3D36C

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
42
structure length
42
Chain Sequence
MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/transferase inhibitor
molecule keywords Sporulation kinase B
total genus 17
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 3d36C01
1PV0A 3D36C
chains in the Genus database with same CATH superfamily
3AG1B 5DM6V 5L3CA 4YJ2B 2ATKC 1GAXA 4JI5O 4DR6O 3C3SA 1JVMA 2DW4A 1K73W 4W4LA 2BTQA 1COWG 1SETA 2HJDA 1VQ4V 4IYHA 5LYJB 1BT8A 1H38A 3BPZA 3CX5F 1H2MA 1E1RG 3ASNB 3HKDA 1N32B 2KQXA 2FMLA 3FB7C 1BCCH 3FX7A 1P49A 1XNQB 4R8CA 4I7ZB 4DV5O 3UT5B 4TOIA 5KHJA 4QJFB 2RN9A 1FFXB 2ETNA 4XBFA 3LSSA 1AJQA 3CRAA 3JATB 4CS3A 5GW7A 1HWYA 3APOA 4LF6O 5KUMA 1YDXA 2Q69A 1EN6A 1FJGO 4PELA 1WP7A 4U7NA 3ZRSA 2A9HA 3OTOO 1KC8W 1IDSA 2YUAA 4EB6B 5LP6B 2NLJC 1GMGA 1FYJA 3JSLA 2Q7GA 3STZC 2A79B 1RFYA 2RCVA 3G67A 3LUTB 2PY5A 4MVZA 4L8JA 1V54B 2F4VO 3QO5A 1SZXA 4YIPA 1ORQC 3CC4V 1O9HA 1JR9A 4CC5A 1NVPD 3ZHUA 1JPXA 3G6BA 4F6RA 1IURA 1QLEB 4WFAV 5KX5B 2YICA 2CK3G 4TV8A 3X2QB 3H1KH 3OTOB 3G4SV 3UKMA 4DUYB 2UXXA 2CTWA 3ZJZA 3SJCC 2ZIOA 4O2AB 3JD4A 1WJZA 2KKWA 4LF4O 2ZNJA 4O4JA 2Q67A 3WG7B 3B09A 3FB6C 1RP3B 4MS2A 2N74A 2PI4A 4LF9O 4X89A 2DQ3A 3F5TA 1SS3A 1UFIA 1PM9A 5BMVA 2CGOA 1YTFB 1J5EO 1OCCC 3N2KA 2UUBO 1ZLZA 4ZHQA 5KHIA 2QWPB 4TQDA 4AI8A 5JJJB 4NXMB 4TQFA 5LHGA 2FYUH 3W7WA 1N33B 5E79Z 2DYRC 3ABLB 4MTFA 3K58A 4PA3A 4X64B 3H1IH 4HAMA 2XNDG 2XAFA 1VF5B 3SPCA 4YHHO 3S3XA 3ZHQA 5K1XA 3P30A 4LF6B 1XL6A 4X1IB 3ZS8C 1WA8A 3K0DA 5B3SC 2YXHA 4FZ0A 1AI7A 2BE3A 5BZBA 2GUZA 4H13B 2KB1A 4H33A 1PPJH 2CH7A 1NR1A 5EYPA 4I55A 1Z5WA 2EIKC 4ZOLA 2XTAA 2EJ7A 2Q0OC 1K4DC 1SRYA 5L3EA 4HNAB 3CRMA 1F7YA 1H2LA 2XAJA 2DYSC 2ZR2A 3RWRD 3L75H 2HG5C 3AG3C 4Q20A 4J7JA 4YY3O 1B06A 2X6AA 3JAKA 4YJ3A 1JJ2U 3K5LA 4O2BB 1WB7A 3CC2V 5D5QA 4GZRB 2X0LA 3CYOA 3GVMA 4B3TB 2E5LO 1L0NH 3MDSA 3QF7A 4Z1MG 5CMUA 3B2EE 4FPPA 2EIMC 4GKJO 1VQMV 1JJOA 3RYIB 2IW5A 4LFAO 2EJRA 3FB8C 3BHPA 2PZSA 3JD3A 2QEXV 3HKDB 4HBNA 3CS5A 1SC5B 1M93A 3EHBB 3UT5A 5FPOA 1EN4A 1HNXB 4MW3A 2QWQB 4QE9A 3SGIA 5JCOC 1Y4MA 4MW8A 4JI6B 4KL1A 1URFA 2L6LA 4UV8A 3T1HO 1XBLA 1K34A 1V55C 4BIZA 5L3BA 3K57A 2WLHA 5IDJA 4DV6B 3HKEB 1SQVH 1S5LZ 1OCRB 4RQEA 2Q8VA 3JYCA 5LP6A 1CEZA 3VQWA 4FLVA 2XAHA 5HFMA 1MOFA 3D8CA 3J81N 3L9DA 4X88A 3O9OA 4XDLA 3UO2A 3JCUZ 1PNKA 4JI4O 3ETGA 4G27B 4AHCA 3ABUA 1XNRB 2JS3A 3DC6A 4BWAA 1SA0A 4F6RB 4DV7B 1OCZC 5KX5A 2OIGA 2EZPA 1NI8A 4UVBA 3R65A 3BAAA 1OHHG 2EINC 3LSUA 4LF7B 5CBFA 1MNGA 3GB7C 1VF7A 1VQ7V 3U0ZA 1AILA 4LFCB 1KBHA 4LNUB 5JCOA 3F7YC 3W7SA 4ASUG 1ENVA 1THZA 3CJHA 1H2NA 5ITZA 3I55V 3SPGA 4CH5A 4NKGB 1G1XB 2QJ1A 3H01A 4IGGA 1GK9A 3OM3B 2ZDIA 3IJ4A 5KMGA 1M90W 1KU9A 2CGNA 2IU3A 2Y0IA 5LP6C 1QHTA 2AGAA 4UFZA 1KKDA 5CA1A 1R6KA 1X4TA 3DC5A 5CB4B 1TAEA 3J80N 4MVMA 3E35A 4H37A 4ZHQB 1BGYH 1J5EB 4TWKA 5LGUA 4DK0A 1DK1A 2LFSA 2IBZH 1VARA 1VF6A 3OAAG 4KUMA 2EIMB 4IL6Z 2W6IG 3CMEV 4DV0O 1Q6HA 1SERA 1QCEA 4QNHB 1TUBB 1PNLA 1WA8B 4QE7A 1KD1W 1K5SA 1Y66A 1I5YA 2GUZB 1IBLO 1GN4A 1B6QA 4DV3O 1O9GA 1VQPV 2WLKA 1S5HC 2M6YA 4BIOA 1KP3A 1NBMG 2CH7B 5EYPB 1FFTB 5GTIZ 4ZOLB 4IYIA 1IZ3A 4J41A 3H1LH 2R70A 4DO2A 3JCZA 3CCQV 3ZMVA 4I50B 3E83A 4RUFA 4YJ3B 2EULA 2O57A 4O2BA 3OW2U 2DJVA 1F23A 2EIJB 4DR5B 5EIBD 4I9QA 1GM9A 4LF7O 4LF9B 1E1QG 4I4TA 1FAFA 1SQFA 2DYRB 2RJZA 1FJGB 2MW2B 2UXCB 2DWEC 4GUNA 4X66B 3RYIA 3ABTA 4PI2A 1M57B 2UXDO 2LFRA 4JI0B 1A32A 5A2QN 3HR0A 3BA9A 4GLXA 3T4DA 1NQTA 4B3MO 1QR9A 2BSKB 3JAMN 3J7AU 3STLC 2NR5A 3QO8A 2YIBA 1KQSU 2UU9O 3W7TA 3WU2Z 3T2MA 4TSFG 3TETA 1ZL8A 2YDEA 2UXBO 3BRCA 4CC6A 4J7KA 2QWOB 3B77A 4ZBMA 3AG3B 1JX9A 2EILC 3HKEA 4MVSA 3OFNG 2P90A 1CPYA 3ZRXA 3CEIA 5BXZA 2QWNB 2XASA 