A;  1XMO B;  1H2S B;  3NXS A;  5L3F A;  4LF4 O;  3MDS A;  2YEV A;  2E5L B;  3ABM C;  3BPZ A;  3ZN1 A;  2A06 H;  1Q3E A;  2XT9 A;  1V9P A;  5KX5 A;  4GKJ B;  2WLJ A;  3GB7 C;  5LHI A;  2ZE7 A;  1E1R G;  4UV9 A;  4EEQ A;  4JI0 B;  2Y69 C;  1FFX A;  4DV5 O;  1I94 B;  3ZMS A;  1YJW V;  3CYO A;  2QWO B;  4GX0 A;  3S3X A;  1FPO A;  4IHJ B;  4ZKI A;  1M4U A;  1Y74 B;  1IXB A;  5DEC A;  3KG2 A;  4I0X A;  3T1C A;  2EBO A;  2HJD A;  2CGO A;  3M99 B;  2HHH O;  3H1I H;  3BCC H;  3DGE A;  3CRA A;  5K1X A;  2BTQ A;  3C3S A;  3UT5 B;  3G6E V;  3ZN0 A;  1K34 A;  5C93 A;  4UUJ C;  3CB2 A;  1RM1 C;  1SQQ H;  3RW0 A;  4QE7 A;  4FLV A;  4JI5 O;  3K79 A;  1SES A;  1Q81 W;  4YJ2 B;  3ZX6 A;  5KUK A;  2AZ2 A;  5EYP A;  3ZCC A;  1XL4 A;  4U3F H;  1FJG B;  5CBF A;  2DYS C;  2QTO A;  3OUS A;  4JYY A;  1L8D A;  2YSU B;  5IYB O;  3T1Y O;  4IYH A;  4R50 A;  1I5X A;  2R9A A;  2YIC A;  4LF9 B;  1AP5 A;  1I7F A;  1JJ2 U;  5JH7 A;  4JI4 O;  3IFX A;  1A32 A;  3B4S A;  2UXD O;  5BMV A;  3G6B A;  4X1Y B;  1IUR A;  3ZS8 C;  4W4K A;  2KB1 A;  1XRE A;  5BY1 A;  5EC2 C;  1N33 B;  3IAY A;  4UCO A;  5GON A;  3RGB A;  1WP7 A;  2R9I A;  4CH5 A;  1K92 A;  4I5S A;  2IBZ H;  2E74 B;  3ETE A;  4X1K A;  1XHZ A;  2Q67 A;  1YF2 A;  2KG7 B;  1MA1 A;  3E22 A;  4DYL A;  1F4M A;  2FTK A;  1X4T A;  3K5L A;  1KQS U;  5IE9 A;  3FX7 A;  3P3N A;  2OIE A;  3A0H Z;  3DXR B;  3ETQ A;  1OZ0 A;  4PV1 B;  3ZMV A;  5LMN B;  4DR3 B;  3ZHQ A;  2WLH A;  2AHY A;  2P5O A;  3QVN A;  4X20 A;  4I7Z B;  1OCC C;  3OR7 C;  2AHZ A;  4XDK A;  4JI3 O;  2JJ2 G;  2PTM A;  1JQ0 A;  5IYZ A;  5JJN B;  1HNW B;  4MTO A;  4XDJ A;  4X62 B;  4TV8 B;  4UCS A;  2QWP B;  1HWY A;  1K5S A;  5LL6 Y;  2LGW A;  5LA6 A;  4U7O A;  3MAQ A;  1DTO A;  1Y76 A;  1TGO A;  2CTW A;  3IC9 A;  3ZRS A;  1QLN A;  4DV1 B;  3BHP A;  1NKD A;  2EIK C;  4NTW A;  2W0F C;  2JDI G;  2CTP A;  3K3W A;  3VQY A;  3AK2 A;  5J2T A;  1XI1 A;  1N8R W;  1XMQ B;  3LNM B;  5JCO A;  4I9Q A;  2XOK G;  3MHS C;  4LBE C;  4PDL A;  1K97 A;  1NVP B;  1PPJ H;  3ZHV A;  2WSS G;  1S0V A;  2WPD G;  4PA6 A;  1IDS A;  1HP8 