4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
b'EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
3B77A 2M7WA 3B8MA 3CYOA 4N21A 5KA5A 1I5YA 5CN0A 5HFLA 3K9AA 1K34A 1JQ0A 1QR8A 1K33A 2EBOA 3H01A 3GWOA 1ENVA 2MK3A 1EBOA 3MHSC 4FIPC 4JF3A 1DF4A 1I5XA 1QCEA 2EZOA 2LP7A 3B8NA 4FJCC 5KA6A 5HFMA 1F23A 4FK5C 5H9CA 1DF5A 2X7RB 4JPRA 1DLBA 3MHHC 4G2KA 1Y4MA 1SZTA 3P30A 1MG1A 4E2LA 1JPXA 1Y66A 3M99B 1QBZA 4JGSA 2EZPA 2OT5A 3WFVA 3CP1A 4N23A 1MOFA 2P6JA 5CMUA 1QR9A
chains in the Genus database with same CATH superfamily
2CTPA 1M5IA 4B3SB 3H1IH 1AI4A 1SKVA 4OGQB 1IZ3A 4OX9B 2OIGA 1JCHA 5L3CA 1JJ2U 3ZN0A 3OMAB 3AK3A 2CK3G 2ITDC 4DR3O 1OV9A 4NYKA 1GH6A 3CRQA 3AG2B 2EZPA 1AJQA 1PM9A 4PDMA 4AQYO 2G38A 4JI2O 2X0LA 1SQPH 3D3QA 1DF4A 3SYCA 4JAUA 3K04A 3JAWB 4FK5C 5H9CA 3U0ZA 4JI4O 1M57C 3W7UA 3JYCA 4P30A 4BIZA 2ZCEA 4EFBA 3CCUV 4EFEA 3CYOA 1US6A 4CH3A 2JGDB 2WLKA 4DR5O 3IC9A 1V9PA 1ZSPA 4LH7A 3ZS8C 1ZL8B 2LW7A 4I55A 4L87A 1EN5A 3OEHG 3FB6C 4MVSA 3B40A 1Q81W 3ABLB 1VF6A 3B8MA 3T1YB 4JYAO 1BL8A 1AI7A 2E74B 2CUGA 5GONA 2CTRA 5J2UB 3UT5B 5LGNA 1KKDA 2YEVB 3FB5C 4JV5B 2HP8A 5LA6B 2Z3YA 1MG1A 3FB7C 1JPXA 1HNWB 1QVFU 2XHBA 3ZCCA 4DRXA 4I5SA 1OCOB 3K03A 5AG2A 5LMNO 3GB7C 4UCOA 3W7WA 1XMOB 3CE2A 4B3TO 4DUZO 5KX5B 4D7SA 1SA0B 4DR4B 2DN9A 4DR1B 5C8YA 3RYCA 1SQQH 2Y4UA 2LFRA 2IU0A 3MD0A 4H44B 5KHIA 3OD4A 1NH2B 3E35A 1HNXO 2QDOA 1RSOA 3T1HB 5FPRA 4DR7O 5CA0A 4JZGA 2O57A 1PD3A 4JPRA 2EILC 2PF4E 3BPZA 1IBLO 2WWWA 3QG5A 1H38A 3CS5A 3JATA 1JQ0A 1QR8A 2FL4A 3QVNA 4UCRA 1L0LH 2RMKB 3M7MX 2QM7A 5IYZB 1RP3B 2F23A 4PA7A 3QO8A 1CP9A 3HKBA 5LHHA 4B3RB 3RW0A 2R70A 4JGSA 4LFBO 1NVPD 1AR4A 4DXWA 2AZ0A 1SERA 1S5JA 4O4LB 1PPJH 1HNZO 1ZUQA 4DV1B 1I08A 5DN6G 1G8MA 2VQFO 1IVSA 4D7TA 3G80A 1PNKA 2A9HA 3H1LH 2CE4A 5ITZA 4MT8A 3HKEA 4N23A 4Z1VA 4ZHQB 4X62O 3APQA 1JOYA 5LHIA 2WA3A 3SJAC 1AI5A 1H2MA 1KYOF 2ILMA 4YJ2A 3CRMA 5FL7G 4DO2A 1TUEB 2LO1A 3R65A 3CCJV 4P9PA 4ASUG 3JSNA 1FJGO 5EZYB 3K58A 1FYJA 1Q90D 5CA1A 2CH7B 1F4NA 4IYIA 1N34O 1NTKH 4JTDB 3SYQA 1W2BU 3X2QC 1EM1A 4LH6A 1RM1B 3E22A 4J7JA 1FXHA 4LFAO 4WBNA 4K3AA 3DXRA 4J7ZA 2OCCB 1JA8A 5LGTA 1PKXA 1N0NA 4GX5A 1AP5A 3RYCB 1YDXA 3D36A 3ML0A 3K57A 3ICXA 4PDVA 2QKAA 3WB2A 2HEPA 4CS4A 5LYJB 5B1AC 2YICA 5J9PC 4FFBB 1Y76A 4ZI7A 1MMMA 2R72A 4G27B 3K5MA 1GAXA 5K1PA 4YHHO 1NR7A 3KCYA 3TK1A 2Z0AA 3ASNB 1E1QG 2EJ7A 4DR6B 5IJ9B 1Q6HA 2PTMA 4NB5A 1B6QA 3L73H 1XMQO 4PDRA 1WPBA 1SETA 2ZR2A 1VQPV 1N32B 3AK1A 1S76D 2IU3A 1Z5WA 1F23A 3N2GA 2QWRB 4LF6O 1M56B 4B3MB 2V4DA 1XNRB 1YJ9V 5DEDA 3HKBB 1FXKC 2N74A 5JJEB 4O4HA 1JR9A 4X8AA 1Q5OA 1IXMA 4OXSA 1XUQA 1IBMO 3OUFA 5TISZ 4QPKA 4DR2B 4DR3B 2LJ2A 3ZIAG 3IJ4A 2EIMC 4KUMA 1ZLZA 2QSAA 1Y74A 4K8XA 1FS0G 2BTQA 1OHHG 4JI4B 4I9QA 5LP6A 2K1EA 3C90A 2Q7GA 4TUYB 1TUBA 4NTWA 4X89A 4GCZA 2KQXA 2XAQA 3RYFA 5FNVA 4DR5B 4IIJB 2ADQB 2Y69C 3F5WC 2Q7HA 2YSUB 4XDKA 3K3WA 3B8NA 1A32A 1QVGU 3OMIB 4I0XB 2AGAA 5EYPA 2WLHA 3DXRB 1XEQA 1QLNA 2YI8A 3CWBH 3B2EE 3ZN1A 4U3JA 1M4UA 4JYAB 2ZIMA 4MVOA 2HHHO 1EN4A 1VF6C 1XDCA 3JD0A 2WPDG 3SPHA 5B3SC 2UUAO 1FXVA 4W4LA 2QKCA 1I7FA 1AVMA 4CS2A 4UV9A 4UB8Z 3J80N 4ZI7B 1WA8A 1M9NA 2JRIA 3DC5A 3UM7A 2B5UA 1JFFB 4J9YB 2P4VA 4FJCC 5LMNB 3KCXA 1ZWIC 4B3TB 5A2QN 1MNGA 3HKDB 4JI5B 3IFXA 3F7YC 1R3JC 4CH6A 5CBGA 4Q20A 4I7ZB 3KG2A 4GYCB 3RYIB 5CB4B 4ZOLB 5LL6Y 4E2LA 4QIWF 4J10A 1HR0O 4MSWC 4PDLA 4R50A 1QR9A 1B04A 3W7TA 1HNXB 3CSXA 5D5PA 2AHZA 2XNDG 3I5DA 4JF3A 3VOUA 3LUTB 2EJRA 1OCCC 1XL4A 3JARB 4X1KB 3M8AA 3SYOA 3VQWA 1IBLB 1PV0A 3BVOA 2M6YA 1OCRC 3S3XA 4X64O 1XQ8A 2JGDA 3JCUZ 3CPWU 1XI1A 1XREA 3AG1C 3K08A 2Q67A 4NXMO 1Y74B 1ZL8A 1H2SB 2AW9A 5LMUO 2X7RB 1NH2D 3E8FA 1QQCA 2Z5UA 3G6BA 4LFBB 5LP6B 3EXAA 4CC6A 5K1XA 1I94O 3AG3B 4O4IB 3OTFA 5J2UA 3UT5A 2YEVA 2VQFB 4TT3G 3ZX6A 1YJWV 2JS5A 1TVKB 5EBLC 5KAIZ 4WFGA 5IJ0A 4X62B 2Y48A 4I4TB 2XOKG 5JH7A 1OCZC 4FM2A 4CS3A 2QJ1A 1JJOA 1U96A 1FJGB 2PGGA 4O4JB 5E1AC 2UUCO 2ZKOA 4WFAV 3E89A 1SZTA 3SYPA 2EINC 1YI2V 4F4LA 4YY3O 1N34B 1NTZH 2QTOA 3ASOC 2NN4A 3SJCC 2JS3A 3K9SA 3SPCA 1DK1A 4JI3O 2XAJA 4UXNA 1KC8W 4LFAB 2Q0OC 3T2MA 5JJNB 3LDCA 2PUSA 5BXZA 1EZJA 4YIPA 1SF9A 2HJDA 1ZX3A 2P5OA 2P90A 3CCSV 5LBQA 5KUKA 2A7WA 1H2GA 1WJZA 3D36C 3ABMC 5FPOA 2IJHA 1B06A 5IYZA 2BCCH 4BR6A 3RT3C 1XBLA 1KBHA 4H37A 4CH5A 4MVUA 1IX9A 4YHHB 2IM9A 5IYBO 4XDLA 2IW5A 1K5QA 1AJPA 3WG7C 3P30A 3M99B 5J2TB 3STLC 3ZBHA 1Q3EA 4CBCA 1XOUA 4O4LA 1XMQB 5BMVA 1I5YA 1LR1A 1FFTB 2Q73A 2B1GA 1M90W 2ZXWC 2RNBA 2ZM6O 1J5EO 2E3CA 3TJTA 1OJHA 1L1FA 4LF6B 1GN4A 3F7VC 1Y4MA 2Q5ZA 5B1NA 4ZHQA 3TETA 2K9PA 1UJWB 1LNQA 5LOVB 4ZKIA 3JAKB 4JASA 4KHPO 1P7BA 4PD4F 1LUVA 1NTMH 2ZDIA 5EZYA 2ATKC 1IBMB 2DYRC 2BE3A 2UXXA 2CH7A 4GKKO 3OEEG 4WCEV 2EIKC 4MW8A 1LUWA 3CD6V 3WB0A 1XNQO 1KD1W 2P6JA 1XILA 1SS3A 4K0KO 5IJ0B 2X6BA 4QE9A 1N33O 4DV0B 1IBKB 5JH7B 2GTSA 2LP7A 3OTOB 3ETQA 4JI6B 1VQ9V 1GM7A 5E79Z 5BZBA 2F1MA 3FYIB 4RUFA 5IWAO 1K5SA 5LYJA 3CCLV 3J81N 3B4SA 4FFBA 1FFXB 1O9GA 4WFHA 4QGPA 3G67A 2DOSA 3P3PA 4DUYO 4MVMA 4J9ZB 1NU1H 1YJNV 2B1IA 1AR1B 4NXNO 2YS8A 4PA9A 5IJ9A 1MZEA 4MTXA 5L3GA 2QWNB 3E2EA 1THZA 4PJ0Z 1ROPA 3TXSA 2WLNA 2HHHB 5HFLA 2UUAB 2ZE7A 4BW9A 3K5OA 2BTOA 3PJSK 5LXTB 3MHHC 3G71V 2VS0A 1NS1A 1F4MA 3QO5A 3A0HZ 4LWSA 4LBEC 2F66C 1HWYA 3VQYA 3HR0A 1K4CC 4TV8B 2AHYA 3ETDA 