1BCCH

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 19
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bccH00
1BGYH 1L0NH 1NTKH 1P84F 1SQBH 3H1LH 3CX5F 1SQPH 3BCCH 2IBZH 3L75H 4PD4F 5KLVH 2A06H 3H1KH 1KB9F 3H1JH 1L0LH 2FYUH 1EZVH 4U3FH 1BE3H 3L73H 1NU1H 1KYOF 3TGUH 1PPJH 1BCCH 1SQXH 3L70H 3CWBH 4D6TH 1NTZH 3H1IH 2BCCH 1SQVH 3L72H 3L71H 3H1HH 1NTMH 1SQQH 3CXHF 3L74H 1PP9H
chains in the Genus database with same CATH superfamily
2LFRA 4RUFA 4UVCA 2B1GA 5CA1B 5BY1A 5L3CA 4D7TA 1QLEC 4O2AA 1G8MA 4MTFA 5J9PC 1N4CA 2WLIB 3ETEA 3HKBA 4O4HA 2XOKG 2P67A 4QJFB 5B1NA 3F7VC 1OCCC 5KHJA 1MG1A 4RQEA 4GYCB 2K9PA 3L72H 1AILA 3R66A 1NVPD 2VRZA 4H0LB 1Y67A 2UXBO 1EN5A 4DR7B 1KU9A 2M6YA 5CN0A 5K1XA 1COWG 3STZC 4PI2A 3FYIB 4B3SB 3ZMSA 1S5LZ 5ITZA 1H2MA 3T1YO 1WPXA 4DV2B 4QE7A 2F93B 1M1KW 5A2QN 3CHXA 4MVOA 3ABKC 3BRCA 4ZIBA 5JWPA 3ZMTA 3MHSC 1IDSA 5IYZA 2ODMA 5LXTB 1QQCA 4DR6O 3CRRA 4DRXB 1HNZB 2WA3A 2QKCA 5BXZA 3WB0A 2JGDA 4TSFG 5LBQA 2Q9LA 1XL4A 3X2QC 4A5UB 1XDCA 1GH6A 4CC6A 3CCQV 2KQXA 3OUSA 4D7SA 3UQ8A 2EJRA 3E8HA 4I55A 4X65O 2NNUA 1M5IA 2IU3A 4RO2A 4GUNA 3BHPA 1YJWV 1XMQO 4O2BA 1US6A 5FPRA 2DYSB 1XNQO 3SYPA 1P84F 4YXWG 1Q3EA 1EN4A 5CBFA 2HVKC 2E75B 3ABUA 4QIWF 3JAWB 3CD6V 1H8HG 2VQEB 4JYAB 1N36O 4HYOA 1S77D 4PI0A 3SPIA 1Q8IA 2QSAA 1ZAUA 3N2KA 1OCOC 3T1YB 3K5NA 1WPBA 4HAMA 1WB8A 2R72A 2PTMA 4ZHQA 4R50A 2BSKA 5CA3A 3BPZA 3AG3C 3B8NA 4DV1B 2XNDG 2Z0AA 1LUVA 1AI7A 2E5LO 2AZ0A 1BHAA 4GX1A 2Q7GA 1E1RG 1YZBA 2OCHA 1JOYA 1XNRB 1VEWA 3AG1C 4Z1VA 1H38A 2D2CB 4DR4O 4PDRA 1XHXA 4EKWA 1R3JC 3ASOB 3BA8A 4J80A 2XAHA 2YC0A 1GTOA 4ZI7B 1FYJA 1BQZA 3IJ4A 2P06A 5EK0A 1QHTA 5K1PA 5J2UA 2JK5C 1WN7A 2PY5A 4O4IB 2IJIA 4FFKA 3K5MA 3VQWA 3SPCA 1XUQA 1P49A 1QLEB 1XMOB 2IU0A 3ZEDA 2G38A 3RVZA 4Z1MG 3CC7V 1BQ0A 1D5AA 3A8TA 4ICGA 1BMFG 2Q7HA 4JYYA 1MZEA 1G4YB 1R6KA 2UXDO 1NU1H 4ASUG 5BR8B 4H37A 1VQ7V 1ZWIC 2DWEC 5DN6G 4O4IA 1GK9A 1MOFA 4FFBA 1GN3A 5IWAO 1SERA 4PDMA 1IBMB 2RJZA 2JS3A 3F5TA 1VMGA 4MW8A 2WLLB 4DR1O 1NI8A 4UCOA 5IYCO 2DYRB 5LGNA 2PGGA 1SETA 5EC2C 5CA0A 4JI5O 2DJVA 4X20A 5EZYB 3RYHB 1CXZB 3JATB 4I4TA 1Q81W 2LQTA 4K0KO 3CXHF 3OT7A 4NXNO 2K1EA 4J7ZA 3QVNA 4TOIA 2ETNA 1ROPA 1N32O 1SQPH 4LH6A 2YIDA 1EFRG 4L87A 4X1KA 4CS2A 5B3SC 2N05A 4BIOA 1ORQC 2MK3A 4QPJA 4DUYO 5EC1C 4YJ2A 3AG2B 4YY3B 4DV4O 3CCEV 1J95A 1WAZA 5FNVB 5EYPA 4DV0O 4MVUA 2X6AA 1HW7A 5B66Z 4X64B 1TVKB 4DV1O 3WB1A 4X65B 3WU2Z 4B3SO 1ZUQA 3K5LA 3J81N 4DUYB 3P3PA 3B8MA 4MVZA 1QBZA 3CCJV 3W7WA 3JD0A 1SQVH 4FLZA 4BWAA 3OR6C 3VQXA 4DV3B 3MDSA 4ZI7A 4WF9V 4I50A 1YSCA 5H9CA 3E83A 1Q90D 4DV5B 1JVMA 1EBOA 3TXQA 1OCOB 2EIJB 1R6TA 3CB2A 4JV5B 1BHBA 3ABTA 1P4RA 4JI0B 1KMIZ 5KA6A 3SPGA 2ITCC 4QPKA 1FFXA 4DUZO 1GM9A 4UCVA 2XAJA 3A0HZ 2YI8A 2ZE6A 5LOVA 5LYJA 4DR2O 2V1DA 4WFEA 1B04A 3T1CA 1SESA 1CEZA 1AP5A 3SPJA 2PYLA 4K8ZA 3AG1B 1KBHA 2QWOB 2UUAO 5BR8O 2KG7B 3GVMA 1I08A 3UCSC 2QM8A 2Q68A 1PL4A 4YY3O 3G67A 4H44B 3CRMA 1LR1A 1IBKB 4DV0B 2YICA 2Q5ZA 1GM7A 1HDJA 1WJZA 2UXBB 2A3QA 5EIBD 1SQXH 5TISZ 4PA6A 4CS3A 2ZNJA 4YJ3B 1G6UA 2JRIA 3LSUA 2FL4A 2YDEA 4IL6Z 1AI4A 1YEWA 4GZRB 5IY5B 2EZPA 3S3XA 3JALA 4LFBO 1QVGU 3B40A 4GX5A 5GONB 1LUWA 2N74A 2XTAA 2P7TC 3OFNG 3JASA 1WB7A 2CK3G 2OIGA 3F5WC 4HZ3A 3FB8C 3CMAV 3ZMUA 3KZIZ 4CS4A 3MAQA 5JVDB 4WFFA 5B1AC 2C2AA 4LF4O 3SR2C 4X62B 3K3WA 5L3BA 3ABKB 4KL1A 4FLVA 4P2ZA 3OR7C 4JYAO 4X8AA 1IBLB 2QDOA 1RM1B 2ZE7A 4LWSA 2OT5A 3HB3B 1F51A 4MVQA 2LGQA 5ITZB 2WLNA 4LF9O 2XASA 3CRCA 3DGEA 1PPJH 3J7AU 4BW9A 3CWBH 2HP8A 1ZSPA 2VWKA 2XAGA 4K35A 2EINC 4QGPA 3APOA 2UU9O 4MTXA 1U97A 1W0JG 2RCVA 2FB5A 2FTKA 2BOBC 4GKKO 1VP7A 1QCEA 1TUEB 2IJKA 5B5EZ 3AG2C 4JTCB 1S3JA 3HKDA 2DYSC 1R1BA 3ASNC 1SZXA 3QO7A 5J2TB 3L74H 3DC6A 4LC1A 3P30A 5LGUA 1QR9A 3ZRWA 3I5DA 4IGGA 1I94O 4JI2B 1D2DA 4DR2B 4MSWC 2QA4V 1XEQA 4J41A 1JJ2U 4MS2A 5D5QA 5LMUO 4FLXA 5C93A 1I5XA 4CH6A 