4Z1VA

Structure of factor inhibiting hif (fih) in complex with fe, no, and nog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z1vA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z1vA01
3OD4A 4QU2A 1H2KA 3P3PA 2WA4A 2CGOA 4AI8A 4B7EA 5JWPA 4Z1VA 2Y0IA 3P3NA 4Z2WA 4JAAA 3D8CA 3KCXA 3KCYA 1H2LA 2YC0A 4BIOA 2WA3A 2YDEA 2W0XA 1MZFA 2ILMA 2XUMA 1MZEA 1H2MA 4B7KA 4NR1A 2CGNA 1YCIA 1IZ3A 1H2NA
chains in the Genus database with same CATH superfamily
2H0BA 1L8DA 3MPBA 3I2HA 5JPNB 5C5TA 1V9PA 4YHHO 1LULA 4MHUA 3V0AB 3IT8A 2Z79A 3MUZ1 4DR1O 2WS92 3NAPA 1WLTA 4X6QB 4HANA 4L99A 3HBKA 3HEIA 4GWMA 4PLOA 3MHSC 2QWPB 1VIBA 1K5MC 3H1HH 3VD4A 4HN0A 3K9SA 3FE5A 3GM8A 4BQ4A 1HNXB 1NBMG 2RM23 2WLQA 4NTWA 4DYLA 4UV9A 2WN3A 2V4VA 4CDWA 5B1NA 4LEJA 1K12A 1IXMA 4CS4A 2F4LA 4UXAA 2XBO1 4ZS2A 3QOPA 1POQA 2XAGA 2X10A 4LBJA 3W5NA 1D4VB 1K5SA 2B39A 1N34O 1O9GA 4WVVA 1W8TA 4GIQA 4JV5B 3ZSEA 2HG5C 4JI3O 5FZ8A 4AGRA 5CISA 3BFRA 2FDKA 4COZA 3I3BA 5FZLA 3IC7A 2ID4A 1X9PA 2PF4E 3JXSA 2FCUA 3ZMZA 3ETDA 3M8AA 1OCCB 5A3UA 3NMBA 2BTVC 3U78A 5BY1A 4QHBA 5KXDA 1PO12 5EC1C 2J1RA 2P3YA 1HB2A 3GHNA 4LF7B 1JTZX 2CWMA 1OD3A 3VV1A 1ZRIA 2KR2A 5H9PA 1EUUA 4XF1A 4WM7C 2XAHA 1WCKA 3BYWA 3U11A 4E4HA 3F5WC 4OI2A 1R6TA 4YGEA 4E8CA 4ES9A 2OYZA 2A7AA 4CVUA 3RYCB 5G04L 4CXYA 1KU9A 3ZRXA 1F51A 2X7RB 4QX5A 5FLHA 4X1YA 3O1OA 5FPRA 2FHRA 3O1TA 4JTAB 5F3EA 1FMD1 3TRSB 1MOFA 2XVKA 1J95A 1LEDA 3J4UH 1UIJA 3ZFGB 4CXWA 1TQ5A 1IGOA 1W90A 5DUWA 3P5BA 3BVCA 2Y48A 4I55A 3UM7A 3O7OA 1US2A 1ZVFA 3SEPA 1S0BA 4BLIA 3ZXJA 2HWF3 3K48A 1GFF2 3PJQA 2A3XA 3WDWA 1GBGA 1MZ6A 3OMIB 4OQ9A 3WDUA 5IJRA 3PUSA 4ARXA 3DV8A 1QNYA 4GQ7A 1OXCA 2VVEA 1O3SA 4DR1B 1IQAA 3HOBA 4I01A 4E27A 5EBLC 5EYPA 1S2EA 3SQOA 3R4SA 1LOAA 1OUXA 2XOMA 2XWBB 3UJQA 2YS8A 2VW2A 4HK9A 3TAYA 3MEPA 4LO8A 3D3AA 3AG3C 4QE9A 1I5YA 5A1FA 2V1DA 4C1WA 1R082 1QJU3 1G7YA 3RZLA 3WW4A 2BOCC 2RR12 3RSJA 2AENA 5J36A 5FYBA 4XBFA 4DUYO 1BBT2 4Y1VA 4XJUA 2RS51 4U3JB 1HKDA 3HKBB 4R4ZA 3BIWE 3WINE 2F4VO 2EA7A 4OPHA 1FNYA 4IV3C 2B5UA 1NY72 3DXUA 3ES4A 1V6KA 5I8SA 3SJQC 1L7RA 2C6SA 5FY7A 4AGGA 2RDCA 5C71A 3ZDVA 3Q8FA 4NN0A 4D0QA 1NLSA 2DU1A 1AXZA 3KQ4B 5LK7B 3H50A 2QM8A 2Y6JA 3CDZB 1VF7A 4A6OA 1ZZ8A 3VZKA 4OUSA 1JZ8A 4FOVA 3W59A 1UJWB 5E16A 5C8CC 2D6NA 1NCRC 3W7XA 5K0UA 1OJHA 1RUI2 1WW4A 5JCOC 1Q56A 3VBUA 1UZVA 3JATA 5DAQA 2GAUA 1CIWA 2PYTA 1UAIA 4XYXA 3EBRA 1EM1A 4X66O 2R073 3ASOB 4YG6A 4NAOA 4Q26A 3WP3A 2HVJC 1PVC2 1K4CC 2C24A 4P2ZA 1FPN1 1SA0B 4AI0A 4XDLA 4IDZA 1ULFA 3J7HA 1GWLA 4JGYB 4S2GA 3FLPA 4QQOA 5F5AA 1ZM1A 2W87A 2C0ZA 3NKTA 2DWRA 5BNNA 2WT1A 1YFWA 2Y64A 1U5ZA 1DQ0A 1I5XA 3H9AA 5E1AC 3AKQA 2ZOEB 3LFIA 4YVSA 4G27B 1RXGA 1NCQB 2ZDIC 4RSUA 2IC1A 3TN93 2GTSA 4HKWA 3QO5A 1PL0A 1S77D 1D2QA 1W8NA 2RG4A 1ULPA 5FZ6A 2BGCA 3RZHA 5CZKA 3WNNA 5KWRA 3F95A 2CYFA 2VZTA 4UV8A 2Y6LA 3O0XA 2ZGMA 5LXTB 4W4ZA 2A6WA 4UXNA 2E6VA 5CAZA 3WP6A 3JD3A 1Q8IA 4M4PA 3ETQA 1HRI2 2DOSA 3N7MA 2YI8A 4YW2A 3FHIB 1UOBA 4RQEA 4YXWG 1XSRA 1FAYA 3STLC 1UPGA 2Q1ZB 1PGL2 2DBNA 3ON7A 1Z7S2 5E79Z 1UMHA 1ZBA1 4GZRB 5A32B 3IBMA 3WDYA 4OHXA 2QKCA 5IYBO 2IXKA 3CPWU 2M7WA 2LALA 1C8M3 1KITA 1OUSA 4NRQA 5GLVA 1W2BU 4O2BB 4Z07A 5LMNO 2QE7G 3IZOA 4CZSA 3IAPA 4HKOA 1JHJA 3JAWB 4ZU5A 3PUIA 1N0NA 4UFJA 4E4DX 1F9KA 4DOUA 2YXHA 2VXJA 4YIPA 2EIMB 1W04A 4XBNA 1VBB3 1K3EA 4DZGA 4W4LA 2PLV1 1UD1A 1RP3B 1W2OA 4FM2A 3BTXA 2A06H 2IXCA 3S5QA 4I9QA 4KBBA 2Y34A 3MIGA 3T1YO 3FLTA 4NPLA 4Q4X1 1JYTA 4GB31 3K03A 4QPJA 3DCQA 1AP5A 1VBE2 1HB1A 2VWJA 3NR7A 3UCSC 3WQ7A 1MS5A 1J58A 5FO7B 4XEZA 1COV1 4LA2A 2WLIB 3DGEA 2ZEWA 2ZX0A 4UI9L 4IEQA 3OTOB 2QDNA 4OI4A 2ZNIA 2OPWA 1WWYA 5FZ7A 1D2DA 4ZU4A 2WKKA 4A45A 3RYFA 4NRMA 4LUKA 2D6PA 1QKQA 2IXIA 2J1AA 4YLZA 2C9AA 1HXS2 2R49A 2IJJA 1WNSA 3L2HA 1IG0A 3ZR6A 2VAUA 3JSNA 4JI5B 5A2QN 2ZMNA 5IWAB 1W8ZA 4LLOA 4FPGA 3IIAA 2QKSA 4IEWA 2WFF1 4XW3A 1XE0A 3OPZA 3RZKA 2LP7A 1M57B 3LOIA 3A22A 3TEYA 4GKJB 1I5ZA 5IJ0B 1Q43A 4XTPA 2R061 3K4ZA 5ANQA 2RNBA 3LZZA 3ZM8A 2CTPA 1TE1B 3OGGA 5JQGB 4QNHB 3VGIA 4OHVA 3OD4A 1REFA 5CB4B 2VZUA 3M1HA 2ZINA 2PFWA 3K2OA 1VPHA 3OAAG 3JB8A 3D8CA 3SEEA 4GKKO 2EX3A 1WLCA 1QQCA 2BBVA 1SCRA 5FUPA 1H4HA 4DUWA 1X9TA 2E7AA 1GZWA 4QX3A 4JYAB 5T5OA 5J2TB 1B04A 1V6NA 2BGPA 3QNEA 4KFMA 3VUOA 3LSUA 4DV1O 3ZSMA 2YFZA 5FZ1A 1Q5OA 2D2CB 3CRMA 2ZGRA 1WJZA 5KXCA 4UCRA 5T52A 3E83A 5A7NA 2DBIA 3G4SV 4IT5A 4GMP1 1JZ4A 1WA6X 2QKAA 4Y20A 4HKLA 2JX9A 1AX1A 5DZFA 3NXSA 5L3FA 1CPMA 5LGTA 2Y69B 4U2AA 4NOTA 3E22A 2XASA 4KL1A 4B1MA 3NAPB 3DEMA 3N36A 5DPNA 2OA2A 4B29A 4MV2A 3S0MA 2XLAA 2VMCA 4Q4Y2 1J5EB 1QOTA 2PHWA 1O59A 2MPFA 3OPWA 4A3XA 4ATFA 4ABMA 2B8MA 5E88A 5EIBD 2PHDA 2QQWA 2OKXA 1UU5A 4M0NA 2QQVA 4LULA 2DCYA 4IUGA 2O0OA 4ZU7A 1RUC3 3VD5A 2RS11 4BXFA 3M3IA 4P5HA 1OCCC 2WLNA 4I0XA 3USSA 3EXUA 5JIAA 4JASA 1Q81W 4J80A 4RR3A 1SBFA 4LBKA 5A1LA 2RQ6A 3MW4A 3NW4A 1RJ7A 1VMJA 3WD5A 2WO3A 3K0GA 1FNZA 2KD7A 4P5YA 4YW4A 5H9CA 5FYVA 4COWA 3ZYGA 4Q1PA 3ZHTA 4I09A 4K35A 2V5YA 3FB6C 3POYA 4CCLA 4G9SB 3L75H 1VEWA 4FT8A 2KA3A 1ASJ3 3DSQA 1XBLA 1Y9QA 1BQPA 