4OX9O 1HNZO 2IH1C 4TV9A 4KXRA 4LF8B 3MHHC 1D2DA 5H6RA 3RVZA 2QM7A 2CUGA 1GRJA 2ZE8A 1MZFA 5IWAB 4PDLA 3RYFA 1NH2B 1Q81W 1SA0B 4DV2O 2QKSA 4IIJB 3DTUB 2QE7G 2GTAA 4UB8Z 2E76B 1OCCB 3ZRVA 2V4DA 4MTGA 4X62O 1GO3F 1OV9A 1AI4A 1WPXA 3UQ8A 2YXYA 2Q7HA 4LNUA 3K0GA 4PDRA 5KA6A 1SQXH 3SYCA 2QTSA 5BR8O 1N4CA 4K8XA 1HR0O 2JRIA 2VWKA 2ZE5A 3CJHB 5FPRA 1BZKA 5CA0A 1HW7A 3ZHTA 5ITZB 3PJSK 5B3SB 3MAQA 3P3PA 2Z0AA 5FNVB 3TGUH 3IC9A 1D5NA 3ZHVA 2ZE6A 5A9GA 4JZGA 5KMGB 5B1OA 4JI8O 1R3LC 2AW9A 3A0HZ 1XMOO 2XUMA 2AHZA 2Q7EA 2YIAA 3QTCA 5CA1B 1F4MA 5CB4A 3CC7V 3OEHG 4YXWG 2GHYA 1OJHA 3NXSA 2PYLA 4HZ3A 4JGSA 5KUKA 5J2TB 4DV5B 2DYSB 3E2EA 2ZD9A 4AQYO 1HDJA 4I0XB 4UCTA 4U3JB 2GTSA 2DOSA 3RT3C 3H1HH 1MZEA 4I9WA 1TUBA 1PKXA 1XI1A 1PNMA 2HP8A 2C2AA 2XAGA 2RMKB 3AK1A 2QGNA 5DECA 2Q73A 5IYCO 2UUBB 2QA4V 1S5JA 2P4VA 2B5UA 3AEIA 4GCZA 3SJQC 1BHAA 4WBNB 3RYCA 2ZR3A 4OPAA 1P7BA 1WPBA 3T4ZA 3G6EV 3E8FA 4I50A 4UUJC 2ZM6B 3FB5C 1MSDA 2RDCA 4FM2A 2D2CB 1AR4A 3ZCCA 4RWUA 1FD9A 1XMQB 2A3QA 1K9MW 3AG4B 4I4TB 2WLIA 5KLVH 3T1HB 3W7XA 3RN4A 1G6UA 3KZIZ 1Q6IA 1HNWO 5F2VO 1NZ6A 3ZN1A 1YVWA 4L87A 1Q5OA 1N36O 1R6TA 1SF9A 2BTOA 1ZUQA 3JARB 1VQOV 1Q6UA 1G4YB 1JCHA 4FIPC 1QNMA 1AJPA 5JJNB 4JTDB 3BVOA 4JI0O 2BSKA 4GX2A 5EC2C 1TGOA 4UVCA 1CP9A 4EFBA 2ADPA 2AZ2A 1ZL8B 1XDCA 2QKCA 2IJJA 4U7OA 4NVPA 5C8YB 2WPDG 1AP6A 1P84F 1LR1A 2UXBB 4XDKA 1AVMA 1VEWA 1I94B 5IWAO 1EZVH 4TV9B 4J9ZB 3RBZA 1QU7A 1M56C 4DR6B 2LGQA 3VBBA 1W59A 4NTWA 5KHGA 1U97A 3RYFB 3ZMSA 3C3TA 4NB5A 3L70H 2BCCH 2LO1A 4IIJA 4A5UB 1R73A 1R3KC 2ZDIC 1KKCA 5EC1C 4DW0A 4FZ1A 1X59A 4DV1B 3OD4A 2QR4A 3L72H 1IBMO 3P3NA 3RW0A 1PD3A 4NXNO 3RFRA 3H1JH 2IM9A 4BIUA 2H3OA 3TXQA 2P06A 2UXCO 4PV1B 3FYEB 4GKKB 2ITCC 4X20B 4PA7A 4B08A 2H8PC 2OT5A 2UXDB 5CA0B 4JI2B 2LJ2A 3ETEA 2Y69C 2HVJC 5FNVA 3U11A 3GWOA 4N21A 4UCUA 3K5NA 4J7ZA 3FFQA 3AG2B 3R66A 3ZHRA 1Y76A 3OR7C 4D7SA 1YJWV 2OTJV 5J2TA 2A06H 2UUAB 1NU1H 1SQQH 3BCCH 3K3WA 3ABKC 3KCYA 5J9PC 5IJ9B 2E5LB 3CSXA 4I0XA 4U3JA 5IJ0A 3CRCA 4JI3B 2F93B 2DWDC 2AZ0A 2AXTZ 1YCIA 2CTQA 2F1MA 3APQA 4DV4O 3NR7A 5BY1A 4DV6O 2W0XA 4J42A 4O4LB 2OTLV 2OWOA 1TUEB 5IT9N 5E1AC 2PF4E 3OE7G 5JVDA 4JI6O 1WP8A 1Z5VA 1VQ6V 2Y4TA 3E22A 2WLJA 1RSOA 4X1YA 3E8BA 4WBNA 3CCUV 3RYCB 1ZX3A 4ICGA 4X62B 2JS5A 3QG5A 2Q6AA 2GSMB 5GONB 3KCXA 4MSWC 5LMUB 4P9PA 1JQ0A 1J95A 3FKSG 2QM4A 1XMOB 1Q86W 1MMMA 1BHBA 4LF5O 4JV5B 3ETDA 4FLYA 1GN6A 3VOUA 5LXTB 4NTXA 3DXRB 1IX9A 4WFEA 5JJEB 4LH6A 1YI2V 2N05A 3JAWB 5HFLA 4D6TH 5EBWC 2WLIB 4CS4A 1PV0A 4IHJB 2IU0A 5L3FA 2P5OA 1MSWD 4MVOA 4PA9A 2ODMA 4R7CA 2B1GA 3FD9A 4DRXB 2ZNIA 5LMUO 4H44B 1FXVA 3JARA 4JASA 2FTKA 4F6EA 1R3IC 4JV5O 4PI0A 1SQBH 4J10A 1S0VA 4FFKA 2CDYA 3W7UA 5JH7A 4FLTA 4MTOA 2RQ6A 4HYOA 2VRZA 1YJNV 2IJKA 3CCRV 3VQYA 4RAIA 1OCOC 4MVUA 5H5NA 2LW7A 3HPLC 1XILA 2HR3A 2YIDA 4MVQA 2VQEB 4Z1VA 1KECA 5C8YA 4PJ0Z 3CCEV 3SJBC 3AG2C 3CCJV 4JI7O 1FXHA 4KP4A 3EVKA 2KG7B 3K5OA 1W2BU 1H2SB 1FXKB 1Q90D 5EBMC 3A0RA 1XQ8A 3ABKB 2UU9B 1HNWB 5LOVB 3H9VA 3K06A 3HKBA 2PI5A 4LFAB 1YXBA 5LL6Y 2JGDB 1XNRO 4UVAA 5FLXN 1K7DA 4NYKA 3DGEA 3JD2A 2IH3C 3ZN0A 2QDOA 4JYYA 3AG7A 4RO2A 3RYHA 1HNXO 1BSMA 2VWJA 4LF8O 4R6ZA 4GKJB 1RM1B 2PGGA 4X20A 2ARHA 2R9IA 4X1KB 2G38A 4LFCO 4DK1A 1DF4A 1QR8A 2HJFC 5LGNA 1H8EG 2X6BA 3OUSA 3D3QA 1H2KA 3OMIB 1YZBA 1NKDA 1NT2B 4X9QA 4CH3A 4MVRA 2OCCC 5CA3A 1AP5A 1Y76B 3JD1A 3UM7A 5JWPA 3K59A 4FLWA 3OT7A 4J9YB 4K3AA 4JI4B 3LNNA 1N0JA 2IJIA 1SQPH 3C90A 3CD6V 5IJ9A 3JSNA 5B1BC 3FAVB 4KHPB 3IFXA 5IJ0B 1TVKB 1N34O 3G71V 1F51A 4PD4F 4K35A 2QSAA 5B1NA 3CE2A 4O4IB 3E86A 2BOBC 5LBQA 3P32A 1N32O 3F7VC 2W0FC 4F4LA 2JVDA 1IBMB 1XNQO 2EIJC 2XHBA 4DYLA 4J11A 2QM8A 4O4LA 4P30A 1YEWA 1XMQO 3HB3B 2ZCEA 2NNUA 4O4HB 5JVDB 3CMAV 5JQGB 4DV4B 