3GB7C

Potassium channel kcsa-fab complex in li+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gb7C00
1R3KC 2WLIA 3SYPA 2YEVA 2ZXWC 3X2QC 4RUEA 5CBHA 3GB7C 4P2ZA 3LDCA 4I9WA 3SPIA 4RUFA 4RO2A 3IFXA 4PA4A 2DWEC 4G28B 3FB5C 2HFEC 5BZBA 2HJFC 2WLLA 3T4DA 4QE9A 4EKWA 2Y69C 4XDJA 3ABLC 3ASOC 2WLLB 3BEHA 3LDEA 4PA7A 2X6AA 2HG5C 1XL6A 4HYOA 2ATKC 3VOUA 4H37A 3E89A 3ASNC 1J95A 3LNMB 4PDMA 4RAIA 2NLJC 3HPLC 1K4CC 2X6CA 3EFFK 2BOCC 2Q6AA 3RVZA 4DXWA 4MVSA 4QNHB 2K1EA 3OR6C 4H33A 4JTAB 5B1BC 3UM7A 4ZBMA 1G4YB 1OCZC 4GX1A 4HZ3A 3SPJA 3E86A 2WLIB 4MVZA 3SYAA 2Q67A 3ZJZA 4F4LA 3OUFA 3T2MA 3E8FA 3ABKC 4PA3A 4MTOA 4MW8A 3K06A 2ITDC 2QKSA 3AG1C 3OR7C 4G27B 4JTDB 2JK5C 4LP8A 3WG7C 1V54C 1OCRC 2AHYA 2IH3C 2OCCC 1M56C 3UKMA 4TWKA 5CBFA 2X6BA 2WLJA 3FB7C 1BL8A 3TETA 2AHZA 5EBWC 4PDRA 3ZRSA 2Q68A 3E83A 4PDLA 4J9ZB 3F7YC 2A0LA 5J9PC 4MSWC 3PJSK 4BW5A 2W0FC 3E8GA 4WFGA 3T4ZA 4R6ZA 2DWDC 4JTCB 5B1AC 3OGCC 3SYQA 4X8AA 4LCUC 4MVOA 4X89A 4R7CA 4PA9A 1K4DC 4MTFA 3TCUA 2DYRC 1S5HC 2EINC 2WLKA 1R3IC 3RBZA 5KUKA 3STZC 1JVMA 1R3LC 3SJQC 2Q69A 3SPHA 3AG2C 3SPCA 4MTGA 4CBCA 3K03A 2P7TC 2DYSC 3OUSA 2A9HA 3K0DA 2BOBC 3SPGA 3AG4C 4MW3A 5EBMC 2KB1A 4GX0A 2H8PC 2WLNA 3LDDA 3E8HA 3F5WC 4QE7A 4UUJC 1XL4A 1OCCC 2R9RB 3ABMC 3E8BA 5CBGA 1QLEC 3RVYA 4R50A 1ORQC 2EIMC 5EC2C 1ZWIC 5EBLC 3STLC 2WLHA 3LUTB 4R8CA 2EIKC 4MVMA 3IGAC 3K08A 3F7VC 2ZD9A 4MVUA 3R65A 4WFEA 3T1CA 4P9OA 3K04A 1LNQA 4J9YB 5EK0A 4X88A 3SYOA 3FB6C 4PA6A 2A79B 4P9PA 1P7BA 5E1AC 3K0GA 1M57C 4MS2A 2HVJC 4MVQA 2IH1C 4KFMA 5IY5C 4GX2A 4XDKA 2QTOA 1OCOC 1R3JC 5EC1C 2WLMA 2EIJC 3FB8C 3SYCA 3KG2A 3AG3C 2HVKC 4OXSA 5KUMA 4XDLA 4LBEC 5B3SC 4WFFA 2ITCC 4P30A 4GX5A 4PDVA 4WFHA 2EILC 1KKDA 3JYCA 4MVRA 3RW0A 1V55C
chains in the Genus database with same CATH superfamily
2YEVA 3GB7C 3L72H 2BCCH 1FXKC 3ZMZA 3H1IH 2PY5A 4B3SB 2VRZA 4JI8B 4G2KA 4DR3B 4KHPB 5GONB 1TGOA 2ETNA 3U11A 4B7KA 4I5SA 3ASNC 3CCQV 4PDMA 4MTXA 5B3SB 2XASA 4GZRB 1MOFA 1R1BA 1TUBB 1CP9A 2HP8A 4IL6Z 3MD0A 2YXLA 1BCCH 2UXNA 3ZN0A 3E86A 4WBNB 5EZYA 4LFAO 1VARA 3B09A 3T2MA 4JI4B 5JJNB 3KKYA 3D36C 1N36B 1R6NA 4TWKA 2X6BA 4UB8Z 4X1IA 4JYAB 4N21A 3ZRVA 2CTPA 1FFTB 3K9AA 3OAAG 3CP1A 1YHQV 1JX9A 4FM2A 5JVDA 5FNVA 4X62B 2UUBB 4B3TO 1RSOA 3B77A 3SJQC 3ZHSA 2IJHA 5LMNB 2D3OW 3KCXA 5CN0A 1EZJA 4YIPA 3WG7B 1K92A 4J10A 5EC2C 5EBLC 1OJHA 4O2BB 1D5AA 3K04A 2YIAA 3QO5A 3SYOA 3WB0A 4ASUG 1U96A 3RFRA 2YUAA 1P7BA 5KAIZ 4FLZA 1UFIA 2ZIMA 4DUZO 4DV2B 4U3JA 2YICA 5KUMA 2EBOA 4WFHA 3CE2A 3ZHVA 2B9ZA 4JYBA 4NXMO 1RPOA 4X66B 1SQQH 1XNQO 1VQ4V 1NH2D 5D5PA 3K5OA 5LL6Y 2PYLA 4WF9V 4LF5O 1KP2A 2Q7EA 4LF8B 2ZE8A 3OD4A 4BIZA 4YHHB 4UVCA 1N0NA 1S72V 4HYOA 2YIBA 2IM9A 3ETGA 3FAVA 4QIWF 2Y0IA 2ILMA 4RWUA 5LP6C 4WBNA 3FYEB 1K7DA 1PD3A 3ETDA 2UUCB 5BR8B 3IJ4A 3ZS8C 2Z0AA 2FKXA 4JI0O 4JTDB 4IYHA 1QBZA 2Q4PA 4TQFA 4ZIBA 4YY3O 1WAZA 3OTFA 4UVAA 4DV6B 3ZN1A 3K3WA 3FB7C 4K8XA 2EZPA 2IJKA 3ZIAG 3F7YC 2A0LA 5HFLA 4R6ZA 4ZHQB 4X8AA 4TUYA 4QPKA 4WFBV 3ZCCA 3TCUA 3EVKA 1S5HC 1W0JG 4GUNA 3AEIA 3RYIB 1AJPA 3IC7A 3JALB 2HHHO 5LYJB 2E74B 3P3NA 3T1HO 1F51A 2QM4A 3SPGA 2PYJA 5EBMC 2XUMA 3CCUV 4CS2A 1HWYA 5JCOA 1XL4A 5L3DA 3STLC 2WLHA 3SR2C 1S5JA 5KX5B 2OIEA 4P9OA 2G38A 1LNQA 1QHTA 3ZRWB 5EK0A 4LFCO 3GVMA 1JJ2U 3QTCA 2HVJC 1KU9A 1ZAUA 1WA8B 1OCOC 1BMFG 4X9QA 3KG2A 3CRAA 5B1NA 1YDXA 1W2BU 3GWKC 1M90W 4LF9B 1B04A 4O2AB 2HEPA 4MVOA 2OCHA 4FFKA 4GKJB 2ARHA 1BS3A 2ZM6B 2F4VB 2VQFO 3LDCA 3S3XA 4DR4O 2JGUA 1G8MA 4NTWA 2E5LO 3CMEV 5IE9A 1NVPB 4TQDA 3IAYA 1Q8IA 1WLEA 2EIJB 3G4SV 4TV9B 1SQPH 2HR3A 2NLJC 4EB6A 1K73W 1VQ9V 1Y6XA 2WWWA 2CH7B 2IU0A 3CCVV 3MHSC 3JATA 4K3AA 4UXNA 4NYKA 1H2MA 1GN3A 3AG1C 2JS3A 3EHBB 5LXTB 4Z1MG 1V9PA 4LFAB 4PDRA 2F23A 5J9PC 4K0KO 1ZX3A 4AI8A 1SF9A 1FJGO 4R7CA 2QDOA 4O4IB 3DC6A 4DV7O 4PI2A 1FXHA 4QGPA 1TAEA 3OMAB 4MW3A 3SDLA 3BHPA 1KB9F 5FPRA 3CS5A 3LDDA 1GMGA 1HR0O 4B3TB 3OEEG 5KA6A 3LUTB 4FZ1A 3ZRWA 1IBMB 1AR5A 3NR7A 4DR7B 3H1KH 4BWAA 4FJCC 5B1AB 3A0RA 4JYYA 3ML0A 4CS3A 3CD6V 1AROP 1T5EA 4FM1A 4JF3A 1YEWA 1W59A 5IY5B 4OX9B 1K5QA 2R70A 2Q8VA 1Q3EA 4YJ2A 3AG3C 4FFBB 4LF7O 5TISZ 5HFMA 1WP7A 1N32O 3JYCA 2ODMA 1N8RW 4J7KA 4DUZB 1F4NA 2PI5A 1Q6UA 1D2DA 1AJQA 4W4LA 5JH7B 5CB4A 2E3CA 3IFXA 1PNMA 2EJRA 2ZDIA 5H9CA 1AI5A 4DYLA 5CA3A 2KKWA 2N05A 1IDSA 1PM9A 3RYHB 4JAAA 1Q43A 2HG5C 1XNQB 1BT8A 4H37A 3W7TA 3N2GA 5LHHA 1RPRA 2JIZG 2CH7A 4LF5B 2QA4V 2UXBO 4H33A 4JI8O 1NR7A 5C8YA 2JJ2G 4X1KB 4KHPO 2Y0PA 1TA8A 2RNBA 4DV1B 1I7FA 2WA3A 4UCVA 5LXTA 1KECA 4PI0A 1GN6A 2HJDA 2F95B 4JI7B 2P4KA 3E83A 4BW5A 4JI0B 3F5TA 4YY3B 1VQ6V 1N36O 1BQZA 1YJNV 2UU9O 2D2CB 4JYAO 1XDCA 2IW5A 4DV0O 1K9MW 1N34O 5DEDA 3OUSA 2YDEA 3F5WC 1H2GA 1QCEA 5CBGA 1IURA 2KG7A 1ORQC 2CE4A 5IWAO 2ZR3A 2HHHB 3CC7V 1XHXA 4O4HA 3T1HB 1SERA 2ZCEA 2GDSA 4J9YB 2DOSA 1PPJH 4PA6A 4I55B 4P9PA 2KQXA 3FFQA 3HB3B 1IBLO 3W7UA 3QG5A 3ZMSA 1M57B 3BA8A 3UT5B 4I9QA 4LFCB 2CAZC 4UFZA 4BIOA 3B4SA 4DV2O 3JD2A 3ICXA 2PF4E 3JASA 1YTFD 1IXBA 4TOIA 3SGIA 1Y76B 1X59A 3A0BZ 2X6AA 2VQFB 1GRJA 2W6JG 3AK2A 3D8CA 2R72A 1XMOO 3LNMB 4DR6B 4L8JA 4DR4B 5IYZB 1H8HG 1SS3A 4DO2A 4Q6GA 1O9GA 4YHHO 1IBKO 4MVZA 2FMLA 2YEVB 3SYAA 3ABKC 3ETQA 4LH7A 4K8ZA 1GTOA 1SA0A 1EN5A 2LQTA 3ZMTA 4Z2WA 1V54B 2P4VA 1OCRB 2LW7A 1UPGA 3LNNA 4PELA 1YJWV 4WFAV 4GLXA 3C90A 3BY6A 1A32A 2QM8A 3DSQA 3APOA 4LCUC 4ZOLB 1ZLZA 4DV6O 2DYRC 2EINC 2O57A 3RBZA 3TXQA 1XMQO 1DF5A 3ABTA 2EULA 5EZYB 1Q86W 2A9HA 2FL4A 2B1IA 2QJ1A 2QWPB 5IJ9B 1FJGB 5EIBC 3OEHG 1VEWA 5KHIA 1M56B 4JV5B 5EYPB 1CPYA 2EIKC 1KUQA 4CZZA 1K5SA 1M9NA 2LP7A 3L9DA 3FB6C 1N4CA 3CHXA 3H1JH 5JVDB 5FNVB 4MVQA 1RSOB 2QGNA 2LFRA 1NBMG 5GW7A 1E1RG 1EN4A 1N0JA 3JSNA 3AG4B 1KKDA 5ITZA 1HDJA 1F4MA 