4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
2EZOA 1K34A 4FK5C 5H9CA 4JPRA 4FJCC 3WFVA 2P6JA 3H01A 3MHHC 1I5XA 1EBOA 1QCEA 1MOFA 1QBZA 3B8MA 3CP1A 4N23A 3GWOA 4JGSA 3P30A 5CMUA 4E2LA 3MHSC 1DF5A 4G2KA 5CN0A 1Y4MA 2OT5A 3K9AA 5HFLA 5KA6A 1JQ0A 2LP7A 3B77A 2EBOA 3B8NA 2MK3A 1I5YA 4N21A 1SZTA 1ENVA 1DF4A 1JPXA 1QR8A 2EZPA 1MG1A 2M7WA 2X7RB 3CYOA 4FIPC 4JF3A 1F23A 5KA5A 1DLBA 5HFMA 1K33A 3M99B 1Y66A 1QR9A
chains in the Genus database with same CATH superfamily
3R65A 2CE4A 5JWPA 3UO2A 3JSNA 5JJNB 3L75H 5KLVH 1N33O 4DR2B 4LP8A 1P7GA 1VQLV 2GSMB 3B2EE 2DQ0A 4B08A 1DK1A 4H13B 2F23A 2XHBA 4KHPB 4WFAV 1N32B 4B3SO 1NTKH 3H9VA 2ZQMA 2Q8VA 2DYRC 3QO8A 4EKWA 4UFZA 4I4TB 4DW1A 4LFCO 4QIWF 2A06H 2W6JG 3CRCA 3HKEB 4LF8O 1XNQB 3CCUV 1Q81W 2EBOA 1N34B 2CDYA 3K9SA 4NVPA 4MT8A 1IBKB 5A9GA 3VBBA 3CX5F 3Q4HB 1BQZA 3AG7A 4YHHB 2AW9A 2BCCH 4UCRA 2RCVA 3SYQA 4B7KA 3WB2A 2IJIA 3OMAB 4DV5B 2XAGA 1S0VA 1YTFB 1MZEA 3ZMTA 4NR1A 3AG1C 4FLTA 4N21A 1SZXA 1HWYA 3L9DA 4J11A 5IJ9B 2C2AA 1JFFB 4DV7O 1X4TA 4UVAA 1SA0B 4LF4B 4O4IB 2OCHA 2LJ2A 3BRCA 4AQYB 1Q8IA 2OT5A 1HR0O 3ZHRA 2HG5C 4JAVA 4YJ2B 1FXHA 1BT8A 3ZRWB 3O65A 1Q6UA 4MTFA 3OFNG 4TV8A 4F4LA 3TGUH 4KXRA 1NR7A 1KP2A 2QGNA 5EBMC 4MVQA 3RFRA 2PI4A 4JTDB 2Y69C 3ICXA 4B3SB 1XQ8A 4I7ZB 4RQEA 1R73A 5B1BB 3E83A 5A2QN 4NKGB 1HNWB 5H5NA 4R50A 4PA4A 4NTXA 1M9NA 4DR4B 1J5EO 2YS8A 1WA8A 3AG1B 1BCCH 4DR6B 1OHHG 2L6LA 4WBNB 4WF9V 5LXTA 1H2KA 3K5OA 3ETGA 3OEEG 1WA8B 2CTRA 4KP4A 1S77D 1FJGO 2ATKC 2WLIB 5LMNO 1AJNA 1SKVA 2G38A 1LUWA 2BOBC 1US6A 1GRJA 3DSQA 3SPJA 5LOVA 5L3CA 2P67A 4W4KA 1OZ0A 1PL0A 2DE0X 1RM1B 2VS0A 3JATB 2ZKOA 3JASB 5L3FA 4ZI7B 2JJ2G 1S72V 4R8CA 1IBMO 4XDKA 2DYSB 3JYCA 1XUQA 2Y0IA 2ZT9B 3CRQA 3KKYA 5D5QA 4KL1A 1KD1W 2F4VB 2OIEA 2NN4A 4TV9B 1BQ0A 5B1NA 3QTCA 5JJEB 2M6YA 5B5EZ 1BS3A 1EN5A 4U7OA 1V54C 2CK3G 3FAVA 5CA0A 1VF7A 2ZE7A 4DV1O 1MSWD 4HBNA 2Q7EA 2CGOA 4X1KA 4DR5O 3SYOA 3L74H 2Q4PA 1NJIW 3K58A 3G6EV 3OEHG 2X6AA 4MVMA 4RQFA 5IT9N 2ZM6B 3ETDA 1N36B 4YJ3B 3P3PA 3CCEV 4LF4O 3RT3C 2ODMA 2EIJB 2ZIOA 3SJQC 2HP8A 2NNUA 4NXMB 4FIPC 3ZHSA 2K9PA 2UXXA 3RYIA 1Q5OA 1VP7A 4DO2A 1NKDA 1JCHA 4HYOA 1FXVA 1U97A 3M8AA 3ZRSA 2YXHA 4X89A 5LXTB 2JK5C 3KG2A 3R66A 1AR1B 1N33B 5KAIZ 1VIBA 2IJJA 3VQXA 3HB3B 4CH4A 2IBZH 4LBEC 1QR8A 1OCRB 2HLDG 1TAEA 4DYLA 3BY6A 4PHZA 5H6QA 5KHHA 2P4KA 4H0LB 1OCOC 3KZIZ 1BHAA 5IYDO 1W0KG 2LW7A 1FFTB 1Q82W 3ABLC 2N74A 4LFCB 5JH7B 3HKBA 3CCRV 5E1AC 2GBOA 2HHHO 2X6BA 2F95B 1VF6A 5KUMA 1P7BA 5KX5B 4LCUC 4H33A 4U3JB 4X64O 4CS2A 4FVMA 3AG4B 2VQEB 3RYHB 5K1PA 4X66O 1VQ8V 1AP5A 1SETA 2HVJC 3G80A 1Z2GA 2WWWA 3LNMB 5KHJA 1ZLZA 3RW0A 4LC1A 3ABMB 3G6BA 5LBQA 1EN6A 5JCOC 2Q73A 2VWKA 4E4EA 3FAVB 5CA0B 3ETEA 3IGAC 5LHGA 4DUYB 4I9WA 1SRYA 2IW5A 4DUYO 4K0KO 5HFLA 3GWKC 4J9ZB 3FYIB 1R3JC 2GTAA 4B7EA 1XNRB 1UPGA 1WB8A 1KKCA 2XT9A 4IYHA 1WB7A 2ZXWB 2GV9A 3ZRVA 2DJVA 3ZCCA 3TXSA 1VQMV 3F5TA 2ZD9A 5IY5B 4GKKB 4GKJO 4JYYA 1ZTEA 5DEDA 4U3FH 1KU9A 2YIAA 2CTQA 4GX5A 1XEQA 1FD9A 3JD1A 2BTOA 1WLEA 4X1IA 3LDEA 4FLZA 3CRAA 1V54B 3G4SV 4LF7B 2PZSA 2ETNA 2LFSA 4LH6A 3JCZA 3TK1A 1LUVA 3HKCA 4JI6O 2Q68A 3OMNB 1EBOA 3HKDB 3P32A 1O9GA 4JI7B 2PI5A 1NVPD 2PF4E 2CTWA 1YHQV 1DTOA 4L87A 2B5UA 2WLHA 1V55B 2QM4A 2WLMA 1GKFA 2IH3C 1HNXB 2ZIMA 1NTMH 3W7XA 3E8GA 1RPRA 3JAKB 1EFRG 4I55A 1FKAO 2ZDIA 1GTOA 2O57A 4DR7O 5GONA 2WLLB 3CMEV 4UV9A 1EM1A 3SR2C 1H8HG 5GONB 3CSXA 4DV2O 5KUKA 4CBCA 4JTCB 2XAFA 1KYOF 1BSMA 3CYOA 5FLXN 2Z0AA 3HKBB 3JARA 3SYCA 1QNMA 1S5JA 2CTPA 5CA1A 5J2TA 2DW4A 5FL7G 3FD9A 4ASUG 3GWOA 1QVFU 3U11A 1YITV 1J5EB 1W2BU 1P49A 3SGIA 4I0XA 1NU1H 5BY1A 4I50A 3GB7C 1XHZA 3K5LA 2ZDIC 2LGQA 2RN9A 3ABMC 1S3JA 2IH1C 1W0JG 1HNZO 4FLXA 1D5AA 4NYKA 2QA4V 4GX2A 4LF5B 4WBNA 1QCEA 1TVKA 2PUSA 4DR3B 3P3NA 2QTOA 4P9PA 5FPRA 4DR5B 3T1HB 4O2AB 2ADPA 2N05A 4WFFA 3CRRA 4B3RB 4JZ2A 2WA3A 3ABKC 4Q20A 1SQFA 1SS3A 1CPYA 3CB2A 4X88A 4FLVA 5GTIZ 4QNHB 2H3OA 4F6RA 4GX0A 2WLJA 1BMFG 2K1EA 4AQYO 2XNDG 4GCZA 1YXBA 2ILMA 1XNRO 3K5NA 1KB9F 2QSAA 3JALB 5IYZB 3QG5A 3C90A 4DUZB 1JA8A 2MW2B 1Z5VA 1Y6XA 3A8TA 3AK1A 1XOUA 4PA7A 3LSSA 4FK5C 1SQXH 5LMUO 2HEPA 4ZHQA 2UUBB 3FB7C 1WPXA 5BR8O 2Q9LA 4JI1B 4GKJB 2YEVA 3CC4V 1SA0A 1VQ7V 1PD3A 4DV6B 2YUAA 5KA5A 3OT7A 3OTFA 1MA1A 2Z3YA 1HNWO 1VEWA 5FPOA 3HKEA 4IIJA 2N04A 4RUFA 3E86A 5D5PA 5CN0A 3IAYA 3ZIAG 1AVMA 4JI4O 4JV5O 4DR6O 4UVBA 2FB5A 2D2CB 4UUJC 4J10A 2X7RB 1CP9A 4QE9A 2UU9B 2OYQA 4JAUA 3N2KB 1D2DA 4MVSA 1IBLO 5ITZB 2DWDC 4O4LB 2YC0A 5LA6B 2UUAB 3ZRXA 3KCXA 3LNNA 5J2UB 2Y48A 4G28B 2AZ2A 1IDSA 3K5MA 3E2EA 3D3IA 2E75B 4RWUA 2V1DA 4CZZA 5LP6A 1PM9A 3BABA 1IZ3A 3RVZA 4NTYA 2JS5A 3I5DA 1G1XB 3H01A 4K3AA 3B8MA 2QWPB 1GN6A 2ITDC 4JI0O 1YDXA 3BVOA 1B04A 3JD0A 5KA6A 2PYJA 1Q3EA 2HHHB 3K59A 4Z1MG 5EBLC 4TOIA 5L3BA 4YHHO 5H9CA 4ZIBA 3RWRD 2BTQB 5CMUA 5LHIA 1AB3A 4E2LA 3APOA 4O2BB 4O4JA 2GUZB 5LYJA 3RYHA 1CXZB 4JYAB 4MVUA 1RP3B 2XTAA 4B3TB 3SJBC 5LGTA 1TUBA 4HZ3A 3QVNA 2UXDB 4OPAA 1X59A 2UXDO 4FMTA 2A0LA 3ZN1A 1R6KA 4B3MB 2OWOA 4W4LA 4Z2WA 2JVDA 3RBZA 2RJZA 1OV9A 4FZ0A 1GH6A 3CCJV 1YI2V 2HKOA 2DOSA 4I9QA 2UXNA 1QQCA 2A9HA 1AR4A 1B3QA 3BFRA 5H2FZ 3ZHQA 4GZRB 2CGNA 2Q6AA 4LF9B 1VQ9V 3DC5A 5E79Z 4WCEV 1ZUQA 1F23A 1M90W 3LDDA 1AROP 4U7NA 1K9MW 4NXNO 3RYIB 4J7KA 1GO3F 1GN2A 4DR4O 4JI6B 4QPJA 4TUYA 1L0LH 