3D36C

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
42
structure length
42
Chain Sequence
b'MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase B
molecule tags Transferase/transferase inhibitor
source organism Geobacillus stearothermophilus
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
total genus 17
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 3d36C01
3D36C 1PV0A
chains in the Genus database with same CATH superfamily
4B3TO 4JTDB 1XNRB 3AEIA 5J2TB 2VWJA 1IURA 4QE7A 4GUNA 2ZNJA 3BFRA 4DK1A 5CN0A 1G4YB 1J95A 4MTFA 3K0GA 4KFMA 4JI7B 1NVPD 4R8CA 4FIPC 3P3PA 2IJIA 5CB4B 2ILMA 3CD6V 4ZHQA 3D3IA 4FZ1A 4ZIBA 4X65B 5LGNA 1HW7A 3BAAA 2K9PA 5IY5B 3E8FA 4DR3B 1NH2B 1A32A 3G6EV 4PI2A 1BHAA 2JJ2G 1K9MW 4JI8O 2PZSA 3E8GA 1V9PA 4TUYA 1NH2D 1FXVA 1T5EA 3RGBA 2WLKA 3IC9A 4X66O 3RYIA 4BIOA 3UM7A 2ZE7A 3S3XA 4AI8A 2F4VB 3K58A 5LHGA 4FM1A 1OCZC 1OCZB 2P90A 3LSSA 3LDDA 1WP8A 5IJ0A 4PDMA 5H5NA 4X8AA 4ICGA 1KYOF 3VOUA 1WJZA 1K92A 2Y0PA 4TV9B 4ZBMA 5ITZA 4JI5O 3JD3A 1L1FA 3ZRWB 3LUTB 1L8DA 1FFXA 4B3MO 4J42A 3JD2A 3WB0A 3SPGA 1HNWB 3CYOA 1GAXA 1IX9A 4EB6B 2QKCA 4LR3A 1KP3A 5EYPA 1QR8A 3FFQA 4UCOA 3T1YB 2ZR2A 4JI3B 2R72A 3RYCA 2ZXWB 1X4TA 2Y4UA 3OW2U 2HHHO 2QA4V 4JF3A 5KHIA 4JV5B 2A0LA 3JALA 1GN2A 5BZBA 2DW4A 1K34A 3K0DA 4LF7B 3CCVV 2R9RB 4HNAA 4JYAB 3L71H 5EC1C 3G67A 2EIJB 5BR8O 1MG1A 1H2LA 4GLXA 1WB8A 5ITZB 4RUEA 5LMUO 1N8RW 1VARA 1EZJA 4LBEC 3SYCA 1S5JA 1Y4MA 4UXNA 3QTCA 3CRQA 1Y76B 1MZEA 2EJRA 3ZHRA 1GM9A 4I50B 4JYYA 2LW7A 3M7MX 2ZCEA 1VQ6V 1VQ9V 1H2NA 2K1EA 4AILC 2JGDB 2ZM6B 2F23A 3JSNA 3R65A 4O2BB 3OEHG 5JJJB 5J2UA 1AJNA 2PY5A 2XHBA 4O4LA 1MA1A 1B06A 3JATB 4O4IB 1M5IA 2N04A 2R9IA 4OX9B 2FL4A 1WP7A 1R3KC 1RPRA 2EIKB 4MVZA 2QWOB 4CBCA 3KKYA 3FB6C 4O2AA 3UT5A 3RBZA 1K33A 1N4CA 3D8CA 1D5AA 4E4EA 1IBMB 5KA5A 2DQ0A 1UPGA 3CRCA 3SPHA 4WFBV 4WCEV 1AR1B 1XMQB 4P30A 2FYUH 3ABTA 2Y48A 2JGDA 3B77A 4H33A 5E1AC 1Q3EA 3H01A 1S5HC 1FXHA 4R7CA 1AP6A 3BA8A 4PA4A 2Z0AA 3HKCA 3IGAC 5IYCO 2WLIB 1V54B 3JD4A 4OPAA 2Q6AA 1CEZA 5CB4A 1N32B 3CMEV 4PD4F 1SQQH 2DN9A 4LP8A 5L3FA 1AI4A 4N21A 4J80A 3L70H 2UUCB 1FPOA 3AK2A 3SJBC 1DF5A 1H8EG 2GV9A 4I0XB 1QVFU 5IYZA 5DN6G 3OTOB 3U10A 3EVKA 2ZD9A 3ZMZA 2WPDG 4D7TA 1VQ4V 4GYCB 4UV8A 1QR9A 4YJ3B 2WWWA 3H9VA 4NVPA 3BCCH 4LNUA 4JTCB 3LDCA 4MVQA 5B3SB 2UUBO 1R73A 1UJWB 1KKDA 3FYIB 3RYIB 3GWOA 2UXDB 4OX9O 1QBZA 4F6RA 3KCYA 4FLTA 4E2LA 4GCZA 3CC7V 4X20A 2RQ6A 4LCUC 2N74A 3CJHB 4EFEA 2UXBO 1N0NA 2UU9B 3B2EE 3ZMUA 3HKDB 3D3QA 2QWPB 4PJ0Z 4NTYA 1AP5A 2IJKA 4NXMO 3F5TA 4HAMA 5B1AC 1VMGA 3CP1A 4DR4O 1GM8A 1FD9A 4IGGA 4DXWA 3T1HO 1Z5WA 4J10A 5DM6V 4A5UB 1CPYA 1QLNA 4X1KB 3IAYA 5KAIZ 2EULA 4B3TB 3LNMB 1VQLV 4BW5A 4JI1O 5LXTB 3SJQC 5FL7G 1E1QG 2KG7B 2EIKC 3X2QC 2YIDA 1OHHG 4LNUB 1AJPA 2FTKA 5L3CA 5JWPA 2Y0IA 1QCEA 2CE4A 4K0KO 3AG2C 1KD1W 1ORQC 3JD1A 3JAMN 3N27A 3MHHC 1BMFG 4XDKA 2LGQA 2WLJA 2YSUB 2RJZA 4JAUA 3B40A 1OZ0A 4DR3O 4DUYB 3OTOO 2PYJA 4K8ZA 5K1PA 2H3OA 4C7UA 2DMXA 2QE7G 1U97A 3WG7B 1XILA 2ADQB 1TGOA 3LSQA 5GTIZ 3HKBA 5L3GA 2UXDO 4B3RB 2W6IG 1S3JA 3RYHA 2R70A 3VQXA 1JVMA 2ZKOA 3RYFB 4JTAB 1ZSPA 1MNGA 1GM7A 1XL6A 2CAZC 5LGTA 4BIZA 1NBMG 1M56B 2E75B 4IHJB 1EBOA 2RMKB 1HNWO 2X0LA 2FKXA 1XL4A 2EILB 1RSOA 1AR4A 1ZLZA 5FPOA 1JCHA 2QWRB 5EK0A 3T1YO 1BCCH 4D7SA 5IYZB 2WLNA 3MD0A 1YJWV 4JGSA 4LC1A 2B1GA 2ARHA 4TSFG 4DR5B 3SPCA 1RPOA 2XNDG 3STZC 4J9ZB 2ADPA 2P4KA 2WLLB 1WNSA 4JYAO 2HP8A 2D2CB 2R9AA 4MVOA 1COWG 5LXTA 2GHYA 5L3BA 2JJ1G 3K5NA 4QJFB 4DV1B 3L74H 1OCCC 5LMUB 4MW3A 3CC2V 2YICA 3HKCB 1XUQA 3ZIAG 1R1BA 2D3OW 1ZX3A 3O65A 2UXCO 3CRRA 2LO1A 2HG5C 3CCRV 1VQMV 4IIJA 1RFYA 1XQ8A 4EKWA 1GTOA 3OMAB 1WA8B 4TT3G 2JEUA 3OT7A 4IIJB 3AK1A 3MHSC 3SYQA 2EBOA 2GDSA 1IBLB 