4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
3B77A 5H9CA 1I5XA 3B8NA 5CN0A 2LP7A 3GWOA 2EZPA 1ENVA 4E2LA 4G2KA 2EBOA 3M99B 1K33A 1Y66A 4JGSA 1QR8A 1QCEA 3H01A 4FK5C 2X7RB 1QBZA 1DF5A 1JPXA 1QR9A 1EBOA 1SZTA 3B8MA 3MHSC 3P30A 1Y4MA 4N23A 5HFLA 2MK3A 1MOFA 3K9AA 5HFMA 3CYOA 4JPRA 2OT5A 4FJCC 5CMUA 1F23A 1JQ0A 4FIPC 1K34A 5KA6A 1I5YA 1DF4A 3CP1A 5KA5A 2M7WA 2P6JA 4JF3A 2EZOA 4N21A 1DLBA 1MG1A 3MHHC 3WFVA
chains in the Genus database with same CATH superfamily
2OCHA 3OAAG 4R7CA 2AHZA 2ZNJA 1R6NA 4DV6O 5CB4B 1K5QA 4FM1A 3A0HZ 4J9ZB 1RM1B 3SJBC 1P7BA 4XBFA 1DGSA 5LMNB 5KHIA 1SRYA 4CS3A 1Q90D 3RYFA 1YTFB 1Y67A 3CCQV 1WB8A 2KG7A 4AQYB 3CD6V 4KUMA 1KB9F 4X65O 4FM2A 1JCHA 1N32O 1EN4A 3CCLV 3RYIB 4PA6A 2XAGA 4LBEC 4QE7A 1Z2GA 2XOKG 2V1DA 2YXYA 3H9VA 4DR4O 4DV5O 1THZA 3ZHSA 3WB1A 1S76D 2Y4TA 2BOBC 5LGTA 3ZBHA 1AVMA 4B3MO 2Q7GA 1HNZO 1I08A 2GUZB 2N05A 1I5XA 1ZSPA 3CSXA 2GDSA 4OX9B 2N04A 2YXLA 2YIDA 1ORQC 4DUZO 4NR1A 4A5UB 3ZMSA 4NB5A 3K58A 1VF6C 3X2QB 4J41A 2ADPA 1WPXA 1GM7A 3QNEA 4YHHO 4P9PA 1XBLA 1SQGA 2ZE8A 3WG7B 3AG3B 3A0RA 1QHTA 3E35A 4F6RA 3CWBH 1M57C 1YVWA 5LMNO 3L72H 1MSWD 1JQ0A 1Q43A 3NXSA 3KCYA 4X8AA 3CCVV 5KA5A 1JX9A 1NR7A 4MS2A 4DV2B 4JI4B 5AG2A 2A06H 4BIZA 1L1FA 1JFFA 2QKSA 4E2LA 1IURA 1FFTB 4I0XA 4UCRA 5LHIA 2OTJV 4GX2A 3FD9A 3U0ZA 2QJ1A 3L71H 1F23A 4X66O 3SR2C 2P06A 2ZIMA 2EIJC 3CP1A 4U3FH 5B66Z 2WA4A 4Q6GA 4ZIBA 3DTUB 3X2QC 1Y6XA 4F6RB 5DN6G 4JTCB 2N74A 1HNWB 1KMIZ 5LGUA 4OX9O 2XAHA 3W7UA 3AG7A 3SPCA 4XDLA 4TOIA 4JI1O 4UFZA 4F6EA 1JFFB 5C93A 2IJHA 4K35A 1GK9A 1EFRG 4FZ0A 4CH5A 3ZX6A 2F4VB 4D6TH 2IM9A 2GHYA 1J5EB 3HKEA 4GX0A 2ZR3A 2Q4PA 3A0BZ 3PJSK 1VQOV 2UXXA 3TJTA 5L3FA 1AJQA 5EZYB 2OTLV 1SQVH 2AZ2A 1BL8A 3T4ZA 3OMAB 2UXNA 3SDLA 1QLEC 1K4DC 4K8XA 1RSOA 1YZBA 3WFVA 1LUWA 4JASA 3T1YO 1GH6A 1H2KA 1H38A 1B6QA 3CMEV 4I50A 3BA9A 4BR6A 3K5MA 4MTOA 5BMVA 4JZGA 2Y69C 2IJKA 5IJ9B 4WF9V 4X64O 4JI8B 1KECA 1NI8A 5L3EA 2PUSA 4BIUA 4IYIA 4I55B 4CC5A 2E75B 1TVKA 2ZE5A 3OTOO 5LHGA 1SS3A 3CC2V 4RQEA 5EC2C 2VQEB 1RSOB 1Q86W 2Q8VA 2V4DA 3B77A 5BY1A 2V7QG 3F7YC 4I50B 2IU0A 1XL4A 3FYEB 4TV8A 1SZTA 3ASNC 4DV1B 2A9HA 1XILA 4PHZA 2L35A 4PDMA 4PA9A 2XTAA 3H1JH 4W4KA 3MDSA 3JAMN 5FNVA 2R9AA 3D3QA 1Q82W 4RAIA 3QVNA 3MAQA 2DYRB 1PPJH 4UVAA 3VQVA 5EBLC 4J7ZA 3QO5A 4ZKIA 2QM7A 4TUYA 3IJ4A 2PI4A 2P6JA 1NS1A 2EJRA 4IL6Z 2PI5A 4EFEA 1Q81W 2LW1A 3C3SA 2UXCB 1VARA 4JYBA 1ENVA 4B7EA 1BE3H 4CS4A 1Y4MA 1QNMA 1AI4A 3CYOA 5JQGA 3RYCB 3RN4A 2Y0PA 1S72V 2E3CA 5TISZ 2YSUB 5B1BB 5KUMA 3CS5A 2AW9A 1K9MW 3RWRD 1Q8IA 3JARA 5BXZA 3TGUH 1OCOB 1Y74A 3G6BA 1TA8A 2YIAA 1K8AW 2DYRC 4NXMO 4GT1A 4CH4A 4TUYB 3THOA 4UCOA 1COWG 1EN5A 2ITCC 1GKFA 4C7UA 4DV1O 3SYPA 5JH7B 3VBBA 1WB7A 4Z1VA 3SPJA 3J80N 2PTMA 3F5TA 1AI5A 2BSKA 3BAAA 3N27A 3AK1A 3QO7A 3H1IH 2LGQA 2X6BA 4JV5O 3W7WA 3G67A 5IWAB 4DR1B 5JQGB 3CHXA 4O2AA 3FKSG 5GONA 2PY5A 5CBFA 4O2BA 4GKJO 3CRQA 1VMGA 2CK3G 4GX1A 3JARB 1ZLZA 1Y74B 3AG1C 4BWAA 4OXSA 4MTXA 3P32A 1OCOC 1NTKH 1XMQB 5LOVA 3ZMVA 1R6KA 5GW7A 2UXCO 4JI3B 2BSKB 4DV0O 1K4CC 1QQCA 4P2ZA 4NTXA 1XNRO 1JMKC 3ZMUA 4MVMA 1IZ3A 4O2AB 2ILMA 5KAFZ 4O2BB 3ZHTA 4HNAA 3RVYA 2P90A 2FTKA 4JAVA 4PI2A 3U11A 1H2NA 5GTHZ 3NR7A 3TXSA 3LSQA 1R1BA 1CP9A 2R70A 5LOVB 1XI1A 5LMUO 3K59A 2RMKB 2H3OA 1XOUA 1P84F 1AILA 3M7MX 5CA1B 1OV9A 1X4TA 5JCOA 1B04A 3DSQA 4DR1O 5IWAO 1PL4A 1PP9H 2UUAB 1EBOA 3UQ8A 3FFQA 3ABLB 4UVBA 5B5EZ 2HJFC 3APOA 4UUJC 3E83A 4FPPA 4LF9O 4K0KO 4DV4B 3K79A 1PNKA 3UKMA 4KHPB 3C3TA 3JYCA 1KP2A 1G1XB 3ZN0A 3E2EA 1Q5OA 2CH7A 4JI3O 3OR7C 1GN3A 3K5NA 1S0VA 4LF5O 1HDJA 5EYPA 1Z5VA 2XHBA 4DR7B 1GO3F 4DV7B 4RUEA 1SQPH 3B40A 2D3OW 1OHHG 2W6JG 1QVGU 2E5LO 1DF5A 1NH2D 2Q5ZA 4JI2B 3VQXA 3FB7C 2JRIA 3E86A 3ABLC 2D2CB 1Q6UA 1AI7A 4X65B 1P4RA 1M4UA 5IYCO 2X6AA 5H9CA 2HVJC 4BW9A 3AK3A 2CH7B 4YJ3B 4MVOA 2RJZA 2F93B 5EYPB 5FPRA 3ZRXA 4X1KB 3CC4V 3K0DA 1R3LC 2F43G 4X1YA 1SF9A 4U3JA 5E1AC 1IXBA 1HNZB 1N4CA 5JCOC 5IT9N 1G4YB 2Q69A 2KB1A 2M6YA 1BMFG 4FMTA 1NH2B 3LNNA 3JSNA 2QKAA 1G6UA 3RYIA 2F1MA 2JDIG 1YXBA 4I7ZB 5D5PA 2ETNA 5B1AB 3E89A 3SYOA 4JAUA 3LDCA 4DR7O 4DV7O 3ZJZA 2RCVA 2ZXWC 2W0XA 5LXTA 2ZQMA 1VF5B 4UB8Z 1GM8A 2DQ3A 1D5NA 3M8AA 2GUZA 4X1YB 4P30A 2QWOB 4U3JB 4ZBMA 4JI2O 4JTAB 1SA0A 3CRCA 3L73H 3SYCA 4PV1B 3DXRB 2ZDIA 2M7WA 1SESA 2WSSG 2ZCEA 5H2FZ 2EILB 5EIBC 5LL6Y 2LP7A 3CX5F 1TGOA 4MVQA 3SYQA 1HNXB 1XEQA 3E8BA 1KU9A 1VQLV 4QPJA 4KP4A 1ZX3A 2LFSA 3CB2A 4CZZA 1IVSA 4DRXB 4MVUA 3CRAA 2A79B 4X66B 3O9OA 4NXNB 4ASUG 5LP6B 5KMGA 1NTZH 1GMGA 3P3NA 1NQTA 2B1IA 5LXTB 1FD9A 1VQMV 3OTFA 2CAZC 1M56B 1SQBH 2VS0A 1SA0B 5EBMC 1RM1C 3I56V 2FKXA 3MHSC 4JYYA 4DXWA 2Y0IA 4JI1B 3T1HB 4BIOA 2ADQB 3JD2A 5KX5A 4YHHB 1I94B 4R8CA 1JOYA 1N0JA 4H0LB 4CH6A 2PYLA 4CC6A 2WLKA 1LUVA 1H2SB 1E1QG 5IE9A 4WFEA 5KMGB 3JASA 1IBMO 2AGAA 2LJ2A 2YI9A 2K1EA 2YS8A 5JJNB 1AROP 3HR0A 2NLJC 1JJOA 1MNGA 4NKGB 1M56C 2F66C 4I4TA 3FB8C 1BT8A 1SQXH 2QSAA 1GN2A 4H13B 2ZM6O 1HP8A 3OFNG 5IYDO 3T1YB 1HNXO 5KX5B 3SJCC 2ZDIC 4EFBA 4F4LA 2Q6AA 4KFMA 4WFAV 2CGNA 1YHQV 2UUCB 5B1OA 4JI5B 2BCCH 3GWKC 1YIJV 4NXNO 4J7JA 3U10A 4J42A 4J80A 4X64B 3K5OA 2QGNA 3G6EV 4LFAB 1S5HC 1FKAO 2QWNB 3CE2A 5FL7G 5EZYA 3GWOA 3JASB 4O4LA 4H33A 3WG7C 3AG3C 3OW2U 5JVDA 3ZS8C 1QCEA 4QJFB 1YJ9V 4GKKB 1OZ0A 1AP6A 1MZFA 2WA3A 4UVCA 2UUBO 