1U96A 2EILC 3A0HZ 1FPOA 1I0HA 4JASA 5EYPA 5FNVB 3OE7G 3SYPA 3NXSA 1IURA 4PD4F 4JI4B 4JV5B 3W7TA 1TUBB 2Z5UA 4TQDA 3M99B 3N27A 1YVWA 2WLLA 2E76B 4DV4O 2AHZA 4DV4B 4X66B 1E79G 1OCOB 3VQYA 3AG3B 2KB1A 1H2MA 5LP6C 2PY5A 1IX9A 3ZBHA 4O4LA 1JR9A 4LH7A 3A0RA 1XL4A 3N2KA 4CS3A 1JOYA 3BHPA 4JI0B 2AXTZ 2EULA 4DW0A 4LFBB 2AHYA 1F7YA 4QPKA 5L3EA 1CEZA 4B3MO 3OUFA 3T2MA 1F51A 1FFXA 4HAMA 4DV0O 1XNQO 3CCQV 2YSUB 4G2KA 1UJWB 2AZ0A 4QE7A 2GHYA 3ZMSA 2EIJC 2Q0AA 2L35A 1L8DA 4C7UA 1S5LZ 4DUZO 5C8YB 3CD6V 4CH5A 3K06A 1Y67A 4OPHA 2CUGA 1JX9A 4H37A 4EEQA 2VQFB 3JAMN 4PDRA 3HKDA 1Y74A 5BMVB 2B9ZA 4G27B 4X20B 1Y74B 4MS2A 1FXKC 2LFRA 5LP6B 1P84F 4I50B 1XL6A 1SQBH 1F4MA 3CCSV 4YJ2A 4WFBV 1URFA 2DQ3A 4NXNB 5L3DA 2QTSA 5EK0A 2HVKC 4DV7B 1PPJH 3E8FA 3FYEB 3J7AU 1XHXA 4LNUB 1IXMA 1YTFD 4JI7O 4AHCA 5EZYB 1RPOA 2BSKB 3AG4C 4P9OA 3JALA 4BR6A 5LGNA 1BE3H 4X62B 2B1GA 1VQ6V 3W7WA 2Q0OC 4PI0A 3OMIB 4DRXA 4WFHA 3JD3A 4OGQB 2XOKG 2HJFC 3RYFA 1Q90D 4FFBB 4K35A 3K3WA 1ENVA 4R7CA 3E22A 2WA4A 5IYCO 1V55C 2XASA 1XDCA 1VF6C 4DK1A 1FS0G 2ZNIA 1QLNA 4JI3B 1K5QA 2JDIG 3OTOO 4JI5B 3UQ8A 4OX9B 3F5WC 4K0KB 3ASOC 5K1XA 4KUMA 2CH7A 4LF6B 1K5SA 4LF6O 4CC6A 1FAFA 2FMLA 3E8HA 4JF3A 1N34O 1JJOA 3GVMA 4DK0A 4UCVA 2R72A 1Q86W 3ABLB 1H2SB 5KHKA 1YEWA 3KCYA 3JATA 2YICA 1MOFA 1Q43A 4XDJA 5IJ0A 3AG2C 5H6RA 3CCMV 3ZJZA 4H44B 1J95A 2RDCA 1VQKV 3J80N 1M93A 2EJ7A 2IJHA 4J7JA 2OCCC 3CS5A 4YY3O 1ZAUA 3EFFK 3LUTB 2H94A 2Y69B 2VWJA 1HDJA 5C93A 2YIBA 4ICGA 3JSLA 4JI2B 4LWSB 4BW5A 2Q7HA 4BW9A 1AJPA 2QWOB 4J41A 1WN7A 4DR2O 2P90A 4GLXA 2F43G 4TV8B 4GKKO 5CA3A 1AP6A 2QR4A 1Y76B 4RAIA 3ETQA 5KMGB 4KHPO 2YXLA 5CBGA 1HW7A 1GM7A 4CS4A 3H1IH 1OCCB 2ZCEA 3CEIA 1DLBA 2P06A 3SPCA 5B66Z 2GUZA 1B06A 4L8JA 4JAAA 1R3IC 3THOA 4A5UB 3QF7A 2BE3A 4LF7O 2OCCB 2RNBA 3ZHVA 4BAYA 1M1KW 2UXBO 1PV0A 1H8EG 2DMXA 1QBZA 2QKCA 4IYIA 4PDMA 1PP9H 5LA6A 4QJFB 4ZOLA 1VQPV 1BGYH 4J80A 3FB5C 2OTLV 2R9AA 4J42A 1E1QG 1VQ4V 2QWQB 1COWG 3EXAA 2WLIA 3AK2A 5JCOA 3K0DA 4IIJB 4X20A 1YF2A 1N0NA 4UV8A 3X2QB 3CC7V 3T4DA 1OCRC 3K03A 2CH7B 1AR5A 3K08A 1B6QA 3QO5A 2EINC 3ZRWA 4DV2B 3FB8C 2M7WA 1JPXA 1WAZA 3OW2U 1K7DA 2ZE5A 1H38A 1E1RG 1K4CC 3EVKA 4JYBA 4UCSA 3J81N 2R9IA 2DN9A 1M57C 4DXWA 1SQGA 2YI8A 1WP7A 1WP8A 1GK9A 1ZX3A 1NVPB 2JGDA 5ITZA 2QE7G 4JI5O 3D8CA 2KSDA 1AJQA 4YXWG 1K8AW 1M56B 4LFBO 4JI8O 1ZSPA 2E5LB 2LW1A 1MG1A 3FB6C 3BA9A 2OIGA 5GW7A 3NR7A 2YIDA 2EIMB 4EB6A 4FM0A 3FKSG 4PA3A 1PKXA 2VQFO 1Z5WA 2WLNA 3MAQA 2A7WA 4BIZA 4MVOA 4EFEA 1QU7A 3H1KH 3MHSC 3F7YC 2CAZC 4LFAO 1PNLA 3K79A 1VF5B 2JEUA 1SQVH 3OD4A 4Q6GA 1DF4A 2P4VA 2ZXWC 3ABKB 1WJZA 1SQPH 1QLEB 3FFQA 2BOCC 4JYAO 4D6TH 5IE9A 5B1AC 5CBFA 3TJTA 2W0FC 1M56C 1YCIA 3CCLV 3MDSA 1IXBA 5JQGB 4X62O 5IJ9A 3CJHB 3L73H 4XDLA 3QO7A 4TT3G 1KP3A 3JARB 1RM1C 1VQ5V 2UUAO 1S76D 4WFGA 2XAQA 2UUBO 4O4IA 4RO2A 1ORQC 4QGPA 4ZOLB 1UFIA 4TV9A 1JFFA 3SPHA 1KMIZ 5EYPB 4GX1A 1WNSA 2EZPA 1JJ2U 2KG7A 1WPBA 1QR9A 3VQVA 3BCCH 2EIKC 4PI2A 5KHIA 1ZL8B 3CC2V 2BTQA 3DXRB 4OX9O 2ZE8A 2YDEA 4CH6A 4F6RB 5J9PC 5JVDB 4ZI7A 1M5IA 3H1LH 3UT5A 3JAWA 1R6NA 4GT1A 3A2FA 3JAWB 4PDVA 5KMGA 4PA6A 2VQEO 1R3KC 4O4JB 5LHHA 1I7FA 4X64B 2HR3A 4ZKIA 2QJ1A 1I5XA 3MHHC 4LF5O 2D3OW 4XBFA 1V9PA 5CA1B 1JMKC 5EC2C 4FZ1A 1FXKB 3E89A 3T1YO 1K92A 3G71V 5JJJB 1TUEB 2A3QA 5B1OA 4YIPA 4IL6Z 1MSDA 1N8RW 2PYLA 2IJKA 1N32O 4B3RO 1VQNV 4D7TA 5IWAB 1SC5B 1IVSA 3HPLC 1I08A 2ZM6O 5BZBA 1LNQA 1FYJA 2HFEC 4UCTA 3EHBB 3LDCA 1H2NA 1JVMA 3U0ZA 4X1YB 4MSWC 4UB8Z 3JD2A 3DC6A 2JIZG 5EBWC 2V4DA 3HR0A 1H2LA 5HFMA 4GUNA 4JI2O 1K73W 1Q6IA 4FM1A 1QLEC 2LQTA 3WFVA 2QWRB 5IJ0B 4PA9A 5LOVB 1KBHA 4DV5O 1A32A 1GMGA 4CC5A 1SESA 1XILA 1NQTA 4RUEA 1P4RA 4DV1B 3BPZA 2HJDA 3ZHTA 4X1IB 2FYUH 1GAXA 3B09A 4TWKA 2UXCB 2ADQB 4DR1B 5IYZA 5BXZA 2UXCO 1SF9A 3D36A 3SYAA 3L71H 5C8YA 3I55V 2VRZA 1DF5A 3RYFB 2W6IG 4FLYA 5IY5C 2V7QG 5B1BC 2B1IA 3CRMA 1ROPA 1NBMG 4BIOA 1YJWV 2ZR2A 3K0GA 3TCUA 1TGOA 1EN4A 1ZWIC 2Y4TA 3M7MX 1N4CA 1EZJA 3OM3B 4CH3A 2EX3A 5L3GA 4JI1O 4AI8A 5B3SC 5JQGA 1QVGU 1NH2B 2P5OA 2QKAA 1XREA 3AG3C 3L72H 4FM2A 2Y4UA 3A0BZ 4O4HA 1Y66A 3CHXA 4FFKA 1THZA 3Q4HA 5DM6V 1M57B 4GYCB 2AGAA 4O2BA 3RVYA 3TETA 2RMKB 4FLUA 1VARA 4DV0B 4KFMA 4DRXB 2KKWA 1KC8W 2R70A 3JCUZ 2F66C 4UCUA 3PN1A 1K33A 3X2QC 1S5HC 2LO1A 3RYCB 4PDLA 2Q67A 1F4NA 3F7VC 2EINB 5EIBC 4X65O 3H1JH 2DYRB 1Q6HA 1MNGA 3OR7C 4X1YA 3OGCC 4I4TA 1TVKB 1KECA 4MTXA 1KQSU 3C3TA 3T1YB 3S3WA 1GN3A 1OCCC 3IC9A 2DWEC 4IT5A 1BZKA 1I94B 2WLKA 3E35A 2ZNJA 3CCVV 2X0LA 3ASNB 4FJCC 1R1BA 1GM8A 3SPIA 3SJAC 3LSQA 1N0JA 4MVZA 4JYCA 3B40A 1K4DC 3ASOB 1XBLA 1PNKA 2F1MA 3OAAG 4EFBA 4JI8B 1NH2D 3HKCB 2F93B 2DYSC 1NT2B 1FXKA 4TUYB 2P7TC 2WPDG 3APQA 1DGSA 1XMOO 1NR1A 2NLJC 5IYBO 2YI9A 2YXYA 2E74B 3ZMVA 5EIBD 5BR8B 5LL6Y 1YIJV 5EC1C 3W7UA 4LF9O 1Y4MA 4BIUA 3AG2B 3I56V 3VOUA 3RYCA 1SZTA 4UB6Z 3U10A 3CE2A 1AI7A 4MVRA 3ABTA 1RSOA 4J7ZA 1K97A 4DR1O 1Q7YW 1R3LC 2XAHA 3JAKA 4I55B 3IJ4A 2JGUA 2FKXA 2IM9A 3K9AA 3B8NA 2QDOA 3BA8A 4AILC 2FTKA 4P2ZA 3T4ZA 1IBKO 1NI8A 3JASA 4FPPA 1FJGB 2EZOA 4MW3A 1NS1A 4DR7B 1L0NH 1YSCA 3RGBA 4DR3O 2GDSA 1MMMA 1QHTA 5AG2A 3STZC 4X8AA 3CXHF 3CJHA 2MK3A 3PJSK 1YZBA 2A79B 1AI5A 1MZFA 4MTOA 2QKSA 2PTMA 5FNVA 5J2UA 1T5EA 1YJNV 4JPRA 3DXRA 2Q5ZA 3OTOB 3CMAV 1IBMB 1GN4A 2IU3A 5B1AB 3WB0A 2XAJA 4LF8B 4YIOA 