4AILC 2V7QG 3OUFA 1KP2A 4PA6A 3E22B 4AQYB 2YS8A 1RSOB 3JASB 4X1YB 1BMFG 4DV1O 1D5AA 1Q82W 5H6QA 5GONA 2F23A 4BAYA 1N36B 1VQNV 1QBZA 4PDMA 5KA5A 3ABLC 3LSQA 2GDSA 4DR4O 3THOA 1YIJV 4GKKO 2WSSG 5LXTA 3I56V 3OGCC 3F5WC 4N23A 3DXRA 4OXSA 4C7UA 1H8HG 3OMNB 1SESA 4ZIBA 1FXKC 3RVYA 3TK1A 5TISZ 3JAWA 5LGTA 5LMNO 1Y74A 1PL4A 1S3JA 5H9CA 4B3SB 2E75B 1OCRC 1TA8A 4IHJA 2Q4PA 3CCSV 3CB2A 3T1CA 3UO3A 1AR1B 1HR0B 4DRXA 4YY3B 4NTYA 4DR2O 4BW5A 1P7GA 2ZINA 1UPGA 2LQTA 5KHKA 2Z3YA 2ZM6O 5EK0A 5JH7B 3BFRA 4UV9A 1IBKB 4JAVA 1T5EA 1NJIW 3KKYA 4KFMA 1W0KG 2P67A 3ICXA 3M8AA 4UCRA 2HFEC 2EX3A 4FVMA 4B7EA 1MA1A 1AJNA 4JYBA 3SR2C 4B3SO 2HKOA 2ZKOA 1K3EA 2MK3A 3U10A 5LHHA 1IBLB 4J80A 4X64O 4LWSB 4UXNA 1QLNA 4Z2WA 1GTOA 2OCCB 2OIEA 3RGBA 3SJAC 1NVPB 1K97A 2KG7A 3EFFK 4B3RB 1AB3A 3D36C 1BL8A 2FKXA 1GH6A 1FXKA 3WB2A 4WCEV 3G80A 3IAYA 4B7KA 1K33A 5LOVA 3K79A 3TCUA 3CCLV 5IY5B 3HKBB 4GX1A 2JGDA 5KAIZ 4UCSA 1XEQA 1EFRG 4FFBB 1I0HA 5IYZB 4DV2B 3SDLA 3K9SA 3MHSC 4R50A 4JI5B 3RYHB 1K92A 2ZT9B 1DGSA 5IE9A 1S76D 3K04A 3N2GA 1ZSPA 2B1IA 3B4SA 4X1KA 1N0NA 5B1BB 4X65O 4GYCB 2YI9A 1VQKV 3TXSA 1VQLV 3ZMUA 5BR8B 4PA4A 1AI6A 2EIKB 2UUCB 1QVFU 1Y6XA 5L3GA 2R9RB 1H2GA 3E8HA 2E74B 2F95B 4CZZA 4LP8A 4DR4B 3LNMB 5EZYA 3D36A 2EINB 3WB1A 2WA4A 3WG7C 2X6CA 3M99B 4LBEC 1R6NA 3FAVA 4WFBV 4JF3A 3JALA 2Q9LA 1TVKA 4G28B 3CXCU 2JJ1G 4O4IA 2M7WA 1WB8A 1K8AW 4U3FH 2R9AA 1DLBA 4LFBO 4YHHB 1IXBA 4ZI7A 2WLNA 3ASOC 3B8NA 3ZIAG 2CE4A 1NR7A 1GM7A 3OR6C 4O4HA 3AK2A 1ZTEA 2DMXA 2JJ2G 3AG4C 4MT8A 5JQGA 1NTZH 4DR7O 4NR1A 3SYOA 3JASA 2WLMA 1B04A 4RUEA 2AHYA 3E8GA 4X66O 5B1AC 4K0KO 1DF5A 1K5QA 5EBLC 4CH6A 1JFFA 2B9ZA 4EFEA 4XDJA 3ZMTA 1UJWB 2UXNA 2OCHA 5L3DA 5LA6B 1FPOA 3AK3A 1RPOA 2YI8A 2R72A 4DV3B 5DEDA 1N8RW 4LH7A 1Y74B 2HEPA 2EILB 3A0BZ 1JOYA 4JYCA 1QVGU 2ITDC 1M56B 1EM1A 4B3TO 4DV7O 2VQFB 5B66Z 2QKAA 4D7TA 3ZEDA 1WLEA 3D3IA 3M7MX 4TT3G 3SYPA 4JI7B 2DQ0A 4UB6Z 1K4CC 3CRQA 4W4KA 3FYIB 3HKCB 4JI1B 1BQZA 3T1YB 1HP8A 1XL4A 2BOCC 3AG1C 1N34B 2OYQA 2Y48A 4RQFA 5C93A 3K08A 2VS0A 4TUYA 5KAFZ 1IBKO 5CN0A 2HVKC 4DR3B 3ABMC 2WWWA 2YIBD 2YC0A 1G8MA 3S3WA 1R1BA 2WA3A 4YIOA 4DV0B 1YITV 4LWSA 1BQ0A 1RM1C 5K1PA 4DUZB 1AI5A 4QPKA 2Q0AA 3ASNC 4FMTA 5H2FZ 1Z2GA 1KB9F 2A0LA 1ZAUA 3ZRWB 4LFBB 1QQCA 2LW1A 1MG1A 4LC1A 2QTOA 5CBHA 4WFGA 4DR1O 1KMIZ 4E4EA 3TJTA 3OGIB 1S72V 1SZTA 2JDIG 1WNSA 2VQEO 5J2UA 2PUSA 4CBCA 1LUWA 1RPRA 2KSDA 4X8AA 2EZOA 1VP7A 2ADQB 4FFBA 5IYZA 3SYQA 1YJ9V 4UCVA 4JTAB 2HLDG 2QWRB 4OX9B 4DXWA 2Y4UA 1L1FA 5KHHA 3N2GB 3MD0A 2XOKG 1EZJA 3BEHA 3CRRA 1AROP 1BE3H 4QGPA 5B5EZ 2WLLA 3OTFA 5B1AB 2CAZC 1OCZB 3SPIA 2JEUA 5IYDO 4GX0A 4QPJA 4K8ZA 3UCSC 2FB5A 5CBGA 3ZMZA 4FJCC 4GX5A 3L74H 2VQFO 1PL0A 5EZYB 2X7RB 2FL4A 2HHHO 5EIBC 1Y67A 4LF4B 3CPWU 5FL7G 2K9PA 3JD0A 2L35A 1S77D 4IT5A 3CXHF 4LCUC 3B8MA 3CCVV 3T1YO 3JALB 1L0LH 5IY5C 1M9NA 1YHQV 4QIWF 2UUAO 4OPHA 4I5SA 3CWBH 3K5MA 1YTFD 4B3RO 3BABA 1NS1A 3CP1A 1OZ0A 3IC7A 1NTKH 4PHZA 1FS0G 2GBOA 4ZI7B 3OMAB 3I5DA 2HHHB 4B3MB 2K1EA 4WFHA 3ZHSA 2Y69B 3KG2A 2ZXWB 1NTMH 1SQGA 1ZWIC 1N33O 1XREA 1XHZA 2XT9A 4WFFA 3ABMB 1JFFB 1OCOB 3Q4HB 2F66C 4NXNB 4H0LB 1MABG 1VQ5V 3ML0A 4K0KB 1Q8IA 2YEVB 5LA6A 1VIBA 4DUZO 4YJ2A 4WF9V 1I5XA 2P4KA 1M1KW 4P9OA 1KYOF 1GKFA 4DR5O 3DSQA 1IVSA 2BTQB 2UUCO 2D3OW 2JK5C 2P7TC 2Y0PA 2RNBA 5LYJA 1LNQA 3K9AA 1CXZB 3A8TA 3BA8A 1L8DA 3VQXA 3EXAA 3L73H 3CCMV 1WAZA 2E3CA 1VQ9V 1I94O 2YSUB 1M4UA 4JI8B 3N27A 5AG2A 3SPHA 1FFXA 3HKCA 4GT1A 4UCOA 2DE0X 4JI3O 1EN5A 1XOUA 4FLUA 2WAMA 3JATA 4TUYB 4JI1O 1LUVA 1JMKC 4E2LA 4FLXA 4PDVA 4NXMO 4FM0A 1M57C 2IJHA 5LHIA 2P6JA 4KHPO 4LF5B 2W6JG 4MTXA 4DR2B 4EB6A 1FKAO 2P22C 2JEXA 1NH2D 1M5IA 2CTRA 3O65A 3QNEA 3ZRWA 2F43G 2A7WA 1KUQA 3WFVA 1HNZB 2N04A 4ZKIA 