A;  2Y0P A;  3SJC C;  1AI5 A;  1TUE B;  1R3L C;  2EIN B;  4O2B B;  2X0L A;  3UKM A;  4P9O A;  3K04 A;  4X64 B;  4UFZ A;  2WLI B;  3JAK B;  2EUL A;  3CRR A;  3A0R A;  1H2N A;  3TGU H;  3HR0 A;  5CA1 B;  3RFR A;  4JI7 B;  5LYJ A;  2OCC C;  4DRX A;  4B08 A;  3K58 A;  1F23 A;  1V55 B;  2UUB O;  2YIA A;  4RUF A;  2BCC H;  1J5E B;  1M57 B;  2D2C B;  2Q5Z A;  2LGQ A;  2Z3Y A;  1UFI A;  1WPX A;  1XNQ O;  5JQG A;  4DK1 A;  4LFA O;  4JAA A;  4HYO A;  4NXN O;  3G67 A;  4CBC A;  4JI1 O;  4PI0 A;  1S5J A;  4I4T A;  2IH1 C;  3JCZ A;  2B9Z A;  4LCU C;  3LUT B;  3JAL B;  1ZL8 B;  4JTA B;  3ZRW A;  2ZDI A;  5BR8 O;  2WLM A;  3AG1 C;  4B3M B;  5HFM A;  3CCS V;  1KB9 F;  3RYF B;  4RUE A;  1ZSP A;  4LP8 A;  2PYL A;  4G27 B;  4JPR A;  3JAW A;  3CRM A;  1VQL V;  2PI4 A;  3D3Q A;  3H01 A;  4I50 A;  3K0D A;  2JEU A;  1WPB A;  3D36 C;  1AJQ A;  3OR6 C;  2Y48 A;  4KXR A;  3X2Q C;  4KP4 A;  3K03 A;  4BIU A;  5CA0 B;  1WB7 A;  3G71 V;  3DC5 A;  3OMA B;  3W7X A;  5LXT B;  4DUY O;  1S5H C;  4UB8 Z;  1BL8 A;  4NTX A;  1D2D A;  2V1D A;  3QO8 A;  1HNX O;  3ETG A;  3CRQ A;  3CCU V;  1TA8 A;  1LUW A;  2YUA A;  1H38 A;  1FD9 A;  2YIB A;  1S72 V;  2E5L O;  5LGT A;  5TIS Z;  1NTM H;  3CJH A;  2LJ2 A;  2Q8V A;  5LP6 A;  5GTI Z;  2W0X A;  1FFX B;  2IU3 A;  2QM7 A;  2W6J G;  3JD4 A;  5H6R A;  3EHB B;  1ZAU A;  1Y6X A;  4CS2 A;  1VF6 C;  4GCZ A;  3K59 A;  4I0X B;  4HAM A;  1DLB A;  4RQF A;  3SGI A;  1Q90 D;  3HKE A;  2BTQ B;  4DR4 O;  4JI6 B;  5B5E Z;  1M1K W;  2F66 C;  3T1H B;  3DSQ A;  4WFE A;  1YSC A;  2N74 A;  5B1A B;  1R3J C;  5J9P C;  3J81 N;  4X65 B;  3HKB A;  4K35 A;  4LR3 A;  2OTL V;  4KHP O;  2JVD A;  2XAQ A;  1G8M A;  3U0Z A;  4DR7 B;  3I55 V;  1XDC A;  3CE2 A;  4LFC O;  5EBW C;  2Q4P A;  3JSL A;  4FIP C;  3BEH A;  1FJG O;  3QNE A;  3ICX A;  4IGG A;  3TK1 A;  4HNA A;  5IJ0 A;  3AG2 B;  5BMV B;  1PNM A;  3JSN A;  2GSM B;  1HNZ B;  4O4H A;  2L35 A;  4LF9 O;  3MD0 A;  4CH4 A;  5GON B;  1AB3 A;  2Q69 A;  5JVD B;  1M57 C;  1DGS A;  5LOV B;  2B1I A;  1KC8 W;  2NLJ C;  1K73 W;  2ODM A;  2LW1 A;  1VF5 B;  2X6C A;  