3D36C

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
42
structure length
42
Chain Sequence
MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Sporulation kinase B
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 17
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 3d36C01
3D36C 1PV0A
chains in the Genus database with same CATH superfamily
4IYIA 4BW5A 2GHYA 5B1BB 5J2TA 2XAJA 2UUAB 2IW5A 1XHXA 4GYCB 2PI5A 4I7ZB 2PUSA 4U3JA 2R72A 4OXSA 3RYCB 4ZOLA 4LF8B 1SF9A 1OJHA 4KHPO 1A32A 4MT8A 5K1PA 1PKXA 3ZX6A 5ITZA 3CJHA 3D3QA 4I0XA 5J2TB 1R3JC 1VQ4V 2Q4PA 4TQFA 1L0LH 3ZCCA 4DV2B 3OGCC 2YIDA 4FLVA 2P5OA 2UUCB 1GAXA 4U3JB 2NLJC 1HWYA 2YEVB 2GTAA 2GV9A 3ASNC 3KZIZ 4N23A 1HNZO 5ITZB 4BIZA 1R6NA 3CJHB 3ABLC 3GWKC 2ZE8A 4D6TH 1VQ7V 2D3OW 3N2GB 1YJNV 3C3TA 1DTOA 1M56C 4TSFG 3ZIAG 4GX0A 1N34B 2QGNA 4B3RO 3AG1C 2EINC 2CDYA 3I5DA 5DEDA 1VP7A 3G4SV 3Q4HB 2VQFB 3JASA 4XDJA 1FAFA 4H44B 4FM1A 2KG7B 2VWJA 2QJ1A 2ATKC 4LF6O 5KHKA 3ZEDA 2BCCH 4LF9B 2Z5UA 2F43G 2JK5C 1OCCC 3QO5A 1JFFA 1VF5B 4DR5B 1AI5A 1KKCA 2JJ1G 3JASB 1FS0G 2EZOA 4EEQA 2K1EA 1XHZA 2VQEO 4JYBA 3CC7V 1U97A 4JI4B 5FPOA 3JALA 5LGUA 3J81N 1RPOA 3IJ4A 1CP9A 3SJAC 4GX1A 3HKCA 4JZ2A 1V55B 2W0XA 3BA8A 5JJNB 1I94O 1GM8A 3L73H 1K8AW 4O4HB 1PM9A 1FYJA 2CTWA 4WFHA 4BAYA 1I5XA 2H3OA 3DXRA 1AJPA 4YJ3A 3SDLA 4NR1A 1OHHG 3LNNA 2EIJC 4GLXA 2Q6AA 4UCVA 4WFBV 5KX5B 1GK9A 3H1HH 4JYYA 4EFBA 1KP2A 3ZMSA 4KHPB 2GSMB 3GVMA 4YJ3B 5IYCO 3H01A 1JR9A 4AILC 2Y48A 4Z1VA 4B7KA 1JJOA 2WLMA 3K3WA 2XAGA 4P9PA 3G6EV 1AP5A 3CS5A 4JI3O 2CE4A 5EIBD 3BA9A 3FB5C 4Q20A 2ZR2A 4X8AA 4DR6O 5JJJB 4J80A 3UT5A 1Q90D 2XAHA 5IY5C 4R50A 2ZE7A 1HNZB 1EFRG 1Y67A 4GX2A 2YUAA 4EFEA 1H2LA 3HKDA 1KB9F 4F4LA 4DR1O 4QPJA 1N0NA 1W0KG 3JCUZ 5GTHZ 2EILC 4G27B 4JI5O 4E2LA 1R3KC 4LH7A 3UT5B 3CSXA 4DXWA 5DECA 1MSWD 4B3RB 4JI0O 4DR3O 1H38A 3ASOC 2DE0X 4EKWA 2KSDA 1XDCA 4I9QA 3KG2A 1BQ0A 4WFAV 2E3CA 3HPLC 1QCEA 2D2CB 2LFSA 3AG4C 1TVKA 1DK1A 4X20A 5JH7A 2OCCC 4RAIA 1ZUQA 1OCRB 3FYEB 3ETDA 1Q6HA 3E2EA 3SR2C 3CB2A 2ZKOA 4DV1O 4LF6B 1Y76A 2ZE6A 3OMIB 3JATB 3HKBB 1BQZA 2CK3G 3A2FA 2Q9LA 1ZAUA 3HB3B 4KL1A 4KFMA 3K5OA 3JAKA 3MD0A 1TVKB 2WLIA 2UUBO 4MVRA 2LGWA 2RNBA 5JH7B 1QQCA 2VQEB 3CYOA 4J11A 3RYHA 3QO7A 1EZJA 2XOKG 4Q6GA 4UVCA 4FFKA 2QM7A 1BS3A 4P30A 1VQKV 1B04A 3SPIA 4B7EA 3JAKB 4I50A 2WLIB 2YSUB 4PA3A 4QPKA 1I94B 1AI7A 5IJ9A 2F66C 2E76B 5LMNO 4LF4O 3CCLV 2CGOA 1NTKH 2R70A 4BWAA 1K3EA 1ZL8A 3RYHB 3K0DA 1IBMO 1ORQC 2EZPA 2EIKB 4FK5C 1PNLA 2QWNB 3L75H 1FXKC 5E1AC 4I50B 2E75B 5IJ9B 3ICXA 2JGDA 4PA4A 4NYKA 5L3BA 3UO2A 2ODMA 2V1DA 1FJGO 4PDLA 3E86A 2PYJA 1KECA 4CH5A 3CCRV 4U3FH 4TT3G 3OE7G 4K35A 2UXBO 4X1IA 4R6ZA 1M57C 3RFRA 4ASUG 2XUMA 4D7SA 1TA8A 3CRRA 1NKDA 3G6BA 2P7TC 3ABUA 1PL4A 5KHGA 1IXBA 3CMAV 3L9DA 3DC5A 3WFVA 4MW8A 4CC5A 4DR4O 4LNUB 5BMVB 2RMKB 2IU0A 3K5NA 5H6RA 1GM7A 4G2KA 2OTLV 1AP6A 4DR1B 2UXDO 4K0KO 1NR1A 5CA0A 4JI5B 2F4VO 1CXZB 3N2KA 2YI9A 4JI0B 4J9YB 4TV8A 4DR3B 1NS1A 2YIBD 5JQGA 4XDKA 2K9PA 1YTFD 4PA6A 5KA6A 1KC8W 3ZMTA 2A9HA 3OR6C 2L6LA 2Q73A 2EULA 2PGGA 1VQNV 5CA0B 4YJ2A 4DV1B 3N2KB 1B6QA 3S3WA 5CBFA 4JTDB 4PELA 2DQ3A 4XDLA 5CA1A 3OEHG 2DYRC 1VF7A 1QR9A 3IAYA 2UUBB 4B08A 1P7GA 5IE9A 1E1QG 4YJ2B 1H8EG 3H1LH 5LMUO 4PHZA 3ZHVA 4RQFA 1B3QA 1KD1W 1QVFU 1WN7A 4DV6O 5CA1B 1G1XB 1HR0O 5EIBC 1X4TA 2ZE5A 1ZWIC 4PI2A 3LNMB 3CC4V 1K9MW 1I08A 5LMNB 1S3JA 3RWRD 1G6UA 4LF4B 2AZ2A 4DUZO 3ZMUA 2RN9A 1HP8A 2Q0AA 3ETGA 4O4JA 3NXSA 1JCHA 4UFZA 1IBMB 1XILA 1FXHA 2JRIA 3SYAA 4QE7A 3OUFA 2QWOB 4FLTA 2R9AA 1M1KW 3O9OA 4IGGA 3DTUB 5C8YA 2CTRA 2LW7A 2CUGA 4BIUA 1OCOB 3K06A 3ABKB 2UXBB 3JCZA 3CRAA 4JYAO 5CBGA 1N36O 4LFBO 2ITCC 2QTOA 1TAEA 3HKEA 4LFCO 4TOIA 3K5MA 3E83A 3HR0A 1GN2A 1M4UA 