4JPRA 2V1DA 2ZQMA 1E79G 5J2UB 4DUYO 4DR1B 3LDCA 5IYBO 4TV8B 3IGAC 2NN4A 1EBOA 1V55B 2XAQA 3A2FA 4Q6GA 3ZX6A 2CTPA 1GN2A 3LDDA 3GWKC 3VQVA 2EBOA 4CS2A 4O2AA 4JYAO 2Q68A 1IXMA 1VMGA 1V54C 2DN9A 4O4JB 3SPJA 2ZXWC 4JAAA 4OGQB 5DN6G 2Z5UA 1GM8A 4LR3A 4DR3O 1YF2A 2WLLB 4JZ2A 1W0JG 4FK5C 3B40A 1AR5A 1I08A 4G2KA 2JIZG 2LP7A 3X2QC 5BMVB 3ASOB 3BY6A 4BW9A 1XHXA 2Q5ZA 3CHXA 1JA8A 4FLZA 1PP9H 3N2KB 1DTOA 2F4VB 4EEQA 4JYAB 1F4NA 1SKVA 1U96A 4DW1A 4JTCB 4DR7B 2H94A 5LMNB 1P4RA 2ILMA 4JI2O 4CH4A 1QLEC 4X65B 3L71H 3QVNA 3PN1A 5GTHZ 1VQ8V 1B3QA 3QO7A 2GV9A 4JAUA 4P2ZA 4X1IA 1Q43A 2PYJA 1XUQA 1WN7A 1US6A 2JGUA 4ABMA 5D5PA 3K03A 2ZE7A 1Q3EA 3WB0A 1GN3A 1R3JC 3LDEA 4FM1A 1Q7YW 1BS3A 4I55B 4BR6A 1VF6C 1V9PA 3OEEG 4HNAA 2LGWA 1ROPA 3SYAA 1I7FA 1YSCA 4EKWA 2PTMA 2ZIMA 3Q4HA 3JAKB 3ZBHA 3ETQA 3E89A 2YEVA 2YXLA
chains in the Genus database with same CATH topology
1PV0A 3D36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PV0 A;  3D36 C; 
#chains in the Genus database with same CATH topology
 3AG1 B;  5DM6 V;  5L3C A;  4YJ2 B;  2ATK C;  1GAX A;  4JI5 O;  4DR6 O;  3C3S A;  1JVM A;  2DW4 A;  1K73 W;  4W4L A;  2BTQ A;  1COW G;  1SET A;  2HJD A;  1VQ4 V;  4IYH A;  5LYJ B;  1BT8 A;  1H38 A;  3BPZ A;  3CX5 F;  1H2M A;  1E1R G;  3ASN B;  3HKD A;  1N32 B;  2KQX A;  2FML A;  3FB7 C;  1BCC H;  3FX7 A;  1P49 A;  1XNQ B;  4R8C A;  4I7Z B;  4DV5 O;  3UT5 B;  4TOI A;  5KHJ A;  4QJF B;  2RN9 A;  1FFX B;  2ETN A;  4XBF A;  3LSS A;  1AJQ A;  3CRA A;  3JAT B;  4CS3 A;  5GW7 A;  1HWY A;  3APO A;  4LF6 O;  5KUM A;  1YDX A;  2Q69 A;  1EN6 A;  1FJG O;  4PEL A;  1WP7 A;  4U7N A;  3ZRS A;  2A9H A;  3OTO O;  1KC8 W;  1IDS A;  2YUA A;  4EB6 B;  5LP6 B;  2NLJ C;  1GMG A;  1FYJ A;  3JSL A;  2Q7G A;  3STZ C;  2A79 B;  1RFY A;  2RCV A;  3G67 A;  3LUT B;  2PY5 A;  4MVZ A;  4L8J A;  1V54 B;  2F4V O;  3QO5 A;  1SZX A;  4YIP A;  1ORQ C;  3CC4 V;  1O9H A;  1JR9 A;  4CC5 A;  1NVP D;  3ZHU A;  1JPX A;  3G6B A;  4F6R A;  1IUR A;  1QLE B;  4WFA V;  5KX5 B;  2YIC A;  2CK3 G;  4TV8 A;  3X2Q B;  3H1K H;  3OTO B;  3G4S V;  3UKM A;  4DUY B;  2UXX A;  2CTW A;  3ZJZ A;  3SJC C;  2ZIO A;  4O2A B;  3JD4 A;  1WJZ A;  2KKW A;  4LF4 O;  2ZNJ A;  4O4J A;  2Q67 A;  3WG7 B;  3B09 A;  3FB6 C;  1RP3 B;  4MS2 A;  2N74 A;  2PI4 A;  4LF9 O;  4X89 A;  2DQ3 A;  3F5T A;  1SS3 A;  1UFI A;  1PM9 A;  5BMV A;  2CGO A;  1YTF B;  1J5E O;  1OCC C;  3N2K A;  2UUB O;  1ZLZ A;  4ZHQ A;  5KHI A;  2QWP B;  4TQD A;  4AI8 A;  5JJJ B;  4NXM B;  4TQF A;  5LHG A;  2FYU H;  3W7W A;  1N33 B;  5E79 Z;  2DYR C;  3ABL B;  4MTF A;  3K58 A;  4PA3 A;  4X64 B;  3H1I H;  4HAM A;  2XND G;  2XAF A;  1VF5 B;  3SPC A;  4YHH O;  3S3X A;  3ZHQ A;  5K1X A;  3P30 A;  4LF6 B;  1XL6 A;  4X1I B;  3ZS8 C;  1WA8 A;  3K0D A;  5B3S C;  2YXH A;  4FZ0 A;  1AI7 A;  2BE3 A;  5BZB A;  2GUZ A;  4H13 B;  2KB1 A;  4H33 A;  1PPJ H;  2CH7 A;  1NR1 A;  5EYP A;  4I55 A;  1Z5W A;  2EIK C;  4ZOL A;  2XTA A;  2EJ7 A;  2Q0O C;  1K4D C;  1SRY A;  5L3E A;  4HNA B;  3CRM A;  1F7Y A;  1H2L A;  2XAJ A;  2DYS C;  2ZR2 A;  3RWR D;  3L75 H;  2HG5 C;  3AG3 C;  4Q20 A;  4J7J A;  4YY3 O;  1B06 A;  2X6A A;  3JAK A;  4YJ3 A;  1JJ2 U;  3K5L A;  4O2B B;  1WB7 A;  3CC2 V;  5D5Q A;  4GZR B;  2X0L A;  3CYO A;  3GVM A;  4B3T B;  2E5L O;  1L0N H;  3MDS A;  3QF7 A;  4Z1M G;  5CMU A;  3B2E E;  4FPP A;  2EIM C;  4GKJ O;  1VQM V;  1JJO A;  3RYI B;  2IW5 A;  4LFA O;  2EJR A;  3FB8 C;  3BHP A;  2PZS A;  3JD3 A;  2QEX V;  3HKD B;  4HBN A;  3CS5 A;  1SC5 B;  1M93 A;  3EHB B;  3UT5 A;  5FPO A;  1EN4 A;  1HNX B;  4MW3 A;  2QWQ B;  4QE9 A;  3SGI A;  5JCO C;  1Y4M A;  4MW8 A;  4JI6 B;  4KL1 A;  1URF A;  2L6L A;  4UV8 A;  3T1H O;  1XBL