3D36C

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
42
structure length
42
Chain Sequence
MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase B
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/transferase inhibitor
total genus 17
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 3d36C01
1PV0A 3D36C
chains in the Genus database with same CATH superfamily
4X65B 5KHKA 1PP9H 2IH1C 1R1BA 3P30A 3ZBHA 1JX9A 2CTRA 4DYLA 4JAUA 2HVKC 2WAMA 2LO1A 4OX9O 2FL4A 3L72H 2B5UA 2H8PC 2CDYA 4K35A 3JARA 1IXMA 2PTMA 4JI2O 3K57A 4JI8O 2GUZB 3SPHA 1Y67A 2ZE6A 4P9OA 1K92A 4LFBB 2OTJV 1XBLA 3WU2Z 2YDEA 2IJJA 4J41A 3JD3A 4ZKIA 1BHAA 1M4UA 4DV7B 2JIZG 3B4SA 1MOFA 3SJQC 1HNZB 5IDJA 2B9ZA 1WA8B 3OGCC 3FB6C 3P3PA 2B1IA 3A0HZ 5LBQA 2DOSA 2GHYA 5LOVA 2UXCO 4DRXA 1Y4MA 4NXNB 1AR5A 5H6RA 4BIOA 1AJPA 1NTZH 2QKCA 1NQTA 1BSMA 4ABMA 4CC6A 2JJ2G 1FJGB 2AHYA 2OCHA 1M9NA 3APOA 1VEWA 5C93A 1NTKH 1K4CC 3ZMZA 3K9AA 4TQDA 5IYZA 4U3FH 5E1AC 1SQXH 2MK3A 3IFXA 3N2GA 1R6KA 4LNUB 1KECA 1BMFG 4FLTA 1FXVA 1Q8IA 3BABA 3JD2A 4GT1A 2QM4A 2QEXV 4GYCB 4MTGA 3BRCA 1Y76A 1ZX3A 1VF6A 1WB7A 4K8XA 1JA8A 4JYAO 4JI0O 1GO3F 2AW9A 5LGNA 3RGBA 4IYHA 3UO2A 4LWSB 4B7EA 4X62B 4YJ2B 2ATKC 1NS1A 4DK1A 3K0GA 4Z1VA 5KMGB 3T4DA 1Q6UA 1XQ8A 3SYAA 1XHZA 3RT3C 2BSKA 1N36O 1S77D 4MW8A 4RUEA 3CHXA 3JARB 3ZRVA 1IXBA 4K0KB 3OAAG 2YICA 1FAFA 1TUBB 4BAYA 3HPLC 5DM6V 5IE9A 1YI2V 4DR1B 2ZNIA 1K9MW 2E75B 4JI3B 1XNQB 1TVKB 5A2QN 4KUMA 5LGUA 4FZ1A 5B1BB 2P67A 5LYJB 4PI2A 2QTOA 4FPPA 2UUAO 4DV0B 1OCCC 1OCCB 3CE2A 4D7TA 3OW2U 1OCRB 4X1YB 2ZXWC 4QNHB 4DUZB 3X2QC 3X2QB 2AZ0A 4HYOA 1GM9A 5LA6A 2Z3YA 2KSDA 3UKMA 4X66B 4FM2A 1SETA 4F6EA 1QQCA 1SERA 3JD4A 5CA0A 1PNMA 4D6TH 2EIKB 2QM8A 3LDEA 2Y48A 1X59A 2FKXA 3IGAC 4DXWA 4AQYO 3TJTA 4GKJB 3M7MX 5LP6B 1MNGA 1MSWD 5JVDA 5J2UA 1HNWO 4HZ3A 3E22B 1YVWA 3T2MA 1E1RG 1V54C 3N2GB 2DWEC 3HB3B 1S72V 1QNMA 2XAJA 1BQ0A 4B7KA 4PA4A 3RVYA 1PV0A 5DECA 1MABG 3MHHC 5C8YA 3MAQA 1GKFA 1QVFU 3B77A 4QPKA 2DQ0A 2X6AA 4WFEA 2UUBB 5IT9N 2YIDA 3O9OA 3B8MA 4E2LA 1EFRG 3RYIB 3FYIB 4GKKB 3LSQA 4JI1O 5JH7B 4I9QA 3K0DA 4RO2A 1KP3A 3OE7G 2GTSA 4NVPA 1M90W 4IYIA 2Z5UA 1TA8A 5H6QA 1V9PA 4HNAA 4QJFB 1K34A 1Y74A 4X8AA 3F5WC 4JI4O 4DV4B 2CTQA 1AR4A 2ETNA 2RNBA 4B3RB 2EJ7A 1HNXO 4AI8A 4PDVA 2O57A 5KA6A 3A2FA 1VQOV 3STZC 5L3FA 3CJHB 1NZ6A 1X4TA 4FLXA 2EIJB 4MTOA 4PA6A 4Q20A 5BZBA 4TV9A 3JCZA 2ZM6B 3AG4C 2HR3A 5JJJB 4JI6O 2Y69C 3I55V 4RQEA 3T1CA 3F5TA 1CP9A 2DYSC 2AHZA 3T1YB 1DF5A 4UCVA 1VF5B 1IVSA 1IDSA 5EC1C 3CCUV 5LHGA 1HP8A 2NR5A 5H5NA 4FLYA 4MVOA 4EB6A 3G80A 3PJSK 4IIJA 4DO2A 1N33B 4P9PA 1XILA 3GWKC 4CH3A 4X88A 1OJHA 3ETQA 4JV5O 2EULA 4B3TO 1PL0A 4DV2O 4BWAA 2OTLV 1IZ3A 1VP7A 3HKDA 4DR6B 3ZN0A 1GM8A 5JVDB 5J2UB 4MVQA 4PDLA 3U0ZA 4RWUA 3HR0A 4PDMA 2H94A 2OIEA 1H38A 3ZHVA 4MVSA 1CEZA 2W6JG 1WP8A 1PL4A 1SA0A 3C3SA 3SDLA 4LF7B 1EN4A 1ZUQA 3ABUA 4DR3B 2A06H 2Q7HA 1TGOA 4LF5O 3ETGA 2YI8A 2P5OA 1H2SB 4RAIA 3OUFA 3H1JH 5EZYB 4ASUG 1B06A 1XNRB 5CBFA 3JASA 1NR1A 3ASNB 4CZZA 4X20A 4J80A 1BQZA 4I55B 2UU9O 4B3MB 4NXMB 2QWNB 3OD4A 5EBMC 1SC5B 2Q5ZA 3AG1C 2BCCH 1Q3EA 2HEPA 1YSCA 1ZL8A 4HAMA 1VMGA 4O4HA 3OTOB 1NI8A 1K33A 5GONA 4DR7B 3SJCC 5IYBO 4X65O 3FB5C 4WCEV 1NVPD 3RYFB 1URFA 2OCCC 1RPOA 4A5UB 2Q69A 3FKSG 4H13B 1RM1B 1VQMV 3OGIB 1E1QG 4JYCA 4TUYA 4TV9B 1YJWV 1M56B 2BOBC 2F93B 1KP2A 1Q86W 4DUYB 2YIAA 5CA1A 4I50A 3CPWU 5J2TA 3H9VA 2UUCB 4GLXA 1Y6XA 5KHGA 3HKEB 4LFBO 5CB4B 4TSFG 3IC7A 1IBKB 5IWAO 3JAWB 2E5LB 4P30A 1RSOA 2P6JA 1NH2D 2VRZA 2VQFB 3L73H 1GRJA 2P06A 4DV7O 1J95A 1XL6A 2KQXA 5ITZA 3O65A 4JZGA 1V55B 2DYRC 4DV1B 1YCIA 2BE3A 1NU1H 3RWRD 3UT5B 2Q7EA 3ZRWA 2ZDIC 2GDSA 3LDCA 1PNLA 4X1KA 3CP1A 1JJ2U 3JAKA 2WLIA 3D3QA 2N74A 5LXTB 1U96A 