4Z1VA

Structure of factor inhibiting hif (fih) in complex with fe, no, and nog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
341
structure length
341
Chain Sequence
VASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Promotes Productive Gas Binding in the alpha-Ketoglutarate-Dependent Oxygenase FIH.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 108
structure length 341
sequence length 341
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 4z1vA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4z1vA01
2ILMA 2XUMA 3D8CA 2YC0A 4B7KA 4NR1A 1H2LA 1H2MA 5JWPA 1MZEA 2WA3A 3P3PA 1YCIA 4Z2WA 4JAAA 4BIOA 1IZ3A 4QU2A 1H2KA 3OD4A 1MZFA 2W0XA 2CGOA 2Y0IA 1H2NA 2YDEA 4B7EA 2WA4A 4AI8A 4Z1VA 3KCYA 3P3NA 2CGNA 3KCXA
chains in the Genus database with same CATH superfamily
4CP9A 3HMYA 1BZKA 3ZKYA 3EB7A 2WFPA 2W1UA 4OGQB 3ZMNA 1ASJ1 1NTMH 3OD4A 3GYDA 1ZRIA 4S2DA 1HRI2 4DK1A 1YITV 2RR12 3UGHA 1AYM2 2CSGA 3SJAC 4BW5A 3ZSMA 3K4ZA 3WG3A 3KGLA 4UF0A 3CQOA 1EPZA 2HHHB 2DW4A 3Q8EA 5C93A 1E5IA 5IE9A 3PL0A 3ZSLA 4QKDA 3A23A 4WVMB 4CH4A 4QX1A 2WABA 3POIA 3ZHQA 1CZTA 4KGQA 5L7OA 3DXRB 3LPFA 4MHUA 1CGPA 1V6OA 3AX4A 3ZIXA 1HV1A 1W04A 4D8MA 3CKHA 2OQ6A 5L3BA 1FOD3 2ZE6A 3E2EA 4LO7A 4MVMA 1NUKA 4E8DA 2WR9A 4MVQA 3I2IA 2WRAA 2C1FA 2ZGUA 1WBLA 2ZEZA 3B77A 3WDTA 2HWE3 1KS5A 3QH7A 2SBAA 3UM7A 4PD4F 2KM2A 5K1PA 2XXZA 4QQHA 1PL0A 5B4NA 2R70A 4RUFA 1XUQA 3MGUA 4XCBA 3WNXA 1JUHA 1WUVA 1AI6A 2EVXA 1OCCC 3ZM8A 1KU9A 5DQ0A 1BE3H 1FV3A 3BFRA 2OYZA 4BHPA 3AKQA 3O1MA 2QQOA 1TUEB 4R4ZA 3GZEA 2V72A 4FPFA 4O4LA 4HVQA 4BR6A 1LU2A 4IHJB 3P3PA 4JRLA 1DYKA 5FZMA 3WNOA 3OOXA 5FK8A 5FZ7A 3WINE 4UCVA 5IWAO 3K79A 4FTBA 1MABG 1NCRA 4I55B 3SPGA 2AHZA 1U96A 2OZ6A 2R72A 5FPOA 4UXNA 5FY0A 1ACCA 3DKWA 1TMF1 4YARA 4JI8B 3RT3C 4BOWA 3M8LA 3DYPA 3HKBB 2KR2A 1H1IA 3V56A 3CCMV 3AG1C 4LWSB 4XPVA 5E89A 4OHYA 3HBZA 1QEXA 2R041 1AYN1 2JE9A 3TRSB 4A5UB 5C70A 2D6LX 3GNEA 2VZ3A 1OOPC 1LUVA 3H0OA 4F3JA 2W91A 2D3OW 4WM8A 5JIAA 2XMLA 3FBYA 2ZGOA 1I7FA 5IVJA 2K46A 3AZYA 2RDCA 1YLLA 5GLZA 1DHKB 3STZC 2ZABA 2XHNA 2IWGB 2JEXA 3ILRA 3M3IA 1RUI2 2DUOA 1IBKO 3UESA 3IAQA 5CMUA 4JZGA 4RS5C 4JTNA 2SLIA 2IXLA 1L3JA 1IS5A 3IMMA 2FL4A 3LAGA 4ARXA 2JDPA 3PURA 4OQ9A 4L8JA 5FOBB 4Z2AA 4ZPIA 2Q30A 2BQPA 4XIKA 3RZGA 3HQUA 2OZJA 5FYSA 2CU5A 2WT2A 3RYHB 1AR81 5LHIA 3K3OA 4Y5SA 4BQ1A 3H1KH 3P30A 4V1PA 2ES3A 5BXZA 1S77D 4YY3O 3MHSC 2JDNA 4JI4O 5CZKA 3O1PA 3AK2A 1FPOA 2EX3A 4S2HA 2B39A 4KWJA 1Y7BA 2WFF3 3CS5A 4XAEA 3CRAA 2P6JA 5E1AC 1YTFD 3SJBC 1XEQA 3AXDA 3LDEA 1R1A1 1VBA2 4JI2B 2A0LA 4FXKB 3D3QA 4BXFA 4PA4A 3W5NA 2HWB2 2ZKNA 3OPTA 3HR9A 1AILA 4QPIC 2GBOA 2QQVA 3S0MA 4FM2A 3QNEA 3WG4A 1VMHA 4TLGA 4ASUG 4X1IA 2ZZJA 3N35A 5KAIZ 1YI2V 4K8RB 2HWD2 3WNPA 5JJJB 2JDYA 1UOBA 1GQGA 3L71H 2CAVA 5FZ3A 3MHZA 1L8DA 5BNOB 1H9WA 4XAAA 3THOA 2K9PA 1AVMA 1FOD1 3SYOA 3IWZA 5IUQA 5F5QA 1R082 4YHHO 1X59A 3H1MA 4TT3G 2CGOA 4FSJA 4COZA 2JG8A 4Y5TA 2FD8A 3K9SA 4EN6B 5IYCO 5AC92 3IT8A 1MEC1 4B3MB 3VL8A 1S5JA 2JDZA 3SEEA 3R65A 4RR3C 4QQOA 5IVVA 1FXKC 1WMFA 1YQ8A 1AJNA 2ZGLA 2WN3A 1JODA 2GTSA 1S0DA 3F5WC 1LHVA 1VLNA 2LP7A 4RHV1 2F95B 1AR91 3ABUA 1BCXA 1KFXL 5F3CA 3WDVA 1LJ7A 4XBNA 2WPDG 5H6QA 4HT1T 3TEXA 5LBQA 3ZHVA 5FYIA 5ANNA 4MO3M 1YVWA 4YWAA 4B3RB 2VY0A 5BNNB 2IXKA 2JK5C 2ZXWB 1GBGA 3GVMA 4UXAA 2VQFB 3B5LB 4CCJA 4GKJO 2EILB 4TOIA 3G67A 1WB7A 4U3JB 3MIDA 3RYFB 1DGRA 1QJZA 1AR4A 2ZIMA 5I8TA 5JR2A 2Y6JA 5LBFA 1OLRA 1W2NA 1AL23 4D69A 4JHTA 2A6ZA 4DR1B 1RGSA 4N8MA 1ENRA 2WZ8A 2QQPA 1CPYA 1Q3EA 1NZ6A 4BAYA 1ZBA3 3ASNC 3ZXAC 3LDKA 2AEYA 4D0QA 4JAAA 4MVRA 1W2OA 1MZFA 3CCRV 4A2UA 3I3DA 3JBG3 1S0JA 1EUUA 4XQ4A 1O9HA 2LFSA 2A6VA 1VQMV 4NJ4A 4KBZA 2BU9A 4LWSA 3FWEA 3M8AA 2GNMA 4F83A 2A71A 4BLJA 5ACA3 2FCUA 4UWDA 1OC1A 1R1A3 4DXRA 4FT8A 2GC3A 4YLZA 3BCWA 4NHKA 1IS6A 1XILA 3EHKA 5TSWA 2QKCA 2ZE7A 1LHNA 4JASA 4IL6Z 1XQNA 2JGDA 2UXDO 5CNAA 3ZYPA 3D0JA 3MLJA 1JN2P 3LEKA 1D5NA 3ABTA 2ZNIA 1W9TA 4DRXB 2BW8A 3SCGA 4NIGA 3RYPA 1SEFA 3DKQA 2JDMA 1ULEA 4UCTA 2W0XA 2WS93 1RUE2 1DF0A 1RM1C 4Q0VA 4LF6B 5LRRA 3S3WA 1GU3A 1RUD2 1UIJA 4UCSA 5JDBA 2P34A 1Q86W 1PGL2 2LFRA 5F3GA 4IYHA 3WNNA 4U36A 4O2AB 4LH7A 2CH7B 1TZOA 3KV9A 5FDBA 2HEPA 1PMHX 2O1QA 4NN0A 1W2TA 1NJIW 1R64A 4FTSA 1VF6A 2OUJA 1X9PA 1GWLA 1IOAA 1DLBA 1BYHA 2HWF3 4AI8A 1SETA 4B4PA 2F43G 4I9QA 1JYIA 3ZKUA 4ASKA 3VQWA 5IYZB 1JBCA 2YICA 1QBZA 4X8NA 4AHCA 2W95A 3JD72 4K7JA 3HD8B 1FKAO 4K0KB 3N9QA 3IDAA 3FFQA 3ZYHA 4JYAB 1UOGA 2R30A 4DV3B 1UMHA 4Q4W3 3IZOA 4JTAB 4E4HA 5AG2A 2IH3C 2GTAA 4XDLA 2AGAA 5L3EA 1J1LA 4E4DX 1K92A 2GUZB 2WFF2 3A0NA 4RQFA 2DJVA 4CBCA 3T0BA 2R6QA 1RYYA 1J3QA 2VOXA 4AVSA 2WQ8A 1DBNA 3T1YB 5F8PA 2X5IC 5APAA 5EIYB 2JG8C 4YVWA 4Y1YA 5FY1A 4JDNA 1QJY1 3VB9A 3IAPA 1V55C 5CFCC 5IK8A 1ODMA 4RGKA 2GZWA 3J8F3 4JKLA 2Q1FA 3I59A 5DUXA 3CRQA 4LF5O 3VKMA 2QBXA 1IPJA 5D2AA 3FBMA 3X2QB 2PLV2 3CYOA 1OQ1A 3ZYJB 2FTKA 4YW4A 1CWPA 1GO3F 2W5FA 3OJBA 2G9ZA 1XE0A 4RQPC 1REEA 4LF4O 4ZS2A 2N05A 1LHUA 4KI5M 1B6QA 1WKYA 1R091 2ZGTA 4BU2A 4MXVA 3CDZB 3WOGA 3ABLC 3AK0A 4LCUC 2VC9A 3DEMA 4PBPA 4OI0A 1O4ZA 