1BCCH

Cytochrome bc1 complex from chicken
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 19
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1bccH00
1NU1H 3BCCH 1L0NH 3H1KH 1L0LH 1NTZH 1KB9F 3TGUH 3H1HH 3L73H 1BGYH 1BCCH 1SQPH 3L74H 1KYOF 3CWBH 3H1IH 1PPJH 1NTMH 3H1JH 3L71H 2BCCH 3L75H 3L72H 1PP9H 2FYUH 2IBZH 3H1LH 1EZVH 3L70H 1SQVH 1NTKH 4PD4F 5KLVH 3CXHF 4D6TH 1SQQH 1SQBH 3CX5F 1BE3H 4U3FH 1P84F 2A06H 1SQXH
chains in the Genus database with same CATH superfamily
4PA3A 2OTJV 1ENVA 3ETQA 3CSXA 2E5LO 5C8YA 3L9DA 2EULA 3L74H 4Z2WA 1VF6A 4PA4A 3DC6A 4TUYA 1DLBA 4ASUG 1DTOA 4H33A 4GKJO 1FKAO 3CP1A 1MZFA 3WU2Z 5GW7A 4ZI7A 3SR2C 1YITV 5LHHA 4JI8B 5IYZA 3LDDA 1AR4A 3Q4HB 2WA4A 1SZXA 2XT9A 5KHGA 2LW1A 5BY1A 4X89A 3STZC 1WP7A 1EN6A 4EEQA 3AK2A 4DR7B 4J42A 3CRCA 3CRRA 2L6LA 1I7FA 2ADQB 1O9GA 3FD9A 3C90A 4DR6O 3B77A 3BRCA 3ABLC 3THOA 5GTHZ 4DV3O 1SQGA 2BOCC 2PZSA 3KCYA 3ABKC 3FB8C 4LNUA 2QJ1A 3UT5B 5IE9A 1GN3A 3CCRV 4O4IB 3RYHB 2HP8A 4E4EA 3BABA 1ORQC 2EILC 4YY3O 4MVRA 4GCZA 3PN1A 5FNVA 2KB1A 3RGBA 3G80A 1VMGA 4RWUA 2YIAA 2KSDA 2QM8A 3AG3C 1XHZA 2M7WA 3OMAB 2DMXA 3WG7C 2ATKC 3JAWB 2WAMA 3NR7A 1BSMA 1G8MA 5JJEB 1XOUA 1LUVA 5E1AC 1QR8A 1VF7A 2LGQA 2AGAA 5ITZA 1YJWV 4LCUC 4AI8A 3N27A 5JVDA 4OPAA 2JK5C 1R3JC 1BQZA 3QTCA 4JI6B 1VARA 1BHAA 1OZ0A 4BWAA 3D3QA 1K92A 2ZE8A 4WFFA 2UXXA 2DYSB 1GH6A 1M57C 4WBNA 2OIEA 4MVZA 3ZCCA 2CAZC 2XAHA 2XAJA 4B3MO 2QR4A 3SPHA 5EIBD 4BIUA 3E8FA 2UUCO 1PV0A 1S3JA 3SGIA 1EFRG 4XDJA 2E76B 1PPJH 3K04A 1BHBA 2F93B 1KKDA 5EBWC 4A5UB 4G28B 1D2DA 3T1CA 3DXRA 4I4TB 4JI2O 1Y76A 1Y67A 4Q20A 3LDCA 1N34O 5LXTB 1Q5OA 1FFXA 3A0BZ 4FZ0A 2GSMB 4UXNA 3ZHTA 2UU9B 4BIZA 2H94A 5JCOA 2CE4A 5J2TB 2NLJC 4DV6O 2UXBB 1ROPA 4PDMA 1K3EA 1L1FA 5IWAB 3SYPA 4CH6A 3CXHF 2JDIG 3ZEDA 3H9VA 2A79B 1SQXH 4LF4B 3ZRWB 2Q8VA 4NB5A 3K06A 1K8AW 3E22A 1H2SB 2B1IA 1PNKA 5GONB 1FS0G 1K7DA 4J7KA 4MTGA 3K5MA 1SQVH 4RQFA 2GDSA 4UVCA 1P4RA 3QF7A 4LF9B 1YCIA 1YI2V 5D5QA 2WLLA 2QM7A 3CCLV 5IYDO 4TV8A 4NYKA 3I56V 2JJ2G 4U7NA 3SPJA 4I9WA 1H2MA 1KBHA 1CEZA 2UUBB 3K0GA 3RT3C 4ZIBA 4K0KO 3H1LH 4P2ZA 3Q4HA 4MS2A 3E86A 1GTOA 4BR6A 1B3QA 1NVPD 1IXBA 3JD4A 4WF9V 1GM7A 3WB1A 1YEWA 1TVKB 1PM9A 1J95A 2X6BA 5IY5C 4K8XA 2QWNB 1M9NA 2YEVB 5LMUO 3T4ZA 3LSSA 2IBZH 4OGQB 4QGPA 3FB6C 1I08A 4JI3B 5CA0B 3SJQC 5KUMA 3AEIA 3W7WA 1DF4A 1Y66A 2C2AA 4DV1B 4JYYA 4DV7O 3T1HB 4OX9B 3LSQA 1U97A 1PP9H 5D5PA 1RSOB 2HHHO 2YXYA 3ETGA 2KG7A 4DW0A 3ZRVA 4IT5A 4E2LA 1MZEA 5JQGA 4CC5A 2Q7GA 4X64O 5KAIZ 4L8JA 2EINB 5LMNB 2LFRA 4H13B 1Z5VA 2H8PC 1D5NA 4DR3O 2RMKB 3ASNB 5LP6C 5LGNA 3CCMV 1JJOA 1JFFB 1GK9A 2Q6AA 5H2FZ 3OUFA 1I94B 2ZIMA 3K9SA 1VQPV 2GUZA 3F5WC 2AZ2A 3HKEB 2F23A 2WLMA 3FKSG 4DV4B 4NXMO 5J2UB 1H2GA 2DW4A 4F6RB 1FXKC 1XNQO 2ZNIA 2ITDC 1HR0O 2Q68A 4LF8O 3TCUA 4CS2A 2Q0AA 3WB0A 4X62O 2XNDG 2K9PA 1NTKH 2P90A 2DN9A 4R8CA 5BMVA 4WFEA 1NVPB 1R3KC 4FLWA 5JWPA 4J10A 1R1BA 1L0LH 1CXZB 2OWOA 3SDLA 3RYFB 3ZIAG 5KA5A 2WLIB 2Q73A 5IJ9B 4X66O 5LXTA 2ZNJA 3AG4B 3G4SV 1WB7A 4GT1A 2OT5A 2V7QG 4X1IB 4AHCA 5C8YB 4JI7B 2DWDC 2AHYA 2HG5C 1EN5A 4TUYB 3K5LA 4RUFA 3ZN1A 4NTYA 4ZI7B 2UXNA 3CD6V 5IYZB 4MVMA 4DYLA 4FVMA 2PF4E 3N2KA 1SQBH 1VQ7V 3MHSC 3I55V 2ZM6B 3BA8A 1OCZB 1IXMA 3K79A 3CMEV 4JYAO 3L73H 3IC9A 3K3WA 3EVKA 2FYUH 2ZCEA 4B3SO 2P5OA 4KL1A 3RFRA 5LL6Y 1Q8IA 5H6QA 4JI1B 2F4VO 5EYPA 4LNUB 3H1KH 2P06A 1W59A 3ZHUA 1YIJV 4FFBB 3JARA 4UUJC 1Q43A 3IJ4A 1OCCC 1X4TA 5FNVB 1T5EA 1V55C 1IBKB 2CTQA 3R66A 4FM2A 1CPYA 4NKGB 3CC2V 4U3FH 4TQFA 1BMFG 2HEPA 3D36A 3ABMC 5BZBA 2V1DA 3CRQA 1AJQA 4J41A 4ZKIA 1RM1B 3JALA 2DYRC 3STLC 1HP8A 5ITZB 4LFBO 4FJCC 3L75H 4JYBA 1BQ0A 1PD3A 3OEHG 1NQTA 5JVDB 4EFBA 4J7JA 2ARHA 3EHBB 4DR5B 2QWOB 1GN4A 4X1YA 3ZN0A 1UPGA 2P67A 1HNWO 2OYQA 2IW5A 1OHHG 2YC0A 2F66C 1Q6IA 4WBNB 1WAZA 5KHJA 3J80N 4LF5O 1ZTEA 2NN4A 4GYCB 3A0RA 3J81N 4DW1A 3SPIA 3ZJZA 4BW9A 1N0JA 3GWOA 