1F51A 1P4RA 3CXCU 4NXNO 1AILA 3CWBH 3JSNA 5EIBC 2Y4TA 1FJGO 2EZPA 1H2NA 1FXKC 5TISZ 4H33A 4RQFA 1HR0B 5CBHA 5E79Z 2QKSA 3CD6V 2A9HA 4W4KA 2IU3A 4ZOLA 2W0FC 4IT5A 2D3OW 2PYJA 4PDRA 1QLEC 5KUMA 3GWOA 1MG1A 1MZEA 1BGYH 1FS0G 1LUWA 3EVKA 3BA8A 4PHZA 1VF7A 3OTFA 1P49A 1TUEB 3T4ZA 4N21A 3FB8C 3B40A 1XREA 3ABLB 3D8CA 3ABKB 3NR7A 1SRYA 2OWOA 4LF9B 4E4EA 4X62O 1OZ0A 1BE3H 1W0JG 3K79A 2EIMB 2DE0X 1OCZB 1L8DA 3SPIA 1KKDA 4UB8Z 2Q0AA 3OEEG 1SZXA 5L3CA 3CRRA 4I7ZB 4NR1A 1XEQA 2VQEB 4J9ZB 1LUVA 4K0KO 1XMQB 3PN1A 2ZQMA 3BEHA 3CCMV 1JR9A 4YJ3B 4DR1O 2ITDC 4JI3O 2YUAA 1XNQO 4F4LA 2XAQA 5DEDA 3UCSC 4DR5B 1JPXA 1IBLB 2JJ1G 1B6QA 3CX5F 1YF2A 1NR7A 2UXDB 2Q0OC 4DV0O 4BIUA 1R3LC 2GSMB 3SYOA 4I4TB 3AK1A 4LFAB 1IX9A 2UXXA 4JTDB 3CCVV 2Y0PA 3J7AU 2QR4A 1R3IC 2RDCA 4DUZO 4G27B 4JF3A 1B3QA 4H44B 2L35A 1FYJA 4X66O 4F6RA 3SR2C 1VQKV 2BTQB 3JAKB 2HHHO 4QGPA 3DTUB 1U97A 5H9CA 1QHTA 3TK1A 2RMKB 3WG7B 3WG7C 4GKJO 3E8FA 3ASOB 2C2AA 3BY6A 3OMIB 3IJ4A 1I5XA 5B3SB 1QVGU 4DR2B 1N34B 1K3EA 1FPOA 3DXRA 4X1IA 1WN7A 5L3EA 4JI7B 1G8MA 2V4DA 2CTWA 4DV6B 1KD1W 4R8CA 4O4LB 3F7VC 3E35A 2UUBO 5BY1A 3SPCA 2LFSA 4I9WA 4CS2A 1PNKA 3CMEV 3BFRA 4QE9A 4GKKO 2P7TC 5K1PA 4FZ0A 3G6EV 3RW0A 4YHHB 3TCUA 1N4CA 2R70A 2WLMA 1AP6A 1N0JA 4DV4O 1THZA 2R9RB 2JS5A 3KCYA 4B3RO 4WBNB 2QKAA 4P2ZA 1R73A 2NN4A 4Q6GA 1VARA 1YIJV 3ZHUA 3U10A 4UV9A 2IJIA 2R9IA 3TGUH 4EKWA 2VWJA 3JALA 3N2KA 4JYBA 2Y0IA 1JFFA 2YSUB 1AJQA 4D7SA 4PA3A 3AK2A 4MW3A 3ZHSA 3RN4A 1AJNA 3T1YO 4GX0A 4PD4F 1WB8A 2OYQA 4DW1A 5B66Z 1AP5A 2KG7A 1EBOA 5L3DA 3U11A 5L3BA 1G6UA 1N33O 1EZVH 1D5NA 5LGTA 1WPBA 5A9GA 1UPGA 3ZIAG 1B04A 2YS8A 3NXSA 3ICXA 3JATA 3JCUZ 5B1BC 3BHPA 4PV1B 3Q4HA 3CXHF 3BVOA 1XMOB 4PA9A 2QWRB 1JOYA 4DR6O 1OCRC 4EFBA 2A3QA 2DN9A 1M93A 2QWPB 4UXNA 2HVJC 1ORQC 4J10A 3G4SV 1NT2B 4JTCB 1EN6A 3P32A 4XDJA 3DXRB 4W4LA 4LF4B 3CRQA 2YXHA 2CTPA 2EJRA 4G28B 1Q81W 2L6LA 4LF7O 2K9PA 2EX3A 4Z2WA 4FLUA 1KMIZ 5IYCO 3AG3C 3AG3B 5LOVB 3GVMA 4DR3O 4DRXB 5IJ9A 2EIKC 3OT7A 1I94B 1H8HG 4H37A 2KKWA 5B1NA 1XNRO 1SF9A 5LP6C 3RBZA 3WB1A 2JEUA 4B3MO 4WFHA 4NXMO 5IYZB 4CH4A 3C3TA 2XTAA 4DW0A 3K5OA 2JRIA 1SQFA 4LR3A 1WPXA 1VQ8V 4MTXA 1MA1A 3CYOA 2X6BA 2YEVA 3OTOO 3ZHQA 3RYHA 4DR7O 1Y76B 1Z2GA 3CCRV 4OPHA 2OIGA 1ZTEA 4MSWC 1QCEA 4O2AA 4LFCB 3ZRSA 4U3JA 3W7XA 3KG2A 3N2KB 5KHHA 1JFFB 5B5EZ 5GTIZ 3ABMC 3ABMB 4I0XA 2XASA 1HW7A 2IH3C 4GX1A 3TXQA 3KKYA 1I0HA 5KUKA 1DK1A 4DUYO 2B1GA 2BSKB 1S3JA 3E89A 3L9DA 2UUCO 2EILC 2EILB 3R66A 4XDKA 1K8AW 3ETDA 1AROP 5CA3A 2E3CA 3AG2B 3K06A 5FNVA 1IBKO 5KAIZ 1M57B 3E86A 4TOIA 3SPJA 3W7TA 1DTOA 2EIJC 2VQFO 2ITCC 4FMTA 3JATB 2DJVA 4JAAA 4DV1O 1YXBA 3B2EE 2E74B 2JGDA 2Q7GA 3VQXA 1R6TA 1AI6A 5FL7G 4UVBA 2W6IG 1GN4A 2H3OA 1Q7YW 3OM3B 5LMNB 3OMAB 5LA6B 2NLJC 3J80N 2BTOA 5LL6Y 4DV5B 3MD0A 5B1AB 3LSSA 1QBZA 4IHJA 5CA0B 1P84F 5GTHZ 4DV3B 4XDLA 2IJHA 3SYCA 4PA7A 1HR0O 4YY3B 2EBOA 2FTKA 4KHPO 1T5EA 1RPRA 4CS4A 4U7OA 1QU7A 4J7KA 1F7YA 4QPJA 3VBBA 2LGQA 2WLNA 1XI1A 4DR4B 4PI0A 2YEVB 3K03A 2WA3A 2LP7A 5C8YB 2LFRA 1DGSA 1PM9A 3CCEV 4O4JA 1FFTB 2ZDIA 4LF9O 5LHHA 3ZN1A 5IY5B 1VQLV 4UVAA 2V1DA 5JCOA 3ASNC 4U3JB 2F1MA 4O4IA 4HBNA 1SS3A 2WLJA 2R72A 1KBHA 5JQGA 3CC2V 2WLHA 4NTWA 5JJNB 5KHIA 4UUJC 4HNAB 1FXKA 1Y74B 3W7UA 4X64B 1AI4A 2VQEO 1XMQO 3F7YC 2QGNA 1S5LZ 1L0LH 2LJ2A 4JI5B 3DC5A 5LHIA 1MMMA 1AI7A 5HFMA 2BOCC 4UVCA 3K08A 5KX5A 1YZBA 4DR5O 1IBLO 1RM1C 5EYPA 5FPOA 1Q6IA 1F23A 4J42A 4JPRA 1M56C 2UXDO 1FFXA 1M5IA 1WJZA 2JVDA 4FFBA 3OFNG 3HKBA 4GCZA 3L74H 4AILC 3RYCA 1YEWA 4LFAO 3H01A 1I5YA 4UCOA 1AB3A 4TV8A 4MVMA 4K8ZA 2WSSG 3A0RA 4FM0A 4EB6B 1AVMA 4IIJB 3WB0A 2ZIOA 1SQVH 1NVPB 2ZT9B 3D36C 1O9HA 2CH7A 1MZFA 4X9QA 4TWKA 1NTMH 3CRCA 1BS3A 1V55C 4LC1A 1HNZO 1GN2A 4DR2O 3HKDB 2JGUA 