5EBLC

Kcsa t75g in the conductive state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
molecule tags Membrane protein
source organism Mus musculus
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5eblC00
4PA6A 4JTCB 4QE9A 2Q6AA 4H37A 3SPJA 1V54C 3SYAA 3T1CA 4QNHB 2AHYA 4JTDB 3SPCA 2Q67A 2ITDC 2JK5C 2WLHA 3RBZA 3RVZA 3T4ZA 3K08A 2EINC 4MTGA 3TETA 4XDLA 2AHZA 4P2ZA 1ORQC 3SPHA 4WFHA 3ASNC 1V55C 2WLJA 1BL8A 4X89A 3ZJZA 2WLMA 4JTAB 2QTOA 2HJFC 4H33A 3UKMA 3F7VC 5EBWC 2R9RB 3FB5C 3FB8C 4MVZA 3LNMB 2YEVA 2Q68A 3R65A 2HVKC 4R7CA 5E1AC 3X2QC 4BW5A 3WG7C 4MTFA 4XDJA 2EIKC 2NLJC 3K0DA 1R3IC 4LCUC 3K04A 4WFFA 2IH1C 2EIMC 1XL6A 3LDEA 3OR6C 4G27B 4CBCA 3LDDA 2BOCC 3OR7C 5KUMA 3AG2C 3SYQA 2WLKA 1OCRC 3FB7C 2HFEC 2BOBC 2H8PC 3AG1C 4EKWA 2Y69C 2HVJC 1K4CC 4LP8A 3SPGA 2DWEC 3JYCA 1R3JC 3ASOC 3F7YC 4WFGA 4MSWC 2Q69A 3OUSA 5B1AC 3SJQC 5IY5C 4P30A 4RUFA 2DWDC 3PJSK 4GX1A 5EC1C 5CBHA 3E8FA 4RO2A 2WLLB 2ATKC 3BEHA 4QE7A 4RAIA 2QKSA 3ABKC 4R8CA 3K06A 4MVMA 2WLIB 2EIJC 2P7TC 4F4LA 4WFEA 4LBEC 3E8HA 4HZ3A 1ZWIC 3SPIA 2W0FC 3AG4C 2X6CA 4RUEA 4DXWA 1K4DC 1KKDA 3IGAC 3T4DA 1XL4A 4PDRA 5EC2C 3SYOA 1OCCC 4P9OA 3K03A 5J9PC 5B3SC 2HG5C 1LNQA 3T2MA 4GX5A 1R3KC 2A9HA 4MW8A 4MVSA 4MS2A 4XDKA 2A0LA 4TWKA 4R50A 2DYRC 2WLIA 4P9PA 4PA3A 2ZXWC 1J95A 1JVMA 3ABLC 4GX0A 3E83A 3STLC 2X6BA 1QLEC 3RW0A 3KG2A 3OUFA 4UUJC 1M56C 3ZRSA 4I9WA 4MTOA 4ZBMA 3E86A 3SYCA 3E89A 1P7BA 4PA7A 1OCOC 2WLNA 2A79B 5CBFA 5CBGA 4G28B 2DYSC 4KFMA 1R3LC 3UM7A 3LUTB 2X6AA 5EBMC 3STZC 2OCCC 4J9ZB 3GB7C 1M57C 3OGCC 3SYPA 1OCZC 3HPLC 2WLLA 2ZD9A 4J9YB 3VOUA 3K0GA 3FB6C 5BZBA 3LDCA 2EILC 4GX2A 4PA9A 4PDLA 4MVRA 4PA4A 5B1BC 1G4YB 3E8GA 4MVQA 4HYOA 4OXSA 4X88A 4MVOA 5KUKA 3ABMC 2K1EA 4X8AA 4R6ZA 4PDMA 3EFFK 4MVUA 2IH3C 3RVYA 3TCUA 5EBLC 2KB1A 1S5HC 3F5WC 3IFXA 4PDVA 5EK0A 3AG3C 2ITCC 4MW3A 3E8BA
chains in the Genus database with same CATH superfamily
2NR5A 1AI4A 4QE9A 1YJ9V 4NXMB 1S5LZ 4H37A 1SRYA 3JSLA 3SPCA 3JASA 2PF4E 1UFIA 3B77A 2EZOA 3HKBA 1YJWV 4DR1B 3ZJZA 3FFQA 1VIBA 2OTJV 2YEVA 3I55V 3R65A 5IT9N 2F43G 1FXKC 1GAXA 4O4LA 4FLXA 3AK1A 3LDDA 4FZ1A 3AG2C 3W7TA 3RFRA 3L70H 4OX9O 2B1GA 2N04A 2R9IA 2XHBA 1AJPA 2HLDG 2WA3A 2M6YA 2EIJC 4LBEC 4PI2A 4E2LA 3ICXA 4K8ZA 4GKJB 1VQ6V 5CB4B 2DQ3A 1XL4A 1KBHA 4RQFA 2VS0A 5J9PC 4LF9O 2CE4A 4B3MO 4DV1B 3H9VA 4TWKA 2WLIA 3ZX6A 1J95A 2B9ZA 4X62B 1VQMV 2CAZC 4UFZA 4IGGA 4ZBMA 3E89A 3BFRA 1K5QA 2QE7G 2YI9A 4J7KA 3FYEB 1PL0A 1BT8A 1Q90D 4DR2O 5LMNO 4X64B 3AEIA 4FM1A 1XNRB 2EX3A 2HJDA 3T1YB 1NZ6A 3CX5F 2HP8A 2RDCA 1YI2V 4WBNA 2P4KA 3JAMN 3N2KA 1Q86W 1F4NA 1KP3A 1JR9A 3VQXA 4YJ3A 2ZDIA 4EFBA 3CS5A 4Z1VA 3DC5A 2Q67A 3HKEA 3G71V 2EINC 3VQVA 1IXMA 1L0LH 1MG1A 2XAGA 3EXAA 5FNVA 5GW7A 5DN6G 1L8DA 4H0LB 1G8MA 1K73W 2KQXA 3ABKB 3O65A 4N21A 2IJHA 3M7MX 2ZKOA 2QWPB 2Y48A 4CH3A 3CD6V 4F6EA 1AJNA 2BCCH 4OPHA 1S0VA 3HKEB 1NJIW 3C90A 1K4CC 4JPRA 3JYCA 3K5LA 4TT3G 4P30A 2JGDB 5L3GA 4GKKB 3CCQV 1XNQO 4AQYB 3BRCA 3K79A 4HZ3A 3AG4C 4DXWA 3ZHVA 3JSNA 3SJBC 4X66B 2WSSG 3DTUB 3ABMB 4X62O 2QDOA 2A0LA 4TSFG 1DLBA 5A9GA 1PD3A 4ZI7B 5KHIA 1JOYA 2Q7GA 4DV0B 4AHCA 2MW2B 1H2LA 4KFMA 1QLEB 2Z5UA 3SYPA 1MA1A 3E2EA 1FXKA 5GONA 4OX9B 1XI1A 1YCIA 3L75H 2VWKA 2ADPA 3JALA 3TCUA 1WB8A 1M56B 4JI7B 3MHHC 1S5HC 4TOIA 3BPZA 3CRAA 4ZHQB 1AILA 2UXXA 4QPKA 1OCCB 2G38A 5LHIA 1VQOV 1K97A 1ORQC 2WLJA 3SJCC 1LR1A 4UCRA 1WPBA 3CC2V 2QTOA 2JRIA 2R9RB 5LOVA 3FB5C 3L9DA 4JI8B 1URFA 1X59A 1XMOB 2PZSA 3TXQA 4ZHQA 4RWUA 4G2KA 2BOCC 1SQVH 1VEWA 2IBZH 1FPOA 2PI4A 3JARA 3F7YC 1S77D 1H38A 1VQ8V 3T1HO 2GUZB 2FYUH 4FIPC 2UUAB 4DR3B 4J10A 1L0NH 2ATKC 4IIJA 2QKSA 3GVMA 3G6BA 1MZEA 3CCRV 1VQNV 1N8RW 2X6CA 2LP7A 2X0LA 3JD4A 2A9HA 2PY5A 1WA8B 4DV0O 3W7SA 3JAKA 5E79Z 2DN9A 4W4KA 3DSQA 3KG2A 4I5SA 3TXSA 4MTOA 3SYCA 4PI0A 4O2AA 2YC0A 2PTMA 3KCYA 2PUSA 1J5EB 4G28B 3I5DA 1ZAUA 1Z2GA 3GB7C 2AZ2A 3AK2A 2WLLA 3FB6C 4NTYA 1QVGU 4X1KA 4EB6A 2EIKB 4OXSA 3QNEA 4UCUA 1M1KW 3IC9A 5K1XA 4DR5O 1IDSA 2Q5ZA 1JFFB 1VF7A 3OW2U 5IYDO 1K9MW 4I4TA 2R9AA 4JTCB 5FPRA 1S72V 4FLVA 1JFFA 1PV0A 2Y0PA 1VQKV 1CEZA 4OPAA 4X20B 5IY5B 4LC1A 1K7DA 1HR0B 1KU9A 3DXRA 2BE3A 2CTWA 1H2GA 5LA6B 1TUBA 2F23A 1KC8W 3OM3B 2QWQB 4JI1O 4F6RB 3HR0A 1V9PA 4K8XA 4BIZA 4NXNB 3T1HB 1JQ0A 5KUMA 2ZE8A 1R6NA 3CCJV 4LF9B 3AG1C 5L3BA 1RM1B 4JV5O 3ASNB 1CXZB 4JYBA 1QNMA 4PHZA 1YTFB 1SQGA 4JYAB 1R73A 3E8FA 4BWAA 3BEHA 3L72H 3FAVA 4RAIA 1FXHA 4I50A 2GSMB 4B3SB 1FXKB 3OMAB 2JDIG 3IGAC 2AGAA 1W0KG 5B1NA 3CCUV 2QWRB 1TGOA 2EBOA 3FX7A 2ETNA 5BXZA 2DYRC 2D3OW 2CK3G 5HFLA 2OCHA 5LP6C 1OCOC 4H44B 4HAMA 3ZHUA 1KP2A 3D3QA 1S76D 3LUTB 2ZNJA 3BA9A 2DMXA 2LGQA 2XASA 3UT5B 4KUMA 2LFSA 3CRMA 5LOVB 2ADQB 2EILC 3ETGA 4FMTA 3CMEV 2HHHB 2LO1A 1NR1A 2RQ6A 1KKCA 5DM6V 5KAIZ 3OEHG 3EFFK 3RVYA 2JGDA 3F5WC 3MDSA 1N4CA 1EN5A 4KP4A 3QVNA 1F4MA 2ZE6A 1Y66A 1YTFD 2QWOB 4UB8Z 5KX5A 3SPHA 2UXBO 1XDCA 1NKDA 1V55C 4DR1O 3OE7G 2YIAA 4DV2B 1RSOA 4GKKO 4DV7O 5C93A 4UV8A 1NR7A 4YY3O 1N34O 4WFFA 1EZVH 1W0JG 5FLXN 4JV5B 5LP6A 1YJNV 3GWOA 2WLKA 4O4HA 4LF6O 4ZI7A 1I94B 2DWEC 2LFRA 3KKYA 2E5LB 4DRXB 2VRZA 4RUFA 2KSDA 3ZHSA 2L35A 4RO2A 2A06H 4R8CA 4O4JA 4NVPA 2YXLA 1K4DC 4NR1A 1HWYA 1XBLA 3FKSG 5B3SB 3CCEV 2CDYA 4PDRA 4TV8A 5EC2C 3SYOA 1AR1B 4J7JA 1WB7A 2ZXWC 4O4IA 3E83A 1M57B 5L3EA 5KHHA 3A0RA 1FJGO 2QTSA 2DYSB 3N2GB 2M7WA 1DF4A 1A32A 3B40A 3AK3A 1V55B 1XNRO 3AG7A 1BS3A 3UO2A 5CA0A 4JZ2A 3K0GA 1AR4A 2ZR3A 1IBKB 4LH7A 1RP3B 5LHGA 4DW1A 5IJ9B 4F6RA 3P32A 2HR3A 2B1IA 2BTQA 1RPOA 4EFEA 1Q3EA 2IU0A 3G80A 3IFXA 4HNAA 4JYAO 4LWSB 2Y4UA 3O9OA 3ETDA 4MW3A 3ZN0A 4QNHB 2QA4V 2AHYA 5JQGB 3RYCB 4WBNB 2JS3A 4MTGA 4JZGA 2PI5A 1X4TA 3CCSV 4JI0B 1GMGA 2HJFC 5LMUO 1K5SA 1W59A 1SF9A 5JQGA 3RYCA 