4Z1VA

Structure of factor inhibiting hif (fih) in complex with fe, no, and nog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z1vA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z1vA01
1H2KA 3D8CA 1IZ3A 4Z2WA 4JAAA 2CGOA 3P3NA 1H2MA 4BIOA 2CGNA 3P3PA 2WA3A 3KCXA 4QU2A 1H2LA 4B7EA 2WA4A 2XUMA 4B7KA 2YDEA 1YCIA 5JWPA 3OD4A 4AI8A 2ILMA 2YC0A 2Y0IA 1MZEA 2W0XA 1MZFA 4NR1A 1H2NA 4Z1VA 3KCYA
chains in the Genus database with same CATH superfamily
3OE7G 1U5ZA 4MGIE 1P8JA 2XAGA 3VUOA 1R3LC 4C8DA 2IWGB 2PLV1 1AYN3 5AVAA 4QPIB 3ZMOA 1CAUA 4IEQA 1LNQA 5CFDC 2WLJA 3LZZA 5ITZB 3VBFB 3AZVA 1KS5A 1W6OB 1GZWA 3SPJA 4JASA 1EPWA 3B5LB 1B09A 4JV4A 2ZGPA 4AEMA 1Q8QA 3JASA 4GXLA 1US6A 3IC7A 3Q8FA 2PN5A 3S57A 3HKBA 5LGUA 4B29A 5GZEA 4JZ2A 4EKWA 3I8TA 4XILA 4ZPIA 1EAH2 3OOXA 1Y76B 1AR72 5IK8A 4Q4W1 4J9YB 3ASOC 1YQ8A 4JHZA 2JD9A 4BA6A 3UT0A 4K9SA 2GP3A 3LA2A 5LK7B 5E88A 3RYHB 2P3KA 1RJ7A 2JDMA 2NN8A 1WLEA 4U3JB 3ITQA 3FHIB 4LPLA 1US3A 4RHV1 3CZUA 1GUIA 1MEC3 1NCRC 1HRV3 4ZZ5A 5J9PC 5E89A 5JR7B 1AJPA 4DK0A 1SCRA 4AW7A 4DRXB 2W52A 3ROUA 2UUAO 4L8QA 4YGEA 5HFLA 3U0ZA 2W95A 4BCUA 3RG0A 4YHHB 3KSCA 2GP5A 1TME2 2Y6GA 4BR6A 2XAFA 2D6PA 1IXMA 4EB6A 1RTVA 2OKXA 1MQTC 3R4SA 1J5EO 2FMLA 1UPGA 4LO6B 4X65O 3RN4A 5IYDO 3PJYA 2WNVA 5FO7B 1GOHA 4K8RB 4CDUA 3HKEA 1GNHA 1XI1A 3O1MA 1WP8A 1OCOB 1LOFA 5FWEA 1LU2A 1QJU3 4MSVA 4COWA 3RFRA 5BNPC 2LS6A 4O4LA 4WBBA 1BBT3 3KF5A 2EF6A 4JI1B 4LF6B 5J1XA 3IIIA 2WSVA 4IEWA 4ZONA 1VQ4V 2E76B 2K1EA 1N47A 2IVIB 5JOWA 1CWPA 1NZ6A 4X1IB 3OTFA 4XJUA 1UPSA 4XFHA 3OYWB 4HFSA 3SYCA 5CBGA 1ZM1A 2XJPA 3F7VC 2YY1A 5FY5A 2ZZQA 5FP7A 1IBMB 1MS8A 2JDUA 3POJA 3HR0A 1AJNA 2DYCA 3POFA 4E4HA 1MACA 4MTGA 5ABJB 1S5JA 5ACA2 2XBO2 2X6BA 3H9VA 1AYM1 1UOGA 2BVBA 4UUJC 3FAVA 4JYBA 1VJ2A 2R9AA 1WJZA 4CXXA 2QQNA 5B4XA 3NRUA 5J2TA 4DEQA 3E8BA 2X6AA 4NOTA 2MK3A 1TNRA 2OQ6A 2JDNA 4O2BB 1OH3A 4R9AA 2XAHA 3DPRC 5A3MA 4U7NA 1JTZX 2WT0A 1ROPA 4RUEA 5FL7G 2EIBA 4IE0A 4DIQA 4DUYO 3FZ3A 2XUMA 1GV9A 2F4PA 2ZPXA 2A6YA 3LDEA 1BEV1 1SQQH 4NN0A 4CU6A 1DLLA 1R1ZA 4XF9A 4QPYA 3N2KB 5IJRA 1PNFA 2JICA 4CYDA 2WLQA 5A6QA 5T52A 5A70A 1POV3 2UU8A 3K4DA 4GT1A 4XFBA 2BNMA 2XWBB 1QOTA 4RAIA 1VMHA 1UZWA 4DK1A 4H33A 3LF7A 4EWAA 5J98B 5IYZB 1J95A 1TMF3 1O3TA 1ZZ7A 2Q30A 3M8AA 2RMU1 3SEEA 1ZTEA 3PMEA 2VOVA 3WG3A 4LR4A 4YY3O 1LECA 5D1IA 1UOFA 5B2GB 5CFCC 2YI9A 2YXYA 1HXS3 3J4UH 4DR7B 1J3RA 4Q4Y3 4FFGA 1W8ZA 1M90W 4XHXA 2OPKA 1QDOA 1HRI3 3ZIWA 4B8EA 4RS5B 5BNOA 3SR2C 1Y74B 1XHZA 1QJX2 5JCTA 2K9ZA 3STLC 4RUFA 1ZBE1 4MGTA 1Q6IA 5EZYB 3KQRA 5IVJA 4AL9A 1Y66A 3ZFEC 4DXRA 3KGZA 1R1A1 2C4XA 3VKOA 5J36A 5BUVA 4A42A 4CP9A 4E8CA 2HWD3 3KCCA 4Y1UA 3AG2B 4NHMA 3I49A 2LGWA 4PT6A 1OVPA 3PJSK 1AX1A 5FZAA 4OFGA 1RXFA 4UW6A 3WNMA 3MW3A 4CEWC 2XOMA 3AM2A 3S5QA 1EZJA 5FPLA 5FZDA 2DF7A 4XZPA 3BU7A 1QOOA 4HPKB 3NW4A 3MIHA 1XHXA 4XCAA 1C5IA 3ABZA 5F32A 2HWB2 4KWJA 5LGTA 1GNZA 4YM0A 4KG8A 3I2FA 4JI0O 1K5SA 3KMHA 1ENQA 1H2LA 1GMGA 1BVP1 4TUYA 3CDZB 3A7QA 1KQSU 1Q8SA 2QA4V 2ZCWA 2WZR2 2PMWB 3MW4A 2W47A 2ZAAA 3EQEA 3IMMA 3ON7A 1PO21 1HR0B 4HVRA 2JGDA 5B1NA 3BA9A 3U10A 1LOCA 2VWKA 2BTQA 4J1WA 3L73H 1SPPA 3OGVA 4ZZ8A 5L3BA 2DTWA 1E79G 3G67A 3TEZA 2F4VB 2UUCB 5FP8A 3HKDA 2V72A 1IKQA 5B5EZ 1T6BX 4AHCA 5L3EA 3QO5A 2DTYA 1B35C 4OYUA 2KM2A 1H8TA 3NV1A 1TGOA 1G6NA 1AI6A 1TUBB 1ZLZA 1C28A 3LFIA 5FP9A 4KBZA 2Q8VA 4E4EA 1X9PA 3ZRWB 4AI3A 2BCCH 1YQCA 2UY9A 3S0MA 3HT2A 2D6LX 1VBE1 3AZXA 3VBBA 5GTHZ 3FLPA 3DKQA 2EILC 1XB9A 4MG2A 4AHWA 2DYSB 2PFWA 4NRPA 1H1AA 2ZXWC 1IPSA 1RYYA 2FCVA 3CJIB 3FL7A 2ETNA 4DW1A 3VHOA 3DGEA 3AZWA 4Q0SA 4AFCA 1P49A 3ZS8C 3LQCA 1ZUQA 5AC92 2V5YA 2YPDA 4CDWA 2GHYA 1SRYA 3RYFB 4HN1A 2LALA 3ETGA 4YWAA 4LE4A 5FYZA 1AJQA 2R32A 4XUTA 4Y1VA 2D6NA 2R061 1U97A 4UCSA 3A0BZ 1FOD3 2PHWA 4DUVA 2E31A 3VZLA 2Q7HA 4OQ9A 3AG1B 3NAPB 4COZA 2Y34A 3RZLA 4HBNA 3OTOO 4QQHA 2WDBA 4I09A 3N35A 2JS5A 2LGQA 3AFGA 2UWAA 2Q8OA 1NCQC 4YW7A 5IAVA 1G9DA 2CY6A 5LA9A 1D2QA 3N7KA 4RQPB 1FXKB 3C90A 4I55A 5FZFA 3ABMC 4J80A 1W8HA 3NQHA 1AX0A 3M3OA 1HNXO 1VEWA 5JR2A 4YJ3B 3RMYA 5FBZA 1N33B 5IY5B 1RUE3 4BPZA 2A6VA 1UMHA 3O1OA 1XXNA 3THOA 3GJAA 3FX3A 1WWYA 2E6VA 3N27A 4JI3B 2RR13 4GJZA 3RVHA 4BYYA 2XNDG 3ZXAC 3JB4C 3PNAA 1S4CA 3A0HZ 1IBLO 4M3CB 3SJCC 5EV7A 4UB6Z 3JATB 4WM8C 4LA3A 4FFFA 1PMHX 4LOSA 1BHBA 1ULOA 3ZXJA 2C24A 1E5HA 1WMXA 2YXHA 4XMAA 2AC1A 4BQ1A 1OKQA 4MSWC 1QU7A 1V6OA 5EFUA 5H9PA 4E9KA 2D5FA 4W6YA 1VQNV 4WFHA 1V9U3 1JMKC 4F3JA 4PLNA 1W0PA 5DQ0A 2JXAA 1LODA 4Q4W2 1VR3A 5C5UA 2W94A 5CB7A 2WNVC 1HQWA 1Y6XA 3GZAA 1BZWA 5EPAA 1ULGA 4FM0A 5FZKA 5KA6A 3HN3A 1W8NA 3URFA 2Z79A 3BY6A 2FQPA 5F3CA 3CCQV 1SERA 4OX9B 1SCSA 4XW3A 4WFBV 2W39A 2C2AA 4N9HA 4P00B 1KYOF 4HK8A 5FREA 2IH3C 1AR82 1N34B 5C9AA 4IYHA 1JHNA 4A3ZA 1PZ7A 2FCUA 4B3SO 1EP0A 5DZGA 3ZKUA 1GOGA 3JAKB 1YITV 2QDRA 1UFIA 4RR3A 2CWMA 4D3WA 3GCXA 3CCUV 3DXRB 5FZ4A 3A8TA 3MIFA 2YICA 4PLMA 4RL7A 4KH9A 4R9DA 1GP6A 3HNMA 2ZX0A 1IGOA 1GZ9A 2ZD9A 1E5SA 1UZYA 3H8UA 3ME2A 4TSVA 2ARBA 2BOJA 3MI8A 4FSJA 3CMAV 4JGZB 4OXSA 2FB5A 3NJXA 4DR4O 4JAUA 