3TETA

Crystal structure of nak2k channel y66f mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tetA00
3OR6C 3E8HA 3LDEA 3SPIA 4RAIA 2A0LA 1K4DC 5J9PC 4R8CA 1OCOC 3GB7C 4KFMA 4F4LA 1JVMA 2ZXWC 1M57C 2AHYA 3AG3C 4H33A 1M56C 4MS2A 4P30A 4RUFA 4XDKA 3UKMA 2KB1A 1OCZC 4P9OA 2X6BA 4MVUA 4HZ3A 4RO2A 3LDDA 4XDLA 4BW5A 1R3JC 4WFHA 4WFGA 2HG5C 2QKSA 1R3KC 2DWDC 2WLLA 4GX0A 4MTOA 2DWEC 3JYCA 3OGCC 5KUMA 4R7CA 3F7YC 4PA7A 2NLJC 2YEVA 2EIJC 3E8FA 4MVSA 3BEHA 3LUTB 5KUKA 3FB8C 2Q68A 4GX5A 3K06A 4WFFA 3IFXA 3RBZA 4HYOA 4I9WA 4G28B 5B1AC 3RW0A 2Q67A 3E83A 4GX2A 5EBLC 5EC2C 4RUEA 3ABMC 4PA9A 4QE7A 3AG2C 2HVJC 2WLHA 4MVRA 1S5HC 2BOCC 2HFEC 2IH3C 2WLIB 3ABLC 3OR7C 3UM7A 3SYPA 1G4YB 4MTFA 4MTGA 3AG4C 1P7BA 2A9HA 3RVZA 2ATKC 4GX1A 4PA4A 2ITDC 3T2MA 3T4DA 2DYSC 1J95A 3E86A 1QLEC 3K04A 2WLNA 3HPLC 4JTAB 4X8AA 3PJSK 2HVKC 2ITCC 4PDVA 5EBWC 5EK0A 2K1EA 3OUSA 4MVZA 4JTCB 1OCRC 4J9ZB 2AHZA 4H37A 3SYAA 3SYQA 5CBGA 2A79B 2P7TC 2QTOA 4OXSA 3T1CA 4CBCA 3F5WC 3TETA 1XL6A 3F7VC 4P2ZA 2Q69A 5CBFA 1KKDA 1V54C 2R9RB 5IY5C 2Q6AA 3FB5C 4X88A 3K0DA 2X6AA 3LDCA 2WLKA 3RVYA 3STZC 4R50A 2EIKC 2DYRC 4UUJC 1OCCC 3ASOC 4X89A 5CBHA 1BL8A 3KG2A 1XL4A 4JTDB 3FB6C 2OCCC 5B3SC 2IH1C 3R65A 2Y69C 2EILC 3X2QC 3E8BA 2X6CA 3OUFA 1V55C 3ZJZA 1R3LC 3E8GA 2EIMC 4G27B 4MW3A 2WLIA 2W0FC 2BOBC 3SPGA 4MVMA 2WLLB 2WLMA 1ORQC 3ABKC 3K08A 2JK5C 4DXWA 3STLC 4XDJA 3T4ZA 3ASNC 2H8PC 4PDRA 3FB7C 1R3IC 4MSWC 4QNHB 3LNMB 4QE9A 4LP8A 4ZBMA 3TCUA 4P9PA 4PDMA 1LNQA 1ZWIC 4PA3A 2WLJA 3IGAC 4TWKA 3E89A 4PDLA 2EINC 3ZRSA 3EFFK 4PA6A 5BZBA 3VOUA 5E1AC 3SYOA 3K03A 3K0GA 4WFEA 4MVOA 3SJQC 4J9YB 4R6ZA 3WG7C 3SPJA 2ZD9A 5EBMC 3SPHA 4EKWA 3SYCA 1K4CC 3AG1C 4MVQA 5B1BC 3SPCA 5EC1C 4LCUC 4LBEC 4MW8A 2HJFC
chains in the Genus database with same CATH superfamily
5LA6B 1PD3A 3CRAA 4X62O 1AB3A 3UQ8A 1OCOC 2ZINA 4F4LA 1BGYH 5KHKA 3HKBB 1H2SB 5A2QN 1PL4A 3FAVB 2Y0PA 4HZ3A 4O2BA 3K79A 4ICGA 2VQEO 2DWDC 1VF7A 4HNAB 2NR5A 2YEVA 4MVSA 5D5QA 5KAIZ 3K06A 4WFFA 1J5EO 1SZXA 5K1PA 2WSSG 5KHIA 2RCVA 3UO2A 1P84F 1P4RA 5GW7A 2YXLA 3ZHSA 3G71V 2Z0AA 1OCCB 3AG4C 4D7SA 1O9HA 1IBKB 2PI5A 2WLNA 4X8AA 5HFLA 2L6LA 3PJSK 4W4KA 2UUAB 1D2DA 2JDIG 2B9ZA 2RNBA 4IL6Z 1JQ0A 4X1YA 5KMGA 4NVPA 3F7VC 4DW1A 2QEXV 2ZNJA 5IY5C 3U0ZA 4FLUA 2IJIA 2OWOA 1X59A 3ETGA 3KG2A 4JTDB 2UUCO 3CXCU 3ETEA 2Y69B 4X20B 4DW0A 3H1IH 3NXSA 3AEIA 3E8GA 4G27B 4QGPA 4MW3A 2W0FC 3G80A 3JARA 1XMOO 1ORQC 3CPWU 1K34A 3CSXA 4E2LA 3P3PA 1YJWV 3ETQA 4O4IB 4YIOA 3KZIZ 4QE9A 2N74A 3CWBH 3IGAC 3B40A 4AQYO 3CCSV 1K5SA 4X65O 4CH4A 1I94B 2UXDO 4X9QA 1QVGU 3DTUB 1RFYA 2ETNA 4YHHB 2BE3A 4FMTA 4RAIA 3CP1A 3ZHRA 2ZXWB 1JVMA 1YCIA 3AG3C 4I4TA 1D5AA 4G2KA 5LHIA 2M7WA 1MNGA 1NZ6A 4WFHA 4GX0A 1NH2B 4YJ3B 3NR7A 4PA7A 2EIJC 1WLEA 4QJFB 3CCRV 4JI8O 3IFXA 3H1JH 1X4TA 5B1AC 1XREA 2UXBO 5EBLC 1Q6UA 1MMMA 5IYZB 1W2BU 1GO3F 1NBMG 1NT2B 2OIGA 2HJDA 5TISZ 1B06A 2XHBA 1Q81W 2IJKA 3RYFA 2UXCO 1QLEC 4K35A 3ICXA 3MAQA 2W0XA 3OM3B 4O2BB 1H2KA 2IJHA 4X66O 4ASUG 1XMQO 5CBFA 2R9RB 4ZOLB 5LGTA 3JAKA 3RYHB 4OX9B 3RYIB 3ZHUA 2FKXA 3I55V 3B8NA 4EEQA 1Z5WA 3E35A 3B8MA 1BL8A 1HNXO 2YIBD 3JCZA 1PP9H 1SQBH 4YY3O 1IBLO 1R3LC 1HR0B 4DR4B 4LFCO 1WNSA 4U7OA 4X1KA 3OT7A 2H3OA 4J42A 5IJ0B 2LP7A 4DR7B 3JD2A 2M6YA 4DV5O 3FFQA 2W6IG 1YTFB 3G6EV 5H9CA 4DV6O 4JI2B 4BIZA 2QM7A 1AILA 3QVNA 2R70A 4R6ZA 4WBNA 4DV0B 3B4SA 4GUNA 4PELA 5IJ9A 1KECA 3LDEA 3DC5A 3CYOA 2FYUH 3GB7C 5H6RA 2R9IA 1I08A 4Z2WA 4P9OA 2HP8A 4DR1O 4FIPC 2F93B 1R3JC 4LH6A 5J2TA 3QF7A 1SA0A 1FFXB 3JYCA 4R7CA 2QM4A 4H44B 5LHHA 2XASA 5H6QA 3TK1A 1VQPV 1AP5A 1GH6A 2W6JG 4YJ2B 1RM1C 4FK5C 2EZPA 1VF6C 3AG2C 4XBFA 3M7MX 4B3MB 3RGBA 2PTMA 2Q0AA 2YC0A 1E1RG 1XHZA 1S3JA 5LP6A 1KU9A 5LOVB 1Q5OA 1PM9A 3SJBC 4LWSB 1Q6IA 4UB6Z 3KKYA 1Q8IA 2IW5A 3R66A 4K0KB 3AK2A 1WAZA 4QPJA 4X88A 1GM8A 3E22B 4R50A 2XT9A 1M9NA 3JAWA 3CCQV 4TOIA 1KP3A 4FPPA 5B3SB 1JFFB 1ZSPA 4DYLA 1H2LA 2IH1C 1URFA 2PZSA 1JJ2U 1KB9F 3ML0A 4B3SB 3JD3A 4UCVA 3O9OA 4QNHB 3K5LA 4ZIBA 2BTQB 4PA3A 1SKVA 3KCYA 4PDLA 2EINB 2PYLA 2F4VB 2QR4A 1Q90D 4IHJA 1F51A 1DLBA 4MVOA 2KSDA 1U97A 2FMLA 3MHSC 2WAMA 3QTCA 3SPIA 3RYCB 2F95B 3WU2Z 4DR5B 3BVOA 1DK1A 3OD4A 2P4KA 2JGDB 3RFRA 3C3TA 1OCRB 2Q7HA 1R6TA 2QWOB 1K97A 1Z2GA 3HR0A 4DV7O 3TXSA 1I94O 2ZT9B 3RW0A 5L3BA 3H1LH 1IXBA 1WA8A 4YHHO 3LSQA 4JI1B 5LP6C 1NVPD 1AJPA 2WLIB 2GSMB 5KAFZ 2YUAA 2P6JA 1S0VA 2WA4A 3HPLC 1M1KW 3CB2A 1VQ7V 3FD9A 3OAAG 4DV1O 2AZ0A 1Y76B 1KD1W 3WB0A 2LGWA 3F5WC 2QKAA 1YZBA 3AK3A 4O4JA 1ENVA 3IJ4A 1N36O 1O9GA 5J2UB 3CRQA 2UUCB 3W7UA 4GKJB 1EN4A 1WPBA 3X2QB 3S3XA 3K9SA 5KX5B 2D2CB 2WLLB 1UJWB 2UXNA 3ABKC 1AI4A 1JX9A 5FL7G 2VQFB 1H8HG 3LNMB 4B3TB 3GVMA 3ZCCA 1ZWIC 4OX9O 4DK1A 4JV5O 2R9AA 1VQOV 1EFRG 1LUVA 2Y0IA 2GDSA 2HHHB 4UCRA 4FLYA 3WG7C 1DF5A 4FJCC 1R6NA 3SPCA 4J10A 5L3CA 4ZHQB 2JRIA 5CA0B 1HR0O 4DR4O 1YDXA 4I0XB 5CMUA 5J9PC 1HNWB 4FLVA 1FXVA 3H9VA 5EYPA 2PY5A 3B77A 1OCZC 4DR7O 1RP3B 1E79G 3ZMSA 1K3EA 4I55A 5EIBC 1QNMA 1V9PA 1XI1A 4WFGA 1K9MW 3C3SA 3OE7G 4JYCA 1BQZA 3Q4HA 2MK3A 2PF4E 4N23A 2UXBB 1MZEA 1SQGA 1E1QG 3E83A 1NTMH 4QE7A 4IYIA 5EZYA 1SESA 3L72H 3CMAV 3OW2U 3H01A 1G4YB 3I56V 2UXCB 4I9QA 2C2AA 2DYSB 3T2MA 3E86A 2XAJA 1KP2A 4LFAB 2CH7A 3SYQA 4H37A 3CRRA 2GUZB 4ZKIA 2DMXA 2XNDG 3MD0A 2Q7EA 5CN0A 1F4NA 1CPYA 1HWYA 2WWWA 4TQDA 4LF8B 3UT5B 4LNUA 5FNVB 1D5NA 5L3DA 5BR8B 2BSKA 1SS3A 4B3MO 4K8XA 1M5IA 1TVKB 1F23A 5CB4B 2N05A 4WF9V 2EILC 4YY3B 3ZMTA 5L3FA 2EIMC 1S76D 4HBNA 5LHGA 2JK5C 3PN1A 1OJHA 3FB7C 1IZ3A 1QHTA 4H13B 2XAGA 2JVDA 4K0KO 4LP8A 1HP8A 3HKDA 3ZRSA 3AK1A 3VOUA 3K03A 3K0GA 3JASB 4F6RA 4OGQB 2E74B 3SYCA 1GMGA 1H2MA 5BXZA 4MW8A 4B3SO 3E8HA 2E76B 1Q6HA 2A0LA 3JALB 1NQTA 4XDKA 2KB1A 1AR1B 