5CA0B 4R6ZA 3CHXA 1FKAO 1VF6A 3UT5B 1FS0G 4KL1A 1IXBA 4FZ0A 4UCRA 4B3SB 2YC0A 4K35A 1HWYA 4FFBB 2YIAA 1R3JC 1TVKB 1PL4A 1Q6IA 2DYSC 4Z1MG 4GX0A 3L75H 4JYBA 1BL8A 3JSLA 1F23A 3CCMV 4MS2A 4DR5O 3H1IH 4D6TH 4KUMA 5LMNO 2OTJV 3EHBB 2CH7B 4JI2B 3A0HZ 3ZHVA 4TQDA 5IJ9A 3DGEA 3DSQA 2WA3A 4JI6B 4O4HB 5LHHA 5D5QA 3A8TA 4DV6B 1UFIA 5EBWC 2Z3YA 2OWOA 3BY6A 3OGCC 4RWUA 4KHPB 4DUZB 4MT8A 1Q81W 1HNXO 4CC5A 3DC5A 3ASNB 3K03A 1FFTB 3E86A 4JI4B 1N32O 2F95B 4MVSA 3I56V 1THZA 2P06A 1XHXA 1LUVA 4FLWA 2PI5A 1S5LZ 4FM2A 5IE9A 4O4IA 2VQFO 1YJNV 3ABUA 1Y74A 3CXHF 1Q90D 2IH3C 2JVDA 4GKJO 3A0BZ 3HKDA 1FFXB 1TA8A 2EINC 1AVMA 2BCCH 3CEIA 1ENVA 3ZMVA 3IJ4A 2E5LO 2AGAA 4BIUA 2EINB 4DV5O 1M1KW 4DR2B 1ZUQA 2CTQA 3FYEB 2UXXA 3E8HA 2UU9O 1VEWA 1Q43A 5GTHZ 2ITCC 5EBLC 2Q5ZA 2Q68A 2BTOA 3B09A 1Z2GA 3OR7C 2RDCA 4JI6O 2LFSA 2DQ3A 3K08A 2XOKG 2EZOA 4UCUA 4JI1B 4QIWF 2QKSA 3WB2A 3SPIA 2ZXWC 1ZTEA 4PDLA 4DV3O 3WFVA 1P49A 4I5SA 1SERA 3AG3B 3VQWA 4JAAA 3K59A 3K57A 1D5NA 3JCUZ 5J2UB 4AQYO 1HNXB 4UFZA 1I94B 3QG5A 2GTAA 2MK3A 2XT9A 4N23A 2X6AA 2DYRB 5DECA 2W6JG 1I0HA 1PNLA 1P4RA 2W0FC 3K5MA 1M9NA 1I7FA 4XDJA 4DV7B 4J7JA 3J80N 5J2TA 2ZE5A 1Q8IA 4PI0A 4NYKA 5IWAO 4RO2A 4UCTA 4EEQA 3BA9A 2IU3A 3SYOA 2DE0X 4JPRA 5FNVB 3KZIZ 1N36O 4ZI7B 2MW2B 4DRXA 1FAFA 2E5LB 1W0JG 3OD4A 4DV5B 2CK3G 1GN4A 1NTZH 2HFEC 1OCCB 5IJ0B 4X1YB 2OYQA 1NTKH 1DLBA 4O2AB 3DXRB 4LFAO 3UCSC 4DV4B 2CDYA 3RYCB 4O4HA 3WB1A 4MW8A 3W7WA 1IZ3A 5IJ9B 1K8AW 2O57A 3W7XA 5JQGB 2JGUA 1P84F 1BS3A 1M90W 3EFFK 4LFCO 1XNRO 4WFEA 3VBBA 2XTAA 4Q20A 5KUMA 3ZN0A 2EJ7A 5BXZA 2QM8A 1YDXA 2WSSG 1XHZA 4OGQB 2X7RB 3BPZA 4FFKA 4MTXA 2VS0A 2YEVA 1YJ9V 1V55C 4QE9A 3CMAV 1Q6HA 4BAYA 4X89A 1NKDA 1I5YA 3A2FA 1AI7A 4X65O 1IBKO 1JMKC 5CA0A 1Q6UA 4LF4B 2YI9A 4JI8B 5GONB 4P9PA 1VQNV 4DO2A 1GK9A 1H2MA 2UXNA 5BY1A 1EN5A 5IYBO 1YCIA 4H44B 1N36B 2PYLA 1CXZB 2JK5C 1ZL8B 2PGGA 3H1HH 1NVPB 1FXKC 2F4VO 2YUAA 5KUKA 3CRAA 4GZRB 3QNEA 2X6BA 3F7YC 1F4MA 2F66C 4MTOA 4WFAV 4MTGA 3ZHTA 3N2KA 4JI0B 2FMLA 3RWRD 1YTFD 4I7ZB 4OXSA 2ZE6A 4DRXB 2VRZA 3DXRA 3OUSA 5LOVB 1N0JA 4B3MB 5DEDA 4EB6A 3ZRVA 1MSWD 4I4TB 4NB5A 1XBLA 2OIGA 4ASUG 5GONA 3SYAA 3CCSV 1HNZB 1RM1B 4PDVA 2XAJA 1SESA 4FK5C 1AI6A 3K9SA 1YIJV 4FM0A 3ZHQA 2CTPA 2M7WA 3QF7A 2ZM6O 4H13B 5LMNB 2YEVB 1YHQV 4HNAB 1RP3B 3M8AA 4JI2O 1US6A 4IHJA 3K79A 1SQGA 3N2KB 4O4JA 1JJOA 4J9YB 1NU1H 5JJNB 5B1NA 2JEXA 4DV0O 2YXYA 5FPRA 2ZINA 4U3JA 2IJJA 1Q86W 1SRYA 4KHPO 5KA6A 5LBQA 4ZKIA 1SS3A 2EZPA 1EN4A 4X1IB 4UCVA 1I08A 5CBFA 3OFNG 2A7WA 2YXHA 3ASOC 2WAMA 3Q4HB 4JI0O 2QM7A 4L87A 4QPJA 3OAAG 1WPXA 1YF2A 2Q69A 5IY5C 1FJGB 5KMGA 5JVDA 5H2FZ 4B7EA 4TWKA 1VQPV 2KB1A 2VQEO 1EZVH 5KMGB 2F43G 4PA9A 1VQ5V 1KUQA 1Y74B 3RN4A 1V55B 4IYIA 1FXKB 2HJFC 5LOVA 2YS8A 1B3QA 1W2BU 1K4CC 2KG7A 3FB5C 3TK1A 3T1CA 4B7KA 1E79G 1GMGA 4X64B 1KMIZ 1KC8W 3AG4C 3AG4B 3ZX6A 2B5UA 2Q0AA 3P30A 1VQ8V 2QM4A 2NN4A 2LGWA 3JASA 4KXRA 3TXSA 3MDSA 2DYRC 4G2KA 3D36C 2GUZA 3C3TA 3I5DA 4WFFA 4PA7A 4G27B 1LUWA 4YXWG 2L35A 1U96A 2OCHA 2Y69C 1OCOB 3JAWA 5CA1A 4J7ZA 4X20B 2UXBB 1SF9A 4F6RB 1OCOC 1QNMA 4YIPA 2P6JA 4BW9A 1LR1A 1MMMA 4TQFA 3P3NA 5BMVB 4EFBA 3G4SV 4PELA 1MZFA 2YXLA 5B5EZ 3ZRXA 5LP6A 2AZ2A 2E3CA 4LF9O 1H2GA 2NLJC 1BSMA 1JR9A 3OUFA 5LGUA 4CH6A 4QNHB 2YIBD 3QO8A 1SQFA 3AG7A 4LF5O 1K3EA 2EX3A 4CZZA 5KAFZ 3B8NA 1PM9A 3NXSA 2UUBB 2WLLA 5JCOA 1M4UA 5JJEB 3M99B 5TISZ 1HDJA 1TVKA 1HR0B 4FFBA 1DGSA 3BABA 4J41A 1YEWA 2OCCC 1AB3A 4X9QA 1QHTA 3H1LH 5KHHA 4TOIA 3CSXA 3H1JH 4UV9A 4FLXA 2YDEA 4QGPA 4DUYO 3STLC 1KB9F 1RSOB 3C90A 4XDLA 3CWBH 4DR4B 3TCUA 2A9HA 4U3FH 3T1HB 4LFBO 3HKEA 3L72H 2LQTA 4U7OA 4ZI7A 4UVBA 5B1BB 5C8YB 3QO7A 4YIOA 1BQZA 4YJ2A 5EYPB 3CC4V 2IBZH 3WG7C 1MSDA 1PKXA 5J9PC 3RYHB 3E2EA 2P4VA 2QWNB 3SDLA 3IC7A 