4GT1 A;  4X1K B;  3RVY A;  2EIJ C;  1N33 O;  4DV2 B;  2LFS A;  4D7S A;  3E22 B;  3OW2 U;  2ARH A;  2ITC C;  3GVM A;  2XUM A;  2R70 A;  3GWK C;  3JAR A;  2H94 A;  4L8J A;  4LF8 B;  3FB5 C;  4DV0 O;  4R7C A;  1XQ8 A;  1BZK A;  2X7R B;  1R3I C;  3BAB A;  1NT2 B;  4QGP A;  2FKX A;  5A2Q N;  3OAA G;  5IYZ B;  3RYH A;  1VQK V;  2UU9 O;  3VBB A;  1COW G;  2OYQ A;  2A7W A;  4Q20 A;  1Y66 A;  4PEL A;  1L0L H;  3Q4H B;  2XTA A;  4PJ0 Z;  4JYB A;  4KFM A;  4QE9 A;  4I55 B;  4J42 A;  4X62 O;  1MZF A;  1SA0 A;  3SJB C;  4ASU G;  2HG5 C;  4DV6 B;  1PL0 A;  4K0K O;  5KA6 A;  1K7D A;  1FKA O;  1JPX A;  3RYC B;  1YDX A;  1N34 B;  1VMG A;  1QR8 A;  4DV7 B;  3AG7 A;  4DV1 O;  4B3R B;  5IWA B;  4LF6 B;  1PD3 A;  4K3A A;  4GYC B;  1QQC A;  2DYR C;  4GX5 A;  3ZMU A;  3HKD A;  4JV5 B;  1M56 B;  1PNK A;  2NR5 A;  1RPR A;  3K08 A;  4FZ0 A;  3LDE A;  4FFK A;  3RN4 A;  4DR5 O;  1NR1 A;  3L71 H;  1S77 D;  4BAY A;  3CCR V;  1OCZ B;  1GK9 A;  4P30 A;  2FB5 A;  1R73 A;  2VWJ A;  5BZB A;  2EIL B;  2M6Y A;  2GDS A;  4PDR A;  5LYJ B;  1WP8 A;  1SQP H;  4DRX B;  5KMG A;  3JAS A;  4B3S B;  2YXH A;  4IT5 A;  3N2K A;  3TXQ A;  4X64 O;  4DV4 B;  1VQP V;  1UJW B;  3AG4 B;  5KLV H;  3H1H H;  4X66 O;  3SR2 C;  1WJZ A;  3OMN B;  1BSM A;  3K57 A;  4JI7 O;  1HW7 A;  1K4D C;  4UB6 Z;  1BT8 A;  1GRJ A;  2QM8 A;  2WA4 A;  4YHH O;  1KMI Z;  1NBM G;  2OTJ V;  3E89 A;  4UCR A;  3JD0 A;  3H1L H;  5EK0 A;  4I4T B;  4BIO A;  1ZUQ A;  5C8Y A;  1AR5 A;  3FB6 C;  5H9C A;  1AR4 A;  3AG3 B;  3OTO O;  4YJ3 B;  5KAF Z;  2KKW A;  4NVP A;  2ITD C;  4F4L A;  3ZHU A;  4LWS A;  2CH7 B;  2OWO A;  4FZ1 A;  4LNU B;  4H37 A;  1P4R A;  1PV0 A;  2EIM C;  3SYO A;  3CCQ V;  1PM9 A;  2VQE O;  3SPJ A;  2ZM6 B;  1MG1 A;  3AG2 C;  3T4Z A;  1ORQ C;  2VQF O;  4GX1 A;  1VAR A;  4LC1 A;  4FLY A;  4BW5 A;  4I50 B;  4B3M O;  2KSD A;  5ITZ B;  2XAJ A;  2PUS A;  3A0B Z;  1IVS A;  1NH2 B;  2PYJ A;  2UUC O;  3DTU B;  3OEH G;  4RQE A;  1S5L Z;  4B3T B;  5EZY A;  1NVP D;  1OCO B;  4DUZ O;  3JYC A;  4X88 A;  3UCS C;  2HLD G;  1K8A W;  4FLU A;  1N0N A;  1XNR B;  4UV8 A;  