5EBLC

Kcsa t75g in the conductive state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5eblC00
2H8PC 3STZC 3JYCA 2X6CA 1V55C 1XL4A 5EC1C 2A0LA 1ZWIC 3UKMA 2EIJC 3ABMC 2IH3C 4PA4A 3TETA 3ABLC 4MVOA 3SPGA 4MW8A 3FB8C 4PA6A 4JTAB 3SYAA 4MSWC 5EC2C 3X2QC 2WLKA 4PDVA 1JVMA 5CBHA 5E1AC 3AG3C 4WFHA 3SPHA 2HJFC 3AG1C 5B1BC 2A79B 4GX1A 1R3JC 2WLLA 5EK0A 3LDDA 2A9HA 2HG5C 2QTOA 2DWEC 2X6AA 4MVUA 4WFFA 3T4DA 4MTOA 4ZBMA 4HZ3A 4WFEA 1R3IC 3PJSK 2Q67A 4MVSA 2WLHA 4RUEA 4TWKA 4PDRA 3ASNC 4JTCB 2DYRC 2JK5C 4MVRA 3RVYA 2Y69C 3STLC 3F7YC 1OCCC 1S5HC 2IH1C 3LNMB 4OXSA 3T2MA 4X89A 3K06A 3E8BA 4PDMA 3ZJZA 1BL8A 2WLNA 4HYOA 5BZBA 1V54C 2AHZA 5CBGA 4XDJA 3E89A 3F5WC 4P9OA 4J9ZB 3SYPA 2HVJC 2ATKC 4G28B 4XDLA 3SPJA 1G4YB 3FB7C 4PA3A 4QE7A 3FB6C 1ORQC 3E8GA 4MS2A 4GX5A 4P9PA 1OCOC 4GX0A 2NLJC 3OUFA 1K4CC 4R7CA 2OCCC 2YEVA 3SJQC 3LDEA 3SYCA 2R9RB 4P30A 3OUSA 2EIKC 2WLLB 4WFGA 3TCUA 1LNQA 5KUKA 2ZXWC 3BEHA 3E8FA 2KB1A 4LP8A 3SPIA 3GB7C 5J9PC 2ITCC 3RBZA 3IFXA 5IY5C 3K03A 2Q69A 2X6BA 2HFEC 5EBLC 4CBCA 1OCRC 4XDKA 4MW3A 4RUFA 4G27B 5EBMC 3E8HA 3UM7A 3AG2C 4DXWA 4JTDB 2EIMC 5KUMA 3SPCA 2BOCC 2HVKC 3LDCA 3T1CA 4R6ZA 2WLMA 1R3LC 3OGCC 5B1AC 3LUTB 3SYOA 2W0FC 3E83A 4J9YB 4X8AA 5B3SC 3ZRSA 2WLJA 3K08A 4F4LA 2DWDC 3OR7C 2ZD9A 1P7BA 4MVMA 2WLIA 3OR6C 4R50A 4H33A 3KG2A 3HPLC 3R65A 4PA7A 3E86A 4GX2A 2WLIB 3K0GA 3FB5C 4P2ZA 4I9WA 4LBEC 3WG7C 1J95A 4PDLA 2Q68A 4EKWA 4MTGA 2EINC 3RW0A 1M56C 2QKSA 4H37A 3SYQA 4RAIA 4UUJC 2BOBC 1QLEC 1K4DC 5EBWC 2P7TC 2EILC 1OCZC 4KFMA 2DYSC 3ASOC 4R8CA 3F7VC 3VOUA 1KKDA 3IGAC 4RO2A 3K0DA 4PA9A 4QNHB 3RVZA 3EFFK 3T4ZA 3K04A 1R3KC 4LCUC 3AG4C 5CBFA 1M57C 4MTFA 3ABKC 4MVQA 4X88A 4BW5A 2K1EA 2ITDC 2Q6AA 2AHYA 1XL6A 4MVZA 4QE9A
chains in the Genus database with same CATH superfamily
2JDIG 1NI8A 4B3TO 1AR4A 3VQWA 1RM1B 3B8MA 1BHAA 3B77A 3OE7G 4LF8B 2W6JG 3X2QB 4UVAA 5DECA 3HKDB 3L72H 2YIBD 2D3OW 1B6QA 4JI0O 1H38A 5FL7G 2WLLA 4DR6B 1Q5OA 4O4IB 1JFFA 2DYRC 3LSSA 4IGGA 4CH3A 2EULA 1S5JA 2XAGA 1AP6A 5B1OA 4PDMA 4HYOA 3B4SA 2B1IA 3ETDA 1WAZA 2IU3A 3FB7C 2KG7B 3CMEV 2UUAB 4D6TH 4GZRB 4BR6A 2R9RB 5KUKA 5LYJB 3BEHA 4J80A 4DV0O 5K1PA 5L3GA 4TV9A 2ZDIA 1VQ8V 2X6BA 3JSNA 3IC9A 4JASA 4UVCA 1N34O 1KMIZ 2ZIOA 4J7JA 5KUMA 1HR0O 3T1CA 1JOYA 3JAKA 1E1QG 3T1HB 3AG4B 4TQDA 2HJDA 1SQQH 3OR7C 4CZZA 4NXNB 4K8ZA 4H33A 4ZI7A 1WB8A 4FLZA 1VQPV 2AZ0A 1D5NA 3E22A 4BAYA 3RYFB 2Y4UA 3RW0A 4UCRA 5LL6Y 2WSSG 1VQMV 2PF4E 1VQ6V 1R3KC 1BE3H 1E1RG 1ZLZA 3H1KH 3VQXA 4UCTA 1FD9A 2FKXA 3AEIA 1SQVH 4U7OA 2VWJA 3IJ4A 4FK5C 2XUMA 1W0JG 3ABLB 4H44B 1NBMG 2O57A 2LQTA 5LOVB 1HNXO 5EIBC 1SZTA 3EXAA 2EJ7A 2XAFA 3CRCA 3AG1C 1AR1B 4OX9B 3RGBA 1W2BU 3RYHA 3QO7A 1K8AW 4X9QA 3BPZA 5LMNB 1IBMO 4U7NA 3CD6V 4DR1B 1R6KA 3RN4A 4H13B 1VF6C 4ZOLA 4NTYA 4X64O 1OCCC 3ZHVA 3E8BA 4IYIA 1V54C 1N8RW 2HVJC 4DV3B 3AK2A 3SGIA 3T1YB 3HKEA 2DJVA 4IIJA 3THOA 4AILC 1VF5B 1IBLB 2VQFB 3H1IH 4TUYA 5LHGA 1XNRO 3OTOB 2LGQA 4BIOA 1KD1W 3LSUA 1OCRB 4TV9B 1OCZB 3JSLA 3AG2C 5H9CA 1BQ0A 4K0KB 2PI5A 2WLMA 2ZE8A 3JAKB 1D5AA 1M1KW 1XILA 1Y67A 5FNVA 4P2ZA 4ZI7B 1Q82W 3PN1A 1JA8A 3E22B 5LP6A 5DEDA 2YI8A 3ZHTA 3HKCB 3K0DA 5BR8B 1H2NA 2F43G 1NKDA 4I55A 1VQ9V 1COWG 2FB5A 1K97A 4HBNA 4W4KA 1DGSA 2AHYA 4LFBO 1XBLA 2H8PC 1JQ0A 4DW0A 3IC7A 3FX7A 3FFQA 1AILA 2IH3C 4W4LA 1R6NA 4O4HA 2CH7A 3H9VA 3K79A 1QLNA 2ZCEA 4JI1O 1N32O 2Q7GA 1M93A 1GTOA 4UCOA 4WFFA 5EZYA 3RYHB 4MTOA 3AG7A 4WFEA 2UXXA 1O9GA 2ARHA 1OV9A 3KKYA 4ZOLB 4JI8B 2VQEB 1S3JA 2N05A 1PL4A 1DF5A 3E8GA 5LA6A 3HKEB 1KECA 4LF7O 3RWRD 2OCHA 4DUYB 4BWAA 1YTFB 3FD9A 1RPOA 1XDCA 4TUYB 3DGEA 2DOSA 3EHBB 5IY5C 4NXMB 1EN4A 4RWUA 4UB6Z 2WA3A 1YDXA 3OGCC 3E83A 4BW9A 1DTOA 5K1XA 1NTKH 1JCHA 2ZR2A 5FNVB 2NR5A 3EVKA 5D5PA 4MT8A 2UXBB 5EBWC 3CEIA 1CXZB 3MHSC 3H1LH 2YIBA 3ASOC 5LP6B 2AGAA 1BT8A 2RJZA 3CHXA 3J81N 2CAZC 3CXCU 1K92A 1SQPH 4DV4O 3J7AU 2ITDC 4X1YA 1DF4A 1Z5WA 3DC6A 1W0KG 1XNQO 2BSKA 1PP9H 4PA4A 1SERA 1MMMA 3RYCB 1FPOA 5KMGA 2YIDA 1GK9A 2CTWA 4DR7B 3SPHA 3BCCH 1G8MA 1IBKB 2JJ1G 1VQOV 1SQXH 2UUAO 1AI4A 4DRXB 4PDRA 1XI1A 1I7FA 2D2CB 1X4TA 1K7DA 3L9DA 2BTOA 1PPJH 2UXNA 2QWQB 2AHZA 3CCQV 1QCEA 3F5WC 4DV1B 2F95B 4IHJA 4XDLA 3ZHUA 1YIJV 3DXRA 2EX3A 2ZE7A 3T1HO 2YEVA 5LA6B 3SJQC 5KLVH 1MG1A 4GKJO 3CPWU 3N2GA 2CTQA 2ZXWC 4DV5B 2KB1A 2ITCC 4X65O 3IFXA 4B3MB 4B7KA 4WFAV 5JCOC 4FVMA 4TOIA 2LFSA 4J42A 4G27B 2WWWA 1I5YA 1L8DA 1XOUA 4X62O 3SYOA 2UUCO 5B3SB 1QVFU 3ZMUA 4ABMA 5BMVA 2F23A 4ZKIA 2ZD9A 1P7BA 3ETEA 3N2KB 3QO5A 2V1DA 1ZL8A 1I94O 5L3CA 3P3NA 5J2UB 2JRIA 3OEEG 5JWPA 3FKSG 4AQYB 4O4LB 1BHBA 3VOUA 4GKKB 1EM1A 3M8AA 4JAVA 4QNHB 2GUZA 5LMUB 4DUZB 1K73W 1M57C 1TA8A 1I0HA 5KHJA 1SKVA 4JI5O 1YXBA 4OX9O 3CCUV 4JYAB 4X1YB 3STZC 1X59A 3G6BA 1RM1C 4X66O 3CP1A 4WF9V 5LMNO 3GWKC 2HHHB 3ZRWA 3ZMVA 1KC8W 4PA6A 1AI5A 5JH7A 5H2FZ 4LFCO 5EIBD 3X2QC 3I55V 3K5OA 4E2LA 2ZKOA 5KMGB 2HJFC 1NR7A 2E76B 3HB3B 3A0BZ 1S76D 1W59A 2NNUA 2CTRA 4RQFA 4X89A 3D36A 3K06A 5IYCO 1NH2D 2PZSA 4CC5A 2B9ZA 4JI3B 3G67A 1Q3EA 5IJ9A 1FAFA 2LFRA 1VQNV 2AW9A 3CX5F 3JAMN 4K0KO 3DXRB 5ITZA 4OPAA 4EB6A 2XASA 1SS3A 3DTUB 3CC2V 3SPIA 1Q81W 3JD4A 3N2GB 5HFLA 2Q69A 2B5UA 3UM7A 4JTDB 1YJWV 4JI2O 4R6ZA 1N33B 4GUNA 2H94A 3WU2Z 1NS1A 4J7ZA 3CE2A 4UV9A 5GW7A 3K58A 2L6LA 2R70A 5BR8O 2P4KA 1WA8A 4FZ0A 4I9WA 4UCSA 4HAMA 4PDLA 2HEPA 2CTPA 1XMQB 2C2AA 3JAWA 1G6UA 1QLEC 1UPGA 2EILB 3Q4HA 5JQGA 2DYSB 4DR5O 3F7VC 1KKDA 3L71H 2ZNJA 4QPJA 2QTSA 1PNKA 2GUZB 2OT5A 4BW5A 1YJ9V 3CC4V 1VMGA 4CS4A 3APQA 2R72A 3VBBA 1SA0A 1XL4A 2ZQMA 2A0LA 3ABMB 1XQ8A 3ABLC 2QWNB 4MW8A 2QKCA 2RN9A 3ZMSA 3ZRWB 5JH7B 2PGGA 2QE7G 3TK1A 3OMIB 1RFYA 4X1KB 1UJWB 1MZFA 3JD1A 4G2KA 3OTFA 4DV2B 5E79Z 1HWYA 1YITV 4RUEA 1KKCA 