3TETA

Crystal structure of nak2k channel y66f mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tetA00
1OCZC 2A0LA 3EFFK 3HPLC 1R3IC 4ZBMA 5CBGA 2AHYA 4XDJA 4DXWA 4G28B 2EIKC 3ZJZA 3SJQC 3LNMB 3ABMC 3F5WC 2WLLB 2DWEC 2EILC 4GX0A 1XL6A 1J95A 1OCCC 3K06A 4R8CA 1K4CC 1S5HC 3ASNC 3LDEA 3LDCA 3SPIA 2X6AA 3OGCC 1OCOC 3K0GA 4HYOA 3OR6C 3T1CA 3FB5C 3JYCA 4QNHB 3E86A 3AG3C 4WFFA 3SPGA 3TCUA 1R3KC 4MVSA 4MVZA 2HVKC 2QTOA 4X88A 5EBLC 4BW5A 3F7VC 2DYRC 4LP8A 4MW8A 1XL4A 3R65A 2Q68A 3RVYA 3RW0A 4PDVA 4RUEA 4X8AA 4GX2A 3GB7C 3ABKC 5E1AC 4HZ3A 4JTAB 2EIMC 2Y69C 4I9WA 4PA9A 2BOBC 5EC2C 4R50A 2X6CA 3OR7C 2HJFC 1LNQA 3STLC 3FB6C 4PA4A 4PDLA 3ABLC 3UM7A 2R9RB 4JTCB 3OUSA 4P30A 3SYCA 1BL8A 2OCCC 3K0DA 2ZXWC 2HVJC 4PA6A 3IFXA 3OUFA 2ITDC 2H8PC 3FB8C 4MVRA 2JK5C 4QE7A 3SPCA 5IY5C 5J9PC 3SYQA 5CBHA 4P2ZA 4WFHA 3E8FA 4LBEC 3E89A 1P7BA 4XDKA 4PA7A 4EKWA 4H37A 4KFMA 2YEVA 5KUMA 2AHZA 3LDDA 2A79B 4J9ZB 4GX1A 3E8GA 5KUKA 4TWKA 5CBFA 1M57C 4LCUC 3FB7C 4WFGA 2IH1C 3T4ZA 2EINC 2Q69A 4PA3A 4P9OA 2DWDC 3WG7C 3TETA 4RAIA 2X6BA 3K04A 4MVMA 4P9PA 4UUJC 2Q6AA 2HFEC 2Q67A 2WLNA 3T2MA 3SPHA 5EK0A 4JTDB 3SYAA 3AG1C 3K03A 3LUTB 4H33A 2A9HA 2WLKA 2IH3C 4QE9A 3SPJA 2ZD9A 3PJSK 3RVZA 3UKMA 2WLJA 1KKDA 3K08A 2DYSC 2QKSA 2WLLA 3X2QC 4J9YB 3ZRSA 4WFEA 2K1EA 4MSWC 4PDMA 3STZC 1K4DC 3IGAC 4XDLA 4MS2A 5BZBA 2WLIB 4MTGA 4GX5A 3T4DA 5B1BC 3VOUA 4RUFA 3E8HA 4R6ZA 3ASOC 3SYOA 4G27B 4MTFA 3AG2C 3BEHA 4MVQA 4MVOA 4R7CA 4RO2A 4CBCA 1V54C 2ATKC 2W0FC 5EBMC 1ORQC 4MW3A 4OXSA 4PDRA 5B3SC 4MTOA 2NLJC 3E8BA 1OCRC 2P7TC 4X89A 5EC1C 3F7YC 1G4YB 3KG2A 1ZWIC 2WLHA 5EBWC 1JVMA 1R3JC 1V55C 3E83A 3SYPA 4F4LA 1M56C 5B1AC 1R3LC 2BOCC 2EIJC 2ITCC 2KB1A 2WLIA 2WLMA 3AG4C 2HG5C 4MVUA 3RBZA 1QLEC
chains in the Genus database with same CATH superfamily
1GM9A 4IYIA 3VQXA 3QO5A 1O9GA 4KHPB 4LF4B 3CSXA 4GT1A 3EVKA 4DO2A 3ETEA 3FB5C 2ZR3A 3MHHC 3N2GA 2BTQB 2ODMA 3WB2A 2QTOA 4UCUA 5FPOA 4N21A 5JVDA 2IJHA 1JJ2U 1QCEA 1X4TA 5FLXN 1BZKA 4X65B 1R6KA 1XILA 5GTHZ 4X66O 1L0LH 3OR7C 4CH4A 2LP7A 4JI1B 4I0XB 2ITDC 5JVDB 2HP8A 1P4RA 2QKCA 1VEWA 2OIGA 4EKWA 4JI6O 4KFMA 5EIBC 3ZN0A 1YDXA 4PD4F 3BA8A 4PELA 3OEHG 4O2AB 3CRAA 4FZ0A 1Y76A 1EN6A 1SQBH 3DSQA 1PL4A 3HKEB 1I5YA 2WLJA 1HW7A 2ZE6A 4NTWA 2QKSA 1XREA 2LW1A 4J10A 4WFEA 1G1XB 3RYIA 3W7UA 4CS3A 3ZCCA 1R73A 2F43G 1JX9A 3CS5A 4JI3B 1YJNV 1YXBA 1XBLA 3E35A 4R6ZA 3GWOA 4DR2B 4MVQA 4RO2A 3CCEV 4DW0A 3JD4A 1O9HA 2UUAO 2ZINA 3VBBA 1YEWA 3E8BA 5FNVA 1G4YB 2QJ1A 5JQGA 1JQ0A 1ZWIC 4B7KA 3ZMVA 4YIOA 4K8XA 2HG5C 3CRQA 4LNUB 2A0LA 4LFCO 1Y74A 2AHYA 4AHCA 1KC8W 5IJ0B 1YSCA 4UVBA 4GCZA 3OM3B 2EILC 5KAFZ 3ETDA 2E5LB 4R8CA 1KP3A 1QR8A 3OGCC 2W0XA 1W59A 4HYOA 4UCOA 1FYJA 3ASNB 1YJ9V 4E4EA 3BVOA 3F7VC 3BRCA 1YIJV 3ZHTA 4FMTA 3ABKC 2JDIG 1F4MA 3UT5A 3ASOB 3STLC 3P3NA 3CJHA 1PM9A 5JH7B 3AEIA 2VQEO 2RQ6A 4YJ2A 5CN0A 5B1OA 4FJCC 5LGNA 2JK5C 3SGIA 4ASUG 4P2ZA 1KECA 1PNMA 3ABLB 1RP3B 2VS0A 3J81N 4B3RB 4FM2A 4ICGA 3FAVB 4UFZA 1WP8A 3P32A 3IC9A 2DWDC 3M99B 5LP6A 1JFFB 1Z2GA 1XMOO 2FMLA 3K03A 1BHAA 4J42A 3KCYA 2HHHB 5LP6C 2UU9B 1AP6A 3UKMA 3JAKA 4LFAO 4YY3O 1A32A 3OW2U 1AB3A 3FYIB 2HHHO 4AILC 1S5JA 4O4IB 4Q6GA 3OMAB 4MTXA 4NVPA 4C7UA 3CWBH 1I08A 4GYCB 2WPDG 4EB6B 3I55V 5EBWC 3JASB 3FX7A 4W4LA 4PHZA 3WFVA 4OPHA 3RBZA 3CCMV 2CUGA 1OCZC 2ARHA 2F23A 1SKVA 2UUCO 3Q4HA 2EIKC 3ABMC 1AR5A 1N33B 2F4VB 1NTMH 2JJ2G 4PI2A 1OCOC 5GW7A 5CA3A 5CB4A 4JI0B 4MVSA 4K35A 4DR6O 3A0BZ 4JAAA 4JZ2A 4BIZA 3R65A 5L3GA 3ML0A 2VQFO 1XNQO 3ZMTA 3C3TA 4LH7A 4GKKB 2DOSA 2OIEA 1NR7A 4WFBV 1QLNA 4O4JA 5KHGA 5ITZA 5B3SB 2YICA 2N04A 2P5OA 4JI7B 3JD0A 5JJJB 2NNUA 3L75H 4WFAV 2JGDA 4LCUC 3I5DA 5GTIZ 3AG1B 2A7WA 5BY1A 4J7ZA 2X6BA 4MVMA 1FXKA 1M9NA 1N36O 1HWYA 3T2MA 1XI1A 4DV3O 5EK0A 3JD3A 3IAYA 4H13B 1TUEB 3LSSA 3A0HZ 3ZEDA 1JOYA 1NU1H 3S3XA 2EZOA 3OAAG 2HLDG 5B5EZ 2ZKOA 4MTFA 2JGUA 4X9QA 1XEQA 2GHYA 2W6JG 3W7TA 3A0RA 2NLJC 1Q81W 1GN4A 5KX5B 4FFBB 2EJRA 2A06H 4JPRA 4ZIBA 3E83A 1DF5A 5DN6G 2WLIA 1KMIZ 2QE7G 4XDJA 3JD2A 4G28B 4FM0A 2KG7A 4DR7O 3F5WC 2XAHA 3UO2A 1EN4A 3OD4A 1RM1C 1WPXA 2VQFB 2D2CB 1K73W 1Q7YW 1JJOA 3WB1A 1AILA 1YZBA 2PGGA 1JFFA 2HVKC 4IYHA 1K92A 4YY3B 3CC7V 2Y69B 1R6NA 2YIDA 1SA0A 2Q68A 2ZDIC 5EYPA 3K9SA 4IHJB 1QVFU 3JALB 1WLEA 4DRXB 4I9WA 4ZHQA 3B8MA 4NXMO 5DECA 3M7MX 5H9CA 4IHJA 4PA4A 4NYKA 2QWQB 4LF8O 1E79G 3CE2A 3UO3A 3FB8C 4A5UB 4YJ2B 5CBHA 2UXCO 1GKFA 4FPPA 1IURA 1XOUA 4UB6Z 3ICXA 3QG5A 1K97A 4ZHQB 4D7TA 1S76D 2OT5A 3G67A 1L1FA 2OTLV 2CH7B 5J2TA 3WG7C 1COWG 5JCOA 1RPOA 3ZHUA 2ZNJA 1Y4MA 1ZSPA 2DYSC 4UCRA 3RYFA 1XMOB 2O57A 3CCJV 1NR1A 2YI9A 4LR3A 4XDLA 2QWPB 1VIBA 3L72H 3O9OA 1M5IA 4MVOA 1AI5A 1CXZB 2QM4A 3J7AU 1Z5VA 2LW7A 1M56B 3T1HO 3H01A 3K79A 2Z3YA 4J7KA 2E76B 1VQ8V 4YJ3A 1H38A 5LA6B 4ABMA 2EIJC 3QNEA 3FKSG 2F93B 1FXKB 4W4KA 1R3IC 4BWAA 1PP9H 4JYCA 1HR0O 2QM7A 1AI7A 2H94A 2LFRA 2BTOA 1S5HC 2YIBD 4JAVA 1AROP 3OR6C 1VF5B 3RGBA 2CTRA 4LWSB 4B3MO 2EX3A 2ILMA 3GB7C 2JGDB 1SQQH 3IC7A 4E2LA 2YI8A 2X6CA 4DV7B 1NTZH 4K0KB 2CTPA 2CAZC 4I55A 4DV2O 2Q4PA 1P7BA 1H2GA 4PA7A 1I94O 4UV8A 4JYYA 3K5NA 5L3BA 3APOA 3VQWA 1PPJH 3FB7C 4JI3O 3CX5F 3ZHQA 2YDEA 3ZMSA 1VMGA 3DTUB 3O65A 4I50B 2WLNA 4JTDB 2A3QA 2XUMA 4QE9A 3SJBC 1N34B 4CH5A 4JYAB 3M8AA 1Q3EA 1KKDA 4F6RB 3CP1A 1AVMA 4LFAB 2ATKC 5EBMC 1YTFD 5BXZA 2PYLA 2P7TC 3JAKB 4TQFA 1QLEB 3F7YC 2R72A 2PI5A 4UCTA 2XASA 1F51A 1D2DA 1AI4A 3AK1A 3ETGA 1NH2D 5TISZ 1XL6A 4QIWF 5KLVH 1UFIA 4YIPA 2P67A 3LDCA 1I7FA 2K9PA 4DUZO 2HEPA 2ZCEA 4MVZA 3MDSA 1ZL8A 4IIJA 4JI8O 1P49A 4K8ZA 3S3WA 1P7GA 2QSAA 2PI4A 3U0ZA 1BSMA 4GLXA 3AG7A 3AK3A 1FFTB 3JALA 1JCHA 2GSMB 1G8MA 1GM8A 5IE9A 1URFA 3T1YB 5CMUA 5IYBO 2R9RB 1T5EA 2QWNB 1ROPA 3ABUA 4I5SA 