2CTWA 2Z5UA 4DUYB 3OTOB 1A32A 3STZC 4I4TB 4LNUB 4MVZA 1JR9A 3OMIB 3AK2A 3T1HO 2FMLA 1UFIA 4EEQA 1I94O 3K03A 3CXCU 2ZE6A 4HAMA 3JSLA 3OE7G 1Q6HA 3FYIB 5IJ9A 1FS0G 2RNBA 2P4VA 3KZIZ 3ZRVA 2QKCA 2KKWA 1Z5WA 4FJCC 2VQFB 2HP8A 4Z2WA 4O4LB 4I55A 5GTIZ 2HG5C 5JVDB 1P49A 2EIKB 3B8NA 4BAYA 4DR3O 4G28B 3CCSV 3ABTA 3AG4B 1QU7A 4ZI7A 1W0JG 4YJ2A 4JYAO 2DYSB 5IYBO 3UCSC 2UUCO 4UCUA 3VOUA 4JI5O 3DC5A 1XL6A 5J2TA 2P22C 5FPOA 4JI7B 2IW5A 1MZEA 4LF8B 1ZAUA 1TUBA 3EFFK 5CBGA 4LFAO 3W7TA 1BQ0A 3FX7A 2CDYA 1E79G 1SETA 4LWSA 1V54B 4EB6A 5K1XA 2UXBB 2HKOA 4GKKO 3K06A 2W0FC 3UO2A 4JZ2A 4GYCB 4DUYO 2O57A 3OUFA 1IDSA 2HLDG 1K97A 2EX3A 3HKBA 4N21A 1L0LH 3IGAC 3MHHC 4QIWF 2QWPB 4ZHQA 4X20A 5CN0A 4ZI7B 5E79Z 4YJ2B 4NXMB 1P7GA 1R6TA 2KQXA 5A2QN 3LDDA 1XHXA 2GTSA 4FK5C 2IU3A 1JPXA 3JATB 1NU1H 2CE4A 1F7YA 2DYSC 1FFXA 5J2TB 4LFBB 1TUBB 3ASOB 5FLXN 4B3TO 2VQFO 3AEIA 3JCZA 2EZOA 4EB6B 1BGYH 4LWSB 5H6QA 3RYCA 4JV5B 3K5LA 1V54C 2XNDG 1QR8A 4GKJB 3CJHA 4MTFA 2ZNIA 4E4EA 3B8MA 1MMMA 2PZSA 2FB5A 3PN1A 3CRMA 1NT2B 4XDJA 3HKBB 4ZHQB 4X20B 2NNUA 4TQFA 2NN4A 1O9HA 3K04A 3TXQA 1N33O 1Q7YW 2WLIB 3Q4HA 5JH7A 1J95A 1ROPA 5B1NA 4JI7O 1S77D 4LF8O 3LNMB 1FFXB 1S5LZ 4H44B 4J11A 1EM1A 4DV0B 4FVMA 3B2EE 2JEUA 2UXBO 1YDXA 2WLNA 3ZRWA 3W7XA 4JPRA 2Q9LA 2VRZA 2H8PC 1XNRB 3FAVB 4X1IA 2YC0A 2JGDA 1DF4A 3RYHA 3CJHB 4TV9A 1YI2V 5J9PC 2HEPA 2UXDB 3CEIA 1EN6A 1L8DA 3M99B 3CPWU 3K9SA 4MW3A 2ATKC 1CEZA 2HFEC 3BY6A 3Q4HB 5LMUB 4TT3G 4NVPA 3L74H 4LFBO 2QTSA 1RFYA 4B3SB 4OPAA 5DM6V 4HZ3A 4MT8A 3E8HA 2BE3A 2GV9A 4DV3O 3ZRWB 3JCUZ 1XQ8A 2WAMA 2QA4V 1N8RW 3HB3B 1N0NA 4PJ0Z 4X1IB 4X89A 1R3JC 2JGDB 3RYHB 4IHJA 4LCUC 4LF9B 2OT5A 4CS2A 4X88A 1Y76A 4K0KB 4TV9B 1KKDA 1VQKV 5B1BC 3ZMZA 2WLLA 3ZHRA 5IY5B 1FXHA 1PNLA 1UJWB 2MW2B 3I5DA 3OUSA 3VQWA 3ETQA 1GN6A 1I0HA 4YXWG 1IBKO 1PD3A 3OEHG 4DR2O 4UV8A 5CBHA 2ZT9B 3LSSA 5CA1A 2LGWA 4LF5B 3TK1A 2JGUA 2P5OA 4MTGA 4PA7A 2YI8A 4B08A 1VQ9V 1WP7A 4UXNA 2EIMB 2E5LB 4IHJB 2UXDO 1FXKA 5EC1C 1Y76B 3SPGA 2JJ1G 2WLLB 4O4IA 3ETDA 3D36A 3ZHUA 3LSUA 4I9QA 1FAFA 5IY5C 1O9GA 2WWWA 4O4JA 1MG1A 1OCZB 4B3SO 3JAWA 1IX9A 4J9YB 3LDEA 4DW1A 1VQ5V 2EJ7A 1T5EA 1K34A 5K1PA 1K3EA 2Y48A 2WLMA 2EULA 4DK0A 1FXKB 4WBNA 1ZTEA 2GSMB 2Q0AA 1NR1A 2QWRB 3G71V 4O4IB 3JAKA 4JI6B 1GN4A 3QG5A 4PELA 3TCUA 4LH6A 1JJ2U 3OMNB 1M5IA 3KCXA 4JTDB 4O4JB 4YJ3A 1VP7A 3A8TA 3OD4A 3SJQC 2B5UA 2XAFA 3D8CA 2XASA 3JAWB 3ABMB 5KLVH 4X1KA 3E22B 3TETA 1US6A 3ABKB 1HW7A 2HHHO 4IGGA 1KBHA 2YIBD 3KKYA 3R66A 3OGCC 2DWEC 3BRCA 4CBCA 4WBNB 4I9WA 1AI6A 5KA6A 4HBNA 1NZ6A 1BHBA 3JAKB 1RPOA 1NJIW 1FXKC 1SQFA 3OM3B 1R3IC 4LC1A 1AR4A 2Q7EA 5JJJB 2DMXA 4QE9A 5JWPA 1H2MA 1M93A 5EK0A 5HFLA 3BA8A 2XUMA 1BZKA 2ARHA 1XUQA 4D7SA 4NTYA 2QM4A 3CCUV 2F95B 1OCCB 2BTOA 1WNSA 1GM9A 1AR1B 3H1LH 3DXRA 5LGNA 2JVDA 4LH7A 2OYQA 4JI6O 3JD0A 4PDRA 5C8YA 1NVPD 4TQDA 2P67A 2IH1C 3QO8A 1MSDA 4FLWA 4DR5B 1I7FA 2DQ0A 5KUKA 1W2BU 4UCVA 2GBOA 4DRXA 2ZD9A 1FJGB 4DYLA 1BS3A 2ITDC 2DWDC 5LP6A 2Q0OC 1KP3A 4GCZA 4QGPA 4UCTA 5CA3A 2XAJA 1VF6A 3HKCA 1IBMB 3JALA 4JI0B 1GRJA 1D2DA 1GAXA 2R9IA 1PV0A 4R50A 2YXHA 1OJHA 2Z3YA 2W6IG 2XAQA 3OEEG 3BCCH 5KHJA 1VQPV 4CH3A 1U96A 4B3RB 2Q7HA 5C8YB 1PM9A 3ML0A 2ZM6B 3DC6A 2PYJA 4LF4B 1OCRB 2VWJA 4X62B 1AJNA 4QNHB 1WP8A 1N34B 2BTQB 5IDJA 5ITZA 1X59A 1NVPB 4WFGA 2OCCB 1WAZA 4FFBA 3GB7C 3IC9A 5B1AC 4W4LA 2AZ0A 1M90W 3JD3A 4DO2A 4LFCO 3HKCB 1H2GA 3L75H 3JALB 2JS3A 1SZXA 1Q6IA 5LBQA 2UUBB 4LF6B 3J81N 1M57B 2ZR2A 4J10A 2DE0X 1S3JA 4YY3O 2OWOA 1I5YA 4DK1A 5DEDA 4DR5O 1NTMH 3ZIAG 2EILC 5ITZB 4UB6Z 1FJGO 1OCRC 3RYFB 1K33A 5EBWC 4FFBB 2ZINA 1NKDA 3K3WA 2KG7B 3J7AU 1EZVH 2OCCC 4JI0O 1GTOA 1WJZA 4FZ1A 1V9PA 1Q3EA 2EIJB 5LP6C 3S3XA 3F5WC 1RP3B 1SKVA 2CTQA 4LNUA 4DR3B 2LQTA 1VQNV 3RW0A 4J7KA 4B3RO 2R9RB 5L3CA 4FLVA 3O65A 1FXVA 2Q73A 4UCSA 1IXMA 4LF4O 4X62O 4JYAB 1UPGA 2NR5A 1N34O 2BOCC 1QVFU 1KD1W 2YUAA 4FLYA 4AQYO 5L3GA 4PD4F 4PA4A 4AI8A 1HR0B 3B09A 2CUGA 2B9ZA 1VIBA 4ABMA 4LF6O 2Q67A 3C90A 1SQQH 1KKCA 2E74B 1AP5A 1BSMA 3ICXA 3UO3A 2HJDA 4FLZA 1G8MA 1QLEB 2EZPA 3G80A 2EBOA 5BR8B 4UV9A 1KC8W 3OT7A 2A0LA 2FL4A 1XNQB 1TUEB 3ETEA 3JD4A 5HFMA 3RVZA 1XMOB 1BQZA 1VQ7V 4B3TB 2KSDA 4AILC 3H1HH 5J2UA 1JA8A 2Y69B 2ZKOA 4I0XB 3K0GA 1DLBA 3CRRA 2DN9A 2QTOA 4OPHA 4U7NA 4JYCA 5CA0A 4I5SA 4PDLA 1WA8A 2B1GA 2CGOA 1LNQA 3K08A 2YEVA 3L9DA 1B06A 1F4NA 2WLHA 1VF7A 3ZHQA 3VQYA 5L3DA 4WFHA 3JATA 1W0KG 1N33B 1XHZA 4DV2O 4JI4O 5H5NA 4PDVA 4RO2A 3EHBB 1XDCA 5L3BA 1K73W 2AHYA 1HR0O 5J2UB 1QR9A 3ASNB 2DOSA 3FB6C 2UU9B 1K7DA 4ZOLA 5CA0B 1WA8B 4L87A 1VEWA 2IJJA 3HKEB 1B3QA 3SJAC 4GLXA 4RUFA 2QE7G 1JVMA 2YEVB 2EIKC 3ETGA 4IT5A 3BHPA 5BZBA 1KQSU 2LFRA 1HNWO 2A7WA 3KG2A 3AG4C 2WLIA 5BR8O 3QF7A 1DTOA 2RDCA 2LW7A 3P30A 2MK3A 1XNQO 2P4KA 4KXRA 3ZEDA 2YDEA 5CMUA 2FYUH 1XMOO 1VQ8V 1FYJA 2JIZG 2H94A 2DW4A 2X6CA 4R6ZA 3FAVA 4DV3B 4KL1A 5LYJA 2OIGA 3S3WA 1WN7A 2F4VO 4GZRB 4ZOLB 5BMVB 2GTAA 2A3QA 1J5EO 1L0NH 4LR3A 2ZE7A 3BEHA 3AG2B 3T1CA 4FLXA 3IAYA 3CXHF 1TVKB 2QM8A 1IBKB 4DR2B 2QEXV 5DECA 1ZUQA 1KYOF 4ICGA 4BW5A 2UU9O 4TWKA 3ASOC 5LYJB 1YITV 2Z0AA 1YSCA 4TV8B 4EKWA 4YIPA 1PNMA 3SPIA 3G4SV 2WPDG 4JI8O 2E76B 2P7TC 5LHHA 1PL0A 2JK5C 1QLNA 5FNVB 4O4HA 2JS5A 2RN9A 3AG2C 1N36B 3AG1B 2CTPA 2QWQB 2X0LA 4RWUA 2Q68A 2VQEO 1URFA 3RBZA 3JD1A 1SC5B 1ZWIC 1Y66A 