3TETA

Crystal structure of nak2k channel y66f mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3tetA00
2H8PC 2Q67A 4MVUA 4MSWC 3SYAA 2EILC 3BEHA 2ATKC 2AHYA 2DYRC 3LDEA 3ZRSA 1XL4A 4MVRA 3LUTB 1ORQC 2DYSC 3AG1C 3FB8C 5BZBA 2WLNA 3IGAC 4KFMA 4QE9A 4WFGA 4EKWA 1R3LC 3OR6C 4LP8A 2ITCC 3STLC 5B3SC 2A79B 3K0DA 4WFHA 3ABKC 2WLLA 3E8GA 3OGCC 4PDMA 2OCCC 4G28B 4ZBMA 1R3JC 3T4DA 5KUKA 4J9ZB 2HVKC 3E8FA 5EK0A 4PA4A 1R3IC 2W0FC 3OUSA 2IH3C 4GX5A 4J9YB 4MVZA 3SYPA 3SPJA 4PA7A 1J95A 3AG4C 3UKMA 5E1AC 5EC2C 3VOUA 3IFXA 2AHZA 2WLJA 3K03A 3SPIA 5B1BC 4MVSA 5EBWC 3LNMB 5CBHA 1QLEC 1OCCC 2EIKC 5EC1C 3HPLC 2ITDC 2HG5C 4R50A 3X2QC 1R3KC 3K04A 3LDCA 2BOCC 4HZ3A 3ABMC 4G27B 2Q68A 2ZD9A 4JTCB 3SPCA 3E8BA 3SYQA 2HJFC 4PDLA 4DXWA 3EFFK 3T2MA 2ZXWC 3ASNC 3RW0A 3E89A 3WG7C 4HYOA 4GX0A 1BL8A 3FB5C 4PA3A 3RVYA 3SYOA 3TCUA 2WLIA 3E86A 3AG2C 4QE7A 3E83A 4RUEA 5B1AC 4H37A 4MTOA 4P9OA 2IH1C 3OUFA 4MS2A 4P9PA 4PA9A 1M57C 2Q6AA 4XDJA 3RVZA 4JTAB 3OR7C 1OCRC 5CBFA 1KKDA 2P7TC 2HVJC 4PDVA 4R6ZA 2A9HA 4P30A 4TWKA 3LDDA 3K08A 4MVOA 4PA6A 5EBLC 3E8HA 4RAIA 4F4LA 2Q69A 2WLIB 4BW5A 2X6AA 3T1CA 2NLJC 5J9PC 3K06A 2R9RB 1S5HC 2DWEC 1K4DC 2WLKA 4LBEC 4MVMA 4WFFA 4CBCA 2X6BA 3KG2A 1V55C 3JYCA 3R65A 3STZC 2WLLB 5CBGA 3ZJZA 2A0LA 4MTFA 4X88A 3TETA 2WLMA 4MW3A 2EIJC 2K1EA 1M56C 2JK5C 1OCZC 1XL6A 1OCOC 3F7VC 1K4CC 3GB7C 2YEVA 4GX2A 3K0GA 4RUFA 4XDLA 2DWDC 3SYCA 5KUMA 3F5WC 4GX1A 4I9WA 4JTDB 2QTOA 3F7YC 2EINC 3FB6C 2BOBC 4QNHB 4UUJC 2X6CA 4WFEA 1JVMA 3UM7A 5IY5C 3ASOC 4R7CA 1P7BA 1LNQA 3PJSK 2HFEC 1V54C 3RBZA 1ZWIC 3AG3C 4X89A 4LCUC 2WLHA 2Y69C 2EIMC 4R8CA 4XDKA 3SJQC 4OXSA 3T4ZA 2QKSA 4H33A 4MTGA 4X8AA 3ABLC 3FB7C 3SPGA 4P2ZA 4MVQA 5EBMC 3SPHA 4RO2A 1G4YB 2KB1A 4PDRA 4MW8A
chains in the Genus database with same CATH superfamily
5LMNO 2NR5A 2YDEA 2Y4TA 1E79G 1KQSU 1GM9A 2DYRC 1ZUQA 1VP7A 5IE9A 1VQPV 2KSDA 1SQGA 4XBFA 3OTOO 3FYIB 2VWKA 2P90A 3DTUB 3ASOB 5CB4A 1YZBA 4KL1A 2IBZH 5BXZA 4JI3O 2YEVB 4J9YB 1HWYA 4ZIBA 3AK3A 5EC2C 1KD1W 4DRXB 2WLJA 4MVSA 1H8HG 2EILB 2ZM6B 3SYQA 3E8BA 4TV8A 3ZRXA 2QGNA 3HB3B 1NZ6A 4CH5A 2UXXA 5J2TA 1L0LH 3WG7C 1BL8A 4O4HB 2EJRA 1SZXA 4ZOLB 5B1AC 2CTPA 2E3CA 3FAVA 3P30A 5CA1A 1S0VA 1AP6A 1OCRC 4R6ZA 3RYFA 5EBLC 2WA4A 4FPPA 2OTLV 2L6LA 2X6AA 4B08A 3RT3C 4FLTA 3OW2U 4YHHO 3STZC 3JYCA 3H01A 4CZZA 3L70H 4I9WA 2BOBC 1N34B 2QWQB 5CA3A 4UV8A 1IBKB 1LNQA 4DR7O 5JH7A 2OYQA 2WLHA 1N36B 1VQ9V 3SPHA 2FMLA 1YCIA 4O4IB 1QVFU 3K59A 2EJ7A 4FVMA 5ITZA 5JJEB 5LMUO 2QDOA 5EZYB 1Z5VA 5BZBA 1YITV 3CE2A 3IGAC 4DR1O 1AI4A 1M93A 2LFRA 5FLXN 4JGSA 2DW4A 2KG7A 2Q0AA 1U97A 2Y4UA 1R3IC 4IYIA 1H2KA 1K9MW 5LXTA 3APQA 1IXBA 1GM7A 2AHZA 5C8YB 1CXZB 5EC1C 1V55B 2UUBO 1AP5A 1OCCB 3B8MA 4JI4B 3UCSC 3SJBC 2OIEA 2B1GA 4PDLA 4U7NA 4Q20A 5KAIZ 1ENVA 4HYOA 4FFBB 4PA3A 1M57B 2WLIA 2ZR2A 1FFXA 2BE3A 5J2UA 1DTOA 1NH2B 3LDDA 2YXHA 4O4JA 4BW5A 3T1CA 2QA4V 4WFFA 1VQ4V 3HKBB 3MDSA 4E2LA 1PNKA 3E22A 3ZRWA 3I56V 4FLYA 4MTFA 4GZRB 3TETA 2YS8A 4K35A 4UV9A 1OCOC 2CH7A 1MMMA 4JI4O 2Z5UA 4KHPO 3ML0A 1P49A 3CCJV 1TAEA 1XDCA 1SRYA 5IYDO 2ZKOA 2PTMA 4WCEV 5IY5C 3A0HZ 2JJ1G 3RBZA 3B4SA 2UUCO 4DRXA 4LCUC 4H33A 4NR1A 1ZL8B 4WBNB 1GM8A 4OX9B 1UFIA 4ZI7A 2BSKA 5K1PA 2H8PC 2Q67A 1X4TA 4DV0B 3BCCH 4W4KA 1HNXB 5TISZ 2YICA 3AG1C 4DR2O 1SETA 3H1HH 1K3EA 1XOUA 2ITCC 4HAMA 1SQQH 1KUQA 2R9IA 3ZRVA 2UUAB 5CA1B 4GCZA 1TVKB 3B09A 3ZHUA 4IHJA 5F2VO 2W0FC 1ZX3A 1WA8A 2Q7GA 5E1AC 4LFAB 1HNWB 4K8ZA 3W7SA 3K5NA 1QNMA 1KECA 3A0BZ 2XT9A 2Q8VA 2Z3YA 4YJ3A 4F6EA 1TUBA 2K9PA 3HKDA 1W59A 1H2MA 3NR7A 1H2GA 2IJJA 1G6UA 4O4LA 3JARB 4LF7O 3E89A 2P4KA 3AG3B 3E83A 2LGQA 2AZ0A 2IU0A 1N4CA 2ADQB 3OUFA 3CCLV 1N33B 4PA9A 1N0NA 3CCVV 2ODMA 1SF9A 4DR1B 4QPKA 1QR8A 1QU7A 1CPYA 3AK1A 4DR6B 5LHIA 4EEQA 2NLJC 1FKAO 2HEPA 4NYKA 1COWG 2QSAA 1XMOO 5IT9N 4QIWF 2F43G 3J7AU 1WJZA 3G80A 2HLDG 2YEVA 4RUFA 4PI0A 2ZM6O 3BABA 4JTDB 4NTXA 4IL6Z 1ZSPA 1JVMA 3ASOC 3QTCA 3OAAG 1M5IA 2UXCO 3G67A 1NTZH 1BHBA 1Z5WA 2RQ6A 5CMUA 1W0JG 3ZBHA 3ABUA 5BMVB 3QF7A 2YC0A 4ZOLA 1QLNA 1XL4A 1QHTA 1VIBA 4QE9A 5D5PA 3CX5F 5KHJA 3QG5A 5KX5A 1VARA 5B1AB 4FLZA 2ZDIC 2G38A 3GWOA 4LFCO 4GKJB 1I08A 2PYJA 4FZ0A 5IYBO 5LP6B 1VQ6V 4ZKIA 1WPXA 2HG5C 3JAKA 3K04A 4QPJA 5BY1A 2EINB 1R6KA 1GN3A 4HNAA 1YXBA 2UU9O 3FB5C 1BMFG 4DV3O 3TCUA 1WP7A 2B5UA 4MTXA 4NXMO 3JAWB 3JSLA 1RFYA 1Q6UA 5CN0A 4PELA 1KKDA 2XAHA 4DV1O 2YSUB 1JJ2U 3ETDA 1D2DA 3IAYA 4DK0A 1EZVH 4GKJO 5LXTB 4JYYA 1XI1A 3FYEB 4JYAO 4DV5B 2WLLB 4JYAB 2AGAA 2VWJA 1CEZA 2XAJA 4IYHA 1R6TA 4XDLA 4LFAO 1JMKC 3FB6C 2X6CA 2NNUA 2QM7A 2X7RB 4TUYB 2FYUH 3K9SA 2H94A 1XNQO 3JD1A 1I94B 1Q6IA 2UXBB 1AI7A 5HFMA 4X89A 4ASUG 2Y69C 3QO7A 1CP9A 1WAZA 2IJHA 4FLUA 2EIMB 2ILMA 4PDRA 4NXNO 1Y6XA 2V7QG 5H5NA 2QR4A 3BEHA 5IWAO 1KMIZ 4B3MB 3QVNA 1WB8A 2YIAA 2LP7A 5JWPA 2JRIA 2E74B 3C3TA 1QQCA 1HR0B 1IX9A 3A2FA 4LFCB 1M90W 3HR0A 2LO1A 4UCVA 3AG2B 2DJVA 5KUKA 3E8FA 5IYZB 3OGIB 5GONB 4FZ1A 3QNEA 1IBMO 4KHPB 1M56B 3AK2A 3P3NA 3EXAA 3L74H 1XEQA 1R6NA 2BSKB 4G27B 3I55V 2QWNB 2AXTZ 2ZIMA 5FNVB 1SC5B 4CC5A 4I7ZB 5B66Z 1WA8B 1KP2A 3RVYA 2GBOA 5KHGA 4MTOA 2JVDA 4JAAA 2GSMB 3RN4A 4AQYB 4RQFA 5E79Z 1Y4MA 2HVJC 3K79A 2CTRA 5GTHZ 2EULA 4CS2A 4LFBB 4RAIA 1GRJA 5J9PC 3HKEA 3S3WA 2LFSA 4LF6B 3ZS8C 4K3AA 2EZOA 4TV9A 4DUYB 5JQGB 4I4TB 3FD9A 3JALB 1SQPH 4JYBA 1NKDA 1XNRB 5LYJA 3H1LH 4D7TA 1KP3A 2EINC 2QWRB 3CCUV 4YJ3B 2HHHO 1DLBA 3RYCA 1NTMH 3AG3C 2GV9A 2YIDA 4JI7O 3UQ8A 4AHCA 3P32A 3L9DA 2P06A 1SS3A 4FFKA 3ETQA 1XMQO 4JI6B 2RN9A 2C2AA 2A79B 3UO2A 1XBLA 3E8GA 3N2GB 2IJIA 3CC2V 4FIPC 3ICXA 2MW2B 1OV9A 2XASA 2HVKC 4YXWG 2XNDG 3G6BA 1EFRG 2NN4A 3ZHTA 3BA9A 1XUQA 3LSQA 1GN6A 2EIJB 3UO3A 4ZHQB 2Y48A 4JI2B 1JR9A 4YHHB 3SJCC 1L0NH 