1I0H A;  1S3J A;  1FYJ A;  2Q68 A;  2UXN A;  3L75 H;  1BS3 A;  2YI8 A;  1F7Y A;  3ML0 A;  5AG2 A;  1ARO P;  2ZE8 A;  3ZHT A;  3CJH B;  2HEP A;  2DWD C;  4O2A B;  3FD9 A;  1PL4 A;  2YDE A;  4FLX A;  4W4L A;  4YY3 B;  1P7G A;  4LF7 B;  4J80 A;  4UVB A;  1QCE A;  1TUB A;  5B3S B;  2JGD A;  4JI8 B;  1SKV A;  1CP9 A;  4JYA B;  1AJP A;  2BE3 A;  2E75 B;  1JX9 A;  4DO2 A;  1JFF A;  2HP8 A;  3HKE B;  4XDL A;  5B1B C;  1FS0 G;  3E35 A;  3CD6 V;  1SRY A;  4FLT A;  1N36 B;  1MAB G;  2WLL A;  3SYC A;  1M5I A;  3E86 A;  2F23 A;  4MSW C;  2P6J A;  3APO A;  3HKB B;  2BOB C;  2AW9 A;  2VRZ A;  4TWK A;  2EJR A;  3T1H O;  2LQT A;  4JZG A;  4ZI7 A;  1SET A;  5FNV A;  4DR2 B;  2HFE C;  3KCY A;  3HKC A;  3A8T A;  1KBH A;  1G4Y B;  1GM8 A;  4X1I A;  1Y67 A;  2IW5 A;  4QNH B;  2EIL C;  4DR7 O;  2ZE5 A;  4HNA B;  5IJ0 B;  4UCU A;  4IIJ B;  4J41 A;  1KEC A;  1MOF A;  3WG7 C;  4AQY B;  2BSK A;  1N4C A;  4O4H B;  4CC5 A;  1GM7 A;  1B6Q A;  4UCV A;  3L70 H;  3AG4 C;  5KUM A;  1QLE C;  2EZO A;  2V7Q G;  2JJ1 G;  5CB4 A;  1CPY A;  4DV3 B;  1SC5 B;  1HNZ O;  1R1B A;  4EFE A;  2P67 A;  3IJ4 A;  5D5P A;  4U3J A;  1G1X B;  3K5O A;  4GX2 A;  5A9G A;  5CBH A;  2ZNJ A;  2FML A;  5EIB D;  4OX9 B;  1QHT A;  1N32 O;  1Q6H A;  1P84 F;  1PP9 H;  2UXC B;  1O9H A;  3LSQ A;  2YXY A;  2UUA B;  3JAT B;  2BTO A;  3VQX A;  2YXL A;  3H1J H;  1AIL A;  2ZDI C;  1XBL A;  2RNB A;  1WA8 A;  2YI9 A;  3W7U A;  3H9V A;  2GHY A;  2D3O W;  3SYA A;  1JOY A;  4AIL C;  1LNQ A;  4O4J A;  4JI2 O;  3RYH B;  3WU2 Z;  4PD4 F;  1IBK B;  1TVK B;  2O57 A;  4BWA A;  3S3W A;  4TSF G;  5FPR A;  2R72 A;  4ZHQ A;  2CE4 A;  5IYD O;  4A5U B;  2IU0 A;  2HVJ C;  5GW7 A;  5B1O A;  4LF4 B;  1BGY H;  1YTF B;  1EZJ A;  1SA0 B;  2ZXW B;  3JCU Z;  5IDJ A;  4DK0 A;  1OJH A;  1W59 A;  4FM1 A;  1XL6 A;  1NTK H;  1N0J A;  4MS2 A;  3AK3 A;  3STZ C;  3W7S A;  1AI4 A;  4PA9 A;  2K1E A;  4J9Z B;  4FM2 A;  3HKD B;  1N34 O;  3P30 A;  4MVQ A;  4X89 A;  3KCX A;  2EZP A;  5LGU A;  2JIZ G;  5IWA O;  2F4V O;  1KYO F;  4GZR B;  1FXK B;  1EZV H;  1GN4 A;  1R3K C;  4WFH A;  2QKS