3D36C

How to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
42
structure length
42
Chain Sequence
MKHLSDELLIESYFKAKELNLSPEFIELIEKEIQRRSLTHKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation kinase B
publication title How to switch off a histidine kinase: crystal structure of Geobacillus stearothermophilus KinB with the inhibitor Sda
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/transferase inhibitor
total genus 17
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2008-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1100 Mainly Alpha Orthogonal Bundle Helix Hairpins Sporulation inhibitor A 3d36C01
3D36C 1PV0A
chains in the Genus database with same CATH superfamily
3CHXA 3AK1A 3FB8C 2X6BA 1XMQO 1Q6UA 4P9PA 5KHKA 3WB0A 4JYCA 3JAWA 2JK5C 1GMGA 2VS0A 3ZCCA 4G2KA 2WLMA 2UUCB 4JI8O 1GM7A 1I94O 1VEWA 4ZOLB 1NU1H 1P4RA 2YIBA 1KB9F 3D3QA 2PI5A 3VQXA 2Q69A 1D5NA 4JYBA 1VF6A 3GWOA 5LMNO 1LUVA 3H1HH 2UXCO 4RQFA 1OCCB 4TWKA 4B7KA 2FMLA 1AP5A 1GO3F 2XAFA 3JALA 3SPIA 3F5TA 2XT9A 2AZ0A 3E89A 2P7TC 4WBNA 2DJVA 3AG4B 2ATKC 4MS2A 1PM9A 4X89A 2QTSA 3T1YO 2NLJC 1KYOF 4I7ZB 3IFXA 2YICA 4JAVA 3TXSA 3JASA 4LFBB 1HP8A 5CBHA 4AHCA 2YSUB 2ZD9A 4X1IB 1FXVA 2E5LB 3STZC 4CS3A 4OPAA 1PKXA 4U7NA 5KHJA 4I5SA 4X1YA 2BSKA 3RYIB 2QDOA 3O9OA 4YJ2A 1L1FA 4MTFA 4I0XA 2ZINA 1BS3A 4FFKA 3MAQA 2OT5A 1Q82W 4B7EA 3B2EE 3M7MX 3OE7G 5IYCO 1SETA 2CGNA 4LH7A 1N36O 1SRYA 1FFXA 1R6KA 1AI4A 4NYKA 4HZ3A 1FD9A 3B4SA 4U7OA 1IBLO 2YC0A 1XREA 4D6TH 5LYJB 3JAMN 4DW1A 4BR6A 2YEVB 3FB6C 1LUWA 4CZZA 4R7CA 4OXSA 1Z2GA 1VQLV 1XI1A 5EBLC 1TVKA 1V55C 1S5LZ 2JGDA 4B08A 5IYZB 1OCOB 5B1AB 1WB8A 1N34O 4NTXA 3KCYA 4QE9A 1IDSA 1S5JA 4LF9B 3JAKA 3SJCC 2EILC 4FM0A 3VQYA 1WP7A 2A0LA 3ZRXA 5BR8B 1MNGA 4DV0O 4RQEA 3KCXA 4H33A 1SA0A 4IYIA 1WPXA 2UUBO 1BCCH 1R6TA 5CB4A 2L6LA 2EIKC 1TGOA 2DOSA 2Q67A 5IJ0B 4PELA 3DGEA 4DR5B 5L3FA 4K3AA 4JV5O 1H2LA 1YZBA 4I55B 3JSLA 1CP9A 3SJQC 4AILC 4RAIA 2QGNA 3QNEA 3H1LH 1S3JA 1GN4A 4EB6B 3CCQV 1FXHA 4JZGA 1MOFA 2EINB 4DV4O 1YIJV 1EFRG 4ZI7A 2P6JA 3Q4HA 4U3FH 3SYCA 2P4KA 2OCCC 4GKKO 1SQQH 1GN3A 2NR5A 2RCVA 3ABUA 4FZ1A 4QPJA 3AG2C 4F6RA 3ZRWB 1M57B 1QLEC 1UPGA 4PDMA 3CSXA 2HVJC 3CMAV 2AW9A 1RPRA 2D3OW 3IAYA 1I5XA 1OCCC 3I56V 4N21A 1WJZA 5C8YB 4PA9A 4LNUB 2YXLA 4JI4B 4JI1B 1Z5WA 3AG4C 1AR4A 4UCSA 1NKDA 2E76B 3LUTB 2F43G 1PP9H 4MT8A 3JYCA 3U11A 1DTOA 1S5HC 4YY3B 2UXXA 5LHHA 3ZHRA 4LF5B 4AQYO 2WLIB 1EN5A 1UFIA 5FNVB 1NR1A 4H44B 3W7TA 3ZJZA 5LA6A 4WFAV 5BMVA 1YJ9V 2QM7A 2N74A 2Q7HA 1B3QA 3RYHA 2OCHA 1VF5B 4O4LB 2QE7G 2CH7A 2DQ3A 4NKGB 1ZAUA 3RBZA 2CTWA 3K04A 1FJGB 3UT5A 2HJDA 4B3TB 1AILA 3L74H 2EULA 4XDLA 4LF6B 3CCLV 5F2VO 4B3SO 2FB5A 5IYBO 4I50B 3SGIA 2GTSA 4DR1O 4JI0O 4Q6GA 4NXMB 2UU9B 2Q0OC 2PY5A 3R65A 3AG3C 4H13B 1M1KW 4MTOA 1P49A 3AG1B 4G28B 1OCOC 2ZDIC 5CA0B 5ITZA 3W7UA 3BVOA 2YI9A 1E79G 1Q43A 1EZVH 3RYCB 4TUYB 4K0KO 3A8TA 5KA6A 4KHPO 3HKEA 4LF7B 4W4LA 3DC5A 4X20B 3JD0A 4ASUG 4DUZO 5L3EA 3HPLC 3E22A 2PTMA 3OR7C 2KB1A 1Y76B 1EM1A 1IVSA 1NT2B 3TJTA 4LH6A 5JQGA 4JI7B 1MG1A 4X64B 3C3SA 3LNMB 1US6A 4K8ZA 3JARA 2IH3C 3WFVA 3OT7A 3N2KA 1BZKA 1VQ8V 2N04A 2ZQMA 2EX3A 4CH5A 3BHPA 4PJ0Z 4HAMA 4PDLA 1KQSU 5D5QA 1SKVA 2Q9LA 4TT3G 3ZHSA 4OX9B 2K1EA 2R72A 4CS2A 1N0NA 2EINC 1PD3A 2H8PC 4DR3O 1MSDA 5LHIA 4FZ0A 3ABTA 5IJ9A 4MW3A 2Z0AA 2QKCA 5EZYA 5HFMA 4NTYA 5JCOA 3G71V 1S76D 3UCSC 1XILA 2XAGA 1K92A 2BE3A 4BIOA 2KSDA 4O4JA 2VRZA 5D5PA 4DV2B 2GUZB 5IYDO 5IY5C 1THZA 1QVFU 5J2UB 4PDVA 3F7YC 5IT9N 3LDEA 4MVUA 4O2BA 2P4VA 4UCOA 3F5WC 1W2BU 1SQFA 2CGOA 4DV6B 3BY6A 2CK3G 5B1NA 1N32O 2PYJA 1N0JA 1WB7A 3ABMB 1XUQA 2WLNA 3OMAB 3E86A 1SERA 3CCJV 4CC6A 2UXBB 4GX0A 1NI8A 2UUAB 1Q90D 1XMOB 4E4EA 3U10A 1XDCA 3ZRVA 2E5LO 2MW2B 1N33B 2X6AA 1GM8A 3CC2V 