3TETA

Crystal structure of nak2k channel y66f mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tetA00
4PDMA 3LDCA 4MVOA 1R3LC 4P9OA 4XDLA 4LCUC 3E8GA 3ZJZA 4P2ZA 2DYSC 1M57C 4PA4A 2DWEC 2ATKC 4MTGA 3ASNC 3SYAA 3E86A 1OCCC 4ZBMA 1K4DC 1ORQC 4TWKA 4X89A 3E8BA 4G27B 5B1AC 3SPGA 3UM7A 2ZXWC 3K04A 3E83A 4MS2A 3T4ZA 1XL4A 3SYQA 4MW3A 4PA7A 5EC2C 5KUMA 3ABKC 5EC1C 1R3JC 2Q68A 4MSWC 4RUFA 1OCRC 3AG1C 4WFFA 4BW5A 1P7BA 3OUFA 1OCOC 2IH1C 4PA6A 5EBMC 4JTDB 5CBGA 4GX5A 4OXSA 3ASOC 2HG5C 3WG7C 2A0LA 1KKDA 1ZWIC 4CBCA 3OUSA 3OR6C 4PDLA 4JTCB 4R6ZA 3FB8C 5B3SC 3E89A 3FB5C 2K1EA 4XDJA 4GX1A 2HVJC 2WLIB 1R3KC 4QE7A 3X2QC 3OGCC 3ZRSA 4LBEC 3R65A 1V54C 1OCZC 4PA9A 2NLJC 3AG2C 4J9ZB 4MVQA 5EBWC 3F5WC 1J95A 4MW8A 4R7CA 3UKMA 4HZ3A 2YEVA 4R50A 4G28B 5CBFA 3K08A 2EILC 2JK5C 4GX0A 1QLEC 2X6BA 4WFEA 3LDDA 2EIMC 2KB1A 3PJSK 3SYPA 3FB7C 5EBLC 2A79B 2QKSA 3SPHA 4RUEA 2WLIA 4PDRA 5EK0A 2H8PC 1XL6A 2WLHA 2EIJC 2EINC 3E8FA 2P7TC 1JVMA 2ITDC 3IFXA 2HVKC 3JYCA 4MTFA 4WFHA 5B1BC 2A9HA 2X6CA 3TETA 1S5HC 4R8CA 3FB6C 2QTOA 3KG2A 2Q69A 2WLLB 3SJQC 3T1CA 3EFFK 4X88A 2WLKA 3AG4C 3F7YC 4RO2A 3K0DA 2ZD9A 2DWDC 4MVRA 4JTAB 3SPJA 3ABMC 3LUTB 1LNQA 4MVZA 1M56C 2BOCC 2IH3C 4MVUA 2WLJA 3TCUA 3SPCA 2WLMA 1K4CC 4H33A 3SYCA 5IY5C 4QNHB 5BZBA 2ITCC 2WLLA 2EIKC 3HPLC 4HYOA 4MVSA 4X8AA 5J9PC 4H37A 2R9RB 4QE9A 3GB7C 3LNMB 3SYOA 3K0GA 4PA3A 3STLC 3OR7C 4UUJC 1BL8A 4XDKA 4PDVA 2AHYA 5E1AC 3STZC 2Q67A 1R3IC 4GX2A 3F7VC 2X6AA 3E8HA 2Y69C 3RVZA 2AHZA 3K06A 3ABLC 4MTOA 4P9PA 4MVMA 2WLNA 2HJFC 3T4DA 2DYRC 4F4LA 3AG3C 5CBHA 3VOUA 5KUKA 3LDEA 2HFEC 2OCCC 3K03A 4J9YB 3RBZA 4RAIA 3IGAC 4LP8A 4WFGA 4I9WA 3RW0A 4EKWA 4DXWA 3T2MA 2W0FC 1V55C 4KFMA 1G4YB 4P30A 3RVYA 2BOBC 2Q6AA 3BEHA 3SPIA
chains in the Genus database with same CATH superfamily
1E1RG 2ZE8A 4O4HB 4DW1A 4IHJB 1VF7A 2ZKOA 1I5XA 4TWKA 4G27B 2GTSA 3E22B 1XL4A 3B8MA 4PA7A 1M9NA 2ZCEA 3QTCA 2N04A 3QF7A 4HAMA 1Y74B 4YHHO 4TT3G 3M7MX 3HKDB 2UU9B 3CEIA 1VF6A 4DV3O 5CA3A 5BR8O 5L3GA 1W2BU 3EXAA 1KD1W 3BABA 2FYUH 3D36C 5CA1B 3ASNB 3NR7A 2ARHA 1MABG 3OUSA 2ZXWB 2UXNA 4DV2B 3E35A 3R65A 1IVSA 4WBNB 1VQKV 1TGOA 3FYEB 1SQPH 2HKOA 1OCRB 1F51A 5L3BA 2Q9LA 2D3OW 2UXDO 4WFEA 1JFFA 1QLEC 2CGOA 3ZMVA 4CS3A 1MG1A 1P7GA 3Q4HA 3OE7G 4X64B 4W4LA 1NJIW 3GVMA 1PNLA 4RO2A 3WU2Z 2P5OA 1ZL8B 3FFQA 2FL4A 4J11A 2PYLA 2RNBA 4O4LA 4DR5O 4O2BA 4DV6B 4JI4O 5A9GA 5IYZA 1GN2A 1QVFU 1HNWB 1XBLA 3AG3C 2N05A 1B3QA 2DE0X 4X1IA 2PY5A 5ITZB 3JASB 1Z5VA 5L3EA 2RJZA 5HFMA 4DXWA 1B04A 4DV0O 4UCSA 3RVYA 4Z1VA 4QPJA 4PDMA 1EN5A 4X62O 3QNEA 3VQVA 1ZX3A 5JJEB 1SS3A 5KLVH 1SRYA 1Q90D 3VQWA 3TGUH 2QJ1A 4TQFA 1YJ9V 5KA6A 1OJHA 5EC1C 1PPJH 3VBBA 2L6LA 3J81N 2F4VO 4RUFA 4DR3B 2JJ1G 4I55A 1MSDA 3N27A 4ICGA 4NVPA 4ZIBA 4GZRB 4F6RA 2XAGA 3ASOC 3U11A 4FLVA 1XREA 3E2EA 3ZS8C 5H6QA 5TISZ 1VQ6V 1R3KC 3AK1A 1NBMG 1QR8A 2F1MA 2UXCB 4JZ2A 5JQGB 4MVQA 1J5EB 4MW8A 5BY1A 2EJRA 1IBLO 1Q82W 4JV5B 3T1YB 4ZOLA 4NXMB 4TUYB 2ITDC 1EN4A 2AXTZ 2A9HA 2XUMA 5L3DA 2WLKA 5D5QA 1SETA 2WSSG 2QKCA 1AROP 3QO7A 1GH6A 4UXNA 1K34A 5FPOA 2QWQB 1XMQB 3ZN0A 1YDXA 5J2TA 2XHBA 5BZBA 1HNWO 1L0NH 5J9PC 5JJJB 3K5LA 4JAAA 1Q6UA 4I4TB 2R9AA 2M6YA 2QM4A 3WB0A 4TOIA 3L75H 4DK0A 5JWPA 4E2LA 3ZMUA 2XOKG 2ZDIC 5IY5B 3M99B 1KC8W 2GBOA 4YJ2A 4CH5A 1M93A 4EKWA 1SA0A 1W59A 4DV4O 1SERA 1G4YB 1PV0A 1GN3A 3ABUA 4MTGA 2QSAA 2L35A 4GCZA 2XTAA 4KL1A 4YXWG 2LQTA 4WCEV 2CTWA 5EC2C 3CP1A 2BSKA 2FB5A 4DR1O 1L1FA 4FK5C 2UUAB 2H3OA 4JI1O 4K8XA 1GN6A 3FKSG 1HNZB 4JTDB 2YEVB 2HG5C 3JALA 4WFBV 2IM9A 1ZWIC 2IU3A 2Q7HA 3CWBH 3BAAA 3OGCC 4E4EA 5IJ9A 3T1YO 1P84F 4U3FH 1WLEA 4NXMO 4UVCA 5CBFA 1R6TA 2YDEA 1K5QA 5LYJA 3IC9A 1MZFA 5L3CA 2H8PC 3L70H 4JYAB 3O9OA 1TVKB 5KHGA 2Y4TA 2WLLB 4FM2A 1E1QG 3EFFK 1XHZA 3SJCC 3ABMC 4FFKA 4X1YA 2YI9A 1I7FA 4BW9A 1VQ4V 4FM0A 3JAWA 1DLBA 1JA8A 1QHTA 2ITCC 1AI4A 1Q86W 1WP7A 5B1BB 2W6IG 3N2KA 4DR7B 2Y69C 3JATB 5IYDO 4MVMA 2ILMA 3JD3A 4FFBA 2DYRC 5IYCO 2FTKA 3M8AA 1YJWV 4B3TO 4QJFB 1EN6A 5IJ0A 3IGAC 1AR4A 5LP6B 1FXKC 2WA3A 2RMKB 2BOBC 4ZKIA 3CCVV 1HW7A 1YIJV 1I94O 4Z2WA 4FM1A 3E86A 4ZBMA 3KKYA 3JARA 1K4DC 5B1AC 3UM7A 2XAJA 3SYQA 3TXSA 1HNZO 3TK1A 4WFAV 1EFRG 2P67A 4JI8B 2CAZC 2CE4A 4K3AA 3FYIB 1Y67A 1BZKA 1OCOC 5CBGA 2GSMB 4O2AB 1JQ0A 5CN0A 1SESA 3NXSA 1ZAUA 4O4LB 1FXHA 3OTFA 3FB5C 4MT8A 5IYZB 2YIBD 1URFA 2ODMA 1KUQA 2ZM6B 1YF2A 3AG2C 3B4SA 2P22C 2JK5C 1N36B 1OZ0A 1RP3B 2QE7G 1S0VA 4GKKO 4ZHQA 4UV8A 5BMVA 1F4MA 3LSUA 4EEQA 3H1HH 4NR1A 2IBZH 4GUNA 5KX5A 1PM9A 5EIBD 2LJ2A 2VQFB 3JAMN 2A3QA 4XBFA 3ZBHA 1H2KA 4YY3B 2EINB 3OEEG 2YSUB 3LNMB 3K59A 2UXBO 2ZR2A 1GM7A 1GRJA 3THOA 4X1KB 5LBQA 3AG4B 1V9PA 4H44B 3T1HB 4X65O 1MOFA 1V54B 2AZ2A 3K57A 1N4CA 2X7RB 4JASA 1HP8A 2ZE5A 1FPOA 2OCHA 3D36A 4FZ0A 4Q20A 1NVPB 4LF7B 1V55C 4BIZA 2ATKC 4KXRA 1R3LC 2V4DA 4HNAB 1KYOF 2Q5ZA 1G1XB 1OCCC 2V1DA 3A0HZ 1YI2V 2GV9A 3T4ZA 4YIPA 2MK3A 3MD0A 2JEXA 5C8YA 2BTQA 2UUCO 1NQTA 2B9ZA 2FKXA 5KMGA 1M57B 2AW9A 4UV9A 4H13B 5DN6G 2ZM6O 1G6UA 1HR0B 1R6NA 1XMOB 2R9IA 3CCSV 4XDJA 1WB7A 3ZX6A 1IXMA 4LBEC 2JS5A 3ABKB 3APOA 2WA4A 2P06A 4JYCA 2CDYA 3B8NA 2EIMC 1BQ0A 1S3JA 3SPHA 2HHHO 4KHPO 4I9QA 2ZR3A 4RQEA 1JVMA 3SGIA 4YJ2B 2VQFO 1SC5B 4YHHB 3FB6C 3RGBA 4JI0O 4QIWF 2ZIOA 2EZOA 2WWWA 1SQGA 4DV3B 1H2SB 1FD9A 2P4KA 2V7QG 2EILB 1A32A 1WP8A 2B1GA 1K4CC 3OMNB 1VQPV 3P3PA 3ZHQA 2YC0A 4I0XB 2JRIA 4DV7O 1MZEA 2X6AA 4LNUA 1IX9A 5JH7B 4LC1A 1KU9A 1Q5OA 3K03A 3BRCA 4UCVA 1HNXO 2Q0AA 5JCOA 4KFMA 2R70A 4JZGA 4KUMA 1W0KG 4JAVA 2VS0A 3APQA 2VQEO 4HBNA 1NVPD 5KA5A 4XDLA 5GTHZ 1IURA 3AK2A 1XOUA 4DR5B 1YJNV 2QGNA 2XT9A 3K04A 4JI4B 2YXYA 4LF8O 3D8CA 4LF9O 2E3CA 3D3QA 4UB6Z 4X20B 5B5EZ 4WFFA 1XMOO 3CJHA 2JVDA 5AG2A 3H1KH 4GYCB 