1YJWV 3I55V 2X7RB 1MABG 3T2MA 4FM0A 1ZL8A 4X9QA 3CCEV 5KAIZ 5F2VO 4U7OA 1IBLB 4NYKA 3WU2Z 3STLC 4QPKA 3E8FA 3CCJV 1MA1A 4TSFG 4IIJA 2LO1A 4O4HB 3BPZA 4JAAA 4Q20A 3H01A 2K9PA 1H8HG 3K57A 1K5SA 3H1KH 1FPOA 3CCRV 1M1KW 3CMAV 1PKXA 3BVOA 3UM7A 3FB5C 1H2LA 1EZJA 2Y4UA 1CPYA 1V55B 1ZL8B 1DK1A 3IFXA 3ZN1A 4GX5A 2HHHB 2RQ6A 1QBZA 3ZRSA 3D3IA 4GUNA 3K9AA 3RFRA 2OIEA 3EXAA 3HKDA 4B7KA 2L6LA 1YJNV 2QR4A 1N36O 4IIJB 5LA6A 5GONB 4DW0A 5D5QA 2EINB 2ODMA 4G2KA 4LF7B 2PGGA 4LP8A 2HR3A 1VQ4V 3E22A 4P9OA 3E8GA 4WFBV 1R3KC 3RT3C 5KHKA 4IYHA 2QDOA 2R72A 4PA3A 4MW8A 3CC7V 4NTWA 3T4DA 3APQA 1IBLO 3N2GA 1V55C 1LR1A 2JJ2G 4PI0A 1AJPA 5B3SB 1NBMG 2EIMC 4YIOA 1K92A 4L8JA 1D5AA 3HKDB 3F7VC 4N23A 1XREA 5LA6B 3WB0A 4FLTA 4HNAB 5KHHA 4MVSA 4FLUA 1U97A 4MVRA 1S5JA 3BFRA 3R65A 5JJEB 5IYZA 3OR6C 3EVKA 3GVMA 4MSWC 4HYOA 1OCZC 2EINC 1KUQA 3SGIA 1XMQO 2CTRA 1YF2A 2HVKC 3P3PA 5H6RA 3ZMTA 4WCEV 1YCIA 1SERA 4DR6B 3DGEA 4G27B 1CXZB 1RPRA 4FIPC 2DJVA 3B4SA 3N2GB 3L70H 2YIBA 1TAEA 1AB3A 3LUTB 3ZHVA 3ABUA 4H37A 2C2AA 5EIBD 4AHCA 1WLEA 4DV6B 3W7SA 3A2FA 5B3SC 3UT5A 2G38A 4K8ZA 2F23A 3MD0A 3D36C 4LF7O 2VWKA 1MOFA 2IH3C 3OGIB 1W59A 1WPBA 5IYZB 5IJ0A 3IC7A 3N2KA 4OGQB 3HPLC 4RQFA 4FFKA 4LFCB 4JF3A 3CCMV 1VQ6V 1N32B 3ABMC 4Z1MG 1HWYA 1R73A 5KHGA 3SPHA 1AR5A 2PF4E 2ZXWB 2XT9A 4DR4B 4DV5B 2ZIOA 3WB2A 5A9GA 1F4MA 3ABKC 2UUAO 5CB4A 3ZCCA 4YY3B 4B3MB 1YTFD 2BTQA 1BCCH 3UT5B 1YEWA 1F51A 4DV4O 1H8EG 4K3AA 3QTCA 4KHPO 4JGSA 4XDKA 5IJ0B 3N2KB 2IBZH 4DUZB 1E1RG 2IJIA 2WLJA 4DR6O 1BHAA 2JEXA 4WFFA 2YICA 3RGBA 1M9NA 1OCCC 3BABA 2AXTZ 4D7TA 3SYAA
chains in the Genus database with same CATH topology
3OAAG 1J95A 1G8MA 1QLEB 1ROPA 2AHZA 4R7CA 5B1NA 1S77D 1R6NA 2EZPA 1K5QA 2EBOA 3LNMB 4UV9A 4J9ZB 1KC8W 1RM1B 2A0LA 1P7BA 4XBFA 1TUEB 2JEUA 3ETEA 1EBOA 3JD4A 4UVBA 1SRYA 3ABLB 2WLNA 2HJFC 3RVZA 3ZRWA 5HFMA 3W7XA 4JPRA 4UUJC 3E83A 1VQ7V 4FPPA 1YTFB 2H8PC 5BZBA 3CCQV 2Y69B 1DF4A 3CD6V 4KUMA 3K0GA 1DLBA 3K79A 1JCHA 2QTOA 1YI2V 5J9PC 4U7NA 3CCLV 1PNKA 4JYCA 3UKMA 4I5SA 4PDLA 4PA6A 2B1GA 2XAGA 4LBEC 3M99B 3CPWU 4QE7A 2XOKG 2V1DA 1LNQA 3JYCA 3K08A 1KP2A 2YEVA 1THZA 4MW3A 2ATKC 3ZN0A 1CEZA 1F4NA 2WLHA 3E2EA 3OR7C 1S76D 2HFEC 3BY6A 5L3DA 1S0VA 2BOBC 5LGTA 4TT3G 4WFHA 1W0KG 1GO3F 5DM6V 4HZ3A 4MT8A 3E8HA 4RUEA 1I5XA 4PDVA 2D3OW 1OHHG 4RO2A 2W6JG 3EHBB 3ZRWB 5L3BA 1QVGU 2WAMA 2QA4V 1N8RW 3HB3B 2AHYA 1K73W 1QR9A 1DF5A 1R3JC 3ASNB 4X89A 1NH2D 3FB7C 3E86A 3ABLC 1ORQC 3FB6C 4LCUC 1K7DA 2OT5A 4X88A 1AI7A 1KKDA 1VQKV 5B1BC 1P4RA 3ZMZA 2WLLA 4L87A 5IY5B 3ZMSA 1FXHA 2IJJA 1PNLA 5IYCO 3X2QB 2X6AA 1UJWB 4RUFA 2YEVB 2QE7G 1JVMA 1WPXA 1GM7A 2EIKC 2HVJC 3ETGA 3QNEA 5H9CA 4P9PA 3WG7B 3AG3B 2LFRA 3OUSA 3A0RA 4MVOA 4YXWG 3E35A 1PD3A 3KG2A 3OEHG 3AG4C 2WLIA 4UV8A 5CBHA 1DTOA 3P30A 2MK3A 1M57C 3ZRXA 3LSSA 1MSWD 3TK1A 5CMUA 1JQ0A 3CC4V 3K0DA 1R3LC 3NXSA 1VQ8V 2F43G 4X8AA 3CCVV 4MTGA 5KA5A 5E1AC 2JIZG 1JX9A 1NR7A 4MS2A 4PA7A 2H94A 1VQ9V 4UXNA 4BIZA 2X6CA 2DW4A 4R6ZA 1L1FA 2EIMB 2QKSA 1G4YB 2Q69A 4E2LA 1FFTB 2KB1A 1FXKA 5EC1C 1BMFG 2OTJV 3SPGA 4FMTA 5LHIA 1NH2B 4GX2A 2JJ1G 2WLLB 3ETDA 2JDIG 3BEHA 1F23A 3D36A 3AG2B 5B1AB 3T1CA 3E89A 3SYOA 2EIJC 3CP1A 5IY5C 4JAUA 2WWWA 3DTUB 3X2QC 1MG1A 1OCZB 5DN6G 3LDCA 4JTCB 2QM8A 2ZXWC 3ZJZA 2ZQMA 2QEXV 5LGUA 1GM8A 2DQ3A 4J9YB 4P30A 2XAHA 3LDEA 4ZBMA 1VQ5V 3W7UA 4JTAB 3SPCA 4BW5A 4XDLA 1K34A 3SYCA 1K3EA 3ASOC 2ZDIA 4TWKA 2IJHA 2M7WA 2Y48A 1SESA 2WLMA 2WSSG 5C93A 1YITV 1YSCA 1GK9A 2EILB 1FXKB 4EKWA 1EFRG 2GSMB 1NR1A 1PNMA 2LP7A 3SPIA 3G4SV 2WPDG 3G71V 4MVQA 3SYQA 3E8BA 1VQLV 2GHYA 4PELA 3TCUA 2P7TC 4QPJA 5LHHA 4KP4A 4GX0A 2LFSA 2ZR3A 4CZZA 1JJ2U 3OMNB 1PL0A 2JK5C 1VQOV 3PJSK 1QLNA 2UXXA 4MVUA 5L3FA 2A79B 1AJQA 4JTDB 3AG2C 3SJQC 4ASUG 3AG1B 2OTLV 2B5UA 2XAFA 1GMGA 2XASA 3ABMB 1BL8A 3T4ZA 1NQTA 2B1IA 2X0LA 3OMAB 1VQMV 2UXNA 2Q68A 1M56B 3RBZA 3JD1A 1QLEC 1K4DC 3TETA 1ZWIC 1Y66A 3ABKB 5EBMC 1YJWV 1RM1C 3I55V 2X7RB 3WFVA 4JASA 1MABG 3I56V 3T2MA 3MHSC 4DXWA 1H38A 1B6QA 3CMEV 3OGCC 3CCEV 2DWEC 4CBCA 4I9WA 1AI6A 3JD2A 5KA6A 4U7OA 1BHBA 4MTOA 2Y69C 4R8CA 1JOYA 1RPOA 2IJKA 1NJIW 1FXKC 3STLC 3OM3B 4QPKA 4WF9V 1R3IC 3E8FA 3CCJV 4LC1A 4TSFG 1KECA 5L3EA 2WLKA 4Q20A 3H01A 4QE9A 1E1QG 5EK0A 4WFEA 1H8HG 4BIUA 1K5SA 5HFLA 2K1EA 3CCRV 1M1KW 5LHGA 3CMAV 1AROP 1PKXA 3CCUV 3CC2V 3UM7A 4RQEA 2NLJC 3FB5C 5EC2C 1OCCB 1EZJA 1GM9A 1M56C 1Q86W 1AR1B 3FB8C 3B77A 1CPYA 1V55B 2V7QG 3IFXA 3F7YC 5LGNA 3ZN1A 4GX5A 3OFNG 2IU0A 5IYDO 1XL4A 3FYEB 1QBZA 1SZTA 3JD0A 4PDRA 3ASNC 2ZDIC 3D3IA 3ZRSA 4F4LA 2Q6AA 3K9AA 4KFMA 1NVPD 2P67A 2IH1C 2A9HA 4WFAV 3QO8A 1YHQV 5B1OA 4PDMA 2DQ0A 5KUKA 1YIJV 1YJNV 1W2BU 4PA9A 2ZD9A 3G6EV 1S5HC 5FL7G 2ITDC 2EINB 3GWOA 1Q82W 2DWDC 4GCZA 1KP3A 4RAIA 4H33A 4G2KA 3WG7C 2XAJA 3AG3C 5CA3A 3OW2U 4LP8A 4QJFB 1QCEA 1YJ9V 2DYRB 1OZ0A 2HR3A 4UVAA 1VQ4V 4P9OA 3E8GA 4UVCA 4WFBV 5EBLC 2Z5UA 1R3KC 2R9IA 4R50A 3QO5A 3STZC 4ZKIA 2QM7A 4MVZA 3OMIB 2Z3YA 2W6IG 2PI4A 2XAQA 4MW8A 4PA3A 3CC7V 2P6JA 3OEEG 3T4DA 2EJRA 1VQPV 2PI5A 3K03A 1Q81W 3CXCU 4HAMA 1V55C 2JJ2G 1AJPA 1ENVA 4JYBA 5B3SB 1NBMG 2EIMC 3ML0A 1OCRB 3OE7G 1K92A 3FYIB 1AJNA 1FS0G 3F7VC 4QNHB 5IDJA 4N23A 1Y4MA 1NVPB 3ZRVA 1AI4A 3CYOA 4WFGA 2OCCB 4FJCC 1S72V 4MVSA 3GB7C 5B1AC 2YSUB 4MVRA 5B1BB 1M90W 5KUMA 3JD3A 2HG5C 3R65A 1K9MW 4DO2A 