4YM1A 1VRH2 4BWOA 4GT1A 4Q6GA 4MZUA 5J7MA 2UUBO 4WVMA 3ZN1A 1V6IA 4KWJA 4QMAA 3SNMA 1OFNA 2WUHA 3ZFGC 3HAGA 4JTCB 1UY4A 2EAAA 2G9ZA 4X1YB 4WZFA 1DQ1A 4DV2O 2D44A 4J1WA 1EFRG 5CB7A 1I1EA 4HOOA 5FYTA 4EEQA 3KCXA 1ZRRA 4K7JA 4BW9A 2FZ2A 3B7MA 1AR81 4X64O 2YICA 4MOAA 3WV6A 1XEQA 1IZ3A 1YJ9V 2XJQA 1S0VA 2EILB 2QZ3A 4LBNA 4I55B 5CN0A 2JJ2G 4LF5B 3ATGA 2P22C 3E6DA 1N1SA 2J42A 4RD7A 4AVSA 1RUD3 4Q0VA 2VMHA 1RPRA 3B8NA 3RPQA 3O1VA 3B00A 2TBVA 2Q8EA 4XDQA 4WBNA 2D5HA 3IDAA 1I6XA 4OCTA 1ST8A 4ZPIA 1WCSA 4RYDA 5EYPB 4JTOA 4JF3A 1DZQA 3O1RA 2IW5A 1AR73 3MF9A 5FBZA 1AYM1 2VQEB 2UUAO 3GBFA 4FPCA 1DZTA 4MVOA 1K34A 4UCOA 2ZGUA 5H2FZ 3ZXKA 1W2AX 5CBGA 1KJRA 1RUJ2 2P4VA 3ZDSA 2B45X 2XUEA 3KZIZ 1QNWA 1SKVA 4LTAA 2CY6A 4CP1A 3VBOA 2MEV2 4YVWA 1XNQB 4A5UB 2XGXA 3JCUZ 1AJKA 1PM4A 5FZIA 1D4M2 1PMIA 2UU9O 5IT6A 5A3LA 5B1OA 2DYRB 1VF6C 3ASOC 4FQZA 2W92A 2JICA 4FCAA 2CL2A 1UZYA 3NNGA 2E7TA 1JOBA 4J25A 3WVJA 2AYHA 1WUVA 5FV3A 3BODA 5C3PA 5K0UB 4JGYC 4AVVA 1MNGA 4YZ5A 3U14A 4NVPA 3K3NA 5EJZB 3RMYA 4DR7B 3GJBA 5TSWA 5IVFA 4BU2A 4FPJA 2QWNB 3L70H 5HXVA 3VBUB 3JATB 1ACCA 3MV11 4E8DA 1KYOF 4J1XA 1JYIA 4IV1A 3IMNA 1O8SA 2DV9A 4FFGA 5C5UA 2UYAA 1CQ9A 5LYJB 4B3TB 2N7GA 5CA6A 4YM3A 3ZHVA 2JWPA 1W03A 4CUBA 5A6ZA 2N05A 1RC6A 4L11A 1NVPD 3HR9A 2HEVF 5BNNB 2VCCA 2VZOA 4DV2B 4H55A 3AZYA 4QHZA 3H01A 2E32A 3I2GA 4YVSB 2YEVB 4XABA 5DUXA 3WQ0A 1VAKA 2VUDA 4XCBA 1YYNA 3OJBA 4SBVA 5T50A 3GZTB 5JSRA 2Q1MA 3VQWA 3MIHA 3MV01 1CWPA 2DQ3A 1GQGA 1AR63 5AVAA 3AP7A 4RAIA 3WP4A 4BIFA 5DN6G 5LW9A 1MABG 1VQ6V 4DRVA 1GWMA 1ZZCA 4LFCO 5F5CA 4QKBA 1OQ1A 1KC8W 4TYSA 1HP8A 3OT7A 3ZXEA 5LA6B 4BQXA 1F5FA 2F66C 1YFXA 4LIVA 2P90A 1NU1H 2EXHA 5GM0A 1OURA 2JXAA 5ABJB 1TME2 4XAAA 2EIMC 4PA7A 2YYOA 3N9PA 4JGZA 3CX5F 4GAZA 5JR7B 1K42A 3PUAA 3FKSG 1HB3A 1NUKA 3ILRA 4DR5B 4LKFA 1VALA 1QJY3 2PAEA 3ZN5A 3EYPA 3SPGA 3IPVA 1QOOA 5HV0A 3WOGA 2ETEA 3VDBA 1PNKA 2PY5A 3I2DA 3CE2A 2XJPA 2VBPA 2IFWA 1OOPA 3M2MA 5FREA 1JZ2A 3KT7A 1W8HA 2VMGA 2BERA 1MEC2 5T54A 1LECA 1R6KA 1X36A 3WDTA 4P9IA 4TN7A 3AKSA 5LRRA 4GKYA 2PHRA 1ZNPA 1AZDA 5DXDA 1OD5A 4AG4A 4Y33A 5HFLA 1TNRA 4EZ4A 1QU0A 1JYWA 4Y4RA 3ZHSA 1FMD3 3BEHA 2FCVA 4JKKA 5LB6A 2RDRA 2IZWA 3B94A 1XL4A 3THTA 2A6XA 4WVZA 3NQHA 5I8TA 4AL9A 1N1YA 3FFZA 1M57C 2C4XA 4HAMA 5GZEA 3DYOA 3MAQA 5GTIZ 4LF8B 4DV6O 3PTRB 4C0BA 4KHPO 4MTGA 1YJLA 4Q8LA 4IEVA 3A0KA 3CU7A 4H7MA 3ZFEA 4RUFA 4XJWA 1VBD2 2GH2A 2ZGNA 4XQDA 1LOGA 3IN9A 2BYVE 4JI8O 5FPBA 4PELA 3JD4A 4TLFA 4O7XA 3FHAA 2QQKA 1D5NA 1HRV2 4LBQA 3LB9A 3AMPA 1JW6A 4CTEA 1BHBA 2ZT9B 3ME2A 2PAKA 1DZRA 1OA2A 1RMU2 1R081 1Y9MA 3KV5A 2AC1A 1VF5B 4OUEA 2RR11 1H6XA 2XB6C 1AXKA 1XU2A 1COWG 5BXXA 3U07A 5AC92 1FXVA 1FFTB 1BBT1 2OTJV 4P9XA 2Y69C 1W6NB 3E2EA 3WG2A 4AFCA 4MXVA 1UXZA 3NAPC 5JXGA 1NY71 2ZXQA 3JAKA 3WG7B 2WNVB 3MLLA 4DK0A 2KM2A 1M9NA 3ST7A 5FPVA 2E53A 5FYYA 3ABUA 2JD4A 3NNFA 1F35A 4HVQA 1NQDA 3LQCA 1GKFA 1JJOA 4K40A 4GD4A 2BNNA 3X29B 1DIWA 1FI2A 2F43G 1JQ0A 5C7GA 1YQ2A 4K1ZA 2PI5A 1YFYA 2XLGA 1BL8A 2YU1A 2UUCO 2CUGA 3IDCB 3PURA 2R9IA 1QXRA 1RUI1 4LLFA 4Z2AA 2HR3A 3G71V 2FD8A 4LHNA 1R3LC 1WP8A 4ORFA 2M6YA 2GP5A 1RUE2 1RSOA 1FPN3 2B4KA 5FR3A 2Q4SA 4HZ3A 1W99A 3QG5A 1QH6A 3CJIA 4OZXA 1VQ8V 2XHNA 5EZYA 2QVSB 1UO9A 4HK8A 3ZHUA 1ZL8A 2CH7A 2OZ6A 1SQQH 2D40A 4I0XB 4RR3B 3G67A 2JG8A 4B3SB 1I3HA 3KV9A 4YZ3A 2E33A 5IVCA 1BEV2 1OF3A 2QEXV 3WF3A 2ZEZA 3ZVXA 5C8WA 1I94B 5FXXA 3V65A 2EIBA 3OMAB 3NNMA 4Q4W3 1IVSA 2QWRB 4UF0A 2Y38A 3D0JA 3IDBB 3MLJA 2JDMA 4JX0A 3ZHQA 1G6NA 4C0HA 4AHZA 3T08A 2EICA 1UCXA 5LL6Y 4XTMA 1HRI1 4XUNA 2BDRA 4YJ3A 3Q8BA 4WVMB 2V7QG 4NJ4A 4HL0A 1MS1A 1KXGA 2B46X 2NN4A 1ZBA3 5DEDA 3FL7A 3ICXA 4L8QA 2EZPA 2EILC 3WHTA 1C5IA 4FFFA 4P9YA 1MS0A 2ETNA 4NKGB 3P3NA 2D6OX 3TB0A 4N90A 4AFBA 3JASB 1WB8A 1UXXX 1BMV1 3T30A 3UO2A 3N2KA 1SDDB 2WINB 1BJQA 2LO1A 2P7TC 2BNOA 2DU0A 4QX1A 3OBRA 3Q8AA 5IJ9A 4QX7A 1YHFA 4O2AB 4DR2O 3SDLA 4S2DA 3I3DA 5F5IA 4AHWA 2PLV3 2B42B 5CFDB 3E6CC 4FLYA 4JDOA 3ABMB 2VXRA 3AK1A 4RHV2 4M4RA 3PDQA 5FP7A 5FOJB 2FTKA 3WDVA 4FPLA 1GN6A 4WBNB 4GB33 2V73A 4HSLA 2RV9A 1VBE1 5I0TA 2OW4A 2WZPP 4CDQB 1RHI3 1COV3 2OQ7A 3TNPB 4BB3A 1REEA 1WKYA 3C7HA 1OV9A 3I3QA 1AR92 3ZXFA 1OKOA 5L73A 3I2OA 4JI6O 3B02A 2Q7GA 2AH2A 4Q2FA 2DYRC 1SC5B 1TMF3 4K1YA 4Z1VA 2FDIA 4NWWA 2Q7EA 1HXS1 2VZQA 1XPWA 3VBOB 2ADDA 2VD7A 4AAPA 3WNKA 2JDUA 4YVWB 5K0UC 1APNA 4OQ8A 2KG7B 1JOYA 2XOKG 5B4NA 1QOSA 3ZSJA 5FY4A 1AL23 1H6YA 3RYHA 4Z92B 2JEUA 3VBUC 4DINB 5K9YA 2DWDC 4AWDA 1AX2A 2E74B 5J96B 4X8PA 4Z1MG 3JD72 3VKNA 2DUOA 4FPOB 3I3EA 5DAXA 2I45A 3LDBA 5JXHA 2YXLA 4CCNA 2N04A 4B4QA 4C1XA 4FSJA 4FVVA 1ZRDA 5CEHA 3BTYA 3W21A 5BNNC 3BAAA 4UCUA 3LFMA 4X88A 4NUBA 1PIV2 2IXJA 1WD4A 4YVSC 2XNDG 4LO6B 3SR2C 3M7AA 4A4AA 1AXYA 1H8HG 1HDJA 2Z0AA 4UW5A 4RFRB 2JE9A 2TUNA 1JU4A 3NO8A 2VBDA 4GMP3 4CU9A 3MIEA 3AMMA 4JI4O 1Y6XA 2EXJA 2ZGTA 3UKTA 4P9OA 4KI5M 4CUAA 3NRUA 2X53S 1LAJA 3T1HO 4AEDA 4FTSA 4KP4A 1XE8A 3ACGA 3CS5A 3ZMUA 2JDKA 2BGOA 1WPBA 1A34A 5A3NA 1BK1A 1R6NA 2IJIA 5FKCA 4RO2A 4Q4Y1 4E9KA 2Q0AA 1V55C 2IXLA 1GQHA 5ABJC 