5C8YB 1NR7A 4AHCA 3TK1A 5LYJB 4DR4B 1P49A 4O2AA 3G71V 1IURA 1O9GA 2OCCB 3RVZA 1WB8A 3CC2V 1OV9A 1F4NA 1PNMA 2FL4A 2N74A 2WLLB 2UXDB 4K0KB 3BCCH 1Q81W 4X9QA 1S77D 2F4VB 4RWUA 2ZXWC 2MK3A 1KYOF 3OT7A 4PJ0Z 2F1MA 4U7NA 3E8GA 4O2AB 1S5LZ 4CH3A 1LR1A 1JVMA 3OMNB 5TISZ 3L71H 3P3PA 4DR2O 3D36C 1VMGA 1D5NA 2UXCO 4UCRA 1RM1C 3VBBA 5EBMC 4MTGA 3LDEA 4FJCC 3TXQA 5FPRA 2UXNA 5JWPA 5EBLC 4YXWG 3E22B 1R3LC 1US6A 2IJHA 4HBNA 2X6AA 3E8FA 2C2AA 2R9RB 4KP4A 5LMUB 1BL8A 1M90W 4H33A 2EX3A 2DYSC 4I5SA 3BY6A 3X2QB 2ZDIC 1HR0B 1XUQA 3TCUA 4DW1A 2BOBC 4BW9A 1QLEC 5GONB 2Y0IA 2WWWA 1YF2A 2CGNA 2VS0A 1OCZC 4RUFA 2LGQA 3ABMB 4DUZB 4JZGA 1NVPB 1WP7A 2FMLA 5IYZA 1Y74A 2WSSG 3LDDA 1M57B 5BY1A 1SETA 3OEEG 1P7BA 2BOCC 3P3NA 5CMUA 2A06H 4NB5A 5B1AC 2BSKA 2QSAA 3OTOO 4O4LB 2LJ2A 4QJFB 3VQXA 3K57A 3M7MX 4Z1MG 2NN4A 5IYZB 1Y74B 2WPDG 2QWQB 1YSCA 1WPBA 2FYUH 2PF4E 4JYAB 3L70H 2XAQA 4UB8Z 1D5AA 1N36B 3DGEA 5JJEB 2BSKB 3A8TA 4LFBB 3SPHA 4P9OA 4LFCB 1S72V 2ZT9B 3B8MA 4LF5O 1XEQA 5IDJA 1XBLA 2IJIA 5DM6V 3FFQA 1Y6XA 4JTAB 4ZOLB 2HP8A 3B77A 3EFFK 4GCZA 3OM3B 1JPXA 2IH3C 5IT9N 4I0XB 1MA1A 4J41A 3L72H 1VQ9V 2XAFA 4IHJA 5KMGA 1GKFA 3CCQV 1SQFA 5FNVA 4AQYO 4DR2B 2UXCB 3K59A 1AR1B 1BHBA 4TQDA 2QR4A 1V54B 1FPOA 2E74B 3I56V 5KMGB 4HAMA 5KHIA 1ZLZA 1SQBH 5FNVB 1MZFA 3BAAA 3ZJZA 5B3SB 3SJCC 1KUQA 1BGYH 5LXTA 1XL6A 1Q5OA 2KKWA 2Q67A 4J10A 5IWAO 4LR3A 3UCSC 3T1CA 2KB1A 2OYQA 2WA3A 5JCOC 1FFXA 1S5HC 3CCMV 4X64O 2DOSA 3JSNA 1QBZA 3ZMVA 2JDIG 1MOFA 3SPJA 4B3TO 1O9HA 1I0HA 1PNKA 3CD6V 1TUBA 1NBMG 2LQTA 1JFFB 3K0GA 4WFEA 3SYOA 2H94A 2Q7HA 1DGSA 3K79A 2QKAA 4DK1A 2HEPA 3JD3A 1YIJV 2FTKA 2Y4TA 1GM9A 5BXZA 2WAMA 4GUNA 5LOVA 3JALB 3OTOB 3CPWU 2P6JA 3ETEA 1TUBB 1UPGA 3SPCA 2N05A 4RO2A 3HKCB 3D36A 1HNWO 2Y69B 2A79B 4X1YA 5KHHA 3GWOA 4BIOA 4J9ZB 3EXAA 4MVUA 3T2MA 3DXRB 3U0ZA 2IBZH 1E79G 2BTOA 2YS8A 4LF5B 4GKKO 2DMXA 3CCEV 4X89A 1XI1A 2M6YA 2FB5A 2IH1C 4IL6Z 1GN3A 1Z2GA 3H9VA 1H2SB 4I4TA 4RQEA 4FLUA 4DRXA 5D5QA 2IM9A 3FAVA 2HR3A 1PV0A 4WBNA 1CPYA 3H1IH 1VF6C 4O2BA 1G4YB 2B5UA 2YIAA 1K7DA 4NTYA 4X65O 4AQYB 4I4TB 1QU7A 2Y0PA 4X66O 1F7YA 1SZXA 1BZKA 3HKDB 3BVOA 4W4LA 3FB6C 4FLWA 4OPHA 3WG7C 4FMTA 1DF5A 2N04A 4JTCB 4WBNB 3STLC 3O65A 2JS3A 4O2BB 1XNQO 2X6BA 2MW2B 1WP8A 4TV9A 3RBZA 4LWSA 1NH2B 5IWAB 4JV5O 1Y66A 4JAVA 4WCEV 1SZTA 1MSDA 4X20B 5HFMA 4FLYA 3T4DA 1RP3B 5IYDO 4X64B 1S5JA 2AHYA 4ZBMA 1SQGA 5B5EZ 1XREA 3I55V 1NJIW 1Y76B 4B3TB 4TV9B 2WA4A 1NQTA 1MNGA 2LW1A 3JD4A 1BMFG 1H2KA 3OUSA 1K5SA 1WNSA 3IC9A 1AB3A 2IJJA 3ZRXA 4BR6A 4LCUC 2B1IA 2E5LO 4JPRA 2V4DA 3T4ZA 3DC6A 3BRCA 3EVKA 2EIMC 3F7VC 1H8HG 1NZ6A 3ASNB 1HNWB 4CH4A 5CN0A 3ABLB 3OAAG 2LO1A 1ZL8B 2B9ZA 2X6CA 3IC7A 2CTQA 2ZQMA 3AG3C 4MVSA 1SQQH 4GKKB 1M56B 5B1NA 2JEUA 1FKAO 3AG2C 3AG1B 3K03A 2EINB 1JMKC 1SC5B 1GN6A 2JGDB 4RUEA 1QNMA 2W6IG 5H9CA 3WU2Z 4CH6A 2HLDG 5H6QA 5LP6C 4X1KA 4DV0O 3OMAB 1WPXA 4J7ZA 3AG7A 3CCSV 2AGAA 4X1IB 3SJBC 1UFIA 4K3AA 3C90A 1AJQA 1OCCB 4PDRA 4X65B 4X88A 1J95A 3CMEV 1EZVH 3U10A 4DW0A 2AW9A 4PV1B 5B1BC 4X66B 3JD2A 2VRZA 4DV3O 5EC1C 2HVKC 4ZIBA 2WLHA 1VARA 1XNQB 3AK1A 4WF9V 4YIOA 1K92A 4TV8B 5JQGB 3A0RA 3JARA 2BTQA 4XBFA 4JV5B 2DWDC 3ZHSA 3UO3A 1S76D 1V9PA 3A0HZ 2EIJB 2P4VA 2PY5A 3LUTB 2ZIMA 2BTQB 1N33O 4R7CA 4UV8A 3VQVA 4DK0A 1WAZA 4ICGA 2E5LB 1W2BU 5LHIA 1QR8A 2CAZC 4UVBA 1H2GA 1TUEB 5FL7G 3ZS8C 4WFGA 4LC1A 2HJFC 3BFRA 5J9PC 4FIPC 4DR7O 5IY5B 2A0LA 1R73A 1WA8A 3RYFA 3SYPA 3WB1A 4JF3A 1R3IC 1YJ9V 3B09A 2WLNA 2JJ2G 1OZ0A 4ZI7A 4O4JB 2EILB 3F7YC 3MHSC 2W0FC 1SA0A 4UCSA 2XASA 1AJNA 4PI0A 4YIPA 4EB6A 3RGBA 3ASOB 1WA8B 1N0JA 4UUJC 3RYFB 4NTWA 4PD4F 4GZRB 3E89A 2GDSA 2UXXA 3S3XA 4ZI7B 2P22C 3QTCA 3B40A 3JAMN 3AG4B 4UCUA 5CB4A 2F95B 1W59A 3ETQA 5F2VO 2A3QA 5EZYA 