4FJCC

Structure of the saga ubp8/sgf11(1-72, delta-znf)/sus1/sgf73 dub module
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
43
structure length
43
Chain Sequence
EETITIDSISNGILNNLLTTLIQDIVARETTQQQLLKTRYPDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 8
publication title A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 17
structure length 43
sequence length 43
chains with identical sequence G
ec nomenclature
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08209 Sgf11 Sgf11 (transcriptional regulation protein)
C PF18519 Sgf11_N SAGA-associated factor 11 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4fjcC00
1Y66A 1QBZA 1QCEA 1I5XA 3H01A 2X7RB 1JPXA 5KA6A 3B77A 3B8MA 1ENVA 2P6JA 3MHHC 1MG1A 1MOFA 3M99B 1DLBA 3P30A 4FJCC 4N21A 2OT5A 1I5YA 5CN0A 4JGSA 2M7WA 5CMUA 1Y4MA 4JF3A 5KA5A 1EBOA 1K33A 1K34A 1JQ0A 2LP7A 3MHSC 1DF5A 1QR8A 5HFMA 1DF4A 3K9AA 1SZTA 3B8NA 2MK3A 4FIPC 4G2KA 4N23A 4FK5C 3CP1A 4JPRA 4E2LA 5H9CA 2EZOA 5HFLA 3CYOA 3GWOA 3WFVA 2EBOA 1QR9A 2EZPA 1F23A
chains in the Genus database with same CATH superfamily
1HNXB 4IIJA 4NR1A 3H01A 3ZIAG 4OX9O 2QJ1A 4G27B 2FTKA 1NH2B 5IYZB 2ARHA 4RO2A 4LF9B 2ZM6O 2Y48A 2F4VO 1U96A 3ETDA 4I55B 2PI5A 5FL7G 2LP7A 3AG2B 1MMMA 1RP3B 1Q5OA 3AG4B 4LF8O 3ABMB 3ZN0A 3W7SA 4I5SA 4LF4O 3JD2A 1VQ8V 3T1HB 4KL1A 2P7TC 3ZRXA 2LJ2A 1MZFA 1IXMA 1F7YA 4XBFA 4CBCA 3KKYA 3Q4HA 1K34A 5IY5C 1TAEA 2A7WA 4K8XA 2E75B 4UFZA 2WLIB 2YXYA 4DR1O 3QG5A 1Q43A 2C2AA 4EEQA 2ZNJA 3CSXA 1YZBA 1IVSA 1J5EB 3E86A 2JJ1G 2DYSC 4N21A 1FD9A 5KX5B 1L0LH 5LOVB 1R6NA 2Q69A 3ASNB 1G6UA 4RQEA 1DTOA 4DR5B 3LSQA 1P84F 3K9AA 1JJOA 4UCSA 1PNKA 3VQYA 4ZHQA 1M56B 4O4HB 1V55B 3JALB 4K0KB 5C93A 3RWRD 3F5WC 4JYAO 3TGUH 1W0JG 5CA0A 5IYCO 5JH7A 3M99B 2A3QA 2XAHA 2WA3A 2WPDG 2IW5A 3CCSV 2RCVA 2LO1A 2WLHA 1VF6C 5B5EZ 5KLVH 1IBMO 1XEQA 5KHHA 1Q6HA 4H44B 1H2SB 1KYOF 5BMVB 4DR4O 2IM9A 2YUAA 1BE3H 1M90W 4R8CA 4GCZA 4K35A 4FFBA 4UB6Z 2XAGA 4G2KA 5BXZA 3JCZA 4GYCB 3TETA 1I94B 3JD0A 5JWPA 3I5DA 3JD3A 2UXXA 2QWNB 4I55A 4YXWG 2HP8A 1Q8IA 1VQ7V 1XL4A 3RYHA 1XNQO 3D8CA 3G67A 4JI7O 4WBNB 1JR9A 1NQTA 1SQVH 3CX5F 2HJDA 1MNGA 3A8TA 1SERA 3O9OA 1N0JA 1CP9A 3OM3B 1M9NA 5LXTB 4H0LB 4B08A 2E74B 3JYCA 3K03A 4FLTA 2X0LA 4JAVA 2ODMA 3G6BA 3KZIZ 5LMUB 4QE9A 3QVNA 3CJHB 2H8PC 5CBFA 5JCOA 2KG7A 3CRCA 3SPGA 4LR3A 4J9YB 3T4ZA 1FJGB 2WLIA 5KAIZ 3W7UA 2JS5A 1TVKB 1THZA 4B3RO 3ABKC 3M8AA 4D7TA 2Q4PA 3JSLA 1F51A 4X1YB 4WFFA 3U10A 2IH1C 3W7WA 3FB8C 1SZXA 2A79B 2L6LA 2H3OA 2JK5C 1SQQH 3JALA 4JI4B 4IYHA 3RFRA 4DV7B 1PL0A 3E83A 2YSUB 1VQ9V 3WFVA 2HG5C 2UXCB 1VEWA 1BQZA 2ILMA 1KD1W 1WNSA 2QSAA 2P90A 2IU0A 4LFBO 1VP7A 3K06A 3CCMV 4FVMA 4WFEA 3CC7V 5E1AC 2A9HA 3ZMVA 4DV2O 3MD0A 1N36B 5BMVA 3OEHG 3ZMTA 3K58A 4LF5O 2JS3A 1D2DA 2P22C 2ZXWB 3CMEV 3BABA 5IWAO 1SETA 3SGIA 4UXNA 1MA1A 2IJHA 4TWKA 3D36C 4HZ3A 1N33B 4CH6A 1WN7A 1H38A 3QO5A 4JI5B 4LF6B 4O4LA 3E22B 3RW0A 4MVSA 4OGQB 2XT9A 2ADPA 2YIBD 1K4CC 3L74H 2E5LO 3ETGA 2YC0A 4R7CA 3UKMA 2PI4A 5LXTA 2XOKG 4BAYA 3CCJV 5J9PC 1XILA 3HKBB 4LFCO 3G4SV 4QNHB 2R9IA 1OZ0A 4J80A 5K1XA 1HNWB 3QNEA 1OCZB 1U97A 5E79Z 3ZRSA 2Q8VA 5GW7A 3BY6A 1FXHA 4X66B 2X7RB 4O4IB 3M7MX 4JAAA 1M5IA 4IL6Z 4ABMA 1G1XB 3HKEB 1TVKA 3BRCA 3CS5A 4U7NA 3UO3A 5B1NA 4JI3B 1NBMG 3HKDA 3C3SA 5LMNO 1NVPB 1VQOV 4ZKIA 4J42A 1XHXA 1RPOA 1NZ6A 1X59A 4DRXB 2IH3C 2AHYA 5DECA 2O57A 4O4JB 4B3MO 1K92A 5CBGA 5LP6B 3W7TA 3AG1C 3ETEA 5IE9A 4WFGA 2CTQA 4FLZA 1QR8A 3R65A 5KHKA 3UQ8A 1TA8A 3JARA 1BGYH 1QR9A 1VARA 1SQFA 3IGAC 1Y66A 1WA8B 2EIMB 1WP8A 3H1LH 2Q0AA 4JI1B 2Q0OC 2AZ0A 4Z1VA 2OT5A 1Q90D 1UJWB 4JI0B 3A2FA 3CXCU 4J7JA 4DK1A 4RUEA 1D5AA 1VIBA 1M57B 2Q7GA 2EIJC 2KQXA 3A0HZ 1YTFB 3JD1A 4OPHA 1YSCA 1B3QA 3ZRWB 4HNAB 1R3IC 2QWQB 5EZYA 2QTOA 4X9QA 2Y0IA 3MHHC 3CHXA 2F66C 4GKJB 3OTOO 1EN4A 2IJJA 1OCRB 3AEIA 5FNVA 1GKFA 3B8NA 4DV5O 4GT1A 4JTDB 4GX5A 1Q3EA 3EHBB 1MABG 4KHPB 4DR3O 1Q86W 2P67A 2UXDO 3RYCB 2ADQB 3ZX6A 5KMGB 1AILA 3SYQA 3SPHA 3OT7A 1IBLO 3DC6A 4P9OA 1TGOA 4LP8A 1Q82W 4J11A 2LW7A 3HKEA 2F4VB 4YJ3A 2QWOB 1HNZO 3ABLB 2EJRA 2AW9A 2R70A 2EX3A 2ZE5A 4IT5A 1PNMA 1GM7A 4DRXA 3CCLV 1SESA 4LF8B 2CUGA 1PL4A 4O4JA 3EVKA 4LF4B 3K9SA 2W6IG 5LP6A 4PA4A 2DN9A 4MTGA 4GUNA 2QTSA 2Q7EA 4ZI7B 1OCCB 2MW2B 4F6RB 1KC8W 1HDJA 2GDSA 3RT3C 4UVAA 5J2TB 1MG1A 2QR4A 2HEPA 1FXKB 4KUMA 3N2GB 1CXZB 2JEUA 4PDVA 1HWYA 3ZMSA 4EFEA 1OCOC 1QLNA 1J95A 2BOCC 4KP4A 5IJ9A 1X4TA 4TUYB 1ENVA 3FD9A 4J41A 3JD4A 3RYFB 4CC5A 4F4LA 3NR7A 2A06H 2ZDIA 4MW3A 4MVRA 5LHHA 5B1BB 1KUQA 4JI2O 3ZRWA 2UXNA 1SA0B 1T5EA 4DV0O 5KHJA 3FX7A 4EB6B 2OYQA 3ABUA 1EN5A 2VWKA 1KP2A 3CCVV 1S76D 2BCCH 5ITZA 3FB6C 1YJWV 2EILB 1SKVA 3CRRA 2UUAO 1IBMB 2W0XA 1RM1C 1Z2GA 3K0DA 4X62O 4FLWA 2QWPB 1R1BA 2Y0PA 5JVDA 3I56V 2XASA 4NVPA 5L3DA 4B7KA 5KUKA 1Q81W 1I7FA 1JMKC 5B1AC 4O2AB 1JX9A 1XMOO 5LA6B 4JI7B 5JCOC 2DW4A 2CE4A 2UUBB 1QVFU 4UCUA 2CDYA 1K8AW 1M1KW 1MOFA 2EIKC 3A0RA 4WFBV 1I0HA 1TUBB 3ZMZA 4AILC 1O9GA 2Q73A 3H1IH 1Y74B 1M4UA 3O65A 5C8YB 1UPGA 2N04A 1AP6A 3TJTA 1NT2B 3OMIB 3K5LA 3SPCA 4PELA 3AG3B 3HB3B 1PKXA 1S5LZ 1XQ8A 3D3IA 1VQLV 4B3TO 1ZL8A 2Y69B 1PPJH 4GKKB 4NXNB 1XMQO 2K1EA 5EBLC 5EYPB 1NTMH 2JGDB 4TUYA 1P7GA 3LUTB 4MTFA 4PJ0Z 4LFAO 3QO8A 1IXBA 1FFTB 1QLEC 3H1JH 2AHZA 1BSMA 2QGNA 5FPRA 2LFRA 1JCHA 1Q6IA 4X65B 3BEHA 4EB6A 2W6JG 2E3CA 5JJJB 4O2BB 4BW5A 2QM4A 4BW9A 