4ABMA 4H44B 4NRQA 1E1RG 5EJZB 5T5PA 2DDUA 2PI5A 4O4IA 2E7AA 2LW1A 1VB4A 4AVAA 3VZMA 4AEDA 1KS4A 1P7BA 1JZ3A 3CMEV 3T2MA 5HV4A 4FO9A 1FYUA 5A1LA 3JD71 3FX3A 4OHVA 3IIIA 1GP6A 1CN1A 4OUMA 4D6TH 4LORA 2YUAA 3WB0A 4PDWC 2DVGA 3EYPA 1OCRB 3OEAA 4EN0A 2ZS6B 5IK7A 5CFCB 4NXNB 2I2SA 1UOJA 1I94B 5CB7A 4XMAA 3JALB 5FJHA 3U10A 3B9CA 2WLLB 1VR3A 4DOUA 3QBQA 4GD4A 4FPCA 4O4JB 4SLIA 4CDQC 5ABJC 4Q4X2 1DF4A 1ZBE3 3KT1A 3ZPOA 5CB4A 5LK7B 2NLRA 1Q43A 2DFCA 1IBMB 1J59A 3P3NA 3FB6C 4LHSA 4LUKA 4QDQA 3DUIA 4GXLA 3BTZA 2P37A 1ZSPA 1F23A 1E5RA 5FREA 3RYIB 3BPZA 5JCOA 3OEEG 4QKFA 1OXCA 5IT6A 5J7MA 2BGCA 1UU4A 1W0OA 2F66C 2VZSA 4HONA 1UYZA 3B40A 3CXHF 1FI2A 1M4WA 2XAGA 3VUOA 3KF5A 5JXGA 4L87A 1GKFA 2Y26A 4UW6A 3WLUA 2YY1A 3AP6A 4QHZA 2LW8A 4FPLA 3BTAA 3WG7B 2DF7A 4D7YA 4O7XA 3HKEA 2Q69A 4YPJA 3IIAA 1W6MA 4DR6O 4DUZB 1F8VA 4O2AA 1H9PA 1QJFA 4C1XA 2DQ0A 2EAAA 2OPKA 1HRV3 5T54A 4U3FH 4UBHA 4AVTA 1HRV1 5EZWA 4UFJA 4O61A 3VBFA 4CU6A 2WDBA 3JAKB 1V6KA 1SS3A 4NVPA 4BIUA 3I2HA 3LWCA 2IUWA 4XUNA 1PM7A 3H50A 1V54C 1IBLB 5FO9B 1QQP1 2HWE2 5CISA 4E2QA 2GN7A 5F32A 5IFTA 3ZFFC 3JXSA 4LBQA 1NQDA 3MUZ1 4Z2WA 1J84A 2XOKG 1WA4A 3SNMA 1W8WA 4X20A 5JPNB 4UVCA 1BEV1 3Q8BA 3H8OA 2PTMA 5F5AA 1L7LA 2JD9A 2C6SA 5A6YA 2ILMA 2VCBA 4LF7O 3MIBA 4E2LA 1RJ7A 1GMMA 4A3ZA 1WLWA 4F7ZA 4UFMA 4B3TO 1WCKA 4RQEA 1X8MA 4UCUA 1T5EA 1FNZA 1ULDA 3CCLV 1Z2GA 2XDVA 5F39A 4IV3B 2X05A 1DLCA 2JE7A 4J41A 2VR4A 3C3TA 1O59A 4KHPB 2P5OA 2IW5A 1OFSA 1B06A 2E31A 2V4VA 2QQLA 5EJ3A 2V4DA 1UFIA 2EIDA 4A7ZA 3HIFA 4U7NA 2IXIA 4NIHA 1W6QB 5FYMA 1CIWA 1RUG3 1GFF2 4QXHA 2OCCC 5AVAA 1N47A 4YRDA 4OPAA 2R7EB 5JI9A 1WNSA 4XHBA 2XH6A 3BA9A 3UKNA 4GH4A 4PJYA 3AG2B 1X36A 1WA8B 3OEBA 1JJ2U 3UKVA 1CQ9A 1SQ4A 1IPSA 1ZL8A 2YC2A 3OPZA 1DF5A 4CCLA 4PDWB 1U12A 4HPKA 1RVF1 3ABLB 1TUBA 1XE8A 2WLPA 4AWDA 3WP4A 1RUJ2 2CUGA 5IY5B 1PZ7A 2JG9C 4WFGA 4KUMA 4XJWA 5A3UA 1U5XA 4HNAB 4LTAA 2ZGKA 2XWBB 4FIPC 1NR7A 3THTA 1DG6A 1Q56A 5B1BC 1COV3 1EN6A 4AHZA 1OPOA 4LQRA 4G3YC 4A41A 3JAKA 2H3OA 1TNRA 5FMOS 1SQVH 2KG7A 4Z1MG 3QD6A 5IVEA 1CAWB 2WLIB 2Q73A 1QKQA 3K5MA 2BFUS 1XNDA 4I3GA 4CCEA 2VZOA 5CB4B 1SESA 1TQ5A 1V70A 4JYBA 4QXKA 2VOWA 3J80N 4I5SA 1GM7A 3RS6A 1KITA 4V2WA 2Y6FA 2RHPA 1MSDA 2DN9A 1HNXO 1JHJA 1ASJ2 2ZHMA 1I94O 2DBNA 4S2GA 1NT2B 2Y6LA 2IJJA 2ZMKA 4CEYA 3VBOA 1OZ0A 2UXXA 4MG2A 1ND2B 1WMEA 1AX0A 1D0GA 4R8HA 2UXCB 2GC0A 1JS9A 2BE3A 2ADPA 5FRAA 3CCQV 1NH2D 3WB1A 2IBZH 5EZYA 1W0PA 3THCA 4XETA 4EN8B 2P6CA 1XHXA 3SC7X 3N27A 3ZSKA 1UPSA 4XFGA 3OFNG 4AVBA 1BL8A 3A7QA 3MFCA 3ZXGA 4XFHA 4YG6A 1UCXA 5FPBA 3O0XA 3S57A 1XXNA 5DECA 2H6BA 4AFCA 4BA6A 2HBUA 2KKWA 1OH4A 1ENVA 1YXBA 3CC7V 2TUNA 5GZGA 2LALA 4JGZC 4IE6A 4M01A 3I2KA 1UYXA 1ZA4A 3E35A 1J58A 2R043 3W21A 3WD5A 4H7LA 1Y4WA 1HIXA 1PMJX 5E8AA 2QWNB 4TSVA 5DAWA 4RHV3 4J7KA 2C0ZA 4I3PA 4DY3A 2HR3A 2VULA 4TLFA 1QQP3 3JSLA 3KV4A 4JV5B 1MMMA 1Y74A 1SDDB 3ABMC 3T0AA 4XUPA 4UFKA 2A6YA 2ZR2A 4FQ4A 3LSEA 1DQ5A 4B1MA 2VG9A 4G9SB 1G86A 4QX2A 1BK0A 1FMD3 1XE7A 3G80A 4Q1PA 1UMZA 3RI8A 4ZOLA 1OURA 2YBKA 2Z5UA 4BK4A 2J1RA 3TK1A 4NWVA 2RDSA 4FLVA 2ZGSA 4N23A 2RG4A 4LF8B 2X0LA 2D5HA 1ZWIC 4DV3O 4YM1A 2EIEA 1NG0A 4JHZA 2O8QA 2VNRA 4LHKA 4QX7A 3CJIB 3J81N 3ETPA 5FZKA 4IEXA 3CJIC 3JU9A 4FZ0A 4LXLA 1SLIA 2P17A 1W06A 2BRTA 4LITA 5FKBA 3TEZA 1TGOA 1W6QA 3ZN4A 3KHBA 2XJSA 4HFSA 3PNAA 3H9AA 2CAZC 4B29A 1NCRC 1XREA 1K5MA 2XJTA 1GR3A 2XL7A 1OA3A 1J5EO 3RW0A 5JXHA 1MQTB 1HRI1 4FP2A 5JZGB 3APOA 4YW7A 4BK5A 3H8UA 1LEMA 2YROA 4OMCA 3JCIA 3ASIA 2UU9O 1NA1A 1SDWA 2AEZA 1CPNA 2VW2A 1ZX5A 2DWDC 1RB8G 1BQ0A 3SPJA 4JI3B 1SFYA 3MD0A 1RUNA 2YPDA 4D6RA 4O2BB 3QH6A 5BNPC 3HKBA 5GTHZ 4TUYB 5BYNA 4CH6A 2LO1A 2GSYA 4DB5A 5BNQA 1K3IA 4DS0A 4CCCA 1POQA 3ZYGA 2JS5A 4OI1A 3VKNA 4ZY9A 2FDFA 4GKKB 3AL6A 4QX8A 4EZHA 4QD2A 3KMHA 1ND2C 4N53B 1N36B 2XR4A 1LR1A 2XHKA 1LCLA 5FZAA 2ENRA 4FOVA 2JEUA 1DU3D 2XGXA 3HAGA 3EHBB 2MEV2 4CCOA 2XASA 4R8CA 5A1FA 1CR7A 4OZOA 1W3VA 2BCCH 1S4CA 2ZHLA 1WGPA 3BABA 3ZXJA 4J1WA 4ARYA 3KB5A 1OLQA 3WF0A 1GAXA 4CEYB 1JOYA 4IHJA 4QB2A 5FPUA 3POBA 4QQLA 4QU2A 3CC2V 4M4RA 1GRJA 3VD4A 3B69A 4X6QB 1D2DA 4O4IB 2IJIA 2XG3A 1RUF1 1ORQC 5C8CB 3ZX6A 1DGRN 4Q8LA 1NCQB 5FLHA 2B9ZA 1SCRA 1NR1A 3SHRA 3FL7A 1VBB3 3L70H 3C90A 2EJ7A 5B1BB 2QWPB 1KYOF 3AVRA 1IURA 4AE2A 3B93A 4ZBMA 3KS7A 3AP4A 4E27A 1AXYA 1Z0HA 1J3RA 2MPFA 1YWKA 5FXVA 3RBZA 1MSWD 4YFZA 5FZDA 5J2UB 2GV9A 3MO4A 2X5IB 4ZI7B 4UW3A 1BSMA 4P2ZA 3JALA 2NNUA 1UMIA 1XDCA 1DYPA 2BGPA 3RVZA 5KMGB 3AG4B 5FL7G 2VW1A 1ZNPA 1PV0A 2W94A 3OM3B 3T09A 3KQ4B 1WLEA 1SBFA 4NHXA 4YG3A 4I02A 1SQPH 4JTOA 2VU9A 2JIZG 4AQ2A 2RQ6A 5EWSA 3SKVA 2ZKOA 2Y48A 2IXCA 4Q0PA 1XYNA 3ABMB 2LRPA 1XBFA 2WNUA 2UUAO 2F23A 2P3IA 2XAHA 2ZM6B 3O7OA 2MEV1 3UV9A 3APQA 2JS3A 3VDDC 2Q9LA 3DXUA 3NNMA 4P9XA 1L7RA 3VZKA 2R49A 1LODA 4LKSA 3T4ZA 1V6LA 3OMAB 2LTNA 4BQ4A 3ZVXA 1XSRA 3MI8A 5ITZA 1N33B 4UW4A 4N9HA 1S72V 4BISA 1GLHA 3ZYFA 4AL9A 1W2BU 2VTFA 3HOBA 1BBT3 2EJRA 4SBVA 5A1AA 2XJRA 5CA3A 1ST8A 1DFQA 1BXHA 3J9SA 1QQP2 1R6NA 4NTYA 3CCEV 3RYKA 3E8GA 3VBSA 3HT1A 2FHRA 4XJAA 2I07B 1YQCA 2LS6A 2YMZA 4OHWA 2W0FC 3VD3A 4E4ZA 3BI3A 