4XQ4A 4FPHA 3CCVV 2NPIA 3J8F2 4YPJA 1DBNA 4R52A 1MVQA 5BNOB 1X59A 3KWVA 5ERLA 1QHTA 1TUBA 3Q8CA 3WB2A 3CL1A 1GM9A 2JKXA 2X6BA 2E31A 4Y5SA 2ZGKA 3LA2A 1QEXA 1N3PA 2FQPA 4FP2A 4UB6Z 3GDBA 3K3OA 5JCTA 5FK8A 2OVUA 5C3QA 4NHYA 1BCCH 4BZ4A 2JB8A 4B4RA 5L9RA 4JGZB 2VQFO 4YM2A 2J1TA 4BR6A 3WU2Z 4QQ2A 1RUH2 2WJSA 3CD6V 4E4EA 4U36A 4LKEA 4EWAA 4WCEV 3I2KA 3HVDA 1RUOA 4HNAA 5FMBA 2A73B 4MGIE 2ZKOA 1RM1B 3CKHA 4BPZA 3MZHA 1JMUB 2WZ8A 1TA8A 3IPVB 2GV9A 3H1LH 4FJCC 3LNNA 4IEXA 3UKMA 5H9QA 1OH3A 1Y9GA 4BLJA 5FAXA 5FQ0A 2VO5A 2W91A 5C3RA 1OOPB 2RM21 2XJSA 3WNMA 2R0HA 2SLIA 3SCHA 5I8YA 5APAA 4EWEA 1XNRB 3MDPA 1IBKO 5IVEA 1PNGA 3DC6A 2ORXA 4MVTA 3GZEA 1JYNA 2YIAA 3ZRWA 5A80A 1T2XA 4JDMA 2ZJCA 2X5IB 3POJA 1BS3A 5CU1A 4Y1ZA 5LA2A 1W6PA 4K8FA 4UB8Z 4ITCA 3LDEA 1AR83 2BSKA 4UFLA 3WUCA 1P7BA 3CO2A 4FLTA 4M01A 4QXHA 4FTBA 2RDSA 2VNVA 4GUNA 1RUG2 5G05L 3CRCA 1CAUA 1W3XA 3OEBA 3ZFEB 1U5YA 3HB3B 5B3SB 1JX9A 1BGYH 5EPAA 1BVP1 3R6SA 4W6XA 4OVEA 5CG9A 1VARA 1FXKA 3S3XA 1NZCA 1ZX3A 2W46A 1HDKA 2DN9A 2XVGA 1DGLA 3HT1A 2VZ1A 4LBQB 5FK7A 5KAFZ 4ZZ5A 1J83A 3U10A 2H8PC 2UU8A 1JODA 3GHMA 4ARYA 4E2GA 1FJGO 2MK3A 4PI0A 1AYM3 3MPPG 5IFPA 1Q8VA 2JDIG 2L6LA 3MI8A 4FFIA 3WG7C 2WNVC 1G9AA 1FOD2 2EULA 2AZ0A 2D3OW 3FX3A 4LK7A 4BMBA 1XJAA 4FXGB 5K1XA 2YROA 3KT4A 1XYNA 3JAMN 4PQ9A 1AR4A 5JR2A 3OF1A 3K4DA 2YDEA 5FLXN 4DEVA 5CIRA 4J7KA 2WWJA 5JVDB 4MGTA 3JAKB 4FLZA 5JMOA 4Q4V2 2A6ZA 1HLCA 3ZKYA 3CEWA 5DG1A 1PO22 2NP0A 1OBNA 3RZJA 3VBRA 5AVPA 1AX0A 2F93B 2G9GA 1N3QA 1AYN2 1QHDA 1Y4WA 1R1A2 3LA3A 3THPA 5KR7A 2B1IA 1CD3G 5F8PA 3I49A 5IFTA 4LNUA 3FWEA 5HV4A 2LTNA 3VL8A 4F83A 1QXPA 5GLWA 5CVRA 3KS7A 4AF9A 1NE4A 1FT9A 4XOGA 1GZCA 1JJ2U 2XL9A 4P14A 4RR3C 4A42A 5FO9B 4NB5A 1RSOB 3T2PA 3M70A 2JD9A 2CWSA 3E5QA 2UXDB 4LWSA 3CJIB 2ZE5A 3CC7V 1O5LA 3NJVA 4WZCA 2JKBA 4CCMA 4B08A 3N9QA 3B69A 3EQEA 3K51A 2AGAA 4CCDA 1LOBA 1REDA 3AP9A 5J9PC 3AZXA 1Z0HA 5A1AA 2VQ0A 2UY8A 5CFCA 4A3ZA 4A6SA 4CYDA 1S4CA 2WS93 1ZZ6A 4F4LA 1YF2A 1F23A 2WLKA 3TK1A 3PLQA 2CDPA 2W1UA 3ACHA 4NMIA 5C9AA 5H6RA 3ZFFA 3VKLA 2VCMA 4LC1A 4KU7A 4CH3A 3J7NA 4AQTA 4ASLA 5H9RA 1AJNA 4FAGA 2V72A 1Q8SA 3T1LA 4H0LB 4PDWA 2PHXA 4AQYO 1GO3F 4JI2O 1XE7A 2X6AA 1S0CA 3CCLV 2HLEA 5FDBA 4BW5A 4CBCA 1SQPH 5CFDC 3ZYHA 3ABMC 2G4IA 4LHLA 3N2KB 4YNIA 2W47A 3E8FA 3O9OA 1LKNA 1QXJA 2CE4A 2JS5A 4ZXKA 1L7LA 3M3EA 4E2QA 4CDQC 2Q5ZA 3O1MA 3ASNB 4B3MO 5KX5B 4LJHA 2YBSA 4UCSA 1SFPA 4ASUG 3FZ3A 1WGPA 1AJOA 5FZ0A 2ADPA 3T2TA 1ZA7A 2IFRA 1C28A 1E5HA 4BJ0A 4WFEA 2Q8VA 4LH6A 4CE8A 3FYEB 2VOWA 4XVHA 1XNBA 2FZ1A 1US6A 2HWC2 2GDFA 4JI1O 1ZRFA 3WXPA 3IDEA 5EZWA 2N74A 2YB7A 2R7EB 4X20A 3IWZA 1AILA 4TWTA 2JRIA 1EUTA 3VBOC 1HNWB 1TVKB 3ZPOA 2JEXA 4YVWC 3FMGA 4EN7B 4E4ZA 2VMEA 1QJX2 3C2UA 5LWBA 3N7LA 1XNKA 2P6CA 2QDOA 3TN92 4EN8B 1VQ5V 2YU2A 4UW4A 4EKWA 3LPGA 2Y60A 1NZ6A 4X62O 1XNCA 2QQMA 4KH9A 1JZ5A 5KUKA 2WAMA 1VBD1 4D7TA 4AI8A 2UWAA 1GNYA 3RYHB 4AQSA 1B6QA 1IOAA 4K0KO 1N3OA 2QNKA 3SJAC 1PK6A 4LBLA 2QQOA 2VMFA 2XONA 4FO9A 2UXBO 1YQ6A 4LF6B 3MYXA 1TVGA 3GZUC 3E35A 3IB3A 3WQ1A 2HEYF 2X0LA 4V1PA 1UU6A 1VQMV 1UWWA 3GYDA 1R083 1HW5A 4CC6A 3OGJA 3ZMTA 2RR13 2OUHA 3DYMA 4IL7A 2BU9A 4DO2A 3H42B 1SBDA 1LNQA 2LW1A 2XAJA 1BBT3 5AC91 1YIPA 1V6OA 2DTWA 1LU1A 1GSLA 4DV3B 4JTNA 2Z4FA 4JAVA 1SETA 5KA6A 4YFZA 3ZYJB 3SXWA 1OPMA 3I4IA 2XDVA 4GJYA 4KWLA 4XCAA 1QNMA 2HHHO 4W4KA 2QQNA 4QPYA 1JPXA 4MGZE 5C3SA 3OGRA 2FBEA 2IVIB 2QWOB 2BOIA 3K3WA 2OS2A 5IVBA 1S3JA 3VDDA 5F32A 2HP8A 4CCJA 3KLSA 4HBNA 4AEDB 2V4DA 4C8DA 5BNOC 5CBLA 3WG4A 2D98A 3AYDA 1RXFA 1RUI3 4UVAA 4RQFA 3CF6E 1URXA 4XZPA 3WF4A 4RFT0 5HCBA 1PVC3 1RUNA 3CMGA 3BB6A 4JGZC 4K6BA 2BUKA 1LU2A 1LEMA 3DPRA 3HKEB 5HBAA 1TUBB 2OPKA 1BE3H 4M3CE 2VTFA 4PT6A 5LBFA 4MYEA 1HR0O 3WB1A 2NLRA 2CAUA 2VZPA 4XHXA 3VKOA 1YSCA 3T2MA 1RM1C 1JA8A 2JDZA 2JK5C 4JI0B 3KV4A 2IUWA 4EYUA 2DMXA 5AG2A 4FFBA 4NIIA 1K4DC 1W6MA 3OTFA 2ZHMA 5C70A 2UURA 2LW7A 3DXRA 4YZ4A 1YXWA 1QQP1 2EIDA 5KHKA 1OOPC 3V64A 4HNAB 3HPNA 3VKMA 3OD0A 1KGYA 2VBBA 3CXHF 4J7ZA 1W8OA 3C7FA 2GNDA 1OLME 4QGNA 5BR8B 4OHZA 4X65B 1KP2A 1QH7A 2W39A 2RN9A 3TCUA 4C7UA 1LOFA 1HRI3 2EAKA 2Y33A 2X5IC 2BRTA 4LXLA 2XXZA 1S0DA 1GMMA 1MVEA 3VBHA 4M3CF 5K1PA 1Z7S3 4KQ7A 4DXRA 5FYSA 4QX0A 2AXTZ 3MHHC 2ZHKA 1EN5A 4K8ZA 4XFHA 1U5XA 3UGHA 2PMWB 3ZRWB 3H3UA 1DHKB 2BFUS 2VZ3A 2WNOA 4IEOA 1GU3A 2ZM6B 3GCXA 1EAH2 1MZFA 4X8NA 1I7FA 4DXZA 3ZKUA 3ZFEC 5EWSA 1W6PB 2YY1A 2A0LA 3SISA 4ZBMA 5B3SC 4N43B 5D1IA 2JG9A 5JLVA 1F2NA 4CP2A 3AL6A 4R9DA 4DW1A 4UW6A 1BZWA 1Y43B 3APQA 1GNHA 3CEIA 1VJ2A 4GX1A 3BU7A 1M4UA 4NHKA 1P49A 3ZXDA 4QPGB 3B09A 1GZTA 2DDUA 1W6QA 1CAUB 5C4WA 4NXMO 4WM8B 2LW8A 2GHYA 3O0WA 1MR5A 4XFAA 4TSFG 2X05A 2IJHA 3AJZA 4XILA 2GUZB 5FPZA 1VBE3 3KHCA 5CNAA 4LKDA 4OX9B 3POGA 4ZKIA 3SLIA 3FLRA 1NQJA 3AVRA 2DTYA 3CRRA 3BPZA 1XHZA 2YGMA 3CMAV 4J6GA 1PGW1 4XJ9A 4CXXA 2W0XA 2OCCB 1OCRB 2W1QA 1OF4A 3JB4C 4DRXA 2J1VA 1H1AA 2EIEA 2Y6FA 1IPKA 4DV0B 1WW7A 4LFBB 5J2UB 3EXAA 1UPSA 1HXS3 2QQIA 4XAEA 3RWKX 1OSGA 2QR4A 3ZR5A 3QF7A 1VMFA 3WT3A 4TV8A 2R042 3I7DA 3UJOA 5EYXA 1GN2A 1IBMO 