3TETA

Crystal structure of nak2k channel y66f mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tetA00
4RUFA 3WG7C 2HFEC 4G28B 1K4DC 3ABMC 4PA3A 3AG2C 1M56C 4G27B 4MVZA 2KB1A 3E8GA 4PA6A 4PDVA 3FB6C 5E1AC 3OUFA 4F4LA 2WLIA 2WLKA 3AG1C 3SYPA 3T4ZA 3ZRSA 3K04A 4PDMA 3RVYA 1R3IC 4PDRA 5J9PC 3ASNC 2AHYA 3LNMB 2EIJC 3IGAC 4P9OA 5EBLC 2WLLB 1V55C 2X6AA 5EK0A 3SPJA 4CBCA 2DWDC 2X6BA 5EC1C 3E8HA 1OCCC 4MSWC 4DXWA 2W0FC 4MVMA 2HVKC 3SPCA 2WLMA 2Q68A 2ITCC 4J9ZB 5B1BC 2WLHA 4GX5A 3STLC 3AG3C 4X88A 3UM7A 4JTCB 3IFXA 4JTDB 5B1AC 1JVMA 4I9WA 3HPLC 3TCUA 4RAIA 5EBWC 3LDDA 2HVJC 3BEHA 3K0DA 4RUEA 4XDJA 4GX0A 3STZC 1XL6A 2WLNA 4H37A 4QE9A 2A9HA 3KG2A 1ORQC 1R3JC 4OXSA 2DWEC 3K03A 4J9YB 4MTGA 4MVRA 5KUMA 5IY5C 3LDEA 4MTFA 1XL4A 4LBEC 2BOBC 3R65A 3E89A 3T1CA 2ZXWC 3F7VC 3K06A 1R3KC 4R7CA 4JTAB 3FB7C 3PJSK 2P7TC 3OR7C 1ZWIC 3GB7C 2DYSC 1P7BA 3E83A 2EIKC 1KKDA 2IH1C 2Q67A 1K4CC 2Q6AA 4R50A 4WFHA 2IH3C 3OR6C 3JYCA 4KFMA 4MVUA 4MW8A 3SPGA 4MVSA 4GX2A 4XDLA 1QLEC 1BL8A 2EILC 4MTOA 3SYAA 5CBHA 3TETA 4QE7A 3SYCA 1OCOC 3T2MA 2WLLA 3ZJZA 4BW5A 2ATKC 3ABLC 2HJFC 3LDCA 3T4DA 2H8PC 2QKSA 3F5WC 3VOUA 3UKMA 5KUKA 2WLIB 4LCUC 5EBMC 4P30A 4R6ZA 4UUJC 3SYQA 3K08A 2Y69C 4GX1A 4MS2A 2Q69A 4QNHB 3LUTB 5CBFA 1G4YB 4MVQA 3ASOC 4MW3A 4WFGA 2EINC 1M57C 3AG4C 4P2ZA 3SYOA 2ZD9A 3X2QC 4WFEA 4RO2A 4PA9A 4R8CA 4PA4A 1J95A 2A79B 3F7YC 2ITDC 1LNQA 2WLJA 3SPIA 2R9RB 2X6CA 4WFFA 2K1EA 2NLJC 3E86A 4MVOA 4PDLA 3RW0A 1S5HC 2BOCC 3EFFK 3OUSA 4X89A 3FB8C 4LP8A 4ZBMA 1OCRC 5BZBA 3E8FA 3K0GA 3RBZA 2OCCC 1R3LC 3FB5C 2HG5C 5B3SC 3ABKC 1OCZC 3E8BA 2JK5C 3OGCC 4HZ3A 2A0LA 2YEVA 4PA7A 4P9PA 3RVZA 4EKWA 4HYOA 1V54C 2EIMC 4H33A 4TWKA 4X8AA 4XDKA 2DYRC 5CBGA 3SJQC 5EC2C 3SPHA 2AHZA 2QTOA
chains in the Genus database with same CATH superfamily
3AG3B 1YTFB 5LP6A 4PA6A 4O4IA 2WA4A 4LF9B 4I55A 2ZINA 2DOSA 1QQCA 3ZRWB 4LH6A 1QCEA 2D2CB 1AI6A 3N2KB 3JALA 3ETQA 2P4VA 4KL1A 3RYCA 2X6BA 4FFBB 3ZHQA 1Q3EA 5A9GA 2WLHA 1KUQA 4TV8A 3KCXA 1QLNA 2RDCA 1JVMA 2E76B 4DV0B 5JH7A 1NTMH 1JFFB 1E1QG 2JJ2G 1YJNV 2AW9A 1VARA 3SJCC 3WB2A 1GN6A 4CH5A 2X0LA 2N05A 1TVKB 1S77D 3K79A 1B04A 1K92A 1YDXA 2HKOA 2P5OA 1YHQV 2DQ3A 5KHGA 3N2KA 1Z5WA 4GKJB 4DR4B 1Q81W 2DMXA 4FFBA 3B09A 2Q73A 5KHKA 3VQWA 1BHBA 1N34B 3M99B 4U7NA 1PP9H 2D3OW 3JARB 1J95A 5K1PA 3I5DA 3I56V 4AQYO 3CSXA 1FXVA 1JFFA 4X20B 3BPZA 5EZYB 1XNQO 2BOCC 2QM8A 2UU9B 2PUSA 1GN3A 4CC5A 4H44B 3VQYA 1TVKA 3QO8A 2ZNIA 2F1MA 4YIPA 4JASA 2DQ0A 2E75B 2H94A 3ETDA 5H5NA 5H9CA 2Q0OC 4GCZA 4LF6B 2WWWA 4FLWA 4UB6Z 2YIAA 2QTOA 2PGGA 1K5QA 4FZ1A 3FB6C 2UXBO 4BWAA 5E79Z 2DE0X 2YXLA 5IE9A 1OCCC 4X20A 2BE3A 2LGQA 3OTOO 5BR8B 4B3TB 5EZYA 1K97A 3ETGA 1HR0B 1GM9A 1VQPV 3HPLC 5IJ9B 1WN7A 4RAIA 2EILB 5KHJA 4XDJA 1L8DA 3STZC 2Y0IA 4JI8B 1ENVA 1F23A 2A9HA 4JI7B 3FKSG 3ABKB 5DM6V 4J10A 4DV6B 3FAVB 3TJTA 3K06A 2QWOB 1CPYA 1H2LA 1MABG 3CE2A 5DEDA 1PNKA 4JI1O 4JI5O 2IH3C 2M6YA 2PY5A 2YI9A 2XASA 4B3MO 1HNZO 4QE7A 3J80N 1MZEA 1PNLA 2VQFO 3F5WC 4LF7O 4LWSA 3CX5F 4JYAB 1ZTEA 3FYEB 1PL4A 1AI4A 4JI2O 3AK3A 2LFSA 3JASB 1RM1C 4LF4O 2EIMB 4J80A 3D8CA 5LGTA 3L74H 4IT5A 2AZ0A 3JAKB 1IBLO 3NXSA 1FFTB 1VQ8V 3FAVA 1IBKO 4L87A 2Q9LA 4TV9B 3ZHRA 1N33B 2GSMB 3QNEA 3K9SA 5CBGA 4LF5O 4ICGA 1OV9A 2ZCEA 1GTOA 5B66Z 4MVZA 1QLEB 1N4CA 4J42A 2WLKA 2OTJV 2QM4A 1B06A 4NTWA 3ZMUA 5LP6C 3JASA 2X7RB 3TGUH 3ML0A 3SPJA 5GONB 1M1KW 2KQXA 4E2LA 1QVGU 3PN1A 1IBLB 3JAKA 1HNXO 3J81N 2YIBD 4N23A 1SQVH 3SDLA 5IYZB 4TV9A 4GX0A 4H37A 4QE9A 2YXYA 2XT9A 4B3RB 1M4UA 3H1IH 1IBMB 4B3SB 4DRXB 4LBEC 2EJRA 2Q0AA 3ZS8C 1GKFA 2R9AA 2DYRB 3FB7C 3E83A 3QF7A 1VP7A 2Q67A 3ABMB 3K5NA 2PI4A 1NVPD 3T2MA 3U10A 2ATKC 4KUMA 5FLXN 1BQZA 3H9VA 3BHPA 2ZIOA 1O9GA 4RQEA 4JI6B 4I9QA 1OCRB 4YY3B 4UVBA 1BE3H 3T1HB 1AJQA 4DV7O 5DECA 4EFEA 2JIZG 2ITDC 1KB9F 1E79G 4ZOLB 2F4VB 1EM1A 4MVOA 4DRXA 3EFFK 3FB8C 1A32A 3DC5A 1Y67A 1W59A 2HP8A 3CCSV 2CDYA 1Y6XA 4HZ3A 4DK0A 1HNWB 4WFAV 5KA6A 1XOUA 4RUFA 4Z1MG 2EX3A 2ODMA 1UJWB 3K58A 4FFKA 4BW9A 3ABLB 5EIBC 1R3IC 4PDRA 5J9PC 1E1RG 3ZMVA 4C7UA 2Y69B 5EC1C 4DXWA 4DUYB 4ZOLA 3N2GA 4O4LB 1W2BU 4G2KA 4X88A 5KLVH 4UV9A 1YIJV 3KCYA 3TCUA 4WBNB 4DUZB 2XAFA 2XUMA 5CMUA 2EZOA 1ORQC 2E5LO 3JCZA 1FFXB 4MTGA 4MVRA 5KUMA 5K1XA 4OGQB 1SZXA 1N32B 4PELA 1KMIZ 2PYLA 1ZUQA 1SESA 3SPGA 4LFBO 1KECA 1B6QA 1SETA 1FPOA 5FL7G 1F51A 2Z0AA 1TAEA 3UCSC 3L73H 3HKCB 5EBMC 4O4LA 1N36B 1XQ8A 2IJIA 2EJ7A 3HKBB 5JJEB 4OX9B 4WBNA 1SKVA 1LNQA 1H8HG 5IT9N 1XEQA 1AJNA 3CD6V 4IIJA 1FFXA 3CRCA 3MAQA 3QG5A 3E8FA 4O2BB 4LF8B 2ZKOA 4KHPO 3ABKC 4Q6GA 4ZHQB 2YEVA 3SJAC 4CS2A 1OCCB 4P9PA 4DV1B 3L70H 1AI7A 1PNMA 4JI0B 2UXNA 4CS3A 2JGUA 2CH7B 4PDVA 3LSQA 4HBNA 3AG1C 2ZDIC 1Q82W 4PDMA 4DR6O 3K5MA 3K59A 1UFIA 1ZX3A 4I7ZB 2B1GA 4JYBA 2VQEB 1XI1A 1I94B 4MVMA 3AG4B 3ZMTA 3QTCA 4JAVA 3STLC 3UO2A 4K8ZA 3O65A 3LSUA 1NT2B 1IX9A 5LMUB 2JS5A 3LDDA 3B40A 4JI4O 1XMQB 4ZHQA 1F4MA 3GWOA 4OXSA 5ITZB 1QU7A 1FJGB 3DSQA 2CH7A 4PI0A 4K3AA 3CWBH 3GB7C 1FAFA 2QA4V 5BY1A 1QLEC 4AI8A 1Q90D 1K7DA 1NTKH 4HAMA 4TSFG 2JEUA 2XOKG 3DC6A 2W0XA 4DV5B 2OTLV 2ZT9B 4DV4O 4X9QA 5FNVB 1J5EO 3HB3B 2K1EA 4JI3B 5ITZA 3T1YB 2R70A 2RQ6A 1XILA 3EXAA 4IYIA 3GWKC 3B2EE 3E8BA 2JK5C 2PI5A 2CGOA 3U11A 1P7GA 4X8AA 2DYRC 3QO7A 3K5OA 1NH2B 3IC9A 4G28B 1K3EA 2OWOA 3ABMC 1RPRA 2FTKA 2CK3G 4KP4A 5IWAB 5J2TB 4IYHA 4QPJA 1KP3A 5KAFZ 2QTSA 1FKAO 2WLLB 5LL6Y 1PM9A 4DV2O 2GTSA 4LFCO 2GUZB 2Y0PA 5FNVA 4BIZA 5FPOA 2ITCC 4FLZA 2VRZA 2RCVA 3HKEB 4RWUA 4ZIBA 4OPHA 2HVJC 3BAAA 1W0KG 2WLNA 2XAQA 1L1FA 4YHHO 1JJOA 1VQ5V 3BFRA 4PV1B 2HR3A 3CHXA 1SERA 2C2AA 1QHTA 3P30A 2F93B 4X64O 2OYQA 2F95B 1P7BA 5J2TA 1AI5A 4UXNA 2WLLA 3W7TA 1KKCA 1WNSA 3ABLC 3BABA 2UXCO 1BT8A 4F6RB 4DR2B 