2DW4A 2DYSB 1PL4A 3CRMA 4GKJB 3L9DA 3FB8C 3R66A 4DV0B 4QE7A 5K1XA 3ZRSA 1LR1A 3N2KB 2NLJC 4X62B 2YXLA 1KKCA 4R7CA 4HZ3A 1QVGU 1Q6HA 2X6BA 4LH6A 3PJSK 2QKSA 2NNUA 2ZDIA 3J80N 3RWRD 3ZMSA 4WFHA 2F4VB 4EFBA 3X2QB 3T1CA 3CE2A 3KCYA 3DXRA 1OCZB 5GTIZ 2DWDC 1YSCA 3SPJA 2LW1A 1BHAA 3JARB 3HKCA 5KHHA 5JVDB 2IU0A 5B1NA 4MVSA 4K35A 1YTFB 3JSLA 5FL7G 3CXHF 4RWUA 1RFYA 4X66O 3ABLC 4P9PA 2OTJV 1IBLB 5JJNB 4TV9B 2ETNA 3C3SA 3IJ4A 3SR2C 4WF9V 2EIKB 2A06H 4DUYB 2VWJA 4PI2A 4UB8Z 4PHZA 2HJDA 3B2EE 1AILA 4LCUC 1N8RW 2LFRA 1GTOA 2PI5A 1Y4MA 3SPGA 2JEUA 1SZTA 5J2UA 3L74H 5KX5B 2GUZB 3ZHSA 1XNQO 2Y0IA 4GKJO 2OYQA 4FVMA 4L8JA 1GN4A 3QG5A 2QKAA 3MAQA 1MA1A 1YHQV 1X4TA 2OIGA 4AI8A 5B3SC 4K8ZA 4DV4B 1XNRO 4NYKA 3G4SV 3UO2A 3FAVB 5GONA 2XAQA 4R50A 4NTXA 3DSQA 2PZSA 2GHYA 2ZINA 4UCUA 2A79B 3ML0A 1CEZA 4OPAA 3N2GA 4DR1B 4D6TH 3E8FA 3TETA 2K9PA 2W6JG 1MNGA 4JI1B 1VQLV 3PN1A 4DRXB 5JCOC 1FXKA 1WA8B 3JAKA 3K0DA 4LF4O 5EZYB 2YS8A 1RM1C 3ZMZA 4DR4B 4B7EA 3L71H 3HKEA 1Y76A 4X8AA 4ASUG 4ZI7B 4H37A 3WB2A 2BTQB 3CMEV 4IL6Z 4TSFG 1YTFD 3RVZA 3RYFA 2H94A 4DR6O 1F23A 4DUYO 1K8AW 4J41A 1L8DA 3OEHG 3BA9A 3RW0A 3CCLV 3UT5A 3DTUB 1L0LH 4B3SO 1N0NA 2QWRB 1BCCH 1YZBA 3AG3B 5KHIA 3OGIB 4I50A 2IJIA 3RYIA 1EBOA 4N23A 2DN9A 5L3FA 3UCSC 4DR2O 1ENVA 2EX3A 5EBMC 2IH1C 4EB6B 4B3TB 2RCVA 5H5NA 3WG7C 2QM7A 1XI1A 1GM9A 3E89A 1OHHG 5KAFZ 2Q73A 2Y4UA 1QCEA 2XAHA 5LMUO 1US6A 4O4IA 4UCOA 1CP9A 4CS4A 3CS5A 1I94B 1QLNA 3I55V 3H01A 3RYHA 4GX0A 3W7WA 2BE3A 4W4KA 2Q8VA 5EBLC 3ASOB 3H1JH 4EFEA 2WLIA 1K7DA 2VWKA 2EIJC 4DR4O 1DF4A 4JAUA 1IBKO 2CK3G 3CX5F 4OX9O 4YIOA 4JI6O 2DQ3A 2WPDG 1U97A 2IH3C 1R1BA 2YICA 1JMKC 4DYLA 2UUBB 5LHGA 2R9RB 3MDSA 1B06A 2JDIG 1H2GA 3I5DA 4UUJC 2AHYA 5E1AC 5H2FZ 4FIPC 3VQXA 1U96A 3CJHB 1Q7YW 1KMIZ 3AK3A 2EULA 3B09A 3JD1A 1THZA 2F66C 4F4LA 3QVNA 4GKKB 2RDCA 4B3RB 1S76D 2HFEC 2ZNJA 2Y48A 1TUBA 2B1IA 2P90A 5EYPA 1IBMB 4DUZO 1M5IA 5CB4A 4JPRA 3E8GA 3ZJZA 4P2ZA 3P3NA 1NT2B 1QU7A 2UXBB 1K5SA 3DXRB 2QWNB 1KBHA 1VF5B 5LA6A 4DV5O 4X65B 1M4UA 4O4HA 4IHJA 1AI6A 1QR9A 3E22A 3HKCB 4OXSA 1VMGA 1JFFB 4DK1A 1NZ6A 4N21A 2HVJC 1S5LZ 3Q4HB 1V54C 4K0KO 5B1OA 3K79A 4J9ZB 5EBWC 3JD4A 2E75B 1ROPA 5CA1A 1VQ8V 2IJHA 2NN4A 1DK1A 4U7OA 5HFLA 1K9MW 3WB1A 4MTFA 3JYCA 1F7YA 2F95B 1Y66A 5LOVA 2UUCB 2JGDA 3CHXA 2Y0PA 4JF3A 4O2BB 2KKWA 5E79Z 5IDJA 2UUBO 2HR3A 4BR6A 3H1IH 3TCUA 1WN7A 3WFVA 1ZTEA 1R73A 4X1IB 5J2UB 1EM1A 3L72H 4JI7O 4B3RO 3CRAA 1P49A 1N33O 3DC5A 4NXNO 1Q6IA 1W0JG 2WLNA 5IE9A 3ABMB 2HJFC 2KQXA 3T4DA 1S77D 2HHHB 4KHPB 1IBMO 1WNSA 1FAFA 2OCCC 3RBZA 4NTWA 1GAXA 2Q0OC 4JGSA 4FZ1A 2XASA 2HLDG 4JI0B 1NS1A 4PELA 1D5AA 3DC6A 3CCJV 3CRRA 1GMGA 3SPIA 2ZE6A 1T5EA 2Y69B 3LDCA 3CMAV 1SZXA 5ITZA 3JASA 4I55B 2DYRB 1IZ3A 3N2GB 4F6RB 2DQ0A 3E83A 1H38A 3ZHRA 5KUMA 4DV7B 3IAYA 2CGNA 4D7SA 5LMNO 1FXKB 1NR7A 3CCQV 3AG1C 4CBCA 1HNXB 3HKEB 3C3TA 5B1AB 1AJQA 3MHSC 2K1EA 3CB2A 4PD4F 1AB3A 4ZOLB 2VQEB 2M7WA 4CS2A 3G71V 3OAAG 1YVWA 1SQBH 3UKMA 1O9HA 1OV9A 2JS3A 3B77A 2YUAA 5DEDA 4LF8B 4LF9B 2UXXA 1YITV 4F6EA 4PV1B 5J2TB 1S5HC 4YJ3A 3ZN1A 2QTOA 1R6KA 1VIBA 3F7YC 3UT5B 2ZD9A 2JIZG 3LUTB 1LNQA 3J7AU 2N74A 3JSNA 1M56C 1SQVH 1VP7A 5FPRA 4I50B 3RYCA 1H2LA 4QNHB 3K0GA 3A0RA 3OR7C 2QTSA 2B5UA 4GX2A 3KZIZ 4CC5A 1SA0B 3E8HA 2F93B 2X0LA 1JCHA 1DGSA 4J9YB 5KAIZ 2GDSA 4WFGA 1WAZA 4I9WA 1NKDA 3ICXA 2YI8A 2BSKB 2CTRA 2QM8A 2YIDA 1S72V 2DWEC 3ASNC 1Q43A 1WB8A 1ORQC 1VQ9V 2EBOA 2ZXWC 3AEIA 3UO3A 3JALB 5LHHA 3K9AA 4J7ZA 2LGWA 1R3JC 4X66B 4PJ0Z 4U3JA 1V55B 4MSWC 1OCRC 3K5NA 5IJ9B 4CH4A 3FD9A 1KQSU 1JJ2U 2A0LA 1OCCB 4BIUA 5LYJB 1X59A 1NR1A 4PA9A 3K5OA 5IYBO 2YEVA 2ZQMA 2JGUA 1BSMA 4JI3O 3LDDA 2ADQB 1VQ5V 2KB1A 3ZEDA 4AHCA 1NH2B 1IDSA 1QNMA 2DJVA 4X1YB 5EK0A 4TV8A 3GWOA 2P7TC 1N0JA 1D5NA 3JAWB 1AJPA 3P32A 5EYPB 1XNQB 3KG2A 3H9VA 3FX7A 4LFBO 5CMUA 1FS0G 2DOSA 2A7WA 2Q4PA 3ZRXA 2EIMB 4C7UA 1AVMA 3SYCA 4FFBB 1XNRB 1NTMH 1TVKA 2NR5A 2WLLA 4FLXA 3CRCA 3G6EV 4B3MB 1GK9A 1BL8A 5LA6B 5IJ0B 4PDVA 3CD6V 3W7TA 2HEPA 3K06A 2E74B 1KECA 5A2QN 4GT1A 2Q7GA 2CH7A 5LGUA 1KP3A 5C93A 3K3WA 4J7JA 3JATA 5K1PA 1VQOV 4QPKA 4LF4B 1VQMV 2O57A 3C90A 1JR9A 4DV1B 4MVOA 4CC6A 4IYIA 1FFXA 5F2VO 4FLTA 4CH6A 1Q3EA 4FLWA 4X89A 3E8BA 4AILC 1H2MA 5LP6A 4LF6O 1N32B 4MS2A 1COWG 2MW2B 5LOVB 2JGDB 1XILA 3OMIB 4UCRA 2W0XA 4DR6B 1XUQA 2VRZA 4PA6A 4IIJA 4B7KA 1XHXA 4FJCC 1BGYH 3OT7A 1KKDA 1PD3A 5FNVA 1M1KW 1IXBA 4H0LB 2IJKA 5IWAB 5IT9N 4ZHQB 4JI2O 5BMVB 2D2CB 4LFCB 4B3SB 1J95A 4O2AA 4G28B 3SJBC 3SDLA 1K3EA 3D3IA 5LXTA 3BY6A 1B6QA 4RUEA 2RQ6A 2KG7A 1NH2D 3IFXA 3S3WA 3CPWU 1TAEA 4DR2B 4UCTA 4JI5B 4ABMA 1ZSPA 4X88A 4JTAB 2YXHA 3ETEA 4I5SA 3ZRWA 4B3MO 1TA8A 5D5PA 2PGGA 5IY5C 1EZVH 2Q7EA 4HYOA 2LGQA 3OTOB 5LMUB 5GW7A 3W7SA 3G6BA 3STZC 1R3IC 3RN4A 3JCUZ 1K73W 1H8EG 2OIEA 3G80A 2UU9O 1PKXA 4LWSA 1MSWD 3VOUA 2PYJA 4DV1O 1QLEB 2Z3YA 1IBKB 4OX9B 4X1KA 4JI6B 1FXVA 2QA4V 4DV2O 1N32O 3ABLB 5C8YB 2XAFA 4O4JA 4PA4A 1BS3A 1JX9A 5KMGB 4NKGB 1NTZH 4PI0A 3ZMTA 1Q81W 4YJ3B 4HNAA 1I08A 4X64O 4MTXA 1HWYA 1KP2A 2DMXA 3BHPA 2IW5A 2QEXV 3ZHTA 1P7BA 4LF5B 4Z1MG 5LGNA 5IWAO 3LSSA 3K58A 3RYCB 1AI5A 3QO8A 2E76B 4LFCO 4R6ZA 1AP6A 4GX1A 2P6JA 4DUZB 5EIBC 3S3XA 1TUEB 4DV6O 2IJJA 2PI4A 3CCUV 1PNMA 4JI5O 1Z5WA 4L87A 4PDRA 1XL6A 3TJTA 1VARA 5B1BC 2X6CA 5B3SB 5B66Z 4DV5B 3ZHUA 5CA0A 1VF6C 1EZJA 1RSOA 3OTOO 3VQYA 4DO2A 4LNUB 1SKVA 3BFRA 4BIOA 4U7NA 1S5JA 3CXCU 3F5TA 1BHBA 1P4RA 3HPLC 5BXZA 5LP6C 4K0KB 3IC7A 4QE9A 3QO5A 4U3JB 4J10A 2RN9A 4DR3O 1RM1B 4LR3A 3HB3B 1YCIA 3K5MA 4I0XA 4BAYA 3T2MA 2W0FC 5JH7A 4DW0A 2UXCO 1QBZA 4P9OA 3LNNA 4I7ZB 1J5EO 3SYAA 1JPXA 4TV8B 1QQCA 3UQ8A 4JV5O 2QWOB 4RQFA 4LF5O 4JI7B 4FLUA 4FMTA 2OWOA 1N33B 2Q68A 3W7XA 1ZLZA 4NXNB 5KHJA 