4J9YB 2QDOA 4Z1MG 4FPPA 3BEHA 4JV5O 2EIKC 5IJ0A 2Q9LA 4IYHA 4KFMA 4H44B 2QWPB 2RNBA 3HKEA 1WA8B 4X8AA 4N23A 5KMGB 1FFXB 1GN6A 5HFLA 1K97A 1P7BA 5LGUA 1N4CA 1MABG 3FB5C 2ZR3A 2OCHA 4GLXA 3CJHA 4TT3G 2IU0A 1HNXB 2EBOA 1YVWA 2A3QA 4DUZO 4IHJB 4JF3A 1WB8A 3OW2U 3H1HH 5B1OA 3SJCC 4NXNB 3CWBH 4DV5B 3H1JH 4TQDA 2WLKA 3G6EV 1AI5A 2QM4A 1GM9A 5LHIA 2Q4PA 1M56C 3ABUA 4IIJB 1XNRB 3GVMA 3JD3A 3CC4V 3K08A 2Y69B 1NU1H 4JYCA 1L0NH 3JATA 2ZDIA 2AHZA 2VWKA 5IJ9A 2WLHA 4XDLA 3AG1B 4LP8A 4IGGA 2DWEC 4X1IA 3K5NA 1IBLB 5L3GA 1QNMA 3L71H 1QQCA 1GRJA 1X59A 2WLLB 1QHTA 1S72V 2CH7A 3RYIB 1IX9A 1WJZA 4TV8B 2CUGA 3HKDA 1OCRB 5CBHA 1FJGB 4BAYA 3CCUV 4XBFA 5BR8B 3O65A 1E1RG 3K59A 4GX2A 4FLYA 3JAKA 1VQMV 3BPZA 2UUAB 3ABTA 1F23A 4JI8O 2W0FC 3BY6A 2DQ0A 3SYCA 5LHGA 4PD4F 4WFGA 2IU3A 1QLEC 3AG2B 4DR7O 4LF7B 4F4LA 2EIMB 1AI6A 1URFA 3RW0A 2M6YA 1TA8A 3QO7A 1R3LC 1THZA 1N36B 3JASA 1NR7A 4HNAB 1AP5A 1SKVA 2ITCC 4FFBA 3OM3B 1P49A 3UM7A 3ZRXA 5KHHA 4QJFB 2KG7B 3G71V 1I0HA 2YXLA 1CP9A 1QVGU 3NXSA 1XEQA 5JQGB 2HJDA 3ZMZA 3L72H 3F7VC 1SS3A 1Q90D 1OCOC 2FKXA 1K5SA 2A06H 1WN7A 1E79G 1V54C 3DTUB 3TXQA 1QLNA 4LF6B 2GUZB 1M93A 3FB7C 1VQ8V 3RYCA 1TUBB 1XL6A 3TETA 1YZBA 3ZHRA 3T4DA 3AK3A 1MSWD 1XBLA 2RN9A 3SPGA 5F2VO 5CBFA 5LYJA 3BHPA 3TGUH 5BMVB 2QE7G 2PYJA 3M7MX 4I7ZB 1LUWA 1WNSA 4JZ2A 3DGEA 1VF6C 3BA9A 4GX0A 5IT9N 4B3MB 2RCVA 1SA0A 1JCHA 4FLVA 1WA8A 5KMGA 1MNGA 4U3JA 5EBLC 2ZXWC 2OIGA 4MT8A 5KAFZ 2E3CA 3KKYA 2YICA 5B1NA 4I55A 2UU9O 1N34B 1SF9A 1IBMB 3VQXA 1QCEA 2Y48A 2DOSA 4UCUA 2PGGA 2ZR2A 4MTOA 4IHJA 2UXBO 3OFNG 3RVZA 4D7SA 3T1YO 5IWAO 3LDEA 2ZIOA 1AB3A 3EFFK 3P3PA 5KX5B 1S5HC 2RDCA 3N2KB 2OCCC 4YIPA 4IIJA 3DSQA 2VRZA 5LP6A 5DM6V 1VQ5V 2R9RB 1R6NA 1Q3EA 1Y74A 4K3AA 4EFEA 4YHHO 4J80A 2EIJB 2JGUA 4QE9A 5B3SC 5B1AB 5B66Z 1ZX3A 1S77D 3IGAC 2YDEA 1HW7A 4LF9O 3RYIA 1FXKA 1F7YA 2WSSG 3ASOC 3E35A 5EYPB 1Q81W 1XHXA 4MSWC 4UCSA 3HKBB 1GM8A 1IDSA 3JARB 3VQYA 2UUBO 4JI5B 1YJ9V 1SESA 1NR1A 5J9PC 3JD0A 4FLXA 4NR1A 4B08A 5FPOA 4CZZA 1SETA 3H01A 1QVFU 4WCEV 1I5YA 2DJVA 5KHKA 1M5IA 3JALB 4D6TH 4B3TB 4PA6A 3B09A 4MVQA 2W6JG 2ZQMA 2CTPA 4DXWA 2QWQB 3B4SA 4WFHA 4JI3O 4GX5A 4JI0B 4HNAA 4YJ3B 5A2QN 1HWYA 4X1YB 3B2EE 3P30A 4PHZA 1YHQV 4DV1O 2FB5A 1XILA 3T1HO 4OX9O 3SJBC 2QKAA 1MA1A 3TK1A 3BCCH 5TISZ 4LBEC 2VQEB 5DN6G 5JCOC 2CTRA 1WLEA 4O4JA 1Z2GA 1VQLV 1FXVA 4TOIA 5LMNO 4XDKA 2EZPA 3ABLB 5IJ0B 1G1XB 2YIDA 3U10A 1I94O 4UVAA 1RFYA 4O4LA 1TUBA 3ABKB 2HLDG 4UCTA 2HJFC 5GTIZ 3W7SA 4JI4B 3CJHB 4TSFG 3JSNA 2LP7A 2XAGA 2Y4TA 2EILB 2F1MA 2IJKA 2PY5A 4PDLA 1JVMA 2UXCB 3AG3B 1XNQB 3WG7B 1HR0B 1AI7A 2Q7EA 4DR1B 3HR0A 3B40A 4X62B 4O2BA 3JD2A 4CBCA 4UVBA 4DUYO 4F6EA 2WLNA 1Y6XA 2BCCH 3OE7G 3JATB 3CYOA 1N8RW 3OTOB 3MDSA 2Q7HA 4I50A 4NTWA 1FAFA 1N32B 4TV9A 1AVMA 2P4VA 1Q7YW 3MHHC 1B6QA 4UCRA 4KHPB 4JI7O 2K1EA 4YJ2A 2CH7B 3ZMVA 1YJNV 3ICXA 1SC5B 1ZSPA 2B1GA 1AI4A 1M57B 2AXTZ 3HKDB 1V9PA 4DK1A 4LFCO 1HNZO 2R70A 5IYBO 4LH6A 4QPKA 3JAKB 2P6JA 1H8EG 5KX5A 1TUEB 3RBZA 4DRXA 4JTCB 3O9OA 1ZL8A 2VQFB 3OMIB 2Y4UA 3P32A 2XASA 3CCEV 2BTQA 2ZM6O 3SJAC 4FFKA 4Q6GA 1NZ6A 1QBZA 2CGOA 2AZ0A 3N2GB 1IVSA 1OV9A 3E2EA 2Z3YA 1KUQA 3I5DA 2E75B 2AW9A 2BSKB 3JASB 2QWRB 4H0LB 4PDVA 4JI1O 1J5EO 4R50A 3D3IA 2OTLV 3HKBA 4B3SB 1LR1A 1ZUQA 5C93A 2HKOA 2QGNA 2EX3A 2YSUB 4I0XA 2EZOA 2N74A 5L3FA 3ZMUA 4JZGA 3APOA 4HZ3A 3CCSV 1JQ0A 1TGOA 2O57A 3QG5A 3K57A 1DGSA 4AQYO 4B3RB 4R6ZA 2DYSC 2UXDB 1VQNV 2XHBA 1PNLA 4DR4B 3VOUA 2A9HA 3ZX6A 3OT7A 4DV2B 5BXZA 2FL4A 2CTWA 1M4UA 4LFAB 2A0LA 2HVJC 4JAAA 1FFTB 1Y4MA 4NVPA 3M99B 4QIWF 5LGTA 1COWG 2F95B 4ICGA 1NKDA 3IC7A 4IYIA 4Z1VA 3RYCB 4YJ3A 1K9MW 5EZYB 4LWSB 4X65B 1XMOB 2BTOA 3ZBHA 4ZHQA 4DR2B 3DC5A 2YUAA 5FPRA 1E1QG 3CB2A 4JASA 1MOFA 5LYJB 1XQ8A 1G4YB 4KXRA 4ZOLB 1GO3F 2R9AA 5FLXN 4MVUA 4NTXA 2ZKOA 5IY5B 5JH7A 5LOVA 1SERA 2JEUA 4LF5B 2HR3A 2G38A 4J7ZA 2YIBD 1SA0B 4X20A 1K4CC 