2NNUA 3R66A 4W4KA 3CS5A 1EFRG 1NQTA 3E8BA 4NXNO 4LF4O 3HPLC 4LF9B 5B66Z 4H37A 2RCVA 3FB7C 1TUEB 4BWAA 2ZR3A 4UB8Z 2AHYA 4UCSA 2HEPA 5K1XA 2E76B 2AHZA 2C2AA 3OM3B 2OCCB 5EZYB 3HKBB 3O9OA 3X2QB 3AG2B 4G28B 4B3RO 5B3SC 2HVJC 4X62B 2BSKB 2ZT9B 5E79Z 1VQOV 4NTWA 4J11A 3HB3B 5LP6C 2CTWA 1SQXH 5KHJA 3BVOA 2GUZB 3ETGA 2X6CA 2QGNA 4NTXA 1ZAUA 4DV1O 1BE3H 1S72V 1W0KG 2Q7GA 4WF9V 3CCLV 3S3WA 1F7YA 2KSDA 3AG1C 1VP7A 2V1DA 1VF5B 2QTOA 1JX9A 1H2SB 3FAVB 1SZTA 1R3IC 3ZBHA 1WB7A 1YTFB 4P9OA 3G80A 1K5QA 4NKGB 4K3AA 3LDEA 3FKSG 3BEHA 1PD3A 2WLMA 3AK3A 2W0XA 4Q6GA 4UB6Z 4LF8O 1SA0B 2HVKC 4JZGA 5JVDB 3MAQA 1XREA 1BZKA 1NR1A 3QO5A 3APOA 2Q73A 3U11A 3E83A 2QEXV 4I55B 1H8HG 1V54C 4X66B 2AXTZ 5KX5B 1JOYA 3RVYA 2B9ZA 4JAVA 2A3QA 3SR2C 3TETA 4LF7O 2XUMA 4PA6A 2CH7A 2V4DA 5EIBD 2ATKC 3CJHA 2LP7A 4KP4A 2Q7EA 1BT8A 5LP6B 5BR8B 4Z2WA 1M93A 3OMNB 4GT1A 2JS5A 4LH7A 4WBNB 2ZDIC 1FYJA 4DUZO 1R6KA 4J7KA 3OTFA 4H0LB 4B3SO 1M57B 4YJ3A 1JPXA 2IW5A 1XEQA 1Y76A 3FB8C 4JI4O 3KG2A 5CA1B 1ZWIC 1CP9A 2F1MA 4FLYA 3J7AU 2EILC 4JI3O 1NZ6A 3ETEA 1QLEC 4L8JA 5LL6Y 1H38A 1S77D 5FNVA 1IXMA 4F6EA 2PI4A 3SJCC 4TV8B 4X64O 3ZRSA 3WU2Z 1JJ2U 1SZXA 1K73W 4MVRA 3KCXA 1SC5B 2Q8VA 2WLIA 2OTLV 3OEEG 2KQXA 3SPJA 4IL6Z 3E89A 3ASOB 1J5EB 1GKFA 1AILA 3GVMA 3UQ8A 1QU7A 1PPJH 4DR2O 1JFFA 3ABKB 3I55V 5KHKA 3JARB 3CPWU 5LYJA 2DOSA 2HJDA 5CBGA 4MVMA 1IBMO 5EBMC 1O9HA 4O4JB 1JFFB 1SETA 3PN1A 2QSAA 3APQA 1R6NA 2IH1C 3W7SA 1YZBA 4YHHB 2DWEC 1BQ0A 3ABLC 4DW0A 3JATA 3ZMTA 4DV3B 4GKJB 4LF5B 4O4LB 3K3WA 4X1IA 1QLEB 3ZCCA 5KLVH 1KKCA 1SKVA 4LF6O 4I4TA 1WA8A 2DYSB 4JYCA 3TJTA 3J81N 4X1KA 4FPPA 1NS1A 3E35A 2BOCC 3DTUB 3ICXA 4HZ3A 1WLEA 3JARA 2HLDG 4DV7O 4O2BA 5LYJB 1NJIW 5IDJA 3QVNA 1KECA 5IWAB 1KU9A 1K97A 1QQCA 3K5LA 5IYDO 2NR5A 3GWKC 1AR5A 1OV9A 2QKAA 3DC6A 5HFMA 3OMIB 3CE2A 4DK0A 4YY3B 2EIMB 3HKEB 3G71V 4AQYB 2BE3A 3CX5F 1L0NH 1I94O 3UO3A 1YI2V 3L73H 2CGNA 4LFAB 3ZRWA 4NXMB 1BHBA 5A9GA 1ROPA 3E22B 2DJVA 2RN9A 2JIZG 4XBFA 1OCRC 3JD0A 2UUCO 3CCEV 3JCZA 1K4DC 2H8PC 3JYCA 1MOFA 3Q4HA 3ABMC 4YHHO 1OCRB 3ZMSA 2M6YA 5B1OA 1AROP 2ZE8A 3OE7G 4WBNA 1XNQO 3IFXA 1IVSA 1GN3A 4HYOA 2P5OA 1N34O 3RYFA 2YI8A 1Y67A 2WLHA 3CCJV 4TV9A 1B04A 3B4SA 4DR6B 1YSCA 1VF7A 1H2KA 4HBNA 1YVWA 1JQ0A 2F93B 1IBKB 5A2QN 3AG1B 2VWKA 4FMTA 5JCOC 1I5XA 5C8YA 4DV2O 3K5OA 1BGYH 1G6UA 5GW7A 2PF4E 1XDCA 1WAZA 4GX1A 2ITDC 2AW9A 3LSUA 3GB7C 5AG2A 1VF6C 4RQEA 2HR3A 5H6QA 3T4DA 2GSMB 4LFCB 4YJ2B 1GN6A 1F51A 1N33B 1DK1A 2ZNIA 3T2MA 1SQVH 3TXQA 1P7BA 1PL0A 2BSKA 1SA0A 3K04A 4K0KB 1O9GA 2Q0OC 1OJHA 1P7GA 3AG3C 4DYLA 4ABMA 1R6TA 4PDRA 5CBHA 5L3DA 5EC2C 4LF8B 3H1KH 3THOA 3K9AA 1S0VA 1FXKA 1NTMH 2ZQMA 1B6QA 2PUSA 3T4ZA 1PP9H 1HP8A 4CH3A 4FLZA 3ABKC 3N2GA 3RFRA 3D36A 1URFA 3ETQA 1KBHA 1XNQB 1EN6A 5LHIA 1E1RG 3CRMA 2DWDC 4CS2A 4JI7O 1AJQA 2QWQB 1NT2B 4K8XA 2Q67A 2LFRA 4RAIA 2QTSA 4DR6O 1W59A 3ETDA 2IU0A 5B1BC 2AZ0A 1AI5A 2ODMA 1KP2A 2QDOA 4UVAA 3SGIA 3ZS8C 3JAWB 3JALB 3ZJZA 5KX5A 1NI8A 2FB5A 1KQSU 1Y6XA 4MVUA 3OGIB 4FVMA 2Q9LA 5FLXN 1YITV 3JAKA 3F7VC 3RW0A 1MABG 2IJHA 2CUGA 1N33O 1XMOB 1G8MA 4ZOLA 1HNZO 1XI1A 2QJ1A 2UXCB 1Q82W 1RM1C 4GKKO 2Q7HA 3CB2A 3G6BA 4W4LA 3ML0A 4DR7O 4CH5A 3BRCA 3JASB 2E74B 4CS3A 2N05A 5LA6A 1PNMA 3ABMB 1PNKA 2ZIOA 3ZEDA 2P7TC 1FJGO 3UKMA 1GH6A 1IBLO 4DV0B 4DW1A 1SQBH 2UUAO 4TV8A 4FLUA 1J5EO 5IT9N 3F5WC 4I9WA 3W7UA 2EIMC 1Z5VA 4U7NA 3ASNC 4I9QA 4B08A 1K5SA 3EXAA 2BTQB 2HHHB 4JV5O 5KHGA 5L3EA 2Y69B 1X59A 4CC6A 1JA8A 4P2ZA 4JASA 5JH7A 3VQVA 1SQPH 5LA6B 1GO3F 4LWSA 2QR4A 2OIEA 1TUBA 5B1AB 3FD9A 4DV6O 4RQFA 1ZL8A 1VIBA 2B1IA 2VQEB 1YXBA 1D2DA 2HKOA 5F2VO 4CS4A 2L6LA 1WN7A 3TGUH 3JAKB 1XMOO 4CH4A 2G38A 4LF6B 4F4LA 2Z5UA 3VQYA 4RUFA 4GKKB 4DR7B 2JRIA 4I55A 5BMVA 2A79B 5EZYA 4PA3A 4GX2A 