2N04A 2Y4TA 2R9AA 4DUYO 4JI6B 4K35A 3ZJZA 4CH4A 4Z1VA 1FXVA 4NXMO 3SYPA 2Z3YA 3ZHSA 4YJ2A 2ZINA 2JS5A 2P4VA 2N74A 1ORQC 4P9PA 4LF6B 3QTCA 4R7CA 2OCCB 1F4MA 3C90A 3RT3C 3JALA 1K33A 4EB6B 2QWOB 3TCUA 3E8FA 3K03A 1OCRC 4I4TA 4ZHQB 1WN7A 3ZRVA 2HVKC 3VQVA 3UT5B 5C8YA 4LF5O 5CBFA 3R65A 4DR2B 2DQ0A 4LBEC 5D5QA 1PKXA 3JATA 5KHHA 1M90W 3CCSV 4DR3B 2XAQA 2EIJB 2UU9B 4H37A 3NXSA 5JVDA 2YDEA 4PI0A 4NB5A 4TQFA 4B7EA 2F66C 3Q4HB 2BCCH 3M99B 1AP5A 4X88A 1Y76A 1KP3A 1K5QA 4DR7O 3BVOA 5IJ0A 1MNGA 4JAUA 4LFAO 2ZT9B 4OPHA 4I50B 4O2AB 4X20A 3K9SA 3CRAA 3FAVB 2H3OA 1JVMA 1HNZO 1TUBB 2LW7A 4JYYA 4QPKA 1EN6A 3OD4A 2KKWA 5LXTA 3RVYA 2Y69C 2Q9LA 3ABUA 3U10A 3ZEDA 4YY3O 4BIUA 5BZBA 3BFRA 1OJHA 3ZCCA 1PD3A 2BE3A 3FB6C 4YJ2B 4CH5A 3E35A 3ABTA 5DN6G 4FLWA 2A06H 2WLLB 1O9HA 1P84F 1JFFB 3K57A 4L87A 5EBLC 4GCZA 3SJBC 1MABG 3BABA 1NJIW 2QGNA 2DQ3A 1SF9A 1J5EO 3CJHA 4UV8A 3JD0A 2EIMC 3SPCA 3QNEA 4I4TB 3O9OA 2Q7EA 2DMXA 1AR5A 5B1AC 1HNWO 2GSMB 2LO1A 1L0NH 2PUSA 4Q20A 2QJ1A 4FFKA 4JPRA 4LH6A 1OZ0A 2QEXV 2W0XA 2Q0OC 3WG7B 1IZ3A 4DR4B 4JYAO 1K4DC 4JZGA 4DW1A 3APOA 2M6YA 3CWBH 1RP3B 5LGTA 4YIPA 5JVDB 5LP6C 1LUWA 3JARA 5EYPA 2JJ2G 5KX5A 3HR0A 3I5DA 1H2LA 4FJCC 1VARA 2FMLA 4EFEA 4FLUA 2WPDG 1VF6A 2OIGA 4YJ3A 2VRZA 1ZWIC 3UKMA 1ZUQA 4B3SB 3CSXA 4N23A 4JV5O 1Z5VA 3SYAA 3M7MX 3HKBA 2E3CA 3AG3B 4KHPB 1SQBH 1SZXA 2F93B 1Q7YW 4DV6O 4HZ3A 5H6QA 2XT9A 4JI4O 1I5XA 4FM2A 4KXRA 4Z1MG 1FYJA 1M4UA 2Z0AA 5CBGA 2JGDA 1AB3A 3D3QA 2EZPA 2E75B 4U3FH 5F2VO 3SJCC 3LDEA 3P32A 3CXHF 3OAAG 4WFGA 2LP7A 2JVDA 5CA0A 2MK3A 1R73A 3JASA 3BAAA 1GO3F 2E74B 4XDKA 2QSAA 2RMKB 1FKAO 2P67A 3CCEV 3CJHB 2W0FC 5B3SC 4FM1A 2WLJA 2G38A 4MVMA 1FXKC 4R50A 3HPLC 1N36B 2Y0PA 4IIJB 4I0XA 3VQYA 2E5LB 2XAHA 1AROP 1CPYA 1XHZA 3U0ZA 2UUBB 2BOBC 1VQ7V 4LC1A 5A9GA 2AXTZ 4O4JA 3W7XA 3A2FA 1CP9A 1YI2V 2ZE6A 3RVZA 2XNDG 4JI7B 3AG1B 2UXCB 2QA4V 4MTFA 2XOKG 4B3TB 3JARB 4PV1B 5EYPB 2VS0A 5KX5B 4QE9A 4WBNA 2JGUA 3CRMA 2IBZH 5DM6V 1M9NA 4RQEA 2XAJA 4YJ3B 2CUGA 4Z2WA 3TETA 3BY6A 4MSWC 1EBOA 4LF8O 2VWKA 1A32A 5E1AC 3HKBB 1V9PA 5CN0A 5B1BB 1TUEB 2ZE5A 4I55B 2A9HA 1GN3A 4PD4F 4JYCA 2Q73A 3ASNB 3CYOA 4DR6O 4MVRA 3FYEB 3STLC 3LNMB 5AG2A 3CCLV 1QQCA 4J9ZB 4PA3A 4O4HB 1WNSA 2CH7B 4GX5A 1IXMA 1B3QA 1LNQA 1VQKV 1YSCA 5EZYB 5IT9N 5J9PC 4DR2O 3MD0A 4AHCA 3JASB 3K5MA 1N0JA 1D2DA 4DK0A 2UU9O 3CMAV 4QJFB 1R3LC 4U3JA 3CRQA 3K5LA 1K5SA 4JYBA 2WLIA 1Q90D 1SESA 4DYLA 2QM8A 5IE9A 4I0XB 4NXNO 2Y48A 4TV8A 4MTGA 4LWSA 1MSDA 1M56C 2QKSA 4LH7A 1S72V 3JD3A 2EILC 2DYSC 3UO2A 3B09A 3TXQA 1XMOB 1WPXA 1DK1A 1US6A 3DSQA 4FIPC 2K9PA 1NR1A 1EZJA 3JYCA 1V55B 1K9MW 1HNXB 3ABMC 5GTIZ 4TSFG 5H5NA 3FB8C 4JTAB 2OIEA 4PELA 4YXWG 1U97A 4D7TA 2MW2B 1NVPD 3ZMZA 1IBMB 4WCEV 3JCZA 1VF7A 4GX1A 5C93A 3A0HZ 3OM3B 1IDSA 4X64B 2EZOA 2HKOA 1F51A 1PL0A 5JCOA 5IY5B 3CB2A 4O2BA 2YICA 1SQGA 1S5HC 5L3FA 3N27A 2BSKB 3ZMTA 3JD2A 4DR1O 4YIOA 3E89A 5LGUA 1BGYH 4IL6Z 4QE7A 2NLJC 4GT1A 2OCCC 2RQ6A 4DV3O 4UVBA 3T1YO 4LNUA 2F4VB 1YTFD 2B1GA 4FLTA 1IBLO 1WLEA 3B40A 2VQFO 1NTMH 4NR1A 1GRJA 1AI7A 2P06A 2KQXA 3E8HA 3OTOO 4FPPA 1ZAUA 3KCYA 1Z2GA 1Q86W 1Q6HA 4U3JB 4IHJB 4CC6A 1BSMA 4I7ZB 2WLIB 3KZIZ 2YEVB 2M7WA 1PV0A 3SJAC 2EINB 4H0LB 3OMAB 4XBFA 4TV8B 3HKDA 3ETQA 4R8CA 2DW4A 4B3SO 3IGAC 2OWOA 4LFBB 3AG4C 3ABKB 4O4IA 2K1EA 3FYIB 3TGUH 3L73H 5BMVB 5IWAB 1XL6A 1AI6A 1IVSA 2W6IG 5JJJB 2HLDG 1ZL8B 1RSOA 1SC5B 2A7WA 4N21A 4JI1B 5IYDO 1N32B 4OGQB 3QVNA 3K59A 5CBHA 4FLVA 4FLXA 4NVPA 2JEXA 1XHXA 5LYJA 4X1IA 1P49A 1R3IC 4E4EA 1U96A 1GM8A 2RNBA 4B08A 3ZHQA 1RPRA 3C3SA 1R1BA 2IH1C 2DN9A 3I56V 1NQTA 2WAMA 1GM9A 2RCVA 4JI8O 2VQEO 1OCOB 3WB1A 3OUFA 5KA6A 3H1JH 1TGOA 3JCUZ 4KP4A 5L3EA 4UXNA 2PTMA 4C7UA 4UCVA 3L70H 1Q43A 1YZBA 2E5LO 4RUFA 5HFMA 3K5NA 1WJZA 5EBMC 3L74H 1URFA 5B5EZ 3OEHG 2IJIA 1JMKC 5IJ9B 3K08A 4JGSA 2DWDC 1KYOF 4GX2A 2JEUA 2UXCO 5ITZB 2UXDB 3WG7C 1GAXA 1H2GA 5LOVA 4NYKA 2FL4A 2P7TC 1OCZC 2ZDIC 4KFMA 3BRCA 1H2KA 4DV4B 1WPBA 2QR4A 1MZEA 4PA9A 1QVGU 1FS0G 2UXBO 1AJNA 1XNQB 2PY5A 4MVQA 4PI2A 1H8HG 4CS3A 4GYCB 3G71V 3ZN0A 2Q6AA 4MVZA 5FLXN 4QGPA 2IJHA 1WA8B 2X6CA 1R6TA 5EC1C 1XUQA 1PM9A 3LSQA 3ZN1A 1RSOB 1P4RA 1YF2A 3JAWB 4TT3G 4DO2A 1WP8A 2WLKA 5JQGB 3AG3C 1AJPA 1KUQA 4Q6GA 2A79B 1IURA 2IJKA 1GM7A 1FXHA 3OW2U 2WLHA 5GONA 4X1IB 2V7QG 1AVMA 1IBKO 5L3DA 5JJNB 1SA0B 2OTLV 4A5UB 2R9IA 5B1NA 3BHPA 2DE0X 3D8CA 1VQLV 1YHQV 1YVWA 1S77D 4GKJB 1GN2A 4GX0A 4BIZA 4DV1O 1FJGB 2LGWA 4X65B 1VQ5V 2EIKB 3OUSA 2CDYA 2HP8A 1LUVA 3GB7C 1PNMA 1QLEB 1K3EA 4X62B 3O65A 4MW3A 3HKCA 5IDJA 4DV5O 2UUCB 2GHYA 1VIBA 5FPRA 4LF4B 2FYUH 1TAEA 4B3MO 1P7GA 3QG5A 2Q5ZA 4ICGA 3CCMV 2JIZG 1I94B 4J9YB 1L1FA 4F4LA 2IU0A 2YIAA 1F7YA 3TJTA 3W7TA 1XMOO 5LBQA 3JALB 4RAIA 1Y66A 1KU9A 2P6JA 5H6RA 2ZM6B 4JI5B 1AJQA 4AQYO 3EFFK 4GKKO 4X66B 3MAQA 5C8YB 5LMUO 1L0LH 4DUZO 4J41A 1WP7A 1B04A 3D3IA 4DV7B 5BY1A 4LFCB 1YJNV 1HW7A 2GV9A 3JATB 2P5OA 2F1MA 3OMNB 5KAFZ 4F6EA 1YCIA 1GH6A 4PDVA 2ILMA 1VQ4V 2HHHO 5JJEB 2L35A 5B1BC 1KP2A 3OFNG 1IX9A 2PI4A 3T4DA 4MVUA 1EZVH 1ZX3A 3ETGA 1Y76B 2DYRB 3ASNC 2YS8A 5GONB 4GLXA 5IJ0B 2F4VO 3T2MA 1BL8A 1BCCH 1PNLA 3U11A 3S3XA 4AI8A 1VP7A 1SRYA 2IM9A 2ATKC 3B8NA 3LNNA 4X20B 1KBHA 4MS2A 2GTSA 4JI3O 5KHIA 1K4CC 2QM4A 2OTJV 5FPOA 2ZIMA 3DC5A 1B06A 3AK3A 3RBZA 4JI2B 5LXTB 2ODMA 4K3AA 4DXWA 2QWRB 4PJ0Z 3LDCA 3ZIAG 3ICXA 3CRRA 4YHHB 3LUTB 1F23A 3NR7A 1JX9A 2ZR3A 4F6RA 3OR6C 3K3WA 5CMUA 4CH6A 1N33O 4J11A 3GVMA 3K0GA 3FB5C 4NTXA 2CK3G 1J95A 4DR5B 2Q68A 5IWAO 3RYCA 2Q7HA 2GBOA 4WFBV 4LF9B 1NVPB 1XMQO 3H01A 4LCUC 5LHIA 4LR3A 3MDSA 4DRXA 4B3RB 4L8JA 2RDCA 2PYJA 1Y74A 3R66A 4FMTA 2Y69B 1V55C 3CC7V 1HDJA 1NT2B 3ZBHA 3CCRV 4MVOA 2CGNA 2CGOA 5EC2C 2QWPB 1THZA 4WFHA 1R3JC 4D7SA 