5KA5A 4DR3B 1X33A 5KMGA 4QHZA 1XL6A 2UUAB 1Q56A 1JYIA 1R3JC 4ONUA 2DU0A 5FY0A 2LM3A 4GA9A 4CEYA 5LOVA 3FC0A 3ZR6A 4B3TB 4I30A 2UY8A 4HT1T 1XOUA 1OSGA 1AXKA 1R1BA 3ZO0B 3NV2A 2RS32 2A06H 1V54B 1JA8A 4IUGA 2RJKA 3J7MA 1V9PA 2OYZA 1J5EB 4ZBMA 5BXZA 4LF4O 3HVDA 1QLEB 1N4CA 1UNBA 2YC0A 4XUQA 1VQLV 1UY1A 1FNYA 4G27B 4AFAA 3M99B 4PDMA 1WBLA 3K04A 2WLLB 5FZHA 5L9VA 4FPOB 3CRQA 3WG7B 1ZL8A 5EBWC 1NQDA 2ZGOA 5LK5A 1UF2C 4QKBA 4TLGA 5DMYA 4K1YA 1UYZA 1PK6A 4WM7C 2AACA 2X8KA 2ZGKA 4FVVA 1OCCC 2XJSA 3J7LA 3W5NA 3LEIA 1HNZB 3EBRA 4OULA 4LTAA 5H9RA 4ZOLB 5BYNA 1QOSA 2RV9A 5JQGB 4WVWA 3HJRA 3N9MA 4CCLA 3WSOA 1LOBA 3ZXFA 1Q6HA 2P67A 2I07B 3I56V 4NB5A 4QB6A 2R071 3LDKA 4QU2A 5FZOB 4Y1YA 5BNOC 5JDBA 1BK1A 1V6NA 4Q0VA 2A5ZA 2OIEA 4Q4V2 1AYN1 3X29B 3MYXA 2G1MA 4RFT0 4YZ4A 4OQ8A 2VVEA 4FFBB 4LBMA 3V65A 2BFUL 1K4DC 1NVPD 2HBTA 3IPVA 4HZ3A 4DUYB 2Y6HA 1QR8A 4XIOA 1F9KA 1JYXA 2VH9A 1A34A 3W7XA 4MVUA 4PI0A 2YIBA 3BI3A 1R081 1GMMA 4LF5B 5IVFA 2Y8KA 4X1KA 4R52A 3AJYA 4LBJA 5CG9A 2F6BA 1VF7A 2HVJC 1PIV2 4CUCA 1S3JA 3JARB 1V6LA 2ZJCA 3I7DA 2RDQA 4MH0E 5JPMB 4QPGA 1NT2B 3TOJA 3H8XA 3K4AA 1DBNA 2WZPP 1DYPA 3B2EE 2RVAA 1SBFA 5L9BA 2E51A 1W8WA 2EINC 4JI4O 1WCSA 4DYLA 3M1HA 1UAIA 4CCEA 1VIBA 1YYNA 1GM9A 4GKXA 1RUJ2 4LWSB 1J83A 5BR8O 1HNWB 3VKMA 5GZDA 2VG9A 2FDKA 3H42B 5CA0A 3VBOC 2QJVA 3WQ0A 5KR7A 2ORXA 3ACGA 4B4RA 5CFDB 4LF8O 1BKZA 5A32B 1KS4A 3UGGA 1YDXA 1HRV1 4QAWA 1R1A2 1J3QA 2A3YA 2W6IG 3WVJA 2A75A 2NMNA 4BIOA 2KG7A 1VBD2 4FFHA 1EPZA 2GC3A 3LOIA 1RUG3 3GWOA 1OJHA 1OBNA 2AW9A 4P9IA 5K1XA 1ULDA 1AR1B 2R042 1XE0A 4IHJB 5ANNA 3E22B 4B3MO 1I08A 1C1LA 4O9GA 4ASKA 2RDNA 4IGPA 1AR63 3WDTA 4A6SA 1RUF3 1E1QG 2WQZC 3VGIA 4PQQA 3ASOB 4YG3A 4CS4A 1C8M2 1THZA 4CCMA 3CS5A 5DDJ2 2WQ8A 5IJ9B 1YFYA 3USUA 4OHZA 2F17A 4X62O 3PHMA 3LPGA 3ZXLA 4GKKB 4QB1A 3K51A 1BBT1 4A7YA 1PO22 3UK9A 1D4M1 1Y9QA 1JYCA 1DGRN 2YS8A 3QTCA 1IBKB 1SG3A 2H3OA 1NCRB 2Q8EA 2JRIA 4OZXA 1GRJA 4CRQA 2FDGA 4HKLA 3U4XA 2YEVA 4CDWC 1OQEA 5BMVB 2LJ2A 2JK5C 4R4ZA 4TWTA 3WR0A 4M3CF 3TAYA 1LCLA 2D6OX 1WP7A 4LFAO 1JMUB 5GLTA 2EJRA 1GO3F 3L72H 4KXRA 1POQA 1TNFA 5JXHA 2DCZA 4IXLA 3SYAA 2O14A 4Y1XA 1QF3A 4JPRA 1HIXA 4XTPA 2JDPA 3VBRA 4PDWA 4CPBD 1DG6A 2E5LO 3O0WA 2QQVA 4LMFA 4U2AA 3N7JA 3ORJA 1J1LA 1VRH2 4GUNA 2DQ3A 2VUJA 1MQTB 2D6MA 3H0OA 4IEUA 1AL22 3DXUA 1S0EA 1J1TA 2J1RA 3D8CA 3EXUA 2VQ0A 4Z82A 2EBOA 2E7AA 5DUUA 2GALA 5BNPB 2ZNIA 4GKJB 2Y6JA 1GK9A 2GV9A 4L92A 3SGIA 1PO11 2GDFA 4FXKB 3KQ4B 3VDCA 3O0VA 4GAZA 5CBLA 3J80N 4O4HA 1Z0HA 4AVSA 3ZFGC 2EIKC 3E8FA 3WW2A 4JTNA 3RZZA 4BDVB 1EV13 1ZRFA 4QX0A 4A6OA 2ZE8A 5FZGA 3LA3A 3CIHA 2ADPA 3RZGA 1FKAO 4WVVA 1WMDA 1H8HG 2V4VA 4J6GA 4R8CA 2DUOA 2OZJA 4NHYA 4LNUA 1ZBA1 4RYDA 2WS91 1SESA 3RBZA 1Q43A 2GTAA 1DGSA 5GZCA 5HCBA 2HJFC 3WF0A 3WY6A 4FLUA 4OCTA 3JD1A 1P7GA 5IT6A 4ZHQB 2RG4A 4EV0A 3ZSKA 4LBQB 1AB3A 2W92A 1I9RA 3NVCA 4AWDA 2BUKA 3SH5A 2FZ1A 4TV9B 4MO3M 1K34A 4UOJA 5FZMA 3FFZA 1HXS1 1PVC3 3DPRB 2HKOA 2VMGA 3AYCA 1AJKA 3N3HA 2P17A 3B77A 1YJNV 1HRI1 1NXD1 5HPOA 2HWC2 4W4KA 3VD9A 2GMPA 4FOQA 4YM1A 2XBO3 3J8F2 2AHYA 4LHNA 1QLNA 3BUCA 5J3UA 2GTSA 5JXJA 4FPCA 5L73A 3W5MA 1A8MA 5KHIA 4QIWF 5IJ0B 3K06A 1COV1 4JI2B 1URFA 3SQOA 3ZMTA 3GYDA 1JN2P 2Y4TA 5K7PA 1UMIA 1VQ7V 1W9TA 4G4FA 5HXMA 3GJBA 2W1SA 4N21A 1SZXA 4EJRA 3UM7A 4MVTA 4K6BA 2WT1A 1SF9A 3LDCA 1R6TA 4QHBA 3CCMV 3C3VA 1QXJA 5D21A 3BU0A 3AC0A 1R091 3FB5C 3C7FA 3LSDA 5CFCB 5GM0A 4LA2A 4XVHA 1QNWA 2YSUB 1JCHA 3I3BA 1HV1A 3T30A 2VCAA 4HYOA 4X8AA 5D8AC 3UJQA 5DXDA 5T55A 4BWAA 1IG0A 1PV0A 4K0KO 3F5TA 1JZ8A 5KAFZ 2LO1A 3ZFEB 5J2UA 5KXCA 3DTUB 2F93B 1ZZBA 2X0LA 3CP1A 3L71H 4PDVA 1PZ8A 2HYKA 2P22C 1AR92 3POWA 2CAUA 4JCKA 4YW6A 3OPZA 5LBFA 1LGNA 2QWQB 5SV5A 1PK6C 2CDPA 4D7YA 3IAPA 4CEWB 1WBFA 2VW0A 4I7ZB 4BOWA 1TAEA 2CUGA 3PDQA 4CCDA 3ZSJA 4GKYA 2UWBA 2WO2A 2QBXA 3BIEA 2CHHA 4EZHA 5JXIA 1GAXA 1QJX3 3SPIA 1WZXA 1W6NA 3H1KH 5EYPA 3A2FA 5FZ9A 3LDRA 1T2XA 3ILRA 1GR3A 4EWDA 3AK2A 3UNPA 4F6RB 1F15A 3JB8A 4DR4B 2PHTA 2WABA 4M0HA 4Y4RA 4EN8B 3ZFFC 5FQ0A 1QEXA 1WCKA 2CTPA 3HNBM 2P4VA 4PIXA 5K9YA 1GTOA 3IC9A 3LOBA 2VOXA 2QJ1A 3T3YA 3T1YB 2Y6KA 5A1LA 5A7QA 3AK1A 1LESA 1SLAA 4DV7B 3A0NA 1Y7BA 2P6CA 2PUSA 4FCAA 2JG8C 2QQWA 3DYMA 4OUSA 1MOFA 5JZGC 3JSLA 3R65A 1K5MA 3SCGA 4YGDA 3V64A 5A7WB 1B35B 4AEDA 2M7WA 2JS3A 4MVMA 1XNKA 1I5XA 5F5AA 3JAMN 2R72A 1BT8A 2E7QA 2P5OA 1WN7A 3MV11 1GSLA 3GBWA 1QH7A 3VZJA 4E4DX 2PTMA 1SS3A 3W21A 4YW4A 2BYVE 1H4HA 2UYBA 1CD3G 4GH4C 4NUBA 4CCNA 1UN1A 3IBMA 5L7OC 4UVAA 2ENRA 5T50A 3K46A 4D69A 3I2KA 1HB3A 2ZE7A 5JJEB 3GBFA 1VQ6V 2KB1A 3L2YA 2EILB 2IJJA 5C8WA 4XFIA 4BK5A 4LT5A 5A7PA 1AYN2 2ZXWB 3KV5A 4A4AA 1PGL1 1S0DA 4YNIA 4FAHA 3VD4A 2XKPA 3SJAC 2V4DA 4JTOA 1BQPA 4E4SA 1RUE1 5F6KA 1LJ7A 1ND3A 4LFBO 3WZ1A 5L19A 2Q0AA 3JQWA 1YTFB 4QX5A 5L3FA 4XC9A 1WA8A 3K5MA 3ES4A 3U14A 1NZIA 1BMV2 1HW5A 4HL0A 1GN2A 1SQVH 1CVNA 3FMGA 1GM7A 1XMQB 3BTAA 3U37A 1BGYH 2WA4A 2P1BA 1LHVA 2RDSA 1K5QA 3VBUA 2P37A 3CB2A 4V2WA 1BQ0A 2VC9A 4ATFA 1K33A 3RMXA 4EN7B 3CMEV 2ZGNA 5FZ0A 3JALB 3A0KA 4P9GA 5JSRA 2DVFA 