1N33B 1YSCA 4ZBMA 2GBOA 4WFBV 2N05A 3F5TA 4U3JB 4FM1A 1EBOA 4YIOA 4X88A 5KLVH 1BE3H 1XMQO 4I55B 2PUSA 5B1BB 3OD4A 4P30A 2JIZG 3C3SA 4DV0O 2LQTA 4FMTA 5KUKA 1G6UA 3SYOA 1OJHA 4DV5O 4P9OA 4GKKO 3QNEA 3FYEB 3AG7A 5LP6B 1MSDA 3IAYA 2L35A 3MD0A 1YTFD 4O4HA 1XNRO 1Y74B 3CMAV 1Z5WA 4R7CA 1JMKC 3AK1A 3OAAG 3LNNA 2Z5UA 5EIBC 1F51A 1XREA 4UB8Z 5A9GA 1M1KW 1SRYA 1IBLO 1HDJA 1AP6A 1FXKB 3KCXA 2ZINA 2E5LB 1XDCA 3D36C 4MVOA 5AG2A 2GTAA 4RAIA 4GZRB 1FJGO 1NTZH 1F4MA 4PI0A 3FX7A 2ADPA 5BR8O 2Q67A 5KHIA 1BL8A 1RPRA 1NJIW 4GKJB 4JTDB 4TWKA 3KG2A 1UFIA 2R72A 1YXBA 4LR3A 2UUAO 3L70H 4PJ0Z 3TJTA 1A32A 2EJRA 4IL6Z 1U96A 2QTOA 2CK3G 1KKCA 3N2GA 2JEXA 4U7OA 1TAEA 4N21A 4LF7O 4B7KA 4O2AB 2BSKA 4FIPC 4UCVA 4DR6B 5EC1C 2EINC 3OMNB 1Q82W 2QKSA 3ASNC 1N36O 3RWRD 2WWWA 3VBBA 4DV3B 5CA1A 1NT2B 3F7YC 4JGSA 1O9HA 2LW7A 3CRMA 3B8MA 1GKFA 4J9ZB 2ZT9B 3FAVA 4YY3B 1N0NA 4O4JB 3PJSK 3RVYA 4MVSA 1YTFB 3HB3B 1AR1B 3W7UA 5CB4A 2RJZA 5L3DA 4W4KA 4UV8A 1K33A 1JX9A 4JTAB 2KKWA 1H8HG 5DEDA 1GMGA 3EXAA 1H2KA 2LFSA 3LUTB 4LF6O 4EB6A 4O4LB 1QU7A 1RP3B 3OUSA 4CS3A 3CCJV 5EZYA 4LWSA 3CE2A 5LBQA 4JI6O 1AR5A 4B7EA 4I9QA 3CX5F 5K1XA 3E89A 2ZDIC 1K34A 4CC6A 3AG4C 1OCCB 2XUMA 4QE7A 2PI5A 1V55B 1NI8A 3D8CA 2DQ3A 1S5JA 4L87A 4ZOLA 1KQSU 1NTMH 4FLTA 3WB2A 2WA3A 1Q86W 3ABMB 2X6CA 5LA6A 5L3EA 4O2BB 1M90W 4WFAV 3UKMA 2GV9A 2D3OW 3HKCA 3ZHVA 2D2CB 1AROP 2LO1A 3R65A 3SYAA 1VP7A 4FLZA 2DYRB 2UUCB 3G67A 1BT8A 3ETDA 3GB7C 1NH2D 4I50B 1VQ9V 2JVDA 4TV9B 4JI2B 3KZIZ 5CBGA 4PDRA 2N04A 5E79Z 1OCZC 4H37A 4YJ2B 3CS5A 1XUQA 2W0XA 4X1KB 1IBMO 4I5SA 3OGIB 4UB6Z 5H6RA 3UO3A 3JSLA 3X2QB 1EM1A 4DV6B 1ZAUA 1VEWA 2RQ6A 1K5QA 3VQWA 5EC2C 2MK3A 2ODMA 4LF4O 4DRXB 1BCCH 1PNMA 1ZL8B 3T1YB 5CN0A 3CCQV 3W7TA 2BTQB 4KUMA 2EIKB 3OTFA 1YDXA 1XL4A 4EKWA 3P3NA 2LGWA 4RQEA 1JJ2U 3ML0A 3E8HA 1SQFA 4YHHB 2JGDA 5L3CA 1R3IC 1K4DC 1KU9A 1R6KA 1VIBA 1F4NA 1RM1C 3W7XA 1JR9A 4P9PA 3IFXA 1ZWIC 3UCSC 2NR5A 2B9ZA 3OGCC 2QSAA 4I0XB 1IZ3A 1M56B 4K0KB 2ETNA 1SZTA 4JI5O 4X9QA 1AJNA 2YIBA 3VQVA 1FPOA 2NNUA 3TXSA 2R9IA 3QVNA 4O2AA 4PELA 4PI2A 1NH2B 2QA4V 4B3TO 3K58A 1KB9F 5LMUB 1AJPA 1BGYH 3OR6C 1KD1W 1MMMA 2YI8A 1W0JG 1JOYA 4JI0O 3K0DA 2Q69A 4ZHQB 4AILC 3CC7V 4FM0A 1W0KG 3FFQA 2E74B 4DV7B 3UT5A 1Q6UA 2Y0IA 4GUNA 4O4IA 2HHHB 4LC1A 3ETEA 3RYHA 2VQEO 2A7WA 1I5XA 1QLEB 5B1BC 5JH7B 5LOVB 2BOBC 4X20B 4GX1A 2FMLA 2JJ1G 4G2KA 3SPCA 1FXHA 3B8NA 2ZE7A 3S3WA 5JJNB 1L8DA 2P7TC 4X64B 4PA9A 3JAWA 4C7UA 1PL0A 5K1PA 5HFMA 4DR3B 1R73A 2BE3A 3ZHQA 1S5LZ 4DV4O 1KYOF 3H1IH 2Y69C 2PTMA 5IYCO 3AG1C 4JI4O 1FD9A 1NS1A 4NXMB 2ZD9A 2ZE6A 3JYCA 5B5EZ 3A2FA 2IJHA 3CHXA 2UXCO 1H2NA 3JAMN 4J11A 4LF8B 4MTFA 5H5NA 1OCOB 2VS0A 5H9CA 3U0ZA 2GTSA 1OCRC 1NBMG 4DR1O 5KA6A 4DK0A 2IH3C 3CCVV 4O4HB 2KQXA 2P22C 5L3BA 4RUEA 1V54B 2ILMA 4FK5C 1SQQH 4CH3A 3OTOO 1S0VA 3APQA 4DUYB 4YXWG 1DK1A 3UO2A 2IH1C 1N32O 4I4TA 3M8AA 4X66B 3CPWU 5FL7G 1WPXA 3CEIA 3J7AU 4KHPO 4X1KA 3AG2C 4G27B 1EN4A 2IM9A 2EIMC 1JA8A 3OEEG 5EK0A 4MTXA 3G6BA 1UJWB 4CH5A 4HBNA 4JPRA 5J2TA 1VQKV 4CS4A 3A0HZ 4LFCB 4KP4A 1HNZB 1VQ4V 2MW2B 2WLJA 2VQFO 4QPJA 1GAXA 2DE0X 3ZRWA 1WP8A 1AILA 3HPLC 2ZXWB 1D5AA 3FYIB 4D7TA 4BIOA 1BZKA 1PKXA 4FZ1A 4MW8A 4JYAB 5GONA 1KC8W 4JAUA 2HFEC 4HYOA 1US6A 2Z0AA 1IURA 2GHYA 4LH7A 4ABMA 4PA7A 1KP2A 1SQPH 2V4DA 5CA1B 2YXHA 4JAVA 3BVOA 1B06A 2F4VB 2QTSA 2X7RB 5CA3A 2X0LA 1J5EB 1JPXA 2OCCB 4FLUA 4BW5A 4CH4A 2HVKC 3QO8A 1IBKO 1LNQA 1VF5B 2XTAA 3FAVB 4PV1B 3E8BA 3MAQA 3C3TA 1R6TA 2QEXV 3S3XA 4B3RO 2XAFA 5B3SB 5CB4B 3U11A 2UXDO 3BFRA 3JD1A 4DR4O 4DO2A 2X6AA 2CDYA 4DV2O 4AQYB 3ZMTA 1TVKA 4LFAO 1GN2A 4K35A 4EB6B 4UV9A 3ASOB 2YEVA 5IDJA 2XAQA 3E83A 4LFBB 4W4LA 4DR5O 3JCUZ 3ZS8C 5CA0A 4X65O 1DF5A 2QKCA 1XMOO 4UFZA 2FTKA 3E8GA 2YS8A 4DR2O 2JS3A 3OR7C 2CGNA 1HNWB 3K5OA 2IJJA 4HAMA 4OPHA 3A8TA 2WPDG 5LA6B 1Q6HA 1RSOA 1RPOA 1EZJA 3HKCB 2JRIA 3K9AA 3K03A 3ZHSA 1MG1A 2H3OA 5JJJB 3X2QC 2IJIA 2XOKG 1N33O 2YI9A 3T2MA 5CMUA 1VQOV 2F43G 1P84F 2EJ7A 4JV5B 3RN4A 1YF2A 3DXRB 4UCOA 1JFFA 2VWJA 1Y76B 3SYQA 2EIJC 3LNMB 3QO5A 1HNXO 5B1AC 4K8ZA 1XMQB 5EBMC 1FYJA 5J2UA 2P4KA 1VQ6V 1H38A 3BAAA 4F6RA 1WPBA 4NXNO 1KMIZ 4RO2A 1PL4A 4QNHB 2LJ2A 3CXCU 3JCZA 4DV0B 4DUZB 3UQ8A 2ZE5A 2PI4A 2B5UA 3CRAA 1H2LA 4OXSA 4MW3A 3ZMSA 1P7GA 1ZLZA 5DECA 3LSUA 2JS5A 3WFVA 1KP3A 3ZRSA 4GKKB 2W6IG 1S76D 1BS3A 1KECA 2Y0PA 1W2BU 2Q5ZA 3E22B 3RYFA 1EZVH 2WLIA 3GWKC 2JGDB 1QR9A 1B04A 2Q0OC 1K73W 1XI1A 2PYLA