1XQ8A 2ADPA 1GTOA 4WFHA 2FTKA 5JH7A 3ZHRA 1M57B 4H37A 3BCCH 3L73H 2AHZA 2RN9A 1N8RW 5KMGA 4TOIA 1SZTA 5HFLA 2F66C 2QWOB 4DV5B 4KL1A 4RWUA 4RAIA 1Y74B 4P9PA 2Q67A 2FYUH 3ZN1A 1H2MA 5DEDA 1K5QA 2M6YA 2OTJV 5JQGB 4DR4B 4KXRA 4J41A 4LFBO 4D6TH 3QO7A 1QQCA 4DR5B 4PDMA 3STZC 1B6QA 1WAZA 1XHZA 1XNRB 5A2QN 3K59A 4NB5A 3SYOA 4R7CA 2V7QG 1Y67A 1V54C 5LMNB 4LF6O 5IYDO 5FNVB 4NXNO 5DM6V 2PY5A 2DE0X 1EBOA 1V55C 3SYPA 2YXHA 1L0NH 5KA5A 3AG4C 4LF7O 4QPKA 4O4LA 5JCOC 1GM7A 1ZUQA 2LO1A 4X62B 2CGOA 3JYCA 3RYCA 1Y76B 1OCCB 1NJIW 2WA3A 2JS3A 4FFKA 3QF7A 4HNAB 2Q0OC 3RW0A 3BABA 4RUEA 5LBQA 1VARA 3TXSA 1L8DA 3JAWA 4BIOA 4R50A 2ZXWB 2QR4A 1DTOA 1VQLV 3G71V 1BL8A 2GTAA 3OUFA 2H8PC 1KU9A 4JI6B 1WA8B 2B1IA 3ZHVA 1MA1A 3ZRWB 1H2KA 2VRZA 2OCCB 4EEQA 1KD1W 4GX1A 2EIKB 1HP8A 3ABMB 4XBFA 4ZI7B 4AQYB 5H2FZ 2Q69A 2G38A 5LHIA 3CCQV 1E1QG 3TETA 1LUVA 1DLBA 1OCOB 2Q8VA 3A8TA 2GUZB 2R9AA 4O2BA 2WLKA 5B66Z 3RN4A 1BQZA 5D5QA 1IBLO 3K9AA 5IYCO 2YXLA 4DW1A 4AQYO 1KKCA 2YIBA 2JS5A 1IBLB 1K34A 4I7ZB 4DV5O 5B3SC 5EC1C 2Z5UA 1SQVH 4KP4A 4I4TA 3JCUZ 1S3JA 1CP9A 2XTAA 4BIUA 2KB1A 1DF4A 1N0NA 1NI8A 1SQPH 4HAMA 3DC5A 2R9IA 4NKGB 1QHTA 3T1YO 2VQEB 4DR6B 1K4CC 3CXCU 1OZ0A 4JI2O 3SPIA 2FL4A 2XAQA 5CA0B 4QNHB 3CRCA 4U7OA 3SPGA 5LOVB 1MNGA 2XAFA 1KBHA 3TK1A 3ZMUA 5EBLC 2Y0PA 4BW5A 2L6LA 1N33O 1SZXA 2P4KA 4X8AA 3U10A 5KMGB 3UT5B 4X64B 2Q7EA 2AZ2A 1JPXA 3OE7G 1SRYA 3UM7A 1VP7A 1US6A 4JTCB 4RQEA 1NKDA 5IY5C 3SYQA 1MABG 2NR5A 5LOVA 4JGSA 3ZX6A 5A9GA 5B1AB 2DJVA 4TWKA 1OV9A 5IJ0A 4UUJC 1VQPV 3SYAA 1IZ3A 1MSWD 3AK2A 1WB7A 3RVZA 5HFMA 5CA1B 4YHHB 4LF9O 3H1HH 1V9PA 1IXBA 3X2QC 3D3IA 4MSWC 2LFSA 1MMMA 4O4HA 1BHBA 5EZYA 3FYEB 5KA6A 2ZDIA 3AG2C 3BEHA 1GN3A 1CEZA 3JSLA 4I4TB 3SJCC 5BMVA 1NVPD 4MTOA 1N36B 4X89A 2Y4UA 2LGWA 1BMFG 3KG2A 3VQVA 1JVMA 1R3JC 4KHPO 3W7XA 2ITCC 1TA8A 3J80N 3HR0A 4PV1B 4J80A 3WG7B 3ZMZA 4DV1B 4GX0A 4LF8B 1M4UA 3ASNC 3D3QA 3T1CA 2RCVA 3ZRWA 3D8CA 4X65O 1YVWA 1YJWV 3PN1A 2YUAA 1XMQB 2DYRC 4MW8A 1GN2A 2KQXA 3HKCA 4ZI7A 4FLYA 1TAEA 2ADQB 4DV3B 4L87A 1GRJA 1JA8A 1ZLZA 2N74A 3ABLC 1RFYA 1XDCA 4U3JA 1H2LA 5K1PA 3BFRA 2EIJB 4D7SA 4JI4B 3KZIZ 4DR1B 3CCSV 2ZIOA 2EINC 1GMGA 1EFRG 1H2SB 4FK5C 4O4LB 4CZZA 4LWSA 2QA4V 1MZEA 1JR9A 2ZR2A 4DV7O 3SPHA 4PI0A 1Q6UA 2Q73A 1PNLA 1SC5B 2IJKA 2QDOA 1BQ0A 3OEEG 3PJSK 1FS0G 1LR1A 5BMVB 2JEXA 1K7DA 2WWWA 2JVDA 3K58A 1FXVA 2F4VO 4YJ3B 3DGEA 1N32B 2CGNA 5H5NA 2UXDO 1Q82W 1OCZB 2IM9A 2Q0AA 2BOCC 3R66A 1K8AW 3SJQC 4B3TB 1K3EA 3ABTA 4FLVA 2C2AA 1OHHG 3LDEA 4QPJA 2ZM6O 1VQ6V 4PJ0Z 1PL0A 3N2KA 3K0GA 2IU0A 2XNDG 3AG3C 4WFFA 2OCHA 5IJ9B 3G4SV 1XL4A 2UUBB 3RVYA 1MSDA 1P84F 2P90A 4JI8B 3CXHF 4X1YA 3CB2A 4B3MB 4DUYO 1Q6IA 1YHQV 3OUSA 4CH3A 1Q90D 4JV5O 3ZHSA 2IJIA 1WB8A 3QVNA 4I9QA 1TGOA 1SESA 1Q43A 1K33A 4DRXA 5JJNB 1AR1B 1TUBB 1MZFA 1PD3A 4LH6A 1SA0B 3C90A 4YHHO 4GUNA 1BCCH 2IH3C 1FAFA 2PZSA 1TVKA 2F95B 1GH6A 2B1GA 2GTSA 3ZRSA 1NH2B 1NZ6A 2B5UA 2GBOA 2UXNA 2WLIB 2E5LO 3RWRD 4JYBA 4CBCA 3E22A 1W0JG 1ORQC 4OXSA 4FFBA 4JASA 3ETQA 4UV9A 4GKJO 5C8YB 4QJFB 2ZE7A 4LF6B 3OTFA 5H6QA 4JI7O 2WLMA 3ZRVA 3NXSA 2YC0A 5CBGA 5L3DA 5BR8B 1XNRO 4TV8B 4F6RA 4JI1O 3BA9A 2FB5A 1KP2A 3JATA 3EXAA 1FPOA 5L3CA 3TCUA 4JYAO 1BS3A 4TUYA 4CS4A 2AW9A 4I50A 5J2UA 1WA8A 4DK1A 1H8HG 1D5AA 1K5SA 4TQDA 2M7WA 3BAAA 3D36A 2ZT9B 1NS1A 1HDJA 3K57A 2VWKA 2BOBC 3KCXA 3L70H 2KKWA 4DR7B 3ABKB 4H44B 2AXTZ 4DR4O 2Y4TA 4FVMA 4DV0O 4HNAA 2CDYA 4O4JB 4I55B 4QE7A 4LF4O 3CMEV 4DV4O 1OCRB 1V55B 4CC5A 4DR1O 4LBEC 1YI2V 1EZJA 2EBOA 4UVCA 1M93A 3AG4B 5KUMA 2YEVA 2PF4E 3LDDA 4FIPC 2QWRB 5KAIZ 2D3OW 4B3SO 4OX9O 1QR9A 3SR2C 1F4NA 3OFNG 4J7JA 4NXNB 3BY6A 1VQKV 5LMNO 4BW9A 2HFEC 4X66B 4TUYB 2R70A 1AJNA 5LA6A 4H33A 3CCUV 3SPJA 3K08A 2N05A 5LMUB 4TV8A 3APQA 5KHKA 2DN9A 4UXNA 4HBNA 1R6TA 3MAQA 3DC6A 1IX9A 4MTGA 3VOUA 4GX5A 1AP5A 1GAXA 4ZOLA 5L3EA 3K3WA 5LXTB 1LUWA 5C8YA 4MW3A 3ZBHA 1WNSA 2Y0IA 3E22B 3HKBB 2X0LA 1VQNV 4F4LA 1MOFA 3B77A 2YXYA 4DXWA 2YS8A 2WLLB 2Q7HA 1AI6A 3P3PA 3K06A 4UCSA 2BSKA 1VQ9V 1WJZA 5F2VO 3CYOA 3JD1A 2XT9A 1N4CA 1U97A 2QM8A 3OT7A 3E86A 3RYHA 4X64O 4IT5A 1BE3H 4LF5B 3CCRV 2UUAB 3CC4V 4LP8A 4DR5O 4J11A 3VQYA 2E75B 4GKKO 5B1NA 2ZE8A 3D36C 1TUBA 5GONA 4EFBA 3B09A 3RT3C 2EIMC 4DUZB 2HJFC 1NQTA 4X1IB 1Q8IA 5B1BB 1SQFA 5EYPB 4PDLA 2H3OA 2HR3A 5J9PC 1ZL8B 4IIJB 3E2EA 1Q6HA 3N27A 5E79Z 3E8FA 1VQMV 4GKJB 4JI5O 5LGTA 1RSOA 2F1MA 4Z1VA 4WF9V 3BPZA 3CPWU 4UCVA 1HNXO 5BR8O 4JV5B 4YXWG 2KG7B 4P9OA 2P06A 5K1XA 3H1LH 1SETA 2CTWA 2RNBA 1WP7A 2FKXA 2WAMA 1IDSA 2BCCH 3AG1C 3LUTB 1IXMA 3CCVV 1GN6A 3WU2Z 1VQOV 1XUQA 3NR7A 3UCSC 1HNZO 4BR6A 2UUBO 1HNWO 1SF9A 2WLLA 2QTSA 2JJ1G 3W7WA 1B3QA 1K4DC 4ZOLB 3ZIAG 3K5MA 1IBMB 4LNUA 1I0HA 4WCEV 2VWJA 5LMUO 1PNKA 3CRRA 2B9ZA 4X62O 1NVPB 1H2NA 3ZRXA 2W0FC 3H1KH 4X1KA 5IY5B 1AJQA 2CK3G 5KX5A 3CEIA 3K5LA 2PUSA 5LXTA 3QO8A 5B1AC 1Q86W 2IBZH 1I94B 4MVUA 3UQ8A 3EFFK 3CHXA 2DW4A 4K3AA 5LL6Y 1IBMO 2PYJA 3FD9A 4L8JA 1RPRA 3G80A 1R3KC 2UXXA 5ITZB 1S77D 4X88A 3X2QB 5KHIA 3G6BA 4O2AA 4KUMA 1WN7A 1NT2B 5IYZA 5E1AC 4HZ3A 4JTAB 3H1IH 2Y69C 2LJ2A 1BGYH 1AR4A 4JF3A 2XOKG 5IYZB 2EZPA 1XHXA 1THZA 4LC1A 4LF9B 2GDSA 2UXCB 3I56V 5J2UB 2UXDB 2MK3A 2XHBA 4CS2A 2GV9A 1Y6XA 2BE3A 2Y48A 1QNMA 5KUKA 1YITV 2IJJA 4TT3G 1WPBA 4WFGA 3GVMA 4PA3A 3Q4HB 1VQ4V 1XNQB 2EILB 3BHPA 2BTQA 2IU3A 1D5NA 3N2GB 5CB4B 4K0KO 3B8NA 1J5EO 3ZS8C 2JIZG 2ZD9A 2DYRB 3QTCA 3JSNA 4X1KB 2OWOA 5C93A 3CMAV 4O4IA 4LFBB 4FM1A 1E1RG 1YCIA 2DYSB 3IGAC 5BZBA 1R1BA 1OJHA 4MS2A 4Z2WA 1H8EG 4G2KA 3E8HA 3ASOC 4G27B 3LSQA 2QEXV 4EB6A 4MT8A 3RYFB 2KSDA 2E74B 4IL6Z 5LHGA 1EM1A 4F6EA 2AZ0A 1M56C 1R3LC 3CCLV 2WA4A 4O4HB 2QKAA 2CH7A 5J2TB 1I5XA 1SQXH 1Q5OA 3B4SA 5CA1A 1FXKC 1J95A 1EN5A 1OCCC 