1BCCH

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 19
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bccH00
1SQQH 3CXHF 1PPJH 1BE3H 3H1JH 3L73H 2BCCH 3L70H 1L0LH 3L72H 2A06H 2IBZH 4D6TH 2FYUH 3L74H 4PD4F 1NU1H 1BGYH 3H1IH 1SQBH 1NTZH 3L75H 3H1KH 3H1HH 1L0NH 1BCCH 5KLVH 1KB9F 1KYOF 3TGUH 1NTKH 1SQVH 3CWBH 3CX5F 1SQXH 3BCCH 3L71H 1P84F 3H1LH 4U3FH 1SQPH 1NTMH 1EZVH 1PP9H
chains in the Genus database with same CATH superfamily
2EIKB 2XUMA 4X62B 1PPJH 3AG4C 3E2EA 1G4YB 2OYQA 1XNRB 2H94A 3ETEA 2OCCB 1UPGA 3NXSA 4QPKA 1FD9A 3W7TA 4B3MB 5KA5A 1KYOF 1BHAA 4LFBB 1YHQV 2V4DA 4LBEC 4PDMA 3KZIZ 3JD2A 4YJ2B 1GMGA 4J41A 3DSQA 4MVQA 3ZHRA 4DW1A 1PNKA 4MVUA 1NTZH 3L75H 1QVGU 5KAFZ 3RGBA 1OCOC 1MA1A 5IY5B 5KAIZ 2Q69A 1SQGA 5LMUO 4JI6O 2G38A 3CX5F 2CTQA 3ZS8C 5B1AB 2UXCB 4MVRA 4CS2A 1KECA 3SYAA 1EN4A 5IJ9A 1XUQA 3ZMZA 1HNWB 3F7VC 1DGSA 5B1OA 1WJZA 2OT5A 4NXMO 2Q5ZA 4JTCB 4Z1VA 2XNDG 2HHHB 2PI4A 2IJIA 2F4VO 3IC9A 2WLHA 4QNHB 4LF8B 2WLKA 2PUSA 3IGAC 2RJZA 1YTFB 2ZR3A 1ROPA 3EVKA 4I0XB 2EJ7A 2ZM6O 3G71V 1BE3H 3Q4HB 5J2UA 5JH7A 4LF9O 1EFRG 1X4TA 5LA6B 4DV3O 1IBLB 3JARA 1KP2A 2LW7A 2UUBB 5F2VO 1W0JG 2PGGA 2QKSA 1OCZB 1W2BU 1K3EA 3FB7C 1MSWD 2R9AA 2AHZA 5EIBC 3E8HA 4DW0A 1VMGA 1WA8A 4JPRA 1SQQH 2JS3A 2AHYA 4H0LB 3OR6C 4PA6A 4FLXA 2GSMB 1N36O 5LGTA 2QWRB 3DGEA 3N2GA 4X62O 1AVMA 4QIWF 4U7NA 4DV1B 2QR4A 4DRXA 2EIMC 2IBZH 2WA4A 2LQTA 5JJEB 1TUBB 3AG2C 1LUWA 2NLJC 3B4SA 3K5OA 3STLC 1ZSPA 4ZI7A 3VQXA 2O57A 1S0VA 3OMAB 4X64O 3LSUA 2Y48A 4BW9A 1AI4A 3CCEV 4EB6A 4I9WA 2GUZA 4LF9B 4QE7A 3T4DA 2QWQB 3QVNA 1NVPD 3OUFA 3ML0A 2RCVA 1YI2V 2GV9A 1S77D 1ZL8A 3CCUV 4JI4B 2QEXV 4DUYB 1PNMA 5DECA 4DK0A 4Z2WA 2JEXA 1VIBA 3JCZA 4TQDA 4FLVA 4OX9B 4LF4O 1OCCC 3TK1A 2RNBA 4DR6B 1OCOB 5LOVB 2WLJA 5E1AC 2KG7B 4O2AB 1N0JA 4DV2B 2DYRB 1IXBA 4JI3O 3OAAG 3C90A 2ZXWB 1LUVA 1WNSA 3K0GA 3CCJV 4LWSB 1ZAUA 2Z3YA 3RYFB 4R6ZA 3DXRB 1PNLA 2JEUA 2HJFC 1JJ2U 2DYSB 5L3GA 2JGDB 2LO1A 1WP7A 5H6QA 4TOIA 2WLIB 2R72A 2AW9A 5IJ0A 1US6A 4DR1B 4JTDB 4AQYO 5L3CA 4OXSA 3CB2A 4PV1B 4X20B 3ZHVA 3ZHUA 1AJPA 3L9DA 1FPOA 3APOA 1XI1A 4LF6O 1VQ8V 1HWYA 3H01A 4IIJB 3KKYA 1AROP 1AP6A 2UXBO 4BW5A 1VQ7V 1VQOV 4UCTA 1QU7A 3B8NA 2ILMA 2ZE5A 1SQPH 4G28B 3A0HZ 3UCSC 3BVOA 3EFFK 2F95B 3D36C 2Q73A 1QLEC 1MZFA 3ABLB 4DR6O 4UCUA 4LF7O 3CXCU 4FZ1A 4MW8A 1NKDA 4I9QA 4EFEA 4U7OA 1SF9A 4HNAB 2CH7B 3D3QA 1FFXB 4FMTA 3M8AA 5EYPB 4WF9V 4RWUA 2HR3A 3FB5C 3BRCA 4UVAA 1E1RG 2ITDC 5BMVA 1N36B 3S3XA 1NT2B 2YIBD 1BGYH 2XTAA 4K8ZA 2L6LA 3MAQA 3OUSA 4J9YB 4JI6B 4UFZA 1KB9F 3OT7A 5LYJA 2RQ6A 2YI8A 2ZXWC 4MTGA 5AG2A 3U10A 3ZCCA 3FD9A 3CC2V 1H2MA 3UT5B 2Y4TA 5IY5C 4O2BB 2CK3G 4JAVA 1QQCA 2EIJC 4F4LA 4O4HA 3ZN1A 2UUCO 2QSAA 4K0KO 3B09A 3SJBC 4WBNA 3MHSC 2IJJA 1Y6XA 4F6EA 3JAWB 2A3QA 3BEHA 3HR0A 4DUZO 2QGNA 1GN4A 3CCLV 5A9GA 4FFBA 5KMGB 2P7TC 3TJTA 4DV6O 4RUEA 1EN5A 1PV0A 5CB4A 2IW5A 1WAZA 5B3SC 5FLXN 2GDSA 4NXNO 2YUAA 1EM1A 3ABMB 1NZ6A 4X9QA 3PN1A 2CE4A 2WLMA 3RN4A 1QHTA 3UO2A 3ZHQA 4NKGB 5KUKA 1A32A 4X65O 1MOFA 2EZPA 2YSUB 3BA8A 1L8DA 2UXDO 4FM2A 4MT8A 1DK1A 4JI1B 3E22A 4QJFB 1OZ0A 3TGUH 4B3TO 2UUAO 4GX1A 2BE3A 2MK3A 4B3TB 1P84F 4PELA 1M57B 5KX5B 3BFRA 1FYJA 1NJIW 1UFIA 3E8BA 2YXLA 4K0KB 1K97A 1K9MW 1XEQA 3W7WA 3CHXA 4PA3A 4H33A 5FPRA 1HR0O 2A0LA 1YTFD 4I7ZB 1XILA 5EBWC 2WPDG 1IBKB 4J10A 2QWNB 1QVFU 4GKJO 1TGOA 2UU9B 3N2GB 2E5LO 3B2EE 3CC4V 2Y69B 4TV9A 3JD3A 2V7QG 1R3KC 4PDLA 3HKDA 1AI6A 4MTFA 2B1GA 4B7EA 1XL6A 1AI7A 5JJJB 5JH7B 3T1HO 4JYAO 2YIDA 2IH3C 2FL4A 2A79B 5B1BB 4TWKA 1GN6A 4DR3O 2YXYA 2LW1A 3JSLA 5H2FZ 2Q9LA 1VQ4V 3AG1C 5EK0A 3VQYA 3CCRV 3JASA 3K0DA 4TT3G 3ZEDA 3FB6C 1ENVA 3DXRA 5IYBO 2KKWA 5JQGB 5J2TB 1V54B 3A0BZ 3J80N 1M90W 2FTKA 4JYBA 3E83A 4UV9A 4GT1A 1RFYA 2JS5A 4LR3A 3L74H 3K03A 4LFAB 5IWAO 4O4LA 3K9AA 4J7JA 1NQTA 5CN0A 4ZOLA 4X1KA 3T2MA 3D8CA 1HP8A 1PL4A 4GKKO 1KC8W 2BTQB 1JJOA 