1V55C 2EILB 1DF4A 5BY1A 2NNUA 1KC8W 4LF6O 1NTKH 4I9WA 1AR4A 4LF7B 2UXDB 2FTKA 4KUMA 5CA1B 2V4DA 3ABLC 5H6QA 2CTRA 1NKDA 4J7ZA 4H0LB 4JZ2A 4U3JB 4J80A 1J95A 2UXCO 2X7RB 4YXWG 3LSQA 4IT5A 3N2KA 1GH6A 4ZBMA 1OCZC 3SPJA 4XBFA 2AZ2A 4OPAA 2UXBB 3K06A 3OR7C 4G27B 4B3MB 2IH3C 2A3QA 3HKDA 1VF6C 5DM6V 2ZT9B 4ZOLA 3FAVB 4LWSA 4JI2B 2WLKA 2XAGA 5IJ9A 3ZX6A 5LGTA 2DYSC 2Q73A 2LGWA 2PZSA 1XREA 2C2AA 2KB1A 3L74H 3K79A 4GX0A 2UU9B 5EYPA 5LOVB 4DV0B 2QR4A 1N34B 1US6A 3ZMVA 2XNDG 3W7WA 2W0XA 2XTAA 4X88A 1GKFA 4TUYB 1Q6IA 5IWAB 3L70H 2DW4A 1IBMO 4DR7O 2HVKC 5B3SC 3CMAV 3P30A 3CXCU 4ABMA 3L75H 1IBLB 2Q0OC 4FPPA 1QLEB 1D5NA 3G67A 4KL1A 1KQSU 1FXKA 4OX9O 1Y4MA 4RO2A 1SQXH 4QJFB 3ZMUA 1COWG 1OZ0A 3BPZA 5CA1A 3CRCA 3T4DA 1XI1A 4TSFG 5LGUA 2VQEB 4JI6O 2WLLB 4JAVA 2ZE6A 5LHIA 3WFVA 3DXRA 1Y66A 5KAFZ 3CJHB 3IC9A 5B1BC 3LSSA 2K9PA 3UM7A 3SJBC 4NKGB 1DLBA 1E79G 1XMOB 1XEQA 1M5IA 3D36A 2QKSA 1NJIW 3WG7C 4CC6A 2QKAA 1IBKB 2Y69B 1X4TA 2HKOA 2LFSA 1HNZB 4DV1O 3JAWB 3BFRA 3T1YB 2DWDC 1MZFA 1MA1A 4EB6B 3CSXA 1B6QA 3HKCB 5L3EA 2BTQB 4JI7O 3JATB 3STZC 3UO2A 3K58A 2B5UA 1KP3A 4DK0A 1BE3H 1I5XA 2P7TC 3K9SA 3HR0A 1Q6HA 2Y4TA 5K1XA 5LOVA 4QE7A 1XMQB 2CGOA 5FPOA 4CC5A 4FLWA 3PN1A 5IT9N 1I5YA 3T1CA 3JSLA 4I4TB 1UJWB 4LNUA 1NQTA 5E1AC 4QPJA 1F7YA 1OCOB 3CCLV 1OCCB 2P90A 3SYPA 4OPHA 1TUEB 4B3RO 3OW2U 2Y4UA 1FD9A 2WLLA 3KZIZ 1L1FA 1BHBA 1K34A 4L87A 1GAXA 4LF6B 3JD3A 1YF2A 1YXBA 5CMUA 4JGSA 4YJ2B 3CJHA 1P4RA 3VQYA 1NH2B 2QEXV 2Y48A 3JD4A 4MVSA 5LP6A 4JTAB 2DE0X 5IYDO 3TXSA 4UV8A 4DV5B 4GCZA 4LFBB 4JAUA 5KHJA 1MNGA 2P6JA 2UXCB 5CB4B 4DR6O 1VIBA 4LR3A 2JK5C 3RT3C 2P22C 3M99B 2JGDA 2OCCC 5CBFA 3K5MA 3JAWA 5IJ0B 1EN6A 3ZRSA 2X0LA 3QF7A 1KD1W 3N2GB 3OGCC 3HKCA 3QNEA 2BTQA 1GM7A 4PA9A 5GTHZ 3BAAA 5C8YB 5KUKA 2AXTZ 1AR1B 2XT9A 4NVPA 1THZA 2H3OA 3AG2C 4JYCA 5F2VO 4FLXA 4X64O 1XUQA 2BOBC 2GV9A 4JI3B 1SQGA 2IBZH 2VWKA 4BR6A 3FD9A 4YJ3A 1M1KW 4UV9A 4R8CA 1LUVA 4FMTA 2RN9A 4I4TA 4MVUA 4WFEA 3OM3B 1H2SB 1FYJA 2H94A 3K0GA 4JV5O 2LJ2A 2Q5ZA 4XDKA 1JJOA 3FKSG 4NB5A 1I94B 1R3JC 2EIJC 3SYCA 4U7OA 4XDLA 4IHJB 3TJTA 4GKKO 4MVRA 1VQ7V 3RW0A 4YIOA 3X2QC 5CBHA 2KSDA 2KG7B 4P2ZA 5JQGB 2XAFA 4U7NA 1J5EO 3JD0A 4O4HB 1NR1A 3JAMN 3OTOO 4JI1O 3AK3A 2CGNA 2YSUB 4ZKIA 4H13B 1XILA 1H2NA 1L0LH 2UXDO 2P67A 1QVFU 3EFFK 2BOCC 1QR8A 3VBBA 4JI6B 4UCRA 4GT1A 3LSUA 1GO3F 1JA8A 2Q67A 3H01A 1KKCA 4KXRA 3CWBH 3CB2A 1MSDA 2Z5UA 3JASB 5IJ0A 3CC2V 1ZL8A 1F23A 2CK3G 3E35A 1G1XB 3JAKB 4WFGA 5B1AC 3E22A 2ZQMA 4B3MO 1H38A 2YC0A 1K4DC 1EZVH 4ICGA 1Q82W 2OWOA 1JVMA 1XQ8A 4CBCA 2Z3YA 2YI9A 2PUSA 4JI2O 1AJNA 1SA0B 1VQLV 3NXSA 3CPWU 1YI2V 4F6RB 2IJJA 3RYFB 4D6TH 5EIBD 1IZ3A 4X20A 1EFRG 4Q20A 4AQYB 2GBOA 4PJ0Z 2YS8A 5LMUO 2ZKOA 4IHJA 5KMGB 3FB8C 3U10A 1AP5A 4LBEC 4NXNO 3OGIB 5JQGA 2A06H 2WLIA 1PNKA 3KCYA 1E1QG 2Q0AA 3B8MA 3CEIA 2DWEC 4G28B 2PTMA 1AI6A 1DGSA 2ZR2A 4QE9A 4DR2O 4B3RB 3BABA 3OMNB 1ENVA 4DK1A 2ATKC 1WN7A 1RM1C 1P49A 4RAIA 3HPLC 4PV1B 4DXWA 4QNHB 1EBOA 2VQEO 5ITZB 2YXYA 4LH6A 1SETA 3SJAC 2GHYA 4PA3A 2WSSG 3ABKB 3QO8A 3P3PA 1NTZH 4EEQA 1XBLA 2XAJA 3ASOB 3JAKA 1XOUA 5CA0A 1Q7YW 2W0FC 2PI4A 1S0VA 5DN6G 3K5NA 1IVSA 3N2KB 4HAMA 1HNZO 2EINB 3OMIB 4X1YB 3T1YO 2QSAA 3J7AU 1Y74B 1AVMA 5FLXN 2QTSA 4F6RA 5GTIZ 2FYUH 1R73A 3RYFA 2F66C 3HKDB 1NS1A 3C3SA 4X64B 2ZD9A 2EIKB 4CH3A 3TGUH 1XNRB 4LWSB 1VQMV 1YZBA 3C3TA 1BGYH 3CRMA 1DK1A 1AILA 5KMGA 1VF7A 4FK5C 3ZHQA 2FB5A 2ZE7A 3H1HH 5LGNA 4O4JA 3W7XA 4DUYB 3ABMB 2ZXWC 2EIMB 3SPIA 1HNXO 2GSMB 2DQ3A 3FX7A 4GKKB 1U97A 2EZOA 3DGEA 2RMKB 1J5EB 3ABLB 2UUAB 5E79Z 3R66A 3OTOB 2OT5A 5DECA 4JI1B 3K5LA 3RN4A 1VQNV 2LGQA 1YTFB 2GTSA 3B2EE 4UCSA 3CCJV 1S76D 4BAYA 5IYBO 1Q5OA 5LBQA 3OUFA 3E8FA 1FXKB 1BSMA 2DN9A 1S3JA 3QO7A 1QQCA 4LP8A 1MG1A 1VQKV 2QKCA 3UKMA 1JCHA 1M56C 5H5NA 5KHHA 4DV5O 2WLJA 1VQ5V 4DRXA 2AHZA 4LFBO 3P32A 4MSWC 3ASNB 2HLDG 5L3FA 1VQPV 3DXRB 5BMVA 3JCZA 4HNAB 4X1YA 2PGGA 1PV0A 3B8NA 3SPHA 1Y74A 4U3FH 1YJ9V 5KHKA 5L3BA 3AG4C 3W7SA 2DYSB 2WAMA 5LA6A 2IJIA 2QWRB 4R50A 4NR1A 4FLYA 4B7EA 1JMKC 2QE7G 2MK3A 5K1PA 3VQVA 2VWJA 4DR1O 4JI3O 1Z5VA 2Q7HA 4MT8A 2GUZB 5IDJA 4DR5O 1IXMA 4KFMA 1SRYA 4AHCA 2QTOA 1QVGU 4O4LA 2L35A 4P30A 4FLTA 2YI8A 4J7JA 1SQVH 3A0HZ 4I50A 1MSWD 5LMUB 3CX5F 1TVKB 1I94O 2BSKB 2XAQA 4NXNB 2HFEC 2R9IA 1PNLA 4LNUB 3ZBHA 1SC5B 4TV8A 4I0XB 1I0HA 4KP4A 1JR9A 2Q6AA 3CCSV 2OIGA 4DR2B 5B1BB 3ZJZA 4F4LA 1Q81W 4MW8A 3O9OA 1BHAA 2JEUA 4FLUA 2CUGA 3Q4HA 1VF6A 1HNWO 1M4UA 2Q68A 1KMIZ 5A9GA 1QR9A 5J2TA 4HNAA 3SYQA 3I55V 2YXHA 4X89A 5LP6B 1R3IC 3CCMV 4MTGA 3G80A 3K03A 1MABG 3N27A 3OE7G 1QU7A 3K0DA 4JI5B 3D3QA 4IIJA 3E8HA 5JCOC 1QLEC 3RVYA 2XOKG 2JGDB 3ZEDA 2AW9A 4UCUA 2WPDG 2ZINA 3ETEA 4MVMA 1FXVA 3HKBB 1MZEA 2GUZA 1B06A 2JEXA 3I56V 1YSCA 2W6IG 2IH1C 4X65O 3U0ZA 4GX2A 5GONA 4JASA 4FM0A 1XHZA 4DW0A 3CXHF 3TK1A 4WFFA 1TUBA 4GX5A 4PDVA 5KA5A 3WB2A 4AQYO 1TVKA 4I7ZB 2BSKA 1NVPD 4RUEA 2N04A 4YJ3B 5IYCO 4JPRA 4PA4A 3FB5C 4DV4O 3I5DA 2HJFC 2Y69C 4PA7A 1HNXB 4I0XA 1K3EA 3JCUZ 3H9VA 3VOUA 3E89A 5B66Z 4NTXA 4F6EA 3SJCC 5C93A 2K1EA 1AB3A 1BQ0A 1M93A 4RQEA 5KLVH 1S77D 4MTOA 4FZ0A 2Q7GA 1WPXA 1AI7A 2JRIA 2DMXA 2B1GA 2ADQB 1R6TA 2OCCB 4J9ZB 2M6YA 4JZGA 4O2BA 3E8GA 4GYCB 1GM9A 1L0NH 4MTFA 2BE3A 1WJZA 4CH4A 2F1MA 1ZTEA 1NZ6A 3AG2B 2L6LA 3AG1B 2P5OA 3RWRD 1OCCC 3OT7A 1ZL8B 1ZWIC 3HKBA 1Z2GA 2NN4A 2RDCA 3E22B 2BTOA 4MS2A 5JJEB 2WLMA 3O65A 4DR1B 1JFFB 4OXSA 2ITCC 1XNRO 1PL0A 4DR5B 1R3KC 2WA4A 4WCEV 3X2QB 3CC4V 3ZRXA 4E2LA 1VMGA 4UCOA 2ZDIC 4EKWA 3B40A 3BRCA 4X20B 3UCSC 4DUYO 2NR5A 3LDEA 2F93B 5BXZA 4J11A 3CRQA 3UO3A 3L71H 4ZHQA 3AG3B 2M7WA 4LC1A 3DC5A 2X6CA 4ZI7B 1PP9H 3M8AA 2LO1A 3RYIA 2F43G 1ROPA 2CTQA 1G4YB 4GX1A 1QNMA 3JALA 2WLIB 1W0KG 3ZHTA 