1LUWA 4KP4A 2ZE7A 2JJ2G 3O65A 3HR0A 3U10A 5LGTA 2E5LB 3OR6C 4PDLA 3SJAC 1XMQO 4X20A 2AZ0A 3K9SA 1Y6XA 3HKBA 3BVOA 1GO3F 3EVKA 4FLZA 1XDCA 3K08A 4BWAA 3SYPA 3FB7C 3OMAB 3ZCCA 1K33A 4JYYA 3TXQA 3WG7B 2FMLA 2CH7B 2EINC 5LMNB 3LSQA 1NTKH 2OTLV 1AJNA 3OFNG 2Q69A 3SJQC 1JOYA 1Y74A 3AG4C 3B40A 2WAMA 3RFRA 1RPOA 4MVRA 3HKDA 3ETQA 1I0HA 2F43G 1BT8A 1FFXB 1BQZA 2CTQA 3CCMV 2WLJA 1RPRA 1VQ7V 1YXBA 2AGAA 4H33A 3CCRV 2YIAA 2EIJB 4IT5A 4NB5A 4LH7A 3GB7C 5H9CA 3L73H 4UFZA 4WBNA 1FKAO 1DTOA 3F7VC 2UUAO 5DM6V 4IIJB 4CH3A 1DF5A 1XEQA 5JVDA 1G8MA 3CC4V 1YEWA 5FNVB 2ZT9B 5FLXN 3ZHVA 4P30A 4J80A 3H1LH 1PP9H 4TV9A 1AP5A 1M57C 1ZL8A 5LXTB 1SQQH 1UJWB 2KG7B 1GKFA 5KHKA 2PUSA 3ETGA 4MW3A 1UPGA 3BPZA 3ABKC 3CCEV 2E5LO 4JYAO 2LW7A 1WPXA 4BW5A 3ZRWB 4IGGA 4TQDA 1I5YA 1SQXH 4GX5A 5GONB 3MHHC 1D2DA 1XQ8A 3BCCH 3OD4A 2BCCH 2Z0AA 4B08A 4JTCB 3U0ZA 4GLXA 2ZNIA 2GUZA 2QR4A 1BE3H 2LFSA 2KSDA 4JYBA 3CC7V 2CTPA 3F5WC 1AI7A 4LWSB 4FLYA 4DR7O 2EILC 2Z5UA 3JAKB 4QGPA 3ZRVA 1K92A 4AQYB 1O9GA 1Q8IA 2WLHA 1WPBA 2HVKC 1FYJA 2C2AA 3FAVA 1N34B 1Y76B 1CPYA 2F23A 3W7UA 2QWPB 3DGEA 1NU1H 1JJOA 4O4JB 3AG7A 1GM8A 3SPCA 3RYFB 4NTYA 1OCOB 2CUGA 2R72A 2XNDG 3GWKC 1HDJA 4DRXA 1WA8A 1Z2GA 3SYOA 3STLC 5EZYA 4XDKA 4IYHA 5H6RA 2GTAA 4OPHA 5JQGA 1WJZA 4JI8O 4JI3B 1MMMA 1FJGB 1VEWA 1ZUQA 5CBHA 3JD0A 3ZIAG 3AG2B 3G67A 4LFAB 4ZI7A 5KUKA 1CXZB 3A8TA 3CYOA 4RAIA 3CSXA 4UVAA 4TUYA 1LUVA 3RYIB 4LFBB 2Q6AA 1AR1B 3CC2V 3A2FA 1E79G 5DECA 4J7KA 2DYSC 4D7TA 1SQFA 1PNKA 3P30A 1N36O 2OCCB 3JD2A 1FFTB 1BMFG 5CA0B 4G2KA 3ETDA 4FPPA 4I4TA 1RSOB 5LHIA 1H2NA 4O4IB 3OUFA 3OM3B 3BA8A 1F4NA 3CRQA 3ABTA 2ADPA 3RYHB 4A5UB 2QDOA 3OW2U 1K97A 4Q6GA 2LP7A 2WLIB 3X2QC 4YY3O 5BR8B 4AQYO 1OCZC 1KB9F 4EB6A 3EHBB 4X9QA 4CZZA 3AG1B 1M90W 2P4VA 1N34O 3T1HO 2BTOA 1NI8A 4LF6B 2PF4E 4R8CA 2UXDB 2LO1A 2ZIMA 3JCZA 4LF7O 3A0BZ 4MVZA 1PL0A 2BOCC 4MVUA 3I56V 2WLMA 1AR5A 2EIKC 2YIBA 2HP8A 1FJGO 4JI2B 4UVBA 2OT5A 1H8HG 2PTMA 4PA3A 2G38A 4LFAO 2Q67A 1TUBB 2AHZA 4MTOA 4J42A 2EZPA 3KCXA 5CB4B 2EJ7A 1M56B 3RT3C 3LDEA 5LL6Y 1SF9A 4OGQB 4LP8A 1HR0O 3HKBB 1VQNV 3BEHA 1UFIA
chains in the Genus database with same CATH topology
1E1RG 4JPRA 1R3LC 3ABLB 3E8GA 3ZJZA 4P2ZA 2XAFA 4PA4A 1OCCC 2V1DA 1I5XA 4TWKA 1JX9A 4G27B 1YI2V 3T4ZA 1XL4A 3B8MA 4PA7A 3ZMTA 1K5SA 1Q81W 2MK3A 3MD0A 1M9NA 2JEXA 4HAMA 4MTXA 1HWYA 1KP2A 4TT3G 2IW5A 1NQTA 2QEXV 1P7BA 1AI6A 4Z1MG 5LGNA 5CA3A 5L3GA 3LSSA 1W2BU 1QR9A 4OXSA 1M57B 1KD1W 4UV9A 5DN6G 3ASNB 1AI5A 3QO8A 1MABG 3OUSA 1R6NA 4N21A 2R9IA 4R6ZA 3CCSV 4XDJA 2ZXWB 2UXNA 4GX1A 2HVJC 1IXMA 2P6JA 4LBEC 3E35A 3R65A 1V54C 3ABKB 1VQKV 5B1OA 3FYEB 1TUEB 3K79A 4J9ZB 5EBWC 2HKOA 3JD4A 2IJJA 1OCRB 1F51A 4JYCA 2PI4A 5L3BA 1ROPA 3CCUV 2D3OW 1PNMA 1VQ8V 4WFEA 1QLEC 3B8NA 2IJHA 2EIMC 4U7OA 1S3JA 3ZMVA 4L87A 3SPHA 4PDRA 5HFLA 1MG1A 1K9MW 2ZR3A 1XL6A 4RQEA 4MTFA 1JVMA 3JYCA 3OE7G 5B1BC 2X6CA 5B3SB 1Y66A 1NJIW 3FB6C 4JF3A 4QIWF 1PNLA 4RO2A 2EZOA 2WWWA 1EZJA 5IDJA 2HR3A 2V7QG 4DO2A 2EILB 3TCUA 3WFVA 2B1GA 3CXCU 1K4CC 4U7NA 1BHBA 3OMNB 1VQPV 1R73A 1P4RA 3HPLC 3IC7A 4QE9A 3QO5A 1QVFU 2X6AA 1W0JG 2WLNA 1RM1B 3ABMB 2HJFC 1S77D 4LC1A 3T4DA 3AG3C 3HB3B 2OCCC 3K03A 3RBZA 5L3EA 4JGSA 2XASA 2HLDG 4BAYA 5HFMA 4DXWA 4PELA 2W0FC 3T2MA 4KFMA 3RVYA 3CCJV 4KUMA 4QPJA 1W0KG 4JAVA 1GMGA 3SPIA 4PDMA 1NVPD 5KA5A 1QBZA 2Y69B 3LDCA 4P9OA 4XDLA 3QNEA 3CMAV 1SRYA 2DYRB 3SYAA 1JPXA 1YJNV 1YJ9V 3K04A 2DQ0A 3E83A 1H38A 5KA6A 4RQFA 5KUMA 4FMTA 5EC1C 2Q68A 3W7XA 3VBBA 1FXKB 1NR7A 4KP4A 4RUFA 3CCQV 2JJ2G 2JJ1G 3AG1C 4WFFA 2DW4A 2DYSB 2XAGA 3ASOC 5LGTA 4CBCA 3OR6C 4PDLA 3E2EA 5B1AB 5H6QA 1AJQA 3MHSC 3FB8C 2K1EA 1VQ6V 1R3KC 4QE7A 3ZRSA 1NBMG 1QR8A 2M7WA 2NLJC 3G71V 3OAAG 4MVQA 4MW8A 4R7CA 3UKMA 4HZ3A 1GO3F 2EJRA 1QVGU 3K08A 2X6BA 3B77A 1Q82W 3PJSK 3SYPA 3FB7C 3OMAB 3ZCCA 1K33A 2QKSA 3WG7B 2UXXA 2NNUA 1YITV 2ZDIA 2EINC 3ZMSA 2ITDC 4WFHA 2A9HA 3LSQA 1S5HC 2OTLV 1AJNA 3X2QB 2QTOA 3OFNG 2Q69A 3T1CA 3SJQC 1R6KA 3ZN1A 1JOYA 1OCZB 5L3DA 2WLKA 3AG4C 3F7YC 1SETA 2WAMA 2WSSG 1RPOA 2ZD9A 2DWDC 4MVRA 1YSCA 2JIZG 3SPJA 2F43G 1AROP 1LNQA 3LUTB 3QO7A 1BHAA 4UXNA 1M56C 3CCMV 1K34A 2WLJA 1RPRA 1VQ7V 3ZN0A 4H33A 3CCRV 4QNHB 5BZBA 2IU0A 5B1NA 4MVSA 2EIJB 5J9PC 3GB7C 1YTFB 3K0GA 3A0RA 3OR7C 5FL7G 5H9CA 2B5UA 4GX2A 1DTOA 3F7VC 3E8HA 3ABLC 4P9PA 2OTJV 5DM6V 2X0LA 1JCHA 1DF5A 4E2LA 1G8MA 2XOKG 3ZMUA 2ZDIC 3CC4V 4J9YB 5IY5B 3M99B 4WF9V 1KC8W 2EIKB 4WFGA 4I9WA 4EKWA 1NKDA 1SERA 4P30A 1G4YB 2QM8A 4LCUC 3ABUA 1N8RW 2LFRA 1GTOA 1M57C 1S72V 2PI5A 1Y4MA 2DWEC 4MTGA 3ASNC 4GCZA 1ORQC 1UJWB 3SPGA 2JEUA 1SZTA 1VQ9V 1GKFA 2EBOA 2ZXWC 3AEIA 4YXWG 4WCEV 3ETGA 4MW3A 5LHHA 5EC2C 3CP1A 3K9AA 3ABKC 1R3JC 1L1FA 3CCEV 4FK5C 1V55B 4MSWC 1OCRC 3FKSG 1WPXA 4BW5A 3ZRWB 4JTDB 1I5YA 4GX5A 1KQSU 3MHHC 2YEVB 2HG5C 1JJ2U 4WFBV 1YHQV 2A0LA 1ZWIC 2IU3A 1OCCB 4JTCB 4BIUA 5B3SC 2LFSA 3OGCC 4JYBA 3CC7V 1NR1A 4PA9A 3G4SV 3F5WC 1WLEA 5IYBO 1AI7A 2YEVA 2XAQA 4R50A 2ZQMA 4UVCA 2GHYA 5CBFA 2EILC 2Z5UA 3ZRVA 3LDDA 1K92A 1K5QA 2KB1A 1VQ5V 5L3CA 1NH2B 2A79B 3ML0A 1CEZA 5EK0A 2H8PC 2WLHA 3E8FA 3GWOA 2P7TC 2HVKC 2C2AA 3TETA 1AJPA 3P32A 3KG2A 1CPYA 2W6JG 2WLLB 1E1QG 3EFFK 3W7UA 1VQLV 1FXKA 3DGEA 3K0DA 5CMUA 1FS0G 1RM1C 3ABMC 3ZMZA 1GM8A 3ZRXA 3SPCA 2EIMB 1VQ4V 3SYCA 1DLBA 1OCOB 2XNDG 2ITCC 2WLLA 4X8AA 3G6EV 1AI4A 4ASUG 1Q86W 4H37A 3SYOA 5B1BB 2W6IG 3STLC 1GK9A 1BL8A 4XDKA 4PDVA 3CMEV 3CD6V 5H6RA 3W7TA 4TSFG 1YTFD 3RVZA 2Y69C 3K06A 5IYDO 4MVMA 2H94A 3JD3A 5CBHA 2DYRC 1F23A 1KECA 2FTKA 3JD0A 3ZIAG 3AG2B 5IYCO 1YJWV 4GT1A 4QJFB 5KUKA 1K8AW 3CYOA 4RAIA 3OEHG 5LGUA 3IGAC 4UVAA 1KP3A 5C93A 3K3WA 3RW0A 1FXKC 3CCLV 1VQOV 4QPKA 1VQMV 2BOBC 2Q6AA 4ZKIA 1AR1B 3CCVV 3CC2V 3DTUB 4MVOA 