4K3AA 4JI2O 4HLTA 5BR8B 4CXWA 4OQ8A 5BR8O 3ATGA 4QPWA 4PDWA 4HPKB 4W6YA 3E22B 1RSOB 2VZVA 3LIHA 5C4WC 4UVAA 1UNBA 5IK4A 4FM0A 1YNAA 3HNBM 2NZ9A 4GB33 2BTQB 4LR4A 3QOPA 2PXJA 2WZPP 4NAMA 1H8HG 3HPNA 3NV2A 2EA7A 2OKXA 2C4XA 3POWA 4LO5B 5A7QA 1GM8A 4LF9O 3CEIA 5J2TB 3SPCA 5LHHA 3JASA 3ETGA 2FCTA 3KD4A 3ZFEA 2WNVB 4OXSA 2BVBA 2F4VB 1RUI1 5FP7A 1YRZA 4P5HA 1H2KA 2Q1MA 2WO2A 1OHFA 3LE0A 5JAXA 4FFHA 4QXCA 2VBBA 4LBLA 2A1XA 2VZ1A 4BE3A 4LIVA 4H33A 3SISA 4OVEA 1FOD2 3LUTB 1SQBH 1H6XA 4HZFA 2QGNA 5B1AB 1OI6A 4DIQA 4DV1B 1NT0A 5J09A 3AK1A 3NJYA 1VIWB 5CA6A 4QMAA 3VDBA 4XJ9A 2E7QA 3LDRA 1CONA 2O8OA 3D3AA 3KZIZ 1U5IA 1CXZB 5EV7A 4Y26A 3TB0A 5FNVB 4DR3B 5L7OC 3D8CA 1MNGA 5L7OB 3UO2A 3DXRA 4XF4A 5JPMB 2W52A 1OD3A 4CC5A 3ZBHA 2E53A 4LFCB 5BUVA 1AROP 2E63A 3VZLA 3I3BA 4NKGB 2IM9A 3H3LA 2E7TA 1UF2C 3OGRA 1ZA7A 4HNAA 2JEMA 3OT7A 1AR73 1KQSU 4K40A 1S2BA 1VBD3 2JD4A 2FCVA 1YHFA 2HVJC 3WQBA 3D4KA 2P6HA 4CCDA 3CC4V 1AR63 5FP8A 2D98A 3E1F1 4R9AA 1YQ5A 1UJWB 2CNAA 2NMOA 2X5IA 1O8PA 4RWUA 4QX5A 3ZYIB 4FOYA 3O14A 5J1XA 2ET7A 1S1AA 2VO5A 1QMJA 3GZUC 3L9JT 2VCCA 3ZCCA 2WINB 2J1SA 4PDLA 5C9AA 3J7LA 1ND3C 1GQHA 1BMV2 4E9KA 2YIBD 2UYAA 3TN93 4GALA 2YXSA 1FD9A 2FKXA 1K5JA 3LCPA 5J96B 1N0NA 1WAZA 3ITQA 4ICGA 1GN4A 4DRXA 5FLJA 5D8AA 5E6HA 3IC7A 3WU2Z 2KA3A 2X29A 1GMGA 4ZU7A 5F5IA 3DYMA 4RR3A 1Q6UA 1OKQA 2XHBA 4LR3A 4CP0A 1AUYA 2JDHA 2I45A 4MW3A 1KKCA 1QVGU 1CD3G 1OSGA 2V5DA 5ITZB 3ZR6A 3DN7A 2A6WA 1RUJ3 1CP9A 4AQYB 1KBHA 4N7IA 5DMYA 5A3WA 5T52A 4JI1O 3SDLA 1IBKB 5DABA 1BLZA 2IH1C 1JPXA 4XYXA 1QU0A 3UJOA 4B4QA 1OCCB 4LFBB 5FAXA 2V7QG 2WKKA 2RDRA 2JGUA 4UW5A 2EZPA 1F5JA 4N43C 3LA2A 3T4HB 1HR0B 1AYM1 1LAJA 4XJUA 3OUIA 5I0DA 2UWCA 4YZ3A 2R16A 4K3UA 5C5UA 1BHAA 2WC2A 3NV4A 4BQYA 1NLSA 1ZM1A 2UUBO 3R6SA 4PELA 2UXBB 2D3RA 4FPHA 3VBHB 4ISQA 5FOJB 4DINB 1JZ8A 1FPN2 4AR2A 1PNGA 4NIDA 1LKNA 1YIJV 2D7FA 4RSUA 3DXTA 4JTDB 3H7YA 1VMGA 3OGJA 1FFTB 2HEWF 3BODA 4MLOA 3WNKA 3JCZA 1RUF3 4MH0E 4YGEA 3DC5A 1QJU3 3ZMZA 3CBNA 4XJZA 3TAYA 4DW0A 4DR4B 3NNJA 3JARA 3RSJA 5LGUA 2EXJA 1PX3A 1Q8PA 5JCTA 1UW8A 3Q9OA 4CDQB 4FBFA 2E32A 5FFOC 3F5TA 4MX3A 2GNDA 1UIKA 4HKWA 4FPKA 2WLJA 1N33O 1LB2A 1UYYA 3K57A 2KXLA 5SV8A 2BWCA 1JXNA 3MBWA 4B7KA 3UGFA 4M3CF 3UGGA 5IJ9B 1VQNV 2QQKA 2HEYF 3F95A 1NTZH 2ZMNA 4YYOA 1LNQA 4JI0O 4N53C 5CU1A 5C9AC 3BOWA 3GXUA 4JGSA 4WFAV 1DCSA 3C7EA 3JAWA 1L1FA 2LUWA 4PJ0Z 2ZD9A 3RWKX 1SA0A 1UXZA 4KU7A 4LNUA 1I3HA 2XNDG 4OPHA 1OD5A 2RMKB 1BVVA 4CP9B 1BGYH 4YJ3A 5H9SA 1QH7A 1KUQA 2ARBA 1LGCA 4AGRA 2HKXA 3I2OA 3FHIB 3ZLIA 3HQRA 1OBNA 5B1AC 4UUJC 5LYJA 1CZVA 2CGNA 1WWYA 2VCAA 2UY8A 5FZFA 2ADDA 4G2KA 3CX5F 2Q8EA 2QNKA 1MPXA 4QM9A 4RA0A 2IJHA 4QT6A 5FK7A 3MLLA 4XF9A 2L9LA 3AYAA 2YS8A 1M1KW 3PN1A 4PA7A 2AZ2A 1VMJA 1D7PM 3MYXA 2BVVA 2D6MA 2RE9A 4FLUA 2YFZA 3C7FA 4A45A 4AEMA 3I3MA 2QVSB 1IZ3A 2AYHA 1SLCA 3W7TA 1DZQA 2B46X 2YBSA 4XABA 4I0AA 1GK9A 4QGLA 2TNFA 3INAA 4JAUA 2VQEB 4IEOA 2JG9B 4AG4A 1RHI1 4P14A 1SHWB 1S2KA 1RUC2 4FAGA 1ND3B 2W6IG 1MZEA 2A3QA 3DGEA 5EFUA 1PIV3 2VECA 4JQTA 3K06A 2BBVA 2JDIG 3SYAA 2DUPA 4X89A 3EQEA 2XJVA 1PM4A 3RWNA 4LJHA 3JARB 5D21A 1JFFB 2XPJA 3DECA 2CHHA 3WF4A 4CDQA 5LA6A 5IAVA 5IAXA 2RNBA 4YIPA 3NJVA 3IB3A 4MW8A 5KHHA 1SG3A 4RUEA 2W2IA 4DR2B 4MHRA 5JQGA 2DCTA 1PO11 4J7ZA 4IDZA 1PNLA 2WZEA 2QTSA 2UXNA 2J7MA 2ADQB 2ID4A 5ISLA 2XWJB 2J1EA 2B5HA 4CC6A 1YEWA 2R071 4CEWB 1UY0A 2YB7A 1YFWA 3BU7A 2YIAA 4LKEA 2VMCA 1FT9A 2WA4A 2HWC3 1SF9A 3C3VA 5FQ0A 3CNAA 3OMIB 1M90W 2WIIB 5CBLA 1GN6A 2GDSA 3ETDA 1LESA 1I5PA 4W6WA 4DR2O 1MOFA 4ATEA 1OH3A 3O0VA 1VBA1 1Z7S3 1M93A 3LOIA 3ZO0B 3JUUA 2GP3A 1YUDA 5I93A 1ZTEA 3D36A 3HN1A 3N36A 3ZMOA 5GONA 1NLQA 1PO22 4J25A 2QZ3A 3CP1A 2OCCB 1JI6A 1LHOA 2GH8A 3VBSC 4FI9A 3KWVA 4X64O 1K33A 1COV2 4NHMA 1UZZA 2VNVA 1ODNA 2VXJA 4L0PA 1KRIA 3LSUA 1KEXA 3SXWA 2X6AA 5IJ0A 3B00A 4P00B 3ZIAG 1SPPB 4JTCB 5A9GA 4OX9B 2A7AA 3FD9A 1RUC1 4O4JA 5KA6A 2VVDA 3ALQA 4I0XA 2HVKC 1R1ZA 1DZTA 1F51A 1W2AX 1UX7A 3PTYA 4XF1A 1D2QA 2NYYA 1XNKA 5DDJ1 4HVRA 4FOWA 1N8RW 3QACA 3WHTA 1W0KG 5LK5A 5LBEA 3K03A 3O1UA 5IDJA 4PDVA 2CTQA 5JVVA 4CPBA 4YW5A 2VUDA 3ZRWB 2ODMA 1XNAA 1XU1A 1SQXH 4LO4B 2ZBJA 1UPGA 1KECA 4MGKE 2ZX2A 3GBWA 3ZSEA 4PLMA 3J8F2 2XBO1 5IWFA 1A8DA 1YQ2A 1QOSA 4LHLA 4CUCA 1HXS3 2PN5A 1PIV1 4O9GA 4WVWA 1HN0A 3DTUB 5FZOA 3O1VA 2NQYA 1P4RA 3LKJA 3UT0A 4GWNA 1M9NA 4DUZO 1YFXA 4I0BA 4GCZA 1RINA 5K0UC 1E1QG 3ZOIA 1ZVFA 5FYUA 1S0GA 1R092 3WP6A 1XNCA 3T4VA 4FMTA 4NXMB 3PVNA 1P7GA 2AXTZ 2VQ0A 2XONA 1SERA 4UCOA 2ZACA 2OIGA 3LF7A 4H7MA 3TNQA 3T1YO 5IHRA 1S2EA 2WBKA 1UZYA 1YF2A 2RCVA 5IVFA 4H55A 2Z0AA 1QXPA 3DCQA 5LHGA 2Q0OC 3MIFA 1CEZA 5EQUA 3TGUH 4Y3OA 1CAWA 5J9PC 4UOJA 3WX5A 3O12A 4RGAA 4N21A 2BUKA 5LA0A 4AVCA 1AL21 3E8BA 1FXZA 5IFPA 2OA2A 1GANA 4KNCA 1LOGA 3R0RA 3OUJA 3MPBA 3QTCA 4NMIA 1VMFA 2AW9A 2CDPA 1FMD2 2MW2B 1IXBA 5EC2C 1H2MA 3LSQA 4LOTA 4CYDA 1YO8A 1RUH1 1EUTA 4U2AA 3VKLA 3UL2A 4X1YA 2Q7GA 3FHQA 5LRSA 4FAHA 4UFLA 4CH3A 4FFFA 4XILA 2XBO2 3FHAA 1WD4A 4ZKTB 2B1IA 3WCSA 1QNWA 5I0UA 1CAVA 2P4VA 3BIWE 3OYWA 2EIMB 3U4SA 3AK3A 3K3NA 4QNHB 2EXHA 3ZS8C 2OYQA 3TETA 