1N34O 5EIBD 4EFEA 4GX2A 1SQPH 5F2VO 1IBMB 4WFBV 3ZJZA 4OPAA 1S5JA 1MSDA 3E8GA 3OUSA 4JI7O 2JS3A 3CRAA 1Q6HA 3ZMUA 2ARHA 5LMUB 2PZSA 1SA0B 3FB7C 1W59A 1YTFB 2JDIG 1NH2B 2A79B 4I5SA 2EINC 1OHHG 2EINB 3BA9A 4MVZA 2LGWA 4WFFA 5L3GA 4C7UA 4KL1A 3JASB 4X20B 3QTCA 1JMKC 2YIBA 3G67A 2ODMA 2LW1A 1PKXA 4MVRA 1K5SA 2PGGA 5JQGB 5AG2A 2GBOA 3SYQA 1RFYA 4QE7A 3K3WA 3JYCA 3CC7V 4MS2A 1N8RW 1ZL8B 2G38A 2DW4A 4O4HB 3EHBB 3QO7A 2QWQB 2MW2B 5GONB 1N0NA 1WA8A 3OR7C 4JAVA 1M1KW 3JD1A 3ABLC 3ABKC 3TXSA 4UV8A 3CRMA 1OV9A 2X7RB 2OT5A 2EIMC 1OCZC 4B3SB 4TUYB 3L75H 4J9YB 3QO5A 2WWWA 4KXRA 3RVZA 3CCQV 3DSQA 3T1HB 5FPRA 2ZCEA 1OCOC 1OCOB 1BCCH 3RYCB 4LF5B 3SYPA 3AG7A 5CA1B 4YXWG 4I50B 5J2TB 4FVMA 2EZOA 4JTAB 5BR8B 4IL6Z 4LF8B 1ZLZA 4LNUA 4BIZA 3SJAC 1RSOB 1L0NH 4FLVA 4WF9V 2CH7B 2ADQB 5KLVH 1N32B 1W2BU 1XMOO 5ITZB 1P7GA 2YIBD 1VQ5V 3L71H 1BHBA 3N27A 3QO8A 3KCXA 3K5MA 1P7BA 4LWSA 4YJ2A 2X0LA 4UCUA 1HDJA 3ABTA 4LF4O 5KMGA 3FYEB 1G1XB 3ZRWB 1D2DA 4X1KB 1Q90D 4YIPA 2WLIB 1QR9A 3DC6A 3G6BA 1I94O 1FD9A 3VOUA 4ZIBA 3HKCA 1XUQA 1CPYA 4H0LB 4CC5A 1LR1A 1TUBA 2RQ6A 3ASOC 2AGAA 2ZNJA 5D5QA 3CEIA 1G4YB 5B3SC 2LQTA 5IWAB 1D5AA 4ZHQA 1TVKA 2ZE7A 2QSAA 4GUNA 4BW9A 4ZOLB 5LYJA 3LSUA 4YIOA 2WLKA 5KA5A 2XAHA 3SPGA 2IBZH 2YXLA 1VQ4V 4GX5A 3QG5A 4FLWA 3QF7A 3VQYA 2HKOA 4X1YA 3E2EA 2WA4A 4LFCO 3STLC 2XOKG 3CC4V 3APQA 1YHQV 1KUQA 4N23A 4KP4A 2D2CB 2F43G 4LF6B 2UXBB 2CE4A 2HFEC 1J5EB 4R50A 5JJEB 1Z5VA 5LP6A 2HP8A 3FAVA 1L1FA 3E22A 4ICGA 2M6YA 1SQQH 2ZD9A 2QDOA 4OXSA 1YJ9V 1JCHA 2HJFC 4EEQA 2ZM6O 4J7JA 4JYYA 3BPZA 2YC0A 1I08A 2YXYA 2Q6AA 2IM9A 4WFAV 1JQ0A 1WP7A 3RYIA 5JH7A 3CCJV 5LMNO 3LNNA 5B1OA 3CMAV 1COWG 2F95B 1WNSA 4F6RB 3K59A 4DV5O 1EM1A 1US6A 2CAZC 4UFZA 3M99B 2Y4UA 1SKVA 2PF4E 3ZCCA 5HFLA 4DV3O 3HKCB 2A0LA 1ZSPA 3IC9A 2F4VB 4YY3O 5CN0A 3CJHA 2E76B 3FD9A 4ZHQB 1I7FA 3AEIA 4X1IB 4DR4O 3UO3A 4MTFA 1VQNV 3CCSV 4OX9B 1K5QA 5IJ0A 1YDXA 3ZMVA 1SZTA 1BZKA 1FKAO 3BCCH 2ZR2A 3MDSA 4JI2B 2YI9A 5BXZA 1XOUA 1VQPV 3B8NA 2ZXWB 4UCSA 4JI8B 1F4NA 5BMVA 4JGSA 3QVNA 3OEHG 1Q43A 3K9SA 2CUGA 4LH6A 3DGEA 4MVUA 1H8EG 4OGQB 2NNUA 3EXAA 1Q82W 3RFRA 2HHHB 3D3IA 3ZX6A 2DQ3A 1S76D 4X64O 3ZHRA 4JI5O 5CBGA 1VF6C 3K5LA 1KQSU 3FAVB 1GMGA 3VQVA 1V54B 1VQ7V 1R6NA 1VIBA 3JALB 1YJNV 2P90A 3JSLA 2UXCB 4CS3A 4ZBMA 2Q9LA 2XAFA 3G71V 4X89A 2Z0AA 1GK9A 3S3XA 3K04A 5EZYA 2Q8VA 3CS5A 1XHXA 1H2LA 1GM7A 4AHCA 4NYKA 4RUFA 4BR6A 2KG7B 4I55A 5D5PA 1NKDA 1WAZA 3AG2C 3JAMN 3M8AA 3K58A 1M57C 2E5LO 4CH5A 1HWYA 3C90A 5K1XA 1KU9A 3JD0A 2AXTZ 2P4VA 2VWKA 2HG5C 3Q4HB 4JYAB 2JEXA 4FK5C 3RYFA 1E79G 2A7WA 2M7WA 4JI0B 2QTSA 4QIWF 3MHSC 3P3NA 1IBMO 1K7DA 3W7SA 4NB5A 1A32A 3AG4B 2Y69B 1Z5WA 1SQBH 5LMUO 3UM7A 2DYSB 5B1AC 5J9PC 5IJ0B 4MT8A 1N36B 4K3AA 5IJ9B 1NBMG 3L70H 2Q73A 4UCRA 2V7QG 4O2BA 4PELA 3HKEA 1PPJH 5CB4A 4ZI7A 4NTYA 5BMVB 4CH6A 2IJKA 3JAWA 2XAGA 1QLNA 2ZIMA 1YITV 3H1HH 2WLLA 3D36A 4J11A 3K5NA 1VQ6V 1R3KC 3LDDA 4R7CA 4TQFA 1SQGA 1ROPA 2PUSA 2FYUH 2UUAB 2IU0A 4U7NA 3CB2A 3RYHB 2P4KA 2ADPA 2N05A 5EBWC 1H2GA 3UT5A 3SGIA 5EC2C 4JZ2A 4O2AB 4XBFA 5IY5C 4B08A 1BT8A 3H1KH 2RJZA 5KHJA 3OR6C 5LXTA 4B3SO 1Q5OA 2Q4PA 2KB1A 3FX7A 3H1IH 4FFKA 4I0XB 2GTAA 2PYLA 2R9AA 5EK0A 3T1HO 1RP3B 3GB7C 5JWPA 1ENVA 3A8TA 1H2MA 2GV9A 4AQYB 1EN5A 1JJOA 2XHBA 1KKCA 2F66C 2ZE5A 5EBLC 2QA4V 2RN9A 2CGNA 2Q68A 5BR8O 3ML0A 2F23A 1HNWB 4LF8O 2CK3G 2XT9A 4FLZA 1O9GA 5FNVB 1ZAUA 1KYOF 2FMLA 3EFFK 2W0XA 1JVMA 3AG1B 4JASA 5DN6G 3ETEA 4UB6Z 3WB2A 2PI4A 4WFGA 1N32O 1F4MA 5GW7A 2PI5A 2JK5C 1KC8W 2FB5A 2VS0A 1DF4A 5IYDO 2OCCB 2JGDB 3S3WA 4G2KA 2LW7A 2X6CA 4KFMA 1IURA 1TAEA 4JI1B 3ZMTA 2DMXA 1UFIA 5H2FZ 4BW5A 3H1LH 4JI4B 1DLBA 1ZWIC 2HLDG 4FJCC 4IHJB 1HNXB 2DWDC 3I5DA 3WFVA 3A0BZ 4O2BB 4YJ3A 1K4DC 5CMUA 4ZI7B 