3LDDA 4ZBMA 5A2QN 1Q6UA 3PJSK 4MVSA 4FM0A 1JJ2U 2QDOA 1OCCB 3F7YC 3QO8A 4DV2O 5KA5A 4OXSA 3E2EA 1GMGA 5KAIZ 2ETNA 1V54B 2BTQA 2EIMB 1NH2B 3RFRA 4JI0B 2X7RB 5B1AB 1K34A 2GTAA 2Q4PA 4G28B 4JI6O 1FXKA 2GDSA 3N2KA 2LJ2A 2A3QA 5J2UA 3SYCA 1XREA 4LF6O 3H1HH 1H2SB 4O4LA 1YEWA 2UXDO 1JR9A 3SDLA 4I5SA 2XHBA 3AG2B 4LF5B 1GN6A 3WFVA 3F5TA 2JGDB 3ZRSA 5CA1A 5LGNA 4DV0B 3KG2A 1BMFG 4F6RB 3G4SV 4IYHA 1N34B 4EKWA 2EINC 3CCJV 1HR0B 5CA0B 5J2TA 3P3PA 4DR3O 4RO2A 1MSWD 2EJRA 2YXHA 3GWOA 3K04A 1TVKA 2CE4A 3ABKC 1N4CA 3UO3A 4DK1A 3ZX6A 4LFAB 2YUAA 1QU7A 1WB7A 3RYIA 1CEZA 1Y74B 1ZSPA 1HNZB 3ML0A 3B2EE 2YSUB 4ASUG 3G6EV 4JF3A 5KHKA 5CB4A 4MTXA 1E79G 4O4JB 5IYZA 2JS3A 2IJJA 4PHZA 4FFBA 2HG5C 2DWEC 3L75H 1UFIA 2Q67A 4YY3B 5LHHA 1I08A 1SQFA 1OHHG 1FJGO 4JTCB 1QHTA 1NZ6A 2JK5C 2PYLA 4WBNB 1FFXA 4K8XA 4IT5A 4NKGB 2YXLA 2WLNA 5B66Z 4UFZA 4XDJA 2BTQB 4P9OA 4UCUA 1S0VA 3SPJA 1G4YB 4HNAA 5CA3A 4LF4O 3WB0A 1FXKB 1OCOC 1LR1A 3AK1A 2XTAA 1ROPA 2P22C 2QKAA 4LP8A 1J5EB 2Z5UA 4FZ1A 1HNWB 2Q8VA 3S3WA 4EEQA 1ZTEA 3D36C 4EFBA 2YI9A 2ZM6O 4J10A 1Y4MA 3SR2C 2QM7A 3WB2A 1XNRB 1S5LZ 5CA1B 3E86A 2WA4A 1MA1A 5IYBO 3W7SA 3IAYA 4UUJC 2AZ2A 4DV7O 1MOFA 3ZS8C 3ASOB 1SETA 5J2TB 4X1KA 4DR4O 4NTWA 1QNMA 2V4DA 4FLYA 3A8TA 1TVKB 3K9AA 3UQ8A 1F4NA 3P30A 1EFRG 2X0LA 1GN4A 3KCXA 3TXSA 4JV5B 1Q8IA 3J80N 3BA8A 1NTZH 3W7UA 3A0RA 2EIJC 2FTKA 3RYIB 3SPGA 4LWSB 3G80A 4CS2A 3CCVV 5TISZ 4DV6B 3ZHRA 1BS3A 3W7WA 4JI4B 2OYQA 3CS5A 5CB4B 1BZKA 1T5EA 5EK0A 2QTOA 5IYZB 2X6AA 4KHPO 4FFBB 5L3BA 4TWKA 2ZNIA 2KSDA 2IW5A 2LW1A 1KB9F 1GKFA 4ZHQA 2NN4A 2Q0AA 4I9QA 1FFXB 2YC0A 1G1XB 3UT5A 3C3TA 1HP8A 1VEWA 2EBOA 2KG7A 4J7KA 1JPXA 2P90A 4ZIBA 1IXBA 4HNAB 2ADQB 4YHHO 4UB8Z 3MHHC 4P30A 2EIKC 5GTHZ 1Q6IA 2ZXWB 3OGIB 1XEQA 1M56B 3ZRXA 4KUMA 4CBCA 1QR8A 2HFEC 1EN5A 4O2BB 2Y0IA 1FFTB 2BOCC 1Y6XA 4LF7B 4LF9O 2YXYA 4KL1A 4X8AA 1H2MA 3OT7A 2ADPA 4PA7A 5BXZA 1BQZA 1N0NA 1KQSU 3RYFA 3BA9A 4I50A 1M5IA 4O2AA 4B3RO 1JJOA 1NU1H 4LNUB 1QBZA 1N36O 3SYQA 1QR9A 3FAVA 1TUBA 4JAAA 4QIWF 1H8EG 2UUBO 4JZ2A 3T4ZA 1M57B 2HR3A 5KHGA 3UCSC 1ENVA 4JI7O 1DLBA 3QF7A
chains in the Genus database with same CATH topology
3CCUV 2JDIG 3STZC 3D3IA 1RM1B 3B8MA 5DM6V 1M9NA 1RM1C 3B77A 1BHAA 3CP1A 3OE7G 4RQEA 4WF9V 2XAJA 1YJNV 2W6JG 3TETA 3ZRWA 3ZMVA 1KC8W 3OMNB 4PA6A 3BY6A 4MSWC 1AI5A 3X2QB 1EBOA 3X2QC 3I55V 4UVAA 4PDVA 4E2LA 5E1AC 1VQ4V 2D3OW 1B6QA 5CN0A 2HJFC 5B1BC 1KP2A 1TUEB 3OFNG 5FL7G 5B1BB 1H38A 1NR7A 2WLLA 2PI4A 2A9HA 3T4DA 4MVUA 3HB3B 1S76D 3ETGA 2NNUA 4JYCA 3ASNB 3ASNC 2DYRB 2DYRC 3CYOA 4MVRA 3FYEB 3LSSA 3STLC 4RQFA 3LNMB 3T2MA 2XAGA 4X89A 3D36A 3K06A 5IYCO 5B1OA 4PDMA 1BL8A 1PNLA 4HYOA 1NH2D 2B1IA 3ETDA 3CCLV 1SRYA 4J9ZB 2IU3A 2ATKC 3B8NA 2LFRA 3FB7C 4PA3A 1VQNV 4MS2A 4GX5A 3CMEV 1IXMA 1K4CC 2XASA 2OTJV 2R9RB 1LNQA 5KUKA 1VQKV 3BEHA 3DTUB 3CC2V 1YSCA 3SPIA 1Q81W 5L3GA 3JD4A 5J9PC 2ZDIA 3RBZA 1VQ8V 5HFLA 2Q69A 2X6BA 3MD0A 2B5UA 4JASA 4UVCA 3UM7A 4DXWA 4JTDB 5KUMA 3CMAV 1YJWV 3LDCA 3T1CA 1JOYA 4R6ZA 1E1QG 3ZIAG 4QJFB 1R3LC 2H94A 3AG4B 3LUTB 1F23A 1K5SA 4UV9A 1JX9A 5GW7A 2ZR3A 3OR7C 4CZZA 4JYBA 2WLIA 3OR6C 3K3WA 4H33A 5CMUA 1VQPV 1SESA 3FB5C 3K0GA 2QM8A 4I9WA 2CK3G 1J95A 4HAMA 4PDLA 2Q68A 2Y48A 4BAYA 4MTGA 3RW0A 1M56C 2QKSA 2C2AA 1S72V 3JD3A 1QLEC 2WSSG 1VQMV 2EILB 2EILC 2DYSB 4WFBV 2DYSC 1VQ6V 3F7VC 1KKDA 4QPJA 1NVPB 3H01A 1R3KC 1WPXA 4LCUC 5LHIA 1PNKA 1E1RG 2OT5A 4BW5A 1YJ9V 4FIPC 3CC4V 3AEIA 1NR1A 4U7OA 1EZJA 3VBBA 3JYCA 2Y69B 1V55B 4FK5C 1V55C 1W0JG 1XL4A 2ZQMA 4FMTA 2A0LA 3CC7V 1K9MW 3ABMB 3ABMC 3ABLB 3ABLC 4MVOA 1NBMG 4TSFG 3CCRV 4MW8A 3FB8C 4JTAB 3ZMSA 5EC2C 4PELA 3ZRWB 4YXWG 1SZTA 1NVPD 1THZA 3ZMZA 2QE7G 2XAFA 4WFHA 3TK1A 4WCEV 3AG1C 3JCZA 3OMIB 1AR1B 4GX1A 1R3JC 5C93A 1UJWB 3QO7A 1W2BU 3OM3B 1K8AW 3LDDA 3JD1A 4G2KA 4ZBMA 2EZOA 3PJSK 4MVSA 1HWYA 1YITV 4RUEA 4U7NA 3CD6V 2HKOA 1F51A 1PL0A 5IY5B 1JJ2U 1R6KA 1OCCB 3F7YC 1OCCC 1S5HC 3QO8A 4OXSA 5KA5A 5L3FA 3E2EA 1GMGA 3E8BA 3ZJZA 1V54B 3ZMTA 1V54C 2EIMB 3JD2A 1NH2B 1FXVA 3E89A 5LGUA 1N8RW 2X7RB 5B1AB 3SYPA 2HVJC 1K34A 2Z3YA 4G28B 1FXKA 4QE7A 1ORQC 4P9PA 2NLJC 4GT1A 4R7CA 2OCCB 1F4MA 2OCCC 3SYCA 4UVBA 1K33A 1YTFD 3TCUA 3E8FA 2B1GA 5LHGA 1WLEA 1KD1W 3K03A 1AI7A 1OCRB 1OCRC 4I5SA 1OCZB 3AG2B 3E8HA 3AG2C 4FPPA 5H9CA 3ZRVA 2HVKC 3WFVA 1Q86W 2PI5A 2WLMA 3ZRSA 5LGNA 1M1KW 5CBFA 3KG2A 3R65A 1BMFG 2DQ0A 2WLIB 4P2ZA 4LBEC 1Q82W 3G4SV 2YEVB 1PKXA 2M7WA 1M90W 3CCSV 4EKWA 2XAQA 2EIJB 2EINB 2EINC 3CCJV 4H37A 3OMAB 4XBFA 3NXSA 4R8CA 2DW4A 3IGAC 4RO2A 3K0DA 1MSWD 2F43G 2EJRA 3M99B 1NKDA 1VQ9V 3GWOA 3K04A 1COWG 3AG4C 3ABKB 4X88A 3ABKC 1K97A 2K1EA 3FYIB 1KP3A 2AHYA 1K5QA 1XL6A 1AI6A 2H8PC 1JQ0A 2W6IG 2HLDG 3IC7A 4JAUA 1CEZA 2IH3C 4N21A 3ML0A 5IYDO 2YSUB 1R6NA 3K79A 1QLNA 4ASUG 3G6EV 1JVMA 4JF3A 5CBHA 4MTXA 1E79G 2IJJA 1GTOA 2JEXA 2HG5C 4QPKA 2DWEC 4WFFA 4MTOA 4WFEA 1R3IC 2Q67A 5LHHA 2UXXA 1OHHG 1VQ5V 4JTCB 2JK5C 1GM8A 3RVYA 1RPRA 2Y69C 3ABUA 2IH1C 4BIUA 2WLNA 5BZBA 3I56V 1NQTA 1S3JA 4XDJA 3ZCCA 4P9OA 1PD3A 1S0VA 2WAMA 3SPJA 1G4YB 1GM9A 5CA3A 1DF5A 3FB6C 3E8GA 3E35A 1OCOB 1FXKB 1OCOC 3OUFA 5KA6A 1KECA 3ABTA 4KP4A 5DN6G 5L3EA 4UXNA 2WLLB 1YTFB 1ROPA 4LP8A 1RPOA 2Z5UA 3DGEA 3EHBB 5IY5C 4L87A 5EBLC 4GCZA 1NJIW 1MABG 4RUFA 5HFMA 2DQ3A 5EBMC 4UV8A 3JD0A 2EIMC 3SPCA 3QNEA 3OGCC 5B1AC 3OEHG 2GSMB 2IJIA 3E83A 1Y4MA 4Q20A 3K08A 4JGSA 2DWDC 2QM7A 3E86A 4GX2A 1DTOA 2JEUA 4JPRA 1OZ0A 2QEXV 1JCHA 2ZR2A 3WG7B 3WG7C 5IYBO 3W7SA 1H2GA 4UUJC 4MT8A 1K4DC 5EBWC 2P7TC 1MOFA 1OCZC 2ZDIC 3MHSC 3ASOB 1SETA 3ASOC 4KFMA 5LGTA 4PA9A 1QVGU 1FS0G 1AJNA 2JJ2G 3CXCU 4MVQA 1K92A 1H8HG 3K9AA 4FJCC 1F4NA 3P30A 1EFRG 3G71V 2ITDC 2X0LA 1DF4A 2Q6AA 3ZN0A 4MVZA 2WPDG 1W0KG 2IJHA 