1E79G 1YIJV 2DYSC 3AG3B 3E86A 4ZBMA 1K4DC 1PNKA 3P30A 4X89A 3E8BA 5B1AC 3UM7A 2IJIA 2XAJA 4MS2A 1COWG 2OCCB 3JD2A 1FFTB 3SYQA 1EBOA 3TK1A 3OMIB 1BMFG 4N23A 4WFAV 5L3FA 1EFRG 2P67A 4G2KA 3ETDA 4FPPA 5LHIA 1ENVA 3FYIB 3OUFA 4PA6A 1OCOC 2IH1C 2GSMB 3OM3B 5EBMC 5CBGA 1F4NA 4FJCC 1JQ0A 3ABTA 1SESA 2QM7A 5CN0A 3WG7C 3NXSA 1KKDA 1PD3A 3OW2U 1M1KW 1K97A 1FXHA 2LP7A 1GM9A 3E89A 3FB5C 1OHHG 2IJKA 4MT8A 2WLIB 3X2QC 1QCEA 2XAHA 1OCZC 3AG2C 3EHBB 1CP9A 1J95A 1QLNA 4G28B 3I55V 4CZZA 3AG1B 3H01A 1M90W 4GX0A 3W7WA 2JK5C 1K3EA 3D3IA 1OZ0A 5EBLC 3BY6A 1B6QA 3ASOB 4RUEA 2QE7G 2WLIA 1K7DA 1S0VA 2EIJC 4R8CA 1NH2D 3IFXA 4UV8A 3CPWU 1F4MA 1DF4A 4JAUA 2CK3G 3JCZA 4X88A 4JTAB 3ETEA 2DQ3A 2WPDG 4I5SA 4MVZA 3ZRWA 1PL0A 2BOCC 2IH3C 4MVUA 4XBFA 3I56V 2WLMA 5IY5C 4HYOA 2EIKC 2EINB 5LHGA 5GW7A 4UVBA 2R9RB 3W7SA 2OT5A 2JDIG 1H8HG 2YSUB 3LNMB 3OEEG 4PA3A 1H2GA 4UUJC 2ZR2A 1GM7A 3STZC 2AHYA 5E1AC 4FIPC 2Q67A 1R3IC 5LBQA 3AG4B 1K73W 1H8EG 2AHZA 4MTOA 1Q7YW 2EZPA 1PKXA 1MOFA 1V54B 3JD1A 1THZA 4F4LA 1MSWD 3VOUA 1M56B 2X7RB 4JASA 3LDEA 1S76D 2HFEC 3D36A 2Y48A 1QLEB 2Z3YA 4LP8A 4Q20A 2B1IA 1NVPB 2P90A 1VQNV 1FXVA 1V55C 4BIZA 2QA4V 2ATKC 3BEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDM A;  3LDC A;  4MVO A;  1R3L C;  4P9O A;  4XDL A;  4LCU C;  3E8G A;  3ZJZ A;  4P2Z A;  2DYS C;  1M57 C;  4PA4 A;  2DWE C;  2ATK C;  4MTG A;  3ASN C;  3SYA A;  3E86 A;  1OCC C;  4ZBM A;  1K4D C;  1ORQ C;  4TWK A;  4X89 A;  3E8B A;  4G27 B;  5B1A C;  3SPG A;  3UM7 A;  2ZXW C;  3K04 A;  3E83 A;  4MS2 A;  3T4Z A;  1XL4 A;  3SYQ A;  4MW3 A;  4PA7 A;  5EC2 C;  5KUM A;  3ABK C;  5EC1 C;  1R3J C;  2Q68 A;  4MSW C;  4RUF A;  1OCR C;  3AG1 C;  4WFF A;  4BW5 A;  1P7B A;  3OUF A;  1OCO C;  2IH1 C;  4PA6 A;  5EBM C;  4JTD B;  5CBG A;  4GX5 A;  4OXS A;  3ASO C;  2HG5 C;  3WG7 C;  2A0L A;  1KKD A;  1ZWI C;  4CBC A;  3OUS A;  3OR6 C;  4PDL A;  4JTC B;  4R6Z A;  3FB8 C;  5B3S C;  3E89 A;  3FB5 C;  2K1E A;  4XDJ A;  4GX1 A;  2HVJ C;  2WLI B;  1R3K C;  4QE7 A;  3X2Q C;  3OGC C;  3ZRS A;  4LBE C;  3R65 A;  1V54 C;  1OCZ C;  4PA9 A;  2NLJ C;  3AG2 C;  4J9Z B;  4MVQ A;  5EBW C;  3F5W C;  1J95 A;  4MW8 A;  4R7C A;  3UKM A;  4HZ3 A;  2YEV A;  4R50 A;  4G28 B;  5CBF A;  3K08 A;  2EIL C;  2JK5 C;  4GX0 A;  1QLE C;  2X6B A;  4WFE A;  3LDD A;  2EIM C;  2KB1 A;  3PJS K;  3SYP A;  3FB7 C;  5EBL C;  2A79 B;  2QKS A;  3SPH A;  4RUE A;  2WLI A;  4PDR A;  5EK0 A;  2H8P C;  1XL6 A;  2WLH A;  2EIJ C;  2EIN C;  3E8F A;  2P7T C;  1JVM A;  2ITD C;  3IFX A;  2HVK C;  3JYC A;  4MTF A;  4WFH A;  5B1B C;  2A9H A;  2X6C A;  3TET A;  1S5H C;  4R8C A;  3FB6 C;  2QTO A;  3KG2 A;  2Q69 A;  2WLL B;  3SJQ C;  3T1C A;  3EFF K;  4X88 A;  2WLK A;  3AG4 C;  3F7Y C;  4RO2 A;  3K0D A;  2ZD9 A;  2DWD C;  4MVR A;  4JTA B;  3SPJ A;  3ABM C;  3LUT B;  1LNQ A;  4MVZ A;  1M56 C;  2BOC C;  2IH3 C;  4MVU A;  2WLJ A;  3TCU A;  3SPC A;  2WLM A;  1K4C C;  4H33 A;  3SYC A;  5IY5 C;  4QNH B;  5BZB A;  2ITC C;  2WLL A;  2EIK C;  3HPL C;  4HYO A;  4MVS A;  4X8A A;  5J9P C;  4H37 A;  2R9R B;  4QE9 A;  3GB7 C;  3LNM B;  3SYO A;  3K0G A;  4PA3 A;  3STL C;  3OR7 C;  4UUJ C;  1BL8 A;  4XDK A;  4PDV A;  2AHY A;  5E1A C;  3STZ C;  2Q67 A;  1R3I C;  4GX2 A;  3F7V C;  2X6A A;  3E8H A;  2Y69 C;  3RVZ A;  2AHZ A;  3K06 A;  3ABL C;  4MTO A;  4P9P A;  4MVM A;  2WLN A;  2HJF C;  3T4D A;  2DYR C;  4F4L A;  3AG3 C;  5CBH A;  3VOU A;  5KUK A;  3LDE A;  2HFE C;  2OCC C;  3K03 A;  4J9Y B;  3RBZ A;  4RAI A;  3IGA C;  4LP8 A;  4WFG A;  4I9W A;  3RW0 A;  4EKW A;  4DXW A;  3T2M A;  2W0F C;  1V55 C;  4KFM A;  1G4Y B;  4P30 A;  3RVY A;  2BOB C;  2Q6A A;  3BEH A;  3SPI A; 
#chains in the Genus database with same CATH topology
 1E1R G;  2ZE8 A;  4O4H B;  4DW1 A;  4IHJ B;  1VF7 A;  2ZKO A;  1I5X A;  4TWK A;  4G27 B;  2GTS A;  3E22 B;  1XL4 A;  3B8M A;  4PA7 A;  1M9N A;  2ZCE A;  3QTC A;  2N04 A;  3QF7 A;  4HAM A;  1Y74 B;  4YHH O;  4TT3 G;  3M7M X;  3HKD B;  2UU9 B;  3CEI A;  1VF6 A;  4DV3 O;  5CA3 A;  5BR8 O;  5L3G A;  1W2B U;  3EXA A;  1KD1 W;  3BAB A;  2FYU H;  3D36 C;  5CA1 B;  3ASN B;  3NR7 A;  2ARH A;  1MAB G;  3OUS A;  2ZXW B;  2UXN A;  4DV2 B;  3E35 A;  3R65 A;  1IVS A;  4WBN B;  1VQK V;  1TGO A;  3FYE B;  1SQP H;  2HKO A;  1OCR B;  1F51 A;  5L3B A;  2Q9L A;  2D3O W;  2UXD O;  4WFE A;  1JFF A;  1QLE C;  2CGO A;  3ZMV A;  4CS3 A;  1MG1 A;  1P7G A;  3Q4H A;  3OE7 G;  4X64 B;  4W4L A;  1NJI W;  3GVM A;  1PNL A;  4RO2 A;  3WU2 Z;  2P5O A;  1ZL8 B;  3FFQ A;  2FL4 A;  4J11 A;  2PYL A;  2RNB A;  4O4L A;  4DR5 O;  4O2B A;  4DV6 B;  4JI4 O;  5A9G A;  5IYZ A;  1GN2 A;  1QVF U;  1HNW B;  1XBL A;  3AG3 C;  2N05 A;  1B3Q A;  2DE0 X;  4X1I A;  2PY5 A;  5ITZ B;  3JAS B;  1Z5V A;  5L3E A;  2RJZ A;  5HFM A;  4DXW A;  1B04 A;  4DV0 O;  4UCS A;  3RVY A;  4Z1V A;  4QPJ A;  4PDM A;  1EN5 A;  4X62 O;  3QNE A;  3VQV A;  1ZX3 A;  5JJE B;  1SS3 A;  5KLV H;  1SRY A;  1Q90 D;  3VQW A;  3TGU H;  2QJ1 A;  4TQF A;  1YJ9 V;  5KA6 A;  1OJH A;  5EC1 C;  1PPJ H;  3VBB A;  2L6L A;  3J81 N;  2F4V O;  4RUF A;  4DR3 B;  2JJ1 G;  4I55 A;  1MSD A;  3N27 A;  4ICG A;  4NVP A;  4ZIB A;  4GZR B;  4F6R A;  2XAG A;  3ASO C;  3U11 A;  4FLV A;  1XRE A;  3E2E A;  3ZS8 C;  5H6Q A;  5TIS Z;  1VQ6 V;  1R3K C;  3AK1 A;  1NBM G;  1QR8 A;  2F1M A;  2UXC B;  4JZ2 A;  5JQG B;  4MVQ A;  1J5E B;  4MW8 A;  5BY1 A;  2EJR A;  1IBL O;  1Q82 W;  4JV5 B;  3T1Y B;  4ZOL A;  4NXM B;  4TUY B;  2ITD C;  1EN4 A;  2AXT Z;  2A9H A;  2XUM A;  5L3D A;  2WLK A;  5D5Q A;  1SET A;  2WSS G;  2QKC A;  1ARO P;  3QO7 A;  1GH6 A;  4UXN A;  1K34 A;  5FPO A;  2QWQ B;  1XMQ B;  3ZN0 A;  1YDX