4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
1MOFA 2EZOA 1F23A 1JPXA 2LP7A 3WFVA 4E2LA 1QR8A 2EZPA 3B8MA 3CP1A 1DF5A 2P6JA 5CN0A 2X7RB 5KA6A 3CYOA 4FJCC 5H9CA 1DLBA 1SZTA 1JQ0A 1DF4A 2M7WA 4N21A 1Y4MA 2MK3A 3MHHC 2OT5A 1QBZA 1QR9A 4G2KA 3P30A 1I5YA 1K33A 5CMUA 3GWOA 4FIPC 4JGSA 3H01A 3M99B 5HFMA 3B8NA 4JPRA 4N23A 3B77A 1I5XA 4FK5C 1MG1A 3MHSC 2EBOA 5HFLA 1K34A 1EBOA 1QCEA 4JF3A 3K9AA 5KA5A 1ENVA 1Y66A
chains in the Genus database with same CATH superfamily
1PD3A 4UCUA 3K5NA 1RPRA 2Q73A 1JX9A 4O4HA 3SGIA 4AI8A 1D2DA 1Y4MA 2YIBA 3ASOB 3I5DA 3TXSA 1R73A 1J95A 1G8MA 4YJ2A 3OM3B 1B3QA 3X2QB 1KC8W 3ZMSA 4FLYA 1P49A 2FL4A 4Q6GA 4NXMO 4R6ZA 3JATA 4DV1O 5JCOC 4F6RB 4DR6O 1NVPB 1F23A 4E2LA 3RFRA 1VF6A 1H2MA 4GX5A 3JAWB 4X65O 2UUBO 4JTAB 5EC2C 4HBNA 4GKJB 3ZN1A 3K58A 5HFMA 4DV4B 3T1YB 3RYFA 5EYPA 2CDYA 1S3JA 3HKDB 1RPOA 4LNUA 1SA0B 4JZGA 2XAJA 1Q8IA 4X1IB 1HR0B 4JI2B 1BCCH 4LCUC 3WFVA 3DC6A 3SYAA 1IXBA 5KHKA 3OD4A 3CYOA 2R9AA 4PA7A 3U0ZA 1H8HG 2HVJC 2ZM6O 5BR8B 4I7ZB 4I5SA 2QR4A 3A0HZ 4LWSB 1YXBA 2F23A 4PDRA 4ZI7A 4WF9V 4KXRA 1Y66A 2CAZC 2WWWA 5BMVB 2F4VB 4JTCB 1FKAO 5JJJB 3B8MA 4JTDB 3FB6C 4XDLA 4DV3O 3OTOO 1N34O 4YXWG 2X6AA 1WNSA 1HDJA 2BCCH 3ZRWA 4FIPC 2XAQA 4ASUG 3DXRA 2B5UA 4IIJB 1LUWA 2UUAO 2WLHA 4CS3A 2EJRA 3RYIB 5IWAB 2K9PA 3F5TA 5K1XA 1V55C 3DC5A 5LYJB 2DMXA 5H9CA 1I0HA 1H2NA 4O4LB 1VP7A 3JARA 3GWOA 4GX1A 4JPRA 4FLTA 4G28B 1SRYA 3C90A 4ICGA 1Q6UA 2EZOA 1WJZA 1SESA 4YIOA 3AG1B 2R9RB 4EKWA 3ETQA 3UKMA 4U7NA 3ZHSA 1MSDA 2DWEC 4UVAA 4CS4A 3G71V 2A06H 4KFMA 3A8TA 5LBQA 3H9VA 2ITCC 1R3KC 2KQXA 1JOYA 2BTQA 2GTSA 2DYSB 1K3EA 2XAHA 2Q5ZA 3CCEV 2PUSA 3QVNA 3K59A 4QNHB 2ZIMA 3K5LA 2A79B 3HKEB 2LJ2A 2WLLA 4MVMA 4FK5C 2VQFB 5EZYB 4B3MO 1AVMA 4DUZB 4AQYO 4WFHA 1NH2D 1VQNV 1G6UA 4B3RB 2QWPB 4B3TO 3MD0A 5B3SB 1XMQO 1GN2A 3JASB 3ABUA 1S5LZ 1ZL8B 4KHPB 3UO2A 4X62O 1NU1H 2GDSA 2ADQB 1PV0A 2KKWA 3I56V 3CEIA 5LA6A 1FFXB 3RYCB 1XNQO 3ZCCA 4X1KB 4MVUA 4ZIBA 4FM1A 2ARHA 2YUAA 4UCTA 4BR6A 5IJ9A 1F4MA 2NR5A 5KMGB 1YHQV 4NTYA 1Z5WA 1D5AA 2AZ0A 4G2KA 3CXHF 1EN4A 1BS3A 1JCHA 4WFEA 4I9QA 3O9OA 4I0XB 5CA3A 5ITZB 5J2TA 3K06A 3KKYA 3ZMZA 5JH7A 1HNWO 5CA1A 4IGGA 1TUEB 4DR1O 4J41A 4PDVA 1P4RA 5EBWC 3JD4A 3CJHA 4DV5B 4JI4O 5LMUB 4OX9O 1N32O 3OMNB 4DR5B 4LFAO 2LGWA 4FZ0A 2JGUA 1DGSA 4MS2A 3RW0A 1AR1B 4ABMA 1IBLB 4DV7O 4IL6Z 4O2AB 5H5NA 3TXQA 1VQ8V 3OEHG 3G6BA 3CX5F 5KA6A 4YIPA 1YZBA 2UXDB 4JV5B 2ZXWB 3P3NA 2DYRB 1B6QA 2HG5C 2AGAA 3TK1A 1QVGU 1W0JG 3I55V 2ZCEA 3CHXA 2IBZH 3FFQA 4UUJC 4ZOLB 2E75B 1D5NA 1SQQH 3K9AA 4B08A 1BE3H 5IE9A 3ZX6A 2PYJA 5CN0A 4ZHQA 5FNVB 1QNMA 2XUMA 1KUQA 2KG7B 3AG7A 1U96A 4KP4A 3J7AU 1SQGA 2N04A 2B1GA 5GONA 3IC7A 3E8GA 1IBMO 5CA0B 2ZXWC 3LDCA 3DGEA 4RQFA 4PHZA 2LFRA 1AJPA 4AILC 4F6RA 3OR7C 4JYBA 1G1XB 3U11A 1YJNV 3E2EA 1GN6A 5LP6B 1BSMA 4DYLA 2Y69B 1QBZA 2KB1A 3GVMA 4PA6A 5LMUO 4TV8B 5L3FA 1MA1A 1PP9H 5DECA 4JYAO 1LNQA 3RYFB 4DUYO 3CD6V 1OCCB 2EIJB 1NJIW 5LOVB 4TV9B 4IHJA 3S3WA 3F7YC 4X1IA 2XAGA 1SQVH 1OJHA 1XUQA 1WA8B 3PJSK 4OXSA 1BHAA 3BA8A 1GM7A 1JR9A 2R72A 3LNMB 3AG3B 4UV9A 2QWQB 1VF5B 3L72H 2AW9A 5DM6V 2YEVB 3SYOA 3CB2A 4RWUA 4J7KA 2YIBD 1VQ4V 2FYUH 2WAMA 2Y4UA 1HNXO 4TSFG 1AP6A 3FB5C 3E86A 3P3PA 2WSSG 4H0LB 1SERA 4CH4A 1H2GA 2P4KA 3E35A 4DR3O 3BABA 2ZNIA 4DV4O 3B40A 2YXLA 4GKJO 4TUYB 3D36A 1S5HC 4J42A 2EIKB 5IY5B 3OFNG 1PL0A 4JI2O 3SPIA 4RO2A 4NTXA 4NTWA 4DV6O 3RN4A 3U10A 2OCCB 2Q69A 5B66Z 3CRAA 2JS3A 2XOKG 2EINB 4TQFA 2JGDB 2HLDG 2ZR2A 5CMUA 1TA8A 2LFSA 4X1YB 2OCHA 5D5PA 1E79G 5FL7G 5J9PC 4XBFA 5IWAO 4NXMB 1OCOC 2IJIA 3ZJZA 4D7TA 5J2UA 4QE9A 1HP8A 3ASOC 3VQVA 4LF6B 2OCCC 1KMIZ 1ZLZA 1M57B 1XOUA 3ETGA 3CCRV 4H13B 1T5EA 2E5LO 1MNGA 4UCVA 3B2EE 4DV2B 3ABKC 2Q4PA 4I55A 1WLEA 4I50A 1BL8A 1K92A 1IURA 2BTQB 3WB0A 1H2KA 3L9DA 4LF7B 2RCVA 3EHBB 1M9NA 5L3GA 2ZINA 4JI5B 1NKDA 4LFAB 1CPYA 5IYCO 4X62B 3JD0A 4FLVA 4MW3A 4Z1MG 1ZUQA 1Q3EA 3H1JH 1S0VA 3WB1A 2V1DA 4MW8A 1N8RW 1NI8A 3G67A 3AK3A 1QR8A 3TETA 2WLKA 1IZ3A 1JFFA 1Y6XA 4JV5O 4FJCC 3K5OA 1HNZO 4FM2A 2Z5UA 3G4SV 1K33A 2VRZA 3H1KH 1N34B 4H37A 4TWKA 5H6QA 2E5LB 4UVCA 1GM8A 2QKSA 2ZNJA 3RYHA 1FFXA 3SYQA 5LHGA 3RYCA 2EIMB 4B3RO 2WLNA 1UPGA 4HZ3A 5GTHZ 2UUCO 1WP7A 5E1AC 2QM7A 1R3JC 4NVPA 5C93A 1ROPA 5KHJA 4KUMA 2UXXA 4HNAB 3JAKA 2RQ6A 2YXYA 3LUTB 4OGQB 5JQGA 3BY6A 1M93A 2QM8A 4I0XA 2EBOA 5HFLA 2YDEA 4EB6B 2ZE8A 4DV0O 2JEXA 4JYYA 5JH7B 1Y76A 4B3TB 2MW2B 2QJ1A 4GUNA 4YHHB 5H2FZ 4DV1B 2CE4A 3LSSA 1YIJV 2EILC 3JSNA 2X6BA 2MK3A 4OPAA 3ZEDA 4FPPA 5KHHA 2UU9B 1AR5A 3VOUA 3MHSC 2GTAA 3AG4C 2Q9LA 3CRMA 1P7BA 1TVKA 1XL6A 4DO2A 2YIAA 1X59A 4DR7O 4GKKB 3CCUV 3RT3C 1Y74A 1QLEB 3VQWA 4LFCB 4Z2WA 4O4HB 1FXHA 1XL4A 4CC6A 5IT9N 1YITV 4UXNA 3D3QA 4JI6B 3WG7B 4GZRB 4X66B 4FLWA 1NZ6A 2GV9A 3M99B 3HKBB 3E22B 3L71H 1SQXH 4ZOLA 4X88A 4L87A 1QLNA 2PY5A 2BSKA 2OWOA 1S5JA 3RVYA 1RSOB 1YDXA 4ZHQB 3O65A 4UCOA 2HJFC 2JVDA 3OMAB 3C3TA 3FB7C 1XILA 2QWNB 1WB8A 2A0LA 4W4LA 1LR1A 4WFAV 1HW7A 3BHPA 3ASNB 3FX7A 1JJOA 3HKDA 1WPBA 3K57A 5LMNB 4DW0A 5B3SC 4LBEC 3QO8A 1XMOO 1FPOA 5F2VO 5JCOA 3E8HA 1I94O 3E8BA 1CEZA 3LDEA 2QEXV 1VF6C 1K9MW 1NTKH 5IYDO 4JF3A 1K7DA 1S77D 4DR4O 4B7EA 3N2GB 4DR2O 4KHPO 4RUEA 2EIJC 2YICA 1U97A 5B1AC 1JVMA 2NNUA 4H33A 2YS8A 4JI6O 1K4DC 1QU7A 3QG5A 1TUBA 2UUCB 2ZIOA 4K0KO 3RYIA 