2X6CA 3W7UA 5EC1C 1ZWIC 3UKMA 3A0RA 2EIJC 2FTKA 4N23A 3LSQA 4PA4A 1SERA 3ZN1A 3SPGA 1P4RA 3SYAA 4TT3G 4DO2A 2WLKA 3CCVV 3AG3B 1GK9A 3AG3C 1AJPA 3W7WA 3SPHA 2A79B 1G8MA 1Q7YW 2JJ1G 2IJKA 5EK0A 1VQOV 1GM7A 2QTOA 2X6AA 4HZ3A 1FXHA 5L3BA 5H6QA 3OW2U 2WLHA 1AI4A 4TWKA 1I5XA 2V7QG 4PDRA 2IW5A 1GKFA 4Z1MG 5L3DA 1K7DA 2UXNA 2OTLV 2AHZA 2R9IA 5B1NA 5CBGA 3CCQV 1QCEA 3F5WC 1VQLV 1YHQV 2EBOA 4XDLA 1JPXA 1S77D 2P90A 1YIJV 2EZPA 4GX0A 4BIZA 2YEVA 3SJQC 3LDEA 3P32A 3MHHC 4P30A 2EIKB 3OUSA 2EIKC 3OAAG 1MG1A 4WFGA 3CPWU 2LP7A 2ZXWB 2ZXWC 2KB1A 3GB7C 2MK3A 1M56B 1R73A 2ITCC 3IFXA 1PNMA 4KUMA 1QLEB 1K3EA 3ZRXA 4CBCA 1QR8A 1GO3F 2HFEC 4WFAV 4XDKA 4MW3A 2LFSA 5IDJA 2GHYA 1FFTB 4G27B 2WWWA 2P67A 3CCEV 2BOCC 1I5YA 3CCMV 2JIZG 3SYOA 5B3SB 2W0FC 4J9YB 4X8AA 3ZMUA 5B3SC 1QVFU 1L1FA 2WLJA 4F4LA 4MVMA 4ZKIA 2ZD9A 1P7BA 2IU0A 1FXKC 4R50A 3ETEA 3HPLC 3QO5A 4PA7A 3W7TA 2V1DA 5LBQA 5L3CA 1KQSU 2XAHA 1AROP 3OEEG 1CPYA 1QBZA 3FKSG 3SYQA 4RAIA 1QR9A 2BOBC 1VQ7V 4LC1A 1Y66A 1BHBA 2P6JA 3VOUA 5H6RA 3W7XA 1CP9A 4QIWF 1YI2V 1AJQA 4JAVA 4QNHB 1H8EG 3RVZA 2XNDG 3EFFK 3T4ZA 3AG1B 1M57B 2HR3A 1M57C 1K73W 2QA4V 4MTFA 2XOKG 1ENVA 1DLBA 4QE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  3STZ C;  3JYC A;  2X6C A;  1V55 C;  1XL4 A;  5EC1 C;  2A0L A;  1ZWI C;  3UKM A;  2EIJ C;  3ABM C;  2IH3 C;  4PA4 A;  3TET A;  3ABL C;  4MVO A;  3SPG A;  4MW8 A;  3FB8 C;  4PA6 A;  4JTA B;  3SYA A;  4MSW C;  5EC2 C;  3X2Q C;  2WLK A;  4PDV A;  1JVM A;  5CBH A;  5E1A C;  3AG3 C;  4WFH A;  3SPH A;  2HJF C;  3AG1 C;  5B1B C;  2A79 B;  4GX1 A;  1R3J C;  2WLL A;  5EK0 A;  3LDD A;  2A9H A;  2HG5 C;  2QTO A;  2DWE C;  2X6A A;  4MVU A;  4WFF A;  3T4D A;  4MTO A;  4ZBM A;  4HZ3 A;  4WFE A;  1R3I C;  3PJS K;  2Q67 A;  4MVS A;  2WLH A;  4RUE A;  4TWK A;  4PDR A;  3ASN C;  4JTC B;  2DYR C;  2JK5 C;  4MVR A;  3RVY A;  2Y69 C;  3STL C;  3F7Y C;  1OCC C;  1S5H C;  2IH1 C;  3LNM B;  4OXS A;  3T2M A;  4X89 A;  3K06 A;  3E8B A;  4PDM A;  3ZJZ A;  1BL8 A;  2WLN A;  4HYO A;  5BZB A;  1V54 C;  2AHZ A;  5CBG A;  4XDJ A;  3E89 A;  3F5W C;  4P9O A;  4J9Z B;  3SYP A;  2HVJ C;  2ATK C;  4G28 B;  4XDL A;  3SPJ A;  1G4Y B;  3FB7 C;  4PA3 A;  4QE7 A;  3FB6 C;  1ORQ C;  3E8G A;  4MS2 A;  4GX5 A;  4P9P A;  1OCO C;  4GX0 A;  2NLJ C;  3OUF A;  1K4C C;  4R7C A;  2OCC C;  2YEV A;  3SJQ C;  3LDE A;  3SYC A;  2R9R B;  4P30 A;  3OUS A;  2EIK C;  2WLL B;  4WFG A;  3TCU A;  1LNQ A;  5KUK A;  2ZXW C;  3BEH A;  3E8F A;  2KB1 A;  4LP8 A;  3SPI A;  3GB7 C;  5J9P C;  2ITC C;  3RBZ A;  3IFX A;  5IY5 C;  3K03 A;  2Q69 A;  2X6B A;  2HFE C;  5EBL C;  4CBC A;  1OCR C;  4XDK A;  4MW3 A;  4RUF A;  4G27 B;  5EBM C;  3E8H A;  3UM7 A;  3AG2 C;  4DXW A;  4JTD B;  2EIM C;  5KUM A;  3SPC A;  2BOC C;  2HVK C;  3LDC A;  3T1C A;  4R6Z A;  2WLM A;  1R3L C;  3OGC C;  5B1A C;  3LUT B;  3SYO A;  2W0F C;  3E83 A;  4J9Y B;  4X8A A;  5B3S C;  3ZRS A;  2WLJ A;  3K08 A;  4F4L A;  2DWD C;  3OR7 C;  2ZD9 A;  1P7B A;  4MVM A;  2WLI A;  3OR6 C;  4R50 A;  4H33 A;  3KG2 A;  3HPL C;  3R65 A;  4PA7 A;  3E86 A;  4GX2 A;  2WLI B;  3K0G A;  3FB5 C;  4P2Z A;  4I9W A;  4LBE C;  3WG7 C;  1J95 A;  4PDL A;  2Q68 A;  4EKW A;  4MTG A;  2EIN C;  3RW0 A;  1M56 C;  2QKS A;  4H37 A;  3SYQ A;  4RAI A;  4UUJ C;  2BOB C;  1QLE C;  1K4D C;  5EBW C;  2P7T C;  2EIL C;  1OCZ C;  4KFM A;  2DYS C;  3ASO C;  4R8C A;  3F7V C;  3VOU A;  1KKD A;  3IGA C;  4RO2 A;  3K0D A;  4PA9 A;  4QNH B;  3RVZ A;  3EFF K;  3T4Z A;  3K04 A;  1R3K C;  4LCU C;  3AG4 C;  5CBF A;  1M57 C;  4MTF A;  3ABK C;  4MVQ A;  4X88 A;  4BW5 A;  2K1E A;  2ITD C;  2Q6A A;  2AHY A;  1XL6 A;  4MVZ A;  4QE9 A; 
#chains in the Genus database with same CATH topology
 2JDI G;  1NI8 A;  4B3T O;  1AR4 A;  3VQW A;  1RM1 B;  3B8M A;  1BHA A;  3B77 A;  3OE7 G;  4LF8 B;  2W6J G;  3X2Q B;  4UVA A;  5DEC A;  3HKD B;  3L72 H;  2YIB D;  2D3O W;  1B6Q A;  4JI0 O;  1H38 A;  5FL7 G;  2WLL A;  4DR6 B;  1Q5O A;  4O4I B;  1JFF A;  2DYR C;  3LSS A;  4IGG A;  4CH3 A;  2EUL A;  1S5J A;  2XAG A;  1AP6 A;  5B1O A;  4PDM A;  4HYO A;  3B4S A;  2B1I A;  3ETD A;  1WAZ A;  2IU3 A;  3FB7 C;  2KG7 B;  3CME V;  2UUA B;  4D6T H;  4GZR B;  4BR6 A;  2R9R B;  5KUK A;  5LYJ B;  3BEH A;  4J80 A;  4DV0 O;  5K1P A;  5L3G A;  4TV9 A;  2ZDI A;  1VQ8 V;  2X6B A;  3JSN A;  3IC9 A;  4JAS A;  4UVC A;  1N34 O;  1KMI Z;  2ZIO A;  4J7J A;  5KUM A;  1HR0 O;  3T1C A;  1JOY A;  3JAK A;  1E1Q G;  3T1H B;  3AG4 B;  4TQD A;  2HJD A;  1SQQ H;  3OR7 C;  4CZZ A;  4NXN B;  4K8Z A;  4H33 A;  4ZI7 A;  1WB8 A;  4FLZ A;  1VQP V;  2AZ0 A;  1D5N A;  3E22 A;  4BAY A;  3RYF B;  2Y4U A;  3RW0 A;  4UCR A;  5LL6 Y;  2WSS G;  1VQM V;  2PF4 E;  1VQ6 V;  1R3K C;  1BE3 H;  1E1R G;  1ZLZ A;  3H1K H;  3VQX A;  4UCT A;  1FD9 A;  2FKX A;  3AEI A;  1SQV H;  4U7O A;  2VWJ A;  3IJ4 A;  4FK5 C;  2XUM A;  1W0J G;  3ABL B;  4H44 B;  1NBM G;  2O57 A;  2LQT A;  5LOV B;  1HNX O;  5EIB C;  1SZT A;  3EXA A;  2EJ7 A;  2XAF A;  3CRC A;  3AG1 C;  1AR1 B;  4OX9 B;  3RGB A;  1W2B U;  3RYH A;  3QO7 A;  1K8A W;  4X9Q A;  3BPZ A;  5LMN B;  1IBM O;  4U7N A;  3CD6 V;  4DR1 B;  1R6K A;  3RN4 A;  4H13 B;  1VF6 C;  4ZOL A;  4NTY A;  4X64 O;  1OCC C;  3ZHV A;  3E8B A;  4IYI A;  1V54 C;  1N8R W;  2HVJ C;  4DV3 B;  3AK2 A;  3SGI A;  3T1Y B;  3HKE A;  2DJV A;  4IIJ A;  3THO A;  4AIL C;  1VF5 B;  1IBL B;  2VQF B;  3H1I H;  4TUY A;  5LHG A;  1XNR O;  3OTO B;  2LGQ A;  4BIO A;  1KD1 W;  3LSU A;  1OCR B;  4TV9 B;  1OCZ B;  3JSL A;  3AG2 C;  5H9C A;  1BQ0 A;  4K0K B;  2PI5 A;  2WLM A;  2ZE8 A;  3JAK B;  1D5A A;  1M1K W;  1XIL A;  1Y67 A;  5FNV A;  4P2Z A;  4ZI7 B;  1Q82 