1GAXA 1AI5A 4GLXA 1I7FA 3CXHF 3JD1A 2ZKOA 3HKCB 1HNZO 4FFBB 5GONA 2F4VO 3ZHVA 1S72V 5KUKA 3APOA 1PL0A 4DR2B 3RBZA 1XUQA 3ZEDA 1YSCA 4JYYA 4PI0A 3N2KB 1AJQA 2WLHA 3SGIA 3FKSG 3ABLC 5ITZB 3CJHB 4MTFA 2RMKB 4YXWG 4DR5O 1XNRB 3SJAC 1RPOA 4UCSA 2OCHA 1BS3A 1FXKB 3TETA 3N27A 4YIPA 2LFRA 2WA3A 3U10A 5JCOC 5LMUB 3CD6V 5B1OA 4EB6B 2XTAA 4JI1O 1US6A 4CS4A 5JQGA 1NTZH 4DR6O 2OCCB 4TUYA 2Y69C 2JJ2G 1L1FA 5E79Z 3VBBA 5JJNB 2YIDA 2EJ7A 1KQSU 4I50A 3T4ZA 3ASNC 3K5MA 4MSWC 1XHXA 1HW7A 1GM7A 1LNQA 2CTWA 4DUYB 3QG5A 1Q3EA 5C8YA 4J11A 4DV3B 3QNEA 1NVPB 5FPRA 4GKJO 5GTHZ 4NTWA 4LH7A 3M99B 3HKEA 2LGQA 3SPHA 4JF3A 1KUQA 4RWUA 3ZRWA 4LCUC 4JI6B 2GTAA 3OEEG 2QKCA 3K58A 1RSOB 3CC2V 2P06A 2ZXWC 1M57B 4IYHA 3UKMA 1ZL8B 4D7TA 2VQFO 5LGNA 5IE9A 1JPXA 3CCUV 4B3TO 2Y48A 5KUMA 1KBHA 2KG7A 4JZ2A 4DV7B 4J7ZA 2HHHO 3OMAB 4KHPB 3L71H 3ABMB 3D3IA 1PNLA 5IY5B 2ZE7A 1GK9A 2HFEC 3G67A 1FJGB 1HNWO 4Q20A 1ZTEA 2A9HA 3T1YB 1EBOA 2EJRA 2OIEA 4WCEV 2OT5A 4DV1B 1TUBA 2K1EA 1QR8A 4J9ZB 4Z1VA 2P7TC 5LXTA 5KHHA 4UFZA 4NTXA 4FVMA 4C7UA 2V7QG 1BQ0A 1N36B 3BY6A 4X64B 3JATA 3MDSA 3ASOC 2JEXA 1THZA 2HR3A 5JJEB 2UUBB 1VF6A 2E75B 3E8BA 3CC7V 4K3AA 3UCSC 3CCLV 1MSDA 5DN6G 4LFAO 3IAYA 2PYJA 4DK0A 3WB1A 4FM0A 4J80A 2YEVB 3LSSA 3AG3B 4ZBMA 4LF8O 4O4LA 2LW1A 5FLXN 4LFBB 5BR8O 4JV5B 4KXRA 5JJJB 2UU9B 5E1AC 3BA9A 4JAAA 3D36C 3AG7A 4OPHA 1UFIA 5B1AB 1VQNV 2A3QA 3OFNG 2QSAA 4U3JA 4UB8Z 4J7KA 4DUZB 1G1XB 5KA5A 1A32A 3TJTA 4PV1B 2K9PA 2DW4A 4MS2A 4X1YB 5KMGB 2QM8A 4JGSA 4BW9A 4RQFA 3LDDA 2LJ2A 1DF4A 4FFKA 3OEHG 4FLXA 2DE0X 4LC1A 3LUTB 2E3CA 4I9WA 4G28B 3OTFA 4UV9A 3FYEB 2JS3A 5EIBD 3SR2C 4O4HA 1Y6XA 4NXNB 2BOCC 3EHBB 3JARB 4CZZA 1P7BA 5LBQA 2CGNA 1J95A 1IURA 1QR9A 2HVKC 3L9DA 3CS5A 3DXRA 1PPJH 3SDLA 3T1CA 4P2ZA 4DR2O 1W59A 2X6AA 3LDCA 2F23A 2EIKC 2DYRC 4UUJC 1B6QA 4L8JA 3FB6C 5B3SC 4I4TB 1XNRO 1V55B 3OUFA 4FM2A 4X1IA 3BHPA 3A0HZ 3SPGA 2Q0OC 4IT5A 3VQXA 5JWPA 2H8PC 4GZRB 2ZE6A 4JI3B 5LMUO 2Q9LA 1QLNA 3RT3C 4HAMA 1CEZA 1GN6A 2EINC 5BZBA 2B5UA 3O65A 2YIAA 1AJNA 3N2GA 5BMVA 1RM1B 3RYFB 3K59A 5LYJA 1VARA 2Q7GA 2ZE5A 5LGUA 2ADQB 2AW9A 2UXXA 1W0KG 1F7YA 4Z1MG 1JCHA 1VMGA 3CCEV 1M56C 3CC4V 1ZLZA 4DV4B 2ADPA 2YI9A 1TAEA 2A06H 1VQLV 4DUYO 3JAKB 3W7WA 1HNZB 3G4SV 1SC5B 3OGCC 4DV3O 3D8CA 2CDYA 3E8FA 4W4LA 2NN4A 2YSUB 3CEIA 2Q67A 4RUEA 1SQPH 4U7NA 4TV9A 4JI6O 3VQWA 2B1IA 1Y66A 2JIZG 1S5HC 3M8AA 4H0LB 3UM7A 2KQXA 4X1KB 2YXHA 4JZGA 3ZS8C 1YJ9V 4JTAB 1HDJA 1JOYA 2Z5UA 2A79B 4OXSA 4CBCA 3K3WA 2QDOA 3J7AU 4KL1A 4KHPO 2DQ3A 1KMIZ 4WBNB 4UVCA 1S77D 3K0DA 3RVYA 3JD0A 4DR6B 3ZMZA 1Q82W 1N32B 5IJ9B 3P3NA 1FJGO 2X7RB 3W7TA 5CA1A 3A8TA 2P22C 3T1YO 3X2QC 1FAFA 1FXHA 4TV8A 1Y74A 5LMNB 4O2AA 2DOSA 5JH7A 2DJVA 5IYBO 5J2TB 1SA0B 4PHZA 4PJ0Z 2B1GA 3SJCC 4JI0B 4BR6A 1VQ4V 3IC9A 1YHQV 4X64O 2QJ1A 2VRZA 3VQYA 4DRXA 3ZN1A 1Q7YW 1SQQH 3SPJA 2UUBO 5KA6A 3K9AA 3AG1C 2R72A 1G6UA 2PUSA 1SETA 3JSLA 4JYBA 3OR6C 3K57A 5LP6B 4CH3A 4ZI7A 4FM1A 1GN2A 2P5OA 2MW2B 3BFRA 2ZQMA 4IIJA 4OPAA 1R3KC 4MTOA 3IC7A 2DWEC 4LFBO 2Y4TA 2UU9O 4AHCA 3FB8C 5CA3A 3JAWB 2ZNIA 4GT1A 4MVRA 1N33B 2QWRB 2AXTZ 1NH2D 3HB3B 2RN9A 4DUZO 2DYSC 5K1XA 3K04A 5JVDA 4LF7O 1WP8A 5LA6A 1NI8A 1OZ0A 1IXMA 5EBWC 3OUSA 4B7KA 2AHZA 5CBGA 2QTOA 3HKBA 3THOA 4IHJB 3FAVA 2AZ2A 3CRMA 4EFBA 2RJZA 2CE4A 4D6TH 3A2FA 2XAQA 4NXNO 4MTXA 5CBHA 3WG7B 1T5EA 1Q43A 3ZJZA 1N4CA 2BOBC 2ZM6B 4JI4B 2WLMA 2CTRA 4NKGB 3CE2A 4CS3A 2A7WA 4B3RO 4PDRA 2ILMA 5C93A 4TT3G 1Y4MA 4U3FH 3E89A 3CRCA 1WA8B 1GKFA 4JYAB 2QA4V 5JCOA 3ZIAG 2ZIOA 3ABUA 2P4VA 3ZN0A 1VQ6V 4NTYA 4MVQA 4FLZA 1NTKH 1H8EG 1QVFU 4KFMA 4X20A 1N0NA 4H33A 2AHYA 1QU7A 5F2VO 4JI3O 4MVUA 4O4JB 1JR9A 1ZAUA 1IBMB 3H1KH 5IWAB 1SQFA 2NLJC 5KHJA 4O4IA 4DV2B 1VEWA 3ZMVA 2FB5A 4PA9A 5DEDA 4A5UB 3OR7C 3SYPA 3P32A 3BRCA 2ZCEA 2EILB 1L0NH 3F5TA 3JCUZ 4DV4O 1YITV 3DC6A 3ZRVA 2IU0A 1VF5B 3K5NA 2ARHA 1H2NA 2FTKA 3OGIB 2JJ1G 4FZ0A 4NR1A 1V54B 3DSQA 3VQVA 1SZTA 2ZDIA 2V4DA 1IX9A 1MABG 4UVBA 4YJ3A 1U96A 1TGOA 4B08A 1BHAA 1OCCC 3WB2A 2EULA 2Q5ZA 2OCCC 1MG1A 1PKXA 2EBOA 5EYPB 1I5XA 5IYZA 1KKCA 4I55B 4LF9B 4MVMA 3BABA 3Q4HB 5D5PA 2ZIMA 1MZFA 3L70H 4P9PA 4FZ1A 1XEQA 4QPKA 2WLJA 1YXBA 2LFSA 5EZYB 1N32O 4GYCB 1XNQB 4UV8A 3SJQC 4ZOLA 3L75H 4WFBV 3RYHA 1K8AW 1ZX3A 3RYIA 5B1BB 5LMNO 2VWJA 2QWNB 5FPOA 4LF6B 2GTSA 1LUWA 2CH7B 3JAMN 1OCOB 3ABLB 1M57C 2OYQA 4JI0O 1GTOA 2X6BA 4IGGA 2XOKG 4LNUB 2BSKB 5IJ0A 1LR1A 5IT9N 1XILA 1Z5VA 2Q68A 4GX5A 1JA8A 4HYOA 4LF5B 3QO8A 2KKWA 2GBOA 2QGNA 3I5DA 3WFVA 4GCZA 4K8ZA 1B04A 3ABMC 3CCJV 4N21A 4JI7O 3D36A 2LQTA 3ZRXA 2CUGA 3AG4B 4LF4B 4FLTA 2EX3A 3RVZA 2CGOA 3CMEV 5H5NA 2ZDIC 2ITCC 2GV9A 1SRYA 1UPGA 3FX7A 2P67A 4JTCB 3HKDB 2HLDG 1BHBA 3P30A 2FL4A 3ASNB 4F6RB 4ABMA 1FFXA 1YF2A 5KHGA 3C90A 1N33O 2DQ0A 4YJ2A 1AROP 3ZX6A 4RQEA 2YS8A 2GHYA 2CAZC 4J7JA 4AILC 1S5LZ 2OTLV 1XBLA 5GONB 1NR7A 1CP9A 2BTOA 1FKAO 3L73H 1DTOA 3TCUA 5LOVA 4LWSA 5AG2A 4LR3A 2DN9A 2VWKA 2ZD9A 5EBMC 2YICA 4FLWA 3E22A 3ABTA 1GM9A 5HFMA 2ZM6O 3BCCH 4JI4O 1JFFA 4UXNA 4CH6A 4RUFA 1P7GA 1H2GA 4BW5A 2HG5C 2WPDG 4JYAO 3UO3A 2ODMA 2EIJB 5JQGB 4I5SA 4GKKB 4TUYB 2BTQA 2XAHA 2PI4A 3K5OA 2YI8A 1M93A 2Q4PA 1RPRA 1FFTB 3ASOB 4LF7B 2ATKC 4I50B 3OMIB 1QLEB 2D3OW 2VS0A 3QO7A 2H94A 5EK0A 1IBMO 4MVZA 5IWAO 3SYAA 4QIWF 3RYCA 2ZE8A 1QBZA 5C8YB 1XL6A 4DV2O 2Q69A 2JGDA 3S3WA 4JAUA 3HKEB 2Q6AA 4AI8A 5DM6V 2CK3G 3TGUH 4UCTA 3ZRWB 4KUMA 1NS1A 1YEWA 2NNUA 3LNNA 5GTIZ 2ZR3A 1V55C 3CCMV 2WLIA 3T1HO 1GRJA 4B3RB 4TQFA 1WJZA 2KG7B 2HEPA 1BT8A 1Y76A 4PA6A 3ETDA 1EZVH 4DO2A 1BSMA 2HKOA 1PNKA 3LSUA 5EC1C 5J2UA 1AI6A 3RWRD 1IVSA 4JI5B 1YI2V 1TUBB 4LF9O 3CX5F 5LXTB 2CTQA 2JEUA 2PGGA 4XDLA 5KX5A 2QKSA 2WLLA 3JATB 2JGUA 1XNQO 1M4UA 3B09A 4JPRA 1AVMA 4WFAV 