5EBLC

Kcsa t75g in the conductive state
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATGVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5eblC00
2HFEC 4QE9A 2WLHA 3SYOA 4PA3A 3UM7A 3WG7C 3R65A 1LNQA 2R9RB 3E8GA 4JTAB 3EFFK 4MW8A 3K04A 5EBMC 1ORQC 3K0GA 3STZC 2DWEC 4KFMA 2WLJA 4HYOA 2WLIA 4GX0A 4RUEA 4PA4A 4ZBMA 3ASNC 3SPIA 3E8FA 3HPLC 2EIMC 4LP8A 1KKDA 3PJSK 2BOCC 2X6CA 4J9ZB 3SPHA 2BOBC 3STLC 2WLKA 3IFXA 2ITCC 3ABLC 3SPCA 4G27B 3E83A 3E8BA 5EBLC 3LDEA 2HG5C 2KB1A 3AG2C 1OCCC 4UUJC 5EK0A 3RVZA 2A79B 2A9HA 2Q68A 4P30A 4GX5A 3TETA 3OR7C 3SPGA 2WLLB 2EILC 4MS2A 4P9OA 3FB5C 2ZD9A 2EINC 3LUTB 4MW3A 3T2MA 4DXWA 2WLMA 4XDJA 2ZXWC 1ZWIC 4MSWC 4MVRA 4PDRA 5KUMA 4X88A 4H33A 3RW0A 4CBCA 2HVJC 1R3LC 1M57C 3RBZA 1J95A 4R7CA 1OCOC 4WFEA 3KG2A 5EC2C 4OXSA 4X8AA 4R6ZA 2QTOA 2WLIB 3OUSA 2DWDC 4MVOA 4RO2A 1OCRC 1R3JC 3T4ZA 4R50A 2EIJC 3FB6C 2AHYA 2A0LA 4R8CA 1OCZC 1V54C 1G4YB 2Q6AA 4PA9A 2K1EA 3SYQA 4P9PA 3K08A 5CBHA 3GB7C 5E1AC 4BW5A 4F4LA 2DYRC 3LDCA 1K4DC 1XL4A 4MVUA 5EC1C 3T1CA 4PDMA 3SYCA 2H8PC 2Y69C 3F7VC 1JVMA 3RVYA 3K06A 2ATKC 4G28B 3LNMB 1V55C 3FB8C 5CBFA 3SYPA 3ZJZA 3JYCA 2EIKC 3SJQC 2JK5C 4H37A 2IH3C 4XDKA 2WLNA 1S5HC 4LBEC 4MVZA 1XL6A 3LDDA 3SYAA 2OCCC 4MVQA 4JTCB 1R3IC 2X6AA 4QE7A 1BL8A 2P7TC 2X6BA 3K0DA 3IGAC 2WLLA 5J9PC 2AHZA 1P7BA 3ABMC 3BEHA 2Q69A 1M56C 2HVKC 5IY5C 5B3SC 3ABKC 1R3KC 4LCUC 4TWKA 5CBGA 4QNHB 3AG1C 4WFFA 3E86A 4MTFA 4RAIA 3T4DA 4MTOA 1K4CC 4RUFA 4JTDB 3AG4C 4GX1A 2ITDC 3UKMA 3ZRSA 2Q67A 3X2QC 2HJFC 3OR6C 4MVMA 4X89A 3OGCC 5B1AC 2DYSC 2YEVA 4J9YB 1QLEC 2IH1C 4PDLA 2W0FC 4I9WA 2NLJC 3E89A 4MVSA 4WFHA 4XDLA 3AG3C 4PA6A 4PDVA 3SPJA 3OUFA 3FB7C 3F5WC 5B1BC 4EKWA 3VOUA 4PA7A 3K03A 5KUKA 2QKSA 4WFGA 4GX2A 3ASOC 4HZ3A 3E8HA 4P2ZA 3TCUA 5BZBA 5EBWC 3F7YC 4MTGA
chains in the Genus database with same CATH superfamily
4DUYO 2WLHA 4DR7B 4PA3A 5CA3A 4E4EA 1Y74A 3K04A 5BMVB 5IYZA 1SRYA 1X4TA 2CUGA 4GX0A 1URFA 3VQXA 3WB0A 4UVAA 1DLBA 1JOYA 3RT3C 4CC5A 4YY3O 3AEIA 4GKJO 4UCRA 3FD9A 4X9QA 3E8BA 4JGSA 5KHGA 3K5NA 3ZHVA 2GUZA 3JARA 1S77D 2CDYA 3VQYA 1AJPA 5CB4A 2XT9A 1XNQO 1IXMA 2F1MA 3DC6A 4FLXA 1RM1C 1VF6A 1K5QA 2K1EA 4GT1A 3RYFB 5A2QN 5CA0B 1FFTB 1SQVH 1XILA 2Q7GA 2XUMA 4X62B 3LNMB 4KXRA 3SJQC 2HJDA 4LF9B 2BTQA 5LP6A 3HR0A 2UXDO 1A32A 4DR5O 5LXTA 2RJZA 2FMLA 2DQ3A 1R3IC 4F6RB 2UUAB 1I94B 3OTFA 3BFRA 3KCXA 4FK5C 2K9PA 2WLLA 1PL4A 2Q7HA 4NXMB 1R3KC 3CXHF 4JTDB 3B77A 2JGDB 1SQFA 2DYSC 4J9YB 1Q81W 4I9WA 5D5QA 5H9CA 1MOFA 4EKWA 4DV3B 4B3TO 1QQCA 3CP1A 2Y4TA 4UCTA 3CB2A 4J42A 1AJNA 2EJRA 3GWOA 2VQFB 4DV5O 1N33O 3OM3B 2VWKA 2WLIA 4DR2O 3APOA 1R6KA 1H8EG 4FLZA 1KKDA 2EIMC 4LP8A 4I0XA 4QPKA 3N2GB 4MTXA 4CH3A 5C8YA 5LA6B 2M6YA 4E2LA 2YS8A 1ENVA 3AG2C 1H38A 2A79B 2A9HA 3SJCC 5LMUO 2ZD9A 3ZHUA 3E22A 4OX9B 1N0NA 1G6UA 2QWOB 2QWNB 1EN5A 1QHTA 3CCLV 4X65B 3D36A 4WFEA 1P84F 1NS1A 1BSMA 3ZS8C 1WB8A 2EX3A 1OCZC 1V54C 1GN2A 1QCEA 2YEVB 1IBMB 2FKXA 5HFMA 3K08A 3ZN1A 1W0KG 2OTLV 1AR1B 3ZMZA 1COWG 1S3JA 4N23A 4CH5A 5LYJA 3CCMV 3SYAA 1IBKO 4FLWA 2RQ6A 3L9DA 1Y66A 3TGUH 1BQ0A 4NB5A 2BSKB 1Q6IA 5JVDB 1XNRB 4KHPO 2PYJA 2ITDC 3CEIA 1SA0A 5DN6G 3ABUA 3ZHSA 1SQQH 2P22C 2KQXA 3OGCC 4FVMA 2RMKB 5A9GA 5LOVB 2R70A 1FYJA 4PA6A 3SPJA 2QM8A 3FB7C 4JAAA 5FPRA 5JCOA 5L3FA 5L3EA 1NJIW 3BAAA 1SERA 4Q20A 3K03A 3G67A 1WLEA 2HFEC 1WA8A 4UVBA 2CH7A 3K0GA 3JATA 1PNMA 4O2AA 4H13B 1DTOA 5K1PA 3CJHB 1KD1W 2X6CA 2CTRA 2L35A 1FJGB 1LUVA 4DV7O 4DR4B 1GAXA 4U3JB 1Z2GA 5ITZB 1OCCC 1YEWA 5B5EZ 5CMUA 1K34A 4LF4B 2QE7G 2GSMB 2PGGA 1ZAUA 1YI2V 3JCZA 2A06H 4DV2O 2LW1A 1OCRB 2OCHA 2ZDIA 5KHJA 1HNXO 4JYAB 4RO2A 5IWAO 3ETDA 3H1IH 4R50A 1O9GA 1Q7YW 2Q6AA 4H44B 4J10A 5DM6V 1Q3EA 2ZIOA 4DUZO 4BW5A 4LR3A 4EB6B 3F7VC 2IJKA 3ZBHA 1NR1A 1K3EA 1M57B 1FXKA 4PHZA 3CCSV 4GLXA 4AI8A 2P67A 4LFCO 3LDDA 1MSWD 3W7XA 1KUQA 3L70H 3ZMVA 3N2KB 4RQFA 1P49A 1NU1H 2EIKB 4MTOA 2IBZH 2XAGA 1BHAA 3B8NA 4BIOA 4XDLA 4MVSA 1IURA 3RYFA 5CA0A 3JASA 1EM1A 3W7SA 2ADPA 3ABMB 4YHHO 4TOIA 4DR1B 3CD6V 2LQTA 2V1DA 4PJ0Z 3QO8A 3F7YC 2UUCB 1WP7A 3U0ZA 4QE9A 3E8GA 2JEUA 3RYCB 2WLJA 4O4LB 3K9SA 1YJWV 4CH4A 3L71H 3THOA 2VRZA 1AR5A 4J9ZB 4K0KB 2JGUA 3STLC 4JI7O 1L0LH 3T1YO 4B3MO 2HG5C 4WBNA 3D8CA 4CH6A 3HKCB 2E74B 3CRQA 2CE4A 2EINC 3SJBC 3T2MA 4UCVA 4LF5B 2EZOA 4AQYO 1N36B 3A2FA 1FS0G 4FM1A 3RFRA 3VQVA 2WWWA 4BIZA 1RPOA 3UO2A 1RP3B 3T4ZA 3TJTA 3QO7A 3E2EA 4ZOLB 1VQ9V 1XL4A 3I5DA 2HHHB 2H8PC 3Q4HA 1KYOF 1VQMV 2HLDG 4JZGA 2XAHA 3FKSG 4YJ2A 3DXRB 3N2GA 3B2EE 5LA6A 2HP8A 4LFBO 5H5NA 2RDCA 4NXNB 1RM1B 1Y67A 3CC2V 2OCCC 4JTCB 3SR2C 4D7TA 4QE7A 4O2BB 2WSSG 2JDIG 4DV6O 2JVDA 3O65A 4JI2O 4L87A 3ZRVA 2A3QA 2AW9A 2W6JG 5L3CA 3FFQA 1I5XA 1AJQA 4X20B 2XAFA 1VQ5V 3RYIA 2YEVA 2QJ1A 1D2DA 4LWSA 2W0FC 2GTSA 2NLJC 3K79A 4DV1O 3OUFA 3F5WC 3TK1A 1FKAO 4GKKB 1XUQA 1SZXA 1ZL8B 1SESA 1N32B 4O4IB 5HFLA 3STZC 2XHBA 4KFMA 5KAFZ 1HR0O 2DYSB 4UFZA 1HW7A 3E8FA 4DR3B 2C2AA 2BSKA 1PL0A 1SETA 4JPRA 3SPHA 3BRCA 5LHGA 2F93B 4C7UA 2PUSA 2X7RB 1JJOA 2Q68A 3OR7C 4FM0A 3VBBA 5LOVA 1Q82W 2ZXWC 2ZQMA 1HNWO 2UU9B 1J95A 2EIMB 5LGTA 2QWPB 3APQA 1OCRC 4R8CA 4PI2A 4YIPA 1F51A 3D3QA 2VQEO 3AG2B 2M7WA 2ZT9B 3T1CA 2FYUH 1AP6A 3ZMSA 4NTXA 4GYCB 3W7UA 1KP3A 1S76D 3CJHA 1EZJA 2YI9A 3AK3A 2CTWA 4FZ1A 4DW0A 1WJZA 4UCOA 3G4SV 3E35A 1N8RW 2DW4A 4U3JA 1XQ8A 4J7JA 5ITZA 1KMIZ 5J2TA 1OCZB 1V54B 1R1BA 2UUBB 2HVKC 3H1LH 5IY5C 2E5LB 4NVPA 1BZKA 4X66O 4QNHB 1M1KW 2DE0X 3JAWB 3X2QB 4BR6A 3B40A 3UKMA 3OE7G 2YXYA 4LF8O 5JQGB 3UO3A 2LFSA 3AG3C 1IZ3A 4EB6A 2ETNA 3A8TA 3BA9A 4ZKIA 5L3GA 1CXZB 5EBWC 1NH2D 2YXHA 1EN4A 1FAFA 3NXSA 4H0LB 5L3DA 3GWKC 2OYQA 3DC5A 2PTMA 4PA4A 2QKAA 3M7MX 3L75H 5BXZA 2CGOA 4JI0B 3N2KA 4J7ZA 3D3IA 2WLKA 1SQPH 