4FLUA 2RQ6A 3ZRSA 3I55V 2CE4A 1NR7A 5B66Z 3N27A 3BABA 3TK1A 3K5MA 5LGTA 3T4ZA 1U97A 1V55B 1VQ4V 3R66A 2JS3A 4WFGA 4X1KB 4LF4B 3U0ZA 1XOUA 1AVMA 1JCHA 2QWNB 4KUMA 2PGGA 3DXRA 5CA1B 4UXNA 5J9PC 1RM1B 2F4VB 3IGAC 4DV5B 3EVKA 5EIBD 1JMKC 5JJNB 5DN6G 3MD0A 1TUBB 5CBGA 4DRXB 1VQ5V 5JH7A 3FB5C 4Z1MG 3TXQA 5JJEB 4LFCB 2LGQA 4LWSA 3APOA 2FL4A 1KUQA 3O65A 3OMIB 4O2AB 2AHZA 5CA3A 4LBEC 4JTDB 4ZHQB 1XHZA 2EIKB 1J5EB 3OR6C 4LF9O 4PA7A 2VWJA 3CRCA 4ZKIA 2WPDG 5TISZ 3K9AA 4QNHB 2DWEC 1YJWV 2ETNA 4GKJB 4PA4A 2ZM6B 1HW7A 2ZE8A 4RUFA 3RVYA 1D5AA 4UCRA 4FVMA 3OTOO 1OHHG 3QTCA 3LSQA 1O9HA 2ZE6A 1JVMA 3CJHB 1MABG 4BW5A 4K8XA 2PI4A 2ZXWC 4DR2B 1SZTA 1XBLA 1URFA 2H94A 3ZMVA 2DN9A 4O4HA 4YJ3B 3CWBH 3FD9A 2OCCB 3ZN0A 1FKAO 1NVPD 2P5OA 2OWOA 3C3TA 5JVDA 1MA1A 4J7JA 5KUMA 3AG2B 2GDSA 2UXDB 5LBQA 1WA8A 1QLEB 4DV3B 1H8HG 2QA4V 1JX9A 1AJQA 1AP6A 2RDCA 3L72H 1JA8A 2RNBA 3P3PA 2GBOA 3N2GA 4TQDA 1K34A 1Y66A 1KP2A 4ZOLA 3CRQA 1KD1W 5FPOA 3JALB 1YHQV 1R3LC 2LQTA 4JI2B 1L8DA 3C90A 4WBNB 4CH3A 4UCVA 3FAVA 2Q8VA 1T5EA 4RUEA 3NR7A 3ABKB 3CS5A 3SPGA 1CEZA 4AI8A 3SDLA 1FPOA 2JVDA 4IHJA 3H1KH 1F7YA 4JYAB 4FPPA 4UB8Z 4JI4O 4JI1O 4W4KA 4DV1B 2YDEA 4IIJB 4Z2WA 5KA5A 3ZN1A 2BSKB 3ABMC 2ADPA 2OTJV 1VQ6V 1G8MA 2D2CB 4MTGA 3FX7A 1DGSA 3EFFK 4DK0A 2X6CA 2YIDA 4K35A 1IBMO 4LF5O 4EFBA 2IU0A 1N4CA 1J95A 3ETEA 4JI5O 3T1HO 2FTKA 2O57A 4R8CA 3ABLB 3CCRV 1MMMA 1KECA 4BWAA 2LGWA 4CS4A 4X66B 1IXBA 4FLZA 5H2FZ 4DR6O 3A2FA 1ZSPA 3AG3B 2AXTZ 3UO3A 4LP8A 3SPCA 1R73A 1K3EA 4LFAO 4B3TO 1TVKB 2KG7A 2JGDB 5GTIZ 4ABMA 3K08A 1RM1C 1RSOA 2OIGA 1CPYA 5KUKA 3CRRA 2ZCEA 1BHAA 4LF6O 3MHSC 5IE9A 1FXKA 2ILMA 1HNXB 3CRAA 1I0HA 1QR9A 3JAKB 5KHHA 1HNZO 4GUNA 1WPBA 5IWAB 4NXMO 1SQVH 2UU9O 1W59A 2W0XA 4I4TB 4FJCC 3M8AA 4TQFA 1NTKH 2A06H 2WA3A 2JDIG 5KMGA 4N23A 1BE3H 1SA0B 4QPKA 4LF8O 1HNWO 4JI3B 2CTQA 3VQWA 3K5NA 3LSSA 4BW9A 1TAEA 4WFBV 4BAYA 2A9HA 4EFEA 2DWDC 3RFRA 3SPJA 2LW1A 4YHHO 4LCUC 4B3MB 2DMXA 3CRMA 4JZ2A 5CN0A 3D36A 2BTQA 3HKDA 4MVMA 4JASA 3ZX6A 4D7TA 2NNUA 2F95B 4GT1A 1AJPA 2QKSA 1Y74A 3RVZA 4DO2A 4C7UA 1K7DA 1YXBA 1YEWA 4MVZA 3K5LA 4UV8A 4FK5C 2ZNJA 4FM2A 2V1DA 5EBMC 4JI8B 1XQ8A 4EB6A 1I94B 1HWYA 1OCRB 1VQPV 4P30A 1F23A 1R3IC 2R9IA 4O4IA 1ROPA 1PL4A 2QKAA 4OX9O 4F6RB 2B1IA 2UXCB 3H01A 3VQVA 2C2AA 3OUFA 2HEPA 2WA4A 1VF6C 5KAIZ 5IY5B 4HNAB 4DUYO 4PV1B 3ZRWA 2Y48A 4G27B 3AEIA 1HR0O 3HB3B 2XOKG 1XNQO 5LXTB 1WP8A 2ZE7A 1VQ7V 3G67A 4NR1A 3SPHA 4UV9A 1ZX3A 2XAHA 4DW0A 2YI8A 3THOA 3ABKC 4DV2O 3MDSA 4LNUA 1OV9A 2ODMA 4I9QA 3T4DA 1VP7A 5AG2A 4DR7B 4FLYA 1G4YB 1Y67A 1JFFB 1MSWD 1JQ0A 4X9QA 2EIMC 5LA6B 1FS0G 5BMVB 4P9OA 5B3SC 3E35A 3EHBB 2WLIA 1DK1A 5KHIA 1N36B 3RYHB 1YF2A 5CMUA 2CH7B 2HHHB 2ZR3A 2UUAO 4FLTA 1QQCA 2IU3A 2JRIA 1XMOO 3UT5B 2PZSA 4UUJC 3P32A 5BZBA 3FB7C 2Q73A 4CBCA 5J2TB 3ZEDA 2Q7GA 1M56B 4TV9B 3ABLC 1RP3B 3M99B 1V54B 2ARHA 1RPOA 3AK3A 5LP6A 3UQ8A 1H2GA 3L9DA 2JIZG 5BY1A 3GVMA 2FYUH 1GM9A 1LNQA 5LMUB 5L3BA 2VQFB 1N34B 4CC5A 4P2ZA 4I9WA 1IBKB 4CH4A 3HKCA 3ZHTA 2QTOA 1ZUQA 3VOUA 4DV5O 3ETQA 1S0VA 3X2QC 3P30A 3OGIB 3CCEV 1FXKC 3RT3C 3WU2Z 4X62O 4DV0B 1EZJA 3OM3B 5CA0A 3K0GA 1E1RG 1GTOA 3OEHG 3B40A 3E22B 4U3JA 4JAAA 5E1AC 4TUYA 5A9GA 2X0LA 2P90A 2V7QG 1QU7A 1SQGA 5JQGB 5H5NA 4X20A 1PPJH 4IYHA 1Y76A 4JV5B 3JARB 1J5EO 2BCCH 1AB3A 2ZXWB 1AR1B 4GKJO 4L8JA 4XDKA 5H9CA 2ZM6O 3N2KB 5L3DA 4PA3A 1XL4A 2N05A 4NVPA 1FFTB 1GN2A 2OIEA 1KMIZ 4MVQA 3ASNC 3SJBC 4BIZA 4LR3A 4IL6Z 3WB1A 4GKKB 1Y4MA 1XNRO 4EKWA 2L35A 2DE0X 4DR2O 4PHZA 2Q6AA 3E8GA 3QO8A 2BTOA 4ICGA 1OCRC 5IJ9B 3T2MA 1EBOA 5EZYB 2V4DA 1MZEA 4J41A 3LDDA 2QSAA 2UUCO 5EYPA 1YVWA 4B3RB 2ZNIA 4DYLA 2ITDC 4FLWA 2ZT9B 3BA9A 1Q81W 1QVGU 5FLXN 3BPZA 3CCSV 4FFBA 1X4TA 4JTAB 3K79A 3CB2A 1W0JG 1NBMG 4MSWC 1H2KA 4O2BB 1H38A 3JD3A 3HR0A 1AR5A 3HKBA 