3KCYA 5LMUB 1QNMA 2IH1C 4JZ2A 3RW0A 1GTOA 1N33O 3R65A 2K9PA 2V1DA 1GM7A 3ZMSA 4YJ3A 4TSFG 2AGAA 5IJ9B 1HNWO 5H9CA 3JALA 5LHIA 4CS3A 1SRYA 2PYLA 1TUBA 5LHHA 1N34B 3MD0A 4ZIBA 2OWOA 1COWG 3N2KB 4K8XA 1PKXA 1Q3EA 2B5UA 3FB8C 5B5EZ 2JJ1G 4JAAA 5GTIZ 3JALB 4UUJC 2OCCC 3RYHB 2XAQA 4KUMA 5JCOC 4DYLA 3K04A 2P6JA 5FNVB 3HKCB 4DUYO 2DWEC 4G27B 5LGUA 4UB6Z 3JATA 3S3WA 2BTQA 4ZKIA 3W7UA 2YICA 1AJQA 1RP3B 2XASA 1HR0B 1SQFA 4TUYB 3ASNC 1SQXH 2EILB 1F4NA 3D36A 4I50A 2QM8A 5C8YB 4GUNA 4P9PA 2JVDA 2JIZG 4HAMA 3RVYA 4DV4B 1F7YA 2XAHA 1Z2GA 3K57A 4JI7B 2LFRA 4NR1A 2CAZC 2EZOA 1XBLA 3HKCA 4DR4B 4KP4A 3SPHA 4FM0A 2ZNJA 3C3TA 1VQNV 3SR2C 3AG3C 1URFA 3DC6A 3ZRXA 2PY5A 1FXKB 1J95A 2YI9A 1K92A 2BTOA 1Y76B 1AI5A 1MG1A 1MZEA 4O2BA 1K5SA 2CH7A 4NVPA 4LWSA 3K9SA 4EKWA 2DQ0A 1N0NA 4UXNA 4UCVA 2EULA 5HFLA 4JI8O 3CS5A 1IVSA 1P4RA 2QTOA 3ETQA 4YXWG 4MW3A 1R6NA 2QM4A 2KG7A 2DJVA 1YSCA 4XDJA 1U96A 3ZMUA 4JV5B 1Q90D 1Q7YW 3JAMN 1M5IA 1NR7A 4E2LA 1WLEA 1BCCH 2YDEA 1LNQA 1OV9A 2WLLA 3BHPA 3NR7A 5CA1B 2UUCB 2DE0X 2IU3A 3SYOA 4TV9B 5IWAB 5EC1C 5E79Z 5IT9N 3MDSA 1IBMB 5KX5A 1PD3A 5BR8B 4X66O 1IURA 5GTHZ 3ZRWB 4DV3B 4R8CA 2C2AA 4L8JA 1SQVH 3ABUA 3U11A 3BCCH 3H9VA 1GN3A 4LC1A 2XHBA 3WG7B 1BT8A 1QR8A 4NYKA 2OTJV 2ZT9B 2EIKC 2QA4V 4D6TH 3OEHG 2M6YA 4O4IB 2ZDIC 4NB5A 1AR1B 4X89A 5IE9A 2Q8VA 1XMOO 4TQFA 4GKKB 2CTWA 2CUGA 1S5LZ 4J7ZA 4FLWA 4LF8O 5KHIA 3J81N 1EZVH 3F5TA 1SA0B 5CBFA 4X1KB 2KSDA 4I4TA 1JX9A 1Y4MA 1GKFA 1N8RW 1K33A 3CJHA 1IXMA 5EIBD 2ZR2A 3QF7A 4JYYA 5EZYB 5HFMA 4H13B 3SPJA 1SS3A 5L3BA 3OM3B 4L87A 3CD6V 2JRIA 1GH6A 1FXVA 4PDRA 1YJWV 1IBMO 4LFCB 3CRAA 1YXBA 2F23A 2W0XA 3ASOC 4JI8B 1IZ3A 4JI3B 3DC5A 3LNMB 5A2QN 3OGIB 4GKJB 1NI8A 2FMLA 3JYCA 1NTMH 2LGQA 1QLEB 4PA9A 2AZ2A 4N21A 1K5QA 1EBOA 2UXNA 3RFRA 1ZLZA 1JA8A 5L3FA 4J80A 5EYPA 1GN2A 3X2QC 3SPCA 3ZJZA 5GONB 3T1YO 4FLZA 4HYOA 3UO3A 2P22C 4CH3A 4WCEV 1JFFA 1S5HC 4ZBMA 2R9IA 2VS0A 2EINB 2ZE8A 5KHHA 1IX9A 3BAAA 5CMUA 3OD4A 3JCUZ 1DTOA 4YIOA 4DR7B 4YIPA 2P06A 3CE2A 3W7SA 3QTCA 5KHKA 3H1IH 2W6JG 1KKCA 4LF6B 2GTAA 4X20A 1K7DA 1JCHA 2UXDB 3VBBA 1HNXB 4D7SA 5LXTA 1O9HA 4P30A 3CWBH 2EIJB 2HEPA 2PF4E 1XMQO 3QO5A 1OHHG 2CGNA 5LMNO 1JQ0A 3JD4A 1DF4A 4BIZA 5IJ0B 2D2CB 2QDOA 3T1HB 1M57C 2XAJA 3O65A 3OTFA 1SA0A 2ETNA 2JGUA 2VQEO 1VQ5V 3DTUB 2DW4A 3AG7A 2Q0OC 3F5WC 3CMAV 1WA8B 4X65B 3CCVV 1TA8A 4J7KA 2N74A 4UCSA 5JVDA 2Z5UA 2JDIG 4JAUA 1OJHA 2E5LB 1F51A 3AK3A 2XOKG 3SYCA 3C3SA 2K1EA 4JZGA 2KQXA 2ADQB 5FPOA 3CCSV 1I0HA 1IBKO 2CDYA 3B40A 4ASUG 1F23A 1TVKA 2DYRC 4FK5C 1KBHA 3ABMC 4ZOLB 2N05A 3ZRSA 1VF7A 4I55B 2B1IA 1I08A 3ABKB 4DV7B 1XREA 4DR3B 1DF5A 1G6UA 3E86A 5BY1A 1YJ9V 4ICGA 4JGSA 3ABKC 1WB8A 4HNAA 2JGDA 2QWOB 3OTOB 4GLXA 4JI7O 1Z5WA 2EBOA 4AI8A 1AILA 2FB5A 3ABTA 1S5JA 3BY6A 3VQVA 3UT5A 2BSKB 3PJSK 2QWPB 1BS3A 1AP5A 3SJAC 1I94O 4O4HB 5B3SB 1BQ0A 1YJNV 3N2KA 3OEEG 3E89A 3H1LH 4BAYA 3THOA 4WFAV 3SYQA 2MW2B 4IYHA 1VQ9V 2ZINA 2VQEB 2VRZA 1BSMA 1JMKC 4G2KA 3W7XA 5BMVB 2NNUA 2Q68A 4PJ0Z 1YIJV 3SGIA 1FS0G 2P90A 1P7BA 4DR7O 1EZJA 4DXWA 4J11A 4RAIA 3K06A 4WFBV 1IDSA 3H1HH 2EINC 1U97A 5H5NA 3OGCC 1Q81W 1EN6A 3QO7A 3P32A 1VQ6V 2P67A 2F43G 3K08A 5JJNB 5CA3A 1FJGB 3JARB 2Y4UA 3R66A 1XNQB 1PL0A 1Q82W 3WFVA 2ZKOA 4K35A 1SESA 4DRXB 2Y0IA 1SQBH 2CGOA 3TCUA 4LF5B 2HG5C 5B1AC 4JTAB 2X6AA 4FFBB 5KMGA 4UCOA 5FL7G 5D5QA 5D5PA 3APQA 1FXKA 1XQ8A 1YDXA 2YC0A 1VQKV 1M4UA 4N23A 4IL6Z 2X6CA 3FAVB 1I7FA 1YCIA 1YITV 2P4VA 3L70H 1H8HG 3L72H 1BL8A 5GW7A 4GX2A 1MABG 2ZE7A 5CA0A 2ATKC 1Q5OA 3TETA 1Z5VA 4UVBA 1M56B 2Q67A 1L1FA 1N4CA 3CP1A 4DR5B 1XMQB 3IC7A 2GUZB 4AHCA 2HVJC 5C8YA 4TUYA 1H8EG 3AG4B 3U0ZA 2PI5A 4O4JB 5LP6C 5LYJB 4MVMA 3VQWA 5TISZ 4BIUA 5IDJA 3M99B 1KP3A 3E8FA 4QGPA 1R6TA 1L0NH 4PI2A 4LFBO 3BABA 2EX3A 4JI5B 1W59A 1H2KA 2ITCC 4KFMA 2WWWA 3OE7G 1CEZA 1TUEB 2BCCH 4QPJA 3LSQA 1GM8A 1SKVA 1AR4A 4W4LA 3J7AU 5CBHA 3CCQV 3LDEA 