1V54C 2B1IA 4BIZA 2KKWA 2D3OW 3CYOA 2HVJC 2QGNA 3KCXA 1BGYH 4WFHA 4F6RA 4EB6B 1HWYA 2M7WA 1V55C 4L8JA 2W0XA 3RN4A 3E35A 4JV5O 3CE2A 4NXMB 4EEQA 4LBEC 3SJQC 1VF6A 3IFXA 1H8EG 2L6LA 1XNQB 1NTMH 4G28B 2GUZA 4H13B 4GKJB 3LNNA 3H1KH 2Z5UA 3ETGA 3NR7A 4JI3O 1JFFA 3CCVV 1K9MW 1NZ6A 3BABA 3K03A 4DR5B 5KHKA 1VF5B 5LYJB 4J9ZB 1E79G 1W0KG 4DK0A 4PELA 1JFFB 3BAAA 5KUKA 4YHHO 1I94B 1NJIW 3LDDA 1M93A 1IXBA 4JI7O 4I5SA 2IJHA 1GN2A 3U11A 3JAMN 3ZJZA 2OWOA 2EIKB 3L73H 4MTOA 5EIBC 3VOUA 3TGUH 4GCZA 2JGUA 3FB6C 2Q69A 4UVBA 4TV9A 1KUQA 3CSXA 3LNMB 3L71H 1SQQH 5IY5C 4DV4B 3BFRA 3CCLV 1AR4A 2X0LA 4AILC 5JCOA 5JQGB 4JI5B 4UUJC 2PI5A 2Q67A 4B3RB 4U7OA 2Y69C 1K7DA 3SJCC 3M7MX 3O9OA 4HBNA 1D5NA 5B1AB 1RP3B 2P4KA 5IYDO 1XNRO 3OMIB 5IJ0B 3ZRWB 1RM1C 3QNEA 2YXHA 4LF7O 3K58A 1HP8A 3HR0A 2P6JA 2ITDC 1DF4A 3UKMA 4LF6B 3H1JH 5H2FZ 2WWWA 2P22C 2B5UA 4GT1A 5IYBO 4KXRA 1QNMA 3FB5C 1KKDA 2EBOA 3KCYA 3B77A 3CS5A 3D36A 4JTAB 4FK5C 4JI1O 3ZS8C 4OXSA 1UJWB 4I9WA 5CA0B 4X66O 1DK1A 3K5OA 2RNBA 3E8FA 4B08A 2QWPB 2YEVA 5KX5A 2BTOA 4O4LB 2O57A 2QR4A 5BZBA 4PA3A 3DC5A 1FAFA 2EJ7A 4F4LA 1SF9A 3N2KB 4PDVA 3FB7C 2YXLA 3L75H 1M57C 2YXYA 4X66B 2UUCB 2EIJC 4CBCA 4G2KA 2NN4A 4LFBB 3FKSG 4E2LA 4Z2WA 4J11A 1VQ6V 1V54B 1HR0O 3HPLC 2A0LA 1K34A 3LDCA 3RYCA 1NTKH 1V55B 1RSOB 3OMNB 5DEDA 5H5NA 2P5OA 3ZMVA 4JI4B 1TUBA 4DYLA 2ZXWB 2AXTZ 2EULA 4PDLA 5B1BC 3K79A 3OD4A 1FPOA 1N33B 5DECA 4AQYB 3D36C 1TVKA 2Y0PA 2ZD9A 1JJOA 4J7KA 4LH7A 1IBLO 3HKEB 1URFA 1YJ9V 2VQFB 2GV9A 4B3RO 2KG7A 3ABLB 3MHHC 3C3SA 3JD2A 1YDXA 4PA4A 1DTOA 3K57A 4JGSA 3RT3C 1R6NA 2RDCA 1YF2A 3STLC 3K0GA 2WLKA 2CTRA 5HFMA 4DW0A 1RPOA 1LNQA 4RAIA 1WNSA 5KMGA 1OV9A 1XQ8A 4LFAB 2NR5A 3ZHRA 2CTPA 4YIPA 2EIKC 5IJ0A 1V9PA 5LMNB 3RGBA 4OGQB 1XMQB 2WAMA 2N04A 2W6IG 3E86A 1H2SB 4JI3B 3H1IH 2LFSA 1WA8A 1XILA 2QWQB 1S5JA 3UO3A 3ETDA 3OMAB 4DV6O 2ZKOA 2YUAA 4CH3A 4DR5O 4I0XB 4X64O 3GWKC 1Q6IA 3CP1A 4DO2A 4LF8O 1A32A 4X89A 1MSWD 2EINB 5CB4B 4JZGA 1R3IC 4KFMA 4FZ0A 2YS8A 2HEPA 3N27A 3H1LH 5JJEB 2BOCC 3BCCH 2QWNB 3U10A 3ZX6A 1GO3F 3JD3A 5D5PA 4NKGB 2UUBB 4JI2O 3ASNB 4C7UA 3LSQA 3A0BZ 1K5SA 3SPHA 1KP2A 1SZTA 3ZN0A 4DR3B 4FLYA 1IBMO 5IE9A 1Z5VA 2BTQA 2FMLA 1K4DC 3QF7A 4N23A 2ZNIA 2XAQA 3CMEV 1GN6A 2KB1A 2VWJA 3T1HB 3HKEA 3RYHA 3B09A 3JD1A 3W7UA 3G71V 3QO8A 3SJBC 1YJNV 2DQ0A 1BT8A 1AJNA 1MABG 2Q8VA 5JJJB 1M57B 2WA4A 1JMKC 3B4SA 1AB3A 1JX9A 5F2VO 2PI4A 1VF7A 1NVPB 5LHIA 1RFYA 4AHCA 2LW1A 1JCHA 1F4NA 1I7FA 1Y66A 1HNWB 1FXVA 4JASA 4TUYB 1AJQA 3C90A 5DM6V 1EZJA 4LF4B 3DXRA 4IHJA 1BSMA 1NH2B 4ZOLB 2Q0OC 5GTIZ 1QVFU 4O4JB 1SQGA 2Q0AA 1WLEA 2LW7A 3RBZA 4DR1B 2ZDIC 1VF6C 5B1BB 3UO2A 3P32A 2H94A 4CZZA 1HNXB 5J2UB 2H3OA 3RWRD 1K8AW 2CAZC 1AR5A 3CXCU 1M9NA 1K97A 4FPPA 4G27B 1WP7A 4LNUB 2HFEC 4JAAA 3T4DA 4R8CA 4X62O 1Y6XA 4LF7B 2YI9A 4LF8B 2WLMA 1R3LC 1DGSA 2R9AA 3GB7C 1AJPA 5IWAB 3N2GA 3RVYA 4P9PA 2IM9A 4CC5A 1WP8A 5LP6A 4JI8B 1XI1A 3SDLA 4NTXA 1N8RW 2OYQA 4DUZB 5HFLA 2CE4A 4B7EA 3ZRSA 2Y69B 2IH1C 3K04A 2QE7G 1HNWO 1FFXB 1W2BU 2Y0IA 2QM7A 5LP6C 2ZE8A 4R6ZA 4XDKA 4MVSA 4YHHB 2BCCH 3K08A 3APQA 3JAWA 4XDLA 1BZKA 5L3GA 2P90A 4NTYA 2UXCB 3ICXA 5CB4A 4P9OA 2UUCO 2E5LB 3EXAA 3DSQA 1NQTA 1N34B 1K33A 5KAIZ 4F6RB 2UUAB 3TXSA 3D3QA 3T1HO 4I55B 3G6EV 1BCCH 3ZCCA 1XREA 1UFIA 3G6BA 2JEXA 1X4TA 3Q4HB 1SC5B 2EIMC 1GM8A 2FKXA 3E89A 2JGDB 4UXNA 1RPRA 4GX2A 4OPHA 5BMVA 5EYPB 3AG4B 2R70A 3A0RA 1MNGA 4QNHB 3AK3A 3IAYA 2Q6AA 3UM7A 2ZQMA 4FM0A 4IIJA 1HR0B 4LCUC 1FXKC 3KG2A 2CTQA 1K4CC 1E1QG 3VQYA 1MMMA 1PM9A 2F66C 3JARA 1YXBA 1OJHA 4FVMA 2UXXA 4UV9A 5JH7A 4DV3O 4MT8A 3OTOO 5IDJA 3RYIA 1VQNV 3N2GB 4WFGA 1ZTEA 2OCCC 5CBGA 2GUZB 2DOSA 5FPOA 5IJ9A 4DW1A 5JCOC 3OW2U 3K9AA 4LFAO 4TT3G 2WLLA 1AI5A 1KD1W 4FMTA 3UT5A 1KB9F 5C8YB 1S72V 2ZXWC 1YHQV 2QJ1A 3I56V 1AP6A 1PL0A 2RMKB 1VIBA 3G80A 4J10A 2NLJC 3P3NA 2LJ2A 3CCMV 1N0JA 1M56C 5AG2A 4B3MB 4O4JA 2VQFO 4ZOLA 