4JPRA 5JJJB 1R1BA 2IBZH 1B6QA 4JI2O 1Q3EA 2PYLA 1ZL8A 3ZMUA 4FLXA 1CXZB 2KQXA 2EJRA 2YXYA 3DTUB 3B8NA 4LFBO 2ADQB 1M93A 2XNDG 2EIJB 5LL6Y 3ZMSA 4DR4B 4WFFA 1PL0A 3ASOB 3G6BA 2ZIOA 1K73W 4GX5A 3CP1A 1VQKV 2H3OA 4WFEA 3CYOA 3W7WA 4MVRA 1GH6A 1VARA 1SS3A 1WAZA 2ITCC 4B3SB 1M56C 3OEEG 4OPHA 2GSMB 2IW5A 1HDJA 3DXRB 2FKXA 1V54C 4PA6A 4MTXA 3ICXA 1FYJA 2KKWA 2W6JG 1PV0A 1Q86W 3TCUA 4DV7B 2EZOA 2Q7EA 1F4NA 5JH7B 1KC8W 2P06A 2PF4E 1P7BA 5KAFZ 4L87A 3G6EV 1DF5A 4K0KB 1TUBA 3IJ4A 3TETA 4KHPB 4DRXA 1QCEA 5KX5B 5EK0A 3CMEV 1ORQC 1L0LH 4KFMA 2GTAA 1HNXO 1AROP 1H2SB 4TV8A 5GONB 1K33A 2DYRB 4NXNB 5IWAO 2A79B 3BEHA 5LOVA 1XL6A 5BR8O 3SR2C 3CEIA 5H6RA 1WLEA 3SYPA 3RYFB 4ZHQA 3ZMZA 2XASA 2VQEB 4KL1A 4J9YB 3OMNB 1DLBA 4JI3O 3K57A 3ZIAG 4JI6B 2ZIMA 3CCMV 1G6UA 3BAAA 4DR5O 4YIOA 2Y0IA 3OGCC 3JATA 1AI7A 3K9SA 2WLLA 4O4HB 4X65B 1Z5VA 3JAWB 2GV9A 3J7AU 3GWKC 2B1GA 4CH6A 3IC7A 2B9ZA 5JVDB 3L75H 4DR3B 2A3QA 3JCZA 1FAFA 4YJ3A 2HLDG 1WA8B 3K5OA 1M90W 3I5DA 2Y4TA 3E8HA 2P67A 1KKCA 2QR4A 3RGBA 3N2GB 1M9NA 3G80A 1SZXA 3K06A 2LP7A 5JCOC 2OTLV 5GW7A 3F7VC 4ZIBA 3A0BZ 1KP3A 1S72V 3L71H 2XAQA 4A5UB 5FL7G 1SESA 3H9VA 1SC5B 3CCVV 1SQPH 3FAVB 4XBFA 3MHHC 3ETDA 2WLHA 3JASB 1N32B 1TA8A 4IHJB 3KG2A 5LHGA 3AG7A 4J10A 1AJNA 1NH2B 3H1IH 2EIMB 1GKFA 4PD4F 2NN4A 4J42A 1VF7A 4X1YB 5B3SB 2ZR2A 4X1IA 4YJ2B 5JWPA 4UVCA 4YY3O 1ZLZA 3A0HZ 4I0XB 2IM9A 2EIJC 1GRJA 3RYIA 4IIJA 4DR7O 3T1CA 3CC7V 1JJ2U 3QO7A 1FFXB 2Z5UA 2JJ2G 3ASOC 1P7GA 4UVAA 4IT5A 4UB6Z 4TSFG 3SYAA 3ML0A 4FM1A 5B5EZ 3WB2A 2DYSC 4J11A 2E3CA 5B1BB 1FJGO 2HHHO 3D3IA 3RW0A 3K0DA 1KU9A 1PNKA 4JYYA 2HG5C 1H2NA 5LYJA 2KG7B 2CTPA 2YEVA 4Z1VA 5C93A 1RSOB 1H2MA 2IJJA 2CAZC 2WSSG 3QF7A 3X2QB 5K1XA 5IYZA 1FXKB 1L0NH 1IX9A 1P84F 2ZDIA 1NS1A 3E2EA 5LMUO 3LSUA 3J80N 1X59A 2QM8A 1I08A 2VQFO 3B77A 2P22C 1IBKO 5KMGB 1XEQA 3K59A 4I4TA 4JGSA 4WCEV 5CB4B 4GX2A 2DYRC 2RJZA 4LF7O 1XHXA 1IZ3A 4H37A 1Q6IA 1TUEB 3K03A 4TOIA 3OTOB 5L3GA 1VQ9V 2X7RB 4H0LB 2BTQB 3HKDB 2LJ2A 5IJ0A 3QVNA 2WWWA 4JI7O 3ZBHA 4X64O 1UJWB 1Y74B 3ASNB 2LO1A 2E75B 1XMQB 2CTRA 2DQ0A 1M4UA 3ZHQA 4I55A 1BQ0A 1GK9A 1NZ6A 2Y4UA 4ZI7B 3Q4HB 3S3XA 3WG7C 1R6NA 1U96A 1D2DA 3APQA 3QG5A 1K5SA 4UCTA 4BIUA 4JAUA 1JOYA 1Y6XA 5LMNB 4O4IB 3OFNG 1VQOV 4GCZA 4UFZA 3SJAC 2MK3A 1BHBA 4X8AA 4DK1A 1R3JC 1K5QA 1NJIW 2YIBD 3TGUH 3GB7C 5B1OA 4F6EA 2QM4A 1VIBA 1NTMH 2EBOA 1YITV 3RN4A 2JEUA 2K9PA 3T1YB 4JF3A 2QWRB 4HNAA 4B3RO 5GTHZ 5C8YA 3BFRA 2XHBA 3BCCH 3OUSA 3W7XA 2W0FC 5BXZA 5LXTA 1IXMA 5L3CA 1K97A 1SF9A 4Q20A 1YCIA 2R9RB 2HFEC 1BGYH 4DV6O 3K3WA 2Q0AA 3ZHUA 1W0KG 3AK2A 5H6QA 2F23A 3PN1A 2E74B 1NH2D 1DF4A 2QWPB 3NXSA 5LGUA 1ZTEA 4F4LA 1ZWIC 1IBMB 1ENVA 4R6ZA 4WFHA 5FNVA 4RWUA 1JFFA 2UXBO 4JI5B 4HBNA 1JJOA 3H1JH 1JPXA 3T1HB 3P3NA 3CXHF 1IBLB 2Y0PA 1YTFB 2WLKA 4DR4O 1PNLA 1N33O 4O4LA 3OW2U 1QNMA 3OD4A 3SYQA 3STLC 4DR6B 2Y69B 1V9PA 2RMKB 5LP6B 4LFAB 3CX5F 3W7SA 5B1BC 4J80A 5J2TA 2BOBC 4TV9A 3CCUV 5E79Z 2OYQA 4J9ZB 4LF4O 4I50A 1K8AW 2F1MA 1M5IA 3KKYA 1Q6HA 4OGQB 5ITZB 2EJ7A 2ZE5A 3DC6A 4QGPA 3VBBA 2F4VO 3HKCB 3SYOA 1HNZB 2VWKA 2IJIA 2YXHA 2ZKOA 2JGUA 1LR1A 1PNMA 5DM6V 2B5UA 1QR8A 3OTFA 4KXRA 3HKEB 2AZ2A 3S3WA 4DV7O 3RWRD 5B1AC 1QBZA 1OJHA 4LF8B 3RYCA 4LFCO 2UUBB 4UVBA 1HNWB 2UXNA 5KHGA 4U3JB 3G4SV 1OCZB 1YDXA 3QO5A 1SQXH 4PI0A 4IGGA 2LFRA 3D8CA 4YHHB 3B09A 1N8RW 4WF9V 5K1PA 1R3KC 2YIAA 4PI2A 1K9MW 4NXNO 1WNSA 4PDRA 5IDJA 2M7WA 4LC1A 3UKMA 5DECA 2M6YA 2R70A 3D36C 2HP8A 2HJFC 1OZ0A 3FYEB 4DV4B 1VQMV 2VQEO 1G1XB 1K4CC 4QIWF 4MVSA 1I5YA 2WAMA 1BSMA 2IH1C 1JR9A 4JI6O 2CUGA 2HVKC 1NVPB 2AHYA 4GX1A 1S77D 1WN7A 3J81N 4FIPC 4X65O 2F66C 2QWQB 2EZPA 1AI6A 1B04A 3CE2A 2IJKA 2UXDO 2QJ1A 5HFLA 4DV3O 5EYPB 1BL8A 4DUYB 5EC2C 1EN6A 4X88A 4J7ZA 1MZFA 4O4JB 1QLNA 1KBHA 1F4MA 1HR0B 4KP4A 4FFBB 