4PDVA 3P30A 2XAGA 4KL1A 1NS1A 4PA4A 4PA7A 4NTWA 3ZRWA 3CCMV 4JYCA 1PP9H 1B06A 4P2ZA 1J5EO 2HFEC 3GWKC 4RUFA 3AG2B 4C7UA 1G1XB 3GB7C 4IT5A 4F6RA 4B08A 1I94B 1SERA 4IHJA 5J2TA 1QCEA 4JI0B 4DV7O 1NBMG 2HKOA 2WLLB 3KG2A 2DQ3A 2R70A 1P49A 5K1PA 1BQZA 1GRJA 4GX5A 1Y67A 4X8AA 1HW7A 1Y76A 5JCOA 3GWOA 2GHYA 3B8MA 1XNQO 3O9OA 1M1KW 5ITZB 3ABLC 2HHHO 1Q6HA 3JAWA 2AXTZ 5J9PC 2WA3A 1GAXA 1D2DA 3FKSG 2BOCC 4JI4O 4QE9A 2HLDG 1T5EA 5LA6A 3SYPA 2E3CA 1MSDA 4FLTA 4JI1O 1H2SB 1JVMA 4MTXA 4YY3O 5BZBA 1SC5B 3AG1B 1XMOB 3RT3C 1KKDA 3A2FA 1RSOA 4JI2O 4MS2A 5DM6V 3T1CA 4JI2B 2LJ2A 5LP6A 1F4MA 2NN4A 5DEDA 1OCZC 3LDCA 1SZXA 3OFNG 3RYHA 3WB1A 2DYSC 1YEWA 3L73H 3FFQA 1E79G 2YEVB 2BOBC 3K59A 4X64B 4OPAA 4HZ3A 5LHGA 2D3OW 4BIOA 2X6BA 1YF2A 1UJWB 4GYCB 2JK5C 2HP8A 1H38A 4J42A 4ZI7B 4FZ0A 2KB1A 5FNVA 1XHXA 4X1YB 2IM9A 2ZD9A 5L3EA 3I55V 1N32O 4IIJA 1B6QA 3OR7C 1N32B 1I5YA 4DUZB 3D3IA 2OCHA 3E8GA 3ZMVA 3LSSA 1XL4A 4O4LB 3I5DA 1OCCB 1K73W 3HB3B 4B3SB 4NXMB 2Y0PA 2ZQMA 4ZHQA 1KD1W 2EILC 1N34O 2P5OA 4CS4A 1VEWA 3WB2A 1BMFG 2GTSA 1S72V 4DR2B 4WFEA 5JQGA 5EC2C 3UM7A 2WLNA 5EBLC 2F93B 1S3JA 4MVZA 4ZHQB 5LGNA 1R3JC 3QNEA 1AJNA 3G4SV 1Q86W 1X59A 3GVMA 2OTLV 4IGGA 1Y74A 4BR6A 2H3OA 2BSKA 4CH6A 3ZMTA 5CA1A 4DV4O 1M9NA 4O2AA 4X66B 4W4KA 1IBLO 1SZTA 3RWRD 1Q6IA 1WB7A 1QLNA 1RM1C 1R1BA 2RDCA 4MVSA 2E74B 1K8AW 1W0KG 3OMNB 1JPXA 1VF6A 4DV0O 2R9RB 4I50B 4GCZA 1HNZO 4WBNB 2YEVA 4RQFA 1FJGO 5LL6Y 1M56C 2QE7G 5J2UB 4U3FH 4LP8A 3MHHC 3ZN0A 2GBOA 4DV5B 5K1XA 3H1JH 5LP6B 1N33B 1JOYA 4TV8A 1NH2D 3BPZA 5KHGA 3G67A 4OGQB 3CYOA 2VQFB 2Q0AA 3H1KH 2UUAB 2ZIMA 1R73A 3RYIB 4I5SA 2DN9A 2JJ2G 1HDJA 3K5LA 5C93A 1KQSU 2N04A 4CC5A 1R6KA 2QKCA 3K79A 1VP7A 3JD1A 1AR5A 1HNZB 2F66C 2X7RB 3CPWU 2OIGA 5KA6A 3KCXA 3M7MX 1XHZA 1KMIZ 4KXRA 3SPIA 2CTPA 1BHBA 2OIEA 2F1MA 4R7CA 2NR5A 2W6IG 1XNRO 4OX9O 3F7YC 1ZWIC 1KUQA 4TV8B 1FXHA 2DOSA 2XAFA 4BWAA 3JATB 1S76D 5EZYA 4DV2O 3T4ZA 1V55C 2ARHA 4D7TA 4NXNB 4LFAO 4DK1A 5BR8O 4XDLA 4J9ZB 5B1NA 2Q7GA 2Q6AA 3T1YB 3G6BA 3Q4HA 3E22B 4LF5O 5CBGA 4YHHB 2B9ZA 4CC6A 3RYCA 4XDKA 3CC7V 3SDLA 1HNXO 4I0XA 4DV6B 1B04A 3TXQA 2CTRA 3JSNA 3RYFA 4DV1O 4UB8Z 4EFBA 4NTYA 1FKAO 2VQFO 2YXHA 3IAYA 4RQEA 1Q8IA 4O4JA 4FPPA 4X1IB 1CPYA 4RO2A 4B3MO 5CB4B 3FX7A 1K4CC 1OCRC 2ZDIA 2ZE6A 4JYAB 2LGWA 4MTOA 2P4KA 4LH6A 2ODMA 2YIBA 1E1QG 4CH4A 4DO2A 1NR1A 3RVZA 4I4TB 1MNGA 3TXSA 5LOVA 1WPXA 2ZIOA 1GM9A 4WFGA 4HBNA 3CSXA 4JV5O 5LXTB 2EJRA 3JAKA 2FYUH 4FIPC 5JVDB 3RYCB 4FJCC 3CRQA 1KU9A 1TAEA 4PHZA 1CP9A 1I5XA 3JASB 3ZIAG 4B3RB 4DV5O 2DWDC 1ORQC 1VQPV 3LUTB 2RN9A 3WU2Z 4LNUA 4P9OA 1BZKA 2QM7A 4JASA 1V55B 1ZX3A 1FFXA 4DR4O 2H8PC 4NTXA 4UCRA 1XOUA 5L3DA 1WN7A 3HKBB 4YY3B 1Y66A 4CH5A 4DV0B 3SJQC 1FFTB 2L35A 3G6EV 2E75B 3P3PA 4AQYB 3SJCC 3JD0A 1NU1H 2XT9A 1VQLV 2A7WA 5DN6G 1M93A 1PM9A 1RM1B 3X2QB 4B3RO 1D5AA 3A8TA 3ZHSA 4WFHA 2RMKB 2VWKA 1NVPB 3EXAA 3CJHB 5LMNB 2IJHA 1DLBA 4LH7A 2WSSG 2IJKA 4Q6GA 1LR1A 1ZTEA 4H37A 4GZRB 1NTKH 4YHHO 2VWJA 4FFKA 1O9GA 4KHPO 3ICXA 1YVWA 3CXHF 5H6RA 1QR9A 2WAMA 3QG5A 2LP7A 5IYCO 2UXXA 2Q4PA 1YZBA 4B7KA 4Q20A 4O4IA 3AK2A 1OCRB 4FLUA 4LCUC 2QKAA 2UUBO 3LNNA 2UU9O 1QBZA 3FYIB 3ASOB 4R50A 4JF3A 2Q7EA 4F6RB 3ETDA 1VARA 3K3WA 4GX0A 2UXCO 4Z1MG 4YJ3B 2QTSA 1R3IC 2HVKC 5EBMC 1Q43A 3K5MA 3SPGA 4ABMA 5LBQA 3OTOO 4YJ2A 1V54C 2PTMA 3P3NA 3CRMA 1SETA 1TVKB 2FKXA 3A0RA 1NH2B 1VF6C 2UXBB 2EIMB 3AEIA 4U3JB 5IYZA 2A9HA 2YIAA 4XBFA 3N27A 4EEQA 1K4DC 1RPOA 2PZSA 4JI5O 1J5EB 2ZCEA 3I56V 4MSWC 4B3SO 3K58A 4IYIA 3IJ4A 4EB6B 1JFFB 2X0LA 3QO8A 4X88A 1H2LA 1P7GA 1VF5B 3UQ8A 4FVMA 2W0FC 4AILC 2AZ0A 4DR1O 4DR2O 3ZBHA 1WP8A 2M7WA 2E76B 3UKMA 3B77A 3IFXA 3HKBA 1ZUQA 4PD4F 3RYIA 3LDDA 4FM1A 3OW2U 2QJ1A 1GK9A 1B3QA 3AG3B 4WFFA 2WLIA 1R3LC 4OPHA 3ZRVA 5B1BC 4FLYA 3K5NA 3HKEB 3HPLC 4H44B 4X1YA 3ASNB 2ADPA 2A06H 4MVOA 2YS8A 5JWPA 1D5NA 3HKDB 1XDCA 4UV8A 1GO3F 5GONA 4LF4B 2PYJA 2IU0A 1Y74B 3VOUA 2Y69C 1K34A 4LF7B 4E4EA 3JAKB 5B66Z 4DR5O 1RSOB 2F4VB 3ZX6A 4PI0A 1G8MA 1H2GA 1FAFA 1MMMA 2LFSA 5CA0B 5KUMA 3ZHTA 2ZM6B 5IYDO 4K3AA 1AB3A 2ZNIA 4A5UB 3FAVA 1FXKC 4CZZA 3HKEA 3G80A 3EHBB 3FYEB 5ITZA 3RBZA 1WPBA 4JI0O 3BA9A 2HJDA 2Z0AA 4UVCA 4I55A 1ZL8B 1CXZB 3AK1A 3CRRA 3OMIB 4IHJB 1H2NA 1L0LH 4X1IA 1JR9A 3ETGA 4U3JA 5IYZB 3CRCA 3CEIA 1Q6UA 3WB0A 5BXZA 4LFCO 3CMEV 5KLVH 4KHPB 1V9PA 2Q7HA 5KHJA 4LNUB 2DMXA 1VQMV 3STZC 3WG7C 1THZA 3L71H 3E35A 4CBCA 1RPRA