2UUAO 5LYJA 2JVDA 2ITDC 3AK1A 1MMMA 1URFA 2MW2B 2DJVA 3ZHRA 5KX5A 1NTMH 5H2FZ 3T4ZA 3UQ8A 4JTCB 1EM1A 4B08A 1BZKA 2CDYA 5KHGA 1N33O 2R9AA 1HNWB 3FYIB 1WA8A 4LF4O 1R3LC 1GM8A 2V1DA 4DV3O 3SPCA 4FVMA 2N74A 1WPBA 3RGBA 1WNSA 4O2AA 1P7GA 3J80N 4W4KA 3CYOA 2ZE5A 2R9RB 1WB8A 3CCEV 1Q90D 1B3QA 2VS0A 3BA9A 3F7VC 5CA0B 3GWOA 1YIJV 1VF5B 1I08A 2LW1A 1VQ8V 1OHHG 5IY5C 4NXMB 1FAFA 1JFFA 3S3WA 2DQ0A 2YIDA 2QWQB 4TV9A 1YVWA 4J41A 3K57A 5J2UB 4N23A 5AG2A 4UB6Z 4X65B 4B3SO 1LR1A 4A5UB 4PHZA 4DR3O 3ZHUA 1DTOA 3VQWA 3MAQA 3THOA 4FLVA 1FS0G 3BEHA 4UCTA 3WU2Z 1KYOF 4ZI7A 3CCRV 4DV4B 4Z1VA 4JI4O 3A2FA 1JPXA 4E4EA 3RVZA 1RM1B 5LHGA 1FFXB 4O4IA 4O4JB 1Z5WA 2E75B 4HZ3A 1H2KA 1R6KA 1PKXA 4CH6A 2QWNB 1K33A 4H44B 3RYCB 5B5EZ 4AILC 4NTYA 4UVBA 4X62O 1QLNA 2UUBO 1BL8A 3TETA 5EBWC 1VP7A 2OTLV 2OTJV 5H6RA 5LMNO 4HBNA 2XHBA 1CEZA 4PD4F 4CS4A 4FFBA 3MHHC 1CXZB 4TT3G 3JARB 2ZIOA 4K35A 1ZSPA 2H8PC 1AI4A 3OFNG 4UUJC 3E8BA 1H2LA 1K97A 3BCCH 2OYQA 3QVNA 2V7QG 5JH7A 4DRXB 3IGAC 1VQOV 3HKEB 4JI5O 1ZUQA 3MDSA 1FKAO 4C7UA 2A79B 2QM7A 3RYHA 5JWPA 5BMVB 1M57C 4IYIA 2DYRB 1AP6A 2ADPA 1NT2B 5EC1C 4X66O 5A2QN 4IGGA 5J2UA 4CH5A 3G71V 5L3CA 1SKVA 4D7SA 4X1KA 5LA6B 4LF8O 1JQ0A 2E5LB 1WB7A 2AZ0A 2A7WA 2ZXWB 4RUFA 1NU1H 5FL7G 2JJ1G 4BW9A 5D5QA 3APQA 1SQBH 1GK9A 5BZBA 1LUWA 1JOYA 4XDJA 2CTWA 3ASOC 1G6UA 1PL4A 1L8DA 2Q9LA 2UUCO 1XL6A 3WB1A 1HP8A 5BR8O 2EX3A 2P06A 4O4LB 1FFXA 2RQ6A 3L73H 1P84F 1K4CC 3OR6C 1IX9A 4EFEA 3ABUA 1V55B 4I50B 5JJJB 3M7MX 2YIBD 2JDIG 3RYCA 1SZTA 3D3IA 4K0KB 1SZXA 1WP8A 2QWOB 1KBHA 1V54C 1OCRC 2AHYA 4BIUA 1RP3B 4DV7B 1RFYA 1OV9A 4D7TA 4RQFA 1SESA 3DTUB 1GN2A 4PDLA 3PJSK 1H8EG 4TV8B 4X1IB 3E2EA 4I55A 2UXXA 1YITV 1Y67A 2ZNIA 2EJ7A 1HR0B 4J42A 3JD1A 1OCZB 1YCIA 3AG7A 2Q69A 3G6BA 3UT5A 1GN4A 3JARA 2GTAA 2XAHA 1SQFA 3CRRA 2E76B 2RJZA 2WLNA 5B1OA 1FPOA 3BVOA 1K8AW 2RCVA 1N33B 2IU3A 3ABMC 2JS5A 3Q4HB 4LF4B 2EIMC 4EFBA 3J81N 4DV3B 3G6EV 1S5LZ 3K59A 3HKEA 4DW1A 3VQXA 3EXAA 2ZNJA 3H1LH 3K08A 3R65A 5J2TB 1HW7A 1NI8A 4LF9O 1N32B 1Y76A 4FIPC 3A8TA 4GKJO 2ZM6O 2F4VO 1O9HA 4OGQB 5IYZA 2EILC 5L3GA 2AGAA 4IIJB
chains in the Genus database with same CATH topology
1NVPD 2YEVA 3X2QC 5CBHA 4RUEA 3GB7C 3JD2A 4P2ZA 5IYCO 2XAFA 4U7NA 1FXKC 4JPRA 3ZMZA 3JD0A 4PA4A 3FB5C 1NR1A 1YTFD 2HJFC 2Y69C 4PA7A 2YSUB 4ZKIA 2X6AA 4G2KA 1K3EA 2W6JG 3VOUA 4I5SA 3E89A 3ASNC 3CCQV 2P67A 3LNMB 4PDMA 1QVFU 3EFFK 4MTXA 2BOCC 2XASA 5B3SB 1MOFA 5C93A 1CP9A 1H8HG 1QR8A 2K1EA 3VBBA 4DO2A 4GT1A 3MD0A 2UXNA 1GO3F 3ZN0A 3E86A 4MVZA 2YEVB 3SYAA 2Q67A 4RQEA 3H01A 1S77D 3T2MA 3ABKC 4MTOA 1WPXA 1GTOA 2Z5UA 3ZMTA 1AI7A 3CC2V 2B1GA 1R6NA 4TWKA 2X6BA 1F23A 1V54B 1OCRB 2CK3G 2OCCB 3E35A 4N21A 3ZRVA 4J9ZB 4PELA 1YJWV 1FFTB 3E8GA 3K9AA 4WFGA 4WFAV 5B1AC 2ZQMA 3BY6A 3OAAG 3CP1A 2QM8A 4LCUC 1YHQV 1GM9A 1H38A 1JX9A 1K4DC 4MTFA 2DYRC 2EINC 3B77A 3RBZA 1Q82W 1DF5A 3ABTA 1JVMA 3SJQC 2IJHA 4CBCA 1Q86W 2Z3YA 3AG2B 2A9HA 2B1IA 2D3OW 1AJNA 5CN0A 3AG1B 1EZJA 3WG7B 3OEHG 1OCCC 1K92A 1M56B 1VQLV 3NXSA 5EC2C 3CPWU 1ZWIC 2IJJA 5EBLC 1YI2V 1CPYA 2EIKC 4CZZA 1K5SA 3K04A 1M9NA 2LP7A 3QO5A 3FB6C 3SYOA 4ASUG 1EFRG 4Q20A 1P7BA 4MS2A 4MVQA 2LFRA 1NBMG 2WLMA 3FB8C 5GW7A 1E1RG 4OXSA 5KUMA 4LBEC 2EBOA 2ITCC 4WFHA 1PL0A 3AG4B 1KKDA 1F4MA 1V55C 1R3KC 2EILB 1DF4A 2WLIA 4JYBA 1PNKA 1RPOA 2NNUA 1KC8W 1E1QG 4I9WA 3B8MA 4WCEV 3X2QB 3CC4V 3ZRXA 4E2LA 1VQ4V 2DWEC 4G28B 1NH2D 2ZDIC 2FTKA 1AI6A 4KUMA 4WF9V 2ZR2A 4QE9A 1KP2A 4EKWA 3ABLC 3LDEA 4BIZA 4UVCA 5H6QA 1NKDA 1S72V 3OMNB 4HYOA 1ENVA 2ATKC 3ETGA 1J95A 4QIWF 1RM1C 3AG3B 2M7WA 4LC1A 3HPLC 4RAIA 2X6CA 2X7RB 4YXWG 3LSQA 4DXWA 4QNHB 1EBOA 3FYEB 1K7DA 1PD3A 3ETDA 2F43G 1ROPA 4ZBMA 1G4YB 1OCZC 1SETA 4GX1A 3SPJA 4XBFA 2WLIB 1W0KG 2GHYA 4PA3A 2WSSG 3K06A 2ITDC 3OR7C 4JTDB 4G27B 3ABKB 3QO8A 1QBZA 4UVAA 2IH3C 3ZN1A 3K3WA 3FB7C 2EZPA 2XAJA 3ASOB 2IJKA 3ZIAG 3F7YC 2A0LA 5HFLA 5DM6V 2W0FC 1Q7YW 3T4ZA 4R6ZA 4JTCB 2PI4A 4X8AA 1S0VA 5DN6G 4QPKA 4WFBV 3ZCCA 3TCUA 2WLKA 1S5HC 1W0JG 3AEIA 2XAGA 3FYIB 4HAMA 1AJPA 3IC7A 1R3LC 1GM8A 2V1DA 2EINB 3SPCA 3OMIB 5LGTA 2DYSC 1F51A 3SPGA 2C2AA 5EBMC 2KB1A 3K79A 4GX0A 3CCUV 3CYOA 1HWYA 1XL4A 2R9RB 1R73A 3CCEV 5L3DA 3STLC 2WLHA 3ZMVA 2XNDG 3F7VC 2ZD9A 3W7WA 4P9OA 2EIKB 1LNQA 3GWOA 3ZRWB 1YIJV 5EK0A 4X88A 1GKFA 1JJ2U 1VQ8V 1OHHG 1VQMV 2HVJC 5IY5C 2DW4A 4FK5C 2DQ0A 1OCOC 1BMFG 3KG2A 2HVKC 5B1NA 5B3SC 1W2BU 3CMAV 1M90W 3P30A 3CXCU 4N23A 5LGNA 3W7XA 4MVOA 4FPPA 3ABMB 1QLEB 2ZXWC 2EIMB 1KQSU 3LDCA 3SPIA 1FXKA 1Y4MA 4RO2A 4QJFB 2GSMB 3ZMUA 1COWG 1DTOA 2DQ3A 1OZ0A 3T4DA 2EZOA 4TSFG 5LGUA 1G8MA 2WLLB 1FS0G 3BEHA 3DGEA 3CMEV 1NVPB 3ABLB 4JAVA 3CCRV 5LHIA 1WLEA 2EIJB 3G4SV 2OT5A 3WFVA 2HR3A 2NLJC 1JPXA 1Y66A 3RVZA 1RM1B 1K73W 1VQNV 5LHGA 1VQ9V 2WWWA 1YTFB 3CCVV 5B1BC 2IU0A 3LSSA 3MHSC 3UM7A 4HZ3A 3CCJV 1S76D 4BAYA 4UXNA 1R6KA 1DLBA 5IYBO 1PKXA 1E79G 5LBQA 3OUFA 3E8FA 1FXKB 1S3JA 3QO7A 1K33A 3D36A 2QKSA 3AG1C 4LP8A 1MG1A 1VQKV 1NJIW 3WG7C 3UKMA 1JCHA 4UVBA 1M56C 3EHBB 1QLNA 2Y69B 2WLJA 1VQ5V 1BL8A 3TETA 4Z1MG 2AHZA 2HKOA 2LFSA 5EBWC 4PDRA 2OTLV 3P32A 5J9PC 4MSWC 2OTJV 2DWDC 3ASNB 2HLDG 5H6RA 5L3FA 1VQPV 4R7CA 1B6QA 3JCZA 5L3EA 1CEZA 1FXHA 3B8NA 3STZC 3SPHA 2B5UA 3OMAB 1KP3A 1I5XA 2P7TC 3MHHC 1YJ9V 5L3BA 4TT3G 3AG4C 4MW3A 3W7SA 2DYSB 2H8PC 1AI4A 2WAMA 3LDDA 3OFNG 1GMGA 2IJIA 4QE7A 4UUJC 3E8BA 4R50A 1K97A 3OEEG 2V7QG 5KA6A 3LUTB 1I5YA 2QE7G 3ZRWA 3IGAC 2MK3A 1VQOV 3T1CA 4FJCC 5B1AB 4MT8A 3A0RA 1UJWB 1NQTA 2A79B 2QM7A 3ML0A 5IDJA 5E1AC 1M57C 1IXMA 4KFMA 2DYRB 3CD6V 1AROP 4QPJA 1SRYA 4JF3A 2QTOA 5EC1C 5IY5B 1K5QA 1QVGU 3G71V 3AG3C 1OCOB 5HFMA 3CCLV 5L3CA 4P30A 3JYCA 1N8RW 1MSWD 1OCCB 1F4NA 1JQ0A 2P90A 3SYPA 2PI5A 1TUEB 1AJQA 4RUFA 2ZXWB 