A;  5J2T A;  2XHB A;  5BZB A;  1HNW O;  1L0N H;  5J9P C;  5JJJ B;  3K5L A;  4JAA A;  1Q6U A;  4I4T B;  2R9A A;  2M6Y A;  2QM4 A;  3WB0 A;  4TOI A;  3L75 H;  4DK0 A;  5JWP A;  4E2L A;  3ZMU A;  2XOK G;  2ZDI C;  5IY5 B;  3M99 B;  1KC8 W;  2GBO A;  4YJ2 A;  4CH5 A;  1M93 A;  4EKW A;  1SA0 A;  1W59 A;  4DV4 O;  1SER A;  1G4Y B;  1PV0 A;  1GN3 A;  3ABU A;  4MTG A;  2QSA A;  2L35 A;  4GCZ A;  2XTA A;  4KL1 A;  4YXW G;  2LQT A;  4WCE V;  2CTW A;  5EC2 C;  3CP1 A;  2BSK A;  2FB5 A;  4DR1 O;  1L1F A;  4FK5 C;  2UUA B;  2H3O A;  4JI1 O;  4K8X A;  1GN6 A;  3FKS G;  1HNZ B;  4JTD B;  2YEV B;  2HG5 C;  3JAL A;  4WFB V;  2IM9 A;  1ZWI C;  2IU3 A;  2Q7H A;  3CWB H;  3BAA A;  3OGC C;  4E4E A;  5IJ9 A;  3T1Y O;  1P84 F;  4U3F H;  1WLE A;  4NXM O;  4UVC A;  5CBF A;  1R6T A;  2YDE A;  1K5Q A;  5LYJ A;  3IC9 A;  1MZF A;  5L3C A;  2H8P C;  3L70 H;  4JYA B;  3O9O A;  1TVK B;  5KHG A;  2Y4T A;  2WLL B;  4FM2 A;  1E1Q G;  3EFF K;  1XHZ A;  3SJC C;  3ABM C;  4FFK A;  4X1Y A;  2YI9 A;  1I7F A;  4BW9 A;  1VQ4 V;  4FM0 A;  3JAW A;  1DLB A;  1JA8 A;  1QHT A;  2ITC C;  1AI4 A;  1Q86 W;  1WP7 A;  5B1B B;  2W6I G;  3N2K A;  4DR7 B;  2Y69 C;  3JAT B;  5IYD O;  4MVM A;  2ILM A;  3JD3 A;  4FFB A;  2DYR C;  5IYC O;  2FTK A;  3M8A A;  1YJW V;  4B3T O;  4QJF B;  1EN6 A;  5IJ0 A;  3IGA C;  1AR4 A;  5LP6 B;  1FXK C;  2WA3 A;  2RMK B;  2BOB C;  4ZKI A;  3CCV V;  1HW7 A;  1YIJ V;  1I94 O;  4Z2W A;  4FM1 A;  3E86 A;  4ZBM A;  3KKY A;  3JAR A;  1K4D C;  5B1A C;  3UM7 A;  2XAJ A;  3SYQ A;  3TXS A;  1HNZ O;  3TK1 A;  4WFA V;  1EFR G;  2P67 A;  4JI8 B;  2CAZ C;  2CE4 A;  4K3A A;  3FYI B;  1Y67 A;  1BZK A;  1OCO C;  5CBG A;  2GSM B;  4O2A B;  1JQ0 A;  5CN0 A;  1SES A;  3NXS A;  1ZAU A;  4O4L B;  1FXH A;  3OTF A;  3FB5 C;  4MT8 A;  5IYZ B;  2YIB D;  1URF A;  2ODM A;  1KUQ A;  2ZM6 B;  1YF2 A;  3AG2 C;  3B4S A;  2P22 C;  2JK5 C;  1N36 B;  1OZ0 A;  1RP3 B;  2QE7 G;  1S0V A;  4GKK O;  4ZHQ A;  4UV8 A;  5BMV A;  1F4M A;  3LSU A;  4EEQ A;  3H1H H;  4NR1 A;  2IBZ H;  4GUN A;  5KX5 A;  1PM9 A;  5EIB D;  2LJ2 A;  2VQF B;  3JAM N;  2A3Q A;  4XBF A;  3ZBH A;  1H2K A;  4YY3 B;  2EIN B;  3OEE G;  2YSU B;  3LNM B;  3K59 A;  2UXB O;  2ZR2 A;  1GM7 A;  1GRJ A;  3THO A;  4X1K B;  5LBQ A;  3AG4 B;  1V9P A;  4H44 B;  3T1H B;  4X65 O;  1MOF A;  1V54 B;  2AZ2 A;  3K57 A;  1N4C A;  2X7R B;  4JAS A;  1HP8 A;  2ZE5 A;  1FPO A;  2OCH A;  3D36 A;  4FZ0 A;  4Q20 A;  1NVP B;  4LF7 B;  1V55 C;  4BIZ A;  2ATK C;  4KXR A;  1R3L C;  2V4D A;  4HNA B;  1KYO F;  2Q5Z A;  1G1X B;  1OCC C;  2V1D A;  3A0H Z;  1YI2 V;  2GV9 A;  3T4Z A;  4YIP A;  2MK3 A;  3MD0 A;  2JEX A;  5C8Y A;  2BTQ A;  2UUC O;  1NQT A;  2B9Z A;  2FKX A;  5KMG A;  1M57 B;  2AW9 A;  4UV9 A;  4H13 B;  5DN6 G;  2ZM6 O;  1G6U A;  1HR0 B;  1R6N A;  1XMO B;  2R9I A;  3CCS V;  4XDJ A;  1WB7 A;  3ZX6 A;  1IXM A;  4LBE C;  2JS5 A;  3ABK B;  3APO A;  2WA4 A;  2P06 A;  4JYC A;  2CDY A;  3B8N A;  2EIM C;  1BQ0 A;  1S3J A;  3SPH A;  2HHH O;  4KHP O;  4I9Q A;  2ZR3 A;  4RQE A;  1JVM A;  3SGI A;  4YJ2 B;  2VQF O;  1SC5 B;  4YHH B;  3FB6 C;  3RGB A;  4JI0 O;  4QIW F;  2ZIO A;  2EZO A;  2WWW A;  1SQG A;  4DV3 B;  1H2S B;  1FD9 A;  2P4K A;  2V7Q G;  2EIL B;  1A32 A;  1WP8 A;  2B1G A;  1K4C C;  3OMN B;  1VQP V;  3P3P A;  3ZHQ A;  2YC0 A;  4I0X B;  2JRI A;  4DV7 O;  1MZE A;  2X6A A;  4LNU A;  1IX9 A;  5JH7 B;  4LC1 A;  1KU9 A;  1Q5O A;  3K03 A;  3BRC A;  4UCV A;  1HNX O;  2Q0A A;  5JCO A;  4KFM A;  2R70 A;  4JZG A;  4KUM A;  1W0K G;  4JAV A;  2VS0 A;  3APQ A;  2VQE O;  4HBN A;  1NVP D;  5KA5 A;  4XDL A;  5GTH Z;  1IUR A;  3AK2 A;  1XOU A;  4DR5 B;  1YJN V;  2QGN A;  2XT9 A;  3K04 A;  4JI4 B;  2YXY A;  4LF8 O;  3D8C A;  4LF9 O;  2E3C A;  3D3Q A;  4UB6 Z;  4X20 B;  5B5E Z;  4WFF A;  1XMO O;  3CJH A;  2JVD A;  5AG2 A;  3H1K H;  4GYC B;  2DW4 A;  2DYS B;  1PL4 A;  3CRM A;  4GKJ B;  3L9D A;  3FB8 C;  3R66 A;  4DV0 B;  4QE7 A;  5K1X A;  3ZRS A;  1LR1 A;  3N2K B;  2NLJ C;  4X62 B;  2YXL A;  1KKC A;  4R7C A;  4HZ3 A;  1QVG U;  1Q6H A;  2X6B A;  4LH6 A;  3PJS K;  2QKS A;  2NNU A;  2ZDI A;  3J80 N;  3RWR D;  3ZMS A;  4WFH A;  2F4V B;  4EFB A;  3X2Q B;  3T1C A;  3CE2 A;  3KCY A;  3DXR A;  1OCZ B;  5GTI Z;  2DWD C;  1YSC A;  3SPJ A;  2LW1 A;  1BHA A;  3JAR B;  3HKC A;  5KHH A;  5JVD B;  2IU0 A;  5B1N A;  4MVS A;  4K35 A;  1YTF B;  3JSL A;  5FL7 G;  3CXH F;  4RWU A;  1RFY A;  4X66 O;  3ABL C;  4P9P A;  2OTJ V;  1IBL B;  5JJN B;  4TV9 B;  2ETN A;  3C3S A;  3IJ4 A;  3SR2 C;  4WF9 V;  2EIK B;  2A06 H;  4DUY B;  2VWJ A;  4PI2 A;  4UB8 Z;  4PHZ A;  2HJD A;  3B2E E;  1AIL A;  4LCU C;  1N8R W;  2LFR A;  1GTO A;  2PI5 A;  1Y4M A;  3SPG A;  2JEU A;  1SZT A;  5J2U A;  3L74 H;  5KX5 B;  2GUZ B;  3ZHS A;  1XNQ O;  2Y0I A;  4GKJ O;  2OYQ A;  4FVM A;  4L8J A;  1GN4 A;  3QG5 A;  2QKA A;  3MAQ A;  1MA1 A;  1YHQ V;  1X4T A;  2OIG A;  4AI8 A;  5B3S C;  4K8Z A;  4DV4 B;  1XNR O;  4NYK A;  3G4S V;  3UO2 A;  3FAV B;  5GON A;  2XAQ A;  4R50 A;  4NTX A;  3DSQ A;  2PZS A;  2GHY A;  2ZIN A;  4UCU A;  2A79 B;  3ML0 A;  1CEZ A;  4OPA A;  3N2G A;  4DR1 B;  4D6T H;  3E8F A;  3TET A;  2K9P A;  2W6J G;  1MNG A;  4JI1 B;  1VQL V;  3PN1 A;  4DRX B;  5JCO C;  1FXK A;  1WA8 B;  3JAK A;  3K0D A;  4LF4 O;  5EZY B;  2YS8 A;  1RM1 C;  3ZMZ A;  4DR4 B;  4B7E A;  3L71 H;  3HKE A;  1Y76 A;  4X8A A;  4ASU G;  4ZI7 B;  4H37 A;  3WB2 A;  2BTQ B;  3CME V;  4IL6 Z;  4TSF G;  1YTF D;  3RVZ A;  3RYF A;  2H94 A;  4DR6 O;  1F23 A;  4DUY O;  1K8A W;  4J41 A;  1L8D A;  3OEH G;  3BA9 A;  3RW0 A;  3CCL V;  3UT5 A;  3DTU B;  1L0L H;  4B3S O;  1N0N A;  2QWR B;  1BCC H;  1YZB