chains in the Genus database with same CATH topology
1SQQH 3CXHF 1PPJH 1BE3H 3H1JH 3L73H 2BCCH 3L70H 1L0LH 3L72H 2A06H 2IBZH 4D6TH 2FYUH 3L74H 4PD4F 1NU1H 1BGYH 3H1IH 1SQBH 1NTZH 3L75H 3H1KH 3H1HH 1L0NH 1BCCH 5KLVH 1KB9F 1KYOF 3TGUH 1NTKH 1SQVH 3CWBH 3CX5F 1SQXH 3BCCH 3L71H 1P84F 3H1LH 4U3FH 1SQPH 1NTMH 1EZVH 1PP9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ H;  3CXH F;  1PPJ H;  1BE3 H;  3H1J H;  3L73 H;  2BCC H;  3L70 H;  1L0L H;  3L72 H;  2A06 H;  2IBZ H;  4D6T H;  2FYU H;  3L74 H;  4PD4 F;  1NU1 H;  1BGY H;  3H1I H;  1SQB H;  1NTZ H;  3L75 H;  3H1K H;  3H1H H;  1L0N H;  1BCC H;  5KLV H;  1KB9 F;  1KYO F;  3TGU H;  1NTK H;  1SQV H;  3CWB H;  3CX5 F;  1SQX H;  3BCC H;  3L71 H;  1P84 F;  3H1L H;  4U3F H;  1SQP H;  1NTM H;  1EZV H;  1PP9 H; 
#chains in the Genus database with same CATH topology
 2EIK B;  2XUM A;  4X62 B;  1PPJ H;  3AG4 C;  3E2E A;  1G4Y B;  2OYQ A;  1XNR B;  2H94 A;  3ETE A;  2OCC B;  1UPG A;  3NXS A;  4QPK A;  1FD9 A;  3W7T A;  4B3M B;  5KA5 A;  1KYO F;  1BHA A;  4LFB B;  1YHQ V;  2V4D A;  4LBE C;  4PDM A;  3KZI Z;  3JD2 A;  4YJ2 B;  1GMG A;  4J41 A;  3DSQ A;  4MVQ A;  3ZHR A;  4DW1 A;  1PNK A;  4MVU A;  1NTZ H;  3L75 H;  1QVG U;  5KAF Z;  3RGB A;  1OCO C;  1MA1 A;  5IY5 B;  5KAI Z;  2Q69 A;  1SQG A;  5LMU O;  4JI6 O;  2G38 A;  3CX5 F;  2CTQ A;  3ZS8 C;  5B1A B;  2UXC B;  4MVR A;  4CS2 A;  1KEC A;  3SYA A;  1EN4 A;  5IJ9 A;  1XUQ A;  3ZMZ A;  1HNW B;  3F7V C;  1DGS A;  5B1O A;  1WJZ A;  2OT5 A;  4NXM O;  2Q5Z A;  4JTC B;  4Z1V A;  2XND G;  2HHH B;  2PI4 A;  2IJI A;  2F4V O;  3IC9 A;  2WLH A;  4QNH B;  4LF8 B;  2WLK A;  2PUS A;  3IGA C;  2RJZ A;  1YTF B;  2ZR3 A;  1ROP A;  3EVK A;  4I0X B;  2EJ7 A;  2ZM6 O;  3G71 V;  1BE3 H;  3Q4H B;  5J2U A;  5JH7 A;  4LF9 O;  1EFR G;  1X4T A;  5LA6 B;  4DV3 O;  1IBL B;  3JAR A;  1KP2 A;  2LW7 A;  2UUB B;  5F2V O;  1W0J G;  2PGG A;  2QKS A;  1OCZ B;  1W2B U;  1K3E A;  3FB7 C;  1MSW D;  2R9A A;  2AHZ A;  5EIB C;  3E8H A;  4DW0 A;  1VMG A;  1WA8 A;  4JPR A;  1SQQ H;  2JS3 A;  2AHY A;  4H0L B;  3OR6 C;  4PA6 A;  4FLX A;  2GSM B;  1N36 O;  5LGT A;  2QWR B;  3DGE A;  3N2G A;  4X62 O;  1AVM A;  4QIW F;  4U7N A;  4DV1 B;  2QR4 A;  4DRX A;  2EIM C;  2IBZ H;  2WA4 A;  2LQT A;  5JJE B;  1TUB B;  3AG2 C;  1LUW A;  2NLJ C;  3B4S A;  3K5O A;  3STL C;  1ZSP A;  4ZI7 A;  3VQX A;  2O57 A;  1S0V A;  3OMA B;  4X64 O;  3LSU A;  2Y48 A;  4BW9 A;  1AI4 A;  3CCE V;  4EB6 A;  4I9W A;  2GUZ A;  4LF9 B;  4QE7 A;  3T4D A;  2QWQ B;  3QVN A;  1NVP D;  3OUF A;  3ML0 A;  2RCV A;  1YI2 V;  2GV9 A;  1S77 D;  1ZL8 A;  3CCU V;  4JI4 B;  2QEX V;  4DUY B;  1PNM A;  5DEC A;  4DK0 A;  4Z2W A;  2JEX A;  1VIB A;  3JCZ A;  4TQD A;  4FLV A;  4OX9 B;  4LF4 O;  1OCC C;  3TK1 A;  2RNB A;  4DR6 B;  1OCO B;  5LOV B;  2WLJ A;  5E1A C;  2KG7 B;  4O2A B;  1N0J A;  4DV2 B;  2DYR B;  1IXB A;  4JI3 O;  3OAA G;  3C90 A;  2ZXW B;  1LUV A;  1WNS A;  3K0G A;  3CCJ V;  4LWS B;  1ZAU A;  2Z3Y A;  3RYF B;  4R6Z A;  3DXR B;  1PNL A;  2JEU A;  2HJF C;  1JJ2 U;  2DYS B;  5L3G A;  2JGD B;  2LO1 A;  1WP7 A;  5H6Q A;  4TOI A;  2WLI B;  2R72 A;  2AW9 A;  5IJ0 A;  1US6 A;  4DR1 B;  4JTD B;  4AQY O;  5L3C A;  4OXS A;  3CB2 A;  4PV1 B;  4X20 B;  3ZHV A;  3ZHU A;  1AJP A;  3L9D A;  1FPO A;  3APO A;  1XI1 A;  4LF6 O;  1VQ8 V;  1HWY A;  3H01 A;  