1M4UA 1XMQO 3WG7C 3W7SA 5LGUA 2YIBD 3ZX6A 1AILA 1Y76A 2QWNB 3ZHUA 5CBHA 1R6TA 1NZ6A 3IFXA 4IHJB 1XMOB 3UCSC 4K8ZA 5CB4A 1OJHA 3LSUA 1VMGA 2H8PC 2BSKA 4UXNA 5CB4B 4NB5A 1K3EA 3ZS8C 1LR1A 1XI1A 3SJCC 1GM9A 1G4YB 2ZINA 3B77A 2UUCB 1I5YA 2EILB 3ZN0A 4BWAA 3O9OA 4NTWA 1OCZC 1AI4A 5KX5A 5J2TB 3RN4A 1I94O 3IC7A 5EZYA 3E22B 2ITCC 1O9HA 2EIKB 1MABG 3AK3A 2JJ1G 4MTGA 1KUQA 4LR3A 2EIMC 4JZGA 4R6ZA 1KKDA 5BMVA 3DGEA 1PL4A 1PNMA 3D36C 3WB1A 3MD0A 1H2GA 2NR5A 3N2GA 2WSSG 1G6UA 3N2GB 3SDLA 4Z1VA 2P22C 3OUSA 3S3XA 2KQXA 5LMNB 2P6JA 5DECA 1RFYA 2EJRA 3P30A 4IGGA 4LNUA 4DV3O 4DV6O 5DN6G 5JH7A 4DV3B 2Q7GA 3WU2Z 2ZE6A 4J9YB 5B3SB 3UM7A 2WAMA 1BHBA 3UT5B 1FFXB 3QNEA 3E8BA 3ZMUA 3L70H 4EB6B 4JI3O 2JGDB 3CWBH 3OGIB 4JGSA 5IDJA 3K04A 1W59A 5F2VO 5KHGA 2YEVB 4TSFG 1RSOB 2LP7A 2E3CA 4ZHQB 1OCZB 2GTSA 4PELA 2JRIA 4FFBA 2KG7B 4ZBMA 3T1CA 1HNZB 2UU9O 2OTJV 3STLC 1HNXO 4LWSA 1K34A 1IBLB 4HNAA 2Q69A 4X65B 3UO3A 4K8XA 3C3SA 2QEXV 1HP8A 1SERA 3T1HO 2QM7A 2UUCO 1ZL8A 1JQ0A 3ABUA 1D5NA 3BEHA 2R9RB 2XUMA 4YJ3A 5IWAO 3WG7B 4X1KB 3K57A 5JVDA 4I5SA 2RQ6A 1VQOV 2LGWA 4WFEA 5TISZ 3UKMA 3CXCU 1YJ9V 5LYJB 4N23A 4PJ0Z 3G67A 4ABMA 3SPGA 2PGGA 4PV1B 1XMQB 4NXMO 3DTUB 3B4SA 4D7SA 1EZVH 1NTZH 2E5LO 3FX7A 2F4VO 2Y0PA 4O4HB 3ZMZA 4JTAB 2ZR3A 3AEIA 3CPWU 5LMUB 4UVCA 4FLWA 4I0XB 3CP1A 3D3QA 2FL4A 4LFAB 2JS3A 1TA8A 1SQQH 4P30A 3ASNC 3H1HH 2JEXA 4HNAB 3TXQA 2IU0A 3VQWA 2W0XA 4OXSA 4B3TO 5KAFZ 4X9QA 2UXBB 4MW8A 4O2AA 4YY3B 4TQFA 2QM8A 4UCOA 1BL8A 1N36O 4IHJA 4U3JA 3ML0A 1G8MA 1L1FA 1HR0B 3JD4A 1AI6A 5GTHZ 3ZEDA 3OR6C 4F6EA 2X6CA 2ARHA 3BAAA
chains in the Genus database with same CATH topology
1EFRG 2B1GA 3R65A 1VQ6V 1ZWIC 2ZDIA 3W7WA 1GTOA 3OMIB 2WLLB 1EZJA 3CMEV 4UV9A 4WFHA 3OM3B 3JD3A 1H8HG 4LP8A 2XOKG 2HJFC 5L3GA 2GSMB 1VQLV 2DQ0A 5B3SC 5KUKA 4CBCA 4JTCB 1QVGU 1NH2B 3K3WA 2XAFA 1ENVA 3CYOA 4WFAV 4R7CA 3SYCA 3AG3C 2ZQMA 1Y66A 1THZA 2DYRC 5IYCO 1V55C 2DW4A 2XASA 3QO8A 4EKWA 5FL7G 5DM6V 1M57B 1FS0G 1QLNA 1K5QA 2JDIG 3RVYA 4ASUG 3TETA 4QIWF 3F5WC 3GWOA 2W6JG 3ASOC 1QVFU 1YITV 4KUMA 4KFMA 1W2BU 3CCUV 1Q81W 1KC8W 2EBOA 1K5SA 3E8HA 3GB7C 4JF3A 2ZDIC 1K33A 3X2QC 3ABMC 4MT8A 1S3JA 1S5HC 2IH1C 3VBBA 4PDLA 1W0JG 2Q67A 3ABLB 1Q86W 1F4NA 3F7VC 2EINB 2QA4V 4GX2A 3SYQA 1QCEA 1MOFA 2IJIA 2DYRB 3OMAB 4XDJA 2XAGA 3OR7C 1S0VA 1YTFB 3OGCC 3AG2C 1KECA 5H6RA 3CCMV 4MTXA 2QTOA 4P9PA 3ZJZA 3ZMTA 1KQSU 1J95A 1VQKV 3AG1C 4N21A 1OCCC 4WFFA 2DWEC 2WLKA 3E35A 1HWYA 3ABKC 2IJHA 4Q20A 3CCVV 1CPYA 2X0LA 2OCCC 4X88A 2C2AA 3ASNB 4FJCC 4UVAA 3EFFK 4QNHB 1GM8A 3SPIA 4GX0A 2WLJA 3LSQA 3LUTB 2H94A 2Y69B 1BMFG 2K1EA 4MVZA 4JYCA 2XNDG 1K4DC 3ASOB 2OT5A 1PNKA 3OAAG 4GCZA 1NH2D 2HG5C 5C93A 4JAVA 1FXHA 2DYSC 3ZRWB 4BW5A 1FXKA 2P7TC 2WPDG 4MTFA 4PA7A 3LSSA 4FK5C 1AJPA 1NR1A 3OFNG 2NLJC 4F4LA 1NR7A 5IYBO 3FB7C 1WPXA 1KP2A 2P90A 2F43G 3ZMVA 1YIJV 5EBMC 2YEVA 5CA3A 5EC1C 4RAIA 3W7UA 3CC4V 4MVQA 1Y4MA 4BIUA 3AG2B 1PD3A 1VQ7V 2PI4A 3I56V 3VOUA 5CBGA 4JTDB 1SZTA 2Y69C 5KA5A 1AI7A 1GM7A 4RQEA 1OCCB 1R73A 3SPCA 1DLBA 4MVRA 5B1BB 3ABTA 3E83A 1R3IC 2Z3YA 1K97A 2OCCB 4BAYA 4R50A 1M1KW 4PA4A 1Q7YW 1R3LC 2XAHA 1H8EG 1QBZA 1M9NA 4PDMA 4QJFB 4RUFA 3E86A 1VQPV 3AG1B 5CN0A 3ZIAG 3K9AA 1OHHG 3B8NA 3FB5C 4UVBA 2OTLV 4UUJC 4WF9V 2X7RB 2FTKA 1CP9A 4P2ZA 1E1QG 4QE9A 3T4ZA 3ETGA 3OEEG 1VQ4V 4JAUA 1COWG 4MVSA 4FPPA 2EZOA 2WLIA 4KP4A 2DWDC 4MW3A 1S77D 3K0DA 2ATKC 2WLIB 1YSCA 1AJNA 3ZRXA 4UV8A 3X2QB 3CC7V 3T4DA 1OCRC 2BOBC 3K03A 3SPJA 2Y48A 3STZC 5L3CA 2P67A 3K08A 1B6QA 3QO5A 4G28B 1OZ0A 1PL0A 2EINC 4X8AA 3ZRWA 1RM1B 2MK3A 3E2EA 3PJSK 3FB8C 3D3IA 2M7WA 1JPXA 2A79B 1K7DA 3OW2U 1AI5A 4MTOA 2V1DA 2QKSA 4CZZA 5L3FA 1H38A 3RVZA 1E1RG 1K4CC 4JYBA 2R9IA 1M57C 4DXWA 1YJNV 4JPRA 3CMAV 3H01A 3B8MA 2JJ2G 1GK9A 4R8CA 1S72V 1NVPB 2IU3A 4XDKA 2QE7G 5B1AB 2DYSB 2ITDC 3JYCA 4YXWG 1AJQA 2XAJA 1K8AW 1M56B 3JD0A 5KA6A 3WG7C 1KD1W 3W7SA 1MG1A 3FB6C 5LGUA 4Z1MG 5CBHA 5B1NA 5EBLC 5GW7A 3IFXA 5L3BA 2EIMB 5H9CA 3FKSG 4PA3A 1PKXA 4U7OA 1V54C 2CK3G 2H8PC 2WLNA 4UXNA 1K3EA 4BIZA 4MVOA 5CMUA 5LHIA 4E2LA 3MHSC 3F7YC 1MSWD 1GM9A 1G4YB 3B77A 1PNLA 3K79A 1I5YA 2EILB 2JEUA 3ZN0A 1DF4A 2ZXWC 3SYOA 3ABKB 1OCZC 1AI4A 1NJIW 3G6EV 3IC7A 3OEHG 1QLEB 4MVUA 2X6AA 4MVMA 2BOCC 2ITCC 4RQFA 2EIKB 1MABG 5LGTA 3ETDA 2JJ1G 4MTGA 4HZ3A 2EIMC 3CCEV 4R6ZA 1KKDA 3DGEA 2EIJB 1PNMA 2A0LA 1R6KA 4FMTA 5B1AC 3ZN1A 5CBFA 3SJQC 2W0FC 1M56C 3CCLV 3MD0A 2NNUA 1H2GA 4FIPC 2UXXA 2WSSG 3RBZA 4DO2A 1NKDA 1JCHA 4HYOA 3CCJV 1YI2V 4XDLA 3OUSA 3QO7A 4TT3G 1KP3A 2HKOA 1RM1C 1VQ5V 1FXVA 2UXNA 1S76D 2A9HA 2P6JA 4WFGA 2XAQA 3ZRSA 4X89A 2JK5C 3KG2A 1AR1B 2EJRA 4RO2A 1ORQC 3P30A 3SPHA 5DN6G 2Q6AA 4GX1A 5B3SB 4J9YB 2IJJA 3UM7A 3HB3B 1VQ9V 2EZPA 4LBEC 4WCEV 1QR8A 2WAMA 1BHBA 1OCRB 1F23A 2HLDG 1JJ2U 1M90W 3BY6A 5H6QA 3LDDA 3QNEA 3E8BA 1QR9A 1OCOC 1AROP 3ZMUA 1BHAA 4U7NA 5IYDO 1K9MW 1W0KG 2EIKC 1FFTB 1GO3F 1Q82W 3CC2V 3ABLC 4JGSA 5IDJA 4QPJA 3K04A 2YEVB 2EILC 4TSFG 3CCRV 5J9PC 4JASA 3OE7G 2LP7A 5E1AC 3SYPA 3NXSA 1OCZB 4PELA 3W7TA 2X6BA 5KUMA 4ZBMA 1P7BA 2Z5UA 1R6NA 3T1CA 3M99B 4GT1A 4LCUC 2OTJV 3STLC 4PDVA 4H33A 4PA6A 1K34A 1R3KC 2WLLA 5LHHA 3AG4B 2AHZA 2Q69A 2HR3A 4ZKIA 3MHHC 1I5XA 1E79G 1OCOB 2QEXV 2D3OW 4XBFA 1VQ8V 3AG3B 1SERA 5EC2C 1SETA 2HVJC 1FXKB 2QM7A 3E89A 2KB1A 2WWWA 1K92A 3G71V 1JQ0A 