A;  3AG3 B;  5KHI A;  3OGI B;  4I50 A;  2IJI A;  3RYI A;  1EBO A;  4N23 A;  2DN9 A;  5L3F A;  3UCS C;  4DR2 O;  1ENV A;  2EX3 A;  5EBM C;  2IH1 C;  4EB6 B;  4B3T B;  2RCV A;  5H5N A;  3WG7 C;  2QM7 A;  1XI1 A;  1GM9 A;  3E89 A;  1OHH G;  5KAF Z;  2Q73 A;  2Y4U A;  1QCE A;  2XAH A;  5LMU O;  1US6 A;  4O4I A;  4UCO A;  1CP9 A;  4CS4 A;  3CS5 A;  1I94 B;  1QLN A;  3I55 V;  3H01 A;  3RYH A;  4GX0 A;  3W7W A;  2BE3 A;  4W4K A;  2Q8V A;  5EBL C;  3ASO B;  3H1J H;  4EFE A;  2WLI A;  1K7D A;  2VWK A;  2EIJ C;  4DR4 O;  1DF4 A;  4JAU A;  1IBK O;  2CK3 G;  3CX5 F;  4OX9 O;  4YIO A;  4JI6 O;  2DQ3 A;  2WPD G;  1U97 A;  2IH3 C;  1R1B A;  2YIC A;  1JMK C;  4DYL A;  2UUB B;  5LHG A;  2R9R B;  3MDS A;  1B06 A;  2JDI G;  1H2G A;  3I5D A;  4UUJ C;  2AHY A;  5E1A C;  5H2F Z;  4FIP C;  3VQX A;  1U96 A;  3CJH B;  1Q7Y W;  1KMI Z;  3AK3 A;  2EUL A;  3B09 A;  3JD1 A;  1THZ A;  2F66 C;  4F4L A;  3QVN A;  4GKK B;  2RDC A;  4B3R B;  1S76 D;  2HFE C;  2ZNJ A;  2Y48 A;  1TUB A;  2B1I A;  2P90 A;  5EYP A;  1IBM B;  4DUZ O;  1M5I A;  5CB4 A;  4JPR A;  3E8G A;  3ZJZ A;  4P2Z A;  3P3N A;  1NT2 B;  1QU7 A;  2UXB B;  1K5S A;  3DXR B;  2QWN B;  1KBH A;  1VF5 B;  5LA6 A;  4DV5 O;  4X65 B;  1M4U A;  4O4H A;  4IHJ A;  1AI6 A;  1QR9 A;  3E22 A;  3HKC B;  4OXS A;  1VMG A;  1JFF B;  4DK1 A;  1NZ6 A;  4N21 A;  2HVJ C;  1S5L Z;  3Q4H B;  1V54 C;  4K0K O;  5B1O A;  3K79 A;  4J9Z B;  5EBW C;  3JD4 A;  2E75 B;  1ROP A;  5CA1 A;  1VQ8 V;  2IJH A;  2NN4 A;  1DK1 A;  4U7O A;  5HFL A;  1K9M W;  3WB1 A;  4MTF A;  3JYC A;  1F7Y A;  2F95 B;  1Y66 A;  5LOV A;  2UUC B;  2JGD A;  3CHX A;  2Y0P A;  4JF3 A;  4O2B B;  2KKW A;  5E79 Z;  5IDJ A;  2UUB O;  2HR3 A;  4BR6 A;  3H1I H;  3TCU A;  1WN7 A;  3WFV A;  1ZTE A;  1R73 A;  4X1I B;  5J2U B;  1EM1 A;  3L72 H;  4JI7 O;  4B3R O;  3CRA A;  1P49 A;  1N33 O;  3DC5 A;  4NXN O;  1Q6I A;  1W0J G;  2WLN A;  5IE9 A;  3ABM B;  2HJF C;  2KQX A;  3T4D A;  1S77 D;  2HHH B;  4KHP B;  1IBM O;  1WNS A;  1FAF A;  2OCC C;  3RBZ A;  4NTW A;  1GAX A;  2Q0O C;  4JGS A;  4FZ1 A;  2XAS A;  2HLD G;  4JI0 B;  1NS1 A;  4PEL A;  1D5A A;  3DC6 A;  3CCJ V;  3CRR A;  1GMG A;  3SPI A;  2ZE6 A;  1T5E A;  2Y69 B;  3LDC A;  3CMA V;  1SZX A;  5ITZ A;  3JAS A;  4I55 B;  2DYR B;  1IZ3 A;  3N2G B;  4F6R B;  2DQ0 A;  3E83 A;  1H38 A;  3ZHR A;  5KUM A;  4DV7 B;  3IAY A;  2CGN A;  4D7S A;  5LMN O;  1FXK B;  1NR7 A;  3CCQ V;  3AG1 C;  4CBC A;  1HNX B;  3HKE B;  3C3T A;  5B1A B;  1AJQ A;  3MHS C;  2K1E A;  3CB2 A;  4PD4 F;  1AB3 A;  4ZOL B;  2VQE B;  2M7W A;  4CS2 A;  3G71 V;  3OAA G;  1YVW A;  1SQB H;  3UKM A;  1O9H A;  1OV9 A;  2JS3 A;  3B77 A;  2YUA A;  5DED A;  4LF8 B;  4LF9 B;  2UXX A;  1YIT V;  4F6E A;  4PV1 B;  5J2T B;  1S5H C;  4YJ3 A;  3ZN1 A;  2QTO A;  1R6K A;  1VIB A;  3F7Y C;  3UT5 B;  2ZD9 A;  2JIZ G;  3LUT B;  1LNQ A;  3J7A U;  2N74 A;  3JSN A;  1M56 C;  1SQV H;  1VP7 A;  5FPR A;  4I50 B;  3RYC A;  1H2L A;  4QNH B;  3K0G A;  3A0R A;  3OR7 C;  2QTS A;  2B5U A;  4GX2 A;  3KZI Z;  4CC5 A;  1SA0 B;  3E8H A;  2F93 B;  2X0L A;  1JCH A;  1DGS A;  4J9Y B;  5KAI Z;  2GDS A;  4WFG A;  1WAZ A;  4I9W A;  1NKD A;  3ICX A;  2YI8 A;  2BSK B;  2CTR A;  2QM8 A;  2YID A;  1S72 V;  2DWE C;  3ASN C;  1Q43 A;  1WB8 A;  1ORQ C;  1VQ9 V;  2EBO A;  2ZXW C;  3AEI A;  3UO3 A;  3JAL B;  5LHH A;  3K9A A;  4J7Z A;  2LGW A;  1R3J C;  4X66 B;  4PJ0 Z;  4U3J A;  1V55 B;  4MSW C;  1OCR C;  3K5N A;  5IJ9 B;  4CH4 A;  3FD9 A;  1KQS U;  1JJ2 U;  2A0L A;  1OCC B;  4BIU A;  5LYJ B;  1X59 A;  1NR1 A;  4PA9 A;  3K5O A;  5IYB O;  2YEV A;  2ZQM A;  2JGU A;  1BSM A;  4JI3 O;  3LDD A;  2ADQ B;  1VQ5 V;  2KB1 A;  3ZED A;  4AHC A;  1NH2 B;  1IDS A;  1QNM A;  2DJV A;  4X1Y B;  5EK0 A;  4TV8 A;  3GWO A;  2P7T C;  1N0J A;  1D5N A;  3JAW B;  1AJP A;  3P32 A;  5EYP B;  1XNQ B;  3KG2 A;  3H9V A;  3FX7 A;  4LFB O;  5CMU A;  1FS0 G;  2DOS A;  2A7W A;  2Q4P A;  3ZRX A;  2EIM B;  4C7U A;  1AVM A;  3SYC A;  4FFB B;  1XNR B;  1NTM H;  1TVK A;  2NR5 A;  2WLL A;  4FLX A;  3CRC A;  3G6E V;  4B3M B;  1GK9 A;  1BL8 A;  5LA6 B;  5IJ0 B;  4PDV A;  3CD6 V;  3W7T A;  2HEP A;  3K06 A;  2E74 B;  1KEC A;  5A2Q N;  4GT1 A;  2Q7G A;  2CH7 A;  5LGU A;  1KP3 A;  5C93 A;  3K3W A;  4J7J A;  3JAT A;  5K1P A;  1VQO V;  4QPK A;  4LF4 B;  1VQM V;  2O57 A;  3C90 A;  1JR9 A;  4DV1 B;  4MVO A;  4CC6 A;  4IYI A;  1FFX A;  5F2V O;  4FLT A;  4CH6 A;  1Q3E A;  4FLW A;  4X89 A;  3E8B A;  4AIL C;  1H2M A;  5LP6 A;  4LF6 O;  1N32 B;  4MS2 A;  1COW G;  2MW2 B;  5LOV B;  2JGD B;  1XIL A;  3OMI B;  4UCR A;  2W0X A;  4DR6 B;  1XUQ A;  2VRZ A;  4PA6 A;  4IIJ A;  4B7K A;  1XHX A;  4FJC C;  1BGY H;  3OT7 A;  1KKD A;  1PD3 A;  5FNV A;  1M1K W;  1IXB A;  4H0L B;  2IJK A;  5IWA B;  5IT9 N;  4ZHQ B;  4JI2 O;  5BMV B;  2D2C B;  4LFC B;  4B3S B;  1J95 A;  4O2A A;  4G28 B;  3SJB C;  3SDL A;  1K3E A;  3D3I A;  5LXT A;  3BY6 A;  1B6Q A;  4RUE A;  2RQ6 A;  2KG7 A;  1NH2 D;  3IFX A;  3S3W A;  3CPW U;  1TAE A;  4DR2 B;  4UCT A;  4JI5 B;  4ABM A;  1ZSP A;  4X88 A;  4JTA B;  2YXH A;  3ETE A;  4I5S A;  3ZRW A;  4B3M O;  1TA8 A;  5D5P A;  2PGG A;  5IY5 C;  1EZV H;  2Q7E A;  4HYO A;  2LGQ A;  3OTO B;  5LMU B;  5GW7 A;  3W7S A;  3G6B A;  3STZ C;  1R3I C;  3RN4 A;  3JCU Z;  1K73 W;  1H8E G;  2OIE A;  3G80 A;  2UU9 O;  1PKX A;  4LWS A;  1MSW D;  3VOU A;  2PYJ A;  4DV1 O;  1QLE B;  2Z3Y A;  1IBK B;  4OX9 B;  4X1K A;  4JI6 B;  1FXV A;  2QA4 V;  4DV2 O;  1N32 O;  3ABL B;  5C8Y B;  2XAF A;  4O4J A;  4PA4 A;  1BS3 A;  1JX9 A;  5KMG B;  4NKG B;  1NTZ H;  4PI0 A;  3ZMT A;  1Q81 W;  4YJ3 B;  4HNA A;  1I08 A;  4X64 O;  4MTX A;  