2UU9O 5BMVB 5EIBD 2NLJC 4X9QA 2CGNA 3JD3A 4PI2A 4UCSA 2DQ0A 3VQVA 3CMAV 3ZHSA 3P3NA 3OW2U 1HR0B 3AG2C 2KKWA 1BZKA 4WFBV 4QPJA 1N8RW 1Y6XA 2X6AA 2YIAA 1VF5B 4Z2WA 1I5XA 2EZOA 2YC0A 1TA8A 5B1OA 4GX0A 5JWPA 1PL0A 4J80A 4D6TH 1QLEB 4TUYA 3RBZA 1KMIZ 3BHPA 4HNAB 4RQFA 4PHZA 4O2BB 1VQ6V 1K9MW 3OFNG 3GWKC 4IIJA 3IAYA 1R1BA 3HKCB 4BIUA 4GKJO 3FD9A 5BR8O 4NXMB 3QO7A 2EX3A 2QKSA 3FYEB 3SPJA 4I0XA 4H0LB 2VWJA 2RQ6A 1CEZA 1MZFA 2DE0X 2UXBB 5D5QA 1YTFD 2DMXA 1DGSA 4OPHA 2FMLA 1I94B 3ABLC 2UUBO 1BHBA 1QU7A 2A3QA 2P7TC 3SR2C 4O2AB 2P4KA 3T1CA 5EK0A 3APOA 3A0RA 5EC2C 1SC5B 2VWKA 2Y4TA 1YVWA 1KUQA 1DF5A 1R6KA 3N2KB 3SYAA 1JFFA 2ZNIA 3JALB 1P4RA 1WP7A 3RGBA 4PA6A 1WNSA 2YUAA 4DV4B 1OCOC 3HKDA 4TQDA 3QNEA 1WAZA 1L0NH 3CRCA 2YIBD 4LFCB 1K3EA 2ZE8A 3QTCA 3MDSA 4RUEA 4MW3A 4WFFA 3LDDA 4X1YB 4TSFG 3OUSA 3RYIA 5CB4A 4ZOLA 2UUCB 4UFZA 1BS3A 4X1IB 5KMGB 1IXBA 1Q6IA 3C3SA 5KAFZ 2QM4A 4YY3B 1OCRB 2HVJC 4H13B 1SQGA 1U97A 3Q4HB 2KB1A 4LNUB 3UO2A 5H6QA 2EULA 3O9OA 1O9HA 4LWSB 3G6EV 1AJNA 4LF7O 1VP7A 3JARA 4X1KA 1SESA 4JI3B 1JMKC 3D8CA 4IT5A 4HYOA 1EZVH 1M1KW 3H9VA 4DV7O 2YIDA 4DV3O 3CX5F 4TQFA 4FLVA 2VRZA 4P9OA 1IURA 2FKXA 1R6TA 1VEWA 2OTLV 2DYSC 3ZMSA 4UCTA 3T1YO 3L75H 4AQYB 2Q6AA 4ABMA 4JI2B 3QF7A 3MHSC 3PN1A 5B1BB 1BE3H 1BGYH 1D2DA 4LP8A 3O65A 1YZBA 1B3QA 5H6RA 4X88A 4O4IA 4PELA 3TXQA 2RN9A 3CC4V 2CDYA 2GSMB 4LF9O 3JD1A 1XMOO 2EIJB 2QWOB 2Q0AA 3K5LA 3BABA 3ZRWB 3DSQA 4DR4O 2QA4V 3UCSC 4IHJB 2Y0PA 2XTAA 1TVKA 2UXCO 2F4VO 3JD2A 5LGUA 2IH3C 1V55B 1E1RG 1N36O 4I4TA 5L3DA 3LSQA 2XAFA 2Y0IA 1K92A 1GN2A 4HZ3A 3CMEV 4UV8A 2WLLA 2OIEA 3U10A 3ZJZA 5KLVH 4KHPB 3NXSA 3T1HO 4MTFA 2L6LA 3K06A 4JI0O 2OYQA 4LCUC 4O4JA 1T5EA 2H94A 2ZDIC 2QM8A 3F5TA 2B9ZA 3KKYA 3E8HA 1XNQB 3FAVB 3AEIA 4GZRB 3K0DA 2ADPA 3UQ8A 2FB5A 3FX7A 4PA3A 2JDIG 3OGIB 3OR7C 4K0KB 4EB6A 2IH1C 2WLJA 4TV9A 3CCMV 4K8ZA 1YF2A 2ODMA 4PI0A 3CC2V 4DUZB 3RYHB 4JI7O 2PZSA 3JSLA 1URFA 1QCEA 4F6EA 1RM1C 2ZINA 2V7QG 3OAAG 1Y67A 1L8DA 4FLUA 2Q8VA 2OCCC 2WLIB 4J42A 1M57B 1ORQC 3K5NA 3LSUA 3BA9A 3IC7A 2CTWA 4FLYA 3E86A 5IY5C 5IWAB 3RFRA 3B09A 3RVZA 4RWUA 4ICGA 2GBOA 2ZXWB 4JYBA 3BAAA 2ETNA 2MK3A 1PP9H 5IT9N 1YTFB 1DTOA 4DR7B 1H2LA 1RPRA 4X65O 3ABKC 4CH4A 2OCHA 3BA8A 4P2ZA 3ZHTA 1HDJA 1D5NA 1NT2B 5J2TA 1WLEA 1YHQV 1AB3A 2OWOA 2BOBC 2QTSA 1VQMV 1Q7YW 2LQTA 3ASNC 2JJ1G 3LSSA 2LGWA 4I50A 5IDJA 3JD4A 2JJ2G 2LW1A 2QWQB 3LNNA 3H1HH 4MTGA 1M93A 4UCUA 1H2NA 2AXTZ 2CTQA 4UB6Z 2W0XA 1WPXA 2WLMA 2LFSA 4RO2A 5LOVA 5H2FZ 2BOCC 3JAKA 1GRJA 4NTYA 2JGUA 2Q7EA 2Q69A 1MA1A 5EBMC 4FLTA 3L9DA 2UU9B 4KP4A 4YJ3B 4JZ2A 3E8BA 2Q4PA 3CXHF 4MTOA 1HNZB 2GTAA 1IDSA 1R3IC 3AG4C 2VQEO 3CEIA 2Q9LA 2JVDA 4I9WA 4J41A 3SJBC 2YXYA 4NVPA 1FD9A 3UO3A 3P32A 1BSMA 1GN3A 3ZMUA 4CZZA 1FPOA 4F6RB 4B7KA 4LF4O 2JEUA 4DV6O 1VF7A 2A79B 2W6IG 1N4CA 2GHYA 2PI4A 1Q86W 2WLLB 4DW0A 2PYJA 4QE7A 4YIOA 3SDLA 2E5LO 2KG7B 2ZR3A 2PYLA 2EILB 1KP2A 1VQOV 4NTXA 3LDEA 3JAMN 3RN4A 2XUMA 5F2VO 1TGOA 2P06A 1GM8A 1BHAA 2JK5C 4LF5O 1FFXA 3J7AU 3OGCC 4X20A 1P7GA 2XASA 4FMTA 4GKJB 5C93A 4EB6B 3RVYA 4TV9B 1N32O 4FIPC 3ABTA 1EFRG 3ZMVA 4U3FH 5L3EA 2DW4A 4GX1A 2UXNA 4PV1B 3UKMA 4Q6GA 1QBZA 1P49A 2QR4A 1H8EG 2UUBB 1Q43A 1V54C 3ZRSA 5EBWC 4JAVA 4WFEA 5LXTA 3EVKA 1S72V 4FLZA 3CB2A 4LC1A 1GTOA 1DLBA 4DR2O 4JYYA 4GX2A 2GUZB 2A0LA 4TV8A 2Q68A 2R9RB 4IYHA 5CMUA 1AI6A 5CBFA 1NQTA 1YCIA 1W59A 4J11A 1BQ0A 2A06H 2R9IA 4I50B 2IJJA 1VIBA 3T4DA 4A5UB 1KB9F 1NBMG 3H1KH 5KHKA 1K7DA 2MW2B 1Z2GA 5LHGA 1X4TA 1GO3F 5CN0A 3X2QB 2ZD9A 4XDJA 4LF7B 2EBOA 2ZQMA 3HB3B 1AILA 5CA3A 4FLWA 4DV7B 2DQ3A 4DV3B 1N0JA 4HNAA 4BAYA 4AILC 2F43G 4JI1O 4J7KA 4O2BA 2F95B 4LF8O 4BIOA 1G1XB 1NR1A 4C7UA 2ZIOA 3CP1A 4DV2O 3HKCA 5GTHZ 1FKAO 4X66O 5JVDB 2RCVA 3K9AA 4UVAA 5B1AB 3FB8C 2BSKB 1VQ8V 1W0KG 4RQEA 2JEXA 3BFRA 1PL4A 3DTUB 1S3JA 4UCVA 3R66A 4U7OA 3BCCH 4AHCA 4JYCA 1VQKV 3H1JH 2GV9A 1KKCA 1G6UA 5LP6C 2DWDC 4LF9B 4HAMA 3AG3C 3K59A 2IJIA 3C3TA 3JASB 1K34A 4O2AA 3BRCA 3CRAA 5A9GA 1H2KA 1R3KC 4JI5O 1QNMA 4X20B 3N2KA 1K4DC 2H8PC 2AZ2A 4R8CA 2UXCB 3JALA 2F4VB 3HPLC 2LGQA 5JCOA 1W0JG 1N36B 4XBFA 3I56V 1GMGA 1FXKB 4JTCB 1OZ0A 1HW7A 3I55V 3A0BZ 1BMFG 3B77A 4IL6Z 2DJVA 1Q6UA 5IYDO 2H3OA 3H01A 4X1YA 3OT7A 4JI0B 1QHTA 4JI8O 1PNLA 4X1IA 5KMGA 5EC1C 2R9AA 1J95A 4FPPA 4LNUA 3Q4HA 2UXDO 3ZHVA 4Z1MG 1NJIW 3ZHQA 2EIMB 4R6ZA 1RFYA 4FFKA 3S3WA 1MOFA 2DYSB 2PY5A 1R6NA 4K35A 3FKSG 4JI7B 1EBOA 4JAAA 4MVQA 1K73W 5KA6A 3FFQA 3G4SV 4GT1A 2ZT9B 3SGIA 2N05A 4UVCA 3STZC 4KFMA 4DV5O 1NI8A 4N21A 3OR6C 1P84F 1WN7A 3SPIA 2Y69B 3L71H 4X65B 2XAGA 3CCRV 4RAIA 1VARA 5B5EZ 3N27A 4YXWG 1Y66A 2FTKA 4I55B 1S0VA 1MABG 1AR5A 4X64B 4MVZA 3CXCU 1MSDA 3ZRWA 3TGUH 3BY6A 4IHJA 2E75B 2KSDA 5DECA 5B3SB 4DYLA 1D5AA 2NR5A 5LMUB 5GONB 2QE7G 2XAHA 3D3IA 2ZNJA 4NR1A 1AP6A 2YI9A 3K0GA 1SQVH 3DGEA 4DRXB 4B3SO 2YXHA 4W4KA 2RDCA 1RPOA 5FLXN 3OM3B 4OX9O 1SRYA 2N04A 4BWAA 4GUNA 1WB7A 2VQEB 4JTAB 2HLDG 3FAVA 5C8YB 5KHHA 4EKWA 5IY5B 4LF4B 4U7NA 1KU9A 4HBNA 3CCQV 1YEWA 4DV6B 5KA5A 3RYHA 1S77D 3ZHRA 4H33A 5CBHA 1CXZB 4FZ0A 3NR7A 1MSWD 1ZAUA 1RSOB 3ABKB 2QWPB 1OCCB 1ZTEA 2E5LB 2WLIA 4ZBMA 1VMGA 1CPYA 5HFMA 5L3BA 5CA0B 2YDEA 1H8HG 2WAMA 1BCCH 1SQFA 3JCZA 3OMNB 1KQSU 4LF5B 3WU2Z 1WP8A 3K79A 2ZE6A 3ZMZA 4IGGA 2XT9A 4FM1A 5B66Z 3AG1B 2DWEC 3JATB 5JQGA 1F51A 3CJHA 1Q82W 2OTJV 