4JI3O 3G6EV 1ENVA 2IH1C 5KLVH 1YSCA 1FXKB 2RN9A 3ETEA 1YI2V 2F1MA 4R50A 4ZKIA 1SZXA 3OGIB 3P30A 1DTOA 2XTAA 1K8AW 3N27A 4JGSA 3H01A 3ZHQA 1F7YA 1DK1A 2YI8A 5B1AB 1PPJH 4PI2A 5BXZA 2WLIB 3HKCB 2LW7A 1HNXB 3ZMUA 3N2KA 3FB8C 2DJVA 4QPKA 2H8PC 1YTFD 3DTUB 1P84F 4JI1O 5IJ0A 1ZWIC 2JGDA 1I94B 2QWOB 1XNQB 1YCIA 1KB9F 4X1YA 3CRRA 3VBBA 1A32A 2GHYA 3H1LH 3ABMC 1PKXA 4MTGA 3UM7A 2ZE7A 3ICXA 4DR3B 3QTCA 3Q4HB 1SETA 2WLLB 1V55B 3SJCC 5EZYA 5IDJA 4CC5A 1KECA 1VIBA 2Y0PA 1EFRG 1NTZH 3RBZA 1QCEA 3VQYA 3JCZA 3RVZA 4DRXA 2YC0A 4UCRA 4I55B 3F7VC 1E1QG 3W7UA 4X66O 2EULA 3X2QC 2ZE5A 4DUZO 4PA3A 2ZKOA 3EXAA 4X1KA 2ILMA 4I4TA 5IJ9B 5LL6Y 1WB7A 1CXZB 1M1KW 5FPRA 2AZ2A 2IJJA 3DSQA 3W7WA 4UB8Z 1XBLA 4W4KA 3E89A 1AROP 1AI5A 3H1HH 4B3MB 1R1BA 3AK1A 1FXVA 1XNRB 4XDJA 1RFYA 1NQTA 4U3FH 2LW1A 2P4VA 2DQ0A 2K1EA 5L3BA 2W0XA 1CP9A 2P22C 3CJHB 5IYZB 2HFEC 3K0DA 2BTOA 2VQEB 5CB4B 4AHCA 4TT3G 3OT7A 2QE7G 1M5IA 2YI9A 5FPOA 3JAKB 4FLZA 1MSWD 4O2AA 4P9PA 3ZBHA 1V54C 5EBLC 4IYIA 4CBCA 1F4NA 2E76B 2V7QG 3ZHTA 1NS1A 4FMTA 1UJWB 1PNLA 2XNDG 2PYLA 4O2BA 5KX5B 3K04A 4H44B 2UUAB 3STZC 1M4UA 3K0GA 1TVKB 2PGGA 1OCOB 1R6NA 1QQCA 2JS5A 4UB6Z 1HR0O 3OTFA 4J11A 1PNKA 1W59A 1IX9A 4QIWF 3JD1A 3IC9A 1S76D 3QO7A 2QGNA 4K8XA 2ZM6B 3E22A 3STLC 2IM9A 2CH7A 1BMFG 2IW5A 3CCMV 2PI5A 1FAFA 3OUFA 2Q7EA 3UCSC 5LMNO 1XHXA 2RDCA 4IT5A 4UV8A 1Y67A 5LXTB 3KG2A 3P32A 2PI4A 3KCXA 1OV9A 4TV8A 2HVKC 1S72V 3R66A 3FYIB 3ZHUA 5BR8O 2L35A 4RAIA 3ZN0A 1IBKB 4FVMA 4LFCO 4EEQA 5CBGA 3ASNC 4IHJB 3BA9A 5DN6G 1RM1C 5JVDA 2Y4TA 1THZA 4J80A 3APOA 4NKGB 3GWKC 4DR4B 1OCRB 4X64O 4JAUA 2F66C 2RJZA 2FB5A 2A7WA 1VQOV 5BY1A 1YEWA 1BHBA 4DW1A 4LH7A 2IU0A 4FFBB 3BRCA 3J80N 2NN4A 3N2GA 2X7RB 4LF5B 3T1HB 2HHHB 3FD9A 1R6TA 3CCVV 1GO3F 3FAVB 1MZEA 2Q0OC 1R3IC 1MG1A 3JALB 4YJ3A 2BOCC 2DQ3A 4BWAA 1TUBB 4B3SO 2IJHA 1EN6A 5L3EA 4CH3A 4DV3B 1BZKA 1VQLV 3C3SA 4U7OA 3LNNA 2QWRB 3E8FA 1G4YB 1J5EO 2DE0X 4MVOA 2LGQA 3CC4V 1VQ6V 2ADPA 5IYBO 2QKAA 5AG2A 3SPGA 5EBMC 1N0NA 3HKCA 4J9ZB 2KSDA 5J2UB 4JYCA 2O57A 4P30A 1JQ0A 4KL1A 3WG7C 5IJ0B 4LF7O 3AG2B 4JAAA 4WFBV 2ETNA 1MZFA 5FLXN 4ZBMA 4PA4A 3G80A 2E74B 1Q82W 4FFKA 4I50B 3L73H 2P6JA 2VQEO 4D7SA 1XMQB 5LP6C 2OYQA 1L0LH 3CWBH 3L75H 3LSQA 3QO5A 3HPLC 3WU2Z 4FLXA 1R3LC 5GTIZ 1SQPH 5A2QN 1NVPD 1JFFB 4JI1B 2LQTA 3T4DA 4DRXB 4WBNA 2WLMA 2VS0A 4U3JA 3OR6C 2E3CA 3NR7A 3K03A 2UU9O 4LF6O 2Z3YA 2Y48A 4DV5O 1XHZA 4I4TB 5KAIZ 1ORQC 3ZHVA 3JD3A 2W0FC 1V9PA 1M57C 4PI0A 2ODMA 5LHHA 1HNWB 3HR0A 2JIZG 2LO1A 3TGUH 4Z1VA 4WFGA 4HNAA 2XHBA 4PD4F 1URFA 4MVQA 3GB7C 2CGOA 2WPDG 1XI1A 4LF4O 4EB6A 2M6YA 4XDKA 1OCCC 3AEIA 5KA5A 3CCJV 2CTRA 5JJNB 1O9GA 3M7MX 1H2LA 2QM4A 5IYZA 2R9IA 3UT5A 4R8CA 4E4EA 3QF7A 1IDSA 2UXCO 2RMKB 2P90A 3TJTA 3ABLC 4GT1A 3CXCU 4X20B 2P67A 4LR3A 1Y74B 4AQYB 3CRCA 1VMGA 5KHIA 4UVBA 2OTJV 1JA8A 3PN1A 5CBHA 1VQ9V 1V54B 4J7JA 2UXCB 1KYOF 1VQPV 4X65B 2UUBB 2UXBO 1N0JA 3HKBA 4OPHA 4O2BB 1K5SA 2ZR3A 3K79A 1OZ0A 1NBMG 5KX5A 3MAQA 1EBOA 3KCYA 1WAZA 1Q6HA 1XNRO 2BSKB 1QHTA 5BZBA 1DF4A 3AG1C 3J81N 1JPXA 2R70A 2PF4E 2CTPA 1ZSPA 2H3OA 1RSOA 4QGPA 2YIDA 5JWPA 3ABLB 3CC2V 1BQ0A 2EILB 3CC7V 2OIGA 3IAYA 1GRJA 1SS3A 1KKCA 2CH7B 1KBHA 3AG4B 4X8AA 2PZSA 4GLXA 2BOBC 2JJ1G 1MMMA 2RNBA 2W6JG 1DLBA 4N21A 5LXTA 1YJ9V 4G27B 1NR7A 2Q7GA 3JAWA 1OHHG 1EZJA 1KD1W 1VQ5V 1P7GA 3BPZA 2B9ZA 3CMAV 3HB3B 4X89A 3SPHA 1MOFA 4LNUB 5EIBD 1N33O 4JI7O 1SA0A 5JVDB 4MSWC 2DN9A 3K5MA 4DR1B 1L0NH 2D2CB 2Q68A 1BQZA 4Q20A 2OT5A 1W0KG 1GM9A 4OX9B 1N32B 3CPWU 4UCSA 4DR5O 1YF2A 4GX2A 2X0LA 1GH6A 1FJGB 2AHZA 4GCZA 1GN4A 4FFBA 1H2SB 1JJ2U 4DK1A 3VQXA 1I08A 1BT8A 1FXKA 2ZE6A 1QVFU 5KHGA 2VWKA 3L74H 4BIOA 4GX0A 3RGBA 1NTMH 3FAVA 2A9HA 2UXBB 4K0KB 3CCLV 1I5XA 1SQBH 5JJEB 3IJ4A 2WLIA 5TISZ 1VF7A 4YJ3B 2CK3G 3N2KB 2DYSC 4BIUA 1HNZB 4PDLA 3A0BZ 1XMOB 4CH5A 5LYJA 4PV1B 4O4LA 1SQFA 2QSAA 1FJGO 1TAEA 3CCQV 3KZIZ 2JJ2G 1OCRC 1R6KA 2XT9A 3ZMVA 1AR4A 1M56B 4PDMA 4LF9B 4NXNO 3B4SA 2XAFA 4BIZA 1M90W 1EZVH 2GUZA 3OUSA 2BE3A 3Q4HA 3B09A 1FXKC 2CTWA 2D3OW 1WPXA 3B8NA 4N23A 2GBOA 1EM1A 1ZX3A 5CBFA 4MTXA 5C8YB 3AG2C 4EFBA 2F43G 1AJQA 5LGTA 1Q5OA 1AB3A 2F95B 2HR3A 3H1IH 4DK0A 3FKSG 2XASA 3ZMTA 4NR1A 4BW9A 1SZTA 4R7CA 1J5EB 2L6LA 1M56C 2WA4A 4LC1A 4J7ZA 4FLUA 4K8ZA 1IBLO 4HAMA 5GW7A 4BAYA 4JI0O 1IVSA 4DV7B 2UXNA 3UQ8A 4K35A 4O4JA 2IU3A 4P2ZA 4TQDA 3K9SA 4U3JB 1QR9A 3JSLA 1YTFB 1XDCA 5B1NA 3JYCA 2EIKC 1W2BU 1MABG 3EFFK 2JDIG 3QNEA 4NB5A 2GSMB 2FKXA 4O4IB 5EIBC 5CB4A 2CUGA 2EINC 4PJ0Z 5EK0A 3A2FA 4DXWA 3D36C 3RWRD 1COWG 3OEEG 3CCSV 2B1IA 2X6CA 5J2TB 3AG3C 3SJQC 4F6EA 5LGUA 3OW2U 1KU9A 3MHHC 4PELA 2ZQMA 1SF9A 5LHIA 4JI8B 2OTLV 3D8CA 3WB2A 3TCUA 2N74A 1Q81W 4CS2A 1K73W 3JCUZ 3OAAG 1L8DA 3M8AA 1AJNA 2NLJC 3ZRXA 1I7FA 3CP1A 1GN3A 3ABMB 3R65A 2WA3A 5H6RA 5L3CA 4YJ2B 2G38A 1WN7A 2Q8VA 2AXTZ 4LF8O 3IGAC 1US6A 4B3SB 1NH2B 1VEWA 2EJ7A 1GTOA 1SKVA 4JASA 3F5WC 5B1BB 3JATB 5A9GA 1PM9A 1WP8A 2QTSA 2ZD9A 2YXHA 3CSXA 1GKFA 3A0RA 2P7TC 4JI4B 4HYOA 1AILA 4EFEA 3SDLA 5FNVA 5LGNA 2KG7A 2HKOA 2QKCA 5EYPB 2Q67A 4I9WA 5GONB 5B5EZ 1K97A 3IFXA 3SYCA 3CE2A 1XQ8A 3ABTA 5CA0A 1N36B 5E79Z 1Q86W 4DV0B 3S3XA 2EX3A 3W7SA 4JI3B 1XREA 2JEUA 2Q7HA 4J9YB 3OE7G 2HJDA 3BEHA 2YSUB 5B1BC 4YHHO 5LP6A 4L8JA 3BAAA 2W6IG 4D6TH 4YY3B 5L3DA 3FYEB 1VQ7V 4JI8O 2ZDIC 1Q90D 5IY5C 1Z5VA 