A;  2OCH A;  2HHH B;  4K8X A;  2QKA A;  1FXV A;  1M9N A;  1ZX3 A;  1Q7Y W;  1Y74 A;  1K33 A;  2UXB O;  1Z5V A;  4IL6 Z;  3N2G A;  4N21 A;  1SQB H;  1WLE A;  1I08 A;  5B3S C;  4D6T H;  3H1K H;  1VP7 A;  4JI5 B;  4B3S O;  1M90 W;  2Q0A A;  2YEV B;  1IBL B;  1F4N A;  3WB1 A;  3T1Y B;  2VWK A;  2IH3 C;  3OM3 B;  2DMX A;  2QDO A;  3GWO A;  1XMO O;  4MTF A;  1FXH A;  5C8Y B;  1AJN A;  3UM7 A;  3CSX A;  5KX5 B;  1K4C C;  4JAV A;  4JI4 B;  3W7T A;  1MMM A;  2UXD B;  1KD1 W;  4F6R A;  3AEI A;  2A9H A;  4ZOL A;  1US6 A;  2UXX A;  5E79 Z;  1GH6 A;  3B2E E;  2P22 C;  4GKJ O;  2PGG A;  1I5Y A;  2IJK A;  2A79 B;  1H8H G;  2Q9L A;  4JI0 O;  3BFR A;  1W2B U;  1I94 O;  4TQF A;  3KZI Z;  4TV9 A;  4WFF A;  4CS3 A;  3D36 A;  1QBZ A;  5KHG A;  5L3E A;  2Q73 A;  1Q5O A;  2ZNI A;  1R6T A;  1R6N A;  4X9Q A;  2DQ3 A;  3WB0 A;  3ZJZ A;  2ILM A;  3ASO B;  1HR0 B;  5EZY B;  4K8Z A;  5EC1 C;  5EYP B;  2XND G;  2EIN C;  4FJC C;  1AR1 B;  3R66 A;  3ABM B;  3A2F A;  3P3P A;  3CXH F;  4ZIB A;  1K9M W;  1DF4 A;  4JI3 B;  2RCV A;  4B3T O;  1VEW A;  3DXR A;  3ETD A;  1QU7 A;  1QNM A;  3N27 A;  5JH7 B;  5K1P A;  4PI2 A;  4J9Y B;  4NR1 A;  1SER A;  3VQV A;  1GAX A;  3STL C;  1GN3 A;  1XNR O;  1YJ9 V;  2F95 B;  1V55 C;  3OFN G;  4GLX A;  4E2L A;  2G38 A;  1SQF A;  2WA3 A;  4MVS A;  3TJT A;  1VF6 A;  3ZMT A; 
#chains in the Genus database with same CATH homology
 3E89 A;  3JD0 A;  1OZ0 A;  1Q82 W;  4UXN A;  5EK0 A;  4FK5 C;  4G28 B;  1K3E A;  1OCR B;  3ZMV A;  2IJJ A;  4MT8 A;  2WLH A;  2AHY A;  2IJI A;  1JVM A;  1MSW D;  2R9R B;  4JYC A;  3FB6 C;  1OCC C;  3OR7 C;  2AHZ A;  1GMG A;  4XDK A;  5H9C A;  2JJ2 G;  2LFR A;  3AG3 B;  3F7V C;  1V54 B;  3CMA V;  4QJF B;  2HJF C;  1JQ0 A;  2ITD C;  3LDC A;  4F4L A;  4BIZ A;  5L3B A;  3RVZ A;  3CC2 V;  4MTO A;  4XDJ A;  1RM1 B;  1S76 D;  3CC7 V;  1BHA A;  2QA4 V;  1HWY A;  1K5S A;  3CC4 V;  2NNU A;  1P4R A;  4H37 A;  2EIM C;  4U7O A;  5E1A C;  3SYO A;  1DTO A;  2WLL B;  5IY5 B;  3CCQ V;  1BMF G;  2F43 G;  5EBM C;  3ZRS A;  3SPJ A;  1QLN A;  4MW3 A;  5CBG A;  2LP7 A;  2WAM A;  1MG1 