1IBKB 1RSOB 4EFEA 1FJGB 1YF2A 2JRIA 4NTYA 3GWKC 5LP6B 5FPRA 3CJHB 3L74H 3OGIB 4X1IA 5IWAB 4X1YB 4PA9A 1JMKC 2QGNA 1LNQA 2ZIMA 4NR1A 2JEUA 3FB6C 5GONB 1U96A 1XMQO 3B2EE 1VF7A 1SERA 2OCCC 1FXHA 4H0LB 3IFXA 1S5LZ 4MVRA 1ZTEA 3SPCA 2ZM6B 3RYHB 3G6EV 3E89A 2ZE5A 3N2KB 4FLZA 2A79B 2BSKB 3E8GA 1VQ5V 4Q20A 4DV2B 4ZKIA 5KHJA 1VF6C 3OTOO 3AG3B 3TGUH 1HNZB 1DGSA 2XAGA 1KQSU 4DV0B 3TXQA 3HKBA 1AJPA 2UXBO 4DR2O 1QU7A 4DR3B 4IGGA 2UXBB 4CH6A 2PTMA 2L35A 3CD6V 1MG1A 2DMXA 3T4DA 3CRMA 1CPYA 1NBMG 4DV6O 4FLWA 3RYIB 1M1KW 3LNNA 4JI0O 1PV0A 1KB9F 1Y66A 4OPAA 1HR0B 4FLUA 3THOA 2X7RB 3HKDA 2XAJA 2WLHA 3MD0A 1S72V 2RDCA 1Z5WA 4JZGA 1QLEC 4GZRB 4ZBMA 4RQFA 2W6IG 3ZJZA 3LNMB 2DWEC 1K9MW 3OMIB 5D5PA 1F7YA 2ZNIA 2X6AA 2YEVB 4O2BB 3KKYA 3FFQA 4I0XA 3HB3B 4PDVA 5LGUA 4GX2A 1KUQA 1IVSA 5IDJA 1FFXA 3IJ4A 3H9VA 5EC2C 4QGPA 5EIBD 3LSUA 2CTQA 4U3JB 3DXRB 2P4VA 4RUFA 3K0DA 4PA6A 2LGQA 2Q7GA 3DXRA 1HNXB 4XDKA 1YTFB 3WB0A 3JATB 3JAWB 4J9ZB 4JI5B 1UPGA 2Z0AA 1FFXB 4B08A 1VF6A 5CBFA 1M57C 1KYOF 3HKCB 4UB8Z 2V4DA 1W0KG 3EHBB 3RYCB 1RM1B 3JASA 4Z1MG 5KHHA 1GK9A 3A2FA 3SDLA 1F23A 4J9YB 4B3TO 3AG2B 1N34O 4N23A 1HNWB 2UU9O 3OMNB 4TV9A 4UVAA 1J5EB 3B40A 4B3SB 4OX9B 1BT8A 5AG2A 2NN4A 5LHHA 3H1JH 2WSSG 3HKDB 1GO3F 4X20A 1OCRC 3F5TA 1EZVH 1TVKB 5FL7G 1S0VA 1V54B 4LF7B 3CC2V 1N32O 1PKXA 2MW2B 1N0JA 1IBKO 5EZYB 2HKOA 1QBZA 3HPLC 2EULA 4DYLA 4U7NA 4FLXA 4OGQB 4DUYB 3FAVA 4B7EA 2RJZA 1B06A 3K5OA 1DK1A 5IWAO 5LYJB 1FKAO 2YSUB 5H6RA 1SS3A 1FJGO 1X59A 1QVGU 4LF5O 1VQ7V 5IT9N 3JARA 2CE4A 3C3SA 3TJTA 1G6UA 4WBNB 2Q9LA 4TSFG 4P30A 2YIAA 3SYCA 2ZXWC 2HVJC 5IJ9A 3L9DA 1NTKH 4JI2B 5LYJA 2P22C 2LQTA 4WBNA 3W7SA 5L3FA 3P30A 2HJDA 1ENVA 2EINB 1FD9A 2V1DA 3JARB 2P6JA 4U3FH 1M90W 2OYQA 4B3RO 4DV4B 2IH1C 3T4ZA 4NTXA 3T1HB 2AGAA 4CC6A 3K04A 3RFRA 4NXMB 2Q6AA 1W2BU 2ETNA 4BAYA 2ZQMA 4AI8A 1SQGA 4FZ1A 2IW5A 2A9HA 5CA0A 3SJAC 3L71H 1UJWB 3JAMN 4JAUA 5JWPA 2Q5ZA 4DV6B 3OTOB 5JJEB 2EIMB 2K1EA 4DV1O 2EJ7A 3U11A 1ZX3A 2RMKB 5B1BC 4TV9B 2E3CA 4DR3O 4DK0A 2DQ0A 4PDRA 1ZAUA 4FLTA 4X20B 2UUCB 3HKEA 2DQ3A 2GUZA 4LFCB 3MHSC 1B04A 4JI4O 3JCZA
chains in the Genus database with same CATH topology
3EFFK 1R3IC 1GM9A 2DW4A 3WG7B 3ZMZA 4JYCA 2QM7A 3QO5A 1AI7A 4GX0A 4GT1A 2H94A 2LFRA 1S5HC 3ASNC 1RPRA 4JAVA 4DO2A 3T1CA 1AROP 3OR6C 3ETEA 3FB5C 2ZR3A 3ZRWA 3MHHC 1R3KC 2UXXA 1YJWV 1S77D 2QTOA 4X88A 4N21A 3X2QB 2IJHA 1JJ2U 1QCEA 2DYRC 4MW8A 4KUMA 3GB7C 5E1AC 4HZ3A 4JTAB 3IC7A 1R6KA 2Y69C 4L87A 4E2LA 2X6CA 3OR7C 4JF3A 2XOKG 2LP7A 2EZPA 3ABLC 1THZA 4LC1A 3I56V 2ITDC 1P4RA 2EIJB 1P7BA 2MK3A 4EKWA 1H2GA 4PA7A 4KFMA 2Y48A 4UV8A 5L3BA 3CCSV 5KUKA 1YITV 2IJJA 3ZN0A 4TT3G 3FB7C 4WFGA 2EINC 4PELA 3OEHG 4PA3A 3ZMSA 1GMGA 1EFRG 3DTUB 1VQ4V 4FK5C 4CZZA 2EILB 2QA4V 2WLNA 2ZR2A 2IU3A 3SPHA 4JTDB 3B8NA 1PNLA 2IJKA 4QE9A 3OEEG 2JIZG 1I5YA 2DYRB 2ZD9A 3PJSK 2WLJA 1FS0G 1KKDA 2QKSA 2JEXA 1K7DA 2WWWA 5C93A 4WFEA 3CP1A 3W7UA 3CMAV 3ZCCA 1R73A 1E1RG 1FXVA 2DYSB 1JX9A 2F43G 3IGAC 4MS2A 5BZBA 1H8EG 1YJNV 4G2KA 3E35A 3E8HA 3ASOC 3GWOA 4G27B 4R6ZA 4MVQA 4RO2A 3CCEV 3DGEA 2ATKC 5EBMC 3LSQA 3JD4A 1YTFD 2QEXV 3VBBA 4MT8A 3E8BA 2P7TC 1QLEB 3F7YC 1G4YB 5LHGA 1Q82W 1JQ0A 1OCZB 1ZWIC 2PI5A 3ZMVA 2XASA 1F51A 1M56C 1R3LC 2BOCC 1AI4A 3CCLV 2HG5C 3ETGA 1NH2D 1K8AW 2A0LA 2AHYA 1KC8W 1I5XA 1YSCA 3SJQC 4UVBA 4GCZA 3OM3B 2EILC 1K3EA 3ABTA 1XL6A 1FXKC 1J95A 1OCCC 2C2AA 3ETDA 4QIWF 4R8CA 1KP3A 1OHHG 1QR8A 2P67A 3LDEA 4QPJA 3LDCA 1VQ6V 1PL0A 3OGCC 3K0GA 4HYOA 2IU0A 2XNDG 3AG3C 4WFFA 3ASNB 4MVZA 1YJ9V 3G4SV 3F7VC 1YIJV 1XL4A 4FMTA 3RVYA 2PI4A 3ABKC 2JDIG 1F4MA 3ASOB 4PA9A 1FFTB 2P90A 1JCHA 1LNQA 2GSMB 3STLC 2JEUA 3FB6C 1G8MA 1GM8A 5CMUA 3AEIA 5IYBO 2R9RB 1YHQV 3OUSA 1SERA 5CN0A 2OCCC 5B1OA 1FXHA 1ROPA 3IFXA 3ABUA 4FJCC 4MVRA 3SPCA 5LGNA 2JK5C 4I5SA 4ASUG 1GTOA 4P2ZA 4WFHA 3G6EV 3E89A 3ABLB 1KECA 1PNMA 2FTKA 2IJIA 1M57B 4H37A 2AHZA 1N8RW 1SESA 1K33A 2A79B 3E8GA 1AR1B 1SZTA 1VQ5V 5HFLA 3P32A 1PD3A 4Q20A 4ZKIA 2DWDC 3M99B 4RAIA 4P9PA 2Q67A 3AG3B 2XAGA 3ZN1A 3K03A 1KQSU 1BHAA 2IH3C 1K5QA 2OTJV 1AJPA 3UKMA 2B1GA 3OW2U 3ZRSA 3QO7A 3FYIB 4PDMA 3STZC 1B6QA 3CD6V 1NH2B 1MG1A 2B5UA 2UXNA 2WLIB 3T4DA 3SYOA 1CPYA 4JYBA 4R7CA 1NBMG 2V7QG 1M1KW 4CBCA 1V54C 1W0JG 3OMAB 4MTXA 1ORQC 4OXSA 1Y66A 4JASA 5IYDO 4UV9A 5DM6V 2WPDG 2X7RB 4QJFB 3I55V 2XAJA 2WLHA 3MD0A 5EBWC 1EBOA 1V55C 3SYPA 5H6QA 1S72V 5KA5A 3WFVA 2WLMA 3AG4C 3RBZA 4QPKA 1QLEC 3CCMV 3ZRVA 1OCZC 3NXSA 4ZBMA 4RQFA 5CBGA 2W6IG 5L3DA 2EIKC 3ZJZA 1GM7A 3LNMB 3ABMC 2DWEC 1K9MW 3OMIB 1KP2A 2JJ2G 2X6AA 1OCOC 5GW7A 2YEVB 5CA3A 5L3CA 3JYCA 3TCUA 1OCCB 1NJIW 4MVSA 1H8HG 1K5SA 3R65A 4BIZA 5L3GA 3RW0A 2M7WA 3HB3B 4PDVA 3ML0A 4GX2A 4RUEA 5LBQA 5LGUA 3D36A 5IDJA 3ZMTA 2BOBC 5EC2C 4R50A 2ZXWB 1DTOA 3ABKB 1VQLV 1NR7A 3G71V 1BL8A 3K0DA 4RUFA 4WFBV 4PA6A 1QLNA 3OUFA 2H8PC 4QE7A 2B1IA 5B3SB 3CMEV 1OCRB 1V55B 4LBEC 1YI2V 1EZJA 2EBOA 4UVCA 3ZRWB 4XDKA 3AG4B 1YTFB 5KUMA 2OCCB 2YEVA 3JD0A 3LDDA 4FIPC 1KD1W 4J9ZB 4GX1A 2EIKB 2D3OW 2NNUA 3ABMB 5CBFA 4WFAV 1M57C 4XBFA 1QR9A 4LCUC 1F4NA 3OFNG 2Q69A 3AG1B 5LHIA 3CCQV 3BY6A 1E1QG 3TETA 1VQKV 2X6BA 1W0KG 4MVMA 1FXKA 1M9NA 1DLBA 1OCOB 2HFEC 1HWYA 3EHBB 3T2MA 1AJNA 5EK0A 3JD3A 1RM1B 1TUEB 4H33A 3CCUV 4Z1MG 2WLKA 3LSSA 3SPJA 1GK9A 1JOYA 3K08A 1F23A 4J9YB 4UXNA 3AG2B 4N23A 3K9AA 5IYCO 3OMNB 4UVAA 4MTGA 3VOUA 4GX5A 2EZOA 3OAAG 2HLDG 5LHHA 5L3EA 3K3WA 4MTFA 1K34A 2WSSG 1GO3F 2GHYA 2W6JG 4MW3A 5B3SC 3A0RA 3W7TA 2NLJC 1Q81W 1OCRC 5EC1C 2Z5UA 5FL7G 2EJRA 4KP4A 1S0VA 4JPRA 1V54B 1S3JA 2X0LA 3CC2V 1VQNV 1CP9A 3E83A 1PKXA 4F4LA 4BIUA 1DF5A 3B77A 1MOFA 1DF4A 2KB1A 2WLIA 5DN6G 4HAMA 2HKOA 2QE7G 1QBZA 3HPLC 2R9IA 4XDJA 4U7NA 3JD2A 4G28B 4DXWA 3F5WC 2WLLB 