5FL7G 2JJ1G 3IFXA 1PNMA 3OW2U 2XAQA 2EJRA 2ZDIA 5H9CA 1AI5A 1GK9A 2HFEC 2R9IA 5BZBA 1PNLA 2WLLA 5CA3A 1L1FA 1BHBA 1JOYA 4XDJA 3ASOC 1K34A 4L87A 2HG5C 3JD3A 1XL6A 4H37A 3W7TA 5CMUA 5LHHA 1RPRA 2JIZG 4JGSA 4KP4A 1P4RA 1K4CC 2QA4V 1NH2B 2Q6AA 2Y48A 3JD4A 4MVSA 3CCSV 2QEXV 3OR6C 4H33A 4JTAB 3ABUA 1NR7A 5IYDO 1V55B 4UV8A 2JJ2G 4GCZA 5B1BB 4JAUA 3ZJZA 2JDIG 4F4LA 2P6JA 1Q81W 4MW8A 1SZTA 3D3IA 1BHAA 2JEUA 2JK5C 1KECA 1V54C 3M99B 1OCRC 2AHYA 2OCCC 4BIUA 5CBFA 4RQFA 1SESA 3DTUB 2Q68A 2X0LA 3E83A 4PDLA 3ZRSA 3PJSK 4BW5A 1H8EG 1QR9A 1KD1W 3E2EA 3OGCC 3SYQA 2UXXA 3QNEA 1YITV 1VQ6V 3I55V 1GM7A 4X89A 4PA9A 1YJNV 1R3IC 3JD1A 3CCMV 1OCZB 5KUKA 1AR1B 2Q69A 1THZA 2IW5A 3AG2C 4MTGA 4JYCA 1K9MW 3K03A 1MABG 2XAHA 3OE7G 3OUSA 3K0DA 2BOBC 2WLNA 5B1OA 1K8AW 3E8HA 3F5WC 1H2GA 1QCEA 2IU3A 5CBGA 3ABMC 1QLEC 3RVYA 2XOKG 1ORQC 2EIMC 1M1KW 3G6EV 2ZR3A 4UV9A 2WPDG 4R8CA 3ETEA 4MVMA 4FMTA 1FXVA 3CC7V 3K08A 1SERA 4MVUA 3R65A 4WFEA 3OM3B 2JEXA 4J9YB 3I56V 4PA6A 1YSCA 2W6IG 4P9PA 2H94A 3K0GA 3HB3B 4FIPC 3W7UA 2IH1C 3ZMSA 4GX2A 4XDKA 1M57B 3FKSG 4JASA 1R3JC 2EIJC 3SYCA 4U7OA 3TK1A 4XDLA 4WFFA 4GX5A 4PDVA 5KA5A 2EILC 5L3GA 4MVRA 1VQ7V 3RW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3K C;  2WLI A;  3SYP A;  2YEV A;  2ZXW C;  3X2Q C;  4RUE A;  5CBH A;  3GB7 C;  4P2Z A;  3LDC A;  4I9W A;  3SPI A;  4RUF A;  4RO2 A;  3IFX A;  4PA4 A;  2DWE C;  4G28 B;  3FB5 C;  2HFE C;  5BZB A;  2HJF C;  2WLL A;  3T4D A;  4QE9 A;  4EKW A;  2Y69 C;  4XDJ A;  3ABL C;  3ASO C;  2WLL B;  3BEH A;  3LDE A;  4PA7 A;  2X6A A;  2HG5 C;  1XL6 A;  4HYO A;  2ATK C;  3VOU A;  4H37 A;  3E89 A;  3ASN C;  1J95 A;  3LNM B;  4PDM A;  4RAI A;  2NLJ C;  3HPL C;  1K4C C;  2X6C A;  3EFF K;  2BOC C;  2Q6A A;  3RVZ A;  4DXW A;  4MVS A;  4QNH B;  2K1E A;  3OR6 C;  4H33 A;  4JTA B;  5B1B C;  3UM7 A;  4ZBM A;  1G4Y B;  1OCZ C;  4GX1 A;  4HZ3 A;  3SPJ A;  3E86 A;  2WLI B;  4MVZ A;  3SYA A;  2Q67 A;  3ZJZ A;  4F4L A;  3OUF A;  3T2M A;  3E8F A;  3ABK C;  4PA3 A;  4MTO A;  4MW8 A;  3K06 A;  2ITD C;  2QKS A;  3AG1 C;  3OR7 C;  4G27 B;  4JTD B;  2JK5 C;  4LP8 A;  3WG7 C;  1V54 C;  1OCR C;  2AHY A;  2IH3 C;  2OCC C;  1M56 C;  3UKM A;  4TWK A;  5CBF A;  2X6B A;  2WLJ A;  3FB7 C;  1BL8 A;  3TET A;  2AHZ A;  5EBW C;  4PDR A;  3ZRS A;  2Q68 A;  3E83 A;  4PDL A;  4J9Z B;  3F7Y C;  2A0L A;  5J9P C;  4MSW C;  3PJS K;  4BW5 A;  2W0F C;  3E8G A;  4WFG A;  3T4Z A;  4R6Z A;  2DWD C;  4JTC B;  5B1A C;  3OGC C;  3SYQ A;  4X8A A;  4LCU C;  4MVO A;  4X89 A;  4R7C A;  4PA9 A;  1K4D C;  4MTF A;  3TCU A;  2DYR C;  1S5H C;  2EIN C;  2WLK A;  1R3I C;  3RBZ A;  5KUK A;  3STZ C;  1JVM A;  1R3L C;  3SJQ C;  2Q69 A;  3SPH A;  3AG2 C;  3SPC A;  4MTG A;  4CBC A;  3K03 A;  2P7T C;  2DYS C;  3OUS A;  2A9H A;  3K0D A;  2BOB C;  3SPG A;  3AG4 C;  4MW3 A;  5EBM C;  2KB1 A;  4GX0 A;  2H8P C;  2WLN A;  3LDD A;  3E8H A;  3F5W C;  4QE7 A;  4UUJ C;  1XL4 A;  1OCC C;  2R9R B;  3ABM C;  3E8B A;  5CBG A;  1QLE C;  3RVY A;  4R50 A;  1ORQ C;  2EIM C;  5EC2 C;  1ZWI C;  5EBL C;  3STL C;  2WLH A;  3LUT B;  4R8C A;  2EIK C;  4MVM A;  3IGA C;  3K08 A;  3F7V C;  2ZD9 A;  4MVU A;  3R65 A;  4WFE A;  3T1C A;  4P9O A;  3K04 A;  1LNQ A;  4J9Y B;  5EK0 A;  4X88 A;  3SYO A;  3FB6 C;  4PA6 A;  2A79 B;  4P9P A;  1P7B A;  5E1A C;  3K0G A;  1M57 C;  4MS2 A;  2HVJ C;  4MVQ A;  2IH1 C;  4KFM A;  5IY5 C;  4GX2 A;  4XDK A;  2QTO A;  1OCO C;  1R3J C;  5EC1 C;  2WLM A;  2EIJ C;  3FB8 C;  3SYC A;  3KG2 A;  3AG3 C;  2HVK C;  4OXS A;  5KUM A;  4XDL A;  4LBE C;  5B3S C;  4WFF A;  2ITC C;  4P30 A;  4GX5 A;  4PDV A;  4WFH A;  2EIL C;  1KKD A;  3JYC A;  4MVR A;  3RW0 A;  1V55 C; 
#chains in the Genus database with same CATH topology
 2YEV A;  3GB7 C;  3L72 H;  2BCC H;  1FXK C;  3ZMZ A;  3H1I H;  2PY5 A;  4B3S B;  2VRZ A;  4JI8 B;  4G2K A;  4DR3 B;  4KHP B;  5GON B;  1TGO A;  2ETN A;  3U11 A;  4B7K A;  4I5S A;  3ASN C;  3CCQ V;  4PDM A;  4MTX A;  5B3S B;  2XAS A;  4GZR B;  1MOF A;  1R1B A;  1TUB B;  1CP9 A;  2HP8 A;  4IL6 Z;  3MD0 A;  2YXL A;  1BCC H;  2UXN A;  3ZN0 A;  3E86 A;  4WBN B;  5EZY A;  4LFA O;  1VAR A;  3B09 A;  3T2M A;  4JI4 B;  5JJN B;  3KKY A;  3D36 C;  1N36 B;  1R6N A;  4TWK A;  2X6B A;  4UB8 Z;  4X1I A;  4JYA B;  4N21 A;  3ZRV A;  2CTP A;  1FFT B;  3K9A A;  3OAA G;  3CP1 A;  1YHQ V;  1JX9 A;  4FM2 A;  5JVD A;  5FNV A;  4X62 B;  2UUB B;  4B3T O;  1RSO A;  3B77 A;  3SJQ C;  3ZHS A;  2IJH A;  5LMN B;  2D3O W;  3KCX A;  5CN0 A;  1EZJ A;  4YIP A;  3WG7 B;  1K92 A;  4J10 A;  5EC2 C;  5EBL C;  1OJH A;  4O2B B;  1D5A A;  3K04 A;  2YIA A;  3QO5 A;  3SYO A;  3WB0 A;  4ASU G;  1U96 A;  3RFR A;  2YUA A;  1P7B A;  5KAI Z;  4FLZ A;  1UFI A;  2ZIM A;  4DUZ O;  4DV2 B;  4U3J A;  2YIC A;  5KUM A;  2EBO A;  4WFH A;  3CE2 A;  3ZHV A;  2B9Z A;  4JYB A;  4NXM O;  1RPO A;  4X66 B;  1SQQ H;  1XNQ O;  1VQ4 V;  1NH2 D;  5D5P A;  3K5O A;  5LL6 Y;  2PYL A;  4WF9 V;  4LF5 O;  1KP2 A;  2Q7E A;  4LF8 B;  2ZE8 A;  3OD4 A;  4BIZ A;  4YHH B;  4UVC A;  1N0N A;  1S72 V;  4HYO A;  2YIB A;  2IM9 A;  3ETG A;  3FAV A;  4QIW F;  2Y0I A;  2ILM A;  4RWU A;  5LP6 C;  4WBN A;  3FYE B;  1K7D A;  1PD3 A;  3ETD A;  2UUC B;  5BR8 B;  3IJ4 A;  3ZS8 C;  2Z0A A;  2FKX A;  4JI0 O;  4JTD B;  4IYH A;  1QBZ A;  2Q4P A;  4TQF A;  4ZIB A;  4YY3 O;  1WAZ A;  3OTF A;  4UVA A;  4DV6 B;  3ZN1 A;  3K3W A;  3FB7 C;  4K8X A;  2EZP A;  2IJK A;  3ZIA G;  3F7Y C;  2A0L A;  5HFL A;  4R6Z A;  4ZHQ B;  4X8A A;  4TUY A;  4QPK A;  4WFB V;  3ZCC A;  3TCU A;  3EVK A;  1S5H C;  1W0J G;  4GUN A;  3AEI A;  3RYI B;  1AJP A;  3IC7 A;  3JAL B;  2HHH O;  5LYJ B;  2E74 B;  3P3N A;  3T1H