3BA8A 4FMTA 3IC9A 1XNQB 1M57C 1YI2V 3FYIB 4GYCB 1COWG 1BT8A 2JJ1G 4D7SA 2GUZA 3A0RA 3CXCU 3HKBB 3L70H 1VMGA 5J2UA 1A32A 2GHYA 2Q68A 2QWOB 1ZL8B 3B8MA 1Q8IA 3FFQA 2DW4A 4AQYB 3JD1A 1H8EG 4GLXA 2CDYA 4EEQA 3ETGA 5FPRA 5EBWC 2HR3A 3L73H 2JS5A 4JYAO 1GAXA 2XAJA 1YJNV 3FKSG 4DV1O 3UO2A 5CBFA 1RFYA 5LGNA 1K4DC 4E2LA 4YIPA 2DYSB 1EN4A 3CPWU 3DSQA 2IJHA 2F93B 2RN9A 4MW8A 4QE7A 1QHTA 3ZHVA 1YTFD 4DR1B 1YSCA 3EXAA 2BOCC 4DXWA 4JI0B 3BRCA 2G38A 2Y69C 2XUMA 3KZIZ 1NQTA 1Q5OA 4ZBMA 1SQBH 4QJFB 4R50A 3E8FA 4X1KA 1IURA 5LP6C 3E8BA 3CD6V 4J7KA 4YXWG 4X66O 4FLVA 4HYOA 4NB5A 5CA1A 2LFSA 1I7FA 2Q5ZA 5EIBC 3LDCA 4UCUA 2QEXV 3LNNA 2HKOA 2YUAA 4LWSB 1Q7YW 2WLJA 4GZRB 4X62B 4XDJA 1BMFG 4DUZB 2EILB 3AG1C 3JD4A 1E1QG 4TV8B 1B06A 1KKDA 3E83A 4O2AA 3OAAG 3UM7A 5KX5A 2Z3YA 1VQNV 3PJSK 5A2QN 2JEXA 2W6IG 2YS8A 5LOVB 2LW7A 1OCZC 5GONA 3JSNA 4NTWA 1O9GA 1AI5A 3ZMTA 2XTAA 3K58A 3JCUZ 3CC4V 3JD2A 1GN6A 3RYFA 2A7WA 1BQZA 3ZS8C 2PUSA 3WG7B 4B3MO 5KLVH 2R9AA 3JATB 3CJHA 2WLLB 1NTZH 1F51A 4MVOA 5DEDA 5EC1C 2Q4PA 2AGAA 4RO2A 1XNRB 4JTCB
chains in the Genus database with same CATH topology
3D36C 1PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D36 C;  1PV0 A; 
#chains in the Genus database with same CATH topology
 3CHX A;  3AK1 A;  3FB8 C;  2X6B A;  1XMQ O;  1Q6U A;  4P9P A;  5KHK A;  3WB0 A;  4JYC A;  3JAW A;  2JK5 C;  1GMG A;  2VS0 A;  3ZCC A;  4G2K A;  2WLM A;  2UUC B;  4JI8 O;  1GM7 A;  1I94 O;  1VEW A;  4ZOL B;  1NU1 H;  1P4R A;  2YIB A;  1KB9 F;  3D3Q A;  2PI5 A;  3VQX A;  2Q69 A;  1D5N A;  4JYB A;  1VF6 A;  3GWO A;  5LMN O;  1LUV A;  3H1H H;  2UXC O;  4RQF A;  1OCC B;  4TWK A;  4B7K A;  2FML A;  1AP5 A;  1GO3 F;  2XAF A;  3JAL A;  3SPI A;  3F5T A;  2XT9 A;  2AZ0 A;  3E89 A;  2P7T C;  4WBN A;  2DJV A;  3AG4 B;  2ATK C;  4MS2 A;  1PM9 A;  4X89 A;  2QTS A;  3T1Y O;  2NLJ C;  1KYO F;  4I7Z B;  3IFX A;  2YIC A;  4JAV A;  3TXS A;  3JAS A;  4LFB B;  1HP8 A;  5CBH A;  4AHC A;  2YSU B;  2ZD9 A;  4X1I B;  1FXV A;  2E5L B;  3STZ C;  4CS3 A;  4OPA A;  1PKX A;  4U7N A;  5KHJ A;  4I5S A;  4X1Y A;  2BSK A;  3RYI B;  2QDO A;  3O9O A;  4YJ2 A;  1L1F A;  4MTF A;  4I0X A;  2ZIN A;  1BS3 A;  4FFK A;  3MAQ A;  2OT5 A;  1Q82 W;  4B7E A;  3B2E E;  3M7M X;  3OE7 G;  5IYC O;  1SET A;  2CGN A;  4LH7 A;  1N36 O;  1SRY A;  1FFX A;  1R6K A;  1AI4 A;  4NYK A;  4HZ3 A;  1FD9 A;  3B4S A;  4U7O A;  1IBL O;  2YC0 A;  1XRE A;  4D6T H;  5LYJ B;  3JAM N;  4DW1 A;  4BR6 A;  2YEV B;  3FB6 C;  1LUW A;  4CZZ A;  4R7C A;  4OXS A;  1Z2G A;  1VQL V;  1XI1 A;  5EBL C;  1TVK A;  1V55 C;  1S5L Z;  2JGD A;  4B08 A;  5IYZ B;  1OCO B;  5B1A B;  1WB8 A;  1N34 O;  4NTX A;  3KCY A;  4QE9 A;  1IDS A;  1S5J A;  4LF9 B;  3JAK A;  3SJC C;  2EIL C;  4FM0 A;  3VQY A;  1WP7 A;  2A0L A;  3ZRX A;  5BR8 B;  1MNG A;  4DV0 O;  4RQE A;  3KCX A;  4H33 A;  1SA0 A;  4IYI A;  1WPX A;  2UUB O;  1BCC H;  1R6T A;  5CB4 A;  2L6L A;  2EIK C;  1TGO A;  2DOS A;  2Q67 A;  5IJ0 B;  4PEL A;  3DGE A;  4DR5 B;  5L3F A;  4K3A A;  4JV5 O;  1H2L A;  1YZB A;  4I55 B;  3JSL A;  1CP9 A;  3SJQ C;  4AIL C;  4RAI A;  2QGN A;  3QNE A;  3H1L H;  1S3J A;  1GN4 A;  4EB6 B;  3CCQ V;  1FXH A;  4JZG A;  1MOF A;  2EIN B;  4DV4 O;  1YIJ V;  1EFR G;  4ZI7 A;  2P6J A;  3Q4H A;  4U3F H;  3SYC A;  2P4K A;  2OCC C;  4GKK O;  1SQQ H;  1GN3 A;  2NR5 A;  2RCV A;  3ABU A;  4FZ1 A;  4QPJ A;  3AG2 C;  4F6R A;  3ZRW B;  1M57 B;  1QLE C;  1UPG A;  4PDM A;  3CSX A;  2HVJ C;  3CMA V;  2AW9 A;  1RPR A;  2D3O W;  3IAY A;  1I5X A;  1OCC C;  3I56 V;  4N21 A;  1WJZ A;  5C8Y B;  4PA9 A;  4LNU B;  2YXL A;  4JI4 B;  4JI1 B;  1Z5W A;  3AG4 C;  1AR4 A;  4UCS A;  1NKD A;  2E76 B;  3LUT B;  2F43 G;  1PP9 H;  4MT8 A;  3JYC A;  3U11 A;  1DTO A;  1S5H C;  4YY3 