2LP7A 1UYPA 3S7IA 1NCQB 1Y4MA 2XKOA 3T1HO 4O7XA 1KBHA 4BQ5A 1PM7A 4IGQA 4MTOA 2FBEA 5F1RA 3J7NA 1IURA 2ZE6A 4JAAA 4W6XA 1BCCH 2CSGA 3PL0A 4DV3B 2ZMKA 3ABMB 3KZ4C 1Z7S3 2XG3A 3AG3C 1FS0G 4IL6Z 4ASMB 1GWLA 2JB4A 3AXEA 1MEC2 1HRV2 2NP0A 2VPVA 3T2OA 3THDA 1H0BA 2WRAA 4MXWA 1VP6A 4ZU4A 1VBC3 2A3QA 3AMHA 3LSSA 2DN9A 5A3WA 3POGA 1KJLA 1CAVA 4NRQA 1UZZA 3WDVA 2YBPA 1RIRA 4O4JB 1GH6A 4WM8B 1WW4A 2N04A 3H9AA 4IV1A 4IW3A 3TWIA 4WFGA 4MW8A 3VBRC 1ZYBA 4CP2A 3CD6V 1I94O 4DXWA 2ARCA 3DKWA 1I5PA 5M0TA 2OZ6A 3Q8AA 5T5PA 5LBBA 2WNVB 4E2QA 3HKEB 1RSOB 2QTOA 3Q8EA 1QDCA 4CDQA 1O5UA 3NJVA 2P3YA 1D5NA 4H7LA 1VP7A 4B3MB 3D36C 2QQOA 4O4LB 1QJU2 4WBNB 4DMIA 2VULA 2KD7A 1GM8A 1GANA 2JX9A 1QNYA 2PF4E 2A1XA 2VNOA 4AQ2A 1QY4A 3I54A 1KMIZ 1RGSA 3BCWA 3KCXA 4LBEC 5JMOA 1MZ6A 1CZTA 2EIJC 3JD73 2VMEA 4LIUA 2A79B 2PHDA 1QXPA 4FBFA 4Q0PA 3CXHF 5FMCA 3GGLA 2XJUA 5FPOA 2UXNA 1IS3A 2BE3A 1VIWB 1HN0A 1W0NA 4BIFA 3Q8CA 1W6QB 4LF7B 4JZRA 3OPWA 2O1QA 4ICGA 4Y24A 4ZS2A 5JOZA 3VHRA 3K9SA 1QVFU 4I01A 2VQUA 1X59A 2W1QA 2Y64A 3ACLA 3TNPB 1O91A 4HNAB 4P9PA 1Y67A 2WLPA 5FMBA 4LFAB 4LKSA 1NOVA 4EN9B 1AR83 4PQ9A 4CUBA 4MZUA 1F7YA 2ZEWA 2WLKA 3FWEA 4GB31 2DW4A 2Z2SB 4GMP3 1YI7A 1XYNA 2UXCO 1O4TA 2PXJA 1AI5A 2ITDC 1XREA 3K57A 5LP6A 1SMVA 3GHNA 3OGIB 1Q82W 1QHTA 2E5LB 2EJ7A 1W9YA 1WLDA 4XF3A 4KL1A 4LH6A 2WYSA 2R1BA 3ZN6A 3BPSA 1NYWA 4OPAA 1FV2A 5C5TA 3G4SV 3ILNA 4QQ2A 4JGYA 4UBGA 1OMIA 3KG2A 4YZ5A 4EYUA 2IU3A 3VL8A 3B94A 4WVZA 3L75H 5FPRA 1JX9A 1MNGA 2B1GA 4UF0A 5C7GA 2P90A 4BQWA 5E8AA 1PM9A 4R9BA 4UCUA 4MXVA 1C4RA 5KBFA 5FKBA 2RS13 4I4TA 1QJFA 1TMF2 3I3QA 5CA6A 4X88A 3BIWE 1YNAA 2LFSA 4X8NA 4WM7B 3OMNB 1OCCB 1YIJV 1RXGA 1WCDJ 1GYKA 4RGGA 4COVA 3NNGA 1KFXL 1RUD1 2FDJA 3FBMA 4XDJA 1OCRC 3OM3B 4SBVA 5KX5A 1HXS2 1RUH3 4AHYA 3RWNA 1DIWA 1PNLA 3NSTA 3CJHB 2ZGRA 4AXOA 4Q4Y2 3ATGA 2GBOA 1H2MA 4LQRA 1HJFA 5BNOB 3ZYBA 1NA1C 1HRI2 3ABUA 2BFUS 1STMA 1S55A 3WHTA 2O8OA 1X4TA 1FFXB 2XONA 1F4HA 5C3SA 3OAAG 3JXSA 3B9IA 4FK5C 4CP9B 5JH7B 4JYYA 4X20A 5C8CC 1KP3A 2ZGLA 1O3QA 1W0JG 3KD4A 3K2OA 4FP3A 5CG8A 2HWD2 1QJY2 2ZZJA 3CC2V 4XEZA 3J7HA 1IQDC 3VHPA 4QPJA 3LSQA 1BXHA 1PX4A 4ASUG 5DG2A 3OPTA 1VARA 1NTKH 1FXVA 2ZAHA 4MGYE 3L9DA 4Q4V3 2VR4A 4NWWA 4ASLA 5IDJA 1CAXA 4MTXA 4DXTA 1LHOA 1UPIA 3EB7A 2EINB 1UOBA 4UV9A 4TUYB 2PYLA 1GNYA 1N0NA 2HG5C 4CDXC 4HZFA 4GX5A 2JGDB 4D94A 3OUJA 1RUC3 3VBOB 4R7CA 3THTA 5D5PA 5E1AC 3MF6A 1S0FA 3IFXA 5HXVA 3ZN1A 3PIJA 4UFLA 1KC8W 4AZZA 2GNDA 2RM23 1EAH1 4ISRA 5KUKA 1AR71 1HX6A 1N3QA 4DV0B 4O61A 4FJCC 2Q7EA 4YVSC 3CCVV 3T1LA 3G71V 2VMIA 1UKRA 2Q1FA 3CX5F 1EM1A 2IM9A 1K5MC 2RCVA 4AF9A 5GLWA 1RHI3 2BTVC 4JQTA 1W28A 2VD7A 2RDCA 1LUVA 3O1VA 3DL3A 5ISLA 1ASJ3 1O9GA 3W7UA 2UWCA 3ZVXA 3ZLIA 3SNMA 1G6UA 1JBCA 2HYXA 5JPNB 5DUXA 3DC6A 2CH7A 2VUCA 1TQ5A 2VZUA 1SZTA 3CCSV 3K03A 3JCIA 3T0AA 4CCJA 4N43C 5FPVA 4QNHB 1V55C 2JENA 4C1WA 5KXBA 1N36B 2FDIA 2QWRB 3FUQA 3FKSG 1WCUA 1RVF3 2DU1A 3L70H 4QPIA 3ZRSA 4QX8A 4UT5A 5ITZA 2JJ2G 3VBFA 3KB5A 4GQ7A 2IU0A 2WLHA 1S0VA 3WP6A 5FUNA 4XF4A 1W6OA 1NU1H 2JIJA 1VAMA 4CP0A 4CDWB 1JZ7A 3D3QA 1UW8A 4YW3A 2YUAA 1TME1 1OLRA 2RS53 4I0XB 3BOWA 4LF6O 1ZVFA 5IT9N 1XSQA 3JD4A 2WO3A 3VKLA 2Q67A 3VBUC 1D0GA 2BOIA 1FOD2 4PA7A 4YJ2B 3GB7C 1Y76A 4KP4A 4IETA 3C7HA 1HB1A 1IBMO 1URXA 4DW0A 1WKYA 4OI2A 3HWJA 4JI7B 1LKNA 1YC61 4FPGA 2PI5A 1Z2GA 4Y3OA 1OFSA 5T5LA 3EMRA 5DN2A 3RYHA 2BSKB 1FPN2 3SYQA 3T0BA 2YFZA 4DR1B 3I59A 4OPHA 3ZYHA 2XMLA 4KI5M 2Y38A 2QE3A 4YG0A 3ZFGB 2EIKB 2BQPA 1RUE2 1JUIA 3L74H 2XBO1 4DRXA 2L9LA 2YB7A 2M6YA 2RR12 3FFQA 4FTSA 4Q1RA 2HBUA 2LRPA 1N1VA 2HEVF 3VDDA 3O14A 4CS3A 2IC1A 4NTXA 5C33A 3TN93 1XNAA 4PBPA 4YW1A 2D43A 2QNKA 3OUFA 5B1OA 4LFBB 4M0NA 2NM1A 1YWKA 1V9U2 2OUHA 1YUDA 2B39A 1ZRCA 4ZY9A 3CYOA 4CDQC 4CU8A 4QM9A 3WD5A 1TVKB 2BGOA 5BNNC 4Y26A 3MIGA 2BTOA 2C5DA 4WF9V 3H50A 4Y20B 1Q8IA 4LBOA 3WB1A 1REEA 1W6PB 4X1IA 2IXHA 1NLSA 2ZIMA 3T1HB 3ZPYA 2R6QA 3P1IA 5J37A 3OYWA 4DR7O 1YTFD 4FQZA 1YVWA 3DSQA 5FZLA 4W6WA 4I3PA 4I9WA 3AG4C 2XL9A 3CCLV 3MO4A 2JIZG 1BHAA 2LUWA 2YI8A 5FK8A 5ABJA 3VBSC 3AX4A 3RDIA 1YJ9V 3MPBA 2IZWA 1N32B 1ZSPA 1S0GA 3AKRA 1JOYA 3GALA 1YZBA 2JIGA 3E5QA 1Y43B 3WXPA 4XDQA 3ZYFA 1VF6C 3LE0A 3LCPA 2W0FC 2K46A 2FL4A 2HWC3 3KVAA 2BNOA 1QJX1 3H7YA 3J8F3 4PLOA 4O2BA 2VUAA 2YC4A 5FYCA 5LW9A 1MS1A 4BU2A 2VOKA 3OUIA 2OTJV 3DXTA 3U07A 1Q81W 3DCQA 4XDKA 3B8MA 2QWPB 5D8AB 5KHGA 3CEIA 3KVBA 2Q9LA 4BQXA 3WP5A 1VMGA 3JSNA 2XB6C 2VOWA 2HWF3 3ACFA 4URTA 2PQSA 2D5HA 1QQP3 4K8ZA 3CLPA 3KV6A 5SV8A 1W8FA 4XBLA 3OBAA 1W8OA 4XFCA 3K58A 2E53A 2WFPA 1LB2A 1ENVA 1ZA7A 2Q4PA 1DQ5A 2R70A 2PGGA 1HR0O 3P32A 4UI9L 2HWE3 2B46X 4XJ8A 2ZHNA 1PK6B 1BCXA 3RYCA 3Q9OA 1JODA 5FYVA 1V6IA 4B4PA 1OH4A 1OA3A 3E2EA 3HN1A 2N05A 3TYJA 2JDHA 2F4VO 1O8PA 4MGQA 2WZR1 3SH3A 3VDBA 3M4FA 1ODMA 2YIAA 2O57A 3V0AB 1GLHA 2YU1A 5FYUA 1NR7A 2JVDA 4M01A 2EXKA 2PELA 1W2AX 3RS6A 4XPVA 2D98A 2X09A 4PHZA 3NNJA 3HIFA 3LSEA 4FO9A 2CYFA 4J7KA 3T2MA 4DR2O 2WAAA 4I50B 3ZFFB 4TV8B 4Q6GA 1H2KA 4RS5A 4CCCA 2ET7A 3MFAA 2OCHA 5IFTA 3SMHA 1E5IA 4JKMA 5EZYA 2CGPA 4FPJA 