3OR6C 1OCOB 1H2GA 4MSWC 2EIKB 4HYOA 1OCZC 3B8NA 2EINC 4BAYA 4G28B 2HVKC 5H6RA 3ZMTA 1K8AW 2DYRC 3CCSV 4WCEV 3ABTA 3AG4B 5LBQA 4GT1A 1SERA 3DGEA 1M57B 1COWG 2ZR2A 1W0JG 2ITCC 4G27B 1GKFA 1RPRA 2DYSB 3SYPA 1S3JA 3VBBA 4FIPC 3SPJA 5IYBO 1AI5A 1I5YA 3VOUA 3LUTB 3QO7A 3ABUA 1XL6A 4H37A 2C2AA 2EILC 3ZIAG 2IW5A 1WLEA 3W7SA 3EFFK 2X6BA 5B3SC 5CBGA 3W7WA 3W7TA 1OCRC 1E79G 1SETA 1K33A 1V54B 3FKSG 5EBWC 5CBFA 3MD0A 1NKDA 2HKOA 3K3WA 2CK3G 1MOFA 3K06A 4GX1A 2IH3C 2OCCC 2W0FC 1GTOA 3IC7A 3AG1C 2EIJB 3OUFA 3HPLC 2HLDG 3F5WC 4OXSA 4RQFA 4JF3A 3CCMV 1K97A 4MTXA 3ABMC 4N21A 1HWYA 1R73A 3P32A 4Z1MG 1VQ6V 3SPHA 1OCOC 3IGAC 3MHHC 4QIWF 5CN0A 1VQNV 3RW0A 2ZXWB 3ZMVA 1R6KA 5GW7A 2R9RB 3LDDA 5L3CA 3ABKC 1F4MA 1FXVA 4FK5C 1IXMA 2IU3A 1JPXA 1K4CC 3ZCCA 2BOCC 2DYSC 4P2ZA 1QVFU 1YTFD 1KQSU 3ASOB 1KD1W 3AEIA 3ZMUA 3JCZA 4MVMA 2EZOA 1F51A 5H6QA 5L3GA 1H8EG 4PA4A 3RVYA 1V54C 2XNDG 2P90A 4JGSA 2FTKA 1QR8A 4JAVA 4XDKA 4MTFA 3B8MA 1E1RG 2IJIA 2Q67A 4XDJA 2WLJA 1BHAA 2JEXA 4WFFA 3LSQA 1CP9A 2NNUA 1M9NA 3K04A 1OCCC 3SYAA 1Q7YW 2WLIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B77 A;  5H9C A;  1I5X A;  3B8N A;  5CN0 A;  2LP7 A;  3GWO A;  2EZP A;  1ENV A;  4E2L A;  4G2K A;  2EBO A;  3M99 B;  1K33 A;  1Y66 A;  4JGS A;  1QR8 A;  1QCE A;  3H01 A;  4FK5 C;  2X7R B;  1QBZ A;  1DF5 A;  1JPX A;  1QR9 A;  1EBO A;  1SZT A;  3B8M A;  3MHS C;  3P30 A;  1Y4M A;  4N23 A;  5HFL A;  2MK3 A;  1MOF A;  3K9A A;  5HFM A;  3CYO A;  4JPR A;  2OT5 A;  4FJC C;  5CMU A;  1F23 A;  1JQ0 A;  4FIP C;  1K34 A;  5KA6 A;  1I5Y A;  1DF4 A;  3CP1 A;  5KA5 A;  2M7W A;  2P6J A;  4JF3 A;  2EZO A;  4N21 A;  1DLB A;  1MG1 A;  3MHH C;  3WFV A; 
#chains in the Genus database with same CATH topology
 2OCH A;  3OAA G;  4R7C A;  2AHZ A;  2ZNJ A;  1R6N A;  4DV6 O;  5CB4 B;  1K5Q A;  4FM1 A;  3A0H Z;  4J9Z B;  1RM1 B;  3SJB C;  1P7B A;  4XBF A;  1DGS A;  5LMN B;  5KHI A;  1SRY A;  4CS3 A;  1Q90 D;  3RYF A;  1YTF B;  1Y67 A;  3CCQ V;  1WB8 A;  2KG7 A;  4AQY B;  3CD6 V;  4KUM A;  1KB9 F;  4X65 O;  4FM2 A;  1JCH A;  1N32 O;  1EN4 A;  3CCL V;  3RYI B;  4PA6 A;  2XAG A;  4LBE C;  4QE7 A;  1Z2G A;  2XOK G;  2V1D A;  2YXY A;  3H9V A;  4DR4 O;  4DV5 O;  1THZ A;  3ZHS A;  3WB1 A;  1S76 D;  2Y4T A;  2BOB C;  5LGT A;  3ZBH A;  1AVM A;  4B3M O;  2Q7G A;  1HNZ O;  1I08 A;  2GUZ B;  2N05 A;  1I5X A;  1ZSP A;  3CSX A;  2GDS A;  4OX9 B;  2N04 A;  2YXL A;  2YID A;  1ORQ C;  4DUZ O;  4NR1 A;  4A5U B;  3ZMS A;  4NB5 A;  3K58 A;  1VF6 C;  3X2Q B;  4J41 A;  2ADP A;  1WPX A;  1GM7 A;  3QNE A;  4YHH O;  4P9P A;  1XBL A;  1SQG A;  2ZE8 A;  3WG7 B;  3AG3 B;  3A0R A;  1QHT A;  3E35 A;  4F6R A;  3CWB H;  1M57 C;  1YVW A;  5LMN O;  3L72 H;  1MSW D;  1JQ0 A;  1Q43 A;  3NXS A;  3KCY A;  4X8A A;  3CCV V;  5KA5 A;  1JX9 A;  1NR7 A;  4MS2 A;  4DV2 B;  4JI4 B;  5AG2 A;  2A06 H;  4BIZ A;  1L1F A;  1JFF A;  2QKS A;  4E2L A;  1IUR A;  1FFT B;  4I0X A;  4UCR A;  5LHI A;  2OTJ V;  4GX2 A;  3FD9 A;  3U0Z A;  2QJ1 A;  3L71 H;  1F23 A;  4X66 O;  3SR2 C;  2P06 A;  2ZIM A;  2EIJ C;  3CP1 A;  4U3F H;  5B66 Z;  2WA4 A;  4Q6G A;  4ZIB A;  3DTU B;  3X2Q C;  1Y6X A;  4F6R B;  5DN6 G;  4JTC B;  2N74 A;  1HNW B;  1KMI Z;  5LGU A;  4OX9 O;  2XAH A;  3W7U A;  3AG7 A;  3SPC A;  4XDL A;  4TOI A;  4JI1 O;  4UFZ A;  4F6E A;  1JFF B;  5C93 A;  2IJH A;  4K35 A;  1GK9 A;  1EFR G;  4FZ0 A;  4CH5 A;  3ZX6 A;  2F4V B;  4D6T H;  2IM9 A;  2GHY A;  1J5E B;  3HKE A;  4GX0 A;  2ZR3 A;  2Q4P A;  3A0B Z;  3PJS K;  1VQO V;  2UXX A;  3TJT A;  5L3F A;  1AJQ A;  5EZY B;  2OTL V;  1SQV H;  2AZ2 A;  1BL8 A;  3T4Z A;  3OMA B;  2UXN A;  3SDL A;  1QLE C;  1K4D C;  4K8X A;  1RSO A;  1YZB A;  3WFV A;  1LUW A;  4JAS A;  3T1Y O;  1GH6 A;  1H2K A;  1H38 A;  1B6Q A;  3CME V;  4I50 A;  3BA9 A;  4BR6 A;  3K5M A;  4MTO A;  5BMV A;  4JZG A;  2Y69 C;  2IJK A;  5IJ9 B;  4WF9 V;  4X64 O;  4JI8 B;  1KEC A;  1NI8 A;  5L3E A;  2PUS A;  4BIU A;  4IYI A;  4I55 B;  4CC5 A;  2E75 B;  1TVK A;  2ZE5 A;  3OTO O;  5LHG A;  1SS3 A;  3CC2 V;  4RQE A;  5EC2 C;  2VQE B;  1RSO B;  1Q86 W;  2Q8V A;  2V4D A;  3B77 A;  5BY1 A;  2V7Q G;  3F7Y C;  4I50 B;  2IU0 A;  1XL4 A;  3FYE B;  4TV8 A;  1SZT A;  3ASN C;  4DV1 B;  2A9H A;  1XIL A;  4PHZ A;  2L35 A;  4PDM A;  4PA9 A;  2XTA A;  3H1J H;  4W4K A;  3MDS A;  3JAM N;  5FNV A;  2R9A A;  3D3Q A;  1Q82 W;  4RAI A;  3QVN A;  3MAQ A;  2DYR B;  1PPJ H;  4UVA A;  3VQV A;  5EBL C;  4J7Z A;  3QO5 A;  4ZKI A;  2QM7 A;  4TUY A;  3IJ4 A;  2PI4 A;  2P6J A;  1NS1 A;  2EJR A;  4IL6 Z;  2PI5 A;  4EFE A;  1Q81 W;  2LW1 A;  3C3S A;  2UXC B;  1VAR A;  4JYB A;  1ENV A;  4B7E A;  1BE3 H;  4CS4 A;  1Y4M A;  1QNM A;  1AI4 A;  3CYO A;  5JQG A;  3RYC B;  3RN4 A;  2Y0P A;  1S72 V;  2E3C A;  5TIS Z;  2YSU B;  5B1B B;  5KUM A;  3CS5 A;  2AW9 A;  1K9M W;  3RWR D;  1Q8I A;  3JAR A;  5BXZ A;  3TGU H;  1OCO B;  1Y74 A;  3G6B A;  1TA8 A;  2YIA A;  1K8A W;  2DYR C;  4NXM O;  4GT1 A;  4CH4 A;  4TUY B;  3THO A;  4UCO A;  1COW G;  1EN5 A;  2ITC C;  1GKF A;  4C7U A;  4DV1 O;  3SYP A;  5JH7 B;  3VBB A;  1WB7 A;  4Z1V A;  3SPJ A;  3J80 N;  2PTM A;  3F5T A;  1AI5 A;  2BSK A;  3BAA A;  3N27 A;  3AK1 A;  3QO7 A;  3H1I H;  2LGQ A;  2X6B A;  4JV5 O;  3W7W A;  3G67 A;  5IWA B;  4DR1 