3ABMC 2R70A 3RYIA 4JTCB 5H6QA 1VF5B 4E4EA 1PNMA 4EFBA 3H1JH 3TXQA 1FYJA 1VMGA 4GX0A 1MSDA 2XAQA 1SA0A 4K8XA 1VQ5V 1VQLV 2AZ2A 1NH2D 4FMTA 1XQ8A 3IC7A 3K06A 1QLEB 1YSCA 3ZJZA 1M56C 1XL6A 3CP1A 3JAWA 5GTIZ 1K7DA 1VQ7V 4FK5C 2V4DA 3F7YC 3S3XA 2UXDO 1IZ3A 2FB5A 4O4IA 1JPXA 3OEHG 4IGGA 3JAKB 1V54C 1US6A 3WU2Z 1Y76B 3PN1A 5K1XA 4LF4B 4DV2B 1VF6C 3ZHSA 2KB1A 2PYLA 1FAFA 4LF8B 5FNVA 2UU9B 4X66B 3TJTA 3GWKC 3KCXA 1HNXO 2ZNJA 2GHYA 1PKXA 1R3LC 4NTYA 2BTOA 1H38A 1VF6A 1F4MA 1I5YA 4ZBMA 3SYPA 4LNUA 1XILA 5JVDB 1OJHA 2LQTA 3W7XA 5EYPB 4PV1B 2Y69B 4YJ2B 4C7UA 2CE4A 1R3KC 2VS0A 2ZD9A 4UCUA 1MA1A 4JI0O 2WAMA 2EBOA 2VQFB 1RSOA 3UT5B 4DR4O 3CRAA 3CXHF 1M57C 3HKBA 1JFFB 3QO5A 5CBFA 2OWOA 4FM0A 1AR5A 4RQEA 2UUCB 2RCVA 1E1RG 4NVPA 2X6BA 5CB4B 1DK1A 4K0KO 1NT2B 4O4HA 2K1EA 2JK5C 4GX2A 1OHHG 3D3QA 3FAVB 2BCCH 2DOSA 3SYCA 3W7TA 1MSWD 1D5NA 4CH4A 1Q5OA 2F93B 3UM7A 3ZMZA 4DR7B 4BIZA 1LR1A 2HFEC 4JI8O 1ZWIC 4LF8O 1OCRB 1YF2A 4XDKA 3JATA 4OXSA 3WB0A 5LGNA 4TV9B 3L72H 4I4TA 3OFNG 5DECA 3VQYA 3K5MA 4FLXA 3RYIB 1EN4A 2FTKA 3SYAA 2W6IG 2ZDIA 5KMGA 2ZQMA 4OX9O 5IJ0A 5L3CA 3U11A 3ZN0A 3RYFB 4B3SO 3RYCB 3AG1B 3JALA 4EB6B 4WFHA 2RJZA 3VQXA 3OGCC 4DK1A 1XREA 1RP3B 1PV0A 2UUAO 1VQMV 4DW1A 5B1OA 5B1NA 3OEEG 3SPIA 1PNLA 5B1BC 5EBWC 2EIKC 2UUBB 2Q9LA 4LR3A 4X1KA 4D6TH 3L71H 3N2GA 1NI8A 1N0JA 2KG7B 4X62O 4DXWA 1JJOA 4I55A 3T2MA 1QCEA 3Q4HB 4YIPA 2A06H 3M7MX 4QE7A 5AG2A 4UFZA 3CCMV 5L3GA 1DF5A 2QEXV 1K34A 5J2TB 5DM6V 3ABMB 2Y0PA 4P30A 3K08A 4Z1MG 4UB6Z 3CPWU 2IW5A 4CBCA 3DC6A 3KKYA 3ZMSA 1IBLB 1V55C 3A8TA 3SDLA 4BWAA 4ZHQA 2EIJC 1P4RA 3H1IH 4JI1O 1K92A 4JF3A 1YJNV 1S72V 3ZHRA 3JCUZ 2WPDG 1OCOB 2Z0AA 3CHXA 3K5LA 4O4JB 5IYCO 2A3QA 2OCCB 4X20B 1PL4A 2ZE6A 3THOA 4CC6A 3RYHB 5LHGA 1SA0B 3W7UA 2D3OW 4J7JA 3DC5A 1SERA 2QTSA 2PGGA 4I5SA 1ROPA 4GT1A 1AI5A 4JI8B 1JOYA 1S5LZ 2ATKC 5JH7B 3CB2A 2P5OA 1ORQC 2DYSC 4B3TO 4WFGA 4DV1B 3STLC 3K0DA 1KC8W 1JFFA 1MABG 3M8AA 2IH3C 1RM1B 3MHSC 3CRRA 1Y74B 4IIJB 1V54B 4CS4A 2CGOA 4TOIA 3ZX6A 4AQYO 5LP6C 2EX3A 4O2BB 2BOCC 2FL4A 5KHHA 1F51A 2P6JA 4B7EA 1YI2V 4FM1A 4CS3A 1U96A 1AR4A 3BHPA 4BIUA 3ETGA 1EZJA 4JI6O 4JTAB 3OR7C 3N27A 2P7TC 2W6JG 4LF5B 3LNNA 2Q73A 3E8HA 2ZR3A 3MHHC 5JVDA 2CGNA 4LF7B 5BR8B 1RSOB 1Y66A 2P4VA 3UT5A 3RWRD 4AILC 2Q0OC 4NXNB 3B8NA 3CEIA 1MZFA 4DO2A 1K4CC 3N2KB 2F4VB 3JD2A 2YI9A 2KKWA 2ZE8A 2OTJV 2JEXA 5EYPA 5JJNB 1Q7YW 3CRQA 4HBNA 1XHZA 3HKDB 3PJSK 1E1QG 3TGUH 1VQOV 4X65O 2LGWA 4DW0A 1WNSA 2YXLA 3CXCU 3TXSA 4UB8Z 5IDJA 1SKVA 2HP8A 3OMNB 3X2QB 3E35A 3ZHVA 1W0KG 4I9QA 1ZL8A 4GKKO 4U3JB 5B3SC 1IXMA 1VQ8V 3JATB 1YJ9V 1Q82W 1HR0O 4DV7B 2RNBA 4F6RA 4Z1VA 1Q86W 3AG4C 3JSNA 2ZINA 1XMOB 1S3JA 3OMAB 3RFRA 3LNMB 3K57A 1YIJV 1PD3A 4LF4O 1K73W 4R50A 4UVAA 4EB6A 5LA6B 1YTFB 2HJFC 4O2AA 3U10A 2CTWA 3JD3A 1R1BA 3OE7G 3CRMA 4JV5B 1OZ0A 5H2FZ 1TUBB 1GKFA 1MG1A 3D3IA 4L8JA 2F23A 1GN4A 1AI6A 2BTQB 4J7ZA 2LW7A 4G2KA 3RVZA 4J11A 4PDVA 1HNWO 4MVOA 3ZMUA 1QBZA 5LMUB 2RMKB 1HP8A 2XAFA 5KAFZ 3CMEV 3CS5A 4HNAB 4KXRA 1ZTEA 3KG2A 3SGIA 4GYCB 4LH6A 1B3QA 2X0LA 3ABKB 2WA3A 3HKCB 2JEUA 3OD4A 3K58A 3F5WC 4DV4B 1Q81W 2VQEO 5DEDA 2VQFO 1W2BU 2FKXA 5ITZB 1BQ0A 2F4VO 2JDIG 1VQKV 1BGYH 3DSQA 4PHZA 1Q8IA 3K5OA 1URFA 1G4YB 1AB3A 3OMIB 1NVPD 4MT8A 2YI8A 4MW8A 2QE7G 3JD0A 5IWAB 3WB2A 4MSWC 2EILC 2AHYA 2DQ3A 1FXVA 1J5EB 3H9VA 2WLNA 4DR6O 4PI2A 2YIBD 3H1KH 2XHBA 2XOKG 3ZHQA 5B5EZ 4UCOA 3DXRA 1BT8A 1Y67A 2L35A 4FJCC 1Q90D 1V9PA 1LUVA 3CJHA 5JCOA 2IM9A 2QKAA 1PM9A 4JI5O 4I50A 1AJQA 2M6YA 5LOVB 2YXYA 3AEIA 4A5UB 3T1YB 1NR7A 2ITDC 4DR5O 1A32A 1M9NA 3U0ZA 1FPOA 2Q68A 4UCSA 1WB7A 3A0RA 5GONA 2IU3A 4BAYA 3AG2C 1B6QA 4WFAV 4P9OA 1S5JA 1L1FA 2Q6AA 3T1YO 1GH6A 4X1IB 3GVMA 4DV3B 2VRZA 4QGPA 2E76B 3B77A 2N74A 4LBEC 1I0HA 1BZKA 3AG4B 4EFEA 4CH3A 2WLMA 4MW3A 4U3JA 1OCZC 1N36O 5CA0B 1NTKH 1T5EA 2OIGA 2E5LO 3TK1A 2QTOA 2XTAA 4UUJC 3NXSA 1M4UA 2LJ2A 1KBHA 4R7CA 1P7BA 2W0XA 2HHHB 2ETNA 1FXKA 4DV4O 4DV6B 1FJGB 4RO2A 1RM1C 1XNRO 1SZTA 1YVWA 4TUYA 4X66O 1NQTA 3JASB 3ZN1A 5LA6A 4LWSA 1G1XB 4X9QA 2Q4PA 5L3FA 3ETEA 1GAXA 4MVRA 3FB8C 4EKWA 3LSUA 4LP8A 3ABKC 2PUSA 1FJGO 3ZCCA 1GK9A 3VBBA 3EHBB 5EK0A 5L3EA 1HW7A 3OUSA 3SPJA 3G6EV 4TQFA 1P84F 1THZA 4PD4F 1AVMA 3B2EE 4JPRA 2QJ1A 3VOUA 4U3FH 2R72A 3CRCA 1FFXB 4JI0B 3I5DA 4O4LB 1OCCC 1FXHA 3OM3B 2R9AA 3ABTA 3L75H 1R73A 3LDCA 3O9OA 4X1YB 3WG7B 3CWBH 3MD0A 3IJ4A 4OGQB 1YTFD 2CK3G 1TUEB 1IBLO 3SYOA 3CC4V 1AROP 1I5XA 3WFVA 3E86A 4RUEA 5LBQA 2DE0X 2HR3A 4P9PA 1NR1A 5B3SB 1BHAA 1F4NA 4XDJA 1G8MA 3K3WA 2B9ZA 2ZE7A 4PA6A 3CCRV 3D36C 2ZCEA 4GKKB 4GUNA 2Q69A 4DV0O 4BIOA 4UCTA 1YHQV 2DWEC 1K4DC 5FL7G 1KB9F 5CBGA 2A0LA 4DV7O 2ZXWB 3GB7C 3F7VC 1AR1B 3ASNB 5KA6A 4DV2O 4X64O 3E2EA 4Q6GA 3CCQV 4O2AB 2YUAA 4KP4A 2GTSA 4DR3O 5GW7A 1YEWA 4B3TB 1DF4A 5KMGB 1N34O 4R8CA 2QKSA 4DUZO 3C90A 4I50B 3IC9A 4H0LB 4X64B 2N05A 4IHJB 4WF9V 3BAAA 3BA8A 2F95B 4MVUA 1PL0A 4JI7B 2LW1A 3P3PA 2GDSA 3LDEA 3FFQA 2GUZB 3ZRSA 3BY6A 3ZMVA 3CSXA 3OR6C 4YIOA 1M1KW 1N32O 5FPOA 2E75B 4WFBV 1AJPA 5LP6A 3T4DA 4NTWA 5KLVH 3BFRA 4JI3B 2N04A 3BRCA 4JASA 4X1KB 1GTOA 3JARA 5LL6Y 4GLXA 1VF7A 1BCCH 2CDYA 4I55B 2XAGA 5A9GA 3K03A 1EM1A 5CBHA 2YIBA 2CUGA 2UXCB 1SQFA 4UCRA 5B1BB 1I7FA 1KKCA 5LMNB 2JIZG 3L73H 3O65A 1X59A 3DXRB 5L3BA 4X62B 4H37A 1LUWA 1MOFA 2IH1C 1EN5A 1FXKB 1HDJA 1S77D 4YJ2A 5A2QN 1H2SB 2QWPB 1GMGA 1QVGU 1K8AW 4F4LA 3LSSA 2WLIB 2R9RB 1S5HC 3T1HO 2WLKA 4DR4B 1Q6HA 3R65A 3C3SA 5LGUA 4X20A 4H44B 2JGDB 3ABLB 5BMVA 1IBMB 4X1IA 1JCHA 3ZEDA 2WWWA 4GX1A 1AILA 1PP9H 3E22B 4NB5A 1JA8A 4WFEA 3G71V 3CD6V 4ICGA 1B04A 2ZT9B 3M99B 5L3DA 4X8AA 3SR2C 3FB7C 4FLWA 3SPGA 2PF4E 5D5QA 3JCZA 1Y76A 3VQVA 4JV5O 3LUTB 3RGBA 2M7WA 5FPRA 4ZI7B 5CA0A 1BQZA 1OCZB 