1HWY A;  1KP2 A;  2DMX A;  3BHP A;  2IW5 A;  2QEX V;  3ZHT A;  1P7B A;  4LF5 B;  4Z1M G;  5LGN A;  5IWA O;  3LSS A;  3K58 A;  3RYC B;  1AI5 A;  3QO8 A;  2E76 B;  4LFC O;  4R6Z A;  1AP6 A;  4GX1 A;  2P6J A;  4DUZ B;  5EIB C;  3S3X A;  1TUE B;  4DV6 O;  2IJJ A;  2PI4 A;  3CCU V;  1PNM A;  4JI5 O;  1Z5W A;  4L87 A;  4PDR A;  1XL6 A;  3TJT A;  1VAR A;  5B1B C;  2X6C A;  5B3S B;  5B66 Z;  4DV5 B;  3ZHU A;  5CA0 A;  1VF6 C;  1EZJ A;  1RSO A;  3OTO O;  3VQY A;  4DO2 A;  4LNU B;  1SKV A;  3BFR A;  4BIO A;  4U7N A;  1S5J A;  3CXC U;  3F5T A;  1BHB A;  1P4R A;  3HPL C;  5BXZ A;  5LP6 C;  4K0K B;  3IC7 A;  4QE9 A;  3QO5 A;  4U3J B;  4J10 A;  2RN9 A;  4DR3 O;  1RM1 B;  4LR3 A;  3HB3 B;  1YCI A;  3K5M A;  4I0X A;  4BAY A;  3T2M A;  2W0F C;  5JH7 A;  4DW0 A;  2UXC O;  1QBZ A;  4P9O A;  3LNN A;  4I7Z B;  1J5E O;  3SYA A;  1JPX A;  4TV8 B;  1QQC A;  3UQ8 A;  4JV5 O;  2QWO B;  4RQF A;  4LF5 O;  4JI7 B;  4FLU A;  4FMT A;  2OWO A;  1N33 B;  2Q68 A;  3W7X A;  1ZLZ A;  4NXN B;  5KHJ A;  1LUW A;  4KP4 A;  2ZE7 A;  2JJ2 G;  3O65 A;  3HR0 A;  3U10 A;  5LGT A;  2E5L B;  3OR6 C;  4PDL A;  3SJA C;  1XMQ O;  4X20 A;  2AZ0 A;  3K9S A;  1Y6X A;  3HKB A;  3BVO A;  1GO3 F;  3EVK A;  4FLZ A;  1XDC A;  3K08 A;  4BWA A;  3SYP A;  3FB7 C;  3OMA B;  3ZCC A;  1K33 A;  4JYY A;  3TXQ A;  3WG7 B;  2FML A;  2CH7 B;  2EIN C;  5LMN B;  3LSQ A;  1NTK H;  2OTL V;  1AJN A;  3OFN G;  2Q69 A;  3SJQ C;  1JOY A;  1Y74 A;  3AG4 C;  3B40 A;  2WAM A;  3RFR A;  1RPO A;  4MVR A;  3HKD A;  3ETQ A;  1I0H A;  2F43 G;  1BT8 A;  1FFX B;  1BQZ A;  2CTQ A;  3CCM V;  2WLJ A;  1RPR A;  1VQ7 V;  1YXB A;  2AGA A;  4H33 A;  3CCR V;  2YIA A;  2EIJ B;  4IT5 A;  4NB5 A;  4LH7 A;  3GB7 C;  5H9C A;  3L73 H;  4UFZ A;  4WBN A;  1FKA O;  1DTO A;  3F7V C;  2UUA O;  5DM6 V;  4IIJ B;  4CH3 A;  1DF5 A;  1XEQ A;  5JVD A;  1G8M A;  3CC4 V;  1YEW A;  5FNV B;  2ZT9 B;  5FLX N;  3ZHV A;  4P30 A;  4J80 A;  3H1L H;  1PP9 H;  4TV9 A;  1AP5 A;  1M57 C;  1ZL8 A;  5LXT B;  1SQQ H;  1UJW B;  2KG7 B;  1GKF A;  5KHK A;  2PUS A;  3ETG A;  4MW3 A;  1UPG A;  3BPZ A;  3ABK C;  3CCE V;  2E5L O;  4JYA O;  2LW7 A;  1WPX A;  4BW5 A;  3ZRW B;  4IGG A;  4TQD A;  1I5Y A;  1SQX H;  4GX5 A;  5GON B;  3MHH C;  1D2D A;  1XQ8 A;  3BCC H;  3OD4 A;  2BCC H;  2Z0A A;  4B08 A;  4JTC B;  3U0Z A;  4GLX A;  2ZNI A;  2GUZ A;  2QR4 A;  1BE3 H;  2LFS A;  2KSD A;  4JYB A;  3CC7 V;  2CTP A;  3F5W C;  1AI7 A;  4LWS B;  4FLY A;  4DR7 O;  2EIL C;  2Z5U A;  3JAK B;  4QGP A;  3ZRV A;  1K92 A;  4AQY B;  1O9G A;  1Q8I A;  2WLH A;  1WPB A;  2HVK C;  1FYJ A;  2C2A A;  3FAV A;  1N34 B;  1Y76 B;  1CPY A;  2F23 A;  3W7U A;  2QWP B;  3DGE A;  1NU1 H;  1JJO A;  4O4J B;  3AG7 A;  1GM8 A;  3SPC A;  3RYF B;  4NTY A;  1OCO B;  2CUG A;  2R72 A;  2XND G;  3GWK C;  1HDJ A;  4DRX A;  1WA8 A;  1Z2G A;  3SYO A;  3STL C;  5EZY A;  4XDK A;  4IYH A;  5H6R A;  2GTA A;  4OPH A;  5JQG A;  1WJZ A;  4JI8 O;  4JI3 B;  1MMM A;  1FJG B;  1VEW A;  1ZUQ A;  5CBH A;  3JD0 A;  3ZIA G;  3AG2 B;  3G67 A;  4LFA B;  4ZI7 A;  5KUK A;  1CXZ B;  3A8T A;  3CYO A;  4RAI A;  3CSX A;  4UVA A;  4TUY A;  1LUV A;  3RYI B;  4LFB B;  2Q6A A;  1AR1 B;  3CC2 V;  3A2F A;  1E79 G;  5DEC A;  4J7K A;  2DYS C;  4D7T A;  1SQF A;  1PNK A;  3P30 A;  1N36 O;  2OCC B;  3JD2 A;  1FFT B;  1BMF G;  5CA0 B;  4G2K A;  3ETD A;  4FPP A;  4I4T A;  1RSO B;  5LHI A;  1H2N A;  4O4I B;  3OUF A;  3OM3 B;  3BA8 A;  1F4N A;  3CRQ A;  3ABT A;  2ADP A;  3RYH B;  4A5U B;  2QDO A;  3OW2 U;  1K97 A;  4Q6G A;  2LP7 A;  2WLI B;  3X2Q C;  4YY3 O;  5BR8 B;  4AQY O;  1OCZ C;  1KB9 F;  4EB6 A;  3EHB B;  4X9Q A;  4CZZ A;  3AG1 B;  1M90 W;  2P4V A;  1N34 O;  3T1H O;  2BTO A;  1NI8 A;  4LF6 B;  2PF4 E;  4R8C A;  2UXD B;  2LO1 A;  2ZIM A;  3JCZ A;  4LF7 O;  3A0B Z;  4MVZ A;  1PL0 A;  2BOC C;  4MVU A;  3I56 V;  2WLM A;  1AR5 A;  2EIK C;  2YIB A;  2HP8 A;  1FJG O;  4JI2 B;  4UVB A;  2OT5 A;  1H8H G;  2PTM A;  4PA3 A;  2G38 A;  4LFA O;  2Q67 A;  1TUB B;  2AHZ A;  4MTO A;  4J42 A;  2EZP A;  3KCX A;  5CB4 B;  2EJ7 A;  1M56 B;  3RT3 C;  3LDE A;  5LL6 Y;  1SF9 A;  4OGQ B;  4LP8 A;  1HR0 O;  3HKB B;  1VQN V;  3BEH A;  1UFI A; 
#chains in the Genus database with same CATH homology
 1E1R G;  4JPR A;  1R3L C;  3ABL B;  3E8G A;  3ZJZ A;  4P2Z A;  2XAF A;  4PA4 A;  1OCC C;  2V1D A;  1I5X A;  4TWK A;  1JX9 A;  4G27 B;  1YI2 V;  3T4Z A;  1XL4 A;  3B8M A;  4PA7 A;  3ZMT A;  1K5S A;  1Q81 W;  2MK3 A;  3MD0 A;  1M9N A;  2JEX A;  4HAM A;  4MTX A;  1HWY A;  1KP2 A;  4TT3 G;  2IW5 A;  1NQT A;  2QEX V;  1P7B A;  1AI6 A;  4Z1M G;  5LGN A;  5CA3 A;  5L3G A;  3LSS A;  1W2B U;  1QR9 A;  4OXS A;  1M57 B;  1KD1 W;  4UV9 A;  5DN6 G;  3ASN B;  1AI5 A;  3QO8 A;  1MAB G;  3OUS A;  1R6N A;  4N21 A;  2R9I A;  4R6Z A;  3CCS V;  4XDJ A;  2ZXW B;  2UXN A;  4GX1 A;  2HVJ C;  1IXM A;  2P6J A;  4LBE C;  3E35 A;  3R65 A;  1V54 C;  3ABK B;  1VQK V;  5B1O A;  3FYE B;  1TUE B;  3K79 A;  4J9Z B;  5EBW C;  2HKO A;  3JD4 A;  2IJJ A;  1OCR B;  1F51 A;  4JYC A;  2PI4 A;  5L3B A;  1ROP A;  3CCU V;  2D3O W;  1PNM A;  1VQ8 V;  4WFE A;  1QLE C;  3B8N A;  2IJH A;  2EIM C;  4U7O A;  1S3J A;  3ZMV A;  4L87 A;  3SPH A;  4PDR A;  5HFL A;  1MG1 A;  1K9M W;  2ZR3 A;  1XL6 A;  4RQE A;  4MTF A;  1JVM A;  3JYC A;  3OE7 G;  5B1B C;  2X6C A;  5B3S B;  1Y66 A;  1NJI W;  3FB6 C;  4JF3 A;  4QIW F;  1PNL A;  4RO2 A;  2EZO A;  2WWW A;  1EZJ A;  5IDJ A;  2HR3 A;  2V7Q G;  4DO2 A;  2EIL B;  3TCU A;  3WFV A;  2B1G A;  3CXC U;  1K4C C;  4U7N A;  1BHB A;  3OMN B;  1VQP V;  1R73 A;  1P4R A;  3HPL C;  3IC7 A;  4QE9 A;  3QO5 A;  1QVF U;  2X6A A;  1W0J G;  2WLN A;  