A;  1K34 A;  1V55 C;  4BIZ A;  5L3B A;  3K57 A;  2WLH A;  5IDJ A;  4DV6 B;  3HKE B;  1SQV H;  1S5L Z;  1OCR B;  4RQE A;  2Q8V A;  3JYC A;  5LP6 A;  1CEZ A;  3VQW A;  4FLV A;  2XAH A;  5HFM A;  1MOF A;  3D8C A;  3J81 N;  3L9D A;  4X88 A;  3O9O A;  4XDL A;  3UO2 A;  3JCU Z;  1PNK A;  4JI4 O;  3ETG A;  4G27 B;  4AHC A;  3ABU A;  1XNR B;  2JS3 A;  3DC6 A;  4BWA A;  1SA0 A;  4F6R B;  4DV7 B;  1OCZ C;  5KX5 A;  2OIG A;  2EZP A;  1NI8 A;  4UVB A;  3R65 A;  3BAA A;  1OHH G;  2EIN C;  3LSU A;  4LF7 B;  5CBF A;  1MNG A;  3GB7 C;  1VF7 A;  1VQ7 V;  3U0Z A;  1AIL A;  4LFC B;  1KBH A;  4LNU B;  5JCO A;  3F7Y C;  3W7S A;  4ASU G;  1ENV A;  1THZ A;  3CJH A;  1H2N A;  5ITZ A;  3I55 V;  3SPG A;  4CH5 A;  4NKG B;  1G1X B;  2QJ1 A;  3H01 A;  4IGG A;  1GK9 A;  3OM3 B;  2ZDI A;  3IJ4 A;  5KMG A;  1M90 W;  1KU9 A;  2CGN A;  2IU3 A;  2Y0I A;  5LP6 C;  1QHT A;  2AGA A;  4UFZ A;  1KKD A;  5CA1 A;  1R6K A;  1X4T A;  3DC5 A;  5CB4 B;  1TAE A;  3J80 N;  4MVM A;  3E35 A;  4H37 A;  4ZHQ B;  1BGY H;  1J5E B;  4TWK A;  5LGU A;  4DK0 A;  1DK1 A;  2LFS A;  2IBZ H;  1VAR A;  1VF6 A;  3OAA G;  4KUM A;  2EIM B;  4IL6 Z;  2W6I G;  3CME V;  4DV0 O;  1Q6H A;  1SER A;  1QCE A;  4QNH B;  1TUB B;  1PNL A;  1WA8 B;  4QE7 A;  1KD1 W;  1K5S A;  1Y66 A;  1I5Y A;  2GUZ B;  1IBL O;  1GN4 A;  1B6Q A;  4DV3 O;  1O9G A;  1VQP V;  2WLK A;  1S5H C;  2M6Y A;  4BIO A;  1KP3 A;  1NBM G;  2CH7 B;  5EYP B;  1FFT B;  5GTI Z;  4ZOL B;  4IYI A;  1IZ3 A;  4J41 A;  3H1L H;  2R70 A;  4DO2 A;  3JCZ A;  3CCQ V;  3ZMV A;  4I50 B;  3E83 A;  4RUF A;  4YJ3 B;  2EUL A;  2O57 A;  4O2B A;  3OW2 U;  2DJV A;  1F23 A;  2EIJ B;  4DR5 B;  5EIB D;  4I9Q A;  1GM9 A;  4LF7 O;  4LF9 B;  1E1Q G;  4I4T A;  1FAF A;  1SQF A;  2DYR B;  2RJZ A;  1FJG B;  2MW2 B;  2UXC B;  2DWE C;  4GUN A;  4X66 B;  3RYI A;  3ABT A;  4PI2 A;  1M57 B;  2UXD O;  2LFR A;  4JI0 B;  1A32 A;  5A2Q N;  3HR0 A;  3BA9 A;  4GLX A;  3T4D A;  1NQT A;  4B3M O;  1QR9 A;  2BSK B;  3JAM N;  3J7A U;  3STL C;  2NR5 A;  3QO8 A;  2YIB A;  1KQS U;  2UU9 O;  3W7T A;  3WU2 Z;  3T2M A;  4TSF G;  3TET A;  1ZL8 A;  2YDE A;  2UXB O;  3BRC A;  4CC6 A;  4J7K A;  2QWO B;  3B77 A;  4ZBM A;  3AG3 B;  1JX9 A;  2EIL C;  3HKE A;  4MVS A;  3OFN G;  2P90 A;  1CPY A;  3ZRX A;  3CEI A;  5BXZ A;  2QWN B;  2XAS A;  4OX9 O;  1HNZ O;  2IH1 C;  4TV9 A;  4KXR A;  4LF8 B;  3MHH C;  1D2D A;  5H6R A;  3RVZ A;  2QM7 A;  2CUG A;  1GRJ A;  2ZE8 A;  1MZF A;  5IWA B;  4PDL A;  3RYF A;  1NH2 B;  1Q81 W;  1SA0 B;  4DV2 O;  2QKS A;  4IIJ B;  3DTU B;  2QE7 G;  2GTA A;  4UB8 Z;  2E76 B;  1OCC B;  3ZRV A;  2V4D A;  4MTG A;  4X62 O;  1GO3 F;  1OV9 A;  1AI4 A;  1WPX A;  3UQ8 A;  2YXY A;  2Q7H A;  4LNU A;  3K0G A;  4PDR A;  5KA6 A;  1SQX H;  3SYC A;  2QTS A;  5BR8 O;  1N4C A;  4K8X A;  1HR0 O;  2JRI A;  2VWK A;  2ZE5 A;  3CJH B;  5FPR A;  1BZK A;  5CA0 A;  1HW7 A;  3ZHT A;  5ITZ B;  3PJS K;  5B3S B;  3MAQ A;  3P3P A;  2Z0A A;  5FNV B;  3TGU H;  3IC9 A;  1D5N A;  3ZHV A;  2ZE6 A;  5A9G A;  4JZG A;  5KMG B;  5B1O A;  4JI8 O;  1R3L C;  2AW9 A;  3A0H Z;  1XMO O;  2XUM A;  2AHZ A;  2Q7E A;  2YIA A;  3QTC A;  5CA1 B;  1F4M A;  5CB4 A;  3CC7 V;  3OEH G;  4YXW G;  2GHY A;  1OJH A;  3NXS A;  2PYL A;  4HZ3 A;  4JGS A;  5KUK A;  5J2T B;  4DV5 B;  2DYS B;  3E2E A;  2ZD9 A;  4AQY O;  1HDJ A;  4I0X B;  4UCT A;  4U3J B;  2GTS A;  2DOS A;  3RT3 C;  3H1H H;  1MZE A;  4I9W A;  1TUB A;  1PKX A;  1XI1 A;  1PNM A;  2HP8 A;  2C2A A;  2XAG A;  2RMK B;  3AK1 A;  2QGN A;  5DEC A;  2Q73 A;  5IYC O;  2UUB B;  2QA4 V;  1S5J A;  2P4V A;  2B5U A;  3AEI A;  4GCZ A;  3SJQ C;  1BHA A;  4WBN B;  3RYC A;  2ZR3 A;  4OPA A;  1P7B A;  1WPB A;  3T4Z A;  3G6E V;  3E8F A;  