4DV0B 5CA3A 3VOUA 1V55C 3D8CA 1HW7A 1QHTA 1XL4A 1GH6A 1PPJH 5HFLA 3HKEB 3LSQA 1IDSA 2PYLA 1LUWA 3TXSA 1IBKO 3E35A 1RPRA 2OWOA 1ENVA 3ZN0A 5EZYB 4HZ3A 1GN4A 1SRYA 4DV3B 2XTAA 1KP3A 4JI1O 1VQ8V 4JI2O 2RCVA 2HKOA 3UQ8A 1AR4A 4O4IA 1EM1A 1ZX3A 1SESA 2A7WA 3T1YO 2HG5C 1FXKA 2IJKA 2OT5A 3CXCU 1JOYA 1TGOA 3J80N 5B66Z 3FX7A 4JI6O 3RYIA 1M9NA 2IU3A 4O4IB 5H2FZ 4B3SO 2OIGA 4P2ZA 2EIMB 2YI8A 2ZD9A 5LA6A 1Y4MA 4NXMO 1YHQV 3U11A 3OR7C 1FXKB 5L3DA 3BHPA 1IXMA 1EBOA 1N33B 2ZNIA 4PA7A 3BPZA 3VQWA 5IYBO 3RYIB 4Z2WA 1Q82W 3JD0A 2M7WA 1VQ6V 3ZHTA 2PZSA 5LP6A 1EN6A 5LA6B 1S0VA 3T1HO 4QE9A 2WLKA 2W6JG 4MTXA 1R6KA 3SJQC 2GUZA 4DR7B 4JI7O 5BR8O 1OCRC 1XMOO 1AVMA 1IVSA 4WFFA 1RSOA 1YDXA 4NXNO 4DV7O 1XQ8A 1CEZA 3AEIA 4J7JA 2YXHA 3H1KH 3RYCA 1N32O 2UU9O 3NR7A 3ZRVA 5L3EA 1R1BA 4CS2A 1XOUA 1Q8IA 1RSOB 1N8RW 2Y4UA 2P67A 4DV4O 4KXRA 3K9AA 4JI8O 4LFAO 4UB6Z 3CWBH 2DWEC 3ML0A 1Q6UA 3FD9A 2DQ0A 2YEVA 3H1JH 3K04A 2Q7GA 3MHHC 3SYQA 2DYRB 1IBKB 2QKCA 1WB7A 3N2GA 1YCIA 3K5LA 2JEXA 2EIKC 5GW7A 3W7SA 2QM8A 3M99B 4JI1B 4JI2B 1YVWA 3CCUV 2Q69A 1BT8A 1Q6IA 3FKSG 1JA8A 5AG2A 1PL0A 4JASA 3Q4HA 1E1RG 1VIBA 1URFA 3T1YB 1FXVA 3QO8A 4IHJB 1J5EO 1YEWA 5JVDA 3SPGA 4LBEC 1Z5VA 3CP1A 2KG7A 3KCXA 2Q68A 4JI6B 1U96A 3CE2A 4B3SB 4FM2A 5CBHA 2AZ0A 1M5IA 1NVPD 3EHBB 5IJ0A 4NXMB 5LGNA 2F93B 5KAFZ 5JVDB 1BHAA 1GRJA 2ZM6O 4NTXA 5H5NA 4CS3A 3ZMZA 1BE3H 2RJZA 1PP9H 5D5PA 5LXTB 5FLXN 1NTZH 3CRQA 3T1HB 1ZTEA 5IJ0B 4O4HA 5BZBA 3PJSK 1FFXB 3ZHUA 5LL6Y 4JI7B 3M8AA 4IIJA 5BR8B 1WJZA 1QVGU 1XMOB 4NXNB 4DV7B 1KBHA 2ZR3A 1Q86W 5EBWC 2JIZG 1FFTB 1VEWA 2F23A 3LSUA 5A9GA 5KX5A 4JYCA 5DN6G 3ZHRA 2QDOA 1N32B 1MG1A 2UU9B 4W4KA 1P84F 4HYOA 1K4DC 2EJ7A 4IIJB 2ZXWB 5LHGA 3ABTA 5LOVB 1IZ3A 4C7UA 4DV4B 1NT2B 3DSQA 3FB8C 5L3GA 4JI8B 1G8MA 4LFAB 3OD4A 1DLBA 1NI8A 1ROPA 3FYIB 4MTFA 3RW0A 4X1YB 1RM1B 2OTJV 3JYCA 5B1OA 1QLNA 2Q0OC 3E8HA 1UJWB 2P4KA 2ADPA 3OW2U 2ZDIA 3SGIA 2NNUA 5KHJA 4J7KA 3FB7C 5GTIZ 4DUYO 3F5WC 1XNRO 1AI6A 2R9IA 2ZCEA 4DRXB 4J42A 1K5QA 1L8DA 2DYSB 1AROP 4DYLA 4MVMA 5LGTA 3FAVB 2YXLA 1JJ2U 4QNHB 1J5EB 1OCOC 3IGAC 1QLEB 1Z5WA 2X0LA 4ZHQA 3ABKC 4F6EA 1OCZB 1HDJA 4LP8A 2YIBA 4FZ0A 3JATA 3HKBA 1KKDA 4OGQB 3BEHA 1AR5A 2RQ6A 4YY3O 4HNAA 1MABG 3K08A 5C93A 5B1AB 5L3FA 4ZHQB 2WLJA 3CX5F 3CCVV 4N21A 2ZM6B 4I55A 1KMIZ 2Z3YA 1SQXH 1YITV 2YICA 2ILMA 4TWKA 3SYCA 1YTFB 1H2MA 1K4CC 4AI8A 3W7TA 2QM4A 4LWSB 2Z0AA 3K9SA 4UCOA 4MSWC 4HNAB 4FM0A 4X62O 1NU1H 2ETNA 1SQVH 4B3MO 4MS2A 1F51A 1LUVA 1K33A 4CBCA 3TETA 1SQPH 4I55B 2YDEA 2EBOA 2B1GA 3UM7A 3BABA 2G38A 4H0LB 3MAQA 5J2UA 1VQPV 1D2DA 1I7FA 4PA9A 2ZNJA 3LSSA 3B4SA 3ZRSA 2QA4V 2V7QG 4F6RA 1SERA 4CS4A 1M93A 4H37A 3W7WA 4CC6A 4I9WA 1DF4A 1KQSU 4QIWF 1BCCH 3N27A 3J7AU 5J2UB 4D7TA 1YI2V 1FD9A 4DV5O 1VQ5V 4NKGB 3X2QC 3JAWA 5E79Z 4GX5A 1XMQO 4MW3A 4F6RB 4FVMA 1WLEA 2GTSA 2PTMA 3R66A 1YJWV 5EK0A 4YHHO 4LNUA 5BMVA 4FLXA 4IT5A 3ABMC 5JCOA 4U7OA 2HHHO 3G80A 3QVNA 4JI3B 1IBLO 3JAWB 4DR6B 1HNXO 4DUYB 2KQXA 3ZRWA 3JSLA 2LP7A 1XNRB 1JX9A 2AHZA 1K97A 1T5EA 2OIEA 4DO2A 3C3SA 2RDCA 4PDMA 4X1KB 1NH2D 4UV9A 2JVDA 4UXNA 1THZA 1AILA 4UCTA 3CXHF 2YC0A 2FKXA 3W7UA 3ZRWB 3K58A 1ZSPA 3QNEA 3OFNG 5KA5A 1I5YA 1SKVA 2EJRA 4ABMA 4YY3B 1JQ0A 4FFBA 2O57A 4NVPA 2GBOA 3RT3C 3VQYA 5LBQA 1W0JG 2HVJC 3CEIA 2LFRA 1BSMA 4JAAA 4FLZA 4L87A 3TJTA 4PDVA 2QWRB 1H2NA 1N4CA 2QTSA 3R65A 4CZZA 4R8CA 3JARB 3APOA 1Q3EA 2P06A 4X62B 4FFBB 4B3MB 1L1FA 3JD1A 3LDCA 4MVQA 2Q7EA 2JS5A 4MVOA 4QGPA 1EN5A 3TGUH 3B8NA 4MVZA 1PD3A 2XNDG 4FPPA 4G28B 3OGIB 3CRMA 3QF7A 2HJDA 1KU9A 4FZ1A 3ZBHA 3B2EE 2L35A 1VQMV 1VF6A 3UKMA 4OX9O 2ZINA 1V54C 2XHBA 5KAIZ 2NR5A 3KCYA 4GKJO 3F5TA 4UVAA 3W7XA 1EN4A 1X59A 5KLVH 1K34A 2DN9A 4LF7O 1MMMA 5B3SC 2JGUA 3AK3A 5A2QN 5K1XA 4KUMA 1LNQA 