1IBKO 1FFTB 1PNMA 3CMEV 1L1FA 2VWJA 1GAXA 4LWSA 1PL4A 4ZI7B 5BMVA 4LFBB 4DR6B 3MDSA 3ML0A 1FD9A 4TOIA 5LOVA 3OGCC 4TV9A 1KP3A 4UFZA 2M7WA 3LSUA 1WA8A 4JZ2A 3BCCH 3ZRWB 4MVRA 1KP2A 2DWDC 3EVKA 1YJWV 3T4ZA 1OCZC 3JALA 2A3QA 3DXRB 4IIJA 3T1YO 4DUYB 3SJBC 2YEVA 3BVOA 2ATKC 1LUVA 1IXMA 5B1OA 1Z2GA 4JAVA 4DR7B 4GKKO 4DV2O 3OTOB 3CS5A 2JRIA 3K3WA 3L70H 1AP5A 3ZS8C 1RM1B 3CRQA 3JARB 1GMGA 3W7TA 4GYCB 4TUYA 1UFIA 2VQFO 3SR2C 3ABKB 2DW4A 2CGNA 2ZDIA 3OMIB 4QPJA 4QJFB 3THOA 1N36O 4NYKA 4IYHA 1VQMV 1OCZB 5DEDA 1DF5A 2DOSA 2C2AA 1EN5A 1BGYH 1B06A 3E83A 2HP8A 1B04A 4MVZA 1E1RG 2F93B 4F4LA 2FMLA 1XEQA 3APQA 1X4TA 4LFBO 4DV6B 4WFFA 5K1PA 2IH3C 1H38A 2UXDO 2Z0AA 5EC1C 2N05A 4MT8A 2JK5C 3T1HO 2HHHO 1N33B 2GUZB 3SPJA 3ETDA 4C7UA 2WLJA 3HKEA 2OIEA 2EIMC 4PA9A 3AK2A 2QA4V 5KAFZ 1JMKC 1SC5B 2PTMA 3BFRA 3SJAC 1VARA 5C8YA 4MTOA 4LF4B 4LF9O 2Q0AA 3UO3A 3JASA 4WBNB 1ZL8A 3LDDA 1K4CC 2Y69C 3SYPA 5LA6B 4LF8B 4CH6A 2V4DA 2AHYA 1NR1A 4X64B 1RP3B 2P06A 2QDOA 1YVWA 2QTOA 2ITDC 5KUKA 2Q6AA 3T2MA 2H94A 1F51A 3JD2A 5KMGA 1GK9A 4A5UB 4NXNB 4LH6A 2ZT9B 1AI7A 2HEPA 3NXSA 2F4VO 4QE7A 4O4JB 4CZZA 1N4CA 2FTKA 1HWYA 1ZAUA 5ITZA 2CTQA 1QLEC 1K34A 4DR2B 3RYHB 1AI4A 1AI6A 3JAMN 4LP8A 5CA1B 1FYJA 1ZTEA 4FZ1A 2IJKA 2LP7A 4B7KA 4MVSA 1KKDA 2EZPA 4WCEV 4X9QA 4J10A 3UT5B 4O4IA 1NT2B 4FM0A 4K3AA 1O9HA 4JI5O 3ZRSA 5D5QA 1Q43A 3T1CA 3ZHRA 5JQGB 1IBMB 4X20A 4JI7B 4BW5A 1K5QA 4RUFA 4JI0B 4MTFA 2P5OA 1Q6IA 1Y76B 4LF5O 2DYRC 2Y0IA 1TGOA 5KUMA 3W7XA 1VQKV 1Q7YW 1H8EG 4P9OA 3SPCA 4YY3O 3D3IA 3K08A 1I5YA 1FS0G 3ZRVA 3B77A 4RQEA 4JYAB 3ZIAG 1KQSU
chains in the Genus database with same CATH topology
1OCOB 1PD3A 1R6NA 1OCOC 2IJIA 2XAFA 1RPRA 4BIZA 1M90W 1JX9A 3ZJZA 4QE9A 3OUSA 3ASOC 1Y4MA 3ASOB 1PNKA 1R73A 1J95A 1FXKC 1G8MA 2D3OW 3OM3B 1WPXA 3JD1A 4QIWF 3X2QB 2OCCC 3B8NA 4N23A 1S76D 3QO7A 1KC8W 3ZMSA 5CBFA 4MTXA 1M57B 3AG2C 2F43G 3STLC 3ETGA 1AJQA 3CCRV 4R6ZA 5LGTA 1BMFG 2IW5A 3CCMV 2HR3A 3ABKC 1NVPB 2PI5A 3FKSG 1F23A 2XASA 3OUFA 4E2LA 1WLEA 1BL8A 1K92A 4UV8A 3ZMTA 3KG2A 1SZTA 3P32A 4GX5A 4R7CA 2PI4A 1M56C 3EHBB 1M9NA 4JTAB 5L3GA 4LC1A 5EC2C 2HVKC 3ZN1A 1NKDA 1CPYA 5HFMA 5IYCO 1S72V 3FYIB 3JD0A 4HAMA 4MW3A 5GW7A 1KQSU 4Z1MG 4RAIA 3ZN0A 1S3JA 4BAYA 1S0VA 1RPOA 2V1DA 4MW8A 5CBGA 1N8RW 3ASNC 5DN6G 2XAJA 1RM1C 2UXNA 4LCUC 3WFVA 3SYAA 1QR8A 3TETA 2WLKA 1THZA 3CYOA 4FJCC 4PA7A 2IU3A 4P2ZA 1OCRB 2Z5UA 3G4SV 1H8HG 1QR9A 2HVJC 1K33A 4JAUA 4H37A 4TWKA 5H6QA 1VQOV 4UVCA 1GM8A 1YTFB 1BHBA 2QKSA 3SYQA 4I5SA 5LHGA 5B1NA 2EIMB 3JYCA 2EIKC 2IU0A 1W2BU 1MABG 3EFFK 4PDRA 4WF9V 2WLNA 1Y66A 2WWWA 2JDIG 4HZ3A 3QNEA 2GSMB 4JTCB 3B8MA 4JTDB 3FB6C 5E1AC 2X7RB 2QM7A 1R3JC 5C93A 4XDLA 1ROPA 2EINC 5EK0A 3CCVV 4YXWG 2X6AA 1GO3F 4DXWA 4KUMA 3ZRWA 2UXXA 1COWG 3OEEG 4FIPC 2XAQA 4ASUG 3LUTB 1R3IC 3CCSV 3BY6A 2QM8A 1MG1A 2B1IA 2BOCC 2EBOA 2X6CA 5HFLA 2B5UA 2DQ3A 3AG3C 3SJQC 2WLHA 2JEXA 5LGUA 3OW2U 2EJRA 3MHHC 2IJHA 4PELA 2ZQMA 5L3EA 3LSSA 1YIJV 2EILC 1V55C 5LHIA 5H9CA 2X6BA 2MK3A 2OTLV 1VQLV 4U7OA 3E8FA 1Q81W 3TCUA 4FPPA 1K73W 1G4YB 3GWOA 4GX1A 3VOUA 4MVOA 3CC4V 4JPRA 1VQ6V 3OAAG 3MHSC 3AG4C 4G28B 5IYBO 1SRYA 3SPGA 1P7BA 1XL6A 5EBMC 4DO2A 1AJNA 2NLJC 3CCUV 1QLEB 2EZOA 3ZRXA 4J9ZB 1FXHA 3CP1A 1XL4A 4JYCA 1SESA 3AG1B 4P30A 3ABMB 2R9RB 4EKWA 3R65A 1JQ0A 5H6RA 4UXNA 5L3CA 1YITV 3WG7C 3UKMA 3WG7B 4U7NA 3AG2B 3IGAC 4WFBV 2DWEC 3M99B 4UVAA 3G71V 4KFMA 1NH2B 5LBQA 1GTOA 4JASA 3F5WC 5B1BB 4ZBMA 2ITCC 2ZD9A 4PA4A 4X88A 4L87A 1R3KC 1QLNA 1Q82W 1GKFA 3A0RA 2P7TC 1JOYA 2P6JA 4HYOA 2DYSB 3RVYA 1K3EA 2XAHA 3CCEV 5LGNA 2HJFC 3OMAB 2HKOA 3FB7C 4QNHB 2A0LA 2A79B 2WLLA 4WFAV 2Q67A 4MVMA 4FK5C 3QO5A 3LSQA 4I9WA 3HPLC 3ASNB 1K97A 3IFXA 3SYCA 1R3LC 3ABTA 4WFHA 1NH2D 1VQNV 1Q86W 3MD0A 5B3SC 1NVPD 4LBEC 3T4DA 5B3SB 3QO8A 3W7SA 4J9YB 2JEUA 2WLMA 3ABUA 3OE7G 3BEHA 2YSUB 5B1BC 3E8HA 3OR6C 2W6IG 3E8BA 3K03A 5L3DA 3FYEB 1VQ7V 1CEZA 2ZDIC 2Z3YA 3LDEA 2Y48A 5IY5C 3I56V 2QEXV 1FFTB 1PNMA 3CMEV 1K9MW 1L1FA 3ZCCA 5IYDO 4MVUA 4JF3A 1ORQC 3JD3A 2W0FC 1K7DA 1F4MA 1S77D 1M57C 3ML0A 5LHHA 1YHQV 3OGCC 4RUEA 2JIZG 2EIJC 1KP3A 5B1AC 2M7WA 4WFGA 1JVMA 4G2KA 3ZRWB 4MVRA 1KP2A 2DWDC 2NNUA 4H33A 1JCHA 1K4DC 1YJWV 4WFEA 3T4ZA 1OCZC 5CA3A 4MVQA 3GB7C 2WPDG 2YEVA 4XDKA 1OCCC 3K06A 3ZMZA 3AEIA 2ATKC 3G6EV 1IXMA 5KA5A 1ENVA 5B1OA 3CCJV 4JAVA 1TUEB 2IH1C 1YSCA 1FXKB 4PDVA 1P4RA 3ETEA 3K3WA 5EBWC 1YI2V 3JD4A 1RM1B 4R50A 2R9IA 4ZKIA 1GMGA 3OMNB 3P30A 1DTOA 4R8CA 1K8AW 3W7TA 4JGSA 3H01A 4MS2A 3RW0A 3ABKB 1AR1B 2P90A 2DW4A 5B1AB 2WLIB 3ABLC 4GT1A 3CXCU 2ZDIA 2P67A 3OMIB 4QPJA 4QJFB 3ZMUA 1VQ8V 3FB8C 3OEHG 1VQMV 1OCZB 4QPKA 2H8PC 1YTFD 3DTUB 4UVBA 1DF5A 2OTJV 5KA6A 2C2AA 5CBHA 1VQ9V 1V54B 2ZXWB 1VQPV 3E83A 1ZWIC 2DYRB 1B6QA 4MVZA 2HG5C 3TK1A 1E1RG 1QVGU 1W0JG 3I55V 1K5SA 2ZR3A 3K79A 4F4LA 1OZ0A 1NBMG 4UUJC 1EBOA 3VBBA 3K9AA 2GHYA 1DF4A 5BZBA 3AG1C 4WFFA 3ABMC 1JPXA 2IH3C 1H38A 1PKXA 4MTGA 5EC1C 5CN0A 3UM7A 4MT8A 2JK5C 3ABLB 3SPJA 3ETDA 4KP4A 1SETA 2WLJA 3CC2V 2EILB 1V55B 2B1GA 2WLLB 2EIMC 4PA9A 2QA4V 3CC7V 5IDJA 1KECA 3IC7A 3E8GA 1EFRG 2ZXWC 3LDCA 4MTOA 1QCEA 3RBZA 3DGEA 4RQFA 2LFRA 1AJPA 3JCZA 3RVZA 3AG4B 3OR7C 4JYBA 4X8AA 2BOBC 2JJ1G 1YJNV 3E2EA 3F7VC 1E1QG 3LDDA 2W6JG 1DLBA 1K4CC 4N21A 3W7UA 1YJ9V 2Y69B 1QBZA 4G27B 1NR7A 2Y69C 3SYPA 2KB1A 4PA6A 