4YY3B 2EIMC 1XL6A 1KMIZ 1WN7A 2L6LA 3ABTA 3ZRVA 3OD4A 4DW0A 1D5AA 2Y69C 2BTQB 1AJQA 2AW9A 2Z3YA 1OZ0A 4I4TB 1CP9A 5GONB 3SJQC 1P4RA 3RYHB 4W4LA 3L74H 5IJ0A 1VQPV 3LSUA 1VQLV 2P67A 2N74A 1RFYA 2YICA 1O9HA 3K03A 1SA0A 3T2MA 3E22B 1HDJA 4MTXA 4O2BB 2YIDA 3WB0A 4JI4B 4D6TH 1EN4A 1OCZB 5EIBD 1OJHA 4ZKIA 3QO5A 3D8CA 4JI3B 2KG7B 4WFAV 5KMGB 4D7SA 5LYJA 1KUQA 3WFVA 1NH2B 4RQEA 3VQYA 1R3LC 4O4JB 3STZC 4J9ZB 3IC7A 2YEVB 3QO7A 2VWJA 2ZXWB 2ZDIC 3J7AU 1BZKA 5KUKA 2K1EA 4JI1B 1P84F 4JGSA 4YHHB 4DYLA 1NVPB 1HNXB 2E76B 1UJWB 3UO3A 3T1CA 3SYAA 2RN9A 1COWG 5IYZA 3M99B 3W7WA 4FJCC 1Q81W 1NBMG 2XAFA 1N32O 1E79G 1BL8A 1SC5B 3ZHTA 2EJ7A 3ZN1A 4Q20A 1XUQA 2Q68A 2RNBA 1Q6UA 4LNUA 3X2QC 2O57A 2YIBA 3CE2A 5KHJA 5LXTB 1LUVA 1J5EO 1KB9F 3X2QB 4AI8A 1YVWA 3N2KB 5EYPA 2QM8A 4UB6Z 4CH4A 2HVJC 4LP8A 5EZYB 1R3JC 4WFGA 4B7KA 1H2KA 1BE3H 5J2UA 1M5IA 3DGEA 2YS8A 5KHKA 4BIUA 5JVDB 5TISZ 3K3WA 2P7TC 4NXMO 5ITZA 4K0KB 4TV9B 3OFNG 4FLWA 4GCZA 4LFAO 2ZR2A 1VQ7V 2VQEB 4BAYA 3CMAV 2ARHA 4I7ZB 5LMUB 4J11A 2OTLV 3I56V 4R50A 2YUAA 4JAAA 3ZEDA 4CS4A 4EEQA 4J80A 3B8NA 4JI5O 4LF8B 2RJZA 2IJIA 3P3NA 1N36B 4JI8O 1OCZC 1R6TA 3OTOB 5DEDA 5B1AB 2DYRB 1WLEA 5KAFZ 4X88A 3IJ4A 1TAEA 1QLNA 2PYLA 3ZIAG 4CZZA 4PDMA 2KB1A 3JCUZ 4UCTA 1HNXO 3F5TA 1Q82W 3CC7V 3CWBH 4NTWA 1N36O 2AHZA 4P2ZA 4DV6B 1HR0O 4LR3A 1BSMA 2R72A 3RYFA 1VARA 5CN0A 3RGBA 1W2BU 3MHSC 4IHJA 2F4VO 2YXHA 4G27B 4FFBB 2W6JG 4JI3O 4ASUG 3OR7C 2IW5A 4LFCB 1MMMA 4DK1A 4B3TB 1VF5B 3CHXA 3AG4B 1XNQB 3CRQA 3LSSA 4GX1A 5CBHA 3H1HH 1IBMB 1FS0G 3ETEA 3ABLB 4H13B 4MT8A 2W0FC 4YHHO 1KKDA 3W7UA 2QSAA 4GZRB 1K33A 3AG2B 1EFRG 2GV9A 2UUBO 4TV9A 4B3TO 4N23A 3TGUH 4LF8O 3E35A 5H2FZ 3ABLC 2VQFO 3RW0A 1WJZA 2IJJA 2F95B 3CCVV 5A2QN 1QVFU 2A79B 5FPOA 2UUCB 4LF4B 1ZSPA 3VOUA 2ZD9A 1AI6A 2E5LO 4UCVA 4JI0O 1YF2A 1B3QA 3KZIZ 5LXTA 3APQA 4YJ2B 4FM0A 5JWPA 5JJJB 4IYHA 2WWWA 1IZ3A 3DXRB 2CGNA 3AG3C 1EZJA 2Y4TA 1H2MA 5LHHA 2OCCB 4DV2O 3JD3A 1K34A 3CEIA 4XDLA 4YJ2A 4WFHA 5JCOC 2WLMA 1N34B 2ODMA 3R66A 1SQXH 4J42A 1FJGB 3K5NA 2Y69B 3LNMB 1ZX3A 1F51A 3WG7C 5LGNA 4ZIBA 2JJ2G 2XUMA 3NXSA 3H1IH 4CBCA 1N32B 1H2NA 3OTOO 1DK1A 1OCRC 4EKWA 4X1IB 3ZBHA 1D2DA 2ZM6B 1B6QA 5IYCO 3CP1A 5IJ9A 1N0JA 3H1LH 3N27A 2WAMA 3G67A 4DR4O 4CC5A 3JATB 2ZINA 1TUEB 3E22A 3FD9A 1FYJA 2Q8VA 2VQFB 5BMVA 1LNQA 2UXDB 1R3KC 4MW8A 4YXWG 1GN3A 1ZL8B 2K9PA 4PA3A 2YXYA 1KYOF 4XBFA 3CCLV 3CJHA 4GT1A 4TV8B 2YI8A 2FMLA 3E86A 3L73H 3SDLA 5LP6B 2UXNA 3Q4HA 1SS3A 1ROPA 2DYSC 3BCCH 3RYIA 5KHGA 2BTOA 4ABMA 3ZMZA 3OGCC 1GM7A 2A7WA 2XT9A 4YIOA 1NI8A 5BZBA 3LDCA 4GX2A 4PDLA 2CUGA 1G4YB 1VQ5V 4MVOA 1WAZA 4JI5B 5KX5B 5BR8B 1Y74B 4DR6B 1P49A 4FPPA 5L3DA 1XILA 5JJEB 1VMGA 5EK0A 1PL4A 2EULA 3C3SA 2Q73A 4PA6A 5B1BB 2LW7A 1V54C 1GM9A 1TA8A 2BSKB 4TUYB 4X89A 1U97A 1AP6A 3UQ8A 4FLYA 2P6JA 4LNUB 1WPXA 3F7VC 3JALB 2JIZG 4FZ0A 1PP9H 2H94A 5JJNB 5CA1B 2WA4A 4DV5O 2LGWA 4LCUC 1M90W 3FYIB 1IURA 5IWAO 1XMOO 1R1BA 2BOBC 2R70A 3HB3B 3M8AA 2IM9A 1EN6A 2ZM6O 2ZIOA 3RN4A 5KLVH 3K5MA 3VQWA 5IY5C 1GN2A 3BVOA 5EC1C 4B3RO 1JPXA 3JCZA 3G4SV 4JI4O 3K5OA 4P9OA 1JX9A 5LYJB 3JD2A 4PD4F 1Y6XA 5J2UB 4JI2B 4E4EA 1QQCA 3BABA 3P3PA 4JASA 2EJRA 3OUFA 1S3JA 2D2CB 4I9WA 4O2BA 1L1FA 5GTIZ 2GDSA 1THZA 4I50B 2EINB 3B2EE 1HNZB 2XAJA 2JS5A 1AVMA 4DV6O 4PA9A 4PA4A 1SESA 1M4UA 1FXVA 1Q5OA 1I0HA 3ZRWB 2CH7B 3SJAC 1CPYA 1XHZA 1NTZH 5F2VO 2UUCO 5FNVB 1Q7YW 4KL1A 2PGGA 2QWNB 4JTDB 2CTPA 3L71H 3CXHF 3K08A 2B5UA 3B4SA 5LA6A 4YJ3B 3JAWB 4EB6B 1SERA 2OIEA 4JTAB 1Q43A 4X1KB 4TQFA 2C2AA 1ZLZA 2NN4A 3OMNB 4R7CA 5E1AC 3MAQA 4XDJA 3EHBB 2IH1C 2V4DA 3OR6C 4O2AB 2NNUA 4QIWF 1PM9A 1QR8A 3H1KH 3QTCA 3SGIA 3CJHB 3ZHQA 5H6QA 4U7NA 4DR2B 1XOUA 4NXNO 5HFMA 3WU2Z 3OUSA 4HNAB 2ZCEA 2DWDC 2ZNIA 1TVKB 1LUWA 2WLLB 4LFBO 3K06A 1NT2B 4F4LA 5K1PA 4K0KO 3RT3C 4Z1MG 4DUZO 2PYJA 4LH6A 3UCSC 5CB4A 1FFXA 2HG5C 4NB5A 4GKJO 4JI2O 1JVMA 4DV4O 4DR7O 4X1IA 5EIBC 3OEEG 2XOKG 4CS2A 1SZXA 1GN6A 3OAAG 1JMKC 3ZCCA 4WCEV 3D3IA 5CBFA 2IJKA 5D5PA 3CCMV 1M57C 2W0XA 3HPLC 2QKAA 1AB3A 2F93B 2QEXV 3PN1A 4MVRA 4HYOA 5LMNB 1PNLA 1IBMO 3CRCA 4PJ0Z 3ZRXA 4X64O 1Q6IA 2FKXA 1JJOA 1OV9A 2E3CA 3QF7A 1E1QG 1GN4A 4UCSA 1NH2D 1SKVA 4WFBV 5H6RA 4DV3O 2F4VB 1IBLB 1D5NA 2W6IG 2X7RB 1QCEA 4IL6Z 4LFAB 4CH5A 1SQBH 4LFCO 3K0DA 3JAWA 1R3IC 3K04A 2Y0IA 3SR2C 2LW1A 1H2SB 3N2GA 1NQTA 2UU9O 2OWOA 4DR5B 1NTKH 3K58A 1MSWD 2UUAO 2AZ0A 2P06A 1VP7A 1OCOB 4FM2A 3ABUA 5LGUA 4ZOLA 2Q0OC 5CMUA 4LF6B 2JGUA 4A5UB 1XMQO 5B66Z 1WP7A 3TJTA 5C8YB 5J2TA 3SPIA 1SA0B 1YHQV 2Q0AA 4DR7B 1E1RG 3CSXA 4GX5A 1BHBA 2QJ1A 2EILB 1JA8A 4DRXA 4JF3A 2F66C 2CTQA 1SZTA 4B3RB 4J41A 3BHPA 4LF4O 2JEUA 5H9CA 1XMQB 3RYHA 5KA5A 4LF5O 3AG3B 3LNNA 1EM1A 2GBOA 2GTAA 2XNDG 4FFBA 3JARB 1NS1A 4I55A 2X6AA 1Q6HA 1AR5A 1FAFA 4JI6B 2OIGA 3CRRA 2IU3A 4IYIA 4ZOLB 4MVQA 5IE9A 4FLTA 4PDVA 2RMKB 3CXCU 1SQQH 2ITCC 4LF5B 4DV3B 3SPJA 3QO8A 1B06A 2FB5A 3HKCA 3ASNC 3ETQA 5LL6Y 3AG1B 5IDJA 4MVZA 2P22C 3K9AA 2UU9B 3OMIB 3OTFA 1M9NA 3HKCB 3T1YO 1H8EG 4TUYA 4ICGA 3K57A 1JJ2U 5IYZB 2HFEC 2H8PC 2KKWA 4DO2A 1YITV 1IXBA 2LJ2A 4MSWC 4I9QA 4D7TA 2Q69A 4X1YA 3A8TA 4YIPA 4UVBA 2CTRA 3KCXA 1ZUQA 2UXCO 4DR4B 4QE7A 4O4IB 4QJFB 1JCHA 4C7UA 3E8HA 1ZWIC 2FTKA 2JVDA 4B08A 1KD1W 1KECA 1YZBA 1QHTA 1IBLO 4FLUA 4MVSA 1NTMH 1Y67A 4K35A 2KG7A 5KMGA 2YDEA 3U11A 1DGSA 1NVPD 3S3WA 3STLC 4KHPB 4UUJC 2DE0X 3TK1A 2A3QA 1I08A 2QM7A 4HBNA 1ZL8A 2EZPA 3EVKA 2DJVA 5BMVB 2UUBB 5CA1A 1I7FA 5EBMC 3D36A 5BR8O 3B09A 1TUBB 1BGYH 2Q7HA 5C8YA 5B1BC 2QKCA 1IX9A 4NTXA 4UVAA 1F23A 1RSOB 2IH3C 2HKOA 2P5OA 2ZQMA 1MSDA 2GUZA 1G6UA 2Z0AA 3ZMTA 2XAQA 2Q6AA 4JYYA 4K3AA 2UXBB 3HKDB 2VQEO 3DC6A 1N33O 3D36C 3GWKC 5D5QA 2ITDC 3RVZA 1SETA 3J80N 3RYFB 4B3MB 1YXBA 2HEPA 1GRJA 4H33A 3UKMA 2YSUB 