2ARCA 4YSFA 3UETA 4BISA 3KZ4C 3VBRB 1HIXA 1HJFA 4FZ0A 4U7NA 2WNUA 1MMMA 4AEKA 3S3WA 1V9U2 3HMYA 3N27A 4ONUA 4YFWA 1K5MA 2CAZC 5FZAA 4R7CA 5FZHA 2DFCA 2BE3A 1PM9A 2RDNA 4LNUB 3CJIC 3J7LA 4XUQA 4Z2WA 4DRRA 5B5EZ 5A3TA 4KG0A 3VN4A 4YY3O 3AJYA 1B09A 5JUVA 1GP4A 4FM1A 5LA0A 2YFUA 4RN5A 1PIV1 1H8TA 2JG8C 5JOWA 1KJLA 3RMXA 3AC0A 3AXEA 3E97A 4LWSB 1G9FA 4YW1A 2RS32 1UFIA 1XNDA 3WCSA 4XFGA 4MVSA 2W68A 3BN6A 3PJYA 1PX3A 4YW5A 1OKQA 1V54B 2K9ZA 3KKYA 4DUZO 1KD1W 3LSDA 4AVAA 1LR5A 1Q7YW 4CEWA 4ASKA 5CFCB 3O1UA 3WUDA 1HNZO 5E8AA 4JYBA 1CEZA 2W0FC 4YW6A 4LO7A 4JCKA 2NMOA 5KUMA 1PKXA 4IHJA 4XDJA 4Q4Y3 5C9AB 3ZFFB 5LA1A 3NV1A 1YQCA 2HWB2 2OXBA 4CH5A 2AR6A 1ND2B 3ZN0A 1RUF2 1C1FA 3CYOA 3ACLA 4S2FA 2A5ZA 1GQPA 3V56A 4BM8A 4PDWB 1TZOA 5T5PA 3WCRA 1R3KC 5F6KA 3VDCA 2YV8A 2P5BA 2VQTA 3TOJA 3ABLB 4LF9B 4QJFB 1PD3A 2WL1A 4CPBA 5A3PA 4PQQA 5IYZA 5DZEA 4MUVA 3SPIA 2ZE6A 1KB9F 1AI6A 3PMEA 2VOXA 1LHNA 3JBG2 3N7JA 1EN6A 5ISLA 5LBEA 4LNVA 5FMOS 4X8AA 1DQ6A 4PJYA 4X1KB 4UVBA 2XVLA 4QE7A 2NNUA 5FUIA 1Q8OA 1CAVB 1VRH3 4MW8A 1EZVH 1AR61 3T0AA 3FB5C 4IE5A 1PVXA 4TTGA 2D6MA 4BQ2A 3SCFA 1I9RA 2HLDG 2JE7A 3OUSA 1MS8A 3UT0A 3THCA 4S2HA 1SLCA 5FMDA 4X20B 1VIWB 4MHRA 3W7UA 3NNJA 1UY3A 5LEJA 2Y0PA 3M3CA 3PUQA 2ZMKA 3A8TA 4D6QA 2Q7HA 1N8RW 4EB6A 4FFHA 3QO8A 1OCOB 1R3IC 5FYZA 1VQKV 5CKQA 4D3WA 2BTQB 4HYOA 3ZYBA 4CU7A 3CP1A 1NH2B 1G8MA 3RWNA 3BTZA 1SPPB 3J80N 2G9FA 1SLBA 1QJY1 5DDJ1 2ARBA 2XJVA 2G1MA 4TV9A 1RUG1 2GZWA 3RYRA 1J59A 2OYQA 3NJXA 4QXBA 4QB6A 3RRDA 4PIZA 4GX2A 3QVNA 3CCRV 2E76B 1M4WA 3EMRA 1SMVA 3ETGA 4R9CA 4OYUA 1HNZB 3HWJA 2XBO2 1NS1A 4FM0A 1OC1A 1JZ6A 3POBA 1XC6A 1R73A 3BPSA 2UXCO 2WFPA 5CYYA 1LENA 4NXNO 1YJKA 2OX0A 4PI2A 4HPKA 1FOD1 2DFBA 3FB8C 4AILC 2ZX3A 3U4SA 4A44A 5KAIZ 1N1VA 1RUJ3 3FBMA 1DGRN 3J26N 3MW3A 5KHHA 4AEDC 2R70A 2K1EA 4CDUB 2MEV3 2QJVA 1YEWA 5F2SA 4CS3A 5FZEA 4N7IA 1L7QA 1GYKA 5BMVA 2E5LB 4Q4V1 1KQSU 1VB2A 1N0JA 4UFMA 1D4M3 5EV7A 2E63A 3NKGA 5FP8A 3PIGA 1SQBH 1O6UA 3VDDB 4YHHB 1AYN1 1R1A1 3VD7A 1G1XB 2VCAA 1DLBA 1IS5A 1NQTA 1UYPA 5LP6A 3QLQA 3OR7C 2A3QA 4G28B 2E7QA 4YWAA 2PELA 2ITDC 4EROA 5K4LA 5F5QA 1XBFA 1VMHA 3AK3A 3ZO0B 1KKCA 4YGBA 1D2SA 1DGRA 3BCWA 3T2QA 2A1XA 3CJXA 2A7WA 3DPRB 2ZHLA 4R9AA 3A2FA 4FXKB 2FYUH 3HIFA 4FIPC 4W50A 1TNFA 4ZXEA 4FPFA 1UZ0A 3G80A 3Q4HA 1LOCA 1O3RA 1N34B 2VZVA 2YHJA 1QBZA 4QPWA 1LB2A 3SH5A 1K45A 3PJSK 4LT5A 5CMUA 2GNMA 4JI3B 3HKCA 1OH4A 1MS3A 4QGLA 3ALQA 4ASMB 2W9XA 4AR2A 3WG3A 1KRIA 4BCUA 3E8HA 5CA0A 4F6RA 4JRLA 2VOKA 2VW1A 3VBBA 5IE9A 2QCSB 4Q0SA 4QT6A 2QZ2A 2VR4A 3A4UA 5IAVA 4HVOA 1VP7A 3BUCA 3MF6A 1YLLA 5H9SA 2ZIMA 5A6XA 4H2AA 2MNGA 4N43C 1HW7A 3VBHB 2RS52 4AGVA 1S5LZ 2WLMA 2H0VA 4KGQA 4QPIB 4XMIA 3W7SA 4LO4B 1TME3 3T2OA 1UY0A 1YTFD 3SKJE 3RN4A 4NTXA 3RS6A 1SZBA 4QDSA 4P00B 4QPGC 3USUA 4CRQA 4LA3A 1RGSA 2VRZA 3K04A 1IHMA 4N7UA 3JQWA 1WCUA 3CJHB 2ZAHA 4WM8C 4I3GA 2JG9B 4XJ8A 4IEPA 2HBTA 3EO6A 1W9YA 4LF4O 2I2SA 1VB4A 3G7DA 2R30A 2XAQA 2E9QA 1YNAA 3A0HZ 3BI3A 4IIJA 4P9WA 1F5JA 3TJTA 3CCSV 4Q4W1 3RI9A 4UBHA 1W6QB 2C2AA 3D3QA 1S72V 5C4WB 1XOYA 1LGCA 1XB9A 3A0BZ 2P5OA 4UFKA 2OCCC 4AEJA 1OCRC 1BLZA 2HWC1 1JFFB 2P06A 3BHPA 1MEC3 5IAXA 5TISZ 4DV5O 1O9HA 2DCZA 4D8MA 1W9FA 4CSWA 3H0OA 2ARAA 1XMQO 5JI9A 1GOGA 1XRUA 2WZR2 3RYIA 1IBLO 2B9UA 3E8BA 3AG7A 4P9PA 4O4LB 2CNAA 2B1GA 5JVVA 1QJX1 4DRXB 1NOVA 4BIUA 3VBRC 4FAHA 5BUVA 4WFAV 3NWKA 1SF9A 1GWKA 3ZX6A 4DUYB 2A9HA 2YSUB 3SGIA 3K58A 2GC1A 5SV5A 4DR4O 2DVBA 5FZOB 5GW7A 2F4VB 4I3PA 4EWDA 4TV8B 4XJZA 1VBD3 4AFDA 4F8AA 2RCVA 4Q0UA 1FD9A 4LFAO 1RFYA 4MGSA 2ZGSA 2HWE2 3OEEG 2OIEA 2VWKA 2WNUB 5C6CA 1HRV3 1S76D 2NM1A 2W94A 1M56B 4CZZA 1W9SA 1A8MA 4CCOA 3HKDB 3I59A 1ZBA2 1KP3A 1UY1A 3B5LB 4KG8A 1RMU3 2JIGA 1RHI1 1UU4A 3SPCA 5KXBA 1OHFA 1PHMA 3V0BA 3EHBB 3UQ8A 5A3MA 4X66B 4CP9A 2IU3A 4V2WA 1V54C 4XETA 5AC93 4Y22A 1ULGA 1YWKA 4H14A 5DUUA 3N3HA 2VUAA 1DGWX 3OUIA 2WYFA 1GR3A 1SEFA 2J1EA 4QKNA 5FYCA 5CFCC 1QGLA 3KSCA 1BHAA 4L97A 3WG1A 1TMF1 2E3CA 5FMCA 3SHRA 1STMA 5JWPA 5IATA 3H8OA 1TAEA 2ZZQA 4MT8A 5FUNA 1W8FA 4RQPB 4XUPA 4WFBV 3E1F1 4I50A 2VOVA 4KWUA 2EIKB 4CH6A 1J1LA 3ZRSA 4HLTA 5C9AC 3M8LA 3ZFFC 2IJKA 2VE1A 1AL21 2ZQMA 4CEWB 1YVWA 4JKLA 3ZIWA 4EN0A 4Q4X2 2RMU2 4GB32 1ZUQA 1YFUA 1ND2C 2Q30A 1JI6A 1CJPA 4O4HA 3RYCA 3MD0A 4PDWC 4AZZA 3UKNA 5JAXA 1S0EA 3WF0A 2VG9A 4CDXA 1DCSA 1I5PA 1QJFA 4RGAA 3AMHA 3W5MA 4IHJB 3ZN6A 1EPZA 3WLUA 4XFFA 3ABLC 4MGYE 2PQSA 4HN1A 3OGSA 1RUE3 4BQWA 1XOUA 3GB7C 3P32A 4JI7O 2XHKA 4UOJA 1CN1A 2WLPA 3CCJV 5HFMA 1YI7A 3B93A 4YZ1A 4IEZA 2GTAA 4H7LA 2PUSA 3FUOA 2HJIA 4YZ2A 2ITCC 1YO8A 5LMUO 3RVZA 3SJCC 3J81N 4I7ZB 3H7JA 3RI8A 1VMGA 4YG3A 1KFUL 4SLIA 1PP9H 4W6YA 2DCTA 2VW0A 2VQUA 2WFF2 5IYZB 1MACA 1SLLA 3KM5A 1BEV3 3CSXA 5LMNB 1QQP3 3RW0A 1ONAA 4HETA 4XXPA 4TT3G 5KBFA 2R062 3W9AA 3SPHA 3BOWA 1EV11 1SQFA 4Q20A 3ZIAG 1NG0A 1N33O 4LBQD 4GWNA 2EVXA 2DCJA 5EFUA 1E5SA 3LNMB 5L36A 3FAVA 4K8RB 1BYHA 1BVVA 1XMOO 4DR3O 1SLAA 3ZN4A 1OCOC 3LCPA 3PUHA 1LNSA 3O0VA 3T1YB 2XKPA 4CDWB 3APBA 2Q73A 4DV4O 1BK0A 3KT1A 5EK0A 3SJBC 1Z78A 4PF1A 5IVJA 