1OHHG 1EZJA 3X2QC 4PA3A 5L3FA 2AHYA 1NR1A 1KD1W 1VQ5V 1LNQA 3CMAV 3CD6V 1OCCB 3HB3B 2QTOA 2ITDC 5KUKA 2EIJB 2Q6AA 4X89A 3SPHA 2H94A 1F51A 3JD2A 3T2MA 1GK9A 1MOFA 1NJIW 1M1KW 3F7YC 2XAGA 4MSWC 2IJJA 1AI7A 3PJSK 3NXSA 4OXSA 3W7WA 2Q68A 4Q20A 2OT5A 4QE7A 4CZZA 1W0KG 1BHAA 2FTKA 1GM9A 1GM7A 3CPWU 1HWYA 3LNMB 3AG3B 4UV9A 3E89A 1AROP 1AI5A 4GX2A 5DM6V 2YEVB 2X0LA 3SYOA 1QLEC 1K34A 2AHZA 1VQ4V 1AI4A 1AI6A 4GCZA 4LP8A 1FXVA 2WAMA 1JJ2U 4XDJA 1NQTA 4TSFG 2DQ0A 3FB5C 2IJKA 1FXKA 2K1EA 2LP7A 2WSSG 3E86A 4MVSA 5L3BA 2EZPA 1SERA 1KKDA 1CP9A 4WCEV 1QVFU 1H2GA 3E35A 2HFEC 3K0DA 4GX0A 3ZRSA 4TT3G 2QE7G 2A9HA 3T1CA 3CCLV 3D36A 1I5XA 1S5HC 2WLIA 2EIKB 1MSWD 5IY5B 3OFNG 2CK3G 1PL0A 3SPIA 4RO2A 1K5QA 4RUFA 4BW5A 4P9PA 2DYSC 4MTFA 1V54C 5EBLC 4CBCA 4BIUA 1F4NA 2OCCB 2Q69A 2DYRC 2V7QG 4PDLA 5KUMA 3W7XA 4FMTA 1VQKV 1UJWB 2XOKG 1Q7YW 2EINB 1PNLA 1H8EG 4P9OA 2XNDG 3SPCA 2HLDG 3D3IA 3K08A 2ZR2A 1I5YA 5CMUA 2LFSA 1FS0G 3ZRVA 3B77A 4RQEA 3CCQV 3K04A 3STZC 1E79G 5FL7G 5J9PC 2JJ2G 1OCRC 1R6KA 4XBFA 3ZIAG 3ZMVA 1M56B 3K0GA 4PDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOF A;  2EZO A;  1F23 A;  1JPX A;  2LP7 A;  3WFV A;  4E2L A;  1QR8 A;  2EZP A;  3B8M A;  3CP1 A;  1DF5 A;  2P6J A;  5CN0 A;  2X7R B;  5KA6 A;  3CYO A;  4FJC C;  5H9C A;  1DLB A;  1SZT A;  1JQ0 A;  1DF4 A;  2M7W A;  4N21 A;  1Y4M A;  2MK3 A;  3MHH C;  2OT5 A;  1QBZ A;  1QR9 A;  4G2K A;  3P30 A;  1I5Y A;  1K33 A;  5CMU A;  3GWO A;  4FIP C;  4JGS A;  3H01 A;  3M99 B;  5HFM A;  3B8N A;  4JPR A;  4N23 A;  3B77 A;  1I5X A;  4FK5 C;  1MG1 A;  3MHS C;  2EBO A;  5HFL A;  1K34 A;  1EBO A;  1QCE A;  4JF3 A;  3K9A A;  5KA5 A;  1ENV A;  1Y66 A; 
#chains in the Genus database with same CATH topology
 1PD3 A;  4UCU A;  3K5N A;  1RPR A;  2Q73 A;  1JX9 A;  4O4H A;  3SGI A;  4AI8 A;  1D2D A;  1Y4M A;  2YIB A;  3ASO B;  3I5D A;  3TXS A;  1R73 A;  1J95 A;  1G8M A;  4YJ2 A;  3OM3 B;  1B3Q A;  3X2Q B;  1KC8 W;  3ZMS A;  4FLY A;  1P49 A;  2FL4 A;  4Q6G A;  4NXM O;  4R6Z A;  3JAT A;  4DV1 O;  5JCO C;  4F6R B;  4DR6 O;  1NVP B;  1F23 A;  4E2L A;  3RFR A;  1VF6 A;  1H2M A;  4GX5 A;  3JAW B;  4X65 O;  2UUB O;  4JTA B;  5EC2 C;  4HBN A;  4GKJ B;  3ZN1 A;  3K58 A;  5HFM A;  4DV4 B;  3T1Y B;  3RYF A;  5EYP A;  2CDY A;  1S3J A;  3HKD B;  1RPO A;  4LNU A;  1SA0 B;  4JZG A;  2XAJ A;  1Q8I A;  4X1I B;  1HR0 B;  4JI2 B;  1BCC H;  4LCU C;  3WFV A;  3DC6 A;  3SYA A;  1IXB A;  5KHK A;  3OD4 A;  3CYO A;  2R9A A;  4PA7 A;  3U0Z A;  1H8H G;  2HVJ C;  2ZM6 O;  5BR8 B;  4I7Z B;  4I5S A;  2QR4 A;  3A0H Z;  4LWS B;  1YXB A;  2F23 A;  4PDR A;  4ZI7 A;  4WF9 V;  4KXR A;  1Y66 A;  2CAZ C;  2WWW A;  5BMV B;  2F4V B;  4JTC B;  1FKA O;  5JJJ B;  3B8M A;  4JTD B;  3FB6 C;  4XDL A;  4DV3 O;  3OTO O;  1N34 O;  4YXW G;  2X6A A;  1WNS A;  1HDJ A;  2BCC H;  3ZRW A;  4FIP C;  2XAQ A;  4ASU G;  3DXR A;  2B5U A;  4IIJ B;  1LUW A;  2UUA O;  2WLH A;  4CS3 A;  2EJR A;  3RYI B;  5IWA B;  2K9P A;  3F5T A;  5K1X A;  1V55 C;  3DC5 A;  5LYJ B;  2DMX A;  5H9C A;  1I0H A;  1H2N A;  4O4L B;  1VP7 A;  3JAR A;  3GWO A;  4GX1 A;  4JPR A;  4FLT A;  4G28 B;  1SRY A;  3C90 A;  4ICG A;  1Q6U A;  2EZO A;  1WJZ A;  1SES A;  4YIO A;  3AG1 B;  2R9R B;  4EKW A;  3ETQ A;  3UKM A;  4U7N A;  3ZHS A;  1MSD A;  2DWE C;  4UVA A;  4CS4 A;  3G71 V;  2A06 H;  4KFM A;  3A8T A;  5LBQ A;  3H9V A;  2ITC C;  1R3K C;  2KQX A;  1JOY A;  2BTQ A;  2GTS A;  2DYS B;  1K3E A;  2XAH A;  2Q5Z A;  3CCE V;  2PUS A;  3QVN A;  3K59 A;  4QNH B;  2ZIM A;  3K5L A;  2A79 B;  3HKE B;  2LJ2 A;  2WLL A;  4MVM A;  4FK5 C;  2VQF B;  5EZY B;  4B3M O;  1AVM A;  4DUZ B;  4AQY O;  4WFH A;  1NH2 D;  1VQN V;  1G6U A;  4B3R B;  2QWP B;  4B3T O;  3MD0 A;  5B3S B;  1XMQ O;  1GN2 A;  3JAS B;  3ABU A;  1S5L Z;  1ZL8 B;  4KHP B;  3UO2 A;  4X62 O;  1NU1 H;  2GDS A;  2ADQ B;  1PV0 A;  2KKW A;  3I56 V;  3CEI A;  5LA6 A;  1FFX B;  3RYC B;  1XNQ O;  3ZCC A;  4X1K B;  4MVU A;  4ZIB A;  4FM1 A;  2ARH A;  2YUA A;  4UCT A;  4BR6 A;  5IJ9 A;  1F4M A;  2NR5 A;  5KMG B;  1YHQ V;  4NTY A;  1Z5W A;  1D5A A;  2AZ0 A;  4G2K A;  3CXH F;  1EN4 A;  1BS3 A;  1JCH A;  4WFE A;  4I9Q A;  3O9O A;  4I0X B;  5CA3 A;  5ITZ B;  5J2T A;  3K06 A;  3KKY A;  3ZMZ A;  5JH7 A;  1HNW O;  5CA1 A;  4IGG A;  1TUE B;  4DR1 O;  4J41 A;  4PDV A;  1P4R A;  5EBW C;  3JD4 A;  3CJH A;  4DV5 B;  4JI4 O;  5LMU B;  4OX9 O;  1N32 O;  3OMN B;  4DR5 B;  4LFA O;  2LGW A;  4FZ0 A;  2JGU A;  1DGS A;  4MS2 A;  3RW0 A;  1AR1 B;  4ABM A;  1IBL B;  4DV7 O;  4IL6 Z;  4O2A B;  5H5N A;  3TXQ A;  1VQ8 V;  3OEH G;  3G6B A;  3CX5 F;  5KA6 A;  4YIP A;  1YZB A;  2UXD B;  4JV5 B;  2ZXW B;  3P3N A;  2DYR B;  1B6Q A;  2HG5 C;  2AGA A;  3TK1 A;  1QVG U;  1W0J G;  3I55 V;  2ZCE A;  3CHX A;  2IBZ H;  3FFQ A;  4UUJ C;  4ZOL B;  2E75 B;  1D5N A;  1SQQ H;  3K9A A;  4B08 A;  1BE3 H;  5IE9 A;  3ZX6 A;  2PYJ A;  5CN0 A;  4ZHQ A;  5FNV B;  1QNM A;  2XUM A;  1KUQ A;  2KG7 B;  3AG7 A;  1U96 A;  4KP4 A;  3J7A U;  1SQG A;  2N04 A;  2B1G A;  5GON A;  3IC7 A;  3E8G A;  1IBM O;  5CA0 B;  2ZXW C;  3LDC A;  3DGE A;  4RQF A;  4PHZ A;  2LFR A;  1AJP A;  4AIL C;  4F6R A;  3OR7 C;  4JYB A;  1G1X B;  3U11 A;  1YJN V;  3E2E A;  1GN6 A;  5LP6 B;  1BSM A;  4DYL A;  2Y69 B;  1QBZ A;  2KB1 A;  3GVM A;  4PA6 A;  5LMU O;  4TV8 B;  5L3F A;  1MA1 A;  1PP9 H;  5DEC A;  4JYA O;  1LNQ A;  3RYF B;  4DUY O;  3CD6 V;  1OCC B;  2EIJ B;  1NJI W;  5LOV B;  4TV9 B;  4IHJ A;  3S3W A;  3F7Y C;  4X1I A;  2XAG A;  1SQV H;  1OJH A;  1XUQ A;  1WA8 B;  3PJS K;  4OXS A;  1BHA A;  3BA8 A;  1GM7 A;  1JR9 A;  2R72 A;  3LNM B;  3AG3 B;  4UV9 A;  2QWQ B;  1VF5 B;  3L72 H;  2AW9 A;  5DM6 V;  2YEV B;  3SYO A;  3CB2 A;  4RWU A;  4J7K A;  2YIB D;  1VQ4 V;  2FYU H;  2WAM A;  2Y4U A;  1HNX O;  4TSF G;  1AP6 A;  3FB5 C;  3E86 A;  3P3P A;  2WSS G;  4H0L B;  1SER A;  4CH4 A;  1H2G A;  2P4K A;  3E35 A;  4DR3 O;  3BAB A;  2ZNI A;  4DV4 O;  3B40 A;  2YXL A;  4GKJ O;  4TUY B;  3D36 A;  1S5H C;  4J42 A;  2EIK B;  5IY5 B;  3OFN G;  1PL0 A;  4JI2 O;  3SPI A;  4RO2 A;  4NTX A;  4NTW A;  4DV6 O;  3RN4 A;  3U10 A;  2OCC B;  2Q69 A;  5B66 Z;  3CRA A;  2JS3 A;  2XOK G;  2EIN B;  4TQF A;  2JGD B;  2HLD G;  2ZR2 A;  5CMU A;  1TA8 A;  2LFS A;  4X1Y B;  2OCH A;  5D5P A;  1E79 G;  5FL7 G;  5J9P C;  4XBF A;  5IWA O;  4NXM B;  1OCO C;  2IJI A;  3ZJZ A;  4D7T A;  5J2U A;  4QE9 A;  1HP8 A;  3ASO C;  3VQV A;  4LF6 B;  2OCC C;  1KMI Z;  1ZLZ A;  1M57 B;  1XOU A;  3ETG A;  3CCR V;  4H13 B;  1T5E A;  2E5L O;  1MNG A;  4UCV A;  3B2E E;  4DV2 B;  3ABK C;  2Q4P A;  4I55 A;  1WLE A;  4I50 A;  1BL8 A;  1K92 A;  1IUR A;  2BTQ B;  3WB0 A;  1H2K A;  3L9D A;  4LF7 B;  2RCV A;  3EHB B;  1M9N A;  5L3G A;  2ZIN A;  4JI5 B;  1NKD A;  4LFA B;  1CPY A;  5IYC O;  4X62 B;  3JD0 A;  4FLV A;  4MW3 A;  4Z1M G;  1ZUQ A;  1Q3E A;  3H1J H;  1S0V A;  3WB1 A;  2V1D A;  4MW8 A;  1N8R W;  1NI8 A;  3G67 A;  3AK3 A;  1QR8 A;  3TET A;  2WLK A;  1IZ3 A;  1JFF A;  1Y6X A;  4JV5 O;  4FJC C;  3K5O A;  1HNZ O;  4FM2 A;  2Z5U A;  3G4S V;  1K33 A;  2VRZ A;  3H1K H;  1N34 B;  4H37 A;  4TWK A;  5H6Q A;  2E5L B;  4UVC A;  1GM8 A;  2QKS A;  2ZNJ A;  3RYH A;  1FFX A;  3SYQ A;  5LHG A;  3RYC A;  2EIM B;  4B3R O;  2WLN A;  1UPG A;  4HZ3 A;  5GTH Z;  2UUC O;  1WP7 A;  5E1A C;  2QM7 A;  1R3J C;  4NVP A;  5C93 A;  1ROP A;  5KHJ A;  4KUM A;  2UXX A;  4HNA B;  3JAK A;  2RQ6 A;  2YXY A;  3LUT B;  4OGQ B;  5JQG A;  3BY6 A;  1M93 A;  2QM8 A;  4I0X A;  2EBO A;  5HFL A;  2YDE A;  4EB6 B;  2ZE8 A;  4DV0 O;  2JEX A;  4JYY A;  5JH7 B;  1Y76 A;  4B3T B;  2MW2 B;  2QJ1 A;  4GUN A;  4YHH B;  5H2F Z;  4DV1 B;  2CE4 A;  3LSS A;  1YIJ V;  2EIL C;  3JSN A;  2X6B A;  2MK3 A;  4OPA A;  3ZED A;  4FPP A;  5KHH A;  2UU9 B;  1AR5 A;  3VOU A;  3MHS C;  2GTA A;  3AG4 C;  2Q9L A;  3CRM A;  1P7B A;  1TVK A;  1XL6 A;  4DO2 A;  2YIA A;  1X59 A;  4DR7 O;  4GKK B;  3CCU V;  3RT3 C;  1Y74 A;  1QLE B;  3VQW A;  4LFC B;  4Z2W A;  4O4H B;  1FXH A;  1XL4 A;  4CC6 A;  5IT9 N;  1YIT V;  4UXN A;  3D3Q A;  4JI6 B;  3WG7 B;  4GZR B;  4X66 B;  4FLW A;  1NZ6 A;  2GV9 A;  3M99 B;  3HKB B;  3E22 B;  3L71 H;  1SQX H;  4ZOL A;  4X88 A;  4L87 A;  1QLN A;  2PY5 A;  2BSK A;  2OWO A;  1S5J A;  3RVY A;  1RSO B;  1YDX A;  4ZHQ B;  3O65 A;  4UCO A;  2HJF C;  2JVD A;  3OMA B;  3C3T A;  3FB7 C;  1XIL A;  2QWN B;  1WB8 A;  2A0L A;  4W4L A;  1LR1 A;  4WFA V;  1HW7 A;  3BHP A;  3ASN B;  3FX7 A;  1JJO A;  3HKD A;  1WPB A;  3K57 A;  5LMN B;  4DW0 A;  5B3S C;  4LBE C;  3QO8 A;  1XMO O;  1FPO A;  5F2V O;  5JCO A;  3E8H A;  1I94 O;  3E8B A;  1CEZ A;  3LDE A;  2QEX V;  1VF6 C;  1K9M W;  1NTK H;  5IYD O;  4JF3 A;  1K7D A;  1S77 D;  4DR4 O;  4B7E A;  3N2G B;  4DR2 O;  4KHP O;  4RUE A;  2EIJ C;  2YIC A;  1U97 A;  5B1A C;  1JVM A;  2NNU A;  4H33 A;  2YS8 A;  4JI6 O;  1K4D C;  1QU7 A;  3QG5 A;  1TUB A;  2UUC B;  2ZIO A;  4K0K O;  3RYI A;  4JI3 O;  3G6E V;  1ENV A;  2IH1 C;  5KLV H;  1YSC A;  1FXK B;  2RN9 A;  3ETE A;  1YI2 V;  2F1M A;  4R50 A;  4ZKI A;  1SZX A;  3OGI B;  3P30 A;  1DTO A;  2XTA A;  1K8A W;  3N27 A;  4JGS A;  3H01 A;  3ZHQ A;  1F7Y A;  1DK1 A;  2YI8 A;  5B1A B;  1PPJ H;  4PI2 A;  5BXZ A;  2WLI B;  3HKC B;  2LW7 A;  1HNX B;  3ZMU A;  3N2K A;  3FB8 C;  2DJV A;  4QPK A;  2H8P C;  1YTF D;  3DTU B;  1P84 F;  4JI1 O;  5IJ0 A;  1ZWI C;  2JGD A;  1I94 B;  2QWO B;  1XNQ B;  1YCI A;  1KB9 F;  4X1Y A;  3CRR A;  3VBB A;  1A32 A;  2GHY A;  3H1L H;  3ABM C;  1PKX A;  4MTG A;  3UM7 A;  2ZE7 A;  3ICX A;  4DR3 B;  3QTC A;  3Q4H B;  1SET A;  2WLL B;  1V55 B;  3SJC C;  5EZY A;  5IDJ A;  4CC5 A;  1KEC A;  1VIB A;  2Y0P A;  1EFR G;  1NTZ H;  3RBZ A;  1QCE A;  3VQY A;  3JCZ A;  3RVZ A;  4DRX A;  2YC0 A;  4UCR A;  4I55 B;  3F7V C;  1E1Q G;  3W7U A;  4X66 O;  2EUL A;  3X2Q C;  2ZE5 A;  4DUZ O;  4PA3 A;  2ZKO A;  3EXA A;  4X1K A;  2ILM A;  4I4T A;  5IJ9 B;  5LL6 Y;  1WB7 A;  1CXZ B;  1M1K W;  5FPR A;  2AZ2 A;  2IJJ A;  3DSQ A;  3W7W A;  4UB8 Z;  1XBL A;  4W4K A;  3E89 A;  1ARO P;  1AI5 A;  3H1H H;  4B3M B;  1R1B A;  3AK1 A;  1FXV A;  1XNR B;  4XDJ A;  1RFY A;  1NQT A;  4U3F H;  2LW1 A;  2P4V A;  2DQ0 A;  2K1E A;  5L3B A;  2W0X A;  1CP9 A;  2P22 C;  3CJH B;  5IYZ B;  2HFE C;  3K0D A;  2BTO A;  2VQE B;  5CB4 B;  4AHC A;  4TT3 G;  3OT7 A;  2QE7 G;  1M5I A;  2YI9 A;  5FPO A;  3JAK B;  4FLZ A;  1MSW D;  4O2A A;  4P9P A;  3ZBH A;  1V54 C;  5EBL C;  4IYI A;  4CBC A;  1F4N A;  2E76 B;  2V7Q G;  3ZHT A;  1NS1 A;  4FMT A;  1UJW B;  1PNL A;  2XND G;  2PYL A;  4O2B A;  5KX5 