A;  1NKD A;  2EIK C;  3TCU A;  2W0F C;  2JDI G;  1L1F A;  1P7B A;  3AG2 C;  3K3W A;  3T4Z A;  1ORQ C;  1E79 G;  1N8R W;  3ZIA G;  4GX1 A;  3LNM B;  1VQ6 V;  4LC1 A;  4BW5 A;  2XOK G;  3BY6 A;  3OMI B;  3MHS C;  3OEE G;  2A0L A;  4LBE C;  4PDL A;  1FXK C;  1K97 A;  3T2M A;  1NVP B;  3LDD A;  2DYR B;  2XAJ A;  2ZQM A;  3E8H A;  2HVK C;  2W6I G;  2WSS G;  1S0V A;  2WPD G;  1NH2 B;  4PA6 A;  1ROP A;  3LSS A;  4Z1M G;  1VQN V;  3DTU B;  3OEH G;  1AI5 A;  1TUE B;  1R3L C;  4RQE A;  2EIN B;  4JGS A;  3CCM V;  1NVP D;  1OCO B;  1YHQ V;  2X0L A;  4MVM A;  3UKM A;  4P9O A;  3K04 A;  3JYC A;  1NH2 D;  3FB7 C;  4X88 A;  4QPK A;  2HLD G;  1EBO A;  4PA7 A;  1K8A W;  4MVR A;  1JCH A;  2WLI B;  3E2E A;  5LHH A;  2HKO A;  3A0R A;  4UV8 A;  1S3J A;  1CEZ A;  1AI6 A;  2OCC C;  4MVO A;  2Q68 A;  3ABK B;  3CPW U;  2UXN A;  1YJN V;  3EFF K;  1F23 A;  3ML0 A;  1V55 B;  4ZBM A;  3E83 A;  4RUF A;  1ARO P;  1IXM A;  1RPO A;  1VQO V;  2DWD C;  1KKD A;  1M57 B;  3ABT A;  2X6B A;  2Z3Y A;  1WPX A;  3FYI B;  2QEX V;  4HYO A;  2WLK A;  1VQ8 V;  3CCL V;  4CBC A;  1ENV A;  5HFL A;  1Y4M A;  4CZZ A;  1VQ4 V;  4X8A A;  3ZRX A;  1J95 A;  3OGC C;  1OCC B;  3CCV V;  1H8E G;  4UVB A;  2H8P C;  2IH1 C;  3JCZ A;  4HZ3 A;  1QCE A;  5B3S B;  4QPJ A;  4YXW G;  1CP9 A;  1DF5 A;  3LUT B;  4LCU C;  1QVF U;  4L87 A;  1AJP A;  1F51 A;  3VOU A;  2Y69 B;  1QVG U;  1JX9 A;  4DO2 A;  1PKX A;  2DW4 A;  4JTA B;  1YIT V;  3ZRW A;  4XDL A;  4MW8 A;  5B1B C;  2EIM B;  1FS0 G;  3E35 A;  2ZR2 A;  3CD6 V;  1SRY A;  2ZDI A;  4I9W A;  4QIW F;  1GKF A;  1KP3 A;  2WLM A;  2EIK B;  3AG1 C;  1MAB G;  2JEX A;  2ZR3 A;  2WLL A;  5CMU A;  3SYC A;  3G4S V;  5HFM A;  3E86 A;  4MSW C;  2P6J A;  3CCS V;  1NR7 A;  2BOB C;  4RUE A;  4TWK A;  2EJR A;  4LP8 A;  5B1A C;  4G27 B;  4JPR A;  3ASO C;  1GM9 A;  5DM6 V;  4UVA A;  4OXS A;  1VQL V;  1SET A;  2PI4 A;  3H01 A;  2HFE C;  1Q86 W;  2ZXW C;  3K0D A;  1THZ A;  2JEU A;  3K06 A;  2XAG A;  1G4Y B;  1GM8 A;  4P2Z A;  3ABL C;  3ZRW B;  4RO2 A;  1YIJ V;  4EKW A;  1AJQ A;  3OR6 C;  2Y48 A;  3X2Q C;  3ZMZ A;  