1FATA 1F8VA 1K12A 1YQ2A 4DRVA 4Z1MG 4FZ1A 2WBKA 2VMDA 2XTAA 4FIPC 4I02A 5JLVA 1JS9A 2YXLA 4QE9A 2JG8B 4H3WA 4XDPA 3WNKA 5IVBA 5EYYA 1Q86W 3ENRA 4F83A 5JZGB 3KWVA 3UV9A 3OGGA 2OPWA 3BFRA 3AZYA 4J42A 3WF4A 2EICA 2JKXA 4HXCA 5BXXA 3UETA 3WU2Z 3M2MA 2P4EA 1VBA3 5LRRA 2QKAA 2JKBA 1GP5A 3W7WA 1QJZA 3OBZA 4R4XA 2XVKA 4GH4B 1EUTA 2ZXQA 2IFWA 5L7OB 5LY1A 1UY0A 3A4UA 1QKQA 3B69A 1ND2A 3WB0A 2GDSA 5AC91 3O65A 1XOYA 3O0XA 3WNXA 4FOWA 1G9CA 2TUNA 1EFRG 5K0UC 1PHMA 2Y6FA 4J11A 5LHHA 1XSRA 2XQXA 1R3IC 3CF6E 1SLIA 5JSPA 2PAKA 2NN4A 1M4UA 1LU1A 1PZ9A 2YG0A 3BTXA 2JDKA 2RMKB 4YGBA 4LFCO 1IVSA 1O7FA 2Z42A 5LMUO 1TG7A 5LMNO 1U5YA 3UGFA 1RMU3 4QPKA 1PNGA 1C1FA 4D8MA 4QDSA 1RUG2 4LO4B 3ZR5A 5JAXA 1LOEA 5BPXA 2VMFA 2WA3A 2GNMA 1NE4A 4XF1A 3ABLC 2R30A 1RUI3 4AQYB 4K40A 4PCRA 1BE3H 2DWEC 2XJVA 1SA0B 1W0KG 1UXXX 4JI3O 3RZKA 1AXYA 1YJWV 2ZA9A 1AR62 3A22A 1YJLA 3UGHA 1WLCA 1LULA 3AKSA 1RUF2 3I2JA 3ZRWA 4KWUA 3TB0A 1O3SA 3FN9A 2P3JA 1XNCA 5K1PA 1SQPH 5E6HA 3K79A 4IV3C 3QH6A 3JBG3 3JUUA 2N74A 4IDZA 4B7EA 4YIOA 4WVMB 3FLRA 5FBJA 3BTZA 4NYKA 3AG3B 3CJIA 3I3EA 4LE3A 4N53A 2V5DA 3W9AA 4BLIA 4RQFA 5EJZB 5EBMC 2XAJA 4JI6O 1OQ1A 3GXUA 4Q20A 4YM3A 1H9WA 2HH9A 4UV8A 4H37A 3RYFA 2JDYA 4OX9O 1XU2A 1YFXA 1QU0A 4RA0A 4WFFA 4LR3A 1N3PA 1N34O 4Z2AA 3CL1A 4YYOA 3VBRB 4KQ7A 3WP4A 1RPRA 4LKDA 4UFJA 4XQDA 2PZSA 5LB6A 3NAPA 5L3DA 1XU1A 3AMPA 1W3XA 1UU4A 1YF2A 2P6JA 3LNNA 5LBCA 1OA4A 1AR81 4I5SA 1Z5WA 4DO2A 1RM1C 5KHJA 2QQLA 4S2DA 1AP6A 5F8PA 2E33A 4RQPA 1FXKA 2PLV3 4BJ0A 2J1UA 4DR3O 4H14A 1XNBA 1A8DA 1F5JA 4N9IA 1S77D 3CCRV 4AEJA 4CCKA 4YJ3A 1EBOA 4DS0A 3VDAA 1VLNA 3VV1A 4BQYA 2JG9A 4IE4A 4B3TO 2EIJB 3H1MA 2B9VA 2GNTA 2UUBO 3THPA 4UFHA 3GHMA 5C3QA 4UWDA 4ZS3A 1EV12 3T2QA 1X9TA 1JW6A 5LGNA 1X8EA 3WEZA 5F2VO 4M3CA 3VDDC 2QR4A 2ZX4A 2A70A 3I97A 3C7EA 3ZMVA 1W6MB 3JATA 4EN0A 1L0NH 3J81N 5LA0A 4D7TA 1E1RG 4JI5B 3GF6A 3MZHA 4DV1O 2K2SA 2JECA 2RS31 5IYCO 1OD5A 3NNFA 3O9OA 1JYTA 2HLEA 4I3GA 5F5CA 3HBKA 4J10A 2Y4UA 3ZYIB 3OEAA 2XOKG 3WDUA 1NZCA 1QQCA 2JWPA 5FWJA 4DNYA 4LBKA 3OY8B 3F5WC 4B7KA 1PVC2 3ES1A 4AI8A 3JU9A 4ITCA 1VQ8V 3PUQA 2X5IC 1OPOA 1HNZO 2O0OA 4NJ4A 1F35A 1DQ2A 4Y33A 4X6RB 3RYRA 4TQDA 3H3ZA 1CAWB 4GYCB 1OQDA 3HQUA 4U7OA 4CXYA 1B6QA 3CRCA 3DXRA 1NKGA 1I6XA 2WN2A 1OCZC 3ELNA 1UL9A 3WW3A 3H1HH 1HDJA 1NUKA 5FYIA 3KKYA 4NIDA 4W65A 3IB3A 3KV9A 5CB4B 5C8YB 1XBFA 3NV3A 2VRZA 1HWYA 4BW5A 3VZMA 2FYUH 4MVRA 4XUPA 4QB2A 4XABA 2ZR2A 5IAXA 4JGZA 1OLME 5A6XA 2ET1A 4K1ZA 1IPJA 2EZOA 2R7EB 2RNBA 4P9WA 2AUYA 3C3SA 4O9EA 4Q4V1 4LF5O 1OCRB 3IGAC 3H1IH 2AGSA 2F95B 2Z5UA 4P30A 4DR6B 4B1MA 4PJ0Z 3PMSA 2ZE5A 4DPNA 4K21A 1FXZA 4XHBA 4Q4X3 2WLIB 2Y0IA 2D7FA 5I0RA 1NA1B 2EXIA 3SLIA 4R8HA 1VQ9V 4IEZA 1RUC1 2DUQA 2ZX1A 3AP7A 3QACA 2BWAA 4Z8BA 4DXSA 3H7JA 3WUCA 5LBQA 1DGWA 5I0UA 1PIV1 3RYPA 3MDPA 3EO6A 5C8CB 3QVNA 2DUPA 5FTTC 1HNWO 2WLLA 1DP0A 3CZJA 5C4WC 2PI4A 5JCOC 3BA8A 1VQPV 1AYM3 1N3OA 4AI2A 1H6XA 2BP6A 3SJBC 4DQAA 5A7OA 1RUJ1 2J1SA 4ZOLA 2NQYA 3H1LH 5JQGA 4XE9A 4CUGA 2C9KA 5EYPB 4OMDA 1I1EA 3ICXA 4AI0A 2ZGSA 4AVBA 1ZRDA 1YIPA 3JYCA 3ACHA 4FM1A 3NV4A 2LW1A 5KC5A 1I5YA 2XR4A 4P9JA 1YRZA 5FQ0B 4AVVA 3D82A 1BEV3 1ZNPA 1PGW2 4A2UA 1VBD1 4CDXB 4XJ9A 4Q26A 3APQA 1QJY3 5ANQA 4JKLA 3MUY1 3AL6A 3LEKA 3C2UA 3AYEA 4ISQA 4LLOA 2R041 2WWWA 3ZEDA 5KWRA 2W5FA 5E16A 5GLZA 4Q8LA 2E74B 3UT5A 4GKKO 3JD2A 2W91A 1WD3A 3ASIA 4YVSB 1BK0A 4IIJB 2A73B 4YPJA 1IBKO 3K4ZA 1C8M1 1K5MB 2XGXA 1VQ5V 5DDJ1 1CX1A 2RMU3 2E75B 3B4SA 3CBNA 4L87A 1SQXH 3STZC 4RD7A 4HLTA 3RYKA 3T2PA 2BZDA 5BNQA 5FV3A 3P6BA 4UXNA 3UO3A 1HB4A 1IG3A 4J25A 4MTFA 2AHZA 1FYUA 1ND2C 4N43B 3NR7A 2QKSA 1V55B 4Z92B 2Y60A 2J7MA 5CMUA 3AVSA 4MADA 1NQTA 3ZOIA 4CH3A 4E8DA 1JU4A 2XQRA 2OX0A 2B7YA 4COYA 1UOJA 1ZBE3 2B5UA 1WW5A 5CFDA 5A32A 3RI9A 1L8DA 2UXBB 3LPFA 3B40A 4JYAB 3L9JT 1B06A 4NTYA 2H94A 3IZOA 5EJ3A 3O1TA 5HCAA 3ZHUA 1W2UA 2PAEA 4GKJO 2OUJA 3VHNA 4DR2B 3ZX6A 4AGRA 2VZQA 2VQFO 3MV01 2RJZA 3VLBB 2EX3A 2VCBA 1VRH1 3OBRA 4B3NA 4J7JA 1YO8A 1AL21 1CIWA 2ADDA 1G8MA 1FAYA 2D3RA 4IHJA 3VBUB 2A0LA 3E22A 4NPLA 4OVEA 4ZU7A 3PUHA 4XBQA 3CU7A 1XMOO 3OCPA 4YRDA 1LHNA 1KITA 1W8UA 2FTKA 2WNUA 3T0DA 1DQ4A 4HOOA 4TN7A 2A6ZA 4X66B 3G80A 4GX1A 5LEJA 3OD0A 4BE3A 1FJGB 5I0DA 3H3UA 4D0QA 4J7ZA 3HQRA 4B1LA 1R3KC 2P7TC 3NKTA 4N53C 4U3FH 1C8NA 1Z7S2 5EQUA 4DY3A 1U96A 2XLFA 3U1XA 4Y4YA 2Y33A 1NCRA 3FB6C 4AQ6A 4X6QB 2Q0OC 3I5DA 3RZHA 3CSXA 3MHHC 5IE9A 2CK3G 5A3TA 1VBC2 1JYNA 4G3YC 4F7ZA 5FLIA 4BW9A 4DINB 1OLMA 1HKDA 1AILA 4OI0A 3GM8A 3IM0A 1JOBA 4LFCB 3POEA 2Q8CA 2WZEA 1FPN3 3B02A 4BAYA 1F4MA 5LMUB 4NHKA 5LMNB 1RJ8A 5FJKA 1VBE3 1MQTA 5F2WA 4JI2O 1OF4A 2H8PC 1H1IA 2DQ0A 4IGOA 3DGTA 2HWC1 2JB8A 1W04A 1BJQA 5FYYA 5BNNB 3MW2A 4MW3A 3J8F1 4DEVA 4GJYA 2WO7A 2BV4A 4CVUA 2ZX3A 1WMEA 4F8AA 3K48A 4TZDA 1VF5B 2JG9C 3ZHQA 4JVAA 4OI1A 2VTFA 3GZEA 3K77A 5CYYA 1AVBA 5FLXN 1NI8A 4ZIBA 3JD72 3CMGA 1ULPA 4WFEA 4G28B 4HG6B 4CXWA 1SLBA 2G38A 4BB3A 2MEV3 4QQPA 1QQP1 2OWOA 1PGSA 4DZGA 4RQEA 2SLIA 4AVCA 3AG4B 2EIEA 1SETA 2R063 3C3TA 4CDUC 1W2NA 4HSJA 4LO8A 4Z2WA 1LOFC 