4I50 A;  4UUJ C;  2ZM6 B;  3FB5 C;  1MSD A;  2RDC A;  4FM2 A;  2D2C B;  1AR4 A;  3ZCC A;  4RWU A;  1FD9 A;  1XMQ B;  2A3Q A;  1K9M W;  3AG4 B;  4I4T B;  2WLI A;  5KLV H;  3T1H B;  3W7X A;  3RN4 A;  1G6U A;  3KZI Z;  1Q6I A;  1HNW O;  5F2V O;  1NZ6 A;  3ZN1 A;  1YVW A;  4L87 A;  1Q5O A;  1N36 O;  1R6T A;  1SF9 A;  2BTO A;  1ZUQ A;  3JAR B;  1VQO V;  1Q6U A;  1G4Y B;  1JCH A;  4FIP C;  1QNM A;  1AJP A;  5JJN B;  4JTD B;  3BVO A;  4JI0 O;  2BSK A;  4GX2 A;  5EC2 C;  1TGO A;  4UVC A;  1CP9 A;  4EFB A;  2ADP A;  2AZ2 A;  1ZL8 B;  1XDC A;  2QKC A;  2IJJ A;  4U7O A;  4NVP A;  5C8Y B;  2WPD G;  1AP6 A;  1P84 F;  1LR1 A;  2UXB B;  4XDK A;  1AVM A;  1VEW A;  1I94 B;  5IWA O;  1EZV H;  4TV9 B;  4J9Z B;  3RBZ A;  1QU7 A;  1M56 C;  4DR6 B;  2LGQ A;  3VBB A;  1W59 A;  4NTW A;  5KHG A;  1U97 A;  3RYF B;  3ZMS A;  3C3T A;  4NB5 A;  3L70 H;  2BCC H;  2LO1 A;  4IIJ A;  4A5U B;  1R73 A;  1R3K C;  2ZDI C;  1KKC A;  5EC1 C;  4DW0 A;  4FZ1 A;  1X59 A;  4DV1 B;  3OD4 A;  2QR4 A;  3L72 H;  1IBM O;  3P3N A;  3RW0 A;  1PD3 A;  4NXN O;  3RFR A;  3H1J H;  2IM9 A;  4BIU A;  2H3O A;  3TXQ A;  2P06 A;  2UXC O;  4PV1 B;  3FYE B;  4GKK B;  2ITC C;  4X20 B;  4PA7 A;  4B08 A;  2H8P C;  2OT5 A;  2UXD B;  5CA0 B;  4JI2 B;  2LJ2 A;  3ETE A;  2Y69 C;  2HVJ C;  5FNV A;  3U11 A;  3GWO A;  4N21 A;  4UCU A;  3K5N A;  4J7Z A;  3FFQ A;  3AG2 B;  3R66 A;  3ZHR A;  1Y76 A;  3OR7 C;  4D7S A;  1YJW V;  2OTJ V;  5J2T A;  2A06 H;  2UUA B;  1NU1 H;  1SQQ H;  3BCC H;  3K3W A;  3ABK C;  3KCY A;  5J9P C;  5IJ9 B;  2E5L B;  3CSX A;  4I0X A;  4U3J A;  5IJ0 A;  3CRC A;  4JI3 B;  2F93 B;  2DWD C;  2AZ0 A;  2AXT Z;  1YCI A;  2CTQ A;  2F1M A;  3APQ A;  4DV4 O;  3NR7 A;  5BY1 A;  4DV6 O;  2W0X A;  4J42 A;  4O4L B;  2OTL V;  2OWO A;  1TUE B;  5IT9 N;  5E1A C;  2PF4 E;  3OE7 G;  5JVD A;  4JI6 O;  1WP8 A;  1Z5V A;  1VQ6 V;  2Y4T A;  3E22 A;  2WLJ A;  1RSO A;  4X1Y A;  3E8B A;  4WBN A;  3CCU V;  3RYC B;  1ZX3 A;  4ICG A;  4X62 B;  2JS5 A;  3QG5 A;  2Q6A A;  2GSM B;  5GON B;  3KCX A;  4MSW C;  5LMU B;  4P9P A;  1JQ0 A;  1J95 A;  3FKS G;  2QM4 A;  1XMO B;  1Q86 W;  1MMM A;  1BHB A;  4LF5 O;  4JV5 B;  3ETD A;  4FLY A;  1GN6 A;  3VOU A;  5LXT B;  4NTX A;  3DXR B;  1IX9 A;  4WFE A;  5JJE B;  4LH6 A;  1YI2 V;  2N05 A;  3JAW B;  5HFL A;  4D6T H;  5EBW C;  2WLI B;  4CS4 A;  1PV0 A;  4IHJ B;  2IU0 A;  5L3F A;  2P5O A;  1MSW D;  4MVO A;  4PA9 A;  2ODM A;  4R7C A;  2B1G A;  3FD9 A;  4DRX B;  2ZNI A;  5LMU O;  4H44 B;  1FXV A;  3JAR A;  4JAS A;  2FTK A;  4F6E A;  1R3I C;  4JV5 O;  4PI0 A;  1SQB H;  4J10 A;  1S0V A;  4FFK A;  2CDY A;  3W7U A;  5JH7 A;  4FLT A;  4MTO A;  2RQ6 A;  4HYO A;  2VRZ A;  1YJN V;  2IJK A;  3CCR V;  3VQY A;  4RAI A;  1OCO C;  4MVU A;  5H5N A;  2LW7 A;  3HPL C;  1XIL A;  2HR3 A;  2YID A;  4MVQ A;  2VQE B;  4Z1V A;  1KEC A;  5C8Y A;  4PJ0 Z;  3CCE V;  3SJB C;  3AG2 C;  3CCJ V;  4JI7 O;  1FXH A;  4KP4 A;  3EVK A;  2KG7 B;  3K5O A;  1W2B U;  1H2S B;  1FXK B;  1Q90 D;  5EBM C;  3A0R A;  1XQ8 A;  3ABK B;  2UU9 B;  1HNW B;  5LOV B;  3H9V A;  3K06 A;  3HKB A;  2PI5 A;  4LFA B;  1YXB A;  5LL6 Y;  2JGD B;  1XNR O;  4UVA A;  5FLX N;  1K7D A;  4NYK A;  3DGE A;  3JD2 A;  2IH3 C;  3ZN0 A;  2QDO A;  4JYY A;  3AG7 A;  4RO2 A;  3RYH A;  1HNX O;  1BSM A;  2VWJ A;  4LF8 O;  4R6Z A;  4GKJ B;  1RM1 B;  2PGG A;  4X20 A;  2ARH A;  2R9I A;  4X1K B;  2G38 A;  4LFC O;  4DK1 A;  1DF4 A;  1QR8 A;  2HJF C;  5LGN A;  1H8E G;  2X6B A;  3OUS A;  3D3Q A;  1H2K A;  3OMI B;  1YZB A;  1NKD A;  1NT2 B;  4X9Q A;  4CH3 A;  4MVR A;  2OCC C;  5CA3 A;  1AP5 A;  1Y76 B;  3JD1 A;  3UM7 A;  5JWP A;  3K59 A;  4FLW A;  3OT7 A;  4J9Y B;  4K3A A;  4JI4 B;  3LNN A;  