2DQ0A 2QM4A 1EN6A 5IDJA 3B4SA 3LDEA 1Y4MA 1WB7A 4O4JA 5EK0A 1FFXA 2EILC 1VQKV 1F4MA 4JAUA 1J5EB 2WLMA 3ETEA 1JFFB 4MVRA 1R3LC 4IIJB 5B1NA 4LFAO 2KKWA 5EC2C 5JH7B 4JI8O 3A0HZ 5JJNB 4LH7A 1HNZB 2NN4A 1IXBA 3JAMN 5JWPA 1OCCB 4JI6B 3B8MA 3CWBH 5F2VO 1AVMA 3FB8C 5CBFA 1YVWA 2F23A 2AZ2A 2AXTZ 1DF4A 2YIDA 3AK2A 3AG7A 1XMQO 2QA4V 5CN0A 4JI4O 4YJ3B 4FFBB 4BW9A 3HKCA 3IGAC 4I4TA 5J9PC 5IYDO 1HP8A 2Q69A 2QEXV 1TA8A 2D3OW 4K35A 4DRXA 4RAIA 5B66Z 4TQDA 1IBLB 3CRRA 4CS2A 1GN3A 4X89A 2NNUA 3IC7A 4I50B 4WFHA 2QM7A 4ZOLA 1AR4A 5EZYB 1SC5B 4AILC 1N4CA 4DR6O 5FL7G 5FPOA 1I08A 2YC0A 2PY5A 4LF6O 3OMNB 4Z1VA 3SYOA 2XAJA 3UM7A 2DN9A 1MG1A 4J80A 1Q5OA 4OPHA 1Q90D 4MW8A 1WN7A 5EBMC 3ZN0A 1Q6UA 1YXBA 2DWEC 4LF7B 4GUNA 4O2BA 1NI8A 4B3RB 3SJAC 5KX5B 2CK3G 3I56V 4PELA 1PV0A 5TISZ 3EHBB 1AILA 1Y76B 5FLXN 3A0BZ 3TETA 4FPPA 4X20A 3OTOO 4JYCA 3HKEB 1E1RG 2Y0PA 5KHHA 3HKBA 4X8AA 2WPDG 1N34B 1R3JC 4BAYA 4LNUB 4WCEV 3JAKB 3WFVA 1ZL8A 2QSAA 2CTQA 3C90A 5E1AC 4O4IA 1K4DC 4D7SA 4OGQB 2Y69C 3HKDB 3CCQV 2EINB 2EJ7A 1XOUA 2BCCH 1N0JA 3SYPA 4Z1MG 4TUYB 1BGYH 5BR8B 4JI3O 2MW2B 4ZHQB 2QTSA 1GTOA 3G6BA 1H2LA 2GBOA 4N21A 4UB6Z 5J2UB 4D6TH 2YXLA 5GONA 1M56C 1FPOA 3RYHB 3CCVV 3AG1C 3SDLA 4JYYA 3G71V 2F4VO 3X2QC 3K59A 2YDEA 2OCCB 2O57A 3RGBA 2LFRA 4YXWG 3ML0A 3PN1A 5EYPA 1F4NA 2PZSA 1RSOB 4ABMA 1Q8IA 1NH2B 1VP7A 2UXBB 1G1XB 3M99B 5LMNO 3CSXA 1MNGA 2GHYA 1XHXA 3H1KH 3ABTA 4RUEA 2OIEA 3K5OA 3I55V 4J41A 2QWRB 4RWUA 2YICA 4DV4O 2BOBC 4FLTA 2H94A 3IJ4A 5EIBC 2ZM6O 1L0NH 3SPCA 3JAWA 4DV0O 1WNSA 1W59A 2UXCO 4CS3A 3OT7A 4JV5O 4I55B 4DXWA 1KECA 2IM9A 4PDRA 4B3SB 3T1HB 2R9AA 4F6EA 2XTAA 4IGGA 2YIBA 5KLVH 1KB9F 3BA8A 5E79Z 3QO5A 2W0XA 2FTKA 4JI1O 3CMEV 1H2NA 1KP2A 4W4LA 2ZXWB 5JJEB 3ZX6A 3B09A 4PD4F 2PYLA 4TV9B 3LSSA 3MHSC 1L8DA 5LHHA 2LP7A 4X64O 5CA1B 1FXKC 2AGAA 2ZR2A 4WF9V 5B1OA 2ZCEA 4IYIA 1YJ9V 3P3PA 4UCSA 1JFFA 5BMVA 1HWYA 3U10A 4IIJA 1SQBH 2Q67A 4DK0A 2HJFC 5B1AC 1CPYA 3C3SA 4DR7O 1VQ8V 5B1BC 3ZMUA 3IAYA 4FJCC 3JALB 5IY5B 3ETGA 1YHQV 2DJVA 1S72V 2IU3A 1EZVH 1OV9A 1NKDA 3MDSA 3ZMTA 1SS3A 2BE3A 3R66A 1MMMA 3G6EV 1KU9A 4YJ3A 4FFBA 4JI5B 3AG3B 4DUYB 4X1YB 3HPLC 1K33A 1SZTA 4IT5A 4ICGA 3BY6A 3JSNA 4JZ2A 2YIBD 4NTWA 1JQ0A 4P30A 5AG2A 1BMFG 3OFNG 4YY3B 4PI0A 2CAZC 5EZYA 1ZWIC 4MSWC 1FXVA 2F43G 4GKJB 1TGOA 4HAMA 4F6RA 1OCOC 1I7FA 1PNLA 4X62O 4CC6A 3OMAB 3BABA 1R73A 4LF9O 4L8JA 1XNQB 3SYCA 2JGDA 2EILB 1YIJV 4ASUG 2GV9A 1S5LZ 1DF5A 5KX5A 1PP9H 2ARHA 1I94O 2UUAO 3JYCA 4U7NA 2GUZB 1YDXA 4DK1A 4NXMO 1XL6A 1Y76A 5KMGB 4MVQA 2X6AA 1BL8A 2P7TC 2X6BA 4Z2WA 5KA6A 2F95B 2UXDB 4DR5B 2XOKG 2Z5UA 2FL4A 4DV3O 4DR6B 1QVGU 1MABG 3ZRSA 2P4KA 1RFYA 5KA5A 4LNUA 4PDLA 3JAKA 3LSQA 3J7AU 1KC8W 1Q86W 1NTZH 4PDVA 2BTQB 2P6JA 1TAEA 2VQFO 5LXTB 3HKDA 5KUKA 3CC4V 1K8AW 4TUYA 3WG7B 1UFIA 2B5UA 3QF7A 2ZE8A 4BWAA 1RPRA 4ZHQA 2Q7EA 3EFFK 4B3TB 2B1GA 2Q0AA 3S3WA 4QGPA 4JF3A 5K1XA 5J2UA 1NR7A 4UV9A 2PI4A 3PJSK 2BOCC 1TUEB 2FB5A 4DV5B 1N33B 3L74H 3IFXA 4OX9O 2ITCC 4DR2B 2IU0A 1E1QG 2ZKOA 2KB1A 4X65O 3GVMA 1IDSA 4RQEA 3RVZA 3LUTB 1IBMO 1VQ4V 3MD0A 2Y48A 2LGQA 1RSOA 4UB8Z 2OIGA 1IVSA 4OXSA 3ZRWB 2WLIB 3OUSA 5LMUB 3ZHTA 2PI5A 1GM7A 2AHYA 3ZHRA 1O9HA 2P90A 5JVDA 2E76B 4I0XB 1GRJA 3DTUB 4F4LA 2DYRC 1TUBB 1ZLZA 3K5LA 1QR8A 1GM9A 3ZJZA 2Q9LA 2IH3C 3EVKA 4MVZA 3J80N 1KKCA 1R6TA 4JASA 1XNRO 1XI1A 4FMTA 4JAVA 3RN4A 2OWOA 2EBOA 4I55A 4KL1A 5B3SC 2Y69B 2RN9A 4FZ0A 1IBKB 1K73W 5IYBO 3QTCA 4MTFA 1NVPB 4GX1A 1QLEC 3BVOA 3G80A 5LHIA 1AP5A 5LYJB 4KHPB 3FX7A 1L1FA 1M56B 3ASOC 1E79G 3AG1B 5C93A 5JJJB 1FJGO 4DR4O 4HYOA 2JRIA 3M8AA 1BT8A 1AI6A 1NTMH 2PF4E 2N04A 1M4UA 2DMXA 4LF4O 4JYBA 3ZRXA 4ZI7B 4B08A 2KG7B 1AI4A 4FIPC 4I9QA 1F23A 2B1IA 4UUJC 1K9MW 1NQTA 4JYAO 3TXSA 3CYOA 4XDJA 4DV7B 5KUMA 3P30A 2E3CA 4R7CA 2GTAA 1YSCA 1JA8A 3CRCA 2EIJC 4O2AB 2HKOA 1YF2A 3SYQA 3ZEDA 1GKFA 4DV2B 1OJHA 4PDMA 1HNXB 1IX9A 5IWAB 2P4VA 2P06A 3OGIB 1TVKB 3CPWU 1GN4A 1VQOV 4DUZB 2ZE7A 2OTJV 2WLNA 1OZ0A 2QR4A 3ZIAG 1U97A 1XBLA 3P3NA 1D5NA 3N27A 2OT5A 2P5OA 3RYCA 3ABKC 2QDOA 2JIZG 4O4LA 1KBHA 4LFCB 3BHPA 1VF6C 3E86A 3W7TA 1PPJH 3OR6C 4DR1O 1QBZA 2WAMA 1M93A 4LH6A 2IH1C 2UUCO 3E89A 1B04A 2X0LA 1FXKB 4W4KA 5H6QA 4K8XA 5LP6C 2LJ2A 1SKVA 4IHJB 3TCUA 3L72H 3WG7C 3R65A 4K0KO 3ZHQA 1AI7A 5KMGA 4QJFB 4WFAV 4YHHB 3JD1A 5B1AB 4FM2A 4B7EA 1XMOO 4TSFG 3ASNC 3CC7V 2RNBA 5B1BB 1BHBA 1MZFA 1P4RA 5LGNA 4NYKA 3UT5B 4LF5O 1Y6XA 1N36O 2VS0A 3LSUA 4MT8A 3JASB 1WAZA 2JEXA 3DXRA 2XASA 4MS2A 3FB5C 1VF7A 4JI7B 3JD3A 1YTFD 4X88A 3T1YB 2CTPA 4B3MB 2HHHO 1K97A 2IJIA 2ZINA 3KG2A 4R6ZA 5IYCO 3UCSC 3ZCCA 2A0LA 1G4YB 4PA9A 2V7QG 4AQYB 1US6A 5GTHZ 5CBHA 5IJ0B 2XAQA 4BIUA 1VIBA 4NXNO 1Z5VA 1JVMA 1V55C 1K5SA 4WBNB 3HB3B 4H37A 1OCOB 1DGSA 1Z5WA 1QU7A 1BE3H 1S5HC 2ZNJA 5LL6Y 3H9VA 3J81N 2Z0AA 3JD4A 2E75B 4X1IB 2QGNA 3BEHA 3D36C 5D5PA 4UCUA 5FNVB 4LFBB 1MZEA 5IJ9B 4CS4A 4EFEA 4KUMA 3ZRWA 1GN6A 3AG4C 4J11A 1ZUQA 2ODMA 2WA3A 1AROP 3Q4HB 4GKKO 4QPJA 1PM9A 4UVCA 4DV6B 4JI2B 2Q5ZA 3FAVB 4UXNA 4YJ2B 1TUBA 1N32O 1EBOA 2VWJA 4FLYA 2JS5A 4GZRB 1U96A 1K92A 5GW7A 4HZ3A 1B3QA 1S5JA 1THZA 3JCUZ 4DV1B 4DR3O 3KZIZ 1LNQA 1GM8A 1M5IA 3U11A 2Q8VA 1XDCA 1YCIA 1QVFU 4A5UB 3K58A 1X59A 4O4HB 5LGUA 3RYIB 4LWSB 4TV8B 3ABLC 1HR0B 2UU9O 4G27B 4GCZA 3P32A 1VEWA 5JCOC 1ZSPA 4MW3A 1ZTEA 1GH6A 1BS3A 5BY1A 3CRAA 2YIAA 2YI8A 3DSQA 4UV8A 3SGIA 2DWDC 1VMGA 3FB6C 1NBMG 3CMAV 1I5YA 2ILMA 1HNWB 3MHHC 2EULA 4DW1A 2L6LA 5JQGA 3EXAA 5LBQA 4K8ZA 2UUBO 3WB1A 2VQEB 4OPAA 4DO2A 2E5LO 1G8MA 4ZI7A 1PNKA 2N74A 2KG7A 2Q0OC 1QNMA 4B7KA 2DYRB 3H01A 1EFRG 3L73H 4ZIBA 2ZDIC 1H2SB 3CS5A 4LCUC 4TWKA 1DK1A 2RCVA 1MSDA 3T4DA 1JR9A 1AB3A 1FXHA 3C3TA 4MVMA 1JX9A 2ADQB 2F66C 4X66B 1VQLV 5KAIZ 3AK1A 3TXQA 4GX2A 