1QVGU 2UUCB 5EK0A 1BL8A 2NNUA 4J7KA 4LFBB 3KCYA 1HR0O 1VQ4V 2CH7B 2AGAA 4C7UA 3ZHSA 4YJ2A 4DV2B 3L70H 2OTJV 2YI9A 1AI6A 3E89A 1YJNV 3WB1A 2V4DA 4P9PA 1L1FA 4LNUA 5IJ0A 4JAUA 4DV4O 4DUYO 3BVOA 3WU2Z 4JZ2A 3P3PA 1R3JC 5IY5B 3SJBC 2YEVA 1TUEB 4FPPA 2K9PA 3FAVB 1G8MA 4QPKA 2E5LB 3HKCB 5JJNB 4DV1O 5IYDO 3OR7C 4HAMA 3QTCA 1K5SA 4I4TB 4BIUA 2HLDG 2P4VA 2DYSB 4X8AA 4LFCB 5IYZA 2YI8A 1KB9F 3ZEDA 4UCTA 4TV8B 1LNQA 2F23A 2WLLB 2Q6AA 1R6TA 3FKSG 3N2KB 1FFXB 1WJZA 2BE3A 3GB7C 4MVMA 1SQPH 2BSKB 4LF7O 4DR6O 4DO2A 2R72A 1OV9A 2D3OW 1GO3F 2ZINA 3UM7A 5LMNB 1H8EG 3H1HH 5EYPA 5CMUA 4NTXA 5D5QA 4B3MB 4LF9O 2D2CB 2XAFA 3TXQA 3C3TA 5DEDA 4J9ZB 2ZE8A 2DJVA 5KX5A 3E8HA 5LOVA 3RYIB 5LGNA 1IX9A 1ZSPA 1DK1A 4JTAB 4OXSA 3I55V 4O4HA 2CTPA 2F93B 4XDKA 4MTOA 2DYRC 4FFKA 4YIPA 2CH7A 1NI8A 2X6BA 2ZQMA 4E2LA 4CS3A 4H33A 4BR6A 4NXMO 5L3CA 4PDRA 1V54C 4FM2A 2QA4V 4TOIA 3L75H 3ZMUA 3DSQA 2PUSA 4PA7A 1ZX3A 1HP8A 2JDIG 1QHTA 1OHHG 2M7WA 3ZN1A 3ZJZA 5B1OA 4JI8B 1J5EO 1F4NA 2ZIOA 2VQFB 2YICA 4DV3B 4IHJB 1H2NA 2E76B 1KKDA 3JAKB 5CA1B 2BTQB 4YY3B 1ZWIC 3OTOB 1Y6XA 4AI8A 1P49A 1RSOB 1ZAUA 1OJHA 2FYUH 5KAFZ 1NTKH 1Y67A 5CB4B 4K0KO 3CCUV 4DV5B 3ASOC 5B3SC 4UVCA 3CEIA 1KQSU 1EBOA 3ABKB 2VQEB 4B3SB 4RQFA 4CZZA 4DR3B 4P2ZA 2Q9LA 4TV8A 3KG2A 3SJCC 5GTHZ 2R9RB 4U3JB 2LGQA 5H6QA 1AP5A 4JI6B 1QBZA 1UFIA 1VF7A 1Y76B 3N2KA 3K3WA 3UT5B 4WBNA 1B6QA 2GV9A 2GTAA 4PDMA 4YHHO 1XNRO 3AG7A 1EM1A 3RVZA 1VQKV 2DE0X 3STLC 1F4MA 2HHHB 3X2QC 1NR7A 1AJPA 2X6AA 1HNZB 4U3FH 2QM8A 1IDSA 3CJHA 5F2VO 1LUWA 3IC7A 4MVZA 3L73H 1QQCA 3OUFA 2Z0AA 3APQA 3E8GA 4QE7A 3L9DA 5CN0A 4U7OA 2ZKOA 2V1DA 4JYCA 4AQYO 3OAAG 2H94A 5BY1A 1KBHA 4X1YA 4IYIA 2XTAA 3L72H 3U11A 2DMXA 3E35A 2ZDIC 3JSNA 1E1QG 2JRIA 3CC4V 2VS0A 1GK9A 4OPAA 3IJ4A 1FAFA 2P06A 4I7ZB 3GVMA 3J81N 3JATB 2F1MA 3CC2V 1QNMA 3G71V 4DR7B 3JCUZ 1JJ2U 1R3LC 4I9WA 3ETQA 4JV5O 1GN3A 3H9VA 2PGGA 3RVYA 4JI2B 4GX0A 4I9QA 4GZRB 1K73W 1FS0G 2XAQA 2KKWA 3JAKA 1S3JA 2PYJA 5CA1A 4I50B 5HFMA 5L3GA 1RSOA 2A0LA 1GN2A 3LDEA 1XHZA 4X88A 5CB4A 2OCCC 1NU1H 1SC5B 2UU9O 1M93A 5EBWC 1WB7A 4DV7O 4FLXA 3CXHF 2QEXV 3T1YO 4DV6B 1GTOA 1GMGA 3UO2A 3PJSK 2UXCO 1YJ9V 1W0KG 2Q7HA 2PZSA 1XUQA 3U0ZA 4WF9V 4JF3A 3E22A 2CAZC 1YI2V 2Y4UA 4K3AA 1Y76A 3OFNG 2YS8A 4CS4A 1Z5WA 3P3NA 2JVDA 2M6YA 2WLKA 4MVOA 3AK2A 4DR2O 4R6ZA 3ZHQA 4IGGA 3AG1B 1N36O 1HW7A 3HKBA 2CGOA 2HR3A 1LR1A 2EINC 3THOA 3IFXA 2QDOA 1XMOB 2OIEA 3CB2A 2ZE6A 3B40A 3QF7A 3RBZA 4OX9B 2HKOA 4I0XB 3WG7C 4O4IA 4TV9B 3K0GA 1EZVH 1JFFB 3CMAV 2ZM6B 1QCEA 4LF6O 1D5NA 5EIBC 2AXTZ 2Y4TA 4Q20A 2B1IA 2P6JA 4X1IB 2YIDA 2UXBO 2LFSA 2EIJB 2CTRA 1VQNV 4FZ0A 4ZBMA 1JQ0A 3HR0A 4TQFA 1JOYA 3T2MA 1NS1A 3JAWB 1AB3A 2YIAA 3ZCCA 1S77D 4PHZA 4EFBA 5AG2A 4B3TB 1HNWO 2JEXA 2DQ0A 1FPOA 1XMQB 4X64O 1K7DA 4IIJB 3J80N 2WAMA 3BA8A 4LFAB 4DR1B 3OUSA 1WA8A 3EXAA 2CTWA 1VQMV 1GM8A 2Q67A 4MTXA 1BZKA 1URFA 1JA8A 5IYBO 4MSWC 4CH5A 2IJKA 4I50A 5BZBA 5H6RA 1N34O 1R73A 2XAJA 2F95B 3OMAB 4D7SA 1Z5VA 4RWUA 4JYAB 4HNAA 2MK3A 1Q7YW 3N27A 2ZE7A 2ZD9A 5A9GA 5L3FA 2BTOA 3OGCC 5LL6Y 1WLEA 1N4CA 4CC6A 1WPBA 4X1KB 4UCRA 3CRQA 2OIGA 3OTFA 2B1GA 4UCOA 4YIOA 3H1KH 1SQGA 5L3EA 3OW2U 4DUYB 4LC1A 1P4RA 4DR4B 4RAIA 2QKCA 4J7ZA 3RYCA 3F7VC 3AG2C 1JPXA 5KMGA 5EIBD 3T4DA 3AG4C 3MAQA 3CCQV 3ABMC 4I0XA 1YF2A 5GTIZ 1GN4A 5CA0B 1JFFA 5JH7B 1OCOB 2G38A 1NTZH 5LGUA 4CH4A 1XNQB 3CPWU 3VQWA 3JASB 2IU3A 1A32A 3D3QA 4J10A 4JASA 5GONB 2DOSA 1NJIW 2QWRB 2FB5A 2FKXA 4LF7B 3J7AU 3QO7A 3JAWA 1MSDA 1VF5B 4BWAA 4ZI7A 3ICXA 2GTSA 3IC9A 4F6RA 1KKCA 1BHBA 1FXVA 3CCRV 1GH6A 2P5OA 3ASNC 5J2TA 1SQBH 1KP3A 2EZPA 1FXKA 1M56C 1V55C 2ZR2A 3AK1A 4PI2A 5H2FZ 4HYOA 3AK3A 1XOUA 2PTMA 4DUZO 1RM1B 4QGPA 3VBBA 3N2GA 3FB7C 5LHIA 4X20B 4B3RB 2ATKC 3EFFK 1GM9A 5JQGB 5LYJB 3RYHB 3SDLA 2WSSG 1BT8A 1AR4A 3RYFA 2XHBA 1V9PA 1P7BA 3OEEG 3ZHUA 5FLXN 1EFRG 2YDEA 1YDXA 1SA0A 1ZTEA 2AZ2A 2GHYA 4W4LA 5B1AB 2N05A 1FYJA 1K33A 4NXMB 1LUVA 1NH2D 1NKDA 2KG7B 3C90A 3E2EA 5L3BA 1VQ5V 1XBLA 2DWEC 4Q6GA 4X1KA 4TSFG 3SYCA 2EIKB 2WWWA 4ZIBA 1RFYA 2CGNA 1H2KA 1AJQA 4LF5B 4JTCB 1IURA 4KFMA 5DM6V 3GWKC 4QJFB 1SRYA 5IWAB 4R50A 1XDCA 3SJQC 3SYOA 4FM0A 2ZR3A 4FMTA 4PV1B 3K79A 4DYLA 1H2MA 1I08A 3LSSA 4GX2A 2F43G 3K04A 4O2AA 1N0NA 2RQ6A 2OCHA 3CRAA 5LA6A 3W7XA 1N32O 4DXWA 2W0FC 3JASA 4YHHB 4TT3G 1XNRB 1BCCH 1QLEB 1SS3A 5GONA 1TUBA 1XL6A 3CRMA 1Y74A 4TQDA 4X89A 5C8YA 2NLJC 2WLJA 1XREA 1COWG 1ROPA 2FL4A 1IBKO 4FLYA 1AVMA 1DF5A 2Q68A 2PY5A 3K59A 4JPRA 1H2GA 5BR8O 5CA3A 1F23A 1H8HG 4X20A 3DTUB 1YVWA 4O4LB 1WPXA 4AQYB 3S3XA 5JQGA 5LYJA 1K4DC 5LBQA 3SPJA 3A0BZ 3ZBHA 1BQ0A 1HNXO 3IAYA 2JGDA 2UUBO 3K5NA 1MZEA 3K08A 4KXRA 3BHPA 3S3WA 4L8JA 4PD4F 4ICGA 5HFLA 4AHCA 3SPIA 4MT8A 4JZGA 2GUZB 4XDJA 4O2BA 1KU9A 5D5PA 5CBHA 2RNBA 3P30A 2ZXWC 4PA3A 1MSWD 3SYPA 4JV5B 3DC5A 3T1HO 2FMLA 4UB8Z 1W2BU 2EJ7A 1PD3A 2DQ3A 2N74A 3VQVA 3HKDB 3BPZA 3B4SA 4GKKO 4NXNO 4BIZA 2ZNIA 5KA6A 4FLVA 4NB5A 2OTLV 1Q6UA 2UU9B 1ZLZA 3T1YB 5KUMA 5KHGA 5LGTA 1K3EA 4X65O 3OR6C 1JVMA 5A2QN 4PA9A 2PYLA 3G6EV 4BIOA 3DGEA 4WFHA 3G80A 1AR5A 4DR5O 2UUCO 3RN4A 1OCZC 3JARB 3PN1A 4WFAV 1AR1B 2LGWA 2HFEC 3FAVA 4MVQA 4W4KA 3HKCA 2RMKB 4DR2B 4LWSB 4I4TA 3T1CA 1SZTA 4L87A 2YXHA 2UXDB 2WLLA 1R3KC 1W59A 3WB2A 1US6A 4XDLA 1IBLB 3BAAA 1FFXA 2HJFC 2HVKC 2DYRB 4JYYA 4WCEV 3STZC 5EZYB 1CEZA 2NN4A 2BSKA 1R6KA 5LP6C 4ASUG 2QE7G 4NYKA 1V54B 4CH3A 1S0VA 2XUMA 1E79G 3ZHTA 