chains in the Genus database with same CATH topology
1NU1H 3BCCH 1L0NH 3H1KH 1L0LH 1NTZH 1KB9F 3TGUH 3H1HH 3L73H 1BGYH 1BCCH 1SQPH 3L74H 1KYOF 3CWBH 3H1IH 1PPJH 1NTMH 3H1JH 3L71H 2BCCH 3L75H 3L72H 1PP9H 2FYUH 2IBZH 3H1LH 1EZVH 3L70H 1SQVH 1NTKH 4PD4F 5KLVH 3CXHF 4D6TH 1SQQH 1SQBH 3CX5F 1BE3H 4U3FH 1P84F 2A06H 1SQXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 H;  3BCC H;  1L0N H;  3H1K H;  1L0L H;  1NTZ H;  1KB9 F;  3TGU H;  3H1H H;  3L73 H;  1BGY H;  1BCC H;  1SQP H;  3L74 H;  1KYO F;  3CWB H;  3H1I H;  1PPJ H;  1NTM H;  3H1J H;  3L71 H;  2BCC H;  3L75 H;  3L72 H;  1PP9 H;  2FYU H;  2IBZ H;  3H1L H;  1EZV H;  3L70 H;  1SQV H;  1NTK H;  4PD4 F;  5KLV H;  3CXH F;  4D6T H;  1SQQ H;  1SQB H;  3CX5 F;  1BE3 H;  4U3F H;  1P84 F;  2A06 H;  1SQX H; 
#chains in the Genus database with same CATH topology
 4PA3 A;  2OTJ V;  1ENV A;  3ETQ A;  3CSX A;  2E5L O;  5C8Y A;  3L9D A;  2EUL A;  3L74 H;  4Z2W A;  1VF6 A;  4PA4 A;  3DC6 A;  4TUY A;  1DLB A;  4ASU G;  1DTO A;  4H33 A;  4GKJ O;  1FKA O;  3CP1 A;  1MZF A;  3WU2 Z;  5GW7 A;  4ZI7 A;  3SR2 C;  1YIT V;  5LHH A;  4JI8 B;  5IYZ A;  3LDD A;  1AR4 A;  3Q4H B;  2WA4 A;  1SZX A;  2XT9 A;  5KHG A;  2LW1 A;  5BY1 A;  4X89 A;  3STZ C;  1WP7 A;  1EN6 A;  4EEQ A;  3AK2 A;  4DR7 B;  4J42 A;  3CRC A;  3CRR A;  2L6L A;  1I7F A;  2ADQ B;  1O9G A;  3FD9 A;  3C90 A;  4DR6 O;  3B77 A;  3BRC A;  3ABL C;  3THO A;  5GTH Z;  4DV3 O;  1SQG A;  2BOC C;  2PZS A;  3KCY A;  3ABK C;  3FB8 C;  4LNU A;  2QJ1 A;  3UT5 B;  5IE9 A;  1GN3 A;  3CCR V;  4O4I B;  3RYH B;  2HP8 A;  4E4E A;  3BAB A;  1ORQ C;  2EIL C;  4YY3 O;  4MVR A;  4GCZ A;  3PN1 A;  5FNV A;  2KB1 A;  3RGB A;  3G80 A;  1VMG A;  4RWU A;  2YIA A;  2KSD A;  2QM8 A;  3AG3 C;  1XHZ A;  2M7W A;  3OMA B;  2DMX A;  3WG7 C;  2ATK C;  3JAW B;  2WAM A;  3NR7 A;  1BSM A;  1G8M A;  5JJE B;  1XOU A;  1LUV A;  5E1A C;  1QR8 A;  1VF7 A;  2LGQ A;  2AGA A;  5ITZ A;  1YJW V;  4LCU C;  4AI8 A;  3N27 A;  5JVD A;  4OPA A;  2JK5 C;  1R3J C;  1BQZ A;  3QTC A;  4JI6 B;  1VAR A;  1BHA A;  1OZ0 A;  4BWA A;  3D3Q A;  1K92 A;  2ZE8 A;  4WFF A;  2UXX A;  2DYS B;  1GH6 A;  1M57 C;  4WBN A;  2OIE A;  4MVZ A;  3ZCC A;  2CAZ C;  2XAH A;  2XAJ A;  4B3M O;  2QR4 A;  3SPH A;  5EIB D;  4BIU A;  3E8F A;  2UUC O;  1PV0 A;  1S3J A;  3SGI A;  1EFR G;  4XDJ A;  2E76 B;  1PPJ H;  3K04 A;  1BHB A;  2F93 B;  1KKD A;  5EBW C;  4A5U B;  4G28 B;  1D2D A;  3T1C A;  3DXR A;  4I4T B;  4JI2 O;  1Y76 A;  1Y67 A;  4Q20 A;  3LDC A;  1N34 O;  5LXT B;  1Q5O A;  1FFX A;  3A0B Z;  4FZ0 A;  2GSM B;  4UXN A;  3ZHT A;  2UU9 B;  4BIZ A;  2H94 A;  5JCO A;  2CE4 A;  5J2T B;  2NLJ C;  4DV6 O;  2UXB B;  1ROP A;  4PDM A;  1K3E A;  1L1F A;  5IWA B;  3SYP A;  4CH6 A;  3CXH F;  2JDI G;  3ZED A;  3H9V A;  2A79 B;  1SQX H;  4LF4 B;  3ZRW B;  2Q8V A;  4NB5 A;  3K06 A;  1K8A W;  3E22 A;  1H2S B;  2B1I A;  1PNK A;  5GON B;  1FS0 G;  1K7D A;  4J7K A;  4MTG A;  3K5M A;  1SQV H;  4RQF A;  2GDS A;  4UVC A;  1P4R A;  3QF7 A;  4LF9 B;  1YCI A;  1YI2 V;  5D5Q A;  2WLL A;  2QM7 A;  3CCL V;  5IYD O;  4TV8 A;  4NYK A;  3I56 V;  2JJ2 G;  4U7N A;  3SPJ A;  4I9W A;  1H2M A;  1KBH A;  1CEZ A;  2UUB B;  3K0G A;  3RT3 C;  4ZIB A;  4K0K O;  3H1L H;  4P2Z A;  3Q4H A;  4MS2 A;  3E86 A;  1GTO A;  4BR6 A;  1B3Q A;  1NVP D;  1IXB A;  