2GUZA 1GAXA 2QE7G 3A2FA 4X65B 2Y69C 4QNHB 4UCUA 1Q43A 1X59A 4WFGA 2H3OA 1L0LH 3HKEA 3TXQA 5LMNO 2F23A 3CCEV 3ZRWA 1H2SB 3WU2Z 2WPDG 3CRQA 3ZRXA 1S5LZ 4J41A 2Y4UA 1TUBB 1F7YA 2UUCO 4UCVA 2PTMA 4ZBMA 3ETEA 3K0GA 5LHIA 5B3SC 5BXZA 1MSDA 3G67A 3OGCC 3L9DA 2Y48A 3OMNB 1VQ6V 5L3CA 3ZHVA 5A2QN 2KB1A 4F6RA 3G4SV 2IJJA 3ZIAG 3F5TA 3APQA 1M90W 5LGNA 3UO3A 3CXCU 4WCEV 4AHCA 1SRYA 3CRMA 5B1BC 3BCCH 1YI2V 1TUBA 4K0KO 1G1XB 1SQBH 2WA3A 4L8JA 4O4HB 2JEXA 4FIPC 1TUEB 1RPOA 3JARA 2Z5UA 5KMGB 3HKDB 4PI2A 3R65A 4AQYB 3BA9A 1DLBA 1XNQB 5D5QA 3JYCA 1EN5A 3AG2B 4O2AB 5CBHA 2DW4A 4NXNO 3RWRD 3A8TA 4ABMA 3DXRB 3CEIA 1N0JA 4J7KA 4ZI7B 4DR1O 1YTFD 3FX7A 1V55B 5JJJB 1DTOA 3AG4C 3OAAG 3MDSA 4O4HA 1EBOA 5LXTB 4FK5C 2UXBB 1I7FA 5B1AB 2R9RB 3P32A 3BY6A 1WPBA 1H2MA 1SQPH 3AG1B 2JRIA 5KMGA 2FMLA 1Y74B 4LP8A 3HKDA 1NBMG 2PF4E 1WP8A 2EZPA 4D7TA 3OW2U 4GKKO 4RQFA 4FM1A 3OTOB 3FFQA 3CYOA 4O2AA 2B1IA 5IJ9A 2DYSB 3TXSA 4FM0A 1JMKC 3DXRA 1AP5A 3S3XA 5H6QA 1N0NA 4G27B 4ZI7A 3I55V 2CE4A 3SYPA 5IDJA 2G38A 2ZE8A 4E4EA 1S76D 2PZSA 1IZ3A 5LBQA 2X6AA 5LXTA 5LHGA 2M7WA 2XAHA 4Z1VA 4JI1B 4U3JB 4JI5B 4B3MB 2WLMA 1YSCA 1NS1A 5EIBD 4GX5A 1HNZB 1NU1H 2ZDIA 1AVMA 4KXRA 1Y74A 1GN4A 3A0RA 2VQFB 3ABTA 2GTAA 4LF7B 3KZIZ 2JJ1G 4JI2B 1H2KA 3N27A 2UUAO 4LF4B 2VS0A 3UQ8A 4JF3A 4IHJB 2N74A 1V54B 1VQOV 1DF4A 1MNGA 4R50A 1VEWA 4KFMA 1IBKB 1AJPA 1I08A 2B9ZA 3TETA 1FS0G 4QPKA 1WB8A 1GH6A 1AR1B 2LFRA 3B4SA 2IU3A 4U3JA 2BTQB 3ICXA 3OT7A 4LCUC 1KYOF 1GRJA 4LF5B 2P22C 2CTWA 5IYDO 3G71V 1K9MW 1QBZA 3OE7G 1WB7A 2KG7B 4PA9A 3H1KH 1EN4A 3S3WA 4X66O 1OHHG 1COWG 3G6BA 5GONA 4D6TH 5BZBA 1SC5B 3LNNA 1YXBA 4IHJA 1BSMA 5AG2A 4UV8A 1HNXB 3CCLV 4EKWA 1I5YA 3TK1A 5JQGB 2UUBO 5IYZA 3W7SA 3E8GA 1XMOO 4F4LA 2RMKB 2JS3A 1AROP 3CRRA 3IGAC 4K35A 4X1IB 2KG7A 2ADQB 3B77A 4FPPA 4B7KA 1JCHA 3B8MA 3SPCA 1O9HA 4DK1A 3ZHSA 2ZQMA 4JTDB 4W4KA 2QGNA 4RUEA 2IW5A 3RGBA 3CCUV 1VQNV 1R3JC 2OCCB 3BVOA 5JQGA 4UFZA 4UCSA 3Q4HB 2Q4PA 3CP1A 4DV7B 1EN6A 3T1CA 4LFAO 3ZEDA 1H2GA 5BMVB 2EIKC 3ZMZA 4YXWG 2QDOA 2YUAA 1PV0A 2NR5A 1NKDA 3IC7A 3ZJZA 4X1IA 3VOUA 2Q8VA 4UUJC 2RJZA 3O9OA 3H1HH 2Q69A 5B3SB 5JCOA 4NTYA 4U7OA 3C3SA 3CCRV 2L35A 3SYOA 1DF5A 2ZD9A 3OGIB 2YICA 1Q5OA 3D3QA 2X6CA 1SF9A 3RYIB 2NNUA 3Q4HA 4JZ2A 1K33A 3RBZA 2LGWA 5BMVA 2XNDG 4FLVA 3P3NA 1P4RA 4JGSA 1JOYA 4DV3O 1HWYA 3D36C 1YCIA 3SPHA 4ASUG 1S72V 5B1BB 3JD0A 2HFEC 3RN4A 1K4DC 3AG2C 1JA8A 1SQXH 2VWJA 2E5LB 2CTPA 1Q6UA 3RVYA 1H8EG 4JV5O 2QSAA 4NVPA 4BIUA 1RSOB 1V55C 4DR5O 2DWDC 1WAZA 4FLUA 1GM8A 2MW2B 1MMMA 4CS4A 4LFBB 1PD3A 1XNRO 5B1AC 4I50B 1L0NH 3ZBHA 3HKCA 3BEHA 1NI8A 2QWQB 2ZR2A 2GHYA 2IBZH 3HKBA 4CH3A 3L72H 4FLYA 1OCZB 2ZM6O 3CC4V 1AR4A 4UB8Z 3FD9A 2LP7A 1QR8A 2FB5A 5LHHA 3OR7C 2DYSC 4MTXA 2IH1C 3WB1A 1K4CC 2Q6AA 1VF6C 3C3TA 2EBOA 2O57A 3OEHG 4MTOA 4O2BA 1RSOA 4KHPB 3OD4A 4JYCA 1AB3A 4TUYB 4CC6A 4R6ZA 1QR9A 2YSUB 3QO5A 1XREA 4I50A 3CPWU 1TGOA 3M8AA 3X2QC 4WFEA 2XAGA 2A79B 1JR9A 1YEWA 2UXXA 4X1YB 4FJCC 4DR6B 2QEXV 5EYPB 3RYFB 3VQVA 1Y66A 1NR7A 1YITV 4DR7O 2CTQA 4LC1A 2E74B 2UXDO 1EFRG 3OEEG 4HYOA 1V54C 4H33A 4TWKA 1XBLA 4JI4B 3WG7C 2HHHO 4DR3O 2YIDA 3K57A 1YVWA 5E1AC 4TUYA 3CMEV 3THOA 4X62O 2PYJA 1ZL8B 5C93A 5TISZ 1D2DA 3ZN1A 3ASOB 1FD9A 1I5XA 2EINB 4X1YA 5CA3A 1IURA 4NXMO 4Z2WA 4NTXA 5EYPA 3RYFA 1H2NA 2QKAA 1R6NA 4QGPA 4I0XB 4JYYA 4D7SA 1H38A 2GV9A 4GUNA 5KHHA 1N8RW 3M7MX 1G6UA 1BCCH 4LF9O 1DGSA 2DWEC 3OTFA 3JATB 2ARHA 2JVDA 3WFVA 4FLXA 3E89A 2ZXWC 4DV4B 1J5EB 4EB6B 4NYKA 3CS5A 2QR4A 3OR6C 1M56B 4GX2A 3E35A 3K9AA 1BL8A 1ZL8A 4TV8B 4IL6Z 3D3IA 4BW5A 1AILA 4DW0A 3ASNB 2QKSA 2FKXA 1HP8A 3UKMA 1R6TA 4DV0O 1Y4MA 4BAYA 3SYQA 1ROPA 5JH7B 4TQFA 2P06A 4I0XA 5L3FA 1VMGA 1MA1A 2QWPB 5JCOC 1FXKC 5B1OA 3JATA 4PJ0Z 2W6IG 1D5AA 1NR1A 1S5HC 2RN9A 4DV2B 4LFCB 1F4NA 4J11A 1U96A 2OCCC 4GKJO 4EB6A 4DR4O 5JVDB 2Q7EA 3VQXA 1JX9A 5IYCO 4OPAA 1P84F 3E2EA 4K8XA 3KKYA 1B3QA 2AHZA 1N34O 4QJFB 1URFA 4N21A 1OZ0A 4YHHB 3U0ZA 4EEQA 2ILMA 4H0LB 3T4ZA 2ZE6A 1YZBA 4J7JA 4P9OA 2Q7GA 4FVMA 4X64B 2UU9O 4H13B 3CCJV 5KAIZ 1ZSPA 3CCVV 2P90A 4J9ZB 1K73W 1VQLV 3UM7A 2QWRB 5F2VO 2EIKB 4LF6O 1QVFU 3ZN0A 2UXCB 4I5SA 1R1BA 5JVDA 5H6RA 1S5JA 1X4TA 2LJ2A 3OFNG 5LMNB 3JCUZ 1NJIW 1R3KC 4R7CA 4JTAB 2HJDA 3PJSK 2P7TC 3AEIA 2P4KA 2UUCB 4MVUA 4QIWF 4XDLA 5BR8O 1OCOC 4B3TO 3EVKA 1HR0O 2BTOA 3LDCA 1W0JG 3HR0A 1SA0B 2H8PC 2EIJB 1Z5VA 1NH2D 4JI8O 4JI7O 2LW1A 1GK9A 2IJKA 3WB0A 4LH7A 4RO2A 4DV6O 4R8CA 4PA4A 4NR1A 2WLJA 3SPIA 1VQ4V 4WFFA 3JSNA 4JZGA 3ZHUA 3E86A 4PDLA 5D5PA 2WSSG 2V1DA 3CCMV 2HG5C 5C8YB 2DJVA 1OCZC 5GW7A 4FM2A 2YXHA 2KSDA 1NVPB 4LR3A 4LWSB 4K0KB 1M9NA 3CRAA 1FXHA 4JYAO 1M93A 1LUVA 2OIGA 4PA3A 1SA0A 2ZE5A 4BR6A 2YIBA 4NB5A 3A0HZ 2F66C 3W7XA 1NQTA 2R9IA 2KKWA 5L3EA 2IJHA 2YDEA 3MD0A 3D36A 4WFBV 1PKXA 5L3BA 1KBHA 1MZFA 3ZHTA 4MSWC 2W0FC 1M57B 1YJ9V 1N33O 2LW7A 3IJ4A 4NXNB 3IFXA 1WJZA 4A5UB 1MOFA 4DR1B 5C8YA 3DTUB 2VWKA 4X1KB 2OT5A 1Z2GA 3K5LA 3EHBB 1YJWV 3KG2A 2GDSA 3CXHF 5IY5C 2R72A 4TQDA 4FMTA 5FPRA 4DO2A 1D5NA 1M5IA 3F7VC 3MHSC 3QVNA 1GN2A 3X2QB 3R66A 1XHXA 3ZRVA 3BRCA 4YJ3B 1UPGA 4MVSA 1SS3A 4IGGA 1WA8B 4ZKIA 4GKKB 5DN6G 1IDSA 1KQSU 1EZJA 2XTAA 4CH4A 4JAAA 4B08A 3JAWB 1RP3B 5JWPA 4B3RO 4Q20A 3ASOC 2EINC 1IBMO 1VF6A 4B3SO 1CXZB 1G8MA 5LA6B 3CJHB 1SZTA 3WG7B 4X1KA 2A7WA 4CZZA 4JAUA 4X89A 1WP7A 3JSLA 1Q86W 4JI6O 4YJ3A 4YY3O 5CN0A 3MHHC 5CA1B 4XDKA 1WA8A 3T1HO 2JDIG 4UCOA 1Q6HA 1M56C 2QKCA 3OUFA 2UUAB 3JAWA 1R73A 1KD1W 3ASNC 2F4VO 1HW7A 3LNMB 2L6LA 3SR2C 1ZLZA 5EK0A 5LA6A 2FYUH 1VQ7V 5GTHZ 3CJHA 2ZXWB 5JJNB 1AR5A 3AG3C 5HFMA 4JTCB 1U97A 4CH6A 2Q5ZA 4B7EA 1HNWO 4I9WA 4LNUB 5EBWC 4FZ0A 2CUGA 2BTQA 4I4TB 1US6A 1XL6A 2XAJA 1VF7A 4GT1A 5CA1A 3K03A 5IYBO 3LDEA 2ETNA 