W;  3PN1 A;  1JA8 A;  3E22 B;  5LP6 A;  5DED A;  2YI8 A;  3ZHT A;  3HKC B;  3K0D A;  5BR8 B;  1H2N A;  2F43 G;  1NKD A;  4I55 A;  1VQ9 V;  1COW G;  2FB5 A;  1K97 A;  4HBN A;  4W4K A;  1DGS A;  2AHY A;  4LFB O;  1XBL A;  2H8P C;  1JQ0 A;  4DW0 A;  3IC7 A;  3FX7 A;  3FFQ A;  1AIL A;  2IH3 C;  4W4L A;  1R6N A;  4O4H A;  2CH7 A;  3H9V A;  3K79 A;  1QLN A;  2ZCE A;  4JI1 O;  1N32 O;  2Q7G A;  1M93 A;  1GTO A;  4UCO A;  4WFF A;  5EZY A;  3RYH B;  4MTO A;  3AG7 A;  4WFE A;  2UXX A;  1O9G A;  2ARH A;  1OV9 A;  3KKY A;  4ZOL B;  4JI8 B;  2VQE B;  1S3J A;  2N05 A;  1PL4 A;  1DF5 A;  3E8G A;  5LA6 A;  3HKE B;  1KEC A;  4LF7 O;  3RWR D;  2OCH A;  4DUY B;  4BWA A;  1YTF B;  3FD9 A;  1RPO A;  1XDC A;  4TUY B;  3DGE A;  2DOS A;  3EHB B;  5IY5 C;  4NXM B;  1EN4 A;  4RWU A;  4UB6 Z;  2WA3 A;  1YDX A;  3OGC C;  3E83 A;  4BW9 A;  1DTO A;  5K1X A;  1NTK H;  1JCH A;  2ZR2 A;  5FNV B;  2NR5 A;  3EVK A;  5D5P A;  4MT8 A;  2UXB B;  5EBW C;  3CEI A;  1CXZ B;  3MHS C;  3H1L H;  2YIB A;  3ASO C;  5LP6 B;  2AGA A;  1BT8 A;  2RJZ A;  3CHX A;  3J81 N;  2CAZ C;  3CXC U;  1K92 A;  1SQP H;  4DV4 O;  3J7A U;  2ITD C;  4X1Y A;  1DF4 A;  1Z5W A;  3DC6 A;  1W0K G;  1XNQ O;  2BSK A;  1PP9 H;  4PA4 A;  1SER A;  1MMM A;  3RYC B;  1FPO A;  5KMG A;  2YID A;  1GK9 A;  2CTW A;  4DR7 B;  3SPH A;  3BCC H;  1G8M A;  1IBK B;  2JJ1 G;  1VQO V;  1SQX H;  2UUA O;  1AI4 A;  4DRX B;  4PDR A;  1XI1 A;  1I7F A;  2D2C B;  1X4T A;  1K7D A;  3L9D A;  2BTO A;  1PPJ H;  2UXN A;  2QWQ B;  2AHZ A;  3CCQ V;  1QCE A;  3F5W C;  4DV1 B;  2F95 B;  4IHJ A;  4XDL A;  3ZHU A;  1YIJ V;  3DXR A;  2EX3 A;  2ZE7 A;  3T1H O;  2YEV A;  5LA6 B;  3SJQ C;  5KLV H;  1MG1 A;  4GKJ O;  3CPW U;  3N2G A;  2CTQ A;  2ZXW C;  4DV5 B;  2KB1 A;  2ITC C;  4X65 O;  3IFX A;  4B3M B;  4B7K A;  4WFA V;  5JCO C;  4FVM A;  4TOI A;  2LFS A;  4J42 A;  4G27 B;  2WWW A;  1I5Y A;  1L8D A;  1XOU A;  4X62 O;  3SYO A;  2UUC O;  5B3S B;  1QVF U;  3ZMU A;  4ABM A;  5BMV A;  2F23 A;  4ZKI A;  2ZD9 A;  1P7B A;  3ETE A;  3N2K B;  3QO5 A;  2V1D A;  1ZL8 A;  1I94 O;  5L3C A;  3P3N A;  5J2U B;  2JRI A;  3OEE G;  5JWP A;  3FKS G;  4AQY B;  4O4L B;  1BHB A;  3VOU A;  4GKK B;  1EM1 A;  3M8A A;  4JAV A;  4QNH B;  2GUZ A;  5LMU B;  4DUZ B;  1K73 W;  1M57 C;  1TA8 A;  1I0H A;  5KHJ A;  1SKV A;  4JI5 O;  1YXB A;  4OX9 O;  3CCU V;  4JYA B;  4X1Y B;  3STZ C;  1X59 A;  3G6B A;  1RM1 C;  4X66 O;  3CP1 A;  4WF9 V;  5LMN O;  3GWK C;  2HHH B;  3ZRW A;  3ZMV A;  1KC8 W;  4PA6 A;  1AI5 A;  5JH7 A;  5H2F Z;  4LFC O;  5EIB D;  3X2Q C;  3I55 V;  3K5O A;  4E2L A;  2ZKO A;  5KMG B;  2HJF C;  1NR7 A;  2E76 B;  3HB3 B;  3A0B Z;  1S76 D;  1W59 A;  2NNU A;  2CTR A;  4RQF A;  4X89 A;  3D36 A;  3K06 A;  5IYC O;  1NH2 D;  2PZS A;  4CC5 A;  2B9Z A;  4JI3 B;  3G67 A;  1Q3E A;  5IJ9 A;  1FAF A;  2LFR A;  1VQN V;  2AW9 A;  3CX5 F;  3JAM N;  4K0K O;  3DXR B;  5ITZ A;  4OPA A;  4EB6 A;  2XAS A;  1SS3 A;  3DTU B;  3CC2 V;  3SPI A;  1Q81 W;  3JD4 A;  3N2G B;  5HFL A;  2Q69 A;  2B5U A;  3UM7 A;  4JTD B;  1YJW V;  4JI2 O;  4R6Z A;  1N33 B;  4GUN A;  2H94 A;  3WU2 Z;  1NS1 A;  4J7Z A;  3CE2 A;  4UV9 A;  5GW7 A;  3K58 A;  2L6L A;  2R70 A;  5BR8 O;  2P4K A;  1WA8 A;  4FZ0 A;  4I9W A;  4UCS A;  4HAM A;  4PDL A;  2HEP A;  2CTP A;  1XMQ B;  2C2A A;  3JAW A;  1G6U A;  1QLE C;  1UPG A;  2EIL B;  3Q4H A;  5JQG A;  2DYS B;  4DR5 O;  3F7V C;  1KKD A;  3L71 H;  2ZNJ A;  4QPJ A;  2QTS A;  1PNK A;  2GUZ B;  2OT5 A;  4BW5 A;  1YJ9 V;  3CC4 V;  1VMG A;  4CS4 A;  3APQ A;  2R72 A;  3VBB A;  1SA0 A;  1XL4 A;  2ZQM A;  2A0L A;  3ABM B;  1XQ8 A;  3ABL C;  2QWN B;  4MW8 A;  2QKC A;  2RN9 A;  3ZMS A;  3ZRW B;  5JH7 B;  2PGG A;  2QE7 G;  3TK1 A;  3OMI B;  1RFY A;  4X1K B;  1UJW B;  1MZF A;  3JD1 A;  4G2K A;  3OTF A;  4DV2 B;  5E79 Z;  1HWY A;  1YIT V;  4RUE A;  1KKC A;  2N04 A;  2Y4T A;  2R9A A;  4DUY O;  4JI6 B;  4K35 A;  3ZJZ A;  4CH4 A;  4Z1V A;  1FXV A;  4NXM O;  3SYP A;  2Z3Y A;  3ZHS A;  4YJ2 A;  2ZIN A;  2JS5 A;  2P4V A;  2N74 A;  1ORQ C;  4P9P A;  4LF6 B;  3QTC A;  4R7C A;  2OCC B;  1F4M A;  3C90 A;  3RT3 C;  3JAL A;  1K33 A;  4EB6 B;  2QWO B;  3TCU A;  3E8F A;  3K03 A;  1OCR C;  4I4T A;  4ZHQ B;  1WN7 A;  3ZRV A;  2HVK C;  3VQV A;  3UT5 B;  5C8Y A;  4LF5 O;  5CBF A;  3R65 A;  4DR2 B;  2DQ0 A;  4LBE C;  5D5Q A;  1PKX A;  3JAT A;  5KHH A;  1M90 W;  3CCS V;  4DR3 B;  2XAQ A;  2EIJ B;  2UU9 B;  4H37 A;  3NXS A;  5JVD A;  2YDE A;  4PI0 A;  4NB5 A;  4TQF A;  4B7E A;  2F66 C;  3Q4H B;  2BCC H;  3M99 B;  1AP5 A;  4X88 A;  1Y76 A;  1KP3 A;  1K5Q A;  4DR7 O;  3BVO A;  5IJ0 A;  1MNG A;  4JAU A;  4LFA O;  2ZT9 B;  4OPH A;  4I50 B;  4O2A B;  4X20 A;  3K9S A;  3CRA A;  3FAV B;  2H3O A;  1JVM A;  1HNZ O;  1TUB B;  2LW7 A;  4JYY A;  4QPK A;  1EN6 A;  3OD4 A;  2KKW A;  5LXT A;  3RVY A;  2Y69 C;  2Q9L A;  3ABU A;  3U10 A;  3ZED A;  4YY3 O;  4BIU A;  5BZB A;  3BFR A;  1OJH A;  3ZCC A;  1PD3 A;  2BE3 A;  3FB6 C;  4YJ2 B;  4CH5 A;  3E35 A;  3ABT A;  5DN6 G;  4FLW A;  2A06 H;  2WLL B;  1O9H A;  1P84 F;  1JFF B;  3K57 A;  4L87 A;  5EBL C;  4GCZ A;  3SJB C;  1MAB G;  3BAB A;  1NJI W;  2QGN A;  2DQ3 A;  1SF9 A;  1J5E O;  3CJH A;  4UV8 A;  3JD0 A;  2EIM C;  3SPC A;  3QNE A;  4I4T B;  3O9O A;  2Q7E A;  2DMX A;  1AR5 A;  5B1A C;  1HNW O;  2GSM B;  2LO1 A;  1L0N H;  2PUS A;  4Q20 A;  2QJ1 A;  4FFK A;  4JPR A;  4LH6 A;  1OZ0 A;  2QEX V;  2W0X A;  2Q0O C;  3WG7 B;  1IZ3 A;  4DR4 B;  4JYA O;  1K4D C;  4JZG A;  4DW1 A;  3APO A;  2M6Y A;  3CWB H;  1RP3 B;  5LGT A;  4YIP A;  5JVD B;  5LP6 C;  1LUW A;  3JAR A;  5EYP A;  2JJ2 G;  5KX5 A;  3HR0 A;  3I5D A;  1H2L A;  