5EIBC 2JS3A 3CCUV 4TUYB 1PV0A 1QVGU 2H94A 2YIBA 4I0XA 3E22A 2ZIMA 3K06A 4DR1B 2UUAB 3A0RA 1DF4A 5CMUA 5D5PA 2XAGA 1TUBB 2XASA 3RVZA 5CA3A 4BR6A 2IM9A 3W7TA 4YY3O 3N2GB 1HR0O 4QPKA 3L9DA 1Y66A 3UO2A 3ABLB 1G1XB 4GX5A 1M56C 3FAVA 3NR7A 1WPBA 4X1YA 3ZHUA 4ZHQB 4LFBB 1XMQO 3FX7A 2P22C 4NR1A 2GTSA 4WFHA 1TAEA 4UVCA 3PJSK 2VQFB 1L0LH 2ETNA 2V7QG 2WA4A 1R3LC 3BHPA 2LJ2A 2PTMA 3U0ZA 5H9CA 2A06H 2LW1A 3HR0A 5H6RA 1S76D 3P32A 1N34B 3CXCU 2JDIG 4X88A 2ZDIA 4AHCA 4IT5A 3OR6C 3SJAC 1XOUA 2XAFA 3B8MA 3RT3C 5C93A 2RNBA 4NXNB 1DTOA 1EM1A 3C3SA 1IDSA 3SYPA 2XAHA 4DV2B 1VQ7V 2GBOA 4FJCC 1F4NA 2XAQA 2BOBC 4JZ2A 2KKWA 4DR1O 3LNNA 4OPHA 4U3JB 2CTRA 1Q5OA 4LWSB 1K7DA 3ZN1A 4ZOLB 4MSWC 1GRJA 1LNQA 1VQKV 4FLVA 1M57C 4LH6A 5JH7B 4X62O 1NR7A 2OT5A 1Q7YW 5JQGA 2P67A 2BTQA 5HFLA 2CGOA 3ZHSA 4PHZA 4Z1VA 4JI5B 4DV4O 3CCQV 4IYHA 4WFGA 2EIJC 4I50A 4UUJC 4PV1B 2Q4PA 2Y4TA 4R50A
chains in the Genus database with same CATH topology
3D36C 1PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D36 C;  1PV0 A; 
#chains in the Genus database with same CATH topology
 4B3T O;  4JTD B;  1XNR B;  3AEI A;  5J2T B;  2VWJ A;  1IUR A;  4QE7 A;  4GUN A;  2ZNJ A;  3BFR A;  4DK1 A;  5CN0 A;  1G4Y B;  1J95 A;  4MTF A;  3K0G A;  4KFM A;  4JI7 B;  1NVP D;  4R8C A;  4FIP C;  3P3P A;  2IJI A;  5CB4 B;  2ILM A;  3CD6 V;  4ZHQ A;  3D3I A;  4FZ1 A;  4ZIB A;  4X65 B;  5LGN A;  1HW7 A;  3BAA A;  2K9P A;  5IY5 B;  3E8F A;  4DR3 B;  1NH2 B;  1A32 A;  3G6E V;  4PI2 A;  1BHA A;  2JJ2 G;  1K9M W;  4JI8 O;  2PZS A;  3E8G A;  1V9P A;  4TUY A;  1NH2 D;  1FXV A;  1T5E A;  3RGB A;  2WLK A;  3IC9 A;  4X66 O;  3RYI A;  4BIO A;  3UM7 A;  2ZE7 A;  3S3X A;  4AI8 A;  2F4V B;  3K58 A;  5LHG A;  4FM1 A;  1OCZ C;  1OCZ B;  2P90 A;  3LSS A;  3LDD A;  1WP8 A;  5IJ0 A;  4PDM A;  5H5N A;  4X8A A;  4ICG A;  1KYO F;  3VOU A;  1WJZ A;  1K92 A;  2Y0P A;  4TV9 B;  4ZBM A;  5ITZ A;  4JI5 O;  3JD3 A;  1L1F A;  3ZRW B;  3LUT B;  1L8D A;  1FFX A;  4B3M O;  4J42 A;  3JD2 A;  3WB0 A;  3SPG A;  1HNW B;  3CYO A;  1GAX A;  1IX9 A;  4EB6 B;  2QKC A;  4LR3 A;  1KP3 A;  5EYP A;  1QR8 A;  3FFQ A;  4UCO A;  3T1Y B;  2ZR2 A;  4JI3 B;  2R72 A;  3RYC A;  2ZXW B;  1X4T A;  2Y4U A;  3OW2 U;  2HHH O;  2QA4 V;  4JF3 A;  5KHI A;  4JV5 B;  2A0L A;  3JAL A;  1GN2 A;  5BZB A;  2DW4 A;  1K34 A;  3K0D A;  4LF7 B;  3CCV V;  2R9R B;  4HNA A;  4JYA B;  3L71 H;  5EC1 C;  3G67 A;  2EIJ B;  5BR8 O;  1MG1 A;  1H2L A;  4GLX A;  1WB8 A;  5ITZ B;  4RUE A;  5LMU O;  1N8R W;  1VAR A;  1EZJ A;  4LBE C;  3SYC A;  1S5J A;  1Y4M A;  4UXN A;  3QTC A;  3CRQ A;  1Y76 B;  1MZE A;  2EJR A;  3ZHR A;  1GM9 A;  4I50 B;  4JYY A;  2LW7 A;  3M7M X;  2ZCE A;  1VQ6 V;  1VQ9 V;  1H2N A;  2K1E A;  4AIL C;  2JGD B;  2ZM6 B;  2F23 A;  3JSN A;  3R65 A;  4O2B B;  3OEH G;  5JJJ B;  5J2U A;  1AJN A;  2PY5 A;  2XHB A;  4O4L A;  1MA1 A;  1B06 A;  3JAT B;  4O4I B;  1M5I A;  2N04 A;  2R9I A;  4OX9 B;  2FL4 A;  1WP7 A;  1R3K C;  1RPR A;  2EIK B;  4MVZ A;  2QWO B;  4CBC A;  3KKY A;  3FB6 C;  4O2A A;  3UT5 A;  3RBZ A;  1K33 A;  1N4C A;  3D8C A;  1D5A A;  4E4E A;  1IBM B;  5KA5 A;  2DQ0 A;  1UPG A;  3CRC A;  3SPH A;  4WFB V;  4WCE V;  1AR1 B;  1XMQ B;  4P30 A;  2FYU H;  3ABT A;  2Y48 A;  2JGD A;  3B77 A;  4H33 A;  5E1A C;  1Q3E A;  3H01 A;  1S5H C;  1FXH A;  4R7C A;  1AP6 A;  3BA8 A;  4PA4 A;  2Z0A A;  3HKC A;  3IGA C;  5IYC O;  2WLI B;  1V54 B;  3JD4 A;  4OPA A;  2Q6A A;  1CEZ A;  5CB4 A;  1N32 B;  3CME V;  4PD4 F;  1SQQ H;  2DN9 A;  4LP8 A;  5L3F A;  1AI4 A;  4N21 A;  4J80 A;  3L70 H;  2UUC B;  1FPO A;  3AK2 A;  3SJB C;  1DF5 A;  1H8E G;  2GV9 A;  4I0X B;  1QVF U;  5IYZ A;  5DN6 G;  3OTO B;  3U10 A;  3EVK A;  2ZD9 A;  3ZMZ A;  2WPD