5FNVB 2UXBB 3E8BA 1BHAA 4PA6A 3BFRA 1AJNA 3LSUA 4DK0A 4Z2WA 1I94O 1VF6A 1S5HC 2EIMC 3K57A 1YITV 3CD6V 4F6EA 1NR1A 3CE2A 3TCUA 2GUZA 4NTWA 3ZRVA 3RYIA 5K1PA 2EBOA 4X64B 1YCIA 2WLNA 1M57C 5EBMC 3ASOB 5B3SB 4A5UB 1L0NH 4DW1A 2ETNA 4YJ3B 1ZUQA 5LMUO 2R9AA 1S72V 1DF4A 2ZIMA 1OCRC 2RN9A 2KSDA 1N8RW 2EZOA 3MDSA 1N34B 1FJGO 1L8DA 2JJ2G 3X2QB 2XNDG 4DW0A 2YIBA 4DV0B 2QKSA 4JGSA 4IHJA 4LCUC 4B7EA 1PNLA 5KA5A 2Z5UA 2BTQA 4FLUA 4LH6A 4UV9A 5H9CA 2LW1A 4JI4O 2UUAB 4GLXA 1NVPD 4H13B 4LWSA 1FKAO 4G28B 5IJ9B 3ABTA 2L35A 4X62B 3VOUA 3ABLC 4U3JA 2V7QG 2LQTA 3CCEV 3UT5A 2BOBC 3ZS8C 2WLMA 2Q5ZA 4JI8O 3LDDA 3FYIB 4ZOLB 5J2UB 1G4YB 5IT9N 2VQFO 5EC1C 1H2LA 3FB5C 4DV3O 4JYBA 3B77A 2PF4E 3BCCH 1DLBA 4YY3O 1OCCC 1PM9A 1Y4MA 2HVJC 5ITZB 3DXRB 3OD4A 1FXKC 2Z3YA 3F5TA 2KB1A 4N23A 1PV0A 1ORQC 1EZJA 1AI7A 3K5OA 3OMNB 1N33O 4B3SO 2JGUA 2VQEO 3TXSA 4JI5O 4D6TH 1BS3A 2ZCEA 4LH7A 1YTFD 2B5UA 3TK1A 3FFQA 4JI6O 3RGBA 5JVDB 3CWBH 2OCCB 4MS2A 5B66Z 3NXSA 2P4KA 3D36A 3CP1A 5B1BC 1QU7A 4PI0A 1VQPV 3CYOA 4DUZB 2HHHO 2QM7A 1KMIZ 1GAXA 2YXLA 2IBZH 3BA9A 4NTYA 5DN6G 3JATA 1PP9H 3F7YC 3HPLC 4FJCC 4GX1A 2VWJA 1WP7A 2GBOA 4EKWA 4X66O 1KECA 2EILC 4CS2A 1WB8A 3OGIB 1SQXH 4QIWF 2EULA 1K97A 3UCSC 4JI3O 2EINB 3B8MA 1XI1A 4H37A 2RJZA 5FPOA 4E4EA 4P30A 3VQXA 3WG7B 1HR0B 4FM1A 1CPYA 3SJAC 3MHSC 1IZ3A 2DWDC 4FIPC 2RDCA 3LNMB 3WB0A 1ZL8B 1VQ6V 1AROP 4HBNA 5TISZ 1EN6A 3LNNA 3Q4HB 4K8ZA 4DR7O 5LHGA 1I5XA 2X6CA 3FYEB 5IDJA 5H5NA 4QPJA 1DGSA 1GRJA 3JAMN 1AI5A 4ZOLA 3SR2C 5J2UA 1B06A 4LBEC 2QKAA 4DV4B 4JI1O 4FZ1A 3R66A 3LDCA 4UUJC 3ZHVA 4JI0O 2WA4A 1O9HA 2JIZG 4ZHQB 2NR5A 3DXRA 1YXBA 1S5JA 1N32B 1I5YA 4MVUA 4DV1B 3AG3C 4DV6O 1B04A 3K5MA 1SF9A 4YJ2B 2B9ZA 2CK3G 3B2EE 4RUFA 4TV9A 5KHIA 5EC2C 4UV8A 5JJEB 4GKJO 4FK5C 2OWOA 2ITCC 3B09A 2VRZA 4PDLA 2Y69C 1WAZA 4X1IA 1YEWA 4UVBA 4LNUB 3ZHRA 1IBKB 1GN6A 4Z1MG 4UCVA 5IJ0B 1BMFG 1E1RG 3OE7G 1YIJV 4MW8A 2GSMB 4KHPO 1AI4A 1YHQV 3E8FA 5BR8B 2IJIA 1VMGA 4DR6B 3P32A 4NKGB 1RPRA 2ZT9B 1K5QA 2ITDC 3ML0A 3SYAA 3L71H 2YEVB 3KCXA 3GWOA 1K9MW 4FFBB 3APOA
chains in the Genus database with same CATH topology
1H8HG 3IC7A 3DTUB 4MVZA 3H01A 3ZIAG 1WPXA 3ABLB 3OUFA 3E8GA 2EJRA 1K4DC 4G27B 2FTKA 4QE7A 5LBQA 1NH2B 4RO2A 5CN0A 3SPJA 4U7OA 2Y48A 3ETDA 1PNMA 1GM7A 2V1DA 3CCLV 5FL7G 2PI5A 1SESA 3K08A 2LP7A 3OAAG 4JYCA 2H94A 3AG2B 2W6IG 5HFLA 4PA4A 3SPIA 4MTGA 4MT8A 3AG4B 3E35A 2ZDIC 1OCCB 3ABMB 4XDJA 3ZN0A 1E1QG 3W7SA 4I5SA 1KC8W 3CC4V 1GK9A 3JD2A 1VQ8V 4UVAA 5CBHA 2P7TC 1MG1A 3ZRXA 1FXKB 3P30A 2ZXWC 4PA3A 1MSWD 1IXMA 4XBFA 4CBCA 3SYPA 4KUMA 3CC2V 1K34A 5IY5C 3G71V 1W2BU 1JJ2U 1R3LC 4I9WA 2JEUA 1PD3A 2DQ3A 4PDVA 1HWYA 3ZMSA 2WLIB 1OCOC 2C2AA 1QLNA 1J95A 2BOCC 4KP4A 4BIZA 3RVYA 5KA6A 1ENVA 3E86A 3JD4A 2JJ1G 4GX0A 2DYSC 4F4LA 2OTLV 4N21A 1K73W 1FS0G 2ZDIA 4MW3A 2XAQA 4MVRA 5LHHA 1S3JA 5B1BB 1R6NA 2Q69A 3ASNB 4RQEA 1DTOA 3ZRWA 2UXNA 5KUMA 5HFMA 3LSQA 1K3EA 3K9AA 5LGTA 5L3GA 1PNKA 3OR6C 2A0LA 3LDEA 1JVMA 1M56B 4PA9A 3ABUA 4X88A 1V55B 2OCCC 3G6EV 5EBWC 5C93A 1KP2A 3DGEA 4WFHA 3CCVV 3F5WC 2QEXV 1GTOA 1OCZC 1GMGA 1S76D 1W0JG 4WFAV 3FB6C 5IYCO 1YJWV 1AR1B 3PJSK 2EILB 3M99B 2HFEC 2XAHA 1YJ9V 1W0KG 4MVQA 2WPDG 4WF9V 4JF3A 2IW5A 1RM1C 1YI2V 3T1CA 1SZTA 3CCSV 3OFNG 4L87A 3K0DA 2WLKA 2WLHA 4MVOA 2WLLA 1R3KC 4R6ZA 3AG1B 4XDLA 2HR3A 3I56V 2HJFC 2HVKC 2DYRB 2XASA 2EINC 4WCEV 3STZC 1M90W 4R8CA 1CEZA 3IFXA 4GCZA 5L3DA 1R6KA 5KUKA 1Q81W 4ASUG 2QE7G 2XAGA 1V54B 4G2KA 5B1AC 3JCZA 3RBZA 2HKOA 3WG7C 3TETA 1JX9A 1S0VA 1E79G 3K0GA 3CMAV 3JD0A 3E8BA 2DW4A 1QCEA 1BHAA 3JD3A 4PA6A 2UXXA 1AJNA 1QVFU 4YXWG 4Q20A 1K8AW 2B1IA 2P6JA 1VQ7V 1MOFA 1M1KW 2EIKC 1XL4A 3A0RA 1S5HC 4WFBV 1NQTA 3ZMZA 2EIMC 2LFSA 2EIJB 1YITV 3CD6V 1VQNV 1SERA 4ZBMA 1JQ0A 1CP9A 3OM3B 1NR1A 1M9NA 3TCUA 1JOYA 3T2MA 3ZRVA 3JYCA 3K03A 2EBOA 3ZCCA 1S77D 3OMIB 2X0LA 4JAVA 2WLNA 1M57C 5EBMC 3ASOB 5B3SB 3SPCA 4PELA 3AG3B 3HB3B 2JEXA 1PKXA 4QE9A 2DQ0A 2H8PC 1K7DA 3D3IA 5CBFA 1VQLV 3SPGA 4J9YB 2WAMA 3T4ZA 2WLIA 3OUSA 2Y69B 3W7UA 1S72V 1DF4A 2K1EA 5EBLC 1OCRC 1THZA 1N8RW 3LUTB 2EZOA 3ABKC 1VQMV 1GM8A 4MTFA 3QO8A 2Q67A 4MTXA 1F51A 1FFTB 1QLEC 4WFFA 5IYBO 4MSWC 2AHZA 2IH1C 2IJKA 2JJ2G 3FB8C 3W7WA 3X2QB 2LFRA 5BZBA 1JCHA 2XNDG 5H6RA 2A79B 2QKSA 1R73A 3BEHA 2JK5C 2W6JG 2XAJA 4JGSA 1PNLA 4LCUC 3OMAB 5KA5A 2Z5UA 4BW5A 1QVGU 5EK0A 1BL8A 1PL0A 2MK3A 2NNUA 1Q7YW 4UV9A 3E83A 2YSUB 5H9CA 1VQ9V 3WFVA 2HG5C 1VQ4V 2ZD9A 1KD1W 5L3FA 3OGCC 1NVPD 1WLEA 2P90A 2IU0A 2OTJV 4G28B 1AI6A 3K06A 3CCMV 2B1GA 3ABTA 3E89A 4WFEA 3CC7V 5E1AC 3VOUA 2A9HA 3ABLC 1YJNV 5L3EA 2V7QG 3ZMVA 3OW2U 4LC1A 3MD0A 1P4RA 4P9PA 3CCEV 3OEHG 2BOBC 1L1FA 3ZMTA 2WLMA 4RAIA 3LDDA 3FYIB 1G4YB 3F7VC 4JAUA 5EC1C 3FB5C 2ZXWB 4JYBA 3AG2C 1JPXA 3CMEV 3B77A 1R3JC 1SETA 3T4DA 3AG4C 4UXNA 5IY5B 2IJHA 1DLBA 4TWKA 1OCCC 3CCQV 3ABMC 4HZ3A 1Y4MA 2YEVA 2HVJC 1TUEB 4FPPA 1OCOB 1FXKC 2Z3YA 1H38A 3QO5A 2KB1A 4N23A 1G8MA 4QPKA 1ORQC 1EZJA 1AI7A 5IYDO 3OR7C 4HAMA 3OMNB 5LGUA 1K5SA 3RW0A 4MVSA 4BIUA 2HLDG 4X8AA 2DYSB 3CPWU 1K4CC 1LNQA 2IU3A 3ETGA 2WLLB 4JASA 4R7CA 3UKMA 1YTFD 2B5UA 2PI4A 2Q6AA 1NJIW 3TK1A 2XOKG 3FKSG 4BAYA 5J9PC 3CCJV 3QO7A 3G4SV 2OCCB 2R9IA 4MS2A 4QNHB 1OZ0A 3GB7C 3NXSA 4MVMA 3D36A 1BHBA 3CP1A 3QNEA 5B1BC 1FXVA 1OCZB 3ZRSA 1VQPV 3CYOA 3CCRV 3ASNC 5GW7A 1KP3A 3BY6A 2EZPA 4DO2A 1FXHA 1FXKA 2QM7A 1M56C 2X7RB 1GO3F 2D3OW 5DN6G 3UM7A 1V55C 2ZR2A 