3F5TA 4JAUA 2WLLA 4PDMA 4IIJA 1UJWB 2QM8A 2ZE5A 4G28B 5IJ9B 4J9ZB 4D7SA 4DR2B 4LC1A 1TGOA 2Q7EA 4JYCA 4LF9O 2RDCA 1WLEA 4PA4A 5JJJB 2F1MA 2PI4A 4PA7A 1J95A 2XUMA 1IBKO 2WSSG 2QKCA 4DV5O 2DQ0A 3B40A 4UXNA 4B3SB 3VQWA 1F7YA 5KHIA 2IJKA 2EIKB 2OCHA 2Q7HA 3W7WA 3QO8A 1S76D 3RW0A 4FM2A 4RWUA 2HKOA 1IDSA 2EZPA 1DGSA 3JASA 2ZIOA 1L8DA 4AI8A 3OTOB 4DYLA 2A9HA 1NS1A 5JQGA 1AJNA 4X65B 4X1YA 4I0XB 1VQNV 4N21A 5KHKA 5LYJB 2AW9A 1XNQB 2O57A 1K97A 1YDXA 3BVOA 3K9AA 4X88A 1KU9A 4UVCA 3K0GA 1YJWV 4K0KB 1HNZO 4N23A 2PY5A 1BS3A 4B3RO 2H3OA 2DYRB 1Q3EA 3DGEA 4TV8B 4J10A 4J41A 3FX7A 4PJ0Z 4W4LA 3J80N 2JGUA 3SJQC 3T4ZA 4JI1B 4MTGA 1BSMA 2V1DA 5EBMC 1H2NA 4J7KA 1ZAUA 4BR6A 5EIBC 1XHXA 4B3RB 3MAQA 1EN6A 4ABMA 1WPBA 4KFMA 1H8EG 3JD4A 5JCOC 1BE3H 3JAMN 3R66A 2GTAA 3ZMTA 3RYHA 2OCCC 1R3JC 1FD9A 5DN6G 4J42A 1JQ0A 1SESA 4MVZA 1GO3F 3OT7A 2GUZA 3OTFA 1SQVH 2PZSA 4LF9B 3J81N 3KCYA 4BW9A 3CCEV 2CAZC 5KX5B 4JI5B 1D5AA 4UVBA 4IT5A 4HZ3A 2A7WA 4U7OA 2D2CB 3AG7A 3HKEB 1SQXH 4DR3B 3FKSG 2ZXWC 2ADPA 4TSFG 5C93A 3ASNC 1FS0G 1PPJH 1FFTB 1N33O 4TQDA 4MS2A 2UXDB 5KA5A 5EZYA 3BPZA 3Q4HA 4B7KA 5EIBD 1RPOA 2ZNIA 1MNGA 1HNZB 2KQXA 4JAVA 5BR8O 1IVSA 1FXKC 5H6RA 5LHHA 3G4SV 4JZGA 2DWDC 2UXBO 1GN2A 4NXMB 2P22C 1I94O 1QR9A 4QNHB 4YY3O 1Y74A 1B06A 3KZIZ 1N8RW 4J80A 1O9GA 2QM4A 2EIMC 3ABLC 4P2ZA 2JGDA 4DV6O 3N2KA 3T1HB 2JS3A 4DR5B 4OPHA 5C8YA 4FFBA 4LNUB 4B3MO 3D8CA 1NBMG 3CJHB 5J2UB 4LF5O 3CMAV 5LOVA 2DMXA 2CH7B 3CC7V 4GX5A 3UKMA 2MK3A 1K33A 1EBOA 1KYOF 2B1IA 3IFXA 4LFBO 2QWOB 1QLEC 3HPLC 5IYZA 3SJAC 3X2QC 1Z2GA 4JI2O 1TA8A 2DYSB 3SPCA 1P7GA 3D36A 3EFFK 5HFLA 1H2LA 1SQBH 1NJIW 4F6RB 2JJ2G 4JZ2A 1VEWA 3ZRWB 4FLVA 1RPRA 1NU1H 4O2BA 1Q43A 4DUZB 2PI5A 1WP8A 2Q5ZA 4TWKA 3CCSV 3WB1A 4QJFB 4NKGB 2JS5A 2DN9A 4DUYO 4MVMA 5IY5B 2ARHA 2P67A 2F66C 1TVKA 5IJ9A 4YY3B 4CH6A 3ZIAG 1WN7A 4KUMA 4WBNA 1MZEA 3EVKA 1N32B 4LF6O 2BTQA 3APOA 4TT3G 5KUMA 4LH7A 1K5SA 4Z2WA 2Y0IA 2CTQA 1NVPB 1O9HA 1K5QA 1JX9A 4I0XA 1J5EO 5H9CA 2VQEB 2E5LB 1ZLZA 4LWSB 1F23A 4OPAA 1UPGA 4H13B 1IURA 2UXNA 4L87A 5IJ0B 2HJDA 4MVQA 5LGTA 3HKCA 2OT5A 3CYOA 1XMQB
chains in the Genus database with same CATH topology
4MVUA 2V7QG 1PL0A 1JOYA 1KQSU 1E79G 2ATKC 3BEHA 1GM9A 2DYRC 3LDEA 3ZRSA 3BY6A 1VQPV 1ORQC 2DYSC 2LP7A 4XBFA 3FYIB 4WFGA 3ZMVA 3OR6C 3STLC 1M90W 2P90A 3DTUB 1M1KW 3K0DA 1KC8W 3ASOB 3AG2B 4WFBV 1AJPA 3T4DA 1MABG 5KUKA 3E8FA 4JASA 1GTOA 2YEVB 2IH3C 4J9YB 1HWYA 3QNEA 1RM1B 3MHSC 5EC2C 2XAGA 1KD1W 1M56B 2WLJA 3K03A 4MVSA 1V54B 5CBHA 5B1BB 1H8HG 2EILB 1R6NA 2BOCC 4G27B 3I55V 3SYQA 3E8BA 1F51A 2P6JA 2JIZG 1YI2V 3ZRXA 3HB3B 2UXXA 5L3BA 3WG7C 1KP2A 1BL8A 3RVYA 2EJRA 5B1AC 4BIUA 4H37A 1MOFA 4MTOA 2IH1C 1FXKB 3ETGA 1EZJA 1S77D 2GSMB 3OR7C 3P30A 4JTAB 4RQFA 1S0VA 1OCRC 2P7TC 1Y4MA 2HVJC 4R6ZA 2W6JG 3K79A 1GMGA 1QVGU 5EBLC 1K8AW 3E8HA 4FPPA 4RAIA 4F4LA 3LSSA 2ZR3A 2WLIB 3MHHC 2OTLV 2X6AA 5J9PC 2R9RB 1S5HC 3OW2U 2WLKA 2LFSA 3STZC 3JYCA 3R65A 1Y66A 2EZOA 5LGUA 3B8NA 3H01A 4DO2A 1K4CC 4CZZA 3ABLB 4JYBA 1NKDA 3JD2A 1JCHA 2WWWA 4I9WA 4GX1A 2OTJV 2JEXA 1KP3A 2EINC 2BOBC 3CCUV 1Q7YW 4WFEA 5CA3A 3G71V 4UV8A 1DLBA 1LNQA 3CD6V 3PJSK 1E1QG 3AG3C 1VQOV 2WLHA 3M99B 5L3DA 4X8AA 3FB7C 3SPGA 1VQ9V 3SPHA 3CXCU 1QVFU 5IDJA 3P32A 3OMNB 3X2QB 3E35A 3JCZA 1W0KG 3LUTB 5BZBA 1YITV 2M7WA 3IGAC 1AI4A 5B3SC 2C2AA 2A79B 1IXMA 1VQ8V 2LFRA 1OCZB 4JAUA 1YJ9V 2WLLA 3E8GA 2DW4A 2IJIA 4JGSA 4FIPC 4PDMA 2QM8A 4G28B 1UJWB 1Q82W 2XASA 3CC2V 4J9ZB 2HVKC 4LC1A 4YXWG 2XNDG 4JYCA 1WLEA 1R3IC 4PA4A 1Q86W 1EFRG 2PI4A 4PA7A 1J95A 3AG4C 1K9MW 2WSSG 1S3JA 3OMAB 3LSQA 1GM7A 2AHZA 2DQ0A 2EIJB 4UXNA 3LNMB 1YIJV 1PD3A 5EC1C 1V55B 1K73W 2IJKA 2Y48A 4R50A 4UVAA 1OCCB 3B8MA 2EIKB 3ABMC 1YTFB 4JTCB 5H6QA 2B1GA 1PNMA 2HJFC 3QO8A 4PDLA 4U7NA 4Q20A 3W7WA 1S76D 3JD3A 3OE7G 3RW0A 1ENVA 1OZ0A 4HYOA 4GX0A 4PA3A 1M57B 1GKFA 2HKOA 2WLIA 2EZPA 1MG1A 2XAQA 3D3IA 2ZR2A 1AI6A 4G2KA 3RVZA 1VQ5V 1VQLV 4PDVA 1DTOA 1NH2B 2A9HA 3LDDA 4MVOA 1AJNA 1NH2D 4FMTA 3ZMUA 1QBZA 3IC7A 1VQNV 2XAFA 4N21A 3T1CA 4BW5A 3CMEV 2QA4V 3K06A 4WFFA 1QLEB 1VQ4V 1K97A 3KG2A 4E2LA 1YSCA 1PNKA 3K9AA 3ZJZA 3ZRWA 3I56V 3CC4V 4MTFA 4X88A 3TETA 1M56C 2X0LA 4UV9A 3ABKB 4UVCA 1XL6A 1OCOC 3CP1A 3K0GA 1YJWV 2Z5UA 3ML0A 4N23A 1K7DA 2JEUA 3CCJV 1VQ7V 4FK5C 3F5WC 1SRYA 3F7YC 1Q81W 5IYDO 2DYRB 3DGEA 4WCEV 5IY5C 1JPXA 1W2BU 2JJ1G 3OEHG 1V54C 3RBZA 2JDIG 4LCUC 3SJQC 1VQKV 3T4ZA 4H33A 4MTGA 2V1DA 5EBMC 1GM8A 1G4YB 3OMIB 2KB1A 1NVPD 4MT8A 4MW8A 2QE7G 2H8PC 2Q67A 3JD0A 4MSWC 2EILC 2AHYA 2DQ3A 1FXVA 3AG1C 1SETA 2WLNA 2GHYA 4KFMA 1H8EG 1PKXA 3JD4A 1K3EA 1R3LC 2ITCC 4HAMA 1H38A 3ZMTA 2R9IA 3ZRVA 2XOKG 1F4MA 1I5YA 2OCCC 4ZBMA 1R3JC 4GCZA 5DN6G 1JQ0A 2W0FC 3SYPA 1SESA 4MVZA 1GO3F 5E1AC 4FJCC 3W7XA 3W7SA 1KECA 3CCEV 2Y69B 2Z3YA 1AJQA 3AEIA 1NR7A 2ITDC 1R3KC 4UVBA 1M9NA 4HZ3A 2Q68A 2ZD9A 4U7OA 2WAMA 2EBOA 1H2GA 2IJJA 2ZXWC 3FKSG 4TSFG 5C93A 3A0RA 3ASNC 1FS0G 3E89A 2IU3A 4BAYA 3AG3B 1FFTB 3AG2C 3E83A 1B6QA 2IU0A 4P9OA 4WFAV 3OUFA 4MS2A 3CCLV 4PA9A 1L1FA 1M57C 3CCVV 5KA5A 2Q6AA 3QO5A 5CBFA 4QPKA 3B77A 1QR8A 4RQEA 1CPYA 1E1RG 5LHIA 1RPOA 2NLJC 4LBEC 4JAVA 2X6BA 3AG4B 1COWG 4QIWF 2WLMA 4MW3A 1FXKC 2F43G 2K1EA 5H6RA 5LHHA 2JK5C 1OCZC 4GX2A 3G4SV 2HLDG 2YEVA 1OHHG 4RUFA 2DWDC 3SYCA 3W7TA 1MSWD 1QR9A 4JTDB 3TK1A 4QNHB 2QTOA 4UUJC 3NXSA 1JVMA 1N8RW 3UM7A 3ZMZA 3ASOC 4R7CA 1P7BA 4BIZA 2HFEC 1ZWIC 3OAAG 1OCRB 1FXKA 2EIMC 4XDKA 4OXSA 5LGNA 1BHBA 3ABLC 4P2ZA 3OFNG 4RO2A 1W0JG 5CMUA 1SZTA 1RM1C 1NQTA 3ZN1A 3ABUA 2FTKA 3SYAA 2W6IG 1QLNA 2ZDIA 5L3FA 3ETEA 2ZQMA 1XL4A 4MVRA 3FB8C 4QE9A 4EKWA 5L3CA 4LP8A 3ZN0A 1NBMG 3AG1B 4WFHA 3ABKC 3OGCC 3CMAV 3ZCCA 1GK9A 3VBBA 3EHBB 5B1AB 5EK0A 2ZDIC 5L3EA 3OUSA 3CC7V 4GX5A 3GWOA 3SPJA 3G6EV 3UKMA 1THZA 2MK3A 1VQMV 1K33A 4JPRA 1EBOA 5B1OA 2B1IA 3IFXA 3OEEG 5B1NA 3VOUA 5IYBO 3SPIA 1PNLA 5B1BC 5EBWC 4ZKIA 1VQ6V 1QLEC 1OCCC 1FXHA 2EIKC 3OM3B 3HPLC 1WPXA 3ABTA 2HG5C 3X2QC 1R73A 3K04A 4QPJA 3LDCA 2EINB 2DYSB 3SPCA 1R6KA 4DXWA 3D36A 3WG7B 3EFFK 3MD0A 5HFLA 3T2MA 1QCEA 1NJIW 2JJ2G 1YTFD 2CK3G 1TUEB 3ZRWB 3FB5C 1BMFG 1AROP 3SYOA 1I5XA 2B5UA 4MTXA 3TCUA 3E86A 4QE7A 4RUEA 3WFVA 1RPRA 5LBQA 2HR3A 4P9PA 3CCMV 5L3GA 1NR1A 5B3SB 1BHAA 1DF5A 1F4NA 5CN0A 4XDJA 2PI5A 4PELA 1G8MA 2QEXV 3K3WA 1K34A 1KKDA 2XAHA 5DM6V 3ABMB 2YSUB 4P30A 4TWKA 1JJ2U 3K08A 4PA6A 3CCRV 3CCSV 3ETDA 4Z1MG 2Q69A 4QJFB 3CPWU 2IW5A 1YHQV 2DWEC 4MVMA 1K4DC 4CBCA 5FL7G 3FYEB 5IY5B 2P67A 3ZMSA 1V55C 5CBGA 2WLLB 2A0LA 1CEZA 2XAJA 2EIJC 3ZIAG 1P4RA 2ZXWB 1K92A 4JF3A 3GB7C 3F7VC 4KUMA 1AR1B 3ASNB 1YJNV 1S72V 5KA6A 4XDLA 2WPDG 1OCOB 3E2EA 3CCQV 4TT3G 5KUMA 3FB6C 1K5SA 1NVPB 2X6CA 2NNUA 1K5QA 2QM7A 4KP4A 2OCCB 2X7RB 1JX9A 5IYCO 5GW7A 2H94A 3JD1A 5H9CA 1AI7A 1F23A 1DF4A 5HFMA 4X89A 4ASUG 4R8CA 2Y69C 2UXNA 3QO7A 1CP9A 5LHGA 4L87A 2QKSA 3W7UA 2D3OW 2IJHA 1SERA 4MVQA 2EIMB 4I5SA 1ROPA 5LGTA 2OT5A 3CYOA 4GT1A 4PDRA 1AI5A 4WF9V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  2Q67 A;  4MVU A;  4MSW C;  3SYA A;  2EIL C;  3BEH A;  2ATK C;  2AHY A;  2DYR C;  3LDE A;  3ZRS A;  1XL4 A;  4MVR A;  3LUT B;  1ORQ C;  2DYS C;  3AG1 C;  3FB8 C;  5BZB A;  2WLN A;  3IGA C;  4KFM A;  4QE9 A;  4WFG A;  4EKW A;  1R3L C;  3OR6 C;  4LP8 A;  2ITC C;  3STL C;  5B3S C;  2A79 B;  3K0D A;  4WFH A;  3ABK C;  2WLL A;  3E8G A;  3OGC C;  4PDM A;  2OCC C;  4G28 B;  4ZBM A;  1R3J C;  3T4D A;  5KUK A;  4J9Z B;  2HVK C;  3E8F A;  5EK0 A;  4PA4 A;  1R3I C;  2W0F C;  3OUS A;  2IH3 C;  4GX5 A;  4J9Y B;  4MVZ A;  3SYP A;  3SPJ A;  4PA7 A;  1J95 A;  3AG4 C;  3UKM A;  5E1A C;  5EC2 C;  3VOU A;  3IFX A;  2AHZ A;  2WLJ A;  3K03 A;  3SPI A;  5B1B C;  4MVS A;  5EBW C;  3LNM B;  5CBH A;  1QLE C;  1OCC C;  2EIK C;  5EC1 C;  3HPL C;  2ITD C;  2HG5 C;  4R50 A;  3X2Q C;  1R3K C;  3K04 A;  3LDC A;  2BOC C;  4HZ3 A;  3ABM C;  4G27 B;  2Q68 A;  2ZD9 A;  4JTC B;  3SPC A;  3E8B A;  3SYQ A;  2HJF C;  4PDL A;  4DXW A;  3EFF K;  3T2M A;  2ZXW C;  3ASN C;  3RW0 A;  3E89 A;  3WG7 C;  4HYO A;  4GX0 A;  1BL8 A;  3FB5 C;  4PA3 A;  3RVY A;  3SYO A;  3TCU A;  2WLI A;  3E86 A;  3AG2 C;  4QE7 A;  3E83 A;  4RUE A;  5B1A C;  4H37 A;  4MTO A;  4P9O A;  2IH1 C;  3OUF A;  4MS2 A;  4P9P A;  4PA9 A;  1M57 C;  2Q6A A;  4XDJ A;  3RVZ A;  4JTA B;  3OR7 C;  1OCR C;  5CBF A;  1KKD A;  2P7T C;  2HVJ C;  4PDV A;  4R6Z A;  2A9H A;  4P30 A;  4TWK A;  3LDD A;  3K08 A;  4MVO A;  4PA6 A;  5EBL C;  3E8H A;  4RAI A;  4F4L A;  2Q69 A;  2WLI B;  4BW5 A;  2X6A A;  3T1C A;  2NLJ C;  5J9P C;  3K06 A;  2R9R B;  1S5H C;  2DWE C;  1K4D C;  2WLK A;  4LBE C;  4MVM A;  4WFF A;  4CBC A;  2X6B A;  3KG2 A;  1V55 C;  3JYC A;  3R65 A;  3STZ C;  2WLL B;  5CBG A;  3ZJZ A;  2A0L A;  4MTF A;  4X88 A;  3TET A;  2WLM A;  4MW3 A;  2EIJ C;  2K1E A;  1M56 C;  2JK5 C;  1OCZ C;  1XL6 A;  1OCO C;  3F7V C;  1K4C C;  3GB7 C;  2YEV A;  4GX2 A;  3K0G A;  4RUF A;  4XDL A;  2DWD C;  3SYC A;  5KUM A;  3F5W C;  4GX1 A;  4I9W A;  4JTD B;  2QTO A;  3F7Y C;  2EIN C;  3FB6 C;  2BOB C;  4QNH B;  4UUJ C;  2X6C A;  4WFE A;  1JVM A;  3UM7 A;  5IY5 C;  3ASO C;  4R7C A;  1P7B A;  1LNQ A;  3PJS K;  2HFE C;  1V54 C;  3RBZ A;  1ZWI C;  3AG3 C;  4X89 A;  4LCU C;  2WLH A;  2Y69 C;  2EIM C;  4R8C A;  4XDK A;  3SJQ C;  4OXS A;  3T4Z A;  2QKS A;  4H33 A;  4MTG A;  4X8A A;  3ABL C;  3FB7 C;  3SPG A;  4P2Z A;  4MVQ A;  5EBM C;  3SPH A;  4RO2 A;  1G4Y B;  2KB1 A;  4PDR A;  4MW8 A; 
#chains in the Genus database with same CATH topology
 5LMN O;  2NR5 A;  2YDE A;  2Y4T A;  1E79 G;  1KQS U;  1GM9 A;  2DYR C;  1ZUQ A;  1VP7 A;  5IE9 A;  1VQP V;  2KSD A;  1SQG A;  4XBF A;  3OTO O;  3FYI B;  2VWK A;  2P90 A;  3DTU B;  3ASO B;  5CB4 A;  1YZB A;  4KL1 A;  2IBZ H;  5BXZ A;  4JI3 O;  2YEV B;  4J9Y B;  1HWY A;  4ZIB A;  3AK3 A;  5EC2 C;  1KD1 W;  4DRX B;  2WLJ A;  4MVS A;  1H8H G;  2EIL B;  2ZM6 B;  3SYQ A;  3E8B A;  4TV8 A;  3ZRX A;  2QGN A;  3HB3 B;  1NZ6 A;  4CH5 A;  2UXX A;  5J2T A;  1L0L H;  3WG7 C;  1BL8 A;  4O4H B;  2EJR A;  1SZX A;  4ZOL B;  5B1A C;  2CTP A;  2E3C A;  3FAV A;  3P30 A;  5CA1 A;  1S0V A;  1AP6 A;  1OCR C;  4R6Z A;  3RYF A;  5EBL C;  2WA4 A;  4FPP A;  2OTL V;  2L6L A;  2X6A A;  4B08 A;  3RT3 C;  4FLT A;  3OW2 U;  4YHH O;  3STZ C;  3JYC A;  3H01 A;  4CZZ A;  3L70 H;  4I9W A;  2BOB C;  1N34 B;  2QWQ B;  5CA3 A;  4UV8 A;  1IBK B;  1LNQ A;  4DR7 O;  5JH7 A;  2OYQ A;  2WLH A;  1N36 B;  1VQ9 V;  3SPH A;  2FML A;  1YCI A;  4O4I B;  1QVF U;  3K59 A;  2EJ7 A;  4FVM A;  5ITZ A;  5JJE B;  5LMU O;  2QDO A;  5EZY B;  1Z5V A;  5BZB A;  1YIT V;  3CE2 A;  3IGA C;  4DR1 O;  1AI4 A;  1M93 A;  2LFR A;  5FLX N;  4JGS A;  2DW4 A;  2KG7 A;  2Q0A A;  1U97 A;  2Y4U A;  1R3I C;  4IYI A;  1H2K A;  1K9M W;  5LXT A;  3APQ A;  1IXB A;  1GM7 A;  2AHZ A;  5C8Y B;  1CXZ B;  5EC1 C;  1V55 B;  2UUB O;  1AP5 A;  1OCC B;  3B8M A;  4JI4 B;  3UCS C;  3SJB C;  2OIE A;  2B1G A;  4PDL A;  4U7N A;  4Q20 A;  5KAI Z;  1ENV A;  4HYO A;  4FFB B;  4PA3 A;  1M57 B;  2WLI A;  2ZR2 A;  1FFX A;  2BE3 A;  5J2U A;  1DTO A;  1NH2 B;  3LDD A;  2YXH A;  4O4J A;  4BW5 A;  3T1C A;  2QA4 V;  4WFF A;  1VQ4 V;  3HKB B;  3MDS A;  4E2L A;  1PNK A;  3E22 A;  3ZRW A;  3I56 V;  4FLY A;  4MTF A;  4GZR B;  3TET A;  2YS8 A;  4K35 A;  4UV9 A;  1OCO C;  2CH7 A;  1MMM A;  4JI4 O;  2Z5U A;  4KHP O;  3ML0 A;  1P49 A;  3CCJ V;  1TAE A;  1XDC A;  1SRY A;  5IYD O;  2ZKO A;  2PTM A;  4WCE V;  