4FJC C;  1VAR A;  2FML A;  4EFE A;  4FLU A;  2WPD G;  1VF6 A;  2OIG A;  4YJ3 A;  2VRZ A;  1ZWI C;  3UKM A;  1ZUQ A;  4B3S B;  3CSX A;  4N23 A;  4JV5 O;  1Z5V A;  3SYA A;  3M7M X;  3HKB A;  2E3C A;  3AG3 B;  4KHP B;  1SQB H;  1SZX A;  2F93 B;  1Q7Y W;  4DV6 O;  4HZ3 A;  5H6Q A;  2XT9 A;  4JI4 O;  1I5X A;  4FM2 A;  4KXR A;  4Z1M G;  1FYJ A;  1M4U A;  2Z0A A;  5CBG A;  2JGD A;  1AB3 A;  3D3Q A;  2EZP A;  2E75 B;  4U3F H;  5F2V O;  3SJC C;  3LDE A;  3P32 A;  3CXH F;  3OAA G;  4WFG A;  2LP7 A;  2JVD A;  5CA0 A;  2MK3 A;  1R73 A;  3JAS A;  3BAA A;  1GO3 F;  2E74 B;  4XDK A;  2QSA A;  2RMK B;  1FKA O;  2P67 A;  3CCE V;  3CJH B;  2W0F C;  5B3S C;  4FM1 A;  2WLJ A;  2G38 A;  4MVM A;  1FXK C;  4R50 A;  3HPL C;  1N36 B;  2Y0P A;  4IIJ B;  4I0X A;  3VQY A;  2E5L B;  2XAH A;  1ARO P;  1CPY A;  1XHZ A;  3U0Z A;  2UUB B;  2BOB C;  1VQ7 V;  4LC1 A;  5A9G A;  2AXT Z;  4O4J A;  3W7X A;  3A2F A;  1CP9 A;  1YI2 V;  2ZE6 A;  3RVZ A;  2XND G;  4JI7 B;  3AG1 B;  2UXC B;  2QA4 V;  4MTF A;  2XOK G;  4B3T B;  3JAR B;  4PV1 B;  5EYP B;  2VS0 A;  5KX5 B;  4QE9 A;  4WBN A;  2JGU A;  3CRM A;  2IBZ H;  5DM6 V;  1M9N A;  4RQE A;  2XAJ A;  4YJ3 B;  2CUG A;  4Z2W A;  3TET A;  3BY6 A;  4MSW C;  1EBO A;  4LF8 O;  2VWK A;  1A32 A;  5E1A C;  3HKB B;  1V9P A;  5CN0 A;  5B1B B;  1TUE B;  2ZE5 A;  4I55 B;  2A9H A;  1GN3 A;  4PD4 F;  4JYC A;  2Q73 A;  3ASN B;  3CYO A;  4DR6 O;  4MVR A;  3FYE B;  3STL C;  3LNM B;  5AG2 A;  3CCL V;  1QQC A;  4J9Z B;  4PA3 A;  4O4H B;  1WNS A;  2CH7 B;  4GX5 A;  1IXM A;  1B3Q A;  1LNQ A;  1VQK V;  1YSC A;  5EZY B;  5IT9 N;  5J9P C;  4DR2 O;  3MD0 A;  4AHC A;  3JAS B;  3K5M A;  1N0J A;  1D2D A;  4DK0 A;  2UU9 O;  3CMA V;  4QJF B;  1R3L C;  4U3J A;  3CRQ A;  3K5L A;  1K5S A;  4JYB A;  2WLI A;  1Q90 D;  1SES A;  4DYL A;  2QM8 A;  5IE9 A;  4I0X B;  4NXN O;  2Y48 A;  4TV8 A;  4MTG A;  4LWS A;  1MSD A;  1M56 C;  2QKS A;  4LH7 A;  1S72 V;  3JD3 A;  2EIL C;  2DYS C;  3UO2 A;  3B09 A;  3TXQ A;  1XMO B;  1WPX A;  1DK1 A;  1US6 A;  3DSQ A;  4FIP C;  2K9P A;  1NR1 A;  1EZJ A;  3JYC A;  1V55 B;  1K9M W;  1HNX B;  3ABM C;  5GTI Z;  4TSF G;  5H5N A;  3FB8 C;  4JTA B;  2OIE A;  4PEL A;  4YXW G;  1U97 A;  4D7T A;  2MW2 B;  1NVP D;  3ZMZ A;  1IBM B;  4WCE V;  3JCZ A;  1VF7 A;  4GX1 A;  5C93 A;  3A0H Z;  3OM3 B;  1IDS A;  4X64 B;  2EZO A;  2HKO A;  1F51 A;  1PL0 A;  5JCO A;  5IY5 B;  3CB2 A;  4O2B A;  2YIC A;  1SQG A;  1S5H C;  5L3F A;  3N27 A;  2BSK B;  3ZMT A;  3JD2 A;  4DR1 O;  4YIO A;  3E89 A;  5LGU A;  1BGY H;  4IL6 Z;  4QE7 A;  2NLJ C;  4GT1 A;  2OCC C;  2RQ6 A;  4DV3 O;  4UVB A;  3T1Y O;  4LNU A;  2F4V B;  1YTF D;  2B1G A;  4FLT A;  1IBL O;  1WLE A;  3B40 A;  2VQF O;  1NTM H;  4NR1 A;  1GRJ A;  1AI7 A;  2P06 A;  2KQX A;  3E8H A;  3OTO O;  4FPP A;  1ZAU A;  3KCY A;  1Z2G A;  1Q86 W;  1Q6H A;  4U3J B;  4IHJ B;  4CC6 A;  1BSM A;  4I7Z B;  2WLI B;  3KZI Z;  2YEV B;  2M7W A;  1PV0 A;  3SJA C;  2EIN B;  4H0L B;  3OMA B;  4XBF A;  4TV8 B;  3HKD A;  3ETQ A;  4R8C A;  2DW4 A;  4B3S O;  3IGA C;  2OWO A;  4LFB B;  3AG4 C;  3ABK B;  4O4I A;  2K1E A;  3FYI B;  3TGU H;  3L73 H;  5BMV B;  5IWA B;  1XL6 A;  1AI6 A;  1IVS A;  2W6I G;  5JJJ B;  2HLD G;  1ZL8 B;  1RSO A;  1SC5 B;  2A7W A;  4N21 A;  4JI1 B;  5IYD O;  1N32 B;  4OGQ B;  3QVN A;  3K59 A;  5CBH A;  4FLV A;  4FLX A;  4NVP A;  2JEX A;  1XHX A;  5LYJ A;  4X1I A;  1P49 A;  1R3I C;  4E4E A;  1U96 A;  1GM8 A;  2RNB A;  4B08 A;  3ZHQ A;  1RPR A;  3C3S A;  1R1B A;  2IH1 C;  2DN9 A;  3I56 V;  1NQT A;  2WAM A;  1GM9 A;  2RCV A;  4JI8 O;  2VQE O;  1OCO B;  3WB1 A;  3OUF A;  5KA6 A;  3H1J H;  1TGO A;  3JCU Z;  4KP4 A;  5L3E A;  4UXN A;  2PTM A;  4C7U A;  4UCV A;  3L70 H;  1Q43 A;  1YZB A;  2E5L O;  4RUF A;  5HFM A;  3K5N A;  1WJZ A;  5EBM C;  3L74 H;  1URF A;  5B5E Z;  3OEH G;  2IJI A;  1JMK C;  5IJ9 B;  3K08 A;  4JGS A;  2DWD C;  1KYO F;  4GX2 A;  2JEU A;  2UXC O;  5ITZ B;  2UXD B;  3WG7 C;  1GAX A;  1H2G A;  5LOV A;  4NYK A;  2FL4 A;  2P7T C;  1OCZ C;  2ZDI C;  4KFM A;  3BRC A;  1H2K A;  4DV4 B;  1WPB A;  2QR4 A;  1MZE A;  4PA9 A;  1QVG U;  1FS0 G;  2UXB O;  1AJN A;  1XNQ B;  2PY5 A;  4MVQ A;  4PI2 A;  1H8H G;  4CS3 A;  4GYC B;  3G71 V;  3ZN0 A;  2Q6A A;  4MVZ A;  5FLX N;  4QGP A;  2IJH A;  1WA8 B;  2X6C A;  1R6T A;  5EC1 C;  1XUQ A;  1PM9 A;  3LSQ A;  3ZN1 A;  1RSO B;  1P4R A;  1YF2 A;  3JAW B;  4TT3 G;  4DO2 A;  1WP8 A;  2WLK A;  5JQG B;  3AG3 C;  1AJP A;  1KUQ A;  4Q6G A;  2A79 B;  1IUR A;  2IJK A;  1GM7 A;  1FXH A;  3OW2 U;  2WLH A;  5GON A;  4X1I B;  2V7Q G;  1AVM A;  1IBK O;  5L3D A;  5JJN B;  1SA0 B;  2OTL V;  4A5U B;  2R9I A;  5B1N A;  3BHP A;  2DE0 X;  3D8C A;  1VQL V;  1YHQ V;  1YVW A;  1S77 D;  4GKJ B;  1GN2 A;  4GX0 A;  4BIZ A;  4DV1 O;  1FJG B;  2LGW A;  4X65 B;  1VQ5 V;  2EIK B;  3OUS A;  2CDY A;  2HP8 A;  1LUV A;  3GB7 C;  1PNM A;  1QLE B;  1K3E A;  4X62 B;  3O65 A;  4MW3 A;  3HKC A;  5IDJ A;  4DV5 O;  2UUC B;  2GHY A;  1VIB A;  5FPR A;  4LF4 B;  2FYU H;  1TAE A;  4B3M O;  1P7G A;  3QG5 A;  2Q5Z A;  4ICG A;  3CCM V;  2JIZ G;  1I94 B;  4J9Y B;  1L1F A;  4F4L A;  2IU0 A;  2YIA A;  1F7Y A;  3TJT A;  3W7T A;  1XMO O;  5LBQ A;  3JAL B;  4RAI A;  1Y66 A;  1KU9 A;  2P6J A;  5H6R A;  2ZM6 B;  4JI5 B;  1AJQ A;  4AQY O;  3EFF K;  4GKK O;  4X66 B;  3MAQ A;  5C8Y B;  5LMU O;  1L0L H;  4DUZ O;  4J41 A;  1WP7 A;  1B04 A;  3D3I A;  4DV7 B;  5BY1 A;  4LFC B;  1YJN V;  1HW7 A;  2GV9 A;  3JAT B;  2P5O A;  2F1M A;  3OMN B;  5KAF Z;  4F6E A;  1YCI A;  1GH6 A;  4PDV A;  2ILM A;  1VQ4 V;  2HHH O;  5JJE B;  2L35 A;  5B1B C;  1KP2 A;  3OFN G;  1IX9 A;  2PI4 A;  3T4D