3JD4 A;  4WF9 V;  1GM7 A;  3WB1 A;  1YEW A;  1TVK B;  1PM9 A;  1J95 A;  2X6B A;  5IY5 C;  4K8X A;  2QWN B;  1M9N A;  2YEV B;  5LMU O;  3T4Z A;  3LSS A;  2IBZ H;  4OGQ B;  4QGP A;  3FB6 C;  1I08 A;  4JI3 B;  5CA0 B;  3SJQ C;  5KUM A;  3AEI A;  3W7W A;  1DF4 A;  1Y66 A;  2C2A A;  4DV1 B;  4JYY A;  4DV7 O;  3T1H B;  4OX9 B;  3LSQ A;  1U97 A;  1PP9 H;  5D5P A;  1RSO B;  2HHH O;  2YXY A;  3ETG A;  2KG7 A;  4DW0 A;  3ZRV A;  4IT5 A;  4E2L A;  1MZE A;  5JQG A;  4CC5 A;  2Q7G A;  4X64 O;  5KAI Z;  4L8J A;  2EIN B;  5LMN B;  2LFR A;  4H13 B;  1Z5V A;  2H8P C;  1D5N A;  4DR3 O;  2RMK B;  3ASN B;  5LP6 C;  5LGN A;  3CCM V;  1JJO A;  1JFF B;  1GK9 A;  2Q6A A;  5H2F Z;  3OUF A;  1I94 B;  2ZIM A;  3K9S A;  1VQP V;  2GUZ A;  3F5W C;  2AZ2 A;  3HKE B;  2F23 A;  2WLM A;  3FKS G;  4DV4 B;  4NXM O;  5J2U B;  1H2G A;  2DW4 A;  4F6R B;  1FXK C;  1XNQ O;  2ZNI A;  2ITD C;  1HR0 O;  2Q68 A;  4LF8 O;  3TCU A;  4CS2 A;  2Q0A A;  3WB0 A;  4X62 O;  2XND G;  2K9P A;  1NTK H;  2P90 A;  2DN9 A;  4R8C A;  5BMV A;  4WFE A;  1NVP B;  1R3K C;  4FLW A;  5JWP A;  4J10 A;  1R1B A;  1L0L H;  1CXZ B;  2OWO A;  3SDL A;  3RYF B;  3ZIA G;  5KA5 A;  2WLI B;  2Q73 A;  5IJ9 B;  4X66 O;  5LXT A;  2ZNJ A;  3AG4 B;  3G4S V;  1WB7 A;  4GT1 A;  2OT5 A;  2V7Q G;  4X1I B;  4AHC A;  5C8Y B;  4JI7 B;  2DWD C;  2AHY A;  2HG5 C;  1EN5 A;  4TUY B;  3K5L A;  4RUF A;  3ZN1 A;  4NTY A;  4ZI7 B;  2UXN A;  3CD6 V;  5IYZ B;  4MVM A;  4DYL A;  4FVM A;  2PF4 E;  3N2K A;  1SQB H;  1VQ7 V;  3MHS C;  3I55 V;  2ZM6 B;  3BA8 A;  1OCZ B;  1IXM A;  3K79 A;  3CME V;  4JYA O;  3L73 H;  3IC9 A;  3K3W A;  3EVK A;  2FYU H;  2ZCE A;  4B3S O;  2P5O A;  4KL1 A;  3RFR A;  5LL6 Y;  1Q8I A;  5H6Q A;  4JI1 B;  2F4V O;  5EYP A;  4LNU B;  3H1K H;  2P06 A;  1W59 A;  3ZHU A;  1YIJ V;  4FFB B;  3JAR A;  4UUJ C;  1Q43 A;  3IJ4 A;  1OCC C;  1X4T A;  5FNV B;  1T5E A;  1V55 C;  1IBK B;  2CTQ A;  3R66 A;  4FM2 A;  1CPY A;  4NKG B;  3CC2 V;  4U3F H;  4TQF A;  1BMF G;  2HEP A;  3D36 A;  3ABM C;  5BZB A;  2V1D A;  3CRQ A;  1AJQ A;  4J41 A;  4ZKI A;  1RM1 B;  3JAL A;  2DYR C;  3STL C;  1HP8 A;  5ITZ B;  4LFB O;  4FJC C;  3L75 H;  4JYB A;  1BQ0 A;  1PD3 A;  3OEH G;  1NQT A;  5JVD B;  4EFB A;  4J7J A;  2ARH A;  3EHB B;  4DR5 B;  2QWO B;  1GN4 A;  4X1Y A;  3ZN0 A;  1UPG A;  2P67 A;  1HNW O;  2OYQ A;  2IW5 A;  1OHH G;  2YC0 A;  2F66 C;  1Q6I A;  4WBN B;  1WAZ A;  5KHJ A;  3J80 N;  4LF5 O;  1ZTE A;  2NN4 A;  4GYC B;  3A0R A;  3J81 N;  4DW1 A;  3SPI A;  3ZJZ A;  4BW9 A;  1N0J A;  3GWO A;  4J9Y B;  2QDO A;  4Z1M G;  4FPP A;  3BEH A;  4JV5 O;  2EIK C;  5IJ0 A;  2Q9L A;  4IYH A;  4KFM A;  4H44 B;  2QWP B;  2RNB A;  3HKE A;  1WA8 B;  4X8A A;  4N23 A;  5KMG B;  1FFX B;  1GN6 A;  5HFL A;  1K97 A;  1P7B A;  5LGU A;  1N4C A;  1MAB G;  3FB5 C;  2ZR3 A;  2OCH A;  4GLX A;  3CJH A;  4TT3 G;  2IU0 A;  1HNX B;  2EBO A;  1YVW A;  2A3Q A;  4DUZ O;  4IHJ B;  4JF3 A;  1WB8 A;  3OW2 U;  3H1H H;  5B1O A;  3SJC C;  4NXN B;  3CWB H;  4DV5 B;  3H1J H;  4TQD A;  2WLK A;  3G6E V;  1AI5 A;  2QM4 A;  1GM9 A;  5LHI A;  2Q4P A;  1M56 C;  3ABU A;  4IIJ B;  1XNR B;  3GVM A;  3JD3 A;  3CC4 V;  3K08 A;  2Y69 B;  1NU1 H;  4JYC A;  1L0N H;  3JAT A;  2ZDI A;  2AHZ A;  2VWK A;  5IJ9 A;  2WLH A;  4XDL A;  3AG1 B;  4LP8 A;  4IGG A;  2DWE C;  4X1I A;  3K5N A;  1IBL B;  5L3G A;  1QNM A;  3L71 H;  1QQC A;  1GRJ A;  1X59 A;  2WLL B;  1QHT A;  1S72 V;  2CH7 A;  3RYI B;  1IX9 A;  1WJZ A;  4TV8 B;  2CUG A;  3HKD A;  1OCR B;  5CBH A;  1FJG B;  4BAY A;  3CCU V;  4XBF A;  5BR8 B;  3O65 A;  1E1R G;  3K59 A;  4GX2 A;  4FLY A;  3JAK A;  1VQM V;  3BPZ A;  2UUA B;  3ABT A;  1F23 A;  4JI8 O;  2W0F C;  3BY6 A;  2DQ0 A;  3SYC A;  5LHG A;  4PD4 F;  4WFG A;  2IU3 A;  1QLE C;  3AG2 B;  4DR7 O;  4LF7 B;  4F4L A;  2EIM B;  1AI6 A;  1URF A;  3RW0 A;  2M6Y A;  1TA8 A;  