5GTHZ 1YTFB 3ABLC 5KAFZ 4JF3A 2ZM6B 1ZLZA 3OUFA 2HJFC 1ENVA 1THZA 3OTFA 5L3FA 2HLDG 1VQ4V 1QLNA 3CRQA 2AHZA 3NXSA 4LFCO 4P30A 2LO1A 1B6QA 3MD0A 4QE9A 1NR7A 3HKCA 4YJ3A 4B3MO 3HKDB 3AG7A 2IJJA 2A9HA 5EBLC 4JYCA 1SQBH 3OM3B 4DR3O 2YEVB 5KX5B 4JAVA 4TV9B 1YVWA 1OCRC 3IC9A 1Q6HA 3W7XA 2E76B 2Q7EA 4KHPO 4MTGA 5CBHA 4LFCB 2UUBO 4I4TB 3WG7B 5GW7A 1Q7YW 4TQFA 4WBNB 3JYCA 3SGIA 1NTZH 3RW0A 4PJ0Z 4UB8Z 1PNKA 3E22A 2RN9A 1SQFA 2CH7A 2MW2B 4LF6O 2UXCO 3QG5A 4WFBV 5LOVB 2A7WA 2HHHB 2HR3A 2BE3A 2AW9A 3FYEB 5LA6B 5LHGA 1R73A 4JI1B 2V4DA 1Q6UA 3ZHQA 1J5EB 1K73W 3OEHG 3ZRVA 5KHIA 1P7GA 1OCZB 5EBWC 4UFZA 5JQGA 2ADPA 4FLUA 1VQMV 2JIZG 1EN6A 3O65A 3RFRA 4NTWA 2OTLV 3ZIAG 3AG4C 4NXNB 3BEHA 2LP7A 1VQKV 2JJ2G 2GTSA 4U3JB 3L70H 1HNXO 3CPWU 4DV2O 4W4KA 1Y74B 1N36B 5JH7B 2XHBA 1F4MA 4CH4A 4F6EA 2F95B 3ZBHA 5KHGA 1O9GA 4LP8A 2OCCB 2V7QG 1IXMA 1EM1A 1IZ3A 1XBLA 2A79B 1S76D 4R7CA 4D6TH 3W7TA 1X59A 3SYQA 2W6JG 1UPGA 4NR1A 1VARA 4U3JA 1ZL8B 3AEIA 4W4LA 1OZ0A 4X20B 1MSDA 3I55V 4ZKIA 3D8CA 1G1XB 2IW5A 3FX7A 2DE0X 2R9IA 3Q4HA 1KECA 4PA7A 1J5EO 4KHPB 2GTAA 4J7JA 2B9ZA 3BY6A 4DR4B 4EB6A 1MA1A 4IT5A 2Q73A 1Z5WA 3BA9A 3F7YC 1YTFD 1B3QA 5L3EA 1ZX3A 5JVDA 1RSOA 2QKAA 4FIPC 4MVMA 4TQDA 1I0HA 3CCSV 1SRYA 2ZE5A 3OAAG 2ILMA 4TWKA 1L8DA 2X7RB 3DXRB 3JAKB 5KA5A 1NKDA 2QTOA 2IH3C 1FD9A 1NH2D 5J2TA 2CUGA 1OCRB 4OPAA 3OE7G 2DQ3A 2KSDA 4UCRA 4WFAV 5E79Z 4X1YB 3OGIB 3WG7C 3LDEA 1KKCA 5LP6B 2Y48A 1R3KC 2JEUA 4K8XA 5IJ9B 3ZHSA 1TAEA 4I7ZB 3JCUZ 2F4VB 3ZHVA 2RQ6A 2JJ1G 5KHHA 5JJNB 4HNAB 2PYJA 3W7SA 3OEEG 3RYIB 4OX9B 3FAVA 2ZINA 2A06H 1TGOA 3FD9A 4UV8A 1K92A 2JDIG 2ZR3A 2AZ2A 1VQLV 1HNZO 2EIMB 2EILB 2F43G 1GMGA 1K3EA 3LUTB 4FFBB 3HKBB 4U7NA 5LHHA 1YI2V 4UCUA 2XUMA 4CH5A 1Y76B 1N0NA 3ABMB 1JQ0A 4BIUA 1OCZC 4U3FH 1PKXA 1SS3A 1YITV 4B3TB 1FXKB 4FJCC 2GSMB 4I50B 4ZBMA 3R65A 3JALB 4GLXA 3BVOA 4WCEV 1KQSU 1VQPV 3SYOA 1JA8A 2LGWA 3IC7A 1H2GA 4BW5A 1Z2GA 1Q86W 3G4SV 4Q6GA 1FXKA 5E1AC 4AQYO 1H2LA 1Y4MA 4UVAA 3JD4A 1CP9A 2HG5C 5H6QA 4EFBA 4DRXA 4X88A 5FNVA 1AR1B 1SKVA 5LXTA 4N21A 4YJ2B 1JPXA 5FL7G 1S0VA 4ABMA 4DXWA 4PA9A 4DV5O 1PV0A 4PD4F 3VBBA 2VQEO 4DV7B 3M8AA 2ZDIA 3E2EA 2OIEA 3FFQA 1AVMA 1M56B 4FZ1A 3E8GA 4PV1B 1GAXA 3FAVB 1Y74A 1JR9A 3E22B 1MZFA 1FJGO 1SA0B 1AI6A 4DV6B 3K0DA 1F23A 4X9QA 1N34O 4WBNA 5LMNO 3ZHTA 4K3AA 1XL6A 4B3TO 1XMOO 4I9QA 1P7BA 1GN4A 4JAUA 4LNUA 2QM4A 4X1YA 1PD3A 2DN9A 1BS3A 5L3DA 1O9HA 4RWUA 3TETA 4MW3A 4IYHA 2WLIA 3L9DA 4O2AB 3SYCA 4OX9O 4BAYA 4JI0O 1FXHA 4KP4A 3JAKA 3S3WA 4LF5B 5LL6Y 4LF9B 1N33O 3K9SA 4FLTA 4TUYA 4AI8A 4FLWA 4YIOA 5FLXN 4MVRA 1IX9A 2PZSA 3OTOB 4IYIA 2ZIOA 2WLJA 4X1KB 3DTUB 1EZVH 3ZN1A 3H01A 3UT5B 1KYOF 2EX3A 2P4VA 4PHZA 3AK2A 2CH7B 2E3CA 3PN1A 2Z3YA 1AROP 4J9YB 3EFFK 1PNLA 2W0FC 4JI4O 2UXDB 3CC4V 2QTSA 2UU9B 2BTQB 3ZHUA 2EILC 2GDSA 2EZOA 1NS1A 4LWSB 2WPDG 2ZT9B 1DLBA 2DW4A 4ZHQB 1TUBB 4JI6B 1L0NH 3HKCB 3ML0A 2ADQB 2ZM6O 1IVSA 3AG3B 3T4ZA 3PJSK 5KLVH 1IURA 3CEIA 2Y4UA 3QO5A 1L0LH 3IGAC 3RYCB 3RYFA 5CA1A 1BE3H 3THOA 2JS5A 4DR7O 1QR8A 4UCTA 3VQVA 4BR6A 4NVPA 3A2FA 5GONA 1FKAO 3RYFB 1XOUA 2JVDA 1FJGB 1YCIA 5KUMA 4UB6Z 4I0XA 2YIBA 3OGCC 5H6RA 3CCUV 2GBOA 4TV8B 4RQFA 1GRJA 3CJHA 1OCCB 2X6BA 2ARHA 3U0ZA 1KC8W 2WLHA 2ATKC 1ZL8A 1NBMG 4UCSA 3TK1A 3E8BA 3M99B 4B7KA 5LA6A 2VS0A 3CRAA 3TCUA 4NXMO 1H2NA 2F23A 5KMGB 2OTJV 4XDJA 2QEXV 2ZR2A 1Q5OA 4NB5A 5LMUB 4GX0A 5LGTA 4FM2A 5EBMC 1VQ9V 1GKFA 1OHHG 2BSKB 4LF5O 2GHYA 2ZCEA 3EHBB 1VQ5V 5B1OA 3AK1A 1YIJV 4DK1A 1IBKO 2QKSA 4JZ2A 4JTDB 4RUEA 4JI7B 3JATA 2YIAA 2DYRC 3T2MA 2AHYA 1FS0G 2Q4PA 5BMVB 4H33A 5CMUA 1B06A 3CJHB 3H1HH 2CDYA 1NR1A 1PP9H 1I5YA 4O2BB 4TV8A 1VQOV 1S5HC 3CX5F 4JI8O 3H9VA 4JI6O 4DV7O 2PUSA 2QWRB 3X2QB 5A9GA 3ZRXA 3KKYA 1Q43A 3CC2V 2X6CA 3ETQA 4NYKA 4JYBA 4GKJO 5B3SB 1M4UA 4KUMA 1L1FA 1WA8B 1W59A 3K06A 1KP3A 4X1IB 1H2KA 3EVKA 3SJAC 3ZMZA 1Q82W 4E4EA 2AGAA 1Y76A 2HJDA 2YSUB 4XBFA 1XHZA 2F1MA 5IYZB 1SA0A 3WB2A 1F7YA 1CPYA 1TA8A 2CTWA 4GKKB 3GWOA 4Q20A 2XT9A 5C8YA 2DWDC 2WSSG 4O4LA 1PNMA 4LR3A 2XAFA 3JSLA 2L35A 3ABMC 2E74B 3CCRV 2PF4E 1FFTB 1M90W 2IBZH 4HNAA 1N32B 4EFEA 1DF5A 5EZYA 3C3TA 4K0KB 1T5EA 3J80N 2F4VO 2Y4TA 3D3IA 2R9RB 3K59A 3TJTA 2HKOA 3JARB 2H8PC 3B2EE 3ASOC 4J42A 2ZIMA 3JCZA 4FM1A 1BL8A 4DR6B 2FYUH 4IIJB 4O4HB 1VQ8V 1NT2B 1QU7A 3JSNA 2HHHO 1U96A 2UXNA 4JPRA 2CGOA 3LSSA 3WFVA 3QTCA 3JASB 2DMXA 3SYAA 1K5QA 4IHJB 4X1IA 2YIBD 5IT9N 2CGNA