2X6CA 2HFEC 1VQ7V 4CC5A 2P67A 1COWG 3ZRXA 2ITCC 3U11A 3CCEV 2E76B 2WA4A 2C2AA 5H5NA 2L35A 2YIBA 3AG4B 4R7CA 1GK9A 3ZEDA 1FAFA 4JV5O 3CCVV 3EFFK 1VQLV 1HNWO 3AG7A 4LR3A 2QEXV 5ITZB 4YJ3A 3HKEB 4UUJC 1R73A 3CRRA 1KECA 1F7YA 1OCZB 1X59A 3GWOA 4DK1A 4DV0O 1IBKO 1YXBA 1SQBH 3SPGA 4WF9V 2ZM6B 3OTOO 4YJ2B 1J5EB 4EEQA 1EN6A 4DR1O 4JI6O 4NKGB 4F6RA 1GM9A 2V1DA 2EINB 1XHXA 1BT8A 2OT5A 5DM6V 2HG5C 5CA1B 2IJKA 3ASOB 1PNMA 5KUMA 3SJQC 2HR3A 1HP8A 2KG7A 3LNMB 1NVPB 3KZIZ 3ZHUA 5GW7A 2CAZC 3ETGA 2D3OW 3E22B 2CGOA 5L3FA 4JI1B 1JVMA 4WBNB 4GKKB 1VQNV 1QLEC 4LF8B 2W0FC 2F93B 1NZ6A 1TAEA 4QNHB 4DV2B 3IGAC 4X66B 3BEHA 3RWRD 2FYUH 3ABMB 1V54B 1SQXH 1XL6A 5KHGA 3L72H 1N33B 1ENVA 2NNUA 4PA4A 1E79G 2PI5A 3CC7V 3ABUA 4FM0A 4QJFB 1WB8A 1Y76B 2HVKC 1NKDA 4DK0A 3WG7B 2P22C 4B3RO 3W7SA 4TOIA 4KL1A 3A8TA 4DUYB 4DV1O 1UPGA 2GUZA 3GVMA 3L74H 4TWKA 4NXNB 5KHJA 1I0HA 2ZE5A 3N2GB 3CJHB 5JQGB 2ARHA 5JCOC 4UVBA 3OE7G 3WB1A 4AI8A 1R3LC 1YIJV 2JIZG 3ZRVA 5IYCO 1K8AW 3JAWA 3MAQA 4O4HB 4JI8B 3DC6A 2WSSG 1K97A 2YXLA 2DYRB 3L70H 4OPAA 1UFIA 2EIKB 2UXDB 1GKFA 4E4EA 1M56C 1S5HC 4L8JA 4GLXA 2HKOA 4B7EA 4FZ1A 1S5LZ 1SZXA 4BW5A 3CHXA 4B08A 3A2FA 2QGNA 2BTQB 1BQZA 4G2KA 2HJFC 1GN6A 1VQ5V 4DW1A 2UXBO 5GTIZ 5JVDA 4ZIBA 4MVRA 4DV5B 1JX9A 2W6JG 2GDSA 3VQXA 1KP3A 2M7WA 1TUBB 3AK2A 2BSKA 2IBZH 3E83A 4MS2A 3RYFB 5FNVB 5IE9A 5LA6A 3ZMTA 5B1BC 3VBBA 5BY1A 4FLXA 2RJZA 1XHZA 2D2CB 3TCUA 5EYPB 1Z5VA 4DR6O 3JASA 4KXRA 4DV4O 1YITV 5KX5A 5JJJB 3EHBB 1SA0A 4G28B 1YSCA 1Q8IA 4LFCO 1K33A 2EIJC 4U3JB 5BR8B 3THOA 3T4ZA 3E8GA 1AROP 3W7XA 1V55C 1FXKA 1VQ4V 3ETEA 4FVMA 4B3MO 1G4YB 5EIBC 1WA8B 3WFVA 1XNRO
chains in the Genus database with same CATH topology
1OCOC 1BMFG 3B77A 5IYDO 3QNEA 1ZWIC 3H01A 1K3EA 1AI4A 3IFXA 3F7YC 4MW3A 4RUEA 4WFFA 3LDDA 1R3JC 4TSFG 1JCHA 1PNLA 3OUSA 5L3CA 1JJ2U 3ZN0A 3OMAB 5EC1C 5CBGA 1J95A 2CK3G 4Q20A 4FPPA 3KG2A 2ITDC 4E2LA 4QIWF 4Z1MG 1OCRB 2HVJC 1NJIW 3AG2B 2EIMB 2EZPA 4R6ZA 2KB1A 1AJQA 4MSWC 4PDLA 1MOFA 5H6QA 2DYSB 4R50A 1QR9A 3W7TA 1R6NA 4PDMA 3G6EV 1AJNA 2X0LA 3FKSG 2AHZA 2XNDG 1SESA 1EBOA 4JF3A 3VOUA 1DF4A 4MVQA 3SYCA 3LUTB 2EJRA 4HYOA 1OCCC 1XL4A 4JAUA 1K73W 1M1KW 3K04A 5KA6A 4FK5C 5H9CA 3SYOA 1M57C 3G4SV 4GT1A 3W7UA 4P9OA 3JYCA 4P30A 4BIZA 4UVCA 3STZC 1OCRC 4KFMA 3CCUV 2OTLV 2DYSC 3CYOA 4N21A 3OR6C 3ZMSA 3CPWU 2Q6AA 2WLKA 3SPIA 2Y69B 3AG1C 3MHSC 3K08A 2Q67A 2XAGA 3CCRV 5B1BB 4RAIA 2X7RB 1NH2D 4L87A 4YXWG 4LP8A 3E8FA 3OEHG 3FB6C 1Y66A 2FTKA 5H6RA 2Z5UA 1S0VA 4X88A 4MVSA 4PELA 1MABG 3CC4V 1Q81W 3ABLB 2GSMB 3AG3B 4MVZA 3B8MA 3CXCU 3JD1A 1BL8A 1AI7A 3ZRWA 2EIJB 3BY6A 2YEVA 3ZRWB 5B3SB 2QA4V 5LGNA 1KKDA 2YEVB 3FB5C 2QE7G 3JD2A 4TT3G 5LGUA 2IH3C 1V55B 2XAHA 1YJWV 2Z3YA 1E1RG 5EBLC 1MG1A 3D3IA 1JPXA 3FB7C 1QVFU 5L3DA 3LSQA 2XAFA 4WFGA 2Y48A 3K0GA 1K92A 3ZCCA 4I5SA 4HZ3A 3CMEV 1OCOB 3K03A 4UV8A 2XOKG 2WLLA 3DGEA 3GB7C 3ZJZA 3W7WA 3NXSA 1OCZC 4MTFA 3K06A 1RPOA 4LCUC 3OM3B 1SRYA 4JTAB 2H94A 2HLDG 5E1AC 2LFRA 2ZDIC 2QM8A 3E89A 4WFAV 1SZTA 3SYPA 2EINC 1YI2V 2IU0A 4EKWA 4F4LA 3E8HA 3MD0A 3AEIA 5IY5B 3K0DA 4U7NA 3CCQV 4PA3A 2JDIG 3OR7C 2QTOA 2IH1C 2WLJA 1NH2B 3E35A 5KA5A 3CCMV 1S77D 3ASOC 4H33A 5CBHA 3CC2V 3SPCA 2XAJA 4UXNA 1QCEA 1RM1C 1KC8W 1MSWD 3ABKB 1OCCB 2WLIA 3T2MA 2V7QG 3LDCA 3OAAG 4ZBMA 1CPYA 5HFMA 1PD3A 1EZJA 4JPRA 2EILC 5L3BA 2OCCC 2WLIB 1M57B 1ORQC 1H8HG 2WAMA 2WWWA 3IC7A 3JCZA 3OMNB 1KQSU 3E86A 1H38A 5IY5C 2P90A 3CCSV 5LBQA 5KUKA 3RVZA 3K79A 1H2GA 3ZMZA 3ABMC 2IJHA 1JQ0A 1QR8A 2ZXWB 4JYBA 2MK3A 3AG1B 2DWEC 1YTFB 1DTOA 2QM7A 1RPRA 4H37A 3ABKC 4MVUA 4PA7A 1F51A 3QO8A 4P2ZA 5IYBO 1CP9A 4XDLA 1WLEA 2IW5A 1K5QA 2X6CA 1YHQV 1Q82W 2OTJV 1AJPA 2HFEC 5LHHA 3WG7C 3P30A 1VQ7V 2BOBC 3M99B 1VQMV 3RW0A 4JGSA 3STLC 2P67A 1COWG 1Q7YW 3ASNC 1NVPD 3ZRXA 2ITCC 4CBCA 2JJ1G 4DXWA 3LSSA 3CCEV 1SERA 1I5YA 5IDJA 1FFTB 2C2AA 3JD4A 2B1GA 2JJ2G 1M90W 2ZXWC 3I55V 4MTGA 3AG4B 5DN6G 1G8MA 4R7CA 1L1FA 1GK9A 1PNKA 2A9HA 3F7VC 2WLMA 1WPXA 2LFSA 1Y4MA 4RO2A 5B1NA 3CCVV 3EFFK 1VQLV 3TETA 2BOCC 1UJWB 4MT8A 1LNQA 4N23A 2QEXV 1JOYA 4ZKIA 5LHIA 4JASA 1AI5A 2Q69A 4UUJC 1R73A 5EBMC 1KECA 1OCZB 4KP4A 3GWOA 1P7BA 5FL7G 3SPGA 4DO2A 4WF9V 3E8BA 4MTOA 1TUEB 2ZDIA 3R65A 1R3IC 3CCJV 4P9PA 2ATKC 4ASUG 3AG4C 2DYRC 2UXXA 3OEEG 1GM9A 4I9WA 4WCEV 2EIKC 2V1DA 2EINB 4MW8A 3P32A 3CD6V 3ZMUA 1F4NA 4CZZA 2OT5A 5DM6V 1KD1W 2HG5C 2P6JA 2JEUA 4JTDB 3SYQA 1W2BU 2IJKA 3ASOB 2A79B 3X2QC 2W6IG 1PNMA 2X6BA 5KUMA 4QE9A 2HR3A 3SJQC 2GHYA 2PI4A 1Q86W 2WLLB 3LNMB 1RM1B 4QE7A 1NVPB 5GW7A 1FXHA 2LP7A 3ETGA 2D3OW 2ZR3A 5L3FA 1VQ9V 1GM7A 2EILB 2OCCB 1JVMA 1KP2A 5LGTA 1PKXA 5BZBA 1VQNV 1QLEC 4GX5A 1VQOV 2W0FC 3LDEA 3D36A 4QNHB 3FYIB 3IGAC 4RUFA 1GM8A 3ML0A 1BHAA 2JK5C 3BEHA 3OGCC 1K5SA 4PDVA 3CCLV 3ABMB 1V54B 1XL6A 2XASA 4FMTA 5C93A 1ENVA 3RVYA 5B1AC 5J9PC 2NNUA 4FIPC 3ABTA 4WFHA 4PA4A 1EFRG 3ZMVA 1E79G 2PI5A 3CC7V 3ABUA 4G27B 4QJFB 4MVMA 2HVKC 2DW4A 1NKDA 1NR7A 4J9ZB 4GX1A 5L3EA 2B1IA 2UXNA 3UKMA 1AR1B 1YJNV 3WG7B 3TK1A 4PA9A 4MTXA 1QBZA 5L3GA 3ASNB 1E1QG 3W7SA 3E2EA 1H8EG 1THZA 1ROPA 1B6QA 2WLNA 4PDRA 5HFLA 1V54C 1SETA 5EBWC 3ZRSA 4JAVA 2ZR2A 1VQPV 4WFEA 1S76D 2IU3A 1S72V 4LC1A 1GTOA 1F23A 3PJSK 1DLBA 3MHHC 3G71V 4TWKA 1M56B 1F4MA 3QO5A 4GX2A 2A0LA 4LBEC 1YJ9V 2Q68A 1FXKC 2R9RB 4UVBA 1HWYA 3OE7G 5CMUA 1AI6A 1K4CC 5CBFA 