4JI6B 3VBSB 2BGCA 5T5OA 4RGKA 1RUOA 3W59A 1NY72 3EHKA 4UFIA 5JWPA 1KDMA 4E2SA 1IX9A 3SCFA 3E5UA 1L7QA 4XDLA 5IWAO 2Q1ZB 3E89A 3FB7C 4ZHQA 1D2SA 4L8JA 4YZ1A 3EYPA 4LBQA 3ILFA 1PX3A 4YVWA 4IEYA 1YLLA 5F9TA 4CTEA 4TV9A 4H55A 2BBAA 5DAQA 1KKCA 3EHBB 3DPRA 5H9CA 4NHXA 1K3IA 1DZRA 1XPWA 4O4IB 2CGOA 4RFRB 2CAVA 2QVSB 5FNVB 3H1WA 4XJWA 1AR91 4N8MA 1DK1A 3MGUA 2JEMA 2XJTA 3UJOA 3NO8A 4AFBA 3RSJA 3Q8BA 2XWJB 4FPYA 1V6MA 3ABTA 3D0SA 1KU9A 1J58A 3EFFK 4LO7A 2QWOB 3LWCA 3BABA 5IJ0A 3RPQA 4EN6B 2OTLV 2Q5ZA 2QUOA 2BJSA 1JFFA 3SPHA 2UUBB 3T1YO 2RS12 4LHKA 1WB7A 3P3NA 2J1TA 4XBFA 2V1DA 2WNEA 5B1BC 5DZEA 4XURA 4TSFG 2P6HA 4DY5A 1QBZA 3CQOA 4DV7O 3RGBA 3GNEA 5CFCA 2Q7GA 3OFNG 4UW4A 3OSDA 4PDRA 1RUH2 4DV1B 4I9QA 1WA4A 5A3UA 3RRDA 3CRMA 3JCZA 2B42B 4IYIA 4TXWA 2AZ0A 3PUAA 1ZZ8A 4DV6B 4ZKTB 4QT6A 3FX7A 3IIAA 2NR5A 1WLTA 3MEPA 5EC1C 4R6ZA 5CNAA 3CRRA 3BGAA 3A23A 3VZKA 2XT9A 5LBEA 3ZFEA 2LQTA 2EA7A 4LULA 2CE4A 1FPOA 1VAKA 3I2OA 1I0HA 2IH1C 2HEWF 1XNQB 4W50A 1JUHA 1HW7A 2ILMA 4NIAA 3QO7A 4HKOA 4JV5O 4CEWA 1CEZA 1OXCA 2VO5A 1LR5A 1DDLA 4OMCA 5F6LB 2YU2A 4N23A 1H4GA 1MMMA 1N1TA 3WF3A 1CAXB 2ZINA 4FPKA 3WV6A 5BV6A 2D2CB 2WFF3 4QX1A 2Z0AA 5GTIZ 1XMQO 3MLLA 4RGAA 5DAWA 3K0GA 5CAZA 1ZWIC 2IXLA 5LA1A 2GNBA 1TZOA 1LEMA 1L1FA 5K0UB 5CA1B 1V6JA 2F23A 5LA6B 2OIIA 4XQWA 2BWCA 3PVOA 1BMV1 4MUVA 1K4CC 4QGLA 1V0AA 1NAEA 1RUC2 3PLQA 1SC5B 4XDOA 1XDCA 4CSWA 4JI8B 3O7OA 1DTOA 3APOA 3AVRA 1POV0 1MR5A 2RM22 1AXZA 4DV3O 1YQ6A 2BU9A 2NNUA 4QX2A 1RHI2 5FLJA 4NRMA 3ABLB 3WNNA 5A7NA 5A7WA 2VOTA 1U5IA 1ASJ2 4AFMA 4W4LA 2Y26A 3RVYA 1WGPA 3BN6A 3OR6C 1U0AA 2SBAA 2R49A 2D3OW 1FNZA 4NE9A 4Q27A 1W39A 1WW7A 4NIIA 2YGMA 5HCFA 3M70A 4Y22B 1MEC1 3BHPA 1APNA 4YM2A 2R073 3WNLA 1FFTB 2ZQMA 5CBFA 4QE7A 5EK0A 1S0CA 2R1DA 1V00A 4UXAA 1GN4A 3CE2A 4IV3B 5JVDA 4EEQA 1RVF2 1EN4A 4LIVA 1R6NA 3SHRA 3VKNA 4YFWA 2P2KA 2XUEA 4Z1VA 1SFYA 1H8TC 2VXJA 4X64B 1SKVA 2HHHB 4QPWA 5HV4A 1MABG 3D0JA 4CA9A 1U5XA 2O8QA 1W05A 2B9UA 1IS6A 5FP3A 1R083 5EHDA 2RS52 4CZZA 1ZZ6A 4HONA 4OUMA 5GZFA 1YXBA 3M7MX 1TE1B 4IE7A 5C6CA 2I74A 4BHPA 5EP9A 2WT2A 3ST7A 1QJU1 4KHPO 2FMDA 4CS2A 1BLZA 5G05L 1G86A 1LRHA 4HVQA 2WNUC 2Q69A 4LF7O 2QTWB 3NJZA 3LAGA 5FPBA 1WCQA 2P34A 3JALA 3AEIA 2R16A 1RM1B 1NCQA 3RYIB 5EYXA 2UYAA 2VECA 4ZXEA 1DYKA 1RL3A 2A7AA 3ZN0A 3I59B 5A6YA 4XACA 5IK4A 4N90A 1F31A 2XJQA 2ETEA 1S5LZ 3L2HA 3AYAA 2F1MA 2WYFA 2D44A 5H6RA 5B3SC 4META 3VZNA 3WDWA 2EULA 2HKXA 1CZSA 4RO2A 4Q2FA 3ZHSA 2HJIA 5FPXA 3VDDB 2IJIA 3AB0A 4O4JA 3DECA 4FQ4A 4WM8A 5DPNA 1OUSA 1W2OA 3T2TA 4ES9A 3TN92 3IDBB 4YW2A 3LUTB 3SJQC 5F3EA 3IDEA 3ZMSA 5EWSA 1CPYA 1XJAA 3ZRXA 3BODA 4LBNA 3LEMA 1K92A 2OYQA 5DAXA 1XYOA 2VQFB 3BALA 3GZUC 2CTWA 3SCHA 5EIBD 1F4NA 3EXAA 1D7PM 4LUKA 4KGQA 1BQZA 3DUIA 4I0WB 4QKNA 1HLCA 4AR2A 3DYPA 1RSOA 3IN9A 4FI9A 2A7WA 4WBNA 2G4IA 2WNOA 4DV5O 1D4M3 3VL9A 5EC2C 5FAXA 1XMOB 2J1AA 1AR4A 2JJ6A 1XNTA 2X5IB 1POV1 2JE7A 2VMCA 1YI9A 3PJQA 4LBLA 4Q4X1 2VWJA 1OZ0A 2C26A 1PPJH 4ZKIA 5KHKA 1QNMA 1KGYA 1NE6A 3NNMA 1OF3A 3WG2A 4L9BA 1TMF1 1UCXA 1O3RA 1OFNA 3O12A 4NTWA 3LGRA 1OCZB 3ZXEA 1VQOV 2BEOA 1W6QA 1NVPB 1OHHG 4R9CA 2WAMA 4HN0A 5I0TA 1AUYA 2XVGA 2DCKA 1ZA4A 2RQ6A 2GMEA 2W0XA 4LUMA 1FMD3 2WKKA 1G1XB 1UQXA 4LHLA 1BVVA 4HNAA 2DCJA 1LOAA 2ATFA 4Q4Y1 3NNLA 4RWUA 5BZBA 4GD4A 2WQ4A 5C9AC 4LHSA 1L7RA 4YVWC 1J3PA 1AX2A 5FZ7A 2WIIB 5A6ZA 4RR3C 2JE9A 4KG0A 4A5UB 1PO13 5DUWA 4ET7A 4WV8A 2VQEB 3OBTA 5L9RA 3H01A 4N7IA 2Z5WA 4B3RB 5KUMA 3POSA 2XLGA 2AENA 2HWD1 1QJY1 2AH2A 4NKGB 1JJOA 2HWF2 3K3NA 4XJZA 3QF7A 1GWMA 1QQP2 5GONB 4MGSA 3Q4HA 4CU9A 2EIGA 4ABMA 4DV2O 2QQPA 1X8MA 4CEYC 1ZBA3 1AVMA 2N7GA 5C4WB 2PHUA 2WS93 4UAPA 1JZ6A 1J59A 4JF3A 3U11A 1M56C 2HWE2 3RYCB 4LH7A 3U75A 5GZGA 5JIAA 2VBBA 4WM7A 3CRAA 2VVFA 2QFEA 1M1KW 3DEMA 4UB8Z 4DV0O 4TWKA 1AP5A 4GZRB 3G6JB 3MICA 4BMEA 3ZMUA 1AR5A 2V7QG 4JGSA 3PTYA 5FMOL 2CU5A 5IUQA 1MPXA 3RQ0A 3CJHA 3WOGA 3W7TA 1UXZA 3HBZA 1NH2B 5IWAB 2DCYA 4Y5Z0 4FOVA 4JAVA 3P5BA 2QQUA 3RZJA 3R05A 4Y1ZA 3BYWA 1XBLA 1FFXA 5T54A 5A7SA 5FYHA 3INAA 2QZ2A 2LW8A 2WJSA 4PF1A 4K3AA 4BZ4A 1F5FA 5FOBB 1XQNA 2EZPA 5D2AA 3V0BB 1E5RA 1N36O 5JH7A 5B1AC 4FLWA 5FZIA 3R66A 4XZUG 1COV3 2DFCA 4EFBA 2R9IA 2JGUA 5LXTB 1D2DA 3POYA 5HBAA 4AAXA 2VXRA 4FOYA 4W4ZA 1S5HC 5LYJB 1REFA 3KCYA 3ML0A 3NL1A 2ADEA 1IQAA 4WZFA 4B08A 3BB6A 4NXMO 3R0RA 4ARXA 2ZHLA 2Z3YA 2IFRA 2A71A 3AFKA 2GUZB 1NX9A 2BRTA 1Q7YW 5EBLC 2LW7A 4YW5A 1R093 3LD8A 3AYDA 1VBA2 4JTAB 4YARA 1OA2A 3ZMNA 3U78A 5IK7A 1M57C 1KB9F 3ZDVA 3P3PA 1JR9A 4NAOA 2XJRA 2DMXA 3ASNC 1ND2B 4K20A 1GP4A 2DDUA 1AHSA 1B04A 3ZKYA 1O59A 4BXSV 3N7MA 3W58A 1G9AA 3VBHA 5FZ8A 3VBOA 2LROA 3TK1A 2WPDG 5T3NA 4E27A 1SFNA 1OKOA 4EWEA 4JI7O 3WX5A 3R4DB 1FOD1 2W1WA 5FXXA 1O4ZA 2DFBA 4QPGC 5GALA 1Q8PA 3RNSA 1G7YA 3SYOA 5I91A 4DR1O 1RMU2 2Q4SA 1Z78A 3DYOA 2ZOEB 5CA3A 1A3KA 1DZQA 2QM8A 4XAAA 3CCEV 2E26A 2P4KA 3IAYA 1NQJA 2G9GA 4AEKA 1RUI2 3KZIZ 4JC1A 3FYIB 5C3PA 2QSAA 1LUWA 1FPN1 1SDWA 2EAKA 1ZX5A 2H0VA 2J22A 4LKFA 4OHWA 3F95A 2ZS6B 4NPMA 4JX0A 3W20A 3HD8B 1CAUB 3QO8A 1JZ2A 5LATA 1QCEA 