A;  4MVU A;  1EZV H;  1ZX3 A;  3ETG A;  1Y76 B;  2DYR B;  3ASN C;  2YS8 A;  5GON B;  4GLX A;  5IJ0 B;  2F4V O;  3T2M A;  1BL8 A;  1BCC H;  1PNL A;  3U11 A;  3S3X A;  4AI8 A;  1VP7 A;  1SRY A;  2IM9 A;  2ATK C;  3B8N A;  3LNN A;  4X20 B;  1KBH A;  4MS2 A;  2GTS A;  4JI3 O;  5KHI A;  1K4C C;  2QM4 A;  2OTJ V;  5FPO A;  2ZIM A;  3DC5 A;  1B06 A;  3AK3 A;  3RBZ A;  4JI2 B;  5LXT B;  2ODM A;  4K3A A;  4DXW A;  2QWR B;  4PJ0 Z;  3LDC A;  3ZIA G;  3ICX A;  3CRR A;  4YHH B;  3LUT B;  1F23 A;  3NR7 A;  1JX9 A;  2ZR3 A;  4F6R A;  3OR6 C;  3K3W A;  5CMU A;  4CH6 A;  1N33 O;  4J11 A;  3GVM A;  3K0G A;  3FB5 C;  4NTX A;  2CK3 G;  1J95 A;  4DR5 B;  2Q68 A;  5IWA O;  3RYC A;  2Q7H A;  2GBO A;  4WFB V;  4LF9 B;  1NVP B;  1XMQ O;  3H01 A;  4LCU C;  5LHI A;  4LR3 A;  3MDS A;  4DRX A;  4B3R B;  4L8J A;  2RDC A;  2PYJ A;  1Y74 A;  3R66 A;  4FMT A;  2Y69 B;  1V55 C;  3CC7 V;  1HDJ A;  1NT2 B;  3ZBH A;  3CCR V;  4MVO A;  2CGN A;  2CGO A;  5EC2 C;  2QWP B;  1THZ A;  4WFH A;  1R3J C;  4D7S A;  3LDD A;  4ZBM A;  5A2Q N;  1Q6U A;  3PJS K;  4MVS A;  4FM0 A;  1JJ2 U;  2QDO A;  1OCC B;  3F7Y C;  3QO8 A;  4DV2 O;  5KA5 A;  4OXS A;  3E2E A;  1GMG A;  5KAI Z;  2ETN A;  1V54 B;  2BTQ A;  2EIM B;  1NH2 B;  3RFR A;  4JI0 B;  2X7R B;  5B1A B;  1K34 A;  2GTA A;  2Q4P A;  4G28 B;  4JI6 O;  1FXK A;  2GDS A;  3N2K A;  2LJ2 A;  2A3Q A;  5J2U A;  3SYC A;  1XRE A;  4LF6 O;  3H1H H;  1H2S B;  4O4L A;  1YEW A;  2UXD O;  1JR9 A;  3SDL A;  4I5S A;  2XHB A;  3AG2 B;  4LF5 B;  1GN6 A;  3WFV A;  3F5T A;  2JGD B;  3ZRS A;  5CA1 A;  5LGN A;  4DV0 B;  3KG2 A;  1BMF G;  4F6R B;  3G4S V;  4IYH A;  1N34 B;  4EKW A;  2EIN C;  3CCJ V;  1HR0 B;  5CA0 B;  5J2T A;  3P3P A;  4DR3 O;  4RO2 A;  1MSW D;  2EJR A;  2YXH A;  3GWO A;  3K04 A;  1TVK A;  2CE4 A;  3ABK C;  1N4C A;  3UO3 A;  4DK1 A;  3ZX6 A;  4LFA B;  2YUA A;  1QU7 A;  1WB7 A;  3RYI A;  1CEZ A;  1Y74 B;  1ZSP A;  1HNZ B;  3ML0 A;  3B2E E;  2YSU B;  4ASU G;  3G6E V;  4JF3 A;  5KHK A;  5CB4 A;  4MTX A;  1E79 G;  4O4J B;  5IYZ A;  2JS3 A;  2IJJ A;  4PHZ A;  4FFB A;  2HG5 C;  2DWE C;  3L75 H;  1UFI A;  2Q67 A;  4YY3 B;  5LHH A;  1I08 A;  1SQF A;  1OHH G;  1FJG O;  4JTC B;  1QHT A;  1NZ6 A;  2JK5 C;  2PYL A;  4WBN B;  1FFX A;  4K8X A;  4IT5 A;  4NKG B;  2YXL A;  2WLN A;  5B66 Z;  4UFZ A;  4XDJ A;  2BTQ B;  4P9O A;  4UCU A;  1S0V A;  3SPJ A;  1G4Y B;  4HNA A;  5CA3 A;  4LF4 O;  3WB0 A;  1FXK B;  1OCO C;  1LR1 A;  3AK1 A;  2XTA A;  1ROP A;  2P22 C;  2QKA A;  4LP8 A;  1J5E B;  2Z5U A;  4FZ1 A;  1HNW B;  2Q8V A;  3S3W A;  4EEQ A;  1ZTE A;  3D36 C;  4EFB A;  2YI9 A;  2ZM6 O;  4J10 A;  1Y4M A;  3SR2 C;  2QM7 A;  3WB2 A;  1XNR B;  1S5L Z;  5CA1 B;  3E86 A;  2WA4 A;  1MA1 A;  5IYB O;  3W7S A;  3IAY A;  4UUJ C;  2AZ2 A;  4DV7 O;  1MOF A;  3ZS8 C;  3ASO B;  1SET A;  5J2T B;  4X1K A;  4DR4 O;  4NTW A;  1QNM A;  2V4D A;  4FLY A;  3A8T A;  1TVK B;  3K9A A;  3UQ8 A;  1F4N A;  3P30 A;  1EFR G;  2X0L A;  1GN4 A;  3KCX A;  3TXS A;  4JV5 B;  1Q8I A;  3J80 N;  3BA8 A;  1NTZ H;  3W7U A;  3A0R A;  2EIJ C;  2FTK A;  3RYI B;  3SPG A;  4LWS B;  3G80 A;  4CS2 A;  3CCV V;  5TIS Z;  4DV6 B;  3ZHR A;  1BS3 A;  3W7W A;  4JI4 B;  2OYQ A;  3CS5 A;  5CB4 B;  1BZK A;  1T5E A;  5EK0 A;  2QTO A;  5IYZ B;  2X6A A;  4KHP O;  4FFB B;  5L3B A;  4TWK A;  2ZNI A;  2KSD A;  2IW5 A;  2LW1 A;  1KB9 F;  1GKF A;  4ZHQ A;  2NN4 A;  2Q0A A;  4I9Q A;  1FFX B;  2YC0 A;  1G1X B;  3UT5 A;  3C3T A;  1HP8 A;  1VEW A;  2EBO A;  2KG7 A;  4J7K A;  1JPX A;  2P90 A;  4ZIB A;  1IXB A;  4HNA B;  2ADQ B;  4YHH O;  4UB8 Z;  3MHH C;  4P30 A;  2EIK C;  5GTH Z;  1Q6I A;  2ZXW B;  3OGI B;  1XEQ A;  1M56 B;  3ZRX A;  4KUM A;  4CBC A;  1QR8 A;  2HFE C;  1EN5 A;  4O2B B;  2Y0I A;  1FFT B;  2BOC C;  1Y6X A;  4LF7 B;  4LF9 O;  2YXY A;  4KL1 A;  4X8A A;  1H2M A;  3OT7 A;  2ADP A;  4PA7 A;  5BXZ A;  1BQZ A;  1N0N A;  1KQS U;  3RYF A;  3BA9 A;  4I50 A;  1M5I A;  4O2A A;  4B3R O;  1JJO A;  1NU1 H;  4LNU B;  1QBZ A;  1N36 O;  3SYQ A;  1QR9 A;  3FAV A;  1TUB A;  4JAA A;  4QIW F;  1H8E G;  2UUB O;  4JZ2 A;  3T4Z A;  1M57 B;  2HR3 A;  5KHG A;  3UCS C;  1ENV A;  4JI7 O;  1DLB A;  3QF7 A; 
#chains in the Genus database with same CATH homology
 3CCU V;  2JDI G;  3STZ C;  3D3I A;  1RM1 B;  3B8M A;  5DM6 V;  1M9N A;  1RM1 C;  3B77 A;  1BHA A;  3CP1 A;  3OE7 G;  4RQE A;  4WF9 V;  2XAJ A;  1YJN V;  2W6J G;  3TET A;  3ZRW A;  3ZMV A;  1KC8 W;  3OMN B;  4PA6 A;  3BY6 A;  4MSW C;  1AI5 A;  3X2Q B;  1EBO A;  3X2Q C;  3I55 V;  4UVA A;  4PDV A;  4E2L A;  5E1A C;  1VQ4 V;  2D3O W;  1B6Q A;  5CN0 A;  2HJF C;  5B1B C;  1KP2 A;  1TUE B;  3OFN G;  5FL7 G;  5B1B B;  1H38 A;  1NR7 A;  2WLL A;  2PI4 A;  2A9H A;  3T4D A;  4MVU A;  3HB3 B;  1S76 D;  3ETG A;  2NNU A;  4JYC A;  3ASN B;  3ASN C;  2DYR B;  2DYR C;  3CYO A;  4MVR A;  3FYE B;  3LSS A;  3STL C;  4RQF A;  3LNM B;  3T2M A;  2XAG A;  4X89 A;  3D36 A;  3K06 A;  5IYC O;  5B1O A;  4PDM A;  1BL8 A;  1PNL A;  4HYO A;  1NH2 D;  2B1I A;  3ETD A;  3CCL V;  1SRY A;  4J9Z B;  2IU3 A;  2ATK C;  3B8N A;  2LFR A;  3FB7 C;  4PA3 A;  1VQN V;  4MS2 A;  4GX5 A;  3CME V;  1IXM A;  1K4C C;  2XAS A;  2OTJ V;  2R9R B;  1LNQ A;  5KUK A;  1VQK V;  3BEH A;  3DTU B;  3CC2 V;  1YSC A;  3SPI A;  1Q81 W;  5L3G A;  3JD4 A;  5J9P C;  2ZDI A;  3RBZ A;  1VQ8 V;  5HFL A;  2Q69 A;  2X6B A;  3MD0 A;  2B5U A;  4JAS A;  4UVC A;  3UM7 A;  4DXW A;  4JTD B;  5KUM A;  3CMA V;  1YJW V;  3LDC A;  3T1C A;  1JOY A;  4R6Z A;  1E1Q G;  3ZIA G;  4QJF B;  1R3L C;  2H94 A;  3AG4 B;  3LUT B;  1F23 A;  1K5S A;  4UV9 A;  1JX9 A;  5GW7 A;  2ZR3 A;  3OR7 C;  4CZZ A;  4JYB A;  