5IY5 C;  3A0H Z;  2JJ1 G;  3RBZ A;  3B4S A;  2UUC O;  4DRX A;  4LCU C;  4H33 A;  4NR1 A;  1ZL8 B;  4WBN B;  1GM8 A;  4OX9 B;  1UFI A;  4ZI7 A;  2BSK A;  5K1P A;  2H8P C;  2Q67 A;  1X4T A;  4DV0 B;  3BCC H;  4W4K A;  1HNX B;  5TIS Z;  2YIC A;  3AG1 C;  4DR2 O;  1SET A;  3H1H H;  1K3E A;  1XOU A;  2ITC C;  4HAM A;  1SQQ H;  1KUQ A;  2R9I A;  3ZRV A;  2UUA B;  5CA1 B;  4GCZ A;  1TVK B;  3B09 A;  3ZHU A;  4IHJ A;  5F2V O;  2W0F C;  1ZX3 A;  1WA8 A;  2Q7G A;  5E1A C;  4LFA B;  1HNW B;  4K8Z A;  3W7S A;  3K5N A;  1QNM A;  1KEC A;  3A0B Z;  2XT9 A;  2Q8V A;  2Z3Y A;  4YJ3 A;  4F6E A;  1TUB A;  2K9P A;  3HKD A;  1W59 A;  1H2M A;  3NR7 A;  1H2G A;  2IJJ A;  1G6U A;  4O4L A;  3JAR B;  4LF7 O;  3E89 A;  2P4K A;  3AG3 B;  3E83 A;  2LGQ A;  2AZ0 A;  2IU0 A;  1N4C A;  2ADQ B;  3OUF A;  3CCL V;  1N33 B;  4PA9 A;  1N0N A;  3CCV V;  2ODM A;  1SF9 A;  4DR1 B;  4QPK A;  1QR8 A;  1QU7 A;  1CPY A;  3AK1 A;  4DR6 B;  5LHI A;  4EEQ A;  2NLJ C;  1FKA O;  2HEP A;  4NYK A;  1COW G;  2QSA A;  1XMO O;  5IT9 N;  4QIW F;  2F43 G;  3J7A U;  1WJZ A;  3G80 A;  2HLD G;  2YEV A;  4RUF A;  4PI0 A;  2ZM6 O;  3BAB A;  4JTD B;  4NTX A;  4IL6 Z;  1ZSP A;  1JVM A;  3ASO C;  3QTC A;  3OAA G;  1M5I A;  2UXC O;  3G67 A;  1NTZ H;  1BHB A;  1Z5W A;  2RQ6 A;  5CMU A;  1W0J G;  3ZBH A;  3ABU A;  5BMV B;  3QF7 A;  2YC0 A;  4ZOL A;  1QLN A;  1XL4 A;  1QHT A;  1VIB A;  4QE9 A;  5D5P A;  3CX5 F;  5KHJ A;  3QG5 A;  5KX5 A;  1VAR A;  5B1A B;  4FLZ A;  2ZDI C;  2G38 A;  3GWO A;  4LFC O;  4GKJ B;  1I08 A;  2PYJ A;  4FZ0 A;  5IYB O;  5LP6 B;  1VQ6 V;  4ZKI A;  1WPX A;  2HG5 C;  3JAK A;  3K04 A;  4QPJ A;  5BY1 A;  2EIN B;  1R6K A;  1GN3 A;  4HNA A;  1YXB A;  2UU9 O;  3FB5 C;  1BMF G;  4DV3 O;  3TCU A;  1WP7 A;  2B5U A;  4MTX A;  4NXM O;  3JAW B;  3JSL A;  1RFY A;  1Q6U A;  5CN0 A;  4PEL A;  1KKD A;  2XAH A;  4DV1 O;  2YSU B;  1JJ2 U;  3ETD A;  1D2D A;  3IAY A;  4DK0 A;  1EZV H;  4GKJ O;  5LXT B;  4JYY A;  1XI1 A;  3FYE B;  4JYA O;  4DV5 B;  2WLL B;  4JYA B;  2AGA A;  2VWJ A;  1CEZ A;  2XAJ A;  4IYH A;  1R6T A;  4XDL A;  4LFA O;  1JMK C;  3FB6 C;  2X6C A;  2NNU A;  2QM7 A;  2X7R B;  4TUY B;  2FYU H;  3K9S A;  2H94 A;  1XNQ O;  3JD1 A;  1I94 B;  1Q6I A;  2UXB B;  1AI7 A;  5HFM A;  4X89 A;  4ASU G;  2Y69 C;  3QO7 A;  1CP9 A;  1WAZ A;  2IJH A;  4FLU A;  2EIM B;  2ILM A;  4PDR A;  4NXN O;  1Y6X A;  2V7Q G;  5H5N A;  2QR4 A;  3BEH A;  5IWA O;  1KMI Z;  4B3M B;  3QVN A;  1WB8 A;  2YIA A;  2LP7 A;  5JWP A;  2JRI A;  2E74 B;  3C3T A;  1QQC A;  1HR0 B;  1IX9 A;  3A2F A;  4LFC B;  1M90 W;  3HR0 A;  2LO1 A;  4UCV A;  3AG2 B;  2DJV A;  5KUK A;  3E8F A;  5IYZ B;  3OGI B;  5GON B;  4FZ1 A;  3QNE A;  1IBM O;  4KHP B;  1M56 B;  3AK2 A;  3P3N A;  3EXA A;  3L74 H;  1XEQ A;  1R6N A;  2BSK B;  4G27 B;  3I55 V;  2QWN B;  2AXT Z;  2ZIM A;  5FNV B;  1SC5 B;  4CC5 A;  4I7Z B;  5B66 Z;  1WA8 B;  1KP2 A;  3RVY A;  2GBO A;  5KHG A;  4MTO A;  2JVD A;  4JAA A;  2GSM B;  3RN4 A;  4AQY B;  4RQF A;  5E79 Z;  1Y4M A;  2HVJ C;  3K79 A;  2CTR A;  5GTH Z;  2EUL A;  4CS2 A;  4LFB B;  4RAI A;  1GRJ A;  5J9P C;  3HKE A;  3S3W A;  2LFS A;  4LF6 B;  3ZS8 C;  4K3A A;  2EZO A;  4TV9 A;  4DUY B;  5JQG B;  4I4T B;  3FD9 A;  3JAL B;  1SQP H;  4JYB A;  1NKD A;  1XNR B;  5LYJ A;  3H1L H;  4D7T A;  1KP3 A;  2EIN C;  2QWR B;  3CCU V;  4YJ3 B;  2HHH O;  1DLB A;  3RYC A;  1NTM H;  3AG3 C;  2GV9 A;  2YID A;  4JI7 O;  3UQ8 A;  4AHC A;  3P32 A;  3L9D A;  2P06 A;  1SS3 A;  4FFK A;  3ETQ A;  1XMQ O;  4JI6 B;  2RN9 A;  2C2A A;  2A79 B;  3UO2 A;  1XBL A;  3E8G A;  3N2G B;  2IJI A;  3CC2 V;  4FIP C;  3ICX A;  2MW2 B;  1OV9 A;  2XAS A;  2HVK C;  4YXW G;  2XND G;  3G6B A;  1EFR G;  2NN4 A;  3ZHT A;  3BA9 A;  1XUQ A;  3LSQ A;  1GN6 A;  2EIJ B;  3UO3 A;  4ZHQ B;  2Y48 A;  4JI2 B;  1JR9 A;  4YHH B;  3SJC C;  1L0N H;  3ABM C;  2R70 A;  3RYI A;  4JTC B;  5H6Q A;  1VF5 B;  4E4E A;  1PNM A;  4EFB A;  3H1J H;  3TXQ A;  1FYJ A;  1VMG A;  4GX0 A;  1MSD A;  2XAQ A;  1SA0 A;  4K8X A;  1VQ5 V;  1VQL V;  2AZ2 A;  1NH2 D;  4FMT A;  1XQ8 A;  3IC7 A;  3K06 A;  1QLE B;  1YSC A;  3ZJZ A;  1M56 C;  1XL6 A;  3CP1 A;  3JAW A;  5GTI Z;  1K7D A;  1VQ7 V;  4FK5 C;  2V4D A;  3F7Y C;  3S3X A;  2UXD O;  1IZ3 A;  2FB5 A;  4O4I A;  1JPX A;  3OEH G;  4IGG A;  3JAK B;  1V54 C;  1US6 A;  3WU2 Z;  1Y76 B;  3PN1 A;  5K1X A;  4LF4 B;  4DV2 B;  1VF6 C;  3ZHS A;  2KB1 A;  2PYL A;  1FAF A;  4LF8 B;  5FNV A;  2UU9 B;  4X66 B;  3TJT A;  3GWK C;  3KCX A;  1HNX O;  2ZNJ A;  2GHY A;  1PKX A;  1R3L C;  4NTY A;  2BTO A;  1H38 A;  1VF6 A;  1F4M A;  1I5Y A;  4ZBM A;  3SYP A;  4LNU A;  1XIL A;  5JVD B;  1OJH A;  2LQT A;  3W7X A;  5EYP B;  4PV1 B;  2Y69 B;  4YJ2 B;  4C7U A;  2CE4 A;  1R3K C;  2VS0 A;  2ZD9 A;  4UCU A;  1MA1 A;  4JI0 O;  2WAM A;  2EBO A;  2VQF B;  1RSO A;  3UT5 B;  4DR4 O;  3CRA A;  3CXH F;  1M57 C;  3HKB A;  1JFF B;  3QO5 A;  5CBF A;  2OWO A;  4FM0 A;  1AR5 A;  4RQE A;  2UUC B;  2RCV A;  1E1R G;  4NVP A;  2X6B A;  5CB4 B;  1DK1 A;  4K0K O;  1NT2 B;  4O4H A;  2K1E A;  2JK5 C;  4GX2 A;  1OHH G;  3D3Q A;  3FAV B;  2BCC H;  2DOS A;  3SYC A;  3W7T A;  1MSW D;  1D5N A;  4CH4 A;  1Q5O A;  2F93 B;  3UM7 A;  3ZMZ A;  4DR7 B;  4BIZ A;  1LR1 A;  2HFE C;  4JI8 O;  1ZWI C;  4LF8 O;  1OCR B;  1YF2 A;  4XDK A;  3JAT A;  4OXS A;  3WB0 A;  5LGN A;  4TV9 B;  3L72 H;  4I4T A;  3OFN G;  5DEC A;  3VQY A;  3K5M A;  4FLX A;  3RYI B;  1EN4 A;  2FTK A;  3SYA A;  2W6I G;  2ZDI A;  5KMG A;  2ZQM A;  4OX9 O;  5IJ0 A;  5L3C A;  3U11 A;  3ZN0 A;  3RYF B;  4B3S O;  3RYC B;  3AG1 B;  3JAL A;  4EB6 B;  4WFH A;  2RJZ A;  3VQX A;  3OGC C;  4DK1 A;  1XRE