3F7YC 4HYOA 1H8EG 3HPLC 1RM1B 4FJCC 4GX1A 3VBBA 3FB7C 5LHIA 5CMUA 4EKWA 2ATKC 4U7NA 3EFFK 5B1NA 1GM9A 1KECA 1NBMG 2EILC 1NVPB 1VQOV 2WSSG 2XAFA 4ZKIA 1RPOA 4QIWF 1K97A 2IH3C 2AHYA 2EINB 1P7BA 3OEEG 4J9ZB 1EFRG 3E8HA 3B8MA 1K92A 5LGNA 5CBGA 4H37A 3W7TA 2GHYA 3AG1C 3ETEA 4JTAB 4OXSA 5B1AB 3I55V 4P30A 3WG7B 4WFGA 1CPYA 1K33A 4XDKA 4MTOA 2DYRC 3MHSC 1QR8A 2DWDC 2X6BA 2ZQMA 3R65A 1NH2D 1NKDA 4FIPC 3E2EA 3LNMB 5L3BA 4E2LA 1VQ5V 1VQ6V 2DWEC 1AROP 4H33A 4TSFG 1QR9A 3SYCA 2EIKB 3IGAC 4PDRA 5L3CA 1Y66A 2WWWA 1V54C 5LHGA 2QA4V 3ZMUA 1I5XA 2X6CA 2EIMB 3FYEB 5IDJA 4PA7A 4QPJA 2OT5A 1UJWB 2JDIG 2M7WA 1OHHG 3ZN1A 3ZJZA 5B1OA 1AJQA 3CXCU 1AI5A 1F4NA 4JTCB 4KFMA 4LBEC 5DM6V 4RUEA 1M57B 4QJFB 1SRYA 2EIJC 1KKDA 3LDCA 1YTFB 4R50A 4UUJC 3JD1A 1YSCA 3SJQC 3SYOA 1ZWIC 3ZRWB 1R3IC 2ZR3A 2JIZG 4FMTA 2QTOA 3K79A 3MHHC 3CCUV 3ASOC 5B3SC 1I5YA 4MVUA 4UVCA 4GX2A 3LSSA 3AG3C 1KQSU 2F43G 2IJJA 3K04A 1OCRB 3AEIA 1EBOA 2CK3G 3ABKB 4RUFA 3W7XA 4RQFA 4CZZA 5EC2C 4UV8A 1GKFA 4P2ZA 3B8NA 4DXWA 2W0FC 3KG2A 4FK5C 4GT1A 2ITCC 4TT3G 2R9RB 4JTDB 1QLEB 4PDLA 2Y69C 4GX5A 5H6QA 3EHBB 1MABG 1QBZA 4UVBA 1XL6A 3K3WA 1B6QA 4Z1MG 1Q86W 4PDMA 2P67A 1BMFG 1E1RG 4X89A 3OE7G 1YIJV 4MW8A 2GSMB 2NLJC 2WLJA 3RVZA 1VQKV 3STLC 1COWG 1AI4A 1F4MA 1ROPA 3E8FA 2IJIA 3SPHA 3SYQA 1YHQV 3X2QC 1NR7A 3P32A 1DF5A 1RPRA 2Q68A 1AJPA 1K5QA 2X6AA 2ITDC 4P9OA 3ML0A 4LP8A 3SYAA 1Q82W 4JPRA 2YEVB 1H2GA 2QM8A 3GWOA 1K9MW 5CA3A 1F23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y66 A;  1QBZ A;  1QCE A;  1I5X A;  3H01 A;  2X7R B;  1JPX A;  5KA6 A;  3B77 A;  3B8M A;  1ENV A;  2P6J A;  3MHH C;  1MG1 A;  1MOF A;  3M99 B;  1DLB A;  3P30 A;  4FJC C;  4N21 A;  2OT5 A;  1I5Y A;  5CN0 A;  4JGS A;  2M7W A;  5CMU A;  1Y4M A;  4JF3 A;  5KA5 A;  1EBO A;  1K33 A;  1K34 A;  1JQ0 A;  2LP7 A;  3MHS C;  1DF5 A;  1QR8 A;  5HFM A;  1DF4 A;  3K9A A;  1SZT A;  3B8N A;  2MK3 A;  4FIP C;  4G2K A;  4N23 A;  4FK5 C;  3CP1 A;  4JPR A;  4E2L A;  5H9C A;  2EZO A;  5HFL A;  3CYO A;  3GWO A;  3WFV A;  2EBO A;  1QR9 A;  2EZP A;  1F23 A; 
#chains in the Genus database with same CATH topology
 1HNX B;  4IIJ A;  4NR1 A;  3H01 A;  3ZIA G;  4OX9 O;  2QJ1 A;  4G27 B;  2FTK A;  1NH2 B;  5IYZ B;  2ARH A;  4RO2 A;  4LF9 B;  2ZM6 O;  2Y48 A;  2F4V O;  1U96 A;  3ETD A;  4I55 B;  2PI5 A;  5FL7 G;  2LP7 A;  3AG2 B;  1MMM A;  1RP3 B;  1Q5O A;  3AG4 B;  4LF8 O;  3ABM B;  3ZN0 A;  3W7S A;  4I5S A;  4LF4 O;  3JD2 A;  1VQ8 V;  3T1H B;  4KL1 A;  2P7T C;  3ZRX A;  2LJ2 A;  1MZF A;  1IXM A;  1F7Y A;  4XBF A;  4CBC A;  3KKY A;  3Q4H A;  1K34 A;  5IY5 C;  1TAE A;  2A7W A;  4K8X A;  2E75 B;  4UFZ A;  2WLI B;  2YXY A;  4DR1 O;  3QG5 A;  1Q43 A;  2C2A A;  4EEQ A;  2ZNJ A;  3CSX A;  1YZB A;  1IVS A;  1J5E B;  3E86 A;  2JJ1 G;  2DYS C;  4N21 A;  1FD9 A;  5KX5 B;  1L0L H;  5LOV B;  1R6N A;  2Q69 A;  3ASN B;  1G6U A;  4RQE A;  1DTO A;  4DR5 B;  3LSQ A;  1P84 F;  3K9A A;  1JJO A;  4UCS A;  1PNK A;  3VQY A;  4ZHQ A;  1M56 B;  4O4H B;  1V55 B;  3JAL B;  4K0K B;  5C93 A;  3RWR D;  3F5W C;  4JYA O;  3TGU H;  1W0J G;  5CA0 A;  5IYC O;  5JH7 A;  3M99 B;  2A3Q A;  2XAH A;  2WA3 A;  2WPD G;  2IW5 A;  3CCS V;  2RCV A;  2LO1 A;  2WLH A;  1VF6 C;  5B5E Z;  5KLV H;  1IBM O;  1XEQ A;  5KHH A;  1Q6H A;  4H44 B;  1H2S B;  1KYO F;  5BMV B;  4DR4 O;  2IM9 A;  2YUA A;  1BE3 H;  1M90 W;  4R8C A;  4GCZ A;  4K35 A;  4FFB A;  4UB6 Z;  2XAG A;  4G2K A;  5BXZ A;  3JCZ A;  4GYC B;  3TET A;  1I94 B;  3JD0 A;  5JWP A;  3I5D A;  3JD3 A;  2UXX A;  2QWN B;  4I55 A;  4YXW G;  2HP8 A;  1Q8I A;  1VQ7 V;  1XL4 A;  3RYH A;  1XNQ O;  3D8C A;  3G67 A;  4JI7 O;  4WBN B;  1JR9 A;  1NQT A;  1SQV H;  3CX5 F;  2HJD A;  1MNG A;  3A8T A;  1SER A;  3O9O A;  1N0J A;  1CP9 A;  3OM3 B;  1M9N A;  5LXT B;  4H0L B;  4B08 A;  2E74 B;  3JYC A;  3K03 A;  4FLT A;  2X0L A;  4JAV A;  2ODM A;  3G6B A;  3KZI Z;  5LMU B;  4QE9 A;  3QVN A;  3CJH B;  2H8P C;  5CBF A;  5JCO A;  2KG7 A;  3CRC A;  3SPG A;  4LR3 A;  4J9Y B;  3T4Z A;  1FJG B;  2WLI A;  5KAI Z;  3W7U A;  2JS5 A;  1TVK B;  1THZ A;  4B3R O;  3ABK C;  3M8A A;  4D7T A;  2Q4P A;  3JSL A;  1F51 A;  4X1Y B;  4WFF A;  3U10 A;  2IH1 C;  3W7W A;  3FB8 C;  1SZX A;  2A79 B;  2L6L A;  2H3O A;  2JK5 C;  1SQQ H;  3JAL A;  4JI4 B;  4IYH A;  3RFR A;  4DV7 B;  1PL0 A;  3E83 A;  2YSU B;  1VQ9 V;  3WFV A;  2HG5 C;  2UXC B;  1VEW A;  1BQZ A;  2ILM A;  1KD1 W;  1WNS A;  2QSA A;  2P90 A;  2IU0 A;  4LFB O;  1VP7 A;  3K06 A;  3CCM V;  4FVM A;  4WFE A;  3CC7 V;  5E1A C;  2A9H A;  3ZMV A;  4DV2 O;  3MD0 A;  1N36 B;  5BMV A;  3OEH G;  3ZMT A;  3K58 A;  4LF5 O;  2JS3 A;  1D2D A;  2P22 C;  2ZXW B;  3CME V;  3BAB A;  5IWA O;  1SET A;  3SGI A;  4UXN A;  1MA1 A;  2IJH A;  4TWK A;  3D36 C;  4HZ3 A;  1N33 B;  4CH6 A;  1WN7 A;  1H38 A;  3QO5 A;  4JI5 B;  4LF6 B;  4O4L A;  3E22 B;  3RW0 A;  4MVS A;  4OGQ B;  2XT9 A;  2ADP A;  2YIB D;  1K4C C;  3L74 H;  2E5L O;  3ETG A;  2YC0 A;  4R7C A;  3UKM A;  2PI4 A;  5LXT A;  2XOK G;  4BAY A;  3CCJ V;  5J9P C;  1XIL A;  3HKB B;  4LFC O;  3G4S V;  4QNH B;  2R9I A;  1OZ0 A;  4J80 A;  5K1X A;  1HNW B;  3QNE A;  1OCZ B;  1U97 A;  5E79 Z;  3ZRS A;  2Q8V A;  5GW7 A;  3BY6 A;  1FXH A;  4X66 B;  2X7R B;  4O4I B;  3M7M X;  4JAA A;  1M5I A;  4IL6 Z;  4ABM A;  1G1X B;  3HKE B;  1TVK A;  3BRC A;  3CS5 A;  4U7N