B;  3K04 A;  4H44 B;  2UUA B;  3STZ C;  1M4U A;  3K0G A;  1TVK B;  2PGG A;  1OCO B;  1R6N A;  1QQC A;  2JS5 A;  4UB6 Z;  1HR0 O;  3OTF A;  4J11 A;  1PNK A;  1W59 A;  1IX9 A;  4QIW F;  3JD1 A;  3IC9 A;  1S76 D;  3QO7 A;  2QGN A;  4K8X A;  2ZM6 B;  3E22 A;  3STL C;  2IM9 A;  2CH7 A;  1BMF G;  2IW5 A;  3CCM V;  2PI5 A;  1FAF A;  3OUF A;  2Q7E A;  3UCS C;  5LMN O;  1XHX A;  2RDC A;  4IT5 A;  4UV8 A;  1Y67 A;  5LXT B;  3KG2 A;  3P32 A;  2PI4 A;  3KCX A;  1OV9 A;  4TV8 A;  2HVK C;  1S72 V;  3R66 A;  3FYI B;  3ZHU A;  5BR8 O;  2L35 A;  4RAI A;  3ZN0 A;  1IBK B;  4FVM A;  4LFC O;  4EEQ A;  5CBG A;  3ASN C;  4IHJ B;  3BA9 A;  5DN6 G;  1RM1 C;  5JVD A;  2Y4T A;  1THZ A;  4J80 A;  3APO A;  4NKG B;  3GWK C;  4DR4 B;  1OCR B;  4X64 O;  4JAU A;  2F66 C;  2RJZ A;  2FB5 A;  2A7W A;  1VQO V;  5BY1 A;  1YEW A;  1BHB A;  4DW1 A;  4LH7 A;  2IU0 A;  4FFB B;  3BRC A;  3J80 N;  2NN4 A;  3N2G A;  2X7R B;  4LF5 B;  3T1H B;  2HHH B;  3FD9 A;  1R6T A;  3CCV V;  1GO3 F;  3FAV B;  1MZE A;  2Q0O C;  1R3I C;  1MG1 A;  3JAL B;  4YJ3 A;  2BOC C;  2DQ3 A;  4BWA A;  1TUB B;  4B3S O;  2IJH A;  1EN6 A;  5L3E A;  4CH3 A;  4DV3 B;  1BZK A;  1VQL V;  3C3S A;  4U7O A;  3LNN A;  2QWR B;  3E8F A;  1G4Y B;  1J5E O;  2DE0 X;  4MVO A;  2LGQ A;  3CC4 V;  1VQ6 V;  2ADP A;  5IYB O;  2QKA A;  5AG2 A;  3SPG A;  5EBM C;  1N0N A;  3HKC A;  4J9Z B;  2KSD A;  5J2U B;  4JYC A;  2O57 A;  4P30 A;  1JQ0 A;  4KL1 A;  3WG7 C;  5IJ0 B;  4LF7 O;  3AG2 B;  4JAA A;  4WFB V;  2ETN A;  1MZF A;  5FLX N;  4ZBM A;  4PA4 A;  3G80 A;  2E74 B;  1Q82 W;  4FFK A;  4I50 B;  3L73 H;  2P6J A;  2VQE O;  4D7S A;  1XMQ B;  5LP6 C;  2OYQ A;  1L0L H;  3CWB H;  3L75 H;  3LSQ A;  3QO5 A;  3HPL C;  3WU2 Z;  4FLX A;  1R3L C;  5GTI Z;  1SQP H;  5A2Q N;  1NVP D;  1JFF B;  4JI1 B;  2LQT A;  3T4D A;  4DRX B;  4WBN A;  2WLM A;  2VS0 A;  4U3J A;  3OR6 C;  2E3C A;  3NR7 A;  3K03 A;  2UU9 O;  4LF6 O;  2Z3Y A;  2Y48 A;  4DV5 O;  1XHZ A;  4I4T B;  5KAI Z;  1ORQ C;  3ZHV A;  3JD3 A;  2W0F C;  1V9P A;  1M57 C;  4PI0 A;  2ODM A;  5LHH A;  1HNW B;  3HR0 A;  2JIZ G;  2LO1 A;  3TGU H;  4Z1V A;  4WFG A;  4HNA A;  2XHB A;  4PD4 F;  1URF A;  4MVQ A;  3GB7 C;  2CGO A;  2WPD G;  1XI1 A;  4LF4 O;  4EB6 A;  2M6Y A;  4XDK A;  1OCC C;  3AEI A;  5KA5 A;  3CCJ V;  2CTR A;  5JJN B;  1O9G A;  3M7M X;  1H2L A;  2QM4 A;  5IYZ A;  2R9I A;  3UT5 A;  4R8C A;  4E4E A;  3QF7 A;  1IDS A;  2UXC O;  2RMK B;  2P90 A;  3TJT A;  3ABL C;  4GT1 A;  3CXC U;  4X20 B;  2P67 A;  4LR3 A;  1Y74 B;  4AQY B;  3CRC A;  1VMG A;  5KHI A;  4UVB A;  2OTJ V;  1JA8 A;  3PN1 A;  5CBH A;  1VQ9 V;  1V54 B;  4J7J A;  2UXC B;  1KYO F;  1VQP V;  4X65 B;  2UUB B;  2UXB O;  1N0J A;  3HKB A;  4OPH A;  4O2B B;  1K5S A;  2ZR3 A;  3K79 A;  1OZ0 A;  1NBM G;  5KX5 A;  3MAQ A;  1EBO A;  3KCY A;  1WAZ A;  1Q6H A;  1XNR O;  2BSK B;  1QHT A;  5BZB A;  1DF4 A;  3AG1 C;  3J81 N;  1JPX A;  2R70 A;  2PF4 E;  2CTP A;  1ZSP A;  2H3O A;  1RSO A;  4QGP A;  2YID A;  5JWP A;  3ABL B;  3CC2 V;  1BQ0 A;  2EIL B;  3CC7 V;  2OIG A;  3IAY A;  1GRJ A;  1SS3 A;  1KKC A;  2CH7 B;  1KBH A;  3AG4 B;  4X8A A;  2PZS A;  4GLX A;  2BOB C;  2JJ1 G;  1MMM A;  2RNB A;  2W6J G;  1DLB A;  4N21 A;  5LXT A;  1YJ9 V;  4G27 B;  1NR7 A;  2Q7G A;  3JAW A;  1OHH G;  1EZJ A;  1KD1 W;  1VQ5 V;  1P7G A;  3BPZ A;  2B9Z A;  3CMA V;  3HB3 B;  4X89 A;  3SPH A;  1MOF A;  4LNU B;  5EIB D;  1N33 O;  4JI7 O;  1SA0 A;  5JVD B;  4MSW C;  2DN9 A;  3K5M A;  4DR1 B;  1L0N H;  2D2C B;  2Q68 A;  1BQZ A;  4Q20 A;  2OT5 A;  1W0K G;  1GM9 A;  4OX9 B;  1N32 B;  3CPW U;  4UCS A;  4DR5 O;  1YF2 A;  4GX2 A;  2X0L A;  1GH6 A;  1FJG B;  2AHZ A;  4GCZ A;  1GN4 A;  4FFB A;  1H2S B;  1JJ2 U;  4DK1 A;  3VQX A;  1I08 A;  1BT8 A;  1FXK A;  2ZE6 A;  1QVF U;  5KHG A;  2VWK A;  3L74 H;  4BIO A;  4GX0 A;  3RGB A;  1NTM H;  3FAV A;  2A9H A;  2UXB B;  4K0K B;  3CCL V;  1I5X A;  1SQB H;  5JJE B;  3IJ4 A;  2WLI A;  5TIS Z;  1VF7 A;  4YJ3 B;  2CK3 G;  3N2K B;  2DYS C;  4BIU A;  1HNZ B;  4PDL A;  3A0B Z;  1XMO B;  4CH5 A;  5LYJ A;  4PV1 B;  4O4L A;  1SQF A;  2QSA A;  1FJG O;  1TAE A;  3CCQ V;  3KZI Z;  2JJ2 G;  1OCR C;  1R6K A;  2XT9 A;  3ZMV A;  1AR4 A;  1M56 B;  4PDM A;  4LF9 B;  4NXN O;  3B4S A;  2XAF A;  4BIZ A;  1M90 W;  1EZV H;  2GUZ A;  3OUS A;  2BE3 A;  3Q4H A;  3B09 A;  1FXK C;  2CTW A;  2D3O W;  1WPX A;  3B8N A;  4N23 A;  2GBO A;  1EM1 A;  1ZX3 A;  5CBF A;  4MTX A;  5C8Y B;  3AG2 C;  4EFB A;  2F43 G;  1AJQ A;  5LGT A;  1Q5O A;  1AB3 A;  2F95 B;  2HR3 A;  3H1I H;  4DK0 A;  3FKS G;  2XAS A;  3ZMT A;  4NR1 A;  4BW9 A;  1SZT A;  4R7C A;  1J5E B;  2L6L A;  1M56 C;  2WA4 A;  4LC1 A;  4J7Z A;  4FLU A;  4K8Z A;  1IBL O;  4HAM A;  5GW7 A;  4BAY A;  4JI0 O;  1IVS A;  4DV7 B;  2UXN A;  3UQ8 A;  4K35 A;  4O4J A;  2IU3 A;  4P2Z A;  4TQD A;  3K9S A;  4U3J B;  1QR9 A;  3JSL A;  1YTF B;  1XDC A;  5B1N A;  3JYC A;  2EIK C;  1W2B U;  1MAB G;  3EFF K;  2JDI G;  3QNE A;  4NB5 A;  2GSM B;  2FKX A;  4O4I B;  5EIB C;  5CB4 A;  2CUG A;  2EIN C;  4PJ0 Z;  5EK0 A;  3A2F A;  4DXW A;  3D36 C;  3RWR D;  1COW G;  3OEE G;  3CCS V;  2B1I A;  2X6C A;  5J2T B;  3AG3 C;  3SJQ C;  4F6E A;  5LGU A;  3OW2 U;  1KU9 A;  3MHH C;  4PEL A;  2ZQM A;  1SF9 A;  5LHI A;  