3POBA 4C0HA 3E83A 4X1YA 1VB2A 1GZWB 4S2HA 5FDBA 3NJYA 4JV5B 4MLOA 1MSDA 4UVCA 1ZAUA 3RT3C 3ZN5A 2WWSA 3JASB 3FLTA 2RR11 5CU1A 3U4SA 3H8OA 1ENXA 1OOPA 4N53B 3JBG2 1H6YA 1X50A 4OLLA 1SQ4A 5FRAA 2JEXA 1S0IA 3HKBB 1UD1A 1LEDA 1XUQA 3AMMA 1MS9A 3RZMA 1O9HA 3FHAA 1K8AW 5FY4A 3ZXKA 3N9QA 4QXBA 2VNGA 3HKCA 2ZX2A 4A44A 2MEV1 4Q29A 4I0XA 1JYWA 1V9U1 3LKJA 2OCCC 4FT8A 3SC7X 2WC2A 3UKTA 2IW5A 3T4DA 1PD3A 1K45A 3IKWA 2VZRA 4GCZA 4L11A 2UXXA 2VVDA 3I4IA 4XIKA 4YJ2A 4FMTA 3K5NA 5JOYA 1O4YA 3CEWA 4F4LA 3S7EA 4BIUA 1Y4WA 2BVVA 1FV3A 3J26N 2P3IA 2JJ1G 4L2NA 5C70A 4QGNA 3MAQA 1DZTA 1IS5A 2VS0A 3OW2U 5AVPA 4UCVA 4WFAV 4GWNA 2XASA 2AYHA 2BSKA 1N32O 1M4WA 1R64A 3ZYPA 2X29A 2PLV2 2ZEZA 1HB2A 3K5OA 5IK5A 4DV4B 2X53S 4JDOA 1W8TA 2JG9B 1JI6A 4HSLA 1W9SA 5K4LA 1DFQA 3ZFGA 1R6KA 3VQVA 4PDWC 5A3PA 3PVNA 2VJXA 2QQMA 1S1AA 5TISZ 4EB6B 4LORA 3PVEA 2C1FA 3EJKA 2YXSA 2CTRA 4DUZO 1DGRA 5FO8B 3UKVA 1EUUA 5E1RA 1JZ4A 1IOAA 4CDUB 3AXDA 1UZVA 1JU3A 4JRAA 5FXZA 3HMYA 1SQBH 3WDXA 3IDAA 3BPZA 1NXMA 2QKCA 4FPFA 3T1CA 2JD4A 4EFEA 2IJKA 2RN9A 2A3XA 3LDBA 2OA2A 3CNAA 4BK4A 3BVOA 3P30A 3RWRD 5LHGA 1MSWD 1DLCA 5CISA 4NO4A 1TVKA 1JH5A 2D6KA 4Z07A 4FLXA 1E57A 1CESA 4FPHA 4M4PA 1BYHA 3MFCA 4KHPB 4D6TH 1MA1A 4AG4A 4XUOA 1IZ3A 4Y20A 4RHV2 4L97A 3M3QA 3POIA 5IW0A 3QD6A 1W6PA 3I3DA 1OURA 1ENSA 5LEKA 3HQXA 3TCUA 1A6CA 5A33A 3C7GA 5KLVH 2ORZA 2OQ7A 1XILA 1VB4A 3THCA 4LXLA 4IEOA 3FAVB 1DF0A 2VQAA 4HK9A 1K73W 5J2TB 2YMZA 5JI9A 3BVCA 1HQLA 2HP8A 4KNCA 2X10A 1DYOA 1KFUL 2VE1A 3ZHRA 2WUHA 4NIGA 4H44B 3HEIA 4CE8A 5B1BB 4TQFA 2VTXJ 2MNGA 1LENA 4LK7A 3FE5A 1W9WA 1DQ1A 4KU8A 3H3LA 3K3WA 2DV9A 4HETA 5LWBA 3M3EA 2WFF1 1O6UA 3PN1A 1S2KA 4AOCA 1OI6A 1W2BU 3HR9A 5LASA 4X65B 5D8AA 4Q4X2 2PQQA 4YIPA 1GN3A 2MPFA 4P9LA 5JSOA 3QBQA 4O2AA 4YLZA 3WNPA 1AL0G 2OXBA 1H9PA 3AKTA 3LSUA 1JJ2U 2D93A 5D5QA 3AZZA 4DV5B 2PYTA 2WZ8A 1AROP 3WINE 1ZX3A 3IWZA 3J9SA 3TEXA 1DLBA 4PF5A 4CH4A 2TNFA 3KM5A 4JRLA 5A3LA 3OJBA 1AYM2 2HEPA 1LOGA 5DUVA 1CX4A 3CKHA 4GB33 2WLNA 5EZWA 1NLRA 3JAWA 4XJAA 3AKPA 4LO5B 3V0AA 1ST8A 1X82A 3WQBA 2BNNA 2AZ2A 2G9FA 5JI7A 5G04L 4AQYO 4KWLA 2CV6A 1UY2A 3E35A 2DOSA 2DCTA 4I50A 2VCMA 3TETA 1BEV2 3KT4A 4TV8A 3ZFFA 1BZKA 1YHQV 1DF4A 1FD9A 1RUG1 5EXOA 4XFGA 2J42A 1WUVA 4Q5OA 5CADA 2NZ9A 4IESA 1X36A 2BW8A 2VUDA 3E5XA 2ZGTA 2ARHA 5EIYB 4P5YA 3UT5B 3APBA 4LBQD 4NR1A 2RJ2A 4QXKA 2FDHA 4OGQB 4P9YA 1QR9A 1AR61 3WG4A 4N7UA 1QXRA 1RUF1 3ZYJB 4TYSA 2Y69C 2JG8A 4X9QA 4B4QA 2ZHMA 2CTVA 3I2IA 5JZGA 2RMU2 4ZI7A 1CONA 5JIUA 4K3UA 3ZYGA 3R4UA 3FYEB 4DV2B 3N2GA 1BHGA 1RUD3 3ZDSA 3BEHA 2ZEXA 4FPPA 4LNVA 2E9QA 2Z4FA 1UYYA 3WDYA 5JXGA 3N7LA 1GZCA 1NBMG 1ENRA 1K97A 2BTQB 5FYTA 5C3RA 1SPPB 5I0SA 4LF9O 4GH4A 3OUSA 5L7OA 4M4RA 1S76D 3TBDA 4D6SA 3BTYA 2WWJA 2VW2A 4NXNO 1QJEA 1PL4A 1SLCA 1UYXA 2HVKC 3HKDB 2ZCEA 4YY3B 3K3OA 3VBHC 3LB9A 3TNQA 3DF0A 1YEWA 2Y48A 3C8XA 4CC5A 2VAUA 1ULCA 1ZBE2 4EQVA 2RJLA 1D5AA 3MF9A 3E97A 4AEDC 3TRSB 4JQRA 1H8TB 4CP1A 5FKCA 4FLZA 3AP4A 4MVQA 3S3WA 1NR1A 5E79Z 1OD3A 1K5JA 4URAA 1VBB3 2X7RB 1OVSA 2MHFA 3FBYA 4XFAA 2AREA 2TBVA 4QKFA 4FFKA 4XFFA 5GLUA 2R0HA 2B4KA 4A3XA 4FAGA 1G9FA 5ERLA 1OT5A 4SLIA 5DECA 2IUWA 2MW2B 1GZTA 2E32A 5LL6Y 3F7YC 1SA0A 3I3MA 5FZ1A 5JOXA 4BXFA 3TEWA 4CU7A 4DUWA 1J84A 2DBNA 2WNUB 1N1SA 4P08A 4QQOA 4UYBA 5L3GA 2A6WA 1UIJA 3OGCC 2K9PA 4JI5O 1TUEB 4NXMB 5AG2A 3PU8A 3B9CA 1ND3C 1NH2D 5F39A 2KQXA 5FY1A 3HT1A 1EV11 1CPNA 2W1UA 2I2SA 1OOPC 4IEXA 1YI2V 5F3GA 4FM2A 4WVMA 1EZVH 5FY9A 1QH6A 4DB5A 4QX3A 4GLXA 5C93A 4OHXA 1UY3A 5IYYA 1ZZCA 2AGAA 1ALYA 5FLHA 1X7NA 4JI0B 3PIGA 1JYVA 2L6LA 1H8VA 2EIMC 1D0HA 4X89A 2J1VA 1EAH3 4NVPA 3WCRA 5B3SB 1AR73 3FUOA 4PJYA 3A0RA 3MHSC 4O65A 1SDDB 3W7SA 1XNRO 5CEHA 1SEFA 1LGBA 5FUIA 1KQRA 2FDFA 4X8PA 1CN1A 3DC5A 5GW7A 2FKXA 1VPHA 1M06G 2P5BA 3I55V 3BRCA 4Q0UA 3AKQA 4QGMA 2CL2A 3WF1A 3D5OA 1TEIA 1LGCA 4A45A 4E2GA 4I55B 4FXGB 1FMD1 5GJ6A 1XEQA 2AR6A 1PVC1 2YYOA 5H9SA 4U3JA 3PURA 2ZKNA 1HN1A 1VBE2 4AI1A 3WQ1A 4ZU5A 3PVBB 2ZM6O 3UL2A 1P84F 3UO2A 4XTMA 4KMQA 1T6GC 3HPLC 1JOJA 3D36A 4IQPA 2ZBJA 2CDYA 1KD7A 3LIHA 2BERA 3ACIA 3MIBA 1M9NA 1SACA 4IV1C 3AMNA 3FB8C 1YFWA 5FYMA 2NMOA 2XHNA 3O1PA 1TME3 3GBGA 2ZGMA 3WB2A 4DR6O 3QCWA 1XL4A 1WD4A 3K9AA 1UX6A 1VMJA 1L3JA 1G8WA 2MEV2 2W68A 3UKNA 3LEGA 2PYJA 1RITA 1W6MA 2G19A 2VZOA 2CGNA 4GULA 2R062 5HFMA 1VQKV 5LZ6A 2DJVA 2OS2A 2YC2A 3CWBH 5DEDA 5B4NA 2QZ3A 3LNMB 4QXCA 3WW4A 4BIZA 1CR7A 4IEPA 1ULEA 3GCWA 4IE5A 1ULFA 1CXZB 3LIGA 3B93A 1XE8A 2PHFA 3I2DA 5C71A 3M8LA 1W90A 3QOPA 5C9AB 4P9XA 3TEYA 1UJWB 4YVWB 4JKKA 1RP3B 2GN3A 5AFEA 4RR3B 3MLKA 4P5HA 1HP8A 5LCWL 3OY8A 4UFKA 1JZ5A 3OTOB 1YIFA 2EALA 2ZABA 1ZRIA 3A21A 2NPIA 2XAQA 2W08A 1MZFA 1KRIA 4DR5O 4XYXA 1K3EA 4H13B 1W9FA 4EROA 5ACA3 3RVZA 1CAWA 1GN6A 3WCSA 3MBWA 4KBBA 5KMGB 4DUXA 4DXZA 2PHLA 2ODMA 1COWG 1HNXB 1G9BA 4JYCA 3CXCU 1YJKA 2QM7A 1Y9MA 3CCJV 3USSA 1I3HA 4CEYB 4HMZA 2A6XA 3GVMA 4JHTA 5LOVB 3OGSA 4ORFA 1R73A 5CB4A 5C8YA 5B66Z 1JFFB 3AP5A 2GH8A 5LP6C 4GX0A 1M56B 4QWNA 3WP3A 1GQHA 1ORQC 1IBLB 2ZEYA 2DYRC 4Q1PA 1DQ0A 5JJNB 2GH2A 