B;  5JQG B;  3CHX A;  4O2A A;  3FKS G;  5GON A;  2PY5 A;  5CBF A;  4O2B A;  4GKJ O;  3CRQ A;  1VMG A;  2CK3 G;  4GX1 A;  3JAR B;  1ZLZ A;  1Y74 B;  3AG1 C;  4BWA A;  4OXS A;  4MTX A;  3P32 A;  1OCO C;  1NTK H;  1XMQ B;  5LOV A;  3ZMV A;  1R6K A;  5GW7 A;  2UXC O;  4JI3 B;  2BSK B;  4DV0 O;  1K4C C;  1QQC A;  4P2Z A;  4NTX A;  1XNR O;  1JMK C;  3ZMU A;  4MVM A;  1IZ3 A;  4O2A B;  2ILM A;  5KAF Z;  4O2B B;  3ZHT A;  4HNA A;  3RVY A;  2P90 A;  2FTK A;  4JAV A;  4PI2 A;  3U11 A;  1H2N A;  5GTH Z;  3NR7 A;  3TXS A;  3LSQ A;  1R1B A;  1CP9 A;  2R70 A;  5LOV B;  1XI1 A;  5LMU O;  3K59 A;  2RMK B;  2H3O A;  1XOU A;  1P84 F;  1AIL A;  3M7M X;  5CA1 B;  1OV9 A;  1X4T A;  5JCO A;  1B04 A;  3DSQ A;  4DR1 O;  5IWA O;  1PL4 A;  1PP9 H;  2UUA B;  1EBO A;  3UQ8 A;  3FFQ A;  3ABL B;  4UVB A;  5B5E Z;  2HJF C;  3APO A;  4UUJ C;  3E83 A;  4FPP A;  4LF9 O;  4K0K O;  4DV4 B;  3K79 A;  1PNK A;  3UKM A;  4KHP B;  3C3T A;  3JYC A;  1KP2 A;  1G1X B;  3ZN0 A;  3E2E A;  1Q5O A;  2CH7 A;  4JI3 O;  3OR7 C;  1GN3 A;  3K5N A;  1S0V A;  4LF5 O;  1HDJ A;  5EYP A;  1Z5V A;  2XHB A;  4DR7 B;  1GO3 F;  4DV7 B;  4RUE A;  1SQP H;  3B40 A;  2D3O W;  1OHH G;  2W6J G;  1QVG U;  2E5L O;  1DF5 A;  1NH2 D;  2Q5Z A;  4JI2 B;  3VQX A;  3FB7 C;  2JRI A;  3E86 A;  3ABL C;  2D2C B;  1Q6U A;  1AI7 A;  4X65 B;  1P4R A;  1M4U A;  5IYC O;  2X6A A;  5H9C A;  2HVJ C;  4BW9 A;  3AK3 A;  2CH7 B;  4YJ3 B;  4MVO A;  2RJZ A;  2F93 B;  5EYP B;  5FPR A;  3ZRX A;  4X1K B;  3CC4 V;  3K0D A;  1R3L C;  2F43 G;  4X1Y A;  1SF9 A;  4U3J A;  5E1A C;  1IXB A;  1HNZ B;  1N4C A;  5JCO C;  5IT9 N;  1G4Y B;  2Q69 A;  2KB1 A;  2M6Y A;  1BMF G;  4FMT A;  1NH2 B;  3LNN A;  3JSN A;  2QKA A;  1G6U A;  3RYI A;  2F1M A;  2JDI G;  1YXB A;  4I7Z B;  5D5P A;  2ETN A;  5B1A B;  3E89 A;  3SYO A;  4JAU A;  3LDC A;  4DR7 O;  4DV7 O;  3ZJZ A;  2RCV A;  2ZXW C;  2W0X A;  5LXT A;  2ZQM A;  1VF5 B;  4UB8 Z;  1GM8 A;  2DQ3 A;  1D5N A;  3M8A A;  2GUZ A;  4X1Y B;  4P30 A;  2QWO B;  4U3J B;  4ZBM A;  4JI2 O;  4JTA B;  1SA0 A;  3CRC A;  3L73 H;  3SYC A;  4PV1 B;  3DXR B;  2ZDI A;  2M7W A;  1SES A;  2WSS G;  2ZCE A;  5H2F Z;  2EIL B;  5EIB C;  5LL6 Y;  2LP7 A;  3CX5 F;  1TGO A;  4MVQ A;  3SYQ A;  1HNX B;  1XEQ A;  3E8B A;  1KU9 A;  1VQL V;  4QPJ A;  4KP4 A;  1ZX3 A;  2LFS A;  3CB2 A;  4CZZ A;  1IVS A;  4DRX B;  4MVU A;  3CRA A;  2A79 B;  4X66 B;  3O9O A;  4NXN B;  4ASU G;  5LP6 B;  5KMG A;  1NTZ H;  1GMG A;  3P3N A;  1NQT A;  2B1I A;  5LXT B;  1FD9 A;  1VQM V;  3OTF A;  2CAZ C;  1M56 B;  1SQB H;  2VS0 A;  1SA0 B;  5EBM C;  1RM1 C;  3I56 V;  2FKX A;  3MHS C;  4JYY A;  4DXW A;  2Y0I A;  4JI1 B;  3T1H B;  4BIO A;  2ADQ B;  3JD2 A;  5KX5 A;  4YHH B;  1I94 B;  4R8C A;  1JOY A;  1N0J A;  4H0L B;  4CH6 A;  2PYL A;  4CC6 A;  2WLK A;  1LUV A;  1H2S B;  1E1Q G;  5IE9 A;  4WFE A;  5KMG B;  3JAS A;  1IBM O;  2AGA A;  2LJ2 A;  2YI9 A;  2K1E A;  2YS8 A;  5JJN B;  1ARO P;  3HR0 A;  2NLJ C;  1JJO A;  1MNG A;  4NKG B;  1M56 C;  2F66 C;  4I4T A;  3FB8 C;  1BT8 A;  1SQX H;  2QSA A;  1GN2 A;  4H13 B;  2ZM6 O;  1HP8 A;  3OFN G;  5IYD O;  3T1Y B;  1HNX O;  5KX5 B;  3SJC C;  2ZDI C;  4EFB A;  4F4L A;  2Q6A A;  4KFM A;  4WFA V;  2CGN A;  1YHQ V;  2UUC B;  5B1O A;  4JI5 B;  2BCC H;  3GWK C;  1YIJ V;  4NXN O;  4J7J A;  3U10 A;  4J42 A;  4J80 A;  4X64 B;  3K5O A;  2QGN A;  3G6E V;  4LFA B;  1S5H C;  1FKA O;  2QWN B;  3CE2 A;  5FL7 G;  5EZY A;  3GWO A;  3JAS B;  4O4L A;  4H33 A;  3WG7 C;  3AG3 C;  3OW2 U;  5JVD A;  3ZS8 C;  1QCE A;  4QJF B;  1YJ9 V;  4GKK B;  1OZ0 A;  1AP6 A;  1MZF A;  2WA3 A;  4UVC A;  2UUB O;  2CTW A;  2Z5U A;  4DUY B;  3OTO B;  1A32 A;  3STZ C;  4I4T B;  4LNU B;  4MVZ A;  1JR9 A;  3OMI B;  3AK2 A;  3T1H O;  2FML A;  1UFI A;  4EEQ A;  1I94 O;  3K03 A;  3CXC U;  2ZE6 A;  4HAM A;  3JSL A;  3OE7 G;  1Q6H A;  3FYI B;  5IJ9 A;  1FS0 G;  2RNB A;  2P4V A;  3KZI Z;  3ZRV A;  2QKC A;  2KKW A;  1Z5W A;  4FJC C;  2VQF B;  2HP8 A;  4Z2W A;  4O4L B;  4I55 A;  5GTI Z;  2HG5 C;  5JVD B;  1P49 A;  2EIK B;  3B8N A;  4BAY A;  4DR3 O;  4G28 B;  3CCS V;  3ABT A;  3AG4 B;  1QU7 A;  4ZI7 A;  1W0J G;  4YJ2 A;  4JYA O;  2DYS B;  5IYB O;  3UCS C;  2UUC O;  4UCU A;  3VOU A;  4JI5 O;  3DC5 A;  1XL6 A;  5J2T A;  2P22 C;  5FPO A;  4JI7 B;  2IW5 A;  1MZE A;  4LF8 B;  1ZAU A;  1TUB A;  3EFF K;  5CBG A;  4LFA O;  3W7T A;  1BQ0 A;  3FX7 A;  2CDY A;  1E79 G;  1SET A;  4LWS A;  1V54 B;  4EB6 A;  5K1X A;  2UXB B;  2HKO A;  4GKK O;  3K06 A;  2W0F C;  3UO2 A;  4JZ2 A;  4GYC B;  4DUY O;  2O57 A;  3OUF A;  1IDS A;  2HLD G;  1K97 A;  2EX3 A;  3HKB A;  4N21 A;  1L0L H;  3IGA C;  3MHH C;  4QIW F;  2QWP B;  4ZHQ A;  4X20 A;  5CN0 A;  4ZI7 B;  5E79 Z;  4YJ2 B;  4NXM B;  1P7G A;  1R6T A;  2KQX A;  5A2Q N;  3LDD A;  1XHX A;  2GTS A;  4FK5 C;  2IU3 A;  1JPX A;  3JAT B;  1NU1 H;  2CE4 A;  1F7Y A;  2DYS C;  1FFX A;  5J2T B;  4LFB B;  1TUB B;  3ASO B;  5FLX N;  4B3T O;  2VQF O;  3AEI A;  3JCZ A;  2EZO A;  4EB6 B;  1BGY H;  4LWS B;  5H6Q A;  3RYC A;  4JV5 B;  3K5L A;  1V54 C;  2XND G;  1QR8 A;  4GKJ B;  3CJH A;  4MTF A;  2ZNI A;  4E4E A;  3B8M A;  1MMM A;  2PZS A;  2FB5 A;  3PN1 A;  3CRM A;  1NT2 B;  4XDJ A;  3HKB B;  4ZHQ B;  4X20 B;  2NNU A;  4TQF A;  2NN4 