1AI6A 2XAHA 3K06A 1RM1C 1K4CC 1WPXA 3CXCU 1VQ9V 1OZ0A 3SPIA 1K73W 3CYOA 3JD1A 2XAQA 2QM8A 1Q7YW 4QNHB 4U7OA 3E86A 3SPGA 2XAFA 3TK1A 2HVKC 3ZMUA 3CCRV 1K92A 2YSUB 5EBLC 2Y69B 3CC7V 1R6NA 4BW5A 3CC4V 4LP8A 5H6RA 2Q68A 2ZDIC 4X8AA 5B1NA 1QVFU 1QVGU 1WLEA 2EIMC 4I9WA 1VQ7V 3B8MA 1JPXA 2HJFC 3OE7G 1NQTA 5H9CA 5B1BB 4PA4A 4PDLA 1SRYA 3UM7A 4TSFG 2HR3A 4JTCB 4P30A 1E79G 3SYCA 2ZXWC 2HVJC 5J9PC 4RQEA 3FB8C 3E2EA 1NKDA 5IY5C 3SYQA 5CBHA 1MABG 3E8FA 1VQMV 4JGSA 3W7SA 1GKFA 5L3FA 3P30A 5LGTA 4FPPA 1ENVA 2EINB 2V1DA 4WF9V 2P6JA 1K97A 5B1AB 1M90W 3CPWU 4TWKA 2IH1C 3T4ZA 1S76D 2OT5A 4YXWG 1L1FA 2OTLV 4P9OA 3WG7C 4UUJC 3K04A 1VQPV 1SETA 2Q6AA 1W2BU 4BAYA 1COWG 2ZQMA 2WAMA 2IW5A 3SYAA 3AG1C 1RPOA 3LUTB 1IXMA 2A9HA 3CCVV 1UJWB 1VQOV 4JAUA 1MSWD 1Y4MA 3RVZA 5HFMA 2DYSC 2WLLA 3X2QC 3CCJV 3D3IA 1NR1A 2EIMB 2K1EA 4MSWC 2JJ1G 3W7WA 1K4DC 2LFSA 3ZIAG 1BHBA 4XDLA 3FYEB 4WCEV 5KA6A 5B1BC 1PNKA 1NVPB 2ZDIA 3AG2C 1AI5A 3BEHA 4MVOA 3ZRXA 1CEZA 2W0FC 2DQ0A 4PDRA 1NVPD 4MTOA 5IY5B 1AJQA 1M56B 2CK3G 3H01A 4X89A 3K79A 2Z3YA 1BMFG 3KG2A 1VQ8V 2DQ3A 1JVMA 1R3JC 3QO8A 1H38A 5B1AC 3W7XA 2EIJC 2ITCC 3MHSC 3FKSG 3QNEA 1Q86W 4MVUA 3JCZA 1FXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ C;  2A0L A;  3EFF K;  3HPL C;  1R3I C;  4ZBM A;  5CBG A;  2AHY A;  4XDJ A;  4DXW A;  4G28 B;  2EIK C;  3ZJZ A;  3SJQ C;  3LNM B;  3ABM C;  3F5W C;  2WLL B;  2DWE C;  2EIL C;  4GX0 A;  1XL6 A;  1J95 A;  1OCC C;  3K06 A;  4R8C A;  1K4C C;  1S5H C;  3ASN C;  3LDE A;  3LDC A;  3SPI A;  2X6A A;  3OGC C;  1OCO C;  3K0G A;  4HYO A;  3OR6 C;  3T1C A;  3FB5 C;  3JYC A;  4QNH B;  3E86 A;  3AG3 C;  4WFF A;  3SPG A;  3TCU A;  1R3K C;  4MVS A;  4MVZ A;  2HVK C;  2QTO A;  4X88 A;  5EBL C;  4BW5 A;  3F7V C;  2DYR C;  4LP8 A;  4MW8 A;  1XL4 A;  3R65 A;  2Q68 A;  3RVY A;  3RW0 A;  4PDV A;  4RUE A;  4X8A A;  4GX2 A;  3GB7 C;  3ABK C;  5E1A C;  4HZ3 A;  4JTA B;  2EIM C;  2Y69 C;  4I9W A;  4PA9 A;  2BOB C;  5EC2 C;  4R50 A;  2X6C A;  3OR7 C;  2HJF C;  1LNQ A;  3STL C;  3FB6 C;  4PA4 A;  4PDL A;  3ABL C;  3UM7 A;  2R9R B;  4JTC B;  3OUS A;  4P30 A;  3SYC A;  1BL8 A;  2OCC C;  3K0D A;  2ZXW C;  2HVJ C;  4PA6 A;  3IFX A;  3OUF A;  2ITD C;  2H8P C;  3FB8 C;  4MVR A;  2JK5 C;  4QE7 A;  3SPC A;  5IY5 C;  5J9P C;  3SYQ A;  5CBH A;  4P2Z A;  4WFH A;  3E8F A;  4LBE C;  3E89 A;  1P7B A;  4XDK A;  4PA7 A;  4EKW A;  4H37 A;  4KFM A;  2YEV A;  5KUM A;  2AHZ A;  3LDD A;  2A79 B;  4J9Z B;  4GX1 A;  3E8G A;  5KUK A;  4TWK A;  5CBF A;  1M57 C;  4LCU C;  3FB7 C;  4WFG A;  2IH1 C;  3T4Z A;  2EIN C;  2Q69 A;  4PA3 A;  4P9O A;  2DWD C;  3WG7 C;  3TET A;  4RAI A;  2X6B A;  3K04 A;  4MVM A;  4P9P A;  4UUJ C;  2Q6A A;  2HFE C;  2Q67 A;  2WLN A;  3T2M A;  3SPH A;  5EK0 A;  4JTD B;  3SYA A;  3AG1 C;  3K03 A;  3LUT B;  4H33 A;  2A9H A;  2WLK A;  2IH3 C;  4QE9 A;  3SPJ A;  2ZD9 A;  3PJS K;  3RVZ A;  3UKM A;  2WLJ A;  1KKD A;  3K08 A;  2DYS C;  2QKS A;  2WLL A;  3X2Q C;  4J9Y B;  3ZRS A;  4WFE A;  2K1E A;  4MSW C;  4PDM A;  3STZ C;  1K4D C;  3IGA C;  4XDL A;  4MS2 A;  5BZB A;  2WLI B;  4MTG A;  4GX5 A;  3T4D A;  5B1B C;  3VOU A;  4RUF A;  3E8H A;  4R6Z A;  3ASO C;  3SYO A;  4G27 B;  4MTF A;  3AG2 C;  3BEH A;  4MVQ A;  4MVO A;  4R7C A;  4RO2 A;  4CBC A;  1V54 C;  2ATK C;  2W0F C;  5EBM C;  1ORQ C;  4MW3 A;  4OXS A;  4PDR A;  5B3S C;  4MTO A;  2NLJ C;  3E8B A;  1OCR C;  2P7T C;  4X89 A;  5EC1 C;  3F7Y C;  1G4Y B;  3KG2 A;  1ZWI C;  2WLH A;  5EBW C;  1JVM A;  1R3J C;  1V55 C;  3E83 A;  3SYP A;  4F4L A;  1M56 C;  5B1A C;  1R3L C;  2BOC C;  2EIJ C;  2ITC C;  2KB1 A;  2WLI A;  2WLM A;  3AG4 C;  2HG5 C;  4MVU A;  3RBZ A;  1QLE C; 
#chains in the Genus database with same CATH topology
 1GM9 A;  4IYI A;  3VQX A;  3QO5 A;  1O9G A;  4KHP B;  4LF4 B;  3CSX A;  4GT1 A;  3EVK A;  4DO2 A;  3ETE A;  3FB5 C;  2ZR3 A;  3MHH C;  3N2G A;  2BTQ B;  2ODM A;  3WB2 A;  2QTO A;  4UCU A;  5FPO A;  4N21 A;  5JVD A;  2IJH A;  1JJ2 U;  1QCE A;  1X4T A;  5FLX N;  1BZK A;  4X65 B;  1R6K A;  1XIL A;  5GTH Z;  4X66 O;  1L0L H;  3OR7 C;  4CH4 A;  2LP7 A;  4JI1 B;  4I0X B;  2ITD C;  5JVD B;  2HP8 A;  1P4R A;  2QKC A;  1VEW A;  2OIG A;  4EKW A;  4JI6 O;  4KFM A;  5EIB C;  3ZN0 A;  1YDX A;  4PD4 F;  3BA8 A;  4PEL A;  3OEH G;  4O2A B;  3CRA A;  4FZ0 A;  1Y76 A;  1EN6 A;  1SQB H;  3DSQ A;  1PL4 A;  3HKE B;  1I5Y A;  2WLJ A;  1HW7 A;  2ZE6 A;  4NTW A;  2QKS A;  1XRE A;  2LW1 A;  4J10 A;  4WFE A;  1G1X B;  3RYI A;  3W7U A;  4CS3 A;  3ZCC A;  1R73 A;  2F43 G;  1JX9 A;  3CS5 A;  4JI3 B;  1YJN V;  1YXB A;  1XBL A;  3E35 A;  4R6Z A;  3GWO A;  4DR2 B;  4MVQ A;  4RO2 A;  3CCE V;  4DW0 A;  3JD4 A;  1O9H A;  2UUA O;  2ZIN A;  3VBB A;  1YEW A;  3E8B A;  5FNV A;  1G4Y B;  2QJ1 A;  5JQG A;  1JQ0 A;  1ZWI C;  4B7K A;  3ZMV A;  4YIO A;  4K8X A;  2HG5 C;  3CRQ A;  4LNU B;  2A0L A;  4LFC O;  1Y74 A;  2AHY A;  4AHC A;  1KC8 W;  5IJ0 B;  1YSC A;  4UVB A;  4GCZ A;  3OM3 B;  2EIL C;  5KAF Z;  3ETD A;  2E5L B;  4R8C A;  1KP3 A;  1QR8 A;  3OGC C;  2W0X A;  1W59 A;  4HYO A;  4UCO A;  1FYJ A;  3ASN B;  1YJ9 V;  4E4E A;  3BVO A;  3F7V C;  3BRC A;  1YIJ V;  3ZHT A;  4FMT A;  3ABK C;  2JDI G;  1F4M A;  3UT5 A;  3ASO B;  3STL C;  3P3N A;  3CJH A;  1PM9 A;  5JH7 B;  3AEI A;  2VQE O;  2RQ6 A;  4YJ2 A;  5CN0 A;  5B1O A;  4FJC C;  5LGN A;  2JK5 C;  3SGI A;  4ASU G;  4P2Z A;  1KEC A;  1PNM A;  3ABL B;  1RP3 B;  2VS0 A;  3J81 N;  4B3R B;  4FM2 A;  4ICG A;  3FAV B;  4UFZ A;  1WP8 A;  3P32 A;  3IC9 A;  2DWD C;  3M99 B;  5LP6 A;  1JFF B;  1Z2G A;  1XMO O;  2FML A;  3K03 A;  1BHA A;  4J42 A;  3KCY A;  2HHH B;  5LP6 C;  2UU9 B;  1AP6 A;  3UKM A;  