G;  4D7T A;  1VQ4 V;  4GYC B;  4UV8 A;  1QR9 A;  4YJ3 B;  2WWW A;  3H9V A;  4NVP A;  3BCC H;  4LNU A;  4JTC B;  3LDC A;  4MVQ A;  5B3S B;  2UUB O;  1R73 A;  1UJW B;  1KKD A;  3FYI B;  3RYI B;  3GWO A;  2UXD B;  4OX9 O;  1QBZ A;  4F6R A;  3KCY A;  4FLT A;  4E2L A;  4GCZ A;  3CC7 V;  4X20 A;  2RQ6 A;  4LCU C;  2N74 A;  3CJH B;  4EFE A;  2UXB O;  1N0N A;  2UU9 B;  3B2E E;  3ZMU A;  3HKD B;  3D3Q A;  2QWP B;  4PJ0 Z;  4NTY A;  1AP5 A;  2IJK A;  4NXM O;  3F5T A;  4HAM A;  5B1A C;  1VMG A;  3CP1 A;  4DR4 O;  1GM8 A;  1FD9 A;  4IGG A;  4DXW A;  3T1H O;  1Z5W A;  4J10 A;  5DM6 V;  4A5U B;  1CPY A;  1QLN A;  4X1K B;  3IAY A;  5KAI Z;  2EUL A;  4B3T B;  3LNM B;  1VQL V;  4BW5 A;  4JI1 O;  5LXT B;  3SJQ C;  5FL7 G;  1E1Q G;  2KG7 B;  2EIK C;  3X2Q C;  2YID A;  1OHH G;  4LNU B;  1AJP A;  2FTK A;  5L3C A;  5JWP A;  2Y0I A;  1QCE A;  2CE4 A;  4K0K O;  3AG2 C;  1KD1 W;  1ORQ C;  3JD1 A;  3JAM N;  3N27 A;  3MHH C;  1BMF G;  4XDK A;  2LGQ A;  2WLJ A;  2YSU B;  2RJZ A;  4JAU A;  3B40 A;  1OZ0 A;  4DR3 O;  4DUY B;  3OTO O;  2PYJ A;  4K8Z A;  5K1P A;  2H3O A;  4C7U A;  2DMX A;  2QE7 G;  1U97 A;  3WG7 B;  1XIL A;  2ADQ B;  1TGO A;  3LSQ A;  5GTI Z;  3HKB A;  5L3G A;  2UXD O;  4B3R B;  2W6I G;  1S3J A;  3RYH A;  2R70 A;  3VQX A;  1JVM A;  2ZKO A;  3RYF B;  4JTA B;  1ZSP A;  1MNG A;  1GM7 A;  1XL6 A;  2CAZ C;  5LGT A;  4BIZ A;  1NBM G;  1M56 B;  2E75 B;  4IHJ B;  1EBO A;  2RMK B;  1HNW O;  2X0L A;  2FKX A;  1XL4 A;  2EIL B;  1RSO A;  1AR4 A;  1ZLZ A;  5FPO A;  1JCH A;  2QWR B;  5EK0 A;  3T1Y O;  1BCC H;  4D7S A;  5IYZ B;  2WLN A;  3MD0 A;  1YJW V;  4JGS A;  4LC1 A;  2B1G A;  2ARH A;  4TSF G;  4DR5 B;  3SPC A;  1RPO A;  2XND G;  3STZ C;  4J9Z B;  2ADP A;  2P4K A;  2WLL B;  1WNS A;  4JYA O;  2HP8 A;  2D2C B;  2R9A A;  4MVO A;  1COW G;  5LXT A;  2GHY A;  5L3B A;  2JJ1 G;  3K5N A;  4QJF B;  4DV1 B;  3L74 H;  1OCC C;  5LMU B;  4MW3 A;  3CC2 V;  2YIC A;  3HKC B;  1XUQ A;  3ZIA G;  1R1B A;  2D3O W;  1ZX3 A;  3O65 A;  2UXC O;  3CRR A;  2LO1 A;  2HG5 C;  3CCR V;  1VQM V;  4IIJ A;  1RFY A;  1XQ8 A;  4EKW A;  1GTO A;  3OMA B;  1WA8 B;  4TT3 G;  2JEU A;  3OT7 A;  4IIJ B;  3AK1 A;  3MHS C;  3SYQ A;  2EBO A;  2GDS A;  1IBL B;  5CA0 B;  4R6Z A;  3CHX A;  1FKA O;  1VF6 A;  3UT5 B;  1FS0 G;  4KL1 A;  1IXB A;  4FZ0 A;  4UCR A;  4B3S B;  2YC0 A;  4K35 A;  1HWY A;  4FFB B;  2YIA A;  1R3J C;  1TVK B;  1PL4 A;  1Q6I A;  2DYS C;  4Z1M G;  4GX0 A;  3L75 H;  4JYB A;  1BL8 A;  3JSL A;  1F23 A;  3CCM V;  4MS2 A;  4DR5 O;  3H1I H;  4D6T H;  4KUM A;  5LMN O;  2OTJ V;  3EHB B;  2CH7 B;  4JI2 B;  3A0H Z;  3ZHV A;  4TQD A;  5IJ9 A;  3DGE A;  3DSQ A;  2WA3 A;  4JI6 B;  4O4H B;  5LHH A;  5D5Q A;  3A8T A;  4DV6 B;  1UFI A;  5EBW C;  2Z3Y A;  2OWO A;  3BY6 A;  3OGC C;  4RWU A;  4KHP B;  4DUZ B;  4MT8 A;  1Q81 W;  1HNX O;  4CC5 A;  3DC5 A;  3ASN B;  3K03 A;  1FFT B;  3E86 A;  4JI4 B;  1N32 O;  2F95 B;  4MVS A;  3I56 V;  1THZ A;  2P06 A;  1XHX A;  1LUV A;  4FLW A;  2PI5 A;  1S5L Z;  4FM2 A;  5IE9 A;  4O4I A;  2VQF O;  1YJN V;  3ABU A;  1Y74 A;  3CXH F;  1Q90 D;  2IH3 C;  2JVD A;  4GKJ O;  3A0B Z;  3HKD A;  1FFX B;  1TA8 A;  2EIN C;  1AVM A;  2BCC H;  3CEI A;  1ENV A;  3ZMV A;  3IJ4 A;  2E5L O;  2AGA A;  4BIU A;  2EIN B;  4DV5 O;  1M1K W;  4DR2 B;  1ZUQ A;  2CTQ A;  3FYE B;  2UXX A;  3E8H A;  2UU9 O;  1VEW A;  1Q43 A;  5GTH Z;  2ITC C;  5EBL C;  2Q5Z A;  2Q68 A;  2BTO A;  3B09 A;  1Z2G A;  3OR7 C;  2RDC A;  4JI6 O;  2LFS A;  2DQ3 A;  3K08 A;  2XOK G;  2EZO A;  4UCU A;  4JI1 B;  4QIW F;  2QKS A;  3WB2 A;  3SPI A;  2ZXW C;  1ZTE A;  4PDL A;  4DV3 O;  3WFV A;  1P49 A;  4I5S A;  1SER A;  3AG3 B;  3VQW A;  4JAA A;  3K59 A;  3K57 A;  1D5N A;  