1O4TA 5EBMC 4FBFA 2EF6A 3OEAA 5IHRA 3C90A 3MFAA 2A3WA 5GLZA 4EB6B 3D0SA 2W3JA 1MA1A 3C3TA 5IYDO 3U0ZA 4DS0A 1QDCA 1JH5A 1CZTA 3LAGA 2PQQA 4YGCA 3SITA 3IM0A 1DQ2A 5FIXA 4DXSA 2ZGLA 4TV9B 4LORA 3C7OA 1FKAO 1H2KA 3KQRA 2EINB 4QAWA 5BV6A 4Q27A 4RHV3 4HONA 1K73W 2JJ1G 5L3EA 1YC61 1UN1A 5JXJA 1VE0A 2DJVA 3CLPA 3QTCA 3NV3A 2CGPA 1DQ5A 4JGYA 4PA3A 4XACA 1ZLZA 4XPVA 5FY5A 5FYMA 1YITV 2Y4TA 1K9MW 1F4AA 5CKMA 1X8MA 3H1KH 2RS12 1LESA 4DUVA 3U75A 4CDUC 1UOJA 4X89A 5I0RA 4PCRA 3N4MA 3TGUH 1AR93 2PYLA 1ULCA 4UFIA 1XREA 4HPKB 1UQXA 4GKKB 1NCQA 5IK4A 3BKZA 1SERA 3VDDC 1K97A 2IH1C 1WB7A 3ZJZA 5L9BA 3PN1A 1Z5VA 4DV1B 2R041 4MVMA 4LBOA 1W0JG 2XLFA 5HXMA 2XR4A 4META 1OQDA 1XDCA 1A78A 4HG6B 2ILMA 4FTEA 2PA7A 5IVYA 2HYXA 1CAWA 3O14A 3JD73 3VZJA 1Y66A 4CCKA 2VECA 1GNZA 3DPRC 2C5DA 5LP6B 1AL0G 5A9GA 5FYUA 1DDLA 1OMIA 4F6EA 3HQXA 1L3JA 1NAEA 3N35A 4DXTA 1UKRA 4CCEA 3GCWA 5BPXA 1CZVA 4HSJA 4TQDA 4O2BA 3CRAA 3AZZA 1PIV3 1DGWA 1MG1A 3DXTA 2AGSA 3C3VA 3ZLIA 4JYCA 2YI9A 3P6BA 3M4FA 1WZXA 3RGBA 4AI9A 5T5LA 3L74H 3EB7A 5EJ1B 1BSMA 5KLVH 2ZX1A 2RS31 5D21A 3Q4HB 1CXZB 3VHNA 3S5AA 5IDJA 3K9AA 1VAMA 1AR1B 5KC6A 2QBXA 4O4IA 5LHIA 1HNXO 3ASIA 1RL3A 2EIGA 2BCCH 5BNPA 2AZ5A 2WNEA 4BH9A 1LTEA 2ODMA 3VQVA 1LOFC 4I0WB 4W65A 1NTZH 1BKZA 3CC4V 4AHYA 3AYAA 4QX2A 3AK0A 1THZA 3CIHA 2J1UA 3H1IH 2AREA 3VBHC 5CA0B 3IJ4A 4F6RB 4XUTA 3L72H 4QPIC 5HPOA 1ULOA 4D6TH 1ZYBA 3RBZA 2ZX2A 3OY8A 4JV5O 5CG8A 3J8F3 4JPRA 3T1CA 1F15A 2A6VA 5L7OA 3JCIA 3UV9A 4LH7A 1RUF1 2UUBB 4IERA 1Q90D 2JG9C 3I5DA 5L3GA 4GX0A 4KUMA 3CC2V 5FJKA 1HB4A 1Q3EA 1XYOA 1U12A 1VQOV 3OUFA 5JIUA 5BYNA 4XURA 2E75B 3MDSA 3WQBA 4LF7O 2B9VA 4L87A 2FCTA 4UFHA 2JDHA 1DQ4A 1RUH3 3OBTA 2VNGA 5C4WC 1SLTA 1PNFA 4ZONA 3HR0A 1CX4A 4BAYA 3K79A 2ZE7A 3GF6A 4X64B 4M3CA 3PNAA 3SKVA 4COUA 4I5SA 4LPLA 3JBG1 2WS91 3Q8EA 3AVSA 1URFA 3NL1A 1W0KG 2JDNA 1AI7A 3BVOA 4I02A 3R05A 3GNEA 2QDRA 4IIJB 5HCAA 3E8GA 2VJXA 4EE2A 4D6SA 4P9GA 1SDWA 2Z5UA 4OZOA 5LCWL 1EN4A 3IAQA 3BCCH 2JENA 1X82A 3C7GA 4DR6O 3OBZA 3HN1A 5FZ3A 4GZ9A 1S2BA 2RMKB 2ZABA 2CHHA 1W3VA 3T4DA 1H2GA 3GVMA 4DPNA 4DXWA 4I2OA 5I0DA 5D5PA 1YJNV 1OLMA 3CMEV 2UUAB 1V55B 2LROA 5JJNB 3VHRA 5FY8A 1PZ8A 3I3MA 2DW4A 1J3PA 4XXAA 2XQXA 2CAVA 1MQTA 4OI0A 4IGOA 5DMYA 2WNUC 4NWVA 3NV4A 2XUMA 1IS3A 5LATA 2QUOA 5DDJ3 3D36C 4BK5A 1M56C 2ZIOA 1DF0A 1RUG3 2O57A 4AXOA 1L1FA 2WSUA 2UY9A 4QQLA 4DMIA 1PO11 3SH4A 2VY0A 3WR0A 3HNYM 4A41A 2UU9B 1W0OA 4TXWA 4C90A 2Y6HA 4OHWA 1H8TC 4QHOA 4OHYA 4RA0A 5FXZA 2CTQA 3A0NA 3LD8A 3I59B 4COYA 3PVNA 3I55V 2ZA9A 3AFGA 4XDPA 5C3OA 4YW3A 4AHXA 1K3IA 2VH9A 1FOD3 1W6OA 1GV9A 3SYPA 1ZSPA 2D97A 4RQPC 3V0BB 1WPXA 2EIKC 1OA4A 4CP9B 2ZGQA 4Y22B 4IE7A 1KMIZ 4NIHA 4NO4A 1S0JA 4CP0A 4CEWC 4KMQA 1YCIA 5JZGA 3RYFB 4URTA 2BFUL 5J1XA 3I56V 1Y3TA 3ETEA 1NI8A 2IBZH 2HEPA 1LRHA 2GNTA 2CSGA 3K46A 4Q4V3 1C4RA 3TEZA 3ZEDA 2C9KA 1PO23 4AVTA 2QM7A 1UYXA 1DFQA 1N36O 2ZCWA 4I50B 5D8AA 1VBA2 4LR4A 1ENVA 2BQPA 3T3YA 1DGSA 1UF2C 1AYN3 2BEOA 2W2IA 1R1A3 3D4KA 5FY0A 1Z2GA 5FLJA 2Z5WA 3PL0A 3E5UA 4Z8BA 4O4HB 5KA5A 4BQ1A 3HBZA 3JD0A 1QLNA 3N7KA 5FFOC 4CDXB 3OGIB 4NYKA 4MVUA 2QJ1A 3ZN6B 2WQ8A 4WFHA 4CH4A 2RVAA 5BXZA 2A70A 1FATA 4DR6B 3WF1A 2RE9A 3SMHA 3WFVA 1W59A 1AB3A 3BIEA 1FS0G 4LFCB 2PAMA 2HWD2 1AF9A 1YJWV 1GZWB 4N53A 3C3SA 2ADQB 4AI2A 3GBWA 3T1MA 1K33A 1HN0A 4MS2A 1YQ5A 3ZHRA 2BOJA 2XQRA 1WMXA 2KXLA 1YRZA 3NVCA 2GU9A 1PMJX 3OG2A 3D6EA 1Y67A 1F31A 4XDOA 4Y20B 3TYJA 2OIGA 3INAA 1OHHG 3H1WA 2PYJA 4U3FH 1Y4MA 3E22B 2X6CA 4I4TA 4CDWC 5I0SA 2VQAA 1SCSA 3B9IA 3ABTA 5T55A 4L9BA 1JOJA 1VQLV 3RZGA 3H1YA 1V00A 2DE0X 3FAVB 1ENRA 4KXRA 3JD1A 1MS4A 1PVC1 3CHXA 3MGUA 2YBKA 1G9DA 2I74A 1K7DA 2JB4A 5IW0A 3WP5A 2VVDA 5FPLA 1EZJA 3T4ZA 4QDQA 4IGPA 1UNBA 1NTKH 2EINC 4OPAA 2YIBA 1M1KW 2R16A 1SQ4A 4NHXA 4PLMA 1EY2A 2QWQB 5L3DA 4BOWA 5EXOA 1ND3A 4FLUA 2ATKC 3CBNA 1ZTEA 3FYIB 2AEYA 3DF0A 2P2KA 3VD9A 1JUIA 2F1MA 4DV6B 2WWSA 4KHPB 3QD6A 4XFCA 4CU6A 2NQYA 2VUCA 4XIOA 1W2NA 1RVF2 2VC9A 1RPOA 1N36B 4R50A 1UX6A 1UOFA 4JQRA 1LGNA 3AKRA 3OTOO 3ILFA 4JI8B 3IIIA 1PL4A 2HWC3 5LYJA 4QM8A 2EJRA 5ACA2 1JVMA 1P7GA 2K0GA 3VBSA 3ECQA 1PGL1 1T6GC 3ZYFA 3BABA 1Z7S1 1JN2P 2TNFA 3DKWA 2YMZA 1Y74A 4JI5O 1JYCA 2WZR1 5IWAO 4MADA 3DTUB 3POEA 2BP6A 5F1RA 2WSVA 2ZACA 1QJX3 5DN2A 1XILA 1ENQA 3IMMA 3E6BA 2YEVA 5KHGA 4B3NA 2BV4A 3BTAA 4GKJO 4FPKA 4PLNA 4EFBA 3LIGA 2CDYA 4Q8KA 4OXSA 2TEPA 1SRYA 4AVCA 1BZKA 4QWNA 3OEHG 1BQ0A 1WA8A 1VP6A 1YXBA 3AXDA 5LP6C 1F8VA 2YUEA 3VD3A 4UWDA 5CKNA 1OCZB 2GMEA 1VBC2 2HWE1 2Z2SB 3JQXA 2L9LA 1BT8A 2GC3A 5HI0A 1CAWB 5FMOL 2WBKA 5LA6A 2HVKC 2D6KA 5K7PA 4JYAO 2UUCB 2PHUA 2P37A 4GKXA 1X7NA 5ABJA 3POWA 5HCFA 3AFKA 4TWKA 3RG0A 2Z69A 2A75A 1NE6A 2B7YA 2XKOA 1BMV2 1WP7A 5IYYA 1LCLA 3MIFA 2Y4UA 1IQDC 4MGQA 1N1TA 2KB1A 5ANNA 2XG3A 4DNYA 4XJAA 3RNSA 1AVBA 2Y0IA 4K8XA 4TQFA 1VQPV 1B35A 2BNMA 4MLOA 2ZEXA 2IVJA 1J5EO 1CPYA 4O4IB 4FOQA 2CGNA 1ZBE2 4N8MA 1KBHA 5BNPB 2PHLA 5J98B 2Q8CA 2JGDA 2RMU1 4O61A 3PVBB 1A8DA 3CZUA 2W5FA 1JR9A 2QM4A 1SFYA 1ODMA 2OTLV 2JEMA 2W52A 3OGVA 1DF4A 2UXXA 2YC2A 3TETA 