5FMOS 1K7DA 1PGW1 4DUZB 4QD2A 1H8EG 4E2LA 2H6BA 4JGYC 2ITCC 3IMNA 2Q1MA 4PI2A 4MVSA 3KV4A 2W2IA 3I2GA 3N2KA 3TXQA 3G7DA 3G6BA 3AK3A 2C0ZA 4UVBA 3QNEA 2BBVA 3TGUH 5FXVA 2V4AA 2WLIA 2YBKA 1XYPA 1ZL8B 1KUQA 1NA1A 4YZ3A 1FI2A 3VD3A 1H38A 5IYZA 3UQ8A 3KGLA 2WWUA 1EN5A 3ECQA 4YG6A 4GIQA 2Y0OA 1AJOA 1RINA 4U36A 5DABA 2D40A 2GU9A 4ZXKA 5F3IA 4OI4A 5B1AB 5C8CA 4FLTA 2XL7A 2WSUA 1ZREA 5BY1A 4PD4F 4B3SB 3KHCA 4XAEA 3AMQA 1VQMV 3AP6A 5GKAC 3ZBHA 5A1FA 1NTMH 2HJDA 2UXBO 2CWSA 4JYAO 4MVOA 3VOUA 1JOPA 3NXSA 3ZJZA 2VZ1A 2ID4A 3AJZA 5TSWA 3N9OA 1RFYA 3WQ7A 4AGVA 1SQGA 2V73A 4PV1B 3PTRB 4PA9A 1Y74A 4XOGA 4ATEA 2WINB 1DCSA 3GDBA 4GMP0 4OHYA 1M57B 2WFF2 1ACCA 4IL7A 4UFMA 2PA7A 4YSFA 4MGZE 3ASNB 3LA7A 1CP9A 3IPVB 4M00A 3O1SA 3X2QC 2JDAA 3BOPA 2WLMA 1S2EA 2IXKA 4CDXA 2Q73A 1O5LA 1AZDA 4L99A 3O1UA 4I2OA 4X1KB 1UKGA 2IXJA 3AK0A 5F2SA 4WCEV 1DGLA 4X66O 3R6SA 2VZPA 4JTCB 1W0OA 4QPGB 1FJGO 4HPKA 2HWB3 4YVSA 3RWKX 4LF4B 4IIJA 1L0LH 2B8MA 3D3AA 3NWKA 1W99A 2W46A 2VZTA 4K8XA 3ZPOA 4QQLA 3K5LA 2ES3A 3S30A 2EAAA 4QDRA 1EN6A 5FK7A 3HOBA 1WW6A 1WPXA 2IVJA 5A3OA 4OUEA 4NIHA 2WZR3 5A3NA 4J9ZB 3KHBA 2WSSG 4GZ9A 4QKDA 3ETPA 5CA0B 4MYEA 4CC6A 4A7KA 4AVAA 1Z7S1 3DV8A 1Z5VA 1XE7A 3B01A 2W9XA 2LTNA 4N43A 1V6KA 2R072 2DBIA 3CHXA 3KT7A 2KG7B 2DVGA 4MT8A 3HB3B 2P06A 4I0AA 2UU9O 5JVDB 4XMIA 1VBC1 1JPXA 1CPMA 2H6CA 3VN4A 1NS1A 3KS7A 5DG1A 2Q8DA 3MLJA 1S0JA 5HI0A 4P9OA 4DRRA 5IVEA 1L7LA 3CPWU 4G9SB 4QM8A 2Y6LA 1DGWX 1XNDA 2KA3A 1NKDA 1HJGA 3QLQA 2YROA 3ABKC 1D4VB 1TUBA 2VQTA 5DZFA 3WHUA 1KKDA 3G6EV 1R082 2VGDA 2OCCB 4CBCA 3E6BA 4JDMA 2YDEA 3USUB 4AQSA 1MVEA 2VL4A 3CJXA 1DHKB 3BCCH 4QPIC 2QTSA 1OUXA 3WUDA 4EZ4A 4UBHA 3LFMA 1FT9A 1WMFA 3VBFC 3OUHA 1S2BA 5T5JA 5A9GA 3FHQA 3VQWA 4C91A 2YEVB 2JEUA 4FZ0A 4KUMA 5AC93 3B09A 1TA8A 3UESA 3JD71 3NKGA 5KAIZ 1GQGA 3UCSC 4XUNA 4XBNA 2GC2A 3GWKC 2UXDO 1BS3A 5IFPA 4ES8A 1A32A 1C3HA 1I7FA 4JI4B 4LF9B 4YFZA 4PDWB 1B3QA 4ZHNA 5FR3A 3MUZ1 5DN6G 1NY71 5IWFA 3E8HA 5BR8B 4NXNB 1T5EA 4MVZA 3OB8A 3S3XA 3FD9A 4MX3A 5I8TA 2GC1A 5CN0A 4LF8B 5HV0A 5LRSA 3WW1A 3B7MA 4CH5A 1NTZH 4XF0A 4GMP1 5L3CA 1I5ZA 5FYBA 5EJ1B 2QEXV 2VBDA 3M7AA 1NLQA 5FPAA 1PMIA 5A80A 5L36A 1SHWB 3PUSA 4BM8A 4O4HB 2NLRA 2BGPA 2DVAA 3VQXA 3K59A 5IVYA 1LAJA 1GKBA 1KJRA 1EYBA 2IJHA 4QX7A 3D6EA 4AILC 2TEPA 5BNNA 3CC7V 4AI9A 2C9AA 3OG2A 4PIZA 3J7AU 1BBT2 1UU6A 2VM9A 1D4M2 2QM4A 4FLYA 1VALA 4LNUB 3MDSA 2NYYA 5I8SA 4YXWG 3T4HB 3K08A 2VU9A 4HKWA 4X62B 2GAUA 2IBZH 1GOFA 2RS11 3H8RA 1C57A 4DFSA 1N0JA 4Q4W3 3ZIAG 1W59A 5FOJB 2YHJA 3SPCA 4CUAA 2VW1A 1SBEA 1NT0A 1RB8G 3ZCCA 2RDRA 4DV6O 2FZ2A 3T08A 1PNKA 1OCOC 5AFBA 2BOCC 3VBSA 4KU7A 1FX5A 5CVRA 5DM6V 1FMD2 1CJDA 1RUH1 1XNRB 2Q6AA 3LDDA 2GZWA 2JDIG 3IJ4A 4RHV3 1K9MW 4NWVA 3OR7C 1HDKA 1XQ8A 2FD8A 4AAPA 1VF6A 1XNQO 2QE7G 2ZIOA 5H2FZ 1QIQA 3JAKA 5FUPA 5C3OA 3SXWA 1Q8VA 2E3CA 4IE6A 3OD4A 5J09A 1PO12 5FYSA 1UIKA 2DURA 2H0BA 2ADQB 4O4IA 5KXDA 4BQ2A 1WNSA 2K0GA 5FNVA 1GU3A 5ABJC 2OT7A 2ZKLA 5LA2A 2ZM6B 4P14A 3VZOA 2ZGQA 3OGRA 4WZCA 1WPBA 3Q4HB 3N4MA 4FP2A 4PBOA 1LNSA 1Q5OA 3F2ZA 3V56A 1IPKA 2VZVA 4MHUA 3AL5A 2FHRA 2BOBC 2DVDA 5FPUA 2F66C 4UCOA 2XLAA 1ZBA2 4S2FA 1OHFA 2FMYA 2ATKC 2X05A 3ZMZA 2WS92 2B9ZA 1REDA 1SLLA 4UCTA 3RJ2X 4NPRA 2LFRA 2XH6A 2RS33 4C7UA 4BLJA 2E63A 4MHRA 4OZOA 3SEPA 1WA6X 4JI8O 2AEZA 5IHRA 5J7MA 1GICA 3OEHG 2VBPA 3VQYA 4K8FA 3IT8A 2D97A 5FZBA 3JD3A 3SDLA 4FPLA 2DE0X 3KF3A 2GSYA 1H2NA 3BAAA 5JUVA 2QQJA 1NJIW 3B00A 1VMFA 3QG5A 2BPA2 5J2UB 1TVGA 2YUEA 5FY7A 3K75B 2RM21 4CCOA 1AI4A 2GMMA 3OF1A 2ZKOA 5KXEA 2D3SA 5FZ6A 3OT7A 4BMBA 2QQKA 1RHI1 1JZ3A 1N8RW 3ALQA 1WB8A 3OEBA 4QXHA 4LC1A 1ASJ1 1COV2 3WNOA 2IXIA 1VBB1 4DR5B 4QHOA 1IS4A 4YZ2A 5CZKA 5JJJB 1UMZA 1W6NB 3MD0A 4LITA 2ZTNA 5H6QA 2QQIA 2Y69B 4XXPA 3HNYM 1KEXA 3SISA 4X64O 2HHHO 2G9ZA 1IKPA 4NHLA 1Q90D 4A41A 1CZVA 5FZOA 4HAMA 4RS5C 4FFIA 1YQ5A 1R092 2KR2A 3HAGA 1LHWA 1RVF1 1YCIA 2Q68A 1US2A 2R9RB 1F23A 2ARXA 3ETQA 1VE0A 4R50A 4FFBA 5FZEA 4E4ZA 3NMBA 3UKMA 2ZT9B 1XC6A 5J48A 5JMCA 1WAZA 3AG2C 5K0UA 5CA1A 3VBHB 5FZCA 4XQ4A 1SZBA 5LA6A 2RS51 2BDRA 4QMAA 4V1PA 3B3QE 4CZSA 1SFPA 1PL0A 5IATA 4XXAA 1PIV3 2ZGUA 4AEDB 2JE8A 5FIXA 1RC6A 1QMJA 3ZRVA 4PELA 1MZ5A 1GFF2 3JARA 1OPMA 1IDSA 1DF5A 2GN7A 4H7MA 2E7TA 1RPOA 5HCHA 2V09A 2Z69A 1F2NA 3N9LA 4K0KB 1A78A 5APAA 2XVLA 3WG1A 4P2ZA 4UW3A 3D3IA 2A9HA 3WFVA 4GX2A 3ZHTA 2ZDIA 3O5SA 3SKJE 4CH6A 5DAVA 1RUJ3 1F51A 2A3WA 2XHKA 4Y5SA 2NLJC 2QDOA 4MS2A 1UZ0A 4LWSA 2KXLA 2YZ4A 4LJHA 5GLVA 1ZRRA 1BSMA 2B5HA 2HEYF 5EIBC 1Q8OA 2X6CA 1M5IA 4X1YB 2YGLA 1R1A3 4ARYA 4C1XA 4Y22A 4UFZA 4YHHO 3SPGA 2B1IA 1ND3B 3M3IA 2W3JA 1W03A 1VBD3 2IXCA 3D4KA 1WLWA 5FP4A 2XDVA 1WA8B 3RJRA 1OOPB 3VKFC 1QHDA 4K35A 2B45X 4IV3A 5LY2A 4D7SA 2R043 4IGGA 4OHVA 5H9QA 4FTEA 2VZ3A 3T4ZA 2RE9A 4UCRA 2EIMB 3TN91 1PP9H 1JXNA 3HKCB 2XPJA 4PIYA 4TTGA 3RW0A 4F6EA 1K42A 1JVMA 4RSUA 4BISA 4JI1O 3MIEA 1C8M3 5DDJ3 4LKEA 4AYUA 2D3PA 5IJ9A 1GWKA 4LCUC 4RN5A 1SLTA 4XCBA 2J1EA 4AK3A 1PO23 2DYSC 1MZEA 3CJIC 1Q6UA 2VNRA 4COUA 4AFDA 1PNMA 3E6CC 5CBHA 1MS4A 5LHIA 1MS0A 3RYIA 