1RM1 B;  3ABM B;  2HJF C;  1S77 D;  4LC1 A;  3T4D A;  3AG3 C;  3HB3 B;  2OCC C;  3K03 A;  3RBZ A;  5L3E A;  4JGS A;  2XAS A;  2HLD G;  4BAY A;  5HFM A;  4DXW A;  4PEL A;  2W0F C;  3T2M A;  4KFM A;  3RVY A;  3CCJ V;  4KUM A;  4QPJ A;  1W0K G;  4JAV A;  1GMG A;  3SPI A;  4PDM A;  1NVP D;  5KA5 A;  1QBZ A;  2Y69 B;  3LDC A;  4P9O A;  4XDL A;  3QNE A;  3CMA V;  1SRY A;  2DYR B;  3SYA A;  1JPX A;  1YJN V;  1YJ9 V;  3K04 A;  2DQ0 A;  3E83 A;  1H38 A;  5KA6 A;  4RQF A;  5KUM A;  4FMT A;  5EC1 C;  2Q68 A;  3W7X A;  3VBB A;  1FXK B;  1NR7 A;  4KP4 A;  4RUF A;  3CCQ V;  2JJ2 G;  2JJ1 G;  3AG1 C;  4WFF A;  2DW4 A;  2DYS B;  2XAG A;  3ASO C;  5LGT A;  4CBC A;  3OR6 C;  4PDL A;  3E2E A;  5B1A B;  5H6Q A;  1AJQ A;  3MHS C;  3FB8 C;  2K1E A;  1VQ6 V;  1R3K C;  4QE7 A;  3ZRS A;  1NBM G;  1QR8 A;  2M7W A;  2NLJ C;  3G71 V;  3OAA G;  4MVQ A;  4MW8 A;  4R7C A;  3UKM A;  4HZ3 A;  1GO3 F;  2EJR A;  1QVG U;  3K08 A;  2X6B A;  3B77 A;  1Q82 W;  3PJS K;  3SYP A;  3FB7 C;  3OMA B;  3ZCC A;  1K33 A;  2QKS A;  3WG7 B;  2UXX A;  2NNU A;  1YIT V;  2ZDI A;  2EIN C;  3ZMS A;  2ITD C;  4WFH A;  2A9H A;  3LSQ A;  1S5H C;  2OTL V;  1AJN A;  3X2Q B;  2QTO A;  3OFN G;  2Q69 A;  3T1C A;  3SJQ C;  1R6K A;  3ZN1 A;  1JOY A;  1OCZ B;  5L3D A;  2WLK A;  3AG4 C;  3F7Y C;  1SET A;  2WAM A;  2WSS G;  1RPO A;  2ZD9 A;  2DWD C;  4MVR A;  1YSC A;  2JIZ G;  3SPJ A;  2F43 G;  1ARO P;  1LNQ A;  3LUT B;  3QO7 A;  1BHA A;  4UXN A;  1M56 C;  3CCM V;  1K34 A;  2WLJ A;  1RPR A;  1VQ7 V;  3ZN0 A;  4H33 A;  3CCR V;  4QNH B;  5BZB A;  2IU0 A;  5B1N A;  4MVS A;  2EIJ B;  5J9P C;  3GB7 C;  1YTF B;  3K0G A;  3A0R A;  3OR7 C;  5FL7 G;  5H9C A;  2B5U A;  4GX2 A;  1DTO A;  3F7V C;  3E8H A;  3ABL C;  4P9P A;  2OTJ V;  5DM6 V;  2X0L A;  1JCH A;  1DF5 A;  4E2L A;  1G8M A;  2XOK G;  3ZMU A;  2ZDI C;  3CC4 V;  4J9Y B;  5IY5 B;  3M99 B;  4WF9 V;  1KC8 W;  2EIK B;  4WFG A;  4I9W A;  4EKW A;  1NKD A;  1SER A;  4P30 A;  1G4Y B;  2QM8 A;  4LCU C;  3ABU A;  1N8R W;  2LFR A;  1GTO A;  1M57 C;  1S72 V;  2PI5 A;  1Y4M A;  2DWE C;  4MTG A;  3ASN C;  4GCZ A;  1ORQ C;  1UJW B;  3SPG A;  2JEU A;  1SZT A;  1VQ9 V;  1GKF A;  2EBO A;  2ZXW C;  3AEI A;  4YXW G;  4WCE V;  3ETG A;  4MW3 A;  5LHH A;  5EC2 C;  3CP1 A;  3K9A A;  3ABK C;  1R3J C;  1L1F A;  3CCE V;  4FK5 C;  1V55 B;  4MSW C;  1OCR C;  3FKS G;  1WPX A;  4BW5 A;  3ZRW B;  4JTD B;  1I5Y A;  4GX5 A;  1KQS U;  3MHH C;  2YEV B;  2HG5 C;  1JJ2 U;  4WFB V;  1YHQ V;  2A0L A;  1ZWI C;  2IU3 A;  1OCC B;  4JTC B;  4BIU A;  5B3S C;  2LFS A;  3OGC C;  4JYB A;  3CC7 V;  1NR1 A;  4PA9 A;  3G4S V;  3F5W C;  1WLE A;  5IYB O;  1AI7 A;  2YEV A;  2XAQ A;  4R50 A;  2ZQM A;  4UVC A;  2GHY A;  5CBF A;  2EIL C;  2Z5U A;  3ZRV A;  3LDD A;  1K92 A;  1K5Q A;  2KB1 A;  1VQ5 V;  5L3C A;  1NH2 B;  2A79 B;  3ML0 A;  1CEZ A;  5EK0 A;  2H8P C;  2WLH A;  3E8F A;  3GWO A;  2P7T C;  2HVK C;  2C2A A;  3TET A;  1AJP A;  3P32 A;  3KG2 A;  1CPY A;  2W6J G;  2WLL B;  1E1Q G;  3EFF K;  3W7U A;  1VQL V;  1FXK A;  3DGE A;  3K0D A;  5CMU A;  1FS0 G;  1RM1 C;  3ABM C;  3ZMZ A;  1GM8 A;  3ZRX A;  3SPC A;  2EIM B;  1VQ4 V;  3SYC A;  1DLB A;  1OCO B;  2XND G;  2ITC C;  2WLL A;  4X8A A;  3G6E V;  1AI4 A;  4ASU G;  1Q86 W;  4H37 A;  3SYO A;  5B1B B;  2W6I G;  3STL C;  1GK9 A;  1BL8 A;  4XDK A;  4PDV A;  3CME V;  3CD6 V;  5H6R A;  3W7T A;  4TSF G;  1YTF D;  3RVZ A;  2Y69 C;  3K06 A;  5IYD O;  4MVM A;  2H94 A;  3JD3 A;  5CBH A;  2DYR C;  1F23 A;  1KEC A;  2FTK A;  3JD0 A;  3ZIA G;  3AG2 B;  5IYC O;  1YJW V;  4GT1 A;  4QJF B;  5KUK A;  1K8A W;  3CYO A;  4RAI A;  3OEH G;  5LGU A;  3IGA C;  4UVA A;  1KP3 A;  5C93 A;  3K3W A;  3RW0 A;  1FXK C;  3CCL V;  1VQO V;  4QPK A;  1VQM V;  2BOB C;  2Q6A A;  4ZKI A;  1AR1 B;  3CCV V;  3CC2 V;  3DTU B;  4MVO A;  1E79 G;  1YIJ V;  2DYS C;  3AG3 B;  3E86 A;  4ZBM A;  1K4D C;  1PNK A;  3P30 A;  4X89 A;  3E8B A;  5B1A C;  3UM7 A;  2IJI A;  2XAJ A;  4MS2 A;  1COW G;  2OCC B;  3JD2 A;  1FFT B;  3SYQ A;  1EBO A;  3TK1 A;  3OMI B;  1BMF G;  4N23 A;  4WFA V;  5L3F A;  1EFR G;  2P67 A;  4G2K A;  3ETD A;  4FPP A;  5LHI A;  1ENV A;  3FYI B;  3OUF A;  4PA6 A;  1OCO C;  2IH1 C;  2GSM B;  3OM3 B;  5EBM C;  5CBG A;  1F4N A;  4FJC C;  1JQ0 A;  3ABT A;  1SES A;  2QM7 A;  5CN0 A;  3WG7 C;  3NXS A;  1KKD A;  1PD3 A;  3OW2 U;  1M1K W;  1K97 A;  1FXH A;  2LP7 A;  1GM9 A;  3E89 A;  3FB5 C;  1OHH G;  2IJK A;  4MT8 A;  2WLI B;  3X2Q C;  1QCE A;  2XAH A;  1OCZ C;  3AG2 C;  3EHB B;  1CP9 A;  1J95 A;  1QLN A;  4G28 B;  3I55 V;  4CZZ A;  3AG1 B;  3H01 A;  1M90 W;  4GX0 A;  3W7W A;  2JK5 C;  1K3E A;  3D3I A;  1OZ0 A;  5EBL C;  3BY6 A;  1B6Q A;  3ASO B;  4RUE A;  2QE7 G;  2WLI A;  1K7D A;  1S0V A;  2EIJ C;  4R8C A;  1NH2 D;  3IFX A;  4UV8 A;  3CPW U;  1F4M A;  1DF4 A;  4JAU A;  2CK3 G;  3JCZ A;  4X88 A;  4JTA B;  3ETE A;  2DQ3 A;  2WPD G;  4I5S A;  4MVZ A;  3ZRW A;  1PL0 A;  2BOC C;  2IH3 C;  4MVU A;  4XBF A;  3I56 V;  2WLM A;  5IY5 C;  4HYO A;  2EIK C;  2EIN B;  5LHG A;  5GW7 A;  4UVB A;  2R9R B;  3W7S A;  2OT5 A;  2JDI G;  1H8H G;  2YSU B;  3LNM B;  3OEE G;  4PA3 A;  1H2G A;  4UUJ C;  2ZR2 A;  1GM7 A;  3STZ C;  2AHY A;  5E1A C;  4FIP C;  2Q67 A;  1R3I C;  5LBQ A;  3AG4 B;  1K73 W;  1H8E G;  2AHZ A;  4MTO A;  1Q7Y W;  2EZP A;  1PKX A;  1MOF A;  1V54 B;  3JD1 A;  1THZ A;  4F4L A;  1MSW D;  3VOU A;  1M56 B;  2X7R B;  4JAS A;  3LDE A;  1S76 D;  2HFE C;  3D36 A;  2Y48 A;  1QLE B;  2Z3Y A;  4LP8 A;  4Q20 A;  2B1I A;  1NVP B;  2P90 A;  1VQN V;  1FXV A;  1V55 C;  4BIZ A;  2QA4 V;  2ATK C;  3BEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...