1R3LC 1YIJV 1NQTA 2JIZG 2AHYA 3ZRVA 3ETDA 2R9IA 5IYCO 1K8AW 4X8AA 1IXMA 2NLJC 4OXSA 2WSSG 2IJJA 3JD3A 1K97A 2DYRB 3OUFA 3T4DA 4QPKA 2EIKB 1GKFA 1NBMG 3ZIAG 2DQ0A 3CMAV 1M56C 1S5HC 3OW2U 1K7DA 3AG2C 2EIMC 4KUMA 5LHGA 4WFBV 1GO3F 4QPJA 2HKOA 1N8RW 5CN0A 3X2QB 2ZD9A 4XDJA 2X6AA 2EBOA 4BW5A 2ZQMA 1FS0G 3HB3B 5CA3A 1I5XA 2EZOA 1OHHG 5B1OA 2DQ3A 4GX0A 1PL0A 4BAYA 2F43G 1QLEB 4G2KA 2HJFC 1VQ5V 2K1EA 3RBZA 4RQFA 1NR1A 4MVRA 1VQ6V 3CP1A 1JX9A 3OFNG 1K9MW 2W6JG 1KP3A 2M7WA 4X89A 4GCZA 2XAQA 3K9AA 4BIUA 3E83A 4UVAA 5B1AB 3FB8C 2Y69C 3F5WC 4MS2A 3QO7A 2YSUB 4XDKA 1VQ8V 1W0KG 2QKSA 3FYEB 3SPJA 3K3WA 3B8NA 3ZMTA 5B1BC 3VBBA 4RQEA 2JEXA 1QVGU 3OMIB 3DTUB 1S3JA 1CEZA 2WLHA 4U7OA 4JYCA 1QLNA 1VQKV 1YTFD 3TCUA 3ZN1A 2DWDC 1YITV 3ABLC 3EHBB 3AG3C 4HAMA 4MVOA 1BHBA 4G28B 1YSCA 2IJIA 1K34A 1K33A 2EIJC 3JD0A 2P7TC 2WPDG 1R3KC 3SPHA 5B3SC 1FXVA 1K4DC 2H8PC 5EK0A 3T1CA 3T4ZA 3A0RA 5EC2C 4R8CA 3E8GA 1AROP 1DF5A 1R6KA 4UV9A 3HPLC 3SYAA 3W7XA 1M9NA 1FXKA 1V55C 1W0JG 4XBFA 1VQ4V 1P4RA 3ETEA 3UM7A 3I56V 2B5UA 1G4YB 1GMGA 4PA6A 4J9YB 3WFVA 1FXKB 4JTCB 1OZ0A 4FJCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  2M7W A;  3B8M A;  3CYO A;  4N21 A;  5KA5 A;  1I5Y A;  5CN0 A;  5HFL A;  3K9A A;  1K34 A;  1JQ0 A;  1QR8 A;  1K33 A;  2EBO A;  3H01 A;  3GWO A;  1ENV A;  2MK3 A;  1EBO A;  3MHS C;  4FIP C;  4JF3 A;  1DF4 A;  1I5X A;  1QCE A;  2EZO A;  2LP7 A;  3B8N A;  4FJC C;  5KA6 A;  5HFM A;  1F23 A;  4FK5 C;  5H9C A;  1DF5 A;  2X7R B;  4JPR A;  1DLB A;  3MHH C;  4G2K A;  1Y4M A;  1SZT A;  3P30 A;  1MG1 A;  4E2L A;  1JPX A;  1Y66 A;  3M99 B;  1QBZ A;  4JGS A;  2EZP A;  2OT5 A;  3WFV A;  3CP1 A;  4N23 A;  1MOF A;  2P6J A;  5CMU A;  1QR9 A; 
#chains in the Genus database with same CATH topology
 2CTP A;  1M5I A;  4B3S B;  3H1I H;  1AI4 A;  1SKV A;  4OGQ B;  1IZ3 A;  4OX9 B;  2OIG A;  1JCH A;  5L3C A;  1JJ2 U;  3ZN0 A;  3OMA B;  3AK3 A;  2CK3 G;  2ITD C;  4DR3 O;  1OV9 A;  4NYK A;  1GH6 A;  3CRQ A;  3AG2 B;  2EZP A;  1AJQ A;  1PM9 A;  4PDM A;  4AQY O;  2G38 A;  4JI2 O;  2X0L A;  1SQP H;  3D3Q A;  1DF4 A;  3SYC A;  4JAU A;  3K04 A;  3JAW B;  4FK5 C;  5H9C A;  3U0Z A;  4JI4 O;  1M57 C;  3W7U A;  3JYC A;  4P30 A;  4BIZ A;  2ZCE A;  4EFB A;  3CCU V;  4EFE A;  3CYO A;  1US6 A;  4CH3 A;  2JGD B;  2WLK A;  4DR5 O;  3IC9 A;  1V9P A;  1ZSP A;  4LH7 A;  3ZS8 C;  1ZL8 B;  2LW7 A;  4I55 A;  4L87 A;  1EN5 A;  3OEH G;  3FB6 C;  4MVS A;  3B40 A;  1Q81 W;  3ABL B;  1VF6 A;  3B8M A;  3T1Y B;  4JYA O;  1BL8 A;  1AI7 A;  2E74 B;  2CUG A;  5GON A;  2CTR A;  5J2U B;  3UT5 B;  5LGN A;  1KKD A;  2YEV B;  3FB5 C;  4JV5 B;  2HP8 A;  5LA6 B;  2Z3Y A;  1MG1 A;  3FB7 C;  1JPX A;  1HNW B;  1QVF U;  2XHB A;  3ZCC A;  4DRX A;  4I5S A;  1OCO B;  3K03 A;  5AG2 A;  5LMN O;  3GB7 C;  4UCO A;  3W7W A;  1XMO B;  3CE2 A;  4B3T O;  4DUZ O;  5KX5 B;  4D7S A;  1SA0 B;  4DR4 B;  2DN9 A;  4DR1 B;  5C8Y A;  3RYC A;  1SQQ H;  2Y4U A;  2LFR A;  2IU0 A;  3MD0 A;  4H44 B;  5KHI A;  3OD4 A;  1NH2 B;  3E35 A;  1HNX O;  2QDO A;  1RSO A;  3T1H B;  5FPR A;  4DR7 O;  5CA0 A;  4JZG A;  2O57 A;  1PD3 A;  4JPR A;  2EIL C;  2PF4 E;  3BPZ A;  1IBL O;  2WWW A;  3QG5 A;  1H38 A;  3CS5 A;  3JAT A;  1JQ0 A;  1QR8 A;  2FL4 A;  3QVN A;  4UCR A;  1L0L H;  2RMK B;  3M7M X;  2QM7 A;  5IYZ B;  1RP3 B;  2F23 A;  4PA7 A;  3QO8 A;  1CP9 A;  3HKB A;  5LHH A;  4B3R B;  3RW0 A;  2R70 A;  4JGS A;  4LFB O;  1NVP D;  1AR4 A;  4DXW A;  2AZ0 A;  1SER A;  1S5J A;  4O4L B;  1PPJ H;  1HNZ O;  1ZUQ A;  4DV1 B;  1I08 A;  5DN6 G;  1G8M A;  2VQF O;  1IVS A;  4D7T A;  3G80 A;  1PNK A;  2A9H A;  3H1L H;  2CE4 A;  5ITZ A;  4MT8 A;  3HKE A;  4N23 A;  4Z1V A;  4ZHQ B;  4X62 O;  3APQ A;  1JOY A;  5LHI A;  2WA3 A;  3SJA C;  1AI5 A;  1H2M A;  1KYO F;  2ILM A;  4YJ2 A;  3CRM A;  5FL7 G;  4DO2 A;  1TUE B;  2LO1 A;  3R65 A;  3CCJ V;  4P9P A;  4ASU G;  3JSN A;  1FJG O;  5EZY B;  3K58 A;  1FYJ A;  1Q90 D;  5CA1 A;  2CH7 B;  1F4N A;  4IYI A;  1N34 O;  1NTK H;  4JTD B;  3SYQ A;  1W2B U;  3X2Q C;  1EM1 A;  4LH6 A;  1RM1 B;  3E22 A;  4J7J A;  1FXH A;  4LFA O;  4WBN A;  4K3A A;  3DXR A;  4J7Z A;  2OCC B;  1JA8 A;  5LGT A;  1PKX A;  1N0N A;  4GX5 A;  1AP5 A;  3RYC B;  1YDX A;  3D36 A;  3ML0 A;  3K57 A;  3ICX A;  4PDV A;  2QKA A;  3WB2 A;  2HEP A;  4CS4 A;  5LYJ B;  5B1A C;  2YIC A;  5J9P C;  4FFB B;  1Y76 A;  4ZI7 A;  1MMM A;  2R72 A;  4G27 B;  3K5M A;  1GAX A;  5K1P A;  4YHH O;  1NR7 A;  3KCY A;  3TK1 A;  2Z0A A;  3ASN B;  1E1Q G;  2EJ7 A;  4DR6 B;  5IJ9 B;  1Q6H A;  2PTM A;  4NB5 A;  1B6Q A;  3L73 H;  1XMQ O;  4PDR A;  1WPB A;  1SET A;  2ZR2 A;  1VQP V;  1N32 B;  3AK1 A;  1S76 D;  2IU3 A;  1Z5W A;  1F23 A;  3N2G A;  2QWR B;  4LF6 O;  1M56 B;  4B3M B;  2V4D A;  1XNR B;  1YJ9 V;  5DED A;  3HKB B;  1FXK C;  2N74 A;  5JJE B;  4O4H A;  1JR9 A;  4X8A A;  1Q5O A;  1IXM A;  4OXS A;  1XUQ A;  1IBM O;  3OUF A;  5TIS Z;  4QPK A;  4DR2 B;  4DR3 B;  2LJ2 A;  3ZIA G;  3IJ4 A;  2EIM C;  4KUM A;  1ZLZ A;  2QSA A;  1Y74 A;  4K8X A;  1FS0 G;  2BTQ A;  1OHH G;  4JI4 B;  4I9Q A;  5LP6 A;  2K1E A;  3C90 A;  2Q7G A;  4TUY B;  1TUB A;  4NTW A;  4X89 A;  4GCZ A;  2KQX A;  2XAQ A;  3RYF A;  5FNV A;  4DR5 B;  4IIJ B;  2ADQ B;  2Y69 C;  3F5W C;  2Q7H A;  2YSU B;  4XDK