2VM9A 3NKTA 1AX2A 1N1SA 3CCSV 1NI8A 3X2QC 2VW0A 2WT0A 4Q29A 1FXHA 4OMDA 3T1HO 1JTZX 3TNPB 1VIBA 4COWA 5H9RA 1VBC2 4NWWA 4JKKA 3RJRA 4EFBA 2VQFO 1W0NA 4E4SA 3K5NA 4QPGA 1K3EA 3VQYA 1SZTA 4EWEA 4QDRA 4JGYC 1N3OA 2KD7A 1F7YA 3OGIB 2ZGQA 3SR2C 1JYNA 2ETEA 2RS32 1W9YA 2VWKA 5EJ1B 2B42B 3T2TA 3WNMA 1TVGA 2LJ2A 4FPEA 4P9JA 1VAMA 3ZXEA 3MDPA 5T55A 1I08A 4LULA 5DUUA 1NA1C 4CCKA 1Z5VA 4DRRA 2PHXA 3KCCA 3OTFA 2VPVA 2VAUA 4O2BA 2D6OX 2DVBA 2M6YA 4DXZA 2MK3A 2C26A 2WQ4A 4JDOA 2UWAA 4X1KB 4B1LA 1XYOA 4WZCA 5FWEA 2QCSB 1W9FA 2ZDIA 5FY8A 3NAPA 3BVCA 1GNHA 2R063 4JI6B 1YJ9V 4DXSA 1SQFA 4BDVB 2J1TA 5LCWL 2QQMA 2QDRA 2HLDG 2YFUA 5T50A 3MW4A 2CDYA 5A6ZA 3AP5A 1H0BA 1ULGA 1OV9A 1DGLA 4DV2B 4JI5O 4COYA 3ORJA 3ES4A 2B5UA 2ZHNA 4Q4Y3 4PIXA 4HAMA 4HN1A 4CS4A 1HNXB 5BNNA 1AR62 4YGDA 2F4PA 3SLIA 2VTXA 1MG1A 4I50B 4B3RO 4UB8Z 4EJRA 2B9UA 1OQDA 1J5EB 2Q8DA 3VZJA 3KKYA 1H30A 2A70A 3WR0A 5F3IA 2BNNA 4IEQA 4AHWA 1XNRO 2UUBB 3L73H 3E8FA 1UKRA 2JDKA 4CU8A 5LB6A 4IE5A 1Y9GA 3VZOA 5A32A 2VQEO 1QXRA 4X64B 4EN7B 4AI2A 2PHTA 3CLPA 5CBFA 4H37A 4UV8A 3UKMA 1AR1B 4YW3A 4KWLA 1RUD3 5GKAC 2W3JA 1M5IA 5T5JA 3ZIWA 4EB6A 1XJAA 1KD7A 3O1RA 4AAPA 2NR5A 2GHYA 5LBCA 1PVC2 2D44A 5JSRA 4Q4V1 1NVPD 4HBNA 4WM8C 3POEA 1D2SA 3NJXA 5JJNB 4GX0A 1RUI3 1ZZCA 4JC1A 1GZWA 1PGL1 1U5ZA 3C7GA 4OI4A 2QE7G 4AI3A 2RMU3 4QPGB 4AQYO 1VF5B 3LNNA 5KMGA 4LO8A 4QGNA 1Y9QA 4DV6O 2Q8VA 3A0BZ 4MOAA 3ILNA 5F7UA 4CUBA 3POYA 4MUVA 3K5LA 4LFAB 3N9NA 1RVF2 4A4AA 2VMIA 2ARHA 4MGIE 1D5AA 1ZAUA 1N1TA 1GUIA 2VOVA 1DZRA 3IM0A 4B7EA 5A3NA 1BK1A 2QEXV 1LOBA 2DYRC 2IU3A 3F7VC 4JZ2A 3E6BA 2KQXA 3O9OA 4TV8A 2PI4A 1OFNA 3QG5A 4J11A 2BTOA 1UYPA 3JBG1 1ZLZA 3TYJA 4L8QA 3T2PA 5DPNA 4LHNA 4ZXEA 5JCOC 4FPOB 4CEWC 2L35A 1HNWB 4R9DA 3H1IH 1QQCA 2WFF1 2BPA2 3K08A 5A3MA 2UURA 2R9RB 1XNRB 3EFFK 3P32A 2VRZA 2Y8KA 3D82A 1H4GA 4IETA 1QJU1 1AR71 2GP5A 2QDOA 1QF3A 3CCVV 2C24A 4N90A 1QJY2 3OG2A 4LFBO 2O14A 2NN8A 2UUCO 5D1IA 1X4TA 1O4YA 4TQDA 5LMUO 1FXKB 3ZXDA 4TWKA 1EZVH 2KG7B 2PLV3 5FO8B 4UB6Z 3J7AU 4K21A 4AQTA 1WCQA 1H2NA 2VUJA 3ON7A 3MZHA 1FPN1 3AFGA 2QQJA 5DAQA 2JJ1G 3T08A 5C33A 1M56B 2XBO3 4UT5A 2VMFA 2BJSA 1Y74B 1URFA 4CSWA 1DQ0A 1MVQA 2JICA 3A21A 1NH2B 1B3QA 4EFEA 4KG8A 2WWJA 2VQTA 2CYFA 2ZX3A 4XJ8A 5FMOL 1DLLA 4LF4B 1UU6A 4IV1B 4RHV2 3S7IA 2GN3A 5J2TA 1IKQA 5HI0A 2GUZA 3NV3A 2X53S 1CAUA 4IEZA 3UQ8A 3K04A 4XZPA 2Y6KA 1W6NA 4R9CA 4QIWF 4WVZA 4DV5B 1OUSA 1PZ8A 4YGCA 2X6BA 3HVDA 4B4RA 4P9OA 3NAPB 3OW2U 4CEYC 4FVMA 1JU3A 3FJSA 4IE7A 4UFZA 2PQQA 5F2WA 1O5LA 1NOVA 4KU8A 4PF5A 1WBFA 2H6CA 2EXKA 5AFBA 3EXAA 4DQAA 4MADA 2J42A 2DOSA 1AB3A 5K7PA 3Q4HA 1LU1A 1ZZ9A 5FYVA 1O3SA 3K48A 1FV2A 2BFUL 3I5DA 1PNFA 2HFEC 4BMBA 2DYSC 2DE0X 5LMUB 3AG2C 3KT7A 2UUCB 1AYM3 1XSQA 4GX2A 3Q8CA 3KG2A 2VMEA 1QJX2 3ZPYA 1XNQB 1KXGA 2PAMA 3DPRB 2Q8OA 3CZJA 1RUH3 5ACA2 3BA8A 3VBFC 1T6BX 1RHI3 3T0DA 5AVPA 2CTRA 4ZXKA 1Y76B 1IBMO 4YY3B 5LASA 3GM8A 1U5YA 1DGSA 2FQPA 5IJ0B 1LENA 1XL6A 1OOPB 3HQXA 4GZ9A 3PMEA 4TTGA 5FXXA 2V09A 1N32O 4IYIA 5FP4A 3DSQA 1IDSA 4YZ1A 4GKKO 1VBE3 1FAFA 1X33A 1HQNA 4IIJB 2A6XA 1S0BA 5A3LA 1BZWA 4BB3A 5HCFA 1AF9A 5JOXA 2XUEA 1PP9H 3ZN6A 4CP2A 2ZT9B 4AXOA 2ZM6O 4XCAA 3PHMA 2MNGA 2VZPA 1VQ8V 4HL0A 2P3KA 3KSCA 4R7CA 3SMHA 2GMEA 2Q0AA 3ZXFA 2EIJB 3KZ4C 2ERFA 4Q5OA 4LE4A 3D5OA 1C5IA 3EJKA 4AQSA 3DYOA 2VOTA 4P9WA 3VHNA 3CRMA 2X6CA 4URAA 4X8PA 4PF1A 1NA1B 4H14A 3OYWB 3VBUA 1HP8A 4QGPA 3VBUC 4X66O 2W39A 1APNA 1W6MB 4HVOA 4NR1A 1UPIA 1WP8A 3NAPC 5K9YA 2GMPA 2PHDA 3PU8A 4WM7C 5A7SA 3C2UA 3CWBH 1V55B 4B3TB 4YM3A 1EFRG 5GLUA 3VBBA 2VD7A 5FBZA 2P06A 1BHBA 1W8ZA 1KDKA 1QIQA 1AJQA 4CDXA 4PA9A 1YJLA 1PGW2 4Y1XA 3VD7A 3VQVA 1HNZB 4XBFA 1LGNA 1IQAA 1RUF2 3RNSA 1IBLO 4AW7A 4KGGA 1EAH1 1QJY3 4WFHA 2EBOA 2DWEC 2AZ0A 2W47A 2Y64A 3ZRVA 1CZSA 5D8AC 1MEC3 1TG7A 4EQVA 1UY2A 3K3WA 1XMOB 3UT5B 4ET7A 3AP9A 1Y66A 1K7DA 5DAVA 5JMOA 2BSKA 1AR93 1RPRA 2BOBC 2VH9A 3ASNB 1XNTA 1Y67A 3POGA 5L9BA 3C7OA 4M0HA 3AZZA 3VV1A 1NQTA 4I4TA 1EV13 3ZHTA 3THDA 1K8AW 5FZ0A 1UWWA 3ZRXA 2X10A 4NE9A 4CS3A 2XJQA 3B9IA 1PZ9A 3WP3A 4ES8A 3ASOB 2JENA 1VE0A 3OGCC 4Y1VA 2DQ3A 4M4PA 3O1SA 4QQ2A 3U37A 4NUBA 1W8NA 2DYSB 4YZ2A 3LSDA 5H9QA 3G6JB 2VZRA 5A33A 1XRUA 3BUCA 3OBZA 4LBEC 3RYRA 3RZMA 4J42A 4NHLA 4W4KA 3T4DA 1O8SA 2AR6A 3IDEA 4I01A 2QQWA 5H9PA 4UYBA 1CJDA 2YEVB 1LOFA 5GZDA 3B8NA 2BV4A 1P84F 2QWRB 4YIOA 3RZKA 5FPRA 2J1AA 4NXNO 4L97A 1CX4A 2FDHA 4LEJA 3HR0A 5ACA1 3VKFC 1Y9MA 2ZEYA 1OMIA 1R081 5IWAB 1HW5A 2VVEA 3M3OA 4WM8B 4P9PA 1UD1A 4JKMA 3RZJA 1DQ1A 4F6RA 1V9U2 4AEDC 1DDLA 1PMIA 3W7WA 3RYIA 2DCZA 2R042 3K51A 5GM0A 2E75B 1D4VB 1A6CA 2JKXA 2YI8A 3WNLA 1ULFA 4K1ZA 1EZJA 3HWJA 1O3RA 1Q5OA 3G6EV 3S6PA 4TV8B 1NAEA 2XLFA 4NYKA 4GJZA 5FZEA 3SH4A 2R072 2Z42A 5JR7B 3L75H 1JFFA 4AHXA 4D3WA 5FMCA 3K77A 3MUY1 2C9AA 2JJ2G 5BNNC 4YJ3B 1W05A 3A22A 3KVAA 2X7RB 4TSFG 2VTXJ 2QM7A 5LOVB 4QJFB 5LW9A 1SFNA 1S5LZ 3ES1A 4JAVA 3WW1A 3CF6E 3IFXA 1VQ5V 2C9KA 4AOCA 1AR82 2GAUA 1I0HA 3GHMA 1ZBA2 3FMGA 1I9RA 1EV11 5GALA 4RO2A 4MTXA 4BIOA 3A4UA 2XL9A 5A3OA 3AB0A 4LF6O 3QO8A 5BXXA 2A5ZA 4CDWC 3VDDA 1QHDA 2H94A 4UFIA 5CA1B 5FLIA 