2Y4UA 5B3SB 5H6RA 5J2TB 5BZBA 1TVKA 2V4DA 3VQWA 3UQ8A 1YJNV 4LF8B 4X1KB 2R9RB 4JI0O 4NR1A 3JD2A 5JH7A 1NVPD 1QLEB 4IL6Z 3SPIA 4U7OA 4I7ZB 2Z3YA 2UXNA 1J5EO 3CRMA 1P7GA 1KQSU 3CCEV 3ASOB 2N05A 2LO1A 3WU2Z 4FFKA 2A7WA 1YZBA 3SPGA 4P9OA 1JMKC 1YTFB 1M90W 4HNAB 1HNZO 1H8HG 2HVJC 3A0RA 1D5AA 4IHJA 2CGNA 4JI6O 4MVOA 1ZX3A 2IJHA 2LW7A 1JJ2U 3F5TA 1T5EA 4P9PA 3DGEA 3LDCA 4LFAB 2ZE6A 4TQFA 3RVYA 4JI8B 4I50A 1GMGA 4O4JB 1FFXB 3UT5A 5H2FZ 2EZPA 1Y74B 3OW2U 2BTOA 5IYZB 2EIJB 1B06A 5EIBD 1Q6HA 2UXXA 1AI5A 1IBLO 1NZ6A 1P7BA 3RWRD 3OEEG 1XMQB 1UPGA 2GDSA 5DECA 1W2BU 4JI4B 1VQNV 1HDJA 1K4CC 4RUFA 2IW5A 2JJ2G 3S3XA 3JSLA 3JARB 3QNEA 1VQPV 5IJ0A 1QR9A 1OHHG 3CX5F 5CB4B 4LF7O 2HR3A 2QWQB 3ABKB 1XMOB 1MA1A 4P2ZA 4FLVA 4YIOA 3ETQA 3W7WA 4QIWF 2W6IG 2Y0IA 1UJWB 4B3RO 4I4TB 5IE9A 2Q73A 3HKEA 4JTAB 4CZZA 3QVNA 2KSDA 2H3OA 1Q43A 4KP4A 4ZBMA 4X1IA 4DRXB 4LF6B 4PV1B 2ZIMA 1CP9A 2ZNIA 4AHCA 1BCCH 4Q6GA 5LP6B 3OEHG 5FNVA 3CXCU 5IJ9A 3BPZA 1VARA 4GX5A 4XBFA 2WLLB 1N34O 5KHKA 3FAVA 1FD9A 1SQGA 1WPXA 3IC9A 4H33A 3ASNB 3RBZA 2XNDG 5IT9N 1H2KA 3WB2A 2WA4A 3OTOB 1M9NA 1F7YA 3RYHA 5BR8O 2R72A 3GB7C 5EC1C 4LC1A 3O9OA 1VF5B 4G28B 1BQZA 2YSUB 1WPBA 2YUAA 4O4HA 2AZ0A 4J7KA 1PKXA 2B9ZA 4TV8A 4LBEC 1H2GA 1V9PA 3CCJV 4DYLA 3BCCH 3HKBB 2AHZA 4JI3B 3OD4A 2HEPA 5C8YB 1V55B 3QG5A 2G38A 4WFFA 1XEQA 3KCYA 3OMIB 3MAQA 1H2MA 3CHXA 5GTIZ 2UXBO 4NTYA 2QKCA 3E22B 1NT2B 1CEZA 2NR5A 3CCRV 3K57A 3JD0A 3VOUA 4PA7A 2F4VB 4WFBV 1VQ7V 4EFBA 4G2KA 5GONB 3H1HH 3AG4B 2MK3A 3OAAG 4I5SA 2ZE5A 1ORQC 4NKGB 1B6QA 4K3AA 1YITV 2JS3A 3CE2A 5DEDA 5LMNB 3FYEB 4B3SO 3T1HO 1SQXH 3E83A 5EBLC 1GK9A 5EYPB 3CCUV 2Q4PA 1GO3F 4TV9A 4DV4B 2JJ1G 2ZM6B 4CBCA 3RW0A 2R9IA 4DV0B 1I0HA 1M57C 5CA1A 2UXCB 1LR1A 1R6NA 4IYHA 2QTOA 1SA0B 1JCHA 4JV5B 3ABLB 4X1KA 2IJJA 3K3WA 5L3BA 4MVUA 1LUWA 4HBNA 1SF9A 1QLNA 3K06A 2ATKC 1S0VA 1W0JG 1XHZA 2EIKC 1WP8A 2JK5C 4TT3G 4XDKA 1ROPA 1WA8B 2CH7B 3NR7A 4JI1B 3JALA 1NTKH 1JPXA 3JATB 2LGWA 3K0DA 1XREA 3ABMC 2ZR3A 4HNAA 4U3FH 5CBGA 4X64B 3K5MA 4EEQA 2DOSA 3ICXA 3KKYA 4X1YA 3LNNA 4FLUA 1PD3A 1K7DA 5KHIA 3H1JH 1VQ6V 2D2CB 2QKSA 4WFGA 3E8HA 4JI5O 3K9AA 3FYIB 4MTGA
chains in the Genus database with same CATH topology
2WLHA 4PA3A 5CA3A 1LNQA 1SESA 1NKDA 1GM8A 3ZMTA 3K04A 3STZC 5HFLA 1SRYA 4KFMA 3G6EV 2DYSB 4GX0A 3AG3B 1QVFU 3E8FA 3HPLC 2C2AA 1PL0A 1DLBA 1K33A 1SETA 1SZTA 4UVAA 5LGUA 1JOYA 4JPRA 3SPHA 3AEIA 5LHGA 3ABLC 3BY6A 4G27B 3E8BA 4GCZA 4JGSA 3P32A 2X7RB 2Q68A 1JQ0A 4P30A 3OR7C 3VBBA 1BMFG 4MW3A 1Q82W 1S77D 3OFNG 2ZXWC 2ZQMA 1ZWIC 4MSWC 1FXVA 2F43G 1AJPA 4HAMA 1J95A 2EIMB 1OCOC 5LGTA 4UV8A 1PNLA 1IXMA 3OMAB 2DWDC 1OCRC 1RM1C 3FB6C 1R73A 4R8CA 1NBMG 3CMAV 1K5QA 1I5YA 2K1EA 4GT1A 1F51A 3AG2B 2M7WA 3T1CA 3MHHC 1FFTB 3ZMSA 3SYCA 2EILB 3W7UA 1KP3A 4ASUG 1YIJV 1S76D 3LNMB 1DF5A 5LBQA 1EZJA 3JYCA 3SJQC 4U7NA 4DO2A 3G4SV 1G8MA 3E35A 1N8RW 2DW4A 1PNKA 1XL6A 4MVQA 1OCZB 1V54B 1R3IC 2DQ3A 2X6AA 1BL8A 2P7TC 2X6BA 4FK5C 5KA6A 2WLLA 2DYRB 3H01A 1EFRG 2HVKC 5IY5C 2ZDIC 2XOKG 1R3KC 4LCUC 2Z5UA 4TWKA 4QNHB 1M1KW 1QVGU 3X2QB 3T4DA 3UKMA 4JTDB 1MABG 3B77A 3ZRSA 1FXHA 3OE7G 4MVMA 1JX9A 5KA5A 2DYSC 1Q81W 4J9YB 4PDLA 3LSQA 4I9WA 1KC8W 1Q86W 2LFSA 3AG3C 4PDVA 5H9CA 1VQLV 2P6JA 1MOFA 4EKWA 5KUKA 3CP1A 4GX2A 3CC4V 4ZKIA 5B3SB 5H6RA 5L3GA 1K8AW 5BZBA 1YJNV 5EBWC 1NH2D 3WG7B 2B5UA 1RPRA 1AJNA 2EJRA 2R9RB 3GWOA 3EFFK 3NXSA 5L3DA 3JD2A 3OM3B 2B1GA 2WLIA 4JF3A 1NVPD 1QLEB 1NR7A 1R6KA 4PA4A 1H8EG 4UV9A 4U7OA 3SPIA 1KKDA 2EIMC 4LP8A 2PI4A 3PJSK 2Z3YA 2BOCC 1TUEB 4QPKA 4MTXA 2UXNA 3D3IA 1KQSU 2WLKA 3IFXA 3CCEV 2DQ0A 3ASOB 4E2LA 2ITCC 5IDJA 2IU0A 1ENVA 3LDEA 1Y4MA 1E1QG 2KB1A 3AG2C 4RQEA 1H38A 5EK0A 3RVZA 2A79B 2A9HA 3SPGA 2EILC 4P9OA 1VQKV 2ZD9A 3LUTB 1F4MA 4JAUA 1YTFB 1M90W 2WLMA 3ETEA 4MVRA 1VQ4V 1H8HG 3MD0A 2HVJC 1R3LC 2Y48A 3A0RA 3CCLV 5B1NA 3D36A 4WFEA 5EC2C 4OXSA 3ZRWB 2WLIB 3OUSA 4MVOA 2IJHA 2PI5A 1GM7A 2AHYA 1JJ2U 1OCZC 1V54C 1QCEA 2YEVB 4P9PA 5HFMA 2P90A 3K08A 4MTGA 3ZN1A 1W0KG 1OCCB 3DGEA 3DTUB 4F4LA 2DYRC 3LDCA 2OTLV 1AR1B 3B8MA 3ZMZA 3RVYA 1QR8A 1COWG 1S3JA 3FB8C 5CBFA 1GMGA 1GM9A 3ZJZA 1DF4A 4N23A 2IH3C 2EZPA 3OW2U 4MVZA 3CCMV 2QA4V 5CN0A 2EIJB 3SYAA 4JASA 1Y66A 2UXXA 3IGAC 4FMTA 1AI5A 4JAVA 5J9PC 2EBOA 5IYDO 1P7BA 2Q69A 5B3SC 2Y69B 2QEXV 2D3OW 3OEEG 1K73W 5IYBO 1W2BU 4MTFA 1NVPB 4RAIA 1VQNV 1K4CC 4RUFA 2IW5A 4GX1A 2ITDC 2JJ2G 5DN6G 3ABUA 4X89A 2NNUA 3OGCC 3IC7A 1QLEC 3QNEA 2QM7A 4WFHA 1VQPV 4PA6A 3SPJA 1QR9A 2QM8A 1OHHG 3FB7C 5L3EA 5LHIA 5L3FA 1NJIW 1SERA 4Q20A 3K03A 5FL7G 2HR3A 1L1FA 1M56B 3ASOC 3ABKB 4P2ZA 1WLEA 3W7WA 1E79G 2W6IG 4QIWF 3AG1B 3OMNB 1UJWB 2HFEC 3SYOA 5C93A 2XAJA 3UM7A 4UVBA 4JTAB 1MG1A 4CZZA 4MW8A 5EBMC 3ZN0A 3K0GA 2DWEC 4HYOA 1PNMA 4KP4A 4ZBMA 1AI6A 1DTOA 1CP9A 2CK3G 1KD1W 2X6CA 3I56V 4JYBA 3OEHG 4PELA 3CXCU 3ZRXA 3EHBB 1AI4A 4FIPC 1F23A 2B1IA 1OCCC 4UUJC 1K9MW 5CMUA 1NQTA 4GX5A 3TETA 1K34A 4FPPA 4XBFA 2WLLB 2QE7G 2GSMB 3CYOA 4XDJA 1WPXA 5KUMA 4H33A 3P30A 4JYCA 3JCZA 1YI2V 3ASNB 1E1RG 3RBZA 2XNDG 4R7CA 1OCRB 2ZDIA 4X8AA 2WPDG 4RO2A 3ETDA 1YSCA 1R3JC 4R50A 2EIJC 4BAYA 2HKOA 1M9NA 1Q7YW 2Q6AA 4WCEV 3WFVA 3SYQA 5DM6V 3GB7C 1GKFA 5E1AC 4BW5A 1K4DC 5EC1C 4LC1A 4PDMA 2Y69C 3CCQV 3F7VC 2EINB 2IJKA 4G28B 1NR1A 3SYPA 4Z1MG 1K3EA 2YSUB 1M57B 3CPWU 1FXKA 1PKXA 1VQOV 3CCSV 2OTJV 2WLNA 4LBEC 1GTOA 2P67A 1H2GA 1OZ0A 3LDDA 3ZIAG 4N21A 3CCJV 1MSWD 3W7XA 2AHZA 2OT5A 1M56C 3ABKC 3ZMVA 2JIZG 3CCVV 3AG1C 1V55B 4RQFA 4WFFA 3E86A 3G71V 2EIKB 3W7TA 4MTOA 3OMIB 3X2QC 3OR6C 1QBZA 2XAGA 2WAMA 1BHAA 3B8NA 4XDLA 2IH1C 2OCCB 3E89A 4MVSA 2X0LA 1FXKB 1CEZA 3CCRV 5H6QA 2LFRA 3JD0A 3VOUA 4YXWG 3ML0A 4PA7A 3W7SA 1F4NA 3ABMB 4WFBV 1NH2B 3CD6V 3TCUA 2V1DA 3QO8A 3F7YC 1VQ7V 