1GTOA 2P22C 3OMNB 1BL8A 1YTFD 1CXZB 1AR1B 1W0KG 1KB9F 2WLLB 1EZJA 4DV6O 4JI6B 3KZIZ 4I4TA 1GH6A 2DYRB 2QWOB 3E8HA 1QR8A 1XL4A 3E8BA 4J7ZA 2QM7A 2GUZA 4LP8A 4GZRB 3FFQA 4O4JB 2N04A 3SJBC 2CGOA 3CCLV 5JCOC 4L87A 4PJ0Z 3IAYA 1SESA 1GAXA 2BTQA 2QJ1A 4IGGA 2RCVA 4LF6O 3ZEDA 2UXBO 4O4IB 4YHHO 3J81N 4FIPC 3I56V 1J5EO 4NTXA 1FXHA 2ZR3A 3CSXA 4JV5B 4B3TB 1XDCA 1FXKB 1S5HC 4UCTA 2ZE8A 3UQ8A 5FLXN 4DV2B 2XNDG 1WLEA 4R6ZA 3LNMB 1UJWB 2K1EA 2XUMA 4TT3G 4KHPB 3R65A 4LH7A 3TETA 2ILMA 2QE7G 2UXNA 5KX5B 3QNEA 5KAFZ 3AK3A 1QLEB 3B09A 5EYPB 1K97A 4O4LA 4L8JA 3BAAA 1FFXB 3ZMSA 3VQWA 4FFBB 3E83A 3HKBB 1LNQA 3ZS8C 4CBCA 2PY5A 2Q67A 1NJIW 1K73W 1VQ9V 3ZHTA 1GN6A 4TV8B 2ZKOA 4Z1MG 4LCUC 4FM1A 2UU9B 1S0VA 2WPDG 1PD3A 4DK0A 4NKGB 3LUTB 3ZRXA 3THOA 4WBNA 1AI5A 2IW5A 4LBEC 1H2KA 3W7WA 2ZINA 1Y66A 2F4VO 1GN3A 2AZ2A 2HJDA 1R3JC
chains in the Genus database with same CATH topology
1PV0A 3D36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV0 A;  3D36 C; 
#chains in the Genus database with same CATH topology
 4X65 B;  5KHK A;  1PP9 H;  2IH1 C;  1R1B A;  3P30 A;  3ZBH A;  1JX9 A;  2CTR A;  4DYL A;  4JAU A;  2HVK C;  2WAM A;  2LO1 A;  4OX9 O;  2FL4 A;  3L72 H;  2B5U A;  2H8P C;  2CDY A;  4K35 A;  3JAR A;  1IXM A;  2PTM A;  4JI2 O;  3K57 A;  4JI8 O;  2GUZ B;  3SPH A;  1Y67 A;  2ZE6 A;  4P9O A;  1K92 A;  4LFB B;  2OTJ V;  1XBL A;  3WU2 Z;  2YDE A;  2IJJ A;  4J41 A;  3JD3 A;  4ZKI A;  1BHA A;  1M4U A;  4DV7 B;  2JIZ G;  3B4S A;  1MOF A;  3SJQ C;  1HNZ B;  5IDJ A;  2B9Z A;  1WA8 B;  3OGC C;  3FB6 C;  3P3P A;  2B1I A;  3A0H Z;  5LBQ A;  2DOS A;  2GHY A;  5LOV A;  2UXC O;  4DRX A;  1Y4M A;  4NXN B;  1AR5 A;  5H6R A;  4BIO A;  1AJP A;  1NTZ H;  2QKC A;  1NQT A;  1BSM A;  4ABM A;  4CC6 A;  2JJ2 G;  1FJG B;  2AHY A;  2OCH A;  1M9N A;  3APO A;  1VEW A;  5C93 A;  1NTK H;  1K4C C;  3ZMZ A;  3K9A A;  4TQD A;  5IYZ A;  4U3F H;  5E1A C;  1SQX H;  2MK3 A;  3IFX A;  3N2G A;  1R6K A;  4LNU B;  1KEC A;  1BMF G;  4FLT A;  1FXV A;  1Q8I A;  3BAB A;  3JD2 A;  4GT1 A;  2QM4 A;  2QEX V;  4GYC B;  4MTG A;  3BRC A;  1Y76 A;  1ZX3 A;  1VF6 A;  1WB7 A;  4K8X A;  1JA8 A;  4JYA O;  4JI0 O;  1GO3 F;  2AW9 A;  5LGN A;  3RGB A;  4IYH A;  3UO2 A;  4LWS B;  4B7E A;  4X62 B;  4YJ2 B;  2ATK C;  1NS1 A;  4DK1 A;  3K0G A;  4Z1V A;  5KMG B;  3T4D A;  1Q6U A;  1XQ8 A;  3SYA A;  1XHZ A;  3RT3 C;  2BSK A;  1N36 O;  1S77 D;  4MW8 A;  4RUE A;  3CHX A;  3JAR B;  3ZRV A;  1IXB A;  4K0K B;  3OAA G;  2YIC A;  1FAF A;  1TUB B;  4BAY A;  3HPL C;  5DM6 V;  5IE9 A;  1YI2 V;  4DR1 B;  2ZNI A;  1K9M W;  2E75 B;  4JI3 B;  1XNQ B;  1TVK B;  5A2Q N;  4KUM A;  5LGU A;  4FZ1 A;  5B1B B;  2P67 A;  5LYJ B;  4PI2 A;  2QTO A;  4FPP A;  2UUA O;  4DV0 B;  1OCC C;  1OCC B;  3CE2 A;  4D7T A;  3OW2 U;  1OCR B;  4X1Y B;  2ZXW C;  4QNH B;  4DUZ B;  3X2Q C;  3X2Q B;  2AZ0 A;  4HYO A;  1GM9 A;  5LA6 A;  2Z3Y A;  2KSD A;  3UKM A;  4X66 B;  4FM2 A;  1SET A;  4F6E A;  1QQC A;  1SER A;  3JD4 A;  5CA0 A;  1PNM A;  4D6T H;  2EIK B;  2QM8 A;  3LDE A;  2Y48 A;  1X59 A;  2FKX A;  3IGA C;  4DXW A;  4AQY O;  3TJT A;  4GKJ B;  3M7M X;  5LP6 B;  1MNG A;  1MSW D;  5JVD A;  5J2U A;  1HNW O;  4HZ3 A;  3E22 B;  1YVW A;  3T2M A;  1E1R G;  1V54 C;  3N2G B;  2DWE C;  3HB3 B;  1S72 V;  1QNM A;  2XAJ A;  1BQ0 A;  4B7K A;  4PA4 A;  3RVY A;  1PV0 A;  5DEC A;  1MAB G;  3MHH C;  5C8Y A;  3MAQ A;  1GKF A;  1QVF U;  3B77 A;  4QPK A;  2DQ0 A;  2X6A A;  4WFE A;  2UUB B;  5IT9 N;  2YID A;  3O9O A;  3B8M A;  4E2L A;  1EFR G;  3RYI B;  3FYI B;  4GKK B;  3LSQ A;  4JI1 O;  5JH7 B;  4I9Q A;  3K0D A;  4RO2 A;  1KP3 A;  3OE7 G;  2GTS A;  4NVP A;  1M90 W;  4IYI A;  2Z5U A;  1TA8 A;  5H6Q A;  1V9P A;  4HNA