1FS0G 4JAVA 3AG2B 4NXMB 1TUEB 4E4EA 1R73A 4LF6O 2EIKB 2DYRB 3GWOA 3BAAA 2EZOA 4TSFG 3H1HH 4DR3B 1VQ8V 4ZHQA 1IBKO 3OTOB 2E5LB 1N34B 5CA0A 4I0XA 1OCRC 2XUMA 4O4LB 2UUAO 1KC8W 1P49A 4L87A 4J41A 5DECA 2BCCH 2IJJA 1FPOA 1XDCA 4UCOA 4LF5O 3KCXA 1KKDA 1BZKA 1DGSA 3FB5C 1K73W 1OV9A 1PNMA 1EN6A 3STZC 3CCVV 1MSWD 4U3JB 1N0JA 4LF4O 2YIBA 1TA8A 1EM1A 1G8MA 2X6CA 1GN3A 2Q8VA 4EFEA 3BPZA 1NU1H 4X62B 3STLC 1L8DA 1SQVH 2AGAA 3EXAA 1M56B 1I5YA 4JASA 1COWG 2L35A 1K92A 4TWKA 2VQEB 2GUZA 3EFFK 1WB7A 1L0LH 4O4HB 3W7XA 1J5EB 5L3GA 4CC5A 3ZHTA 3GWKC 3J81N 3UT5A 5B5EZ 5FNVA 2IBZH 4LBEC 2HJFC 2N04A 1TVKA 5CB4A 3DXRB 1NJIW 5KLVH 1I0HA 5H2FZ 2F1MA 4P30A 3APQA 3ZHQA 3F7YC 3QO5A 4Q6GA 1AR5A 2XAFA 3J80N 1H38A 5EC2C 4JI7B 1EZJA 4X1IB 1B3QA 1YJNV 3L74H 3JASA 5L3EA 4MTGA 5IYCO 5IYDO 3MHHC 3T4DA 5A9GA 2F43G 5IDJA 1R1BA 3W7SA 1K33A 3JALA 3B2EE 1F4MA 1YIJV 1XMOB 3JD4A 3FYIB 2OTJV 4BWAA 1MA1A 1GN4A 4GKKO 4CH5A 3N2GB 1QCEA 5BMVB 2F66C 2V1DA 1VQMV 3HKCA 2WLKA 4FFBA 5LYJB 2RQ6A 2G38A 4AQYB 5B66Z 1IDSA 1OHHG 4X89A 4X65B 1WP7A 5B1NA 1KYOF 2UXDB 3R65A 3N2KA 1EN5A 4UVAA 1SF9A 4CC6A 1PV0A 2QWPB 3AG1B 1N8RW 3DGEA 1YVWA 5ITZA 3CJHA 3ABKB 4NB5A 1VQ9V 1SERA 4XDJA 1R3IC 2LW7A 2CTPA 4HNAA 1FXKA 3EVKA 4PI2A 1VQ5V 4TV9B 3SYOA 4JI2O 4JI8B 1MOFA 3A0BZ 4B7EA 3A0RA 4EB6A 1QQCA 3JSNA 4DV0O 2QWQB 1AI7A 1K4DC 2Z3YA 4R8CA 3ZMUA 1FYJA 2Q73A 5BY1A 4CS2A 1OCZB 4BIUA 2X0LA 1BCCH 1NKDA 3E2EA 4RO2A 2YXYA 1BE3H 1K5QA 1WN7A 4X66B 3BEHA 3CHXA 1XMQB 5CA1B 1Q86W 5LL6Y 4GX2A 1SQXH 4TV8B 1Y74B 3BA8A 2HVJC 1YTFD 3U11A 4O2AB 4JI5O 2IM9A 2RDCA 5JH7B 2IH3C 1ROPA 1HNXB 4GX1A 3D3QA 4PA4A 2ITDC 1IBLB 3RN4A 4PDVA 4LFCB 1RSOA 3TXQA 4NYKA 2LO1A 1ZL8A 1R6KA 4DRXB 1V54C 4DV5B 1VQKV 1AP6A 4BIOA 4F6EA 4NXMO 2YDEA 4DV6B 2QE7G 4MT8A 1CXZB 1XL4A 4ZI7B 1XQ8A 2O57A 1AR4A 2JS5A 1ZUQA 4DR3O 3OMNB 3T1HB 3OTOO 2E5LO 1N34O 1FXKC 2EIMB 2Y4UA 4KP4A 4I7ZB 4IIJB 1FD9A 1VIBA 1WPXA 1BMFG 2ZR2A 3K08A 1Y67A 4DXWA 3G6BA 1JJOA 1VP7A 1XOUA 1WB8A 1W0JG 4DR1B 3ZBHA 4PDMA 1NR1A 4UCUA 4BAYA 4WFEA 4J9YB 1K7DA 1JMKC 1S5JA 2P90A 1K4CC 4PD4F 2IU3A 5B1BC 5JVDB 4EKWA 1M90W 2QTSA
chains in the Genus database with same CATH topology
5LGUA 5HFMA 1PD3A 2UXXA 1W0KG 5CMUA 4Z1MG 1JCHA 5J9PC 4UXNA 1OCOC 1FXVA 4F4LA 3CCEV 4RUFA 1M56C 3CC4V 3B77A 1OCZC 1H2GA 1E79G 4HZ3A 3ZMSA 1K3EA 4BW5A 1VQLV 3K79A 4WFGA 2HG5C 3W7WA 3G4SV 2DWDC 3OE7G 1K9MW 3OGCC 2WPDG 4JYCA 2EIJB 2YEVA 4I5SA 2MK3A 4N23A 3E8FA 4MVSA 2YSUB 3K06A 4WFFA 2WSSG 2Q67A 1E1QG 2XAHA 3E83A 4RUEA 4U7NA 4QE7A 2PI4A 1P4RA 1SESA 5GW7A 2B1IA 1Y66A 2JIZG 1S5HC 3CMAV 3OW2U 3H01A 1RPRA 3G71V 1FFTB 3UM7A 1G4YB 1OCCB 3AG4C 3ASOB 3I56V 2ATKC 2C2AA 2DYSB 3OMIB 3T2MA 1QLEB 3E86A 2PI5A 2XAJA 1YJ9V 2WLNA 1KP2A 4JTAB 4X8AA 3QO7A 5HFLA 2D3OW 3PJSK 2H94A 5EK0A 4MVZA 1JOYA 3SYAA 4QIWF 2JDIG 4H37A 3SYQA 1QBZA 4ZKIA 2Z5UA 2A79B 4OXSA 2XNDG 1JQ0A 4CBCA 3K3WA 3MD0A 1XL6A 3F7VC 2QEXV 2Q69A 1F4NA 5CN0A 1CPYA 1HWYA 2WWWA 2DQ3A 4JAUA 5IY5C 2Q6AA 5DM6V 2CK3G 4UVCA 1S77D 3K0DA 3RVYA 3JD0A 3ZRWB 2IJIA 5L3DA 4KUMA 3ZMZA 1Q82W 3ETGA 1F23A 2NNUA 2X7RB 3W7TA 3KG2A 4JTDB 3CXCU 3ETEA 2Y69B 4WF9V 2EILC 3X2QC 3ZMTA 1FXHA 2ZR3A 1V55C 3NXSA 3AEIA 5L3FA 3E8GA 2EIMC 4G27B 3CCMV 4MW3A 1S76D 2WLIA 2W0FC 5IYBO 1ORQC 5LHGA 3CPWU 1K34A 2JK5C 2B1GA 4E2LA 1YJWV 3FB7C 2XAGA 4QE9A 4LP8A 1VQ4V 3IGAC 1YHQV 3ZRSA 4PA6A 3ETDA 3VOUA 3CCSV 1K5SA 3K03A 3K0GA 3ZN1A 1Q7YW 4DO2A 3SPJA 5KA6A 3K9AA 3SYCA 1QVGU 3AG1C 3DTUB 1GMGA 2HKOA 1PNKA 5EC1C 4MW8A 1SETA 1AI6A 4JYBA 3OR6C 3E8HA 1YI2V 4FMTA 4RAIA 2A0LA 3CP1A 1NQTA 2ZXWB 1JVMA 3AG3C 4XDKA 4G2KA 2KB1A 2JEUA 1AR1B 5LHIA 1AI5A 2M7WA 2ZQMA 4XDLA 3JD1A 4WFHA 4GX0A 2QKSA 1R3KC 2WLLA 4MTOA 3IC7A 1NH2B 2DWEC 4PA7A 2EIJC 1WLEA 4QJFB 1S72V 5KUKA 3FB8C 5CA3A 3CCRV 1PL0A 3IFXA 3RBZA 4JPRA 5B1AC 4WFAV 1YSCA 5EBLC 1FS0G 4JAVA 3AG2B 1AJQA 4GT1A 1W2BU 2WLHA 4MVRA 1TUEB 1GO3F 1NBMG 1R73A 1NH2D 3HB3B 3FKSG 2EIKB 3ABLC 2DYRB 4MTFA 3GWOA 1Q81W 2IJKA 2EZOA 4TSFG 4YXWG 2DYSC 1QLEC 3K04A 1VQ8V 1OZ0A 1IXMA 1RPOA 5EBWC 3OUSA 1FXKB 1OCRC 3OM3B 2AHZA 1KC8W 4L87A 5CBGA 3TETA 2IJHA 2QTOA 4ASUG 2LFRA 5CBFA 2IJJA 3CD6V 1KKDA 2R9RB 5B1OA 5LGTA 3FB5C 1K73W 1PNMA 2XAQA 3STZC 3I55V 3B8NA 5L3CA 3E35A 3CCVV 1MSWD 4MTXA 3B8MA 1BL8A 5CBHA 2OCCB 2Y69C 2JJ2G 1L1FA 1G8MA 3JCZA 3WG7B 2X6CA 3ZJZA 1R3LC 3VBBA 2BOBC 2WLMA 4U7OA 1KQSU 3STLC 3T4ZA 3ASNC 4PDRA 2LP7A 1M56B 1I5YA 3JD2A 4MSWC 4JASA 5C93A 1COWG 4TT3G 1Y4MA 1GM7A 1K92A 1LNQA 2W6IG 4TWKA 3E89A 1YTFB 3G6EV 5H9CA 1GKFA 3EFFK 3QNEA 1NVPB 2QA4V 4BIZA 2QM7A 3W7XA 3ZIAG 3M99B 5L3GA 4R6ZA 3ABUA 3SPHA 3ZN0A 1VQ6V 4JF3A 4MVQA 3ZRWA 4LCUC 4LBEC 2HJFC 4PELA 1KECA 3LDEA 3OEEG 3CYOA 1H8EG 3GB7C 4KFMA 1NJIW 3CC2V 1QVFU 2ZXWC 1M57B 5H6RA 4H33A 2AHYA 3UKMA 2R9IA 4P30A 4P9OA 5LGNA 4MVUA 1JPXA 4FIPC 3CCUV 1R3JC 2Y48A 3JYCA 5KUMA 4R7CA 3F7YC 5LHHA 2NLJC 3QO5A 2XASA 5H6QA 3TK1A 1VQPV 2XAFA 2W6JG 1RM1C 1H38A 3ZMVA 4FK5C 3OMAB 5EC2C 2EZPA 3ABMB 3D3IA 4PA9A 1EZJA 1PNLA 5IY5B 3AG2C 4XBFA 1YJNV 1GK9A 2HFEC 3OR7C 4Q20A 3SYPA 5L3EA 3P32A 4MTGA 2A9HA 1EBOA 5IYCO 5IYDO 3MHHC 3T4DA 2EILB 2EJRA 4WCEV 2OT5A 2F43G 1E1RG 5IDJA 1S3JA 3W7SA 1YITV 1K33A 2K1EA 3ZRVA 1QR8A 4J9ZB 1F4MA 2IU0A 1YIJV 3JD4A 2P7TC 3FYIB 2FTKA 2OTJV 2JJ1G 2IW5A 2V7QG 1V54B 1QCEA 1SZTA 2ZDIA 2V1DA 4UVBA 1MABG 4QPJA 4X88A 3BY6A 1GM8A 1VQMV 2WLKA 4R50A 1BHAA 1M9NA 1OCCC 1OHHG 3ASOC 4X89A 2JEXA 3CCQV 5B1NA 1KP3A 1THZA 4FPPA 5B3SB 2HR3A 2OCCC 2IH1C 1MG1A 3R65A 1PKXA 2EBOA 4UVAA 3E8BA 3CC7V 1JJ2U 1I5XA 3AG1B 3ML0A 3CCLV 5DN6G 3JD3A 1N8RW 3DGEA 4MVMA 3ABKB 1VQ9V 1SERA 4XDJA 2YEVB 3LSSA 1R3IC 3AG3B 4QNHB 4ZBMA 4P9PA 1FXKA 4QPKA 4PA3A 2WLJA 1VQ5V 4PDLA 2EINB 2LFSA 1F51A 5E1AC 3SYOA 1DLBA 1MOFA 4MVOA 4UV8A 