A;  3UO3 A;  5B1N A;  4JI3 B;  1NBM G;  3HKD A;  3C3S A;  5LMN O;  1NVP B;  1VQO V;  4ZKI A;  4J42 A;  1XHX A;  1RPO A;  1NZ6 A;  1X59 A;  4DRX B;  2IH3 C;  2AHY A;  5DEC A;  2O57 A;  4O4J B;  4B3M O;  1K92 A;  5CBG A;  5LP6 B;  3W7T A;  3AG1 C;  3ETE A;  5IE9 A;  4WFG A;  2CTQ A;  4FLZ A;  1QR8 A;  3R65 A;  5KHK A;  3UQ8 A;  1TA8 A;  3JAR A;  1BGY H;  1QR9 A;  1VAR A;  1SQF A;  3IGA C;  1Y66 A;  1WA8 B;  2EIM B;  1WP8 A;  3H1L H;  2Q0A A;  4JI1 B;  2Q0O C;  2AZ0 A;  4Z1V A;  2OT5 A;  1Q90 D;  1UJW B;  4JI0 B;  3A2F A;  3CXC U;  4J7J A;  4DK1 A;  4RUE A;  1D5A A;  1VIB A;  1M57 B;  2Q7G A;  2EIJ C;  2KQX A;  3A0H Z;  1YTF B;  3JD1 A;  4OPH A;  1YSC A;  1B3Q A;  3ZRW B;  4HNA B;  1R3I C;  2QWQ B;  5EZY A;  2QTO A;  4X9Q A;  2Y0I A;  3MHH C;  3CHX A;  2F66 C;  4GKJ B;  3OTO O;  1EN4 A;  2IJJ A;  1OCR B;  3AEI A;  5FNV A;  1GKF A;  3B8N A;  4DV5 O;  4GT1 A;  4JTD B;  4GX5 A;  1Q3E A;  3EHB B;  1MAB G;  4KHP B;  4DR3 O;  1Q86 W;  2P67 A;  2UXD O;  3RYC B;  2ADQ B;  3ZX6 A;  5KMG B;  1AIL A;  3SYQ A;  3SPH A;  3OT7 A;  1IBL O;  3DC6 A;  4P9O A;  1TGO A;  4LP8 A;  1Q82 W;  4J11 A;  2LW7 A;  3HKE A;  2F4V B;  4YJ3 A;  2QWO B;  1HNZ O;  3ABL B;  2EJR A;  2AW9 A;  2R70 A;  2EX3 A;  2ZE5 A;  4IT5 A;  1PNM A;  1GM7 A;  4DRX A;  3CCL V;  1SES A;  4LF8 B;  2CUG A;  1PL4 A;  4O4J A;  3EVK A;  4LF4 B;  3K9S A;  2W6I G;  5LP6 A;  4PA4 A;  2DN9 A;  4MTG A;  4GUN A;  2QTS A;  2Q7E A;  4ZI7 B;  1OCC B;  2MW2 B;  4F6R B;  1KC8 W;  1HDJ A;  2GDS A;  3RT3 C;  4UVA A;  5J2T B;  1MG1 A;  2QR4 A;  2HEP A;  1FXK B;  4KUM A;  3N2G B;  1CXZ B;  2JEU A;  4PDV A;  1HWY A;  3ZMS A;  4EFE A;  1OCO C;  1QLN A;  1J95 A;  2BOC C;  4KP4 A;  5IJ9 A;  1X4T A;  4TUY B;  1ENV A;  3FD9 A;  4J41 A;  3JD4 A;  3RYF B;  4CC5 A;  4F4L A;  3NR7 A;  2A06 H;  2ZDI A;  4MW3 A;  4MVR A;  5LHH A;  5B1B B;  1KUQ A;  4JI2 O;  3ZRW A;  2UXN A;  1SA0 B;  1T5E A;  4DV0 O;  5KHJ A;  3FX7 A;  4EB6 B;  2OYQ A;  3ABU A;  1EN5 A;  2VWK A;  1KP2 A;  3CCV V;  1S76 D;  2BCC H;  5ITZ A;  3FB6 C;  1YJW V;  2EIL B;  1SKV A;  3CRR A;  2UUA O;  1IBM B;  2W0X A;  1RM1 C;  1Z2G A;  3K0D A;  4X62 O;  4FLW A;  2QWP B;  1R1B A;  2Y0P A;  5JVD A;  3I56 V;  2XAS A;  4NVP A;  5L3D A;  4B7K A;  5KUK A;  1Q81 W;  1I7F A;  1JMK C;  5B1A C;  4O2A B;  1JX9 A;  1XMO O;  5LA6 B;  4JI7 B;  5JCO C;  2DW4 A;  2CE4 A;  2UUB B;  1QVF U;  4UCU A;  2CDY A;  1K8A W;  1M1K W;  1MOF A;  2EIK C;  3A0R A;  4WFB V;  1I0H A;  1TUB B;  3ZMZ A;  4AIL C;  1O9G A;  2Q73 A;  3H1I H;  1Y74 B;  1M4U A;  3O65 A;  5C8Y B;  1UPG A;  2N04 A;  1AP6 A;  3TJT A;  1NT2 B;  3OMI B;  3K5L A;  3SPC A;  4PEL A;  3AG3 B;  3HB3 B;  1PKX A;  1S5L Z;  1XQ8 A;  3D3I A;  1VQL V;  4B3T O;  1ZL8 A;  2Y69 B;  1PPJ H;  4GKK B;  4NXN B;  1XMQ O;  2K1E A;  5EBL C;  5EYP B;  1NTM H;  2JGD B;  4TUY A;  1P7G A;  3LUT B;  4MTF A;  4PJ0 Z;  4LFA O;  3QO8 A;  1IXB A;  1FFT B;  1QLE C;  3H1J H;  2AHZ A;  1BSM A;  2QGN A;  5FPR A;  2LFR A;  1JCH A;  1Q6I A;  4X65 B;  3BEH A;  4EB6 A;  2W6J G;  2E3C A;  5JJJ B;  4O2B B;  4BW5 A;  2QM4 A;  4BW9 A;  1QVG U;  2UUC B;  5EK0 A;  1BL8 A;  2NNU A;  4J7K A;  4LFB B;  3KCY A;  1HR0 O;  1VQ4 V;  2CH7 B;  2AGA A;  4C7U A;  3ZHS A;  4YJ2 A;  4DV2 B;  3L70 H;  2OTJ V;  2YI9 A;  1AI6 A;  3E89 A;  1YJN V;  3WB1 A;  2V4D A;  4P9P A;  1L1F A;  4LNU A;  5IJ0 A;  4JAU A;  4DV4 O;  4DUY O;  3BVO A;  3WU2 Z;  4JZ2 A;  3P3P A;  1R3J C;  5IY5 B;  3SJB C;  2YEV A;  1TUE B;  4FPP A;  2K9P A;  3FAV B;  1G8M A;  4QPK A;  2E5L B;  3HKC B;  5JJN B;  4DV1 O;  5IYD O;  3OR7 C;  4HAM A;  3QTC A;  1K5S A;  4I4T B;  4BIU A;  2HLD G;  2P4V A;  2DYS B;  4X8A A;  4LFC B;  5IYZ A;  2YI8 A;  1KB9 F;  3ZED A;  4UCT A;  4TV8 B;  1LNQ A;  2F23 A;  2WLL B;  2Q6A A;  1R6T A;  3FKS G;  3N2K B;  1FFX B;  1WJZ A;  2BE3 A;  3GB7 C;  4MVM A;  1SQP H;  2BSK B;  4LF7 O;  4DR6 O;  4DO2 A;  2R72 A;  1OV9 A;  2D3O W;  1GO3 F;  2ZIN A;  3UM7 A;  5LMN B;  1H8E G;  3H1H H;  5EYP A;  5CMU A;  4NTX A;  5D5Q A;  4B3M B;  4LF9 O;  2D2C B;  2XAF A;  3TXQ A;  3C3T A;  5DED A;  4J9Z B;  2ZE8 A;  2DJV A;  5KX5 A;  3E8H A;  5LOV A;  3RYI B;  5LGN A;  1IX9 A;  1ZSP A;  1DK1 A;  4JTA B;  4OXS A;  3I55 V;  4O4H A;  2CTP A;  2F93 B;  4XDK A;  4MTO A;  2DYR C;  4FFK A;  4YIP A;  2CH7 A;  1NI8 A;  2X6B A;  2ZQM A;  4E2L A;  4CS3 A;  4H33 A;  4BR6 A;  4NXM O;  5L3C A;  4PDR A;  1V54 C;  4FM2 A;  2QA4 V;  4TOI A;  3L75 H;  3ZMU A;  3DSQ A;  2PUS A;  4PA7 A;  1ZX3 A;  1HP8 A;  2JDI G;  1QHT A;  1OHH G;  2M7W A;  3ZN1 A;  3ZJZ A;  5B1O A;  4JI8 B;  1J5E O;  1F4N A;  2ZIO A;  2VQF B;  2YIC A;  4DV3 B;  4IHJ B;  1H2N A;  2E76 B;  1KKD A;  3JAK B;  5CA1 B;  2BTQ B;  4YY3 B;  1ZWI C;  3OTO B;  1Y6X A;  4AI8 A;  1P49 A;  1RSO B;  1ZAU A;  1OJH A;  2FYU H;  5KAF Z;  1NTK H;  1Y67 A;  5CB4 B;  4K0K O;  3CCU V;  4DV5 B;  3ASO C;  5B3S C;  4UVC A;  3CEI A;  1KQS U;  1EBO A;  3ABK B;  2VQE B;  4B3S B;  4RQF A;  4CZZ A;  4DR3 B;  4P2Z A;  2Q9L A;  4TV8 A;  3KG2 A;  3SJC C;  5GTH Z;  2R9R B;  4U3J B;  2LGQ A;  5H6Q A;  1AP5 A;  4JI6 B;  1QBZ A;  1UFI A;  1VF7 A;  1Y76 B;  3N2K A;  3K3W A;  3UT5 B;  4WBN A;  1B6Q A;  2GV9 A;  2GTA A;  4PDM A;  4YHH O;  1XNR O;  3AG7 A;  1EM1 A;  3RVZ A;  1VQK V;  2DE0 X;  3STL C;  1F4M A;  2HHH B;  3X2Q C;  1NR7 