1S0VA 1XL4A 1ZAUA 1JQ0A 1PL0A 2BOBC 1FYJA 1PPJH 4PD4F 3W7UA 5IJ0B 4X66B 4GLXA 4DUYO 4WFHA 1VIBA 3N2GB 1NTZH 1WLEA 3DGEA 2ZR3A 2CAZC 1FXKB 3AK1A 3CB2A 2P6JA 2ADPA 3T4DA 1IXMA 2WLIB 4DUZO 1YF2A 3A0BZ 3AK2A 3P3PA 3RT3C 2UUBB 4GX1A 1RFYA 1G4YB 2AXTZ 2BSKB 3JD1A 5CB4B 2MK3A 1VQMV 2V4DA 4LNUA 1XMOB 1N32O 4I4TA 4W4LA 1IXBA 3F7YC 1VQ9V 5LYJB 1LR1A 2DN9A 2AZ2A 1S3JA 2F43G 5GTIZ 2W6JG 1V9PA 2Q7HA 1VQKV 5IJ0A 2IM9A 1KP2A 1N36O 1FXKA 2YI8A 2HLDG 2QM7A 4JPRA 1SQGA 4F6EA 4OX9O 4HNAB 3AG7A 2WLIA 3OMIB 1Y76B 4UVAA 1GO3F 3ZRSA 3K04A 2BSKA 4IIJB 5CB4A 2AHYA 2Z3YA 4LFAB 2EIJC 1TA8A 5B5EZ 5EBLC 1CP9A 4CBCA 3ABUA 3OMAB 5KHIA 3CC2V 3E8HA 4LF8O 5LYJA 3RFRA 2YEVB 4DV1O 3JD4A 3JD2A 4UVCA 2BCCH 4JI0O 1K5SA 3H1LH 1OCOB 1JJ2U 2OIEA 3APOA 5J2UB 3SGIA 4MTFA 3W7WA 1HDJA 2QWNB 1BHAA 1R6KA 3C90A 4O4JB 1DK1A 2ZIMA 4HNAA 1ZWIC 2VQEO 1AP6A 1Y76A 1I94O 1K8AW 3RYIA 2CTRA 1VF5B 2LO1A 3G6EV 1BZKA 2EILC 4YJ2B 2HEPA 5LMUO 4DV3B 2OCHA 1XMQO 4P30A 3ZX6A 4MS2A 5CBFA 3CCQV 4MVQA 4MW3A 1M57C 3E22B 4GYCB 3L71H 4FLTA 4AILC 1XHZA 1FJGO 1BQ0A 3VBBA 4JV5B 5J2UA 3RW0A 4DR5B 2A06H 1BMFG 3G80A 5CA0B 1Q8IA 3GVMA 4O4JA 2CGNA 3FB5C 2WAMA 1Q6IA 4UCTA 1K34A 1XNRB 1GM7A 2N04A 1GMGA 2A0LA 4PA7A 3RVZA 2EIMC 1CEZA 4YJ2A 3SJQC 4GZRB 4WF9V 3UT5B 4DV5O 3ZMSA 4EFBA 2V7QG 4XBFA 5LGUA 5LOVB 2ZM6B 1IVSA 4JI3O 5L3DA 3E22A 3T1YO 2B5UA 1NZ6A 5IY5B 2K9PA 2IU0A 2NN4A 1MG1A 3JAMN 2HVKC 1RM1B 2Y4TA 2Q68A 4J7ZA 2YS8A 2FL4A 4NKGB 5B1NA 3CC7V 4U3FH 3H1JH 5CA0A 2JGDB 1KU9A 2LQTA 1THZA 3K0DA 2XHBA 2QJ1A 3OM3B 4J9YB 3RYHB 1Q7YW 3J7AU 2YC0A 1OJHA 5IWAO 2EULA 2E3CA 3UT5A 1QNMA 3NR7A 5KA5A 3IAYA 3JD3A 1XUQA 1KKDA 5KX5B 5LOVA 5H2FZ 1SQFA 4DYLA 4MW8A 4TOIA 4DR7B 2A3QA 2P67A 3K3WA 3SYAA 4PHZA 3SYCA 1I0HA 1T5EA 1P49A 2UXDB 5LP6B 4O4IB 3B8NA 2HJFC 1MSWD 4I55B 5KUKA 2ZE7A 2GBOA 1KC8W 3K08A 3LUTB 3LSSA 4MT8A 1BS3A 2HHHB 3CMAV 4DW1A 4DR3B 3BA8A 4P2ZA 1EZVH 3JALB 2JGDA 4BIOA 3RYCB 5L3GA 5HFLA 1WPXA 2ZNJA 4X62B 1XDCA 4YIOA 3H01A 2NLJC 1BGYH 4TT3G 3RYHA 3OUSA 1JPXA 1OCRC 1R3LC 4UCRA 3SJBC 3ZCCA 1LUWA 1SQQH 4NXMB 3FYIB 2AGAA 5KX5A 4DR2O 2RNBA 4X65O 5EC2C 3L75H
chains in the Genus database with same CATH topology
2UXNA 3AG3B 1YTFB 3W7SA 4PA3A 4PA6A 4PDVA 3E8GA 4F4LA 3LSQA 3AG1C 2ZDIC 1Q82W 3ZRWB 3W7XA 1NQTA 2R9IA 4PDMA 5L3EA 1AROP 1QCEA 2IJHA 1AI6A 3IGAC 3MD0A 3D36A 4WFBV 1PKXA 5L3BA 2X6BA 2B1GA 4JYBA 3B77A 4MSWC 4FPPA 2W0FC 4MVMA 1JCHA 1M57B 3AG4B 3B8MA 3SPCA 3ZMTA 1YJ9V 4JAVA 3STLC 2WLHA 3IFXA 2ZQMA 1QLNA 4JTDB 1JVMA 1MOFA 3LDDA 4RUEA 2IW5A 3DTUB 3CCUV 2OT5A 1VQNV 3EHBB 1F4MA 1YJWV 3KG2A 1E1QG 2JJ2G 1R3JC 2OCCB 3GWOA 4OXSA 1YJNV 5IY5C 4FMTA 3CP1A 4DO2A 3T1CA 2X0LA 3F7VC 3MHSC 1H2GA 1S77D 3K79A 3X2QB 3GB7C 1K92A 2EIKC 3ZMZA 2HKOA 4YXWG 3ZRVA 1YHQV 2QA4V 4MVSA 2DQ3A 1QLEC 1K7DA 1NKDA 3IC7A 3ZJZA 4ZKIA 1Q81W 5DN6G 1KQSU 1EZJA 4HAMA 3VOUA 4TSFG 4UUJC 2JEUA 2Q69A 5B3SB 1BHBA 2XOKG 4Q20A 3M99B 3ASOC 4U7NA 4U7OA 2EINC 3CCRV 2D3OW 3SYOA 1DF5A 2OTLV 2ZD9A 1G8MA 1J95A 3I56V 1SZTA 3WG7B 1FXVA 2X6CA 3HB3B 2K1EA 4CZZA 2BOCC 4JAUA 2NNUA 4X89A 2QM8A 1K33A 3RBZA 3QO8A 2XNDG 1Q86W 4JASA 2DQ0A 3E8BA 1P4RA 2H94A 3ETDA 5H9CA 4JGSA 2JK5C 1JOYA 2PI5A 4GCZA 5CN0A 3MHHC 1HWYA 2WWWA 4XDKA 4X8AA 2DYRC 3QO7A 3SPHA 4ASUG 1S72V 5B1BB 2QTOA 1NH2B 2JDIG 3JD0A 2HFEC 4G28B 1K3EA 1K4DC 3ABMC 1RPRA 3AG2C 1M56C 1K5QA 2FTKA 3FB6C 3OUFA 2CK3G 4KP4A 4QPJA 1R73A 1KP3A 1H8EG 3RVYA 1KD1W 3ASNC 3LNMB 4BIUA 2WLLB 1V55C 5EK0A 2DWDC 1VQ7V 1OCCC 1GM8A 2ZXWB 4BIZA 1PD3A 2ITCC 3AG3C 5HFMA 4JTCB 1K97A 3ETGA 1GM9A 5B1AC 4I9WA 1VQPV 3HPLC 4RAIA 5EBWC 2EILB 2HVJC 3BEHA 4XDJA 1W0KG 2ZR2A 3STZC 1ENVA 1XL6A 2GHYA 2WLNA 2XAJA 2XAQA 1L1FA 1F23A 2A9HA 4GT1A 1VQ5V 2HR3A 3FKSG 3K03A 5IYBO 1SERA 3LDEA 2C2AA 1S0VA 3ABKB 1OCZB 1XL4A 5DM6V 1JQ0A 3CC4V 1PL0A 3P30A 2BOBC 2LP7A 3W7UA 3K06A 1QR8A 5LHHA 1CPYA 3OR7C 1MABG 1P7BA 2DYSC 1PNKA 4MTXA 2IH1C 4WFHA 1K4CC 2Q6AA 2IH3C 1WLEA 2XASA 1AI5A 2EBOA 4UXNA 3DGEA 3OEHG 2ZR3A 4MTOA 1FXKB 4QE7A 2WLLA 3W7TA 1PNLA 2P6JA 3ABLC 3T4DA 3F5WC 4JYCA 1IXMA 2WLIB 4R6ZA 2QE7G 3FYEB 2Y69C 1QR9A 1AI4A 4GX1A 4QNHB 1G4YB 2LFSA 2YSUB 3JD1A 3QO5A 4WFGA 2MK3A 1VQMV 3CPWU 1RM1C 2EIMB 3X2QC 4WFEA 2XAGA 2A79B 3F7YC 3CCEV 3ZRWA 1VQ9V 2UXXA 5LGTA 2WPDG 4FJCC 3ZRXA 2QEXV 3NXSA 1S3JA 1Y66A 1NR7A 1YITV 1FFTB 2F43G 4ZBMA 1VQ8V 2W6JG 3ETEA 4LC1A 4L87A 3K0GA 1VQKV 5LHIA 5B3SC 2GSMB 1EFRG 3OGCC 3QNEA 3OEEG 4HYOA 1V54C 2Y48A 3OMNB 4H33A 4TWKA 1KP2A 5CBGA 1VQ6V 1FXKA 5L3CA 1GTOA 2HLDG 2QM7A 4JPRA 3WG7C 4MVZA 2KB1A 1QLEB 5E1AC 2WLIA 2WLKA 3G4SV 3OMIB 2OTJV 3CMEV 4UVAA 3ZMUA 1GO3F 3ZRSA 3K04A 2AHYA 2IJJA 2Z3YA 2EIJC 5C93A 5EBLC 2X7RB 3ZIAG 1CP9A 4CBCA 3ABUA 3ML0A 3OMAB 3SPJA 3CC2V 3ZN1A 1M90W 5LGNA 1M1KW 3E8HA 3ASOB 4E2LA 1I5XA 2EINB 1QVGU 5CA3A 3CXCU 4WCEV 1SRYA 5B1BC 1YI2V 2YEVB 1R6NA 3JD4A 3JD2A 4N23A 1H38A 4UVCA 1N8RW 1K5SA 1OCOB 2JEXA 4GX0A 1JJ2U 4FIPC 4H37A 1TUEB 4QE9A 2DWEC 4MTFA 1RPOA 3W7WA 2Z5UA 4LBEC 2EJRA 1BHAA 3WFVA 1R6KA 3R65A 3E89A 2ZXWC 1GKFA 2DYRB 3FB7C 1ZWIC 3E83A 2Q67A 1K8AW 3ABMB 3JYCA 3OR6C 3AG2B 1M56B 3G6EV 4GX2A 3E35A 3K9AA 2PI4A 1BL8A 2EILC 5CBHA 1NVPD 3T2MA 2DW4A 3D3IA 4BW5A 2ATKC 4KUMA 4RQEA 3ASNB 2QKSA 1OCRB 3UKMA 1Y4MA 1YTFD 4BAYA 4P30A 3SYQA 1ROPA 4UVBA 1V55B 4MS2A 1DTOA 5CBFA 3CCQV 4MVQA 1AJQA 4MW3A 1M57C 3AG4C 5L3FA 3OAAG 1EBOA 4FK5C 2JIZG 2ITDC 1E79G 5B1AB 2R9RB 3P32A 3VBBA 1FXKC 3BY6A 5B1OA 4MVOA 3AG1B 2W6IG 1NR1A 1S5HC 3RW0A 3EFFK 3FB8C 4LP8A 1BMFG 1NBMG 1F4NA 2EZPA 2OCCC 3FB5C 2WAMA 3OW2U 4RQFA 3CCSV 1K34A 1GM7A 1JX9A 4HZ3A 1GMGA 2A0LA 5IYCO 4PA7A 3RVZA 2EIMC 3E2EA 1CEZA 3CYOA 4WFAV 3SJQC 5KA6A 2B1IA 2DYSB 2AHZA 4RUFA 4Z1MG 4WF9V 4QJFB 4N21A 5H6QA 1UJWB 4G27B 3ZMSA 1OZ0A 2V7QG 4XBFA 5LGUA 