4EV0A 2EIJB 3JARA 4PIXA 1H38A 3OY8B 4LE4A 2P6HA 3POFA 4XF4A 1C1LA 1H2LA 1VQNV 5L7OB 3T4VA 1R092 4IV1B 2RJKA 1F7YA 1XQ8A 3UESA 2D3RA 3POSA 2Z3YA 1QF3A 1NH2D 3AEIA 3RWRD 3ELNA 4H13B 1O3QA 2XJUA 2V5DA 4BQ5A 1OA3A 4NRPA 2R1BA 3RYKA 1ALYA 4MO3M 5LASA 4LITA 4X9QA 5GLUA 4LE3A 1US3A 1V6JA 4PA4A 2YUAA 4UAPA 3ZIXA 3UGFA 5JXIA 2BVBA 3JALA 1EV13 2WA3A 5IK7A 2B9ZA 3JYCA 4M3CB 3B77A 3RZZA 1W2UA 1YUDA 4EFEA 3FC0A 2GN3A 3RZMA 5EHDA 3QO7A 4DR2B 5LY1A 2W95A 2WAOA 4JYYA 2GSYA 2YXYA 3NSTA 4EN9B 3R4UA 4OMCA 3J9SA 3CCMV 1RYYA 2ZXWB 4UW3A 5T3NA 3GZAA 1W6NA 4GH4A 4J41A 4MH0E 3BOPA 3TEWA 5DQ0A 3DECA 5JJJB 1AJPA 2WNVA 4J10A 5FZKA 3FD9A 1H30A 3BGAA 4HFSA 4LF5O 1KDMA 3LPFA 1JXNA 1E5IA 1U97A 1OFSA 2AEZA 4RUEA 4W6WA 1EAH3 2VVFA 3H8RA 2AHZA 5FZDA 1Q6IA 4FK5C 3H7YA 2W1SA 2LQTA 3DL3A 2CTVA 4JI6B 3ROUA 2YC0A 1MQTB 4HT1T 1AJQA 1SESA 2JJ6A 2WYSA 1ZRCA 3B2EE 5E6HA 1YI9A 1G86A 1QWRA 4B3RO 1IS6A 1NZIA 1W9TA 5FZ9A 1JOPA 4K21A 4L0PA 3B40A 1V6MA 2VQEO 3B4SA 4V2VA 4JQTA 4URAA 1SHWB 1LUVA 3OSDA 5FWJA 4Q29A 2EJ7A 1VRH1 4H37A 3G6BA 3TBDA 3B9CA 3VHPA 4C91A 4ZHNA 5B4XA 5C8YA 5L3CA 3AKTA 5BZBA 2ZKLA 1W0NA 4XBQA 3J7MA 5KMGA 1G9CA 1XNQO 4I30A 1GMGA 1W6OB 4LHKA 5GZGA 1ZX5A 3K59A 1POV0 4WFFA 1U96A 2A6YA 5F3GA 2LS6A 1QJEA 1M5IA 1D0GA 4IXLA 2XTAA 5JZGB 2CK3G 1C57A 1ENSA 1QCEA 3ORJA 2R043 1ULEA 1BXHA 4IE0A 1PZ9A 5GALA 4JGSA 5A6YA 4DR7O 1WW6A 3UYJA 4CDXC 2ZGOA 2ZE8A 1P4RA 4JI4B 4NROA 1SQVH 2QQJA 5D8AB 2Q8DA 2WDBA 2IWGB 4UYBA 1NLRA 3AK2A 2RM22 1V9U3 3A7QA 1ZA4A 4MVQA 3T1HB 4NIAA 5CADA 4B3TO 5DG2A 1RB8G 1ORQC 3I2JA 3AKPA 1GKBA 3AG4B 1MPXA 2ZCEA 1UOGA 3OGCC 4NIGA 4B8EA 3M99B 3ABKB 1AHSA 3HN3A 3JASA 4AW7A 1G4YB 2BVVA 3HNBM 1XI1A 4B1LA 5C93A 3W20A 1O7FA 1RUJ1 4JRAA 1CR7A 4AEMA 4O2AA 3BA9A 3E5XA 1OPOA 4P9LA 2RS33 3LUTB 1K5JA 2P17A 3NV2A 4N53B 2MEV1 3K57A 3KVBA 5CFDA 1QLEB 1LGBA 2EXIA 2DQ0A 3UK9A 3ABZA 3GWKC 2QQPA 2VQFB 3ML0A 1D4M1 2WLLA 4X1IA 2WO7A 4BA6A 3CCEV 5IWFA 4CDQA 3AG1B 4B3RB 2Q5TA 4XBLA 4KGGA 1BHGA 2DUPA 5ITZA 3OE7G 3N2GA 3ZMVA 4I4TB 4FPYA 1X50A 3QH6A 3CRQA 5K8SA 1DYOA 1XYPA 3DC5A 1HX6A 4J42A 4XF0A 3WNOA 1KEXA 4PDRA 2HWB3 3LEMA 2YPJA 3KMHA 5LGUA 1O91A 4IW3A 1RUF3 3K0DA 4DR5O 2F6BA 4LKSA 3RVYA 4CS2A 1I0HA 1E57A 2Q0OC 5F37A 4AQ2A 4UVCA 1KD7A 4PA9A 1IBKB 1FV3A 5DAWA 2EZOA 5EZYB 3QCWA 3H3LA 2KG7A 1ZL8B 4D6RA 1GZ9A 2BTOA 2BBAA 2LM3A 4QM9A 1K5QA 2CH7B 1PNLA 4J7JA 4FZ1A 3TNQA 4PBPA 5FJHA 4JZGA 2HWF2 2JG8B 3LSSA 4L2NA 4COVA 1W2TA 5F6LB 4OI1A 4AFAA 1D5AA 1ND3B 1Y76A 4AK3A 3WF2A 3JBG3 5FO8B 3P1IA 5GTHZ 5GZDA 5F39A 4LK6A 3AMQA 4LBEC 4PDLA 2J7MA 2OCHA 4OUMA 5FNVA 3B3QE 5DZGA 5A7PA 4UF0B 4GXLA 2R32A 3FHQA 3PHMA 4WF9V 4NAMA 2W6IG 1QJU2 4LBMA 5FZFA 1NCQC 3QBQA 2V4AA 3T0BA 1RTVA 4YJ3B 1OI6A 3VBSB 5FL7G 4LF8O 2AHYA 2FMDA 1FJGB 3GXUA 1VQ9V 1Y74B 4LP8A 3MO4A 2VM9A 1TME1 1DTOA 1NLQA 1AI4A 3HPLC 3IC9A 1OCZC 3K4AA 4Y26A 2EXKA 2PXJA 1Q6HA 1OLRA 2EBOA 1UIKA 4H33A 4J11A 1Z5WA 4G3YC 3WZ1A 4PBOA 2QSAA 3RDIA 2VS0A 4XMAA 1WA8B 5I0UA 4ICGA 5IJ9B 1PO13 4JZRA 4DUXA 3CB2A 1CONA 3ZSKA 1G6UA 3CCQV 3GGLA 5BNOA 2PI4A 1SZXA 2CGOA 1VAVA 1J1TA 2R072 2XBO3 2RJLA 2QTWB 1LHVA 1NJIW 2G19A 3WW2A 4LUMA 3QACA 4IEUA 4K3UA 2Q69A 1MEC1 5LRSA 3L2YA 3H9VA 4UCVA 1CAXA 3MBWA 4BHPA 2P67A 2FB5A 3TWIA 4QB2A 2WO2A 3THOA 1NTMH 4XQWA 4H44B 1BCXA 1FAFA 1UZWA 4M00A 4CPBD 1DLCA 3M3QA 3N9NA 1H9WA 5BNPC 3SYOA 3ZSLA 2AACA 1GLHA 1GAXA 1W06A 2YPDA 4MVZA 2D3PA 4MSWC 4CEYA 3KVAA 1B35B 4YIOA 2EIJC 1VBA1 3AL5A 4Y1YA 4CC5A 3H8UA 3VZMA 1AI5A 1GOFA 5B66Z 2NMNA 2HBUA 4O4JA 3G6EV 4UFZA 2O8QA 5LY2A 4QQHA 1H1MA 3UKVA 3H1MA 5L7OC 4JZ2A 2JGDB 4KWKA 4IV1C 1RIRA 4AQ6A 1HRV1 4RS5A 3N9MA 1NA1A 2JS3A 1FFXA 4IL6Z 1ODNA 3LDRA 2A79B 3JARB 2X5IA 1RMU1 3S7EA 1MZ5A 2RJ2A 4IYIA 4MX3A 4B3SO 3RFRA 1WAZA 3LOBA 1C8M2 2OZJA 1W9WA 1HQLA 3LF7A 3VBFA 5FZCA 3HD8B 4IYHA 4MG2A 2DVGA 1FYUA 2HWD1 3AM2A 1I94O 4QKFA 4DW0A 4AQYB 5I91A 2PGGA 1KFXL 5A33A 5FPOA 4JI2B 1UZZA 3VL9A 2PZSA 2DWEC 4R8CA 5GONA 1VBB2 1O4YA 2LGQA 3LEIA 4BMEA 4RWUA 1RINA 2YG0A 3URFA 1IKPA 1KDKA 2ZXWC 1QMJA 3O1SA 3JALB 4N21A 1UW8A 5KXEA 1KUQA 5A70A 1EYBA 4XF3A 1WMFA 4B3MB 3FBYA 3M7MX 2ZGPA 2P34A 4PDVA 4AE2A 4YGDA 4ISQA 3L9DA 2HEWF 3AZVA 5JOXA 3C7EA 1UX7A 1RUE1 2JDYA 1XQNA 3K5LA 2RS53 3MIDA 4GH4B 2ERFA 1MQTC 4DQAA 3KD4A 4JI1B 3WX5A 3F2ZA 3MFCA 3KCYA 5J37A 1WLWA 5JVDA 1BQZA 2IXHA 3WSOA 3ZMNA 3JSLA 1HQWA 2WO1A 3K06A 1K92A 5JDBA 2OWOA 1A3KA 2BZDA 4GCZA 4R6ZA 3WHUA 5IK5A 2Z42A 3AP5A 2R9RB 4TOIA 3LDCA 1BEV1 4Q0QA 1AP6A 1DYKA 3F7VC 4K9SA 2JIJA 1CJDA 4GWJA 1B06A 4X62B 2QTOA 1RVF1 3CXCU 3FFQA 1L0NH 5CBHA 1HQNA 2XMLA 3ES1A 2OT5A 2ES3A 2WR9A 1B3QA 2ZMLA 4K0KB 3P3PA 5ACA1 5B1BB 5FQ0B 1IPSA 2YZ4A 2QKDA 4Y24A 2GDSA 3CCUV 3LA7A 4D69A 1YI2V 5C8YB 2UXBB 1RJ8A 5LGNA 1UY2A 4GLXA 2HH9A 5JZGC 3OUHA 2J1SA 1WMDA 2ZR2A 4N9IA 2WZR3 2Q4PA 1XSQA 1LODA 5KMGB 3S57A 2WA4A 3S30A 5IVVA 1IG3A 2MW2B 4ZZ8A 3VQXA 3ITQA 2QQUA 5EQUA 2FDGA 3HT2A 2EALA 5F3IA 3VZLA 2Q9LA 5EP9A 5D8AC 2ZZJA 5CA1A 4ZOLA 2WT0A 1UPIA 1QQP2 2FMYA 4L92A 2BSKB 4B4PA 2C1FA 5JOZA 3APOA 1JUHA 1HJGA 1NKDA 3O1PA 4XUOA 2XHBA 4HMZA 2ZTNA 4IESA 3SYAA 