O;  1F51 A;  2QM4 A;  3SPG A;  2PYJ A;  5EBM C;  2XUM A;  3CCU V;  4CS2 A;  1HWY A;  5JCO A;  1XL4 A;  5L3D A;  3STL C;  2WLH A;  3SR2 C;  1S5J A;  5KX5 B;  2OIE A;  4P9O A;  2G38 A;  1LNQ A;  1QHT A;  3ZRW B;  5EK0 A;  4LFC O;  3GVM A;  1JJ2 U;  3QTC A;  2HVJ C;  1KU9 A;  1ZAU A;  1WA8 B;  1OCO C;  1BMF G;  4X9Q A;  3KG2 A;  3CRA A;  5B1N A;  1YDX A;  1W2B U;  3GWK C;  1M90 W;  4LF9 B;  1B04 A;  4O2A B;  2HEP A;  4MVO A;  2OCH A;  4FFK A;  4GKJ B;  2ARH A;  1BS3 A;  2ZM6 B;  2F4V B;  2VQF O;  3LDC A;  3S3X A;  4DR4 O;  2JGU A;  1G8M A;  4NTW A;  2E5L O;  3CME V;  5IE9 A;  1NVP B;  4TQD A;  3IAY A;  1Q8I A;  1WLE A;  2EIJ B;  3G4S V;  4TV9 B;  1SQP H;  2HR3 A;  2NLJ C;  4EB6 A;  1K73 W;  1VQ9 V;  1Y6X A;  2WWW A;  2CH7 B;  2IU0 A;  3CCV V;  3MHS C;  3JAT A;  4K3A A;  4UXN A;  4NYK A;  1H2M A;  1GN3 A;  3AG1 C;  2JS3 A;  3EHB B;  5LXT B;  4Z1M G;  1V9P A;  4LFA B;  4PDR A;  2F23 A;  5J9P C;  4K0K O;  1ZX3 A;  4AI8 A;  1SF9 A;  1FJG O;  4R7C A;  2QDO A;  4O4I B;  3DC6 A;  4DV7 O;  4PI2 A;  1FXH A;  4QGP A;  1TAE A;  3OMA B;  4MW3 A;  3SDL A;  3BHP A;  1KB9 F;  5FPR A;  3CS5 A;  3LDD A;  1GMG A;  1HR0 O;  4B3T B;  3OEE G;  5KA6 A;  3LUT B;  4FZ1 A;  3ZRW A;  1IBM B;  1AR5 A;  3NR7 A;  4DR7 B;  3H1K H;  4BWA A;  4FJC C;  5B1A B;  3A0R A;  4JYY A;  3ML0 A;  4CS3 A;  3CD6 V;  1ARO P;  1T5E A;  4FM1 A;  4JF3 A;  1YEW A;  1W59 A;  5IY5 B;  4OX9 B;  1K5Q A;  2R70 A;  2Q8V A;  1Q3E A;  4YJ2 A;  3AG3 C;  4FFB B;  4LF7 O;  5TIS Z;  5HFM A;  1WP7 A;  1N32 O;  3JYC A;  2ODM A;  1N8R W;  4J7K A;  4DUZ B;  1F4N A;  2PI5 A;  1Q6U A;  1D2D A;  1AJQ A;  4W4L A;  5JH7 B;  5CB4 A;  2E3C A;  3IFX A;  1PNM A;  2EJR A;  2ZDI A;  5H9C A;  1AI5 A;  4DYL A;  5CA3 A;  2KKW A;  2N05 A;  1IDS A;  1PM9 A;  3RYH B;  4JAA A;  1Q43 A;  2HG5 C;  1XNQ B;  1BT8 A;  4H37 A;  3W7T A;  3N2G A;  5LHH A;  1RPR A;  2JIZ G;  2CH7 A;  4LF5 B;  2QA4 V;  2UXB O;  4H33 A;  4JI8 O;  1NR7 A;  5C8Y A;  2JJ2 G;  4X1K B;  4KHP O;  2Y0P A;  1TA8 A;  2RNB A;  4DV1 B;  1I7F A;  2WA3 A;  4UCV A;  5LXT A;  1KEC A;  4PI0 A;  1GN6 A;  2HJD A;  2F95 B;  4JI7 B;  2P4K A;  3E83 A;  4BW5 A;  4JI0 B;  3F5T A;  4YY3 B;  1VQ6 V;  1N36 O;  1BQZ A;  1YJN V;  2UU9 O;  2D2C B;  4JYA O;  1XDC A;  2IW5 A;  4DV0 O;  1K9M W;  1N34 O;  5DED A;  3OUS A;  2YDE A;  3F5W C;  1H2G A;  1QCE A;  5CBG A;  1IUR A;  2KG7 A;  1ORQ C;  2CE4 A;  5IWA O;  2ZR3 A;  2HHH B;  3CC7 V;  1XHX A;  4O4H A;  3T1H B;  1SER A;  2ZCE A;  2GDS A;  4J9Y B;  2DOS A;  1PPJ H;  4PA6 A;  4I55 B;  4P9P A;  2KQX A;  3FFQ A;  3HB3 B;  1IBL O;  3W7U A;  3QG5 A;  3ZMS A;  1M57 B;  3BA8 A;  3UT5 B;  4I9Q A;  4LFC B;  2CAZ C;  4UFZ A;  4BIO A;  3B4S A;  4DV2 O;  3JD2 A;  3ICX A;  2PF4 E;  3JAS A;  1YTF D;  1IXB A;  4TOI A;  3SGI A;  1Y76 B;  1X59 A;  3A0B Z;  2X6A A;  2VQF B;  1GRJ A;  2W6J G;  3AK2 A;  3D8C A;  2R72 A;  1XMO O;  3LNM B;  4DR6 B;  4L8J A;  4DR4 B;  5IYZ B;  1H8H G;  1SS3 A;  4DO2 A;  4Q6G A;  1O9G A;  4YHH O;  1IBK O;  4MVZ A;  2FML A;  2YEV B;  3SYA A;  3ABK C;  3ETQ A;  4LH7 A;  4K8Z A;  1GTO A;  1SA0 A;  1EN5 A;  2LQT A;  3ZMT A;  4Z2W A;  1V54 B;  2P4V A;  1OCR B;  2LW7 A;  1UPG A;  3LNN A;  4PEL A;  1YJW V;  4WFA V;  4GLX A;  3C90 A;  3BY6 A;  1A32 A;  2QM8 A;  3DSQ A;  3APO A;  4LCU C;  4ZOL B;  1ZLZ A;  4DV6 O;  2DYR C;  2EIN C;  2O57 A;  3RBZ A;  3TXQ A;  1XMQ O;  1DF5 A;  3ABT A;  2EUL A;  5EZY B;  1Q86 W;  2A9H A;  2FL4 A;  2B1I A;  2QJ1 A;  2QWP B;  5IJ9 B;  1FJG B;  5EIB C;  3OEH G;  1VEW A;  5KHI A;  1M56 B;  4JV5 B;  5EYP B;  1CPY A;  2EIK C;  1KUQ A;  4CZZ A;  1K5S A;  1M9N A;  2LP7 A;  3L9D A;  3FB6 C;  1N4C A;  3CHX A;  3H1J H;  5JVD B;  5FNV B;  4MVQ A;  1RSO B;  2QGN A;  2LFR A;  1NBM G;  5GW7 A;  1E1R G;  1EN4 A;  1N0J A;  3JSN A;  3AG4 B;  1KKD A;  5ITZ A;  1HDJ A;  1F4M A;  1V55 C;  2EIL B;  1DF4 A;  5BY1 A;  2NNU A;  1KC8 W;  4LF6 O;  1NTK H;  4I9W A;  1AR4 A;  4LF7 B;  2UXD B;  2FTK A;  4KUM A;  5CA1 B;  2V4D A;  3ABL C;  5H6Q A;  2CTR A;  1NKD A;  4J7Z A;  4H0L B;  4JZ2 A;  4U3J B;  4J80 A;  1J95 A;  2UXC O;  2X7R B;  4YXW G;  3LSQ A;  4IT5 A;  3N2K A;  1GH6 A;  4ZBM A;  1OCZ C;  3SPJ A;  4XBF A;  2AZ2 A;  4OPA A;  2UXB B;  3K06 A;  3OR7 C;  4G27 B;  4B3M B;  2IH3 C;  2A3Q A;  3HKD A;  1VF6 C;  5DM6 V;  2ZT9 B;  4ZOL A;  3FAV B;  4LWS A;  4JI2 B;  2WLK A;  2XAG A;  5IJ9 A;  3ZX6 A;  5LGT A;  2DYS C;  2Q73 A;  2LGW A;  2PZS A;  1XRE A;  2C2A A;  2KB1 A;  3L74 H;  3K79 A;  4GX0 A;  2UU9 B;  5EYP A;  5LOV B;  4DV0 B;  2QR4 A;  1N34 B;  1US6 A;  3ZMV A;  2XND G;  3W7W A;  2W0X A;  2XTA A;  4X88 A;  1GKF A;  4TUY B;  1Q6I A;  5IWA B;  3L70 H;  2DW4 A;  1IBM O;  4DR7 O;  2HVK C;  5B3S C;  3CMA V;  3P30 A;  3CXC U;  4ABM A;  3L75 H;  1IBL B;  2Q0O C;  4FPP A;  1QLE B;  1D5N A;  3G67 A;  4KL1 A;  1KQS U;  1FXK A;  4OX9 O;  1Y4M A;  4RO2 A;  1SQX H;  4QJF B;  3ZMU A;  1COW G;  1OZ0 A;  3BPZ A;  5CA1 A;  3CRC A;  3T4D A;  1XI1 A;  4TSF G;  5LGU A;  2VQE B;  4JI6 O;  2WLL B;  4JAV A;  2ZE6 A;  5LHI A;  3WFV A;  3DXR A;  1Y66 A;  5KAF Z;  3CJH B;  3IC9 A;  5B1B C;  3LSS A;  2K9P A;  3UM7 A;  3SJB C;  4NKG B;  1DLB A;  1E79 G;  1XMO B;  1XEQ A;  1M5I A;  3D36 A;  2QKS A;  1NJI W;  3WG7 C;  4CC6 A;  2QKA A;  1IBK B;  2Y69 B;  1X4T A;  2HKO A;  2LFS A;  1HNZ B;  4DV1 O;  3JAW B;  3BFR A;  3T1Y B;  2DWD C;  1MZF A;  1MA1 A;  4EB6 B;  3CSX A;  1B6Q A;  3HKC B;  5L3E A;  2BTQ B;  4JI7 O;  3JAT B;  3STZ C;  3UO2 A;  3K58 A;  2B5U A;  1KP3 A;  4DK0 A;  1BE3 H;  1I5X A;  2P7T C;  3K9S A;  3HR0 A;  1Q6H A;  2Y4T A;  5K1X A;  5LOV A;  4QE7 A;  1XMQ B;  2CGO A;  5FPO