3VBBA 3ZS8C 2XAHA 3BY6A 1XQ8A 1IVSA 4U3JB 3A2FA 1BQ0A 4BW5A 4MTFA 1V54B 5BY1A 4DUZB 3LDEA 4NKGB 1PKXA 1MNGA 3BA8A 5JCOA 5IYBO 2LQTA 1GH6A 5JH7A 1GKFA 4I0XA 1N33B 1AI5A 1SQFA 4B7EA 2UXCB 4U3FH 4DUYO 3SPGA 3W7XA 1AROP 1YIJV 1XHXA 5CA3A 4GLXA 3JD0A 3P30A 3ABKC 1U96A 2JJ1G 4MVMA 2WLIB 4Q6GA 3ZMVA 4WFEA 2GHYA 4RUEA 5B5EZ 3T4DA 1AI7A 2Q7EA 1HW7A 5B3SC 2RCVA 4KHPO 1FKAO 1GTOA 4MS2A 2MK3A 1QR9A 4P9PA 1Z5VA 1WP8A 2X6BA 1QLEC 2QGNA 1HNWB 1FD9A 2GTSA 5H5NA 3WB1A 4L87A 1GK9A 4OGQB 2ZIMA 1N0NA 5CBGA 1VQ4V 1BHAA 1PNMA 4QPJA 1UPGA 2ZT9B 2F1MA 4DR3O 1HNZO 2DOSA 4J9YB 1KQSU 1Y76B 1GO3F 4JAVA 1I94O 1K8AW 3ABMC 4R6ZA 4LFBB 1TVKA 4JI7O 2V1DA 1S5JA 4PV1B 3H1JH 1BQZA 2DW4A 4FFKA 4L8JA 3PJSK 2EIMB 4O4HB 1DF5A 3JASB 1YDXA 3RBZA 3T4ZA 3TETA 3U10A 2QR4A 4IHJB 2E75B 4X9QA 3A0BZ 4UXNA 3FB8C 1O9GA 2BSKA 2HVKC 1HP8A 2NLJC 4UVCA 2P90A 3B8MA 2OT5A 1SQPH 4UV9A 1US6A 4GUNA 3U0ZA 4LF7B 1MZFA 1Y74A 1AP5A 3ASOC 3J81N 1QBZA 1WNSA 3MD0A 4WF9V 2AXTZ 2CH7A 4DV5B 4CC6A 1OCRB 3ZRWA 1K92A 3QG5A 4QGPA 4I55B 3RYIB 1ENVA 5L3CA 1BMFG 3S3XA 3UT5A 3WG7B 3CYOA 4JI6O 3LSQA 2YIBD 4J7ZA 4IIJB 3CPWU 4TQDA 3ZRSA 1HNWO 3CB2A 3RWRD 4X1YB 1P7BA 1PNKA 2DQ0A 4AQYO 5LBQA 1M93A 1QU7A 3JATA 1PPJH 1T5EA 5KA6A 3WB2A 2ZE5A 4X66O 4DR6O 5IJ0B 3ZHRA 5FL7G 5ITZB 3E8GA 4JYCA 5JVDA 4U7OA 4X8AA 3JD1A 2OYQA 2P4VA 1Y4MA 4X65B 4MVUA 3NR7A 3A0HZ 3C3TA 3E8BA 2EIJB 3OT7A 1XEQA 5GTHZ 1FFTB 4BIOA 4FLZA 4DV1O 1YEWA 3ZMUA 1YSCA 2JK5C 2WLHA 2Q4PA 2E74B 4NYKA 4CS3A 2WPDG 2Q9LA 3ASOB 1DTOA 5EBWC 1VF6C 1Y76A 1G1XB 1I5YA 2EIKC 3APOA 2XTAA 1Q8IA 1EBOA 2HHHO 1MABG 4BW9A 1I5XA 4X20A 4LWSA 5B1OA 3SYQA 2QM4A 3FB7C 3H01A 4LF7O 3CC4V 3Q4HB 4FK5C 1K3EA 1XREA 4KXRA 2V7QG 5B1AC 5LGTA 5L3FA 1GM8A 4IT5A 1ZTEA 5CA0B 3K59A 4UCOA 3G6EV 4B3SO 3BAAA 1F7YA 4DUYB 4FVMA 1RPRA 3ZMSA 1OCCC 4DV7B 3OGIB 3FAVB 1H8HG 1BCCH 1VQ9V 5DECA 4CH6A 4XDKA 5J2TB 3IAYA 4GX0A 2CGOA 1IBKO 5EZYA 2UXDO 1FFXB 1R6KA 1M56C 4AILC 2N05A 1VF6A 2H3OA 3JAKB 4I0XB 1WA8A 5EYPB 2ILMA 4PA7A 5IWAB 4GYCB 5AG2A 2WLNA 1Z5WA 4BR6A 2ZE7A 4O4LB 3UM7A 2OCCC 4DK0A 1NU1H 3THOA 4JAUA 4U3JA 1P7GA 4DV4B 2JEXA 1OHHG 3ML0A 3HKBB 1RM1C 1B04A 4X65O 5EBLC 5JH7B 1MOFA 2FL4A 3HKDA 3K9SA 4Z2WA 4PELA
chains in the Genus database with same CATH topology
1AI4A 4QE9A 1YJ9V 3SPJA 4H37A 1SRYA 1EZJA 3QO8A 5LHHA 1F4MA 3SPCA 2OCCB 3JD3A 1K34A 1Y66A 4XDLA 1YTFD 3B77A 2EZOA 3SPHA 1YJWV 4WFHA 1NKDA 1V55C 3ASNC 3ZJZA 2WLMA 3OE7G 2OTJV 3AG1B 5IDJA 4MVZA 2Y69B 3LNMB 2YEVA 3I55V 3K9AA 3R65A 5C93A 1F51A 3WG7C 2F43G 4UV8A 5LGNA 1FXKC 2JJ2G 3OMIB 1NR7A 3NXSA 4WFFA 1M9NA 1W0JG 1H8EG 4CBCA 3LDDA 1YJNV 3GWOA 3AG2C 2WLKA 3W7TA 1OCRC 1JJ2U 2HFEC 2H8PC 4EKWA 4DO2A 1YITV 2B1GA 2DWEC 2LFRA 2R9IA 4MSWC 1B6QA 2Q69A 5IYCO 3CP1A 4UVBA 4RUFA 2WAMA 1AJPA 2HLDG 4RO2A 4QE7A 4QJFB 4R8CA 1JCHA 2EIJC 4LBEC 4E2LA 3E8HA 1TUEB 1ZWIC 2FTKA 1K4DC 1KD1W 1HWYA 1VQ6V 2DQ3A 1KECA 3FKSG 1XL4A 5B3SB 4RQFA 3CCEV 4PDRA 5EC2C 3SYOA 5J9PC 1LNQA 1R3KC 4MW8A 4YXWG 4MVSA 1AR1B 4TWKA 2WLIA 4PA3A 2ZXWC 1J95A 1NVPD 3E83A 1M57B 4XBFA 5L3EA 3STLC 1VQMV 4UUJC 3A0RA 3CCLV 4GT1A 3TK1A 2DYSB 4ZBMA 3E86A 2QM7A 3E89A 2M7WA 2EZPA 1DF4A 2UXNA 1K5QA 1V55B 1ROPA 2QE7G 2DYSC 1PL0A 3FYEB 5EBMC 3D36A 3OGCC 1GM7A 3ZMZA 3K0GA 2ZR3A 5BZBA 3AEIA 3LDCA 5LHGA 4GX2A 5B1BC 4PDLA 1G4YB 3P32A 2HR3A 1VQ5V 4MVOA 4UVAA 2B1IA 1RPOA 1F23A 2IH3C 2HKOA 2ZQMA 1YI2V 4FPPA 5L3DA 2IU0A 3IFXA 1Q86W 1F4NA 5EK0A 1KP3A 3ETDA 4MW3A 2ZDIA 4PA6A 5B1BB 2XAQA 2Q6AA 3ZMTA 1V54C 3ZN0A 4QNHB 2QA4V 1GM9A 2AHYA 2Q67A 2ITDC 3G71V 3RVZA 2EINC 1SETA 1IXMA 4MTGA 2PI5A 3CCSV 1MG1A 2XAGA 4X89A 1GMGA 5GW7A 2HJFC 4H33A 3UKMA 2P6JA 5DN6G 1WPXA 3F7VC 2YSUB 3VBBA 2XAHA 1G8MA 3BY6A 1K5SA 1K73W 2JIZG 3ABKB 4N21A 4BW5A 2IJHA 2H94A 4MTFA 1V54B 4LCUC 1M90W 2EIMC 1XL6A 2Y48A 1PKXA 1AJNA 3FYIB 3LDEA 3CD6V 5IYBO 3ABTA 1S0VA 1GKFA 1NJIW 3ZRVA 1AI5A 2BOBC 2Y69C 1K4CC 4JPRA 3SPGA 1AJQA 2Z3YA 3JYCA 3W7XA 3HB3B 1OZ0A 1CP9A 1AROP 4TT3G 3SJQC 5IY5C 1YIJV 1P4RA 4P30A 5CA3A 5EC1C 5L3GA 1VQPV 3JD0A 3P30A 3ABKC 3CCQV 2JJ1G 4MVMA 2WLIB 3ZMVA 1VQLV 1JPXA 2P67A 3JCZA 3K79A 2GHYA 4HZ3A 4WFEA 3AG4C 4RUEA 3G4SV 4DXWA 3T4DA 1AI7A 4P9OA 3K03A 2WSSG 3DTUB 3ABMB 5B3SC 3T2MA 1GTOA 1JX9A 4MS2A 3JD2A 2MK3A 2A0LA 4MTXA 4TSFG 1QR9A 1DLBA 4P9PA 1OCZB 1PD3A 4JASA 2EJRA 2X6BA 1QLEC 3OUFA 4ZKIA 1S3JA 3QO5A 4I9WA 4L87A 1JOYA 1GK9A 1L1FA 4WFAV 1THZA 5CBGA 1VQ4V 3WFVA 1PNMA 4QPJA 1NH2B 4RQEA 1BHAA 2EINB 1R3LC 4KFMA 3STZC 1QLEB 2Z5UA 4J9ZB 3SYPA 4J9YB 2XAJA 3IC7A 1KQSU 3E2EA 1GO3F 2YEVB 3QO7A 1FXKA 2ZXWB 2ZDIC 4PA9A 4JAVA 1SESA 4PA4A 1K8AW 5KUKA 3ABMC 2K1EA 1FXVA 4R6ZA 3ZRWB 3TCUA 1M56B 3MHHC 4JGSA 1CPYA 2V1DA 1S5HC 1NVPB 1Q7YW 2DW4A 3PJSK 2EIMB 1UJWB 3T1CA 3SYAA 1COWG 3M99B 3W7WA 4JTDB 4FJCC 1DF5A 2UXXA 1NBMG 3RBZA 3T4ZA 1Q81W 3K08A 2XAFA 4QPKA 1OCCB 2B5UA 3TETA 5LHIA 1VQOV 1K97A 1ORQC 1E79G 2WLJA 1BL8A 1SERA 4JTAB 3ZN1A 3CC2V 2QTOA 4Q20A 4UXNA 2R9RB 3FB8C 3FB5C 2C2AA 2Q68A 3OMNB 2HVKC 4R7CA 5E1AC 3X2QC 4XDJA 3EHBB 2NLJC 4UVCA 2P90A 2IH1C 3B8MA 2OT5A 3OR6C 2NNUA 4QIWF 4G2KA 1QR8A 2BOCC 3X2QB 4UV9A 2QM8A 2PI4A 5H6QA 4U7NA 2HVJC 4LP8A 1R3JC 3F7YC 3ASOC 4WFGA 1S77D 1H38A 5HFMA 1VQ8V 1QBZA 3OUSA 3MD0A 4FIPC 4WF9V 2DWDC 3DGEA 1OCRB 3ZRWA 1K92A 2WLLB 2ATKC 4BIUA 2QKSA 3K06A 3K3WA 2P7TC 3CCRV 1ENVA 4F4LA 1N8RW 1VQNV 5L3CA 1BMFG 2X6CA 3OFNG 2LP7A 4Z1MG 3WG7B 3CYOA 2X0LA 4GCZA 3JD4A 2ZR2A 1VQ7V 3LSQA 2HG5C 4BAYA 3CMAV 2A9HA 2OTLV 3I56V 4R50A 3W7SA 1JVMA 3CPWU 3B8NA 3KG2A 3OEEG 2XOKG 3ZRSA 4I5SA 4MTOA 3OAAG 3SYCA 3ZCCA 1P7BA 4WCEV 1PNKA 2DQ0A 3D3IA 2IJIA 5CBFA 5LBQA 4G28B 2IJKA 3CCMV 3GB7C 1M57C 5KA6A 1OCZC 3HPLC 2WLLA 3FB6C 5FL7G 5B1AB 2QEXV 1QVGU 2DYRB 4MVRA 1WLEA 3E8GA 4X88A 2EIKB 4HYOA 4OXSA 4JYCA 3QNEA 