chains in the Genus database with same CATH topology
1BGYH 1L0NH 1NTKH 1P84F 1SQBH 3H1LH 3CX5F 1SQPH 3BCCH 2IBZH 3L75H 4PD4F 5KLVH 2A06H 3H1KH 1KB9F 3H1JH 1L0LH 2FYUH 1EZVH 4U3FH 1BE3H 3L73H 1NU1H 1KYOF 3TGUH 1PPJH 1BCCH 1SQXH 3L70H 3CWBH 4D6TH 1NTZH 3H1IH 2BCCH 1SQVH 3L72H 3L71H 3H1HH 1NTMH 1SQQH 3CXHF 3L74H 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  1L0N H;  1NTK H;  1P84 F;  1SQB H;  3H1L H;  3CX5 F;  1SQP H;  3BCC H;  2IBZ H;  3L75 H;  4PD4 F;  5KLV H;  2A06 H;  3H1K H;  1KB9 F;  3H1J H;  1L0L H;  2FYU H;  1EZV H;  4U3F H;  1BE3 H;  3L73 H;  1NU1 H;  1KYO F;  3TGU H;  1PPJ H;  1BCC H;  1SQX H;  3L70 H;  3CWB H;  4D6T H;  1NTZ H;  3H1I H;  2BCC H;  1SQV H;  3L72 H;  3L71 H;  3H1H H;  1NTM H;  1SQQ H;  3CXH F;  3L74 H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 2LFR A;  4RUF A;  4UVC A;  2B1G A;  5CA1 B;  5BY1 A;  5L3C A;  4D7T A;  1QLE C;  4O2A A;  1G8M A;  4MTF A;  5J9P C;  1N4C A;  2WLI B;  3ETE A;  3HKB A;  4O4H A;  2XOK G;  2P67 A;  4QJF B;  5B1N A;  3F7V C;  1OCC C;  5KHJ A;  1MG1 A;  4RQE A;  4GYC B;  2K9P A;  3L72 H;  1AIL A;  3R66 A;  1NVP D;  2VRZ A;  4H0L B;  1Y67 A;  2UXB O;  1EN5 A;  4DR7 B;  1KU9 A;  2M6Y A;  5CN0 A;  5K1X A;  1COW G;  3STZ C;  4PI2 A;  3FYI B;  4B3S B;  3ZMS A;  1S5L Z;  5ITZ A;  1H2M A;  3T1Y O;  1WPX A;  4DV2 B;  4QE7 A;  2F93 B;  1M1K W;  5A2Q N;  3CHX A;  4MVO A;  3ABK C;  3BRC A;  4ZIB A;  5JWP A;  3ZMT A;  3MHS C;  1IDS A;  5IYZ A;  2ODM A;  5LXT B;  1QQC A;  4DR6 O;  3CRR A;  4DRX B;  1HNZ B;  2WA3 A;  2QKC A;  5BXZ A;  3WB0 A;  2JGD A;  4TSF G;  5LBQ A;  2Q9L A;  1XL4 A;  3X2Q C;  4A5U B;  1XDC A;  1GH6 A;  4CC6 A;  3CCQ V;  2KQX A;  3OUS A;  4D7S A;  3UQ8 A;  2EJR A;  3E8H A;  4I55 A;  4X65 O;  2NNU A;  1M5I A;  2IU3 A;  4RO2 A;  4GUN A;  3BHP A;  1YJW V;  1XMQ O;  4O2B A;  1US6 A;  5FPR A;  2DYS B;  1XNQ O;  3SYP A;  1P84 F;  4YXW G;  1Q3E A;  1EN4 A;  5CBF A;  2HVK C;  2E75 B;  3ABU A;  4QIW F;  3JAW B;  3CD6 V;  1H8H G;  2VQE B;  4JYA B;  1N36 O;  4HYO A;  1S77 D;  4PI0 A;  3SPI A;  1Q8I A;  2QSA A;  1ZAU A;  3N2K A;  1OCO C;  3T1Y B;  3K5N A;  1WPB A;  4HAM A;  1WB8 A;  2R72 A;  2PTM A;  4ZHQ A;  4R50 A;  2BSK A;  5CA3 A;  3BPZ A;  3AG3 C;  3B8N A;  4DV1 B;  2XND G;  2Z0A A;  1LUV A;  1AI7 A;  2E5L O;  2AZ0 A;  1BHA A;  4GX1 A;  2Q7G A;  1E1R G;  1YZB A;  2OCH A;  1JOY A;  1XNR B;  1VEW A;  3AG1 C;  4Z1V A;  1H38 A;  2D2C B;  4DR4 O;  4PDR A;  1XHX A;  4EKW A;  1R3J C;  3ASO B;  3BA8 A;  4J80 A;  2XAH A;  2YC0 A;  1GTO A;  4ZI7 B;  1FYJ A;  1BQZ A;  3IJ4 A;  2P06 A;  5EK0 A;  1QHT A;  5K1P A;  5J2U A;  2JK5 C;  1WN7 A;  2PY5 A;  4O4I B;  2IJI A;  4FFK A;  3K5M A;  3VQW A;  3SPC A;  1XUQ A;  1P49 A;  1QLE B;  1XMO B;  2IU0 A;  3ZED A;  2G38 A;  3RVZ A;  4Z1M G;  3CC7 V;  1BQ0 A;  1D5A A;  3A8T A;  4ICG A;  1BMF G;  2Q7H A;  4JYY A;  1MZE A;  1G4Y B;  1R6K A;  2UXD O;  1NU1 H;  4ASU G;  5BR8 B;  4H37 A;  1VQ7 V;  1ZWI C;  2DWE C;  5DN6 G;  4O4I A;  1GK9 A;  1MOF A;  4FFB A;  1GN3 A;  5IWA O;  1SER A;  4PDM A;  1IBM B;  2RJZ A;  2JS3 A;  3F5T A;  1VMG A;  4MW8 A;  2WLL B;  4DR1 O;  1NI8 A;  4UCO A;  5IYC O;  2DYR B;  5LGN A;  2PGG A;  1SET A;  5EC2 C;  5CA0 A;  4JI5 O;  2DJV A;  4X20 A;  5EZY B;  3RYH B;  1CXZ B;  3JAT B;  4I4T A;  1Q81 W;  2LQT A;  4K0K O;  