3JAK A;  4LFA O;  4YY3 O;  1A32 A;  3OW2 U;  1AB3 A;  3FYI B;  2HHH O;  4AIL C;  1S5J A;  4O4I B;  4Q6G A;  3OMA B;  4MTX A;  4NVP A;  4C7U A;  3CWB H;  1I08 A;  4GYC B;  2WPD G;  4EB6 B;  3I55 V;  5EBW C;  3JAS B;  3FX7 A;  4W4L A;  4PHZ A;  3WFV A;  4OPH A;  3RBZ A;  3CCM V;  2CUG A;  1OCZ C;  2ARH A;  2F23 A;  1SKV A;  2UUC O;  3Q4H A;  2EIK C;  3ABM C;  1AR5 A;  1N33 B;  2F4V B;  1NTM H;  2JJ2 G;  4PI2 A;  1OCO C;  5GW7 A;  5CA3 A;  5CB4 A;  4JI0 B;  4MVS A;  4K35 A;  4DR6 O;  3A0B Z;  4JAA A;  4JZ2 A;  4BIZ A;  3R65 A;  5L3G A;  3ML0 A;  2VQF O;  1XNQ O;  3ZMT A;  3C3T A;  4LH7 A;  4GKK B;  2DOS A;  2OIE A;  1NR7 A;  4WFB V;  1QLN A;  4O4J A;  5KHG A;  5ITZ A;  5B3S B;  2YIC A;  2N04 A;  2P5O A;  4JI7 B;  3JD0 A;  5JJJ B;  2NNU A;  3L75 H;  4WFA V;  2JGD A;  4LCU C;  3I5D A;  5GTI Z;  3AG1 B;  2A7W A;  5BY1 A;  4J7Z A;  2X6B A;  4MVM A;  1FXK A;  1M9N A;  1N36 O;  1HWY A;  3T2M A;  1XI1 A;  4DV3 O;  5EK0 A;  3JD3 A;  3IAY A;  4H13 B;  1TUE B;  3LSS A;  3A0H Z;  3ZED A;  1JOY A;  1NU1 H;  3S3X A;  2EZO A;  3OAA G;  2HLD G;  5B5E Z;  2ZKO A;  4MTF A;  2JGU A;  4X9Q A;  1XEQ A;  2GHY A;  2W6J G;  3W7T A;  3A0R A;  2NLJ C;  1Q81 W;  1GN4 A;  5KX5 B;  4FFB B;  2EJR A;  2A06 H;  4JPR A;  4ZIB A;  3E83 A;  1DF5 A;  5DN6 G;  2WLI A;  1KMI Z;  2QE7 G;  4XDJ A;  3JD2 A;  4G28 B;  4FM0 A;  2KG7 A;  4DR7 O;  3F5W C;  2XAH A;  3UO2 A;  1EN4 A;  3OD4 A;  1RM1 C;  1WPX A;  2VQF B;  2D2C B;  1K73 W;  1Q7Y W;  1JJO A;  3WB1 A;  1AIL A;  1YZB A;  2PGG A;  1JFF A;  2HVK C;  4IYH A;  1K92 A;  4YY3 B;  3CC7 V;  2Y69 B;  1R6N A;  2YID A;  1SA0 A;  2Q68 A;  2ZDI C;  5EYP A;  3K9S A;  4IHJ B;  1QVF U;  3JAL B;  1WLE A;  4DRX B;  4I9W A;  4ZHQ A;  3B8M A;  4NXM O;  5DEC A;  3M7M X;  5H9C A;  4IHJ A;  4PA4 A;  4NYK A;  2QWQ B;  4LF8 O;  1E79 G;  3CE2 A;  3UO3 A;  3FB8 C;  4A5U B;  4YJ2 B;  5CBH A;  2UXC O;  1GKF A;  4FPP A;  1IUR A;  1XOU A;  4UB6 Z;  3ICX A;  3QG5 A;  1K97 A;  4ZHQ B;  4D7T A;  1S76 D;  2OT5 A;  3G67 A;  1L1F A;  2OTL V;  2CH7 B;  5J2T A;  3WG7 C;  1COW G;  5JCO A;  1RPO A;  3ZHU A;  2ZNJ A;  1Y4M A;  1ZSP A;  2DYS C;  4UCR A;  3RYF A;  1XMO B;  2O57 A;  3CCJ V;  1NR1 A;  2YI9 A;  4LR3 A;  4XDL A;  2QWP B;  1VIB A;  3L72 H;  3O9O A;  1M5I A;  4MVO A;  1AI5 A;  1CXZ B;  2QM4 A;  3J7A U;  1Z5V A;  2LW7 A;  1M56 B;  3T1H O;  3H01 A;  3K79 A;  2Z3Y A;  4J7K A;  2E76 B;  1VQ8 V;  4YJ3 A;  1H38 A;  5LA6 B;  4ABM A;  2EIJ C;  3QNE A;  3FKS G;  2F93 B;  1FXK B;  4W4K A;  1R3I C;  4BWA A;  1PP9 H;  4JYC A;  1HR0 O;  2QM7 A;  1AI7 A;  2H94 A;  2LFR A;  2BTO A;  1S5H C;  2YIB D;  4JAV A;  1ARO P;  3OR6 C;  1VF5 B;  3RGB A;  2CTR A;  4LWS B;  4B3M O;  2EX3 A;  2ILM A;  3GB7 C;  2JGD B;  1SQQ H;  3IC7 A;  4E2L A;  2YI8 A;  2X6C A;  4DV7 B;  1NTZ H;  4K0K B;  2CTP A;  2CAZ C;  4I55 A;  4DV2 O;  2Q4P A;  1P7B A;  1H2G A;  4PA7 A;  1I94 O;  4UV8 A;  4JYY A;  3K5N A;  5L3B A;  3APO A;  3VQW A;  1PPJ H;  3FB7 C;  4JI3 O;  3CX5 F;  3ZHQ A;  2YDE A;  3ZMS A;  1VMG A;  3DTU B;  3O65 A;  4I50 B;  2WLN A;  4JTD B;  2A3Q A;  2XUM A;  4QE9 A;  3SJB C;  1N34 B;  4CH5 A;  4JYA B;  3M8A A;  1Q3E A;  1KKD A;  4F6R B;  3CP1 A;  1AVM A;  4LFA B;  2ATK C;  5EBM C;  1YTF D;  5BXZ A;  2PYL A;  2P7T C;  3JAK B;  4TQF A;  1QLE B;  3F7Y C;  2R72 A;  2PI5 A;  4UCT A;  2XAS A;  1F51 A;  1D2D A;  1AI4 A;  3AK1 A;  3ETG A;  1NH2 D;  5TIS Z;  1XL6 A;  4QIW F;  5KLV H;  1UFI A;  4YIP A;  2P67 A;  3LDC A;  1I7F A;  2K9P A;  4DUZ O;  2HEP A;  2ZCE A;  4MVZ A;  3MDS A;  1ZL8 A;  4IIJ A;  4JI8 O;  1P49 A;  4K8Z A;  3S3W A;  1P7G A;  2QSA A;  2PI4 A;  3U0Z A;  1BSM A;  4GLX A;  3AG7 A;  3AK3 A;  1FFT B;  3JAL A;  1JCH A;  2GSM B;  1G8M A;  1GM8 A;  5IE9 A;  1URF A;  3T1Y B;  5CMU A;  5IYB O;  2R9R B;  1T5E A;  2QWN B;  1ROP A;  3ABU A;  4I5S A;  1XQ8 A;  2ADP A;  1GTO A;  4WFH A;  2FTK A;  5JH7 A;  3ZHR A;  1M57 B;  4H37 A;  3BCC H;  3L73 H;  2AHZ A;  2RN9 A;  1N8R W;  5KMG A;  4TOI A;  1SZT A;  5HFL A;  2F66 C;  2QWO B;  4DV5 B;  4KL1 A;  4RWU A;  4RAI A;  1Y74 B;  4P9P A;  2Q67 A;  2FYU H;  3ZN1 A;  1H2M A;  5DED A;  1K5Q A;  2M6Y A;  2OTJ V;  5JQG B;  4DR4 B;  4KXR A;  4J41 A;  4LFB O;  4D6T H;  3QO7 A;  1QQC A;  4DR5 B;  4PDM A;  3STZ C;  1B6Q A;  1WAZ A;  1XHZ A;  1XNR B;  5A2Q N;  3K59 A;  4NB5 A;  3SYO A;  4R7C A;  2V7Q G;  1Y67 A;  1V54 C;  5LMN B;  4LF6 O;  5IYD O;  5FNV B;  4NXN O;  5DM6 V;  2PY5 A;  2DE0 X;  1EBO A;  1V55 C;  3SYP A;  2YXH A;  1L0N H;  5KA5 A;  3AG4 C;  4LF7 O;  4QPK A;  4O4L A;  5JCO C;  1GM7 A;  1ZUQ A;  2LO1 A;  4X62 B;  2CGO A;  3JYC A;  3RYC A;  1Y76 B;  1OCC B;  1NJI W;  2WA3 A;  2JS3 A;  4FFK A;  3QF7 A;  4HNA B;  2Q0O C;  3RW0 A;  3BAB A;  4RUE A;  5LBQ A;  1VAR A;  3TXS A;  1L8D A;  3JAW A;  4BIO A;  4R50 A;  2ZXW B;  2QR4 A;  1DTO A;  1VQL V;  3G71 V;  1BL8 A;  2GTA A;  3OUF A;  2H8P C;  1KU9 A;  4JI6 B;  1WA8 B;  2B1I A;  3ZHV A;  1MA1 A;  3ZRW B;  1H2K A;  2VRZ A;  2OCC B;  4EEQ A;  1KD1 W;  4GX1 A;  2EIK B;  1HP8 A;  3ABM B;  4XBF A;  4ZI7 B;  4AQY B;  5H2F Z;  2Q69 A;  2G38 A;  5LHI A;  3CCQ V;  1E1Q G;  3TET A;  1LUV A;  1DLB A;  1OCO B;  2Q8V A;  3A8T A;  2GUZ B;  2R9A A;  4O2B A;  2WLK A;  5B66 Z;  3RN4 A;  1BQZ A;  5D5Q A;  1IBL O;  3K9A A;  5IYC O;  2YXL A;  4DW1 A;  4AQY O;  1KKC A;  2YIB A;  2JS5 A;  1IBL B;  1K34 A;  4I7Z B;  4DV5 O;  5B3S C;  5EC1 C;  2Z5U A;  1SQV H;  4KP4 A;  4I4T A;  3JCU Z;  1S3J A;  1CP9 A;  2XTA A;  4BIU A;  2KB1 A;  1DF4 A;  1N0N A;  1NI8 A;  1SQP H;  4HAM A;  3DC5 A;  2R9I A;  4NKG B;  1QHT A;  3T1Y O;  2VQE B;  4DR6 B;  1K4C C;  3CXC U;  1OZ0 