A;  1AJP A;  2X6A A;  1HNZ B;  4U3F H;  2QM8 A;  1IDS A;  3CJH A;  5F2V O;  1LUW A;  3IC7 A;  4MVZ A;  3L73 H;  1QQC A;  3OUF A;  2Z0A A;  3APQ A;  3E8G A;  4QE7 A;  3L9D A;  5CN0 A;  4U7O A;  2ZKO A;  2V1D A;  4JYC A;  4AQY O;  3OAA G;  2H94 A;  5BY1 A;  1KBH A;  4X1Y A;  4IYI A;  2XTA A;  3L72 H;  3U11 A;  2DMX A;  3E35 A;  2ZDI C;  3JSN A;  1E1Q G;  2JRI A;  3CC4 V;  2VS0 A;  1GK9 A;  4OPA A;  3IJ4 A;  1FAF A;  2P06 A;  4I7Z B;  3GVM A;  3J81 N;  3JAT B;  2F1M A;  3CC2 V;  1QNM A;  3G71 V;  4DR7 B;  3JCU Z;  1JJ2 U;  1R3L C;  4I9W A;  3ETQ A;  4JV5 O;  1GN3 A;  3H9V A;  2PGG A;  3RVY A;  4JI2 B;  4GX0 A;  4I9Q A;  4GZR B;  1K73 W;  1FS0 G;  2XAQ A;  2KKW A;  3JAK A;  1S3J A;  2PYJ A;  5CA1 A;  4I50 B;  5HFM A;  5L3G A;  1RSO A;  2A0L A;  1GN2 A;  3LDE A;  1XHZ A;  4X88 A;  5CB4 A;  2OCC C;  1NU1 H;  1SC5 B;  2UU9 O;  1M93 A;  5EBW C;  1WB7 A;  4DV7 O;  4FLX A;  3CXH F;  2QEX V;  3T1Y O;  4DV6 B;  1GTO A;  1GMG A;  3UO2 A;  3PJS K;  2UXC O;  1YJ9 V;  1W0K G;  2Q7H A;  2PZS A;  1XUQ A;  3U0Z A;  4WF9 V;  4JF3 A;  3E22 A;  2CAZ C;  1YI2 V;  2Y4U A;  4K3A A;  1Y76 A;  3OFN G;  2YS8 A;  4CS4 A;  1Z5W A;  3P3N A;  2JVD A;  2M6Y A;  2WLK A;  4MVO A;  3AK2 A;  4DR2 O;  4R6Z A;  3ZHQ A;  4IGG A;  3AG1 B;  1N36 O;  1HW7 A;  3HKB A;  2CGO A;  2HR3 A;  1LR1 A;  2EIN C;  3THO A;  3IFX A;  2QDO A;  1XMO B;  2OIE A;  3CB2 A;  2ZE6 A;  3B40 A;  3QF7 A;  3RBZ A;  4OX9 B;  2HKO A;  4I0X B;  3WG7 C;  4O4I A;  4TV9 B;  3K0G A;  1EZV H;  1JFF B;  3CMA V;  2ZM6 B;  1QCE A;  4LF6 O;  1D5N A;  5EIB C;  2AXT Z;  2Y4T A;  4Q20 A;  2B1I A;  2P6J A;  4X1I B;  2YID A;  2UXB O;  2LFS A;  2EIJ B;  2CTR A;  1VQN V;  4FZ0 A;  4ZBM A;  1JQ0 A;  3HR0 A;  4TQF A;  1JOY A;  3T2M A;  1NS1 A;  3JAW B;  1AB3 A;  2YIA A;  3ZCC A;  1S77 D;  4PHZ A;  4EFB A;  5AG2 A;  4B3T B;  1HNW O;  2JEX A;  2DQ0 A;  1FPO A;  1XMQ B;  4X64 O;  1K7D A;  4IIJ B;  3J80 N;  2WAM A;  3BA8 A;  4LFA B;  4DR1 B;  3OUS A;  1WA8 A;  3EXA A;  2CTW A;  1VQM V;  1GM8 A;  2Q67 A;  4MTX A;  1BZK A;  1URF A;  1JA8 A;  5IYB O;  4MSW C;  4CH5 A;  2IJK A;  4I50 A;  5BZB A;  5H6R A;  1N34 O;  1R73 A;  2XAJ A;  2F95 B;  3OMA B;  4D7S A;  1Z5V A;  4RWU A;  4JYA B;  4HNA A;  2MK3 A;  1Q7Y W;  3N27 A;  2ZE7 A;  2ZD9 A;  5A9G A;  5L3F A;  2BTO A;  3OGC C;  5LL6 Y;  1WLE A;  1N4C A;  4CC6 A;  1WPB A;  4X1K B;  4UCR A;  3CRQ A;  2OIG A;  3OTF A;  2B1G A;  4UCO A;  4YIO A;  3H1K H;  1SQG A;  5L3E A;  3OW2 U;  4DUY B;  4LC1 A;  1P4R A;  4DR4 B;  4RAI A;  2QKC A;  4J7Z A;  3RYC A;  3F7V C;  3AG2 C;  1JPX A;  5KMG A;  5EIB D;  3T4D A;  3AG4 C;  3MAQ A;  3CCQ V;  3ABM C;  4I0X A;  1YF2 A;  5GTI Z;  1GN4 A;  5CA0 B;  1JFF A;  5JH7 B;  1OCO B;  2G38 A;  1NTZ H;  5LGU A;  4CH4 A;  1XNQ B;  3CPW U;  3VQW A;  3JAS B;  2IU3 A;  1A32 A;  3D3Q A;  4J10 A;  4JAS A;  5GON B;  2DOS A;  1NJI W;  2QWR B;  2FB5 A;  2FKX A;  4LF7 B;  3J7A U;  3QO7 A;  3JAW A;  1MSD A;  1VF5 B;  4BWA A;  4ZI7 A;  3ICX A;  2GTS A;  3IC9 A;  4F6R A;  1KKC A;  1BHB A;  1FXV A;  3CCR V;  1GH6 A;  2P5O A;  3ASN C;  5J2T A;  1SQB H;  1KP3 A;  2EZP A;  1FXK A;  1M56 C;  1V55 C;  2ZR2 A;  3AK1 A;  4PI2 A;  5H2F Z;  4HYO A;  3AK3 A;  1XOU A;  2PTM A;  4DUZ O;  1RM1 B;  4QGP A;  3VBB A;  3N2G A;  3FB7 C;  5LHI A;  4X20 B;  4B3R B;  2ATK C;  3EFF K;  1GM9 A;  5JQG B;  5LYJ B;  3RYH B;  3SDL A;  2WSS G;  1BT8 A;  1AR4 A;  3RYF A;  2XHB A;  1V9P A;  1P7B A;  3OEE G;  3ZHU A;  5FLX N;  1EFR G;  2YDE A;  1YDX A;  1SA0 A;  1ZTE A;  2AZ2 A;  2GHY A;  4W4L A;  5B1A B;  2N05 A;  1FYJ A;  1K33 A;  4NXM B;  1LUV A;  1NH2 D;  1NKD A;  2KG7 B;  3C90 A;  3E2E A;  5L3B A;  1VQ5 V;  1XBL A;  2DWE C;  4Q6G A;  4X1K A;  4TSF G;  3SYC A;  2EIK B;  2WWW A;  4ZIB A;  1RFY A;  2CGN A;  1H2K A;  1AJQ A;  4LF5 B;  4JTC B;  1IUR A;  4KFM A;  5DM6 V;  3GWK C;  4QJF B;  1SRY A;  5IWA B;  4R50 A;  1XDC A;  3SJQ C;  3SYO A;  4FM0 A;  2ZR3 A;  4FMT A;  4PV1 B;  3K79 A;  4DYL A;  1H2M A;  1I08 A;  3LSS A;  4GX2 A;  2F43 G;  3K04 A;  4O2A A;  1N0N A;  2RQ6 A;  2OCH A;  3CRA A;  5LA6 A;  3W7X A;  1N32 O;  4DXW A;  2W0F C;  3JAS A;  4YHH B;  4TT3 G;  1XNR B;  1BCC H;  1QLE B;  1SS3 A;  5GON A;  1TUB A;  1XL6 A;  3CRM A;  1Y74 A;  4TQD A;  4X89 A;  5C8Y A;  2NLJ C;  2WLJ A;  1XRE A;  1COW G;  1ROP A;  2FL4 A;  1IBK O;  4FLY A;  1AVM A;  1DF5 A;  2Q68 A;  2PY5 A;  3K59 A;  4JPR A;  1H2G A;  5BR8 O;  5CA3 A;  1F23 A;  1H8H G;  4X20 A;  3DTU B;  1YVW A;  4O4L B;  1WPX A;  4AQY B;  3S3X A;  5JQG A;  5LYJ A;  1K4D C;  5LBQ A;  3SPJ A;  3A0B Z;  3ZBH A;  1BQ0 A;  1HNX O;  3IAY A;  2JGD A;  2UUB O;  3K5N A;  1MZE A;  3K08 A;  4KXR A;  3BHP A;  3S3W A;  4L8J A;  4PD4 F;  4ICG A;  5HFL A;  4AHC A;  3SPI A;  4MT8 A;  4JZG A;  2GUZ B;  4XDJ A;  4O2B A;  1KU9 A;  5D5P A;  5CBH A;  2RNB A;  3P30 A;  2ZXW C;  4PA3 A;  1MSW D;  3SYP A;  4JV5 B;  3DC5 A;  3T1H O;  2FML A;  4UB8 Z;  1W2B U;  2EJ7 A;  1PD3 A;  2DQ3 A;  2N74 A;  3VQV A;  3HKD B;  3BPZ A;  3B4S A;  4GKK O;  4NXN O;  4BIZ A;  2ZNI A;  5KA6 A;  4FLV A;  4NB5 A;  2OTL V;  1Q6U A;  2UU9 B;  1ZLZ A;  3T1Y B;  5KUM A;  5KHG A;  5LGT A;  1K3E A;  4X65 O;  3OR6 C;  1JVM A;  5A2Q N;  4PA9 A;  2PYL A;  3G6E V;  4BIO A;  3DGE A;  4WFH A;  3G80 A;  1AR5 A;  4DR5 O;  2UUC O;  3RN4 A;  1OCZ C;  3JAR