3CXH F;  3OT7 A;  4NXN O;  2K1E A;  4J7Z A;  3QVN A;  4TOI A;  2ETN A;  1ROP A;  1N32 O;  1SQP H;  4LH6 A;  2YID A;  1EFR G;  4L87 A;  4X1K A;  4CS2 A;  5B3S C;  2N05 A;  4BIO A;  1ORQ C;  2MK3 A;  4QPJ A;  4DUY O;  5EC1 C;  4YJ2 A;  3AG2 B;  4YY3 B;  4DV4 O;  3CCE V;  1J95 A;  1WAZ A;  5FNV B;  5EYP A;  4DV0 O;  4MVU A;  2X6A A;  1HW7 A;  5B66 Z;  4X64 B;  1TVK B;  4DV1 O;  3WB1 A;  4X65 B;  3WU2 Z;  4B3S O;  1ZUQ A;  3K5L A;  3J81 N;  4DUY B;  3P3P A;  3B8M A;  4MVZ A;  1QBZ A;  3CCJ V;  3W7W A;  3JD0 A;  1SQV H;  4FLZ A;  4BWA A;  3OR6 C;  3VQX A;  4DV3 B;  3MDS A;  4ZI7 A;  4WF9 V;  4I50 A;  1YSC A;  5H9C A;  3E83 A;  1Q90 D;  4DV5 B;  1JVM A;  1EBO A;  3TXQ A;  1OCO B;  2EIJ B;  1R6T A;  3CB2 A;  4JV5 B;  1BHB A;  3ABT A;  1P4R A;  4JI0 B;  1KMI Z;  5KA6 A;  3SPG A;  2ITC C;  4QPK A;  1FFX A;  4DUZ O;  1GM9 A;  4UCV A;  2XAJ A;  3A0H Z;  2YI8 A;  2ZE6 A;  5LOV A;  5LYJ A;  4DR2 O;  2V1D A;  4WFE A;  1B04 A;  3T1C A;  1SES A;  1CEZ A;  1AP5 A;  3SPJ A;  2PYL A;  4K8Z A;  3AG1 B;  1KBH A;  2QWO B;  2UUA O;  5BR8 O;  2KG7 B;  3GVM A;  1I08 A;  3UCS C;  2QM8 A;  2Q68 A;  1PL4 A;  4YY3 O;  3G67 A;  4H44 B;  3CRM A;  1LR1 A;  1IBK B;  4DV0 B;  2YIC A;  2Q5Z A;  1GM7 A;  1HDJ A;  1WJZ A;  2UXB B;  2A3Q A;  5EIB D;  1SQX H;  5TIS Z;  4PA6 A;  4CS3 A;  2ZNJ A;  4YJ3 B;  1G6U A;  2JRI A;  3LSU A;  2FL4 A;  2YDE A;  4IL6 Z;  1AI4 A;  1YEW A;  4GZR B;  5IY5 B;  2EZP A;  3S3X A;  3JAL A;  4LFB O;  1QVG U;  3B40 A;  4GX5 A;  5GON B;  1LUW A;  2N74 A;  2XTA A;  2P7T C;  3OFN G;  3JAS A;  1WB7 A;  2CK3 G;  2OIG A;  3F5W C;  4HZ3 A;  3FB8 C;  3CMA V;  3ZMU A;  3KZI Z;  4CS4 A;  3MAQ A;  5JVD B;  4WFF A;  5B1A C;  2C2A A;  4LF4 O;  3SR2 C;  4X62 B;  3K3W A;  5L3B A;  3ABK B;  4KL1 A;  4FLV A;  4P2Z A;  3OR7 C;  4JYA O;  4X8A A;  1IBL B;  2QDO A;  1RM1 B;  2ZE7 A;  4LWS A;  2OT5 A;  3HB3 B;  1F51 A;  4MVQ A;  2LGQ A;  5ITZ B;  2WLN A;  4LF9 O;  2XAS A;  3CRC A;  3DGE A;  1PPJ H;  3J7A U;  4BW9 A;  3CWB H;  2HP8 A;  1ZSP A;  2VWK A;  2XAG A;  4K35 A;  2EIN C;  4QGP A;  3APO A;  2UU9 O;  4MTX A;  1U97 A;  1W0J G;  2RCV A;  2FB5 A;  2FTK A;  2BOB C;  4GKK O;  1VP7 A;  1QCE A;  1TUE B;  2IJK A;  5B5E Z;  3AG2 C;  4JTC B;  1S3J A;  3HKD A;  2DYS C;  1R1B A;  3ASN C;  1SZX A;  3QO7 A;  5J2T B;  3L74 H;  3DC6 A;  4LC1 A;  3P30 A;  5LGU A;  1QR9 A;  3ZRW A;  3I5D A;  4IGG A;  1I94 O;  4JI2 B;  1D2D A;  4DR2 B;  4MSW C;  2QA4 V;  1XEQ A;  4J41 A;  1JJ2 U;  4MS2 A;  5D5Q A;  5LMU O;  4FLX A;  5C93 A;  1I5X A;  4CH6 A;  1V54 C;  2B1I A;  4BIZ A;  2KKW A;  2D3O W;  3CYO A;  2HVJ C;  2QGN A;  3KCX A;  1BGY H;  4WFH A;  4F6R A;  4EB6 B;  1HWY A;  2M7W A;  1V55 C;  4L8J A;  2W0X A;  3RN4 A;  3E35 A;  4JV5 O;  3CE2 A;  4NXM B;  4EEQ A;  4LBE C;  3SJQ C;  1VF6 A;  3IFX A;  1H8E G;  2L6L A;  1XNQ B;  1NTM H;  4G28 B;  2GUZ A;  4H13 B;  4GKJ B;  3LNN A;  3H1K H;  2Z5U A;  3ETG A;  3NR7 A;  4JI3 O;  1JFF A;  3CCV V;  1K9M W;  1NZ6 A;  3BAB A;  3K03 A;  4DR5 B;  5KHK A;  1VF5 B;  5LYJ B;  4J9Z B;  1E79 G;  1W0K G;  4DK0 A;  4PEL A;  1JFF B;  3BAA A;  5KUK A;  4YHH O;  1I94 B;  1NJI W;  3LDD A;  1M93 A;  1IXB A;  4JI7 O;  4I5S A;  2IJH A;  1GN2 A;  3U11 A;  3JAM N;  3ZJZ A;  2OWO A;  2EIK B;  3L73 H;  4MTO A;  5EIB C;  3VOU A;  3TGU H;  4GCZ A;  2JGU A;  3FB6 C;  2Q69 A;  4UVB A;  4TV9 A;  1KUQ A;  3CSX A;  3LNM B;  3L71 H;  1SQQ H;  5IY5 C;  4DV4 B;  3BFR A;  3CCL V;  1AR4 A;  2X0L A;  4AIL C;  5JCO A;  5JQG B;  4JI5 B;  4UUJ C;  2PI5 A;  2Q67 A;  4B3R B;  4U7O A;  2Y69 C;  1K7D A;  3SJC C;  3M7M X;  3O9O A;  4HBN A;  1D5N A;  5B1A B;  1RP3 B;  2P4K A;  5IYD O;  1XNR O;  3OMI B;  5IJ0 B;  3ZRW B;  1RM1 C;  3QNE A;  2YXH A;  4LF7 O;  3K58 A;  1HP8 A;  3HR0 A;  2P6J A;  2ITD C;  1DF4 A;  3UKM A;  4LF6 B;  3H1J H;  5H2F Z;  2WWW A;  