3SJQC 4WFBV 3A0RA 1K8AW 5B1AB 5B1BB 3MHSC 2WAMA 1VQNV 1AI7A 3OFNG 3SPIA 1K4DC 2Z3YA 1OCOB 4R8CA 3ZMUA 5KA5A 3ABLB 1M57C 2DW4A 4MS2A 2QM8A 1OCZB 4BIUA 1GTOA 4JGSA 2X6BA 2X0LA 1NKDA 4RQFA 3E2EA 4RO2A 3LDDA 2XOKG 1DF4A 1K5QA 1OCRB 3OEHG 3BEHA 4LC1A 3LUTB 2Q68A 4GX5A 1K97A 4HYOA 4I9WA 1Q86W 3QO8A 4G28B 3RW0A 5L3BA 4GX2A 3WFVA 4GCZA 3ABMC 4UV9A 3FYEB 3LSQA 2HVJC 3CCJV 4N21A 1YTFD 3D36A 3ZRXA 2BOCC 1AJPA 3EHBB 1NVPD 2IH3C 1ROPA 2WLIB 2GSMB 4CZZA 3AG4B 1P7BA 3RVZA 2P6JA 4GX1A 1S0VA 4PA4A 2ITDC 5LBQA 1J95A 3CMEV 1QR9A 3HPLC 1M1KW 2ZDIC 1VQ7V 2HVKC 2ITCC 3OAAG 4PDVA 1SRYA 2P67A 4JTCB 1KD1W 3T1CA 2HLDG 3F5WC 1BHBA 1R6KA 3P30A 4P2ZA 3ASNB 1V54C 1VQKV 1ENVA 2X6AA 3LDCA 2QE7G 4MT8A 2EIKC 2DYRC 2DQ0A 4UUJC 3W7UA 1B6QA 1XL4A 1AROP 3FB6C 5B3SC 3X2QB 3OMNB 1V55B 3OUFA 1FXKC 2EIMB 4KP4A 4RQEA 1WPXA 2GHYA 3SPGA 1UJWB 1BMFG 2WLLB 2UXNA 2ZR2A 1AI4A 3ABKC 3K08A 4DXWA 2OTLV 1JX9A 1NR7A 2H8PC 1CP9A 1W0JG 5FL7G 1H8HG 1DTOA 3LNMB 3TCUA 1QLNA 4PDMA 3ZCCA 1ZWIC 4HAMA 1CEZA 2EINC 1NR1A 5BZBA 2B5UA 1VQOV 1EFRG 4BAYA 4WFEA 1AJNA 4J9YB 1K7DA 3WG7C 1DF5A 2ZD9A 5EBMC 1RM1B 4FJCC 2P90A 1K4CC 1M90W 1R6NA 2IU3A 5B1BC 3SPCA 4EKWA 3ABTA 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR6 C;  3E8H A;  3LDE A;  3SPI A;  4RAI A;  2A0L A;  1K4D C;  5J9P C;  4R8C A;  1OCO C;  3GB7 C;  4KFM A;  4F4L A;  1JVM A;  2ZXW C;  1M57 C;  2AHY A;  3AG3 C;  4H33 A;  1M56 C;  4MS2 A;  4P30 A;  4RUF A;  4XDK A;  3UKM A;  2KB1 A;  1OCZ C;  4P9O A;  2X6B A;  4MVU A;  4HZ3 A;  4RO2 A;  3LDD A;  4XDL A;  4BW5 A;  1R3J C;  4WFH A;  4WFG A;  2HG5 C;  2QKS A;  1R3K C;  2DWD C;  2WLL A;  4GX0 A;  4MTO A;  2DWE C;  3JYC A;  3OGC C;  5KUM A;  4R7C A;  3F7Y C;  4PA7 A;  2NLJ C;  2YEV A;  2EIJ C;  3E8F A;  4MVS A;  3BEH A;  3LUT B;  5KUK A;  3FB8 C;  2Q68 A;  4GX5 A;  3K06 A;  4WFF A;  3IFX A;  3RBZ A;  4HYO A;  4I9W A;  4G28 B;  5B1A C;  3RW0 A;  2Q67 A;  3E83 A;  4GX2 A;  5EBL C;  5EC2 C;  4RUE A;  3ABM C;  4PA9 A;  4QE7 A;  3AG2 C;  2HVJ C;  2WLH A;  4MVR A;  1S5H C;  2BOC C;  2HFE C;  2IH3 C;  2WLI B;  3ABL C;  3OR7 C;  3UM7 A;  3SYP A;  1G4Y B;  4MTF A;  4MTG A;  3AG4 C;  1P7B A;  2A9H A;  3RVZ A;  2ATK C;  4GX1 A;  4PA4 A;  2ITD C;  3T2M A;  3T4D A;  2DYS C;  1J95 A;  3E86 A;  1QLE C;  3K04 A;  2WLN A;  3HPL C;  4JTA B;  4X8A A;  3PJS K;  2HVK C;  2ITC C;  4PDV A;  5EBW C;  5EK0 A;  2K1E A;  3OUS A;  4MVZ A;  4JTC B;  1OCR C;  4J9Z B;  2AHZ A;  4H37 A;  3SYA A;  3SYQ A;  5CBG A;  2A79 B;  2P7T C;  2QTO A;  4OXS A;  3T1C A;  4CBC A;  3F5W C;  3TET A;  1XL6 A;  3F7V C;  4P2Z A;  2Q69 A;  5CBF A;  1KKD A;  1V54 C;  2R9R B;  5IY5 C;  2Q6A A;  3FB5 C;  4X88 A;  3K0D A;  2X6A A;  3LDC A;  2WLK A;  3RVY A;  3STZ C;  4R50 A;  2EIK C;  2DYR C;  4UUJ C;  1OCC C;  3ASO C;  4X89 A;  5CBH A;  1BL8 A;  3KG2 A;  1XL4 A;  4JTD B;  3FB6 C;  2OCC C;  5B3S C;  2IH1 C;  3R65 A;  2Y69 C;  2EIL C;  3X2Q C;  3E8B A;  2X6C A;  3OUF A;  1V55 C;  3ZJZ A;  1R3L C;  3E8G A;  2EIM C;  4G27 B;  4MW3 A;  2WLI A;  2W0F C;  2BOB C;  3SPG A;  4MVM A;  2WLL B;  2WLM A;  1ORQ C;  3ABK C;  3K08 A;  2JK5 C;  4DXW A;  3STL C;  4XDJ A;  3T4Z A;  3ASN C;  2H8P C;  4PDR A;  3FB7 C;  1R3I C;  4MSW C;  4QNH B;  3LNM B;  4QE9 A;  4LP8 A;  4ZBM A;  3TCU A;  4P9P A;  4PDM A;  1LNQ A;  1ZWI C;  4PA3 A;  2WLJ A;  3IGA C;  4TWK A;  3E89 A;  4PDL A;  2EIN C;  3ZRS A;  3EFF K;  4PA6 A;  5BZB A;  3VOU A;  5E1A C;  3SYO A;  3K03 A;  3K0G A;  4WFE A;  4MVO A;  3SJQ C;  4J9Y B;  4R6Z A;  3WG7 C;  3SPJ A;  2ZD9 A;  5EBM C;  3SPH A;  4EKW A;  3SYC A;  1K4C C;  3AG1 C;  4MVQ A;  5B1B C;  3SPC A;  5EC1 C;  4LCU C;  4LBE C;  4MW8 A;  2HJF C; 
#chains in the Genus database with same CATH topology
 5LA6 B;  1PD3 A;  3CRA A;  4X62 O;  1AB3 A;  3UQ8 A;  1OCO C;  2ZIN A;  4F4L A;  1BGY H;  5KHK A;  3HKB B;  1H2S B;  5A2Q N;  1PL4 A;  3FAV B;  2Y0P A;  4HZ3 A;  4O2B A;  3K79 A;  4ICG A;  2VQE O;  2DWD C;  1VF7 A;  4HNA B;  2NR5 A;  2YEV A;  4MVS A;  5D5Q A;  5KAI Z;  3K06 A;  4WFF A;  1J5E O;  1SZX A;  5K1P A;  2WSS G;  5KHI A;  2RCV A;  3UO2 A;  1P84 F;  1P4R A;  5GW7 A;  2YXL A;  3ZHS A;  3G71 V;  2Z0A A;  1OCC B;  3AG4 C;  4D7S A;  1O9H A;  1IBK B;  2PI5 A;  2WLN A;  4X8A A;  5HFL A;  2L6L A;  3PJS K;  4W4K A;  2UUA B;  1D2D A;  2JDI G;  2B9Z A;  2RNB A;  4IL6 Z;  1JQ0 A;  4X1Y A;  5KMG A;  4NVP A;  3F7V C;  4DW1 A;  2QEX V;  2ZNJ A;  5IY5 C;  3U0Z A;  4FLU A;  2IJI A;  2OWO A;  1X59 A;  3ETG A;  3KG2 A;  4JTD B;  2UUC O;  3CXC U;  3ETE A;  2Y69 B;  4X20 B;  4DW0 A;  3H1I H;  3NXS A;  3AEI A;  3E8G A;  4G27 B;  4QGP A;  4MW3 A;  2W0F C;  3G80 A;  3JAR A;  1XMO O;  1ORQ C;  3CPW U;  1K34 A;  3CSX A;  4E2L A;  3P3P A;  1YJW V;  3ETQ A;  4O4I B;  4YIO A;  3KZI Z;  4QE9 A;  2N74 A;  3CWB H;  3IGA C;  3B40 A;  4AQY O;  3CCS V;  1K5S A;  4X65 O;  4CH4 A;  1I94 B;  2UXD O;  4X9Q A;  1QVG U;  3DTU B;  1RFY A;  2ETN A;  4YHH B;  2BE3 A;  4FMT A;  4RAI A;  3CP1 A;  3ZHR A;  2ZXW B;  1JVM A;  1YCI A;  3AG3 C;  4I4T A;  1D5A A;  4G2K A;  5LHI A;  2M7W A;  1MNG A;  1NZ6 A;  4WFH A;  4GX0 A;  1NH2 B;  4YJ3 B;  3NR7 A;  4PA7 A;  2EIJ C;  1WLE A;  4QJF B;  3CCR V;  4JI8 O;  3IFX A;  3H1J H;  1X4T A;  5B1A C;  1XRE A;  2UXB O;  5EBL C;  1Q6U A;  1MMM A;  5IYZ B;  1W2B U;  1GO3 F;  1NBM G;  1NT2 B;  2OIG A;  2HJD A;  5TIS Z;  1B06 A;  2XHB A;  1Q81 W;  2IJK A;  3RYF A;  2UXC O;  1QLE C;  4K35 A;  3ICX A;  3MAQ A;  2W0X A;  3OM3 B;  4O2B B;  1H2K A;  2IJH A;  4X66 O;  4ASU G;  1XMQ O;  5CBF A;  2R9R B;  4ZOL B;  5LGT A;  3JAK A;  3RYH B;  4OX9 B;  3RYI B;  3ZHU A;  2FKX A;  3I55 V;  3B8N A;  4EEQ A;  1Z5W