3QO7 A;  1R3L C;  1THZ A;  1N36 B;  3JAS A;  1NR7 A;  4HNA B;  1AP5 A;  1SKV A;  2ITC C;  4FFB A;  3OM3 B;  1P49 A;  3UM7 A;  3ZRX A;  5KHH A;  4QJF B;  2KG7 B;  3G71 V;  1I0H A;  2YXL A;  1CP9 A;  1QVG U;  3NXS A;  1XEQ A;  5JQG B;  2HJD A;  3ZMZ A;  3L72 H;  3F7V C;  1SS3 A;  1Q90 D;  1OCO C;  2FKX A;  1K5S A;  2A06 H;  1WN7 A;  1E79 G;  1V54 C;  3DTU B;  3TXQ A;  1QLN A;  4LF6 B;  2GUZ B;  1M93 A;  3FB7 C;  1VQ8 V;  3RYC A;  1TUB B;  1XL6 A;  3TET A;  1YZB A;  3ZHR A;  3T4D A;  3AK3 A;  1MSW D;  1XBL A;  2RN9 A;  3SPG A;  5F2V O;  5CBF A;  5LYJ A;  3BHP A;  3TGU H;  5BMV B;  2QE7 G;  2PYJ A;  3M7M X;  4I7Z B;  1LUW A;  1WNS A;  4JZ2 A;  3DGE A;  1VF6 C;  3BA9 A;  4GX0 A;  5IT9 N;  4B3M B;  2RCV A;  1SA0 A;  1JCH A;  4FLV A;  1WA8 A;  5KMG A;  1MNG A;  4U3J A;  5EBL C;  2ZXW C;  2OIG A;  4MT8 A;  5KAF Z;  2E3C A;  3KKY A;  2YIC A;  5B1N A;  4I55 A;  2UU9 O;  1N34 B;  1SF9 A;  1IBM B;  3VQX A;  1QCE A;  2Y48 A;  2DOS A;  4UCU A;  2PGG A;  2ZR2 A;  4MTO A;  4IHJ A;  2UXB O;  3OFN G;  3RVZ A;  4D7S A;  3T1Y O;  5IWA O;  3LDE A;  2ZIO A;  1AB3 A;  3EFF K;  3P3P A;  5KX5 B;  1S5H C;  2RDC A;  3N2K B;  2OCC C;  4YIP A;  4IIJ A;  3DSQ A;  2VRZ A;  5LP6 A;  5DM6 V;  1VQ5 V;  2R9R B;  1R6N A;  1Q3E A;  1Y74 A;  4K3A A;  4EFE A;  4YHH O;  4J80 A;  2EIJ B;  2JGU A;  4QE9 A;  5B3S C;  5B1A B;  5B66 Z;  1ZX3 A;  1S77 D;  3IGA C;  2YDE A;  1HW7 A;  4LF9 O;  3RYI A;  1FXK A;  1F7Y A;  2WSS G;  3ASO C;  3E35 A;  5EYP B;  1Q81 W;  1XHX A;  4MSW C;  4UCS A;  3HKB B;  1GM8 A;  1IDS A;  3JAR B;  3VQY A;  2UUB O;  4JI5 B;  1YJ9 V;  1SES A;  1NR1 A;  5J9P C;  3JD0 A;  4FLX A;  4NR1 A;  4B08 A;  5FPO A;  4CZZ A;  1SET A;  3H01 A;  1QVF U;  4WCE V;  1I5Y A;  2DJV A;  5KHK A;  1M5I A;  3JAL B;  4D6T H;  4B3T B;  4PA6 A;  3B09 A;  4MVQ A;  2W6J G;  2ZQM A;  2CTP A;  4DXW A;  2QWQ B;  3B4S A;  4WFH A;  4JI3 O;  4GX5 A;  4JI0 B;  4HNA A;  4YJ3 B;  5A2Q N;  1HWY A;  4X1Y B;  3B2E E;  3P30 A;  4PHZ A;  1YHQ V;  4DV1 O;  2FB5 A;  1XIL A;  3T1H O;  4OX9 O;  3SJB C;  2QKA A;  1MA1 A;  3TK1 A;  3BCC H;  5TIS Z;  4LBE C;  2VQE B;  5DN6 G;  5JCO C;  2CTR A;  1WLE A;  4O4J A;  1Z2G A;  1VQL V;  1FXV A;  4TOI A;  5LMN O;  4XDK A;  2EZP A;  3ABL B;  5IJ0 B;  1G1X B;  2YID A;  3U10 A;  1I94 O;  4UVA A;  1RFY A;  4O4L A;  1TUB A;  3ABK B;  2HLD G;  4UCT A;  2HJF C;  5GTI Z;  3W7S A;  4JI4 B;  3CJH B;  4TSF G;  3JSN A;  2LP7 A;  2XAG A;  2Y4T A;  2EIL B;  2F1M A;  2IJK A;  2PY5 A;  4PDL A;  1JVM A;  2UXC B;  3AG3 B;  1XNQ B;  3WG7 B;  1HR0 B;  1AI7 A;  2Q7E A;  4DR1 B;  3HR0 A;  3B40 A;  4X62 B;  4O2B A;  3JD2 A;  4CBC A;  4UVB A;  4DUY O;  4F6E A;  2WLN A;  1Y6X A;  2BCC H;  3OE7 G;  3JAT B;  3CYO A;  1N8R W;  3OTO B;  3MDS A;  2Q7H A;  4I50 A;  4NTW A;  1FAF A;  1N32 B;  4TV9 A;  1AVM A;  2P4V A;  1Q7Y W;  3MHH C;  1B6Q A;  4UCR A;  4KHP B;  4JI7 O;  2K1E A;  4YJ2 A;  2CH7 B;  3ZMV A;  1YJN V;  3ICX A;  1SC5 B;  1ZSP A;  2B1G A;  1AI4 A;  1M57 B;  2AXT Z;  3HKD B;  1V9P A;  4DK1 A;  4LFC O;  1HNZ O;  2R70 A;  5IYB O;  4LH6 A;  4QPK A;  3JAK B;  2P6J A;  1H8E G;  5KX5 A;  1TUE B;  3RBZ A;  4DRX A;  4JTC B;  3O9O A;  1ZL8 A;  2VQF B;  3OMI B;  2Y4U A;  3P32 A;  2XAS A;  3CCE V;  2BTQ A;  2ZM6 O;  3SJA C;  4FFK A;  4Q6G A;  1NZ6 A;  1QBZ A;  2CGO A;  2AZ0 A;  3N2G B;  1IVS A;  1OV9 A;  3E2E A;  2Z3Y A;  1KUQ A;  3I5D A;  2E75 B;  2AW9 A;  2BSK B;  3JAS B;  2QWR B;  4H0L B;  4PDV A;  4JI1 O;  1J5E O;  4R50 A;  3D3I A;  2OTL V;  3HKB A;  4B3S B;  1LR1 A;  1ZUQ A;  5C93 A;  2HKO A;  2QGN A;  2EX3 A;  2YSU B;  4I0X A;  2EZO A;  2N74 A;  5L3F A;  3ZMU A;  4JZG A;  3APO A;  4HZ3 A;  3CCS V;  1JQ0 A;  1TGO A;  2O57 A;  3QG5 A;  3K57 A;  1DGS A;  4AQY O;  4B3R B;  4R6Z A;  2DYS C;  2UXD B;  1VQN V;  2XHB A;  1PNL A;  4DR4 B;  3VOU A;  2A9H A;  3ZX6 A;  