4KP4 A;  2IW5 A;  3K03 A;  4QNH B;  2EIL C;  4BIU A;  3FKS G;  3OUF A;  4XBF A;  2XAF A;  3G71 V;  3OMA B;  1KEC A;  1MOF A;  2DYS B;  3W7X A;  1S5H C;  3JD2 A;  3WG7 C;  1BL8 A;  1GO3 F;  1GM7 A;  3SYQ A;  1B6Q A;  5KUM A;  3AG4 C;  3CCJ V;  1QLE C;  2V1D A;  2XAS A;  3ASN C;  1W0J G;  2EZO A;  1KP2 A;  3QO8 A;  2V7Q G;  5LHG A;  2OCC B;  2JJ1 G;  2WLI A;  3ETG A;  2IJH A;  3CCU V;  1CPY A;  1QR9 A;  3SPH A;  2P67 A;  1H38 A;  2PI5 A;  3T4D A;  4GX2 A;  5CBH A;  5FL7 G;  2P90 A;  2MK3 A;  1S72 V;  5LGT A;  3JD1 A;  1OCR C;  1VQ9 V;  3R65 A;  2ZD9 A;  2IU3 A;  2QM7 A;  3LSQ A;  1V54 C;  3F7Y C;  2WWW A;  2W6J G;  3SJQ C;  4MVZ A;  3JD4 A;  5H6R A;  3EHB B;  5CA3 A;  2BOC C;  2M7W A;  4H33 A;  5EBL C;  1PNL A;  4GCZ A;  4JAS A;  2ZDI C;  3B77 A;  2B5U A;  5H6Q A;  5IY5 C;  1EFR G;  4HAM A;  3K0G A;  3F5W C;  3ZRV A;  1DLB A;  3W7U A;  4RQF A;  4JAU A;  5IYC O;  2WLN A;  5B1B B;  1OHH G;  2GHY A;  3SYA A;  2D3O W;  1JOY A;  1LNQ A;  4PDV A;  1AI7 A;  1M1K W;  1W0K G;  3W7W A;  3AG1 B;  4TSF G;  1SZT A;  4WFE A;  1BHB A;  1YSC A;  5IYD O;  1YI2 V;  2IU0 A;  2HVJ C;  5B1A B;  5GW7 A;  5B1O A;  1R3J C;  5J9P C;  4KUM A;  5KA5 A;  1YTF B;  1ZWI C;  2OTL V;  1EZJ A;  4FMT A;  2XAQ A;  3SPC A;  4WFB V;  3B8N A;  3I56 V;  2JK5 C;  2ZXW B;  1G8M A;  1FXK A;  2OT5 A;  5IDJ A;  3IC7 A;  3I55 V;  5L3C A;  2ATK C;  5L3D A;  3X2Q B;  3PJS K;  4PDM A;  1XL6 A;  5CN0 A;  4WFA V;  5EBW C;  4R8C A;  4JTD B;  4MS2 A;  3E8G A;  1YTF D;  4FIP C;  3STZ C;  5LGN A;  4WCE V;  3W7S A;  3BEH A;  1AI4 A;  4PA9 A;  3QNE A;  3WG7 B;  2K1E A;  4J9Z B;  3TK1 A;  2C2A A;  3AG2 B;  3P30 A;  2DQ0 A;  4MVQ A;  4U7N A;  3ABU A;  3WFV A;  4X89 A;  2P7T C;  2XAH A;  3ABK C;  2EZP A;  1PNM A;  5LGU A;  1QLE B;  2GSM B;  2JIZ G;  3K9A A;  3SPG A;  2X6A A;  1M56 C;  3MD0 A;  4MVU A;  1FXK B;  3RBZ A;  3NXS A;  1R3K C;  4WFH A;  5L3F A;  2DWE C;  2Q69 A;  5LBQ A;  2QKS A;  1M57 C;  2YEV A;  4WF9 V;  2B1I A;  1KC8 W;  2NLJ C;  1K73 W;  1OCZ C;  3ABM C;  1FXV A;  1M9N A;  1Q7Y W;  2X6C A;  4GT1 A;  3RVY A;  1K33 A;  2EIJ C;  