B;  3PN1 A;  4WFA V;  1AR1 B;  2LGW A;  2HFE C;  3FAV A;  4MVQ A;  4W4K A;  3HKC A;  2RMK B;  4DR2 B;  4LWS B;  4I4T A;  3T1C A;  1SZT A;  4L87 A;  2YXH A;  2UXD B;  2WLL A;  1R3K C;  1W59 A;  3WB2 A;  1US6 A;  4XDL A;  1IBL B;  3BAA A;  1FFX A;  2HJF C;  2HVK C;  2DYR B;  4JYY A;  4WCE V;  3STZ C;  5EZY B;  1CEZ A;  2NN4 A;  2BSK A;  1R6K A;  5LP6 C;  4ASU G;  2QE7 G;  4NYK A;  1V54 B;  4CH3 A;  1S0V A;  2XUM A;  1E79 G;  3ZHT A;  5FNV B;  2UXB B;  3E8B A;  1BHA A;  4PA6 A;  3BFR A;  1AJN A;  3LSU A;  4DK0 A;  4Z2W A;  1I94 O;  1VF6 A;  1S5H C;  2EIM C;  3K57 A;  1YIT V;  3CD6 V;  4F6E A;  1NR1 A;  3CE2 A;  3TCU A;  2GUZ A;  4NTW A;  3ZRV A;  3RYI A;  5K1P A;  2EBO A;  4X64 B;  1YCI A;  2WLN A;  1M57 C;  5EBM C;  3ASO B;  5B3S B;  4A5U B;  1L0N H;  4DW1 A;  2ETN A;  4YJ3 B;  1ZUQ A;  5LMU O;  2R9A A;  1S72 V;  1DF4 A;  2ZIM A;  1OCR C;  2RN9 A;  2KSD A;  1N8R W;  2EZO A;  3MDS A;  1N34 B;  1FJG O;  1L8D A;  2JJ2 G;  3X2Q B;  2XND G;  4DW0 A;  2YIB A;  4DV0 B;  2QKS A;  4JGS A;  4IHJ A;  4LCU C;  4B7E A;  1PNL A;  5KA5 A;  2Z5U A;  2BTQ A;  4FLU A;  4LH6 A;  4UV9 A;  5H9C A;  2LW1 A;  4JI4 O;  2UUA B;  4GLX A;  1NVP D;  4H13 B;  4LWS A;  1FKA O;  4G28 B;  5IJ9 B;  3ABT A;  2L35 A;  4X62 B;  3VOU A;  3ABL C;  4U3J A;  2V7Q G;  2LQT A;  3CCE V;  3UT5 A;  2BOB C;  3ZS8 C;  2WLM A;  2Q5Z A;  4JI8 O;  3LDD A;  3FYI B;  4ZOL B;  5J2U B;  1G4Y B;  5IT9 N;  2VQF O;  5EC1 C;  1H2L A;  3FB5 C;  4DV3 O;  4JYB A;  3B77 A;  2PF4 E;  3BCC H;  1DLB A;  4YY3 O;  1OCC C;  1PM9 A;  1Y4M A;  2HVJ C;  5ITZ B;  3DXR B;  3OD4 A;  1FXK C;  2Z3Y A;  3F5T A;  2KB1 A;  4N23 A;  1PV0 A;  1ORQ C;  1EZJ A;  1AI7 A;  3K5O A;  3OMN B;  1N33 O;  4B3S O;  2JGU A;  2VQE O;  3TXS A;  4JI5 O;  4D6T H;  1BS3 A;  2ZCE A;  4LH7 A;  1YTF D;  2B5U A;  3TK1 A;  3FFQ A;  4JI6 O;  3RGB A;  5JVD B;  3CWB H;  2OCC B;  4MS2 A;  5B66 Z;  3NXS A;  2P4K A;  3D36 A;  3CP1 A;  5B1B C;  1QU7 A;  4PI0 A;  1VQP V;  3CYO A;  4DUZ B;  2HHH O;  2QM7 A;  1KMI Z;  1GAX A;  2YXL A;  2IBZ H;  3BA9 A;  4NTY A;  5DN6 G;  3JAT A;  1PP9 H;  3F7Y C;  3HPL C;  4FJC C;  4GX1 A;  2VWJ A;  1WP7 A;  2GBO A;  4EKW A;  4X66 O;  1KEC A;  2EIL C;  4CS2 A;  1WB8 A;  3OGI B;  1SQX H;  4QIW F;  2EUL A;  1K97 A;  3UCS C;  4JI3 O;  2EIN B;  3B8M A;  1XI1 A;  4H37 A;  2RJZ A;  5FPO A;  4E4E A;  4P30 A;  3VQX A;  3WG7 B;  1HR0 B;  4FM1 A;  1CPY A;  3SJA C;  3MHS C;  1IZ3 A;  2DWD C;  4FIP C;  2RDC A;  3LNM B;  3WB0 A;  1ZL8 B;  1VQ6 V;  1ARO P;  4HBN A;  5TIS Z;  1EN6 A;  3LNN A;  3Q4H B;  4K8Z A;  4DR7 O;  5LHG A;  1I5X A;  2X6C A;  3FYE B;  5IDJ A;  5H5N A;  4QPJ A;  1DGS A;  1GRJ A;  3JAM N;  1AI5 A;  4ZOL A;  3SR2 C;  5J2U A;  1B06 A;  4LBE C;  2QKA A;  4DV4 B;  4JI1 O;  4FZ1 A;  3R66 A;  3LDC A;  4UUJ C;  3ZHV A;  4JI0 O;  2WA4 A;  1O9H A;  2JIZ G;  4ZHQ B;  2NR5 A;  3DXR A;  1YXB A;  1S5J A;  1N32 B;  1I5Y A;  4MVU A;  4DV1 B;  3AG3 C;  4DV6 O;  1B04 A;  3K5M A;  1SF9 A;  4YJ2 B;  2B9Z A;  2CK3 G;  3B2E E;  4RUF A;  4TV9 A;  5KHI A;  5EC2 C;  4UV8 A;  5JJE B;  4GKJ O;  4FK5 C;  2OWO A;  2ITC C;  3B09 A;  2VRZ A;  4PDL A;  2Y69 C;  1WAZ A;  4X1I A;  1YEW A;  4UVB A;  4LNU B;  3ZHR A;  1IBK B;  1GN6 A;  4Z1M G;  4UCV A;  5IJ0 B;  1BMF G;  1E1R G;  3OE7 G;  1YIJ V;  4MW8 A;  2GSM B;  4KHP O;  1AI4 A;  1YHQ V;  3E8F A;  5BR8 B;  2IJI A;  1VMG A;  4DR6 B;  3P32 A;  4NKG B;  1RPR A;  2ZT9 B;  1K5Q A;  2ITD C;  3ML0 A;  3SYA A;  3L71 H;  2YEV B;  3KCX A;  3GWO A;  1K9M W;  4FFB B;  3APO A; 
#chains in the Genus database with same CATH homology
 1H8H G;  3IC7 A;  3DTU B;  4MVZ A;  3H01 A;  3ZIA G;  1WPX A;  3ABL B;  3OUF A;  3E8G A;  2EJR A;  1K4D C;  4G27 B;  2FTK A;  4QE7 A;  5LBQ A;  1NH2 B;  4RO2 A;  5CN0 A;  3SPJ A;  4U7O A;  2Y48 A;  3ETD A;  1PNM A;  1GM7 A;  2V1D A;  3CCL V;  5FL7 G;  2PI5 A;  1SES A;  3K08 A;  2LP7 A;  3OAA G;  4JYC A;  2H94 A;  3AG2 B;  2W6I G;  5HFL A;  4PA4 A;  3SPI A;  4MTG A;  4MT8 A;  3AG4 B;  3E35 A;  2ZDI C;  1OCC B;  3ABM B;  4XDJ A;  3ZN0 A;  1E1Q G;  3W7S A;  4I5S A;  1KC8 W;  3CC4 V;  1GK9 A;  3JD2 A;  1VQ8 V;  4UVA A;  5CBH A;  2P7T C;  1MG1 A;  3ZRX A;  1FXK B;  3P30 A;  2ZXW C;  4PA3 A;  1MSW D;  1IXM A;  4XBF A;  4CBC A;  3SYP A;  4KUM A;  3CC2 V;  1K34 A;  5IY5 C;  3G71 V;  1W2B U;  1JJ2 U;  1R3L C;  4I9W A;  2JEU A;  1PD3 A;  2DQ3 A;  4PDV A;  1HWY A;  3ZMS A;  2WLI B;  1OCO C;  2C2A A;  1QLN A;  1J95 A;  2BOC C;  4KP4 A;  4BIZ A;  3RVY A;  5KA6 A;  1ENV A;  3E86 A;  3JD4 A;  2JJ1 G;  4GX0 A;  2DYS C;  4F4L A;  2OTL V;  4N21 A;  1K73 W;  1FS0 G;  2ZDI A;  4MW3 A;  2XAQ A;  4MVR A;  5LHH A;  1S3J A;  5B1B B;  1R6N A;  2Q69 A;  3ASN B;  4RQE A;  1DTO A;  3ZRW A;  2UXN A;  5KUM A;  5HFM A;  3LSQ A;  1K3E A;  3K9A A;  5LGT A;  5L3G A;  1PNK A;  3OR6 C;  2A0L A;  3LDE A;  1JVM A;  1M56 B;  4PA9 A;  3ABU A;  4X88 A;  1V55 B;  2OCC C;  3G6E V;  5EBW C;  5C93 A;  1KP2 A;  3DGE A;  4WFH A;  3CCV V;  3F5W C;  2QEX V;  1GTO A;  1OCZ C;  1GMG A;  1S76 D;  1W0J G;  4WFA V;  3FB6 C;  5IYC O;  1YJW V;  1AR1 B;  3PJS K;  2EIL B;  3M99 B;  2HFE C;  2XAH A;  1YJ9 V;  1W0K G;  4MVQ A;  2WPD G;  4WF9 V;  4JF3 A;  2IW5 A;  1RM1 C;  1YI2 V;  3T1C A;  1SZT A;  3CCS V;  3OFN G;  4L87 A;  3K0D A;  2WLK A;  2WLH A;  4MVO A;  2WLL A;  1R3K