A;  4CC5 A;  4FLW A;  3PN1 A;  5IT9 N;  1I5Y A;  3T1C A;  3JSL A;  4I4T B;  1UJW B;  4LNU A;  1NQT A;  5E1A C;  4QPJ A;  1F7Y A;  1OCO B;  3CCL V;  1OCC B;  2P90 A;  3SYP A;  4OPH A;  1TUE B;  4B3R O;  3OW2 U;  2Y4U A;  1FD9 A;  2WLL A;  3KZI Z;  1L1F A;  1BHB A;  1K34 A;  4L87 A;  1GAX A;  4LF6 B;  3JD3 A;  1YF2 A;  1YXB A;  5CMU A;  4JGS A;  4YJ2 B;  3CJH A;  1P4R A;  3VQY A;  1NH2 B;  2QEX V;  2Y48 A;  3JD4 A;  4MVS A;  5LP6 A;  4JTA B;  2DE0 X;  5IYD O;  3TXS A;  4UV8 A;  4DV5 B;  4GCZ A;  4LFB B;  4JAU A;  5KHJ A;  1MNG A;  2P6J A;  2UXC B;  5CB4 B;  4DR6 O;  1VIB A;  4LR3 A;  2JK5 C;  3RT3 C;  2P22 C;  3M99 B;  2JGD A;  2OCC C;  5CBF A;  3K5M A;  3JAW A;  5IJ0 B;  1EN6 A;  3ZRS A;  2X0L A;  3QF7 A;  1KD1 W;  3N2G B;  3OGC C;  3HKC A;  3QNE A;  2BTQ A;  1GM7 A;  4PA9 A;  5GTH Z;  3BAA A;  5C8Y B;  5KUK A;  2AXT Z;  1AR1 B;  2XT9 A;  4NVP A;  1THZ A;  2H3O A;  3AG2 C;  4JYC A;  5F2V O;  4FLX A;  4X64 O;  1XUQ A;  2BOB C;  2GV9 A;  4JI3 B;  1SQG A;  2IBZ H;  2VWK A;  4BR6 A;  3FD9 A;  4YJ3 A;  1M1K W;  4UV9 A;  4R8C A;  1LUV A;  4FMT A;  2RN9 A;  4I4T A;  4MVU A;  4WFE A;  3OM3 B;  1H2S B;  1FYJ A;  2H94 A;  3K0G A;  4JV5 O;  2LJ2 A;  2Q5Z A;  4XDK A;  1JJO A;  3FKS G;  4NB5 A;  1I94 B;  1R3J C;  2EIJ C;  3SYC A;  4U7O A;  4XDL A;  4IHJ B;  3TJT A;  4GKK O;  4MVR A;  1VQ7 V;  3RW0 A;  4YIO A;  3X2Q C;  5CBH A;  2KSD A;  2KG7 B;  4P2Z A;  5JQG B;  2XAF A;  4U7N A;  1J5E O;  3JD0 A;  4O4H B;  1NR1 A;  3JAM N;  3OTO O;  4JI1 O;  3AK3 A;  2CGN A;  2YSU B;  4ZKI A;  4H13 B;  1XIL A;  1H2N A;  1L0L H;  2UXD O;  2P67 A;  1QVF U;  3EFF K;  2BOC C;  1QR8 A;  3VBB A;  4JI6 B;  4UCR A;  4GT1 A;  3LSU A;  1GO3 F;  1JA8 A;  2Q67 A;  3H01 A;  1KKC A;  4KXR A;  3CWB H;  3CB2 A;  1MSD A;  2Z5U A;  3JAS B;  5IJ0 A;  3CC2 V;  1ZL8 A;  1F23 A;  2CK3 G;  3E35 A;  1G1X B;  3JAK B;  4WFG A;  5B1A C;  3E22 A;  2ZQM A;  4B3M O;  1H38 A;  2YC0 A;  1K4D C;  1EZV H;  4ICG A;  1Q82 W;  2OWO A;  1JVM A;  1XQ8 A;  4CBC A;  2Z3Y A;  2YI9 A;  2PUS A;  4JI2 O;  1AJN A;  1SA0 B;  1VQL V;  3NXS A;  3CPW U;  1YI2 V;  4F6R B;  2IJJ A;  3RYF B;  4D6T H;  5EIB D;  1IZ3 A;  4X20 A;  1EFR G;  4Q20 A;  4AQY B;  2GBO A;  4PJ0 Z;  2YS8 A;  5LMU O;  2ZKO A;  4IHJ A;  5KMG B;  3FB8 C;  3U10 A;  1AP5 A;  4LBE C;  4NXN O;  3OGI B;  5JQG A;  2A06 H;  2WLI A;  1PNK A;  3KCY A;  1E1Q G;  2Q0A A;  3B8M A;  3CEI A;  2DWE C;  4G28 B;  2PTM A;  1AI6 A;  1DGS A;  2ZR2 A;  4QE9 A;  4DR2 O;  4B3R B;  3BAB A;  3OMN B;  1ENV A;  4DK1 A;  2ATK C;  1WN7 A;  1RM1 C;  1P49 A;  4RAI A;  3HPL C;  4PV1 B;  4DXW A;  4QNH B;  1EBO A;  2VQE O;  5ITZ B;  2YXY A;  4LH6 A;  1SET A;  3SJA C;  2GHY A;  4PA3 A;  2WSS G;  3ABK B;  3QO8 A;  3P3P A;  1NTZ H;  4EEQ A;  1XBL A;  2XAJ A;  3ASO B;  3JAK A;  1XOU A;  5CA0 A;  1Q7Y W;  2W0F C;  2PI4 A;  1S0V A;  5DN6 G;  3K5N A;  1IVS A;  3N2K B;  4HAM A;  1HNZ O;  2EIN B;  3OMI B;  4X1Y B;  3T1Y O;  2QSA A;  3J7A U;  1Y74 B;  1AVM A;  5FLX N;  2QTS A;  4F6R A;  5GTI Z;  2FYU H;  1R73 A;  3RYF A;  2F66 C;  3HKD B;  1NS1 A;  3C3S A;  4X64 B;  2ZD9 A;  2EIK B;  4CH3 A;  3TGU H;  1XNR B;  4LWS B;  1VQM V;  1YZB A;  3C3T A;  1BGY H;  3CRM A;  1DK1 A;  1AIL A;  5KMG A;  1VF7 A;  4FK5 C;  3ZHQ A;  2FB5 A;  2ZE7 A;  3H1H H;  5LGN A;  4O4J A;  3W7X A;  4DUY B;  3ABM B;  2ZXW C;  2EIM B;  3SPI A;  1HNX O;  2GSM B;  2DQ3 A;  3FX7 A;  4GKK B;  1U97 A;  2EZO A;  3DGE A;  2RMK B;  1J5E B;  3ABL B;  2UUA B;  5E79 Z;  3R66 A;  3OTO B;  2OT5 A;  5DEC A;  4JI1 B;  3K5L A;  3RN4 A;  1VQN V;  2LGQ A;  1YTF B;  2GTS A;  3B2E E;  4UCS A;  3CCJ V;  1S76 D;  4BAY A;  5IYB O;  1Q5O A;  5LBQ A;  3OUF A;  3E8F A;  1FXK B;  1BSM A;  2DN9 A;  1S3J A;  3QO7 A;  1QQC A;  4LP8 A;  1MG1 A;  1VQK V;  2QKC A;  3UKM A;  1JCH A;  1M56 C;  5H5N A;  5KHH A;  4DV5 O;  2WLJ A;  1VQ5 V;  4DRX A;  2AHZ A;  4LFB O;  3P32 A;  4MSW C;  3ASN B;  2HLD G;  5L3F A;  1VQP V;  3DXR B;  5BMV A;  3JCZ A;  4HNA B;  4X1Y A;  2PGG A;  1PV0 A;  3B8N A;  3SPH A;  1Y74 A;  4U3F H;  1YJ9 V;  5KHK A;  5L3B A;  3AG4 C;  3W7S A;  2DYS B;  2WAM A;  5LA6 A;  2IJI A;  2QWR B;  4R50 A;  4NR1 A;  4FLY A;  4B7E A;  1JMK C;  2QE7 G;  2MK3 A;  5K1P A;  3VQV A;  2VWJ A;  4DR1 O;  4JI3 O;  1Z5V A;  2Q7H A;  4MT8 A;  2GUZ B;  5IDJ A;  4DR5 O;  1IXM A;  4KFM A;  1SRY A;  4AHC A;  2QTO A;  1QVG U;  4O4L A;  2L35 A;  4P30 A;  4FLT A;  2YI8 A;  4J7J A;  1SQV H;  3A0H Z;  4I50 A;  1MSW D;  5LMU B;  3CX5 F;  1TVK B;  1I94 O;  2BSK B;  2XAQ A;  4NXN B;  2HFE C;  2R9I A;  1PNL A;  4LNU B;  3ZBH A;  1SC5 B;  4TV8 A;  4I0X B;  1I0H A;  4KP4 A;  1JR9 A;  2Q6A A;  3CCS V;  2OIG A;  4DR2 B;  5B1B B;  3ZJZ A;  4F4L A;  1Q81 W;  4MW8 A;  3O9O A;  1BHA A;  2JEU A;  4FLU A;  2CUG A;  3Q4H A;  1VF6 A;  1HNW O;  1M4U A;  2Q68 A;  1KMI Z;  5A9G A;  1QR9 A;  5J2T A;  4HNA A;  3SYQ A;  3I55 V;  2YXH A;  4X89 A;  5LP6 B;  1R3I C;  3CCM V;  4MTG A;  3G80 A;  3K03 A;  1MAB G;  3N27 A;  3OE7 G;  1QU7 A;  3K0D A;  4JI5 B;  3D3Q A;  4IIJ A;  3E8H A;  5JCO C;  1QLE C;  3RVY A;  2XOK G;  2JGD B;  3ZED A;  2AW9 A;  4UCU A;  2WPD G;  2ZIN A;  3ETE A;  4MVM A;  1FXV A;  3HKB B;  1MZE A;  2GUZ A;  1B06 A;  2JEX A;  3I56 V;  1YSC A;  2W6I G;  2IH1 C;  4X65 O;  3U0Z A;  4GX2 A;  5GON A;  4JAS A;  4FM0 A;  1XHZ A;  4DW0 A;  3CXH F;  3TK1 A;  4WFF A;  1TUB A;  4GX5 A;  4PDV A;  5KA5 A;  3WB2 A;  4AQY O;  1TVK A;  4I7Z B;  2BSK A;  1NVP D;  4RUE A;  2N04 A;  4YJ3 B;  5IYC O;  4JPR A;  4PA4 A;  3FB5 C;  4DV4 O;  3I5D A;  2HJF C;  2Y69 C;  4PA7 A;  1HNX B;  4I0X A;  1K3E A;  3JCU Z;  3H9V A;  3VOU A;  3E89 A;  