3M99B 4G2KA 4QE9A 3WG7C 3R65A 3E8GA 3AG4B 2MK3A 2GHYA 2JEUA 3OAAG 4I5SA 1ORQC 1AI7A 4QJFB 2WLJA 4WFAV 3JD1A 5B1AB 1B6QA 1YITV 1YJWV 3ABTA 4RUEA 4TSFG 3I55V 3ASNC 3CC7V 5B1BB 1BHBA 1P4RA 5LGNA 4J9ZB 3FYEB 2BOBC 3STLC 2H94A 3SPCA 4MT8A 3E83A 5EBLC 2HG5C 1GK9A 2JEXA 3CCUV 1GO3F 2XASA 4MS2A 3FB5C 2EINC 4DXWA 3T2MA 1KECA 2JJ1G 2EZOA 3JD3A 1YTFD 4PDRA 4CBCA 4X88A 3RW0A 2R9IA 1M57C 1FS0G 1K97A 2IJIA 2WWWA 4BIZA 1RPOA 3KG2A 1R6NA 4R6ZA 2QTOA 5IYCO 1JCHA 3T4ZA 3ZCCA 2A0LA 3ABLB 1G4YB 4PA9A 2V7QG 3QO7A 2IJJA 3E2EA 3QO5A 1VQ9V 5CBHA 3K3WA 2XAQA 4BIUA 5L3BA 4MVUA 1XL4A 2FTKA 2H8PC 3CMEV 1JVMA 1QLNA 3K06A 2ATKC 1S0VA 1VQMV 1KP2A 1W0JG 1V55C 2HLDG 2ZXWB 1K5SA 3HB3B 2EIKC 2XAHA 3FKSG 2JK5C 4TT3G 1OCOB 3LSSA 3MHSC 4H37A 4XDKA 5LHHA 1ROPA 2LP7A 1S5HC 1RM1B 3CC2V 1JPXA 2OCCC 4JTCB 3JD4A 1FXKC 4QE7A 2WSSG 2ZR2A 4WF9V 3K0DA 5B1OA 2JDIG 1YJ9V 3ABMC 3BEHA 2ZR3A 1HWYA 5CBGA 4L87A 3ZRVA 2W6JG 5L3CA 4KUMA 3ZRWA 3AG4C 1I5XA 2Q67A 1AROP 2HJFC 1AJQA 4QPJA 2XAFA 4UVCA 5B1AC 2YEVA 1VQ5V 2W0FC 1CPYA 2NLJC 1PD3A 4UXNA 3K79A 1VQ8V 3OUFA 1K7DA 3F5WC 5B1BC 3ZMUA 1EBOA 3TK1A 4FJCC 1VQ6V 1K92A 2QKSA 4WFGA 5GW7A 5IY5B 3ETGA 4HZ3A 1YHQV 3E8HA 3K9AA 1S72V 3FYIB 1THZA 2IU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFE C;  4QE9 A;  2WLH A;  3SYO A;  4PA3 A;  3UM7 A;  3WG7 C;  3R65 A;  1LNQ A;  2R9R B;  3E8G A;  4JTA B;  3EFF K;  4MW8 A;  3K04 A;  5EBM C;  1ORQ C;  3K0G A;  3STZ C;  2DWE C;  4KFM A;  2WLJ A;  4HYO A;  2WLI A;  4GX0 A;  4RUE A;  4PA4 A;  4ZBM A;  3ASN C;  3SPI A;  3E8F A;  3HPL C;  2EIM C;  4LP8 A;  1KKD A;  3PJS K;  2BOC C;  2X6C A;  4J9Z B;  3SPH A;  2BOB C;  3STL C;  2WLK A;  3IFX A;  2ITC C;  3ABL C;  3SPC A;  4G27 B;  3E83 A;  3E8B A;  5EBL C;  3LDE A;  2HG5 C;  2KB1 A;  3AG2 C;  1OCC C;  4UUJ C;  5EK0 A;  3RVZ A;  2A79 B;  2A9H A;  2Q68 A;  4P30 A;  4GX5 A;  3TET A;  3OR7 C;  3SPG A;  2WLL B;  2EIL C;  4MS2 A;  4P9O A;  3FB5 C;  2ZD9 A;  2EIN C;  3LUT B;  4MW3 A;  3T2M A;  4DXW A;  2WLM A;  4XDJ A;  2ZXW C;  1ZWI C;  4MSW C;  4MVR A;  4PDR A;  5KUM A;  4X88 A;  4H33 A;  3RW0 A;  4CBC A;  2HVJ C;  1R3L C;  1M57 C;  3RBZ A;  1J95 A;  4R7C A;  1OCO C;  4WFE A;  3KG2 A;  5EC2 C;  4OXS A;  4X8A A;  4R6Z A;  2QTO A;  2WLI B;  3OUS A;  2DWD C;  4MVO A;  4RO2 A;  1OCR C;  1R3J C;  3T4Z A;  4R50 A;  2EIJ C;  3FB6 C;  2AHY A;  2A0L A;  4R8C A;  1OCZ C;  1V54 C;  1G4Y B;  2Q6A A;  4PA9 A;  2K1E A;  3SYQ A;  4P9P A;  3K08 A;  5CBH A;  3GB7 C;  5E1A C;  4BW5 A;  4F4L A;  2DYR C;  3LDC A;  1K4D C;  1XL4 A;  4MVU A;  5EC1 C;  3T1C A;  4PDM A;  3SYC A;  2H8P C;  2Y69 C;  3F7V C;  1JVM A;  3RVY A;  3K06 A;  2ATK C;  4G28 B;  3LNM B;  1V55 C;  3FB8 C;  5CBF A;  3SYP A;  3ZJZ A;  3JYC A;  2EIK C;  3SJQ C;  2JK5 C;  4H37 A;  2IH3 C;  4XDK A;  2WLN A;  1S5H C;  4LBE C;  4MVZ A;  1XL6 A;  3LDD A;  3SYA A;  2OCC C;  4MVQ A;  4JTC B;  1R3I C;  2X6A A;  4QE7 A;  1BL8 A;  2P7T C;  2X6B A;  3K0D A;  3IGA C;  2WLL A;  5J9P C;  2AHZ A;  1P7B A;  3ABM C;  3BEH A;  2Q69 A;  1M56 C;  2HVK C;  5IY5 C;  5B3S C;  3ABK C;  1R3K C;  4LCU C;  4TWK A;  5CBG A;  4QNH B;  3AG1 C;  4WFF A;  3E86 A;  4MTF A;  4RAI A;  3T4D A;  4MTO A;  1K4C C;  4RUF A;  4JTD B;  3AG4 C;  4GX1 A;  2ITD C;  3UKM A;  3ZRS A;  2Q67 A;  3X2Q C;  2HJF C;  3OR6 C;  4MVM A;  4X89 A;  3OGC C;  5B1A C;  2DYS C;  2YEV A;  4J9Y B;  1QLE C;  2IH1 C;  4PDL A;  2W0F C;  4I9W A;  2NLJ C;  3E89 A;  4MVS A;  4WFH A;  4XDL A;  3AG3 C;  4PA6 A;  4PDV A;  3SPJ A;  3OUF A;  3FB7 C;  3F5W C;  5B1B C;  4EKW A;  3VOU A;  4PA7 A;  3K03 A;  5KUK A;  2QKS A;  4WFG A;  4GX2 A;  3ASO C;  4HZ3 A;  3E8H A;  4P2Z A;  3TCU A;  5BZB A;  5EBW C;  3F7Y C;  4MTG A; 
#chains in the Genus database with same CATH topology
 4DUY O;  2WLH A;  4DR7 B;  4PA3 A;  5CA3 A;  4E4E A;  1Y74 A;  3K04 A;  5BMV B;  5IYZ A;  1SRY A;  1X4T A;  2CUG A;  4GX0 A;  1URF A;  3VQX A;  3WB0 A;  4UVA A;  1DLB A;  1JOY A;  3RT3 C;  4CC5 A;  4YY3 O;  3AEI A;  4GKJ O;  4UCR A;  3FD9 A;  4X9Q A;  3E8B A;  4JGS A;  5KHG A;  3K5N A;  3ZHV A;  2GUZ A;  3JAR A;  1S77 D;  2CDY A;  3VQY A;  1AJP A;  5CB4 A;  2XT9 A;  1XNQ O;  1IXM A;  2F1M A;  3DC6 A;  4FLX A;  1RM1 C;  1VF6 A;  1K5Q A;  2K1E A;  4GT1 A;  3RYF B;  5A2Q N;  5CA0 B;  1FFT B;  1SQV H;  1XIL A;  2Q7G A;  2XUM A;  4X62 B;  3LNM B;  4KXR A;  3SJQ C;  2HJD A;  4LF9 B;  2BTQ A;  5LP6 A;  3HR0 A;  2UXD O;  1A32 A;  4DR5 O;  5LXT A;  2RJZ A;  2FML A;  2DQ3 A;  1R3I C;  4F6R B;  2UUA B;  1I94 B;  3OTF A;  3BFR A;  3KCX A;  4FK5 C;  2K9P A;  2WLL A;  1PL4 A;  2Q7H A;  4NXM B;  1R3K C;  3CXH F;  4JTD B;  3B77 A;  2JGD B;  1SQF A;  2DYS C;  4J9Y B;  1Q81 W;  4I9W A;  5D5Q A;  5H9C A;  1MOF A;  4EKW A;  4DV3 B;  4B3T O;  1QQC A;  3CP1 A;  2Y4T A;  4UCT A;  3CB2 A;  4J42 A;  1AJN A;  2EJR A;  3GWO A;  2VQF B;  4DV5 O;  1N33 O;  3OM3 B;  2VWK A;  2WLI A;  4DR2 O;  3APO A;  1R6K A;  1H8E G;  4FLZ A;  1KKD A;  2EIM C;  4LP8 A;  4I0X A;  4QPK A;  3N2G B;  4MTX A;  4CH3 A;  5C8Y A;  5LA6 B;  2M6Y A;  4E2L A;  2YS8 A;  1ENV A;  3AG2 C;  1H38 A;  2A79 B;  2A9H A;  3SJC C;  5LMU O;  2ZD9 A;  3ZHU A;  3E22 A;  4OX9 B;  1N0N A;  1G6U A;  2QWO B;  2QWN B;  1EN5 A;  1QHT A;  3CCL V;  4X65 B;  3D36 A;  4WFE A;  1P84 F;  1NS1 A;  1BSM A;  3ZS8 C;  1WB8 A;  2EX3 A;  1OCZ C;  1V54 C;  1GN2 A;  1QCE A;  2YEV B;  1IBM B;  2FKX A;  5HFM A;  3K08 A;  3ZN1 A;  1W0K G;  2OTL V;  1AR1 B;  3ZMZ A;  1COW G;  1S3J A;  4N23 A;  4CH5 A;  5LYJ A;  3CCM V;  3SYA A;  1IBK O;  4FLW A;  2RQ6 A;  3L9D A;  1Y66 A;  3TGU H;  1BQ0 A;  4NB5 A;  2BSK B;  1Q6I A;  5JVD B;  1XNR B;  4KHP O;  2PYJ A;  2ITD C;  