3I55V 3SYPA 3T4ZA 5IDJA 3ABLB 1S76D 1R3IC 4PDRA 5J9PC 1E1RG 3ZMVA 5L3DA 5LBQA 4P9OA 2B5UA 5IY5B 2X6AA 2Y69B 5LHGA 2M7WA 2IU0A 2XAHA 5EC1C 3CCJV 4DXWA 1MG1A 3CCVV 2HVKC 1RM1B 2P90A 2WLMA 1YSCA 2Q68A 4J9ZB 4GX5A 1W2BU 1K73W 1VQLV 4G2KA 4X88A 3UM7A 2ZDIA 5B1NA 3CC7V 2EIKB 1QVFU 3ZN0A 3A0RA 4UV9A 3ABTA 1YIJV 3TCUA 4I5SA 1THZA 2JJ1G 3K0DA 2XAFA 5H6RA 5CMUA 2EZOA 3OM3B 1ORQC 3JCZA 3OFNG 4J9YB 4MVRA 4MTGA 5KUMA 1Q7YW 1NJIW 4PELA 4JF3A 5KA5A 1V54B 1R3KC 4R7CA 3JD3A 1DF4A 4JTAB 1VQOV 3PJSK 2P7TC 1KKDA 3AEIA 4R50A 1SESA 4MW8A 4MVUA 3SPGA 4KFMA 4QIWF 1KECA 3K3WA 2P67A 4XDLA 3SYAA 1B6QA 1AJPA 1SETA 5FL7G 3SYCA 1F51A 1OCOC 1FS0G 4QPKA 3TETA 3B8NA 1AR1B 1W0JG 2HJFC 2LFRA 2H8PC 3LDCA 2IU3A 1MSWD 2EIJB 5KUKA 1NH2D 4LCUC 5EBMC 1KC8W 3K08A 2IJIA 3LUTB 3LSSA 4MT8A 3CMAV 5IYDO 1GK9A 3G71V 2IJKA 4P2ZA 1K9MW 1QBZA 3OE7G 4RO2A 4PA9A 4R8CA 4PA4A 5L3GA 5HFLA 1WPXA 1LNQA 2WLJA 1H8HG 3SPIA 1VQ4V 4WFFA 3H01A 1AJNA 3CD6V 2NLJC 4TT3G 3E86A 4PDLA 1OHHG 2WSSG 3OUSA 1COWG 1JPXA 2V1DA 1OCRC 5BZBA 3E8FA 1R3LC 3CCMV 2HG5C 3ZCCA 3ABKC 1OCZC 5GW7A 4UV8A 3FYIB 1NVPB 3CCLV 1M9NA 2YEVA 1OCCB 4P9PA 1FXHA 4EKWA 1I5YA 3TK1A 5EC2C 1AI7A 1PNMA 1DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUF A;  3WG7 C;  2HFE C;  4G28 B;  1K4D C;  3ABM C;  4PA3 A;  3AG2 C;  1M56 C;  4G27 B;  4MVZ A;  2KB1 A;  3E8G A;  4PA6 A;  4PDV A;  3FB6 C;  5E1A C;  3OUF A;  4F4L A;  2WLI A;  2WLK A;  3AG1 C;  3SYP A;  3T4Z A;  3ZRS A;  3K04 A;  4PDM A;  3RVY A;  1R3I C;  4PDR A;  5J9P C;  3ASN C;  2AHY A;  3LNM B;  2EIJ C;  3IGA C;  4P9O A;  5EBL C;  2WLL B;  1V55 C;  2X6A A;  5EK0 A;  3SPJ A;  4CBC A;  2DWD C;  2X6B A;  5EC1 C;  3E8H A;  1OCC C;  4MSW C;  4DXW A;  2W0F C;  4MVM A;  2HVK C;  3SPC A;  2WLM A;  2Q68 A;  2ITC C;  4J9Z B;  5B1B C;  2WLH A;  4GX5 A;  3STL C;  3AG3 C;  4X88 A;  3UM7 A;  4JTC B;  3IFX A;  4JTD B;  5B1A C;  1JVM A;  4I9W A;  3HPL C;  3TCU A;  4RAI A;  5EBW C;  3LDD A;  2HVJ C;  3BEH A;  3K0D A;  4RUE A;  4XDJ A;  4GX0 A;  3STZ C;  1XL6 A;  2WLN A;  4H37 A;  4QE9 A;  2A9H A;  3KG2 A;  1ORQ C;  1R3J C;  4OXS A;  2DWE C;  3K03 A;  4J9Y B;  4MTG A;  4MVR A;  5KUM A;  5IY5 C;  3LDE A;  4MTF A;  1XL4 A;  4LBE C;  2BOB C;  3R65 A;  3E89 A;  3T1C A;  2ZXW C;  3F7V C;  3K06 A;  1R3K C;  4R7C A;  4JTA B;  3FB7 C;  3PJS K;  2P7T C;  3OR7 C;  1ZWI C;  3GB7 C;  2DYS C;  1P7B A;  3E83 A;  2EIK C;  1KKD A;  2IH1 C;  2Q67 A;  1K4C C;  2Q6A A;  4R50 A;  4WFH A;  2IH3 C;  3OR6 C;  3JYC A;  4KFM A;  4MVU A;  4MW8 A;  3SPG A;  4MVS A;  4GX2 A;  4XDL A;  1QLE C;  1BL8 A;  2EIL C;  4MTO A;  3SYA A;  5CBH A;  3TET A;  4QE7 A;  3SYC A;  1OCO C;  3T2M A;  2WLL A;  3ZJZ A;  4BW5 A;  2ATK C;  3ABL C;  2HJF C;  3LDC A;  3T4D A;  2H8P C;  2QKS A;  3F5W C;  3VOU A;  3UKM A;  5KUK A;  2WLI B;  4LCU C;  5EBM C;  4P30 A;  4R6Z A;  4UUJ C;  3SYQ A;  3K08 A;  2Y69 C;  4GX1 A;  4MS2 A;  2Q69 A;  4QNH B;  3LUT B;  5CBF A;  1G4Y B;  4MVQ A;  3ASO C;  4MW3 A;  4WFG A;  2EIN C;  1M57 C;  3AG4 C;  4P2Z A;  3SYO A;  2ZD9 A;  3X2Q C;  4WFE A;  4RO2 A;  4PA9 A;  4R8C A;  4PA4 A;  1J95 A;  2A79 B;  3F7Y C;  2ITD C;  1LNQ A;  2WLJ A;  3SPI A;  2R9R B;  2X6C A;  4WFF A;  2K1E A;  2NLJ C;  3E86 A;  4MVO A;  4PDL A;  3RW0 A;  1S5H C;  2BOC C;  3EFF K;  3OUS A;  4X89 A;  3FB8 C;  4LP8 A;  4ZBM A;  1OCR C;  5BZB A;  3E8F A;  3K0G A;  3RBZ A;  2OCC C;  1R3L C;  3FB5 C;  2HG5 C;  5B3S C;  3ABK C;  1OCZ C;  3E8B A;  2JK5 C;  3OGC C;  4HZ3 A;  2A0L A;  2YEV A;  4PA7 A;  4P9P A;  3RVZ A;  4EKW A;  4HYO A;  1V54 C;  2EIM C;  4H33 A;  4TWK A;  4X8A A;  4XDK A;  2DYR C;  5CBG A;  3SJQ C;  5EC2 C;  3SPH A;  2AHZ A;  2QTO A; 
#chains in the Genus database with same CATH topology
 3AG3 B;  1YTF B;  5LP6 A;  4PA6 A;  4O4I A;  2WA4 A;  4LF9 B;  4I55 A;  2ZIN A;  2DOS A;  1QQC A;  3ZRW B;  4LH6 A;  1QCE A;  2D2C B;  1AI6 A;  3N2K B;  3JAL A;  3ETQ A;  2P4V A;  4KL1 A;  3RYC A;  2X6B A;  4FFB B;  3ZHQ A;  1Q3E A;  5A9G A;  2WLH A;  1KUQ A;  4TV8 A;  3KCX A;  1QLN A;  2RDC A;  1JVM A;  2E76 B;  4DV0 B;  5JH7 A;  1NTM H;  1JFF B;  1E1Q G;  2JJ2 G;  1YJN V;  2AW9 A;  1VAR A;  3SJC C;  3WB2 A;  1GN6 A;  4CH5 A;  2X0L A;  2N05 A;  1TVK B;  1S77 D;  3K79 A;  1B04 A;  1K92 A;  1YDX A;  2HKO A;  2P5O A;  1YHQ V;  2DQ3 A;  5KHG A;  3N2K A;  1Z5W A;  4GKJ B;  4DR4 B;  1Q81 W;  2DMX A;  4FFB A;  3B09 A;  2Q73 A;  5KHK A;  3VQW A;  1BHB A;  1N34 B;  3M99 B;  4U7N A;  1PP9 H;  2D3O W;  3JAR B;  1J95 A;  5K1P A;  3I5D A;  3I56 V;  4AQY O;  3CSX A;  1FXV A;  1JFF A;  4X20 B;  3BPZ A;  5EZY B;  1XNQ O;  2BOC C;  2QM8 A;  2UU9 B;  2PUS A;  1GN3 A;  4CC5 A;  4H44 B;  3VQY A;  1TVK A;  3QO8 A;  2ZNI A;  2F1M A;  4YIP A;  4JAS A;  2DQ0 A;  2E75 B;  2H94 A;  3ETD A;  5H5N A;  5H9C A;  2Q0O C;  4GCZ A;  4LF6 B;  2WWW A;  4FLW A;  4UB6 Z;  2YIA A;  2QTO A;  2PGG A;  1K5Q A;  4FZ1 A;  3FB6 C;  2UXB O;  4BWA A;  5E79 Z;  2DE0 X;  2YXL A;  5IE9 A;  1OCC C;  4X20 A;  2BE3 A;  2LGQ A;  3OTO O;  5BR8 B;  4B3T B;  5EZY A;  1K97 A;  3ETG A;  1HR0 B;  1GM9 A;  1VQP V;  3HPL C;  5IJ9 B;  1WN7 A;  4RAI A;  2EIL B;  5KHJ A;  4XDJ A;  1L8D A;  3STZ C;  2Y0I A;  4JI8 B;  1ENV A;  1F23 A;  2A9H A;  4JI7 B;  3FKS G;  3ABK B;  5DM6 V;  4J10 A;  4DV6 B;  3FAV B;  3TJT A;  3K06 A;  2QWO B;  1CPY A;  1H2L A;  1MAB G;  3CE2 A;  5DED A;  1PNK A;  4JI1 O;  4JI5 O;  2IH3 C;  2M6Y A;  2PY5 A;  2YI9 A;  2XAS A;  4B3M O;  1HNZ O;  4QE7 A;  3J80 N;  1MZE A;  1PNL A;  2VQF O;  3F5W C;  4LF7 O;  4LWS A;  3CX5 F;  4JYA B;  1ZTE A;  3FYE B;  1PL4 A;  1AI4 A;  4JI2 O;  3AK3 A;  2LFS A;  3JAS B;  1RM1 C;  4LF4 O;  2EIM B;  4J80 