A;  3K3W A;  3B8N A;  1A32 A;  1QVG U;  3OMI B;  4I0X B;  2AGA A;  5EYP A;  2WLH A;  3DXR B;  1XEQ A;  1QLN A;  2YI8 A;  3CWB H;  3B2E E;  3ZN1 A;  4U3J A;  1M4U A;  4JYA B;  2ZIM A;  4MVO A;  2HHH O;  1EN4 A;  1VF6 C;  1XDC A;  3JD0 A;  2WPD G;  3SPH A;  5B3S C;  2UUA O;  1FXV A;  4W4L A;  2QKC A;  1I7F A;  1AVM A;  4CS2 A;  4UV9 A;  4UB8 Z;  3J80 N;  4ZI7 B;  1WA8 A;  1M9N A;  2JRI A;  3DC5 A;  3UM7 A;  2B5U A;  1JFF B;  4J9Y B;  2P4V A;  4FJC C;  5LMN B;  3KCX A;  1ZWI C;  4B3T B;  5A2Q N;  1MNG A;  3HKD B;  4JI5 B;  3IFX A;  3F7Y C;  1R3J C;  4CH6 A;  5CBG A;  4Q20 A;  4I7Z B;  3KG2 A;  4GYC B;  3RYI B;  5CB4 B;  4ZOL B;  5LL6 Y;  4E2L A;  4QIW F;  4J10 A;  1HR0 O;  4MSW C;  4PDL A;  4R50 A;  1QR9 A;  1B04 A;  3W7T A;  1HNX B;  3CSX A;  5D5P A;  2AHZ A;  2XND G;  3I5D A;  4JF3 A;  3VOU A;  3LUT B;  2EJR A;  1OCC C;  1XL4 A;  3JAR B;  4X1K B;  3M8A A;  3SYO A;  3VQW A;  1IBL B;  1PV0 A;  3BVO A;  2M6Y A;  1OCR C;  3S3X A;  4X64 O;  1XQ8 A;  2JGD A;  3JCU Z;  3CPW U;  1XI1 A;  1XRE A;  3AG1 C;  3K08 A;  2Q67 A;  4NXM O;  1Y74 B;  1ZL8 A;  1H2S B;  2AW9 A;  5LMU O;  2X7R B;  1NH2 D;  3E8F A;  1QQC A;  2Z5U A;  3G6B A;  4LFB B;  5LP6 B;  3EXA A;  4CC6 A;  5K1X A;  1I94 O;  3AG3 B;  4O4I B;  3OTF A;  5J2U A;  3UT5 A;  2YEV A;  2VQF B;  4TT3 G;  3ZX6 A;  1YJW V;  2JS5 A;  1TVK B;  5EBL C;  5KAI Z;  4WFG A;  5IJ0 A;  4X62 B;  2Y48 A;  4I4T B;  2XOK G;  5JH7 A;  1OCZ C;  4FM2 A;  4CS3 A;  2QJ1 A;  1JJO A;  1U96 A;  1FJG B;  2PGG A;  4O4J B;  5E1A C;  2UUC O;  2ZKO A;  4WFA V;  3E89 A;  1SZT A;  3SYP A;  2EIN C;  1YI2 V;  4F4L A;  4YY3 O;  1N34 B;  1NTZ H;  2QTO A;  3ASO C;  2NN4 A;  3SJC C;  2JS3 A;  3K9S A;  3SPC A;  1DK1 A;  4JI3 O;  2XAJ A;  4UXN A;  1KC8 W;  4LFA B;  2Q0O C;  3T2M A;  5JJN B;  3LDC A;  2PUS A;  5BXZ A;  1EZJ A;  4YIP A;  1SF9 A;  2HJD A;  1ZX3 A;  2P5O A;  2P90 A;  3CCS V;  5LBQ A;  5KUK A;  2A7W A;  1H2G A;  1WJZ A;  3D36 C;  3ABM C;  5FPO A;  2IJH A;  1B06 A;  5IYZ A;  2BCC H;  4BR6 A;  3RT3 C;  1XBL A;  1KBH A;  4H37 A;  4CH5 A;  4MVU A;  1IX9 A;  4YHH B;  2IM9 A;  5IYB O;  4XDL A;  2IW5 A;  1K5Q A;  1AJP A;  3WG7 C;  3P30 A;  3M99 B;  5J2T B;  3STL C;  3ZBH A;  1Q3E A;  4CBC A;  1XOU A;  4O4L A;  1XMQ B;  5BMV A;  1I5Y A;  1LR1 A;  1FFT B;  2Q73 A;  2B1G A;  1M90 W;  2ZXW C;  2RNB A;  2ZM6 O;  1J5E O;  2E3C A;  3TJT A;  1OJH A;  1L1F A;  4LF6 B;  1GN4 A;  3F7V C;  1Y4M A;  2Q5Z A;  5B1N A;  4ZHQ A;  3TET A;  2K9P A;  1UJW B;  1LNQ A;  5LOV B;  4ZKI A;  3JAK B;  4JAS A;  4KHP O;  1P7B A;  4PD4 F;  1LUV A;  1NTM H;  2ZDI A;  5EZY A;  2ATK C;  1IBM B;  2DYR C;  2BE3 A;  2UXX A;  2CH7 A;  4GKK O;  3OEE G;  4WCE V;  2EIK C;  4MW8 A;  1LUW A;  3CD6 V;  3WB0 A;  1XNQ O;  1KD1 W;  2P6J A;  1XIL A;  1SS3 A;  4K0K O;  5IJ0 B;  2X6B A;  4QE9 A;  1N33 O;  4DV0 B;  1IBK B;  5JH7 B;  2GTS A;  2LP7 A;  3OTO B;  3ETQ A;  4JI6 B;  1VQ9 V;  1GM7 A;  5E79 Z;  5BZB A;  2F1M A;  3FYI B;  4RUF A;  5IWA O;  1K5S A;  5LYJ A;  3CCL V;  3J81 N;  3B4S A;  4FFB A;  1FFX B;  1O9G A;  4WFH A;  4QGP A;  3G67 A;  2DOS A;  3P3P A;  4DUY O;  4MVM A;  4J9Z B;  1NU1 H;  1YJN V;  2B1I A;  1AR1 B;  4NXN O;  2YS8 A;  4PA9 A;  5IJ9 A;  1MZE A;  4MTX A;  5L3G A;  2QWN B;  3E2E A;  1THZ A;  4PJ0 Z;  1ROP A;  3TXS A;  2WLN A;  2HHH B;  5HFL A;  2UUA B;  2ZE7 A;  4BW9 A;  3K5O A;  2BTO A;  3PJS K;  5LXT B;  3MHH C;  3G71 V;  2VS0 A;  1NS1 A;  1F4M A;  3QO5 A;  3A0H Z;  4LWS A;  4LBE C;  2F66 C;  1HWY A;  3VQY A;  3HR0 A;  1K4C C;  4TV8 B;  2AHY A;  3ETD A;  2UU9 O;  5BMV B;  5EIB D;  2NLJ C;  4X9Q A;  2CGN A;  3JD3 A;  4PI2 A;  4UCS A;  2DQ0 A;  3VQV A;  3CMA V;  3ZHS A;  3P3N A;  3OW2 U;  1HR0 B;  3AG2 C;  2KKW A;  1BZK A;  4WFB V;  4QPJ A;  1N8R W;  1Y6X A;  2X6A A;  2YIA A;  1VF5 B;  4Z2W A;  1I5X A;  2EZO A;  2YC0 A;  1TA8 A;  5B1O A;  4GX0 A;  5JWP A;  1PL0 A;  4J80 A;  4D6T H;  1QLE B;  4TUY A;  3RBZ A;  1KMI Z;  3BHP A;  4HNA B;  4RQF A;  4PHZ A;  4O2B B;  1VQ6 V;  1K9M W;  3OFN G;  3GWK C;  4IIJ A;  3IAY A;  1R1B A;  3HKC B;  4BIU A;  4GKJ O;  3FD9 A;  5BR8 O;  4NXM B;  3QO7 A;  2EX3 A;  2QKS A;  3FYE B;  3SPJ A;  4I0X A;  4H0L B;  2VWJ A;  2RQ6 A;  1CEZ A;  1MZF A;  2DE0 X;  2UXB B;  5D5Q A;  1YTF D;  2DMX A;  1DGS A;  4OPH A;  2FML A;  1I94 B;  3ABL C;  2UUB O;  1BHB A;  1QU7 A;  2A3Q A;  2P7T C;  3SR2 C;  4O2A B;  2P4K A;  3T1C A;  5EK0 A;  3APO A;  3A0R A;  5EC2 C;  1SC5 B;  2VWK A;  2Y4T A;  1YVW A;  1KUQ A;  1DF5 A;  1R6K A;  3N2K B;  3SYA A;  1JFF A;  2ZNI A;  3JAL B;  1P4R A;  1WP7 A;  3RGB A;  4PA6 A;  1WNS A;  2YUA A;  4DV4 B;  1OCO C;  3HKD A;  4TQD A;  3QNE A;  1WAZ A;  1L0N H;  3CRC A;  2YIB D;  4LFC B;  1K3E A;  2ZE8 A;  3QTC A;  3MDS A;  4RUE A;  4MW3 A;  4WFF A;  3LDD A;  4X1Y B;  4TSF G;  3OUS A;  3RYI A;  5CB4 A;  4ZOL A;  2UUC B;  4UFZ A;  1BS3 A;  4X1I B;  5KMG B;  1IXB A;  1Q6I A;  3C3S A;  5KAF Z;  2QM4 A;  4YY3 B;  1OCR B;  2HVJ C;  4H13 B;  1SQG A;  1U97 A;  3Q4H B;  2KB1 A;  4LNU B;  3UO2 A;  5H6Q A;  2EUL A;  3O9O A;  1O9H A;  4LWS B;  3G6E V;  1AJN A;  4LF7 O;  1VP7 A;  3JAR A;  4X1K A;  1SES A;  4JI3 B;  1JMK C;  3D8C A;  4IT5 A;  4HYO A;  1EZV H;  1M1K W;  3H9V A;  4DV7 O;  2YID A;  4DV3 O;  