3CEI A;  1SA0 A;  5DN6 G;  3ABU A;  3ZHS A;  1SQQ H;  2P22 C;  2KQX A;  3OGC C;  4FVM A;  2RMK B;  5A9G A;  5LOV B;  2R70 A;  1FYJ A;  4PA6 A;  3SPJ A;  2QM8 A;  3FB7 C;  4JAA A;  5FPR A;  5JCO A;  5L3F A;  5L3E A;  1NJI W;  3BAA A;  1SER A;  4Q20 A;  3K03 A;  3G67 A;  1WLE A;  2HFE C;  1WA8 A;  4UVB A;  2CH7 A;  3K0G A;  3JAT A;  1PNM A;  4O2A A;  4H13 B;  1DTO A;  5K1P A;  3CJH B;  1KD1 W;  2X6C A;  2CTR A;  2L35 A;  1FJG B;  1LUV A;  4DV7 O;  4DR4 B;  1GAX A;  4U3J B;  1Z2G A;  5ITZ B;  1OCC C;  1YEW A;  5B5E Z;  5CMU A;  1K34 A;  4LF4 B;  2QE7 G;  2GSM B;  2PGG A;  1ZAU A;  1YI2 V;  3JCZ A;  2A06 H;  4DV2 O;  2LW1 A;  1OCR B;  2OCH A;  2ZDI A;  5KHJ A;  1HNX O;  4JYA B;  4RO2 A;  5IWA O;  3ETD A;  3H1I H;  4R50 A;  1O9G A;  1Q7Y W;  2Q6A A;  4H44 B;  4J10 A;  5DM6 V;  1Q3E A;  2ZIO A;  4DUZ O;  4BW5 A;  4LR3 A;  4EB6 B;  3F7V C;  2IJK A;  3ZBH A;  1NR1 A;  1K3E A;  1M57 B;  1FXK A;  4PHZ A;  3CCS V;  4GLX A;  4AI8 A;  2P67 A;  4LFC O;  3LDD A;  1MSW D;  3W7X A;  1KUQ A;  3L70 H;  3ZMV A;  3N2K B;  4RQF A;  1P49 A;  1NU1 H;  2EIK B;  4MTO A;  2IBZ H;  2XAG A;  1BHA A;  3B8N A;  4BIO A;  4XDL A;  4MVS A;  1IUR A;  3RYF A;  5CA0 A;  3JAS A;  1EM1 A;  3W7S A;  2ADP A;  3ABM B;  4YHH O;  4TOI A;  4DR1 B;  3CD6 V;  2LQT A;  2V1D A;  4PJ0 Z;  3QO8 A;  3F7Y C;  2UUC B;  1WP7 A;  3U0Z A;  4QE9 A;  3E8G A;  2JEU A;  3RYC B;  2WLJ A;  4O4L B;  3K9S A;  1YJW V;  4CH4 A;  3L71 H;  3THO A;  2VRZ A;  1AR5 A;  4J9Z B;  4K0K B;  2JGU A;  3STL C;  4JI7 O;  1L0L H;  3T1Y O;  4B3M O;  2HG5 C;  4WBN A;  3D8C A;  4CH6 A;  3HKC B;  2E74 B;  3CRQ A;  2CE4 A;  2EIN C;  3SJB C;  3T2M A;  4UCV A;  4LF5 B;  2EZO A;  4AQY O;  1N36 B;  3A2F A;  1FS0 G;  4FM1 A;  3RFR A;  3VQV A;  2WWW A;  4BIZ A;  1RPO A;  3UO2 A;  1RP3 B;  3T4Z A;  3TJT A;  3QO7 A;  3E2E A;  4ZOL B;  1VQ9 V;  1XL4 A;  3I5D A;  2HHH B;  2H8P C;  3Q4H A;  1KYO F;  1VQM V;  2HLD G;  4JZG A;  2XAH A;  3FKS G;  4YJ2 A;  3DXR B;  3N2G A;  3B2E E;  5LA6 A;  2HP8 A;  4LFB O;  5H5N A;  2RDC A;  4NXN B;  1RM1 B;  1Y67 A;  3CC2 V;  2OCC C;  4JTC B;  3SR2 C;  4D7T A;  4QE7 A;  4O2B B;  2WSS G;  2JDI G;  4DV6 O;  2JVD A;  3O65 A;  4JI2 O;  4L87 A;  3ZRV A;  2A3Q A;  2AW9 A;  2W6J G;  5L3C A;  3FFQ A;  1I5X A;  1AJQ A;  4X20 B;  2XAF A;  1VQ5 V;  3RYI A;  2YEV A;  2QJ1 A;  1D2D A;  4LWS A;  2W0F C;  2GTS A;  2NLJ C;  3K79 A;  4DV1 O;  3OUF A;  3F5W C;  3TK1 A;  1FKA O;  4GKK B;  1XUQ A;  1SZX A;  1ZL8 B;  1SES A;  1N32 B;  4O4I B;  5HFL A;  3STZ C;  2XHB A;  4KFM A;  5KAF Z;  1HR0 O;  2DYS B;  4UFZ A;  1HW7 A;  3E8F A;  4DR3 B;  2C2A A;  2BSK A;  1PL0 A;  1SET A;  4JPR A;  3SPH A;  3BRC A;  5LHG A;  2F93 B;  4C7U A;  2PUS A;  2X7R B;  1JJO A;  2Q68 A;  3OR7 C;  4FM0 A;  3VBB A;  5LOV A;  1Q82 W;  2ZXW C;  2ZQM A;  1HNW O;  2UU9 B;  1J95 A;  2EIM B;  5LGT A;  2QWP B;  3APQ A;  1OCR C;  4R8C A;  4PI2 A;  4YIP A;  1F51 A;  3D3Q A;  2VQE O;  3AG2 B;  2M7W A;  2ZT9 B;  3T1C A;  2FYU H;  1AP6 A;  3ZMS A;  4NTX A;  4GYC B;  3W7U A;  1KP3 A;  1S76 D;  3CJH A;  1EZJ A;  2YI9 A;  3AK3 A;  2CTW A;  4FZ1 A;  4DW0 A;  1WJZ A;  4UCO A;  3G4S V;  3E35 A;  1N8R W;  2DW4 A;  4U3J A;  1XQ8 A;  4J7J A;  5ITZ A;  1KMI Z;  5J2T A;  1OCZ B;  1V54 B;  1R1B A;  2UUB B;  2HVK C;  3H1L H;  5IY5 C;  2E5L B;  4NVP A;  1BZK A;  4X66 O;  4QNH B;  1M1K W;  2DE0 X;  3JAW B;  3X2Q B;  4BR6 A;  3B40 A;  3UKM A;  3OE7 G;  2YXY A;  4LF8 O;  5JQG B;  3UO3 A;  2LFS A;  3AG3 C;  1IZ3 A;  4EB6 A;  2ETN A;  3A8T A;  3BA9 A;  4ZKI A;  5L3G A;  1CXZ B;  5EBW C;  1NH2 D;  2YXH A;  1EN4 A;  1FAF A;  3NXS A;  4H0L B;  5L3D A;  3GWK C;  2OYQ A;  3DC5 A;  2PTM A;  4PA4 A;  2QKA A;  3M7M X;  3L75 H;  5BXZ A;  2CGO A;  4JI0 B;  3N2K A;  4J7Z A;  3D3I A;  2WLK A;  1SQP H;  2DQ0 A;  2QM4 A;  1EN6 A;  5IDJ A;  3B4S A;  3LDE A;  1Y4M A;  1WB7 A;  4O4J A;  5EK0 A;  1FFX A;  2EIL C;  1VQK V;  1F4M A;  4JAU A;  1J5E B;  2WLM A;  3ETE A;  1JFF B;  4MVR A;  1R3L C;  4IIJ B;  5B1N A;  4LFA O;  2KKW A;  5EC2 C;  5JH7 B;  4JI8 O;  3A0H Z;  5JJN B;  4LH7 A;  1HNZ B;  2NN4 A;  1IXB A;  3JAM N;  5JWP A;  1OCC B;  4JI6 B;  3B8M A;  3CWB H;  5F2V O;  1AVM A;  3FB8 C;  5CBF A;  1YVW A;  2F23 A;  2AZ2 A;  2AXT Z;  1DF4 A;  2YID A;  3AK2 A;  3AG7 A;  1XMQ O;  2QA4 V;  5CN0 A;  4JI4 O;  4YJ3 B;  4FFB B;  4BW9 A;  3HKC A;  3IGA C;  4I4T A;  5J9P C;  5IYD O;  1HP8 A;  2Q69 A;  2QEX V;  1TA8 A;  2D3O W;  4K35 A;  4DRX A;  4RAI A;  5B66 Z;  4TQD A;  1IBL B;  3CRR A;  4CS2 A;  1GN3 A;  4X89 A;  2NNU A;  3IC7 A;  4I50 B;  4WFH A;  2QM7 A;  4ZOL A;  1AR4 A;  5EZY B;  1SC5 B;  4AIL C;  1N4C A;  4DR6 O;  5FL7 G;  5FPO A;  1I08 A;  2YC0 A;  2PY5 A;  4LF6 O;  3OMN B;  4Z1V A;  3SYO A;  2XAJ A;  3UM7 A;  2DN9 A;  1MG1 A;  4J80 A;  1Q5O A;  4OPH A;  1Q90 D;  4MW8 A;  1WN7 A;  5EBM C;  3ZN0 A;  1Q6U A;  1YXB A;  2DWE C;  4LF7 B;  4GUN A;  4O2B A;  1NI8 A;  4B3R B;  3SJA C;  5KX5 B;  2CK3 G;  3I56 V;  4PEL A;  1PV0 A;  5TIS Z;  3EHB B;  1AIL A;  1Y76 B;  5FLX N;  3A0B Z;  3TET A;  4FPP A;  4X20 A;  3OTO O;  4JYC A;  3HKE B;  1E1R G;  2Y0P A;  5KHH A;  3HKB A;  4X8A A;  2WPD G;  1N34 B;  1R3J C;  4BAY A;  4LNU B;  4WCE V;  3JAK B;  3WFV A;  1ZL8 A;  2QSA A;  2CTQ A;  3C90 A;  5E1A C;  4O4I A;  1K4D C;  4D7S A;  4OGQ B;  2Y69 C;  3HKD B;  3CCQ V;  2EIN B;  2EJ7 A;  1XOU A;  2BCC H;  1N0J A;  3SYP A;  4Z1M G;  4TUY B;  1BGY H;  5BR8 B;  4JI3 O;  2MW2 B;  4ZHQ B;  2QTS A;  1GTO A;  3G6B A;  1H2L A;  2GBO A;  4N21 A;  4UB6 Z;  5J2U B;  4D6T H;  2YXL A;  5GON A;  1M56 C;  1FPO A;  3RYH B;  3CCV V;  3AG1 C;  3SDL A;  4JYY A;  3G71 V;  2F4V