4IIJ B;  3KKY A;  1ARO P;  1AP6 A;  2UXB O;  4BW5 A;  1VQ7 V;  1VQO V;  4UCT A;  1QU7 A;  3B8N A;  2ILM A;  2ZE5 A;  1SQP H;  4G28 B;  3A0H Z;  3UCS C;  3BVO A;  3EFF K;  2F95 B;  3D36 C;  2Q73 A;  1QLE C;  1MZF A;  3ABL B;  4DR6 O;  4UCU A;  4LF7 O;  3CXC U;  4FZ1 A;  4MW8 A;  1NKD A;  4I9Q A;  4EFE A;  4U7O A;  1SF9 A;  4HNA B;  2CH7 B;  3D3Q A;  1FFX B;  4FMT A;  3M8A A;  5EYP B;  4WF9 V;  4RWU A;  2HR3 A;  3FB5 C;  3BRC A;  4UVA A;  1E1R G;  2ITD C;  5BMV A;  1N36 B;  3S3X A;  1NT2 B;  2YIB D;  1BGY H;  2XTA A;  4K8Z A;  2L6L A;  3MAQ A;  3OUS A;  4J9Y B;  4JI6 B;  4UFZ A;  1KB9 F;  3OT7 A;  5LYJ A;  2RQ6 A;  2YI8 A;  2ZXW C;  4MTG A;  5AG2 A;  3U10 A;  3ZCC A;  3FD9 A;  3CC2 V;  1H2M A;  3UT5 B;  2Y4T A;  5IY5 C;  4O2B B;  2CK3 G;  4JAV A;  1QQC A;  2EIJ C;  4F4L A;  4O4H A;  3ZN1 A;  2UUC O;  2QSA A;  4K0K O;  3B09 A;  3SJB C;  4WBN A;  3MHS C;  2IJJ A;  1Y6X A;  4F6E A;  3JAW B;  2A3Q A;  3BEH A;  3HR0 A;  4DUZ O;  2QGN A;  1GN4 A;  3CCL V;  5A9G A;  4FFB A;  5KMG B;  2P7T C;  3TJT A;  4DV6 O;  4RUE A;  1EN5 A;  1PV0 A;  5CB4 A;  2IW5 A;  1WAZ A;  5B3S C;  5FLX N;  2GDS A;  4NXN O;  2YUA A;  1EM1 A;  3ABM B;  1NZ6 A;  4X9Q A;  3PN1 A;  2CE4 A;  2WLM A;  3RN4 A;  1QHT A;  3UO2 A;  3ZHQ A;  4NKG B;  5KUK A;  1A32 A;  4X65 O;  1MOF A;  2EZP A;  2YSU B;  3BA8 A;  1L8D A;  2UXD O;  4FM2 A;  4MT8 A;  1DK1 A;  4JI1 B;  3E22 A;  4QJF B;  1OZ0 A;  3TGU H;  4B3T O;  2UUA O;  4GX1 A;  2BE3 A;  2MK3 A;  4B3T B;  1P84 F;  4PEL A;  1M57 B;  5KX5 B;  3BFR A;  1FYJ A;  1NJI W;  1UFI A;  3E8B A;  2YXL A;  4K0K B;  1K97 A;  1K9M W;  1XEQ A;  3W7W A;  3CHX A;  4PA3 A;  4H33 A;  5FPR A;  1HR0 O;  2A0L A;  1YTF D;  4I7Z B;  1XIL A;  5EBW C;  2WPD G;  1IBK B;  4J10 A;  2QWN B;  1QVF U;  4GKJ O;  1TGO A;  2UU9 B;  3N2G B;  2E5L O;  3B2E E;  3CC4 V;  2Y69 B;  4TV9 A;  3JD3 A;  2V7Q G;  1R3K C;  4PDL A;  3HKD A;  1AI6 A;  4MTF A;  2B1G A;  4B7E A;  1XL6 A;  1AI7 A;  5JJJ B;  5JH7 B;  3T1H O;  4JYA O;  2YID A;  2IH3 C;  2FL4 A;  2A79 B;  5B1B B;  4TWK A;  1GN6 A;  4DR3 O;  2YXY A;  2LW1 A;  3JSL A;  5H2F Z;  2Q9L A;  1VQ4 V;  3AG1 C;  5EK0 A;  3VQY A;  3CCR V;  3JAS A;  3K0D A;  4TT3 G;  3ZED A;  3FB6 C;  1ENV A;  3DXR A;  5IYB O;  2KKW A;  5JQG B;  5J2T B;  1V54 B;  3A0B Z;  3J80 N;  1M90 W;  2FTK A;  4JYB A;  3E83 A;  4UV9 A;  4GT1 A;  1RFY A;  2JS5 A;  4LR3 A;  3L74 H;  3K03 A;  4LFA B;  5IWA O;  4O4L A;  3K9A A;  4J7J A;  1NQT A;  5CN0 A;  4ZOL A;  4X1K A;  3T2M A;  3D8C A;  1HP8 A;  1PL4 A;  4GKK O;  1KC8 W;  2BTQ B;  1JJO A;  3KCY A;  5LMU B;  1QNM A;  2IH1 C;  4JZ2 A;  3RW0 A;  1GTO A;  1N33 O;  3R65 A;  2K9P A;  2V1D A;  1GM7 A;  3ZMS A;  4YJ3 A;  4TSF G;  2AGA A;  5IJ9 B;  1HNW O;  5H9C A;  3JAL A;  5LHI A;  4CS3 A;  1SRY A;  2PYL A;  1TUB A;  5LHH A;  1N34 B;  3MD0 A;  4ZIB A;  2OWO A;  1COW G;  3N2K B;  4K8X A;  1PKX A;  1Q3E A;  2B5U A;  3FB8 C;  5B5E Z;  2JJ1 G;  4JAA A;  5GTI Z;  3JAL B;  4UUJ C;  2OCC C;  3RYH B;  2XAQ A;  4KUM A;  5JCO C;  4DYL A;  3K04 A;  2P6J A;  5FNV B;  3HKC B;  4DUY O;  2DWE C;  4G27 B;  5LGU A;  4UB6 Z;  3JAT A;  3S3W A;  2BTQ A;  4ZKI A;  3W7U A;  2YIC A;  1AJQ A;  1RP3 B;  2XAS A;  1HR0 B;  1SQF A;  4TUY B;  3ASN C;  1SQX H;  2EIL B;  1F4N A;  3D36 A;  4I50 A;  2QM8 A;  5C8Y B;  4GUN A;  4P9P A;  2JVD A;  2JIZ G;  4HAM A;  3RVY A;  4DV4 B;  1F7Y A;  2XAH A;  1Z2G A;  3K57 A;  4JI7 B;  2LFR A;  4NR1 A;  2CAZ C;  2EZO A;  1XBL A;  3HKC A;  4DR4 B;  4KP4 A;  3SPH A;  4FM0 A;  2ZNJ A;  3C3T A;  1VQN V;  3SR2 C;  3AG3 C;  1URF A;  3DC6 A;  3ZRX A;  2PY5 A;  1FXK B;  1J95 A;  2YI9 A;  1K92 A;  2BTO A;  1Y76 B;  1AI5 A;  1MG1 A;  1MZE A;  4O2B A;  1K5S A;  2CH7 A;  4NVP A;  4LWS A;  3K9S A;  4EKW A;  2DQ0 A;  1N0N A;  4UXN A;  4UCV A;  2EUL A;  5HFL A;  4JI8 O;  3CS5 A;  1IVS A;  1P4R