5B66 Z;  4NTX A;  4F6E A;  3SJC C;  5C93 A;  2K1E A;  1AB3 A;  1BQ0 A;  1M93 A;  4RQE A;  5KLV H;  1S77 D;  4MTO A;  4FZ0 A;  2Q7G A;  1WPX A;  1AI7 A;  2JRI A;  2DMX A;  2B1G A;  2ADQ B;  1R6T A;  2OCC B;  4J9Z B;  2M6Y A;  4JZG A;  4O2B A;  3E8G A;  4GYC B;  1GM9 A;  1L0N H;  4MTF A;  2BE3 A;  1WJZ A;  4CH4 A;  2F1M A;  1ZTE A;  1NZ6 A;  3AG2 B;  2L6L A;  3AG1 B;  2P5O A;  3RWR D;  1OCC C;  3OT7 A;  1ZL8 B;  1ZWI C;  3HKB A;  1Z2G A;  2NN4 A;  2RDC A;  3E22 B;  2BTO A;  4MS2 A;  5JJE B;  2WLM A;  3O65 A;  4DR1 B;  1JFF B;  4OXS A;  2ITC C;  1XNR O;  1PL0 A;  4DR5 B;  1R3K C;  2WA4 A;  4WCE V;  3X2Q B;  3CC4 V;  3ZRX A;  4E2L A;  1VMG A;  4UCO A;  2ZDI C;  4EKW A;  3B40 A;  3BRC A;  4X20 B;  3UCS C;  4DUY O;  2NR5 A;  3LDE A;  2F93 B;  5BXZ A;  4J11 A;  3CRQ A;  3UO3 A;  3L71 H;  4ZHQ A;  3AG3 B;  2M7W A;  4LC1 A;  3DC5 A;  2X6C A;  4ZI7 B;  1PP9 H;  3M8A A;  2LO1 A;  3RYI A;  2F43 G;  1ROP A;  2CTQ A;  1G4Y B;  4GX1 A;  1QNM A;  3JAL A;  2WLI B;  1W0K G;  3ZHT A;  2UUA O;  5LYJ A;  2JVD A;  2ITD C;  3AK1 A;  1MMM A;  1URF A;  2MW2 B;  2DJV A;  3ZHR A;  5KX5 A;  1NTM H;  5H2F Z;  3T4Z A;  3UQ8 A;  4JTC B;  1EM1 A;  4B08 A;  1BZK A;  2CDY A;  5KHG A;  1N33 O;  2R9A A;  1HNW B;  3FYI B;  1WA8 A;  4LF4 O;  1R3L C;  1GM8 A;  2V1D A;  4DV3 O;  3SPC A;  4FVM A;  2N74 A;  1WPB A;  3RGB A;  1WNS A;  4O2A A;  1P7G A;  3J80 N;  4W4K A;  3CYO A;  2ZE5 A;  2R9R B;  1WB8 A;  3CCE V;  1Q90 D;  1B3Q A;  2VS0 A;  3BA9 A;  3F7V C;  5CA0 B;  3GWO A;  1YIJ V;  1VF5 B;  1I08 A;  2LW1 A;  1VQ8 V;  1OHH G;  5IY5 C;  4NXM B;  1FAF A;  1JFF A;  3S3W A;  2DQ0 A;  2YID A;  2QWQ B;  4TV9 A;  1YVW A;  4J41 A;  3K57 A;  5J2U B;  4N23 A;  5AG2 A;  4UB6 Z;  4X65 B;  4B3S O;  1LR1 A;  4A5U B;  4PHZ A;  4DR3 O;  3ZHU A;  1DTO A;  3VQW A;  3MAQ A;  3THO A;  4FLV A;  1FS0 G;  3BEH A;  4UCT A;  3WU2 Z;  1KYO F;  4ZI7 A;  3CCR V;  4DV4 B;  4Z1V A;  4JI4 O;  3A2F A;  1JPX A;  4E4E A;  3RVZ A;  1RM1 B;  5LHG A;  1FFX B;  4O4I A;  4O4J B;  1Z5W A;  2E75 B;  4HZ3 A;  1H2K A;  1R6K A;  1PKX A;  4CH6 A;  2QWN B;  1K33 A;  4H44 B;  3RYC B;  5B5E Z;  4AIL C;  4NTY A;  4UVB A;  4X62 O;  1QLN A;  2UUB O;  1BL8 A;  3TET A;  5EBW C;  1VP7 A;  2OTL V;  2OTJ V;  5H6R A;  5LMN O;  4HBN A;  2XHB A;  1CEZ A;  4PD4 F;  4CS4 A;  4FFB A;  3MHH C;  1CXZ B;  4TT3 G;  3JAR B;  2ZIO A;  4K35 A;  1ZSP A;  2H8P C;  1AI4 A;  3OFN G;  4UUJ C;  3E8B A;  1H2L A;  1K97 A;  3BCC H;  2OYQ A;  3QVN A;  2V7Q G;  5JH7 A;  4DRX B;  3IGA C;  1VQO V;  3HKE B;  4JI5 O;  1ZUQ A;  3MDS A;  1FKA O;  4C7U A;  2A79 B;  2QM7 A;  3RYH A;  5JWP A;  5BMV B;  1M57 C;  4IYI A;  2DYR B;  1AP6 A;  2ADP A;  1NT2 B;  5EC1 C;  4X66 O;  5A2Q N;  4IGG A;  5J2U A;  4CH5 A;  3G71 V;  5L3C A;  1SKV A;  4D7S A;  4X1K A;  5LA6 B;  4LF8 O;  1JQ0 A;  2E5L B;  1WB7 A;  2AZ0 A;  2A7W A;  2ZXW B;  4RUF A;  1NU1 H;  5FL7 G;  2JJ1 G;  4BW9 A;  5D5Q A;  3APQ A;  1SQB H;  1GK9 A;  5BZB A;  1LUW A;  1JOY A;  4XDJ A;  2CTW A;  3ASO C;  1G6U A;  1PL4 A;  1L8D A;  2Q9L A;  2UUC O;  1XL6 A;  3WB1 A;  1HP8 A;  5BR8 O;  2EX3 A;  2P06 A;  4O4L B;  1FFX A;  2RQ6 A;  3L73 H;  1P84 F;  1K4C C;  3OR6 C;  1IX9 A;  4EFE A;  3ABU A;  1V55 B;  4I50 B;  5JJJ B;  3M7M X;  2YIB D;  2JDI G;  3RYC A;  1SZT A;  3D3I A;  4K0K B;  1SZX A;  1WP8 A;  2QWO B;  1KBH A;  1V54 C;  1OCR C;  2AHY A;  4BIU A;  1RP3 B;  4DV7 B;  1RFY A;  1OV9 A;  4D7T A;  4RQF A;  1SES A;  3DTU B;  1GN2 A;  4PDL A;  3PJS K;  1H8E G;  4TV8 B;  4X1I B;  3E2E A;  4I55 A;  2UXX A;  1YIT V;  1Y67 A;  2ZNI A;  2EJ7 A;  1HR0 B;  4J42 A;  3JD1 A;  1OCZ B;  1YCI A;  3AG7 A;  2Q69 A;  3G6B A;  3UT5 A;  1GN4 A;  3JAR A;  2GTA A;  2XAH A;  1SQF A;  3CRR A;  2E76 B;  2RJZ A;  2WLN A;  5B1O A;  1FPO A;  3BVO A;  1K8A W;  2RCV A;  1N33 B;  2IU3 A;  3ABM C;  2JS5 A;  3Q4H B;  4LF4 B;  2EIM C;  4EFB A;  3J81 N;  4DV3 B;  3G6E V;  1S5L Z;  3K59 A;  3HKE A;  4DW1 A;  3VQX A;  3EXA A;  2ZNJ A;  3H1L H;  3K08 A;  3R65 A;  5J2T B;  1HW7 A;  1NI8 A;  4LF9 O;  1N32 B;  1Y76 A;  4FIP C;  3A8T A;  4GKJ O;  2ZM6 O;  2F4V O;  1O9H A;  4OGQ B;  5IYZ A;  2EIL C;  5L3G A;  2AGA A;  4IIJ B; 
#chains in the Genus database with same CATH homology
 1NVP D;  2YEV A;  3X2Q C;  5CBH A;  4RUE A;  3GB7 C;  3JD2 A;  4P2Z A;  5IYC O;  2XAF A;  4U7N A;  1FXK C;  4JPR A;  3ZMZ A;  3JD0 A;  4PA4 A;  3FB5 C;  1NR1 A;  1YTF D;  2HJF C;  2Y69 C;  4PA7 A;  2YSU B;  4ZKI A;  2X6A A;  4G2K A;  1K3E A;  2W6J G;  3VOU A;  4I5S A;  3E89 A;  3ASN C;  3CCQ V;  2P67 A;  3LNM B;  4PDM A;  1QVF U;  3EFF K;  4MTX A;  2BOC C;  2XAS A;  5B3S B;  1MOF A;  5C93 A;  1CP9 A;  1H8H G;  1QR8 A;  2K1E A;  3VBB A;  4DO2 A;  4GT1 A;  3MD0 A;  2UXN A;  1GO3 F;  3ZN0 A;  3E86 A;  4MVZ A;  2YEV B;  3SYA A;  2Q67 A;  4RQE A;  3H01 A;  1S77 D;  3T2M A;  3ABK C;  4MTO A;  1WPX A;  1GTO A;  2Z5U A;  3ZMT A;  1AI7 A;  3CC2 V;  2B1G A;  1R6N A;  4TWK A;  2X6B A;  1F23 A;  1V54 B;  1OCR B;  2CK3 G;  2OCC B;  3E35 A;  4N21 A;  3ZRV A;  4J9Z B;  4PEL A;  1YJW V;  1FFT B;  3E8G A;  3K9A A;  4WFG A;  4WFA V;  5B1A C;  2ZQM A;  3BY6 A;  3OAA G;  3CP1 A;  2QM8 A;  4LCU C;  1YHQ V;  1GM9 A;  1H38 A;  1JX9 A;  1K4D C;  4MTF A;  2DYR C;  2EIN C;  3B77 A;  3RBZ A;  1Q82 W;  1DF5 A;  3ABT A;  1JVM A;  3SJQ C;  2IJH A;  4CBC A;  1Q86 W;  2Z3Y A;  3AG2 B;  2A9H A;  2B1I A;  2D3O W;  1AJN A;  5CN0 A;  3AG1 B;  1EZJ A;  3WG7 B;  3OEH G;  1OCC C;  1K92 A;  1M56 B;  1VQL V;  3NXS A;  5EC2 C;  3CPW U;  1ZWI C;  2IJJ A;  5EBL C;  1YI2 V;  1CPY A;  2EIK C;  4CZZ A;  1K5S A;  3K04 A;  1M9N A;  2LP7 A;  3QO5 A;  3FB6 C;  3SYO A;  