A;  3E35 A;  3B8M A;  1BL8 A;  1HNX O;  2YIB D;  3JCZ A;  1PP9 H;  1SQB H;  4YY3 O;  1IBL O;  1R3L C;  1HR0 B;  4DR4 B;  4LFC O;  1WNS A;  4U7O A;  4X1K A;  3OT7 A;  2H3O A;  4J42 A;  5IJ0 B;  2LP7 A;  4DR7 B;  3JD2 A;  2M6Y A;  4DV5 O;  3FFQ A;  2W6I G;  1YTF B;  3G6E V;  5H9C A;  4DV6 O;  4JI2 B;  4BIZ A;  2QM7 A;  1AIL A;  3QVN A;  2R70 A;  4R6Z A;  4WBN A;  4DV0 B;  3B4S A;  4GUN A;  4PEL A;  5IJ9 A;  1KEC A;  3LDE A;  3DC5 A;  3CYO A;  2FYU H;  3GB7 C;  5H6R A;  2R9I A;  1I08 A;  4Z2W A;  4P9O A;  2HP8 A;  4DR1 O;  4FIP C;  2F93 B;  1R3J C;  4LH6 A;  5J2T A;  3QF7 A;  1SA0 A;  1FFX B;  3JYC A;  4R7C A;  2QM4 A;  4H44 B;  5LHH A;  2XAS A;  5H6Q A;  3TK1 A;  1VQP V;  1AP5 A;  1GH6 A;  2W6J G;  4YJ2 B;  1RM1 C;  4FK5 C;  2EZP A;  1VF6 C;  3AG2 C;  4XBF A;  3M7M X;  4B3M B;  3RGB A;  2PTM A;  2Q0A A;  2YC0 A;  1E1R G;  1XHZ A;  1S3J A;  5LP6 A;  1KU9 A;  5LOV B;  1Q5O A;  1PM9 A;  3SJB C;  4LWS B;  1Q6I A;  4UB6 Z;  3KKY A;  1Q8I A;  2IW5 A;  3R66 A;  4K0K B;  3AK2 A;  1WAZ A;  4QPJ A;  4X88 A;  1GM8 A;  3E22 B;  4R50 A;  2XT9 A;  1M9N A;  3JAW A;  3CCQ V;  4TOI A;  1KP3 A;  4FPP A;  5B3S B;  1JFF B;  1ZSP A;  4DYL A;  1H2L A;  2IH1 C;  1URF A;  2PZS A;  1JJ2 U;  1KB9 F;  3ML0 A;  4B3S B;  3JD3 A;  4UCV A;  3O9O A;  4QNH B;  3K5L A;  4ZIB A;  2BTQ B;  4PA3 A;  1SKV A;  3KCY A;  4PDL A;  2EIN B;  2PYL A;  2F4V B;  2QR4 A;  1Q90 D;  4IHJ A;  1F51 A;  1DLB A;  4MVO A;  2KSD A;  1U97 A;  2FML A;  3MHS C;  2WAM A;  3QTC A;  3SPI A;  3RYC B;  2F95 B;  3WU2 Z;  4DR5 B;  3BVO A;  1DK1 A;  3OD4 A;  2P4K A;  2JGD B;  3RFR A;  3C3T A;  1OCR B;  2Q7H A;  1R6T A;  2QWO B;  1K97 A;  1Z2G A;  3HR0 A;  4DV7 O;  3TXS A;  1I94 O;  2ZT9 B;  3RW0 A;  5L3B A;  3H1L H;  1IXB A;  1WA8 A;  4YHH O;  3LSQ A;  4JI1 B;  5LP6 C;  1NVP D;  1AJP A;  2WLI B;  2GSM B;  5KAF Z;  2YUA A;  2P6J A;  1S0V A;  2WA4 A;  3HPL C;  1M1K W;  3CB2 A;  1VQ7 V;  3FD9 A;  3OAA G;  4DV1 O;  2AZ0 A;  1Y76 B;  1KD1 W;  3WB0 A;  2LGW A;  3F5W C;  2QKA A;  1YZB A;  3AK3 A;  4O4J A;  1ENV A;  3IJ4 A;  1N36 O;  1O9G A;  5J2U B;  3CRQ A;  2UUC B;  3W7U A;  4GKJ B;  1EN4 A;  1WPB A;  3X2Q B;  3S3X A;  3K9S A;  5KX5 B;  2D2C B;  2WLL B;  1UJW B;  2UXN A;  3ABK C;  1AI4 A;  1JX9 A;  5FL7 G;  2VQF B;  1H8H G;  3LNM B;  4B3T B;  3GVM A;  3ZCC A;  1ZWI C;  4OX9 O;  4DK1 A;  4JV5 O;  2R9A A;  1VQO V;  1EFR G;  1LUV A;  2Y0I A;  2GDS A;  2HHH B;  4UCR A;  4FLY A;  3WG7 C;  1DF5 A;  4FJC C;  1R6N A;  3SPC A;  4J10 A;  5L3C A;  4ZHQ B;  2JRI A;  5CA0 B;  1HR0 O;  4DR4 O;  1YDX A;  4I0X B;  5CMU A;  5J9P C;  1HNW B;  4FLV A;  1FXV A;  3H9V A;  5EYP A;  2PY5 A;  3B77 A;  1OCZ C;  4DR7 O;  1RP3 B;  1E79 G;  3ZMS A;  1K3E A;  4I55 A;  5EIB C;  1QNM A;  1V9P A;  1XI1 A;  4WFG A;  1K9M W;  3C3S A;  3OE7 G;  4JYC A;  1BQZ A;  3Q4H A;  2MK3 A;  2PF4 E;  4N23 A;  2UXB B;  1MZE A;  1SQG A;  1E1Q G;  3E83 A;  1NTM H;  4QE7 A;  4IYI A;  5EZY A;  1SES A;  3L72 H;  3CMA V;  3OW2 U;  3H01 A;  1G4Y B;  3I56 V;  2UXC B;  4I9Q A;  2C2A A;  2DYS B;  3T2M A;  3E86 A;  2XAJ A;  1KP2 A;  4LFA B;  2CH7 A;  3SYQ A;  4H37 A;  3CRR A;  2GUZ B;  4ZKI A;  2DMX A;  2XND G;  3MD0 A;  2Q7E A;  5CN0 A;  1F4N A;  1CPY A;  1HWY A;  2WWW A;  4TQD A;  4LF8 B;  3UT5 B;  4LNU A;  5FNV B;  1D5N A;  5L3D A;  5BR8 B;  2BSK A;  1SS3 A;  4B3M O;  4K8X A;  1M5I A;  1TVK B;  1F23 A;  5CB4 B;  2N05 A;  4WF9 V;  2EIL C;  4YY3 B;  3ZMT A;  5L3F A;  2EIM C;  1S76 D;  4HBN A;  5LHG A;  2JK5 C;  3PN1 A;  1OJH A;  3FB7 C;  1IZ3 A;  1QHT A;  4H13 B;  2XAG A;  2JVD A;  4K0K O;  4LP8 A;  1HP8 A;  3HKD A;  3ZRS A;  3AK1 A;  3VOU A;  3K03 A;  3K0G A;  3JAS B;  4F6R A;  4OGQ B;  2E74 B;  3SYC A;  1GMG A;  1H2M A;  5BXZ A;  4MW8 A;  4B3S O;  3E8H A;  2E76 B;  1Q6H A;  2A0L A;  3JAL B;  1NQT A;  4XDK A;  2KB1 A;  1AR1 B;  1GAX A;  1AI5 A;  4GLX A;  1I7F A;  3CXH F;  3JD1 A;  2ZKO A;  3HKC B;  1HNZ O;  4FFB B;  5GON A;  2F4V O;  3ZHV A;  1S72 V;  5KUK A;  3APO A;  1PL0 A;  4DR2 B;  3RBZ A;  1XUQ A;  3ZED A;  1YSC A;  4JYY A;  4PI0 A;  3N2K B;  1AJQ A;  2WLH A;  3SGI A;  3FKS G;  3ABL C;  5ITZ B;  3CJH B;  4MTF A;  2RMK B;  4YXW G;  4DR5 O;  1XNR B;  3SJA C;  1RPO A;  4UCS A;  2OCH A;  1BS3 A;  1FXK B;  3TET A;  3N27 A;  4YIP A;  2LFR A;  2WA3 A;  3U10 A;  5JCO C;  5LMU B;  3CD6 V;  5B1O A;  4EB6 B;  2XTA A;  4JI1 O;  1US6 A;  4CS4 A;  5JQG A;  1NTZ H;  4DR6 O;  2OCC B;  4TUY A;  2Y69 C;  2JJ2 G;  1L1F A;  5E79 Z;  3VBB A;  5JJN B;  2YID A;  2EJ7 A;  1KQS U;  4I50 A;  3T4Z A;  3ASN C;  3K5M A;  4MSW C;  1XHX A;  1HW7 A;  1GM7 A;  1LNQ A;  2CTW A;  4DUY B;  3QG5 A;  1Q3E A;  5C8Y A;  4J11 A;  4DV3 B;  3QNE A;  1NVP B;  5FPR A;  4GKJ O;  5GTH Z;  4NTW A;  4LH7 A;  3M99 B;  3HKE A;  2LGQ A;  3SPH A;  4JF3 A;  1KUQ A;  4RWU A;  3ZRW A;  4LCU C;  4JI6 B;  2GTA A;  3OEE G;  2QKC A;  3K58 A;  1RSO B;  3CC2 V;  2P06 A;  2ZXW C;  1M57 B;  4IYH A;  3UKM A;  1ZL8 B;  4D7T A;  2VQF O;  5LGN A;  5IE9 A;  1JPX A;  3CCU V;  4B3T O;  2Y48 A;  5KUM A;  1KBH A;  2KG7 A;  4JZ2 A;  4DV7 B;  4J7Z A;  2HHH O;  3OMA B;  4KHP B;  3L71 H;  3ABM B;  3D3I A;  1PNL A;  5IY5 B;  2ZE7 A;  1GK9 A;  2HFE C;  3G67 A;  1FJG B;  1HNW O;  4Q20 A;  1ZTE A;  2A9H A;  3T1Y B;  1EBO A;  2EJR A;  2OIE A;  4WCE V;  2OT5 A;  4DV1 B;  1TUB A;  2K1E A;  1QR8 A;  4J9Z B;  4Z1V A;  2P7T C;  5LXT A;  5KHH A;  4UFZ A;  4NTX A;  4FVM A;  4C7U A;  2V7Q G;  1BQ0 A;  1N36 B;  3BY6 A;  4X64 B;  3JAT A;  3MDS A;  3ASO C;  2JEX A;  1THZ A;  2HR3 A;  5JJE B;  2UUB B;  1VF6 A;  2E75 B;  3E8B A;  3CC7 V;  4K3A A;  3UCS C;  3CCL V;  1MSD A;  5DN6 G;  