A;  2QTO A;  3ETQ A;  4YXW G;  4MW3 A;  1R6N A;  2QM4 A;  2KG7 A;  2DJV A;  1YSC A;  4XDJ A;  1U96 A;  3ZMU A;  4JV5 B;  1Q90 D;  1Q7Y W;  3JAM N;  1M5I A;  1NR7 A;  4E2L A;  1WLE A;  1BCC H;  2YDE A;  1LNQ A;  1OV9 A;  2WLL A;  3BHP A;  3NR7 A;  5CA1 B;  2UUC B;  2DE0 X;  2IU3 A;  3SYO A;  4TV9 B;  5IWA B;  5EC1 C;  5E79 Z;  5IT9 N;  3MDS A;  1IBM B;  5KX5 A;  1PD3 A;  5BR8 B;  4X66 O;  1IUR A;  5GTH Z;  3ZRW B;  4DV3 B;  4R8C A;  2C2A A;  4L8J A;  1SQV H;  3ABU A;  3U11 A;  3BCC H;  3H9V A;  1GN3 A;  4LC1 A;  2XHB A;  3WG7 B;  1BT8 A;  1QR8 A;  4NYK A;  2OTJ V;  2ZT9 B;  2EIK C;  2QA4 V;  4D6T H;  3OEH G;  2M6Y A;  4O4I B;  2ZDI C;  4NB5 A;  1AR1 B;  4X89 A;  5IE9 A;  2Q8V A;  1XMO O;  4TQF A;  4GKK B;  2CTW A;  2CUG A;  1S5L Z;  4J7Z A;  4FLW A;  4LF8 O;  5KHI A;  3J81 N;  1EZV H;  3F5T A;  1SA0 B;  5CBF A;  4X1K B;  2KSD A;  4I4T A;  1JX9 A;  1Y4M A;  1GKF A;  1N8R W;  1K33 A;  3CJH A;  1IXM A;  5EIB D;  2ZR2 A;  3QF7 A;  4JYY A;  5EZY B;  5HFM A;  4H13 B;  3SPJ A;  1SS3 A;  5L3B A;  3OM3 B;  4L87 A;  3CD6 V;  2JRI A;  1GH6 A;  1FXV A;  4PDR A;  1YJW V;  1IBM O;  4LFC B;  3CRA A;  1YXB A;  2F23 A;  2W0X A;  3ASO C;  4JI8 B;  1IZ3 A;  4JI3 B;  3DC5 A;  3LNM B;  5A2Q N;  3OGI B;  4GKJ B;  1NI8 A;  2FML A;  3JYC A;  1NTM H;  2LGQ A;  1QLE B;  4PA9 A;  2AZ2 A;  4N21 A;  1K5Q A;  1EBO A;  2UXN A;  3RFR A;  1ZLZ A;  1JA8 A;  5L3F A;  4J80 A;  5EYP A;  1GN2 A;  3X2Q C;  3SPC A;  3ZJZ A;  5GON B;  3T1Y O;  4FLZ A;  4HYO A;  3UO3 A;  2P22 C;  4CH3 A;  4WCE V;  1JFF A;  1S5H C;  4ZBM A;  2R9I A;  2VS0 A;  2EIN B;  2ZE8 A;  5KHH A;  1IX9 A;  3BAA A;  5CMU A;  3OD4 A;  3JCU Z;  1DTO A;  4YIO A;  4DR7 B;  4YIP A;  2P06 A;  3CE2 A;  3W7S A;  3QTC A;  5KHK A;  3H1I H;  2W6J G;  1KKC A;  4LF6 B;  2GTA A;  4X20 A;  1K7D A;  1JCH A;  2UXD B;  3VBB A;  1HNX B;  4D7S A;  5LXT A;  1O9H A;  4P30 A;  3CWB H;  2EIJ B;  2HEP A;  2PF4 E;  1XMQ O;  3QO5 A;  1OHH G;  2CGN A;  5LMN O;  1JQ0 A;  3JD4 A;  1DF4 A;  4BIZ A;  5IJ0 B;  2D2C B;  2QDO A;  3T1H B;  1M57 C;  2XAJ A;  3O65 A;  3OTF A;  1SA0 A;  2ETN A;  2JGU A;  2VQE O;  1VQ5 V;  3DTU B;  2DW4 A;  3AG7 A;  2Q0O C;  3F5W C;  3CMA V;  1WA8 B;  4X65 B;  3CCV V;  1TA8 A;  4J7K A;  2N74 A;  4UCS A;  5JVD A;  2Z5U A;  2JDI G;  4JAU A;  1OJH A;  2E5L B;  1F51 A;  3AK3 A;  2XOK G;  3SYC A;  3C3S A;  2K1E A;  4JZG A;  2KQX A;  2ADQ B;  5FPO A;  3CCS V;  1I0H A;  1IBK O;  2CDY A;  3B40 A;  4ASU G;  1F23 A;  1TVK A;  2DYR C;  4FK5 C;  1KBH A;  3ABM C;  4ZOL B;  2N05 A;  3ZRS A;  1VF7 A;  4I55 B;  2B1I A;  1I08 A;  3ABK B;  4DV7 B;  1XRE A;  4DR3 B;  1DF5 A;  1G6U A;  3E86 A;  5BY1 A;  1YJ9 V;  4ICG A;  4JGS A;  3ABK C;  1WB8 A;  4HNA A;  2JGD A;  2QWO B;  3OTO B;  4GLX A;  4JI7 O;  1Z5W A;  2EBO A;  4AI8 A;  1AIL A;  2FB5 A;  3ABT A;  1S5J A;  3BY6 A;  3VQV A;  3UT5 A;  2BSK B;  3PJS K;  2QWP B;  1BS3 A;  1AP5 A;  3SJA C;  1I94 O;  4O4H B;  5B3S B;  1BQ0 A;  1YJN V;  3N2K A;  3OEE G;  3E89 A;  3H1L H;  4BAY A;  3THO A;  4WFA V;  3SYQ A;  2MW2 B;  4IYH A;  1VQ9 V;  2ZIN A;  2VQE B;  2VRZ A;  1BSM A;  1JMK C;  4G2K A;  3W7X A;  5BMV B;  2NNU A;  2Q68 A;  4PJ0 Z;  1YIJ V;  3SGI A;  1FS0 G;  2P90 A;  1P7B A;  4DR7 O;  1EZJ A;  4DXW A;  4J11 A;  4RAI A;  3K06 A;  4WFB V;  1IDS A;  3H1H H;  2EIN C;  1U97 A;  5H5N A;  3OGC C;  1Q81 W;  1EN6 A;  3QO7 A;  3P32 A;  1VQ6 V;  2P67 A;  2F43 G;  3K08 A;  5JJN B;  5CA3 A;  1FJG B;  3JAR B;  2Y4U A;  3R66 A;  1XNQ B;  1PL0 A;  1Q82 W;  3WFV A;  2ZKO A;  4K35 A;  1SES A;  4DRX B;  2Y0I A;  1SQB H;  2CGO A;  3TCU A;  4LF5 B;  2HG5 C;  5B1A C;  4JTA B;  2X6A A;  4FFB B;  5KMG A;  4UCO A;  5FL7 G;  5D5Q A;  5D5P A;  3APQ A;  1FXK A;  1XQ8 A;  1YDX A;  2YC0 A;  1VQK V;  1M4U A;  4N23 A;  4IL6 Z;  2X6C A;  3FAV B;  1I7F A;  1YCI A;  1YIT V;  2P4V A;  