A;  4QJF B;  1K34 A;  1Y74 A;  4X8A A;  3F5W C;  4JI4 O;  4DV4 B;  2CTQ A;  1AR4 A;  2ETN A;  2RNB A;  4B3R B;  2EJ7 A;  1HNX O;  4AI8 A;  4PDV A;  2O57 A;  5KA6 A;  3A2F A;  1VQO V;  3STZ C;  5L3F A;  3CJH B;  1NZ6 A;  1X4T A;  4FLX A;  2EIJ B;  4MTO A;  4PA6 A;  4Q20 A;  5BZB A;  4TV9 A;  3JCZ A;  2ZM6 B;  3AG4 C;  2HR3 A;  5JJJ B;  4JI6 O;  2Y69 C;  3I55 V;  4RQE A;  3T1C A;  3F5T A;  1CP9 A;  2DYS C;  2AHZ A;  3T1Y B;  1DF5 A;  4UCV A;  1VF5 B;  1IVS A;  1IDS A;  5EC1 C;  3CCU V;  5LHG A;  1HP8 A;  2NR5 A;  5H5N A;  4FLY A;  4MVO A;  4EB6 A;  3G80 A;  3PJS K;  4IIJ A;  4DO2 A;  1N33 B;  4P9P A;  1XIL A;  3GWK C;  4CH3 A;  4X88 A;  1OJH A;  3ETQ A;  4JV5 O;  2EUL A;  4B3T O;  1PL0 A;  4DV2 O;  4BWA A;  2OTL V;  1IZ3 A;  1VP7 A;  3HKD A;  4DR6 B;  3ZN0 A;  1GM8 A;  5JVD B;  5J2U B;  4MVQ A;  4PDL A;  3U0Z A;  4RWU A;  3HR0 A;  4PDM A;  2H94 A;  2OIE A;  1H38 A;  3ZHV A;  4MVS A;  1CEZ A;  2W6J G;  1WP8 A;  1PL4 A;  1SA0 A;  3C3S A;  3SDL A;  4LF7 B;  1EN4 A;  1ZUQ A;  3ABU A;  4DR3 B;  2A06 H;  2Q7H A;  1TGO A;  4LF5 O;  3ETG A;  2YI8 A;  2P5O A;  1H2S B;  4RAI A;  3OUF A;  3H1J H;  5EZY B;  4ASU G;  1B06 A;  1XNR B;  5CBF A;  3JAS A;  1NR1 A;  3ASN B;  4CZZ A;  4X20 A;  4J80 A;  1BQZ A;  4I55 B;  2UU9 O;  4B3M B;  4NXM B;  2QWN B;  3OD4 A;  5EBM C;  1SC5 B;  2Q5Z A;  3AG1 C;  2BCC H;  1Q3E A;  2HEP A;  1YSC A;  1ZL8 A;  4HAM A;  1VMG A;  4O4H A;  3OTO B;  1NI8 A;  1K33 A;  5GON A;  4DR7 B;  3SJC C;  5IYB O;  4X65 O;  3FB5 C;  4WCE V;  1NVP D;  3RYF B;  1URF A;  2OCC C;  1RPO A;  4A5U B;  2Q69 A;  3FKS G;  4H13 B;  1RM1 B;  1VQM V;  3OGI B;  1E1Q G;  4JYC A;  4TUY A;  4TV9 B;  1YJW V;  1M56 B;  2BOB C;  2F93 B;  1KP2 A;  1Q86 W;  4DUY B;  2YIA A;  5CA1 A;  4I50 A;  3CPW U;  5J2T A;  3H9V A;  2UUC B;  4GLX A;  1Y6X A;  5KHG A;  3HKE B;  4LFB O;  5CB4 B;  4TSF G;  3IC7 A;  1IBK B;  5IWA O;  3JAW B;  2E5L B;  4P30 A;  1RSO A;  2P6J A;  1NH2 D;  2VRZ A;  2VQF B;  3L73 H;  1GRJ A;  2P06 A;  4DV7 O;  1J95 A;  1XL6 A;  2KQX A;  5ITZ A;  3O65 A;  4JZG A;  1V55 B;  2DYR C;  4DV1 B;  1YCI A;  2BE3 A;  1NU1 H;  3RWR D;  3UT5 B;  2Q7E A;  3ZRW A;  2ZDI C;  2GDS A;  3LDC A;  1PNL A;  4X1K A;  3CP1 A;  1JJ2 U;  3JAK A;  2WLI A;  3D3Q A;  2N74 A;  5LXT B;  1U96 A;  1F51 A;  1P4R A;  3CXC U;  4NXN O;  1AIL A;  3CWB H;  3JSN A;  5EIB C;  2Y4T A;  1FJG O;  2EZP A;  1H2N A;  1FXK C;  5TIS Z;  4H33 A;  4RQF A;  1HR0 B;  5CBH A;  5E79 Z;  2QKS A;  3CD6 V;  2A9H A;  4W4K A;  2IU3 A;  4ZOL A;  2W0F C;  4IT5 A;  2D3O W;  2PYJ A;  4PDR A;  1QLE C;  5KUM A;  3GWO A;  1MG1 A;  1MZE A;  1BGY H;  1FS0 G;  1LUW A;  3EVK A;  3BA8 A;  4PHZ A;  1VF7 A;  3OTF A;  1P49 A;  1TUE B;  3T4Z A;  4N21 A;  3FB8 C;  3B40 A;  1XRE A;  3ABL B;  3D8C A;  3ABK B;  3NR7 A;  1SRY A;  2OWO A;  4LF9 B;  4E4E A;  4X62 O;  1OZ0 A;  1BE3 H;  1W0J G;  3K79 A;  2EIM B;  2DE0 X;  1OCZ B;  1L8D A;  3SPI A;  1KKD A;  4UB8 Z;  2Q0A A;  3OEE G;  1SZX A;  5L3C A;  3CRR A;  4I7Z B;  4NR1 A;  1XEQ A;  2VQE B;  4J9Z B;  1LUV A;  4K0K O;  1XMQ B;  3PN1 A;  2ZQM A;  3BEH A;  3CCM V;  1JR9 A;  4YJ3 B;  4DR1 O;  2ITD C;  4JI3 O;  2YUA A;  1XNQ O;  4F4L A;  2XAQ A;  5DED A;  3UCS C;  4DR5 B;  1JPX A;  1IBL B;  2JJ1 G;  1B6Q A;  3CX5 F;  1YF2 A;  1NR7 A;  2UXD B;  2Q0O C;  4DV0 O;  4BIU A;  1R3L C;  2GSM B;  3SYO A;  4I4T B;  3AK1 A;  4LFA B;  1IX9 A;  2UXX A;  4JTD B;  3CCV V;  2Y0P A;  3J7A U;  2QR4 A;  1R3I C;  2RDC A;  4DUZ O;  4G27 B;  4JF3 A;  1B3Q A;  4H44 B;  2L35 A;  1FYJ A;  4X66 O;  4F6R A;  3SR2 C;  1VQK V;  2BTQ B;  3JAK B;  2HHH O;  4QGP A;  3DTU B;  1U97 A;  5H9C A;  1QHT A;  3TK1 A;  2RMK B;  3WG7 B;  3WG7 C;  4GKJ O;  