4DV5B 2QKSA 2YXYA 1AI4A 1P4RA 1SS3A 1XMQB 2UUAO 1GMGA 1FJGB 5LYJA 3WB0A 3WG7B 4YHHB 3G67A 2ZIOA 1SA0B 4LF8O 2WLLA 2VWKA 3D3IA 1VQLV 2HHHB 2Q5ZA 3P32A 1IBLB 5KUKA 4EB6B 3ZN1A 1Q7YW 1HNXB 3E8BA 1YZBA 1B06A 4K8ZA 4JGSA 1NTMH 5KUMA 4L8JA 2ARHA 5CB4B 4DV2O 1K73W 2UUCO 2OCHA 3CHXA 1RFYA 3AK2A 2ADQB 2P90A 2CTPA 2QE7G 2PI4A 2Y69C 4IYHA 4ZKIA 1MZEA 3QG5A 4K8XA 3STZC 2QWPB 2ITDC 3P30A 5EYPA 3E22A 4JAUA 3KKYA 1N34O 4LH6A 4MTOA 2BE3A 3RN4A 3MDSA 4TUYA 3PN1A 3APQA 2VQFO 5EYPB 2X7RB 4H13B 2AXTZ 4E4EA 3ZHQA 5GONA 4GT1A 4LF9O 5EC2C 4TUYB 1IX9A 4DR5O 3AG3B 1F23A 3WB2A 4OPAA 3CCJV 1VQOV 2DW4A 2HFEC 3AG2B 5LHHA 2CH7A 4DV6B 1YXBA 4OX9B 3THOA 3CRCA 1F4MA 4JI4O 4GKJB 1L0NH 4A5UB 1GTOA 1Q43A 4O4LA 2DJVA 3A0BZ 1GO3F 4LF7B 1R6TA 5LP6B 2QEXV 3GB7C 5L3CA 3OTFA 3L74H 2CH7B 2XT9A 1COWG 3IFXA 3RVYA 2H8PC 2GUZB 2Q8VA
chains in the Genus database with same CATH topology
3D36C 1PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D36 C;  1PV0 A; 
#chains in the Genus database with same CATH topology
 4IYI A;  4BW5 A;  2GHY A;  5B1B B;  5J2T A;  2XAJ A;  2UUA B;  2IW5 A;  1XHX A;  4GYC B;  2PI5 A;  4I7Z B;  2PUS A;  4U3J A;  2R72 A;  4OXS A;  3RYC B;  4ZOL A;  4LF8 B;  1SF9 A;  1OJH A;  4KHP O;  1A32 A;  4MT8 A;  5K1P A;  1PKX A;  3ZX6 A;  5ITZ A;  3CJH A;  3D3Q A;  4I0X A;  5J2T B;  1R3J C;  1VQ4 V;  2Q4P A;  4TQF A;  1L0L H;  3ZCC A;  4DV2 B;  3OGC C;  2YID A;  4FLV A;  2P5O A;  2UUC B;  1GAX A;  4U3J B;  2NLJ C;  1HWY A;  2YEV B;  2GTA A;  2GV9 A;  3ASN C;  3KZI Z;  4N23 A;  1HNZ O;  5ITZ B;  4BIZ A;  1R6N A;  3CJH B;  3ABL C;  3GWK C;  2ZE8 A;  4D6T H;  1VQ7 V;  2D3O W;  3N2G B;  1YJN V;  3C3T A;  1DTO A;  1M56 C;  4TSF G;  3ZIA G;  4GX0 A;  1N34 B;  2QGN A;  4B3R O;  3AG1 C;  2EIN C;  2CDY A;  3I5D A;  5DED A;  1VP7 A;  3G4S V;  3Q4H B;  2VQF B;  3JAS A;  4XDJ A;  1FAF A;  4H44 B;  4FM1 A;  2KG7 B;  2VWJ A;  2QJ1 A;  2ATK C;  4LF6 O;  5KHK A;  3ZED A;  2BCC H;  4LF9 B;  2Z5U A;  2F43 G;  2JK5 C;  1OCC C;  3QO5 A;  1JFF A;  1VF5 B;  4DR5 B;  1AI5 A;  1KKC A;  2JJ1 G;  3JAS B;  1FS0 G;  2EZO A;  4EEQ A;  2K1E A;  1XHZ A;  2VQE O;  4JYB A;  3CC7 V;  1U97 A;  4JI4 B;  5FPO A;  3JAL A;  5LGU A;  3J81 N;  1RPO A;  3IJ4 A;  1CP9 A;  3SJA C;  4GX1 A;  3HKC A;  4JZ2 A;  1V55 B;  2W0X A;  3BA8 A;  5JJN B;  1I94 O;  1GM8 A;  3L73 H;  1K8A W;  4O4H B;  1PM9 A;  1FYJ A;  2CTW A;  4WFH A;  4BAY A;  1I5X A;  2H3O A;  3DXR A;  1AJP A;  4YJ3 A;  3SDL A;  4NR1 A;  1OHH G;  3LNN A;  2EIJ C;  4GLX A;  2Q6A A;  4UCV A;  4WFB V;  5KX5 B;  1GK9 A;  3H1H H;  4JYY A;  4EFB A;  1KP2 A;  3ZMS A;  4KHP B;  2GSM B;  3GVM A;  4YJ3 B;  5IYC O;  3H01 A;  1JR9 A;  4AIL C;  2Y48 A;  4Z1V A;  4B7K A;  1JJO A;  2WLM A;  3K3W A;  2XAG A;  4P9P A;  3G6E V;  1AP5 A;  3CS5 A;  4JI3 O;  2CE4 A;  5EIB D;  3BA9 A;  3FB5 C;  4Q20 A;  2ZR2 A;  4X8A A;  4DR6 O;  5JJJ B;  4J80 A;  3UT5 A;  1Q90 D;  2XAH A;  5IY5 C;  4R50 A;  2ZE7 A;  1HNZ B;  1EFR G;  1Y67 A;  4GX2 A;  2YUA A;  4EFE A;  1H2L A;  3HKD A;  1KB9 F;  4F4L A;  4DR1 O;  4QPJ A;  1N0N A;  1W0K G;  3JCU Z;  5GTH Z;  2EIL C;  4G27 B;  4JI5 O;  4E2L A;  1R3K C;  4LH7 A;  3UT5 B;  3CSX A;  4DXW A;  5DEC A;  1MSW D;  4B3R B;  4JI0 O;  4DR3 O;  1H38 A;  3ASO C;  2DE0 X;  4EKW A;  2KSD A;  1XDC A;  4I9Q A;  3KG2 A;  1BQ0 A;  4WFA V;  2E3C A;  3HPL C;  1QCE A;  2D2C B;  2LFS A;  3AG4 C;  1TVK A;  1DK1 A;  4X20 A;  5JH7 A;  2OCC C;  4RAI A;  1ZUQ A;  1OCR B;  3FYE B;  3ETD A;  1Q6H A;  3E2E A;  3SR2 C;  3CB2 A;  2ZKO A;  4DV1 O;  4LF6 B;  1Y76 A;  2ZE6 A;  3OMI B;  3JAT B;  3HKB B;  1BQZ A;  2CK3 G;  3A2F A;  2Q9L A;  1ZAU A;  3HB3 B;  4KL1 A;  4KFM A;  3K5O A;  3JAK A;  3MD0 A;  1TVK