3JCU Z;  5J2U B;  4AQY O;  1HNX B;  4UFZ A;  1I94 B;  3QG5 A;  2GTA A;  2MK3 A;  2XT9 A;  4N23 A;  2X6A A;  2DYR B;  5DEC A;  2W6J G;  1I0H A;  1PNL A;  1P4R A;  2W0F C;  3K5M A;  1M9N A;  1I7F A;  4XDJ A;  4DV7 B;  4J7J A;  3J80 N;  5J2T A;  2ZE5 A;  1Q8I A;  4PI0 A;  4NYK A;  5IWA O;  4RO2 A;  4UCT A;  4EEQ A;  3BA9 A;  2IU3 A;  3SYO A;  2DE0 X;  4JPR A;  5FNV B;  3KZI Z;  1N36 O;  4ZI7 B;  2MW2 B;  4DRX A;  1FAF A;  2E5L B;  1W0J G;  3OD4 A;  4DV5 B;  2CK3 G;  1GN4 A;  1NTZ H;  2HFE C;  1OCC B;  5IJ0 B;  4X1Y B;  2OYQ A;  1NTK H;  1DLB A;  4O2A B;  3DXR B;  4LFA O;  3UCS C;  4DV4 B;  2CDY A;  3RYC B;  4O4H A;  3WB1 A;  4MW8 A;  3W7W A;  1IZ3 A;  5IJ9 B;  1K8A W;  2O57 A;  3W7X A;  5JQG B;  2JGU A;  1P84 F;  1BS3 A;  1M90 W;  3EFF K;  4LFC O;  1XNR O;  4WFE A;  3VBB A;  2XTA A;  4Q20 A;  5KUM A;  3ZN0 A;  2EJ7 A;  5BXZ A;  2QM8 A;  1YDX A;  2WSS G;  1XHZ A;  4OGQ B;  2X7R B;  3BPZ A;  4FFK A;  4MTX A;  2VS0 A;  2YEV A;  1YJ9 V;  1V55 C;  4QE9 A;  3CMA V;  1Q6H A;  4BAY A;  4X89 A;  1NKD A;  1I5Y A;  3A2F A;  1AI7 A;  4X65 O;  1IBK O;  1JMK C;  5CA0 A;  1Q6U A;  4LF4 B;  2YI9 A;  4JI8 B;  5GON B;  4P9P A;  1VQN V;  4DO2 A;  1GK9 A;  1H2M A;  2UXN A;  5BY1 A;  1EN5 A;  5IYB O;  1YCI A;  4H44 B;  1N36 B;  2PYL A;  1CXZ B;  2JK5 C;  1ZL8 B;  2PGG A;  3H1H H;  1NVP B;  1FXK C;  2F4V O;  2YUA A;  5KUK A;  3CRA A;  4GZR B;  3QNE A;  2X6B A;  3F7Y C;  1F4M A;  2F66 C;  4MTO A;  4WFA V;  4MTG A;  3ZHT A;  3N2K A;  4JI0 B;  2FML A;  3RWR D;  1YTF D;  4I7Z B;  4OXS A;  2ZE6 A;  4DRX B;  2VRZ A;  3DXR A;  3OUS A;  5LOV B;  1N0J A;  4B3M B;  5DED A;  4EB6 A;  3ZRV A;  1MSW D;  4I4T B;  4NB5 A;  1XBL A;  2OIG A;  4ASU G;  5GON A;  3SYA A;  3CCS V;  1HNZ B;  1RM1 B;  4PDV A;  2XAJ A;  1SES A;  4FK5 C;  1AI6 A;  3K9S A;  1YIJ V;  4FM0 A;  3ZHQ A;  2CTP A;  2M7W A;  3QF7 A;  2ZM6 O;  4H13 B;  5LMN B;  2YEV B;  1YHQ V;  4HNA B;  1RP3 B;  3M8A A;  4JI2 O;  1US6 A;  4IHJ A;  3K79 A;  1SQG A;  3N2K B;  4O4J A;  1JJO A;  4J9Y B;  1NU1 H;  5JJN B;  5B1N A;  2JEX A;  4DV0 O;  2YXY A;  5FPR A;  2ZIN A;  4U3J A;  2IJJ A;  1Q86 W;  1SRY A;  4KHP O;  5KA6 A;  5LBQ A;  4ZKI A;  1SS3 A;  2EZP A;  1EN4 A;  4X1I B;  4UCV A;  1I08 A;  5CBF A;  3OFN G;  2A7W A;  2YXH A;  3ASO C;  2WAM A;  3Q4H B;  4JI0 O;  2QM7 A;  4L87 A;  4QPJ A;  3OAA G;  1WPX A;  1YF2 A;  2Q69 A;  5IY5 C;  1FJG B;  5KMG A;  5JVD A;  5H2F Z;  4B7E A;  4TWK A;  1VQP V;  2KB1 A;  2VQE O;  1EZV H;  5KMG B;  2F43 G;  4PA9 A;  1VQ5 V;  1KUQ A;  1Y74 B;  3RN4 A;  1V55 B;  4IYI A;  1FXK B;  2HJF C;  5LOV A;  2YS8 A;  1B3Q A;  1W2B U;  1K4C C;  2KG7 A;  3FB5 C;  3TK1 A;  3T1C A;  4B7K A;  1E79 G;  1GMG A;  4X64 B;  1KMI Z;  1KC8 W;  3AG4 C;  3AG4 B;  3ZX6 A;  2B5U A;  2Q0A A;  3P30 A;  1VQ8 V;  2QM4 A;  2NN4 A;  2LGW A;  3JAS A;  4KXR A;  3TXS A;  3MDS A;  2DYR C;  4G2K A;  3D36 C;  2GUZ A;  3C3T A;  3I5D A;  4WFF A;  4PA7 A;  4G27 B;  1LUW A;  4YXW G;  2L35 A;  1U96 A;  2OCH A;  2Y69 C;  1OCO B;  3JAW A;  5CA1 A;  4J7Z A;  4X20 B;  2UXB B;  1SF9 A;  4F6R B;  1OCO C;  1QNM A;  4YIP A;  2P6J A;  4BW9 A;  1LR1 A;  1MMM A;  4TQF A;  3P3N A;  5BMV B;  4EFB A;  3G4S V;  4PEL A;  1MZF A;  2YXL A;  5B5E Z;  3ZRX A;  5LP6 A;  2AZ2 A;  2E3C A;  4LF9 O;  1H2G A;  2NLJ C;  1BSM A;  1JR9 A;  3OUF A;  5LGU A;  4CH6 A;  4QNH B;  2YIB D;  3QO8 A;  1SQF A;  3AG7 A;  4LF5 O;  1K3E A;  2EX3 A;  4CZZ A;  5KAF Z;  3B8N A;  1PM9 A;  3NXS A;  2UUB B;  2WLL A;  5JCO A;  1M4U A;  5JJE B;  3M99 B;  5TIS Z;  1HDJ A;  1TVK A;  1HR0 B;  4FFB A;  1DGS A;  3BAB A;  4J41 A;  1YEW A;  2OCC C;  1AB3 A;  4X9Q A;  1QHT A;  3H1L H;  5KHH A;  4TOI A;  3CSX A;  3H1J H;  4UV9 A;  4FLX A;  2YDE A;  4QGP A;  4DUY O;  3STL C;  1KB9 F;  1RSO B;  3C90 A;  4XDL A;  3CWB H;  4DR4 B;  3TCU A;  2A9H A;  4U3F H;  3T1H B;  4LFB O;  3HKE A;  3L72 H;  2LQT A;  4U7O A;  4ZI7 A;  4UVB A;  5B1B B;  5C8Y B;  3QO7 A;  4YIO A;  1BQZ A;  4YJ2 A;  5EYP B;  3CC4 V;  2IBZ H;  3WG7 C;  1MSD A;  1PKX A;  5J9P C;  3RYH B;  3E2E A;  2P4V A;  2QWN B;  3SDL A;  3IC7 A;  2NNU A;  3R66 A;  4W4K A;  3CS5 A;  1EFR G;  1NQT A;  3E8B A;  4NXN O;  4LF4 O;  3HPL C;  4LF9 B;  5B66 Z;  4H37 A;  2RCV A;  3FB7 C;  1TUE B;  4BWA A;  2ZR3 A;  4UB8 Z;  2AHY A;  4UCS A;  2HEP A;  5K1X A;  2E76 B;  2AHZ A;  2C2A A;  3OM3 B;  2OCC B;  5EZY B;  3HKB B;  3O9O A;  3X2Q B;  3AG2 B;  4G28 B;  4B3R O;  5B3S C;  2HVJ C;  4X62 B;  2BSK B;  2ZT9 B;  5E79 Z;  1VQO V;  4NTW A;  4J11 A;  3HB3 B;  5LP6 C;  2CTW A;  1SQX H;  5KHJ A;  3BVO A;  2GUZ B;  3ETG A;  2X6C A;  2QGN A;  4NTX A;  1ZAU A;  4DV1 O;  1BE3 H;  1S72 V;  1W0K G;  2Q7G A;  4WF9 V;  3CCL V;  3S3W A;  1F7Y A;  2KSD A;  3AG1 C;  1VP7 A;  2V1D A;  1VF5 B;  2QTO A;  1JX9 A;  1H2S B;  3FAV B;  1SZT A;  1R3I C;  3ZBH A;  1WB7 A;  1YTF B;  4P9O A;  3G80 A;  1K5Q A;  4NKG B;  4K3A A;  3LDE A;  3FKS G;  3BEH A;  1PD3 A;  2WLM A;  3AK3 A;  2W0X A;  4Q6G A;  4UB6 Z;  4LF8 O;  1SA0 B;  2HVK C;  4JZG A;  5JVD B;  3MAQ A;  1XRE A;  1BZK A;  1NR1 A;  3QO5 A;  3APO A;  2Q73 A;  3U11 A;  3E83 A;  2QEX V;  4I55 B;  1H8H G;  1V54 C;  4X66 B;  2AXT Z;  5KX5 B;  1JOY A;  3RVY A;  2B9Z A;  4JAV A;  2A3Q A;  3SR2 C;  3TET A;  4LF7 O;  2XUM A;  4PA6 A;  2CH7 A;  2V4D A;  5EIB D;  2ATK C;  3CJH A;  2LP7 A;  4KP4 A;  2Q7E A;  1BT8 A;  5LP6 B;  5BR8 B;  4Z2W A;  1M93 A;  3OMN B;  4GT1 A;  2JS5 A;  4LH7 A;  4WBN B;  2ZDI C;  1FYJ A;  4DUZ O;  1R6K A;  4J7K A;  3OTF A;  4H0L B;  4B3S O;  1M57 B;  4YJ3 A;  1JPX A;  2IW5 A;  1XEQ A;  1Y76 A;  3FB8 C;  4JI4 O;  3KG2 A;  5CA1 B;  1ZWI C;  1CP9 A;  2F1M A;  4FLY A;  3J7A U;  2EIL C;  4JI3 O;  1NZ6 A;  3ETE A;  1QLE C;  4L8J A;  5LL6 Y;  1H38 A;  1S77 D;  5FNV A;  1IXM A;  4F6E A;  2PI4 A;  3SJC C;  4TV8 B;  4X64 O;  3ZRS A;  3WU2 Z;  1JJ2 U;  1SZX A;  1K73 W;  4MVR A;  3KCX A;  1SC5 B;  2Q8V A;  2WLI A;  2OTL V;  3OEE G;  2KQX A;  3SPJ A;  4IL6 Z;  3E89 A;  3ASO B;  1J5E B;  1GKF A;  1AIL A;  3GVM A;  3UQ8 A;  1QU7 A;  1PPJ H;  4DR2 O;  1JFF A;  3ABK B;  3I55 V;  5KHK A;  3JAR B;  3CPW U;  5LYJ A;  2DOS A;  2HJD A;  5CBG A;  4MVM A;  1IBM O;  5EBM C;  1O9H A;  4O4J B;  1JFF B;  1SET A;  3PN1 A;  2QSA A;  3APQ A;  1R6N A;  2IH1 C;  3W7S A;  1YZB A;  4YHH B;  2DWE C;  1BQ0 A;  3ABL C;  4DW0 A;  3JAT A;  3ZMT A;  4DV3 B;  4GKJ B;  4LF5 B;  4O4L B;  3K3W A;  4X1I A;  1QLE B;  3ZCC A;  5KLV H;  1KKC A;  1SKV A;  4LF6 O;  4I4T A;  1WA8 A;  2DYS B;  4JYC A;  3TJT A;  3J81 N;  4X1K A;  4FPP A;  1NS1 A;  3E35 A;  2BOC C;  3DTU B;  3ICX A;  4HZ3 A;  1WLE A;  3JAR A;  2HLD G;  4DV7 O;  4O2B A;  5LYJ B;  1NJI W;  5IDJ A;  3QVN A;  1KEC A;  5IWA B;  1KU9 A;  1K97 A;  1QQC A;  3K5L A;  5IYD O;  2NR5 A;  3GWK C;  1AR5 A;  1OV9 A;  2QKA A;  3DC6 A;  5HFM A;  3OMI B;  3CE2 A;  4DK0 A;  4YY3 B;  2EIM B;  3HKE B;  3G71 V;  4AQY B;  2BE3 A;  3CX5 F;  1L0N H;  1I94 O;  3UO3 A;  1YI2 V;  3L73 H;  2CGN A;  4LFA B;  3ZRW A;  4NXM B;  1BHB A;  5A9G A;  1ROP A;  3E22 B;  2DJV A;  2RN9 A;  2JIZ G;  4XBF A;  1OCR C;  3JD0 A;  2UUC O;  3CCE V;  3JCZ A;  1K4D C;  2H8P C;  3JYC A;  1MOF A;  3Q4H A;  3ABM C;  4YHH O;  1OCR B;  3ZMS A;  2M6Y A;  5B1O A;  1ARO P;  2ZE8 A;  3OE7 G;  4WBN A;  1XNQ O;  3IFX A;  1IVS A;  1GN3 A;  4HYO A;  2P5O A;  1N34 O;  3RYF A;  2YI8 A;  1Y67 A;  2WLH A;  3CCJ V;  4TV9 A;  1B04 A;  3B4S A;  4DR6 B;  1YSC A;  1VF7 A;  1H2K A;  4HBN A;  