3E8F A;  3ASO B;  2C2A A;  3BY6 A;  3OMI B;  3IJ4 A;  1I5X A;  5B3S B;  1QVG U;  4DR2 B;  1N34 B;  1K3E A;  1FPO A;  3DXR A;  4X1I A;  1WN7 A;  5L3E A;  4JI7 B;  1G8M A;  2V4D A;  2CTW A;  4DV6 B;  1KD1 W;  4R8C A;  4O4L B;  3F7V C;  3E35 A;  2UUB O;  5BY1 A;  3SPC A;  2LFS A;  4I9W A;  4CS2 A;  1PNK A;  3CME V;  3BFR A;  4QE9 A;  4GKK O;  2P7T C;  5K1P A;  4FZ0 A;  3G6E V;  3RW0 A;  4YHH B;  3TCU A;  1N4C A;  2R70 A;  2WLM A;  1AP6 A;  1N0J A;  4DV4 O;  1THZ A;  2R9R B;  2JS5 A;  3KCY A;  4B3R O;  4WBN B;  2QKA A;  4P2Z A;  1R73 A;  2NN4 A;  4Q6G A;  1VAR A;  1YIJ V;  3ZHU A;  3U10 A;  4UV9 A;  2IJI A;  2R9I A;  3TGU H;  4EKW A;  2VWJ A;  3JAL A;  3N2K A;  4JYB A;  2Y0I A;  1JFF A;  2YSU B;  1AJQ A;  4D7S A;  4PA3 A;  3AK2 A;  4MW3 A;  3ZHS A;  3RN4 A;  1AJN A;  3T1Y O;  4GX0 A;  4PD4 F;  1WB8 A;  2OYQ A;  4DW1 A;  5B66 Z;  1AP5 A;  2KG7 A;  1EBO A;  5L3D A;  3U11 A;  5L3B A;  1G6U A;  1N33 O;  1EZV H;  1D5N A;  5LGT A;  1WPB A;  5A9G A;  1UPG A;  3ZIA G;  1B04 A;  2YS8 A;  3NXS A;  3ICX A;  3JAT A;  3JCU Z;  5B1B C;  3BHP A;  4PV1 B;  3Q4H A;  3CXH F;  3BVO A;  1XMO B;  4PA9 A;  2QWR B;  1JOY A;  4DR6 O;  1OCR C;  4EFB A;  2A3Q A;  2DN9 A;  1M93 A;  2QWP B;  4UXN A;  2HVJ C;  1ORQ C;  4J10 A;  3G4S V;  1NT2 B;  4JTC B;  1EN6 A;  3P32 A;  4XDJ A;  3DXR B;  4W4L A;  4LF4 B;  3CRQ A;  2YXH A;  2CTP A;  2EJR A;  4G28 B;  1Q81 W;  2L6L A;  4LF7 O;  2K9P A;  2EX3 A;  4Z2W A;  4FLU A;  1KMI Z;  5IYC O;  3AG3 C;  3AG3 B;  5LOV B;  3GVM A;  4DR3 O;  4DRX B;  5IJ9 A;  2EIK C;  3OT7 A;  1I94 B;  1H8H G;  4H37 A;  2KKW A;  5B1N A;  1XNR O;  1SF9 A;  5LP6 C;  3RBZ A;  3WB1 A;  2JEU A;  4B3M O;  4WFH A;  4NXM O;  5IYZ B;  4CH4 A;  3C3T A;  2XTA A;  4DW0 A;  3K5O A;  2JRI A;  1SQF A;  4LR3 A;  1WPX A;  1VQ8 V;  4MTX A;  1MA1 A;  3CYO A;  2X6B A;  2YEV A;  3OTO O;  3ZHQ A;  3RYH A;  4DR7 O;  1Y76 B;  1Z2G A;  3CCR V;  4OPH A;  2OIG A;  1ZTE A;  4MSW C;  1QCE A;  4O2A A;  4LFC B;  3ZRS A;  4U3J A;  3W7X A;  3KG2 A;  3N2K B;  5KHH A;  1JFF B;  5B5E Z;  5GTI Z;  3ABM C;  3ABM B;  4I0X A;  2XAS A;  1HW7 A;  2IH3 C;  4GX1 A;  3TXQ A;  3KKY A;  1I0H A;  5KUK A;  1DK1 A;  4DUY O;  2B1G A;  2BSK B;  1S3J A;  3E89 A;  3L9D A;  2UUC O;  2EIL C;  2EIL B;  3R66 A;  4XDK A;  1K8A W;  3ETD A;  1ARO P;  5CA3 A;  2E3C A;  3AG2 B;  3K06 A;  5FNV A;  1IBK O;  5KAI Z;  1M57 B;  3E86 A;  4TOI A;  3SPJ A;  3W7T A;  1DTO A;  2EIJ C;  2VQF O;  2ITC C;  4FMT A;  3JAT B;  2DJV A;  4JAA A;  4DV1 O;  1YXB A;  3B2E E;  2E74 B;  2JGD A;  2Q7G A;  3VQX A;  1R6T A;  1AI6 A;  5FL7 G;  4UVB A;  2W6I G;  1GN4 A;  2H3O A;  1Q7Y W;  3OM3 B;  5LMN B;  3OMA B;  5LA6 B;  2NLJ C;  3J80 N;  2BTO A;  5LL6 Y;  4DV5 B;  3MD0 A;  5B1A B;  3LSS A;  1QBZ A;  4IHJ A;  5CA0 B;  1P84 F;  5GTH Z;  4DV3 B;  4XDL A;  2IJH A;  3SYC A;  4PA7 A;  1HR0 O;  4YY3 B;  2EBO A;  2FTK A;  4KHP O;  1T5E A;  1RPR A;  4CS4 A;  4U7O A;  1QU7 A;  4J7K A;  1F7Y A;  4QPJ A;  3VBB A;  2LGQ A;  2WLN A;  1XI1 A;  4DR4 B;  4PI0 A;  2YEV B;  3K03 A;  2WA3 A;  2LP7 A;  5C8Y B;  2LFR A;  1DGS A;  1PM9 A;  3CCE V;  4O4J A;  1FFT B;  2ZDI A;  4LF9 O;  5LHH A;  3ZN1 A;  5IY5 B;  1VQL V;  4UVA A;  2V1D A;  5JCO A;  3ASN C;  4U3J B;  2F1M A;  4O4I A;  4HBN A;  1SS3 A;  2WLJ A;  2R72 A;  1KBH A;  5JQG A;  3CC2 V;  2WLH A;  4NTW A;  5JJN B;  5KHI A;  4UUJ C;  4HNA B;  1FXK A;  1Y74 B;  3W7U A;  4X64 B;  1AI4 A;  2VQE O;  1XMQ O;  3F7Y C;  2QGN A;  1S5L Z;  1L0L H;  2LJ2 A;  4JI5 B;  3DC5 A;  5LHI A;  1MMM A;  1AI7 A;  5HFM A;  2BOC C;  4UVC A;  3K08 A;  5KX5 A;  1YZB A;  4DR5 O;  1IBL O;  1RM1 C;  5EYP A;  5FPO A;  1Q6I A;  1F23 A;  4J42 A;  4JPR A;  1M56 C;  2UXD