A;  4JI2 O;  3SPI A;  2FL4 A;  2XAQ A;  5CA0 B;  4QNH B;  3CRC A;  4U7O A;  3SPG A;  5LOV B;  1MNG A;  2XAF A;  1KBH A;  3TK1 A;  3ZMU A;  5EBL C;  2Y0P A;  4BW5 A;  2L6L A;  1N33 O;  1SZX A;  2P4K A;  4X8A A;  3U10 A;  5KMG B;  3UT5 B;  4X64 B;  2Q7E A;  2AZ2 A;  1JPX A;  3OE7 G;  1SRY A;  3UM7 A;  1VP7 A;  1US6 A;  4JTC B;  4RQE A;  1NKD A;  5IY5 C;  3SYQ A;  1MAB G;  2NR5 A;  5LOV A;  4JGS A;  3ZX6 A;  5A9G A;  5B1A B;  2DJV A;  4TWK A;  1OV9 A;  5IJ0 A;  4UUJ C;  1VQP V;  3SYA A;  1IZ3 A;  1MSW D;  3AK2 A;  1WB7 A;  3RVZ A;  5HFM A;  5CA1 B;  4YHH B;  4LF9 O;  3H1H H;  1V9P A;  1IXB A;  3X2Q C;  3D3I A;  4MSW C;  2LFS A;  1MMM A;  4O4H A;  1BHB A;  5EZY A;  3FYE B;  5KA6 A;  2ZDI A;  3AG2 C;  3BEH A;  1GN3 A;  1CEZ A;  3JSL A;  4I4T B;  3SJC C;  5BMV A;  1NVP D;  4MTO A;  1N36 B;  4X89 A;  2Y4U A;  2LGW A;  1BMF G;  3KG2 A;  3VQV A;  1JVM A;  1R3J C;  4KHP O;  3W7X A;  2ITC C;  1TA8 A;  3J80 N;  3HR0 A;  4PV1 B;  4J80 A;  3WG7 B;  3ZMZ A;  4DV1 B;  4GX0 A;  4LF8 B;  1M4U A;  3ASN C;  3D3Q A;  3T1C A;  2RCV A;  3ZRW A;  3D8C A;  4X65 O;  1YVW A;  1YJW V;  3PN1 A;  2YUA A;  1XMQ B;  2DYR C;  4MW8 A;  1GN2 A;  2KQX A;  3HKC A;  4ZI7 A;  4FLY A;  1TAE A;  2ADQ B;  4DV3 B;  4L87 A;  1GRJ A;  1JA8 A;  1ZLZ A;  2N74 A;  3ABL C;  1RFY A;  1XDC A;  4U3J A;  1H2L A;  5K1P A;  3BFR A;  2EIJ B;  4D7S A;  4JI4 B;  3KZI Z;  4DR1 B;  3CCS V;  2ZIO A;  2EIN C;  1GMG A;  1EFR G;  1H2S B;  4FK5 C;  4O4L B;  4CZZ A;  4LWS A;  2QA4 V;  1MZE A;  1JR9 A;  2ZR2 A;  4DV7 O;  3SPH A;  4PI0 A;  1Q6U A;  2Q73 A;  1PNL A;  1SC5 B;  2IJK A;  2QDO A;  1BQ0 A;  3OEE G;  3PJS K;  1FS0 G;  1LR1 A;  5BMV B;  2JEX A;  1K7D A;  2WWW A;  2JVD A;  3K58 A;  1FXV A;  2F4V O;  4YJ3 B;  3DGE A;  1N32 B;  2CGN A;  5H5N A;  2UXD O;  1Q82 W;  1OCZ B;  2IM9 A;  2Q0A A;  2BOC C;  3R66 A;  1K8A W;  3SJQ C;  4B3T B;  1K3E A;  3ABT A;  4FLV A;  2C2A A;  1OHH G;  3LDE A;  4QPJ A;  2ZM6 O;  1VQ6 V;  4PJ0 Z;  1PL0 A;  3N2K A;  3K0G A;  2IU0 A;  2XND G;  3AG3 C;  4WFF A;  2OCH A;  5IJ9 B;  3G4S V;  1XL4 A;  2UUB B;  3RVY A;  1MSD A;  1P84 F;  2P90 A;  4JI8 B;  3CXH F;  4X1Y A;  3CB2 A;  4B3M B;  4DUY O;  1Q6I A;  1YHQ V;  3OUS A;  4CH3 A;  1Q90 D;  4JV5 O;  3ZHS A;  2IJI A;  1WB8 A;  3QVN A;  4I9Q A;  1TGO A;  1SES A;  1Q43 A;  1K33 A;  4DRX A;  5JJN B;  1AR1 B;  1TUB B;  1MZF A;  1PD3 A;  4LH6 A;  1SA0 B;  3C90 A;  4YHH O;  4GUN A;  1BCC H;  2IH3 C;  1FAF A;  2PZS A;  1TVK A;  2F95 B;  1GH6 A;  2B1G A;  2GTS A;  3ZRS A;  1NH2 B;  1NZ6 A;  2B5U A;  2GBO A;  2UXN A;  2WLI B;  2E5L O;  3RWR D;  4JYB A;  4CBC A;  3E22 A;  1W0J G;  1ORQ C;  4OXS A;  4FFB A;  4JAS A;  3ETQ A;  4UV9 A;  4GKJ O;  5C8Y B;  4QJF B;  2ZE7 A;  4LF6 B;  3OTF A;  5H6Q A;  4JI7 O;  2WLM A;  3ZRV A;  3NXS A;  2YC0 A;  5CBG A;  5L3D A;  5BR8 B;  1XNR O;  4TV8 B;  4F6R A;  4JI1 O;  3BA9 A;  2FB5 A;  1KP2 A;  3JAT A;  3EXA A;  1FPO A;  5L3C A;  3TCU A;  4JYA O;  1BS3 A;  4TUY A;  4CS4 A;  2AW9 A;  4I50 A;  5J2U A;  1WA8 A;  4DK1 A;  1H8H G;  1D5A A;  1K5S A;  4TQD A;  2M7W A;  3BAA A;  3D36 A;  2ZT9 B;  1NS1 A;  1HDJ A;  3K57 A;  2VWK A;  2BOB C;  3KCX A;  3L70 H;  2KKW A;  4DR7 B;  3ABK B;  4H44 B;  2AXT Z;  4DR4 O;  2Y4T A;  4FVM A;  4DV0 O;  4HNA A;  2CDY A;  4O4J B;  4I55 B;  4QE7 A;  4LF4 O;  3CME V;  4DV4 O;  1OCR B;  1V55 B;  4CC5 A;  4DR1 O;  4LBE C;  1YI2 V;  1EZJ A;  2EBO A;  4UVC A;  1M93 A;  3AG4 B;  5KUM A;  2YEV A;  2PF4 E;  3LDD A;  4FIP C;  2QWR B;  5KAI Z;  2D3O W;  4B3S O;  4OX9 O;  1QR9 A;  3SR2 C;  1F4N A;  3OFN G;  4J7J A;  4NXN B;  3BY6 A;  1VQK V;  5LMN O;  4BW9 A;  2HFE C;  4X66 B;  4TUY B;  2R70 A;  1AJN A;  5LA6 A;  4H33 A;  3CCU V;  3SPJ A;  3K08 A;  2N05 A;  5LMU B;  4TV8 A;  3APQ A;  5KHK A;  2DN9 A;  4UXN A;  4HBN A;  1R6T A;  3MAQ A;  3DC6 A;  1IX9 A;  4MTG A;  3VOU A;  4GX5 A;  1AP5 A;  1GAX A;  4ZOL A;  5L3E A;  3K3W A;  5LXT B;  1LUW A;  5C8Y A;  4MW3 A;  3ZBH A;  1WNS A;  2Y0I A;  3E22 B;  3HKB B;  2X0L A;  1VQN V;  4F4L A;  1MOF A;  3B77 A;  2YXY A;  4DXW A;  2YS8 A;  2WLL B;  2Q7H A;  1AI6 A;  3P3P A;  3K06 A;  4UCS A;  2BSK A;  1VQ9 V;  1WJZ A;  5F2V O;  3CYO A;  3JD1 A;  2XT9 A;  1N4C A;  1U97 A;  2QM8 A;  3OT7 A;  3E86 A;  3RYH A;  4X64 O;  4IT5 A;  1BE3 H;  4LF5 B;  3CCR V;  2UUA B;  3CC4 V;  4LP8 A;  4DR5 O;  4J11 A;  3VQY A;  2E75 B;  4GKK O;  5B1N A;  2ZE8 A;  3D36 C;  1TUB A;  5GON A;  4EFB A;  3B09 A;  3RT3 C;  2EIM C;  4DUZ B;  2HJF C;  1NQT A;  4X1I B;  1Q8I A;  5B1B B;  1SQF A;  5EYP B;  4PDL A;  2H3O A;  2HR3 A;  5J9P C;  1ZL8 B;  4IIJ B;  3E2E A;  1Q6H A;  3N27 A;  5E79 Z;  3E8F A;  1VQM V;  4GKJ B;  4JI5 O;  5LGT A;  1RSO A;  2F1M A;  4Z1V A;  4WF9 V;  3BPZ A;  3CPW U;  4UCV A;  1HNX O;  5BR8 O;  4JV5 B;  4YXW G;  2KG7 B;  4P9O A;  2P06 A;  5K1X A;  3H1L H;  1SET A;  2CTW A;  2RNB A;  1WP7 A;  2FKX A;  2WAM A;  1IDS A;  2BCC H;  3AG1 C;  3LUT B;  1IXM A;  3CCV V;  1GN6 A;  3WU2 Z;  1VQO V;  1XUQ A;  3NR7 A;  3UCS C;  1HNZ O;  4BR6 A;  2UUB O;  1HNW O;  1SF9 A;  2WLL A;  2QTS A;  2JJ1 G;  3W7W A;  1B3Q A;  1K4D C;  4ZOL B;  3ZIA G;  3K5M A;  1IBM B;  4LNU A;  1I0H A;  4WCE V;  2VWJ A;  5LMU O;  1PNK A;  3CRR A;  2B9Z A;  4X62 O;  1NVP B;  1H2N A;  3ZRX A;  2W0F C;  3H1K H;  4X1K A;  5IY5 B;  1AJQ A;  2CK3 G;  5KX5 A;  3CEI A;  3K5L A;  2PUS A;  5LXT A;  3QO8 A;  5B1A C;  1Q86 W;  2IBZ H;  1I94 B;  4MVU A;  3UQ8 A;  3EFF K;  3CHX A;  2DW4 A;  4K3A A;  5LL6 Y;  1IBM O;  2PYJ A;  3FD9 A;  4L8J A;  1RPR A;  3G80 A;  1R3K C;  2UXX A;  5ITZ B;  1S77 D;  4X88 A;  3X2Q B;  5KHI A;  3G6B A;  4O2A A;  4KUM A;  