3ZN1 A;  3TET A;  2LFS A;  2B1G A;  2Z5U A;  4N21 A;  2WLJ A;  3HB3 B;  3OW2 U;  3GB7 C;  5LHI A;  1E1R G;  1WLE A;  5B3S C;  4UV9 A;  2ITC C;  2HR3 A;  3OE7 G;  2Y69 C;  4TT3 G;  4WFG A;  1M90 W;  2YEV B;  1VQM V;  3IGA C;  3ZMS A;  2H94 A;  1YJW V;  1H2G A;  1F4N A;  3CYO A;  4GX0 A;  5B1N A;  3FB5 C;  2IH3 C;  3OM3 B;  4ZKI A;  3QO5 A;  3GWO A;  5L3G A;  4MTF A;  2Q6A A;  1FXH A;  3KG2 A;  1AJN A;  3T1C A;  2EBO A;  3UM7 A;  1K5Q A;  1K4C C;  4R7C A;  4JAV A;  2X7R B;  1R3I C;  3M99 B;  3W7T A;  1FFT B;  5DN6 G;  1KD1 W;  3DGE A;  3AEI A;  2A9H A;  3OAA G;  4UVC A;  2UXX A;  4JF3 A;  1GTO A;  3AG3 C;  1VQK V;  3VBB A;  1COW G;  3G6E V;  3FB8 C;  4Q20 A;  1Y66 A;  1K34 A;  4PEL A;  3ZN0 A;  5C93 A;  4UUJ C;  1RM1 C;  1I5Y A;  4JYB A;  4KFM A;  3RW0 A;  4QE9 A;  4QE7 A;  2IJK A;  3K79 A;  1SES A;  1Q81 W;  2A79 B;  1VQ5 V;  1H8H G;  5KUK A;  4ASU G;  2HG5 C;  1W2B U;  3CME V;  3ZCC A;  4WFF A;  1XL4 A;  1PL0 A;  2CK3 G;  5CBF A;  2DYS C;  2QTO A;  1QBZ A;  3D36 A;  1K7D A;  3OUS A;  1JPX A;  5KA6 A;  5L3E A;  2YSU B;  5IYB O;  1QR8 A;  4R50 A;  1I5X A;  3B8M A;  3CCE V;  1PD3 A;  3D3I A;  1JJ2 U;  1NJI W;  3IFX A;  1R6N A;  3CP1 A;  2DYR C;  2DQ3 A;  4GX5 A;  3ZJZ A;  3ZMU A;  3ASO B;  1M56 B;  4JTC B;  1PNK A;  1RPR A;  3K08 A;  4PA3 A;  3HPL C;  2KB1 A;  3LDE A;  5EC1 C;  2XND G;  1NR1 A;  5EC2 C;  3QO7 A;  3JD3 A;  4MTX A;  3E8B A;  1S77 D;  2EIN C;  3ABL B;  4FJC C;  4BAY A;  1AR1 B;  3CCR V;  3SYP A;  1OCZ B;  1OCO C;  1GK9 A;  3ABM B;  1E1Q G;  4P30 A;  2R9I A;  1K9M W;  1R73 A;  3FYE B;  1DF4 A;  2EIJ B;  2EIL B;  5BZB A;  1K92 A;  4FPP A;  4R6Z A;  4I5S A;  2QE7 G;  3ETD A;  3SPI A;  4PDR A;  3ETE A;  4J9Y B;  1NQT A;  1SER A;  1VQ7 V;  2Q67 A;  4RAI A;  1R6K A;  1VQP V;  3CXC U;  1UJW B;  4PA4 A;  3STL C;  3AG4 B;  4MTG A;  3OMN B;  3ASN B;  1F4M A;  3E8F A;  3P32 A;  1YJ9 V;  3OFN G;  1V55 C;  4P9P A;  4E2L A;  1K4D C;  2FTK A;  4G2K A;  3MHH C;  2QM8 A;  1KQS U;  4N23 A;  4MVS A;  4DXW A;  1NBM G;  3ZMT A;  2OTJ V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...