B;  2UXX A;  5LHH A;  3ZHR A;  4LF5 B;  4AQY O;  2WLI B;  1EN5 A;  1UFI A;  5FNV B;  1NR1 A;  4H44 B;  3W7T A;  3ZJZ A;  5LA6 A;  4WFA V;  5BMV A;  1YJ9 V;  2QM7 A;  2N74 A;  2Q7H A;  1B3Q A;  3RYH A;  2OCH A;  1VF5 B;  4O4L B;  2QE7 G;  2CH7 A;  2DQ3 A;  4NKG B;  1ZAU A;  3RBZ A;  2CTW A;  3K04 A;  1FJG B;  3UT5 A;  2HJD A;  4B3T B;  1AIL A;  3L74 H;  2EUL A;  4XDL A;  4LF6 B;  3CCL V;  5F2V O;  4B3S O;  2FB5 A;  5IYB O;  4I50 B;  3SGI A;  2GTS A;  4DR1 O;  4JI0 O;  4Q6G A;  4NXM B;  2UU9 B;  2Q0O C;  2PY5 A;  3R65 A;  3AG3 C;  4H13 B;  1M1K W;  4MTO A;  1P49 A;  3AG1 B;  4G28 B;  1OCO C;  2ZDI C;  5CA0 B;  5ITZ A;  3W7U A;  3BVO A;  2YI9 A;  1E79 G;  1Q43 A;  1EZV H;  3RYC B;  4TUY B;  4K0K O;  3A8T A;  5KA6 A;  4KHP O;  3HKE A;  4LF7 B;  4W4L A;  3DC5 A;  4X20 B;  3JD0 A;  4ASU G;  4DUZ O;  5L3E A;  3HPL C;  3E22 A;  2PTM A;  3OR7 C;  2KB1 A;  1Y76 B;  1EM1 A;  1IVS A;  1NT2 B;  3TJT A;  4LH6 A;  5JQG A;  4JI7 B;  1MG1 A;  4X64 B;  3C3S A;  3LNM B;  1US6 A;  4K8Z A;  3JAR A;  2IH3 C;  3WFV A;  3OT7 A;  3N2K A;  1BZK A;  1VQ8 V;  2N04 A;  2ZQM A;  2EX3 A;  4CH5 A;  3BHP A;  4PJ0 Z;  4HAM A;  4PDL A;  1KQS U;  5D5Q A;  1SKV A;  2Q9L A;  4TT3 G;  3ZHS A;  4OX9 B;  2K1E A;  2R72 A;  4CS2 A;  1N0N A;  2EIN C;  1PD3 A;  2H8P C;  4DR3 O;  1MSD A;  5LHI A;  4FZ0 A;  3ABT A;  5IJ9 A;  4MW3 A;  2Z0A A;  2QKC A;  5EZY A;  5HFM A;  4NTY A;  5JCO A;  3G71 V;  1S76 D;  3UCS C;  1XIL A;  2XAG A;  1K92 A;  2BE3 A;  4BIO A;  2KSD A;  4O4J A;  2VRZ A;  5D5P A;  4DV2 B;  2GUZ B;  5IYD O;  5IY5 C;  1THZ A;  1QVF U;  5J2U B;  4PDV A;  3F7Y C;  5IT9 N;  3LDE A;  4MVU A;  4O2B A;  2P4V A;  4UCO A;  3F5W C;  1W2B U;  1SQF A;  2CGO A;  4DV6 B;  3BY6 A;  2CK3 G;  5B1N A;  1N32 O;  2PYJ A;  1N0J A;  1WB7 A;  3ABM B;  1XUQ A;  2WLN A;  3OMA B;  3E86 A;  1SER A;  3CCJ V;  4CC6 A;  2UXB B;  4GX0 A;  1NI8 A;  2UUA B;  1Q90 D;  1XMO B;  4E4E A;  3U10 A;  1XDC A;  3ZRV A;  2E5L O;  2MW2 B;  1N33 B;  2X6A A;  1GM8 A;  3CC2 V;  4FLU A;  2RQ6 A;  3ZRS A;  3I55 V;  2CE4 A;  1NR7 A;  5B66 Z;  3N27 A;  3BAB A;  3TK1 A;  3K5M A;  5LGT A;  3T4Z A;  1U97 A;  1V55 B;  1VQ4 V;  3R66 A;  2JS3 A;  4WFG A;  4X1K B;  4LF4 B;  3U0Z A;  1XOU A;  1AVM A;  1JCH A;  2QWN B;  4KUM A;  2PGG A;  3DXR A;  5CA1 B;  4UXN A;  5J9P C;  1RM1 B;  2F4V B;  3IGA C;  4DV5 B;  3EVK A;  5EIB D;  1JMK C;  5JJN B;  5DN6 G;  3MD0 A;  1TUB B;  5CBG A;  4DRX B;  1VQ5 V;  5JH7 A;  3FB5 C;  4Z1M G;  3TXQ A;  5JJE B;  4LFC B;  2LGQ A;  4LWS A;  3APO A;  2FL4 A;  1KUQ A;  3O65 A;  3OMI B;  4O2A B;  2AHZ A;  5CA3 A;  4LBE C;  4JTD B;  4ZHQ B;  1XHZ A;  2EIK B;  1J5E B;  3OR6 C;  4LF9 O;  4PA7 A;  2VWJ A;  3CRC A;  4ZKI A;  2WPD G;  5TIS Z;  3K9A A;  4QNH B;  2DWE C;  1YJW V;  2ETN A;  4GKJ B;  4PA4 A;  2ZM6 B;  1HW7 A;  2ZE8 A;  4RUF A;  3RVY A;  1D5A A;  4UCR A;  4FVM A;  3OTO O;  1OHH G;  3QTC A;  3LSQ A;  1O9H A;  2ZE6 A;  1JVM A;  3CJH B;  1MAB G;  4BW5 A;  4K8X A;  2PI4 A;  2ZXW C;  4DR2 B;  1SZT A;  1XBL A;  1URF A;  2H94 A;  3ZMV A;  2DN9 A;  4O4H A;  4YJ3 B;  3CWB H;  3FD9 A;  2OCC B;  3ZN0 A;  1FKA O;  1NVP D;  2P5O A;  2OWO A;  3C3T A;  5JVD A;  1MA1 A;  4J7J A;  5KUM A;  3AG2 B;  2GDS A;  2UXD B;  5LBQ A;  1WA8 A;  1QLE B;  4DV3 B;  1H8H G;  2QA4 V;  1JX9 A;  1AJQ A;  1AP6 A;  2RDC A;  3L72 H;  1JA8 A;  2RNB A;  3P3P A;  2GBO A;  3N2G A;  4TQD A;  1K34 A;  1Y66 A;  1KP2 A;  4ZOL A;  3CRQ A;  1KD1 W;  5FPO A;  3JAL B;  1YHQ V;  1R3L C;  2LQT A;  4JI2 B;  1L8D A;  3C90 A;  4WBN B;  4CH3 A;  4UCV A;  3FAV A;  2Q8V A;  1T5E A;  4RUE A;  3NR7 A;  3ABK B;  3CS5 A;  3SPG A;  1CEZ A;  4AI8 A;  3SDL A;  1FPO A;  2JVD A;  4IHJ A;  3H1K H;  1F7Y A;  4JYA B;  4FPP A;  4UB8 Z;  4JI4 