3ABUA 1TUEB 3BEHA 2R9RB 3LNMB 3RW0A 5B1OA 4LC1A 3ABMB 5LBQA 1N8RW 3WG7B 2IJKA 1VQNV 3A0RA 4I5SA 1XL4A 3HPLC 1VQOV 5BZBA 1LNQA 2HFEC 3ETEA 3IGAC 4WFEA 3EHBB 5LHGA 3UKMA 1JOYA 3CXCU 3LDCA 1YJ9V 4N23A 1JVMA 4I9WA 1SRYA 2AHYA 2IW5A 4QPKA 5L3EA 1CEZA 3SPGA 3OUFA 3DTUB 5HFLA 1F51A 4MSWC 3T2MA 3JD2A 4HAMA 2JIZG 4J9ZB 5EBWC 3CCQV 3FYIB 1R3JC 2YSUB 4G2KA 1UJWB 4QE7A 2GHYA 3ZMSA 2EIJC 5HFMA 3ZMZA 4JTAB 2ZXWB 2ZR3A 1K73W 3AEIA 3ZRVA 3CPWU 3ZCCA 3CD6V 3K06A 1QLEC 1VQMV 4UVCA 1JX9A 3WFVA 4H37A 2ZD9A 5IY5B 4PA9A 3CP1A 4PDRA 4G27B 1GMGA 1SESA 4MS2A 1NQTA 4RUEA 4GX5A 1P4RA 1FXKC 2LFRA 4P30A 3JD1A 1WLEA 1XL6A 3ASNC 1F4MA 3CCSV 3LDEA 5LGNA 2JEXA 1V54B 2IU0A 4WFBV 4OXSA 3G4SV 2DQ3A 2LFSA 3JCZA 4TWKA 5L3DA 3TK1A 4MW8A 5EK0A 2HVKC 3D36A 2Q68A 2QM8A 3OMNB 3SYAA 3E8FA 1EBOA 3P32A 3FYEB 1BL8A 3I55V 2PI5A 1NVPD 1IXMA 1YTFD 1DF5A 3ML0A 2W6IG 1G8MA 1YHQV 5IY5C 2V7QG 1DTOA 4L87A 2B5UA 1RPOA 2WLHA 5B1BC 1V55B 1L1FA 3JD4A 1AI6A 2B1IA 3AG4C 2WLMA 1ROPA 3OR6C 1NBMG 1GKFA 2IH3C 2X6CA 4P9OA 1YJWV 2ZR2A 3K0GA 3W7XA 3E8GA 3TCUA 1RPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZO A;  1K34 A;  4FK5 C;  5H9C A;  4JPR A;  4FJC C;  3WFV A;  2P6J A;  3H01 A;  3MHH C;  1I5X A;  1EBO A;  1QCE A;  1MOF A;  1QBZ A;  3B8M A;  3CP1 A;  4N23 A;  3GWO A;  4JGS A;  3P30 A;  5CMU A;  4E2L A;  3MHS C;  1DF5 A;  4G2K A;  5CN0 A;  1Y4M A;  2OT5 A;  3K9A A;  5HFL A;  5KA6 A;  1JQ0 A;  2LP7 A;  3B77 A;  2EBO A;  3B8N A;  2MK3 A;  1I5Y A;  4N21 A;  1SZT A;  1ENV A;  1DF4 A;  1JPX A;  1QR8 A;  2EZP A;  1MG1 A;  2M7W A;  2X7R B;  3CYO A;  4FIP C;  4JF3 A;  1F23 A;  5KA5 A;  1DLB A;  5HFM A;  1K33 A;  3M99 B;  1Y66 A;  1QR9 A; 
#chains in the Genus database with same CATH topology
 3R65 A;  2CE4 A;  5JWP A;  3UO2 A;  3JSN A;  5JJN B;  3L75 H;  5KLV H;  1N33 O;  4DR2 B;  4LP8 A;  1P7G A;  1VQL V;  2GSM B;  3B2E E;  2DQ0 A;  4B08 A;  1DK1 A;  4H13 B;  2F23 A;  2XHB A;  4KHP B;  4WFA V;  1N32 B;  4B3S O;  1NTK H;  3H9V A;  2ZQM A;  2Q8V A;  2DYR C;  3QO8 A;  4EKW A;  4UFZ A;  4I4T B;  4DW1 A;  4LFC O;  4QIW F;  2A06 H;  2W6J G;  3CRC A;  3HKE B;  4LF8 O;  1XNQ B;  3CCU V;  1Q81 W;  2EBO A;  1N34 B;  2CDY A;  3K9S A;  4NVP A;  4MT8 A;  1IBK B;  5A9G A;  3VBB A;  3CX5 F;  3Q4H B;  1BQZ A;  3AG7 A;  4YHH B;  2AW9 A;  2BCC H;  4UCR A;  2RCV A;  3SYQ A;  4B7K A;  3WB2 A;  2IJI A;  3OMA B;  4DV5 B;  2XAG A;  1S0V A;  1YTF B;  1MZE A;  3ZMT A;  4NR1 A;  3AG1 C;  4FLT A;  4N21 A;  1SZX A;  1HWY A;  3L9D A;  4J11 A;  5IJ9 B;  2C2A A;  1JFF B;  4DV7 O;  1X4T A;  4UVA A;  1SA0 B;  4LF4 B;  4O4I B;  2OCH A;  2LJ2 A;  3BRC A;  4AQY B;  1Q8I A;  2OT5 A;  1HR0 O;  3ZHR A;  2HG5 C;  4JAV A;  4YJ2 B;  1FXH A;  1BT8 A;  3ZRW B;  3O65 A;  1Q6U A;  4MTF A;  3OFN G;  4TV8 A;  4F4L A;  3TGU H;  4KXR A;  1NR7 A;  1KP2 A;  2QGN A;  5EBM C;  4MVQ A;  3RFR A;  2PI4 A;  4JTD B;  2Y69 C;  3ICX A;  4B3S B;  1XQ8 A;  4I7Z B;  4RQE A;  1R73 A;  5B1B B;  3E83 A;  5A2Q N;  4NKG B;  1HNW B;  5H5N A;  4R50 A;  4PA4 A;  4NTX A;  1M9N A;  4DR4 B;  1J5E O;  2YS8 A;  1WA8 A;  3AG1 B;  1BCC H;  4DR6 B;  1OHH G;  2L6L A;  4WBN B;  4WF9 V;  5LXT A;  1H2K A;  3K5O A;  3ETG A;  3OEE G;  1WA8 B;  2CTR A;  4KP4 A;  1S77 D;  1FJG O;  2ATK C;  2WLI B;  5LMN O;  1AJN A;  1SKV A;  2G38 A;  1LUW A;  2BOB C;  1US6 A;  1GRJ A;  3DSQ A;  3SPJ A;  5LOV A;  5L3C A;  2P67 A;  4W4K A;  1OZ0 A;  1PL0 A;  2DE0 X;  1RM1 B;  2VS0 A;  3JAT B;  2ZKO A;  3JAS B;  5L3F A;  4ZI7 B;  2JJ2 G;  1S72 V;  4R8C A;  1IBM O;  4XDK A;  2DYS B;  3JYC A;  1XUQ A;  2Y0I A;  2ZT9 B;  3CRQ A;  3KKY A;  5D5Q A;  4KL1 A;  1KD1 W;  2F4V B;  2OIE A;  2NN4 A;  4TV9 B;  1BQ0 A;  5B1N A;  3QTC A;  5JJE B;  2M6Y A;  5B5E Z;  1BS3 A;  1EN5 A;  4U7O A;  1V54 C;  2CK3 G;  3FAV A;  5CA0 A;  1VF7 A;  2ZE7 A;  4DV1 O;  1MSW D;  4HBN A;  2Q7E A;  2CGO A;  4X1K A;  4DR5 O;  3SYO A;  3L74 H;  2Q4P A;  1NJI W;  3K58 A;  3G6E V;  3OEH G;  2X6A A;  4MVM A;  4RQF A;  5IT9 N;  2ZM6 B;  3ETD A;  1N36 B;  4YJ3 B;  3P3P A;  3CCE V;  4LF4 O;  3RT3 C;  2ODM A;  2EIJ B;  2ZIO A;  3SJQ C;  2HP8 A;  2NNU A;  4NXM B;  4FIP C;  3ZHS A;  2K9P A;  2UXX A;  3RYI A;  1Q5O A;  1VP7 A;  4DO2 A;  1NKD A;  1JCH A;  4HYO A;  1FXV A;  1U97 A;  3M8A A;  3ZRS A;  2YXH A;  4X89 A;  5LXT B;  2JK5 C;  3KG2 A;  3R66 A;  1AR1 B;  1N33 B;  5KAI Z;  1VIB A;  2IJJ A;  3VQX A;  3HB3 B;  4CH4 A;  2IBZ H;  4LBE C;  1QR8 A;  1OCR B;  2HLD G;  1TAE A;  4DYL A;  3BY6 A;  4PHZ A;  5H6Q A;  5KHH A;  2P4K A;  4H0L B;  1OCO C;  3KZI Z;  1BHA A;  5IYD O;  1W0K G;  2LW7 A;  1FFT B;  1Q82 W;  3ABL C;  2N74 A;  4LFC B;  5JH7 B;  3HKB A;  3CCR V;  5E1A C;  2GBO A;  2HHH O;  2X6B A;  2F95 B;  1VF6 A;  5KUM A;  1P7B A;  5KX5 B;  4LCU C;  4H33 A;  4U3J B;  4X64 O;  4CS2 A;  4FVM A;  3AG4 B;  2VQE B;  3RYH B;  5K1P A;  4X66 O;  1VQ8 V;  1AP5 A;  1SET A;  2HVJ C;  3G80 A;  1Z2G A;  2WWW A;  3LNM B;  5KHJ A;  1ZLZ A;  3RW0 A;  4LC1 A;  3ABM B;  3G6B A;  5LBQ A;  1EN6 A;  5JCO C;  2Q73 A;  2VWK A;  4E4E A;  3FAV B;  5CA0 B;  3ETE A;  3IGA C;  5LHG A;  4DUY B;  4I9W A;  1SRY A;  2IW5 A;  4DUY O;  4K0K O;  5HFL A;  3GWK C;  4J9Z B;  3FYI B;  1R3J C;  2GTA A;  4B7E A;  1XNR B;  1UPG A;  1WB8 A;  1KKC A;  2XT9 