4LFA O;  3IAY A;  2PYJ A;  4DK0 A;  3WB1 A;  4FM0 A;  4J80 A;  2YEV B;  3LSS A;  3AG3 B;  4ZBM A;  4LF8 O;  4O4L A;  2LW1 A;  5FLX N;  4LFB B;  5BR8 O;  4JV5 B;  4KXR A;  5JJJ B;  2UU9 B;  5E1A C;  3BA9 A;  4JAA A;  3D36 C;  3AG7 A;  4OPH A;  1UFI A;  5B1A B;  1VQN V;  2A3Q A;  3OFN G;  2QSA A;  4U3J A;  4UB8 Z;  4J7K A;  4DUZ B;  1G1X B;  5KA5 A;  1A32 A;  3TJT A;  4PV1 B;  2K9P A;  2DW4 A;  4MS2 A;  4X1Y B;  5KMG B;  2QM8 A;  4JGS A;  4BW9 A;  4RQF A;  3LDD A;  2LJ2 A;  1DF4 A;  4FFK A;  3OEH G;  4FLX A;  2DE0 X;  4LC1 A;  3LUT B;  2E3C A;  4I9W A;  4G28 B;  3OTF A;  4UV9 A;  3FYE B;  2JS3 A;  5EIB D;  3SR2 C;  4O4H A;  1Y6X A;  4NXN B;  2BOC C;  3EHB B;  3JAR B;  4CZZ A;  1P7B A;  5LBQ A;  2CGN A;  1J95 A;  1IUR A;  1QR9 A;  2HVK C;  3L9D A;  3CS5 A;  3DXR A;  1PPJ H;  3SDL A;  3T1C A;  4P2Z A;  4DR2 O;  1W59 A;  2X6A A;  3LDC A;  2F23 A;  2EIK C;  2DYR C;  4UUJ C;  1B6Q A;  4L8J A;  3FB6 C;  5B3S C;  4I4T B;  1XNR O;  1V55 B;  3OUF A;  4FM2 A;  4X1I A;  3BHP A;  3A0H Z;  3SPG A;  2Q0O C;  4IT5 A;  3VQX A;  5JWP A;  2H8P C;  4GZR B;  2ZE6 A;  4JI3 B;  5LMU O;  2Q9L A;  1QLN A;  3RT3 C;  4HAM A;  1CEZ A;  1GN6 A;  2EIN C;  5BZB A;  2B5U A;  3O65 A;  2YIA A;  1AJN A;  3N2G A;  5BMV A;  1RM1 B;  3RYF B;  3K59 A;  5LYJ A;  1VAR A;  2Q7G A;  2ZE5 A;  5LGU A;  2ADQ B;  2AW9 A;  2UXX A;  1W0K G;  1F7Y A;  4Z1M G;  1JCH A;  1VMG A;  3CCE V;  1M56 C;  3CC4 V;  1ZLZ A;  4DV4 B;  2ADP A;  2YI9 A;  1TAE A;  2A06 H;  1VQL V;  4DUY O;  3JAK B;  3W7W A;  1HNZ B;  3G4S V;  1SC5 B;  3OGC C;  4DV3 O;  3D8C A;  2CDY A;  3E8F A;  4W4L A;  2NN4 A;  2YSU B;  3CEI A;  2Q67 A;  4RUE A;  1SQP H;  4U7N A;  4TV9 A;  4JI6 O;  3VQW A;  2B1I A;  1Y66 A;  2JIZ G;  1S5H C;  3M8A A;  4H0L B;  3UM7 A;  2KQX A;  4X1K B;  2YXH A;  4JZG A;  3ZS8 C;  1YJ9 V;  4JTA B;  1HDJ A;  1JOY A;  2Z5U A;  2A79 B;  4OXS A;  4CBC A;  3K3W A;  2QDO A;  3J7A U;  4KL1 A;  4KHP O;  2DQ3 A;  1KMI Z;  4WBN B;  4UVC A;  1S77 D;  3K0D A;  3RVY A;  3JD0 A;  4DR6 B;  3ZMZ A;  1Q82 W;  1N32 B;  5IJ9 B;  3P3N A;  1FJG O;  2X7R B;  3W7T A;  5CA1 A;  3A8T A;  2P22 C;  3T1Y O;  3X2Q C;  1FAF A;  1FXH A;  4TV8 A;  1Y74 A;  5LMN B;  4O2A A;  2DOS A;  5JH7 A;  2DJV A;  5IYB O;  5J2T B;  1SA0 B;  4PHZ A;  4PJ0 Z;  2B1G A;  3SJC C;  4JI0 B;  4BR6 A;  1VQ4 V;  3IC9 A;  1YHQ V;  4X64 O;  2QJ1 A;  2VRZ A;  3VQY A;  4DRX A;  3ZN1 A;  1Q7Y W;  1SQQ H;  3SPJ A;  2UUB O;  5KA6 A;  3K9A A;  3AG1 C;  2R72 A;  1G6U A;  2PUS A;  1SET A;  3JSL A;  4JYB A;  3OR6 C;  3K57 A;  5LP6 B;  4CH3 A;  4ZI7 A;  4FM1 A;  1GN2 A;  2P5O A;  2MW2 B;  3BFR A;  2ZQM A;  4IIJ A;  4OPA A;  1R3K C;  4MTO A;  3IC7 A;  2DWE C;  4LFB O;  2Y4T A;  2UU9 O;  4AHC A;  3FB8 C;  5CA3 A;  3JAW B;  2ZNI A;  4GT1 A;  4MVR A;  1N33 B;  2QWR B;  2AXT Z;  1NH2 D;  3HB3 B;  2RN9 A;  4DUZ O;  2DYS C;  5K1X A;  3K04 A;  5JVD A;  4LF7 O;  1WP8 A;  5LA6 A;  1NI8 A;  1OZ0 A;  1IXM A;  5EBW C;  3OUS A;  4B7K A;  2AHZ A;  5CBG A;  2QTO A;  3HKB A;  3THO A;  4IHJ B;  3FAV A;  2AZ2 A;  3CRM A;  4EFB A;  2RJZ A;  2CE4 A;  4D6T H;  3A2F A;  2XAQ A;  4NXN O;  4MTX A;  5CBH A;  3WG7 B;  1T5E A;  1Q43 A;  3ZJZ A;  1N4C A;  2BOB C;  2ZM6 B;  4JI4 B;  2WLM A;  2CTR A;  4NKG B;  3CE2 A;  4CS3 A;  2A7W A;  4B3R O;  4PDR A;  2ILM A;  5C93 A;  4TT3 G;  1Y4M A;  4U3F H;  3E89 A;  3CRC A;  1WA8 B;  1GKF A;  4JYA B;  2QA4 V;  5JCO A;  3ZIA G;  2ZIO A;  3ABU A;  2P4V A;  3ZN0 A;  1VQ6 V;  4NTY A;  4MVQ A;  4FLZ A;  1NTK H;  1H8E G;  1QVF U;  4KFM A;  4X20 A;  1N0N A;  4H33 A;  2AHY A;  1QU7 A;  5F2V O;  4JI3 O;  4MVU A;  4O4J B;  1JR9 A;  1ZAU A;  1IBM B;  3H1K H;  5IWA B;  1SQF A;  2NLJ C;  5KHJ A;  4O4I A;  4DV2 B;  1VEW A;  3ZMV A;  2FB5 A;  4PA9 A;  5DED A;  4A5U B;  3OR7 C;  3SYP A;  3P32 A;  3BRC A;  2ZCE A;  2EIL B;  1L0N H;  3F5T A;  3JCU Z;  4DV4 O;  1YIT V;  3DC6 A;  3ZRV A;  2IU0 A;  1VF5 B;  3K5N A;  2ARH A;  1H2N A;  2FTK A;  3OGI B;  2JJ1 G;  4FZ0 A;  4NR1 A;  1V54 B;  3DSQ A;  3VQV A;  1SZT A;  2ZDI A;  2V4D A;  1IX9 A;  1MAB G;  4UVB A;  4YJ3 A;  1U96 A;  1TGO A;  4B08 A;  1BHA A;  1OCC C;  3WB2 A;  2EUL A;  2Q5Z A;  2OCC C;  1MG1 A;  1PKX A;  2EBO A;  5EYP B;  1I5X A;  5IYZ A;  1KKC A;  4I55 B;  4LF9 B;  4MVM A;  3BAB A;  3Q4H B;  5D5P A;  2ZIM A;  1MZF A;  3L70 H;  4P9P A;  4FZ1 A;  1XEQ A;  4QPK A;  2WLJ A;  1YXB A;  2LFS A;  5EZY B;  1N32 O;  4GYC B;  1XNQ B;  4UV8 A;  3SJQ C;  4ZOL A;  3L75 H;  4WFB V;  3RYH A;  1K8A W;  1ZX3 A;  3RYI A;  5B1B B;  5LMN O;  2VWJ A;  2QWN B;  5FPO A;  4LF6 B;  2GTS A;  1LUW A;  2CH7 B;  3JAM N;  1OCO B;  3ABL B;  1M57 C;  2OYQ A;  4JI0 O;  1GTO A;  2X6B A;  4IGG A;  2XOK G;  4LNU B;  2BSK B;  5IJ0 A;  1LR1 A;  5IT9 N;  1XIL A;  1Z5V A;  2Q68 A;  4GX5 A;  1JA8 A;  4HYO A;  4LF5 B;  3QO8 A;  2KKW A;  2GBO A;  2QGN A;  3I5D A;  3WFV A;  4GCZ A;  4K8Z A;  1B04 A;  3ABM C;  3CCJ V;  4N21 A;  4JI7 O;  3D36 A;  2LQT A;  3ZRX A;  2CUG A;  3AG4 B;  4LF4 B;  4FLT A;  2EX3 A;  3RVZ A;  2CGO A;  3CME V;  5H5N A;  2ZDI C;  2ITC C;  2GV9 A;  1SRY A;  1UPG A;  3FX7 A;  2P67 A;  4JTC B;  3HKD B;  2HLD G;  1BHB A;  3P30 A;  2FL4 A;  3ASN B;  4F6R B;  4ABM A;  1FFX A;  1YF2 A;  5KHG A;  3C90 A;  1N33 O;  2DQ0 A;  4YJ2 A;  1ARO P;  3ZX6 A;  4RQE A;  2YS8 A;  2GHY A;  2CAZ C;  4J7J A;  4AIL C;  1S5L Z;  2OTL V;  1XBL A;  5GON B;  1NR7 A;  1CP9 A;  2BTO A;  1FKA O;  3L73 H;  1DTO A;  3TCU A;  5LOV A;  4LWS A;  5AG2 A;  4LR3 A;  2DN9 A;  2VWK A;  2ZD9 A;  5EBM C;  2YIC A;  4FLW A;  3E22 A;  3ABT A;  1GM9 A;  5HFM A;  2ZM6 O;  3BCC H;  4JI4 O;  1JFF A;  4UXN A;  4CH6 A;  4RUF A;  