1WN7 A;  1NT2 B;  5IYZ A;  5E1A C;  4HZ3 A;  4JTA B;  3H1I H;  2Y69 C;  2LJ2 A;  1BGY H;  1AR4 A;  4JF3 A;  2XOK G;  5IYZ B;  2EZP A;  1XHX A;  1THZ A;  4LC1 A;  4LF9 B;  2GDS A;  2UXC B;  3I56 V;  5J2U B;  2UXD B;  2MK3 A;  2XHB A;  4CS2 A;  2GV9 A;  1Y6X A;  2BE3 A;  2Y48 A;  1QNM A;  5KUK A;  1YIT V;  2IJJ A;  4TT3 G;  1WPB A;  4WFG A;  3GVM A;  4PA3 A;  3Q4H B;  1VQ4 V;  1XNQ B;  2EIL B;  3BHP A;  2BTQ A;  2IU3 A;  1D5N A;  3N2G B;  5CB4 B;  4K0K O;  3B8N A;  1J5E O;  3ZS8 C;  2JIZ G;  2ZD9 A;  2DYR B;  3QTC A;  3JSN A;  4X1K B;  2OWO A;  5C93 A;  3CMA V;  4O4I A;  4LFB B;  4FM1 A;  1E1R G;  1YCI A;  2DYS B;  3IGA C;  5BZB A;  1R1B A;  1OJH A;  4MS2 A;  4Z2W A;  1H8E G;  4G2K A;  3E8H A;  3ASO C;  4G27 B;  3LSQ A;  2QEX V;  4EB6 A;  4MT8 A;  3RYF B;  2KSD A;  2E74 B;  4IL6 Z;  5LHG A;  1EM1 A;  4F6E A;  2AZ0 A;  1M56 C;  1R3L C;  3CCL V;  2WA4 A;  4O4H B;  2QKA A;  2CH7 A;  5J2T B;  1I5X A;  1SQX H;  1Q5O A;  3B4S A;  5CA1 A;  1FXK C;  1J95 A;  1EN5 A;  1OCC C;  1IBK B;  1RSO B;  4EFE A;  1FJG B;  1YF2 A;  2JRI A;  4NTY A;  3GWK C;  5LP6 B;  5FPR A;  3CJH B;  3L74 H;  3OGI B;  4X1I A;  5IWA B;  4X1Y B;  4PA9 A;  1JMK C;  2QGN A;  1LNQ A;  2ZIM A;  4NR1 A;  2JEU A;  3FB6 C;  5GON B;  1U96 A;  1XMQ O;  3B2E E;  1VF7 A;  1SER A;  2OCC C;  1FXH A;  4H0L B;  3IFX A;  1S5L Z;  4MVR A;  1ZTE A;  3SPC A;  2ZM6 B;  3RYH B;  3G6E V;  3E89 A;  2ZE5 A;  3N2K B;  4FLZ A;  2A79 B;  2BSK B;  3E8G A;  1VQ5 V;  4Q20 A;  4DV2 B;  4ZKI A;  5KHJ A;  1VF6 C;  3OTO O;  3AG3 B;  3TGU H;  1HNZ B;  1DGS A;  2XAG A;  1KQS U;  4DV0 B;  3TXQ A;  3HKB A;  1AJP A;  2UXB O;  4DR2 O;  1QU7 A;  4DR3 B;  4IGG A;  2UXB B;  4CH6 A;  2PTM A;  2L35 A;  3CD6 V;  1MG1 A;  2DMX A;  3T4D A;  3CRM A;  1CPY A;  1NBM G;  4DV6 O;  4FLW A;  3RYI B;  1M1K W;  3LNN A;  4JI0 O;  1PV0 A;  1KB9 F;  1Y66 A;  4OPA A;  1HR0 B;  4FLU A;  3THO A;  2X7R B;  3HKD A;  2XAJ A;  2WLH A;  3MD0 A;  1S72 V;  2RDC A;  1Z5W A;  4JZG A;  1QLE C;  4GZR B;  4ZBM A;  4RQF A;  2W6I G;  3ZJZ A;  3LNM B;  2DWE C;  1K9M W;  3OMI B;  5D5P A;  1F7Y A;  2ZNI A;  2X6A A;  2YEV B;  4O2B B;  3KKY A;  3FFQ A;  4I0X A;  3HB3 B;  4PDV A;  5LGU A;  4GX2 A;  1KUQ A;  1IVS A;  5IDJ A;  1FFX A;  3IJ4 A;  3H9V A;  5EC2 C;  4QGP A;  5EIB D;  3LSU A;  2CTQ A;  4U3J B;  3DXR B;  2P4V A;  4RUF A;  3K0D A;  4PA6 A;  2LGQ A;  2Q7G A;  3DXR A;  1HNX B;  4XDK A;  1YTF B;  3WB0 A;  3JAT B;  3JAW B;  4J9Z B;  4JI5 B;  1UPG A;  2Z0A A;  1FFX B;  4B08 A;  1VF6 A;  5CBF A;  1M57 C;  1KYO F;  3HKC B;  4UB8 Z;  2V4D A;  1W0K G;  3EHB B;  3RYC B;  1RM1 B;  3JAS A;  4Z1M G;  5KHH A;  1GK9 A;  3A2F A;  3SDL A;  1F23 A;  4J9Y B;  4B3T O;  3AG2 B;  1N34 O;  4N23 A;  1HNW B;  2UU9 O;  3OMN B;  4TV9 A;  4UVA A;  1J5E B;  3B40 A;  4B3S B;  4OX9 B;  1BT8 A;  5AG2 A;  2NN4 A;  5LHH A;  3H1J H;  2WSS G;  3HKD B;  1GO3 F;  4X20 A;  1OCR C;  3F5T A;  1EZV H;  1TVK B;  5FL7 G;  1S0V A;  1V54 B;  4LF7 B;  3CC2 V;  1N32 O;  1PKX A;  2MW2 B;  1N0J A;  1IBK O;  5EZY B;  2HKO A;  1QBZ A;  3HPL C;  2EUL A;  4DYL A;  4U7N A;  4FLX A;  4OGQ B;  4DUY B;  3FAV A;  4B7E A;  2RJZ A;  1B06 A;  3K5O A;  1DK1 A;  5IWA O;  5LYJ B;  1FKA O;  2YSU B;  5H6R A;  1SS3 A;  1FJG O;  1X59 A;  1QVG U;  4LF5 O;  1VQ7 V;  5IT9 N;  3JAR A;  2CE4 A;  3C3S A;  3TJT A;  1G6U A;  4WBN B;  2Q9L A;  4TSF G;  4P30 A;  2YIA A;  3SYC A;  2ZXW C;  2HVJ C;  5IJ9 A;  3L9D A;  1NTK H;  4JI2 B;  5LYJ A;  2P22 C;  2LQT A;  4WBN A;  3W7S A;  5L3F A;  3P30 A;  2HJD A;  1ENV A;  2EIN B;  1FD9 A;  2V1D A;  3JAR B;  2P6J A;  4U3F H;  1M90 W;  2OYQ A;  4B3R O;  4DV4 B;  2IH1 C;  3T4Z A;  4NTX A;  3T1H B;  2AGA A;  4CC6 A;  3K04 A;  3RFR A;  4NXM B;  2Q6A A;  1W2B U;  2ETN A;  4BAY A;  2ZQM A;  4AI8 A;  1SQG A;  4FZ1 A;  2IW5 A;  2A9H A;  5CA0 A;  3SJA C;  3L71 H;  1UJW B;  3JAM N;  4JAU A;  5JWP A;  2Q5Z A;  4DV6 B;  3OTO B;  5JJE B;  2EIM B;  2K1E A;  4DV1 O;  2EJ7 A;  3U11 A;  1ZX3 A;  2RMK B;  5B1B C;  4TV9 B;  2E3C A;  4DR3 O;  4DK0 A;  2DQ0 A;  4PDR A;  1ZAU A;  4FLT A;  4X20 B;  2UUC B;  3HKE A;  2DQ3 A;  2GUZ A;  4LFC B;  3MHS C;  1B04 A;  4JI4 O;  3JCZ A; 
#chains in the Genus database with same CATH homology
 3EFF K;  1R3I C;  1GM9 A;  2DW4 A;  3WG7 B;  3ZMZ A;  4JYC A;  2QM7 A;  3QO5 A;  1AI7 A;  4GX0 A;  4GT1 A;  2H94 A;  2LFR A;  1S5H C;  3ASN C;  1RPR A;  4JAV A;  4DO2 A;  3T1C A;  1ARO P;  3OR6 C;  3ETE A;  3FB5 C;  2ZR3 A;  3ZRW A;  3MHH C;  1R3K C;  2UXX A;  1YJW V;  1S77 D;  2QTO A;  4X88 A;  4N21 A;  3X2Q B;  2IJH A;  1JJ2 U;  1QCE A;  2DYR C;  4MW8 A;  4KUM A;  3GB7 C;  5E1A C;  4HZ3 A;  4JTA B;  3IC7 A;  1R6K A;  2Y69 C;  4L87 A;  4E2L A;  2X6C A;  3OR7 C;  4JF3 A;  2XOK G;  2LP7 A;  2EZP A;  3ABL C;  1THZ A;  4LC1 A;  3I56 V;  2ITD C;  1P4R A;  2EIJ B;  1P7B A;  2MK3 A;  4EKW A;  1H2G A;  4PA7 A;  4KFM A;  2Y48 A;  4UV8 A;  5L3B A;  3CCS V;  5KUK A;  1YIT V;  2IJJ A;  3ZN0 A;  4TT3 G;  3FB7 C;  4WFG A;  2EIN C;  4PEL A;  3OEH G;  4PA3 A;  3ZMS A;  1GMG A;  1EFR G;  3DTU B;  1VQ4 V;  4FK5 C;  4CZZ A;  2EIL B;  2QA4 V;  2WLN A;  2ZR2 A;  2IU3 A;  3SPH A;  4JTD B;  3B8N A;  1PNL A;  2IJK A;  4QE9 A;  3OEE G;  2JIZ G;  1I5Y A;  2DYR B;  2ZD9 A;  3PJS K;  2WLJ A;  1FS0 G;  1KKD A;  2QKS A;  2JEX A;  1K7D A;  2WWW A;  5C93 A;  4WFE A;  3CP1 A;  3W7U A;  3CMA V;  3ZCC A;  1R73 A;  1E1R G;  1FXV A;  2DYS B;  1JX9 A;  2F43 G;  3IGA C;  4MS2 A;  5BZB A;  1H8E G;  1YJN V;  4G2K A;  3E35 A;  3E8H A;  3ASO C;  3GWO A;  4G27 B;  4R6Z A;  4MVQ A;  4RO2 A;  3CCE V;  3DGE A;  2ATK C;  5EBM C;  3LSQ A;  3JD4 A;  1YTF D;  2QEX V;  