A;  4IYH A;  1WB7 A;  2ZXW B;  2GV9 A;  3ZRV A;  2DJV A;  3ZCC A;  3TXS A;  1VQM V;  3F5T A;  2ZD9 A;  5IY5 B;  4GKK B;  4GKJ O;  4JYY A;  1ZTE A;  5DED A;  4U3F H;  1KU9 A;  2YIA A;  2CTQ A;  4GX5 A;  1XEQ A;  1FD9 A;  3JD1 A;  2BTO A;  1WLE A;  4X1I A;  3LDE A;  4FLZ A;  3CRA A;  1V54 B;  3G4S V;  4LF7 B;  2PZS A;  2ETN A;  2LFS A;  4LH6 A;  3JCZ A;  3TK1 A;  1LUV A;  3HKC A;  4JI6 O;  2Q68 A;  3OMN B;  1EBO A;  3HKD B;  3P32 A;  1O9G A;  4JI7 B;  2PI5 A;  1NVP D;  2PF4 E;  2CTW A;  1YHQ V;  1DTO A;  4L87 A;  2B5U A;  2WLH A;  1V55 B;  2QM4 A;  2WLM A;  1GKF A;  2IH3 C;  1HNX B;  2ZIM A;  1NTM H;  3W7X A;  3E8G A;  1RPR A;  3JAK B;  1EFR G;  4I55 A;  1FKA O;  2ZDI A;  1GTO A;  2O57 A;  4DR7 O;  5GON A;  2WLL B;  3CME V;  4UV9 A;  1EM1 A;  3SR2 C;  1H8H G;  5GON B;  3CSX A;  4DV2 O;  5KUK A;  4CBC A;  4JTC B;  2XAF A;  1KYO F;  1BSM A;  3CYO A;  5FLX N;  2Z0A A;  3HKB B;  3JAR A;  3SYC A;  1QNM A;  1S5J A;  2CTP A;  5CA1 A;  5J2T A;  2DW4 A;  5FL7 G;  3FD9 A;  4ASU G;  3GWO A;  1QVF U;  3U11 A;  1YIT V;  1J5E B;  1W2B U;  1P49 A;  3SGI A;  4I0X A;  1NU1 H;  5BY1 A;  4I50 A;  3GB7 C;  1XHZ A;  3K5L A;  2ZDI C;  2LGQ A;  2RN9 A;  3ABM C;  1S3J A;  2IH1 C;  1W0J G;  1HNZ O;  4FLX A;  1D5A A;  4NYK A;  2QA4 V;  4GX2 A;  4LF5 B;  4WBN A;  1QCE A;  1TVK A;  2PUS A;  4DR3 B;  3P3N A;  2QTO A;  4P9P A;  5FPR A;  4DR5 B;  3T1H B;  4O2A B;  2ADP A;  2N05 A;  4WFF A;  3CRR A;  4B3R B;  4JZ2 A;  2WA3 A;  3ABK C;  4Q20 A;  1SQF A;  1SS3 A;  1CPY A;  3CB2 A;  4X88 A;  4FLV A;  5GTI Z;  4QNH B;  2H3O A;  4F6R A;  4GX0 A;  2WLJ A;  1BMF G;  2K1E A;  4AQY O;  2XND G;  4GCZ A;  1YXB A;  2ILM A;  1XNR O;  3K5N A;  1KB9 F;  2QSA A;  3JAL B;  5IYZ B;  3QG5 A;  3C90 A;  4DUZ B;  1JA8 A;  2MW2 B;  1Z5V A;  1Y6X A;  3A8T A;  3AK1 A;  1XOU A;  4PA7 A;  3LSS A;  4FK5 C;  1SQX H;  5LMU O;  2HEP A;  4ZHQ A;  2UUB B;  3FB7 C;  1WPX A;  5BR8 O;  2Q9L A;  4JI1 B;  4GKJ B;  2YEV A;  3CC4 V;  1SA0 A;  1VQ7 V;  1PD3 A;  4DV6 B;  2YUA A;  5KA5 A;  3OT7 A;  3OTF A;  1MA1 A;  2Z3Y A;  1HNW O;  1VEW A;  5FPO A;  3HKE A;  4IIJ A;  2N04 A;  4RUF A;  3E86 A;  5D5P A;  5CN0 A;  3IAY A;  3ZIA G;  1AVM A;  4JI4 O;  4JV5 O;  4DR6 O;  4UVB A;  2FB5 A;  2D2C B;  4UUJ C;  4J10 A;  2X7R B;  1CP9 A;  4QE9 A;  2UU9 B;  2OYQ A;  4JAU A;  3N2K B;  1D2D A;  4MVS A;  1IBL O;  5ITZ B;  2DWD C;  4O4L B;  2YC0 A;  5LA6 B;  2UUA B;  3ZRX A;  3KCX A;  3LNN A;  5J2U B;  2Y48 A;  4G28 B;  2AZ2 A;  1IDS A;  3K5M A;  3E2E A;  3D3I A;  2E75 B;  4RWU A;  2V1D A;  4CZZ A;  5LP6 A;  1PM9 A;  3BAB A;  1IZ3 A;  3RVZ A;  4NTY A;  2JS5 A;  3I5D A;  1G1X B;  3H01 A;  4K3A A;  3B8M A;  2QWP B;  1GN6 A;  2ITD C;  4JI0 O;  1YDX A;  3BVO A;  1B04 A;  3JD0 A;  5KA6 A;  2PYJ A;  1Q3E A;  2HHH B;  3K59 A;  4Z1M G;  5EBL C;  4TOI A;  5L3B A;  4YHH O;  5H9C A;  4ZIB A;  3RWR D;  2BTQ B;  5CMU A;  5LHI A;  1AB3 A;  4E2L A;  3APO A;  4O2B B;  4O4J A;  2GUZ B;  5LYJ A;  3RYH A;  1CXZ B;  4JYA B;  4MVU A;  1RP3 B;  2XTA A;  4B3T B;  3SJB C;  5LGT A;  1TUB A;  4HZ3 A;  3QVN A;  2UXD B;  4OPA A;  1X59 A;  2UXD O;  4FMT A;  2A0L A;  3ZN1 A;  1R6K A;  4B3M B;  2OWO A;  4W4L A;  4Z2W A;  2JVD A;  3RBZ A;  2RJZ A;  1OV9 A;  4FZ0 A;  1GH6 A;  3CCJ V;  1YI2 V;  2HKO A;  2DOS A;  4I9Q A;  2UXN A;  1QQC A;  2A9H A;  1AR4 A;  1B3Q A;  3BFR A;  5H2F Z;  3ZHQ A;  4GZR B;  2CGN A;  2Q6A A;  4LF9 B;  1VQ9 V;  3DC5 A;  5E79 Z;  4WCE V;  1ZUQ A;  1F23 A;  1M90 W;  3LDD A;  1ARO P;  4U7N A;  1K9M W;  4NXN O;  3RYI B;  4J7K A;  1GO3 F;  1GN2 A;  4DR4 O;  4JI6 B;  4QPJ A;  4TUY A;  1L0L H;  1U96 A;  2EIL C;  3A0H Z;  1FPO A;  1I0H A;  4JAS A;  5EYP A;  5FNV B;  3OE7 G;  3SYP A;  3NXS A;  1IUR A;  4PD4 F;  4JI4 B;  4JV5 B;  3W7T A;  1TUB B;  2Z5U A;  4TQD A;  3M99 B;  3N27 A;  1YVW A;  2WLL A;  2E76 B;  4DV4 O;  2AHZ A;  4DV4 B;  4X66 B;  1E79 G;  1OCO B;  3VQY A;  3AG3 B;  2KB1 A;  1H2M A;  5LP6 C;  2PY5 A;  1IX9 A;  3ZBH A;  4O4L A;  1JR9 A;  4LH7 A;  3A0R A;  1XL4 A;  3N2K A;  4CS3 A;  1JOY A;  3BHP A;  4JI0 B;  2AXT Z;  2EUL A;  4DW0 A;  4LFB B;  2AHY A;  1F7Y A;  4QPK A;  5L3E A;  1CEZ A;  4B3M O;  3OUF A;  3T2M A;  1F51 A;  1FFX A;  4HAM A;  4DV0 O;  1XNQ O;  3CCQ V;  2YSU B;  4G2K A;  1UJW B;  2AZ0 A;  4QE7 A;  2GHY A;  3ZMS A;  2EIJ C;  2Q0A A;  2L35 A;  1L8D A;  4C7U A;  1S5L Z;  4DUZ O;  5C8Y B;  3CD6 V;  4CH5 A;  3K06 A;  1Y67 A;  4OPH A;  2CUG A;  1JX9 A;  4H37 A;  4EEQ A;  2VQF B;  3JAM N;  4PDR A;  3HKD A;  1Y74 A;  5BMV B;  2B9Z A;  4G27 B;  4X20 B;  1Y74 B;  4MS2 A;  1FXK C;  2LFR A;  5LP6 B;  1P84 F;  4I50 B;  1XL6 A;  1SQB H;  1F4M A;  3CCS V;  4YJ2 A;  4WFB V;  1URF A;  2DQ3 A;  4NXN B;  5L3D A;  2QTS A;  5EK0 A;  2HVK C;  4DV7 B;  1PPJ H;  3E8F A;  3FYE B;  3J7A U;  1XHX A;  4LNU B;  1IXM A;  1YTF D;  4JI7 O;  4AHC A;  5EZY B;  1RPO A;  2BSK B;  3AG4 C;  4P9O A;  3JAL A;  4BR6 A;  5LGN A;  1BE3 H;  4X62 B;  2B1G A;  1VQ6 V;  3W7W A;  2Q0O C;  4PI0 A;  3OMI B;  4DRX A;  4WFH A;  3JD3 A;  4OGQ B;  2XOK G;  2HJF C;  3RYF A;  1Q90 D;  4FFB B;  4K35 A;  3K3W A;  1ENV A;  4R7C A;  3E22 A;  2WA4 A;  5IYC O;  1V55 C;  2XAS A;  1XDC A;  1VF6 C;  4DK1 A;  1FS0 G;  2ZNI A;  1QLN A;  4JI3 B;  1K5Q