1P7G A;  1H2G A;  4BW5 A;  2HG5 C;  2WPD G;  4JYA O;  3UO3 A;  2ODM A;  2EIJ B;  5JQG B;  4I5S A;  4GKK B;  4TUY B;  2BTQ A;  2XAH A;  2PI4 A;  3K5O A;  2YI8 A;  1M93 A;  2Q4P A;  1RPR A;  1FFT B;  3ASO B;  4LF7 B;  2ATK C;  4I50 B;  3OMI B;  1QLE B;  2D3O W;  2VS0 A;  3QO7 A;  2H94 A;  5EK0 A;  1IBM O;  4MVZ A;  5IWA O;  3SYA A;  4QIW F;  3RYC A;  2ZE8 A;  1QBZ A;  5C8Y B;  1XL6 A;  4DV2 O;  2Q69 A;  2JGD A;  3S3W A;  4JAU A;  3HKE B;  2Q6A A;  4AI8 A;  5DM6 V;  2CK3 G;  3TGU H;  4UCT A;  3ZRW B;  4KUM A;  1NS1 A;  1YEW A;  2NNU A;  3LNN A;  5GTI Z;  2ZR3 A;  1V55 C;  3CCM V;  2WLI A;  3T1H O;  1GRJ A;  4B3R B;  4TQF A;  1WJZ A;  2KG7 B;  2HEP A;  1BT8 A;  1Y76 A;  4PA6 A;  3ETD A;  1EZV H;  4DO2 A;  1BSM A;  2HKO A;  1PNK A;  3LSU A;  5EC1 C;  5J2U A;  1AI6 A;  3RWR D;  1IVS A;  4JI5 B;  1YI2 V;  1TUB B;  4LF9 O;  3CX5 F;  5LXT B;  2CTQ A;  2JEU A;  2PGG A;  4XDL A;  5KX5 A;  2QKS A;  2WLL A;  3JAT B;  2JGU A;  1XNQ O;  1M4U A;  3B09 A;  4JPR A;  1AVM A;  4WFA V;  1FS0 G;  4JAV A;  3AG2 B;  4NXM B;  1TUE B;  4E4E A;  1R73 A;  4LF6 O;  2EIK B;  2DYR B;  3GWO A;  3BAA A;  2EZO A;  4TSF G;  3H1H H;  4DR3 B;  1VQ8 V;  4ZHQ A;  1IBK O;  3OTO B;  2E5L B;  1N34 B;  5CA0 A;  4I0X A;  1OCR C;  2XUM A;  4O4L B;  2UUA O;  1KC8 W;  1P49 A;  4L87 A;  4J41 A;  5DEC A;  2BCC H;  2IJJ A;  1FPO A;  1XDC A;  4UCO A;  4LF5 O;  3KCX A;  1KKD A;  1BZK A;  1DGS A;  3FB5 C;  1K73 W;  1OV9 A;  1PNM A;  1EN6 A;  3STZ C;  3CCV V;  1MSW D;  4U3J B;  1N0J A;  4LF4 O;  2YIB A;  1TA8 A;  1EM1 A;  1G8M A;  2X6C A;  1GN3 A;  2Q8V A;  4EFE A;  3BPZ A;  1NU1 H;  4X62 B;  3STL C;  1L8D A;  1SQV H;  2AGA A;  3EXA A;  1M56 B;  1I5Y A;  4JAS A;  1COW G;  2L35 A;  1K92 A;  4TWK A;  2VQE B;  2GUZ A;  3EFF K;  1WB7 A;  1L0L H;  4O4H B;  3W7X A;  1J5E B;  5L3G A;  4CC5 A;  3ZHT A;  3GWK C;  3J81 N;  3UT5 A;  5B5E Z;  5FNV A;  2IBZ H;  4LBE C;  2HJF C;  2N04 A;  1TVK A;  5CB4 A;  3DXR B;  1NJI W;  5KLV H;  1I0H A;  5H2F Z;  2F1M A;  4P30 A;  3APQ A;  3ZHQ A;  3F7Y C;  3QO5 A;  4Q6G A;  1AR5 A;  2XAF A;  3J80 N;  1H38 A;  5EC2 C;  4JI7 B;  1EZJ A;  4X1I B;  1B3Q A;  1YJN V;  3L74 H;  3JAS A;  5L3E A;  4MTG A;  5IYC O;  5IYD O;  3MHH C;  3T4D A;  5A9G A;  2F43 G;  5IDJ A;  1R1B A;  3W7S A;  1K33 A;  3JAL A;  3B2E E;  1F4M A;  1YIJ V;  1XMO B;  3JD4 A;  3FYI B;  2OTJ V;  4BWA A;  1MA1 A;  1GN4 A;  4GKK O;  4CH5 A;  3N2G B;  1QCE A;  5BMV B;  2F66 C;  2V1D A;  1VQM V;  3HKC A;  2WLK A;  4FFB A;  5LYJ B;  2RQ6 A;  2G38 A;  4AQY B;  5B66 Z;  1IDS A;  1OHH G;  4X89 A;  4X65 B;  1WP7 A;  5B1N A;  1KYO F;  2UXD B;  3R65 A;  3N2K A;  1EN5 A;  4UVA A;  1SF9 A;  4CC6 A;  1PV0 A;  2QWP B;  3AG1 B;  1N8R W;  3DGE A;  1YVW A;  5ITZ A;  3CJH A;  3ABK B;  4NB5 A;  1VQ9 V;  1SER A;  4XDJ A;  1R3I C;  2LW7 A;  2CTP A;  4HNA A;  1FXK A;  3EVK A;  4PI2 A;  1VQ5 V;  4TV9 B;  3SYO A;  4JI2 O;  4JI8 B;  1MOF A;  3A0B Z;  4B7E A;  3A0R A;  4EB6 A;  1QQC A;  3JSN A;  4DV0 O;  2QWQ B;  1AI7 A;  1K4D C;  2Z3Y A;  4R8C A;  3ZMU A;  1FYJ A;  2Q73 A;  5BY1 A;  4CS2 A;  1OCZ B;  4BIU A;  2X0L A;  1BCC H;  1NKD A;  3E2E A;  4RO2 A;  2YXY A;  1BE3 H;  1K5Q A;  1WN7 A;  4X66 B;  3BEH A;  3CHX A;  1XMQ B;  5CA1 B;  1Q86 W;  5LL6 Y;  4GX2 A;  1SQX H;  4TV8 B;  1Y74 B;  3BA8 A;  2HVJ C;  1YTF D;  3U11 A;  4O2A B;  4JI5 O;  2IM9 A;  2RDC A;  5JH7 B;  2IH3 C;  1ROP A;  1HNX B;  4GX1 A;  3D3Q A;  4PA4 A;  2ITD C;  1IBL B;  3RN4 A;  4PDV A;  4LFC B;  1RSO A;  3TXQ A;  4NYK A;  2LO1 A;  1ZL8 A;  1R6K A;  4DRX B;  1V54 C;  4DV5 B;  1VQK V;  1AP6 A;  4BIO A;  4F6E A;  4NXM O;  2YDE A;  4DV6 B;  2QE7 G;  4MT8 A;  1CXZ B;  1XL4 A;  4ZI7 B;  1XQ8 A;  2O57 A;  1AR4 A;  2JS5 A;  1ZUQ A;  4DR3 O;  3OMN B;  3T1H B;  3OTO O;  2E5L O;  1N34 O;  1FXK C;  2EIM B;  2Y4U A;  4KP4 A;  4I7Z B;  4IIJ B;  1FD9 A;  1VIB A;  1WPX A;  1BMF G;  2ZR2 A;  3K08 A;  1Y67 A;  4DXW A;  3G6B A;  1JJO A;  1VP7 A;  1XOU A;  1WB8 A;  1W0J G;  4DR1 B;  3ZBH A;  4PDM A;  1NR1 A;  4UCU A;  4BAY A;  4WFE A;  4J9Y B;  1K7D A;  1JMK C;  1S5J A;  2P90 A;  1K4C C;  4PD4 F;  2IU3 A;  5B1B C;  5JVD B;  4EKW A;  1M90 W;  2QTS A; 
#chains in the Genus database with same CATH homology
 5LGU A;  5HFM A;  1PD3 A;  2UXX A;  1W0K G;  5CMU A;  4Z1M G;  1JCH A;  5J9P C;  4UXN A;  1OCO C;  1FXV A;  4F4L A;  3CCE V;  4RUF A;  1M56 C;  3CC4 V;  3B77 A;  1OCZ C;  1H2G A;  1E79 G;  4HZ3 A;  3ZMS A;  1K3E A;  4BW5 A;  1VQL V;  3K79 A;  4WFG A;  2HG5 C;  3W7W A;  3G4S V;  2DWD C;  3OE7 G;  1K9M W;  3OGC C;  2WPD G;  4JYC A;  2EIJ B;  2YEV A;  4I5S A;  2MK3 A;  4N23 A;  3E8F A;  4MVS A;  2YSU B;  3K06 A;  4WFF A;  2WSS G;  2Q67 A;  1E1Q G;  2XAH A;  3E83 A;  4RUE A;  4U7N A;  4QE7 A;  2PI4 A;  1P4R A;  1SES A;  5GW7 A;  2B1I A;  1Y66 A;  2JIZ G;  1S5H C;  3CMA V;  3OW2 U;  3H01 A;  1RPR A;  3G71 V;  1FFT B;  3UM7 A;  1G4Y B;  1OCC B;  3AG4 C;  3ASO B;  3I56 V;  2ATK C;  2C2A A;  2DYS B;  3OMI B;  3T2M A;  1QLE B;  3E86 A;  2PI5 A;  2XAJ A;  1YJ9 V;  2WLN A;  1KP2 A;  4JTA B;  4X8A A;  3QO7 A;  5HFL A;  2D3O W;  3PJS K;  2H94 A;  5EK0 A;  4MVZ A;  1JOY A;  3SYA A;  4QIW F;  2JDI G;  4H37 A;  3SYQ A;  1QBZ A;  4ZKI A;  2Z5U A;  2A79 B;  4OXS A;  2XND G;  1JQ0 A;  4CBC A;  3K3W A;  3MD0 A;  1XL6 A;  3F7V C;  2QEX V;  2Q69 A;  1F4N A;  5CN0 A;  1CPY A;  1HWY A;  2WWW A;  2DQ3 A;  4JAU A;  5IY5 C;  2Q6A A;  5DM6 V;  2CK3 G;  4UVC A;  1S77 D;  3K0D A;  3RVY A;  3JD0 A;  3ZRW B;  2IJI A;  5L3D A;  4KUM A;  3ZMZ A;  1Q82 W;  3ETG A;  1F23 A;  2NNU A;  2X7R B;  3W7T A;  3KG2 A;  4JTD B;  3CXC U;  3ETE A;  2Y69 B;  4WF9 