4U7OA 1QLNA 4X8AA 1PNLA 3JD1A 1M1KW 3ZIAG 3ZRXA 4CZZA 4PDMA 1Y4MA 4MVUA 3OW2U 2KB1A 5IYDO 1K9MW 3E8BA 2EIJB 4JTCB 1FFTB 1S72V 3ZMUA 1Q82W 1E1QG 1YSCA 2JK5C 2WLHA 3CC7V 1VQKV 1CEZA 2AHZA 4P2ZA 4LC1A 5IY5B 1NH2D 1K7DA 4WFBV 5H6RA 2WPDG 3ASOB 1DTOA 2W6IG 1H2GA 2X7RB 5EBWC 1QCEA 5CN0A 1W2BU 1KC8W 3OM3B 3MHSC 1I5YA 2EIKC 3K0DA 1R3IC 3K04A 1EBOA 4G27B 1MABG 4BIZA 1I5XA 1JQ0A 2W6JG 4ASUG 5B1OA 1NQTA 3OR7C 5KUMA 3SYQA 2IW5A 1R6NA 3CCJV 3FB7C 3H01A 1MSWD 3AG1C 5L3BA 3CC4V 1RM1B 3ASNB 4FK5C 1K3EA 1OCOB 3ABUA 2V7QG 5LGUA 3AG4B 5B1AC 4JYBA 5CMUA 1YTFB 3LSSA 4GX1A 5LGTA 1R73A 5L3FA 1GM8A 3E8FA 5CBHA 3BEHA 4RAIA 1FS0G 3ETEA 3ABLB 1FXHA 3G6EV 2GSMB 4MT8A 3SPIA 2W0FC 1FXKB 3OMAB 1KKDA 2JDIG 3IGAC 1W0KG 3W7UA 1YHQV 1RPRA 5B1NA 3ZMSA 1OCCC 3CCUV 1K33A 1H8HG 4KP4A 3AG2B 1EFRG 1E1RG 2EBOA 4GX5A 1VQ9V 1BHBA 2EILB 4XDKA 2DYRC 4JF3A 4N23A 2D3OW 3E35A 1SZTA 2CK3G 3ABLC 4GX0A 3RW0A 5HFLA 1R6KA 1M56C 2JEUA 5H9CA 2IJJA 5KA5A 4PA7A 3AG3B 3CCVV 2XNDG 1OCOC 2WLNA 1QVFU 4HAMA 2A79B 1KP2A 1S76D 3UM7A 3LUTB 2X6AA 2OCCC 2XASA 3VOUA 2ZD9A 4JAUA 1AI6A 4KUMA 2LFSA 2IU3A 2EILC 3ETGA 2JEXA 4FMTA 4MVQA 3CMEV 1OHHG 1NR1A 3ML0A 1RM1C 5DM6V 3OEHG 3EFFK 3RVYA 5EBLC 3F5WC 4PDVA 2WWWA 1MOFA 3CXCU 3AG3C 2ITCC 4PELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PA6 A;  4JTC B;  4QE9 A;  2Q6A A;  4H37 A;  3SPJ A;  1V54 C;  3SYA A;  3T1C A;  4QNH B;  2AHY A;  4JTD B;  3SPC A;  2Q67 A;  2ITD C;  2JK5 C;  2WLH A;  3RBZ A;  3RVZ A;  3T4Z A;  3K08 A;  2EIN C;  4MTG A;  3TET A;  4XDL A;  2AHZ A;  4P2Z A;  1ORQ C;  3SPH A;  4WFH A;  3ASN C;  1V55 C;  2WLJ A;  1BL8 A;  4X89 A;  3ZJZ A;  2WLM A;  4JTA B;  2QTO A;  2HJF C;  4H33 A;  3UKM A;  3F7V C;  5EBW C;  2R9R B;  3FB5 C;  3FB8 C;  4MVZ A;  3LNM B;  2YEV A;  2Q68 A;  3R65 A;  2HVK C;  4R7C A;  5E1A C;  3X2Q C;  4BW5 A;  3WG7 C;  4MTF A;  4XDJ A;  2EIK C;  2NLJ C;  3K0D A;  1R3I C;  4LCU C;  3K04 A;  4WFF A;  2IH1 C;  2EIM C;  1XL6 A;  3LDE A;  3OR6 C;  4G27 B;  4CBC A;  3LDD A;  2BOC C;  3OR7 C;  5KUM A;  3AG2 C;  3SYQ A;  2WLK A;  1OCR C;  3FB7 C;  2HFE C;  2BOB C;  2H8P C;  3AG1 C;  4EKW A;  2Y69 C;  2HVJ C;  1K4C C;  4LP8 A;  3SPG A;  2DWE C;  3JYC A;  1R3J C;  3ASO C;  3F7Y C;  4WFG A;  4MSW C;  2Q69 A;  3OUS A;  5B1A C;  3SJQ C;  5IY5 C;  4P30 A;  4RUF A;  2DWD C;  3PJS K;  4GX1 A;  5EC1 C;  5CBH A;  3E8F A;  4RO2 A;  2WLL B;  2ATK C;  3BEH A;  4QE7 A;  4RAI A;  2QKS A;  3ABK C;  4R8C A;  3K06 A;  4MVM A;  2WLI B;  2EIJ C;  2P7T C;  4F4L A;  4WFE A;  4LBE C;  3E8H A;  4HZ3 A;  1ZWI C;  3SPI A;  2W0F C;  3AG4 C;  2X6C A;  4RUE A;  4DXW A;  1K4D C;  1KKD A;  3IGA C;  3T4D A;  1XL4 A;  4PDR A;  5EC2 C;  3SYO A;  1OCC C;  4P9O A;  3K03 A;  5J9P C;  5B3S C;  2HG5 C;  1LNQ A;  3T2M A;  4GX5 A;  1R3K C;  2A9H A;  4MW8 A;  4MVS A;  4MS2 A;  4XDK A;  2A0L A;  4TWK A;  4R50 A;  2DYR C;  2WLI A;  4P9P A;  4PA3 A;  2ZXW C;  1J95 A;  1JVM A;  3ABL C;  4GX0 A;  3E83 A;  3STL C;  2X6B A;  1QLE C;  3RW0 A;  3KG2 A;  3OUF A;  4UUJ C;  1M56 C;  3ZRS A;  4I9W A;  4MTO A;  4ZBM A;  3E86 A;  3SYC A;  3E89 A;  1P7B A;  4PA7 A;  1OCO C;  2WLN A;  2A79 B;  5CBF A;  5CBG A;  4G28 B;  2DYS C;  4KFM A;  1R3L C;  3UM7 A;  3LUT B;  2X6A A;  5EBM C;  3STZ C;  2OCC C;  4J9Z B;  3GB7 C;  1M57 C;  3OGC C;  3SYP A;  1OCZ C;  3HPL C;  2WLL A;  2ZD9 A;  4J9Y B;  3VOU A;  3K0G A;  3FB6 C;  5BZB A;  3LDC A;  2EIL C;  4GX2 A;  4PA9 A;  4PDL A;  4MVR A;  4PA4 A;  5B1B C;  1G4Y B;  3E8G A;  4MVQ A;  4HYO A;  4OXS A;  4X88 A;  4MVO A;  5KUK A;  3ABM C;  2K1E A;  4X8A A;  4R6Z A;  4PDM A;  3EFF K;  4MVU A;  2IH3 C;  3RVY A;  3TCU A;  5EBL C;  2KB1 A;  1S5H C;  3F5W C;  3IFX A;  4PDV A;  5EK0 A;  3AG3 C;  2ITC C;  4MW3 A;  3E8B A; 
#chains in the Genus database with same CATH topology
 2NR5 A;  1AI4 A;  4QE9 A;  1YJ9 V;  4NXM B;  1S5L Z;  4H37 A;  1SRY A;  3JSL A;  3SPC A;  3JAS A;  2PF4 E;  1UFI A;  3B77 A;  2EZO A;  3HKB A;  1YJW V;  4DR1 B;  3ZJZ A;  3FFQ A;  1VIB A;  2OTJ V;  2YEV A;  3I55 V;  3R65 A;  5IT9 N;  2F43 G;  1FXK C;  1GAX A;  4O4L A;  4FLX A;  3AK1 A;  3LDD A;  4FZ1 A;  3AG2 C;  3W7T A;  3RFR A;  3L70 H;  4OX9 O;  2B1G A;  2N04 A;  2R9I A;  2XHB A;  1AJP A;  2HLD G;  2WA3 A;  2M6Y A;  2EIJ C;  4LBE C;  4PI2 A;  4E2L A;  3ICX A;  4K8Z A;  4GKJ B;  1VQ6 V;  5CB4 B;  2DQ3 A;  1XL4 A;  1KBH A;  4RQF A;  2VS0 A;  5J9P C;  4LF9 O;  2CE4 A;  4B3M O;  4DV1 B;  3H9V A;  4TWK A;  2WLI A;  3ZX6 A;  1J95 A;  2B9Z A;  4X62 B;  1VQM V;  2CAZ C;  4UFZ A;  4IGG A;  4ZBM A;  3E89 A;  3BFR A;  1K5Q A;  2QE7 G;  2YI9 A;  4J7K A;  3FYE B;  1PL0 A;  1BT8 A;  1Q90 D;  4DR2 O;  5LMN O;  4X64 B;  3AEI A;  4FM1 A;  1XNR B;  2EX3 A;  2HJD A;  3T1Y B;  1NZ6 A;  3CX5 F;  2HP8 A;  2RDC A;  1YI2 V;  4WBN A;  2P4K A;  3JAM N;  3N2K A;  1Q86 W;  1F4N A;  1KP3 A;  1JR9 A;  3VQX A;  4YJ3 A;  2ZDI A;  4EFB A;  3CS5 A;  4Z1V A;  3DC5 A;  2Q67 A;  3HKE A;  3G71 V;  2EIN C;  3VQV A;  1IXM A;  1L0L H;  1MG1 A;  2XAG A;  3EXA A;  5FNV A;  5GW7 A;  5DN6 G;  1L8D A;  4H0L B;  1G8M A;  1K73 W;  2KQX A;  3ABK B;  3O65 A;  4N21 A;  2IJH A;  3M7M X;  2ZKO A;  2QWP B;  2Y48 A;  4CH3 A;  3CD6 V;  4F6E A;  1AJN A;  2BCC H;  4OPH A;  1S0V A;  3HKE B;  1NJI W;  3C90 A;  1K4C C;  4JPR A;  3JYC A;  3K5L A;  4TT3 G;  4P30 A;  2JGD B;  5L3G A;  4GKK B;  3CCQ V;  1XNQ O;  4AQY B;  3BRC A;  3K79 A;  4HZ3 A;  3AG4 C;  4DXW A;  3ZHV A;  3JSN A;  3SJB C;  4X66 B;  2WSS G;  3DTU B;  3ABM B;  4X62 O;  2QDO A;  2A0L A;  4TSF G;  1DLB A;  5A9G A;  1PD3 A;  4ZI7 B;  5KHI A;  1JOY A;  2Q7G A;  4DV0 B;  4AHC A;  2MW2 B;  1H2L A;  4KFM A;  1QLE B;  2Z5U A;  3SYP A;  1MA1 