B;  2WLI A;  2UUB O;  4MVR A;  2LGW A;  2RNB A;  5JH7 B;  1QQC A;  2VQE B;  3CYO A;  4J11 A;  3RYH A;  3QO7 A;  1EZJ A;  2XOK G;  4Q6G A;  4UVC A;  4FFK A;  2QM7 A;  1BS3 A;  4P30 A;  1VQK V;  1B04 A;  3SPI A;  4B7E A;  3JAK B;  4I50 A;  2WLI B;  2YSU B;  4PA3 A;  4QPK A;  1I94 B;  1AI7 A;  5IJ9 A;  2F66 C;  2E76 B;  5LMN O;  4LF4 O;  3CCL V;  2CGO A;  1NTK H;  2R70 A;  4BWA A;  1K3E A;  1ZL8 A;  3RYH B;  3K0D A;  1IBM O;  1ORQ C;  2EZP A;  2EIK B;  4FK5 C;  1PNL A;  2QWN B;  3L75 H;  1FXK C;  5E1A C;  4I50 B;  2E75 B;  5IJ9 B;  3ICX A;  2JGD A;  4PA4 A;  4NYK A;  5L3B A;  3UO2 A;  2ODM A;  2V1D A;  1FJG O;  4PDL A;  3E86 A;  2PYJ A;  1KEC A;  4CH5 A;  3CCR V;  4U3F H;  4TT3 G;  3OE7 G;  4K35 A;  2UXB O;  4X1I A;  4R6Z A;  1M57 C;  3RFR A;  4ASU G;  2XUM A;  4D7S A;  1TA8 A;  3CRR A;  1NKD A;  3G6B A;  2P7T C;  3ABU A;  1PL4 A;  5KHG A;  1IXB A;  3CMA V;  3L9D A;  3DC5 A;  3WFV A;  4MW8 A;  4CC5 A;  4DR4 O;  4LNU B;  5BMV B;  2RMK B;  2IU0 A;  3K5N A;  5H6R A;  1GM7 A;  4G2K A;  2OTL V;  1AP6 A;  4DR1 B;  2UXD O;  4K0K O;  1NR1 A;  5CA0 A;  4JI5 B;  2F4V O;  1CXZ B;  3N2K A;  2YI9 A;  4JI0 B;  4J9Y B;  4TV8 A;  4DR3 B;  1NS1 A;  2YIB D;  5JQG A;  4XDK A;  2K9P A;  1YTF D;  4PA6 A;  5KA6 A;  1KC8 W;  3ZMT A;  2A9H A;  3OR6 C;  2L6L A;  2Q73 A;  2EUL A;  2PGG A;  1VQN V;  5CA0 B;  4YJ2 A;  4DV1 B;  3N2K B;  1B6Q A;  3S3W A;  5CBF A;  4JTD B;  4PEL A;  2DQ3 A;  4XDL A;  5CA1 A;  3OEH G;  2DYR C;  1VF7 A;  1QR9 A;  3IAY A;  2UUB B;  4B08 A;  1P7G A;  5IE9 A;  1E1Q G;  4YJ2 B;  1H8E G;  3H1L H;  5LMU O;  4PHZ A;  3ZHV A;  4RQF A;  1B3Q A;  1KD1 W;  1QVF U;  1WN7 A;  4DV6 O;  5CA1 B;  1G1X B;  1HR0 O;  5EIB C;  1X4T A;  2ZE5 A;  1ZWI C;  4PI2 A;  3LNM B;  3CC4 V;  1K9M W;  1I08 A;  5LMN B;  1S3J A;  3RWR D;  1G6U A;  4LF4 B;  2AZ2 A;  4DUZ O;  3ZMU A;  2RN9 A;  1HP8 A;  2Q0A A;  3ETG A;  4O4J A;  3NXS A;  1JCH A;  4UFZ A;  1IBM B;  1XIL A;  1FXH A;  2JRI A;  3SYA A;  4QE7 A;  3OUF A;  2QWO B;  4FLT A;  2R9A A;  1M1K W;  3O9O A;  4IGG A;  3DTU B;  5C8Y A;  2CTR A;  2LW7 A;  2CUG A;  4BIU A;  1OCO B;  3K06 A;  3ABK B;  2UXB B;  3JCZ A;  3CRA A;  4JYA O;  5CBG A;  1N36 O;  4LFB O;  2ITC C;  2QTO A;  1TAE A;  3HKE A;  4LFC O;  4TOI A;  3K5M A;  3E83 A;  3HR0 A;  1GN2 A;  1M4U A;  5C8Y B;  1NR7 A;  4AHC A;  3TK1 A;  5LYJ B;  4DR4 B;  1P49 A;  4O2A A;  3G71 V;  1IUR A;  1O9G A;  2OCC B;  3RVZ A;  1WB8 A;  3CC2 V;  1OV9 A;  1F4N A;  1PNM A;  2FL4 A;  2N74 A;  2WLL B;  2UXD B;  4K0K B;  3BCC H;  1Q81 W;  4X9Q A;  1S77 D;  2F4V B;  4RWU A;  2ZXW C;  2MK3 A;  1KYO F;  3OT7 A;  4PJ0 Z;  2F1M A;  4U7N A;  3E8G A;  4O2A B;  1S5L Z;  4CH3 A;  1LR1 A;  1JVM A;  3OMN B;  5TIS Z;  3L71 H;  3P3P A;  4DR2 O;  3D36 C;  1VMG A;  1D5N A;  2UXC O;  4UCR A;  1RM1 C;  3VBB A;  5EBM C;  4MTG A;  3LDE A;  4FJC C;  3TXQ A;  5FPR A;  2UXN A;  5JWP A;  5EBL C;  4YXW G;  3E22 B;  1R3L C;  1US6 A;  2IJH A;  4HBN A;  2X6A A;  3E8F A;  2C2A A;  2R9R B;  4KP4 A;  5LMU B;  1BL8 A;  1M90 W;  4H33 A;  2EX3 A;  2DYS C;  4I5S A;  3BY6 A;  3X2Q B;  2ZDI C;  1HR0 B;  1XUQ A;  3TCU A;  4DW1 A;  2BOB C;  4BW9 A;  1QLE C;  5GON B;  2Y0I A;  2WWW A;  1YF2 A;  2CGN A;  2VS0 A;  1OCZ C;  4RUF A;  2LGQ A;  3ABM B;  4DUZ B;  4JZG A;  1NVP B;  1WP7 A;  2FML A;  5IYZ A;  1Y74 A;  2WSS G;  3LDD A;  1M57 B;  5BY1 A;  1SET A;  3OEE G;  1P7B A;  2BOC C;  3P3N A;  5CMU A;  2A06 H;  4NB5 A;  5B1A C;  2BSK A;  2QSA A;  3OTO O;  4O4L B;  2LJ2 A;  4QJF B;  3VQX A;  3K57 A;  3M7M X;  4Z1M G;  2NN4 A;  5IYZ B;  1Y74 B;  2WPD G;  2QWQ B;  1YSC A;  1WPB A;  2FYU H;  2PF4 E;  4JYA B;  3L70 H;  2XAQ A;  4UB8 Z;  1D5A A;  1N36 B;  3DGE A;  