C;  4R6Z A;  3AG1 B;  4XDL A;  2HR3 A;  3I56 V;  2HJF C;  2HVK C;  2DYR B;  2XAS A;  2EIN C;  4WCE V;  3STZ C;  1M90 W;  4R8C A;  1CEZ A;  3IFX A;  4GCZ A;  5L3D A;  1R6K A;  5KUK A;  1Q81 W;  4ASU G;  2QE7 G;  2XAG A;  1V54 B;  4G2K A;  5B1A C;  3JCZ A;  3RBZ A;  2HKO A;  3WG7 C;  3TET A;  1JX9 A;  1S0V A;  1E79 G;  3K0G A;  3CMA V;  3JD0 A;  3E8B A;  2DW4 A;  1QCE A;  1BHA A;  3JD3 A;  4PA6 A;  2UXX A;  1AJN A;  1QVF U;  4YXW G;  4Q20 A;  1K8A W;  2B1I A;  2P6J A;  1VQ7 V;  1MOF A;  1M1K W;  2EIK C;  1XL4 A;  3A0R A;  1S5H C;  4WFB V;  1NQT A;  3ZMZ A;  2EIM C;  2LFS A;  2EIJ B;  1YIT V;  3CD6 V;  1VQN V;  1SER A;  4ZBM A;  1JQ0 A;  1CP9 A;  3OM3 B;  1NR1 A;  1M9N A;  3TCU A;  1JOY A;  3T2M A;  3ZRV A;  3JYC A;  3K03 A;  2EBO A;  3ZCC A;  1S77 D;  3OMI B;  2X0L A;  4JAV A;  2WLN A;  1M57 C;  5EBM C;  3ASO B;  5B3S B;  3SPC A;  4PEL A;  3AG3 B;  3HB3 B;  2JEX A;  1PKX A;  4QE9 A;  2DQ0 A;  2H8P C;  1K7D A;  3D3I A;  5CBF A;  1VQL V;  3SPG A;  4J9Y B;  2WAM A;  3T4Z A;  2WLI A;  3OUS A;  2Y69 B;  3W7U A;  1S72 V;  1DF4 A;  2K1E A;  5EBL C;  1OCR C;  1THZ A;  1N8R W;  3LUT B;  2EZO A;  3ABK C;  1VQM V;  1GM8 A;  4MTF A;  3QO8 A;  2Q67 A;  4MTX A;  1F51 A;  1FFT B;  1QLE C;  4WFF A;  5IYB O;  4MSW C;  2AHZ A;  2IH1 C;  2IJK A;  2JJ2 G;  3FB8 C;  3W7W A;  3X2Q B;  2LFR A;  5BZB A;  1JCH A;  2XND G;  5H6R A;  2A79 B;  2QKS A;  1R73 A;  3BEH A;  2JK5 C;  2W6J G;  2XAJ A;  4JGS A;  1PNL A;  4LCU C;  3OMA B;  5KA5 A;  2Z5U A;  4BW5 A;  1QVG U;  5EK0 A;  1BL8 A;  1PL0 A;  2MK3 A;  2NNU A;  1Q7Y W;  4UV9 A;  3E83 A;  2YSU B;  5H9C A;  1VQ9 V;  3WFV A;  2HG5 C;  1VQ4 V;  2ZD9 A;  1KD1 W;  5L3F A;  3OGC C;  1NVP D;  1WLE A;  2P90 A;  2IU0 A;  2OTJ V;  4G28 B;  1AI6 A;  3K06 A;  3CCM V;  2B1G A;  3ABT A;  3E89 A;  4WFE A;  3CC7 V;  5E1A C;  3VOU A;  2A9H A;  3ABL C;  1YJN V;  5L3E A;  2V7Q G;  3ZMV A;  3OW2 U;  4LC1 A;  3MD0 A;  1P4R A;  4P9P A;  3CCE V;  3OEH G;  2BOB C;  1L1F A;  3ZMT A;  2WLM A;  4RAI A;  3LDD A;  3FYI B;  1G4Y B;  3F7V C;  4JAU A;  5EC1 C;  3FB5 C;  2ZXW B;  4JYB A;  3AG2 C;  1JPX A;  3CME V;  3B77 A;  1R3J C;  1SET A;  3T4D A;  3AG4 C;  4UXN A;  5IY5 B;  2IJH A;  1DLB A;  4TWK A;  1OCC C;  3CCQ V;  3ABM C;  4HZ3 A;  1Y4M A;  2YEV A;  2HVJ C;  1TUE B;  4FPP A;  1OCO B;  1FXK C;  2Z3Y A;  1H38 A;  3QO5 A;  2KB1 A;  4N23 A;  1G8M A;  4QPK A;  1ORQ C;  1EZJ A;  1AI7 A;  5IYD O;  3OR7 C;  4HAM A;  3OMN B;  5LGU A;  1K5S A;  3RW0 A;  4MVS A;  4BIU A;  2HLD G;  4X8A A;  2DYS B;  3CPW U;  1K4C C;  1LNQ A;  2IU3 A;  3ETG A;  2WLL B;  4JAS A;  4R7C A;  3UKM A;  1YTF D;  2B5U A;  2PI4 A;  2Q6A A;  1NJI W;  3TK1 A;  2XOK G;  3FKS G;  4BAY A;  5J9P C;  3CCJ V;  3QO7 A;  3G4S V;  2OCC B;  2R9I A;  4MS2 A;  4QNH B;  1OZ0 A;  3GB7 C;  3NXS A;  4MVM A;  3D36 A;  1BHB A;  3CP1 A;  3QNE A;  5B1B C;  1FXV A;  1OCZ B;  3ZRS A;  1VQP V;  3CYO A;  3CCR V;  3ASN C;  5GW7 A;  1KP3 A;  3BY6 A;  2EZP A;  4DO2 A;  1FXH A;  1FXK A;  2QM7 A;  1M56 C;  2X7R B;  1GO3 F;  2D3O W;  5DN6 G;  3UM7 A;  1V55 C;  2ZR2 A;  3F7Y C;  4HYO A;  1H8E G;  3HPL C;  1RM1 B;  4FJC C;  4GX1 A;  3VBB A;  3FB7 C;  5LHI A;  5CMU A;  4EKW A;  2ATK C;  4U7N A;  3EFF K;  5B1N A;  1GM9 A;  1KEC A;  1NBM G;  2EIL C;  1NVP B;  1VQO V;  2WSS G;  2XAF A;  4ZKI A;  1RPO A;  4QIW F;  1K97 A;  2IH3 C;  2AHY A;  2EIN B;  1P7B A;  3OEE G;  4J9Z B;  1EFR G;  3E8H A;  3B8M A;  1K92 A;  5LGN A;  5CBG A;  4H37 A;  3W7T A;  2GHY A;  3AG1 C;  3ETE A;  4JTA B;  4OXS A;  5B1A B;  3I55 V;  4P30 A;  3WG7 B;  4WFG A;  1CPY A;  1K33 A;  4XDK A;  4MTO A;  2DYR C;  3MHS C;  1QR8 A;  2DWD C;  2X6B A;  2ZQM A;  3R65 A;  1NH2 D;  1NKD A;  4FIP C;  3E2E A;  3LNM B;  5L3B A;  4E2L A;  1VQ5 V;  1VQ6 V;  2DWE C;  1ARO P;  4H33 A;  4TSF G;  1QR9 A;  3SYC A;  2EIK B;  3IGA C;  4PDR A;  5L3C A;  1Y66 A;  2WWW A;  1V54 C;  5LHG A;  2QA4 V;  3ZMU A;  1I5X A;  2X6C A;  2EIM B;  3FYE B;  5IDJ A;  4PA7 A;  4QPJ A;  2OT5 A;  1UJW B;  2JDI G;  2M7W A;  1OHH G;  3ZN1 A;  3ZJZ A;  5B1O A;  1AJQ A;  3CXC U;  1AI5 A;  1F4N A;  4JTC B;  4KFM A;  4LBE C;  5DM6 V;  4RUE A;  1M57 B;  4QJF B;  1SRY A;  2EIJ C;  1KKD A;  3LDC A;  1YTF B;  4R50 A;  4UUJ C;  3JD1 A;  1YSC A;  3SJQ C;  3SYO A;  1ZWI C;  3ZRW B;  1R3I C;  2ZR3 A;  2JIZ G;  4FMT A;  2QTO A;  3K79 A;  3MHH C;  3CCU V;  3ASO C;  5B3S C;  1I5Y A;  4MVU A;  4UVC A;  4GX2 A;  3LSS A;  3AG3 C;  1KQS U;  2F43 G;  2IJJ A;  3K04 A;  1OCR B;  3AEI A;  1EBO A;  2CK3 G;  3ABK B;  4RUF A;  3W7X A;  4RQF A;  4CZZ A;  5EC2 C;  4UV8 A;  1GKF A;  4P2Z A;  3B8N A;  4DXW A;  2W0F C;  3KG2 A;  4FK5 C;  4GT1 A;  2ITC C;  4TT3 G;  2R9R B;  4JTD B;  1QLE B;  4PDL A;  2Y69 C;  4GX5 A;  5H6Q A;  3EHB B;  1MAB G;  1QBZ A;  4UVB A;  1XL6 A;  3K3W A;  1B6Q A;  4Z1M G;  1Q86 W;  4PDM A;  2P67 A;  1BMF G;  1E1R G;  4X89 A;  3OE7 G;  1YIJ V;  4MW8 A;  2GSM B;  2NLJ C;  2WLJ A;  3RVZ A;  1VQK V;  3STL C;  1COW G;  1AI4 A;  1F4M A;  1ROP A;  3E8F A;  2IJI A;  3SPH A;  3SYQ A;  1YHQ V;  3X2Q C;  1NR7 A;  3P32 A;  1DF5 A;  1RPR A;  2Q68 A;  1AJP A;  1K5Q A;  2X6A A;  2ITD C;  4P9O A;  3ML0 A;  4LP8 A;  3SYA A;  1Q82 W;  4JPR A;  2YEV B;  1H2G A;  2QM8 A;  3GWO A;  1K9M W;  5CA3 A;  1F23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...