A;  3E2E A;  1FXK A;  5GON A;  4OX9 B;  1XI1 A;  1YCI A;  3L75 H;  2VWK A;  2ADP A;  3JAL A;  3TCU A;  1WB8 A;  1M56 B;  4JI7 B;  3MHH C;  1S5H C;  4TOI A;  3BPZ A;  3CRA A;  4ZHQ B;  1AIL A;  2UXX A;  4QPK A;  1OCC B;  2G38 A;  5LHI A;  1VQO V;  1K97 A;  1ORQ C;  2WLJ A;  3SJC C;  1LR1 A;  4UCR A;  1WPB A;  3CC2 V;  2QTO A;  2JRI A;  2R9R B;  5LOV A;  3FB5 C;  3L9D A;  4JI8 B;  1URF A;  1X59 A;  1XMO B;  2PZS A;  3TXQ A;  4ZHQ A;  4RWU A;  4G2K A;  2BOC C;  1SQV H;  1VEW A;  2IBZ H;  1FPO A;  2PI4 A;  3JAR A;  3F7Y C;  1S77 D;  1H38 A;  1VQ8 V;  3T1H O;  2GUZ B;  2FYU H;  4FIP C;  2UUA B;  4DR3 B;  4J10 A;  1L0N H;  2ATK C;  4IIJ A;  2QKS A;  3GVM A;  3G6B A;  1MZE A;  3CCR V;  1VQN V;  1N8R W;  2X6C A;  2LP7 A;  2X0L A;  3JD4 A;  2A9H A;  2PY5 A;  1WA8 B;  4DV0 O;  3W7S A;  3JAK A;  5E79 Z;  2DN9 A;  4W4K A;  3DSQ A;  3KG2 A;  4I5S A;  3TXS A;  4MTO A;  3SYC A;  4PI0 A;  4O2A A;  2YC0 A;  2PTM A;  3KCY A;  2PUS A;  1J5E B;  4G28 B;  3I5D A;  1ZAU A;  1Z2G A;  3GB7 C;  2AZ2 A;  3AK2 A;  2WLL A;  3FB6 C;  4NTY A;  1QVG U;  4X1K A;  4EB6 A;  2EIK B;  4OXS A;  3QNE A;  4UCU A;  1M1K W;  3IC9 A;  5K1X A;  4DR5 O;  1IDS A;  2Q5Z A;  1JFF B;  1VF7 A;  3OW2 U;  5IYD O;  1K9M W;  4I4T A;  2R9A A;  4JTC B;  5FPR A;  1S72 V;  4FLV A;  1JFF A;  1PV0 A;  2Y0P A;  1VQK V;  1CEZ A;  4OPA A;  4X20 B;  5IY5 B;  4LC1 A;  1K7D A;  1HR0 B;  1KU9 A;  3DXR A;  2BE3 A;  2CTW A;  1H2G A;  5LA6 B;  1TUB A;  2F23 A;  1KC8 W;  3OM3 B;  2QWQ B;  4JI1 O;  4F6R B;  3HR0 A;  1V9P A;  4K8X A;  4BIZ A;  4NXN B;  3T1H B;  1JQ0 A;  5KUM A;  2ZE8 A;  1R6N A;  3CCJ V;  4LF9 B;  3AG1 C;  5L3B A;  1RM1 B;  4JV5 O;  3ASN B;  1CXZ B;  4JYB A;  1QNM A;  4PHZ A;  1YTF B;  1SQG A;  4JYA B;  1R73 A;  3E8F A;  4BWA A;  3BEH A;  3L72 H;  3FAV A;  4RAI A;  1FXH A;  4I50 A;  2GSM B;  4B3S B;  1FXK B;  3OMA B;  2JDI G;  3IGA C;  2AGA A;  1W0K G;  5B1N A;  3CCU V;  2QWR B;  1TGO A;  2EBO A;  3FX7 A;  2ETN A;  5BXZ A;  2DYR C;  2D3O W;  2CK3 G;  5HFL A;  2OCH A;  5LP6 C;  1OCO C;  4H44 B;  4HAM A;  3ZHU A;  1KP2 A;  3D3Q A;  1S76 D;  3LUT B;  2ZNJ A;  3BA9 A;  2DMX A;  2LGQ A;  2XAS A;  3UT5 B;  4KUM A;  2LFS A;  3CRM A;  5LOV B;  2ADQ B;  2EIL C;  3ETG A;  4FMT A;  3CME V;  2HHH B;  2LO1 A;  1NR1 A;  2RQ6 A;  1KKC A;  5DM6 V;  5KAI Z;  3OEH G;  3EFF K;  3RVY A;  2JGD A;  3F5W C;  3MDS A;  1N4C A;  1EN5 A;  4KP4 A;  3QVN A;  1F4M A;  2ZE6 A;  1Y66 A;  1YTF D;  2QWO B;  4UB8 Z;  5KX5 A;  3SPH A;  2UXB O;  1XDC A;  1NKD A;  1V55 C;  4DR1 O;  3OE7 G;  2YIA A;  4DV2 B;  1RSO A;  4GKK O;  4DV7 O;  5C93 A;  4UV8 A;  1NR7 A;  4YY3 O;  1N34 O;  4WFF A;  1EZV H;  1W0J G;  5FLX N;  4JV5 B;  5LP6 A;  1YJN V;  3GWO A;  2WLK A;  4O4H A;  4LF6 O;  4ZI7 A;  1I94 B;  2DWE C;  2LFR A;  3KKY A;  2E5L B;  4DRX B;  2VRZ A;  4RUF A;  2KSD A;  3ZHS A;  2L35 A;  4RO2 A;  2A06 H;  4R8C A;  4O4J A;  4NVP A;  2YXL A;  1K4D C;  4NR1 A;  1HWY A;  1XBL A;  3FKS G;  5B3S B;  3CCE V;  2CDY A;  4PDR A;  4TV8 A;  5EC2 C;  3SYO A;  1AR1 B;  4J7J A;  1WB7 A;  2ZXW C;  4O4I A;  3E83 A;  1M57 B;  5L3E A;  5KHH A;  3A0R A;  1FJG O;  2QTS A;  2DYS B;  3N2G B;  2M7W A;  1DF4 A;  1A32 A;  3B40 A;  3AK3 A;  1V55 B;  1XNR O;  3AG7 A;  1BS3 A;  3UO2 A;  5CA0 A;  4JZ2 A;  3K0G A;  1AR4 A;  2ZR3 A;  1IBK B;  4LH7 A;  1RP3 B;  5LHG A;  4DW1 A;  5IJ9 B;  4F6R A;  3P32 A;  2HR3 A;  2B1I A;  2BTQ A;  1RPO A;  4EFE A;  1Q3E A;  2IU0 A;  3G80 A;  3IFX A;  4HNA A;  4JYA O;  4LWS B;  2Y4U A;  3O9O A;  3ETD A;  4MW3 A;  3ZN0 A;  4QNH B;  2QA4 V;  2AHY A;  5JQG B;  3RYC B;  4WBN B;  2JS3 A;  4MTG A;  4JZG A;  2PI5 A;  1X4T A;  3CCS V;  4JI0 B;  1GMG A;  2HJF C;  5LMU O;  1K5S A;  1W59 A;  1SF9 A;  5JQG A;  3RYC A;  4YY3 B;  2EIM C;  1XL6 A;  1KMI Z;  1WN7 A;  2L6L A;  3ABT A;  3ZRV A;  3OD4 A;  4DW0 A;  1D5A A;  2Y69 C;  2BTQ B;  1AJQ A;  2AW9 A;  2Z3Y A;  1OZ0 A;  4I4T B;  1CP9 A;  5GON B;  3SJQ C;  1P4R A;  3RYH B;  4W4L A;  3L74 H;  5IJ0 A;  1VQP V;  3LSU A;  1VQL V;  2P67 A;  2N74 A;  1RFY A;  2YIC A;  1O9H A;  3K03 A;  1SA0 A;  3T2M A;  3E22 B;  1HDJ A;  4MTX A;  4O2B B;  2YID A;  3WB0 A;  4JI4 B;  4D6T H;  1EN4 A;  1OCZ B;  5EIB D;  1OJH A;  4ZKI A;  3QO5 A;  3D8C A;  4JI3 B;  2KG7 B;  4WFA V;  5KMG B;  4D7S A;  5LYJ A;  1KUQ A;  3WFV A;  1NH2 B;  4RQE A;  3VQY A;  1R3L C;  4O4J B;  3STZ C;  4J9Z B;  3IC7 A;  2YEV B;  3QO7 A;  2VWJ A;  2ZXW B;  2ZDI C;  3J7A U;  1BZK A;  5KUK A;  2K1E A;  4JI1 B;  1P84 F;  4JGS A;  4YHH B;  4DYL A;  1NVP B;  1HNX B;  2E76 B;  1UJW B;  3UO3 A;  3T1C A;  3SYA A;  2RN9 A;  1COW G;  5IYZ A;  3M99 B;  3W7W A;  4FJC C;  1Q81 W;  1NBM G;  2XAF A;  1N32 O;  1E79 G;  1BL8 A;  1SC5 B;  3ZHT A;  2EJ7 A;  3ZN1 A;  4Q20 A;  1XUQ A;  2Q68 A;  2RNB A;  1Q6U A;  4LNU A;  3X2Q C;  2O57 A;  2YIB A;  3CE2 A;  5KHJ A;  5LXT B;  1LUV A;  1J5E O;  1KB9 F;  3X2Q B;  4AI8 A;  1YVW A;  3N2K B;  5EYP A;  2QM8 A;  4UB6 Z;  4CH4 A;  2HVJ C;  4LP8 A;  5EZY B;  1R3J C;  4WFG A;  4B7K A;  1H2K A;  1BE3 H;  5J2U A;  1M5I A;  3DGE A;  2YS8 A;  5KHK A;  4BIU A;  5JVD B;  5TIS Z;  3K3W A;  2P7T C;  4NXM O;  5ITZ A;  4K0K B;  4TV9 B;  3OFN G;  4FLW A;  4GCZ A;  4LFA O;  2ZR2 A;  1VQ7 V;  2VQE B;  4BAY A;  3CMA V;  2ARH A;  4I7Z B;  5LMU B;  4J11 A;  2OTL V;  3I56 V;  4R50 A;  2YUA A;  4JAA A;  3ZED A;  4CS4 A;  4EEQ A;  4J80 A;  3B8N A;  4JI5 O;  4LF8 B;  2RJZ A;  2IJI A;  3P3N A;  1N36 B;  4JI8 O;  1OCZ C;  1R6T A;  3OTO B;  5DED A;  5B1A B;  2DYR B;  1WLE A;  5KAF Z;  4X88 A;  3IJ4 A;  1TAE A;  1QLN A;  2PYL A;  3ZIA G;  4CZZ A;  4PDM A;  2KB1 A;  3JCU Z;  4UCT A;  1HNX O;  3F5T A;  