2P22 C;  2B5U A;  4GT1 A;  5IYB O;  4KXR A;  1QNM A;  3FB5 C;  1KKD A;  2EBO A;  3KCY A;  3B77 A;  3CS5 A;  3D36 A;  4JTA B;  4FK5 C;  4JI1 O;  3ZS8 C;  4OXS A;  1UJW B;  4I9W A;  5CA0 B;  4X66 O;  1DK1 A;  3K5O A;  2RNB A;  3E8F A;  4B08 A;  2QWP B;  2YEV A;  5KX5 A;  2BTO A;  4O4L B;  2O57 A;  2QR4 A;  5BZB A;  4PA3 A;  3DC5 A;  1FAF A;  2EJ7 A;  4F4L A;  1SF9 A;  3N2K B;  4PDV A;  3FB7 C;  2YXL A;  3L75 H;  1M57 C;  2YXY A;  4X66 B;  2UUC B;  2EIJ C;  4CBC A;  4G2K A;  2NN4 A;  4LFB B;  3FKS G;  4E2L A;  4Z2W A;  4J11 A;  1VQ6 V;  1V54 B;  1HR0 O;  3HPL C;  2A0L A;  1K34 A;  3LDC A;  3RYC A;  1NTK H;  1V55 B;  1RSO B;  3OMN B;  5DED A;  5H5N A;  2P5O A;  3ZMV A;  4JI4 B;  1TUB A;  4DYL A;  2ZXW B;  2AXT Z;  2EUL A;  4PDL A;  5B1B C;  3K79 A;  3OD4 A;  1FPO A;  1N33 B;  5DEC A;  4AQY B;  3D36 C;  1TVK A;  2Y0P A;  2ZD9 A;  1JJO A;  4J7K A;  4LH7 A;  1IBL O;  3HKE B;  1URF A;  1YJ9 V;  2VQF B;  2GV9 A;  4B3R O;  2KG7 A;  3ABL B;  3MHH C;  3C3S A;  3JD2 A;  1YDX A;  4PA4 A;  1DTO A;  3K57 A;  4JGS A;  3RT3 C;  1R6N A;  2RDC A;  1YF2 A;  3STL C;  3K0G A;  2WLK A;  2CTR A;  5HFM A;  4DW0 A;  1RPO A;  1LNQ A;  4RAI A;  1WNS A;  5KMG A;  1OV9 A;  1XQ8 A;  4LFA B;  2NR5 A;  3ZHR A;  2CTP A;  4YIP A;  2EIK C;  5IJ0 A;  1V9P A;  5LMN B;  3RGB A;  4OGQ B;  1XMQ B;  2WAM A;  2N04 A;  2W6I G;  3E86 A;  1H2S B;  4JI3 B;  3H1I H;  2LFS A;  1WA8 A;  1XIL A;  2QWQ B;  1S5J A;  3UO3 A;  3ETD A;  3OMA B;  4DV6 O;  2ZKO A;  2YUA A;  4CH3 A;  4DR5 O;  4I0X B;  4X64 O;  3GWK C;  1Q6I A;  3CP1 A;  4DO2 A;  4LF8 O;  1A32 A;  4X89 A;  1MSW D;  2EIN B;  5CB4 B;  4JZG A;  1R3I C;  4KFM A;  4FZ0 A;  2YS8 A;  2HEP A;  3N27 A;  3H1L H;  5JJE B;  2BOC C;  3BCC H;  2QWN B;  3U10 A;  3ZX6 A;  1GO3 F;  3JD3 A;  5D5P A;  4NKG B;  2UUB B;  4JI2 O;  3ASN B;  4C7U A;  3LSQ A;  3A0B Z;  1K5S A;  3SPH A;  1KP2 A;  1SZT A;  3ZN0 A;  4DR3 B;  4FLY A;  1IBM O;  5IE9 A;  1Z5V A;  2BTQ A;  2FML A;  1K4D C;  3QF7 A;  4N23 A;  2ZNI A;  2XAQ A;  3CME V;  1GN6 A;  2KB1 A;  2VWJ A;  3T1H B;  3HKE A;  3RYH A;  3B09 A;  3JD1 A;  3W7U A;  3G71 V;  3QO8 A;  3SJB C;  1YJN V;  2DQ0 A;  1BT8 A;  1AJN A;  1MAB G;  2Q8V A;  5JJJ B;  1M57 B;  2WA4 A;  1JMK C;  3B4S A;  1AB3 A;  1JX9 A;  5F2V O;  2PI4 A;  1VF7 A;  1NVP B;  5LHI A;  1RFY A;  4AHC A;  2LW1 A;  1JCH A;  1F4N A;  1I7F A;  1Y66 A;  1HNW B;  1FXV A;  4JAS A;  4TUY B;  1AJQ A;  3C90 A;  5DM6 V;  1EZJ A;  4LF4 B;  3DXR A;  4IHJ A;  1BSM A;  1NH2 B;  4ZOL B;  2Q0O C;  5GTI Z;  1QVF U;  4O4J B;  1SQG A;  2Q0A A;  1WLE A;  2LW7 A;  3RBZ A;  4DR1 B;  2ZDI C;  1VF6 C;  5B1B B;  3UO2 A;  3P32 A;  2H94 A;  4CZZ A;  1HNX B;  5J2U B;  2H3O A;  3RWR D;  1K8A W;  2CAZ C;  1AR5 A;  3CXC U;  1M9N A;  1K97 A;  4FPP A;  4G27 B;  1WP7 A;  4LNU B;  2HFE C;  4JAA A;  3T4D A;  4R8C A;  4X62 O;  1Y6X A;  4LF7 B;  2YI9 A;  4LF8 B;  2WLM A;  1R3L C;  1DGS A;  2R9A A;  3GB7 C;  1AJP A;  5IWA B;  3N2G A;  3RVY A;  4P9P A;  2IM9 A;  4CC5 A;  1WP8 A;  5LP6 A;  4JI8 B;  1XI1 A;  3SDL A;  4NTX A;  1N8R W;  2OYQ A;  4DUZ B;  5HFL A;  2CE4 A;  4B7E A;  3ZRS A;  2Y69 B;  2IH1 C;  3K04 A;  2QE7 G;  1HNW O;  1FFX B;  1W2B U;  2Y0I A;  2QM7 A;  5LP6 C;  2ZE8 A;  4R6Z A;  4XDK A;  4MVS A;  4YHH B;  2BCC H;  3K08 A;  3APQ A;  3JAW A;  4XDL A;  1BZK A;  5L3G A;  2P90 A;  4NTY A;  2UXC B;  3ICX A;  5CB4 A;  4P9O A;  2UUC O;  2E5L B;  3EXA A;  3DSQ A;  1NQT A;  1N34 B;  1K33 A;  5KAI Z;  4F6R B;  2UUA B;  3TXS A;  3D3Q A;  3T1H O;  4I55 B;  3G6E V;  1BCC H;  3ZCC A;  1XRE A;  1UFI A;  3G6B A;  2JEX A;  1X4T A;  3Q4H B;  1SC5 B;  2EIM C;  1GM8 A;  2FKX A;  3E89 A;  2JGD B;  4UXN A;  1RPR A;  4GX2 A;  4OPH A;  5BMV A;  5EYP B;  3AG4 B;  2R70 A;  3A0R A;  1MNG A;  4QNH B;  3AK3 A;  3IAY A;  2Q6A A;  3UM7 A;  2ZQM A;  4FM0 A;  4IIJ A;  