4JI8 B;  2OTL V;  3D8C A;  3WB2 A;  3TCU A;  2N74 A;  1Q81 W;  4CS2 A;  1K73 W;  3JCU Z;  3OAA G;  1L8D A;  3M8A A;  1AJN A;  2NLJ C;  3ZRX A;  1I7F A;  3CP1 A;  1GN3 A;  3ABM B;  3R65 A;  2WA3 A;  5H6R A;  5L3C A;  4YJ2 B;  2G38 A;  1WN7 A;  2Q8V A;  2AXT Z;  4LF8 O;  3IGA C;  1US6 A;  4B3S B;  1NH2 B;  1VEW A;  2EJ7 A;  1GTO A;  1SKV A;  4JAS A;  3F5W C;  5B1B B;  3JAT B;  5A9G A;  1PM9 A;  1WP8 A;  2QTS A;  2ZD9 A;  2YXH A;  3CSX A;  1GKF A;  3A0R A;  2P7T C;  4JI4 B;  4HYO A;  1AIL A;  4EFE A;  3SDL A;  5FNV A;  5LGN A;  2KG7 A;  2HKO A;  2QKC A;  5EYP B;  2Q67 A;  4I9W A;  5GON B;  5B5E Z;  1K97 A;  3IFX A;  3SYC A;  3CE2 A;  1XQ8 A;  3ABT A;  5CA0 A;  1N36 B;  5E79 Z;  1Q86 W;  4DV0 B;  3S3X A;  2EX3 A;  3W7S A;  4JI3 B;  1XRE A;  2JEU A;  2Q7H A;  4J9Y B;  3OE7 G;  2HJD A;  3BEH A;  2YSU B;  5B1B C;  4YHH O;  5LP6 A;  4L8J A;  3BAA A;  2W6I G;  4D6T H;  4YY3 B;  5L3D A;  3FYE B;  1VQ7 V;  4JI8 O;  2ZDI C;  1Q90 D;  5IY5 C;  1Z5V A;  1IBK O;  1FFT B;  1PNM A;  3CME V;  1L1F A;  2VWJ A;  1GAX A;  4LWS A;  1PL4 A;  4ZI7 B;  5BMV A;  4LFB B;  4DR6 B;  3MDS A;  3ML0 A;  1FD9 A;  4TOI A;  5LOV A;  3OGC C;  4TV9 A;  1KP3 A;  4UFZ A;  2M7W A;  3LSU A;  1WA8 A;  4JZ2 A;  3BCC H;  3ZRW B;  4MVR A;  1KP2 A;  2DWD C;  3EVK A;  1YJW V;  3T4Z A;  1OCZ C;  3JAL A;  2A3Q A;  3DXR B;  4IIJ A;  3T1Y O;  4DUY B;  3SJB C;  2YEV A;  3BVO A;  2ATK C;  1LUV A;  1IXM A;  5B1O A;  1Z2G A;  4JAV A;  4DR7 B;  4GKK O;  4DV2 O;  3OTO B;  3CS5 A;  2JRI A;  3K3W A;  3L70 H;  1AP5 A;  3ZS8 C;  1RM1 B;  3CRQ A;  3JAR B;  1GMG A;  3W7T A;  4GYC B;  4TUY A;  1UFI A;  2VQF O;  3SR2 C;  3ABK B;  2DW4 A;  2CGN A;  2ZDI A;  3OMI B;  4QPJ A;  4QJF B;  3THO A;  1N36 O;  4NYK A;  4IYH A;  1VQM V;  1OCZ B;  5DED A;  1DF5 A;  2DOS A;  2C2A A;  1EN5 A;  1BGY H;  1B06 A;  3E83 A;  2HP8 A;  1B04 A;  4MVZ A;  1E1R G;  2F93 B;  4F4L A;  2FML A;  1XEQ A;  3APQ A;  1X4T A;  4LFB O;  4DV6 B;  4WFF A;  5K1P A;  2IH3 C;  1H38 A;  2UXD O;  2Z0A A;  5EC1 C;  2N05 A;  4MT8 A;  2JK5 C;  3T1H O;  2HHH O;  1N33 B;  2GUZ B;  3SPJ A;  3ETD A;  4C7U A;  2WLJ A;  3HKE A;  2OIE A;  2EIM C;  4PA9 A;  3AK2 A;  2QA4 V;  5KAF Z;  1JMK C;  1SC5 B;  2PTM A;  3BFR A;  3SJA C;  1VAR A;  5C8Y A;  4MTO A;  4LF4 B;  4LF9 O;  2Q0A A;  3UO3 A;  3JAS A;  4WBN B;  1ZL8 A;  3LDD A;  1K4C C;  2Y69 C;  3SYP A;  5LA6 B;  4LF8 B;  4CH6 A;  2V4D A;  2AHY A;  1NR1 A;  4X64 B;  1RP3 B;  2P06 A;  2QDO A;  1YVW A;  2QTO A;  2ITD C;  5KUK A;  2Q6A A;  3T2M A;  2H94 A;  1F51 A;  3JD2 A;  5KMG A;  1GK9 A;  4A5U B;  4NXN B;  4LH6 A;  2ZT9 B;  1AI7 A;  2HEP A;  3NXS A;  2F4V O;  4QE7 A;  4O4J B;  4CZZ A;  1N4C A;  2FTK A;  1HWY A;  1ZAU A;  5ITZ A;  2CTQ A;  1QLE C;  1K34 A;  4DR2 B;  3RYH B;  1AI4 A;  1AI6 A;  3JAM N;  4LP8 A;  5CA1 B;  1FYJ A;  1ZTE A;  4FZ1 A;  2IJK A;  2LP7 A;  4B7K A;  4MVS A;  1KKD A;  2EZP A;  4WCE V;  4X9Q A;  4J10 A;  3UT5 B;  4O4I A;  1NT2 B;  4FM0 A;  4K3A A;  1O9H A;  4JI5 O;  3ZRS A;  5D5Q A;  1Q43 A;  3T1C A;  3ZHR A;  5JQG B;  1IBM B;  4X20 A;  4JI7 B;  4BW5 A;  1K5Q A;  4RUF A;  4JI0 B;  4MTF A;  2P5O A;  1Q6I A;  1Y76 B;  4LF5 O;  2DYR C;  2Y0I A;  1TGO A;  5KUM A;  3W7X A;  1VQK V;  1Q7Y W;  1H8E G;  4P9O A;  3SPC A;  4YY3 O;  3D3I A;  3K08 A;  1I5Y A;  1FS0 G;  3ZRV A;  3B77 A;  4RQE A;  4JYA B;  3ZIA G;  1KQS U; 
#chains in the Genus database with same CATH homology
 1OCO B;  1PD3 A;  1R6N A;  1OCO C;  2IJI A;  2XAF A;  1RPR A;  4BIZ A;  1M90 W;  1JX9 A;  3ZJZ A;  4QE9 A;  3OUS A;  3ASO C;  1Y4M A;  3ASO B;  1PNK A;  1R73 A;  1J95 A;  1FXK C;  1G8M A;  2D3O W;  3OM3 B;  1WPX A;  3JD1 A;  4QIW F;  3X2Q B;  2OCC C;  3B8N A;  4N23 A;  1S76 D;  3QO7 A;  1KC8 W;  3ZMS A;  5CBF A;  4MTX A;  1M57 B;  3AG2 C;  2F43 G;  3STL C;  3ETG A;  1AJQ A;  3CCR V;  4R6Z A;  5LGT A;  1BMF G;  2IW5 A;  3CCM V;  2HR3 A;  3ABK C;  1NVP B;  2PI5 A;  3FKS G;  1F23 A;  2XAS A;  3OUF A;  4E2L A;  1WLE A;  1BL8 A;  1K92 A;  4UV8 A;  3ZMT A;  3KG2 A;  1SZT A;  3P32 A;  4GX5 A;  4R7C A;  2PI4 A;  1M56 C;  3EHB B;  1M9N A;  4JTA B;  5L3G A;  4LC1 A;  5EC2 C;  2HVK C;  3ZN1 A;  1NKD A;  1CPY A;  5HFM A;  5IYC O;  1S72 V;  3FYI B;  3JD0 A;  4HAM A;  4MW3 A;  5GW7 A;  1KQS U;  4Z1M G;  4RAI A;  3ZN0 A;  1S3J A;  4BAY A;  1S0V A;  1RPO A;  2V1D A;  4MW8 A;  5CBG A;  1N8R W;  3ASN C;  5DN6 G;  2XAJ A;  1RM1 C;  2UXN A;  4LCU C;  3WFV A;  3SYA A;  1QR8 A;  3TET A;  2WLK A;  1THZ A;  3CYO A;  4FJC C;  4PA7 A;  2IU3 A;  4P2Z A;  1OCR B;  2Z5U A;  3G4S V;  1H8H G;  1QR9 A;  2HVJ C;  1K33 A;  4JAU A;  4H37 A;  4TWK A;  5H6Q A;  1VQO V;  4UVC A;  1GM8 A;  1YTF B;  1BHB A;  2QKS A;  3SYQ A;  4I5S A;  5LHG A;  5B1N A;  2EIM B;  3JYC A;  2EIK C;  2IU0 A;  1W2B U;  1MAB G;  3EFF K;  4PDR A;  4WF9 V;  2WLN A;  1Y66 A;  2WWW A;  2JDI G;  4HZ3 A;  3QNE A;  2GSM B;  4JTC B;  3B8M A;  4JTD B;  3FB6 C;  5E1A C;  2X7R B;  2QM7 A;  1R3J C;  5C93 A;  4XDL A;  1ROP A;  2EIN C;  5EK0 A;  3CCV V;  4YXW G;  2X6A A;  1GO3 F;  4DXW A;  4KUM A;  3ZRW A;  2UXX A;  1COW G;  3OEE G;  4FIP C;  2XAQ A;  4ASU G;  3LUT B;  1R3I C;  3CCS V;  3BY6 A;  2QM8 A;  1MG1 A;  2B1I A;  2BOC C;  2EBO A;  2X6C A;  5HFL A;  2B5U A;  