3OT7 A;  4DV2 B;  5BXZ A;  2FL4 A;  2CTW A;  1M4U A;  4LFA B;  2A0L A;  2HVJ C;  4JAA A;  1FFT B;  1Y4M A;  4NVP A;  3M99 B;  4QIW F;  5LGT A;  1COW G;  2F95 B;  4ICG A;  1NKD A;  3IC7 A;  4IYI A;  4Z1V A;  3RYC B;  4YJ3 A;  1K9M W;  5EZY B;  4LWS B;  4X65 B;  1XMO B;  2BTO A;  3ZBH A;  4ZHQ A;  4DR2 B;  3DC5 A;  2YUA A;  5FPR A;  1E1Q G;  3CB2 A;  4JAS A;  1MOF A;  5LYJ B;  1XQ8 A;  1G4Y B;  4KXR A;  4ZOL B;  1GO3 F;  2R9A A;  5FLX N;  4MVU A;  4NTX A;  2ZKO A;  5IY5 B;  5JH7 A;  5LOV A;  1SER A;  2JEU A;  4LF5 B;  2HR3 A;  2G38 A;  4J7Z A;  2YIB D;  1SA0 B;  4X20 A;  1K4C C;  1N33 B;  1YSC A;  4ZBM A;  2GBO A;  4WFB V;  2N05 A;  3F5T A;  4U3J B;  4FM1 A;  1EBO A;  4YIO A;  4X88 A;  5KLV H;  1BE3 H;  1XMQ O;  4I55 B;  2PUS A;  5B1B B;  3OD4 A;  4P30 A;  2JIZ G;  3C3S A;  4DV0 O;  2LQT A;  4FMT A;  5KUK A;  1G6U A;  3SYO A;  1OJH A;  4DV5 O;  4P9O A;  4GKK O;  3QNE A;  3FYE B;  3AG7 A;  5LP6 B;  1MSD A;  3IAY A;  2L35 A;  3MD0 A;  1YTF D;  4O4H A;  1XNR O;  1Y74 B;  3CMA V;  1Z5W A;  4R7C A;  1JMK C;  3AK1 A;  3OAA G;  3LNN A;  2Z5U A;  5EIB C;  1F51 A;  1XRE A;  4UB8 Z;  5A9G A;  1M1K W;  1SRY A;  1IBL O;  1HDJ A;  1AP6 A;  1FXK B;  3KCX A;  2ZIN A;  2E5L B;  1XDC A;  3D36 C;  4MVO A;  5AG2 A;  2GTA A;  4RAI A;  4GZR B;  1FJG O;  1NTZ H;  1F4M A;  4PI0 A;  3FX7 A;  2ADP A;  5BR8 O;  2Q67 A;  5KHI A;  1BL8 A;  1RPR A;  1NJI W;  4GKJ B;  4JTD B;  4TWK A;  3KG2 A;  1UFI A;  2R72 A;  1YXB A;  4LR3 A;  2UUA O;  3L70 H;  4PJ0 Z;  3TJT A;  1A32 A;  2EJR A;  4IL6 Z;  1U96 A;  2QTO A;  2CK3 G;  1KKC A;  3N2G A;  2JEX A;  4U7O A;  1TAE A;  4N21 A;  4LF7 O;  4B7K A;  4O2A B;  2BSK A;  4FIP C;  4UCV A;  4DR6 B;  5EC1 C;  2EIN C;  3OMN B;  1Q82 W;  2QKS A;  3ASN C;  1N36 O;  3RWR D;  2WWW A;  3VBB A;  4DV3 B;  5CA1 A;  1NT2 B;  3F7Y C;  4JGS A;  1O9H A;  2LW7 A;  3CRM A;  3B8M A;  1GKF A;  4J9Z B;  2ZT9 B;  3FAV A;  4YY3 B;  1N0N A;  4O4J B;  3PJS K;  3RVY A;  4MVS A;  1YTF B;  3HB3 B;  1AR1 B;  3W7U A;  5CB4 A;  2RJZ A;  5L3D A;  4W4K A;  4UV8 A;  1K33 A;  1JX9 A;  4JTA B;  2KKW A;  1H8H G;  5DED A;  1GMG A;  3EXA A;  1H2K A;  2LFS A;  3LUT B;  4LF6 O;  4EB6 A;  4O4L B;  1QU7 A;  1RP3 B;  3OUS A;  4CS3 A;  3CCJ V;  5EZY A;  4LWS A;  3CE2 A;  5LBQ A;  4JI6 O;  1AR5 A;  4B7E A;  4I9Q A;  3CX5 F;  5K1X A;  3E89 A;  2ZDI C;  1K34 A;  4CC6 A;  3AG4 C;  1OCC B;  2XUM A;  4QE7 A;  2PI5 A;  1V55 B;  1NI8 A;  3D8C A;  2DQ3 A;  1S5J A;  4L87 A;  4ZOL A;  1KQS U;  1NTM H;  4FLT A;  3WB2 A;  2WA3 A;  1Q86 W;  3ABM B;  2X6C A;  5LA6 A;  5L3E A;  4O2B B;  1M90 W;  4WFA V;  3UKM A;  2GV9 A;  2D3O W;  3HKC A;  3ZHV A;  2D2C B;  1ARO P;  2LO1 A;  3R65 A;  3SYA A;  1VP7 A;  4FLZ A;  2DYR B;  2UUC B;  3G67 A;  1BT8 A;  3ETD A;  3GB7 C;  1NH2 D;  4I50 B;  1VQ9 V;  2JVD A;  4TV9 B;  4JI2 B;  3KZI Z;  5CBG A;  4PDR A;  2N04 A;  5E79 Z;  1OCZ C;  4H37 A;  4YJ2 B;  3CS5 A;  1XUQ A;  2W0X A;  4X1K B;  1IBM O;  4I5S A;  3OGI B;  4UB6 Z;  5H6R A;  3UO3 A;  3JSL A;  3X2Q B;  1EM1 A;  4DV6 B;  1ZAU A;  1VEW A;  2RQ6 A;  1K5Q A;  3VQW A;  5EC2 C;  2MK3 A;  2ODM A;  4LF4 O;  4DRX B;  1BCC H;  1PNM A;  1ZL8 B;  3T1Y B;  5CN0 A;  3CCQ V;  3W7T A;  2BTQ B;  4KUM A;  2EIK B;  3OTF A;  1YDX A;  1XL4 A;  4EKW A;  3P3N A;  2LGW A;  4RQE A;  1JJ2 U;  3ML0 A;  3E8H A;  1SQF A;  4YHH B;  2JGD A;  5L3C A;  1R3I C;  1K4D C;  1KU9 A;  1R6K A;  1VIB A;  1F4N A;  1RM1 C;  3W7X A;  1JR9 A;  4P9P A;  3IFX A;  1ZWI C;  3UCS C;  2NR5 A;  2B9Z A;  3OGC C;  2QSA A;  4I0X B;  1IZ3 A;  1M56 B;  4K0K B;  2ETN A;  1SZT A;  4JI5 O;  4X9Q A;  1AJN A;  2YIB A;  3VQV A;  1FPO A;  2NNU A;  3TXS A;  2R9I A;  3QVN A;  4O2A A;  4PEL A;  4PI2 A;  1NH2 B;  2QA4 V;  4B3T O;  3K58 A;  1KB9 F;  5LMU B;  1AJP A;  1BGY H;  3OR6 C;  1KD1 W;  1MMM A;  2YI8 A;  1W0J G;  1JOY A;  4JI0 O;  