A;  2JDI G;  3OTO O;  4JI5 B;  3UQ8 A;  4OX9 B;  3F5W C;  4K0K B;  3ASO C;  5K1X A;  4KUM A;  2CH7 A;  4LF6 B;  1K5S A;  4LF6 O;  4CC6 A;  1FAF A;  2FML A;  3E8H A;  4JF3 A;  1N34 O;  1JJO A;  3GVM A;  4DK0 A;  4UCV A;  2R72 A;  1Q86 W;  3ABL B;  1H2S B;  5KHK A;  1YEW A;  3KCY A;  3JAT A;  2YIC A;  1MOF A;  1Q43 A;  4XDJ A;  5IJ0 A;  3AG2 C;  5H6R A;  3CCM V;  3ZJZ A;  4H44 B;  1J95 A;  2RDC A;  1VQK V;  3J80 N;  1M93 A;  2EJ7 A;  2IJH A;  4J7J A;  2OCC C;  3CS5 A;  4YY3 O;  1ZAU A;  3EFF K;  3LUT B;  2H94 A;  2Y69 B;  2VWJ A;  1HDJ A;  5C93 A;  2YIB A;  4ICG A;  3JSL A;  4JI2 B;  4LWS B;  4BW5 A;  2Q7H A;  4BW9 A;  1AJP A;  2QWO B;  4J41 A;  1WN7 A;  4DR2 O;  2P90 A;  4GLX A;  2F43 G;  4TV8 B;  4GKK O;  5CA3 A;  1AP6 A;  2QR4 A;  1Y76 B;  4RAI A;  3ETQ A;  5KMG B;  4KHP O;  2YXL A;  5CBG A;  1HW7 A;  1GM7 A;  4CS4 A;  3H1I H;  1OCC B;  2ZCE A;  3CEI A;  1DLB A;  2P06 A;  3SPC A;  5B66 Z;  2GUZ A;  1B06 A;  4L8J A;  4JAA A;  1R3I C;  3THO A;  4A5U B;  3QF7 A;  2BE3 A;  4LF7 O;  2OCC B;  2RNB A;  3ZHV A;  4BAY A;  1M1K W;  2UXB O;  1PV0 A;  1H8E G;  2DMX A;  1QBZ A;  2QKC A;  4IYI A;  4PDM A;  1PP9 H;  5LA6 A;  4QJF B;  4ZOL A;  1VQP V;  1BGY H;  4J80 A;  3FB5 C;  2OTL V;  2R9A A;  4J42 A;  1E1Q G;  1VQ4 V;  2QWQ B;  1COW G;  3EXA A;  2WLI A;  3AK2 A;  5JCO A;  3K0D A;  4IIJ B;  4X20 A;  1YF2 A;  1N0N A;  4UV8 A;  3X2Q B;  3CC7 V;  3T4D A;  1OCR C;  3K03 A;  2CH7 B;  1AR5 A;  3K08 A;  1B6Q A;  3QO5 A;  2EIN C;  3ZRW A;  4DV2 B;  3FB8 C;  2M7W A;  1JPX A;  1WAZ A;  3OW2 U;  1K7D A;  2ZE5 A;  1H38 A;  1E1R G;  1K4C C;  3EVK A;  4JYB A;  4UCS A;  3J81 N;  2R9I A;  2DN9 A;  1M57 C;  4DXW A;  1SQG A;  2YI8 A;  1WP7 A;  1WP8 A;  1GK9 A;  1ZX3 A;  1NVP B;  2JGD A;  5ITZ A;  2QE7 G;  4JI5 O;  3D8C A;  2KSD A;  1AJQ A;  4YXW G;  1K8A W;  1M56 B;  4LFB O;  4JI8 O;  1ZSP A;  2E5L B;  2LW1 A;  1MG1 A;  3FB6 C;  3BA9 A;  2OIG A;  5GW7 A;  3NR7 A;  2YID A;  2EIM B;  4EB6 A;  4FM0 A;  3FKS G;  4PA3 A;  1PKX A;  2VQF O;  1Z5W A;  2WLN A;  3MAQ A;  2A7W A;  4BIZ A;  4MVO A;  4EFE A;  1QU7 A;  3H1K H;  3MHS C;  3F7Y C;  2CAZ C;  4LFA O;  1PNL A;  3K79 A;  1VF5 B;  2JEU A;  1SQV H;  3OD4 A;  4Q6G A;  1DF4 A;  2P4V A;  2ZXW C;  3ABK B;  1WJZ A;  1SQP H;  1QLE B;  3FFQ A;  2BOC C;  4JYA O;  4D6T H;  5IE9 A;  5B1A C;  5CBF A;  3TJT A;  2W0F C;  1M56 C;  1YCI A;  3CCL V;  3MDS A;  1IXB A;  5JQG B;  4X62 O;  5IJ9 A;  3CJH B;  3L73 H;  4XDL A;  3QO7 A;  4TT3 G;  1KP3 A;  3JAR B;  1RM1 C;  1VQ5 V;  2UUA O;  1S76 D;  4WFG A;  2XAQ A;  2UUB O;  4O4I A;  4RO2 A;  1ORQ C;  4QGP A;  4ZOL B;  1UFI A;  4TV9 A;  1JFF A;  3SPH A;  1KMI Z;  5EYP B;  4GX1 A;  1WNS A;  2EZP A;  1JJ2 U;  2KG7 A;  1WPB A;  1QR9 A;  3VQV A;  3BCC H;  2EIK C;  4PI2 A;  5KHI A;  1ZL8 B;  3CC2 V;  2BTQ A;  3DXR B;  4OX9 O;  2ZE8 A;  2YDE A;  4CH6 A;  4F6R B;  5J9P C;  5JVD B;  4ZI7 A;  1M5I A;  3H1L H;  3UT5 A;  3JAW A;  1R6N A;  4GT1 A;  3A2F A;  3JAW B;  4PDV A;  5KMG A;  4PA6 A;  2VQE O;  1R3K C;  4O4J B;  5LHH A;  1I7F A;  4X64 B;  2HR3 A;  4ZKI A;  2QJ1 A;  1I5X A;  3MHH C;  4LF5 O;  2D3O W;  4XBF A;  1V9P A;  5CA1 B;  1JMK C;  5EC2 C;  4FZ1 A;  1FXK B;  3E89 A;  3T1Y O;  1K92 A;  3G71 V;  5JJJ B;  1TUE B;  2A3Q A;  5B1O A;  4YIP A;  4IL6 Z;  1MSD A;  1N8R W;  2PYL A;  2IJK A;  1N32 O;  4B3R O;  1VQN V;  4D7T A;  5IWA B;  1SC5 B;  1IVS A;  3HPL C;  1I08 A;  2ZM6 O;  5BZB A;  1LNQ A;  1FYJ A;  2HFE C;  4UCT A;  3EHB B;  3LDC A;  1H2N A;  1JVM A;  3U0Z A;  4X1Y B;  4MSW C;  4UB8 Z;  3JD2 A;  3DC6 A;  2JIZ G;  5EBW C;  2V4D A;  3HR0 A;  1H2L A;  5HFM A;  4GUN A;  4JI2 O;  1K73 W;  1Q6I A;  4FM1 A;  1QLE C;  2LQT A;  3WFV A;  2QWR B;  5IJ0 B;  4PA9 A;  5LOV B;  1KBH A;  4DV5 O;  1A32 A;  1GMG A;  4CC5 A;  1SES A;  1XIL A;  1NQT A;  4RUE A;  1P4R A;  4DV1 B;  3BPZ A;  2HJD A;  3ZHT A;  4X1I B;  2FYU H;  1GAX A;  3B09 A;  4TWK A;  2UXC B;  2ADQ B;  4DR1 B;  5IYZ A;  5BXZ A;  2UXC O;  1SF9 A;  3D36 A;  3SYA A;  3L71 H;  5C8Y A;  3I55 V;  2VRZ A;  1DF5 A;  3RYF B;  2W6I G;  4FLY A;  5IY5 C;  2V7Q G;  5B1B C;  2B1I A;  3CRM A;  1ROP A;  1NBM G;  4BIO A;  1YJW V;  2ZR2 A;  3K0G A;  3TCU A;  1TGO A;  1EN4 A;  1ZWI C;  2Y4T A;  3M7M X;  1N4C A;  1EZJ A;  3OM3 B;  4CH3 A;  2EX3 A;  5L3G A;  4JI1 O;  4AI8 A;  5B3S C;  5JQG A;  1QVG U;  1NH2 B;  2P5O A;  2QKA A;  1XRE A;  3AG3 C;  3L72 H;  4FM2 A;  2Y4U A;  3A0B Z;  4O4H A;  1Y66 A;  3CHX A;  4FFK A;  1THZ A;  3Q4H A;  5DM6 V;  1M57 B;  4GYC B;  2AGA A;  4O2B A;  3RVY A;  3TET A;  2RMK B;  4FLU A;  1VAR A;  4DV0 B;  4KFM A;  4DRX B;  2KKW A;  1KC8 W;  2R70 A;  3JCU Z;  2F66 C;  4UCU A;  3PN1 A;  1K33 A;  3X2Q C;  1S5H C;  2LO1 A;  3RYC B;  4PDL A;  2Q67 A;  1F4N A;  3F7V C;  2EIN B;  5EIB C;  4X65 O;  3H1J H;  2DYR B;  1Q6H A;  1MNG A;  3OR7 C;  4X1Y A;  3OGC C;  4I4T A;  1TVK B;  1KEC A;  4MTX A;  1KQS U;  3C3T A;  3T1Y B;  3S3W A;  1GN3 A;  1OCC C;  3IC9 A;  2DWE C;  4IT5 A;  1BZK A;  1I94 B;  2WLK A;  3E35 A;  2ZNJ A;  3CCV V;  2X0L A;  3ASN B;  4FJC C;  1R1B A;  1GM8 A;  3SPI A;  3SJA C;  3LSQ A;  1N0J A;  4MVZ A;  4JYC A;  3B40 A;  1K4D C;  3ASO B;  1XBL A;  1PNK A;  2F1M A;  3OAA G;  4EFB A;  4JI8 B;  1NH2 D;  