2DQ3 A;  3AG3 C;  3SJQ C;  2WLH A;  2JEX A;  5LGU A;  3OW2 U;  2EJR A;  3MHH C;  2IJH A;  4PEL A;  2ZQM A;  5L3E A;  3LSS A;  1YIJ V;  2EIL C;  1V55 C;  5LHI A;  5H9C A;  2X6B A;  2MK3 A;  2OTL V;  1VQL V;  4U7O A;  3E8F A;  1Q81 W;  3TCU A;  4FPP A;  1K73 W;  1G4Y B;  3GWO A;  4GX1 A;  3VOU A;  4MVO A;  3CC4 V;  4JPR A;  1VQ6 V;  3OAA G;  3MHS C;  3AG4 C;  4G28 B;  5IYB O;  1SRY A;  3SPG A;  1P7B A;  1XL6 A;  5EBM C;  4DO2 A;  1AJN A;  2NLJ C;  3CCU V;  1QLE B;  2EZO A;  3ZRX A;  4J9Z B;  1FXH A;  3CP1 A;  1XL4 A;  4JYC A;  1SES A;  3AG1 B;  4P30 A;  3ABM B;  2R9R B;  4EKW A;  3R65 A;  1JQ0 A;  5H6R A;  4UXN A;  5L3C A;  1YIT V;  3WG7 C;  3UKM A;  3WG7 B;  4U7N A;  3AG2 B;  3IGA C;  4WFB V;  2DWE C;  3M99 B;  4UVA A;  3G71 V;  4KFM A;  1NH2 B;  5LBQ A;  1GTO A;  4JAS A;  3F5W C;  5B1B B;  4ZBM A;  2ITC C;  2ZD9 A;  4PA4 A;  4X88 A;  4L87 A;  1R3K C;  1QLN A;  1Q82 W;  1GKF A;  3A0R A;  2P7T C;  1JOY A;  2P6J A;  4HYO A;  2DYS B;  3RVY A;  1K3E A;  2XAH A;  3CCE V;  5LGN A;  2HJF C;  3OMA B;  2HKO A;  3FB7 C;  4QNH B;  2A0L A;  2A79 B;  2WLL A;  4WFA V;  2Q67 A;  4MVM A;  4FK5 C;  3QO5 A;  3LSQ A;  4I9W A;  3HPL C;  3ASN B;  1K97 A;  3IFX A;  3SYC A;  1R3L C;  3ABT A;  4WFH A;  1NH2 D;  1VQN V;  1Q86 W;  3MD0 A;  5B3S C;  1NVP D;  4LBE C;  3T4D A;  5B3S B;  3QO8 A;  3W7S A;  4J9Y B;  2JEU A;  2WLM A;  3ABU A;  3OE7 G;  3BEH A;  2YSU B;  5B1B C;  3E8H A;  3OR6 C;  2W6I G;  3E8B A;  3K03 A;  5L3D A;  3FYE B;  1VQ7 V;  1CEZ A;  2ZDI C;  2Z3Y A;  3LDE A;  2Y48 A;  5IY5 C;  3I56 V;  2QEX V;  1FFT B;  1PNM A;  3CME V;  1K9M W;  1L1F A;  3ZCC A;  5IYD O;  4MVU A;  4JF3 A;  1ORQ C;  3JD3 A;  2W0F C;  1K7D A;  1F4M A;  1S77 D;  1M57 C;  3ML0 A;  5LHH A;  1YHQ V;  3OGC C;  4RUE A;  2JIZ G;  2EIJ C;  1KP3 A;  5B1A C;  2M7W A;  4WFG A;  1JVM A;  4G2K A;  3ZRW B;  4MVR A;  1KP2 A;  2DWD C;  2NNU A;  4H33 A;  1JCH A;  1K4D C;  1YJW V;  4WFE A;  3T4Z A;  1OCZ C;  5CA3 A;  4MVQ A;  3GB7 C;  2WPD G;  2YEV A;  4XDK A;  1OCC C;  3K06 A;  3ZMZ A;  3AEI A;  2ATK C;  3G6E V;  1IXM A;  5KA5 A;  1ENV A;  5B1O A;  3CCJ V;  4JAV A;  1TUE B;  2IH1 C;  1YSC A;  1FXK B;  4PDV A;  1P4R A;  3ETE A;  3K3W A;  5EBW C;  1YI2 V;  3JD4 A;  1RM1 B;  4R50 A;  2R9I A;  4ZKI A;  1GMG A;  3OMN B;  3P30 A;  1DTO A;  4R8C A;  1K8A W;  3W7T A;  4JGS A;  3H01 A;  4MS2 A;  3RW0 A;  3ABK B;  1AR1 B;  2P90 A;  2DW4 A;  5B1A B;  2WLI B;  3ABL C;  4GT1 A;  3CXC U;  2ZDI A;  2P67 A;  3OMI B;  4QPJ A;  4QJF B;  3ZMU A;  1VQ8 V;  3FB8 C;  3OEH G;  1VQM V;  1OCZ B;  4QPK A;  2H8P C;  1YTF D;  3DTU B;  4UVB A;  1DF5 A;  2OTJ V;  5KA6 A;  2C2A A;  5CBH A;  1VQ9 V;  1V54 B;  2ZXW B;  1VQP V;  3E83 A;  1ZWI C;  2DYR B;  1B6Q A;  4MVZ A;  2HG5 C;  3TK1 A;  1E1R G;  1QVG U;  1W0J G;  3I55 V;  1K5S A;  2ZR3 A;  3K79 A;  4F4L A;  1OZ0 A;  1NBM G;  4UUJ C;  1EBO A;  3VBB A;  3K9A A;  2GHY A;  1DF4 A;  5BZB A;  3AG1 C;  4WFF A;  3ABM C;  1JPX A;  2IH3 C;  1H38 A;  1PKX A;  4MTG A;  5EC1 C;  5CN0 A;  3UM7 A;  4MT8 A;  2JK5 C;  3ABL B;  3SPJ A;  3ETD A;  4KP4 A;  1SET A;  2WLJ A;  3CC2 V;  2EIL B;  1V55 B;  2B1G A;  2WLL B;  2EIM C;  4PA9 A;  2QA4 V;  3CC7 V;  5IDJ A;  1KEC A;  3IC7 A;  3E8G A;  1EFR G;  2ZXW C;  3LDC A;  4MTO A;  1QCE A;  3RBZ A;  3DGE A;  4RQF A;  2LFR A;  1AJP A;  3JCZ A;  3RVZ A;  3AG4 B;  3OR7 C;  4JYB A;  4X8A A;  2BOB C;  2JJ1 G;  1YJN V;  3E2E A;  3F7V C;  1E1Q G;  3LDD A;  2W6J G;  1DLB A;  1K4C C;  4N21 A;  3W7U A;  1YJ9 V;  2Y69 B;  1QBZ A;  4G27 B;  1NR7 A;  2Y69 C;  3SYP A;  2KB1 A;  4PA6 A;  1OHH G;  1EZJ A;  3X2Q C;  4PA3 A;  5L3F A;  2AHY A;  1NR1 A;  1KD1 W;  1VQ5 V;  1LNQ A;  3CMA V;  3CD6 V;  1OCC B;  3HB3 B;  2QTO A;  2ITD C;  5KUK A;  2EIJ B;  2Q6A A;  4X89 A;  3SPH A;  2H94 A;  1F51 A;  3JD2 A;  3T2M A;  1GK9 A;  1MOF A;  1NJI W;  1M1K W;  3F7Y C;  2XAG A;  4MSW C;  2IJJ A;  1AI7 A;  3PJS K;  3NXS A;  4OXS A;  3W7W A;  2Q68 A;  4Q20 A;  2OT5 A;  4QE7 A;  4CZZ A;  1W0K G;  1BHA A;  2FTK A;  1GM9 A;  1GM7 A;  3CPW U;  1HWY A;  3LNM B;  3AG3 B;  4UV9 A;  3E89 A;  1ARO P;  1AI5 A;  4GX2 A;  5DM6 V;  2YEV B;  2X0L A;  3SYO A;  1QLE C;  1K34 A;  2AHZ A;  1VQ4 V;  1AI4 A;  1AI6 A;  4GCZ A;  4LP8 A;  1FXV A;  2WAM A;  1JJ2 U;  4XDJ A;  1NQT A;  4TSF G;  2DQ0 A;  3FB5 C;  2IJK A;  1FXK A;  2K1E A;  2LP7 A;  2WSS G;  3E86 A;  4MVS A;  5L3B A;  2EZP A;  1SER A;  1KKD A;  1CP9 A;  4WCE V;  1QVF U;  1H2G A;  3E35 A;  2HFE C;  3K0D A;  4GX0 A;  3ZRS A;  4TT3 G;  2QE7 G;  2A9H A;  3T1C A;  3CCL V;  3D36 A;  1I5X A;  1S5H C;  2WLI A;  2EIK B;  1MSW D;  5IY5 B;  3OFN G;  2CK3 G;  1PL0 A;  3SPI A;  4RO2 A;  1K5Q A;  4RUF A;  4BW5 A;  4P9P A;  2DYS C;  4MTF A;  1V54 C;  5EBL C;  4CBC A;  4BIU A;  1F4N A;  2OCC B;  2Q69 A;  2DYR C;  2V7Q G;  4PDL A;  5KUM A;  3W7X A;  4FMT A;  1VQK V;  1UJW B;  2XOK G;  1Q7Y W;  2EIN B;  1PNL A;  1H8E G;  4P9O A;  2XND G;  3SPC A;  2HLD G;  3D3I A;  3K08 A;  2ZR2 A;  1I5Y A;  5CMU A;  2LFS A;  1FS0 G;  3ZRV A;  3B77 A;  4RQE A;  3CCQ V;  3K04 A;  3STZ C;  1E79 G;  5FL7 G;  5J9P C;  2JJ2 G;  1OCR C;  1R6K A;  4XBF A;  3ZIA G;  3ZMV A;  1M56 B;  3K0G A;  4PDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...