A;  3D8C A;  5LGT A;  3L74 H;  4IT5 A;  2AZ0 A;  3JAK B;  1IBL O;  3NXS A;  1FFT B;  1VQ8 V;  3FAV A;  1IBK O;  4L87 A;  2Q9L A;  4TV9 B;  3ZHR A;  1N33 B;  2GSM B;  3QNE A;  3K9S A;  5CBG A;  4LF5 O;  4ICG A;  1OV9 A;  2ZCE A;  1GTO A;  5B66 Z;  4MVZ A;  1QLE B;  1N4C A;  4J42 A;  2WLK A;  2OTJ V;  2QM4 A;  1B06 A;  4NTW A;  3ZMU A;  5LP6 C;  3JAS A;  2X7R B;  3TGU H;  3ML0 A;  3SPJ A;  5GON B;  1M1K W;  2KQX A;  4E2L A;  1QVG U;  3PN1 A;  1IBL B;  3JAK A;  1HNX O;  3J81 N;  2YIB D;  4N23 A;  1SQV H;  3SDL A;  5IYZ B;  4TV9 A;  4GX0 A;  4H37 A;  4QE9 A;  2YXY A;  2XT9 A;  4B3R B;  1M4U A;  3H1I H;  1IBM B;  4B3S B;  4DRX B;  4LBE C;  2EJR A;  2Q0A A;  3ZS8 C;  1GKF A;  2R9A A;  2DYR B;  3FB7 C;  3E83 A;  3QF7 A;  1VP7 A;  2Q67 A;  3ABM B;  3K5N A;  2PI4 A;  1NVP D;  3T2M A;  3U10 A;  2ATK C;  4KUM A;  5FLX N;  1BQZ A;  3H9V A;  3BHP A;  2ZIO A;  1O9G A;  4RQE A;  4JI6 B;  4I9Q A;  1OCR B;  4YY3 B;  4UVB A;  1BE3 H;  3T1H B;  1AJQ A;  4DV7 O;  5DEC A;  4EFE A;  2JIZ G;  2ITD C;  1KB9 F;  1E79 G;  4ZOL B;  2F4V B;  1EM1 A;  4MVO A;  4DRX A;  3EFF K;  3FB8 C;  1A32 A;  3DC5 A;  1Y67 A;  1W59 A;  2HP8 A;  3CCS V;  2CDY A;  1Y6X A;  4HZ3 A;  4DK0 A;  1HNW B;  4WFA V;  5KA6 A;  1XOU A;  4RUF A;  4Z1M G;  2EX3 A;  2ODM A;  1UJW B;  3K58 A;  4FFK A;  4BW9 A;  3ABL B;  5EIB C;  1R3I C;  4PDR A;  5J9P C;  1E1R G;  3ZMV A;  4C7U A;  2Y69 B;  5EC1 C;  4DXW A;  4DUY B;  4ZOL A;  3N2G A;  4O4L B;  1W2B U;  4G2K A;  4X88 A;  5KLV H;  4UV9 A;  1YIJ V;  3KCY A;  3TCU A;  4WBN B;  4DUZ B;  2XAF A;  2XUM A;  5CMU A;  2EZO A;  1ORQ C;  2E5L O;  3JCZ A;  1FFX B;  4MTG A;  4MVR A;  5KUM A;  5K1X A;  4OGQ B;  1SZX A;  1N32 B;  4PEL A;  1KMI Z;  2PYL A;  1ZUQ A;  1SES A;  3SPG A;  4LFB O;  1KEC A;  1B6Q A;  1SET A;  1FPO A;  5FL7 G;  1F51 A;  2Z0A A;  1TAE A;  3UCS C;  3L73 H;  3HKC B;  5EBM C;  4O4L A;  1N36 B;  1XQ8 A;  2IJI A;  2EJ7 A;  3HKB B;  5JJE B;  4OX9 B;  4WBN A;  1SKV A;  1LNQ A;  1H8H G;  5IT9 N;  1XEQ A;  1AJN A;  3CD6 V;  4IIJ A;  1FFX A;  3CRC A;  3MAQ A;  3QG5 A;  3E8F A;  4O2B B;  4LF8 B;  2ZKO A;  4KHP O;  3ABK C;  4Q6G A;  4ZHQ B;  2YEV A;  3SJA C;  4CS2 A;  1OCC B;  4P9P A;  4DV1 B;  3L70 H;  1AI7 A;  1PNM A;  4JI0 B;  2UXN A;  4CS3 A;  2JGU A;  2CH7 B;  4PDV A;  3LSQ A;  4HBN A;  3AG1 C;  2ZDI C;  1Q82 W;  4PDM A;  4DR6 O;  3K5M A;  3K59 A;  1UFI A;  1ZX3 A;  4I7Z B;  2B1G A;  4JYB A;  2VQE B;  1XI1 A;  1I94 B;  4MVM A;  3AG4 B;  3ZMT A;  3QTC A;  4JAV A;  3STL C;  3UO2 A;  4K8Z A;  3O65 A;  3LSU A;  1NT2 B;  1IX9 A;  5LMU B;  2JS5 A;  3LDD A;  3B40 A;  4JI4 O;  1XMQ B;  4ZHQ A;  1F4M A;  3GWO A;  4OXS A;  5ITZ B;  1QU7 A;  1FJG B;  3DSQ A;  2CH7 A;  4PI0 A;  4K3A A;  3CWB H;  3GB7 C;  1FAF A;  2QA4 V;  5BY1 A;  1QLE C;  4AI8 A;  1Q90 D;  1K7D A;  1NTK H;  4HAM A;  4TSF G;  2JEU A;  2XOK G;  3DC6 A;  2W0X A;  4DV5 B;  2OTL V;  2ZT9 B;  4DV4 O;  4X9Q A;  5FNV B;  1J5E O;  3HB3 B;  2K1E A;  4JI3 B;  5ITZ A;  3T1Y B;  2R70 A;  2RQ6 A;  1XIL A;  3EXA A;  4IYI A;  3GWK C;  3B2E E;  3E8B A;  2JK5 C;  2PI5 A;  2CGO A;  3U11 A;  1P7G A;  4X8A A;  2DYR C;  3QO7 A;  3K5O A;  1NH2 B;  3IC9 A;  4G28 B;  1K3E A;  2OWO A;  3ABM C;  1RPR A;  2FTK A;  2CK3 G;  4KP4 A;  5IWA B;  5J2T B;  4IYH A;  4QPJ A;  1KP3 A;  5KAF Z;  2QTS A;  1FKA O;  2WLL B;  5LL6 Y;  1PM9 A;  4DV2 O;  2GTS A;  4LFC O;  2GUZ B;  2Y0P A;  5FNV A;  4BIZ A;  5FPO A;  2ITC C;  4FLZ A;  2VRZ A;  2RCV A;  3HKE B;  4RWU A;  4ZIB A;  4OPH A;  2HVJ C;  3BAA A;  1W0K G;  2WLN A;  2XAQ A;  1L1F A;  4YHH O;  1JJO A;  1VQ5 V;  3BFR A;  4PV1 B;  2HR3 A;  3CHX A;  1SER A;  2C2A A;  1QHT A;  3P30 A;  2F93 B;  4X64 O;  2OYQ A;  2F95 B;  1P7B A;  5J2T A;  1AI5 A;  4UXN A;  2WLL A;  3W7T A;  1KKC A;  1WNS A;  3ABL C;  3BAB A;  2UXC O;  1BT8 A;  4F6R B;  4DR2 B;  2GUZ A;  1GAX A;  2QE7 G;  3A2F A;  4X65 B;  2Y69 C;  4QNH B;  4UCU A;  1Q43 A;  1X59 A;  4WFG A;  2H3O A;  1L0L H;  3HKE A;  3TXQ A;  5LMN O;  2F23 A;  3CCE V;  3ZRW A;  1H2S B;  3WU2 Z;  2WPD G;  3CRQ A;  3ZRX A;  1S5L Z;  4J41 A;  2Y4U A;  1TUB B;  1F7Y A;  2UUC O;  4UCV A;  2PTM A;  4ZBM A;  3ETE A;  3K0G A;  5LHI A;  5B3S C;  5BXZ A;  1MSD A;  3G67 A;  3OGC C;  3L9D A;  2Y48 A;  3OMN B;  1VQ6 V;  5L3C A;  3ZHV A;  5A2Q N;  2KB1 A;  4F6R A;  3G4S V;  2IJJ A;  3ZIA G;  3F5T A;  3APQ A;  1M90 W;  5LGN A;  3UO3 A;  3CXC U;  4WCE V;  4AHC A;  1SRY A;  3CRM A;  5B1B C;  3BCC H;  1YI2 V;  1TUB A;  4K0K O;  1G1X B;  1SQB H;  2WA3 A;  4L8J A;  4O4H B;  2JEX A;  4FIP C;  1TUE B;  1RPO A;  3JAR A;  2Z5U A;  5KMG B;  3HKD B;  4PI2 A;  3R65 A;  4AQY B;  3BA9 A;  1DLB A;  1XNQ B;  5D5Q A;  3JYC A;  1EN5 A;  3AG2 B;  4O2A B;  5CBH A;  2DW4 A;  4NXN O;  3RWR D;  3A8T A;  4ABM A;  3DXR B;  3CEI A;  1N0J A;  4J7K A;  4ZI7 B;  4DR1 O;  1YTF D;  3FX7 A;  1V55 B;  5JJJ B;  1DTO A;  3AG4 C;  3OAA G;  3MDS A;  4O4H A;  1EBO A;  5LXT B;  4FK5 C;  2UXB B;  1I7F A;  5B1A B;  2R9R B;  3P32 A;  3BY6 A;  1WPB A;  1H2M A;  1SQP H;  3AG1 B;  2JRI A;  5KMG A;  2FML A;  1Y74 B;  4LP8 A;  3HKD A;  1NBM G;  2PF4 E;  1WP8 A;  2EZP A;  4D7T A;  3OW2 U;  4GKK O;  4RQF A;  4FM1 A;  3OTO B;  3FFQ A;  3CYO A;  4O2A A;  2B1I A;  5IJ9 A;  2DYS B;  3TXS A;  4FM0 A;  1JMK C;  3DXR A;  1AP5 A;  3S3X A;  5H6Q A;  1N0N A;  4G27 B;  4ZI7 A;  3I55 V;  2CE4 A;  3SYP A;  5IDJ A;  2G38 A;  2ZE8 A;  4E4E A;  1S76 D;  2PZS A;  1IZ3 A;  5LBQ A;  2X6A A;  5LXT A;  5LHG A;  2M7W A;  2XAH A;  4Z1V A;  4JI1 B;  4U3J B;  4JI5 B;  4B3M B;  2WLM A;  1YSC A;  1NS1 A;  5EIB D;  4GX5 A;  1HNZ B;  1NU1 H;  2ZDI A;  1AVM A;  4KXR A;  1Y74 