3HKC B;  2F93 B;  2DYS C;  1NT2 B;  1FXK A;  4TUY B;  2P7T C;  2WPD G;  3APQ A;  1DGS A;  1XMO O;  1NR1 A;  2NLJ C;  5IYB O;  2YI9 A;  2YXY A;  2E74 B;  3ZMV A;  5EIB D;  5BR8 B;  5LL6 Y;  1YIJ V;  5EC1 C;  3W7U A;  4LF9 O;  1Y4M A;  4BIU A;  3AG2 B;  3I56 V;  3VOU A;  3RYC A;  1SZT A;  4UB6 Z;  3U10 A;  3CE2 A;  1AI7 A;  4MVR A;  3ABT A;  1RSO A;  4J7Z A;  1K97 A;  4DR1 O;  1Q7Y W;  1R3L C;  2XAH A;  3JAK A;  4I55 B;  3IJ4 A;  2JGU A;  2FKX A;  2IM9 A;  3K9A A;  3B8N A;  2QDO A;  3BA8 A;  4AIL C;  2FTK A;  4P2Z A;  3T4Z A;  1IBK O;  1NI8 A;  3JAS A;  4FPP A;  1FJG B;  2EZO A;  4MW3 A;  1NS1 A;  4DR7 B;  1L0N H;  1YSC A;  3RGB A;  4DR3 O;  2GDS A;  1MMM A;  1QHT A;  5AG2 A;  3STZ C;  4X8A A;  3CXH F;  3CJH A;  2MK3 A;  3PJS K;  1YZB A;  2A79 B;  1AI5 A;  1MZF A;  4MTO A;  2QKS A;  2PTM A;  5FNV A;  5J2U A;  1T5E A;  1YJN V;  4JPR A;  3DXR A;  2Q5Z A;  3OTO B;  3CMA V;  1IBM B;  1GN4 A;  2IU3 A;  5B1A B;  3WB0 A;  2XAJ A;  4LF8 B;  4YIO A;  1M4U A;  1XMQ O;  3WG7 C;  3W7S A;  5LGU A;  2YIB D;  3ZX6 A;  1AIL A;  1Y76 A;  2QWN B;  3ZHU A;  5CBH A;  1R6T A;  1NZ6 A;  3IFX A;  4IHJ B;  1XMO B;  3UCS C;  4K8Z A;  5CB4 A;  1OJH A;  3LSU A;  1VMG A;  2H8P C;  2BSK A;  4UXN A;  5CB4 B;  4NB5 A;  1K3E A;  3ZS8 C;  1LR1 A;  1XI1 A;  3SJC C;  1GM9 A;  1G4Y B;  2ZIN A;  3B77 A;  2UUC B;  1I5Y A;  2EIL B;  3ZN0 A;  4BWA A;  3O9O A;  4NTW A;  1OCZ C;  1AI4 A;  5KX5 A;  5J2T B;  3RN4 A;  1I94 O;  3IC7 A;  5EZY A;  3E22 B;  2ITC C;  1O9H A;  2EIK B;  1MAB G;  3AK3 A;  2JJ1 G;  4MTG A;  1KUQ A;  4LR3 A;  2EIM C;  4JZG A;  4R6Z A;  1KKD A;  5BMV A;  3DGE A;  1PL4 A;  1PNM A;  3D36 C;  3WB1 A;  3MD0 A;  1H2G A;  2NR5 A;  3N2G A;  2WSS G;  1G6U A;  3N2G B;  3SDL A;  4Z1V A;  2P22 C;  3OUS A;  3S3X A;  2KQX A;  5LMN B;  2P6J A;  5DEC A;  1RFY A;  2EJR A;  3P30 A;  4IGG A;  4LNU A;  4DV3 O;  4DV6 O;  5DN6 G;  5JH7 A;  4DV3 B;  2Q7G A;  3WU2 Z;  2ZE6 A;  4J9Y B;  5B3S B;  3UM7 A;  2WAM A;  1BHB A;  3UT5 B;  1FFX B;  3QNE A;  3E8B A;  3ZMU A;  3L70 H;  4EB6 B;  4JI3 O;  2JGD B;  3CWB H;  3OGI B;  4JGS A;  5IDJ A;  3K04 A;  1W59 A;  5F2V O;  5KHG A;  2YEV B;  4TSF G;  1RSO B;  2LP7 A;  2E3C A;  4ZHQ B;  1OCZ B;  2GTS A;  4PEL A;  2JRI A;  4FFB A;  2KG7 B;  4ZBM A;  3T1C A;  1HNZ B;  2UU9 O;  2OTJ V;  3STL C;  1HNX O;  4LWS A;  1K34 A;  1IBL B;  4HNA A;  2Q69 A;  4X65 B;  3UO3 A;  4K8X A;  3C3S A;  2QEX V;  1HP8 A;  1SER A;  3T1H O;  2QM7 A;  2UUC O;  1ZL8 A;  1JQ0 A;  3ABU A;  1D5N A;  3BEH A;  2R9R B;  2XUM A;  4YJ3 A;  5IWA O;  3WG7 B;  4X1K B;  3K57 A;  5JVD A;  4I5S A;  2RQ6 A;  1VQO V;  2LGW A;  4WFE A;  5TIS Z;  3UKM A;  3CXC U;  1YJ9 V;  5LYJ B;  4N23 A;  4PJ0 Z;  3G67 A;  4ABM A;  3SPG A;  2PGG A;  4PV1 B;  1XMQ B;  4NXM O;  3DTU B;  3B4S A;  4D7S A;  1EZV H;  1NTZ H;  2E5L O;  3FX7 A;  2F4V O;  2Y0P A;  4O4H B;  3ZMZ A;  4JTA B;  2ZR3 A;  3AEI A;  3CPW U;  5LMU B;  4UVC A;  4FLW A;  4I0X B;  3CP1 A;  3D3Q A;  2FL4 A;  4LFA B;  2JS3 A;  1TA8 A;  1SQQ H;  4P30 A;  3ASN C;  3H1H H;  2JEX A;  4HNA B;  3TXQ A;  2IU0 A;  3VQW A;  2W0X A;  4OXS A;  4B3T O;  5KAF Z;  4X9Q A;  2UXB B;  4MW8 A;  4O2A A;  4YY3 B;  4TQF A;  2QM8 A;  4UCO A;  1BL8 A;  1N36 O;  4IHJ A;  4U3J A;  3ML0 A;  1G8M A;  1L1F A;  1HR0 B;  3JD4 A;  1AI6 A;  5GTH Z;  3ZED A;  3OR6 C;  4F6E A;  2X6C A;  2ARH A;  3BAA A; 
#chains in the Genus database with same CATH homology
 1EFR G;  2B1G A;  3R65 A;  1VQ6 V;  1ZWI C;  2ZDI A;  3W7W A;  1GTO A;  3OMI B;  2WLL B;  1EZJ A;  3CME V;  4UV9 A;  4WFH A;  3OM3 B;  3JD3 A;  1H8H G;  4LP8 A;  2XOK G;  2HJF C;  5L3G A;  2GSM B;  1VQL V;  2DQ0 A;  5B3S C;  5KUK A;  4CBC A;  4JTC B;  1QVG U;  1NH2 B;  3K3W A;  2XAF A;  1ENV A;  3CYO A;  4WFA V;  4R7C A;  3SYC A;  3AG3 C;  2ZQM A;  1Y66 A;  1THZ A;  2DYR C;  5IYC O;  1V55 C;  2DW4 A;  2XAS A;  3QO8 A;  4EKW A;  5FL7 G;  5DM6 V;  1M57 B;  1FS0 G;  1QLN A;  1K5Q A;  2JDI G;  3RVY A;  4ASU G;  3TET A;  4QIW F;  3F5W C;  3GWO A;  2W6J G;  3ASO C;  1QVF U;  1YIT V;  4KUM A;  4KFM A;  1W2B U;  3CCU V;  1Q81 W;  1KC8 W;  2EBO A;  1K5S A;  3E8H A;  3GB7 C;  4JF3 A;  2ZDI C;  1K33 A;  3X2Q C;  3ABM C;  4MT8 A;  1S3J A;  1S5H C;  2IH1 C;  3VBB A;  4PDL A;  1W0J G;  2Q67 A;  3ABL B;  1Q86 W;  1F4N A;  3F7V C;  2EIN B;  2QA4 V;  4GX2 A;  3SYQ A;  1QCE A;  1MOF A;  2IJI A;  2DYR B;  3OMA B;  4XDJ A;  2XAG A;  3OR7 C;  1S0V A;  1YTF B;  3OGC C;  3AG2 C;  1KEC A;  5H6R A;  3CCM V;  4MTX A;  2QTO A;  4P9P A;  3ZJZ A;  3ZMT A;  1KQS U;  1J95 A;  1VQK V;  3AG1 C;  4N21 A;  1OCC C;  4WFF A;  2DWE C;  2WLK A;  3E35 A;  1HWY A;  3ABK C;  2IJH A;  4Q20 A;  3CCV V;  1CPY A;  2X0L A;  2OCC C;  4X88 A;  2C2A A;  3ASN B;  4FJC C;  4UVA A;  3EFF K;  4QNH B;  1GM8 A;  3SPI A;  4GX0 A;  2WLJ A;  3LSQ A;  3LUT B;  2H94 A;  2Y69 B;  1BMF G;  2K1E A;  4MVZ A;  4JYC A;  2XND G;  1K4D C;  3ASO B;  2OT5 A;  1PNK A;  3OAA G;  4GCZ A;  1NH2 D;  2HG5 C;  5C93 A;  4JAV A;  1FXH A;  2DYS C;  3ZRW B;  4BW5 A;  1FXK A;  2P7T C;  2WPD G;  4MTF A;  4PA7 A;  3LSS A;  4FK5 C;  1AJP A;  1NR1 A;  3OFN G;  2NLJ C;  4F4L A;  1NR7 A;  5IYB O;  3FB7 C;  1WPX A;  1KP2 A;  2P90 A;  2F43 G;  3ZMV A;  1YIJ V;  5EBM C;  2YEV A;  