3VBB A;  4MT8 A;  3E8B A;  2P7T C;  1QLE B;  3F7Y C;  1G4Y B;  5LHG A;  1Q82 W;  1JQ0 A;  1OCZ B;  1ZWI C;  2PI5 A;  3ZMV A;  2XAS A;  1F51 A;  1M56 C;  1R3L C;  2BOC C;  1AI4 A;  3CCL V;  2HG5 C;  3ETG A;  1NH2 D;  1K8A W;  2A0L A;  2AHY A;  1KC8 W;  1I5X A;  1YSC A;  3SJQ C;  4UVB A;  4GCZ A;  3OM3 B;  2EIL C;  1K3E A;  3ABT A;  1XL6 A;  1FXK C;  1J95 A;  1OCC C;  2C2A A;  3ETD A;  4QIW F;  4R8C A;  1KP3 A;  1OHH G;  1QR8 A;  2P67 A;  3LDE A;  4QPJ A;  3LDC A;  1VQ6 V;  1PL0 A;  3OGC C;  3K0G A;  4HYO A;  2IU0 A;  2XND G;  3AG3 C;  4WFF A;  3ASN B;  4MVZ A;  1YJ9 V;  3G4S V;  3F7V C;  1YIJ V;  1XL4 A;  4FMT A;  3RVY A;  2PI4 A;  3ABK C;  2JDI G;  1F4M A;  3ASO B;  4PA9 A;  1FFT B;  2P90 A;  1JCH A;  1LNQ A;  2GSM B;  3STL C;  2JEU A;  3FB6 C;  1G8M A;  1GM8 A;  5CMU A;  3AEI A;  5IYB O;  2R9R B;  1YHQ V;  3OUS A;  1SER A;  5CN0 A;  2OCC C;  5B1O A;  1FXH A;  1ROP A;  3IFX A;  3ABU A;  4FJC C;  4MVR A;  3SPC A;  5LGN A;  2JK5 C;  4I5S A;  4ASU G;  1GTO A;  4P2Z A;  4WFH A;  3G6E V;  3E89 A;  3ABL B;  1KEC A;  1PNM A;  2FTK A;  2IJI A;  1M57 B;  4H37 A;  2AHZ A;  1N8R W;  1SES A;  1K33 A;  2A79 B;  3E8G A;  1AR1 B;  1SZT A;  1VQ5 V;  5HFL A;  3P32 A;  1PD3 A;  4Q20 A;  4ZKI A;  2DWD C;  3M99 B;  4RAI A;  4P9P A;  2Q67 A;  3AG3 B;  2XAG A;  3ZN1 A;  3K03 A;  1KQS U;  1BHA A;  2IH3 C;  1K5Q A;  2OTJ V;  1AJP A;  3UKM A;  2B1G A;  3OW2 U;  3ZRS A;  3QO7 A;  3FYI B;  4PDM A;  3STZ C;  1B6Q A;  3CD6 V;  1NH2 B;  1MG1 A;  2B5U A;  2UXN A;  2WLI B;  3T4D A;  3SYO A;  1CPY A;  4JYB A;  4R7C A;  1NBM G;  2V7Q G;  1M1K W;  4CBC A;  1V54 C;  1W0J G;  3OMA B;  4MTX A;  1ORQ C;  4OXS A;  1Y66 A;  4JAS A;  5IYD O;  4UV9 A;  5DM6 V;  2WPD G;  2X7R B;  4QJF B;  3I55 V;  2XAJ A;  2WLH A;  3MD0 A;  5EBW C;  1EBO A;  1V55 C;  3SYP A;  5H6Q A;  1S72 V;  5KA5 A;  3WFV A;  2WLM A;  3AG4 C;  3RBZ A;  4QPK A;  1QLE C;  3CCM V;  3ZRV A;  1OCZ C;  3NXS A;  4ZBM A;  4RQF A;  5CBG A;  2W6I G;  5L3D A;  2EIK C;  3ZJZ A;  1GM7 A;  3LNM B;  3ABM C;  2DWE C;  1K9M W;  3OMI B;  1KP2 A;  2JJ2 G;  2X6A A;  1OCO C;  5GW7 A;  2YEV B;  5CA3 A;  5L3C A;  3JYC A;  3TCU A;  1OCC B;  1NJI W;  4MVS A;  1H8H G;  1K5S A;  3R65 A;  4BIZ A;  5L3G A;  3RW0 A;  2M7W A;  3HB3 B;  4PDV A;  3ML0 A;  4GX2 A;  4RUE A;  5LBQ A;  5LGU A;  3D36 A;  5IDJ A;  3ZMT A;  2BOB C;  5EC2 C;  4R50 A;  2ZXW B;  1DTO A;  3ABK B;  1VQL V;  1NR7 A;  3G71 V;  1BL8 A;  3K0D A;  4RUF A;  4WFB V;  4PA6 A;  1QLN A;  3OUF A;  2H8P C;  4QE7 A;  2B1I A;  5B3S B;  3CME V;  1OCR B;  1V55 B;  4LBE C;  1YI2 V;  1EZJ A;  2EBO A;  4UVC A;  3ZRW B;  4XDK A;  3AG4 B;  1YTF B;  5KUM A;  2OCC B;  2YEV A;  3JD0 A;  3LDD A;  4FIP C;  1KD1 W;  4J9Z B;  4GX1 A;  2EIK B;  2D3O W;  2NNU A;  3ABM B;  5CBF A;  4WFA V;  1M57 C;  4XBF A;  1QR9 A;  4LCU C;  1F4N A;  3OFN G;  2Q69 A;  3AG1 B;  5LHI A;  3CCQ V;  3BY6 A;  1E1Q G;  3TET A;  1VQK V;  2X6B A;  1W0K G;  4MVM A;  1FXK A;  1M9N A;  1DLB A;  1OCO B;  2HFE C;  1HWY A;  3EHB B;  3T2M A;  1AJN A;  5EK0 A;  3JD3 A;  1RM1 B;  1TUE B;  4H33 A;  3CCU V;  4Z1M G;  2WLK A;  3LSS A;  3SPJ A;  1GK9 A;  1JOY A;  3K08 A;  1F23 A;  4J9Y B;  4UXN A;  3AG2 B;  4N23 A;  3K9A A;  5IYC O;  3OMN B;  4UVA A;  4MTG A;  3VOU A;  4GX5 A;  2EZO A;  3OAA G;  2HLD G;  5LHH A;  5L3E A;  3K3W A;  4MTF A;  1K34 A;  2WSS G;  1GO3 F;  2GHY A;  2W6J G;  4MW3 A;  5B3S C;  3A0R A;  3W7T A;  2NLJ C;  1Q81 W;  1OCR C;  5EC1 C;  2Z5U A;  5FL7 G;  2EJR A;  4KP4 A;  1S0V A;  4JPR A;  1V54 B;  1S3J A;  2X0L A;  3CC2 V;  1VQN V;  1CP9 A;  3E83 A;  1PKX A;  4F4L A;  4BIU A;  1DF5 A;  3B77 A;  1MOF A;  1DF4 A;  2KB1 A;  2WLI A;  5DN6 G;  4HAM A;  2HKO A;  2QE7 G;  1QBZ A;  3HPL C;  2R9I A;  4XDJ A;  4U7N A;  3JD2 A;  4G28 B;  4DXW A;  3F5W C;  2WLL B;  1AI6 A;  2XAH A;  3K06 A;  1RM1 C;  1K4C C;  1WPX A;  3CXC U;  1VQ9 V;  1OZ0 A;  3SPI A;  1K73 W;  3CYO A;  3JD1 A;  2XAQ A;  2QM8 A;  1Q7Y W;  4QNH B;  4U7O A;  3E86 A;  3SPG A;  2XAF A;  3TK1 A;  2HVK C;  3ZMU A;  3CCR V;  1K92 A;  2YSU B;  5EBL C;  2Y69 B;  3CC7 V;  1R6N A;  4BW5 A;  3CC4 V;  4LP8 A;  5H6R A;  2Q68 A;  2ZDI C;  4X8A A;  5B1N A;  1QVF U;  1QVG U;  1WLE A;  2EIM C;  4I9W A;  1VQ7 V;  3B8M A;  1JPX A;  2HJF C;  3OE7 G;  1NQT A;  5H9C A;  5B1B B;  4PA4 A;  4PDL A;  1SRY A;  3UM7 A;  4TSF G;  2HR3 A;  4JTC B;  4P30 A;  1E79 G;  3SYC A;  2ZXW C;  2HVJ C;  5J9P C;  4RQE A;  3FB8 C;  3E2E A;  1NKD A;  5IY5 C;  3SYQ A;  5CBH A;  1MAB G;  3E8F A;  1VQM V;  4JGS A;  3W7S A;  1GKF A;  5L3F A;  3P30 A;  5LGT A;  4FPP A;  1ENV A;  2EIN B;  2V1D A;  4WF9 V;  2P6J A;  1K97 A;  5B1A B;  1M90 W;  3CPW U;  4TWK A;  2IH1 C;  3T4Z A;  1S76 D;  2OT5 A;  4YXW G;  1L1F A;  2OTL V;  4P9O A;  3WG7 C;  4UUJ C;  3K04 A;  1VQP V;  1SET A;  2Q6A A;  1W2B U;  4BAY A;  1COW G;  2ZQM A;  2WAM A;  2IW5 A;  3SYA A;  3AG1 C;  1RPO A;  3LUT B;  1IXM A;  2A9H A;  3CCV V;  1UJW B;  1VQO V;  4JAU A;  1MSW D;  1Y4M A;  3RVZ A;  5HFM A;  2DYS C;  2WLL A;  3X2Q C;  3CCJ V;  3D3I A;  1NR1 A;  2EIM B;  2K1E A;  4MSW C;  2JJ1 G;  3W7W A;  1K4D C;  2LFS A;  3ZIA G;  1BHB A;  4XDL A;  3FYE B;  4WCE V;  5KA6 A;  5B1B C;  1PNK A;  1NVP B;  2ZDI A;  3AG2 C;  1AI5 A;  3BEH A;  4MVO A;  3ZRX A;  1CEZ A;  2W0F C;  2DQ0 A;  4PDR A;  1NVP D;  4MTO A;  5IY5 B;  1AJQ A;  1M56 B;  2CK3 G;  3H01 A;  4X89 A;  3K79 A;  2Z3Y A;  1BMF G;  3KG2 A;  1VQ8 V;  2DQ3 A;  1JVM A;  1R3J C;  3QO8 A;  1H38 A;  5B1A C;  3W7X A;  2EIJ C;  2ITC C;  3MHS C;  3FKS G;  3QNE A;  1Q86 W;  4MVU A;  3JCZ A;  1FXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...