1N0J A;  2IJI A;  1SQP H;  3C90 A;  3CD6 V;  5IJ9 A;  3JSN A;  5B1B C;  3FAV B;  4KHP B;  3IFX A;  5IJ0 B;  1TVK B;  1N34 O;  3G71 V;  1F51 A;  4PD4 F;  4K35 A;  2QSA A;  5B1N A;  3CE2 A;  4O4I B;  3E86 A;  2BOB C;  5LBQ A;  3P32 A;  1N32 O;  3F7V C;  2W0F C;  4F4L A;  2JVD A;  1IBM B;  1XNQ O;  2EIJ C;  2XHB A;  4DYL A;  4J11 A;  2QM8 A;  4O4L A;  4P30 A;  1YEW A;  1XMQ O;  3HB3 B;  2ZCE A;  2NNU A;  4O4H B;  5JVD B;  3CMA V;  5JQG B;  4DV4 B;  4AIL C;  2V7Q G;  3OUF A;  1KP2 A;  4PA6 A;  3E22 B;  4AQY B;  2YS8 A;  1RSO B;  3JAS B;  4X1Y B;  1BMF G;  4DV1 O;  1D5A A;  1Q82 W;  5H6Q A;  5GON A;  2F23 A;  4BAY A;  1N36 B;  1VQN V;  1QBZ A;  4PDM A;  5KA5 A;  3ABL C;  3LSQ A;  2GDS A;  4DR4 O;  3THO A;  1YIJ V;  4GKK O;  2WSS G;  5LXT A;  3I56 V;  3OGC C;  3F5W C;  4N23 A;  3DXR A;  4OXS A;  4C7U A;  1H8H G;  3OMN B;  1SES A;  4ZIB A;  1FXK C;  3RVY A;  3TK1 A;  5TIS Z;  3JAW A;  5LGT A;  5LMN O;  1Y74 A;  1PL4 A;  1S3J A;  5H9C A;  4B3S B;  2E75 B;  1OCR C;  1TA8 A;  4IHJ A;  2Q4P A;  3CCS V;  3CB2 A;  3T1C A;  3UO3 A;  1AR1 B;  1HR0 B;  4DRX A;  4YY3 B;  4NTY A;  4DR2 O;  4BW5 A;  1P7G A;  2ZIN A;  1UPG A;  2LQT A;  5KHK A;  2Z3Y A;  2ZM6 O;  5EK0 A;  5JH7 B;  3BFR A;  4UV9 A;  1IBK B;  4JAV A;  1T5E A;  1NJI W;  3KKY A;  4KFM A;  1W0K G;  2P67 A;  3ICX A;  3M8A A;  4UCR A;  2HFE C;  2EX3 A;  4FVM A;  4B7E A;  1MA1 A;  1AJN A;  4JYB A;  3SR2 C;  4B3S O;  2HKO A;  2ZKO A;  1K3E A;  2MK3 A;  3U10 A;  5LHH A;  1IBL B;  4J80 A;  4X64 O;  4LWS B;  4UXN A;  1QLN A;  4Z2W A;  1GTO A;  2OCC B;  2OIE A;  3RGB A;  3SJA C;  1NVP B;  1K97 A;  2KG7 A;  3EFF K;  4B3R B;  1AB3 A;  3D36 C;  1BL8 A;  2FKX A;  1GH6 A;  1FXK A;  3WB2 A;  4WCE V;  3G80 A;  3IAY A;  4B7K A;  1K33 A;  5LOV A;  3K79 A;  3TCU A;  3CCL V;  5IY5 B;  3HKB B;  4GX1 A;  2JGD A;  5KAI Z;  4UCS A;  1XEQ A;  1EFR G;  4FFB B;  1I0H A;  5IYZ B;  4DV2 B;  3SDL A;  3K9S A;  3MHS C;  4R50 A;  4JI5 B;  3RYH B;  1K92 A;  2ZT9 B;  1DGS A;  5IE9 A;  1S76 D;  3K04 A;  3N2G A;  1ZSP A;  2B1I A;  3B4S A;  4X1K A;  1N0N A;  5B1B B;  4X65 O;  4GYC B;  2YI9 A;  1VQK V;  3TXS A;  1VQL V;  3ZMU A;  5BR8 B;  4PA4 A;  1AI6 A;  2EIK B;  2UUC B;  1QVF U;  1Y6X A;  5L3G A;  2R9R B;  1H2G A;  3E8H A;  2E74 B;  2F95 B;  4CZZ A;  4LP8 A;  4DR4 B;  3LNM B;  5EZY A;  3D36 A;  2EIN B;  3WB1 A;  2WA4 A;  3WG7 C;  2X6C A;  3M99 B;  4LBE C;  1R6N A;  3FAV A;  4WFB V;  4JF3 A;  3JAL A;  2Q9L A;  1TVK A;  4G28 B;  3CXC U;  2JJ1 G;  4O4I A;  2M7W A;  1WB8 A;  1K8A W;  4U3F H;  2R9A A;  1DLB A;  4LFB O;  4YHH B;  1IXB A;  4ZI7 A;  2WLN A;  3ASO C;  3B8N A;  3ZIA G;  2CE4 A;  1NR7 A;  1GM7 A;  3OR6 C;  4O4H A;  3AK2 A;  1ZTE A;  2DMX A;  2JJ2 G;  3AG4 C;  4MT8 A;  5JQG A;  1NTZ H;  4DR7 O;  4NR1 A;  3SYO A;  3JAS A;  2WLM A;  1B04 A;  4RUE A;  2AHY A;  3E8G A;  4X66 O;  5B1A C;  4K0K O;  1DF5 A;  1K5Q A;  5EBL C;  4CH6 A;  1JFF A;  2B9Z A;  4EFE A;  4XDJ A;  3ZMT A;  1UJW B;  2UXN A;  2OCH A;  5L3D A;  5LA6 B;  1FPO A;  3AK3 A;  1RPO A;  2YI8 A;  2R72 A;  4DV3 B;  5DED A;  1N8R W;  4LH7 A;  1Y74 B;  2HEP A;  2EIL B;  3A0B Z;  1JOY A;  4JYC A;  1QVG U;  2ITD C;  1M56 B;  1EM1 A;  4B3T O;  4DV7 O;  2VQF B;  5B66 Z;  2QKA A;  4D7T A;  3ZED A;  1WLE A;  3D3I A;  3M7M X;  4TT3 G;  3SYP A;  4JI7 B;  2DQ0 A;  4UB6 Z;  1K4C C;  3CRQ A;  4W4K A;  3FYI B;  3HKC B;  4JI1 B;  1BQZ A;  3T1Y B;  1HP8 A;  1XL4 A;  2BOC C;  3AG1 C;  1N34 B;  2OYQ A;  2Y48 A;  4RQF A;  5C93 A;  3K08 A;  2VS0 A;  4TUY A;  5KAF Z;  1IBK O;  5CN0 A;  2HVK C;  4DR3 B;  3ABM C;  2WWW A;  2YIB D;  2YC0 A;  1G8M A;  3S3W A;  1R1B A;  2WA3 A;  4YIO A;  4DV0 B;  1YIT V;  4LWS A;  1BQ0 A;  1RM1 