O;  4JI1 O;  4W4K A;  4DV1 B;  2YDE A;  4IIJ B;  4Z2W A;  5KA5 A;  3ZN1 A;  2BSK B;  3ABM C;  2ADP A;  2OTJ V;  1VQ6 V;  1G8M A;  2D2C B;  4MTG A;  3FX7 A;  1DGS A;  3EFF K;  4DK0 A;  2X6C A;  2YID A;  4K35 A;  1IBM O;  4LF5 O;  4EFB A;  2IU0 A;  1N4C A;  1J95 A;  3ETE A;  4JI5 O;  3T1H O;  2FTK A;  2O57 A;  4R8C A;  3ABL B;  3CCR V;  1MMM A;  1KEC A;  4BWA A;  2LGW A;  4CS4 A;  4X66 B;  1IXB A;  4FLZ A;  5H2F Z;  4DR6 O;  3A2F A;  1ZSP A;  3AG3 B;  2AXT Z;  3UO3 A;  4LP8 A;  3SPC A;  1R73 A;  1K3E A;  4LFA O;  4B3T O;  1TVK B;  2KG7 A;  2JGD B;  5GTI Z;  4ABM A;  3K08 A;  1RM1 C;  1RSO A;  2OIG A;  1CPY A;  5KUK A;  3CRR A;  2ZCE A;  1BHA A;  4LF6 O;  3MHS C;  5IE9 A;  1FXK A;  2ILM A;  1HNX B;  3CRA A;  1I0H A;  1QR9 A;  3JAK B;  5KHH A;  1HNZ O;  4GUN A;  1WPB A;  5IWA B;  4NXM O;  1SQV H;  2UU9 O;  1W59 A;  2W0X A;  4I4T B;  4FJC C;  3M8A A;  4TQF A;  1NTK H;  2A06 H;  2WA3 A;  2JDI G;  5KMG A;  4N23 A;  1BE3 H;  1SA0 B;  4QPK A;  4LF8 O;  1HNW O;  4JI3 B;  2CTQ A;  3VQW A;  3K5N A;  3LSS A;  4BW9 A;  1TAE A;  4WFB V;  4BAY A;  2A9H A;  4EFE A;  2DWD C;  3RFR A;  3SPJ A;  2LW1 A;  4YHH O;  4LCU C;  4B3M B;  2DMX A;  3CRM A;  4JZ2 A;  5CN0 A;  3D36 A;  2BTQ A;  3HKD A;  4MVM A;  4JAS A;  3ZX6 A;  4D7T A;  2NNU A;  2F95 B;  4GT1 A;  1AJP A;  2QKS A;  1Y74 A;  3RVZ A;  4DO2 A;  4C7U A;  1K7D A;  1YXB A;  1YEW A;  4MVZ A;  3K5L A;  4UV8 A;  4FK5 C;  2ZNJ A;  4FM2 A;  2V1D A;  5EBM C;  4JI8 B;  1XQ8 A;  4EB6 A;  1I94 B;  1HWY A;  1OCR B;  1VQP V;  4P30 A;  1F23 A;  1R3I C;  2R9I A;  4O4I A;  1ROP A;  1PL4 A;  2QKA A;  4OX9 O;  4F6R B;  2B1I A;  2UXC B;  3H01 A;  3VQV A;  2C2A A;  3OUF A;  2HEP A;  2WA4 A;  1VF6 C;  5KAI Z;  5IY5 B;  4HNA B;  4DUY O;  4PV1 B;  3ZRW A;  2Y48 A;  4G27 B;  3AEI A;  1HR0 O;  3HB3 B;  2XOK G;  1XNQ O;  5LXT B;  1WP8 A;  2ZE7 A;  1VQ7 V;  3G67 A;  4NR1 A;  3SPH A;  4UV9 A;  1ZX3 A;  2XAH A;  4DW0 A;  2YI8 A;  3THO A;  3ABK C;  4DV2 O;  3MDS A;  4LNU A;  1OV9 A;  2ODM A;  4I9Q A;  3T4D A;  1VP7 A;  5AG2 A;  4DR7 B;  4FLY A;  1G4Y B;  1Y67 A;  1JFF B;  1MSW D;  1JQ0 A;  4X9Q A;  2EIM C;  5LA6 B;  1FS0 G;  5BMV B;  4P9O A;  5B3S C;  3E35 A;  3EHB B;  2WLI A;  1DK1 A;  5KHI A;  1N36 B;  3RYH B;  1YF2 A;  5CMU A;  2CH7 B;  2HHH B;  2ZR3 A;  2UUA O;  4FLT A;  1QQC A;  2IU3 A;  2JRI A;  1XMO O;  3UT5 B;  2PZS A;  4UUJ C;  3P32 A;  5BZB A;  3FB7 C;  2Q73 A;  4CBC A;  5J2T B;  3ZED A;  2Q7G A;  1M56 B;  4TV9 B;  3ABL C;  1RP3 B;  3M99 B;  1V54 B;  2ARH A;  1RPO A;  3AK3 A;  5LP6 A;  3UQ8 A;  1H2G A;  3L9D A;  2JIZ G;  5BY1 A;  3GVM A;  2FYU H;  1GM9 A;  1LNQ A;  5LMU B;  5L3B A;  2VQF B;  1N34 B;  4CC5 A;  4P2Z A;  4I9W A;  1IBK B;  4CH4 A;  3HKC A;  3ZHT A;  2QTO A;  1ZUQ A;  3VOU A;  4DV5 O;  3ETQ A;  1S0V A;  3X2Q C;  3P30 A;  3OGI B;  3CCE V;  1FXK C;  3RT3 C;  3WU2 Z;  4X62 O;  4DV0 B;  1EZJ A;  3OM3 B;  5CA0 A;  3K0G A;  1E1R G;  1GTO A;  3OEH G;  3B40 A;  3E22 B;  4U3J A;  4JAA A;  5E1A C;  4TUY A;  5A9G A;  2X0L A;  2P90 A;  2V7Q G;  1QU7 A;  1SQG A;  5JQG B;  5H5N A;  4X20 A;  1PPJ H;  4IYH A;  1Y76 A;  4JV5 B;  3JAR B;  1J5E O;  2BCC H;  1AB3 A;  2ZXW B;  1AR1 B;  4GKJ O;  4L8J A;  4XDK A;  5H9C A;  2ZM6 O;  3N2K B;  5L3D A;  4PA3 A;  1XL4 A;  2N05 A;  4NVP A;  1FFT B;  1GN2 A;  2OIE A;  1KMI Z;  4MVQ A;  3ASN C;  3SJB C;  4BIZ A;  4LR3 A;  4IL6 Z;  3WB1 A;  4GKK B;  1Y4M A;  1XNR O;  4EKW A;  2L35 A;  2DE0 X;  4DR2 O;  4PHZ A;  2Q6A A;  3E8G A;  3QO8 A;  2BTO A;  4ICG A;  1OCR C;  5IJ9 B;  3T2M A;  1EBO A;  5EZY B;  2V4D A;  1MZE A;  4J41 A;  3LDD A;  2QSA A;  2UUC O;  5EYP A;  1YVW A;  4B3R B;  2ZNI A;  4DYL A;  2ITD C;  4FLW A;  2ZT9 B;  3BA9 A;  1Q81 W;  1QVG U;  5FLX N;  3BPZ A;  3CCS V;  4FFB A;  1X4T A;  4JTA B;  3K79 A;  3CB2 A;  1W0J G;  1NBM G;  4MSW C;  1H2K A;  4O2B B;  1H38 A;  3JD3 A;  3HR0 A;  1AR5 A;  3HKB A;  4JPR A;  5JJJ B;  1R1B A;  2IBZ H;  1B6Q A;  4JI2 O;  1Q3E A;  2PYL A;  1ZL8 A;  3ZMU A;  4FLX A;  1CXZ B;  2KQX A;  2EJR A;  2YXY A;  3DTU B;  3B8N A;  4LFB O;  2ADQ B;  1M93 A;  2XND G;  2EIJ B;  5LL6 Y;  3ZMS A;  4DR4 B;  4WFF A;  1PL0 A;  3ASO B;  3G6B A;  2ZIO A;  1K73 W;  4GX5 A;  3CP1 A;  1VQK V;  2H3O A;  4WFE A;  3CYO A;  3W7W A;  4MVR A;  1GH6 A;  1VAR A;  1SS3 A;  1WAZ A;  2ITC C;  4B3S B;  1M56 C;  3OEE G;  4OPH A;  2GSM B;  2IW5 A;  1HDJ A;  3DXR B;  2FKX A;  1V54 C;  4PA6 A;  4MTX A;  3ICX A;  1FYJ A;  2KKW A;  2W6J G;  1PV0 A;  1Q86 W;  3TCU A;  4DV7 B;  2EZO A;  2Q7E A;  1F4N A;  5JH7 B;  1KC8 W;  2P06 A;  2PF4 E;  1P7B A;  5KAF Z;  4L87 A;  3G6E V;  1DF5 A;  4K0K B;  1TUB A;  3IJ4 A;  3TET A;  4KHP B;  4DRX A;  1QCE A;  5KX5 B;  5EK0 A;  3CME V;  1ORQ C;  1L0L H;  4KFM A;  2GTA A;  1HNX O;  1ARO P;  1H2S B;  4TV8 A;  5GON B;  1K33 A;  2DYR B;  4NXN B;  5IWA O;  2A79 B;  3BEH A;  5LOV A;  1XL6 A;  5BR8 O;  3SR2 C;  3CEI A;  5H6R A;  1WLE A;  3SYP A;  3RYF B;  4ZHQ A;  3ZMZ A;  2XAS A;  2VQE B;  4KL1 A;  4J9Y B;  3OMN B;  1DLB A;  4JI3 O;  3K57 A;  3ZIA G;  4JI6 B;  2ZIM A;  3CCM V;  1G6U A;  3BAA A;  4DR5 O;  4YIO A;  2Y0I A;  3OGC C;  3JAT A;  1AI7 A;  3K9S A;  2WLL A;  4O4H B;  4X65 B;  1Z5V A;  3JAW B;  2GV9 A;  3J7A U;  3GWK C;  2B1G A;  4CH6 A;  3IC7 A;  2B9Z A;  5JVD B;  3L75 H;  4DR3 B;  2A3Q A;  3JCZ A;  1FAF A;  4YJ3 A;  2HLD G;  1WA8 B;  3K5O A;  1M90 W;  3I5D A;  2Y4T A;  3E8H A;  2P67 A;  1KKC A;  2QR4 A;  3RGB A;  3N2G B;  1M9N A;  3G80 A;  1SZX A;  3K06 A;  2LP7 A;  5JCO C;  2OTL V;  5GW7 A;  3F7V C;  4ZIB A;  3A0B Z;  1KP3 A;  1S72 V;  3L71 H;  2XAQ A;  4A5U B;  5FL7 G;  1SES A;  3H9V A;  1SC5 B;  3CCV V;  1SQP H;  3FAV B;  4XBF A;  3MHH C;  3ETD A;  2WLH A;  3JAS B;  1N32 B;  1TA8 A;  4IHJ B;  3KG2 A;  5LHG A;  3AG7 A;  4J10 A;  1AJN A;  1NH2 B;  3H1I H;  2EIM B;  1GKF A;  4PD4 F;  2NN4 A;  4J42 A;  1VF7 A;  4X1Y B;  5B3S B;  2ZR2 A;  4X1I A;  4YJ2 B;  5JWP A;  4UVC A;  4YY3 O;  1ZLZ A;  3A0H Z;  4I0X B;  2IM9 A;  2EIJ C;  1GRJ A;  3RYI A;  4IIJ A;  4DR7 O;  3T1C A;  3CC7 V;  1JJ2 U;  3QO7 A;  1FFX B;  2Z5U A;  2JJ2 G;  3ASO C;  1P7G A;  4UVA A;  4IT5 A;  4UB6 Z;  4TSF G;  3SYA A;  3ML0 A;  4FM1 A;  5B5E Z;  3WB2 A;  2DYS C;  4J11 A;  2E3C A;  5B1B B;  1FJG O;  2HHH O;  3D3I A;  3RW0 A;  3K0D A;  1KU9 A;  1PNK A;  4JYY A;  2HG5 C;  1H2N A;  5LYJ A;  2KG7 B;  2CTP A;  2YEV A;  4Z1V A;  5C93 A;  1RSO B;  1H2M A;  2IJJ A;  2CAZ C;  2WSS G;  3QF7 A;  3X2Q B;  5K1X A;  5IYZ A;  1FXK B;  1L0N H;  1IX9 A;  1P84 F;  2ZDI A;  1NS1 A;  3E2E A;  5LMU O;  3LSU A;  3J80 N;  1X59 A;  2QM8 A;  1I08 A;  2VQF O;  3B77 A;  2P22 C;  1IBK O;  5KMG B;  1XEQ A;  3K59 A;  4I4T A;  4JGS A;  4WCE V;  5CB4 B;  4GX2 A;  2DYR C;  2RJZ A;  4LF7 O;  1XHX A;  1IZ3 A;  4H37 A;  1Q6I A;  1TUE B;  3K03 A;  4TOI A;  3OTO B;  5L3G A;  1VQ9 V;  2X7R B;  4H0L B;  2BTQ B;  3HKD B;  2LJ2 A;  5IJ0 A;  3QVN A;  2WWW A;  4JI7 O;  3ZBH A;  4X64 O;  1UJW B;  1Y74 B;  3ASN B;  2LO1 A;  2E75 B;  1XMQ B;  2CTR A;  2DQ0 A;  1M4U A;  3ZHQ A;  4I55 A;  1BQ0 A;  1GK9 A;  1NZ6 A;  2Y4U A;  4ZI7 B;  3Q4H B;  3S3X A;  3WG7 C;  1R6N A;  1U96 A;  1D2D A;  3APQ A;  3QG5 A;  1K5S A;  4UCT A;  4BIU A;  4JAU A;  1JOY A;  1Y6X A;  5LMN B;  4O4I B;  3OFN G;  1VQO V;  4GCZ A;  4UFZ A;  3SJA C;  2MK3 A;  1BHB A;  4X8A A;  4DK1 A;  1R3J C;  1K5Q A;  1NJI W;  2YIB D;  3TGU H;  3GB7 C;  5B1O A;  4F6E A;  2QM4 A;  1VIB A;  1NTM H;  2EBO A;  1YIT V;  3RN4 A;  2JEU A;  2K9P A;  3T1Y B;  4JF3 A;  2QWR