A;  1GN4 A;  3A0R A;  2VQF B;  3ABT A;  2GTA A;  4LF7 B;  3KZI Z;  2JJ1 G;  4JI2 B;  1H2K A;  3N27 A;  2UUA O;  4LF4 B;  2VS0 A;  3UQ8 A;  4JF3 A;  4IHJ B;  2N74 A;  1V54 B;  1VQO V;  1DF4 A;  1MNG A;  4R50 A;  1VEW A;  4KFM A;  1IBK B;  1AJP A;  1I08 A;  2B9Z A;  3TET A;  1FS0 G;  4QPK A;  1WB8 A;  1GH6 A;  1AR1 B;  2LFR A;  3B4S A;  2IU3 A;  4U3J A;  2BTQ B;  3ICX A;  3OT7 A;  4LCU C;  1KYO F;  1GRJ A;  4LF5 B;  2P22 C;  2CTW A;  5IYD O;  3G71 V;  1K9M W;  1QBZ A;  3OE7 G;  1WB7 A;  2KG7 B;  4PA9 A;  3H1K H;  1EN4 A;  3S3W A;  4X66 O;  1OHH G;  1COW G;  3G6B A;  5GON A;  4D6T H;  5BZB A;  1SC5 B;  3LNN A;  1YXB A;  4IHJ A;  1BSM A;  5AG2 A;  4UV8 A;  1HNX B;  3CCL V;  4EKW A;  1I5Y A;  3TK1 A;  5JQG B;  2UUB O;  5IYZ A;  3W7S A;  3E8G A;  1XMO O;  4F4L A;  2RMK B;  2JS3 A;  1ARO P;  3CRR A;  3IGA C;  4K35 A;  4X1I B;  2KG7 A;  2ADQ B;  3B77 A;  4FPP A;  4B7K A;  1JCH A;  3B8M A;  3SPC A;  1O9H A;  4DK1 A;  3ZHS A;  2ZQM A;  4JTD B;  4W4K A;  2QGN A;  4RUE A;  2IW5 A;  3RGB A;  3CCU V;  1VQN V;  1R3J C;  2OCC B;  3BVO A;  5JQG A;  4UFZ A;  4UCS A;  3Q4H B;  2Q4P A;  3CP1 A;  4DV7 B;  1EN6 A;  3T1C A;  4LFA O;  3ZED A;  1H2G A;  5BMV B;  2EIK C;  3ZMZ A;  4YXW G;  2QDO A;  2YUA A;  1PV0 A;  2NR5 A;  1NKD A;  3IC7 A;  3ZJZ A;  4X1I A;  3VOU A;  2Q8V A;  4UUJ C;  2RJZ A;  3O9O A;  3H1H H;  2Q69 A;  5B3S B;  5JCO A;  4NTY A;  4U7O A;  3C3S A;  3CCR V;  2L35 A;  3SYO A;  1DF5 A;  2ZD9 A;  3OGI B;  2YIC A;  1Q5O A;  3D3Q A;  2X6C A;  1SF9 A;  3RYI B;  2NNU A;  3Q4H A;  4JZ2 A;  1K33 A;  3RBZ A;  2LGW A;  5BMV A;  2XND G;  4FLV A;  3P3N A;  1P4R A;  4JGS A;  1JOY A;  4DV3 O;  1HWY A;  3D36 C;  1YCI A;  3SPH A;  4ASU G;  1S72 V;  5B1B B;  3JD0 A;  2HFE C;  3RN4 A;  1K4D C;  3AG2 C;  1JA8 A;  1SQX H;  2VWJ A;  2E5L B;  2CTP A;  1Q6U A;  3RVY A;  1H8E G;  4JV5 O;  2QSA A;  4NVP A;  4BIU A;  1RSO B;  1V55 C;  4DR5 O;  2DWD C;  1WAZ A;  4FLU A;  1GM8 A;  2MW2 B;  1MMM A;  4CS4 A;  4LFB B;  1PD3 A;  1XNR O;  5B1A C;  4I50 B;  1L0N H;  3ZBH A;  3HKC A;  3BEH A;  1NI8 A;  2QWQ B;  2ZR2 A;  2GHY A;  2IBZ H;  3HKB A;  4CH3 A;  3L72 H;  4FLY A;  1OCZ B;  2ZM6 O;  3CC4 V;  1AR4 A;  4UB8 Z;  3FD9 A;  2LP7 A;  1QR8 A;  2FB5 A;  5LHH A;  3OR7 C;  2DYS C;  4MTX A;  2IH1 C;  3WB1 A;  1K4C C;  2Q6A A;  1VF6 C;  3C3T A;  2EBO A;  2O57 A;  3OEH G;  4MTO A;  4O2B A;  1RSO A;  4KHP B;  3OD4 A;  4JYC A;  1AB3 A;  4TUY B;  4CC6 A;  4R6Z A;  1QR9 A;  2YSU B;  3QO5 A;  1XRE A;  4I50 A;  3CPW U;  1TGO A;  3M8A A;  3X2Q C;  4WFE A;  2XAG A;  2A79 B;  1JR9 A;  1YEW A;  2UXX A;  4X1Y B;  4FJC C;  4DR6 B;  2QEX V;  5EYP B;  3RYF B;  3VQV A;  1Y66 A;  1NR7 A;  1YIT V;  4DR7 O;  2CTQ A;  4LC1 A;  2E74 B;  2UXD O;  1EFR G;  3OEE G;  4HYO A;  1V54 C;  4H33 A;  4TWK A;  1XBL A;  4JI4 B;  3WG7 C;  2HHH O;  4DR3 O;  2YID A;  3K57 A;  1YVW A;  5E1A C;  4TUY A;  3CME V;  3THO A;  4X62 O;  2PYJ A;  1ZL8 B;  5C93 A;  5TIS Z;  1D2D A;  3ZN1 A;  3ASO B;  1FD9 A;  1I5X A;  2EIN B;  4X1Y A;  5CA3 A;  1IUR A;  4NXM O;  4Z2W A;  4NTX A;  5EYP A;  3RYF A;  1H2N A;  2QKA A;  1R6N A;  4QGP A;  4I0X B;  4JYY A;  4D7S A;  1H38 A;  2GV9 A;  4GUN A;  5KHH A;  1N8R W;  3M7M X;  1G6U A;  1BCC H;  4LF9 O;  1DGS A;  2DWE C;  3OTF A;  3JAT B;  2ARH A;  2JVD A;  3WFV A;  4FLX A;  3E89 A;  2ZXW C;  4DV4 B;  1J5E B;  4EB6 B;  4NYK A;  3CS5 A;  2QR4 A;  3OR6 C;  1M56 B;  4GX2 A;  3E35 A;  3K9A A;  1BL8 A;  1ZL8 A;  4TV8 B;  4IL6 Z;  3D3I A;  4BW5 A;  1AIL A;  4DW0 A;  3ASN B;  2QKS A;  2FKX A;  1HP8 A;  3UKM A;  1R6T A;  4DV0 O;  1Y4M A;  4BAY A;  3SYQ A;  1ROP A;  5JH7 B;  4TQF A;  2P06 A;  4I0X A;  5L3F A;  1VMG A;  1MA1 A;  2QWP B;  5JCO C;  1FXK C;  5B1O A;  3JAT A;  4PJ0 Z;  2W6I G;  1D5A A;  1NR1 A;  1S5H C;  2RN9 A;  4DV2 B;  4LFC B;  1F4N A;  4J11 A;  1U96 A;  2OCC C;  4GKJ O;  4EB6 A;  4DR4 O;  5JVD B;  2Q7E A;  3VQX A;  1JX9 A;  5IYC O;  4OPA A;  1P84 F;  3E2E A;  4K8X A;  3KKY A;  1B3Q A;  2AHZ A;  1N34 O;  4QJF B;  1URF A;  4N21 A;  1OZ0 A;  4YHH B;  3U0Z A;  4EEQ A;  2ILM A;  4H0L B;  3T4Z A;  2ZE6 A;  1YZB A;  4J7J A;  4P9O A;  2Q7G A;  4FVM A;  4X64 B;  2UU9 O;  4H13 B;  3CCJ V;  5KAI Z;  1ZSP A;  3CCV V;  2P90 A;  4J9Z B;  1K73 W;  1VQL V;  3UM7 A;  2QWR B;  5F2V O;  2EIK B;  4LF6 O;  1QVF U;  3ZN0 A;  2UXC B;  4I5S A;  1R1B A;  5JVD A;  5H6R A;  1S5J A;  1X4T A;  2LJ2 A;  3OFN G;  5LMN B;  3JCU Z;  1NJI W;  1R3K C;  4R7C A;  4JTA B;  2HJD A;  3PJS K;  2P7T C;  3AEI A;  2P4K A;  2UUC B;  4MVU A;  4QIW F;  4XDL A;  5BR8 O;  1OCO C;  4B3T O;  3EVK A;  1HR0 O;  2BTO A;  3LDC A;  1W0J G;  3HR0 A;  1SA0 B;  2H8P C;  2EIJ B;  1Z5V A;  1NH2 D;  4JI8 O;  4JI7 O;  2LW1 A;  1GK9 A;  2IJK A;  3WB0 A;  4LH7 A;  4RO2 A;  4DV6 O;  4R8C A;  4PA4 A;  4NR1 A;  2WLJ A;  3SPI A;  1VQ4 V;  4WFF A;  3JSN A;  4JZG A;  3ZHU A;  3E86 A;  4PDL A;  5D5P A;  2WSS G;  2V1D A;  3CCM V;  2HG5 C;  5C8Y B;  2DJV A;  1OCZ C;  5GW7 A;  4FM2 A;  2YXH A;  2KSD A;  1NVP B;  4LR3 A;  4LWS B;  4K0K B;  1M9N A;  3CRA A;  1FXH A;  4JYA O;  1M93 A;  1LUV A;  2OIG A;  4PA3 A;  1SA0 A;  2ZE5 A;  4BR6 A;  2YIB A;  4NB5 A;  3A0H Z;  2F66 C;  3W7X A;  1NQT A;  2R9I A;  2KKW A;  5L3E A;  2IJH A;  2YDE A;  3MD0 A;  3D36 A;  4WFB V;  1PKX A;  5L3B A;  1KBH A;  1MZF A;  3ZHT A;  4MSW C;  2W0F C;  1M57 B;  1YJ9 V;  1N33 O;  2LW7 A;  3IJ4 A;  4NXN B;  3IFX A;  1WJZ A;  4A5U B;  1MOF A;  4DR1 B;  5C8Y A;  3DTU B;  2VWK A;  4X1K B;  2OT5 A;  1Z2G A;  3K5L A;  3EHB B;  1YJW V;  3KG2 A;  2GDS A;  3CXH F;  5IY5 C;  2R72 A;  4TQD A;  4FMT A;  5FPR A;  4DO2 A;  1D5N A;  1M5I A;  