A;  1RP3 B;  1PV0 A;  2UUA O;  1VQM V;  4DW1 A;  5B1O A;  5B1N A;  3OEE G;  3SPI A;  1PNL A;  5B1B C;  5EBW C;  2EIK C;  2UUB B;  2Q9L A;  4LR3 A;  4X1K A;  4D6T H;  3L71 H;  3N2G A;  1NI8 A;  1N0J A;  2KG7 B;  4X62 O;  4DXW A;  1JJO A;  4I55 A;  3T2M A;  1QCE A;  3Q4H B;  4YIP A;  2A06 H;  3M7M X;  4QE7 A;  5AG2 A;  4UFZ A;  3CCM V;  5L3G A;  1DF5 A;  2QEX V;  1K34 A;  5J2T B;  5DM6 V;  3ABM B;  2Y0P A;  4P30 A;  3K08 A;  4Z1M G;  4UB6 Z;  3CPW U;  2IW5 A;  4CBC A;  3DC6 A;  3KKY A;  3ZMS A;  1IBL B;  1V55 C;  3A8T A;  3SDL A;  4BWA A;  4ZHQ A;  2EIJ C;  1P4R A;  3H1I H;  4JI1 O;  1K92 A;  4JF3 A;  1YJN V;  1S72 V;  3ZHR A;  3JCU Z;  2WPD G;  1OCO B;  2Z0A A;  3CHX A;  3K5L A;  4O4J B;  5IYC O;  2A3Q A;  2OCC B;  4X20 B;  1PL4 A;  2ZE6 A;  3THO A;  4CC6 A;  3RYH B;  5LHG A;  1SA0 B;  3W7U A;  2D3O W;  4J7J A;  3DC5 A;  1SER A;  2QTS A;  2PGG A;  4I5S A;  1ROP A;  4GT1 A;  1AI5 A;  4JI8 B;  1JOY A;  1S5L Z;  2ATK C;  5JH7 B;  3CB2 A;  2P5O A;  1ORQ C;  2DYS C;  4B3T O;  4WFG A;  4DV1 B;  3STL C;  3K0D A;  1KC8 W;  1JFF A;  1MAB G;  3M8A A;  2IH3 C;  1RM1 B;  3MHS C;  3CRR A;  1Y74 B;  4IIJ B;  1V54 B;  4CS4 A;  2CGO A;  4TOI A;  3ZX6 A;  4AQY O;  5LP6 C;  2EX3 A;  4O2B B;  2BOC C;  2FL4 A;  5KHH A;  1F51 A;  2P6J A;  4B7E A;  1YI2 V;  4FM1 A;  4CS3 A;  1U96 A;  1AR4 A;  3BHP A;  4BIU A;  3ETG A;  1EZJ A;  4JI6 O;  4JTA B;  3OR7 C;  3N27 A;  2P7T C;  2W6J G;  4LF5 B;  3LNN A;  2Q73 A;  3E8H A;  2ZR3 A;  3MHH C;  5JVD A;  2CGN A;  4LF7 B;  5BR8 B;  1RSO B;  1Y66 A;  2P4V A;  3UT5 A;  3RWR D;  4AIL C;  2Q0O C;  4NXN B;  3B8N A;  3CEI A;  1MZF A;  4DO2 A;  1K4C C;  3N2K B;  2F4V B;  3JD2 A;  2YI9 A;  2KKW A;  2ZE8 A;  2OTJ V;  2JEX A;  5EYP A;  5JJN B;  1Q7Y W;  3CRQ A;  4HBN A;  1XHZ A;  3HKD B;  3PJS K;  1E1Q G;  3TGU H;  1VQO V;  4X65 O;  2LGW A;  4DW0 A;  1WNS A;  2YXL A;  3CXC U;  3TXS A;  4UB8 Z;  5IDJ A;  1SKV A;  2HP8 A;  3OMN B;  3X2Q B;  3E35 A;  3ZHV A;  1W0K G;  4I9Q A;  1ZL8 A;  4GKK O;  4U3J B;  5B3S C;  1IXM A;  1VQ8 V;  3JAT B;  1YJ9 V;  1Q82 W;  1HR0 O;  4DV7 B;  2RNB A;  4F6R A;  4Z1V A;  1Q86 W;  3AG4 C;  3JSN A;  2ZIN A;  1XMO B;  1S3J A;  3OMA B;  3RFR A;  3LNM B;  3K57 A;  1YIJ V;  1PD3 A;  4LF4 O;  1K73 W;  4R50 A;  4UVA A;  4EB6 A;  5LA6 B;  1YTF B;  2HJF C;  4O2A A;  3U10 A;  2CTW A;  3JD3 A;  1R1B A;  3OE7 G;  3CRM A;  4JV5 B;  1OZ0 A;  5H2F Z;  1TUB B;  1GKF A;  1MG1 A;  3D3I A;  4L8J A;  2F23 A;  1GN4 A;  1AI6 A;  2BTQ B;  4J7Z A;  2LW7 A;  4G2K A;  3RVZ A;  4J11 A;  4PDV A;  1HNW O;  4MVO A;  3ZMU A;  1QBZ A;  5LMU B;  2RMK B;  1HP8 A;  2XAF A;  5KAF Z;  3CME V;  3CS5 A;  4HNA B;  4KXR A;  1ZTE A;  3KG2 A;  3SGI A;  4GYC B;  4LH6 A;  1B3Q A;  2X0L A;  3ABK B;  2WA3 A;  3HKC B;  2JEU A;  3OD4 A;  3K58 A;  3F5W C;  4DV4 B;  1Q81 W;  2VQE O;  5DED A;  2VQF O;  1W2B U;  2FKX A;  5ITZ B;  1BQ0 A;  2F4V O;  2JDI G;  1VQK V;  1BGY H;  3DSQ A;  4PHZ A;  1Q8I A;  3K5O A;  1URF A;  1G4Y B;  1AB3 A;  3OMI B;  1NVP D;  4MT8 A;  2YI8 A;  4MW8 A;  2QE7 G;  3JD0 A;  5IWA B;  3WB2 A;  4MSW C;  2EIL C;  2AHY A;  2DQ3 A;  1FXV A;  1J5E B;  3H9V A;  2WLN A;  4DR6 O;  4PI2 A;  2YIB D;  3H1K H;  2XHB A;  2XOK G;  3ZHQ A;  5B5E Z;  4UCO A;  3DXR A;  1BT8 A;  1Y67 A;  2L35 A;  4FJC C;  1Q90 D;  1V9P A;  1LUV A;  3CJH A;  5JCO A;  2IM9 A;  2QKA A;  1PM9 A;  4JI5 O;  4I50 A;  1AJQ A;  2M6Y A;  5LOV B;  2YXY A;  3AEI A;  4A5U B;  3T1Y B;  1NR7 A;  2ITD C;  4DR5 O;  1A32 A;  1M9N A;  3U0Z A;  1FPO A;  2Q68 A;  4UCS A;  1WB7 A;  3A0R A;  5GON A;  2IU3 A;  4BAY A;  3AG2 C;  1B6Q A;  4WFA V;  4P9O A;  1S5J A;  1L1F A;  2Q6A A;  3T1Y O;  1GH6 A;  4X1I B;  3GVM A;  4DV3 B;  2VRZ A;  4QGP A;  2E76 B;  3B77 A;  2N74 A;  4LBE C;  1I0H A;  1BZK A;  3AG4 B;  4EFE A;  4CH3 A;  2WLM A;  4MW3 A;  4U3J A;  1OCZ C;  1N36 O;  5CA0 B;  1NTK H;  1T5E A;  2OIG A;  2E5L O;  3TK1 A;  2QTO A;  2XTA A;  4UUJ C;  3NXS A;  1M4U A;  2LJ2 A;  1KBH A;  4R7C A;  1P7B A;  2W0X A;  2HHH B;  2ETN A;  1FXK A;  4DV4 O;  4DV6 B;  1FJG B;  4RO2 A;  1RM1 C;  1XNR O;  1SZT A;  1YVW A;  4TUY A;  4X66 O;  1NQT A;  3JAS B;  3ZN1 A;  5LA6 A;  4LWS A;  1G1X B;  4X9Q A;  2Q4P A;  5L3F A;  3ETE A;  1GAX A;  4MVR A;  3FB8 C;  4EKW A;  3LSU A;  4LP8 A;  3ABK C;  2PUS A;  1FJG O;  3ZCC A;  1GK9 A;  3VBB A;  3EHB B;  5EK0 A;  5L3E A;  1HW7 A;  3OUS A;  3SPJ A;  3G6E V;  4TQF A;  1P84 F;  1THZ A;  4PD4 F;  1AVM A;  3B2E E;  4JPR A;  2QJ1 A;  3VOU A;  4U3F H;  2R72 A;  3CRC A;  1FFX B;  4JI0 B;  3I5D A;  4O4L B;  1OCC C;  1FXH A;  3OM3 B;  2R9A A;  3ABT A;  3L75 H;  1R73 A;  3LDC A;  3O9O A;  4X1Y B;  3WG7 B;  3CWB H;  3MD0 A;  3IJ4 A;  4OGQ B;  1YTF D;  2CK3 G;  1TUE B;  1IBL O;  3SYO A;  3CC4 V;  1ARO P;  1I5X A;  3WFV A;  3E86 A;  4RUE A;  5LBQ A;  2DE0 X;  2HR3 A;  4P9P A;  1NR1 A;  5B3S B;  1BHA A;  1F4N A;  4XDJ A;  1G8M A;  3K3W A;  2B9Z A;  2ZE7 A;  4PA6 A;  3CCR V;  3D36 C;  2ZCE A;  4GKK B;  4GUN A;  2Q69 A;  4DV0 O;  4BIO A;  4UCT A;  1YHQ V;  2DWE C;  1K4D C;  5FL7 G;  1KB9 F;  5CBG A;  2A0L A;  4DV7 O;  2ZXW B;  3GB7 C;  3F7V C;  1AR1 B;  3ASN B;  5KA6 A;  4DV2 O;  4X64 O;  3E2E A;  4Q6G A;  3CCQ V;  4O2A B;  2YUA A;  4KP4 A;  2GTS A;  4DR3 O;  5GW7 A;  1YEW A;  4B3T B;  1DF4 A;  5KMG B;  1N34 O;  4R8C A;  2QKS A;  4DUZ O;  3C90 A;  4I50 B;  3IC9 A;  4H0L B;  4X64 B;  2N05 A;  4IHJ B;  4WF9 V;  3BAA A;  3BA8 A;  2F95 B;  4MVU A;  1PL0 A;  4JI7 B;  2LW1 A;  3P3P A;  2GDS A;  3LDE A;  3FFQ A;  2GUZ B;  3ZRS A;  3BY6 A;  3ZMV A;  3CSX A;  3OR6 C;  4YIO A;  1M1K W;  1N32 O;  5FPO A;  2E75 B;  4WFB V;  1AJP A;  5LP6 