3L70 H;  1H8H G;  3L72 H;  1BL8 A;  5GW7 A;  4GX2 A;  1MAB G;  2ZE7 A;  5CA0 A;  2ATK C;  1Q5O A;  3TET A;  1Z5V A;  4UVB A;  1M56 B;  2Q67 A;  1L1F A;  1N4C A;  3CP1 A;  4DR5 B;  1XMQ B;  3IC7 A;  2GUZ B;  4AHC A;  2HVJ C;  5C8Y A;  4TUY A;  1H8E G;  3AG4 B;  3U0Z A;  2PI5 A;  4O4J B;  5LP6 C;  5LYJ B;  4MVM A;  3VQW A;  5TIS Z;  4BIU A;  5IDJ A;  3M99 B;  1KP3 A;  3E8F A;  4QGP A;  1R6T A;  1L0N H;  4PI2 A;  4LFB O;  3BAB A;  2EX3 A;  4JI5 B;  1W59 A;  1H2K A;  2ITC C;  4KFM A;  2WWW A;  3OE7 G;  1CEZ A;  1TUE B;  2BCC H;  4QPJ A;  3LSQ A;  1GM8 A;  1SKV A;  1AR4 A;  4W4L A;  3J7A U;  5CBH A;  3CCQ V;  3LDE A;  4PDV A;  3P30 A;  2XAG A;  4KL1 A;  1NS1 A;  4PA4 A;  4PA7 A;  4NTW A;  3ZRW A;  3CCM V;  4JYC A;  1PP9 H;  1B06 A;  4P2Z A;  1J5E O;  2HFE C;  3GWK C;  4RUF A;  3AG2 B;  4C7U A;  1G1X B;  3GB7 C;  4IT5 A;  4F6R A;  4B08 A;  1I94 B;  1SER A;  4IHJ A;  5J2T A;  1QCE A;  4JI0 B;  4DV7 O;  1NBM G;  2HKO A;  2WLL B;  3KG2 A;  2DQ3 A;  2R70 A;  1P49 A;  5K1P A;  1BQZ A;  1GRJ A;  4GX5 A;  1Y67 A;  4X8A A;  1HW7 A;  1Y76 A;  5JCO A;  3GWO A;  2GHY A;  3B8M A;  1XNQ O;  3O9O A;  1M1K W;  5ITZ B;  3ABL C;  2HHH O;  1Q6H A;  3JAW A;  2AXT Z;  5J9P C;  2WA3 A;  1GAX A;  1D2D A;  3FKS G;  2BOC C;  4JI4 O;  4QE9 A;  2HLD G;  1T5E A;  5LA6 A;  3SYP A;  2E3C A;  1MSD A;  4FLT A;  4JI1 O;  1H2S B;  1JVM A;  4MTX A;  4YY3 O;  5BZB A;  1SC5 B;  3AG1 B;  1XMO B;  3RT3 C;  1KKD A;  3A2F A;  1RSO A;  4JI2 O;  4MS2 A;  5DM6 V;  3T1C A;  4JI2 B;  2LJ2 A;  5LP6 A;  1F4M A;  2NN4 A;  5DED A;  1OCZ C;  3LDC A;  1SZX A;  3OFN G;  3RYH A;  3WB1 A;  2DYS C;  1YEW A;  3L73 H;  3FFQ A;  1E79 G;  2YEV B;  2BOB C;  3K59 A;  4X64 B;  4OPA A;  4HZ3 A;  5LHG A;  2D3O W;  4BIO A;  2X6B A;  1YF2 A;  1UJW B;  4GYC B;  2JK5 C;  2HP8 A;  1H38 A;  4J42 A;  4ZI7 B;  4FZ0 A;  2KB1 A;  5FNV A;  1XHX A;  4X1Y B;  2IM9 A;  2ZD9 A;  5L3E A;  3I55 V;  1N32 O;  4IIJ A;  1B6Q A;  3OR7 C;  1N32 B;  1I5Y A;  4DUZ B;  3D3I A;  2OCH A;  3E8G A;  3ZMV A;  3LSS A;  1XL4 A;  4O4L B;  3I5D A;  1OCC B;  1K73 W;  3HB3 B;  4B3S B;  4NXM B;  2Y0P A;  2ZQM A;  4ZHQ A;  1KD1 W;  2EIL C;  1N34 O;  2P5O A;  4CS4 A;  1VEW A;  3WB2 A;  1BMF G;  2GTS A;  1S72 V;  4DR2 B;  4WFE A;  5JQG A;  5EC2 C;  3UM7 A;  2WLN A;  5EBL C;  2F93 B;  1S3J A;  4MVZ A;  4ZHQ B;  5LGN A;  1R3J C;  3QNE A;  1AJN A;  3G4S V;  1Q86 W;  1X59 A;  3GVM A;  2OTL V;  4IGG A;  1Y74 A;  4BR6 A;  2H3O A;  2BSK A;  4CH6 A;  3ZMT A;  5CA1 A;  4DV4 O;  1M9N A;  4O2A A;  4X66 B;  4W4K A;  1IBL O;  1SZT A;  3RWR D;  1Q6I A;  1WB7 A;  1QLN A;  1RM1 C;  1R1B A;  2RDC A;  4MVS A;  2E74 B;  1K8A W;  1W0K G;  3OMN B;  1JPX A;  1VF6 A;  4DV0 O;  2R9R B;  4I50 B;  4GCZ A;  1HNZ O;  4WBN B;  2YEV A;  4RQF A;  1FJG O;  5LL6 Y;  1M56 C;  2QE7 G;  5J2U B;  4U3F H;  4LP8 A;  3MHH C;  3ZN0 A;  2GBO A;  4DV5 B;  5K1X A;  3H1J H;  5LP6 B;  1N33 B;  1JOY A;  4TV8 A;  1NH2 D;  3BPZ A;  5KHG A;  3G67 A;  4OGQ B;  3CYO A;  2VQF B;  2Q0A A;  3H1K H;  2UUA B;  2ZIM A;  1R73 A;  3RYI B;  4I5S A;  2DN9 A;  2JJ2 G;  1HDJ A;  3K5L A;  5C93 A;  1KQS U;  2N04 A;  4CC5 A;  1R6K A;  2QKC A;  3K79 A;  1VP7 A;  3JD1 A;  1AR5 A;  1HNZ B;  2F66 C;  2X7R B;  3CPW U;  2OIG A;  5KA6 A;  3KCX A;  3M7M X;  1XHZ A;  1KMI Z;  4KXR A;  3SPI A;  2CTP A;  1BHB A;  2OIE A;  2F1M A;  4R7C A;  2NR5 A;  2W6I G;  1XNR O;  4OX9 O;  3F7Y C;  1ZWI C;  1KUQ A;  4TV8 B;  1FXH A;  2DOS A;  2XAF A;  4BWA A;  3JAT B;  1S76 D;  5EZY A;  4DV2 O;  3T4Z A;  1V55 C;  2ARH A;  4D7T A;  4NXN B;  4LFA O;  4DK1 A;  5BR8 O;  4XDL A;  4J9Z B;  5B1N A;  2Q7G A;  2Q6A A;  3T1Y B;  3G6B A;  3Q4H A;  3E22 B;  4LF5 O;  5CBG A;  4YHH B;  2B9Z A;  4CC6 A;  3RYC A;  4XDK A;  3CC7 V;  3SDL A;  1HNX O;  4I0X A;  4DV6 B;  1B04 A;  3TXQ A;  2CTR A;  3JSN A;  3RYF A;  4DV1 