1Q82 W;  3CC7 V;  3CWB H;  4NTW A;  1N36 O;  2AHZ A;  4P2Z A;  4DV6 B;  1HR0 O;  4LR3 A;  1BSM A;  2R72 A;  3RYF A;  1VAR A;  5CN0 A;  3RGB A;  1W2B U;  3MHS C;  4IHJ A;  2F4V O;  2YXH A;  4G27 B;  4FFB B;  2W6J G;  4JI3 O;  4ASU G;  3OR7 C;  2IW5 A;  4LFC B;  1MMM A;  4DK1 A;  4B3T B;  1VF5 B;  3CHX A;  3AG4 B;  1XNQ B;  3CRQ A;  3LSS A;  4GX1 A;  5CBH A;  3H1H H;  1IBM B;  1FS0 G;  3ETE A;  3ABL B;  4H13 B;  4MT8 A;  2W0F C;  4YHH O;  1KKD A;  3W7U A;  2QSA A;  4GZR B;  1K33 A;  3AG2 B;  1EFR G;  2GV9 A;  2UUB O;  4TV9 A;  4B3T O;  4N23 A;  3TGU H;  4LF8 O;  3E35 A;  5H2F Z;  3ABL C;  2VQF O;  3RW0 A;  1WJZ A;  2IJJ A;  2F95 B;  3CCV V;  5A2Q N;  1QVF U;  2A79 B;  5FPO A;  2UUC B;  4LF4 B;  1ZSP A;  3VOU A;  2ZD9 A;  1AI6 A;  2E5L O;  4UCV A;  4JI0 O;  1YF2 A;  1B3Q A;  3KZI Z;  5LXT A;  3APQ A;  4YJ2 B;  4FM0 A;  5JWP A;  5JJJ B;  4IYH A;  2WWW A;  1IZ3 A;  3DXR B;  2CGN A;  3AG3 C;  1EZJ A;  2Y4T A;  1H2M A;  5LHH A;  2OCC B;  4DV2 O;  3JD3 A;  1K34 A;  3CEI A;  4XDL A;  4YJ2 A;  4WFH A;  5JCO C;  2WLM A;  1N34 B;  2ODM A;  3R66 A;  1SQX H;  4J42 A;  1FJG B;  3K5N A;  2Y69 B;  3LNM B;  1ZX3 A;  1F51 A;  3WG7 C;  5LGN A;  4ZIB A;  2JJ2 G;  2XUM A;  3NXS A;  3H1I H;  4CBC A;  1N32 B;  1H2N A;  3OTO O;  1DK1 A;  1OCR C;  4EKW A;  4X1I B;  3ZBH A;  1D2D A;  2ZM6 B;  1B6Q A;  5IYC O;  3CP1 A;  5IJ9 A;  1N0J A;  3H1L H;  3N27 A;  2WAM A;  3G67 A;  4DR4 O;  4CC5 A;  3JAT B;  2ZIN A;  1TUE B;  3E22 A;  3FD9 A;  1FYJ A;  2Q8V A;  2VQF B;  5BMV A;  1LNQ A;  2UXD B;  1R3K C;  4MW8 A;  4YXW G;  1GN3 A;  1ZL8 B;  2K9P A;  4PA3 A;  2YXY A;  1KYO F;  4XBF A;  3CCL V;  3CJH A;  4GT1 A;  4TV8 B;  2YI8 A;  2FML A;  3E86 A;  3L73 H;  3SDL A;  5LP6 B;  2UXN A;  3Q4H A;  1SS3 A;  1ROP A;  2DYS C;  3BCC H;  3RYI A;  5KHG A;  2BTO A;  4ABM A;  3ZMZ A;  3OGC C;  1GM7 A;  2A7W A;  2XT9 A;  4YIO A;  1NI8 A;  5BZB A;  3LDC A;  4GX2 A;  4PDL A;  2CUG A;  1G4Y B;  1VQ5 V;  4MVO A;  1WAZ A;  4JI5 B;  5KX5 B;  5BR8 B;  1Y74 B;  4DR6 B;  1P49 A;  4FPP A;  5L3D A;  1XIL A;  5JJE B;  1VMG A;  5EK0 A;  1PL4 A;  2EUL A;  3C3S A;  2Q73 A;  4PA6 A;  5B1B B;  2LW7 A;  1V54 C;  1GM9 A;  1TA8 A;  2BSK B;  4TUY B;  4X89 A;  1U97 A;  1AP6 A;  3UQ8 A;  4FLY A;  2P6J A;  4LNU B;  1WPX A;  3F7V C;  3JAL B;  2JIZ G;  4FZ0 A;  1PP9 H;  2H94 A;  5JJN B;  5CA1 B;  2WA4 A;  4DV5 O;  2LGW A;  4LCU C;  1M90 W;  3FYI B;  1IUR A;  5IWA O;  1XMO O;  1R1B A;  2BOB C;  2R70 A;  3HB3 B;  3M8A A;  2IM9 A;  1EN6 A;  2ZM6 O;  2ZIO A;  3RN4 A;  5KLV H;  3K5M A;  3VQW A;  5IY5 C;  1GN2 A;  3BVO A;  5EC1 C;  4B3R O;  1JPX A;  3JCZ A;  3G4S V;  4JI4 O;  3K5O A;  4P9O A;  1JX9 A;  5LYJ B;  3JD2 A;  4PD4 F;  1Y6X A;  5J2U B;  4JI2 B;  4E4E A;  1QQC A;  3BAB A;  3P3P A;  4JAS A;  2EJR A;  3OUF A;  1S3J A;  2D2C B;  4I9W A;  4O2B A;  1L1F A;  5GTI Z;  2GDS A;  1THZ A;  4I50 B;  2EIN B;  3B2E E;  1HNZ B;  2XAJ A;  2JS5 A;  1AVM A;  4DV6 O;  4PA9 A;  4PA4 A;  1SES A;  1M4U A;  1FXV A;  1Q5O A;  1I0H A;  3ZRW B;  2CH7 B;  3SJA C;  1CPY A;  1XHZ A;  1NTZ H;  5F2V O;  2UUC O;  5FNV B;  1Q7Y W;  4KL1 A;  2PGG A;  2QWN B;  4JTD B;  2CTP A;  3L71 H;  3CXH F;  3K08 A;  2B5U A;  3B4S A;  5LA6 A;  4YJ3 B;  3JAW B;  4EB6 B;  1SER A;  2OIE A;  4JTA B;  1Q43 A;  4X1K B;  4TQF A;  2C2A A;  1ZLZ A;  2NN4 A;  3OMN B;  4R7C A;  5E1A C;  3MAQ A;  4XDJ A;  3EHB B;  2IH1 C;  2V4D A;  3OR6 C;  4O2A B;  2NNU A;  4QIW F;  1PM9 A;  1QR8 A;  3H1K H;  3QTC A;  3SGI A;  3CJH B;  3ZHQ A;  5H6Q A;  4U7N A;  4DR2 B;  1XOU A;  4NXN O;  5HFM A;  3WU2 Z;  3OUS A;  4HNA B;  2ZCE A;  2DWD C;  2ZNI A;  1TVK B;  1LUW A;  2WLL B;  4LFB O;  3K06 A;  1NT2 B;  4F4L A;  5K1P A;  4K0K O;  3RT3 C;  4Z1M G;  4DUZ O;  2PYJ A;  4LH6 A;  3UCS C;  5CB4 A;  1FFX A;  2HG5 C;  4NB5 A;  4GKJ O;  4JI2 O;  1JVM A;  4DV4 O;  4DR7 O;  4X1I A;  5EIB C;  3OEE G;  2XOK G;  4CS2 A;  1SZX A;  1GN6 A;  3OAA G;  1JMK C;  3ZCC A;  4WCE V;  3D3I A;  5CBF A;  2IJK A;  5D5P A;  3CCM V;  1M57 C;  2W0X A;  3HPL C;  2QKA A;  1AB3 A;  2F93 B;  2QEX V;  3PN1 A;  4MVR A;  4HYO A;  5LMN B;  1PNL A;  1IBM O;  3CRC A;  4PJ0 Z;  3ZRX A;  4X64 O;  1Q6I A;  2FKX A;  1JJO A;  1OV9 A;  2E3C A;  3QF7 A;  1E1Q G;  1GN4 A;  4UCS A;  1NH2 D;  1SKV A;  4WFB V;  5H6R A;  4DV3 O;  2F4V B;  1IBL B;  1D5N A;  2W6I G;  2X7R B;  1QCE A;  4IL6 Z;  4LFA B;  4CH5 A;  1SQB H;  4LFC O;  3K0D A;  3JAW A;  1R3I C;  3K04 A;  2Y0I A;  3SR2 C;  2LW1 A;  1H2S B;  3N2G A;  1NQT A;  2UU9 O;  2OWO A;  4DR5 B;  1NTK H;  3K58 A;  1MSW D;  2UUA O;  2AZ0 A;  2P06 A;  1VP7 A;  1OCO B;  4FM2 A;  3ABU A;  5LGU A;  4ZOL A;  2Q0O C;  5CMU A;  4LF6 B;  2JGU A;  4A5U B;  1XMQ O;  5B66 Z;  1WP7 A;  3TJT A;  5C8Y B;  5J2T A;  3SPI A;  1SA0 B;  1YHQ V;  2Q0A A;  4DR7 B;  1E1R G;  3CSX A;  4GX5 A;  1BHB A;  2QJ1 A;  2EIL B;  1JA8 A;  4DRX A;  4JF3 A;  2F66 C;  2CTQ A;  1SZT A;  4B3R B;  4J41 A;  3BHP A;  4LF4 O;  2JEU A;  5H9C A;  1XMQ B;  3RYH A;  5KA5 A;  4LF5 O;  3AG3 B;  3LNN A;  1EM1 A;  2GBO A;  2GTA A;  2XND G;  4FFB A;  3JAR B;  1NS1 A;  4I55 A;  2X6A A;  1Q6H A;  1AR5 A;  1FAF A;  4JI6 B;  2OIG A;  3CRR A;  2IU3 A;  4IYI A;  4ZOL B;  4MVQ A;  5IE9 A;  4FLT A;  4PDV A;  2RMK B;  3CXC U;  1SQQ H;  2ITC C;  4LF5 B;  4DV3 B;  3SPJ A;  3QO8 A;  1B06 A;  2FB5 A;  3HKC A;  3ASN C;  3ETQ A;  5LL6 Y;  3AG1 B;  5IDJ A;  4MVZ A;  2P22 C;  3K9A A;  2UU9 B;  3OMI B;  3OTF A;  1M9N A;  3HKC B;  3T1Y O;  1H8E G;  4TUY A;  4ICG A;  3K57 A;  1JJ2 U;  5IYZ B;  2HFE C;  2H8P C;  2KKW A;  4DO2 A;  1YIT V;  1IXB A;  2LJ2 A;  4MSW C;  4I9Q A;  4D7T A;  2Q69 A;  4X1Y A;  3A8T A;  