5JJE B;  2BSK B;  3A8T A;  4LFB B;  3SPH A;  4P9O A;  4LFC B;  1S72 V;  2ZT9 B;  3B8M A;  4LF5 O;  1XEQ A;  5IDJ A;  1XBL A;  2IJI A;  5DM6 V;  3FFQ A;  1Y6X A;  4JTA B;  4ZOL B;  2HP8 A;  3B77 A;  3EFF K;  4GCZ A;  3OM3 B;  1JPX A;  2IH3 C;  5IT9 N;  4I0X B;  1MA1 A;  4J41 A;  3L72 H;  1VQ9 V;  2XAF A;  4IHJ A;  5KMG A;  1GKF A;  3CCQ V;  1SQF A;  5FNV A;  4AQY O;  4DR2 B;  2UXC B;  3K59 A;  1AR1 B;  1BHB A;  4TQD A;  2QR4 A;  1V54 B;  1FPO A;  2E74 B;  3I56 V;  5KMG B;  4HAM A;  5KHI A;  1ZLZ A;  1SQB H;  5FNV B;  1MZF A;  3BAA A;  3ZJZ A;  5B3S B;  3SJC C;  1KUQ A;  1BGY H;  5LXT A;  1XL6 A;  1Q5O A;  2KKW A;  2Q67 A;  4J10 A;  5IWA O;  4LR3 A;  3UCS C;  3T1C A;  2KB1 A;  2OYQ A;  2WA3 A;  5JCO C;  1FFX A;  1S5H C;  3CCM V;  4X64 O;  2DOS A;  3JSN A;  1QBZ A;  3ZMV A;  2JDI G;  1MOF A;  3SPJ A;  4B3T O;  1O9H A;  1I0H A;  1PNK A;  3CD6 V;  1TUB A;  1NBM G;  2LQT A;  1JFF B;  3K0G A;  4WFE A;  3SYO A;  2H94 A;  2Q7H A;  1DGS A;  3K79 A;  2QKA A;  4DK1 A;  2HEP A;  3JD3 A;  1YIJ V;  2FTK A;  2Y4T A;  1GM9 A;  5BXZ A;  2WAM A;  4GUN A;  5LOV A;  3JAL B;  3OTO B;  3CPW U;  2P6J A;  3ETE A;  1TUB B;  1UPG A;  3SPC A;  2N05 A;  4RO2 A;  3HKC B;  3D36 A;  1HNW O;  2Y69 B;  2A79 B;  4X1Y A;  5KHH A;  3GWO A;  4BIO A;  4J9Z B;  3EXA A;  4MVU A;  3T2M A;  3DXR B;  3U0Z A;  2IBZ H;  1E79 G;  2BTO A;  2YS8 A;  4LF5 B;  4GKK O;  2DMX A;  3CCE V;  4X89 A;  1XI1 A;  2M6Y A;  2FB5 A;  2IH1 C;  4IL6 Z;  1GN3 A;  1Z2G A;  3H9V A;  1H2S B;  4I4T A;  4RQE A;  4FLU A;  4DRX A;  5D5Q A;  2IM9 A;  3FAV A;  2HR3 A;  1PV0 A;  4WBN A;  1CPY A;  3H1I H;  1VF6 C;  4O2B A;  1G4Y B;  2B5U A;  2YIA A;  1K7D A;  4NTY A;  4X65 O;  4AQY B;  4I4T B;  1QU7 A;  2Y0P A;  4X66 O;  1F7Y A;  1SZX A;  1BZK A;  3HKD B;  3BVO A;  4W4L A;  3FB6 C;  4FLW A;  4OPH A;  3WG7 C;  4FMT A;  1DF5 A;  2N04 A;  4JTC B;  4WBN B;  3STL C;  3O65 A;  2JS3 A;  4O2B B;  1XNQ O;  2X6B A;  2MW2 B;  1WP8 A;  4TV9 A;  3RBZ A;  4LWS A;  1NH2 B;  5IWA B;  4JV5 O;  1Y66 A;  4JAV A;  4WCE V;  1SZT A;  1MSD A;  4X20 B;  5HFM A;  4FLY A;  3T4D A;  1RP3 B;  5IYD O;  4X64 B;  1S5J A;  2AHY A;  4ZBM A;  1SQG A;  5B5E Z;  1XRE A;  3I55 V;  1NJI W;  1Y76 B;  4B3T B;  4TV9 B;  2WA4 A;  1NQT A;  1MNG A;  2LW1 A;  3JD4 A;  1BMF G;  1H2K A;  3OUS A;  1K5S A;  1WNS A;  3IC9 A;  1AB3 A;  2IJJ A;  3ZRX A;  4BR6 A;  4LCU C;  2B1I A;  2E5L O;  4JPR A;  2V4D A;  3T4Z A;  3DC6 A;  3BRC A;  3EVK A;  2EIM C;  3F7V C;  1H8H G;  1NZ6 A;  3ASN B;  1HNW B;  4CH4 A;  5CN0 A;  3ABL B;  3OAA G;  2LO1 A;  1ZL8 B;  2B9Z A;  2X6C A;  3IC7 A;  2CTQ A;  2ZQM A;  3AG3 C;  4MVS A;  1SQQ H;  4GKK B;  1M56 B;  5B1N A;  2JEU A;  1FKA O;  3AG2 C;  3AG1 B;  3K03 A;  2EIN B;  1JMK C;  1SC5 B;  1GN6 A;  2JGD B;  4RUE A;  1QNM A;  2W6I G;  5H9C A;  3WU2 Z;  4CH6 A;  2HLD G;  5H6Q A;  5LP6 C;  4X1K A;  4DV0 O;  3OMA B;  1WPX A;  4J7Z A;  3AG7 A;  3CCS V;  2AGA A;  4X1I B;  3SJB C;  1UFI A;  4K3A A;  3C90 A;  1AJQ A;  1OCC B;  4PDR A;  4X65 B;  4X88 A;  1J95 A;  3CME V;  1EZV H;  3U10 A;  4DW0 A;  2AW9 A;  4PV1 B;  5B1B C;  4X66 B;  3JD2 A;  2VRZ A;  4DV3 O;  5EC1 C;  2HVK C;  4ZIB A;  2WLH A;  1VAR A;  1XNQ B;  3AK1 A;  4WF9 V;  4YIO A;  1K92 A;  4TV8 B;  5JQG B;  3A0R A;  3JAR A;  2BTQ A;  4XBF A;  4JV5 B;  2DWD C;  3ZHS A;  3UO3 A;  1S76 D;  1V9P A;  3A0H Z;  2EIJ B;  2P4V A;  2PY5 A;  3LUT B;  2ZIM A;  2BTQ B;  1N33 O;  4R7C A;  4UV8 A;  3VQV A;  4DK0 A;  1WAZ A;  4ICG A;  2E5L B;  1W2B U;  5LHI A;  1QR8 A;  2CAZ C;  4UVB A;  1H2G A;  1TUE B;  5FL7 G;  3ZS8 C;  4WFG A;  4LC1 A;  2HJF C;  3BFR A;  5J9P C;  4FIP C;  4DR7 O;  5IY5 B;  2A0L A;  1R73 A;  1WA8 A;  3RYF A;  