O;  1FFX A;  1M5I A;  1WJZ A;  2JVD A;  4FFB A;  3OFN G;  3HKB A;  4GCZ A;  3L74 H;  4AIL C;  3RYC A;  1YEW A;  4LFA O;  3H01 A;  1I5Y A;  4UCO A;  1AB3 A;  4TV8 A;  4MVM A;  4K8Z A;  2WSS G;  3A0R A;  4FM0 A;  4EB6 B;  1AVM A;  4IIJ B;  3WB0 A;  2ZIO A;  1SQV H;  1NVP B;  2ZT9 B;  3D36 C;  1O9H A;  2CH7 A;  1MZF A;  4X9Q A;  4TWK A;  1NTM H;  3CRC A;  1BS3 A;  1V55 C;  4LC1 A;  1HNZ O;  1GN2 A;  4DR2 O;  3HKD B;  2JGU A;  1N34 O;  5EIB D;  4EFE A;  4GX2 A;  1SQP H;  5F2V O;  1IBM B;  4WFB V;  3ZJZ A;  4OPA A;  1S5J A;  1MSD A;  3E8G A;  3OUS A;  4JI7 O;  2JS3 A;  3CRA A;  1Q6H A;  3ZMU A;  2ARH A;  5LMU B;  2PZS A;  1SA0 B;  3FB7 C;  1W59 A;  1YTF B;  2JDI G;  1NH2 B;  2A79 B;  4I5S A;  2EIN C;  1OHH G;  2EIN B;  3BA9 A;  4MVZ A;  2LGW A;  4WFF A;  5L3G A;  4C7U A;  4KL1 A;  3JAS B;  4X20 B;  3QTC A;  1JMK C;  2YIB A;  3G67 A;  2ODM A;  2LW1 A;  1PKX A;  4MVR A;  1K5S A;  2PGG A;  5JQG B;  5AG2 A;  2GBO A;  3SYQ A;  1RFY A;  4QE7 A;  3K3W A;  3JYC A;  3CC7 V;  4MS2 A;  1N8R W;  1ZL8 B;  2G38 A;  2DW4 A;  4O4H B;  3EHB B;  3QO7 A;  2QWQ B;  2MW2 B;  5GON B;  1N0N A;  1WA8 A;  3OR7 C;  4JAV A;  1M1K W;  3JD1 A;  3ABL C;  3ABK C;  3TXS A;  4UV8 A;  3CRM A;  1OV9 A;  2X7R B;  2OT5 A;  2EIM C;  1OCZ C;  4B3S B;  4TUY B;  3L75 H;  4J9Y B;  3QO5 A;  2WWW A;  4KXR A;  3RVZ A;  3CCQ V;  3DSQ A;  3T1H B;  5FPR A;  2ZCE A;  1OCO C;  1OCO B;  1BCC H;  3RYC B;  4LF5 B;  3SYP A;  3AG7 A;  5CA1 B;  4YXW G;  4I50 B;  5J2T B;  4FVM A;  2EZO A;  4JTA B;  5BR8 B;  4IL6 Z;  4LF8 B;  1ZLZ A;  4LNU A;  4BIZ A;  3SJA C;  1RSO B;  1L0N H;  4FLV A;  4WF9 V;  2CH7 B;  2ADQ B;  5KLV H;  1N32 B;  1W2B U;  1XMO O;  5ITZ B;  1P7G A;  2YIB D;  1VQ5 V;  3L71 H;  1BHB A;  3N27 A;  3QO8 A;  3KCX A;  3K5M A;  1P7B A;  4LWS A;  4YJ2 A;  2X0L A;  4UCU A;  1HDJ A;  3ABT A;  4LF4 O;  5KMG A;  3FYE B;  1G1X B;  3ZRW B;  1D2D A;  4X1K B;  1Q90 D;  4YIP A;  2WLI B;  1QR9 A;  3DC6 A;  3G6B A;  1I94 O;  1FD9 A;  3VOU A;  4ZIB A;  3HKC A;  1XUQ A;  1CPY A;  4H0L B;  4CC5 A;  1LR1 A;  1TUB A;  2RQ6 A;  3ASO C;  2AGA A;  2ZNJ A;  5D5Q A;  3CEI A;  1G4Y B;  5B3S C;  2LQT A;  5IWA B;  1D5A A;  4ZHQ A;  1TVK A;  2ZE7 A;  2QSA A;  4GUN A;  4BW9 A;  4ZOL B;  5LYJ A;  3LSU A;  4YIO A;  2WLK A;  5KA5 A;  2XAH A;  3SPG A;  2IBZ H;  2YXL A;  1VQ4 V;  4GX5 A;  3QG5 A;  4FLW A;  3QF7 A;  3VQY A;  2HKO A;  4X1Y A;  3E2E A;  2WA4 A;  4LFC O;  3STL C;  2XOK G;  3CC4 V;  3APQ A;  1YHQ V;  1KUQ A;  4N23 A;  4KP4 A;  2D2C B;  2F43 G;  4LF6 B;  2UXB B;  2CE4 A;  2HFE C;  1J5E B;  4R50 A;  5JJE B;  1Z5V A;  5LP6 A;  2HP8 A;  3FAV A;  1L1F A;  3E22 A;  4ICG A;  2M6Y A;  1SQQ H;  2ZD9 A;  2QDO A;  4OXS A;  1YJ9 V;  1JCH A;  2HJF C;  4EEQ A;  2ZM6 O;  4J7J A;  4JYY A;  3BPZ A;  2YC0 A;  1I08 A;  2YXY A;  2Q6A A;  2IM9 A;  4WFA V;  1JQ0 A;  1WP7 A;  3RYI A;  5JH7 A;  3CCJ V;  5LMN O;  3LNN A;  5B1O A;  3CMA V;  1COW G;  2F95 B;  1WNS A;  4F6R B;  3K59 A;  4DV5 O;  1EM1 A;  1US6 A;  2CAZ C;  4UFZ A;  3M99 B;  2Y4U A;  1SKV A;  2PF4 E;  3ZCC A;  5HFL A;  4DV3 O;  3HKC B;  2A0L A;  1ZSP A;  3IC9 A;  2F4V B;  4YY3 O;  5CN0 A;  3CJH A;  2E76 B;  3FD9 A;  4ZHQ B;  1I7F A;  3AEI A;  4X1I B;  4DR4 O;  3UO3 A;  4MTF A;  1VQN V;  3CCS V;  4OX9 B;  1K5Q A;  5IJ0 A;  1YDX A;  3ZMV A;  1SZT A;  1BZK A;  1FKA O;  3BCC H;  2ZR2 A;  3MDS A;  4JI2 B;  2YI9 A;  5BXZ A;  1XOU A;  1VQP V;  3B8N A;  2ZXW B;  4UCS A;  4JI8 B;  1F4N A;  5BMV A;  4JGS A;  3QVN A;  3OEH G;  1Q43 A;  3K9S A;  2CUG A;  4LH6 A;  3DGE A;  4MVU A;  1H8E G;  4OGQ B;  2NNU A;  3EXA A;  1Q82 W;  3RFR A;  2HHH B;  3D3I A;  3ZX6 A;  2DQ3 A;  1S76 D;  4X64 O;  3ZHR A;  4JI5 O;  5CBG A;  