3CX5 F;  4TQF A;  4FLV A;  2VRZ A;  4P9O A;  1IUR A;  2FKX A;  1R6T A;  1VEW A;  2OTL V;  2DYS C;  3ZMS A;  4UCT A;  3T1Y O;  3L75 H;  4AQY B;  2Q6A A;  4ABM A;  4JI2 B;  3QF7 A;  3MHS C;  3PN1 A;  5B1B B;  1BE3 H;  1BGY H;  1D2D A;  4LP8 A;  3O65 A;  1YZB A;  1B3Q A;  5H6R A;  4X88 A;  4O4I A;  4PEL A;  3TXQ A;  2RN9 A;  3CC4 V;  2CDY A;  2GSM B;  4LF9 O;  3JD1 A;  1XMO O;  2EIJ B;  2QWO B;  2Q0A A;  3K5L A;  3BAB A;  3ZRW B;  3DSQ A;  4DR4 O;  2QA4 V;  3UCS C;  4IHJ B;  2Y0P A;  2XTA A;  1TVK A;  2UXC O;  2F4V O;  3JD2 A;  5LGU A;  2IH3 C;  1V55 B;  1E1R G;  1N36 O;  4I4T A;  5L3D A;  3LSQ A;  2XAF A;  2Y0I A;  1K92 A;  1GN2 A;  4HZ3 A;  3CME V;  4UV8 A;  2WLL A;  2OIE A;  3U10 A;  3ZJZ A;  5KLV H;  4KHP B;  3NXS A;  3T1H O;  4MTF A;  2L6L A;  3K06 A;  4JI0 O;  2OYQ A;  4LCU C;  4O4J A;  1T5E A;  2H94 A;  2ZDI C;  2QM8 A;  3F5T A;  2B9Z A;  3KKY A;  3E8H A;  1XNQ B;  3FAV B;  3AEI A;  4GZR B;  3K0D A;  2ADP A;  3UQ8 A;  2FB5 A;  3FX7 A;  4PA3 A;  2JDI G;  3OGI B;  3OR7 C;  4K0K B;  4EB6 A;  2IH1 C;  2WLJ A;  4TV9 A;  3CCM V;  4K8Z A;  1YF2 A;  2ODM A;  4PI0 A;  3CC2 V;  4DUZ B;  3RYH B;  4JI7 O;  2PZS A;  3JSL A;  1URF A;  1QCE A;  4F6E A;  1RM1 C;  2ZIN A;  2V7Q G;  3OAA G;  1Y67 A;  1L8D A;  4FLU A;  2Q8V A;  2OCC C;  2WLI B;  4J42 A;  1M57 B;  1ORQ C;  3K5N A;  3LSU A;  3BA9 A;  3IC7 A;  2CTW A;  4FLY A;  3E86 A;  5IY5 C;  5IWA B;  3RFR A;  3B09 A;  3RVZ A;  4RWU A;  4ICG A;  2GBO A;  2ZXW B;  4JYB A;  3BAA A;  2ETN A;  2MK3 A;  1PP9 H;  5IT9 N;  1YTF B;  1DTO A;  4DR7 B;  1H2L A;  1RPR A;  4X65 O;  3ABK C;  4CH4 A;  2OCH A;  3BA8 A;  4P2Z A;  3ZHT A;  1HDJ A;  1D5N A;  1NT2 B;  5J2T A;  1WLE A;  1YHQ V;  1AB3 A;  2OWO A;  2BOB C;  2QTS A;  1VQM V;  1Q7Y W;  2LQT A;  3ASN C;  2JJ1 G;  3LSS A;  2LGW A;  4I50 A;  5IDJ A;  3JD4 A;  2JJ2 G;  2LW1 A;  2QWQ B;  3LNN A;  3H1H H;  4MTG A;  1M93 A;  4UCU A;  1H2N A;  2AXT Z;  2CTQ A;  4UB6 Z;  2W0X A;  1WPX A;  2WLM A;  2LFS A;  4RO2 A;  5LOV A;  5H2F Z;  2BOC C;  3JAK A;  1GRJ A;  4NTY A;  2JGU A;  2Q7E A;  2Q69 A;  1MA1 A;  5EBM C;  4FLT A;  3L9D A;  2UU9 B;  4KP4 A;  4YJ3 B;  4JZ2 A;  3E8B A;  2Q4P A;  3CXH F;  4MTO A;  1HNZ B;  2GTA A;  1IDS A;  1R3I C;  3AG4 C;  2VQE O;  3CEI A;  2Q9L A;  2JVD A;  4I9W A;  4J41 A;  3SJB C;  2YXY A;  4NVP A;  1FD9 A;  3UO3 A;  3P32 A;  1BSM A;  1GN3 A;  3ZMU A;  4CZZ A;  1FPO A;  4F6R B;  4B7K A;  4LF4 O;  2JEU A;  4DV6 O;  1VF7 A;  2A79 B;  2W6I G;  1N4C A;  2GHY A;  2PI4 A;  1Q86 W;  2WLL B;  4DW0 A;  2PYJ A;  4QE7 A;  4YIO A;  3SDL A;  2E5L O;  2KG7 B;  2ZR3 A;  2PYL A;  2EIL B;  1KP2 A;  1VQO V;  4NTX A;  3LDE A;  3JAM N;  3RN4 A;  2XUM A;  5F2V O;  1TGO A;  2P06 A;  1GM8 A;  1BHA A;  2JK5 C;  4LF5 O;  1FFX A;  3J7A U;  3OGC C;  4X20 A;  1P7G A;  2XAS A;  4FMT A;  4GKJ B;  5C93 A;  4EB6 B;  3RVY A;  4TV9 B;  1N32 O;  4FIP C;  3ABT A;  1EFR G;  3ZMV A;  4U3F H;  5L3E A;  2DW4 A;  4GX1 A;  2UXN A;  4PV1 B;  3UKM A;  4Q6G A;  1QBZ A;  1P49 A;  2QR4 A;  1H8E G;  2UUB B;  1Q43 A;  1V54 C;  3ZRS A;  5EBW C;  4JAV A;  4WFE A;  5LXT A;  3EVK A;  1S72 V;  4FLZ A;  3CB2 A;  4LC1 A;  1GTO A;  1DLB A;  4DR2 O;  4JYY A;  4GX2 A;  2GUZ B;  2A0L A;  4TV8 A;  2Q68 A;  2R9R B;  4IYH A;  5CMU A;  1AI6 A;  5CBF A;  1NQT A;  1YCI A;  1W59 A;  4J11 A;  1BQ0 A;  2A06 H;  2R9I A;  4I50 B;  2IJJ A;  1VIB A;  3T4D A;  4A5U B;  1KB9 F;  1NBM G;  3H1K H;  5KHK A;  1K7D A;  2MW2 B;  1Z2G A;  5LHG A;  1X4T A;  1GO3 F;  5CN0 A;  3X2Q B;  2ZD9 A;  4XDJ A;  4LF7 B;  2EBO A;  2ZQM A;  3HB3 B;  1AIL A;  5CA3 A;  4FLW A;  4DV7 B;  2DQ3 A;  4DV3 B;  1N0J A;  4HNA A;  4BAY A;  4AIL C;  2F43 G;  4JI1 O;  4J7K A;  4O2B A;  2F95 B;  4LF8 O;  4BIO A;  1G1X B;  1NR1 A;  4C7U A;  2ZIO A;  3CP1 A;  4DV2 O;  3HKC A;  5GTH Z;  1FKA O;  4X66 O;  5JVD B;  2RCV A;  3K9A A;  4UVA A;  5B1A B;  3FB8 C;  2BSK B;  1VQ8 V;  1W0K G;  4RQE A;  2JEX A;  3BFR A;  1PL4 A;  3DTU B;  1S3J A;  4UCV A;  3R66 A;  4U7O A;  3BCC H;  4AHC A;  4JYC A;  1VQK V;  3H1J H;  2GV9 A;  1KKC A;  1G6U A;  5LP6 C;  2DWD C;  4LF9 B;  4HAM A;  3AG3 C;  3K59 A;  2IJI A;  3C3T A;  3JAS B;  1K34 A;  4O2A A;  3BRC A;  3CRA A;  5A9G A;  1H2K A;  1R3K C;  4JI5 O;  1QNM A;  4X20 B;  3N2K A;  1K4D C;  2H8P C;  2AZ2 A;  4R8C A;  2UXC B;  3JAL A;  2F4V B;  3HPL C;  2LGQ A;  5JCO A;  1W0J G;  1N36 B;  4XBF A;  3I56 V;  1GMG A;  1FXK B;  4JTC B;  1OZ0 A;  1HW7 A;  3I55 V;  3A0B Z;  1BMF G;  3B77 A;  4IL6 Z;  2DJV A;  1Q6U A;  5IYD O;  2H3O A;  3H01 A;  4X1Y A;  3OT7 A;  4JI0 B;  1QHT A;  4JI8 O;  1PNL A;  4X1I A;  5KMG A;  5EC1 C;  2R9A A;  1J95 A;  4FPP A;  4LNU A;  3Q4H A;  2UXD O;  3ZHV A;  4Z1M G;  1NJI W;  3ZHQ A;  2EIM B;  4R6Z A;  1RFY A;  4FFK A;  3S3W A;  1MOF A;  2DYS B;  2PY5 A;  1R6N A;  4K35 A;  3FKS G;  4JI7 B;  1EBO A;  4JAA A;  4MVQ A;  1K73 W;  5KA6 A;  3FFQ A;  3G4S V;  4GT1 A;  2ZT9 B;  3SGI A;  2N05 A;  4UVC A;  3STZ C;  4KFM A;  4DV5 O;  1NI8 A;  4N21 A;  3OR6 C;  1P84 F;  1WN7 A;  3SPI A;  2Y69 B;  3L71 H;  4X65 B;  2XAG A;  3CCR V;  4RAI A;  1VAR A;  5B5E Z;  3N27 A;  4YXW G;  1Y66 A;  2FTK A;  4I55 B;  1S0V A;  1MAB G;  1AR5 A;  4X64 B;  4MVZ A;  3CXC U;  1MSD A;  3ZRW A;  3TGU H;  3BY6 