3SYP A;  3WB1 A;  4JF3 A;  1R3I C;  1YJ9 V;  3B09 A;  2WLN A;  2JJ2 G;  1OZ0 A;  4ZI7 A;  4O4J B;  2EIL B;  3F7Y C;  3MHS C;  2W0F C;  1SA0 A;  4UCS A;  2XAS A;  1AJN A;  4PI0 A;  4YIP A;  4EB6 A;  3RGB A;  3ASO B;  1WA8 B;  1N0J A;  4UUJ C;  3RYF B;  4NTW A;  4PD4 F;  4GZR B;  3E89 A;  2GDS A;  2UXX A;  3S3X A;  4ZI7 B;  2P22 C;  3QTC A;  3B40 A;  3JAM N;  3AG4 B;  4UCU A;  5CB4 A;  2F95 B;  1W59 A;  3ETQ A;  5F2V O;  2A3Q A;  5EZY A;  4DV0 B;  5CA3 A;  3VOU A;  1V55 C;  3D8C A;  1HW7 A;  1QHT A;  1XL4 A;  1GH6 A;  1PPJ H;  5HFL A;  3HKE B;  3LSQ A;  1IDS A;  2PYL A;  1LUW A;  3TXS A;  1IBK O;  3E35 A;  1RPR A;  2OWO A;  1ENV A;  3ZN0 A;  5EZY B;  4HZ3 A;  1GN4 A;  1SRY A;  4DV3 B;  2XTA A;  1KP3 A;  4JI1 O;  1VQ8 V;  4JI2 O;  2RCV A;  2HKO A;  3UQ8 A;  1AR4 A;  4O4I A;  1EM1 A;  1ZX3 A;  1SES A;  2A7W A;  3T1Y O;  2HG5 C;  1FXK A;  2IJK A;  2OT5 A;  3CXC U;  1JOY A;  1TGO A;  3J80 N;  5B66 Z;  3FX7 A;  4JI6 O;  3RYI A;  1M9N A;  2IU3 A;  4O4I B;  5H2F Z;  4B3S O;  2OIG A;  4P2Z A;  2EIM B;  2YI8 A;  2ZD9 A;  5LA6 A;  1Y4M A;  4NXM O;  1YHQ V;  3U11 A;  3OR7 C;  1FXK B;  5L3D A;  3BHP A;  1IXM A;  1EBO A;  1N33 B;  2ZNI A;  4PA7 A;  3BPZ A;  3VQW A;  5IYB O;  3RYI B;  4Z2W A;  1Q82 W;  3JD0 A;  2M7W A;  1VQ6 V;  3ZHT A;  2PZS A;  5LP6 A;  1EN6 A;  5LA6 B;  1S0V A;  3T1H O;  4QE9 A;  2WLK A;  2W6J G;  4MTX A;  1R6K A;  3SJQ C;  2GUZ A;  4DR7 B;  4JI7 O;  5BR8 O;  1OCR C;  1XMO O;  1AVM A;  1IVS A;  4WFF A;  1RSO A;  1YDX A;  4NXN O;  4DV7 O;  1XQ8 A;  1CEZ A;  3AEI A;  4J7J A;  2YXH A;  3H1K H;  3RYC A;  1N32 O;  2UU9 O;  3NR7 A;  3ZRV A;  5L3E A;  1R1B A;  4CS2 A;  1XOU A;  1Q8I A;  1RSO B;  1N8R W;  2Y4U A;  2P67 A;  4DV4 O;  4KXR A;  3K9A A;  4JI8 O;  4LFA O;  4UB6 Z;  3CWB H;  2DWE C;  3ML0 A;  1Q6U A;  3FD9 A;  2DQ0 A;  2YEV A;  3H1J H;  3K04 A;  2Q7G A;  3MHH C;  3SYQ A;  2DYR B;  1IBK B;  2QKC A;  1WB7 A;  3N2G A;  1YCI A;  3K5L A;  2JEX A;  2EIK C;  5GW7 A;  3W7S A;  2QM8 A;  3M99 B;  4JI1 B;  4JI2 B;  1YVW A;  3CCU V;  2Q69 A;  1BT8 A;  1Q6I A;  3FKS G;  1JA8 A;  5AG2 A;  1PL0 A;  4JAS A;  3Q4H A;  1E1R G;  1VIB A;  1URF A;  3T1Y B;  1FXV A;  3QO8 A;  4IHJ B;  1J5E O;  1YEW A;  5JVD A;  3SPG A;  4LBE C;  1Z5V A;  3CP1 A;  2KG7 A;  3KCX A;  2Q68 A;  4JI6 B;  1U96 A;  3CE2 A;  4B3S B;  4FM2 A;  5CBH A;  2AZ0 A;  1M5I A;  1NVP D;  3EHB B;  5IJ0 A;  4NXM B;  5LGN A;  2F93 B;  5KAF Z;  5JVD B;  1BHA A;  1GRJ A;  2ZM6 O;  4NTX A;  5H5N A;  4CS3 A;  3ZMZ A;  1BE3 H;  2RJZ A;  1PP9 H;  5D5P A;  5LXT B;  5FLX N;  1NTZ H;  3CRQ A;  3T1H B;  1ZTE A;  5IJ0 B;  4O4H A;  5BZB A;  3PJS K;  1FFX B;  3ZHU A;  5LL6 Y;  4JI7 B;  3M8A A;  4IIJ A;  5BR8 B;  1WJZ A;  1QVG U;  1XMO B;  4NXN B;  4DV7 B;  1KBH A;  2ZR3 A;  1Q86 W;  5EBW C;  2JIZ G;  1FFT B;  1VEW A;  2F23 A;  3LSU A;  5A9G A;  5KX5 A;  4JYC A;  5DN6 G;  3ZHR A;  2QDO A;  1N32 B;  1MG1 A;  2UU9 B;  4W4K A;  1P84 F;  4HYO A;  1K4D C;  2EJ7 A;  4IIJ B;  2ZXW B;  5LHG A;  3ABT A;  5LOV B;  1IZ3 A;  4C7U A;  4DV4 B;  1NT2 B;  3DSQ A;  3FB8 C;  5L3G A;  4JI8 B;  1G8M A;  4LFA B;  3OD4 A;  1DLB A;  1NI8 A;  1ROP A;  3FYI B;  4MTF A;  3RW0 A;  4X1Y B;  1RM1 B;  2OTJ V;  3JYC A;  5B1O A;  1QLN A;  2Q0O C;  3E8H A;  1UJW B;  2P4K A;  2ADP A;  3OW2 U;  2ZDI A;  3SGI A;  2NNU A;  5KHJ A;  4J7K A;  3FB7 C;  5GTI Z;  4DUY O;  3F5W C;  1XNR O;  1AI6 A;  2R9I A;  2ZCE A;  4DRX B;  4J42 A;  1K5Q A;  1L8D A;  2DYS B;  1ARO P;  4DYL A;  4MVM A;  5LGT A;  3FAV B;  2YXL A;  1JJ2 U;  4QNH B;  1J5E B;  1OCO C;  3IGA C;  1QLE B;  1Z5W A;  2X0L A;  4ZHQ A;  3ABK C;  4F6E A;  1OCZ B;  1HDJ A;  4LP8 A;  2YIB A;  4FZ0 A;  3JAT A;  3HKB A;  1KKD