O;  3X2Q C;  3K59 A;  2YDE A;  2OCC B;  2O57 A;  3RGB A;  2LFR A;  4YXW G;  3ML0 A;  3PN1 A;  5EYP A;  1F4N A;  2PZS A;  1RSO B;  4ABM A;  1Q8I A;  1NH2 B;  1VP7 A;  2UXB B;  1G1X B;  3M99 B;  5LMN O;  3CSX A;  1MNG A;  2GHY A;  1XHX A;  3H1K H;  3ABT A;  4RUE A;  2OIE A;  3K5O A;  3I55 V;  4J41 A;  2QWR B;  4RWU A;  2YIC A;  4DV4 O;  2BOB C;  4FLT A;  2H94 A;  3IJ4 A;  5EIB C;  2ZM6 O;  1L0N H;  3SPC A;  3JAW A;  4DV0 O;  1WNS A;  1W59 A;  2UXC O;  4CS3 A;  3OT7 A;  4JV5 O;  4I55 B;  4DXW A;  1KEC A;  2IM9 A;  4PDR A;  4B3S B;  3T1H B;  2R9A A;  4F6E A;  2XTA A;  4IGG A;  2YIB A;  5KLV H;  1KB9 F;  3BA8 A;  5E79 Z;  3QO5 A;  2W0X A;  2FTK A;  4JI1 O;  3CME V;  1H2N A;  1KP2 A;  4W4L A;  2ZXW B;  5JJE B;  3ZX6 A;  3B09 A;  4PD4 F;  2PYL A;  4TV9 B;  3LSS A;  3MHS C;  1L8D A;  5LHH A;  2LP7 A;  4X64 O;  5CA1 B;  1FXK C;  2AGA A;  2ZR2 A;  4WF9 V;  5B1O A;  2ZCE A;  4IYI A;  1YJ9 V;  3P3P A;  4UCS A;  1JFF A;  5BMV A;  1HWY A;  3U10 A;  4IIJ A;  1SQB H;  2Q67 A;  4DK0 A;  2HJF C;  5B1A C;  1CPY A;  3C3S A;  4DR7 O;  1VQ8 V;  5B1B C;  3ZMU A;  3IAY A;  4FJC C;  3JAL B;  5IY5 B;  3ETG A;  1YHQ V;  2DJV A;  1S72 V;  2IU3 A;  1EZV H;  1OV9 A;  1NKD A;  3MDS A;  3ZMT A;  1SS3 A;  2BE3 A;  3R66 A;  1MMM A;  3G6E V;  1KU9 A;  4YJ3 A;  4FFB A;  4JI5 B;  3AG3 B;  4DUY B;  4X1Y B;  3HPL C;  1K33 A;  1SZT A;  4IT5 A;  4ICG A;  3BY6 A;  3JSN A;  4JZ2 A;  2YIB D;  4NTW A;  1JQ0 A;  4P30 A;  5AG2 A;  1BMF G;  3OFN G;  4YY3 B;  4PI0 A;  2CAZ C;  5EZY A;  1ZWI C;  4MSW C;  1FXV A;  2F43 G;  4GKJ B;  1TGO A;  4HAM A;  4F6R A;  1OCO C;  1I7F A;  1PNL A;  4X62 O;  4CC6 A;  3OMA B;  3BAB A;  1R73 A;  4LF9 O;  4L8J A;  1XNQ B;  3SYC A;  2JGD A;  2EIL B;  1YIJ V;  4ASU G;  2GV9 A;  1S5L Z;  1DF5 A;  5KX5 A;  1PP9 H;  2ARH A;  1I94 O;  2UUA O;  3JYC A;  4U7N A;  2GUZ B;  1YDX A;  4DK1 A;  4NXM O;  1XL6 A;  1Y76 A;  5KMG B;  4MVQ A;  2X6A A;  1BL8 A;  2P7T C;  2X6B A;  4Z2W A;  5KA6 A;  2F95 B;  2UXD B;  4DR5 B;  2XOK G;  2Z5U A;  2FL4 A;  4DV3 O;  4DR6 B;  1QVG U;  1MAB G;  3ZRS A;  2P4K A;  1RFY A;  5KA5 A;  4LNU A;  4PDL A;  3JAK A;  3LSQ A;  3J7A U;  1KC8 W;  1Q86 W;  1NTZ H;  4PDV A;  2BTQ B;  2P6J A;  1TAE A;  2VQF O;  5LXT B;  3HKD A;  5KUK A;  3CC4 V;  1K8A W;  4TUY A;  3WG7 B;  1UFI A;  2B5U A;  3QF7 A;  2ZE8 A;  4BWA A;  1RPR A;  4ZHQ A;  2Q7E A;  3EFF K;  4B3T B;  2B1G A;  2Q0A A;  3S3W A;  4QGP A;  4JF3 A;  5K1X A;  5J2U A;  1NR7 A;  4UV9 A;  2PI4 A;  3PJS K;  2BOC C;  1TUE B;  2FB5 A;  4DV5 B;  1N33 B;  3L74 H;  3IFX A;  4OX9 O;  2ITC C;  4DR2 B;  2IU0 A;  1E1Q G;  2ZKO A;  2KB1 A;  4X65 O;  3GVM A;  1IDS A;  4RQE A;  3RVZ A;  3LUT B;  1IBM O;  1VQ4 V;  3MD0 A;  2Y48 A;  2LGQ A;  1RSO A;  4UB8 Z;  2OIG A;  1IVS A;  4OXS A;  3ZRW B;  2WLI B;  3OUS A;  5LMU B;  3ZHT A;  2PI5 A;  1GM7 A;  2AHY A;  3ZHR A;  1O9H A;  2P90 A;  5JVD A;  2E76 B;  4I0X B;  1GRJ A;  3DTU B;  4F4L A;  2DYR C;  1TUB B;  1ZLZ A;  3K5L A;  1QR8 A;  1GM9 A;  3ZJZ A;  2Q9L A;  2IH3 C;  3EVK A;  4MVZ A;  3J80 N;  1KKC A;  1R6T A;  4JAS A;  1XNR O;  1XI1 A;  4FMT A;  4JAV A;  3RN4 A;  2OWO A;  2EBO A;  4I55 A;  4KL1 A;  5B3S C;  2Y69 B;  2RN9 A;  4FZ0 A;  1IBK B;  1K73 W;  5IYB O;  3QTC A;  4MTF A;  1NVP B;  4GX1 A;  1QLE C;  3BVO A;  3G80 A;  5LHI A;  1AP5 A;  5LYJ B;  4KHP B;  3FX7 A;  1L1F A;  1M56 B;  3ASO C;  1E79 G;  3AG1 B;  5C93 A;  5JJJ B;  1FJG O;  4DR4 O;  4HYO A;  2JRI A;  3M8A A;  1BT8 A;  1AI6 A;  1NTM H;  2PF4 E;  2N04 A;  1M4U A;  2DMX A;  4LF4 O;  4JYB A;  3ZRX A;  4ZI7 B;  4B08 A;  2KG7 B;  1AI4 A;  4FIP C;  4I9Q A;  1F23 A;  2B1I A;  4UUJ C;  1K9M W;  1NQT A;  4JYA O;  3TXS A;  3CYO A;  4XDJ A;  4DV7 B;  5KUM A;  3P30 A;  2E3C A;  4R7C A;  2GTA A;  1YSC A;  1JA8 A;  3CRC A;  2EIJ C;  4O2A B;  2HKO A;  1YF2 A;  3SYQ A;  3ZED A;  1GKF A;  4DV2 B;  1OJH A;  4PDM A;  1HNX B;  1IX9 A;  5IWA B;  2P4V A;  2P06 A;  3OGI B;  1TVK B;  3CPW U;  1GN4 A;  1VQO V;  4DUZ B;  2ZE7 A;  2OTJ V;  2WLN A;  1OZ0 A;  2QR4 A;  3ZIA G;  1U97 A;  1XBL A;  3P3N A;  1D5N A;  3N27 A;  2OT5 A;  2P5O A;  3RYC A;  3ABK C;  2QDO A;  2JIZ G;  4O4L A;  1KBH A;  4LFC B;  3BHP A;  1VF6 C;  3E86 A;  3W7T A;  1PPJ H;  3OR6 C;  4DR1 O;  1QBZ A;  2WAM A;  1M93 A;  4LH6 A;  2IH1 C;  2UUC O;  3E89 A;  1B04 A;  2X0L A;  1FXK B;  4W4K A;  5H6Q A;  4K8X A;  5LP6 C;  2LJ2 A;  1SKV A;  4IHJ B;  3TCU A;  3L72 H;  3WG7 C;  3R65 A;  4K0K O;  3ZHQ A;  1AI7 A;  5KMG A;  4QJF B;  4WFA V;  4YHH B;  3JD1 A;  5B1A B;  4FM2 A;  4B7E A;  1XMO O;  4TSF G;  3ASN C;  3CC7 V;  2RNB A;  5B1B B;  1BHB A;  1MZF A;  1P4R A;  5LGN A;  4NYK A;  3UT5 B;  4LF5 O;  1Y6X A;  1N36 O;  2VS0 A;  3LSU A;  4MT8 A;  3JAS B;  1WAZ A;  2JEX A;  3DXR A;  2XAS A;  4MS2 A;  3FB5 C;  1VF7 A;  4JI7 B;  3JD3 A;  1YTF D;  4X88 A;  3T1Y B;  2CTP A;  4B3M B;  2HHH O;  1K97 A;  2IJI A;  2ZIN A;  3KG2 A;  4R6Z A;  5IYC O;  3UCS C;  3ZCC A;  2A0L A;  1G4Y B;  4PA9 A;  2V7Q G;  4AQY B;  1US6 A;  5GTH Z;  5CBH A;  5IJ0 B;  2XAQ A;  4BIU A;  1VIB A;  4NXN O;  1Z5V A;  1JVM A;  1V55 C;  1K5S A;  4WBN B;  3HB3 B;  4H37 A;  1OCO B;  1DGS A;  1Z5W A;  1QU7 A;  1BE3 H;  1S5H C;  2ZNJ A;  5LL6 Y;  3H9V A;  3J81 N;  2Z0A A;  3JD4 A;  2E75 B;  4X1I B;  2QGN A;  3BEH A;  3D36 C;  5D5P A;  4UCU A;  5FNV B;  4LFB B;  1MZE A;  5IJ9 B;  4CS4 A;  4EFE A;  4KUM A;  3ZRW A;  1GN6 A;  3AG4 C;  4J11 A;  1ZUQ A;  2ODM A;  2WA3 A;  1ARO P;  3Q4H B;  4GKK O;  4QPJ A;  1PM9 A;  4UVC A;  4DV6 B;  4JI2 B;  2Q5Z A;  3FAV B;  4UXN A;  4YJ2 B;  1TUB A;  1N32 O;  1EBO A;  2VWJ A;  4FLY A;  2JS5 A;  4GZR B;  1U96 A;  1K92 