A;  4IHJ A;  2E75 B;  2KSD A;  5DEC A;  5B3S B;  4DYL A;  1D5A A;  2NR5 A;  5LMU B;  5GON B;  2QE7 G;  2XAH A;  3D3I A;  2ZNJ A;  4NR1 A;  1AP6 A;  2YI9 A;  3K0G A;  1SQV H;  3DGE A;  4DRX B;  4B3S O;  2YXH A;  4W4K A;  2RDC A;  1RPO A;  5FLX N;  3OM3 B;  4OX9 O;  1SRY A;  2N04 A;  4BWA A;  4GUN A;  1WB7 A;  2VQE B;  4JTA B;  2HLD G;  3FAV A;  5C8Y B;  5KHH A;  4EKW A;  5IY5 B;  4LF4 B;  4U7N A;  1KU9 A;  4HBN A;  3CCQ V;  1YEW A;  4DV6 B;  5KA5 A;  3RYH A;  1S77 D;  3ZHR A;  4H33 A;  5CBH A;  1CXZ B;  4FZ0 A;  3NR7 A;  1MSW D;  1ZAU A;  1RSO B;  3ABK B;  2QWP B;  1OCC B;  1ZTE A;  2E5L B;  2WLI A;  4ZBM A;  1VMG A;  1CPY A;  5HFM A;  5L3B A;  5CA0 B;  2YDE A;  1H8H G;  2WAM A;  1BCC H;  1SQF A;  3JCZ A;  3OMN B;  1KQS U;  4LF5 B;  3WU2 Z;  1WP8 A;  3K79 A;  2ZE6 A;  3ZMZ A;  4IGG A;  2XT9 A;  4FM1 A;  5B66 Z;  3AG1 B;  2DWE C;  3JAT B;  5JQG A;  1F51 A;  3CJH A;  1Q82 W;  2OTJ V;  2X6C A;  2HFE C;  1VQ7 V;  4CC5 A;  2P67 A;  1COW G;  3ZRX A;  2ITC C;  3U11 A;  3CCE V;  2E76 B;  2WA4 A;  2C2A A;  5H5N A;  2L35 A;  2YIB A;  3AG4 B;  4R7C A;  1GK9 A;  3ZED A;  1FAF A;  4JV5 O;  3CCV V;  3EFF K;  1VQL V;  1HNW O;  3AG7 A;  4LR3 A;  2QEX V;  5ITZ B;  4YJ3 A;  3HKE B;  4UUJ C;  1R73 A;  3CRR A;  1KEC A;  1F7Y A;  1OCZ B;  1X59 A;  3GWO A;  4DK1 A;  4DV0 O;  1IBK O;  1YXB A;  1SQB H;  3SPG A;  4WF9 V;  2ZM6 B;  3OTO O;  4YJ2 B;  1J5E B;  4EEQ A;  1EN6 A;  4DR1 O;  4JI6 O;  4NKG B;  4F6R A;  1GM9 A;  2V1D A;  2EIN B;  1XHX A;  1BT8 A;  2OT5 A;  5DM6 V;  2HG5 C;  5CA1 B;  2IJK A;  3ASO B;  1PNM A;  5KUM A;  3SJQ C;  2HR3 A;  1HP8 A;  2KG7 A;  3LNM B;  1NVP B;  3KZI Z;  3ZHU A;  5GW7 A;  2CAZ C;  3ETG A;  2D3O W;  3E22 B;  2CGO A;  5L3F A;  4JI1 B;  1JVM A;  4WBN B;  4GKK B;  1VQN V;  1QLE C;  4LF8 B;  2W0F C;  2F93 B;  1NZ6 A;  1TAE A;  4QNH B;  4DV2 B;  3IGA C;  4X66 B;  3BEH A;  3RWR D;  2FYU H;  3ABM B;  1V54 B;  1SQX H;  1XL6 A;  5KHG A;  3L72 H;  1N33 B;  1ENV A;  2NNU A;  4PA4 A;  1E79 G;  2PI5 A;  3CC7 V;  3ABU A;  4FM0 A;  4QJF B;  1WB8 A;  1Y76 B;  2HVK C;  1NKD A;  4DK0 A;  3WG7 B;  2P22 C;  4B3R O;  3W7S A;  4TOI A;  4KL1 A;  3A8T A;  4DUY B;  4DV1 O;  1UPG A;  2GUZ A;  3GVM A;  3L74 H;  4TWK A;  4NXN B;  5KHJ A;  1I0H A;  2ZE5 A;  3N2G B;  3CJH B;  5JQG B;  2ARH A;  5JCO C;  4UVB A;  3OE7 G;  3WB1 A;  4AI8 A;  1R3L C;  1YIJ V;  2JIZ G;  3ZRV A;  5IYC O;  1K8A W;  3JAW A;  3MAQ A;  4O4H B;  4JI8 B;  3DC6 A;  2WSS G;  1K97 A;  2YXL A;  2DYR B;  3L70 H;  4OPA A;  1UFI A;  2EIK B;  2UXD B;  1GKF A;  4E4E A;  1M56 C;  1S5H C;  4L8J A;  4GLX A;  2HKO A;  4B7E A;  4FZ1 A;  1S5L Z;  1SZX A;  4BW5 A;  3CHX A;  4B08 A;  3A2F A;  2QGN A;  2BTQ B;  1BQZ A;  4G2K A;  2HJF C;  1GN6 A;  1VQ5 V;  4DW1 A;  2UXB O;  5GTI Z;  5JVD A;  4ZIB A;  4MVR A;  4DV5 B;  1JX9 A;  2W6J G;  2GDS A;  3VQX A;  1KP3 A;  2M7W A;  1TUB B;  3AK2 A;  2BSK A;  2IBZ H;  3E83 A;  4MS2 A;  3RYF B;  5FNV B;  5IE9 A;  5LA6 A;  3ZMT A;  5B1B C;  3VBB A;  5BY1 A;  4FLX A;  2RJZ A;  1XHZ A;  2D2C B;  3TCU A;  5EYP B;  1Z5V A;  4DR6 O;  3JAS A;  4KXR A;  4DV4 O;  1YIT V;  5KX5 A;  5JJJ B;  3EHB B;  1SA0 A;  4G28 B;  1YSC A;  1Q8I A;  4LFC O;  1K33 A;  2EIJ C;  4U3J B;  5BR8 B;  3THO A;  3T4Z A;  3E8G A;  1ARO P;  3W7X A;  1V55 C;  1FXK A;  1VQ4 V;  3ETE A;  4FVM A;  4B3M O;  1G4Y B;  5EIB C;  1WA8 B;  3WFV A;  1XNR O; 
#chains in the Genus database with same CATH homology
 1OCO C;  1BMF G;  3B77 A;  5IYD O;  3QNE A;  1ZWI C;  3H01 A;  1K3E A;  1AI4 A;  3IFX A;  3F7Y C;  4MW3 A;  4RUE A;  4WFF A;  3LDD A;  1R3J C;  4TSF G;  1JCH A;  1PNL A;  3OUS A;  5L3C A;  1JJ2 U;  3ZN0 A;  3OMA B;  5EC1 C;  5CBG A;  1J95 A;  2CK3 G;  4Q20 A;  4FPP A;  3KG2 A;  2ITD C;  4E2L A;  4QIW F;  4Z1M G;  1OCR B;  2HVJ C;  1NJI W;  3AG2 B;  2EIM B;  2EZP A;  4R6Z A;  2KB1 A;  1AJQ A;  4MSW C;  4PDL A;  1MOF A;  5H6Q A;  2DYS B;  4R50 A;  1QR9 A;  3W7T A;  1R6N A;  4PDM A;  3G6E V;  1AJN A;  2X0L A;  3FKS G;  2AHZ A;  2XND G;  1SES A;  1EBO A;  4JF3 A;  3VOU A;  1DF4 A;  4MVQ A;  3SYC A;  3LUT B;  2EJR A;  4HYO A;  1OCC C;  1XL4 A;  4JAU A;  1K73 W;  1M1K W;  3K04 A;  5KA6 A;  4FK5 C;  5H9C A;  3SYO A;  1M57 C;  3G4S V;  4GT1 A;  3W7U A;  4P9O A;  3JYC A;  4P30 A;  4BIZ A;  4UVC A;  3STZ C;  1OCR C;  4KFM A;  3CCU V;  2OTL V;  2DYS C;  3CYO A;  4N21 A;  3OR6 C;  3ZMS A;  3CPW U;  2Q6A A;  2WLK A;  3SPI A;  2Y69 B;  3AG1 C;  3MHS C;  3K08 A;  2Q67 A;  2XAG A;  3CCR V;  5B1B B;  4RAI A;  2X7R B;  1NH2 D;  4L87 A;  4YXW G;  4LP8 A;  3E8F A;  3OEH G;  3FB6 C;  1Y66 A;  2FTK A;  5H6R A;  2Z5U A;  1S0V A;  4X88 A;  4MVS A;  4PEL A;  1MAB G;  3CC4 V;  1Q81 W;  3ABL B;  2GSM B;  3AG3 B;  4MVZ A;  3B8M A;  3CXC U;  3JD1 A;  1BL8 A;  1AI7 A;  3ZRW A;  2EIJ B;  3BY6 A;  2YEV A;  3ZRW B;  5B3S B;  2QA4 V;  5LGN A;  1KKD A;  2YEV B;  3FB5 C;  2QE7 G;  3JD2 A;  4TT3 G;  5LGU A;  2IH3 C;  1V55 B;  2XAH A;  1YJW V;  2Z3Y A;  1E1R G;  5EBL C;  1MG1 A;  3D3I A;  1JPX A;  3FB7 C;  1QVF U;  5L3D A;  3LSQ A;  2XAF A;  4WFG A;  2Y48 A;  3K0G A;  1K92 A;  3ZCC A;  4I5S A;  4HZ3 A;  3CME V;  1OCO B;  3K03 A;  4UV8 A;  2XOK G;  2WLL A;  3DGE A;  3GB7 C;  3ZJZ A;  3W7W A;  3NXS A;  1OCZ C;  4MTF A;  