A;  3T4D A;  4NTW A;  5KLV H;  3BFR A;  4JI3 B;  2N04 A;  3BRC A;  4JAS A;  4X1K B;  1GTO A;  3JAR A;  5LL6 Y;  4GLX A;  1VF7 A;  1BCC H;  2CDY A;  4I55 B;  2XAG A;  5A9G A;  3K03 A;  1EM1 A;  5CBH A;  2YIB A;  2CUG A;  2UXC B;  1SQF A;  4UCR A;  5B1B B;  1I7F A;  1KKC A;  5LMN B;  2JIZ G;  3L73 H;  3O65 A;  1X59 A;  3DXR B;  5L3B A;  4X62 B;  4H37 A;  1LUW A;  1MOF A;  2IH1 C;  1EN5 A;  1FXK B;  1HDJ A;  1S77 D;  4YJ2 A;  5A2Q N;  1H2S B;  2QWP B;  1GMG A;  1QVG U;  1K8A W;  4F4L A;  3LSS A;  2WLI B;  2R9R B;  1S5H C;  3T1H O;  2WLK A;  4DR4 B;  1Q6H A;  3R65 A;  3C3S A;  5LGU A;  4X20 A;  4H44 B;  2JGD B;  3ABL B;  5BMV A;  1IBM B;  4X1I A;  1JCH A;  3ZED A;  2WWW A;  4GX1 A;  1AIL A;  1PP9 H;  3E22 B;  4NB5 A;  1JA8 A;  4WFE A;  3G71 V;  3CD6 V;  4ICG A;  1B04 A;  2ZT9 B;  3M99 B;  5L3D A;  4X8A A;  3SR2 C;  3FB7 C;  4FLW A;  3SPG A;  2PF4 E;  5D5Q A;  3JCZ A;  1Y76 A;  3VQV A;  4JV5 O;  3LUT B;  3RGB A;  2M7W A;  5FPR A;  4ZI7 B;  5CA0 A;  1BQZ A;  1OCZ B;  3F5T A;  4JAU A;  2WLL A;  4PDM A;  4IIJ A;  1UJW B;  2QM8 A;  2ZE5 A;  4G28 B;  5IJ9 B;  4J9Z B;  4D7S A;  4DR2 B;  4LC1 A;  1TGO A;  2Q7E A;  4JYC A;  4LF9 O;  2RDC A;  1WLE A;  4PA4 A;  5JJJ B;  2F1M A;  2PI4 A;  4PA7 A;  1J95 A;  2XUM A;  1IBK O;  2WSS G;  2QKC A;  4DV5 O;  2DQ0 A;  3B40 A;  4UXN A;  4B3S B;  3VQW A;  1F7Y A;  5KHI A;  2IJK A;  2EIK B;  2OCH A;  2Q7H A;  3W7W A;  3QO8 A;  1S76 D;  3RW0 A;  4FM2 A;  4RWU A;  2HKO A;  1IDS A;  2EZP A;  1DGS A;  3JAS A;  2ZIO A;  1L8D A;  4AI8 A;  3OTO B;  4DYL A;  2A9H A;  1NS1 A;  5JQG A;  1AJN A;  4X65 B;  4X1Y A;  4I0X B;  1VQN V;  4N21 A;  5KHK A;  5LYJ B;  2AW9 A;  1XNQ B;  2O57 A;  1K97 A;  1YDX A;  3BVO A;  3K9A A;  4X88 A;  1KU9 A;  4UVC A;  3K0G A;  1YJW V;  4K0K B;  1HNZ O;  4N23 A;  2PY5 A;  1BS3 A;  4B3R O;  2H3O A;  2DYR B;  1Q3E A;  3DGE A;  4TV8 B;  4J10 A;  4J41 A;  3FX7 A;  4PJ0 Z;  4W4L A;  3J80 N;  2JGU A;  3SJQ C;  3T4Z A;  4JI1 B;  4MTG A;  1BSM A;  2V1D A;  5EBM C;  1H2N A;  4J7K A;  1ZAU A;  4BR6 A;  5EIB C;  1XHX A;  4B3R B;  3MAQ A;  1EN6 A;  4ABM A;  1WPB A;  4KFM A;  1H8E G;  3JD4 A;  5JCO C;  1BE3 H;  3JAM N;  3R66 A;  2GTA A;  3ZMT A;  3RYH A;  2OCC C;  1R3J C;  1FD9 A;  5DN6 G;  4J42 A;  1JQ0 A;  1SES A;  4MVZ A;  1GO3 F;  3OT7 A;  2GUZ A;  3OTF A;  1SQV H;  2PZS A;  4LF9 B;  3J81 N;  3KCY A;  4BW9 A;  3CCE V;  2CAZ C;  5KX5 B;  4JI5 B;  1D5A A;  4UVB A;  4IT5 A;  4HZ3 A;  2A7W A;  4U7O A;  2D2C B;  3AG7 A;  3HKE B;  1SQX H;  4DR3 B;  3FKS G;  2ZXW C;  2ADP A;  4TSF G;  5C93 A;  3ASN C;  1FS0 G;  1PPJ H;  1FFT B;  1N33 O;  4TQD A;  4MS2 A;  2UXD B;  5KA5 A;  5EZY A;  3BPZ A;  3Q4H A;  4B7K A;  5EIB D;  1RPO A;  2ZNI A;  1MNG A;  1HNZ B;  2KQX A;  4JAV A;  5BR8 O;  1IVS A;  1FXK C;  5H6R A;  5LHH A;  3G4S V;  4JZG A;  2DWD C;  2UXB O;  1GN2 A;  4NXM B;  2P22 C;  1I94 O;  1QR9 A;  4QNH B;  4YY3 O;  1Y74 A;  1B06 A;  3KZI Z;  1N8R W;  4J80 A;  1O9G A;  2QM4 A;  2EIM C;  3ABL C;  4P2Z A;  2JGD A;  4DV6 O;  3N2K A;  3T1H B;  2JS3 A;  4DR5 B;  4OPH A;  5C8Y A;  4FFB A;  4LNU B;  4B3M O;  3D8C A;  1NBM G;  3CJH B;  5J2U B;  4LF5 O;  3CMA V;  5LOV A;  2DMX A;  2CH7 B;  3CC7 V;  4GX5 A;  3UKM A;  2MK3 A;  1K33 A;  1EBO A;  1KYO F;  2B1I A;  3IFX A;  4LFB O;  2QWO B;  1QLE C;  3HPL C;  5IYZ A;  3SJA C;  3X2Q C;  1Z2G A;  4JI2 O;  1TA8 A;  2DYS B;  3SPC A;  1P7G A;  3D36 A;  3EFF K;  5HFL A;  1H2L A;  1SQB H;  1NJI W;  4F6R B;  2JJ2 G;  4JZ2 A;  1VEW A;  3ZRW B;  4FLV A;  1RPR A;  1NU1 H;  4O2B A;  1Q43 A;  4DUZ B;  2PI5 A;  1WP8 A;  2Q5Z A;  4TWK A;  3CCS V;  3WB1 A;  4QJF B;  4NKG B;  2JS5 A;  2DN9 A;  4DUY O;  4MVM A;  5IY5 B;  2ARH A;  2P67 A;  2F66 C;  1TVK A;  5IJ9 A;  4YY3 B;  4CH6 A;  3ZIA G;  1WN7 A;  4KUM A;  4WBN A;  1MZE A;  3EVK A;  1N32 B;  4LF6 O;  2BTQ A;  3APO A;  4TT3 G;  5KUM A;  4LH7 A;  1K5S A;  4Z2W A;  2Y0I A;  2CTQ A;  1NVP B;  1O9H A;  1K5Q A;  1JX9 A;  4I0X A;  1J5E O;  5H9C A;  2VQE B;  2E5L B;  1ZLZ A;  4LWS B;  1F23 A;  4OPA A;  1UPG A;  4H13 B;  1IUR A;  2UXN A;  4L87 A;  5IJ0 B;  2HJD A;  4MVQ A;  5LGT A;  3HKC A;  2OT5 A;  3CYO A;  1XMQ B; 
#chains in the Genus database with same CATH homology
 4MVU A;  2V7Q G;  1PL0 A;  1JOY A;  1KQS U;  1E79 G;  2ATK C;  3BEH A;  1GM9 A;  2DYR C;  3LDE A;  3ZRS A;  3BY6 A;  1VQP V;  1ORQ C;  2DYS C;  2LP7 A;  4XBF A;  3FYI B;  4WFG A;  3ZMV A;  3OR6 C;  3STL C;  1M90 W;  2P90 A;  3DTU B;  1M1K W;  3K0D A;  1KC8 W;  3ASO B;  3AG2 B;  4WFB V;  1AJP A;  3T4D A;  1MAB G;  5KUK A;  3E8F A;  4JAS A;  1GTO A;  2YEV B;  2IH3 C;  4J9Y B;  1HWY A;  3QNE A;  1RM1 B;  3MHS C;  5EC2 C;  2XAG A;  1KD1 W;  1M56 B;  2WLJ A;  3K03 A;  4MVS A;  1V54 B;  5CBH A;  5B1B B;  1H8H G;  2EIL B;  1R6N A;  2BOC C;  4G27 B;  3I55 V;  3SYQ A;  3E8B A;  1F51 A;  2P6J A;  2JIZ G;  1YI2 V;  3ZRX A;  3HB3 B;  2UXX A;  5L3B A;  3WG7 C;  1KP2 A;  1BL8 A;  3RVY A;  2EJR A;  5B1A C;  4BIU A;  4H37 A;  1MOF A;  4MTO A;  2IH1 C;  1FXK B;  3ETG A;  1EZJ A;  1S77 D;  2GSM B;  3OR7 C;  3P30 A;  4JTA B;  4RQF A;  1S0V A;  1OCR C;  2P7T C;  1Y4M A;  2HVJ C;  4R6Z A;  2W6J G;  3K79 A;  1GMG A;  1QVG U;  5EBL C;  1K8A W;  3E8H A;  4FPP A;  4RAI A;  4F4L A;  3LSS A;  2ZR3 A;  2WLI B;  3MHH C;  2OTL V;  2X6A A;  5J9P C;  2R9R B;  1S5H C;  3OW2 U;  2WLK A;  2LFS A;  3STZ C;  3JYC A;  3R65 A;  1Y66 A;  2EZO A;  5LGU A;  3B8N A;  3H01 A;  4DO2 A;  1K4C C;  4CZZ A;  3ABL B;  4JYB A;  1NKD A;  3JD2 A;  1JCH A;  2WWW A;  4I9W A;  4GX1 A;  2OTJ V;  2JEX A;  1KP3 A;  2EIN C;  2BOB C;  3CCU V;  1Q7Y W;  4WFE A;  5CA3 A;  3G71 V;  