A;  4OGQ B;  3BEH A;  1AR5 A;  2RQ6 A;  4YY3 O;  4HNA A;  1MAB G;  3K08 A;  5C93 A;  5B1A B;  5L3F A;  4ZHQ B;  2WLJ A;  3CX5 F;  3CCV V;  4N21 A;  2ZM6 B;  4I55 A;  1KMI Z;  2Z3Y A;  1SQX H;  1YIT V;  2YIC A;  2ILM A;  4TWK A;  3SYC A;  1YTF B;  1H2M A;  1K4C C;  4AI8 A;  3W7T A;  2QM4 A;  4LWS B;  2Z0A A;  3K9S A;  4UCO A;  4MSW C;  4HNA B;  4FM0 A;  4X62 O;  1NU1 H;  2ETN A;  1SQV H;  4B3M O;  4MS2 A;  1F51 A;  1LUV A;  1K33 A;  4CBC A;  3TET A;  1SQP H;  4I55 B;  2YDE A;  2EBO A;  2B1G A;  3UM7 A;  3BAB A;  2G38 A;  4H0L B;  3MAQ A;  5J2U A;  1VQP V;  1D2D A;  1I7F A;  4PA9 A;  2ZNJ A;  3LSS A;  3B4S A;  3ZRS A;  2QA4 V;  2V7Q G;  4F6R A;  1SER A;  4CS4 A;  1M93 A;  4H37 A;  3W7W A;  4CC6 A;  4I9W A;  1DF4 A;  1KQS U;  4QIW F;  1BCC H;  3N27 A;  3J7A U;  5J2U B;  4D7T A;  1YI2 V;  1FD9 A;  4DV5 O;  1VQ5 V;  4NKG B;  3X2Q C;  3JAW A;  5E79 Z;  4GX5 A;  1XMQ O;  4MW3 A;  4F6R B;  4FVM A;  1WLE A;  2GTS A;  2PTM A;  3R66 A;  1YJW V;  5EK0 A;  4YHH O;  4LNU A;  5BMV A;  4FLX A;  4IT5 A;  3ABM C;  5JCO A;  4U7O A;  2HHH O;  3G80 A;  3QVN A;  4JI3 B;  1IBL O;  3JAW B;  4DR6 B;  1HNX O;  4DUY B;  2KQX A;  3ZRW A;  3JSL A;  2LP7 A;  1XNR B;  1JX9 A;  2AHZ A;  1K97 A;  1T5E A;  2OIE A;  4DO2 A;  3C3S A;  2RDC A;  4PDM A;  4X1K B;  1NH2 D;  4UV9 A;  2JVD A;  4UXN A;  1THZ A;  1AIL A;  4UCT A;  3CXH F;  2YC0 A;  2FKX A;  3W7U A;  3ZRW B;  3K58 A;  1ZSP A;  3QNE A;  3OFN G;  5KA5 A;  1I5Y A;  1SKV A;  2EJR A;  4ABM A;  4YY3 B;  1JQ0 A;  4FFB A;  2O57 A;  4NVP A;  2GBO A;  3RT3 C;  3VQY A;  5LBQ A;  1W0J G;  2HVJ C;  3CEI A;  2LFR A;  1BSM A;  4JAA A;  4FLZ A;  4L87 A;  3TJT A;  4PDV A;  2QWR B;  1H2N A;  1N4C A;  2QTS A;  3R65 A;  4CZZ A;  4R8C A;  3JAR B;  3APO A;  1Q3E A;  2P06 A;  4X62 B;  4FFB B;  4B3M B;  1L1F A;  3JD1 A;  3LDC A;  4MVQ A;  2Q7E A;  2JS5 A;  4MVO A;  4QGP A;  1EN5 A;  3TGU H;  3B8N A;  4MVZ A;  1PD3 A;  2XND G;  4FPP A;  4G28 B;  3OGI B;  3CRM A;  3QF7 A;  2HJD A;  1KU9 A;  4FZ1 A;  3ZBH A;  3B2E E;  2L35 A;  1VQM V;  1VF6 A;  3UKM A;  4OX9 O;  2ZIN A;  1V54 C;  2XHB A;  5KAI Z;  2NR5 A;  3KCY A;  4GKJ O;  3F5T A;  4UVA A;  3W7X A;  1EN4 A;  1X59 A;  5KLV H;  1K34 A;  2DN9 A;  4LF7 O;  1MMM A;  5B3S C;  2JGU A;  3AK3 A;  5A2Q N;  5K1X A;  4KUM A;  1LNQ A;  4DV5 B;  2QKS A;  2YXY A;  1AI4 A;  1P4R A;  1SS3 A;  1XMQ B;  2UUA O;  1GMG A;  1FJG B;  5LYJ A;  3WB0 A;  3WG7 B;  4YHH B;  3G67 A;  2ZIO A;  1SA0 B;  4LF8 O;  2WLL A;  2VWK A;  3D3I A;  1VQL V;  2HHH B;  2Q5Z A;  3P32 A;  1IBL B;  5KUK A;  4EB6 B;  3ZN1 A;  1Q7Y W;  1HNX B;  3E8B A;  1YZB A;  1B06 A;  4K8Z A;  4JGS A;  1NTM H;  5KUM A;  4L8J A;  2ARH A;  5CB4 B;  4DV2 O;  1K73 W;  2UUC O;  2OCH A;  3CHX A;  1RFY A;  3AK2 A;  2ADQ B;  2P90 A;  2CTP A;  2QE7 G;  2PI4 A;  2Y69 C;  4IYH A;  4ZKI A;  1MZE A;  3QG5 A;  4K8X A;  3STZ C;  2QWP B;  2ITD C;  3P30 A;  5EYP A;  3E22 A;  4JAU A;  3KKY A;  1N34 O;  4LH6 A;  4MTO A;  2BE3 A;  3RN4 A;  3MDS A;  4TUY A;  3PN1 A;  3APQ A;  2VQF O;  5EYP B;  2X7R B;  4H13 B;  2AXT Z;  4E4E A;  3ZHQ A;  5GON A;  4GT1 A;  4LF9 O;  5EC2 C;  4TUY B;  1IX9 A;  4DR5 O;  3AG3 B;  1F23 A;  3WB2 A;  4OPA A;  3CCJ V;  1VQO V;  2DW4 A;  2HFE C;  3AG2 B;  5LHH A;  2CH7 A;  4DV6 B;  1YXB A;  4OX9 B;  3THO A;  3CRC A;  1F4M A;  4JI4 O;  4GKJ B;  1L0N H;  4A5U B;  1GTO A;  1Q43 A;  4O4L A;  2DJV A;  3A0B Z;  1GO3 F;  4LF7 B;  1R6T A;  5LP6 B;  2QEX V;  3GB7 C;  5L3C A;  3OTF A;  3L74 H;  2CH7 B;  2XT9 A;  1COW G;  3IFX A;  3RVY A;  2H8P C;  2GUZ B;  2Q8V A; 
#chains in the Genus database with same CATH homology
 3D36 C;  1PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...