O;  4UB8 Z;  4EFB A;  4NTY A;  1FKA O;  2VQF O;  2YXH A;  3IAY A;  4RQE A;  1Q8I A;  4O4J A;  4FPP A;  4X1I B;  1CPY A;  4RO2 A;  4B3M O;  5CB4 B;  3FX7 A;  1K4C C;  1OCR C;  2ZDI A;  2ZE6 A;  4JYA B;  2LGW A;  4MTO A;  2P4K A;  4LH6 A;  2ODM A;  2YIB A;  1E1Q G;  4CH4 A;  4DO2 A;  1NR1 A;  3RVZ A;  4I4T B;  1MNG A;  3TXS A;  5LOV A;  1WPX A;  2ZIO A;  1GM9 A;  4WFG A;  4HBN A;  3CSX A;  4JV5 O;  5LXT B;  2EJR A;  3JAK A;  2FYU H;  4FIP C;  5JVD B;  3RYC B;  4FJC C;  3CRQ A;  1KU9 A;  1TAE A;  4PHZ A;  1CP9 A;  1I5X A;  3JAS B;  3ZIA G;  4B3R B;  4DV5 O;  2DWD C;  1ORQ C;  1VQP V;  3LUT B;  2RN9 A;  3WU2 Z;  4LNU A;  4P9O A;  1BZK A;  2QM7 A;  4JAS A;  1V55 B;  1ZX3 A;  1FFX A;  4DR4 O;  2H8P C;  4NTX A;  4UCR A;  1XOU A;  5L3D A;  1WN7 A;  3HKB B;  4YY3 B;  1Y66 A;  4CH5 A;  4DV0 B;  3SJQ C;  1FFT B;  2L35 A;  3G6E V;  2E75 B;  3P3P A;  4AQY B;  3SJC C;  3JD0 A;  1NU1 H;  2XT9 A;  1VQL V;  2A7W A;  5DN6 G;  1M93 A;  1PM9 A;  1RM1 B;  3X2Q B;  4B3R O;  1D5A A;  3A8T A;  3ZHS A;  4WFH A;  2RMK B;  2VWK A;  1NVP B;  3EXA A;  3CJH B;  5LMN B;  2IJH A;  1DLB A;  4LH7 A;  2WSS G;  2IJK A;  4Q6G A;  1LR1 A;  1ZTE A;  4H37 A;  4GZR B;  1NTK H;  4YHH O;  2VWJ A;  4FFK A;  1O9G A;  4KHP O;  3ICX A;  1YVW A;  3CXH F;  5H6R A;  1QR9 A;  2WAM A;  3QG5 A;  2LP7 A;  5IYC O;  2UXX A;  2Q4P A;  1YZB A;  4B7K A;  4Q20 A;  4O4I A;  3AK2 A;  1OCR B;  4FLU A;  4LCU C;  2QKA A;  2UUB O;  3LNN A;  2UU9 O;  1QBZ A;  3FYI B;  3ASO B;  4R50 A;  4JF3 A;  2Q7E A;  4F6R B;  3ETD A;  1VAR A;  3K3W A;  4GX0 A;  2UXC O;  4Z1M G;  4YJ3 B;  2QTS A;  1R3I C;  2HVK C;  5EBM C;  1Q43 A;  3K5M A;  3SPG A;  4ABM A;  5LBQ A;  3OTO O;  4YJ2 A;  1V54 C;  2PTM A;  3P3N A;  3CRM A;  1SET A;  1TVK B;  2FKX A;  3A0R A;  1NH2 B;  1VF6 C;  2UXB B;  2EIM B;  3AEI A;  4U3J B;  5IYZ A;  2A9H A;  2YIA A;  4XBF A;  3N27 A;  4EEQ A;  1K4D C;  1RPO A;  2PZS A;  4JI5 O;  1J5E B;  2ZCE A;  3I56 V;  4MSW C;  4B3S O;  3K58 A;  4IYI A;  3IJ4 A;  4EB6 B;  1JFF B;  2X0L A;  3QO8 A;  4X88 A;  1H2L A;  1P7G A;  1VF5 B;  3UQ8 A;  4FVM A;  2W0F C;  4AIL C;  2AZ0 A;  4DR1 O;  4DR2 O;  3ZBH A;  1WP8 A;  2M7W A;  2E76 B;  3UKM A;  3B77 A;  3IFX A;  3HKB A;  1ZUQ A;  4PD4 F;  3RYI A;  3LDD A;  4FM1 A;  3OW2 U;  2QJ1 A;  1GK9 A;  1B3Q A;  3AG3 B;  4WFF A;  2WLI A;  1R3L C;  4OPH A;  3ZRV A;  5B1B C;  4FLY A;  3K5N A;  3HKE B;  3HPL C;  4H44 B;  4X1Y A;  3ASN B;  2ADP A;  2A06 H;  4MVO A;  2YS8 A;  5JWP A;  1D5N A;  3HKD B;  1XDC A;  4UV8 A;  1GO3 F;  5GON A;  4LF4 B;  2PYJ A;  2IU0 A;  1Y74 B;  3VOU A;  2Y69 C;  1K34 A;  4LF7 B;  4E4E A;  3JAK B;  5B66 Z;  4DR5 O;  1RSO B;  2F4V B;  3ZX6 A;  4PI0 A;  1G8M A;  1H2G A;  1FAF A;  1MMM A;  2LFS A;  5CA0 B;  5KUM A;  3ZHT A;  2ZM6 B;  5IYD O;  4K3A A;  1AB3 A;  2ZNI A;  4A5U B;  3FAV A;  1FXK C;  4CZZ A;  3HKE A;  3G80 A;  3EHB B;  3FYE B;  5ITZ A;  3RBZ A;  1WPB A;  4JI0 O;  3BA9 A;  2HJD A;  2Z0A A;  4UVC A;  4I55 A;  1ZL8 B;  1CXZ B;  3AK1 A;  3CRR A;  3OMI B;  4IHJ B;  1H2N A;  1L0L H;  4X1I A;  1JR9 A;  3ETG A;  4U3J A;  5IYZ B;  3CRC A;  3CEI A;  1Q6U A;  3WB0 A;  5BXZ A;  4LFC O;  3CME V;  5KLV H;  4KHP B;  1V9P A;  2Q7H A;  5KHJ A;  4LNU B;  2DMX A;  1VQM V;  3STZ C;  3WG7 C;  1THZ A;  3L71 H;  3E35 A;  4CBC A;  1RPR A; 
#chains in the Genus database with same CATH homology
 1SQQ H;  3CXH F;  1PPJ H;  1BE3 H;  3H1J H;  3L73 H;  2BCC H;  3L70 H;  1L0L H;  3L72 H;  2A06 H;  2IBZ H;  4D6T H;  2FYU H;  3L74 H;  4PD4 F;  1NU1 H;  1BGY H;  3H1I H;  1SQB H;  1NTZ H;  3L75 H;  3H1K H;  3H1H H;  1L0N H;  1BCC H;  5KLV H;  1KB9 F;  1KYO F;  3TGU H;  1NTK H;  1SQV H;  3CWB H;  3CX5 F;  1SQX H;  3BCC H;  3L71 H;  1P84 F;  3H1L H;  4U3F H;  1SQP H;  1NTM H;  1EZV H;  1PP9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...