4UV8 A;  1DLB A;  1LNQ A;  3CD6 V;  3PJS K;  1E1Q G;  3AG3 C;  1VQO V;  2WLH A;  3M99 B;  5L3D A;  4X8A A;  3FB7 C;  3SPG A;  1VQ9 V;  3SPH A;  3CXC U;  1QVF U;  5IDJ A;  3P32 A;  3OMN B;  3X2Q B;  3E35 A;  3JCZ A;  1W0K G;  3LUT B;  5BZB A;  1YIT V;  2M7W A;  3IGA C;  1AI4 A;  5B3S C;  2C2A A;  2A79 B;  1IXM A;  1VQ8 V;  2LFR A;  1OCZ B;  4JAU A;  1YJ9 V;  2WLL A;  3E8G A;  2DW4 A;  2IJI A;  4JGS A;  4FIP C;  4PDM A;  2QM8 A;  4G28 B;  1UJW B;  1Q82 W;  2XAS A;  3CC2 V;  4J9Z B;  2HVK C;  4LC1 A;  4YXW G;  2XND G;  4JYC A;  1WLE A;  1R3I C;  4PA4 A;  1Q86 W;  1EFR G;  2PI4 A;  4PA7 A;  1J95 A;  3AG4 C;  1K9M W;  2WSS G;  1S3J A;  3OMA B;  3LSQ A;  1GM7 A;  2AHZ A;  2DQ0 A;  2EIJ B;  4UXN A;  3LNM B;  1YIJ V;  1PD3 A;  5EC1 C;  1V55 B;  1K73 W;  2IJK A;  2Y48 A;  4R50 A;  4UVA A;  1OCC B;  3B8M A;  2EIK B;  3ABM C;  1YTF B;  4JTC B;  5H6Q A;  2B1G A;  1PNM A;  2HJF C;  3QO8 A;  4PDL A;  4U7N A;  4Q20 A;  3W7W A;  1S76 D;  3JD3 A;  3OE7 G;  3RW0 A;  1ENV A;  1OZ0 A;  4HYO A;  4GX0 A;  4PA3 A;  1M57 B;  1GKF A;  2HKO A;  2WLI A;  2EZP A;  1MG1 A;  2XAQ A;  3D3I A;  2ZR2 A;  1AI6 A;  4G2K A;  3RVZ A;  1VQ5 V;  1VQL V;  4PDV A;  1DTO A;  1NH2 B;  2A9H A;  3LDD A;  4MVO A;  1AJN A;  1NH2 D;  4FMT A;  3ZMU A;  1QBZ A;  3IC7 A;  1VQN V;  2XAF A;  4N21 A;  3T1C A;  4BW5 A;  3CME V;  2QA4 V;  3K06 A;  4WFF A;  1QLE B;  1VQ4 V;  1K97 A;  3KG2 A;  4E2L A;  1YSC A;  1PNK A;  3K9A A;  3ZJZ A;  3ZRW A;  3I56 V;  3CC4 V;  4MTF A;  4X88 A;  3TET A;  1M56 C;  2X0L A;  4UV9 A;  3ABK B;  4UVC A;  1XL6 A;  1OCO C;  3CP1 A;  3K0G A;  1YJW V;  2Z5U A;  3ML0 A;  4N23 A;  1K7D A;  2JEU A;  3CCJ V;  1VQ7 V;  4FK5 C;  3F5W C;  1SRY A;  3F7Y C;  1Q81 W;  5IYD O;  2DYR B;  3DGE A;  4WCE V;  5IY5 C;  1JPX A;  1W2B U;  2JJ1 G;  3OEH G;  1V54 C;  3RBZ A;  2JDI G;  4LCU C;  3SJQ C;  1VQK V;  3T4Z A;  4H33 A;  4MTG A;  2V1D A;  5EBM C;  1GM8 A;  1G4Y B;  3OMI B;  2KB1 A;  1NVP D;  4MT8 A;  4MW8 A;  2QE7 G;  2H8P C;  2Q67 A;  3JD0 A;  4MSW C;  2EIL C;  2AHY A;  2DQ3 A;  1FXV A;  3AG1 C;  1SET A;  2WLN A;  2GHY A;  4KFM A;  1H8E G;  1PKX A;  3JD4 A;  1K3E A;  1R3L C;  2ITC C;  4HAM A;  1H38 A;  3ZMT A;  2R9I A;  3ZRV A;  2XOK G;  1F4M A;  1I5Y A;  2OCC C;  4ZBM A;  1R3J C;  4GCZ A;  5DN6 G;  1JQ0 A;  2W0F C;  3SYP A;  1SES A;  4MVZ A;  1GO3 F;  5E1A C;  4FJC C;  3W7X A;  3W7S A;  1KEC A;  3CCE V;  2Y69 B;  2Z3Y A;  1AJQ A;  3AEI A;  1NR7 A;  2ITD C;  1R3K C;  4UVB A;  1M9N A;  4HZ3 A;  2Q68 A;  2ZD9 A;  4U7O A;  2WAM A;  2EBO A;  1H2G A;  2IJJ A;  2ZXW C;  3FKS G;  4TSF G;  5C93 A;  3A0R A;  3ASN C;  1FS0 G;  3E89 A;  2IU3 A;  4BAY A;  3AG3 B;  1FFT B;  3AG2 C;  3E83 A;  1B6Q A;  2IU0 A;  4P9O A;  4WFA V;  3OUF A;  4MS2 A;  3CCL V;  4PA9 A;  1L1F A;  1M57 C;  3CCV V;  5KA5 A;  2Q6A A;  3QO5 A;  5CBF A;  4QPK A;  3B77 A;  1QR8 A;  4RQE A;  1CPY A;  1E1R G;  5LHI A;  1RPO A;  2NLJ C;  4LBE C;  4JAV A;  2X6B A;  3AG4 B;  1COW G;  4QIW F;  2WLM A;  4MW3 A;  1FXK C;  2F43 G;  2K1E A;  5H6R A;  5LHH A;  2JK5 C;  1OCZ C;  4GX2 A;  3G4S V;  2HLD G;  2YEV A;  1OHH G;  4RUF A;  2DWD C;  3SYC A;  3W7T A;  1MSW D;  1QR9 A;  4JTD B;  3TK1 A;  4QNH B;  2QTO A;  4UUJ C;  3NXS A;  1JVM A;  1N8R W;  3UM7 A;  3ZMZ A;  3ASO C;  4R7C A;  1P7B A;  4BIZ A;  2HFE C;  1ZWI C;  3OAA G;  1OCR B;  1FXK A;  2EIM C;  4XDK A;  4OXS A;  5LGN A;  1BHB A;  3ABL C;  4P2Z A;  3OFN G;  4RO2 A;  1W0J G;  5CMU A;  1SZT A;  1RM1 C;  1NQT A;  3ZN1 A;  3ABU A;  2FTK A;  3SYA A;  2W6I G;  1QLN A;  2ZDI A;  5L3F A;  3ETE A;  2ZQM A;  1XL4 A;  4MVR A;  3FB8 C;  4QE9 A;  4EKW A;  5L3C A;  4LP8 A;  3ZN0 A;  1NBM G;  3AG1 B;  4WFH A;  3ABK C;  3OGC C;  3CMA V;  3ZCC A;  1GK9 A;  3VBB A;  3EHB B;  5B1A B;  5EK0 A;  2ZDI C;  5L3E A;  3OUS A;  3CC7 V;  4GX5 A;  3GWO A;  3SPJ A;  3G6E V;  3UKM A;  1THZ A;  2MK3 A;  1VQM V;  1K33 A;  4JPR A;  1EBO A;  5B1O A;  2B1I A;  3IFX A;  3OEE G;  5B1N A;  3VOU A;  5IYB O;  3SPI A;  1PNL A;  5B1B C;  5EBW C;  4ZKI A;  1VQ6 V;  1QLE C;  1OCC C;  1FXH A;  2EIK C;  3OM3 B;  3HPL C;  1WPX A;  3ABT A;  2HG5 C;  3X2Q C;  1R73 A;  3K04 A;  4QPJ A;  3LDC A;  2EIN B;  2DYS B;  3SPC A;  1R6K A;  4DXW A;  3D36 A;  3WG7 B;  3EFF K;  3MD0 A;  5HFL A;  3T2M A;  1QCE A;  1NJI W;  2JJ2 G;  1YTF D;  2CK3 G;  1TUE B;  3ZRW B;  3FB5 C;  1BMF G;  1ARO P;  3SYO A;  1I5X A;  2B5U A;  4MTX A;  3TCU A;  3E86 A;  4QE7 A;  4RUE A;  3WFV A;  1RPR A;  5LBQ A;  2HR3 A;  4P9P A;  3CCM V;  5L3G A;  1NR1 A;  5B3S B;  1BHA A;  1DF5 A;  1F4N A;  5CN0 A;  4XDJ A;  2PI5 A;  4PEL A;  1G8M A;  2QEX V;  3K3W A;  1K34 A;  1KKD A;  2XAH A;  5DM6 V;  3ABM B;  2YSU B;  4P30 A;  4TWK A;  1JJ2 U;  3K08 A;  4PA6 A;  3CCR V;  3CCS V;  3ETD A;  4Z1M G;  2Q69 A;  4QJF B;  3CPW U;  2IW5 A;  1YHQ V;  2DWE C;  4MVM A;  1K4D C;  4CBC A;  5FL7 G;  3FYE B;  5IY5 B;  2P67 A;  3ZMS A;  1V55 C;  5CBG A;  2WLL B;  2A0L A;  1CEZ A;  2XAJ A;  2EIJ C;  3ZIA G;  1P4R A;  2ZXW B;  1K92 A;  4JF3 A;  3GB7 C;  3F7V C;  4KUM A;  1AR1 B;  3ASN B;  1YJN V;  1S72 V;  5KA6 A;  4XDL A;  2WPD G;  1OCO B;  3E2E A;  3CCQ V;  4TT3 G;  5KUM A;  3FB6 C;  1K5S A;  1NVP B;  2X6C A;  2NNU A;  1K5Q A;  2QM7 A;  4KP4 A;  2OCC B;  2X7R B;  1JX9 A;  5IYC O;  5GW7 A;  2H94 A;  3JD1 A;  5H9C A;  1AI7 A;  1F23 A;  1DF4 A;  5HFM A;  4X89 A;  4ASU G;  4R8C A;  2Y69 C;  2UXN A;  3QO7 A;  1CP9 A;  5LHG A;  4L87 A;  2QKS A;  3W7U A;  2D3O W;  2IJH A;  1SER A;  4MVQ A;  2EIM B;  4I5S A;  1ROP A;  5LGT A;  2OT5 A;  3CYO A;  4GT1 A;  4PDR A;  1AI5 A;  4WF9 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...