1HR0 B;  4LCU C;  1FXK C;  3KG2 A;  2CTQ A;  1K4C C;  1E1Q G;  3VQY A;  1MMM A;  1PM9 A;  2F66 C;  3JAR A;  1YXB A;  1OJH A;  4FVM A;  2UXX A;  4UV9 A;  5JH7 A;  4DV3 O;  4MT8 A;  3OTO O;  5IDJ A;  3RYI A;  1VQN V;  3N2G B;  4WFG A;  1ZTE A;  2OCC C;  5CBG A;  2GUZ B;  2DOS A;  5FPO A;  5IJ9 A;  4DW1 A;  5JCO C;  3OW2 U;  3K9A A;  4LFA O;  4TT3 G;  2WLL A;  1AI5 A;  1KD1 W;  4FMT A;  3UT5 A;  1KB9 F;  5C8Y B;  1S72 V;  2ZXW C;  1YHQ V;  2QJ1 A;  3I56 V;  1AP6 A;  1PL0 A;  2RMK B;  1VIB A;  3G80 A;  4J10 A;  2NLJ C;  3P3N A;  2LJ2 A;  3CCM V;  1N0J A;  1M56 C;  5AG2 A;  4B3M B;  4O4J A;  2VQF O;  4ZOL A;  5GTH Z;  1YTF B;  3ABL C;  5KAF Z;  4JF3 A;  2ZM6 B;  1ZLZ A;  3OUF A;  2HJF C;  1ENV A;  1THZ A;  3OTF A;  5L3F A;  2HLD G;  1VQ4 V;  1QLN A;  3CRQ A;  2AHZ A;  3NXS A;  4LFC O;  4P30 A;  2LO1 A;  1B6Q A;  3MD0 A;  4QE9 A;  1NR7 A;  3HKC A;  4YJ3 A;  4B3M O;  3HKD B;  3AG7 A;  2IJJ A;  2A9H A;  5EBL C;  4JYC A;  1SQB H;  3OM3 B;  4DR3 O;  2YEV B;  5KX5 B;  4JAV A;  4TV9 B;  1YVW A;  1OCR C;  3IC9 A;  1Q6H A;  3W7X A;  2E76 B;  2Q7E A;  4KHP O;  4MTG A;  5CBH A;  4LFC B;  2UUB O;  4I4T B;  3WG7 B;  5GW7 A;  1Q7Y W;  4TQF A;  4WBN B;  3JYC A;  3SGI A;  1NTZ H;  3RW0 A;  4PJ0 Z;  4UB8 Z;  1PNK A;  3E22 A;  2RN9 A;  1SQF A;  2CH7 A;  2MW2 B;  4LF6 O;  2UXC O;  3QG5 A;  4WFB V;  5LOV B;  2A7W A;  2HHH B;  2HR3 A;  2BE3 A;  2AW9 A;  3FYE B;  5LA6 B;  5LHG A;  1R73 A;  4JI1 B;  2V4D A;  1Q6U A;  3ZHQ A;  1J5E B;  1K73 W;  3OEH G;  3ZRV A;  5KHI A;  1P7G A;  1OCZ B;  5EBW C;  4UFZ A;  5JQG A;  2ADP A;  4FLU A;  1VQM V;  2JIZ G;  1EN6 A;  3O65 A;  3RFR A;  4NTW A;  2OTL V;  3ZIA G;  3AG4 C;  4NXN B;  3BEH A;  2LP7 A;  1VQK V;  2JJ2 G;  2GTS A;  4U3J B;  3L70 H;  1HNX O;  3CPW U;  4DV2 O;  4W4K A;  1Y74 B;  1N36 B;  5JH7 B;  2XHB A;  1F4M A;  4CH4 A;  4F6E A;  2F95 B;  3ZBH A;  5KHG A;  1O9G A;  4LP8 A;  2OCC B;  2V7Q G;  1IXM A;  1EM1 A;  1IZ3 A;  1XBL A;  2A79 B;  1S76 D;  4R7C A;  4D6T H;  3W7T A;  1X59 A;  3SYQ A;  2W6J G;  1UPG A;  4NR1 A;  1VAR A;  4U3J A;  1ZL8 B;  3AEI A;  4W4L A;  1OZ0 A;  4X20 B;  1MSD A;  3I55 V;  4ZKI A;  3D8C A;  1G1X B;  2IW5 A;  3FX7 A;  2DE0 X;  2R9I A;  3Q4H A;  1KEC A;  4PA7 A;  1J5E O;  4KHP B;  2GTA A;  4J7J A;  2B9Z A;  3BY6 A;  4DR4 B;  4EB6 A;  1MA1 A;  4IT5 A;  2Q73 A;  1Z5W A;  3BA9 A;  3F7Y C;  1YTF D;  1B3Q A;  5L3E A;  1ZX3 A;  5JVD A;  1RSO A;  2QKA A;  4FIP C;  4MVM A;  4TQD A;  1I0H A;  3CCS V;  1SRY A;  2ZE5 A;  3OAA G;  2ILM A;  4TWK A;  1L8D A;  2X7R B;  3DXR B;  3JAK B;  5KA5 A;  1NKD A;  2QTO A;  2IH3 C;  1FD9 A;  1NH2 D;  5J2T A;  2CUG A;  1OCR B;  4OPA A;  3OE7 G;  2DQ3 A;  2KSD A;  4UCR A;  4WFA V;  5E79 Z;  4X1Y B;  3OGI B;  3WG7 C;  3LDE A;  1KKC A;  5LP6 B;  2Y48 A;  1R3K C;  2JEU A;  4K8X A;  5IJ9 B;  3ZHS A;  1TAE A;  4I7Z B;  3JCU Z;  2F4V B;  3ZHV A;  2RQ6 A;  2JJ1 G;  5KHH A;  5JJN B;  4HNA B;  2PYJ A;  3W7S A;  3OEE G;  3RYI B;  4OX9 B;  3FAV A;  2ZIN A;  2A06 H;  1TGO A;  3FD9 A;  4UV8 A;  1K92 A;  2JDI G;  2ZR3 A;  2AZ2 A;  1VQL V;  1HNZ O;  2EIM B;  2EIL B;  2F43 G;  1GMG A;  1K3E A;  3LUT B;  4FFB B;  3HKB B;  4U7N A;  5LHH A;  1YI2 V;  4UCU A;  2XUM A;  4CH5 A;  1Y76 B;  1N0N A;  3ABM B;  1JQ0 A;  4BIU A;  1OCZ C;  4U3F H;  1PKX A;  1SS3 A;  1YIT V;  4B3T B;  1FXK B;  4FJC C;  2GSM B;  4I50 B;  4ZBM A;  3R65 A;  3JAL B;  4GLX A;  3BVO A;  4WCE V;  1KQS U;  1VQP V;  3SYO A;  1JA8 A;  2LGW A;  3IC7 A;  1H2G A;  4BW5 A;  1Z2G A;  1Q86 W;  3G4S V;  4Q6G A;  1FXK A;  5E1A C;  4AQY O;  1H2L A;  1Y4M A;  4UVA A;  3JD4 A;  1CP9 A;  2HG5 C;  5H6Q A;  4EFB A;  4DRX A;  4X88 A;  5FNV A;  1AR1 B;  1SKV A;  5LXT A;  4N21 A;  4YJ2 B;  1JPX A;  5FL7 G;  1S0V A;  4ABM A;  4DXW A;  4PA9 A;  4DV5 O;  1PV0 A;  4PD4 F;  3VBB A;  2VQE O;  4DV7 B;  3M8A A;  