A;  5GW7 A;  4HZ3 A;  1B3Q A;  1S5J A;  1THZ A;  3JCU Z;  4DV1 B;  4DR3 O;  3KZI Z;  1LNQ A;  1GM8 A;  1M5I A;  3U11 A;  2Q8V A;  1XDC A;  1YCI A;  1QVF U;  4A5U B;  3K58 A;  1X59 A;  4O4H B;  5LGU A;  3RYI B;  4LWS B;  4TV8 B;  3ABL C;  1HR0 B;  2UU9 O;  4G27 B;  4GCZ A;  3P32 A;  1VEW A;  5JCO C;  1ZSP A;  4MW3 A;  1ZTE A;  1GH6 A;  1BS3 A;  5BY1 A;  3CRA A;  2YIA A;  2YI8 A;  3DSQ A;  4UV8 A;  3SGI A;  2DWD C;  1VMG A;  3FB6 C;  1NBM G;  3CMA V;  1I5Y A;  2ILM A;  1HNW B;  3MHH C;  2EUL A;  4DW1 A;  2L6L A;  5JQG A;  3EXA A;  5LBQ A;  4K8Z A;  2UUB O;  3WB1 A;  2VQE B;  4OPA A;  4DO2 A;  2E5L O;  1G8M A;  4ZI7 A;  1PNK A;  2N74 A;  2KG7 A;  2Q0O C;  1QNM A;  4B7K A;  2DYR B;  3H01 A;  1EFR G;  3L73 H;  4ZIB A;  2ZDI C;  1H2S B;  3CS5 A;  4LCU C;  4TWK A;  1DK1 A;  2RCV A;  1MSD A;  3T4D A;  1JR9 A;  1AB3 A;  1FXH A;  3C3T A;  4MVM A;  1JX9 A;  2ADQ B;  2F66 C;  4X66 B;  1VQL V;  5KAI Z;  3AK1 A;  3TXQ A;  4GX2 A;  2Y4U A;  5B3S B;  5H6R A;  5J2T B;  5BZB A;  1TVK A;  2V4D A;  3VQW A;  3UQ8 A;  1YJN V;  4LF8 B;  4X1K B;  2R9R B;  4JI0 O;  4NR1 A;  3JD2 A;  5JH7 A;  1NVP D;  1QLE B;  4IL6 Z;  3SPI A;  4U7O A;  4I7Z B;  2Z3Y A;  2UXN A;  1J5E O;  3CRM A;  1P7G A;  1KQS U;  3CCE V;  3ASO B;  2N05 A;  2LO1 A;  3WU2 Z;  4FFK A;  2A7W A;  1YZB A;  3SPG A;  4P9O A;  1JMK C;  1YTF B;  1M90 W;  4HNA B;  1HNZ O;  1H8H G;  2HVJ C;  3A0R A;  1D5A A;  4IHJ A;  2CGN A;  4JI6 O;  4MVO A;  1ZX3 A;  2IJH A;  2LW7 A;  1JJ2 U;  3F5T A;  1T5E A;  4P9P A;  3DGE A;  3LDC A;  4LFA B;  2ZE6 A;  4TQF A;  3RVY A;  4JI8 B;  4I50 A;  1GMG A;  4O4J B;  1FFX B;  3UT5 A;  5H2F Z;  2EZP A;  1Y74 B;  3OW2 U;  2BTO A;  5IYZ B;  2EIJ B;  1B06 A;  5EIB D;  1Q6H A;  2UXX A;  1AI5 A;  1IBL O;  1NZ6 A;  1P7B A;  3RWR D;  3OEE G;  1XMQ B;  1UPG A;  2GDS A;  5DEC A;  1W2B U;  4JI4 B;  1VQN V;  1HDJ A;  1K4C C;  4RUF A;  2IW5 A;  2JJ2 G;  3S3X A;  3JSL A;  3JAR B;  3QNE A;  1VQP V;  5IJ0 A;  1QR9 A;  1OHH G;  3CX5 F;  5CB4 B;  4LF7 O;  2HR3 A;  2QWQ B;  3ABK B;  1XMO B;  1MA1 A;  4P2Z A;  4FLV A;  4YIO A;  3ETQ A;  3W7W A;  4QIW F;  2W6I G;  2Y0I A;  1UJW B;  4B3R O;  4I4T B;  5IE9 A;  2Q73 A;  3HKE A;  4JTA B;  4CZZ A;  3QVN A;  2KSD A;  2H3O A;  1Q43 A;  4KP4 A;  4ZBM A;  4X1I A;  4DRX B;  4LF6 B;  4PV1 B;  2ZIM A;  1CP9 A;  2ZNI A;  4AHC A;  1BCC H;  4Q6G A;  5LP6 B;  3OEH G;  5FNV A;  3CXC U;  5IJ9 A;  3BPZ A;  1VAR A;  4GX5 A;  4XBF A;  2WLL B;  1N34 O;  5KHK A;  3FAV A;  1FD9 A;  1SQG A;  1WPX A;  3IC9 A;  4H33 A;  3ASN B;  3RBZ A;  2XND G;  5IT9 N;  1H2K A;  3WB2 A;  2WA4 A;  3OTO B;  1M9N A;  1F7Y A;  3RYH A;  5BR8 O;  2R72 A;  3GB7 C;  5EC1 C;  4LC1 A;  3O9O A;  1VF5 B;  4G28 B;  1BQZ A;  2YSU B;  1WPB A;  2YUA A;  4O4H A;  2AZ0 A;  4J7K A;  1PKX A;  2B9Z A;  4TV8 A;  4LBE C;  1H2G A;  1V9P A;  3CCJ V;  4DYL A;  3BCC H;  3HKB B;  2AHZ A;  4JI3 B;  3OD4 A;  2HEP A;  5C8Y B;  1V55 B;  3QG5 A;  2G38 A;  4WFF A;  1XEQ A;  3KCY A;  3OMI B;  3MAQ A;  1H2M A;  3CHX A;  5GTI Z;  2UXB O;  4NTY A;  2QKC A;  3E22 B;  1NT2 B;  1CEZ A;  2NR5 A;  3CCR V;  3K57 A;  3JD0 A;  3VOU A;  4PA7 A;  2F4V B;  4WFB V;  1VQ7 V;  4EFB A;  4G2K A;  5GON B;  3H1H H;  3AG4 B;  2MK3 A;  3OAA G;  4I5S A;  2ZE5 A;  1ORQ C;  4NKG B;  1B6Q A;  4K3A A;  1YIT V;  2JS3 A;  3CE2 A;  5DED A;  5LMN B;  3FYE B;  4B3S O;  3T1H O;  1SQX H;  3E83 A;  5EBL C;  1GK9 A;  5EYP B;  3CCU V;  2Q4P A;  1GO3 F;  4TV9 A;  4DV4 B;  2JJ1 G;  2ZM6 B;  4CBC A;  3RW0 A;  2R9I A;  4DV0 B;  1I0H A;  1M57 C;  5CA1 A;  2UXC B;  1LR1 A;  1R6N A;  4IYH A;  2QTO A;  1SA0 B;  1JCH A;  4JV5 B;  3ABL B;  4X1K A;  2IJJ A;  3K3W A;  5L3B A;  4MVU A;  1LUW A;  4HBN A;  1SF9 A;  1QLN A;  3K06 A;  2ATK C;  1S0V A;  1W0J G;  1XHZ A;  2EIK C;  1WP8 A;  2JK5 C;  4TT3 G;  4XDK A;  1ROP A;  1WA8 B;  2CH7 B;  3NR7 A;  4JI1 B;  3JAL A;  1NTK H;  1JPX A;  3JAT B;  2LGW A;  3K0D A;  1XRE A;  3ABM C;  2ZR3 A;  4HNA A;  4U3F H;  5CBG A;  4X64 B;  3K5M A;  4EEQ A;  2DOS A;  3ICX A;  3KKY A;  4X1Y A;  3LNN A;  4FLU A;  1PD3 A;  1K7D A;  5KHI A;  3H1J H;  1VQ6 V;  2D2C B;  2QKS A;  4WFG A;  3E8H A;  4JI5 O;  3K9A A;  3FYI B;  4MTG A; 
#chains in the Genus database with same CATH homology
 2WLH A;  4PA3 A;  5CA3 A;  1LNQ A;  1SES A;  1NKD A;  1GM8 A;  3ZMT A;  3K04 A;  3STZ C;  5HFL A;  1SRY A;  4KFM A;  3G6E V;  2DYS B;  4GX0 A;  3AG3 B;  1QVF U;  3E8F A;  3HPL C;  2C2A A;  1PL0 A;  1DLB A;  1K33 A;  1SET A;  1SZT A;  4UVA A;  5LGU A;  1JOY A;  4JPR A;  3SPH A;  3AEI A;  5LHG A;  3ABL C;  3BY6 A;  4G27 B;  3E8B A;  4GCZ A;  4JGS A;  3P32 A;  2X7R B;  2Q68 A;  1JQ0 A;  4P30 A;  3OR7 C;  3VBB A;  1BMF G;  4MW3 A;  1Q82 W;  1S77 D;  3OFN G;  2ZXW C;  2ZQM A;  1ZWI C;  4MSW C;  1FXV A;  2F43 G;  1AJP A;  4HAM A;  1J95 A;  2EIM B;  1OCO C;  5LGT A;  4UV8 A;  1PNL A;  1IXM A;  3OMA B;  2DWD C;  1OCR C;  1RM1 C;  3FB6 C;  1R73 A;  4R8C A;  1NBM G;  3CMA V;  1K5Q A;  1I5Y A;  2K1E A;  4GT1 A;  1F51 A;  3AG2 B;  2M7W A;  3T1C A;  3MHH C;  1FFT B;  3ZMS A;  3SYC A;  2EIL B;  3W7U A;  1KP3 A;  4ASU G;  1YIJ V;  1S76 D;  3LNM B;  1DF5 A;  5LBQ A;  1EZJ A;  3JYC A;  3SJQ C;  4U7N A;  4DO2 A;  3G4S V;  1G8M A;  3E35 A;  1N8R W;  2DW4 A;  1PNK A;  1XL6 A;  4MVQ A;  1OCZ B;  1V54 B;  1R3I C;  2DQ3 A;  2X6A A;  1BL8 A;  2P7T C;  2X6B A;  4FK5 C;  5KA6 A;  2WLL A;  2DYR B;  3H01 A;  1EFR G;  2HVK C;  5IY5 C;  2ZDI C;  2XOK G;  1R3K C;  4LCU C;  2Z5U A;  4TWK A;  4QNH B;  1M1K W;  1QVG U;  3X2Q B;  3T4D A;  3UKM A;  4JTD B;  1MAB G;  3B77 A;  3ZRS A;  1FXH A;  3OE7 G;  4MVM A;  1JX9 A;  5KA5 A;  2DYS C;  1Q81 W;  