3F7V C;  3MHS C;  3QVN A;  1GN2 A;  3X2Q B;  3R66 A;  1XHX A;  3ZRV A;  3BRC A;  4YJ3 B;  1UPG A;  4MVS A;  1SS3 A;  4IGG A;  1WA8 B;  4ZKI A;  4GKK B;  5DN6 G;  1IDS A;  1KQS U;  1EZJ A;  2XTA A;  4CH4 A;  4JAA A;  4B08 A;  3JAW B;  1RP3 B;  5JWP A;  4B3R O;  4Q20 A;  3ASO C;  2EIN C;  1IBM O;  1VF6 A;  4B3S O;  1CXZ B;  1G8M A;  5LA6 B;  3CJH B;  1SZT A;  3WG7 B;  4X1K A;  2A7W A;  4CZZ A;  4JAU A;  4X89 A;  1WP7 A;  3JSL A;  1Q86 W;  4JI6 O;  4YJ3 A;  4YY3 O;  5CN0 A;  3MHH C;  5CA1 B;  4XDK A;  1WA8 A;  3T1H O;  2JDI G;  4UCO A;  1Q6H A;  1M56 C;  2QKC A;  3OUF A;  2UUA B;  3JAW A;  1R73 A;  1KD1 W;  3ASN C;  2F4V O;  1HW7 A;  3LNM B;  2L6L A;  3SR2 C;  1ZLZ A;  5EK0 A;  5LA6 A;  2FYU H;  1VQ7 V;  5GTH Z;  3CJH A;  2ZXW B;  5JJN B;  1AR5 A;  3AG3 C;  5HFM A;  4JTC B;  1U97 A;  4CH6 A;  2Q5Z A;  4B7E A;  1HNW O;  4I9W A;  4LNU B;  5EBW C;  4FZ0 A;  2CUG A;  2BTQ A;  4I4T B;  1US6 A;  1XL6 A;  2XAJ A;  1VF7 A;  4GT1 A;  5CA1 A;  3K03 A;  5IYB O;  3LDE A;  2ETN A;  1S0V A;  1XL4 A;  1ZAU A;  1JQ0 A;  1PL0 A;  2BOB C;  1FYJ A;  1PPJ H;  4PD4 F;  3W7U A;  5IJ0 B;  4X66 B;  4GLX A;  4DUY O;  4WFH A;  1VIB A;  3N2G B;  1NTZ H;  1WLE A;  3DGE A;  2ZR3 A;  2CAZ C;  1FXK B;  3AK1 A;  3CB2 A;  2P6J A;  2ADP A;  3T4D A;  1IXM A;  2WLI B;  4DUZ O;  1YF2 A;  3A0B Z;  3AK2 A;  3P3P A;  3RT3 C;  2UUB B;  4GX1 A;  1RFY A;  1G4Y B;  2AXT Z;  2BSK B;  3JD1 A;  5CB4 B;  2MK3 A;  1VQM V;  2V4D A;  4LNU A;  1XMO B;  1N32 O;  4I4T A;  4W4L A;  1IXB A;  3F7Y C;  1VQ9 V;  5LYJ B;  1LR1 A;  2DN9 A;  2AZ2 A;  1S3J A;  2F43 G;  5GTI Z;  2W6J G;  1V9P A;  2Q7H A;  1VQK V;  5IJ0 A;  2IM9 A;  1KP2 A;  1N36 O;  1FXK A;  2YI8 A;  2HLD G;  2QM7 A;  4JPR A;  1SQG A;  4F6E A;  4OX9 O;  4HNA B;  3AG7 A;  2WLI A;  3OMI B;  1Y76 B;  4UVA A;  1GO3 F;  3ZRS A;  3K04 A;  2BSK A;  4IIJ B;  5CB4 A;  2AHY A;  2Z3Y A;  4LFA B;  2EIJ C;  1TA8 A;  5B5E Z;  5EBL C;  1CP9 A;  4CBC A;  3ABU A;  3OMA B;  5KHI A;  3CC2 V;  3E8H A;  4LF8 O;  5LYJ A;  3RFR A;  2YEV B;  4DV1 O;  3JD4 A;  3JD2 A;  4UVC A;  2BCC H;  4JI0 O;  1K5S A;  3H1L H;  1OCO B;  1JJ2 U;  2OIE A;  3APO A;  5J2U B;  3SGI A;  4MTF A;  3W7W A;  1HDJ A;  2QWN B;  1BHA A;  1R6K A;  3C90 A;  4O4J B;  1DK1 A;  2ZIM A;  4HNA A;  1ZWI C;  2VQE O;  1AP6 A;  1Y76 A;  1I94 O;  1K8A W;  3RYI A;  2CTR A;  1VF5 B;  2LO1 A;  3G6E V;  1BZK A;  2EIL C;  4YJ2 B;  2HEP A;  5LMU O;  4DV3 B;  2OCH A;  1XMQ O;  4P30 A;  3ZX6 A;  4MS2 A;  5CBF A;  3CCQ V;  4MVQ A;  4MW3 A;  1M57 C;  3E22 B;  4GYC B;  3L71 H;  4FLT A;  4AIL C;  1XHZ A;  1FJG O;  1BQ0 A;  3VBB A;  4JV5 B;  5J2U A;  3RW0 A;  4DR5 B;  2A06 H;  1BMF G;  3G80 A;  5CA0 B;  1Q8I A;  3GVM A;  4O4J A;  2CGN A;  3FB5 C;  2WAM A;  1Q6I A;  4UCT A;  1K34 A;  1XNR B;  1GM7 A;  2N04 A;  1GMG A;  2A0L A;  4PA7 A;  3RVZ A;  2EIM C;  1CEZ A;  4YJ2 A;  3SJQ C;  4GZR B;  4WF9 V;  3UT5 B;  4DV5 O;  3ZMS A;  4EFB A;  2V7Q G;  4XBF A;  5LGU A;  5LOV B;  2ZM6 B;  1IVS A;  4JI3 O;  5L3D A;  3E22 A;  3T1Y O;  2B5U A;  1NZ6 A;  5IY5 B;  2K9P A;  2IU0 A;  2NN4 A;  1MG1 A;  3JAM N;  2HVK C;  1RM1 B;  2Y4T A;  2Q68 A;  4J7Z A;  2YS8 A;  2FL4 A;  4NKG B;  5B1N A;  3CC7 V;  4U3F H;  3H1J H;  5CA0 A;  2JGD B;  1KU9 A;  2LQT A;  1THZ A;  3K0D A;  2XHB A;  2QJ1 A;  3OM3 B;  4J9Y B;  3RYH B;  1Q7Y W;  3J7A U;  2YC0 A;  1OJH A;  5IWA O;  2EUL A;  2E3C A;  3UT5 A;  1QNM A;  3NR7 A;  5KA5 A;  3IAY A;  3JD3 A;  1XUQ A;  1KKD A;  5KX5 B;  5LOV A;  5H2F Z;  1SQF A;  4DYL A;  4MW8 A;  4TOI A;  4DR7 B;  2A3Q A;  2P67 A;  3K3W A;  3SYA A;  4PHZ A;  3SYC A;  1I0H A;  1T5E A;  1P49 A;  2UXD B;  5LP6 B;  4O4I B;  3B8N A;  2HJF C;  1MSW D;  4I55 B;  5KUK A;  2ZE7 A;  2GBO A;  1KC8 W;  3K08 A;  3LUT B;  3LSS A;  4MT8 A;  1BS3 A;  2HHH B;  3CMA V;  4DW1 A;  4DR3 B;  3BA8 A;  4P2Z A;  1EZV H;  3JAL B;  2JGD A;  4BIO A;  3RYC B;  5L3G A;  5HFL A;  1WPX A;  2ZNJ A;  4X62 B;  1XDC A;  4YIO A;  3H01 A;  2NLJ C;  1BGY H;  4TT3 G;  3RYH A;  3OUS A;  1JPX A;  1OCR C;  1R3L C;  4UCR A;  3SJB C;  3ZCC A;  1LUW A;  1SQQ H;  4NXM B;  3FYI B;  2AGA A;  5KX5 A;  4DR2 O;  2RNB A;  4X65 O;  5EC2 C;  3L75 H; 
#chains in the Genus database with same CATH homology
 2UXN A;  3AG3 B;  1YTF B;  3W7S A;  4PA3 A;  4PA6 A;  4PDV A;  3E8G A;  4F4L A;  3LSQ A;  3AG1 C;  2ZDI C;  1Q82 W;  3ZRW B;  3W7X A;  1NQT A;  2R9I A;  4PDM A;  5L3E A;  1ARO P;  1QCE A;  2IJH A;  1AI6 A;  3IGA C;  3MD0 A;  3D36 A;  4WFB V;  1PKX A;  5L3B A;  2X6B A;  2B1G A;  4JYB A;  3B77 A;  4MSW C;  4FPP A;  2W0F C;  4MVM A;  1JCH A;  1M57 B;  3AG4 B;  3B8M A;  3SPC A;  3ZMT A;  1YJ9 V;  4JAV A;  3STL C;  2WLH A;  3IFX A;  2ZQM A;  1QLN A;  4JTD B;  1JVM A;  1MOF A;  3LDD A;  4RUE A;  2IW5 A;  3DTU B;  3CCU V;  2OT5 A;  1VQN V;  3EHB B;  1F4M A;  1YJW V;  3KG2 A;  1E1Q G;  2JJ2 G;  1R3J C;  2OCC B;  3GWO A;  4OXS A;  1YJN V;  5IY5 C;  4FMT A;  3CP1 A;  4DO2 A;  3T1C A;  2X0L A;  3F7V C;  3MHS C;  1H2G A;  1S77 D;  3K79 A;  3X2Q B;  3GB7 C;  1K92 A;  2EIK C;  3ZMZ A;  2HKO A;  4YXW G;  3ZRV A;  1YHQ V;  2QA4 V;  4MVS A;  2DQ3 A;  1QLE C;  1K7D A;  1NKD A;  3IC7 A;  3ZJZ A;  4ZKI A;  1Q81 W;  5DN6 G;  1KQS U;  1EZJ A;  4HAM A;  3VOU A;  4TSF G;  4UUJ C;  2JEU A;  2Q69 A;  5B3S B;  1BHB A;  2XOK G;  4Q20 A;  3M99 B;  3ASO C;  4U7N A;  4U7O A;  2EIN C;  3CCR V;  2D3O W;  3SYO A;  1DF5 A;  2OTL V;  2ZD9 A;  1G8M A;  1J95 A;  3I56 V;  1SZT A;  3WG7 B;  1FXV A;  2X6C A;  3HB3 B;  2K1E A;  4CZZ A;  2BOC C;  4JAU A;  2NNU A;  4X89 A;  2QM8 A;  1K33 A;  3RBZ A;  3QO8 A;  2XND G;  1Q86 W;  4JAS A;  2DQ0 A;  3E8B A;  1P4R