4DR1O 1VQPV 5FY9A 1HLCA 1CIYA 2GH2A 1W8OA 2CY6A 3VHOA 3K5OA 4HANA 1IHMA 1IXMA 3JB4C 3N9MA 2XTAA 4FOQA 4GT1A 2QQUA 2PQSA 3WG7C 4YW6A 4AFDA 4FPGA 4Q4Y2 4DEVA 2UYBA 3K4AA 4KXRA 5EPAA 5KX5B 1BJQA 4ZOLB 2HH9A 1Q8OA 4A7YA 1NE6A 1AXZA 3POJA 2FMLA 1XU2A 4I0XB 3VBOC 3WQ0A 3NVCA 3J8F1 2V5YA 1UX6A 5LA1A 1WMXA 2VGDA 3BN6A 3Q8FA 5B4XA 1RUD1 1RUG1 5EK0A 2ADEA 3VGIA 1EAH2 4CDUC 3ZN1A 4ZU4A 3NJZA 3VLBB 5KA5A 5BNPA 4UFHA 3TN92 2OTJV 5FPZA 1YSCA 4O4LB 4LFAO 4JZRA 3AJYA 1Q90D 1GV9A 1H6YA 2XKOA 3FAVB 3WF1A 1FNYA 4LNUB 1E5HA 2XKPA 4W8JA 1Q6IA 4EE2A 1WN7A 2OTLV 2OIEA 2Z69A 3DPRA 3LIGA 4XDKA 3NSTA 4LBQB 2RMU2 4N43A 1MQTA 4DV4O 5GZEA 3FYEB 3UJQA 3WSOA 2XT9A 2Q8CA 3RVYA 1OQEA 3AKRA 3VBHA 4AFBA 5FY5A 5A6XA 4N9IA 1YI7A 2YC0A 3DGTA 3H3UA 2RJZA 1WP7A 2WA3A 1C8M1 5KLVH 5FBJA 5IYBO 1AI4A 5CA0A 1RTVA 3ZR5A 3N2GA 3SJQC 5FZGA 4QPIB 4PI2A 2YU2A 4DXTA 3K0GA 4RR3B 3ABKC 5LY1A 1W28A 2OW4A 4LE3A 1ASJ3 1SCSA 2YYOA 4JI4B 2JDUA 5L3CA 3T2OA 5KHKA 3I3EA 4XF0A 1H1MA 4BQ2A 4RS5A 4ASLA 1XC6A 1ND3A 4FFIA 4FCAA 4XOGA 2RS53 3LGRA 3M3CA 3ZFFA 2VBPA 2WNUB 1Y3TA 3LDDA 2PLV1 3NV1A 1I5YA 1A32A 4FLWA 1A8MA 3I2FA 3UETA 3I2GA 4Y1UA 3IDBB 2XJPA 2JIJA 1PHMA 5K8SA 4BCUA 4V2VA 5FUIA 2ZA9A 5FPXA 3VD5A 4FM1A 2ARAA 2K2SA 5BMVB 2XOMA 4FZ1A 5HXMA 4JV5O 1PKXA 1T6GC 3K4DA 2Z2SB 1HB1A 5JI7A 4X9QA 1JOPA 1YDXA 3CMGA 3WDWA 5C3SA 1G8WA 3U4XA 4KMQA 5K0UA 2XAJA 4CZZA 5FZ6A 2ZGMA 5FUPA 5FQ0B 1OCZB 4DV1O 5KXCA 1GQPA 2IVIB 4LOSA 1XOYA 4YHHB 2W1SA 3EXUA 3NR7A 1Y4MA 2XJUA 4RFRB 1KFUL 3ACIA 3DV8A 1CESA 5T5LA 2HYXA 5DZFA 3B4SA 2P67A 5IYZA 1O4TA 3N7JA 3VDDB 4IEPA 2AH2A 2RVAA 2FDIA 5F2VO 2D6NA 3ECQA 4LBMA 3I2DA 1BHGA 2JGDB 1NVPB 1S5HC 2DWRA 1V9PA 2PHLA 4L99A 3H1WA 3W5MA 4EZ4A 4XXAA 2CV6A 4Q26A 1L0NH 3ABZA 2Q68A 4WBBA 5FP3A 4KWKA 4LF7B 4J1XA 3WG2A 4GB32 1AR83 5HXVA 4YGBA 1HKDA 2JKBA 2ZR3A 2IJKA 1V6IA 5E1RA 2GU9A 3H1YA 3HEIA 2WLLA 1O91A 1CVNA 1HNWO 1CX1A 1N1VA 2R062 2Q5TA 4OX9O 1QR8A 1LEDA 2E6VA 4LK7A 3WG1A 4X1YB 1OHHG 3OMNB 3M3EA 2G38A 4K9SA 4MXWB 1TMF3 1UQXA 3SQOA 2B8MA 1VRH3 4IEWA 3WEZA 5L19A 3I59B 1WJZA 1PGSA 4RS5B 4XUQA 1JOBA 4ZHNA 5CFDB 1W6OB 1SMVA 4YVSB 2RM22 3CCJV 3T3YA 3ZSJA 2AHYA 2ZQMA 4XBLA 4X62B 3PTRB 1G1XB 2RS12 2BGOA 3M4FA 2P7TC 2VNGA 3FYIB 1HR0O 1TNFA 3U11A 5FZOB 2DVDA 2Y38A 1O9GA 4DV4B 5C8YA 2ZX4A 3BVOA 5GONB 4LP8A 1RXGA 1K9MW 3E6DA 3WW3A 4X1IB 3BHPA 4Q4V2 4DR5B 1FFXB 5A7PA 1YCIA 1GP4A 3VDAA 3BB6A 1H8VA 3AG3B 5A32B 3ACHA 4G27B 1QOOA 1S76D 5I0TA 4DY5A 3I8TA 5LA2A 5IJRA 1UU5A 1GN3A 4E2SA 5BNOA 1K4DC 1O7FA 4DV0O 2QKDA 1ENXA 1ENQA 4DR7B 1TAEA 3G6BA 2A9HA 1SPPA 2YSUB 1STMA 4FPYA 1AVBA 2CGPA 3DF0A 4QPGC 4YSFA 1VRBA 2CTWA 1WW5A 4OHXA 2IC1A 4FFGA 3RDIA 5JOZA 4C7UA 3TEYA 3CIHA 3WT3A 4AFMA 4EKWA 1UKGA 3U14A 1OA4A 2K0GA 1UY1A 1P8JA 2R061 2ZX0A 4IGQA 4L92A 1EN4A 1R6KA 2R9IA 4AHYA 2ETNA 2A06H 4BWAA 4HMZA 2VJXA 4O65A 4TYSA 2PYJA 4QPYA 2Z4FA 3VL9A 3AG4C 4Q4W1 2RR11 5JH7A 4KBBA 4RD7A 1QU7A 4RAIA 4IESA 3PVOA 3ZDSA 3E89A 3FLPA 1H8TC 3MIHA 3IBMA 3H1HH 2UXCO 4LKDA 4XDOA 1RUOA 3URFA 5IYDO 4P9YA 4CXXA 4MXWA 2QDNA 4MVZA 1MZ6A 2OXBA 2D97A 4J7JA 2HP8A 4XTPA 1C3HA 2YEVA 4LO6B 2HWB3 4META 1AZDA 4K35A 4E4EA 4COVA 4CDWB 3WFVA 1GZCA 2DBIA 3I49A 1OUXA 3SEPA 1AL0G 3C8XA 4XXPA 3OGVA 5A2QN 5GZCA 1F4AA 2J1UA 2TBVA 4ATFA 3SITA 4BPZA 3A2FA 4Q6GA 4WM7A 4QX0A 1FXKA 3OPWA 2EIKC 2ZIOA 3AZVA 3F2ZA 4WVMA 1YIPA 1R73A 3MF9A 3BU0A 4C0HA 1UL9A 4ES9A 1I1EA 3I2JA 3H01A 2QJVA 2GC2A 2PHFA 5C8WA 1FFXA 2JB4A 4IUGA 5IVYA 2PYTA 4OLLA 1EYBA 2CL2A 4C1WA 1R093 4DZGA 5FWJA 1NY71 5C9AB 5JVDB 5AC93 3N4MA 4HSJA 5AC91 1MS9A 1FX5A 1O5UA 3BAAA 5LP6C 2VE1A 1BBT2 5IVBA 3GF6A 4HSLA 2DTYA 1NCQC 3SJCC 5D8AB 5FZ4A 1WPXA 5I0SA 3T1LA 2F4VO 2LQTA 2YDEA 3MV11 5ABJA 1V00A 3VKOA 2JIGA 5BY5A 2P90A 2ZCWA 2HJFC 4FP3A 1ZBA1 4WBNB 3NKGA 4Z82A 2EINC 3OUFA 3AMNA 5FY7A 5KHIA 1C4RA 2YC4A 1RC6A 3OTOO 4FFKA 3HKEB 2ZOEB 3STLC 1ZBE1 3I97A 4K6BA 1SKVA 1XL4A 2W1WA 2WLKA 4JI8O 1BQPA 2Y4TA 3WP5A 2WJSA 1EBOA 5DAXA 4HKOA 2PA7A 3ENRA 2JDAA 4OCTA 1ND2A 4OUSA 5FTTC 5KHJA 5L3GA 2NLJC 1NZCA 3IAYA 1N36O 4EV0A 1XNQO 1QLNA 2WZR1 3PU3A 4BLIA 1W0JG 2ZTNA 4EYUA 1YYNA 4OUEA 1VAKA 1VBC3 4LNVA 4XF3A 1REFA 2FDGA 3E5XA 3FN9A 1UY4A 4BMEA 1A34A 1PO21 5A3TA 5FPLA 3C7HA 1NU1H 3RMYA 3ZDVA 2H0BA 4XMIA 2GC1A 1R3KC 5SV5A 2RS13 3OEHG 1GTOA 4F4LA 4XZUG 2A3WA 5F9TA 1IS4A 2QKAA 4JGZB 1F9KA 5FY4A 1VBE2 1V9U1 2ZX1A 3USUA 1C1LA 5A70A 5T3NA 4AGVA 1Z7S1 1P49A 4YJ2B 3SCHA 4XVHA 4GMP0 3RYCB 5E16A 5JSOA 1HWYA 4GULA 2FYUH 5K1XA 4IGPA 3SYQA 2Y6HA 4ZHQA 1YC61 4KG0A 1NTKH 5JOWA 4WV8A 2AACA 4QGMA 2B1GA 4Y4YA 1GSLA 4EWDA 2CWMA 3LZZA 4XURA 5JH7B 3VQXA 2WO3A 1NYWA 4KHPO 2ZXWC 2YXYA 1ZZ7A 3UKTA 4O4HA 3J7NA 3RJ2X 1VQKV 5LA6B 3EBRA 5EZYB 2G9GA 3RYHA 1QOTA 4PHZA 5FV3A 4JYAO 4PIYA 5C71A 4FLZA 5EC1C 4WFFA 3AYDA 4H3WA 1ULPA 3KV6A 4ISRA 3OR7C 1KJLA 2BZDA 1US6A 1VALA 4QHOA 5FYHA 3AKSA 5K0UB 4CPBD 4QE9A 4QQPA 3S5AA 4DXWA 2ZHKA 4CXYA 4I30A 3N7LA 1M06G 3N2GB 1T2XA 1A3KA 3KGZA 4LMFA 4IE4A 3NNFA 3JYCA 1JMKC 5CFCA 2PY5A 4CZSA 1AJPA 1J95A 1VRH1 3ILFA 5FZ1A 5JSPA 1AJOA 1SBDA 3POSA 1EY2A 1QWRA 2QTWB 3SYCA 2ITDC 3AMHA 2VWJA 1OCZC 1WCUA 4GQ7A 4DRVA 3TOJA 3E5UA 