A;  1O9H A;  3K04 A;  3TXQ A;  1N33 O;  1Q7Y W;  2WLI B;  3Q4H A;  5JH7 A;  1J95 A;  1ROP A;  5B1N A;  4JI7 O;  1S77 D;  4LF8 O;  3LNM B;  1FFX B;  1S5L Z;  4H44 B;  4J11 A;  1EM1 A;  4DV0 B;  4FVM A;  3B2E E;  2JEU A;  2UXB O;  1YDX A;  2WLN A;  3ZRW A;  3W7X A;  4JPR A;  2Q9L A;  2VRZ A;  2H8P C;  1XNR B;  3FAV B;  4X1I A;  2YC0 A;  2JGD A;  1DF4 A;  3RYH A;  3CJH B;  4TV9 A;  1YI2 V;  5J9P C;  2HEP A;  2UXD B;  3CEI A;  1EN6 A;  1L8D A;  3M99 B;  3CPW U;  3K9S A;  4MW3 A;  2ATK C;  1CEZ A;  2HFE C;  3BY6 A;  3Q4H B;  5LMU B;  4TT3 G;  4NVP A;  3L74 H;  4LFB O;  2QTS A;  1RFY A;  4B3S B;  4OPA A;  5DM6 V;  4HZ3 A;  4MT8 A;  3E8H A;  2BE3 A;  2GV9 A;  4DV3 O;  3ZRW B;  3JCU Z;  1XQ8 A;  2WAM A;  2QA4 V;  1N8R W;  3HB3 B;  1N0N A;  4PJ0 Z;  4X1I B;  4X89 A;  1R3J C;  2JGD B;  3RYH B;  4IHJ A;  4LCU C;  4LF9 B;  2OT5 A;  4CS2 A;  4X88 A;  1Y76 A;  4K0K B;  4TV9 B;  1KKD A;  1VQK V;  5B1B C;  3ZMZ A;  2WLL A;  3ZHR A;  5IY5 B;  1FXH A;  1PNL A;  1UJW B;  2MW2 B;  3I5D A;  3OUS A;  3VQW A;  3ETQ A;  1GN6 A;  1I0H A;  4YXW G;  1IBK O;  1PD3 A;  3OEH G;  4DR2 O;  4UV8 A;  5CBH A;  2ZT9 B;  3LSS A;  5CA1 A;  2LGW A;  4LF5 B;  3TK1 A;  2JGU A;  2P5O A;  4MTG A;  4PA7 A;  2YI8 A;  4B08 A;  1VQ9 V;  1WP7 A;  4UXN A;  2EIM B;  2E5L B;  4IHJ B;  2UXD O;  1FXK A;  5EC1 C;  1Y76 B;  3SPG A;  2JJ1 G;  2WLL B;  4O4I A;  3ETD A;  3D36 A;  3ZHU A;  3LSU A;  4I9Q A;  1FAF A;  5IY5 C;  1O9G A;  2WWW A;  4O4J A;  1MG1 A;  1OCZ B;  4B3S O;  3JAW A;  1IX9 A;  4J9Y B;  3LDE A;  4DW1 A;  1VQ5 V;  2EJ7 A;  1T5E A;  1K34 A;  5K1P A;  1K3E A;  2Y48 A;  2WLM A;  2EUL A;  4DK0 A;  1FXK B;  4WBN A;  1ZTE A;  2GSM B;  2Q0A A;  1NR1 A;  2QWR B;  3G71 V;  4O4I B;  3JAK A;  4JI6 B;  1GN4 A;  3QG5 A;  4PEL A;  3TCU A;  4LH6 A;  1JJ2 U;  3OMN B;  1M5I A;  3KCX A;  4JTD B;  4O4J B;  4YJ3 A;  1VP7 A;  3A8T A;  3OD4 A;  3SJQ C;  2B5U A;  2XAF A;  3D8C A;  2XAS A;  3JAW B;  3ABM B;  5KLV H;  4X1K A;  3E22 B;  3TET A;  1US6 A;  3ABK B;  1HW7 A;  2HHH O;  4IGG A;  1KBH A;  2YIB D;  3KKY A;  3R66 A;  3OGC C;  2DWE C;  3BRC A;  4CBC A;  4WBN B;  4I9W A;  1AI6 A;  5KA6 A;  4HBN A;  1NZ6 A;  1BHB A;  3JAK B;  1RPO A;  1NJI W;  1FXK C;  1SQF A;  3OM3 B;  1R3I C;  4LC1 A;  1AR4 A;  2Q7E A;  5JJJ B;  2DMX A;  4QE9 A;  5JWP A;  1H2M A;  1M93 A;  5EK0 A;  5HFL A;  3BA8 A;  2XUM A;  1BZK A;  2ARH A;  1XUQ A;  4D7S A;  4NTY A;  2QM4 A;  3CCU V;  2F95 B;  1OCC B;  2BTO A;  1WNS A;  1GM9 A;  1AR1 B;  3H1L H;  3DXR A;  5LGN A;  2JVD A;  4LH7 A;  2OYQ A;  4JI6 O;  3JD0 A;  4PDR A;  5C8Y A;  1NVP D;  4TQD A;  2P67 A;  2IH1 C;  3QO8 A;  1MSD A;  4FLW A;  4DR5 B;  1I7F A;  2DQ0 A;  5KUK A;  1W2B U;  4UCV A;  2GBO A;  4DRX A;  2ZD9 A;  1FJG B;  4DYL A;  1BS3 A;  2ITD C;  2DWD C;  5LP6 A;  2Q0O C;  1KP3 A;  4GCZ A;  4QGP A;  4UCT A;  5CA3 A;  2XAJ A;  1VF6 A;  3HKC A;  1IBM B;  3JAL A;  4JI0 B;  1GRJ A;  1D2D A;  1GAX A;  2R9I A;  1PV0 A;  4R50 A;  2YXH A;  1OJH A;  2Z3Y A;  2W6I G;  2XAQ A;  3OEE G;  3BCC H;  5KHJ A;  1VQP V;  4CH3 A;  1U96 A;  4B3R B;  2Q7H A;  5C8Y B;  1PM9 A;  3ML0 A;  2ZM6 B;  3DC6 A;  2PYJ A;  4LF4 B;  1OCR B;  2VWJ A;  4X62 B;  1AJN A;  4QNH B;  1WP8 A;  1N34 B;  2BTQ B;  5IDJ A;  5ITZ A;  1X59 A;  1NVP B;  4WFG A;  2OCC B;  1WAZ A;  4FFB A;  3GB7 C;  3IC9 A;  5B1A C;  4W4L A;  2AZ0 A;  1M90 W;  3JD3 A;  4DO2 A;  4LFC O;  3HKC B;  1H2G A;  3L75 H;  3JAL B;  2JS3 A;  1SZX A;  1Q6I A;  5LBQ A;  2UUB B;  4LF6 B;  3J81 N;  1M57 B;  2ZR2 A;  4J10 A;  2DE0 X;  1S3J A;  4YY3 O;  2OWO A;  1I5Y A;  4DK1 A;  5DED A;  4DR5 O;  1NTM H;  3ZIA G;  2EIL C;  5ITZ B;  4UB6 Z;  1FJG O;  1OCR C;  3RYF B;  1K33 A;  5EBW C;  4FFB B;  2ZIN A;  1NKD A;  3K3W A;  2KG7 B;  3J7A U;  1EZV H;  2OCC C;  4JI0 O;  1GTO A;  1WJZ A;  4FZ1 A;  1V9P A;  1Q3E A;  2EIJ B;  5LP6 C;  3S3X A;  3F5W C;  1RP3 B;  1SKV A;  2CTQ A;  4LNU A;  4DR3 B;  2LQT A;  1VQN V;  3RW0 A;  4J7K A;  4B3R O;  2R9R B;  5L3C A;  4FLV A;  3O65 A;  1FXV A;  2Q73 A;  4UCS A;  1IXM A;  4LF4 O;  4X62 O;  4JYA B;  1UPG A;  2NR5 A;  1N34 O;  2BOC C;  1QVF U;  1KD1 W;  2YUA A;  4FLY A;  4AQY O;  5L3G A;  4PD4 F;  4PA4 A;  4AI8 A;  1HR0 B;  3B09 A;  2CUG A;  2B9Z A;  1VIB A;  4ABM A;  4LF6 O;  2Q67 A;  3C90 A;  1SQQ H;  1KKC A;  2E74 B;  1AP5 A;  1BSM A;  3ICX A;  3UO3 A;  2HJD A;  4FLZ A;  1G8M A;  1QLE B;  2EZP A;  3G80 A;  2EBO A;  5BR8 B;  4UV9 A;  1KC8 W;  3OT7 A;  2A0L A;  2FL4 A;  1XNQ B;  1TUE B;  3ETE A;  3JD4 A;  5HFM A;  3RVZ A;  1XMO B;  1BQZ A;  1VQ7 V;  4B3T B;  2KSD A;  4AIL C;  3H1H H;  5J2U A;  1JA8 A;  2Y69 B;  2ZKO A;  4I0X B;  3K0G A;  1DLB A;  3CRR A;  2DN9 A;  2QTO A;  4OPH A;  4U7N A;  4JYC A;  5CA0 A;  4I5S A;  4PDL A;  1WA8 A;  2B1G A;  2CGO A;  1LNQ A;  3K08 A;  2YEV A;  3L9D A;  1B06 A;  1F4N A;  2WLH A;  1VF7 A;  3ZHQ A;  3VQY A;  5L3D A;  4WFH A;  3JAT A;  1W0K G;  1N33 B;  1XHZ A;  4DV2 O;  4JI4 O;  5H5N A;  4PDV A;  4RO2 A;  3EHB B;  1XDC A;  5L3B A;  1K73 W;  2AHY A;  1HR0 O;  5J2U B;  1QR9 A;  3ASN B;  2DOS A;  3FB6 C;  2UU9 B;  1K7D A;  4ZOL A;  5CA0 B;  1WA8 B;  4L87 A;  1VEW A;  2IJJ A;  3HKE B;  1B3Q A;  3SJA C;  4GLX A;  4RUF A;  2QE7 G;  1JVM A;  2YEV B;  2EIK C;  