A;  2H94 A;  3ETD A;  5H9C A;  4JGS A;  2JK5 C;  1JOY A;  2PI5 A;  4GCZ A;  5CN0 A;  3MHH C;  1HWY A;  2WWW A;  4XDK A;  4X8A A;  2DYR C;  3QO7 A;  3SPH A;  4ASU G;  1S72 V;  5B1B B;  2QTO A;  1NH2 B;  2JDI G;  3JD0 A;  2HFE C;  4G28 B;  1K3E A;  1K4D C;  3ABM C;  1RPR A;  3AG2 C;  1M56 C;  1K5Q A;  2FTK A;  3FB6 C;  3OUF A;  2CK3 G;  4KP4 A;  4QPJ A;  1R73 A;  1KP3 A;  1H8E G;  3RVY A;  1KD1 W;  3ASN C;  3LNM B;  4BIU A;  2WLL B;  1V55 C;  5EK0 A;  2DWD C;  1VQ7 V;  1OCC C;  1GM8 A;  2ZXW B;  4BIZ A;  1PD3 A;  2ITC C;  3AG3 C;  5HFM A;  4JTC B;  1K97 A;  3ETG A;  1GM9 A;  5B1A C;  4I9W A;  1VQP V;  3HPL C;  4RAI A;  5EBW C;  2EIL B;  2HVJ C;  3BEH A;  4XDJ A;  1W0K G;  2ZR2 A;  3STZ C;  1ENV A;  1XL6 A;  2GHY A;  2WLN A;  2XAJ A;  2XAQ A;  1L1F A;  1F23 A;  2A9H A;  4GT1 A;  1VQ5 V;  2HR3 A;  3FKS G;  3K03 A;  5IYB O;  1SER A;  3LDE A;  2C2A A;  1S0V A;  3ABK B;  1OCZ B;  1XL4 A;  5DM6 V;  1JQ0 A;  3CC4 V;  1PL0 A;  3P30 A;  2BOB C;  2LP7 A;  3W7U A;  3K06 A;  1QR8 A;  5LHH A;  1CPY A;  3OR7 C;  1MAB G;  1P7B A;  2DYS C;  1PNK A;  4MTX A;  2IH1 C;  4WFH A;  1K4C C;  2Q6A A;  2IH3 C;  1WLE A;  2XAS A;  1AI5 A;  2EBO A;  4UXN A;  3DGE A;  3OEH G;  2ZR3 A;  4MTO A;  1FXK B;  4QE7 A;  2WLL A;  3W7T A;  1PNL A;  2P6J A;  3ABL C;  3T4D A;  3F5W C;  4JYC A;  1IXM A;  2WLI B;  4R6Z A;  2QE7 G;  3FYE B;  2Y69 C;  1QR9 A;  1AI4 A;  4GX1 A;  4QNH B;  1G4Y B;  2LFS A;  2YSU B;  3JD1 A;  3QO5 A;  4WFG A;  2MK3 A;  1VQM V;  3CPW U;  1RM1 C;  2EIM B;  3X2Q C;  4WFE A;  2XAG A;  2A79 B;  3F7Y C;  3CCE V;  3ZRW A;  1VQ9 V;  2UXX A;  5LGT A;  2WPD G;  4FJC C;  3ZRX A;  2QEX V;  3NXS A;  1S3J A;  1Y66 A;  1NR7 A;  1YIT V;  1FFT B;  2F43 G;  4ZBM A;  1VQ8 V;  2W6J G;  3ETE A;  4LC1 A;  4L87 A;  3K0G A;  1VQK V;  5LHI A;  5B3S C;  2GSM B;  1EFR G;  3OGC C;  3QNE A;  3OEE G;  4HYO A;  1V54 C;  2Y48 A;  3OMN B;  4H33 A;  4TWK A;  1KP2 A;  5CBG A;  1VQ6 V;  1FXK A;  5L3C A;  1GTO A;  2HLD G;  2QM7 A;  4JPR A;  3WG7 C;  4MVZ A;  2KB1 A;  1QLE B;  5E1A C;  2WLI A;  2WLK A;  3G4S V;  3OMI B;  2OTJ V;  3CME V;  4UVA A;  3ZMU A;  1GO3 F;  3ZRS A;  3K04 A;  2AHY A;  2IJJ A;  2Z3Y A;  2EIJ C;  5C93 A;  5EBL C;  2X7R B;  3ZIA G;  1CP9 A;  4CBC A;  3ABU A;  3ML0 A;  3OMA B;  3SPJ A;  3CC2 V;  3ZN1 A;  1M90 W;  5LGN A;  1M1K W;  3E8H A;  3ASO B;  4E2L A;  1I5X A;  2EIN B;  1QVG U;  5CA3 A;  3CXC U;  4WCE V;  1SRY A;  5B1B C;  1YI2 V;  2YEV B;  1R6N A;  3JD4 A;  3JD2 A;  4N23 A;  1H38 A;  4UVC A;  1N8R W;  1K5S A;  1OCO B;  2JEX A;  4GX0 A;  1JJ2 U;  4FIP C;  4H37 A;  1TUE B;  4QE9 A;  2DWE C;  4MTF A;  1RPO A;  3W7W A;  2Z5U A;  4LBE C;  2EJR A;  1BHA A;  3WFV A;  1R6K A;  3R65 A;  3E89 A;  2ZXW C;  1GKF A;  2DYR B;  3FB7 C;  1ZWI C;  3E83 A;  2Q67 A;  1K8A W;  3ABM B;  3JYC A;  3OR6 C;  3AG2 B;  1M56 B;  3G6E V;  4GX2 A;  3E35 A;  3K9A A;  2PI4 A;  1BL8 A;  2EIL C;  5CBH A;  1NVP D;  3T2M A;  2DW4 A;  3D3I A;  4BW5 A;  2ATK C;  4KUM A;  4RQE A;  3ASN B;  2QKS A;  1OCR B;  3UKM A;  1Y4M A;  1YTF D;  4BAY A;  4P30 A;  3SYQ A;  1ROP A;  4UVB A;  1V55 B;  4MS2 A;  1DTO A;  5CBF A;  3CCQ V;  4MVQ A;  1AJQ A;  4MW3 A;  1M57 C;  3AG4 C;  5L3F A;  3OAA G;  1EBO A;  4FK5 C;  2JIZ G;  2ITD C;  1E79 G;  5B1A B;  2R9R B;  3P32 A;  3VBB A;  1FXK C;  3BY6 A;  5B1O A;  4MVO A;  3AG1 B;  2W6I G;  1NR1 A;  1S5H C;  3RW0 A;  3EFF K;  3FB8 C;  4LP8 A;  1BMF G;  1NBM G;  1F4N A;  2EZP A;  2OCC C;  3FB5 C;  2WAM A;  3OW2 U;  4RQF A;  3CCS V;  1K34 A;  1GM7 A;  1JX9 A;  4HZ3 A;  1GMG A;  2A0L A;  5IYC O;  4PA7 A;  3RVZ A;  2EIM C;  3E2E A;  1CEZ A;  3CYO A;  4WFA V;  3SJQ C;  5KA6 A;  2B1I A;  2DYS B;  2AHZ A;  4RUF A;  4Z1M G;  4WF9 V;  4QJF B;  4N21 A;  5H6Q A;  1UJW B;  4G27 B;  3ZMS A;  1OZ0 A;  2V7Q G;  4XBF A;  5LGU A;  3I55 V;  3SYP A;  3T4Z A;  5IDJ A;  3ABL B;  1S76 D;  1R3I C;  4PDR A;  5J9P C;  1E1R G;  3ZMV A;  5L3D A;  5LBQ A;  4P9O A;  2B5U A;  5IY5 B;  2X6A A;  2Y69 B;  5LHG A;  2M7W A;  2IU0 A;  2XAH A;  5EC1 C;  3CCJ V;  4DXW A;  1MG1 A;  3CCV V;  2HVK C;  1RM1 B;  2P90 A;  2WLM A;  1YSC A;  2Q68 A;  4J9Z B;  4GX5 A;  1W2B U;  1K73 W;  1VQL V;  4G2K A;  4X88 A;  3UM7 A;  2ZDI A;  5B1N A;  3CC7 V;  2EIK B;  1QVF U;  3ZN0 A;  3A0R A;  4UV9 A;  3ABT A;  1YIJ V;  3TCU A;  4I5S A;  1THZ A;  2JJ1 G;  3K0D A;  2XAF A;  5H6R A;  5CMU A;  2EZO A;  3OM3 B;  1ORQ C;  3JCZ A;  3OFN G;  4J9Y B;  4MVR A;  4MTG A;  5KUM A;  1Q7Y W;  1NJI W;  4PEL A;  4JF3 A;  5KA5 A;  1V54 B;  1R3K C;  4R7C A;  3JD3 A;  1DF4 A;  4JTA B;  1VQO V;  3PJS K;  2P7T C;  1KKD A;  3AEI A;  4R50 A;  1SES A;  4MW8 A;  4MVU A;  3SPG A;  4KFM A;  4QIW F;  1KEC A;  3K3W A;  2P67 A;  4XDL A;  3SYA A;  1B6Q A;  1AJP A;  1SET A;  5FL7 G;  3SYC A;  1F51 A;  1OCO C;  1FS0 G;  4QPK A;  3TET A;  3B8N A;  1AR1 B;  1W0J G;  2HJF C;  2LFR A;  2H8P C;  3LDC A;  2IU3 A;  1MSW D;  2EIJ B;  5KUK A;  1NH2 D;  4LCU C;  5EBM C;  1KC8 W;  3K08 A;  2IJI A;  3LUT B;  3LSS A;  4MT8 A;  3CMA V;  5IYD O;  1GK9 A;  3G71 V;  2IJK A;  4P2Z A;  1K9M W;  1QBZ A;  3OE7 G;  4RO2 A;  4PA9 A;  4R8C A;  4PA4 A;  5L3G A;  5HFL A;  1WPX A;  1LNQ A;  2WLJ A;  1H8H G;  3SPI A;  1VQ4 V;  4WFF A;  3H01 A;  1AJN A;  3CD6 V;  2NLJ C;  4TT3 G;  3E86 A;  4PDL A;  1OHH G;  2WSS G;  3OUS A;  1COW G;  1JPX A;  2V1D A;  1OCR C;  5BZB A;  3E8F A;  1R3L C;  3CCM V;  2HG5 C;  3ZCC A;  3ABK C;  1OCZ C;  5GW7 A;  4UV8 A;  3FYI B;  1NVP B;  3CCL V;  1M9N A;  2YEV A;  1OCC B;  4P9P A;  1FXH A;  4EKW A;  1I5Y A;  3TK1 A;  5EC2 C;  1AI7 A;  1PNM A;  1DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...