4J9Y B;  4PDL A;  3LSQ A;  4I9W A;  1KC8 W;  1Q86 W;  2LFS A;  3AG3 C;  4PDV A;  5H9C A;  1VQL V;  2P6J A;  1MOF A;  4EKW A;  5KUK A;  3CP1 A;  4GX2 A;  3CC4 V;  4ZKI A;  5B3S B;  5H6R A;  5L3G A;  1K8A W;  5BZB A;  1YJN V;  5EBW C;  1NH2 D;  3WG7 B;  2B5U A;  1RPR A;  1AJN A;  2EJR A;  2R9R B;  3GWO A;  3EFF K;  3NXS A;  5L3D A;  3JD2 A;  3OM3 B;  2B1G A;  2WLI A;  4JF3 A;  1NVP D;  1QLE B;  1NR7 A;  1R6K A;  4PA4 A;  1H8E G;  4UV9 A;  4U7O A;  3SPI A;  1KKD A;  2EIM C;  4LP8 A;  2PI4 A;  3PJS K;  2Z3Y A;  2BOC C;  1TUE B;  4QPK A;  4MTX A;  2UXN A;  3D3I A;  1KQS U;  2WLK A;  3IFX A;  3CCE V;  2DQ0 A;  3ASO B;  4E2L A;  2ITC C;  5IDJ A;  2IU0 A;  1ENV A;  3LDE A;  1Y4M A;  1E1Q G;  2KB1 A;  3AG2 C;  4RQE A;  1H38 A;  5EK0 A;  3RVZ A;  2A79 B;  2A9H A;  3SPG A;  2EIL C;  4P9O A;  1VQK V;  2ZD9 A;  3LUT B;  1F4M A;  4JAU A;  1YTF B;  1M90 W;  2WLM A;  3ETE A;  4MVR A;  1VQ4 V;  1H8H G;  3MD0 A;  2HVJ C;  1R3L C;  2Y48 A;  3A0R A;  3CCL V;  5B1N A;  3D36 A;  4WFE A;  5EC2 C;  4OXS A;  3ZRW B;  2WLI B;  3OUS A;  4MVO A;  2IJH A;  2PI5 A;  1GM7 A;  2AHY A;  1JJ2 U;  1OCZ C;  1V54 C;  1QCE A;  2YEV B;  4P9P A;  5HFM A;  2P90 A;  3K08 A;  4MTG A;  3ZN1 A;  1W0K G;  1OCC B;  3DGE A;  3DTU B;  4F4L A;  2DYR C;  3LDC A;  2OTL V;  1AR1 B;  3B8M A;  3ZMZ A;  3RVY A;  1QR8 A;  1COW G;  1S3J A;  3FB8 C;  5CBF A;  1GMG A;  1GM9 A;  3ZJZ A;  1DF4 A;  4N23 A;  2IH3 C;  2EZP A;  3OW2 U;  4MVZ A;  3CCM V;  2QA4 V;  5CN0 A;  2EIJ B;  3SYA A;  4JAS A;  1Y66 A;  2UXX A;  3IGA C;  4FMT A;  1AI5 A;  4JAV A;  5J9P C;  2EBO A;  5IYD O;  1P7B A;  2Q69 A;  5B3S C;  2Y69 B;  2QEX V;  2D3O W;  3OEE G;  1K73 W;  5IYB O;  1W2B U;  4MTF A;  1NVP B;  4RAI A;  1VQN V;  1K4C C;  4RUF A;  2IW5 A;  4GX1 A;  2ITD C;  2JJ2 G;  5DN6 G;  3ABU A;  4X89 A;  2NNU A;  3OGC C;  3IC7 A;  1QLE C;  3QNE A;  2QM7 A;  4WFH A;  1VQP V;  4PA6 A;  3SPJ A;  1QR9 A;  2QM8 A;  1OHH G;  3FB7 C;  5L3E A;  5LHI A;  5L3F A;  1NJI W;  1SER A;  4Q20 A;  3K03 A;  5FL7 G;  2HR3 A;  1L1F A;  1M56 B;  3ASO C;  3ABK B;  4P2Z A;  1WLE A;  3W7W A;  1E79 G;  2W6I G;  4QIW F;  3AG1 B;  3OMN B;  1UJW B;  2HFE C;  3SYO A;  5C93 A;  2XAJ A;  3UM7 A;  4UVB A;  4JTA B;  1MG1 A;  4CZZ A;  4MW8 A;  5EBM C;  3ZN0 A;  3K0G A;  2DWE C;  4HYO A;  1PNM A;  4KP4 A;  4ZBM A;  1AI6 A;  1DTO A;  1CP9 A;  2CK3 G;  1KD1 W;  2X6C A;  3I56 V;  4JYB A;  3OEH G;  4PEL A;  3CXC U;  3ZRX A;  3EHB B;  1AI4 A;  4FIP C;  1F23 A;  2B1I A;  1OCC C;  4UUJ C;  1K9M W;  5CMU A;  1NQT A;  4GX5 A;  3TET A;  1K34 A;  4FPP A;  4XBF A;  2WLL B;  2QE7 G;  2GSM B;  3CYO A;  4XDJ A;  1WPX A;  5KUM A;  4H33 A;  3P30 A;  4JYC A;  3JCZ A;  1YI2 V;  3ASN B;  1E1R G;  3RBZ A;  2XND G;  4R7C A;  1OCR B;  2ZDI A;  4X8A A;  2WPD G;  4RO2 A;  3ETD A;  1YSC A;  1R3J C;  4R50 A;  2EIJ C;  4BAY A;  2HKO A;  1M9N A;  1Q7Y W;  2Q6A A;  4WCE V;  3WFV A;  3SYQ A;  5DM6 V;  3GB7 C;  1GKF A;  5E1A C;  4BW5 A;  1K4D C;  5EC1 C;  4LC1 A;  4PDM A;  2Y69 C;  3CCQ V;  3F7V C;  2EIN B;  2IJK A;  4G28 B;  1NR1 A;  3SYP A;  4Z1M G;  1K3E A;  2YSU B;  1M57 B;  3CPW U;  1FXK A;  1PKX A;  1VQO V;  3CCS V;  2OTJ V;  2WLN A;  4LBE C;  1GTO A;  2P67 A;  1H2G A;  1OZ0 A;  3LDD A;  3ZIA G;  4N21 A;  3CCJ V;  1MSW D;  3W7X A;  2AHZ A;  2OT5 A;  1M56 C;  3ABK C;  3ZMV A;  2JIZ G;  3CCV V;  3AG1 C;  1V55 B;  4RQF A;  4WFF A;  3E86 A;  3G71 V;  2EIK B;  3W7T A;  4MTO A;  3OMI B;  3X2Q C;  3OR6 C;  1QBZ A;  2XAG A;  2WAM A;  1BHA A;  3B8N A;  4XDL A;  2IH1 C;  2OCC B;  3E89 A;  4MVS A;  2X0L A;  1FXK B;  1CEZ A;  3CCR V;  5H6Q A;  2LFR A;  3JD0 A;  3VOU A;  4YXW G;  3ML0 A;  4PA7 A;  3W7S A;  1F4N A;  3ABM B;  4WFB V;  1NH2 B;  3CD6 V;  3TCU A;  2V1D A;  3QO8 A;  3F7Y C;  1VQ7 V;  3M99 B;  4G2K A;  4QE9 A;  3WG7 C;  3R65 A;  3E8G A;  3AG4 B;  2MK3 A;  2GHY A;  2JEU A;  3OAA G;  4I5S A;  1ORQ C;  1AI7 A;  4QJF B;  2WLJ A;  4WFA V;  3JD1 A;  5B1A B;  1B6Q A;  1YIT V;  1YJW V;  3ABT A;  4RUE A;  4TSF G;  3I55 V;  3ASN C;  3CC7 V;  5B1B B;  1BHB A;  1P4R A;  5LGN A;  4J9Z B;  3FYE B;  2BOB C;  3STL C;  2H94 A;  3SPC A;  4MT8 A;  3E83 A;  5EBL C;  2HG5 C;  1GK9 A;  2JEX A;  3CCU V;  1GO3 F;  2XAS A;  4MS2 A;  3FB5 C;  2EIN C;  4DXW A;  3T2M A;  1KEC A;  2JJ1 G;  2EZO A;  3JD3 A;  1YTF D;  4PDR A;  4CBC A;  4X88 A;  3RW0 A;  2R9I A;  1M57 C;  1FS0 G;  1K97 A;  2IJI A;  2WWW A;  4BIZ A;  1RPO A;  3KG2 A;  1R6N A;  4R6Z A;  2QTO A;  5IYC O;  1JCH A;  3T4Z A;  3ZCC A;  2A0L A;  3ABL B;  1G4Y B;  4PA9 A;  2V7Q G;  3QO7 A;  2IJJ A;  3E2E A;  3QO5 A;  1VQ9 V;  5CBH A;  3K3W A;  2XAQ A;  4BIU A;  5L3B A;  4MVU A;  1XL4 A;  2FTK A;  2H8P C;  3CME V;  1JVM A;  1QLN A;  3K06 A;  2ATK C;  1S0V A;  1VQM V;  1KP2 A;  1W0J G;  1V55 C;  2HLD G;  2ZXW B;  1K5S A;  3HB3 B;  2EIK C;  2XAH A;  3FKS G;  2JK5 C;  4TT3 G;  1OCO B;  3LSS A;  3MHS C;  4H37 A;  4XDK A;  5LHH A;  1ROP A;  2LP7 A;  1S5H C;  1RM1 B;  3CC2 V;  1JPX A;  2OCC C;  4JTC B;  3JD4 A;  1FXK C;  4QE7 A;  2WSS G;  2ZR2 A;  4WF9 V;  3K0D A;  5B1O A;  2JDI G;  1YJ9 V;  3ABM C;  3BEH A;  2ZR3 A;  1HWY A;  5CBG A;  4L87 A;  3ZRV A;  2W6J G;  5L3C A;  4KUM A;  3ZRW A;  3AG4 C;  1I5X A;  2Q67 A;  1ARO P;  2HJF C;  1AJQ A;  4QPJ A;  2XAF A;  4UVC A;  5B1A C;  2YEV A;  1VQ5 V;  2W0F C;  1CPY A;  2NLJ C;  1PD3 A;  4UXN A;  3K79 A;  1VQ8 V;  3OUF A;  1K7D A;  3F5W C;  5B1B C;  3ZMU A;  1EBO A;  3TK1 A;  4FJC C;  1VQ6 V;  1K92 A;  2QKS A;  4WFG A;  5GW7 A;  5IY5 B;  3ETG A;  4HZ3 A;  1YHQ V;  3E8H A;  3K9A A;  1S72 V;  3FYI B;  1THZ A;  2IU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...