2ZDI A;  3E2E A;  2OIE A;  3FFQ A;  1AVM A;  1M56 B;  4FZ1 A;  3E8G A;  4PV1 B;  1GAX A;  3FAV B;  1Y74 A;  1JR9 A;  3E22 B;  1MZF A;  1FJG O;  1SA0 B;  1AI6 A;  4DV6 B;  3K0D A;  1F23 A;  4X9Q A;  1N34 O;  4WBN A;  5LMN O;  3ZHT A;  4K3A A;  1XL6 A;  4B3T O;  1XMO O;  4I9Q A;  1P7B A;  1GN4 A;  4JAU A;  4LNU A;  2QM4 A;  4X1Y A;  1PD3 A;  2DN9 A;  1BS3 A;  5L3D A;  1O9H A;  4RWU A;  3TET A;  4MW3 A;  4IYH A;  2WLI A;  3L9D A;  4O2A B;  3SYC A;  4OX9 O;  4BAY A;  4JI0 O;  1FXH A;  4KP4 A;  3JAK A;  3S3W A;  4LF5 B;  5LL6 Y;  4LF9 B;  1N33 O;  3K9S A;  4FLT A;  4TUY A;  4AI8 A;  4FLW A;  4YIO A;  5FLX N;  4MVR A;  1IX9 A;  2PZS A;  3OTO B;  4IYI A;  2ZIO A;  2WLJ A;  4X1K B;  3DTU B;  1EZV H;  3ZN1 A;  3H01 A;  3UT5 B;  1KYO F;  2EX3 A;  2P4V A;  4PHZ A;  3AK2 A;  2CH7 B;  2E3C A;  3PN1 A;  2Z3Y A;  1ARO P;  4J9Y B;  3EFF K;  1PNL A;  2W0F C;  4JI4 O;  2UXD B;  3CC4 V;  2QTS A;  2UU9 B;  2BTQ B;  3ZHU A;  2EIL C;  2GDS A;  2EZO A;  1NS1 A;  4LWS B;  2WPD G;  2ZT9 B;  1DLB A;  2DW4 A;  4ZHQ B;  1TUB B;  4JI6 B;  1L0N H;  3HKC B;  3ML0 A;  2ADQ B;  2ZM6 O;  1IVS A;  3AG3 B;  3T4Z A;  3PJS K;  5KLV H;  1IUR A;  3CEI A;  2Y4U A;  3QO5 A;  1L0L H;  3IGA C;  3RYC B;  3RYF A;  5CA1 A;  1BE3 H;  3THO A;  2JS5 A;  4DR7 O;  1QR8 A;  4UCT A;  3VQV A;  4BR6 A;  4NVP A;  3A2F A;  5GON A;  1FKA O;  3RYF B;  1XOU A;  2JVD A;  1FJG B;  1YCI A;  5KUM A;  4UB6 Z;  4I0X A;  2YIB A;  3OGC C;  5H6R A;  3CCU V;  2GBO A;  4TV8 B;  4RQF A;  1GRJ A;  3CJH A;  1OCC B;  2X6B A;  2ARH A;  3U0Z A;  1KC8 W;  2WLH A;  2ATK C;  1ZL8 A;  1NBM G;  4UCS A;  3TK1 A;  3E8B A;  3M99 B;  4B7K A;  5LA6 A;  2VS0 A;  3CRA A;  3TCU A;  4NXM O;  1H2N A;  2F23 A;  5KMG B;  2OTJ V;  4XDJ A;  2QEX V;  2ZR2 A;  1Q5O A;  4NB5 A;  5LMU B;  4GX0 A;  5LGT A;  4FM2 A;  5EBM C;  1VQ9 V;  1GKF A;  1OHH G;  2BSK B;  4LF5 O;  2GHY A;  2ZCE A;  3EHB B;  1VQ5 V;  5B1O A;  3AK1 A;  1YIJ V;  4DK1 A;  1IBK O;  2QKS A;  4JZ2 A;  4JTD B;  4RUE A;  4JI7 B;  3JAT A;  2YIA A;  2DYR C;  3T2M A;  2AHY A;  1FS0 G;  2Q4P A;  5BMV B;  4H33 A;  5CMU A;  1B06 A;  3CJH B;  3H1H H;  2CDY A;  1NR1 A;  1PP9 H;  1I5Y A;  4O2B B;  4TV8 A;  1VQO V;  1S5H C;  3CX5 F;  4JI8 O;  3H9V A;  4JI6 O;  4DV7 O;  2PUS A;  2QWR B;  3X2Q B;  5A9G A;  3ZRX A;  3KKY A;  1Q43 A;  3CC2 V;  2X6C A;  3ETQ A;  4NYK A;  4JYB A;  4GKJ O;  5B3S B;  1M4U A;  4KUM A;  1L1F A;  1WA8 B;  1W59 A;  3K06 A;  1KP3 A;  4X1I B;  1H2K A;  3EVK A;  3SJA C;  3ZMZ A;  1Q82 W;  4E4E A;  2AGA A;  1Y76 A;  2HJD A;  2YSU B;  4XBF A;  1XHZ A;  2F1M A;  5IYZ B;  1SA0 A;  3WB2 A;  1F7Y A;  1CPY A;  1TA8 A;  2CTW A;  4GKK B;  3GWO A;  4Q20 A;  2XT9 A;  5C8Y A;  2DWD C;  2WSS G;  4O4L A;  1PNM A;  4LR3 A;  2XAF A;  3JSL A;  2L35 A;  3ABM C;  2E74 B;  3CCR V;  2PF4 E;  1FFT B;  1M90 W;  2IBZ H;  4HNA A;  1N32 B;  4EFE A;  1DF5 A;  5EZY A;  3C3T A;  4K0K B;  1T5E A;  3J80 N;  2F4V O;  2Y4T A;  3D3I A;  2R9R B;  3K59 A;  3TJT A;  2HKO A;  3JAR B;  2H8P C;  3B2E E;  3ASO C;  4J42 A;  2ZIM A;  3JCZ A;  4FM1 A;  1BL8 A;  4DR6 B;  2FYU H;  4IIJ B;  4O4H B;  1VQ8 V;  1NT2 B;  1QU7 A;  3JSN A;  2HHH O;  1U96 A;  2UXN A;  4JPR A;  2CGO A;  3LSS A;  3WFV A;  3QTC A;  3JAS B;  2DMX A;  3SYA A;  1K5Q A;  4IHJ B;  4X1I A;  2YIB D;  5IT9 N;  2CGN A; 
#chains in the Genus database with same CATH homology
 1BGY H;  1L0N H;  1NTK H;  1P84 F;  1SQB H;  3H1L H;  3CX5 F;  1SQP H;  3BCC H;  2IBZ H;  3L75 H;  4PD4 F;  5KLV H;  2A06 H;  3H1K H;  1KB9 F;  3H1J H;  1L0L H;  2FYU H;  1EZV H;  4U3F H;  1BE3 H;  3L73 H;  1NU1 H;  1KYO F;  3TGU H;  1PPJ H;  1BCC H;  1SQX H;  3L70 H;  3CWB H;  4D6T H;  1NTZ H;  3H1I H;  2BCC H;  1SQV H;  3L72 H;  3L71 H;  3H1H H;  1NTM H;  1SQQ H;  3CXH F;  3L74 H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...