C;  5K1P A;  4DUZ B;  1AI5 A;  4QPK A;  2Q0A A;  3ASN C;  4FMT A;  5H2F Z;  1Z2G A;  1KB9 F;  2A0L A;  1ZAU A;  3ZRW B;  4LFB B;  1QQC A;  2LW1 A;  1MG1 A;  4LC1 A;  2QTO A;  5CBH A;  4WFG A;  4DR1 O;  1KMI Z;  4E4E A;  3TJT A;  3OGI B;  1S72 V;  1SZT A;  2JDI G;  1WNS A;  2VQE O;  5J2U A;  2PUS A;  4CBC A;  1LUW A;  1RPR A;  2KSD A;  4X8A A;  2EZO A;  1VP7 A;  2ADQ B;  4FFB A;  5IYZ A;  3SYQ A;  1YJ9 V;  4UCV A;  4JTA B;  2HLD G;  2QWR B;  4OX9 B;  4DXW A;  2Y4U A;  1L1F A;  5KHH A;  3N2G B;  3MD0 A;  2XOK G;  1EZJ A;  3BEH A;  3CRR A;  1ARO P;  1BE3 H;  4QGP A;  5B5E Z;  2WLL A;  3OTF A;  5B1A B;  2CAZ C;  1OCZ B;  3SPI A;  2JEU A;  5IYD O;  4GX0 A;  4QPJ A;  4K8Z A;  3UCS C;  2FB5 A;  5CBG A;  3ZMZ A;  4FJC C;  4GX5 A;  3L74 H;  2VQF O;  1PL0 A;  5EZY B;  2X7R B;  2FL4 A;  2HHH O;  5EIB C;  1Y67 A;  4LF4 B;  3CPW U;  5FL7 G;  2K9P A;  3JD0 A;  2L35 A;  1S77 D;  4IT5 A;  3CXH F;  4LCU C;  3B8M A;  3CCV V;  3T1Y O;  3JAL B;  1L0L H;  5IY5 C;  1M9N A;  1YHQ V;  4QIW F;  2UUA O;  4OPH A;  4I5S A;  3CWB H;  3K5M A;  1YTF D;  4B3R O;  3BAB A;  1NS1 A;  3CP1 A;  1OZ0 A;  3IC7 A;  1NTK H;  4PHZ A;  1FS0 G;  2GBO A;  4ZI7 B;  3OMA B;  3I5D A;  2HHH B;  4B3M B;  2K1E A;  4WFH A;  3ZHS A;  2Y69 B;  3KG2 A;  2ZXW B;  1NTM H;  1SQG A;  1ZWI C;  1N33 O;  1XRE A;  1XHZ A;  2XT9 A;  4WFF A;  3ABM B;  1JFF B;  1OCO B;  3Q4H B;  2F66 C;  4NXN B;  4H0L B;  1MAB G;  1VQ5 V;  3ML0 A;  4K0K B;  1Q8I A;  2YEV B;  5LA6 A;  1VIB A;  4DUZ O;  4YJ2 A;  4WF9 V;  1I5X A;  2P4K A;  1M1K W;  4P9O A;  1KYO F;  1GKF A;  4DR5 O;  3DSQ A;  1IVS A;  2BTQ B;  2UUC O;  2D3O W;  2JK5 C;  2P7T C;  2Y0P A;  2RNB A;  5LYJ A;  1LNQ A;  3K9A A;  1CXZ B;  3A8T A;  3BA8 A;  1L8D A;  3VQX A;  3EXA A;  3L73 H;  3CCM V;  1WAZ A;  2E3C A;  1VQ9 V;  1I94 O;  2YSU B;  1M4U A;  4JI8 B;  3N27 A;  5AG2 A;  3SPH A;  1FFX A;  3HKC A;  4GT1 A;  4UCO A;  2DE0 X;  4JI3 O;  1EN5 A;  1XOU A;  4FLU A;  2WAM A;  3JAT A;  4TUY B;  4JI1 O;  1LUV A;  1JMK C;  4E2L A;  4FLX A;  4PDV A;  4NXM O;  4FM0 A;  1M57 C;  2IJH A;  5LHI A;  2P6J A;  4KHP O;  4LF5 B;  2W6J G;  4MTX A;  4DR2 B;  4EB6 A;  1FKA O;  2P22 C;  2JEX A;  1NH2 D;  1M5I A;  2CTR A;  3O65 A;  3QNE A;  3ZRW A;  2F43 G;  2A7W A;  1KUQ A;  3WFV A;  1HNZ B;  2N04 A;  4ZKI A;  4JPR A;  2V1D A;  2ZQM A;  1E79 G;  5J2U B;  4DUY O;  4DR1 B;  3LDC A;  5IYB O;  4TV8 B;  3IGA C;  2NN4 A;  1EBO A;  1V55 B;  2XAQ A;  3A2F A;  4Q6G A;  3ZX6 A;  2CTP A;  1GN2 A;  3LDD A;  3GWK C;  3VQV A;  2EBO A;  4CS2 A;  4O2A A;  4JYA O;  2Q68 A;  1IXM A;  1VMG A;  1V54 C;  2DN9 A;  4O4J B;  3SPJ A;  2ZXW C;  4JAA A;  4OGQ B;  5DN6 G;  2Z5U A;  1GM8 A;  4LR3 A;  4DR3 O;  1YF2 A;  2WLL B;  4JZ2 A;  1W0J G;  4FK5 C;  3B40 A;  1AR5 A;  1I08 A;  4G2K A;  2JIZ G;  2LP7 A;  3X2Q C;  5BMV B;  3ASO B;  3BY6 A;  4BW9 A;  1XHX A;  2Q5Z A;  3CHX A;  1JA8 A;  4FLZ A;  1PP9 H;  3N2K B;  1DTO A;  2F4V B;  4EEQ A;  4JYA B;  1F4N A;  1SKV A;  1U96 A;  4DW1 A;  4JTC B;  4DR7 B;  2H94 A;  5LMN B;  1P4R A;  2ILM A;  4JI2 O;  4CH4 A;  1QLE C;  4X65 B;  3L71 H;  3QVN A;  3PN1 A;  5GTH Z;  1VQ8 V;  1B3Q A;  3QO7 A;  2GV9 A;  4JAU A;  4P2Z A;  4X1I A;  1Q43 A;  2PYJ A;  1XUQ A;  1WN7 A;  1US6 A;  2JGU A;  4ABM A;  5D5P A;  3K03 A;  2ZE7 A;  1Q3E A;  3WB0 A;  1GN3 A;  1R3J C;  3LDE A;  4FM1 A;  1Q7Y W;  1BS3 A;  4I55 B;  4BR6 A;  1VF6 C;  1V9P A;  3OEE G;  4HNA A;  2LGW A;  1ROP A;  3SYA A;  1I7F A;  1YSC A;  4EKW A;  2PTM A;  2ZIM A;  3Q4H A;  3JAK B;  3ZBH A;  3ETQ A;  3E89 A;  2YEV A;  2YXL A; 
#chains in the Genus database with same CATH homology
 1PV0 A;  3D36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...