4YIP A;  4UVB A;  2CTR A;  3KCX A;  1ZUQ A;  2UXC O;  4DR4 B;  4QE7 A;  4O4I B;  4QJF B;  1JCH A;  4C7U A;  3E8H A;  1ZWI C;  2FTK A;  2JVD A;  4B08 A;  1KD1 W;  1KEC A;  1YZB A;  1QHT A;  1IBL O;  4FLU A;  4MVS A;  1NTM H;  1Y67 A;  4K35 A;  2KG7 A;  5KMG A;  2YDE A;  3U11 A;  1DGS A;  1NVP D;  3S3W A;  3STL C;  4KHP B;  4UUJ C;  2DE0 X;  3TK1 A;  2A3Q A;  1I08 A;  2QM7 A;  4HBN A;  1ZL8 A;  2EZP A;  3EVK A;  2DJV A;  5BMV B;  2UUB B;  5CA1 A;  1I7F A;  5EBM C;  3D36 A;  5BR8 O;  3B09 A;  1TUB B;  1BGY H;  2Q7H A;  5C8Y A;  5B1B C;  2QKC A;  1IX9 A;  4NTX A;  4UVA A;  1F23 A;  1RSO B;  2IH3 C;  2HKO A;  2P5O A;  2ZQM A;  1MSD A;  2GUZ A;  1G6U A;  2Z0A A;  3ZMT A;  2XAQ A;  2Q6A A;  4JYY A;  4K3A A;  2UXB B;  3HKD B;  2VQE O;  3DC6 A;  1N33 O;  3D36 C;  3GWK C;  5D5Q A;  2ITD C;  3RVZ A;  1SET A;  3J80 N;  3RYF B;  4B3M B;  1YXB A;  2HEP A;  1GRJ A;  4H33 A;  3UKM A;  2YSU B;  3VBB A;  3ZS8 C;  2XAH A;  3BY6 A;  1XQ8 A;  1IVS A;  4U3J B;  3A2F A;  1BQ0 A;  4BW5 A;  4MTF A;  1V54 B;  5BY1 A;  4DUZ B;  3LDE A;  4NKG B;  1PKX A;  1MNG A;  3BA8 A;  5JCO A;  5IYB O;  2LQT A;  1GH6 A;  5JH7 A;  1GKF A;  4I0X A;  1N33 B;  1AI5 A;  1SQF A;  4B7E A;  2UXC B;  4U3F H;  4DUY O;  3SPG A;  3W7X A;  1ARO P;  1YIJ V;  1XHX A;  5CA3 A;  4GLX A;  3JD0 A;  3P30 A;  3ABK C;  1U96 A;  2JJ1 G;  4MVM A;  2WLI B;  4Q6G A;  3ZMV A;  4WFE A;  2GHY A;  4RUE A;  5B5E Z;  3T4D A;  1AI7 A;  2Q7E A;  1HW7 A;  5B3S C;  2RCV A;  4KHP O;  1FKA O;  1GTO A;  4MS2 A;  2MK3 A;  1QR9 A;  4P9P A;  1Z5V A;  1WP8 A;  2X6B A;  1QLE C;  2QGN A;  1HNW B;  1FD9 A;  2GTS A;  5H5N A;  3WB1 A;  4L87 A;  1GK9 A;  4OGQ B;  2ZIM A;  1N0N A;  5CBG A;  1VQ4 V;  1BHA A;  1PNM A;  4QPJ A;  1UPG A;  2ZT9 B;  2F1M A;  4DR3 O;  1HNZ O;  2DOS A;  4J9Y B;  1KQS U;  1Y76 B;  1GO3 F;  4JAV A;  1I94 O;  1K8A W;  3ABM C;  4R6Z A;  4LFB B;  1TVK A;  4JI7 O;  2V1D A;  1S5J A;  4PV1 B;  3H1J H;  1BQZ A;  2DW4 A;  4FFK A;  4L8J A;  3PJS K;  2EIM B;  4O4H B;  1DF5 A;  3JAS B;  1YDX A;  3RBZ A;  3T4Z A;  3TET A;  3U10 A;  2QR4 A;  4IHJ B;  2E75 B;  4X9Q A;  3A0B Z;  4UXN A;  3FB8 C;  1O9G A;  2BSK A;  2HVK C;  1HP8 A;  2NLJ C;  4UVC A;  2P90 A;  3B8M A;  2OT5 A;  1SQP H;  4UV9 A;  1US6 A;  4GUN A;  3U0Z A;  4LF7 B;  1MZF A;  1Y74 A;  1AP5 A;  3ASO C;  3J81 N;  1QBZ A;  1WNS A;  3MD0 A;  4WF9 V;  2AXT Z;  2CH7 A;  4DV5 B;  4CC6 A;  1OCR B;  3ZRW A;  1K92 A;  3QG5 A;  4QGP A;  4I55 B;  3RYI B;  1ENV A;  5L3C A;  1BMF G;  3S3X A;  3UT5 A;  3WG7 B;  3CYO A;  4JI6 O;  3LSQ A;  2YIB D;  4J7Z A;  4IIJ B;  3CPW U;  4TQD A;  3ZRS A;  1HNW O;  3CB2 A;  3RWR D;  4X1Y B;  1P7B A;  1PNK A;  2DQ0 A;  4AQY O;  5LBQ A;  1M93 A;  1QU7 A;  3JAT A;  1PPJ H;  1T5E A;  5KA6 A;  3WB2 A;  2ZE5 A;  4X66 O;  4DR6 O;  5IJ0 B;  3ZHR A;  5FL7 G;  5ITZ B;  3E8G A;  4JYC A;  5JVD A;  4U7O A;  4X8A A;  3JD1 A;  2OYQ A;  2P4V A;  1Y4M A;  4X65 B;  4MVU A;  3NR7 A;  3A0H Z;  3C3T A;  3E8B A;  2EIJ B;  3OT7 A;  1XEQ A;  5GTH Z;  1FFT B;  4BIO A;  4FLZ A;  4DV1 O;  1YEW A;  3ZMU A;  1YSC A;  2JK5 C;  2WLH A;  2Q4P A;  2E74 B;  4NYK A;  4CS3 A;  2WPD G;  2Q9L A;  3ASO B;  1DTO A;  5EBW C;  1VF6 C;  1Y76 A;  1G1X B;  1I5Y A;  2EIK C;  3APO A;  2XTA A;  1Q8I A;  1EBO A;  2HHH O;  1MAB G;  4BW9 A;  1I5X A;  4X20 A;  4LWS A;  5B1O A;  3SYQ A;  2QM4 A;  3FB7 C;  3H01 A;  4LF7 O;  3CC4 V;  3Q4H B;  4FK5 C;  1K3E A;  1XRE A;  4KXR A;  2V7Q G;  5B1A C;  5LGT A;  5L3F A;  1GM8 A;  4IT5 A;  1ZTE A;  5CA0 B;  3K59 A;  4UCO A;  3G6E V;  4B3S O;  3BAA A;  1F7Y A;  4DUY B;  4FVM A;  1RPR A;  3ZMS A;  1OCC C;  4DV7 B;  3OGI B;  3FAV B;  1H8H G;  1BCC H;  1VQ9 V;  5DEC A;  4CH6 A;  4XDK A;  5J2T B;  3IAY A;  4GX0 A;  2CGO A;  1IBK O;  5EZY A;  2UXD O;  1FFX B;  1R6K A;  1M56 C;  4AIL C;  2N05 A;  1VF6 A;  2H3O A;  3JAK B;  4I0X B;  1WA8 A;  5EYP B;  2ILM A;  4PA7 A;  5IWA B;  4GYC B;  5AG2 A;  2WLN A;  1Z5W A;  4BR6 A;  2ZE7 A;  4O4L B;  3UM7 A;  2OCC C;  4DK0 A;  1NU1 H;  3THO A;  4JAU A;  4U3J A;  1P7G A;  4DV4 B;  2JEX A;  1OHH G;  3ML0 A;  3HKB B;  1RM1 C;  1B04 A;  4X65 O;  5EBL C;  5JH7 B;  1MOF A;  2FL4 A;  3HKD A;  3K9S A;  4Z2W A;  4PEL A; 
#chains in the Genus database with same CATH homology
 1AI4 A;  4QE9 A;  1YJ9 V;  3SPJ A;  4H37 A;  1SRY A;  1EZJ A;  3QO8 A;  5LHH A;  1F4M A;  3SPC A;  2OCC B;  3JD3 A;  1K34 A;  1Y66 A;  4XDL A;  1YTF D;  3B77 A;  2EZO A;  3SPH A;  1YJW V;  4WFH A;  1NKD A;  1V55 C;  3ASN C;  3ZJZ A;  2WLM A;  3OE7 G;  2OTJ V;  3AG1 B;  5IDJ A;  4MVZ A;  2Y69 B;  3LNM B;  2YEV A;  3I55 V;  3K9A A;  3R65 A;  5C93 A;  1F51 A;  3WG7 C;  2F43 G;  4UV8 A;  5LGN A;  1FXK C;  2JJ2 G;  3OMI B;  1NR7 A;  3NXS A;  4WFF A;  1M9N A;  1W0J G;  1H8E G;  4CBC A;  3LDD A;  1YJN V;  3GWO A;  3AG2 C;  2WLK A;  3W7T A;  1OCR C;  1JJ2 U;  2HFE C;  2H8P C;  4EKW A;  4DO2 A;  1YIT V;  2B1G A;  2DWE C;  2LFR A;  2R9I A;  4MSW C;  1B6Q A;  2Q69 A;  5IYC O;  3CP1 A;  4UVB A;  4RUF A;  2WAM A;  1AJP A;  2HLD G;  4RO2 A;  4QE7 A;  4QJF B;  4R8C A;  1JCH A;  2EIJ C;  4LBE C;  4E2L A;  3E8H A;  1TUE B;  1ZWI C;  2FTK A;  1K4D C;  1KD1 W;  1HWY A;  1VQ6 V;  2DQ3 A;  1KEC A;  3FKS G;  1XL4 A;  5B3S B;  4RQF A;  3CCE V;  4PDR A;  5EC2 C;  3SYO A;  5J9P C;  1LNQ A;  1R3K C;  4MW8 A;  4YXW G;  4MVS A;  1AR1 B;  4TWK A;  2WLI A;  4PA3 A;  2ZXW C;  1J95 A;  1NVP D;  3E83 A;  1M57 B;  4XBF A;  5L3E A;  3STL C;  1VQM V;  4UUJ C;  3A0R A;  3CCL V;  4GT1 A;  3TK1 A;  2DYS B;  4ZBM A;  3E86 A;  2QM7 A;  3E89 A;  2M7W A;  2EZP A;  1DF4 A;  2UXN A;  1K5Q A;  1V55 B;  1ROP A;  2QE7 G;  2DYS C;  1PL0 A;  3FYE B;  5EBM