1YVW A;  1JQ0 A;  2F93 B;  1IBK B;  5A2Q N;  3AG1 B;  2VWK A;  4FMT A;  5JCO C;  1I5X A;  5C8Y A;  4DV2 O;  3K5O A;  1BGY H;  1G6U A;  5GW7 A;  2PF4 E;  1XDC A;  1WAZ A;  4GX1 A;  2ITD C;  2AW9 A;  3LSU A;  3GB7 C;  5AG2 A;  1VF6 C;  4RQE A;  2HR3 A;  5H6Q A;  3T4D A;  2GSM B;  4LFC B;  4YJ2 B;  1GN6 A;  1F51 A;  1N33 B;  1DK1 A;  2ZNI A;  3T2M A;  1SQV H;  3TXQ A;  1P7B A;  1PL0 A;  2BSK A;  1SA0 A;  3K04 A;  4K0K B;  1O9G A;  2Q0O C;  1OJH A;  1P7G A;  3AG3 C;  4DYL A;  4ABM A;  1R6T A;  4PDR A;  5CBH A;  5L3D A;  5EC2 C;  4LF8 B;  3H1K H;  3THO A;  3K9A A;  1S0V A;  1FXK A;  1NTM H;  2ZQM A;  1B6Q A;  2PUS A;  3T4Z A;  1PP9 H;  1HP8 A;  4CH3 A;  4FLZ A;  3ABK C;  3N2G A;  3RFR A;  3D36 A;  1URF A;  3ETQ A;  1KBH A;  1XNQ B;  1EN6 A;  5LHI A;  1E1R G;  3CRM A;  2DWD C;  4CS2 A;  4JI7 O;  1AJQ A;  2QWQ B;  1NT2 B;  4K8X A;  2Q67 A;  2LFR A;  4RAI A;  2QTS A;  4DR6 O;  1W59 A;  3ETD A;  2IU0 A;  5B1B C;  2AZ0 A;  1AI5 A;  2ODM A;  1KP2 A;  2QDO A;  4UVA A;  3SGI A;  3ZS8 C;  3JAW B;  3JAL B;  3ZJZ A;  5KX5 A;  1NI8 A;  2FB5 A;  1KQS U;  1Y6X A;  4MVU A;  3OGI B;  4FVM A;  2Q9L A;  5FLX N;  1YIT V;  3JAK A;  3F7V C;  3RW0 A;  1MAB G;  2IJH A;  2CUG A;  1N33 O;  1XMO B;  1G8M A;  4ZOL A;  1HNZ O;  1XI1 A;  2QJ1 A;  2UXC B;  1Q82 W;  1RM1 C;  4GKK O;  2Q7H A;  3CB2 A;  3G6B A;  4W4L A;  3ML0 A;  4DR7 O;  4CH5 A;  3BRC A;  3JAS B;  2E74 B;  4CS3 A;  2N05 A;  5LA6 A;  1PNM A;  3ABM B;  1PNK A;  2ZIO A;  3ZED A;  2P7T C;  1FJG O;  3UKM A;  1GH6 A;  1IBL O;  4DV0 B;  4DW1 A;  1SQB H;  2UUA O;  4TV8 A;  4FLU A;  1J5E O;  5IT9 N;  3F5W C;  4I9W A;  3W7U A;  2EIM C;  1Z5V A;  4U7N A;  3ASN C;  4I9Q A;  4B08 A;  1K5S A;  3EXA A;  2BTQ B;  2HHH B;  4JV5 O;  5KHG A;  5L3E A;  2Y69 B;  1X59 A;  4CC6 A;  1JA8 A;  4P2Z A;  4JAS A;  5JH7 A;  3VQV A;  1SQP H;  5LA6 B;  1GO3 F;  4LWS A;  2QR4 A;  2OIE A;  1TUB A;  5B1A B;  3FD9 A;  4DV6 O;  4RQF A;  1ZL8 A;  1VIB A;  2B1I A;  2VQE B;  1YXB A;  1D2D A;  2HKO A;  5F2V O;  4CS4 A;  2L6L A;  1WN7 A;  3TGU H;  3JAK B;  1XMO O;  4CH4 A;  2G38 A;  4LF6 B;  4F4L A;  2Z5U A;  3VQY A;  4RUF A;  4GKK B;  4DR7 B;  2JRI A;  4I55 A;  5BMV A;  2A79 B;  5EZY A;  4PA3 A;  4GX2 A;  5EIB C;  2JS3 A;  3CCU V;  4TUY B;  1PV0 A;  1QVG U;  2H94 A;  2YIB A;  4I0X A;  3E22 A;  2ZIM A;  3K06 A;  4DR1 B;  2UUA B;  3A0R A;  1DF4 A;  5CMU A;  5D5P A;  2XAG A;  1TUB B;  2XAS A;  3RVZ A;  5CA3 A;  4BR6 A;  2IM9 A;  3W7T A;  4YY3 O;  3N2G B;  1HR0 O;  4QPK A;  3L9D A;  1Y66 A;  3UO2 A;  3ABL B;  1G1X B;  4GX5 A;  1M56 C;  3FAV A;  3NR7 A;  1WPB A;  4X1Y A;  3ZHU A;  4ZHQ B;  4LFB B;  1XMQ O;  3FX7 A;  2P22 C;  4NR1 A;  2GTS A;  4WFH A;  1TAE A;  4UVC A;  3PJS K;  2VQF B;  1L0L H;  2ETN A;  2V7Q G;  2WA4 A;  1R3L C;  3BHP A;  2LJ2 A;  2PTM A;  3U0Z A;  5H9C A;  2A06 H;  2LW1 A;  3HR0 A;  5H6R A;  1S76 D;  3P32 A;  1N34 B;  3CXC U;  2JDI G;  4X88 A;  2ZDI A;  4AHC A;  4IT5 A;  3OR6 C;  3SJA C;  1XOU A;  2XAF A;  3B8M A;  3RT3 C;  5C93 A;  2RNB A;  4NXN B;  1DTO A;  1EM1 A;  3C3S A;  1IDS A;  3SYP A;  2XAH A;  4DV2 B;  1VQ7 V;  2GBO A;  4FJC C;  1F4N A;  2XAQ A;  2BOB C;  4JZ2 A;  2KKW A;  4DR1 O;  3LNN A;  4OPH A;  4U3J B;  2CTR A;  1Q5O A;  4LWS B;  1K7D A;  3ZN1 A;  4ZOL B;  4MSW C;  1GRJ A;  1LNQ A;  1VQK V;  4FLV A;  1M57 C;  4LH6 A;  5JH7 B;  4X62 O;  1NR7 A;  2OT5 A;  1Q7Y W;  5JQG A;  2P67 A;  2BTQ A;  5HFL A;  2CGO A;  3ZHS A;  4PHZ A;  4Z1V A;  4JI5 B;  4DV4 O;  3CCQ V;  4IYH A;  4WFG A;  2EIJ C;  4I50 A;  4UUJ C;  4PV1 B;  2Q4P A;  2Y4T A;  4R50 A; 
#chains in the Genus database with same CATH homology
 3D36 C;  1PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...