5L9VA 4NTWA 3PVEA 3AXEA 3B02A 4ZZ8A 2PAKA 1MVEA 1QXJA 4JPRA 1V6JA 3ZFEC 1W2UA 2DURA 1PVC1 2YUEA 3JQWA 3PIGA 1DQ4A 1IQDC 3I4IA 3ZN5A 4DR6B 2A3XA 1Z7S2 5DM6V 2WYSA 4DR7O 2EICA 4YZ4A 5JUVA 4NOTA 4NRPA 1H2GA 3GWKC 1US3A 2BOJA 2MEV3 1NLRA 2HYKA 3VN4A 1NBMG 2OX0A 2RDQA 2VUCA 4YM0A 3GZAA 4F8AA 1W99A 3LSSA 4QE7A 1S0CA 1FMD1 3WDUA 2UU9B 5I0RA 1DTOA 2PHRA 3K0DA 4XQDA 1H8EG 5KHGA 5JQGB 1KP2A 1IG3A 4B3SO 2CDOA 2EALA 1H2SB 5CADA 2BTVC 4J10A 4WZFA 3RN4A 3H7JA 5EYXA 5FZHA 4CEWA 5FMDA 1ALYA 4NPMA 3E6CC 3P5BA 3WQ1A 2D93A 1UXXX 1HX6A 1GNZA 4GX1A 3ME2A 2HWF1 3KT4A 1OLME 4GLXA 4YZ5A 4JYCA 1W9WA 3B01A 5FIXA 2Y60A 4E8CA 4XIOA 4AEJA 1WB8A 4TXWA 1FJGB 2MHFA 4BWOA 5CYYA 1QJU2 1DGWA 1B35B 5DG2A 4IERA 5C6CA 1EN5A 1G9FA 1TEIA 4HETA 4LPLA 3B2EE 1URXA 4QU1A 4P9GA 3I56V 1N34O 4DFSA 2LM3A 1R3LC 3S3XA 4A3XA 3HB3B 5LY2A 2YBPA 2JE8A 1VQ6V 2WLNA 4M0NA 1PO13 3H3ZA 4Z07A 4G4FA 3D6EA 1XYPA 3GCWA 3IDCB 4QX3A 5J2UA 5JIUA 1ZRRA 1VARA 3AMMA 1NKGA 2G19A 1FJGO 4ZKIA 1EPWA 5DG1A 2RS11 1CPMA 2BYVE 4KP4A 5J98B 4BXSV 1GP5A 4N53A 1B04A 5D5QA 4QXBA 4IT5A 2DVAA 1V9U3 1JZ4A 4B08A 5IYYA 4QWNA 2ZNJA 3LA7A 3M7AA 4LBKA 5J3UA 5EYYA 2DV9A 2DUQA 3CRCA 4PA6A 2E5LO 4JI0B 4K8ZA 2YG0A 3ROUA 3GZTB 4CUGA 3AVSA 4CVUA 4NPRA 4MZUA 3O1TA 2EIBA 2WUHA 1NQJA 2CTPA 2EIGA 5KC6A 3D3IA 4AEKA 1GWKA 3ZRSA 2VZQA 1VJ2A 4BW9A 4MYEA 2QE3A 4Q0UA 2OIIA 3QO5A 2ZAAA 4XEZA 4GKXA 2RDNA 1VEWA 1WCDJ 1UN1A 2QA4V 3LA3A 2C2AA 5IK5A 2FDJA 3AP7A 1G6NA 4W65A 4LH6A 2V1DA 1PK6A 4EWAA 3FC0A 5CAZA 4UI9L 4JI5B 4DV2O 2DCYA 5C3PA 5KBFA 3VBSB 1W8UA 4D94A 5CFDC 2DU0A 3FKSG 2Y4UA 4IV1A 3J7MA 4FFBB 1DIWA 4IGOA 3WHUA 2OCHA 1HW7A 1ZX3A 3OUSA 1AL22 3WV6A 2P5BA 2Y69C 3S30A 1RHI2 4B8EA 3ACLA 3TJTA 1ZZ6A 1OCRC 2WLIA 1HJFA 3THPA 1W8TA 2W08A 1QH6A 4AK3A 2UXBO 4B3NA 4LLOA 1UZWA 1W90A 2Q1ZB 2WT1A 3ZHSA 2Q7EA 1TA8A 1RUH2 1G9AA 1UY3A 3CO2A 1Z5WA 4AFAA 4A44A 2DCJA 3AG1B 3OUHA 3BKZA 2UU8A 1RMU2 2VS0A 2B9VA 4NRMA 4CDUA 1VPHA 4C0BA 1KKDA 4KWUA 1POV3 2A73B 1LOFC 1AYN2 4ORFA 4CP1A 3JASB 2QWOB 3M7MX 1H8TA 2WZR3 2HG5C 3W7UA 1MACA 2ZJCA 5LXTB 2BERA 3L2YA 2DYRB 1MS3A 4JDMA 3ZJZA 3NNLA 4RFT0 3TCUA 1RP3B 3HKDB 3R4UA 1XMQB 3DC6A 2WWSA 1QLEC 1LOCA 1GOGA 2JX9A 3V0BB 2OT5A 2WS92 4F6EA 3VBRB 4JF3A 5A80A 3M3QA 4LF9B 4LKFA 3ZFGB 3SPHA 3NRUA 2OQ7A 4RL7A 4BJ0A 3GGLA 4HG6B 2DCKA 2D5FA 2VNOA 3BEHA 3RFRA 3O65A 1VQ4V 1PX4A 1VBD2 2RJKA 2Y34A 3D36C 1F4MA 3ASOC 1HB2A 4MTOA 3I54A 3Q8AA 5A6QA 4MSVA 3HN3A 3SH5A 2VOKA 2F17A 1ZZBA 2PHWA 1J1TA 3G71V 3FUOA 1GN2A 4LBQD 5JXJA 1LULA 1S0VA 1S0IA 1VF6C 3H8XA 5A7WA 4FVVA 3JD0A 2KSDA 3UYJA 1R3JC 1WW7A 4TV9A 3UK9A 3JCUZ 1FXVA 3VBOB 2AUYA 5LGNA 1BMV1 1JCHA 4DW1A 2ITCC 5DDJ3 4MGYE 1D4M3 4NTXA 5KC5A 1IGOA 5HFMA 3BYWA 2HJDA 1RPOA 5GJ6A 5CKNA 1RL3A 5C7GA 1V0AA 5H6RA 4OZXA 4GWIA 1JW6A 1JYVA 4O9EA 3UNPA 3IPVB 3PUIA 2D3PA 5FPAA 5FYBA 4TN7A 5GLWA 5J48A 3ZYRA 3SH3A 4BH9A 5L3FA 3KF3A 3MHHC 1YFUA 3MW3A 4A42A 3EVKA 1MEC2 5FZCA 4OYUA 2O0OA 5F5CA 3HBKA 2LGWA 4W4ZA 2YIBA 2P22C 4ONUA 1JYWA 3CSXA 1RM1B 1YZBA 4BYYA 4E2GA 1JQ0A 2HWD3 4DEQA 1W8HA 2KB1A 3M99B 3MF6A 4ITCA 1F35A 2R0FA 3JATB 1GNYA 1G8MA 3AM2A 2DTWA 3CHXA 1G7YA 4NIAA 3NWKA 3IGAC 1EV12 1K5SA 4TWTA 3NO8A 4L9BA 4RYDA 4K20A 1M57C 3RG0A 1JJOA 5I8SA 4ZU5A 2D2CB 5H9CA 1XI1A 5FYYA 4AEDB 2EINB 1DYOA 4FK5C 3ACGA 1F5FA 5JLVA 2ZEXA 1S3JA 4P30A 5C3RA 2ZGRA 1Q8QA 2RN9A 1KJRA 5FO7B 1WMDA 2EZOA 3N9LA 4IV3C 4Y20B 3TXQA 4MGZE 2Y69B 5EBLC 1KGYA 3A0HZ 5F6LB 2WQZC 3T30A 3USUB 5IATA 3W59A 2E74B 4X65O 4IE0A 3OSDA 4BM8A 1BT8A 3L9DA 3VDCA 3OE7G 2WWWA 5GLVA 1Z78A 2Q6AA 4I2OA 2V73A 1YQ6A 4CDXC 1BS3A 4IV1C 4XW3A 3QVNA 2P4EA 4Y24A 4GJYA 4YXWG 3KVBA 2ORZA 5FZ9A 1UO9A 1X8EA 4BIZA 1ENSA 4TV9B 2ZZQA 1ZREA 3EMRA 3RZHA 3ZFFB 3ICXA 3A0RA 4GUNA 4ZS3A 5FLXN 3TWIA 5HFLA 3ML0A 2WAAA 1HRI3 2RR13 3OB8A 1C8NA 1W6NB 4P5YA 4O4HB 4EEQA 4NPLA 3J7HA 2D40A 1GZTA 1VF7A 5JZGA 2DYCA 1JHNA 3AMQA 1D4M1 1ULCA 2QQIA 3OGGA 1OT5A 5LP6B 1VBC1 1CAVB 2Y6GA 1NCQA 5FYZA 5BNPB 2CH7A 1R1A2 3VBHC 2JVDA 2R073 5IJ9A 4YVSC 1GH6A 4IW3A 2VMGA 5CFDA 3BOPA 4FPPA 2LROA 2HWB1 4MGTA 1IX9A 2QWQB 1J83A 1GZ9A 4PLNA 1ZRDA 5GW7A 2RV9A 4MVUA 2E51A 4LK6A 5JXIA 4R9BA 2EULA 3W20A 3M70A 4XE9A 3JB8A 3NW4A 4GAZA 4H13B 5C8YB 3R4SA 4EROA 2HWD1 1W3XA 5F2SA 5LBBA 3WF2A 2JJ6A 3DL3A 3CJHA 1NCRB 2HBTA 3MLKA 4CRQA 2BBAA 5BZBA 2N7GA 2ZKLA 3SCFA 1RUE3 1WLCA 1COWG 5GZFA 2QR4A 5LATA 4X20B 2WAOA 4Y4RA 5FYTA 1BKZA 2Z3YA 4AAXA 3APBA 3P6BA 2OWOA 3U07A 4PIZA 1M4UA 5EYPB 2GALA 2YGLA 3V0AB 2HKOA 1XPWA 4QPJA 2XQXA 4Z1VA 3ACFA 4KFMA 1RUC3 2WNUC 5JWPA 4Y33A 3NMBA 3B94A 4XACA 4R50A 1K42A 1AR5A 1AR61 1MS1A 1JU4A 3AYEA 1O3TA 1LECA 4YNIA 3G7DA 3LEMA 3WCRA 3LQCA 1N4CA 1O6UA 2EXIA 1QNYA 2A79B 2OUHA 2Z79A 4KQ7A 1MS0A 4KH9A 1VAVA 5L9RA 2XB6C 4DNYA 2WLQA 1WD3A 1K5MC 4PQ9A 1PD3A 3A0KA 4DV5O 1RSOA 1RIRA 4X8AA 3WB2A 2YV8A 4JCKA 2BP6A 5FCCA 1PVC3 1XHZA 1A78A 2RM21 1THZA 3K58A 5F6KA 4PDMA 1G4YB 3BGAA 2ET1A 4W50A 2WO1A 3JD2A 4JI1B 5CVRA 2N04A 5IY5C 1PO23 4QPIA 4J6GA 2TEPA 2WNVA 2RMU1 4P08A 2Q4SA 4K8XA 1R1BA 2DU1A 3N7KA 2Z5WA 2Q4PA 3ST7A 3RWRD 4FQZA 2ZPXA 5LEJA 1QGLA 4W6XA 1QLEB 4AILC 2XLAA 3OR6C 3KQRA 2HWC1 4Z8BA 4BIFA 