5CA3 A;  5EC1 C;  4RAI A;  3W7U A;  3CC4 V;  4MVQ A;  1Y4M A;  4BIU A;  3AG2 B;  1PD3 A;  1VQ7 V;  2PI4 A;  3I56 V;  3VOU A;  5CBG A;  4JTD B;  1SZT A;  2Y69 C;  5KA5 A;  1AI7 A;  1GM7 A;  4RQE A;  1OCC B;  1R73 A;  3SPC A;  1DLB A;  4MVR A;  5B1B B;  3ABT A;  3E83 A;  1R3I C;  2Z3Y A;  1K97 A;  2OCC B;  4BAY A;  4R50 A;  1M1K W;  4PA4 A;  1Q7Y W;  1R3L C;  2XAH A;  1H8E G;  1QBZ A;  1M9N A;  4PDM A;  4QJF B;  4RUF A;  3E86 A;  1VQP V;  3AG1 B;  5CN0 A;  3ZIA G;  3K9A A;  1OHH G;  3B8N A;  3FB5 C;  4UVB A;  2OTL V;  4UUJ C;  4WF9 V;  2X7R B;  2FTK A;  1CP9 A;  4P2Z A;  1E1Q G;  4QE9 A;  3T4Z A;  3ETG A;  3OEE G;  1VQ4 V;  4JAU A;  1COW G;  4MVS A;  4FPP A;  2EZO A;  2WLI A;  4KP4 A;  2DWD C;  4MW3 A;  1S77 D;  3K0D A;  2ATK C;  2WLI B;  1YSC A;  1AJN A;  3ZRX A;  4UV8 A;  3X2Q B;  3CC7 V;  3T4D A;  1OCR C;  2BOB C;  3K03 A;  3SPJ A;  2Y48 A;  3STZ C;  5L3C A;  2P67 A;  3K08 A;  1B6Q A;  3QO5 A;  4G28 B;  1OZ0 A;  1PL0 A;  2EIN C;  4X8A A;  3ZRW A;  1RM1 B;  2MK3 A;  3E2E A;  3PJS K;  3FB8 C;  3D3I A;  2M7W A;  1JPX A;  2A79 B;  1K7D A;  3OW2 U;  1AI5 A;  4MTO A;  2V1D A;  2QKS A;  4CZZ A;  5L3F A;  1H38 A;  3RVZ A;  1E1R G;  1K4C C;  4JYB A;  2R9I A;  1M57 C;  4DXW A;  1YJN V;  4JPR A;  3CMA V;  3H01 A;  3B8M A;  2JJ2 G;  1GK9 A;  4R8C A;  1S72 V;  1NVP B;  2IU3 A;  4XDK A;  2QE7 G;  5B1A B;  2DYS B;  2ITD C;  3JYC A;  4YXW G;  1AJQ A;  2XAJ A;  1K8A W;  1M56 B;  3JD0 A;  5KA6 A;  3WG7 C;  1KD1 W;  3W7S A;  1MG1 A;  3FB6 C;  5LGU A;  4Z1M G;  5CBH A;  5B1N A;  5EBL C;  5GW7 A;  3IFX A;  5L3B A;  2EIM B;  5H9C A;  3FKS G;  4PA3 A;  1PKX A;  4U7O A;  1V54 C;  2CK3 G;  2H8P C;  2WLN A;  4UXN A;  1K3E A;  4BIZ A;  4MVO A;  5CMU A;  5LHI A;  4E2L A;  3MHS C;  3F7Y C;  1MSW D;  1GM9 A;  1G4Y B;  3B77 A;  1PNL A;  3K79 A;  1I5Y A;  2EIL B;  2JEU A;  3ZN0 A;  1DF4 A;  2ZXW C;  3SYO A;  3ABK B;  1OCZ C;  1AI4 A;  1NJI W;  3G6E V;  3IC7 A;  3OEH G;  1QLE B;  4MVU A;  2X6A A;  4MVM A;  2BOC C;  2ITC C;  4RQF A;  2EIK B;  1MAB G;  5LGT A;  3ETD A;  2JJ1 G;  4MTG A;  4HZ3 A;  2EIM C;  3CCE V;  4R6Z A;  1KKD A;  3DGE A;  2EIJ B;  1PNM A;  2A0L A;  1R6K A;  4FMT A;  5B1A C;  3ZN1 A;  5CBF A;  3SJQ C;  2W0F C;  1M56 C;  3CCL V;  3MD0 A;  2NNU A;  1H2G A;  4FIP C;  2UXX A;  2WSS G;  3RBZ A;  4DO2 A;  1NKD A;  1JCH A;  4HYO A;  3CCJ V;  1YI2 V;  4XDL A;  3OUS A;  3QO7 A;  4TT3 G;  1KP3 A;  2HKO A;  1RM1 C;  1VQ5 V;  1FXV A;  2UXN A;  1S76 D;  2A9H A;  2P6J A;  4WFG A;  2XAQ A;  3ZRS A;  4X89 A;  2JK5 C;  3KG2 A;  1AR1 B;  2EJR A;  4RO2 A;  1ORQ C;  3P30 A;  3SPH A;  5DN6 G;  2Q6A A;  4GX1 A;  5B3S B;  4J9Y B;  2IJJ A;  3UM7 A;  3HB3 B;  1VQ9 V;  2EZP A;  4LBE C;  4WCE V;  1QR8 A;  2WAM A;  1BHB A;  1OCR B;  1F23 A;  2HLD G;  1JJ2 U;  1M90 W;  3BY6 A;  5H6Q A;  3LDD A;  3QNE A;  3E8B A;  1QR9 A;  1OCO C;  1ARO P;  3ZMU A;  1BHA A;  4U7N A;  5IYD O;  1K9M W;  1W0K G;  2EIK C;  1FFT B;  1GO3 F;  1Q82 W;  3CC2 V;  3ABL C;  4JGS A;  5IDJ A;  4QPJ A;  3K04 A;  2YEV B;  2EIL C;  4TSF G;  3CCR V;  5J9P C;  4JAS A;  3OE7 G;  2LP7 A;  5E1A C;  3SYP A;  3NXS A;  1OCZ B;  4PEL A;  3W7T A;  2X6B A;  5KUM A;  4ZBM A;  1P7B A;  2Z5U A;  1R6N A;  3T1C A;  3M99 B;  4GT1 A;  4LCU C;  2OTJ V;  3STL C;  4PDV A;  4H33 A;  4PA6 A;  1K34 A;  1R3K C;  2WLL A;  5LHH A;  3AG4 B;  2AHZ A;  2Q69 A;  2HR3 A;  4ZKI A;  3MHH C;  1I5X A;  1E79 G;  1OCO B;  2QEX V;  2D3O W;  4XBF A;  1VQ8 V;  3AG3 B;  1SER A;  5EC2 C;  1SET A;  2HVJ C;  1FXK B;  2QM7 A;  3E89 A;  2KB1 A;  2WWW A;  1K92 A;  3G71 V;  1JQ0 A;  3ABU A;  1TUE B;  3BEH A;  2R9R B;  3LNM B;  3RW0 A;  5B1O A;  4LC1 A;  3ABM B;  5LBQ A;  1N8R W;  3WG7 B;  2IJK A;  1VQN V;  3A0R A;  4I5S A;  1XL4 A;  3HPL C;  1VQO V;  5BZB A;  1LNQ A;  2HFE C;  3ETE A;  3IGA C;  4WFE A;  3EHB B;  5LHG A;  3UKM A;  1JOY A;  3CXC U;  3LDC A;  1YJ9 V;  4N23 A;  1JVM A;  4I9W A;  1SRY A;  2AHY A;  2IW5 A;  4QPK A;  5L3E A;  1CEZ A;  3SPG A;  3OUF A;  3DTU B;  5HFL A;  1F51 A;  4MSW C;  3T2M A;  3JD2 A;  4HAM A;  2JIZ G;  4J9Z B;  5EBW C;  3CCQ V;  3FYI B;  1R3J C;  2YSU B;  4G2K A;  1UJW B;  4QE7 A;  2GHY A;  3ZMS A;  2EIJ C;  5HFM A;  3ZMZ A;  4JTA B;  2ZXW B;  2ZR3 A;  1K73 W;  3AEI A;  3ZRV A;  3CPW U;  3ZCC A;  3CD6 V;  3K06 A;  1QLE C;  1VQM V;  4UVC A;  1JX9 A;  3WFV A;  4H37 A;  2ZD9 A;  5IY5 B;  4PA9 A;  3CP1 A;  4PDR A;  4G27 B;  1GMG A;  1SES A;  4MS2 A;  1NQT A;  4RUE A;  4GX5 A;  1P4R A;  1FXK C;  2LFR A;  4P30 A;  3JD1 A;  1WLE A;  1XL6 A;  3ASN C;  1F4M A;  3CCS V;  3LDE A;  5LGN A;  2JEX A;  1V54 B;  2IU0 A;  4WFB V;  4OXS A;  3G4S V;  2DQ3 A;  2LFS A;  3JCZ A;  4TWK A;  5L3D A;  3TK1 A;  4MW8 A;  5EK0 A;  2HVK C;  3D36 A;  2Q68 A;  2QM8 A;  3OMN B;  3SYA A;  3E8F A;  1EBO A;  3P32 A;  3FYE B;  1BL8 A;  3I55 V;  2PI5 A;  1NVP D;  1IXM A;  1YTF D;  1DF5 A;  3ML0 A;  2W6I G;  1G8M A;  1YHQ V;  5IY5 C;  2V7Q G;  1DTO A;  4L87 A;  2B5U A;  1RPO A;  2WLH A;  5B1B C;  1V55 B;  1L1F A;  3JD4 A;  1AI6 A;  2B1I A;  3AG4 C;  2WLM A;  1ROP A;  3OR6 C;  1NBM G;  1GKF A;  2IH3 C;  2X6C A;  4P9O A;  1YJW V;  2ZR2 A;  3K0G A;  3W7X A;  3E8G A;  3TCU A;  1RPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...