3AG4C 3K5OA 4IGGA 3MHZA 2CV6A 2HHHB 3MLKA 1KECA 1WBLA 2NLJC 3ZMSA 2VTXJ 3U37A 3WY6A 3ZYRA 2GMMA 3ABKC 1CX1A 1YZBA 4YYOA 4I9WA 1Y7BA 2HWE3 5HCHA 1VBC1 1SG3A 5BY5A 1E5RA 3I2IA 1NR1A 2ET7A 3AP4A 4RHV1 3BU0A 1AVMA 4ZY9A 1FXKB 3BA8A 1M93A 4Q5OA 2W6JG 2VMIA 5FZ4A 4JHTA 4NHLA 1J3QA 1IURA 1VRBA 4FMTA 3IGAC 1LR1A 5FP3A 4AI3A 1RUC2 5DABA 4N53C 1TEIA 5GJ6A 5GZFA 2V09A 5L3BA 1QLEC 2DURA 5JJEB 4CUGA 1SQGA 1AR91 2H6CA 3IAYA 1DLLA 1SS3A 1POV1 1QY4A 5F3CA 3OPTA 5JH7A 4IE4A 3MICA 3K75B 3U1XA 1GM8A 5JSOA 3AG1C 5KX5A 1HR0B 3I8TA 1PM7A 1D7PM 3C8XA 2WQZC 3ZRVA 3EJKA 2CU5A 3UL2A 4DIQA 2WZEA 4P02B 1OZ0A 1ZBE1 1ASJ2 2WC2A 2HJFC 2WLLB 4Q4X3 2RMU3 4X1IB 4FVMA 4PHZA 1WMEA 3JD71 5AFEA 1CGPA 5ITZB 3AB0A 2Y8KA 3N2GB 2P3JA 1YHQV 4XFIA 1LHOA 1PGW2 1O4ZA 1TVKA 1SQXH 5BNQA 2F23A 2VCBA 4QQPA 2WLJA 1MZEA 1YDXA 1QDOA 2WAAA 3IFXA 4BYYA 1IXBA 3LGRA 1R091 3HNMA 4HVRA 4LHSA 4W8JA 3T09A 2W08A 1GTOA 2DCKA 4U7OA 5A7WA 2GSMB 4F7ZA 2LGWA 1ND3C 3CQOA 4I0AA 1YTFB 5B1AB 2NN8A 5FY1A 4DY5A 4JV4A 3T0DA 4ZI7A 4DFSA 4MTXA 1AR5A 1QU7A 2WFF3 2VL4A 3WB0A 3Q9OA 1RUD2 2P1BA 2DUQA 5A3OA 4KBZA 5FYHA 2R063 2ZKNA 1LHWA 1J84A 4BIZA 1Y76B 4OGQB 4KNCA 3EFFK 4AOCA 1XNRO 2GALA 1JS9A 3VBSC 3KHBA 2D43A 4A7ZA 1AR72 5FNVB 4GJZA 4OMDA 4G2KA 4NXMB 1FX5A 2CTWA 4NIDA 5J48A 4WM7A 3JU9A 2VNOA 4AYUA 3J8F1 4O65A 4PF5A 2ZR3A 3ZXGA 1E79G 4BIOA 2D5FA 1WN7A 3NJYA 3SPJA 2X09A 4GALA 4FOYA 1ROPA 2X8KA 3JD2A 2BW8A 2HFEC 4DB5A 3GBGA 4KU8A 5FZBA 2SBAA 2Y26A 1EBOA 2ZBJA 3WNPA 1ZZ9A 1P84F 1UYYA 3K08A 1WCDJ 4INDA 2GNBA 2FKXA 1RUH1 4LIUA 3ZYIB 2DYCA 4EZHA 3SYQA 3WW3A 2FMLA 4IETA 1QR8A 4R4XA 4E2SA 2VZSA 1LHUA 2P4KA 1DK1A 2K2SA 2QFEA 3ZX7A 1KS4A 1CESA 3OOXA 5FCCA 5J3UA 1IBMB 2F17A 4TSVA 3LEKA 4XE9A 5LEKA 1GOHA 3HKEA 3N9OA 3A23A 3FJSA 1WA4A 1AUYA 1W28A 2RS13 3K5MA 2Q68A 3WEZA 1C3HA 2VNRA 4CCCA 1NT0A 1CAXB 3VZNA 2LFRA 4YY3B 4JC1A 3NNLA 4N23A 1B35C 2Y6GA 1PZ7A 5E89A 1X8EA 3OM3B 4DV7O 3VQYA 5LA9A 4B7EA 1IKQA 5A7QA 4IV3A 2XJRA 2UWBA 4YJ2A 2D3SA 2DYSB 2ZPXA 1DYPA 4CEYB 5KHJA 1ZREA 2Q8OA 3OYWA 3SC7X 4FPPA 2VTXA 2NZ9A 3LKJA 4NE9A 4DUZB 5FRAA 1AR62 5JPMB 2YIDA 4QGMA 3OW2U 3WDXA 4O4JB 3LIHA 5FYIA 2XAFA 3AX4A 5C8CA 4FQ4A 1NCRA 1R3JC 2PTMA 2UXDO 1PK6B 2UXNA 5DECA 4RS5B 1S0GA 1M06G 5IT9N 1S2KA 2PHFA 5A7SA 4TUYA 1NA1B 4ES8A 3KGZA 5JCOA 5DAPA 1FFXB 4FLVA 2BJSA 1L0LH 4LQRA 3HQUA 2FL4A 3X2QB 4N43A 3DYPA 3D3IA 3AG2B 3VBFB 5LOVA 2VU9A 3RVHA 1H9PA 1DU3D 2JDPA 5FP9A 1QJY2 5DDJ2 3TXSA 1UMIA 1I08A 4QPGA 5A33B 4ZS3A 3MW2A 3ACFA 3F7YC 4LMFA 1JU3A 1NX9A 1C8NA 4WM8A 1GANA 1G8WA 5GONB 1PO21 3SH3A 4JAAA 2ZDIA 4FLWA 4MTFA 2GUZA 4CU8A 5E1RA 1JZ3A 1LUWA 2MHFA 2A3YA 2ZX4A 3FB7C 1S1AA 4GH4C 2K46A 4A7KA 2E26A 4LOSA 1D0HA 1DP0A 1NYWA 4MW3A 4XHBA 3K77A 2VMDA 1QVFU 4OLLA 3S7IA 1YIJV 3L9JT 3KGLA 2ORZA 5H5NA 2XH6A 1FMD2 4QB1A 5GKAC 3UT5A 1UL9A 2P3KA 1MS9A 3ILNA 2E51A 5DM6V 5J2UA 1RITA 4D7YA 2ZHNA 2R0FA 4X6RB 3WNXA 1DF5A 1C5HA 1NR7A 4ATEA 3AYCA 2OIIA 1OVSA 1VR3A 1HN1A 2P3IA 4HZFA 3L71H 1F4HA 1FYJA 4RGKA 2NR5A 5FLIA 2GN7A 4P30A 2HWF1 4DV7B 3ZBHA 4MXWA 4FFBB 3R4DB 2QQLA 1W6MB 4CA9A 5LBBA 5B1BC 1S5HC 3DXRB 2VGDA 1K8AW 4MVRA 3U4XA 4NPRA 4Y1UA 3HJRA 4Z82A 1T6BX 4LO5B 1QVGU 4JTDB 2K9PA 3WNLA 2ENRA 1HNWO 1MSWD 5F2WA 1N32O 1GN3A 1GP6A 2DF7A 1QJU1 1FV2A 3GWOA 3EHKA 4LR3A 1FPOA 5JSPA 4Y1XA 3T4HB 4Y5TA 5CBFA 1Q6UA 1H2NA 1IS4A 1F4MA 2UXCB 4K3AA 2XL7A 2BWCA 4NXNB 3OFNG 4DY3A 3EVKA 1QJZA 4GA9A 1W39A 3R66A 1GN4A 2WWWA 4WV8A 4PA6A 4QIWF 2XJTA 2RJZA 2GC0A 5CA1B 4ZOLB 3DKQA 4AI1A 2HKOA 3KV6A 1FXKC 1XL6A 2R1DA 2UYBA 1G9BA 4LF6O 3W58A 5EIYB 1SBEA 2DVFA 3OB8A 1U0AA 3LSQA 4ZHQA 4PD4F 1EPWA 2H94A 1YQ8A 5KHIA 5IY5B 2XPJA 1ND2A 5FPXA 2FDFA 2R071 4GWIA 3ZCCA 1FPN2 1V70A 1N4CA 4GX5A 4DV3O 3FX7A 1M90W 3ACIA 1GP5A 5DUVA 2AZ2A 2WSSG 4P9JA 5FZGA 3AYEA 4QU1A 2PHTA 4QKDA 3LDKA 4WVWA 3LEGA 2GH8A 2O14A 3VHOA 2AW9A 3CZJA 1X4TA 1H4GA 3V0AA 1S0FA 1TUEB 1SACA 5JH7B 2BPA2 2KQXA 3P30A 3KG2A 2B5HA 5EJ3A 4DK1A 3TN91 1JBCA 3VOUA 4MGKE 4GULA 2GBOA 1Q8PA 4WBBA 2ZAAA 4X1KA 4Q4W2 3DN7A 2IM9A 1VBA3 1CAVA 4QGPA 1R1ZA 1SZTA 4JAUA 4FFKA 1IDSA 4WFGA 1CP9A 5IUQA 4F3JA 4D7SA 4YG0A 5CA3A 4J9ZB 4E4SA 4MSVA 5AFBA 1K5MB 2UWCA 2ATFA 4TZDA 4LCUC 5B1AC 2RDQA 2VZRA 1H2SB 3VKFC 4JI0O 2XT9A 5A3WA 4DEQA 1N32B 2JIZG 3WW1A 3N9LA 4EN6B 1XNAA 1MSDA 2HKXA 2F4PA 1E1RG 1CIYA 2BTQA 1C8M1 2QA4V 1H1IA 4OULA 5GLTA 2RHPA 2HWD3 1H8TB 1SPPA 5A7OA 2G38A 4TLGA 5A7WB 1OVPA 1PMHX 1NVPB 2D6LX 2JE8A 2AUYA 3ZYPA 4ZIBA 4ZI7B 1PGSA 5BR8O 4PDMA 4X65O 3B01A 2ADEA 1ULDA 1W8WA 3PU8A 3H3ZA 3F5TA 1VBB1 2PLV2 3BRCA 3BALA 2F95B 1WBFA 3PVEA 2CTRA 3R65A 2H6BA 4LOTA 3PTYA 3RJ2X 4LF4B 5EC2C 3GALA 1RHI2 1COV2 1W05A 1J3RA 3CWBH 4ISRA 3R0RA 4QU2A 5I93A 2JGUA 2ZM6O 3E86A 1W0PA 1F4NA 1WCQA 1A32A 1TGOA 4WM7B 4L8JA 5F2VO 1KS5A 1UKGA 4GYCB 3D5OA 4YW7A 3IKWA 4CDUA 4DV5B 5EYYA 2IU0A 2BOBC 4BQYA 3ZFGA 1P8JA 1H2MA 3VLBB 1TMF2 2YBPA 4UCTA 5FTTC 1WLDA 4ET7A 1XMQB 4QXCA 1IBLB 1KQRA 4UT5A 4FP3A 2GC2A 3L73H 4RGGA 4ZKTB 2OT7A 1AL22 3UO3A 4XF9A 1GK9A 4E2LA 5T5JA 2R6QA 3KF3A 2DVDA 1EP0A 2VOTA 4OX9O 5JMCA 2JECA 1CZSA 2Y6KA 3I54A 4DR4B 2P4EA 