1VF6 C;  3K5L A;  1KQS U;  3FAV B;  1GMG A;  3VQV A;  1V54 B;  1VQ7 V;  1R6N A;  1VIB A;  3JAL B;  1YJN V;  2P90 A;  3JSL A;  2UXC B;  4CS3 A;  4ZBM A;  2Q9L A;  2XAF A;  3G71 V;  4X89 A;  2Z0A A;  1GK9 A;  3S3X A;  3K04 A;  5EZY A;  2Q8V A;  3CS5 A;  1XHX A;  1H2L A;  1GM7 A;  4AHC A;  4NYK A;  4RUF A;  4BR6 A;  2KG7 B;  4I55 A;  5D5P A;  1NKD A;  1WAZ A;  3AG2 C;  3JAM N;  3M8A A;  3K58 A;  1M57 C;  2E5L O;  4CH5 A;  1HWY A;  3C90 A;  5K1X A;  1KU9 A;  3JD0 A;  2AXT Z;  2P4V A;  2VWK A;  2HG5 C;  3Q4H B;  4JYA B;  2JEX A;  4FK5 C;  3RYF A;  1E79 G;  2A7W A;  2M7W A;  4JI0 B;  2QTS A;  4QIW F;  3MHS C;  3P3N A;  1IBM O;  1K7D A;  3W7S A;  4NB5 A;  1A32 A;  3AG4 B;  2Y69 B;  1Z5W A;  1SQB H;  5LMU O;  3UM7 A;  2DYS B;  5B1A C;  5J9P C;  5IJ0 B;  4MT8 A;  1N36 B;  4K3A A;  5IJ9 B;  1NBM G;  3L70 H;  2Q73 A;  4UCR A;  2V7Q G;  4O2B A;  4PEL A;  3HKE A;  1PPJ H;  5CB4 A;  4ZI7 A;  4NTY A;  5BMV B;  4CH6 A;  2IJK A;  3JAW A;  2XAG A;  1QLN A;  2ZIM A;  1YIT V;  3H1H H;  2WLL A;  3D36 A;  4J11 A;  3K5N A;  1VQ6 V;  1R3K C;  3LDD A;  4R7C A;  4TQF A;  1SQG A;  1ROP A;  2PUS A;  2FYU H;  2UUA B;  2IU0 A;  4U7N A;  3CB2 A;  3RYH B;  2P4K A;  2ADP A;  2N05 A;  5EBW C;  1H2G A;  3UT5 A;  3SGI A;  5EC2 C;  4JZ2 A;  4O2A B;  4XBF A;  5IY5 C;  4B08 A;  1BT8 A;  3H1K H;  2RJZ A;  5KHJ A;  3OR6 C;  5LXT A;  4B3S O;  1Q5O A;  2Q4P A;  2KB1 A;  3FX7 A;  3H1I H;  4FFK A;  4I0X B;  2GTA A;  2PYL A;  2R9A A;  5EK0 A;  3T1H O;  1RP3 B;  3GB7 C;  5JWP A;  1ENV A;  3A8T A;  1H2M A;  2GV9 A;  4AQY B;  1EN5 A;  1JJO A;  2XHB A;  1KKC A;  2F66 C;  2ZE5 A;  5EBL C;  2QA4 V;  2RN9 A;  2CGN A;  2Q68 A;  5BR8 O;  3ML0 A;  2F23 A;  1HNW B;  4LF8 O;  2CK3 G;  2XT9 A;  4FLZ A;  1O9G A;  5FNV B;  1ZAU A;  1KYO F;  2FML A;  3EFF K;  2W0X A;  1JVM A;  3AG1 B;  4JAS A;  5DN6 G;  3ETE A;  4UB6 Z;  3WB2 A;  2PI4 A;  4WFG A;  1N32 O;  1F4M A;  5GW7 A;  2PI5 A;  2JK5 C;  1KC8 W;  2FB5 A;  2VS0 A;  1DF4 A;  5IYD O;  2OCC B;  2JGD B;  3S3W A;  4G2K A;  2LW7 A;  2X6C A;  4KFM A;  1IUR A;  1TAE A;  4JI1 B;  3ZMT A;  2DMX A;  1UFI A;  5H2F Z;  4BW5 A;  3H1L H;  4JI4 B;  1DLB A;  1ZWI C;  2HLD G;  4FJC C;  4IHJ B;  1HNX B;  2DWD C;  3I5D A;  3WFV A;  3A0B Z;  4O2B B;  4YJ3 A;  1K4D C;  5CMU A;  4ZI7 B;  1GTO A;  2P22 C;  3OMN B;  1BL8 A;  1YTF D;  1CXZ B;  1AR1 B;  1W0K G;  1KB9 F;  2WLL B;  1EZJ A;  4DV6 O;  4JI6 B;  3KZI Z;  4I4T A;  1GH6 A;  2DYR B;  2QWO B;  3E8H A;  1QR8 A;  1XL4 A;  3E8B A;  4J7Z A;  2QM7 A;  2GUZ A;  4LP8 A;  4GZR B;  3FFQ A;  4O4J B;  2N04 A;  3SJB C;  2CGO A;  3CCL V;  5JCO C;  4L87 A;  4PJ0 Z;  3IAY A;  1SES A;  1GAX A;  2BTQ A;  2QJ1 A;  4IGG A;  2RCV A;  4LF6 O;  3ZED A;  2UXB O;  4O4I B;  4YHH O;  3J81 N;  4FIP C;  3I56 V;  1J5E O;  4NTX A;  1FXH A;  2ZR3 A;  3CSX A;  4JV5 B;  4B3T B;  1XDC A;  1FXK B;  1S5H C;  4UCT A;  2ZE8 A;  3UQ8 A;  5FLX N;  4DV2 B;  2XND G;  1WLE A;  4R6Z A;  3LNM B;  1UJW B;  2K1E A;  2XUM A;  4TT3 G;  4KHP B;  3R65 A;  4LH7 A;  3TET A;  2ILM A;  2QE7 G;  2UXN A;  5KX5 B;  3QNE A;  5KAF Z;  3AK3 A;  1QLE B;  3B09 A;  5EYP B;  1K97 A;  4O4L A;  4L8J A;  3BAA A;  1FFX B;  3ZMS A;  3VQW A;  4FFB B;  3E83 A;  3HKB B;  1LNQ A;  3ZS8 C;  4CBC A;  2PY5 A;  2Q67 A;  1NJI W;  1K73 W;  1VQ9 V;  3ZHT A;  1GN6 A;  4TV8 B;  2ZKO A;  4Z1M G;  4LCU C;  4FM1 A;  2UU9 B;  1S0V A;  2WPD G;  1PD3 A;  4DK0 A;  4NKG B;  3LUT B;  3ZRX A;  3THO A;  4WBN A;  1AI5 A;  2IW5 A;  4LBE C;  1H2K A;  3W7W A;  2ZIN A;  1Y66 A;  2F4V O;  1GN3 A;  2AZ2 A;  2HJD A;  1R3J C; 
#chains in the Genus database with same CATH homology
 1PV0 A;  3D36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...