1LOEA 2Y0PA 1X7NA 3OF1A 1KMIZ 1ZUQA 3AJZA 3AC0A 4UAPA 3MPPG 4MTGA 3CJXA 3NNGA 3WW4A 1F4HA 4R4XA 4DUVA 3GB7C 4PI0A 3C3SA 1YTFB 3IMNA 4XHXA 4BZ4A 2QFEA 2NPIA 1NE4A 2HLEA 1RUE1 4YW1A 2D6KA 3WDYA 4QAWA 1H8TB 1NZIA 5FZBA 5LEKA 4GMP3 3GDBA 4DK0A 3G4SV 5F3EA 5FXZA 5FNVA 2XAFA 1BEV3 3HKDA 3ZYBA 2XQRA 3WY6A 4AI1A 2NMNA 4P9IA 2QJ1A 4DMIA 2P2KA 3JD3A 3WUDA 2BTQA 2W87A 1KDMA 4LLFA 3HKCA 3K46A 3RGBA 3MEPA 2NM1A 1F31A 1UZVA 5CA0B 1VQOV 4EB6B 4UCRA 3V65A 5EBWC 4DR4O 1S55A 5C4WB 3R4DB 2WWUA 3CD6V 5CG8A 1UZ0A 3EO6A 3ZFEB 3BIEA 1C1FA 4LT5A 1BVP1 5JOYA 1D0HA 1GZWB 3CRRA 2OPWA 4BQ5A 5G04L 1YJNV 1FS0G 4TQFA 3B3QE 3AEIA 3B8MA 1I5ZA 3IC9A 1HXS1 4KL1A 1PL4A 4DO2A 4H2AA 4RQPA 3B09A 3CJHB 4LBNA 5A33B 2ZCEA 4N7UA 2E26A 2WO7A 3AMPA 5A7WB 5HPOA 5H2FZ 2ZXQA 5DXDA 3LNMB 2AC1A 3LDCA 5JVDA 3HNYM 4JQRA 3CE2A 1K4CC 4CE8A 2HWE1 3MICA 1TVKA 3K59A 1JZ6A 4DV0B 1YIFA 1C57A 2B45X 3FE5A 2FBEA 1YHQV 4ZIBA 3BTXA 2W1QA 1HRV2 3U0ZA 3POFA 4ZONA 5DUWA 5ANQA 1XMQO 1IPKA 4INDA 2WN2A 1COV1 3SKJE 2W68A 1VBD1 4WBNA 1LUWA 4GYCB 3MAQA 2JWPA 1BBT1 4F6RB 2P3YA 4CU9A 1JZ7A 5DAPA 3RYCA 4QB1A 5KWRA 1QJX3 4Y1ZA 5KR7A 4QKNA 5A7NA 2J1VA 3OBAA 1M56C 1DGWX 5FKCA 3JBG2 4X62O 1OA2A 2UWBA 1Q8IA 1WA8A 3OY8A 3IJ4A 4JGYA 2LW7A 2ZINA 3IN9A 4IL7A 1SRYA 5KXDA 2NN4A 1JYTA 4LC1A 2Q67A 4URTA 5CIRA 4UV9A 2A7WA 2ZE5A 4X66B 3K9AA 3AKTA 4GB31 3LDBA 2ZE8A 5CN0A 1B09A 1VRH2 4GH4C 2YXLA 5C8CA 3N7MA 1SQQH 3VD9A 1VP6A 5CG9A 1G9DA 2YZ4A 1E5SA 1SLTA 5LYJB 2WYFA 1OLMA 5DUVA 2RM23 3AL5A 4LBOA 1KB9F 5KXBA 1XB9A 3DPRC 1AYN3 3FFZA 5HCHA 4TZDA 1OOPA 2WSUA 1CAUB 4CCMA 1Y6XA 2Q5ZA 4LBJA 4Q4V3 4AI9A 5CEHA 1VQ7V 1YXWA 2PHUA 2A75A 2Q7HA 1YJKA 4D6SA 3PJSK 2EAKA 2WZR2 3L74H 3UCSC 5C3QA 1JOJA 2DFBA 2ZDIC 1QDOA 3H42B 2RJLA 2WNVC 2CE4A 2ZGPA 4DV6B 3WUCA 2JXAA 4MGQA 1KQRA 3JD4A 2VUAA 5J36A 5K4LA 2PFWA 5B1NA 1LGBA 3O1OA 5DN6G 4NROA 5CKQA 4K1YA 3PDQA 1SC5B 1F2NA 4XUOA 5FXWA 5HCAA 1NXD1 3GJAA 2E33A 2YXHA 3Q4HB 3HT2A 3PUSA 4NXMO 2X09A 1IS3A 2D6PA 4XFBA 3FB7C 2Y0OA 3MIGA 3CEWA 4MVTA 5C8CC 3I7DA 3SYPA 4C91A 1PPJH 3ETQA 5ABJB 4YM2A 3WQ7A 3IKWA 1TME3 4EN9B 2EIKB 5LGTA 3W7SA 5KXEA 3R66A 2QZ2A 1QR9A 1X9TA 2OS2A 4G28B 4Q20A 4QM8A 5FYCA 2HWF2 3QCWA 2R1BA 1US2A 2BWAA 1QHTA 2OVUA 2XVKA 1X82A 4QPKA 2QKSA 1LHWA 2VMHA 3HKCB 1HNZO 3T1CA 3H8RA 5DZEA 1W03A 4GIQA 4C8DA 1U0AA 4CDWA 1HDJA 1I6XA 2E9QA 1NKDA 5C3OA 4FPJA 4OFGA 1QJX1 3D0SA 4Q8KA 3ABKB 4J80A 4CH5A 5CBGA 4Z92B 3ZMVA 2RJ2A 3BRCA 1Q8SA 1BEV2 4IIJA 2XAQA 1J3PA 2F6BA 4PCRA 4N43B 3QLQA 2UY9A 3FB8C 4HOOA 1WLTA 3W58A 1C28A 3JQXA 3KCXA 2PMWB 5HBAA 1N3QA 3OTOB 4QKBA 4RN5A 1KP3A 1MZ5A 5EYPA 2E5LB 3E5QA 3LOBA 2ZGNA 3LFMA 4FLYA 5J37A 1RJ8A 1CAXB 1N1YA 3TEWA 1LNSA 4J9ZB 2W9XA 3U78A 1OJHA 1L0LH 4PV1B 4X1KA 2YHJA 1RVF3 5DN2A 3M1HA 1V6MA 1RFYA 1PNMA 3AG7A 2QUOA 3VZNA 1ZZ8A 4FTEA 1C8M2 3MIEA 1RITA 5FZ8A 3HPLC 1SZXA 5LP6A 1ROPA 4CU7A 4HK8A 2BSKB 4JV4A 1SFPA 2CTVA 2E3CA 4XTMA 1GOFA 1X50A 3VHRA 2FDKA 2D43A 1MS5A 1Q6HA 3FB5C 2GNTA 3GJBA 2I74A 3T1HB 3WW2A 4P02B 1Q7YW 3I3QA 4NHYA 3T1MA 4C90A 3S5QA 1R3IC 3JZVA 1VBA3 1ONAA 1DP0A 1SQGA 1E79G 2AGSA 4A6OA 1K5QA 3RYFA 4PT6A 1F4NA 5T5OA 4UBGA 4WCEV 1QY4A 3O5SA 2EIJC 2ATKC 1H1AA 3BALA 2B4KA 4DV7B 3OD0A 2IZWA 2IVJA 4GMP1 1W39A 5LA9A 5BV6A 1OCOC 4YFWA 4BQ3A 1OCOB 1L7QA 3ZMSA 1Y43B 2WSSG 3BPSA 1K45A 3FLTA 4FLXA 5HV0A 3H1LH 4Q4X3 1AI5A 5L73A 3V0AA 4WFEA 5GLTA 3F7YC 2JG8B 3SGIA 1BCCH 1R083 1ZRCA 4JYYA 3LPGA 1XQ8A 4JI7B 2CWSA 2R32A 1FATA 1W6PB 2WL1A 4M3CA 4GKJB 3I55V 4A6SA 1SZBA 5B1OA 2IXHA 3KHCA 1ZRFA 2QM4A 1JMUB 3CJIA 4K0KO 1RMU3 1DK1A 3OCPA 1HDKA 3ZRWA 2UUAB 4JI3O 3CB2A 3LD8A 3R05A 1S0FA 4XFAA 1BQZA 5F1RA 2PELA 1Q81W 3MFAA 2EIMC 2FZ2A 1AP6A 4R6ZA 2VCMA 2IFRA 4FJCC 3GCXA 4QDSA 5A7OA 1AI7A 5IVCA 3VOUA 3PUAA 1XMOO 1SBEA 3USSA 1HQLA 3K75B 2IXJA 5B5EZ 3NXSA 1ULOA 2HWC2 5LWBA 3RMXA 3PLQA 3JSNA 2G1MA 2VMDA 1KC8W 2R0HA 4CTEA 5FMBA 4P9LA 1ZYBA 3FLRA 4MT8A 5IT9N 1TMF2 5B66Z 3VBFB 2BNOA 1DQ2A 1GOHA 4QHBA 4S2FA 1NX9A 5G05L 1H2LA 1R6TA 4MGSA 4CCNA 1MS8A 2Y33A 3QO7A 4JGZA 1FYJA 1W9SA 3FUQA 4AZZA 1TME2 1VP7A 2ZAHA 1WLDA 4RQPB 5I91A 4XUTA 2EF6A 4AVVA 5FZLA 4YJ2A 1GICA 2PF4E 4X6RB 3RZZA 1N34B 1E57A 3ZFGC 2XVLA 4XFCA 3WXPA 1TVKB 3X29B 4Q2FA 3PMSA 5DEDA 1RUG2 4YVWC 2GSMB 3MW2A 3H9VA 2EILC 2BOCC 1POV1 4JX0A 4Q4X1 1EAH3 4A7KA 5DDJ2 3TN91 2P4KA 4R52A 1U97A 3GWOA 4OHZA 1AXKA 2K9ZA 2ORXA 1PNKA 3RRDA 4XFFA 3E97A 4B3MO 2ZEWA 2X8KA 2R1DA 4LF8O 3IPVA 4XQWA 1JVMA 1BMFG 5LZ6A 3AYCA 2NP0A 4NO4A 5EXOA 1JR9A 1HXS2 5KUKA 3TBDA 2WNEA 3V64A 5JMCA 1RUJ1 2CK3G 2G4IA 2RS31 1WA6X 1Q82W 1W6OA 4YVSA 2HEVF 5ERLA 4PBOA 4J9YB 2N74A 3ZFGA 3FAVA 4ZI7A 4I50A 5DZGA 4H0LB 1V54B 2WAMA 4HK9A 1WPBA 3NL1A 3JAWB 1S0EA 4PQQA 4DUYB 1N32B 1VQLV 3E22A 1Q8VA 4GWJA 4IXLA 1AX1A 1SA0B 1MQTC 1ZL8B 3ZXLA 1UOFA 1B35A 3CL1A 1K97A 3JATA 1JUIA 1GYKA 4AQ6A 1C8M3 5EP9A 1OVPA 3JD73 2UXDB 4I55A 1N0JA 2FMYA 5FUNA 2QSAA 4WFBV 4ASMB 1QDCA 3BTYA 2P1BA 4HN0A 2W92A 3ZXKA 1TME1 1PVXA 4Q4W2 4M00A 2GDFA 4LF5B 1POV0 5B2GB 1Y76A 5CBHA 1G9CA 4FFBA 4K8FA 1PGW1 4MSWC 2YIDA 1UAIA 3J4UH 3CU7A 3B7MA 2BNMA 4Y20A 2RS52 4WM7B 5LMNB 1WW4A 5BPXA 1JA8A 3ZN0A 5M0TA 3RVHA 