3UGGA 3ETPA 1XU1A 3I97A 3JZVA 1RVF3 2ZD9A 4D94A 4NR1A 3E89A 2H3OA 2P6JA 1XNTA 3K5NA 2WT2A 1JYXA 1JHNA 5ACA3 4LFAB 5FWEA 4J9YB 1X33A 4DV0O 1QIQA 3VZOA 3OR6C 4IQPA 1R1BA 4LFBO 1IPJA 4U3JA 1TG7A 3HKBA 4QD2A 1JYVA 4BWAA 2L35A 1CPNA 1HV0A 5LK5A 3AG3B 5EBWC 2HYKA 4OFGA 4CUCA 2DYSC 3MIBA 3G6JB 1U5IA 4Q1RA 1OT5A 4NPMA 4CEYC 3PMSA 1EAH1 3RQ0A 5F7UA 5H6QA 3ZXLA 2D7FA 5IYCO 1EV12 3PIJA 1KKDA 5FOBB 4PIYA 4N9HA 4IV3B 1R64A 1S55A 5GZCA 5IK8A 4YJ2B 1PK6C 4RS5C 5DAVA 1NA1C 2ZEYA 4RL7A 1AROP 1Q86W 1NXD1 1SFNA 2OQ6A 3OYWB 3O12A 1VBC3 1PPJH 1VF6A 2J22A 3X2QC 3STZC 1SA0A 2HJDA 2I07B 5FP4A 1O5UA 3AG2C 3AZWA 4QPIA 5C8CB 4IEYA 3W7TA 1NCRB 1DG6A 3VBFC 3AP6A 1FXZA 1O3TA 3SCGA 2R9AA 4PJ0Z 1RUC1 4TUYB 1LOEA 3A21A 4Y3OA 5M0TA 2DVAA 4R8HA 3SYCA 1PNMA 2IH3C 4AHCA 4XFBA 3CJHA 3OUJA 4PV1B 1FXHA 2FDHA 5KC5A 3M3OA 1POV3 5FPAA 5FPUA 3KCCA 4JI7B 2YIBD 2A71A 2WWUA 3FN9A 3GJAA 4BQ3A 5F9TA 2WIIB 4YM0A 1VLNA 2QE3A 4NHMA 5LZ6A 4HXCA 5LOVB 1CVNA 2FDJA 4BXSV 2NYYA 4R9BA 2WLHA 1XXNA 4IGQA 2VPVA 5LMUB 2LRPA 3O5SA 4MTOA 2VUJA 3D82A 2YGLA 1ZBE3 5BMVB 2X29A 1VQ4V 1LJ7A 5LXTA 2Q67A 1ASJ1 3TEXA 1ENXA 4YRDA 1JFFA 2QTSA 4BE3A 3ENRA 3H1JH 4I0BA 2PN5A 4A7YA 5FY9A 2GP3A 3AMNA 5EIBC 4QPKA 3LWCA 2C26A 1V9U1 4H3WA 5FZMA 4JDNA 1S5JA 1UMZA 1JZ7A 2O8OA 1OLQA 1N33B 2ET1A 2ZS6B 3LDDA 2GMPA 3MUY1 3FUQA 2WRAA 2JVDA 5A32A 4LF9O 3UNPA 1H0BA 1IX9A 4O4LA 2QGNA 5L9VA 3OBAA 1R093 1XMOB 1WD3A 4DR3B 3KB5A 3VDAA 4FPEA 1XHXA 2WPDG 2ARXA 3UT5B 2R72A 1QR9A 5JOYA 2WN2A 1O8PA 4XIKA 1AR82 1GRJA 4QDRA 1ZZBA 2W1WA 5FZOA 3JAWA 1VQ7V 1PX4A 4DV4B 2D93A 4P08A 1NKGA 4BDVB 3LSEA 4UBGA 3ZPYA 5D2AA 3KF5A 1H8VA 3OCPA 4A2UA 3W7WA 1BMFG 1XUQA 5B2GB 3OMNB 1RUD1 4M0HA 1W8UA 5FKBA 2CDOA 3HQRA 4MXWB 3D36A 4FI9A 2YXSA 3HKCB 4Y4YA 3QH7A 5JI7A 1JCHA 4AAXA 3HKDA 4Y5Z0 4Q0PA 2BWAA 2LJ2A 3THDA 1H8EG 2WLIA 1AR71 3NJZA 1AYM2 1HV1A 3PVOA 3TXQA 3VB9A 3POIA 4XDKA 1S0IA 4XZUG 4DO0A 2XWJB 1GH6A 2HWB1 4FOWA 5FXWA 4XC9A 2ARHA 3B8MA 1SLIA 4JVAA 1WLEA 2Q6AA 4IE6A 3RYPA 1NT2B 3J7AU 4JHZA 1V0AA 4RQPA 1JMKC 3I2FA 2WABA 4GMP0 1GICA 2YC4A 2KSDA 1ZAUA 2OUJA 4K20A 3A0RA 3CNAA 2KKWA 3USUB 3RT3C 3DUIA 3H8XA 5LBQA 5IY5C 5IJ0A 3JUUA 2Q1FA 4EJRA 2WQ4A 5SV8A 4QX8A 1OQEA 3BY6A 3LE0A 1NXMA 1UYZA 1Q8QA 5J09A 5JQGA 4QXKA 3ZMOA 3ZXAC 4B7KA 3ZOIA 1V6LA 4YARA 4AVBA 4O9GA 5CB4A 2LFSA 4ZHQB 4UUJC 1ZWIC 3O65A 2VULA 1ZZ7A 1T5EA 5FBJA 4O9EA 4NTYA 1N47A 5LHHA 4FLXA 2JDAA 1YIFA 1GUIA 5L19A 3ZS8C 5FXVA 3JCZA 5J2TA 3PU3A 1HWYA 2O1QA 5C33A 4BK4A 5LBCA 1Q82W 2LUWA 3ASNC 5D5QA 2Y0OA 2E5LO 4G4FA 1E1QG 4JKMA 2ZNJA 5LHGA 4EQVA 1A6CA 1GM7A 4AFMA 1WW5A 5A6QA 3DGTA 3RJRA 3S6PA 1PV0A 3RYIB
chains in the Genus database with same CATH topology
3WG1A 3NO8A 1TMF1 2H0BA 4GMP3 3MIEA 3AMMA 3SHRA 5JWPA 3MPBA 2EXJA 5JPNB 2ZZQA 2ZGTA 1LULA 3V0AB 2D3PA 3UKTA 3IT8A 2Z79A 4RQPB 2VOVA 2WS92 2X53S 3NAPA 1J1LA 1WLTA 4CEYA 4X6QB 4AEDA 4HANA 4HLTA 5C9AC 4FTSA 3M8LA 3ZFFC 4L99A 1B35B 1XE8A 4GWMA 4PLOA 1VBA1 1AL21 4CEWB 1K5MC 4Y1YA 3ZIWA 4EN0A 3H8UA 4Q4X2 2RMU2 4GB32 3VZMA 4M23A 1YFUA 1ND2C 4HN0A 2Q30A 1BK1A 3FE5A 2NMNA 1CJPA 2O8QA 4QQHA 1H1MA 3UKVA 3H1MA 5L7OC 2RM23 4KWKA 4IV1C 2WLQA 4PDWC 4Q4Y1 4E9KA 1RIRA 2Q0AA 2IXLA 3UKNA 1S0EA 4AQ6A 1GQHA 5ABJC 5JAXA 1HRV1 4XQ4A 2VG9A 4CDXA 4RGAA 4RS5A 4FPHA 3AMHA 4CDWA 2NPIA 4LEJA 3ZN6A 1EPZA 3J8F2 1DBNA 1NA1A 4R52A 3WLUA 4XFFA 1MVQA 4UXAA 2XBO1 5BNOB 3QOPA 4MGYE 4HN1A 1RUE3 3CL1A 4LBJA 1D4VB 2X5IA 2B39A 1RMU1 2XHKA 3S7EA 1MZ5A 1CN1A 2WLPA 2ZGKA 4WVVA 3LA2A 1YI7A 4GIQA 4MX3A 1N3PA 3B93A 4IEZA 4YZ1A 4H7LA 2FQPA 4FP2A 3FUOA 2HJIA 4YZ2A 5KEUA 5JCTA 1C8M2 3LOBA 2OZJA 1HQLA 2OVUA 3ZSEA 3VBFA 1YO8A 3HD8B 2DVGA 1FYUA 4BZ4A 4AGRA 2HWD1 4B4RA 3AM2A 3H7JA 3RI8A 4JGZB 4COZA 4YG3A 1KFUL 4YM2A 4SLIA 5I91A 1KFXL 4QQ2A 1RUH2 2WJSA 4W6YA 2DCTA 5A33A 2VW0A 4U36A 1UZZA 3VL9A 4EWAA 2WFF2 1MACA 1SLLA 3KM5A 1RUOA 1BEV3 2BTVC 1VBB2 1O4YA 2A73B 1QQP3 4QHBA 1ONAA 4MGIE 4HETA 4XXPA 5KXDA 1PO12 4BMEA 5KBFA 1RINA 2R062 3W9AA 4BPZA 3URFA 3BOWA 3MZHA 1EV11 3GHNA 1JTZX 1IKPA 2CWMA 1NG0A 3IPVB 1KDKA 4LBQD 4GWNA 3VV1A 2EVXA 1QMJA 2DCJA 5H9PA 4IEXA 4XF1A 5EFUA 4WM7C 1UW8A 5H9QA 5KXEA 4BLJA 5L36A 1EYBA 5FAXA 1WCKA 4XF3A 5FQ0A 1WMFA 3U11A 1BYHA 1BVVA 3FBYA 2ZGPA 1OOPB 2RM21 4OI2A 2XJSA 4YGEA 4ES9A 2R0HA 2OYZA 1SLAA 2SLIA 2A7AA 3ZN4A 3LCPA 3SCHA 2P34A 5I8YA 4AE2A 3O0VA 4YGDA 4EWEA 4M2GA 4ISQA 2HEWF 3MDPA 4QX5A 5FLHA 1PNGA 2XKPA 3AZVA 5JOXA 4CDWB 3APBA 2FHRA 1RUE1 4MVTA 1XQNA 3KT1A 1Z78A 2RS53 1O4TA 3MIDA 4GH4B 1FMD1 4FBFA 3TRSB 2ERFA 1MQTC 4DQAA 2XVKA 3KD4A 1LEDA 2EF6A 3WX5A 3MFCA 4JDMA 3KCYA 2ZJCA 5J37A 3J4UH 2X5IB 5CU1A 1WLWA 4Y1ZA 1W6PA 4K8FA 2WBQA 4ITCA 1UIJA 2IXHA 3MFAA 2A3WA 3ZMNA 1AR83 5GLZA 3ZFGB 1TQ5A 1IGOA 1HQWA 3D0SA 5DUWA 3WUCA 3CO2A 4M01A 4FTBA 3EATX 4DS0A 3U0ZA 1QDCA 5JDBA 3O7OA 1JH5A 3LAGA 1ZVFA 2PQQA 4YGCA 3SITA 1A3KA 1S0BA 1RUG2 4BLIA 3IM0A 3ZXJA 1DQ2A 3WHUA 2HWF3 3K48A 5IK5A 1GFF2 2Z42A 3AP5A 3PJQA 2A3XA 1BEV1 2ZGLA 3WDWA 1GBGA 1MZ6A 1CAUA 4Q0QA 3ZFEB 2WBOA 1DYKA 1U5YA 3WDUA 1H2KA 3KQRA 3DV8A 1QNYA 4GQ7A 4K9SA 2VVEA 1O3SA 1IQAA 5BV6A 1BVP1