3K0D A;  2Q69 A;  4ZHQ B;  4AIL C;  3CC7 V;  4FM0 A;  1W0K G;  3FFQ A;  2E74 B;  4DV7 B;  3UT5 A;  1Q6U A;  2Y0I A;  4GUN A;  4O4I A;  2HHH B;  4LC1 A;  3ETE A;  3RYH A;  2VQE O;  2A7W A;  1I5X A;  1QLE B;  5B1B C;  5JH7 B;  5LOV B;  2BOB C;  4X20 B;  4GX1 A;  2FML A;  2JJ1 G;  4G2K A;  3SPC A;  1FXH A;  3B8N A;  2ZE7 A;  3S3W A;  5JJN B;  1L8D A;  2P7T C;  4X64 B;  4PA9 A;  3JAW A;  4C7U A;  1PL0 A;  5K1P A;  5HFM A;  4DR3 B;  1R73 A;  2BE3 A;  3ZHQ A;  1S5L Z;  4DV4 O;  1KYO F;  3H1I H;  2Y69 C;  2PTM A;  5IYC O;  3AG1 C;  4JI4 O;  1FD9 A;  1NS1 A;  4NXM B;  2ZD9 A;  2ZE6 A;  3JYC A;  5B5E Z;  3A2F A;  2IJH A;  3CHX A;  2UXC O;  1H2N A;  3JAM N;  4J11 A;  4LF8 B;  4MTF A;  5H5N A;  1OCO B;  2VS0 A;  5H9C A;  3U0Z A;  2GTS A;  1OCR C;  1NBM G;  4DR1 O;  5KA6 A;  4DK0 A;  2IH3 C;  3CCV V;  4O4H B;  2KQX A;  2P22 C;  5L3B A;  4RUE A;  1V54 B;  2ILM A;  4FK5 C;  1SQQ H;  4CH3 A;  3OTO O;  1S0V A;  3APQ A;  4DUY B;  4YXW G;  1DK1 A;  3UO2 A;  2IH1 C;  1N32 O;  4I4T A;  3M8A A;  4X66 B;  3CPW U;  5FL7 G;  1WPX A;  3CEI A;  3J7A U;  4KHP O;  4X1K A;  3AG2 C;  4G27 B;  1EN4 A;  2IM9 A;  2EIM C;  1JA8 A;  3OEE G;  5EK0 A;  4MTX A;  3G6B A;  1UJW B;  4CH5 A;  4HBN A;  4JPR A;  5J2T A;  1VQK V;  4CS4 A;  3A0H Z;  4LFC B;  4KP4 A;  1HNZ B;  1VQ4 V;  2MW2 B;  2WLJ A;  2VQF O;  4QPJ A;  1GAX A;  2DE0 X;  3ZRW A;  1WP8 A;  1AIL A;  3HPL C;  2ZXW B;  1D5A A;  3FYI B;  4D7T A;  4BIO A;  1BZK A;  1PKX A;  4FZ1 A;  4MW8 A;  4JYA B;  5GON A;  1KC8 W;  4JAU A;  2HFE C;  4HYO A;  1US6 A;  2Z0A A;  1IUR A;  2GHY A;  4LH7 A;  4ABM A;  4PA7 A;  1KP2 A;  1SQP H;  2V4D A;  5CA1 B;  2YXH A;  4JAV A;  3BVO A;  1B06 A;  2F4V B;  2QTS A;  2X7R B;  5CA3 A;  2X0L A;  1J5E B;  1JPX A;  2OCC B;  4FLU A;  4BW5 A;  4CH4 A;  2HVK C;  3QO8 A;  1IBK O;  1LNQ A;  1VF5 B;  2XTA A;  3FAV B;  4PV1 B;  3E8B A;  3MAQ A;  3C3T A;  1R6T A;  2QEX V;  3S3X A;  4B3R O;  2XAF A;  5B3S B;  5CB4 B;  3U11 A;  2UXD O;  3BFR A;  3JD1 A;  4DR4 O;  4DO2 A;  2X6A A;  2CDY A;  4DV2 O;  4AQY B;  3ZMT A;  1TVK A;  4LFA O;  1GN2 A;  4K35 A;  4EB6 B;  4UV9 A;  3ASO B;  2YEV A;  5IDJ A;  2XAQ A;  3E83 A;  4LFB B;  4W4L A;  4DR5 O;  3JCU Z;  3ZS8 C;  5CA0 A;  4X65 O;  1DF5 A;  2QKC A;  1XMO O;  4UFZ A;  2FTK A;  3E8G A;  2YS8 A;  4DR2 O;  2JS3 A;  3OR7 C;  2CGN A;  1HNW B;  3K5O A;  2IJJ A;  4HAM A;  4OPH A;  3A8T A;  2WPD G;  5LA6 B;  1Q6H A;  1RSO A;  1RPO A;  1EZJ A;  3HKC B;  2JRI A;  3K9A A;  3K03 A;  3ZHS A;  1MG1 A;  2H3O A;  5JJJ B;  3X2Q C;  2IJI A;  2XOK G;  1N33 O;  2YI9 A;  3T2M A;  5CMU A;  1VQO V;  2F43 G;  1P84 F;  2EJ7 A;  4JV5 B;  3RN4 A;  1YF2 A;  3DXR B;  4UCO A;  1JFF A;  2VWJ A;  1Y76 B;  3SYQ A;  2EIJ C;  3LNM B;  3QO5 A;  1HNX O;  5B1A C;  4K8Z A;  1XMQ B;  5EBM C;  1FYJ A;  5J2U A;  2P4K A;  1VQ6 V;  1H38 A;  3BAA A;  4F6R A;  1WPB A;  4NXN O;  1KMI Z;  4RO2 A;  1PL4 A;  4QNH B;  2LJ2 A;  3CXC U;  3JCZ A;  4DV0 B;  4DUZ B;  3UQ8 A;  2ZE5 A;  2PI4 A;  2B5U A;  3CRA A;  1H2L A;  4OXS A;  4MW3 A;  3ZMS A;  1P7G A;  1ZLZ A;  5DEC A;  3LSU A;  2JS5 A;  3WFV A;  1KP3 A;  3ZRS A;  4GKK B;  2W6I G;  1S76 D;  1BS3 A;  1KEC A;  2Y0P A;  1W2B U;  2Q5Z A;  3E22 B;  3RYF A;  1EZV H;  2WLI A;  3GWK C;  2JGD B;  1QR9 A;  1B04 A;  2Q0O C;  1K73 W;  1XI1 A;  2PYL A; 
#chains in the Genus database with same CATH homology
 1NU1 H;  3BCC H;  1L0N H;  3H1K H;  1L0L H;  1NTZ H;  1KB9 F;  3TGU H;  3H1H H;  3L73 H;  1BGY H;  1BCC H;  1SQP H;  3L74 H;  1KYO F;  3CWB H;  3H1I H;  1PPJ H;  1NTM H;  3H1J H;  3L71 H;  2BCC H;  3L75 H;  3L72 H;  1PP9 H;  2FYU H;  2IBZ H;  3H1L H;  1EZV H;  3L70 H;  1SQV H;  1NTK H;  4PD4 F;  5KLV H;  3CXH F;  4D6T H;  1SQQ H;  1SQB H;  3CX5 F;  1BE3 H;  4U3F H;  1P84 F;  2A06 H;  1SQX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...