4ASU G;  1EFR G;  4Q20 A;  1P7B A;  4MS2 A;  4MVQ A;  2LFR A;  1NBM G;  2WLM A;  3FB8 C;  5GW7 A;  1E1R G;  4OXS A;  5KUM A;  4LBE C;  2EBO A;  2ITC C;  4WFH A;  1PL0 A;  3AG4 B;  1KKD A;  1F4M A;  1V55 C;  1R3K C;  2EIL B;  1DF4 A;  2WLI A;  4JYB A;  1PNK A;  1RPO A;  2NNU A;  1KC8 W;  1E1Q G;  4I9W A;  3B8M A;  4WCE V;  3X2Q B;  3CC4 V;  3ZRX A;  4E2L A;  1VQ4 V;  2DWE C;  4G28 B;  1NH2 D;  2ZDI C;  2FTK A;  1AI6 A;  4KUM A;  4WF9 V;  2ZR2 A;  4QE9 A;  1KP2 A;  4EKW A;  3ABL C;  3LDE A;  4BIZ A;  4UVC A;  5H6Q A;  1NKD A;  1S72 V;  3OMN B;  4HYO A;  1ENV A;  2ATK C;  3ETG A;  1J95 A;  4QIW F;  1RM1 C;  3AG3 B;  2M7W A;  4LC1 A;  3HPL C;  4RAI A;  2X6C A;  2X7R B;  4YXW G;  3LSQ A;  4DXW A;  4QNH B;  1EBO A;  3FYE B;  1K7D A;  1PD3 A;  3ETD A;  2F43 G;  1ROP A;  4ZBM A;  1G4Y B;  1OCZ C;  1SET A;  4GX1 A;  3SPJ A;  4XBF A;  2WLI B;  1W0K G;  2GHY A;  4PA3 A;  2WSS G;  3K06 A;  2ITD C;  3OR7 C;  4JTD B;  4G27 B;  3ABK B;  3QO8 A;  1QBZ A;  4UVA A;  2IH3 C;  3ZN1 A;  3K3W A;  3FB7 C;  2EZP A;  2XAJ A;  3ASO B;  2IJK A;  3ZIA G;  3F7Y C;  2A0L A;  5HFL A;  5DM6 V;  2W0F C;  1Q7Y W;  3T4Z A;  4R6Z A;  4JTC B;  2PI4 A;  4X8A A;  1S0V A;  5DN6 G;  4QPK A;  4WFB V;  3ZCC A;  3TCU A;  2WLK A;  1S5H C;  1W0J G;  3AEI A;  2XAG A;  3FYI B;  4HAM A;  1AJP A;  3IC7 A;  1R3L C;  1GM8 A;  2V1D A;  2EIN B;  3SPC A;  3OMI B;  5LGT A;  2DYS C;  1F51 A;  3SPG A;  2C2A A;  5EBM C;  2KB1 A;  3K79 A;  4GX0 A;  3CCU V;  3CYO A;  1HWY A;  1XL4 A;  2R9R B;  1R73 A;  3CCE V;  5L3D A;  3STL C;  2WLH A;  3ZMV A;  2XND G;  3F7V C;  2ZD9 A;  3W7W A;  4P9O A;  2EIK B;  1LNQ A;  3GWO A;  3ZRW B;  1YIJ V;  5EK0 A;  4X88 A;  1GKF A;  1JJ2 U;  1VQ8 V;  1OHH G;  1VQM V;  2HVJ C;  5IY5 C;  2DW4 A;  4FK5 C;  2DQ0 A;  1OCO C;  1BMF G;  3KG2 A;  2HVK C;  5B1N A;  5B3S C;  1W2B U;  3CMA V;  1M90 W;  3P30 A;  3CXC U;  4N23 A;  5LGN A;  3W7X A;  4MVO A;  4FPP A;  3ABM B;  1QLE B;  2ZXW C;  2EIM B;  1KQS U;  3LDC A;  3SPI A;  1FXK A;  1Y4M A;  4RO2 A;  4QJF B;  2GSM B;  3ZMU A;  1COW G;  1DTO A;  2DQ3 A;  1OZ0 A;  3T4D A;  2EZO A;  4TSF G;  5LGU A;  1G8M A;  2WLL B;  1FS0 G;  3BEH A;  3DGE A;  3CME V;  1NVP B;  3ABL B;  4JAV A;  3CCR V;  5LHI A;  1WLE A;  2EIJ B;  3G4S V;  2OT5 A;  3WFV A;  2HR3 A;  2NLJ C;  1JPX A;  1Y66 A;  3RVZ A;  1RM1 B;  1K73 W;  1VQN V;  5LHG A;  1VQ9 V;  2WWW A;  1YTF B;  3CCV V;  5B1B C;  2IU0 A;  3LSS A;  3MHS C;  3UM7 A;  4HZ3 A;  3CCJ V;  1S76 D;  4BAY A;  4UXN A;  1R6K A;  1DLB A;  5IYB O;  1PKX A;  1E79 G;  5LBQ A;  3OUF A;  3E8F A;  1FXK B;  1S3J A;  3QO7 A;  1K33 A;  3D36 A;  2QKS A;  3AG1 C;  4LP8 A;  1MG1 A;  1VQK V;  1NJI W;  3WG7 C;  3UKM A;  1JCH A;  4UVB A;  1M56 C;  3EHB B;  1QLN A;  2Y69 B;  2WLJ A;  1VQ5 V;  1BL8 A;  3TET A;  4Z1M G;  2AHZ A;  2HKO A;  2LFS A;  5EBW C;  4PDR A;  2OTL V;  3P32 A;  5J9P C;  4MSW C;  2OTJ V;  2DWD C;  3ASN B;  2HLD G;  5H6R A;  5L3F A;  1VQP V;  4R7C A;  1B6Q A;  3JCZ A;  5L3E A;  1CEZ A;  1FXH A;  3B8N A;  3STZ C;  3SPH A;  2B5U A;  3OMA B;  1KP3 A;  1I5X A;  2P7T C;  3MHH C;  1YJ9 V;  5L3B A;  4TT3 G;  3AG4 C;  4MW3 A;  3W7S A;  2DYS B;  2H8P C;  1AI4 A;  2WAM A;  3LDD A;  3OFN G;  1GMG A;  2IJI A;  4QE7 A;  4UUJ C;  3E8B A;  4R50 A;  1K97 A;  3OEE G;  2V7Q G;  5KA6 A;  3LUT B;  1I5Y A;  2QE7 G;  3ZRW A;  3IGA C;  2MK3 A;  1VQO V;  3T1C A;  4FJC C;  5B1A B;  4MT8 A;  3A0R A;  1UJW B;  1NQT A;  2A79 B;  2QM7 A;  3ML0 A;  5IDJ A;  5E1A C;  1M57 C;  1IXM A;  4KFM A;  2DYR B;  3CD6 V;  1ARO P;  4QPJ A;  1SRY A;  4JF3 A;  2QTO A;  5EC1 C;  5IY5 B;  1K5Q A;  1QVG U;  3G71 V;  3AG3 C;  1OCO B;  5HFM A;  3CCL V;  5L3C A;  4P30 A;  3JYC A;  1N8R W;  1MSW D;  1OCC B;  1F4N A;  1JQ0 A;  2P90 A;  3SYP A;  2PI5 A;  1TUE B;  1AJQ A;  4RUF A;  2ZXW B;  5FL7 G;  2JJ1 G;  3IFX A;  1PNM A;  3OW2 U;  2XAQ A;  2EJR A;  2ZDI A;  5H9C A;  1AI5 A;  1GK9 A;  2HFE C;  2R9I A;  5BZB A;  1PNL A;  2WLL A;  5CA3 A;  1L1F A;  1BHB A;  1JOY A;  4XDJ A;  3ASO C;  1K34 A;  4L87 A;  2HG5 C;  3JD3 A;  1XL6 A;  4H37 A;  3W7T A;  5CMU A;  5LHH A;  1RPR A;  2JIZ G;  4JGS A;  4KP4 A;  1P4R A;  1K4C C;  2QA4 V;  1NH2 B;  2Q6A A;  2Y48 A;  3JD4 A;  4MVS A;  3CCS V;  2QEX V;  3OR6 C;  4H33 A;  4JTA B;  3ABU A;  1NR7 A;  5IYD O;  1V55 B;  4UV8 A;  2JJ2 G;  4GCZ A;  5B1B B;  4JAU A;  3ZJZ A;  2JDI G;  4F4L A;  2P6J A;  1Q81 W;  4MW8 A;  1SZT A;  3D3I A;  1BHA A;  2JEU A;  2JK5 C;  1KEC A;  1V54 C;  3M99 B;  1OCR C;  2AHY A;  2OCC C;  4BIU A;  5CBF A;  4RQF A;  1SES A;  3DTU B;  2Q68 A;  2X0L A;  3E83 A;  4PDL A;  3ZRS A;  3PJS K;  4BW5 A;  1H8E G;  1QR9 A;  1KD1 W;  3E2E A;  3OGC C;  3SYQ A;  2UXX A;  3QNE A;  1YIT V;  1VQ6 V;  3I55 V;  1GM7 A;  4X89 A;  4PA9 A;  1YJN V;  1R3I C;  3JD1 A;  3CCM V;  1OCZ B;  5KUK A;  1AR1 B;  2Q69 A;  1THZ A;  2IW5 A;  3AG2 C;  4MTG A;  4JYC A;  1K9M W;  3K03 A;  1MAB G;  2XAH A;  3OE7 G;  3OUS A;  3K0D A;  2BOB C;  2WLN A;  5B1O A;  1K8A W;  3E8H A;  3F5W C;  1H2G A;  1QCE A;  2IU3 A;  5CBG A;  3ABM C;  1QLE C;  3RVY A;  2XOK G;  1ORQ C;  2EIM C;  1M1K W;  3G6E V;  2ZR3 A;  4UV9 A;  2WPD G;  4R8C A;  3ETE A;  4MVM A;  4FMT A;  1FXV A;  3CC7 V;  3K08 A;  1SER A;  4MVU A;  3R65 A;  4WFE A;  3OM3 B;  2JEX A;  4J9Y B;  3I56 V;  4PA6 A;  1YSC A;  2W6I G;  4P9P A;  2H94 A;  3K0G A;  3HB3 B;  4FIP C;  3W7U A;  2IH1 C;  3ZMS A;  4GX2 A;  4XDK A;  1M57 B;  3FKS G;  4JAS A;  1R3J C;  2EIJ C;  3SYC A;  4U7O A;  3TK1 A;  4XDL A;  4WFF A;  4GX5 A;  4PDV A;  5KA5 A;  2EIL C;  5L3G A;  4MVR A;  1VQ7 V;  3RW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...