3ETG A;  4IT5 A;  3BHP A;  5BZB A;  1KQS U;  2LFR A;  1HNW O;  2A7W A;  3KG2 A;  3AG4 C;  2WLI A;  5BR8 O;  3QF7 A;  1DTO A;  2RDC A;  2LW7 A;  3P30 A;  2MK3 A;  1XNQ O;  2P4K A;  4KXR A;  3ZED A;  2YDE A;  5CMU A;  2FYU H;  1XMO O;  1VQ8 V;  1FYJ A;  2JIZ G;  2H94 A;  2DW4 A;  2X6C A;  4R6Z A;  3FAV A;  4DV3 B;  4KL1 A;  5LYJ A;  2OIG A;  3S3W A;  1WN7 A;  2F4V O;  4GZR B;  4ZOL B;  5BMV B;  2GTA A;  2A3Q A;  1J5E O;  1L0N H;  4LR3 A;  2ZE7 A;  3BEH A;  3AG2 B;  3T1C A;  4FLX A;  3IAY A;  3CXH F;  1TVK B;  2QM8 A;  1IBK B;  4DR2 B;  2QEX V;  5DEC A;  1ZUQ A;  1KYO F;  4ICG A;  4BW5 A;  2UU9 O;  4TWK A;  3ASO C;  5LYJ B;  1YIT V;  2Z0A A;  1YSC A;  4TV8 B;  4EKW A;  4YIP A;  1PNM A;  3SPI A;  3G4S V;  2WPD G;  4JI8 O;  2E76 B;  2P7T C;  5LHH A;  1PL0 A;  2JK5 C;  1QLN A;  5FNV B;  4O4H A;  2JS5 A;  2RN9 A;  3AG2 C;  1N36 B;  3AG1 B;  2CTP A;  2QWQ B;  2X0L A;  4RWU A;  2Q68 A;  2VQE O;  1URF A;  3RBZ A;  3JD1 A;  1SC5 B;  1ZWI C;  1Y66 A;  1YJW V;  3I55 V;  2X7R B;  1MAB G;  3T2M A;  4FM0 A;  1ZL8 A;  4X9Q A;  3CCE V;  5KAI Z;  5F2V O;  4U7O A;  1IBL B;  4NYK A;  3WU2 Z;  3STL C;  4QPK A;  3E8F A;  3CCJ V;  1MA1 A;  4TSF G;  4IIJ A;  2LO1 A;  4O4H B;  3BPZ A;  4JAA A;  4Q20 A;  3H01 A;  2K9P A;  1H8H G;  3K57 A;  1K5S A;  3H1K H;  1FPO A;  3CCR V;  1M1K W;  3CMA V;  1PKX A;  3BVO A;  3UM7 A;  3FB5 C;  1H2L A;  1EZJ A;  2Y4U A;  1CPY A;  1V55 B;  1ZL8 B;  1DK1 A;  3IFX A;  3ZN1 A;  4GX5 A;  2HHH B;  2RQ6 A;  1QBZ A;  3ZRS A;  3D3I A;  4GUN A;  3K9A A;  3RFR A;  2OIE A;  3EXA A;  3HKD A;  4B7K A;  2L6L A;  1YJN V;  2QR4 A;  1N36 O;  4IIJ B;  5LA6 A;  5GON B;  4DW0 A;  5D5Q A;  2EIN B;  2ODM A;  4G2K A;  4LF7 B;  2PGG A;  4LP8 A;  2HR3 A;  1VQ4 V;  3E22 A;  4P9O A;  3E8G A;  4WFB V;  1R3K C;  3RT3 C;  5KHK A;  4IYH A;  2QDO A;  2R72 A;  4PA3 A;  4MW8 A;  3CC7 V;  4NTW A;  3T4D A;  3APQ A;  1IBL O;  3N2G A;  1V55 C;  1LR1 A;  2JJ2 G;  4PI0 A;  1AJP A;  5B3S B;  1NBM G;  2EIM C;  4YIO A;  1K92 A;  4L8J A;  1D5A A;  3HKD B;  3F7V C;  4N23 A;  1XRE A;  5LA6 B;  3WB0 A;  4FLT A;  4HNA B;  5KHH A;  4MVS A;  4FLU A;  1U97 A;  4MVR A;  1S5J A;  3BFR A;  3R65 A;  5JJE B;  5IYZ A;  3OR6 C;  3EVK A;  3GVM A;  4MSW C;  4HYO A;  1OCZ C;  2EIN C;  1KUQ A;  3SGI A;  1XMQ O;  2CTR A;  1YF2 A;  2HVK C;  3P3P A;  5H6R A;  3ZMT A;  4WCE V;  1YCI A;  1SER A;  4DR6 B;  3DGE A;  4G27 B;  1CXZ B;  1RPR A;  4FIP C;  2DJV A;  3B4S A;  3N2G B;  3L70 H;  2YIB A;  1TAE A;  1AB3 A;  3LUT B;  3ZHV A;  3ABU A;  4H37 A;  2C2A A;  5EIB D;  4AHC A;  1WLE A;  4DV6 B;  3W7S A;  3A2F A;  5B3S C;  3UT5 A;  2G38 A;  4K8Z A;  2F23 A;  3MD0 A;  3D36 C;  4LF7 O;  2VWK A;  1MOF A;  2IH3 C;  3OGI B;  1W59 A;  1WPB A;  5IYZ B;  5IJ0 A;  3IC7 A;  3N2K A;  4OGQ B;  3HPL C;  4RQF A;  4FFK A;  4LFC B;  4JF3 A;  3CCM V;  1VQ6 V;  1N32 B;  3ABM C;  4Z1M G;  1HWY A;  1R73 A;  5KHG A;  3SPH A;  1AR5 A;  2PF4 E;  2ZXW B;  2XT9 A;  4DR4 B;  4DV5 B;  2ZIO A;  3WB2 A;  5A9G A;  1F4M A;  3ABK C;  2UUA O;  5CB4 A;  3ZCC A;  4YY3 B;  4B3M B;  1YTF D;  2BTQ A;  1BCC H;  3UT5 B;  1YEW A;  1F51 A;  4DV4 O;  1H8E G;  4K3A A;  3QTC A;  4KHP O;  4JGS A;  4XDK A;  5IJ0 B;  3N2K B;  2IBZ H;  4DUZ B;  1E1R G;  2IJI A;  2WLJ A;  4DR6 O;  1BHA A;  2JEX A;  4WFF A;  2YIC A;  3RGB A;  1M9N A;  1OCC C;  3BAB A;  2AXT Z;  4D7T A;  3SYA A; 
#chains in the Genus database with same CATH homology
 3OAA G;  1J95 A;  1G8M A;  1QLE B;  1ROP A;  2AHZ A;  4R7C A;  5B1N A;  1S77 D;  1R6N A;  2EZP A;  1K5Q A;  2EBO A;  3LNM B;  4UV9 A;  4J9Z B;  1KC8 W;  1RM1 B;  2A0L A;  1P7B A;  4XBF A;  1TUE B;  2JEU A;  3ETE A;  1EBO A;  3JD4 A;  4UVB A;  1SRY A;  3ABL B;  2WLN A;  2HJF C;  3RVZ A;  3ZRW A;  5HFM A;  3W7X A;  4JPR A;  4UUJ C;  3E83 A;  1VQ7 V;  4FPP A;  1YTF B;  2H8P C;  5BZB A;  3CCQ V;  2Y69 B;  1DF4 A;  3CD6 V;  4KUM A;  3K0G A;  1DLB A;  3K79 A;  1JCH A;  2QTO A;  1YI2 V;  5J9P C;  4U7N A;  3CCL V;  1PNK A;  4JYC A;  3UKM A;  4I5S A;  4PDL A;  4PA6 A;  2B1G A;  2XAG A;  4LBE C;  3M99 B;  3CPW U;  4QE7 A;  2XOK G;  2V1D A;  1LNQ A;  3JYC A;  3K08 A;  1KP2 A;  2YEV A;  1THZ A;  4MW3 A;  2ATK C;  3ZN0 A;  1CEZ A;  1F4N A;  2WLH A;  3E2E A;  3OR7 C;  1S76 D;  2HFE C;  3BY6 A;  5L3D A;  1S0V A;  2BOB C;  5LGT A;  4TT3 G;  4WFH A;  1W0K G;  1GO3 F;  5DM6 V;  4HZ3 A;  4MT8 A;  3E8H A;  4RUE A;  1I5X A;  4PDV A;  2D3O W;  1OHH G;  4RO2 A;  2W6J G;  3EHB B;  3ZRW B;  5L3B A;  1QVG U;  2WAM A;  2QA4 V;  1N8R W;  3HB3 B;  2AHY A;  1K73 W;  1QR9 A;  1DF5 A;  1R3J C;  3ASN B;  4X89 A;  1NH2 D;  3FB7 C;  3E86 A;  3ABL C;  1ORQ C;  3FB6 C;  4LCU C;  1K7D A;  2OT5 A;  4X88 A;  1AI7 A;  1KKD A;  1VQK V;  5B1B C;  1P4R A;  3ZMZ A;  2WLL A;  4L87 A;  5IY5 B;  3ZMS A;  1FXH A;  2IJJ A;  1PNL A;  5IYC O;  3X2Q B;  2X6A A;  1UJW B;  4RUF A;  2YEV B;  2QE7 G;  1JVM A;  1WPX A;  1GM7 A;  2EIK C;  2HVJ C;  3ETG A;  3QNE A;  5H9C A;  4P9P A;  3WG7 B;  3AG3 B;  2LFR A;  3OUS A;  3A0R A;  4MVO A;  4YXW G;  3E35 A;  1PD3 A;  3KG2 A;  3OEH G;  3AG4 C;  2WLI A;  4UV8 A;  5CBH A;  1DTO A;  3P30 A;  2MK3 A;  1M57 C;  3ZRX A;  3LSS A;  1MSW D;  3TK1 A;  5CMU A;  1JQ0 A;  3CC4 V;  3K0D A;  1R3L C;  3NXS A;  1VQ8 V;  