V;  2EIL C;  3X2Q C;  3ZMT A;  1FXH A;  2ZR3 A;  1V55 C;  3NXS A;  3AEI A;  5L3F A;  3E8G A;  2EIM C;  4G27 B;  3CCM V;  4MW3 A;  1S76 D;  2WLI A;  2W0F C;  5IYB O;  1ORQ C;  5LHG A;  3CPW U;  1K34 A;  2JK5 C;  2B1G A;  4E2L A;  1YJW V;  3FB7 C;  2XAG A;  4QE9 A;  4LP8 A;  1VQ4 V;  3IGA C;  1YHQ V;  3ZRS A;  4PA6 A;  3ETD A;  3VOU A;  3CCS V;  1K5S A;  3K03 A;  3K0G A;  3ZN1 A;  1Q7Y W;  4DO2 A;  3SPJ A;  5KA6 A;  3K9A A;  3SYC A;  1QVG U;  3AG1 C;  3DTU B;  1GMG A;  2HKO A;  1PNK A;  5EC1 C;  4MW8 A;  1SET A;  1AI6 A;  4JYB A;  3OR6 C;  3E8H A;  1YI2 V;  4FMT A;  4RAI A;  2A0L A;  3CP1 A;  1NQT A;  2ZXW B;  1JVM A;  3AG3 C;  4XDK A;  4G2K A;  2KB1 A;  2JEU A;  1AR1 B;  5LHI A;  1AI5 A;  2M7W A;  2ZQM A;  4XDL A;  3JD1 A;  4WFH A;  4GX0 A;  2QKS A;  1R3K C;  2WLL A;  4MTO A;  3IC7 A;  1NH2 B;  2DWE C;  4PA7 A;  2EIJ C;  1WLE A;  4QJF B;  1S72 V;  5KUK A;  3FB8 C;  5CA3 A;  3CCR V;  1PL0 A;  3IFX A;  3RBZ A;  4JPR A;  5B1A C;  4WFA V;  1YSC A;  5EBL C;  1FS0 G;  4JAV A;  3AG2 B;  1AJQ A;  4GT1 A;  1W2B U;  2WLH A;  4MVR A;  1TUE B;  1GO3 F;  1NBM G;  1R73 A;  1NH2 D;  3HB3 B;  3FKS G;  2EIK B;  3ABL C;  2DYR B;  4MTF A;  3GWO A;  1Q81 W;  2IJK A;  2EZO A;  4TSF G;  4YXW G;  2DYS C;  1QLE C;  3K04 A;  1VQ8 V;  1OZ0 A;  1IXM A;  1RPO A;  5EBW C;  3OUS A;  1FXK B;  1OCR C;  3OM3 B;  2AHZ A;  1KC8 W;  4L87 A;  5CBG A;  3TET A;  2IJH A;  2QTO A;  4ASU G;  2LFR A;  5CBF A;  2IJJ A;  3CD6 V;  1KKD A;  2R9R B;  5B1O A;  5LGT A;  3FB5 C;  1K73 W;  1PNM A;  2XAQ A;  3STZ C;  3I55 V;  3B8N A;  5L3C A;  3E35 A;  3CCV V;  1MSW D;  4MTX A;  3B8M A;  1BL8 A;  5CBH A;  2OCC B;  2Y69 C;  2JJ2 G;  1L1F A;  1G8M A;  3JCZ A;  3WG7 B;  2X6C A;  3ZJZ A;  1R3L C;  3VBB A;  2BOB C;  2WLM A;  4U7O A;  1KQS U;  3STL C;  3T4Z A;  3ASN C;  4PDR A;  2LP7 A;  1M56 B;  1I5Y A;  3JD2 A;  4MSW C;  4JAS A;  5C93 A;  1COW G;  4TT3 G;  1Y4M A;  1GM7 A;  1K92 A;  1LNQ A;  2W6I G;  4TWK A;  3E89 A;  1YTF B;  3G6E V;  5H9C A;  1GKF A;  3EFF K;  3QNE A;  1NVP B;  2QA4 V;  4BIZ A;  2QM7 A;  3W7X A;  3ZIA G;  3M99 B;  5L3G A;  4R6Z A;  3ABU A;  3SPH A;  3ZN0 A;  1VQ6 V;  4JF3 A;  4MVQ A;  3ZRW A;  4LCU C;  4LBE C;  2HJF C;  4PEL A;  1KEC A;  3LDE A;  3OEE G;  3CYO A;  1H8E G;  3GB7 C;  4KFM A;  1NJI W;  3CC2 V;  1QVF U;  2ZXW C;  1M57 B;  5H6R A;  4H33 A;  2AHY A;  3UKM A;  2R9I A;  4P30 A;  4P9O A;  5LGN A;  4MVU A;  1JPX A;  4FIP C;  3CCU V;  1R3J C;  2Y48 A;  3JYC A;  5KUM A;  4R7C A;  3F7Y C;  5LHH A;  2NLJ C;  3QO5 A;  2XAS A;  5H6Q A;  3TK1 A;  1VQP V;  2XAF A;  2W6J G;  1RM1 C;  1H38 A;  3ZMV A;  4FK5 C;  3OMA B;  5EC2 C;  2EZP A;  3ABM B;  3D3I A;  4PA9 A;  1EZJ A;  1PNL A;  5IY5 B;  3AG2 C;  4XBF A;  1YJN V;  1GK9 A;  2HFE C;  3OR7 C;  4Q20 A;  3SYP A;  5L3E A;  3P32 A;  4MTG A;  2A9H A;  1EBO A;  5IYC O;  5IYD O;  3MHH C;  3T4D A;  2EIL B;  2EJR A;  4WCE V;  2OT5 A;  2F43 G;  1E1R G;  5IDJ A;  1S3J A;  3W7S A;  1YIT V;  1K33 A;  2K1E A;  3ZRV A;  1QR8 A;  4J9Z B;  1F4M A;  2IU0 A;  1YIJ V;  3JD4 A;  2P7T C;  3FYI B;  2FTK A;  2OTJ V;  2JJ1 G;  2IW5 A;  2V7Q G;  1V54 B;  1QCE A;  1SZT A;  2ZDI A;  2V1D A;  4UVB A;  1MAB G;  4QPJ A;  4X88 A;  3BY6 A;  1GM8 A;  1VQM V;  2WLK A;  4R50 A;  1BHA A;  1M9N A;  1OCC C;  1OHH G;  3ASO C;  4X89 A;  2JEX A;  3CCQ V;  5B1N A;  1KP3 A;  1THZ A;  4FPP A;  5B3S B;  2HR3 A;  2OCC C;  2IH1 C;  1MG1 A;  3R65 A;  1PKX A;  2EBO A;  4UVA A;  3E8B A;  3CC7 V;  1JJ2 U;  1I5X A;  3AG1 B;  3ML0 A;  3CCL V;  5DN6 G;  3JD3 A;  1N8R W;  3DGE A;  4MVM A;  3ABK B;  1VQ9 V;  1SER A;  4XDJ A;  2YEV B;  3LSS A;  1R3I C;  3AG3 B;  4QNH B;  4ZBM A;  4P9P A;  1FXK A;  4QPK A;  4PA3 A;  2WLJ A;  1VQ5 V;  4PDL A;  2EIN B;  2LFS A;  1F51 A;  5E1A C;  3SYO A;  1DLB A;  1MOF A;  4MVO A;  4UV8 A;  3SJQ C;  4WFB V;  3A0R A;  1K8A W;  5B1A B;  5B1B B;  3MHS C;  2WAM A;  1VQN V;  1AI7 A;  3OFN G;  3SPI A;  1K4D C;  2Z3Y A;  1OCO B;  4R8C A;  3ZMU A;  5KA5 A;  3ABL B;  1M57 C;  2DW4 A;  4MS2 A;  2QM8 A;  1OCZ B;  4BIU A;  1GTO A;  4JGS A;  2X6B A;  2X0L A;  1NKD A;  4RQF A;  3E2E A;  4RO2 A;  3LDD A;  2XOK G;  1DF4 A;  1K5Q A;  1OCR B;  3OEH G;  3BEH A;  4LC1 A;  3LUT B;  2Q68 A;  4GX5 A;  1K97 A;  4HYO A;  4I9W A;  1Q86 W;  3QO8 A;  4G28 B;  3RW0 A;  5L3B A;  4GX2 A;  3WFV A;  4GCZ A;  3ABM C;  4UV9 A;  3FYE B;  3LSQ A;  2HVJ C;  3CCJ V;  4N21 A;  1YTF D;  3D36 A;  3ZRX A;  2BOC C;  1AJP A;  3EHB B;  1NVP D;  2IH3 C;  1ROP A;  2WLI B;  2GSM B;  4CZZ A;  3AG4 B;  1P7B A;  3RVZ A;  2P6J A;  4GX1 A;  1S0V A;  4PA4 A;  2ITD C;  5LBQ A;  1J95 A;  3CME V;  1QR9 A;  3HPL C;  1M1K W;  2ZDI C;  1VQ7 V;  2HVK C;  2ITC C;  3OAA G;  4PDV A;  1SRY A;  2P67 A;  4JTC B;  1KD1 W;  3T1C A;  2HLD G;  3F5W C;  1BHB A;  1R6K A;  3P30 A;  4P2Z A;  3ASN B;  1V54 C;  1VQK V;  1ENV A;  2X6A A;  3LDC A;  2QE7 G;  4MT8 A;  2EIK C;  2DYR C;  2DQ0 A;  4UUJ C;  3W7U A;  1B6Q A;  1XL4 A;  1ARO P;  3FB6 C;  5B3S C;  3X2Q B;  3OMN B;  1V55 B;  3OUF A;  1FXK C;  2EIM B;  4KP4 A;  4RQE A;  1WPX A;  2GHY A;  3SPG A;  1UJW B;  1BMF G;  2WLL B;  2UXN A;  2ZR2 A;  1AI4 A;  3ABK C;  3K08 A;  4DXW A;  2OTL V;  1JX9 A;  1NR7 A;  2H8P C;  1CP9 A;  1W0J G;  5FL7 G;  1H8H G;  1DTO A;  3LNM B;  3TCU A;  1QLN A;  4PDM A;  3ZCC A;  1ZWI C;  4HAM A;  1CEZ A;  2EIN C;  1NR1 A;  5BZB A;  2B5U A;  1VQO V;  1EFR G;  4BAY A;  4WFE A;  1AJN A;  4J9Y B;  1K7D A;  3WG7 C;  1DF5 A;  2ZD9 A;  5EBM C;  1RM1 B;  4FJC C;  2P90 A;  1K4C C;  1M90 W;  1R6N A;  2IU3 A;  5B1B C;  3SPC A;  4EKW A;  3ABT A;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...