3ETEA 4JZGA 4MXWB 1CJPA 2C6SA 5BMVA 4LP8A 1M93A 1SQFA 2CDOA 2QKDA 3JQXA 5FZ3A 2W6JG 1GQPA 2YIBD 1UY4A 5F37A 1CAVB 2UURA 3C7OA 3VD7A 3ZSMA 1PGL2 5JVVA 4IV1B 2WO1A 2L35A 3JD0A 4LOTA 4Q0QA 3MIDA 5ACA1 3AG1C 3NAPC 2OVUA 4INDA 2VQEO 1VRH3 1BL8A 2UU9B 1U12A 1AL23 1GKFA 1DQ6A 1YXWA 2VTXA 4B3RO 2YPJA 2ZMNA 3AG7A 2EXJA 2WL1A 4GWJA 1UWWA 3KLSA 4CDQB 1H30A 2ARAA 4RQPC 1FXKC 2I45A 4YGCA 1H1MA 3H1YA 5H5NA 5BNPA 2JDZA 2PY5A 1ZZ9A 2VNVA 4PDLA 4MOAA 5IY5C 3OGJA 5F5IA 4AVTA 4UW5A 3SH4A 1LTEA 4BH9A 2WAOA 3E86A 1DU3D 4C0BA 2HWF1 1PVXA 1HQNA 3GZTB 5A1AA 1LHUA 1PMJX 1JHJA 2QWNB 4TT3G 1FYJA 2X5IA 1OV9A 4HANA 4MV2A 4FTBA 3WLUA 2XHBA 3MPPG 5A33B 1V70A 3ZSLA 1MS5A 3VB9A 2HWE1 1KD1W 5IVVA 2QDNA 2PAMA 3CC4V 4DOUA 2UXDB 5IVCA 2W87A 3OMAB 2XXZA 1FAFA 4KWKA 5KC6A 2EIDA 2YBSA 1N1YA 2CNAA 3M3CA 5LP6B 4HVOA 1KP2A 5I8YA 2ZACA 4DO0A 5FY8A 2DYRB 4D6RA 5A2QN 3ZN6B 3SITA 2HR3A 2EXHA 4Q8KA 1W06A 3HPNA 4BWOA 1MG1A 5FO9B 4JGYB 3KT1A 4XETA 2AEYA 4EE2A 4S2GA 4L0PA 2ZHKA 4H2AA 1I94B 2AZ5A 3IAQA 3E6DA 3ETDA 2ZMLA 2VY0A 1OLQA 2VZSA 4UF0B 2HFEC 2EVXA 1UO9A 2QCSB 5IYBO 3SKVA 1YSCA 3VD5A 1QWRA 1ODNA 5KHHA 1KECA 4O2AB 3T09A 2FCTA 2AXTZ 3O1RA 4I4TB 1HV0A 4JGZC 2F4LA 1H2GA 3MHZA 1CQ9A 4NAMA 3JZVA 3T4VA 2WN3A 5GONA 3N36A 4GALA 4A7ZA 1S0BA 5K8SA 2VCCA 1G4YB 5CIRA 1PM4A 2OIGA 1QGLA 4J41A 1VBA1 5C4WA 1CGPA 4MGKE 2HWB1 4M3CE 3PUIA 2GC0A 3B8NA 5JCOA 1W3VA 5KX5B 4BQ3A 3TXSA 1BMFG 1MVQA 4IERA 4V2VA 3E1F1 4I0BA 1UU5A 3IDCB 4Y5TA 4JDNA 1V54C 2ZNJA 1ONAA 4AE2A 1LR1A 1H2SB 2Q5TA 2HLDG 1VRBA 3UYJA 5F7UA 4D6QA 5DAPA 4IT5A 3JAWB 2UUCO 5BY5A 3RI8A 4GB32 4GWMA 2CTQA 3SYPA 3ZHVA 5FPZA 4K7JA 1QLEC 3EVKA 4LK6A 2OW4A 5FFOC 1QVGU 2VMHA 4C90A 4TLFA 4X20B 4G2KA 2WR9A 1KDKA 3OMIB 4FPEA 3WG7C 3X2QB 1AR93 1JQ0A 3TJTA 1GBGA 3OEEG 5CKNA 1CIYA 1YFUA 3E8GA 2UXCB 5FCCA 1RMU1 4W8JA 4NROA 4PA3A 1RUNA 2R0FA 3T1MA 3FJSA 1P4RA 2ZR3A 3WF2A 2DWDC 3I2HA 1RUI1 3JCUZ 3V0BA 4QGPA 2KKWA 1OC1A 1IXBA 4LEJA 5CKQA 5FJHA 2PHXA 4KGGA 4QDQA 4LLFA 5LXTA 4AQTA 2KSDA 1Y9GA 5LYJA 4J1XA 1VAVA 4AHXA 4QJFB 4TOIA 4ZI7B 1AI7A 1S72V 3S6PA 4F6RA 3N2GB 1AF9A 2PHRA 2GUZA 4FLVA 4CPBA 3ZN4A 1KXGA 2YFUA 1RUD2 5CKMA 3S5AA 3JBG1 1IHMA 4JTDB 2Y0PA 3WT3A 2CAZC 2ERFA 1Q3EA 1MS3A 5J96B 1SBDA 1PKXA 2RHPA 3ZIXA 2DVBA 3CO2A 4PA4A 1YHFA 4BQ4A 2DWRA 4P02B 3ZX7A 3AP9A 1F4AA 3ZXGA 1EY2A 4PA6A 4H0LB 1Y3TA 4QU1A 3ZXDA 1O8SA 1FXHA 3DN7A 5I93A 1P7BA 3ZYRA 1W2TA 3K0DA 1B35A 3QH7A 2OT5A 3ABKB 3ZM8A 2YIDA 1VBB2 5FXWA 1NG0A 5F5QA 4KFMA 3H1JH 2QGNA 3N9PA 4AHZA 2CH7B 4NMIA 4DV4O 2YV8A 2GSMB 1C5HA 4GWIA 1XRUA 1N33O 2ZDIC 2F43G 1UX7A 4AGGA 3BKZA 4IEVA 3PU3A 3N9NA 4FVMA 3ZSEA 5FMDA
chains in the Genus database with same CATH topology
1W2UA 2PAEA 1U5ZA 2OUJA 4MGIE 3VHNA 2XKPA 4A3XA 4FAGA 1G9FA 4AGRA 3VUOA 2IWGB 1BQPA 2PLV1 4JTOA 1AYN3 1RUE1 4QPIB 4SLIA 5AVAA 4E4SA 3VLBB 3ZMOA 1CAUA 1VRH1 5F6KA 4IEQA 1LJ7A 1ND3A 5L19A 3WZ1A 5CFDC 3OBRA 4B3NA 3LZZA 3VBFB 1YO8A 3AZVA 1AL21 1CIWA 2Q0AA 5JOXA 1KS5A 3JQWA 4QX5A 1FAYA 1W6OB 2D3RA 3ES4A 3VBUB 1VZ5A 1GZWA 1BMV2 2WNUB 1HW5A 4HL0A 1N1SA 1CVNA 4QQOA 1EPWA 3B5LB 3FMGA 4OVEA 1B09A 4ZU7A 4JV4A 3BTAA 2A6WA 2ZGPA 4AEMA 1Q8QA 4XBQA 3CU7A 1UIJA 2WA4A 4GXLA 3OCPA 1LHVA 3B9CA 1ND3C 4YRDA 1LHNA 1KITA 3VBUA 2P37A 1GVGA 2WNUA 3HT1A 2PN5A 1EV11 1DQ4A 4ATFA 4FAHA 1CPNA 2I2SA 1OOPC 4IEXA 3RMXA 4B29A 5GZEA 2A6ZA 4EN7B 2ZGNA 3I8TA 4WVMA 4XILA 5LEJA 1QH6A 1EAH2 3A0KA 4P9GA 4DB5A 3OD0A 5JSRA 1AR72 2DVFA 3S7IA 4BE3A 1NCQB 4OHXA 1ZZCA 3H3UA 1ALYA 2XKOA 1X7NA 5FLHA 5IK8A 1H8VA 3NKTA 1D0HA 4N53C 4Q4W1 1EAH3 4NVPA 1C8NA 3WCRA 1AR73 1PM7A 1Z7S2 4DY3A 5F1RA 2FBEA 3FUOA 4BA6A 4PJYA 2XLFA 4K9SA 4JAAA 4W6XA 4Y4YA 1NCRA 1SEFA 1LGBA 4X6QB 4AQ6A 3LA2A 2ZMKA 5LK7B 1KQRA 3KZ4C 4X8PA 1CN1A 2WBQA 1Z7S3 5E88A 2XG3A 1M06G 4ASMB 2P3KA 3AXEA 1RJ7A 4Q0UA 2NN8A 3AKQA 1MEC2 4QGMA 2CL2A 1HRV2 1VBC2 2NP0A 3D5OA 1TEIA 2VPVA 4G3YC 1LGCA 1H0BA 4F7ZA 5FLIA 3FHIB 4E2GA 4MXWA 4RHV1 1VP6A 4FXGB 4DINB 1NCRC 4M2GA 1MEC3 1FMD1 1HRV3 1OS7A 1HKDA 1VBC3 3AMHA 4ZU4A 5GJ6A 4OI0A 2AR6A 1PVC1 5E89A 3IM0A 5JR7B 2YYOA 1KJLA 5H9SA 1CAVA 1UZZA 1SCRA 2ZKNA 3WDVA 1RIRA 4AW7A 2W52A 1VBE2 1FPN3 4WM8B 3B02A 3ROUA 4AI1A 1WW4A 3H9AA 4IV1A 4ZU5A 4NHKA 3WQ1A 3TWIA 4L8QA 3VBRC 1ZYBA 3PVBB 4YGEA 3UL2A 4CP2A 1RJ8A 1VZ4A 4XTMA 1T6GC 3U0ZA 1VBE3 1MQTA 1OTJA 4J5IA 1JOJA 3DKWA 4IQPA 2ZBJA 4BCUA 1H1IA 1KD7A 3RG0A 3DGTA 2HWC1 2OZ6A 3KSCA 1BJQA 3MIBA 5BNNB 5T5PA 3MW2A 3J8F1 2WNVB 1SACA 4IV1C 4E2QA 1TME2 3AMNA 2ZX3A 1YFWA 2D6PA 1WMEA 4F8AA 3K48A 1RTVA 2NMOA 1MQTC 3R4SA 1QDCA 4TZDA 4CDQA 1O5UA 2JG9C 1TME3 4H7LA 4JVAA 3GBGA 2ZGMA 4LO6B 1QJU2 4OI1A 3QCWA 4DMIA 2VULA 3PJYA 2WNVA 5FO7B 1WD4A 1AVBA 1UX6A 1GANA 1L3JA 1G8WA 2JX9A 2MEV2 2W68A 3UKNA 4CDUA 1QNYA 1GNHA 2VNOA 4AQ2A 1QY4A 1RITA 3I54A 1LOFA 3JD72 1LU2A 1QJU3 4MSVA 4COWA 1W6MA 1RGSA 3BCWA 5BNPC 2CGNA 4GULA 3KCXA 2R062 1SLBA 4M25A 1BBT3 1MZ6A 2MEV3 1QQP1 1PGSA 4QQPA 4WBBA 3R1JA 2EF6A 4DZGA 3JD73 2QZ3A 2SLIA 2PHDA 2WSVA 4AVCA 2R063 1QXPA 3WW4A 4FBFA 1CR7A 4Q0PA 4IEWA 4IEPA 1N47A 5JOWA 1ULEA 4CDUC 2XJUA 3OTFA 4XJUA 1ULFA 4HSJA 1IS3A