2F43 G;  4X8A A;  3CCV V;  4MTG A;  5KA5 A;  5E1A C;  2JIZ G;  1JX9 A;  1NR7 A;  4MS2 A;  4PA7 A;  2H94 A;  1VQ9 V;  4UXN A;  4BIZ A;  2X6C A;  2DW4 A;  4R6Z A;  1L1F A;  2EIM B;  2QKS A;  1G4Y B;  2Q69 A;  4E2L A;  1FFT B;  2KB1 A;  1FXK A;  5EC1 C;  1BMF G;  2OTJ V;  3SPG A;  4FMT A;  5LHI A;  1NH2 B;  4GX2 A;  2JJ1 G;  2WLL B;  3ETD A;  2JDI G;  3BEH A;  1F23 A;  3D36 A;  3AG2 B;  5B1A B;  3T1C A;  3E89 A;  3SYO A;  2EIJ C;  3CP1 A;  5IY5 C;  4JAU A;  2WWW A;  3DTU B;  3X2Q C;  1MG1 A;  1OCZ B;  5DN6 G;  3LDC A;  4JTC B;  2QM8 A;  2ZXW C;  3ZJZ A;  2ZQM A;  2QEX V;  5LGU A;  1GM8 A;  2DQ3 A;  4J9Y B;  4P30 A;  2XAH A;  3LDE A;  4ZBM A;  1VQ5 V;  3W7U A;  4JTA B;  3SPC A;  4BW5 A;  4XDL A;  1K34 A;  3SYC A;  1K3E A;  3ASO C;  2ZDI A;  4TWK A;  2IJH A;  2M7W A;  2Y48 A;  1SES A;  2WLM A;  2WSS G;  5C93 A;  1YIT V;  1YSC A;  1GK9 A;  2EIL B;  1FXK B;  4EKW A;  1EFR G;  2GSM B;  1NR1 A;  1PNM A;  2LP7 A;  3SPI A;  3G4S V;  2WPD G;  3G71 V;  4MVQ A;  3SYQ A;  3E8B A;  1VQL V;  2GHY A;  4PEL A;  3TCU A;  2P7T C;  4QPJ A;  5LHH A;  4KP4 A;  4GX0 A;  2LFS A;  2ZR3 A;  4CZZ A;  1JJ2 U;  3OMN B;  1PL0 A;  2JK5 C;  1VQO V;  3PJS K;  1QLN A;  2UXX A;  4MVU A;  5L3F A;  2A79 B;  1AJQ A;  4JTD B;  3AG2 C;  3SJQ C;  4ASU G;  3AG1 B;  2OTL V;  2B5U A;  2XAF A;  1GMG A;  2XAS A;  3ABM B;  1BL8 A;  3T4Z A;  1NQT A;  2B1I A;  2X0L A;  3OMA B;  1VQM V;  2UXN A;  2Q68 A;  1M56 B;  3RBZ A;  3JD1 A;  1QLE C;  1K4D C;  3TET A;  1ZWI C;  1Y66 A;  3ABK B;  5EBM C;  1YJW V;  1RM1 C;  3I55 V;  2X7R B;  3WFV A;  4JAS A;  1MAB G;  3I56 V;  3T2M A;  3MHS C;  4DXW A;  1H38 A;  1B6Q A;  3CME V;  3OGC C;  3CCE V;  2DWE C;  4CBC A;  4I9W A;  1AI6 A;  3JD2 A;  5KA6 A;  4U7O A;  1BHB A;  4MTO A;  2Y69 C;  4R8C A;  1JOY A;  1RPO A;  2IJK A;  1NJI W;  1FXK C;  3STL C;  3OM3 B;  4QPK A;  4WF9 V;  1R3I C;  3E8F A;  3CCJ V;  4LC1 A;  4TSF G;  1KEC A;  5L3E A;  2WLK A;  4Q20 A;  3H01 A;  4QE9 A;  1E1Q G;  5EK0 A;  4WFE A;  1H8H G;  4BIU A;  1K5S A;  5HFL A;  2K1E A;  3CCR V;  1M1K W;  5LHG A;  3CMA V;  1ARO P;  1PKX A;  3CCU V;  3CC2 V;  3UM7 A;  4RQE A;  2NLJ C;  3FB5 C;  5EC2 C;  1OCC B;  1EZJ A;  1GM9 A;  1M56 C;  1Q86 W;  1AR1 B;  3FB8 C;  3B77 A;  1CPY A;  1V55 B;  2V7Q G;  3IFX A;  3F7Y C;  5LGN A;  3ZN1 A;  4GX5 A;  3OFN G;  2IU0 A;  5IYD O;  1XL4 A;  3FYE B;  1QBZ A;  1SZT A;  3JD0 A;  4PDR A;  3ASN C;  2ZDI C;  3D3I A;  3ZRS A;  4F4L A;  2Q6A A;  3K9A A;  4KFM A;  1NVP D;  2P67 A;  2IH1 C;  2A9H A;  4WFA V;  3QO8 A;  1YHQ V;  5B1O A;  4PDM A;  2DQ0 A;  5KUK A;  1YIJ V;  1YJN V;  1W2B U;  4PA9 A;  2ZD9 A;  3G6E V;  1S5H C;  5FL7 G;  2ITD C;  2EIN B;  3GWO A;  1Q82 W;  2DWD C;  4GCZ A;  1KP3 A;  4RAI A;  4H33 A;  4G2K A;  3WG7 C;  2XAJ A;  3AG3 C;  5CA3 A;  3OW2 U;  4LP8 A;  4QJF B;  1QCE A;  1YJ9 V;  2DYR B;  1OZ0 A;  2HR3 A;  4UVA A;  1VQ4 V;  4P9O A;  3E8G A;  4UVC A;  4WFB V;  5EBL C;  2Z5U A;  1R3K C;  2R9I A;  4R50 A;  3QO5 A;  3STZ C;  4ZKI A;  2QM7 A;  4MVZ A;  3OMI B;  2Z3Y A;  2W6I G;  2PI4 A;  2XAQ A;  4MW8 A;  4PA3 A;  3CC7 V;  2P6J A;  3OEE G;  3T4D A;  2EJR A;  1VQP V;  2PI5 A;  3K03 A;  1Q81 W;  3CXC U;  4HAM A;  1V55 C;  2JJ2 G;  1AJP A;  1ENV A;  4JYB A;  5B3S B;  1NBM G;  2EIM C;  3ML0 A;  1OCR B;  3OE7 G;  1K92 A;  3FYI B;  1AJN A;  1FS0 G;  3F7V C;  4QNH B;  5IDJ A;  4N23 A;  1Y4M A;  1NVP B;  3ZRV A;  1AI4 A;  3CYO A;  4WFG A;  2OCC B;  4FJC C;  1S72 V;  4MVS A;  3GB7 C;  5B1A C;  2YSU B;  4MVR A;  5B1B B;  1M90 W;  5KUM A;  3JD3 A;  2HG5 C;  3R65 A;  1K9M W;  4DO2 A;  3OR6 C;  1OCO B;  1H2G A;  4MSW C;  2EIK B;  4HYO A;  1OCZ C;  3B8N A;  2EIN C;  4BAY A;  4G28 B;  2HVK C;  5H6R A;  3ZMT A;  1K8A W;  2DYR C;  3CCS V;  4WCE V;  3ABT A;  3AG4 B;  5LBQ A;  4GT1 A;  1SER A;  3DGE A;  1M57 B;  1COW G;  2ZR2 A;  1W0J G;  2ITC C;  4G27 B;  1GKF A;  1RPR A;  2DYS B;  3SYP A;  1S3J A;  3VBB A;  4FIP C;  3SPJ A;  5IYB O;  1AI5 A;  1I5Y A;  3VOU A;  3LUT B;  3QO7 A;  3ABU A;  1XL6 A;  4H37 A;  2C2A A;  2EIL C;  3ZIA G;  2IW5 A;  1WLE A;  3W7S A;  3EFF K;  2X6B A;  5B3S C;  5CBG A;  3W7W A;  3W7T A;  1OCR C;  1E79 G;  1SET A;  1K33 A;  1V54 B;  3FKS G;  5EBW C;  5CBF A;  3MD0 A;  1NKD A;  2HKO A;  3K3W A;  2CK3 G;  1MOF A;  3K06 A;  4GX1 A;  2IH3 C;  2OCC C;  2W0F C;  1GTO A;  3IC7 A;  3AG1 C;  2EIJ B;  3OUF A;  3HPL C;  2HLD G;  3F5W C;  4OXS A;  4RQF A;  4JF3 A;  3CCM V;  1K97 A;  4MTX A;  3ABM C;  4N21 A;  1HWY A;  1R73 A;  3P32 A;  4Z1M G;  1VQ6 V;  3SPH A;  1OCO C;  3IGA C;  3MHH C;  4QIW F;  5CN0 A;  1VQN V;  3RW0 A;  2ZXW B;  3ZMV A;  1R6K A;  5GW7 A;  2R9R B;  3LDD A;  5L3C A;  3ABK C;  1F4M A;  1FXV A;  4FK5 C;  1IXM A;  2IU3 A;  1JPX A;  1K4C C;  3ZCC A;  2BOC C;  2DYS C;  4P2Z A;  1QVF U;  1YTF D;  1KQS U;  3ASO B;  1KD1 W;  3AEI A;  3ZMU A;  3JCZ A;  4MVM A;  2EZO A;  1F51 A;  5H6Q A;  5L3G A;  1H8E G;  4PA4 A;  3RVY A;  1V54 C;  2XND G;  2P90 A;  4JGS A;  2FTK A;  1QR8 A;  4JAV A;  4XDK A;  4MTF A;  3B8M A;  1E1R G;  2IJI A;  2Q67 A;  4XDJ A;  2WLJ A;  1BHA A;  2JEX A;  4WFF A;  3LSQ A;  1CP9 A;  2NNU A;  1M9N A;  3K04 A;  1OCC C;  3SYA A;  1Q7Y W;  2WLI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...