4D6QA 1REDA 1VBB1 2F93B 4I0WB 2C5DA 3E83A 1RXFA 3AZWA 4CDXB 3M2MA 3ZN6B 4DO0A 5I8YA 2ZMLA 4Q4Y1 3WZ1A 2A3YA 4RGGA 2M7WA 5KUMA 5B3SB 4AF9A 1JZ2A 4BQXA 3OAAG 2WLMA 2F4LA 1PO12 1IVSA 2QM8A 3N9PA 5L3DA 1AR92 1HV0A 2CAUA 4WVVA 2V4AA 1NS1A 2ARXA 4XDPA 4FXGB 3N2KB 4DUWA 1JX9A 1LRHA 3PIJA 3OY8B 4JGYB 4DR3O 4Q27A 1JH5A 4D7TA 2AZ5A 4CS2A 1K34A 4YG0A 4GA9A 4DYLA 2L6LA 5AFEA 5F37A 2OT7A 3WVJA 1NY72 2R9AA 3V0BA 3AKPA 3AZXA 1WW6A 5FP9A 3UT5A 2VQAA 1TUBB 4XC9A 1JYCA 5FR3A 1HB3A 4XDJA 5B3SC 3E8HA 3CMAV 4L2NA 1PK6B 5A3PA 4AI0A 3VBUB 1WZXA 1W59A 5E88A 2YI9A 1MS4A 4I9WA 3HJRA 5H5NA 4BQWA 4MTFA 1MR5A 3KM5A 4I09A 4LIUA 1QCEA 2QQNA 1V6NA 4X88A 2FB5A 3A8TA 2D3SA 1GM9A 1OPMA 4PLOA 5L36A 1WCSA 2RS33 5TISZ 1YJWV 1AHSA 5FPVA 2DVFA 2DMXA 4PA3A 4MVSA 3W7XA 2PAEA 3ZHRA 3PJYA 1SACA 2YGMA 1VB2A 1K73W 1ZBE2 3L2HA 1PM9A 4LUMA 3S7EA 3WF3A 4FLTA 2PGGA 4CDUB 1XBLA 2W6JG 1OF4A 3JD1A 4HKLA 1XOUA 1VQ9V 4NB5A 2PUSA 4MS2A 5EBMC 1I5XA 1IKPA 2BOIA 2QTOA 4NIIA 3RQ0A 4Y5Z0 3FX7A 4IV3A 1AJKA 1AR72 4UVBA 4MVOA 1AP5A 2H0VA 5BMVA 4MV2A 3ETEA 3ZMTA 4X65B 1OKOA 4U7OA 1CJPA 3J26N 4B3SB 2WSVA 3VHPA 3RZLA 1PIV2 2JB8A 3VBRC 3P1IA 2O57A 3CCUV 3KLSA 3VBRA 3RPQA 3PUQA 3PJQA 3MDSA 2BDRA 1EP0A 1GWMA 4UF0B 4L11A 2IU0A 1NXMA 1VBE1 4Y22B 1G9BA 3ELNA 1QNMA 2J22A 1MA1A 4HZ3A 2PYLA 1RMU1 4XFIA 4CA9A 4DUYO 4Q0QA 2E76B 4YW2A 1K5MB 3CXCU 2HJIA 4JI6O 2WS91 3L72H 4W4LA 2JRIA 3O0WA 5BY1A 3GALA 4IEYA 4HXCA 5BNOC 1FAYA 3BCCH 2JECA 2WNOA 3GBFA 2Y0IA 3ZEDA 1SLLA 3ZHUA 1M57B 4OI2A 2WLHA 3RI9A 3SPIA 3N9OA 2VBDA 1CAXA 2VZUA 1KD1W 1HB4A 3K2OA 5LXTA 4TUYA 3HNMA 2LGQA 2VXRA 2FMDA 2ARCA 1W6PA 3ZMUA 3PUHA 2VL4A 3MV01 1JYXA 4HYOA 5HCBA 3ZX7A 2XUMA 2W46A 3LB9A 2ATFA 1N3PA 4DV7O 1OF3A 3N3HA 4ZZ5A 1SLBA 1LR5A 1LTEA 5CA1A 1K12A 1YI9A 2FZ1A 4DPNA 1GKBA 4M3CE 4GWMA 3OBRA 1HQWA 3WDXA 4AYUA 1W8FA 1H4HA 5GTIZ 1D4M2 2K1EA 3H1JH 4LA2A 2VVFA 5E79Z 1JZ5A 1G6UA 2RS51 3OGSA 4ZHQB 4GH4B 1PK6C 4I4TB 4JI7O 3N2KA 2HHHO 1VBB2 1XNBA 5FJKA 1FPN3 5JZGC 4DUXA 5KX5A 4GZRB 4IQPA 4PDRA 2B7YA 3U1XA 4U3JA 1O3QA 3JAMN 4LFCO 2GMMA 1OVSA 5EIBD 1F15A 3W9AA 3GBGA 2G9FA 4QB6A 5D5PA 1YFYA 3AFKA 5C5TA 5LOVA 4WF9V 3TXSA 4D7SA 3U75A 3AG3C 5IW0A 4Q1RA 3T2QA 5CKMA 1IG0A 5C4WA 4Y22A 5EHDA 1QVFU 1C5HA 5EIBC 3UO3A 3KV5A 1TE1B 3OBTA 2AENA 4AGGA 4OULA 3LEGA 4M3CB 2H8PC 2P3JA 3PVBB 5JJEB 1QJEA 4IEVA 1DQ6A 4CUAA 5LL6Y 4JRAA 3KCYA 3CPWU 4GKYA 4JVAA 4IGGA 3FZ3A 1HN1A 2IFWA 4DR5O 5KAFZ 3QF7A 3BY6A 4IEUA 2AREA 5FZIA 2JG9A 4GX5A 2XVGA 4XDQA 4LA3A 3CZUA 2XLGA 2VQUA 4XBQA 4NAOA 1B35C 2F1MA 4I7ZB 3LFIA 3NQHA 2PZSA 2GNBA 3LEIA 1EM1A 1SLAA 4COUA 1LOAA 1HJGA 2VZTA 3E86A 4Q0SA 2YPJA 2BEOA 5LMNO 1H38A 2YU1A 3GHNA 4YVWB
chains in the Genus database with same CATH topology
4I2OA 2V73A 5GZDA 4HLTA 4CDXC 3HMYA 4IV1C 4XW3A 2WFPA 4Y24A 3ATGA 4PDWA 4HPKB 4W6YA 3ZMNA 1ASJ1 1X8EA 3OD4A 3GYDA 4L97A 1CX4A 4FFAA 5C4WC 4S2DA 4LEJA 1HRI2 1ENSA 2ZZQA 1ZREA 5IK4A 2RR12 5ACA1 1YNAA 3VKFC 3ZFFB 1AYM2 2NZ9A 3TWIA 4GB33 4LR4A 3QOPA 1OMIA 1HRI3 3ZSMA 2WZPP 1R081 3WG3A 2RR13 3KGLA 1HW5A 3NV2A 2VVEA 1C8NA 1W6NB 1EPZA 1OIJB 2EA7A 3M3OA 4WM8B 3POWA 1UD1A 4LO5B 2D40A 4Y0EA 1DQ1A 5JZGA 2DYCA 1JHNA 3AMQA 1D4M1 1ULCA 3OGGA 1V9U2 4AEDC 1VBC1 1DDLA 1PMIA 2DCZA 1CAVB 2R042 3ZSLA 4WVMB 1NCQA 3K51A 3KD4A 3ZFEA 5GM0A 1D4VB 2WNVB 2BVBA 4KGQA 1A6CA 1RUI1 5L7OA 1ULFA 1YRZA 4K1ZA 4P5HA 5BNPB 1R1A2 1H2KA 2Q1MA 3HWJA 3VBHC 1CGPA 1V6OA 3AX4A 2R073 3ZIXA 1O3RA 1OHFA 1Q5OA 1HV1A 4YVSC 5JAXA 3S6PA 2VMGA 2XLFA 3BOPA 4LBLA 5CFDA 1FOD3 3SH4A 2HWB1 2R072 2Z42A 2OG7A 4BE3A 5JR7B 3SISA 4LO7A 1GZ9A 4PLNA 1ZRDA 4D3WA 4AHXA 4OVEA 3PVJA 1FOD2 2E51A 4HZFA 4R9BA 2C9AA 2C1FA 2ZGUA 3M70A 5BNNC 1OI6A 4XE9A 1WBLA 5J09A 3JB8A 1VIWB 5CA6A 3NW4A 4QMAA 3R4SA 4XJ9A 2HWD1 4EROA 2E7QA 4BGKA 2JJ6A 3WDTA 3DL3A 2HWE3 1KS5A 1NCRB 3MLKA 4CRQA 3QH7A 2N7GA 2SBAA 1CONA 2O8OA 2ZKLA 3SCFA 1SFNA 1RUE3 1U5IA 3ES1A 1WLCA 5GZFA 2KM2A 3WW1A 3CF6E 4YLMX 4QQHA 5EV7A 4Y26A 3TB0A 5L7OC 3D8CA 3MGUA 1AR82 5L7OB 2GAUA 3WNXA 1JUHA 1WUVA 4XF4A 5JPMB 1BKZA 2EVXA 1ZBA2 2W52A 3GHMA 3FMGA 3APBA 2E53A 1I9RA 1EV11 5GALA 5BUVA 4BIOA 2E63A 3A4UA 3U07A 2XL9A 4PIZA 3VZLA 3AB0A 1FV3A 2GALA 2OYZA 4BHPA 2YGLA 5BXXA 3V0AB 2E7TA 3AKQA 2A5ZA 1UF2C 4CDWC 3VDDA 4Z1VA 1QHDA 4R4ZA 2JEMA 5FLIA 1AR73 4K40A 4FPFA 4HVQA 1RUC3 1LU2A 1S2BA 1VBD3 2WNUC 5JWPA 2JD4A 1JR7A 1HLCA 3P3PA 4JRLA 3B94A 1DYKA 2GH2A 2CY6A 1YHFA 3VHOA 1AR61 4HANA 1IHMA 3JB4C 3D4KA 1MS1A 1AR63 4FOQA 3WINE 3AYEA 1O3TA 1LECA 2D98A 4R9AA 4YNIA 2CNAA 2NMOA 3G7DA 4FTBA 2X5IA 3WCRA 1NCRA 4QX5A 3ZYIB 2OZ6A 4AFDA 4FOYA 4FPGA 4Q4Y2 1OS7A 3O14A 2UYBA 2ET7A 1S1AA 3DKWA 1BJQA 1TMF1 2EXIA 4YARA 1Q8OA 1QNYA 4A7YA 2OUHA 2Z79A 4KQ7A 1QMJA 3GZUC 1NE6A 3L9JT 1AXZA 1MS0A 4BOWA 4KH9A 1VAVA 3M8LA 2WINB 1XU2A 2XB6C 4DNYA 3VBOC 3WQ0A 1H1IA 3NVCA 2WLQA 3V56A 5C9AA 1WD3A 3J8F1 2V5YA 1K5MC 4PQ9A 1ND3C 1UX6A 4XPVA 1GQHA 3A0KA 5E89A 4OHYA 1BMV2 2VGDA 4E9KA 2WBOA 1RIRA 3HBZA 2UYAA 2R041 3TN93 1RUD1 1RUG1 4GALA 2YXSA 2YV8A 3LCPA 4JCKA 3VGIA 5J96B 1EAH2 4CDUC 1AYN1 2JE9A 3TRSB 4ZU4A 5FCCA 1PVC3 2D6LX 3GNEA 3NJZA 5D8AA 5FLJA 3VLBB 1OOPC 1A78A 5BNPA 2RM21