2WLI A;  3OR6 C;  3K3W A;  4H33 A;  5CMU A;  1VQP V;  1SES A;  3FB5 C;  3K0G A;  2QM8 A;  4I9W A;  2CK3 G;  1J95 A;  4HAM A;  4PDL A;  2Q68 A;  2Y48 A;  4BAY A;  4MTG A;  3RW0 A;  1M56 C;  2QKS A;  2C2A A;  1S72 V;  3JD3 A;  1QLE C;  2WSS G;  1VQM V;  2EIL B;  2EIL C;  2DYS B;  4WFB V;  2DYS C;  1VQ6 V;  3F7V C;  1KKD A;  4QPJ A;  1NVP B;  3H01 A;  1R3K C;  1WPX A;  4LCU C;  5LHI A;  1PNK A;  1E1R G;  2OT5 A;  4BW5 A;  1YJ9 V;  4FIP C;  3CC4 V;  3AEI A;  1NR1 A;  4U7O A;  1EZJ A;  3VBB A;  3JYC A;  2Y69 B;  1V55 B;  4FK5 C;  1V55 C;  1W0J G;  1XL4 A;  2ZQM A;  4FMT A;  2A0L A;  3CC7 V;  1K9M W;  3ABM B;  3ABM C;  3ABL B;  3ABL C;  4MVO A;  1NBM G;  4TSF G;  3CCR V;  4MW8 A;  3FB8 C;  4JTA B;  3ZMS A;  5EC2 C;  4PEL A;  3ZRW B;  4YXW G;  1SZT A;  1NVP D;  1THZ A;  3ZMZ A;  2QE7 G;  2XAF A;  4WFH A;  3TK1 A;  4WCE V;  3AG1 C;  3JCZ A;  3OMI B;  1AR1 B;  4GX1 A;  1R3J C;  5C93 A;  1UJW B;  3QO7 A;  1W2B U;  3OM3 B;  1K8A W;  3LDD A;  3JD1 A;  4G2K A;  4ZBM A;  2EZO A;  3PJS K;  4MVS A;  1HWY A;  1YIT V;  4RUE A;  4U7N A;  3CD6 V;  2HKO A;  1F51 A;  1PL0 A;  5IY5 B;  1JJ2 U;  1R6K A;  1OCC B;  3F7Y C;  1OCC C;  1S5H C;  3QO8 A;  4OXS A;  5KA5 A;  5L3F A;  3E2E A;  1GMG A;  3E8B A;  3ZJZ A;  1V54 B;  3ZMT A;  1V54 C;  2EIM B;  3JD2 A;  1NH2 B;  1FXV A;  3E89 A;  5LGU A;  1N8R W;  2X7R B;  5B1A B;  3SYP A;  2HVJ C;  1K34 A;  2Z3Y A;  4G28 B;  1FXK A;  4QE7 A;  1ORQ C;  4P9P A;  2NLJ C;  4GT1 A;  4R7C A;  2OCC B;  1F4M A;  2OCC C;  3SYC A;  4UVB A;  1K33 A;  1YTF D;  3TCU A;  3E8F A;  2B1G A;  5LHG A;  1WLE A;  1KD1 W;  3K03 A;  1AI7 A;  1OCR B;  1OCR C;  4I5S A;  1OCZ B;  3AG2 B;  3E8H A;  3AG2 C;  4FPP A;  5H9C A;  3ZRV A;  2HVK C;  3WFV A;  1Q86 W;  2PI5 A;  2WLM A;  3ZRS A;  5LGN A;  1M1K W;  5CBF A;  3KG2 A;  3R65 A;  1BMF G;  2DQ0 A;  2WLI B;  4P2Z A;  4LBE C;  1Q82 W;  3G4S V;  2YEV B;  1PKX A;  2M7W A;  1M90 W;  3CCS V;  4EKW A;  2XAQ A;  2EIJ B;  2EIN B;  2EIN C;  3CCJ V;  4H37 A;  3OMA B;  4XBF A;  3NXS A;  4R8C A;  2DW4 A;  3IGA C;  4RO2 A;  3K0D A;  1MSW D;  2F43 G;  2EJR A;  3M99 B;  1NKD A;  1VQ9 V;  3GWO A;  3K04 A;  1COW G;  3AG4 C;  3ABK B;  4X88 A;  3ABK C;  1K97 A;  2K1E A;  3FYI B;  1KP3 A;  2AHY A;  1K5Q A;  1XL6 A;  1AI6 A;  2H8P C;  1JQ0 A;  2W6I G;  2HLD G;  3IC7 A;  4JAU A;  1CEZ A;  2IH3 C;  4N21 A;  3ML0 A;  5IYD O;  2YSU B;  1R6N A;  3K79 A;  1QLN A;  4ASU G;  3G6E V;  1JVM A;  4JF3 A;  5CBH A;  4MTX A;  1E79 G;  2IJJ A;  1GTO A;  2JEX A;  2HG5 C;  4QPK A;  2DWE C;  4WFF A;  4MTO A;  4WFE A;  1R3I C;  2Q67 A;  5LHH A;  2UXX A;  1OHH G;  1VQ5 V;  4JTC B;  2JK5 C;  1GM8 A;  3RVY A;  1RPR A;  2Y69 C;  3ABU A;  2IH1 C;  4BIU A;  2WLN A;  5BZB A;  3I56 V;  1NQT A;  1S3J A;  4XDJ A;  3ZCC A;  4P9O A;  1PD3 A;  1S0V A;  2WAM A;  3SPJ A;  1G4Y B;  1GM9 A;  5CA3 A;  1DF5 A;  3FB6 C;  3E8G A;  3E35 A;  1OCO B;  1FXK B;  1OCO C;  3OUF A;  5KA6 A;  1KEC A;  3ABT A;  4KP4 A;  5DN6 G;  5L3E A;  4UXN A;  2WLL B;  1YTF B;  1ROP A;  4LP8 A;  1RPO A;  2Z5U A;  3DGE A;  3EHB B;  5IY5 C;  4L87 A;  5EBL C;  4GCZ A;  1NJI W;  1MAB G;  4RUF A;  5HFM A;  2DQ3 A;  5EBM C;  4UV8 A;  3JD0 A;  2EIM C;  3SPC A;  3QNE A;  3OGC C;  5B1A C;  3OEH G;  2GSM B;  2IJI A;  3E83 A;  1Y4M A;  4Q20 A;  3K08 A;  4JGS A;  2DWD C;  2QM7 A;  3E86 A;  4GX2 A;  1DTO A;  2JEU A;  4JPR A;  1OZ0 A;  2QEX V;  1JCH A;  2ZR2 A;  3WG7 B;  3WG7 C;  5IYB O;  3W7S A;  1H2G A;  4UUJ C;  4MT8 A;  1K4D C;  5EBW C;  2P7T C;  1MOF A;  1OCZ C;  2ZDI C;  3MHS C;  3ASO B;  1SET A;  3ASO C;  4KFM A;  5LGT A;  4PA9 A;  1QVG U;  1FS0 G;  1AJN A;  2JJ2 G;  3CXC U;  4MVQ A;  1K92 A;  1H8H G;  3K9A A;  4FJC C;  1F4N A;  3P30 A;  1EFR G;  3G71 V;  2ITD C;  2X0L A;  1DF4 A;  2Q6A A;  3ZN0 A;  4MVZ A;  2WPD G;  1W0K G;  2IJH A;  2X6C A;  3W7U A;  5EC1 C;  1ZWI C;  3UKM A;  3A0R A;  2EIJ C;  2FTK A;  4N23 A;  3LSQ A;  4PA4 A;  1SER A;  3ZN1 A;  3SPG A;  1P4R A;  3SYA A;  4TT3 G;  4DO2 A;  2WLK A;  3CCV V;  3AG3 B;  1GK9 A;  3AG3 C;  1AJP A;  3W7W A;  3SPH A;  2A79 B;  1G8M A;  1Q7Y W;  2JJ1 G;  2IJK A;  5EK0 A;  1VQO V;  1GM7 A;  2QTO A;  2X6A A;  4HZ3 A;  1FXH A;  5L3B A;  5H6Q A;  3OW2 U;  2WLH A;  1AI4 A;  4TWK A;  1I5X A;  2V7Q G;  4PDR A;  2IW5 A;  1GKF A;  4Z1M G;  5L3D A;  1K7D A;  2UXN A;  2OTL V;  2AHZ A;  2R9I A;  5B1N A;  5CBG A;  3CCQ V;  1QCE A;  3F5W C;  1VQL V;  1YHQ V;  2EBO A;  4XDL A;  1JPX A;  1S77 D;  2P90 A;  1YIJ V;  2EZP A;  4GX0 A;  4BIZ A;  2YEV A;  3SJQ C;  3LDE A;  3P32 A;  3MHH C;  4P30 A;  2EIK B;  3OUS A;  2EIK C;  3OAA G;  1MG1 A;  4WFG A;  3CPW U;  2LP7 A;  2ZXW B;  2ZXW C;  2KB1 A;  3GB7 C;  2MK3 A;  1M56 B;  1R73 A;  2ITC C;  3IFX A;  1PNM A;  4KUM A;  1QLE B;  1K3E A;  3ZRX A;  4CBC A;  1QR8 A;  1GO3 F;  2HFE C;  4WFA V;  4XDK A;  4MW3 A;  2LFS A;  5IDJ A;  2GHY A;  1FFT B;  4G27 B;  2WWW A;  2P67 A;  3CCE V;  2BOC C;  1I5Y A;  3CCM V;  2JIZ G;  3SYO A;  5B3S B;  2W0F C;  4J9Y B;  4X8A A;  3ZMU A;  5B3S C;  1QVF U;  1L1F A;  2WLJ A;  4F4L A;  4MVM A;  4ZKI A;  2ZD9 A;  1P7B A;  2IU0 A;  1FXK C;  4R50 A;  3ETE A;  3HPL C;  3QO5 A;  4PA7 A;  3W7T A;  2V1D A;  5LBQ A;  5L3C A;  1KQS U;  2XAH A;  1ARO P;  3OEE G;  1CPY A;  1QBZ A;  3FKS G;  3SYQ A;  4RAI A;  1QR9 A;  2BOB C;  1VQ7 V;  4LC1 A;  1Y66 A;  1BHB A;  2P6J A;  3VOU A;  5H6R A;  3W7X A;  1CP9 A;  4QIW F;  1YI2 V;  1AJQ A;  4JAV A;  4QNH B;  1H8E G;  3RVZ A;  2XND G;  3EFF K;  3T4Z A;  3AG1 B;  1M57 B;  2HR3 A;  1M57 C;  1K73 W;  2QA4 V;  4MTF A;  2XOK G;  1ENV A;  1DLB A;  4QE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...