C;  3D36 A;  3OGC C;  1GM7 A;  3ZMZ A;  3K0G A;  2ZR3 A;  5BZB A;  3AEI A;  3LDC A;  5LHG A;  4GX2 A;  5B1B C;  4PDL A;  1G4Y B;  3P32 A;  2HR3 A;  1VQ5 V;  4MVO A;  4UVA A;  2B1I A;  1RPO A;  1F23 A;  2IH3 C;  2HKO A;  2ZQM A;  1YI2 V;  4FPP A;  5L3D A;  2IU0 A;  3IFX A;  1Q86 W;  1F4N A;  5EK0 A;  1KP3 A;  3ETD A;  4MW3 A;  2ZDI A;  4PA6 A;  5B1B B;  2XAQ A;  2Q6A A;  3ZMT A;  1V54 C;  3ZN0 A;  4QNH B;  2QA4 V;  1GM9 A;  2AHY A;  2Q67 A;  2ITD C;  3G71 V;  3RVZ A;  2EIN C;  1SET A;  1IXM A;  4MTG A;  2PI5 A;  3CCS V;  1MG1 A;  2XAG A;  4X89 A;  1GMG A;  5GW7 A;  2HJF C;  4H33 A;  3UKM A;  2P6J A;  5DN6 G;  1WPX A;  3F7V C;  2YSU B;  3VBB A;  2XAH A;  1G8M A;  3BY6 A;  1K5S A;  1K73 W;  2JIZ G;  3ABK B;  4N21 A;  4BW5 A;  2IJH A;  2H94 A;  4MTF A;  1V54 B;  4LCU C;  1M90 W;  2EIM C;  1XL6 A;  2Y48 A;  1PKX A;  1AJN A;  3FYI B;  3LDE A;  3CD6 V;  5IYB O;  3ABT A;  1S0V A;  1GKF A;  1NJI W;  3ZRV A;  1AI5 A;  2BOB C;  2Y69 C;  1K4C C;  4JPR A;  3SPG A;  1AJQ A;  2Z3Y A;  3JYC A;  3W7X A;  3HB3 B;  1OZ0 A;  1CP9 A;  1ARO P;  4TT3 G;  3SJQ C;  5IY5 C;  1YIJ V;  1P4R A;  4P30 A;  5CA3 A;  5EC1 C;  5L3G A;  1VQP V;  3JD0 A;  3P30 A;  3ABK C;  3CCQ V;  2JJ1 G;  4MVM A;  2WLI B;  3ZMV A;  1VQL V;  1JPX A;  2P67 A;  3JCZ A;  3K79 A;  2GHY A;  4HZ3 A;  4WFE A;  3AG4 C;  4RUE A;  3G4S V;  4DXW A;  3T4D A;  1AI7 A;  4P9O A;  3K03 A;  2WSS G;  3DTU B;  3ABM B;  5B3S C;  3T2M A;  1GTO A;  1JX9 A;  4MS2 A;  3JD2 A;  2MK3 A;  2A0L A;  4MTX A;  4TSF G;  1QR9 A;  1DLB A;  4P9P A;  1OCZ B;  1PD3 A;  4JAS A;  2EJR A;  2X6B A;  1QLE C;  3OUF A;  4ZKI A;  1S3J A;  3QO5 A;  4I9W A;  4L87 A;  1JOY A;  1GK9 A;  1L1F A;  4WFA V;  1THZ A;  5CBG A;  1VQ4 V;  3WFV A;  1PNM A;  4QPJ A;  1NH2 B;  4RQE A;  1BHA A;  2EIN B;  1R3L C;  4KFM A;  3STZ C;  1QLE B;  2Z5U A;  4J9Z B;  3SYP A;  4J9Y B;  2XAJ A;  3IC7 A;  1KQS U;  3E2E A;  1GO3 F;  2YEV B;  3QO7 A;  1FXK A;  2ZXW B;  2ZDI C;  4PA9 A;  4JAV A;  1SES A;  4PA4 A;  1K8A W;  5KUK A;  3ABM C;  2K1E A;  1FXV A;  4R6Z A;  3ZRW B;  3TCU A;  1M56 B;  3MHH C;  4JGS A;  1CPY A;  2V1D A;  1S5H C;  1NVP B;  1Q7Y W;  2DW4 A;  3PJS K;  2EIM B;  1UJW B;  3T1C A;  3SYA A;  1COW G;  3M99 B;  3W7W A;  4JTD B;  4FJC C;  1DF5 A;  2UXX A;  1NBM G;  3RBZ A;  3T4Z A;  1Q81 W;  3K08 A;  2XAF A;  4QPK A;  1OCC B;  2B5U A;  3TET A;  5LHI A;  1VQO V;  1K97 A;  1ORQ C;  1E79 G;  2WLJ A;  1BL8 A;  1SER A;  4JTA B;  3ZN1 A;  3CC2 V;  2QTO A;  4Q20 A;  4UXN A;  2R9R B;  3FB8 C;  3FB5 C;  2C2A A;  2Q68 A;  3OMN B;  2HVK C;  4R7C A;  5E1A C;  3X2Q C;  4XDJ A;  3EHB B;  2NLJ C;  4UVC A;  2P90 A;  2IH1 C;  3B8M A;  2OT5 A;  3OR6 C;  2NNU A;  4QIW F;  4G2K A;  1QR8 A;  2BOC C;  3X2Q B;  4UV9 A;  2QM8 A;  2PI4 A;  5H6Q A;  4U7N A;  2HVJ C;  4LP8 A;  1R3J C;  3F7Y C;  3ASO C;  4WFG A;  1S77 D;  1H38 A;  5HFM A;  1VQ8 V;  1QBZ A;  3OUS A;  3MD0 A;  4FIP C;  4WF9 V;  2DWD C;  3DGE A;  1OCR B;  3ZRW A;  1K92 A;  2WLL B;  2ATK C;  4BIU A;  2QKS A;  3K06 A;  3K3W A;  2P7T C;  3CCR V;  1ENV A;  4F4L A;  1N8R W;  1VQN V;  5L3C A;  1BMF G;  2X6C A;  3OFN G;  2LP7 A;  4Z1M G;  3WG7 B;  3CYO A;  2X0L A;  4GCZ A;  3JD4 A;  2ZR2 A;  1VQ7 V;  3LSQ A;  2HG5 C;  4BAY A;  3CMA V;  2A9H A;  2OTL V;  3I56 V;  4R50 A;  3W7S A;  1JVM A;  3CPW U;  3B8N A;  3KG2 A;  3OEE G;  2XOK G;  3ZRS A;  4I5S A;  4MTO A;  3OAA G;  3SYC A;  3ZCC A;  1P7B A;  4WCE V;  1PNK A;  2DQ0 A;  3D3I A;  2IJI A;  5CBF A;  5LBQ A;  4G28 B;  2IJK A;  3CCM V;  3GB7 C;  1M57 C;  5KA6 A;  1OCZ C;  3HPL C;  2WLL A;  3FB6 C;  5FL7 G;  5B1A B;  2QEX V;  1QVG U;  2DYR B;  4MVR A;  1WLE A;  3E8G A;  4X88 A;  2EIK B;  4HYO A;  4OXS A;  4JYC A;  3QNE A;  4U7O A;  1QLN A;  4X8A A;  1PNL A;  3JD1 A;  1M1K W;  3ZIA G;  3ZRX A;  4CZZ A;  4PDM A;  1Y4M A;  4MVU A;  3OW2 U;  2KB1 A;  5IYD O;  1K9M W;  3E8B A;  2EIJ B;  4JTC B;  1FFT B;  1S72 V;  3ZMU A;  1Q82 W;  1E1Q G;  1YSC A;  2JK5 C;  2WLH A;  3CC7 V;  1VQK V;  1CEZ A;  2AHZ A;  4P2Z A;  4LC1 A;  5IY5 B;  1NH2 D;  1K7D A;  4WFB V;  5H6R A;  2WPD G;  3ASO B;  1DTO A;  2W6I G;  1H2G A;  2X7R B;  5EBW C;  1QCE A;  5CN0 A;  1W2B U;  1KC8 W;  3OM3 B;  3MHS C;  1I5Y A;  2EIK C;  3K0D A;  1R3I C;  3K04 A;  1EBO A;  4G27 B;  1MAB G;  4BIZ A;  1I5X A;  1JQ0 A;  2W6J G;  4ASU G;  5B1O A;  1NQT A;  3OR7 C;  5KUM A;  3SYQ A;  2IW5 A;  1R6N A;  3CCJ V;  3FB7 C;  3H01 A;  1MSW D;  3AG1 C;  5L3B A;  3CC4 V;  1RM1 B;  3ASN B;  4FK5 C;  1K3E A;  1OCO B;  3ABU A;  2V7Q G;  5LGU A;  3AG4 B;  5B1A C;  4JYB A;  5CMU A;  1YTF B;  3LSS A;  4GX1 A;  5LGT A;  1R73 A;  5L3F A;  1GM8 A;  3E8F A;  5CBH A;  3BEH A;  4RAI A;  1FS0 G;  3ETE A;  3ABL B;  1FXH A;  3G6E V;  2GSM B;  4MT8 A;  3SPI A;  2W0F C;  1FXK B;  3OMA B;  1KKD A;  2JDI G;  3IGA C;  1W0K G;  3W7U A;  1YHQ V;  1RPR A;  5B1N A;  3ZMS A;  1OCC C;  3CCU V;  1K33 A;  1H8H G;  4KP4 A;  3AG2 B;  1EFR G;  1E1R G;  2EBO A;  4GX5 A;  1VQ9 V;  1BHB A;  2EIL B;  4XDK A;  2DYR C;  4JF3 A;  4N23 A;  2D3O W;  3E35 A;  1SZT A;  2CK3 G;  3ABL C;  4GX0 A;  3RW0 A;  5HFL A;  1R6K A;  1M56 C;  2JEU A;  5H9C A;  2IJJ A;  5KA5 A;  4PA7 A;  3AG3 B;  3CCV V;  2XND G;  1OCO C;  2WLN A;  1QVF U;  4HAM A;  2A79 B;  1KP2 A;  1S76 D;  3UM7 A;  3LUT B;  2X6A A;  2OCC C;  2XAS A;  3VOU A;  2ZD9 A;  4JAU A;  1AI6 A;  4KUM A;  2LFS A;  2IU3 A;  2EIL C;  3ETG A;  2JEX A;  4FMT A;  4MVQ A;  3CME V;  1OHH G;  1NR1 A;  3ML0 A;  1RM1 C;  5DM6 V;  3OEH G;  3EFF K;  3RVY A;  5EBL C;  3F5W C;  4PDV A;  2WWW A;  1MOF A;  3CXC U;  3AG3 C;  2ITC C;  4PEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...