3K06 A;  1RPO A;  4LCU C;  3OM3 B;  1SRY A;  4JTA B;  2H94 A;  2HLD G;  5E1A C;  2LFR A;  2ZDI C;  2QM8 A;  3E89 A;  4WFA V;  1SZT A;  3SYP A;  2EIN C;  1YI2 V;  2IU0 A;  4EKW A;  4F4L A;  3E8H A;  3MD0 A;  3AEI A;  5IY5 B;  3K0D A;  4U7N A;  3CCQ V;  4PA3 A;  2JDI G;  3OR7 C;  2QTO A;  2IH1 C;  2WLJ A;  1NH2 B;  3E35 A;  5KA5 A;  3CCM V;  1S77 D;  3ASO C;  4H33 A;  5CBH A;  3CC2 V;  3SPC A;  2XAJ A;  4UXN A;  1QCE A;  1RM1 C;  1KC8 W;  1MSW D;  3ABK B;  1OCC B;  2WLI A;  3T2M A;  2V7Q G;  3LDC A;  3OAA G;  4ZBM A;  1CPY A;  5HFM A;  1PD3 A;  1EZJ A;  4JPR A;  2EIL C;  5L3B A;  2OCC C;  2WLI B;  1M57 B;  1ORQ C;  1H8H G;  2WAM A;  2WWW A;  3IC7 A;  3JCZ A;  3OMN B;  1KQS U;  3E86 A;  1H38 A;  5IY5 C;  2P90 A;  3CCS V;  5LBQ A;  5KUK A;  3RVZ A;  3K79 A;  1H2G A;  3ZMZ A;  3ABM C;  2IJH A;  1JQ0 A;  1QR8 A;  2ZXW B;  4JYB A;  2MK3 A;  3AG1 B;  2DWE C;  1YTF B;  1DTO A;  2QM7 A;  1RPR A;  4H37 A;  3ABK C;  4MVU A;  4PA7 A;  1F51 A;  3QO8 A;  4P2Z A;  5IYB O;  1CP9 A;  4XDL A;  1WLE A;  2IW5 A;  1K5Q A;  2X6C A;  1YHQ V;  1Q82 W;  2OTJ V;  1AJP A;  2HFE C;  5LHH A;  3WG7 C;  3P30 A;  1VQ7 V;  2BOB C;  3M99 B;  1VQM V;  3RW0 A;  4JGS A;  3STL C;  2P67 A;  1COW G;  1Q7Y W;  3ASN C;  1NVP D;  3ZRX A;  2ITC C;  4CBC A;  2JJ1 G;  4DXW A;  3LSS A;  3CCE V;  1SER A;  1I5Y A;  5IDJ A;  1FFT B;  2C2A A;  3JD4 A;  2B1G A;  2JJ2 G;  1M90 W;  2ZXW C;  3I55 V;  4MTG A;  3AG4 B;  5DN6 G;  1G8M A;  4R7C A;  1L1F A;  1GK9 A;  1PNK A;  2A9H A;  3F7V C;  2WLM A;  1WPX A;  2LFS A;  1Y4M A;  4RO2 A;  5B1N A;  3CCV V;  3EFF K;  1VQL V;  3TET A;  2BOC C;  1UJW B;  4MT8 A;  1LNQ A;  4N23 A;  2QEX V;  1JOY A;  4ZKI A;  5LHI A;  4JAS A;  1AI5 A;  2Q69 A;  4UUJ C;  1R73 A;  5EBM C;  1KEC A;  1OCZ B;  4KP4 A;  3GWO A;  1P7B A;  5FL7 G;  3SPG A;  4DO2 A;  4WF9 V;  3E8B A;  4MTO A;  1TUE B;  2ZDI A;  3R65 A;  1R3I C;  3CCJ V;  4P9P A;  2ATK C;  4ASU G;  3AG4 C;  2DYR C;  2UXX A;  3OEE G;  1GM9 A;  4I9W A;  4WCE V;  2EIK C;  2V1D A;  2EIN B;  4MW8 A;  3P32 A;  3CD6 V;  3ZMU A;  1F4N A;  4CZZ A;  2OT5 A;  5DM6 V;  1KD1 W;  2HG5 C;  2P6J A;  2JEU A;  4JTD B;  3SYQ A;  1W2B U;  2IJK A;  3ASO B;  2A79 B;  3X2Q C;  2W6I G;  1PNM A;  2X6B A;  5KUM A;  4QE9 A;  2HR3 A;  3SJQ C;  2GHY A;  2PI4 A;  1Q86 W;  2WLL B;  3LNM B;  1RM1 B;  4QE7 A;  1NVP B;  5GW7 A;  1FXH A;  2LP7 A;  3ETG A;  2D3O W;  2ZR3 A;  5L3F A;  1VQ9 V;  1GM7 A;  2EIL B;  2OCC B;  1JVM A;  1KP2 A;  5LGT A;  1PKX A;  5BZB A;  1VQN V;  1QLE C;  4GX5 A;  1VQO V;  2W0F C;  3LDE A;  3D36 A;  4QNH B;  3FYI B;  3IGA C;  4RUF A;  1GM8 A;  3ML0 A;  1BHA A;  2JK5 C;  3BEH A;  3OGC C;  1K5S A;  4PDV A;  3CCL V;  3ABM B;  1V54 B;  1XL6 A;  2XAS A;  4FMT A;  5C93 A;  1ENV A;  3RVY A;  5B1A C;  5J9P C;  2NNU A;  4FIP C;  3ABT A;  4WFH A;  4PA4 A;  1EFR G;  3ZMV A;  1E79 G;  2PI5 A;  3CC7 V;  3ABU A;  4G27 B;  4QJF B;  4MVM A;  2HVK C;  2DW4 A;  1NKD A;  1NR7 A;  4J9Z B;  4GX1 A;  5L3E A;  2B1I A;  2UXN A;  3UKM A;  1AR1 B;  1YJN V;  3WG7 B;  3TK1 A;  4PA9 A;  4MTX A;  1QBZ A;  5L3G A;  3ASN B;  1E1Q G;  3W7S A;  3E2E A;  1H8E G;  1THZ A;  1ROP A;  1B6Q A;  2WLN A;  4PDR A;  5HFL A;  1V54 C;  1SET A;  5EBW C;  3ZRS A;  4JAV A;  2ZR2 A;  1VQP V;  4WFE A;  1S76 D;  2IU3 A;  1S72 V;  4LC1 A;  1GTO A;  1F23 A;  3PJS K;  1DLB A;  3MHH C;  3G71 V;  4TWK A;  1M56 B;  1F4M A;  3QO5 A;  4GX2 A;  2A0L A;  4LBE C;  1YJ9 V;  2Q68 A;  1FXK C;  2R9R B;  4UVB A;  1HWY A;  3OE7 G;  5CMU A;  1AI6 A;  1K4C C;  5CBF A;  1R3L C;  1YIJ V;  1NQT A;  2JIZ G;  2AHY A;  3ZRV A;  3ETD A;  2R9I A;  5IYC O;  1K8A W;  4X8A A;  1IXM A;  2NLJ C;  4OXS A;  2WSS G;  2IJJ A;  3JD3 A;  1K97 A;  2DYR B;  3OUF A;  3T4D A;  4QPK A;  2EIK B;  1GKF A;  1NBM G;  3ZIA G;  2DQ0 A;  3CMA V;  1M56 C;  1S5H C;  3OW2 U;  1K7D A;  3AG2 C;  2EIM C;  4KUM A;  5LHG A;  4WFB V;  1GO3 F;  4QPJ A;  2HKO A;  1N8R W;  5CN0 A;  3X2Q B;  2ZD9 A;  4XDJ A;  2X6A A;  2EBO A;  4BW5 A;  2ZQM A;  1FS0 G;  3HB3 B;  5CA3 A;  1I5X A;  2EZO A;  1OHH G;  5B1O A;  2DQ3 A;  4GX0 A;  1PL0 A;  4BAY A;  2F43 G;  1QLE B;  4G2K A;  2HJF C;  1VQ5 V;  2K1E A;  3RBZ A;  4RQF A;  1NR1 A;  4MVR A;  1VQ6 V;  3CP1 A;  1JX9 A;  3OFN G;  1K9M W;  2W6J G;  1KP3 A;  2M7W A;  4X89 A;  4GCZ A;  2XAQ A;  3K9A A;  4BIU A;  3E83 A;  4UVA A;  5B1A B;  3FB8 C;  2Y69 C;  3F5W C;  4MS2 A;  3QO7 A;  2YSU B;  4XDK A;  1VQ8 V;  1W0K G;  2QKS A;  3FYE B;  3SPJ A;  3K3W A;  3B8N A;  3ZMT A;  5B1B C;  3VBB A;  4RQE A;  2JEX A;  1QVG U;  3OMI B;  3DTU B;  1S3J A;  1CEZ A;  2WLH A;  4U7O A;  4JYC A;  1QLN A;  1VQK V;  1YTF D;  3TCU A;  3ZN1 A;  2DWD C;  1YIT V;  3ABL C;  3EHB B;  3AG3 C;  4HAM A;  4MVO A;  1BHB A;  4G28 B;  1YSC A;  2IJI A;  1K34 A;  1K33 A;  2EIJ C;  3JD0 A;  2P7T C;  2WPD G;  1R3K C;  3SPH A;  5B3S C;  1FXV A;  1K4D C;  2H8P C;  5EK0 A;  3T1C A;  3T4Z A;  3A0R A;  5EC2 C;  4R8C A;  3E8G A;  1ARO P;  1DF5 A;  1R6K A;  4UV9 A;  3HPL C;  3SYA A;  3W7X A;  1M9N A;  1FXK A;  1V55 C;  1W0J G;  4XBF A;  1VQ4 V;  1P4R A;  3ETE A;  3UM7 A;  3I56 V;  2B5U A;  1G4Y B;  1GMG A;  4PA6 A;  4J9Y B;  3WFV A;  1FXK B;  4JTC B;  1OZ0 A;  4FJC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...