B;  4HNA A;  4B3R O;  5GTH Z;  5C8Y A;  3BFR A;  2XHB A;  3BCC H;  3OUS A;  3W7X A;  2W0F C;  5BXZ A;  5LXT A;  1IXM A;  5L3C A;  1K97 A;  1SF9 A;  4Q20 A;  1YCI A;  2R9R B;  2HFE C;  1BGY H;  4DV6 O;  3K3W A;  2Q0A A;  3ZHU A;  1W0K G;  3AK2 A;  5H6Q A;  2F23 A;  3PN1 A;  2E74 B;  1NH2 D;  1DF4 A;  2QWP B;  3NXS A;  5LGU A;  1ZTE A;  4F4L A;  1ZWI C;  1IBM B;  1ENV A;  4R6Z A;  4WFH A;  5FNV A;  4RWU A;  1JFF A;  2UXB O;  4JI5 B;  4HBN A;  1JJO A;  3H1J H;  1JPX A;  3T1H B;  3P3N A;  3CXH F;  1IBL B;  2Y0P A;  1YTF B;  2WLK A;  4DR4 O;  1PNL A;  1N33 O;  4O4L A;  3OW2 U;  1QNM A;  3OD4 A;  3SYQ A;  3STL C;  4DR6 B;  2Y69 B;  1V9P A;  2RMK B;  5LP6 B;  4LFA B;  3CX5 F;  3W7S A;  5B1B C;  4J80 A;  5J2T A;  2BOB C;  4TV9 A;  3CCU V;  5E79 Z;  2OYQ A;  4J9Z B;  4LF4 O;  4I50 A;  1K8A W;  2F1M A;  1M5I A;  3KKY A;  1Q6H A;  4OGQ B;  5ITZ B;  2EJ7 A;  2ZE5 A;  3DC6 A;  4QGP A;  3VBB A;  2F4V O;  3HKC B;  3SYO A;  1HNZ B;  2VWK A;  2IJI A;  2YXH A;  2ZKO A;  2JGU A;  1LR1 A;  1PNM A;  5DM6 V;  2B5U A;  1QR8 A;  3OTF A;  4KXR A;  3HKE B;  2AZ2 A;  3S3W A;  4DV7 O;  3RWR D;  5B1A C;  1QBZ A;  1OJH A;  4LF8 B;  3RYC A;  4LFC O;  2UUB B;  4UVB A;  1HNW B;  2UXN A;  5KHG A;  4U3J B;  3G4S V;  1OCZ B;  1YDX A;  3QO5 A;  1SQX H;  4PI0 A;  4IGG A;  2LFR A;  3D8C A;  4YHH B;  3B09 A;  1N8R W;  4WF9 V;  5K1P A;  1R3K C;  2YIA A;  4PI2 A;  1K9M W;  4NXN O;  1WNS A;  4PDR A;  5IDJ A;  2M7W A;  4LC1 A;  3UKM A;  5DEC A;  2M6Y A;  2R70 A;  3D36 C;  2HP8 A;  2HJF C;  1OZ0 A;  3FYE B;  4DV4 B;  1VQM V;  2VQE O;  1G1X B;  1K4C C;  4QIW F;  4MVS A;  1I5Y A;  2WAM A;  1BSM A;  2IH1 C;  1JR9 A;  4JI6 O;  2CUG A;  2HVK C;  1NVP B;  2AHY A;  4GX1 A;  1S77 D;  1WN7 A;  3J81 N;  4FIP C;  4X65 O;  2F66 C;  2QWQ B;  2EZP A;  1AI6 A;  1B04 A;  3CE2 A;  2IJK A;  2UXD O;  2QJ1 A;  5HFL A;  4DV3 O;  5EYP B;  1BL8 A;  4DUY B;  5EC2 C;  1EN6 A;  4X88 A;  4J7Z A;  1MZF A;  4O4J B;  1QLN A;  1KBH A;  1F4M A;  1HR0 B;  4KP4 A;  4FFB B;  3BA8 A;  4FMT A;  3IC9 A;  1XNQ B;  1M57 C;  1YI2 V;  3FYI B;  4GYC B;  1COW G;  1BT8 A;  2JJ1 G;  4D7S A;  2GUZ A;  3A0R A;  3CXC U;  3HKB B;  3L70 H;  1VMG A;  5J2U A;  1A32 A;  2GHY A;  2Q68 A;  2QWO B;  1ZL8 B;  3B8M A;  1Q8I A;  3FFQ A;  2DW4 A;  4AQY B;  3JD1 A;  1H8E G;  4GLX A;  2CDY A;  4EEQ A;  3ETG A;  5FPR A;  5EBW C;  2HR3 A;  3L73 H;  2JS5 A;  4JYA O;  1GAX A;  2XAJ A;  1YJN V;  3FKS G;  4DV1 O;  3UO2 A;  5CBF A;  1RFY A;  5LGN A;  1K4D C;  4E2L A;  4YIP A;  2DYS B;  1EN4 A;  3CPW U;  3DSQ A;  2IJH A;  2F93 B;  2RN9 A;  4MW8 A;  4QE7 A;  1QHT A;  3ZHV A;  1YTF D;  4DR1 B;  1YSC A;  3EXA A;  2BOC C;  4DXW A;  4JI0 B;  3BRC A;  2G38 A;  2Y69 C;  2XUM A;  3KZI Z;  1NQT A;  1Q5O A;  4ZBM A;  1SQB H;  4QJF B;  4R50 A;  3E8F A;  4X1K A;  1IUR A;  5LP6 C;  3E8B A;  3CD6 V;  4J7K A;  4YXW G;  4X66 O;  4FLV A;  4HYO A;  4NB5 A;  5CA1 A;  2LFS A;  1I7F A;  2Q5Z A;  5EIB C;  3LDC A;  4UCU A;  2QEX V;  3LNN A;  2HKO A;  2YUA A;  4LWS B;  1Q7Y W;  2WLJ A;  4GZR B;  4X62 B;  4XDJ A;  1BMF G;  4DUZ B;  2EIL B;  3AG1 C;  3JD4 A;  1E1Q G;  4TV8 B;  1B06 A;  1KKD A;  3E83 A;  4O2A A;  3OAA G;  3UM7 A;  5KX5 A;  2Z3Y A;  1VQN V;  3PJS K;  5A2Q N;  2JEX A;  2W6I G;  2YS8 A;  5LOV B;  2LW7 A;  1OCZ C;  5GON A;  3JSN A;  4NTW A;  1O9G A;  1AI5 A;  3ZMT A;  2XTA A;  3K58 A;  3JCU Z;  3CC4 V;  3JD2 A;  1GN6 A;  3RYF A;  2A7W A;  1BQZ A;  3ZS8 C;  2PUS A;  3WG7 B;  4B3M O;  5KLV H;  2R9A A;  3JAT B;  3CJH A;  2WLL B;  1NTZ H;  1F51 A;  4MVO A;  5DED A;  5EC1 C;  2Q4P A;  2AGA A;  4RO2 A;  1XNR B;  4JTC B; 
#chains in the Genus database with same CATH homology
 3D36 C;  1PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...