3GB7C

Potassium channel kcsa-fab complex in li+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gb7C00
4JTDB 4X88A 3AG1C 3WG7C 2JK5C 5BZBA 4H33A 5CBGA 3SJQC 2HJFC 5J9PC 1K4CC 3RVYA 4RUFA 1OCOC 4PA7A 4F4LA 3STLC 2A0LA 1G4YB 3F7YC 4LP8A 3K08A 4OXSA 5E1AC 3SYOA 2ZXWC 1V55C 3SPGA 2HFEC 3KG2A 4MVQA 2Q68A 4PA3A 4MTFA 3VOUA 3TCUA 1LNQA 3E8BA 3FB5C 2DYSC 1M56C 4R7CA 3FB6C 4MVZA 4PDMA 5CBFA 2WLIA 2OCCC 4WFEA 2WLKA 4JTAB 4RUEA 1OCRC 4R8CA 5EC2C 2EILC 4BW5A 5KUKA 2DWEC 3LNMB 1P7BA 3ABMC 4LCUC 5IY5C 3SYPA 3EFFK 3UM7A 2KB1A 3K03A 4QE9A 3T4DA 4G28B 2EIJC 3FB8C 4UUJC 4P30A 4MW3A 2EIMC 4P9PA 2YEVA 4MSWC 4QNHB 4X89A 2X6BA 4KFMA 4RO2A 3R65A 1QLEC 1JVMA 2W0FC 4TWKA 4J9YB 1R3LC 1S5HC 3SPHA 3E89A 3FB7C 4XDLA 3TETA 2WLNA 2Q69A 4WFFA 1R3IC 2X6CA 3LDCA 4HYOA 4P2ZA 2R9RB 2A79B 4J9ZB 5B3SC 3PJSK 2WLJA 4GX2A 5CBHA 2IH1C 5EK0A 2HVJC 4R50A 3E8HA 3X2QC 4GX5A 4ZBMA 2WLLB 3AG2C 4PA4A 3SYQA 2Q6AA 2WLMA 2BOBC 2QTOA 4RAIA 4P9OA 2HG5C 3LDEA 1R3KC 4I9WA 4PA9A 5KUMA 3RBZA 3ABKC 2X6AA 3E83A 4JTCB 3ZRSA 2DYRC 2ATKC 5B1AC 5B1BC 3ABLC 2AHZA 4MS2A 3SPCA 3T4ZA 2Q67A 3SYAA 3LDDA 4WFGA 3ASNC 3K06A 2HVKC 3E8GA 1BL8A 1J95A 4XDKA 4PA6A 4G27B 4EKWA 2ITCC 3IFXA 5EBWC 1XL6A 5EBLC 4PDVA 1V54C 1ORQC 4GX0A 4MTGA 2QKSA 4QE7A 3T2MA 3SPJA 1OCCC 4H37A 4MTOA 2Y69C 3RW0A 1XL4A 1KKDA 3E86A 4HZ3A 4MVUA 3OR7C 1OCZC 4LBEC 4DXWA 2A9HA 3SYCA 3UKMA 3E8FA 3F7VC 5EBMC 3ASOC 3BEHA 3ZJZA 1K4DC 2WLHA 4MW8A 2WLLA 2P7TC 3AG3C 3OGCC 4GX1A 2BOCC 2NLJC 3OUSA 4R6ZA 3GB7C 4X8AA 3K0GA 4XDJA 2IH3C 4MVOA 3OR6C 2H8PC 3OUFA 4PDRA 4PDLA 4CBCA 2DWDC 4WFHA 3K0DA 2WLIB 3F5WC 3IGAC 3RVZA 2EINC 3AG4C 3HPLC 3K04A 2ITDC 3SPIA 2EIKC 2K1EA 1R3JC 2ZD9A 3STZC 3T1CA 1M57C 5EC1C 4MVRA 4MVSA 4MVMA 3LUTB 2AHYA 1ZWIC 3JYCA
chains in the Genus database with same CATH superfamily
2Q5ZA 3CC7V 2VWKA 1Y76B 1KQSU 2RJZA 3ZN0A 1LUVA 2RNBA 3SJQC 3HKEB 2IBZH 1N34O 1XREA 4AI8A 3JD1A 1K4CC 4NYKA 4NXNB 4UB8Z 3STLC 5E1AC 5EYPB 2Y48A 4UV9A 1IBMB 1VF6A 4KL1A 1XNQO 5KAFZ 2WLKA 1KUQA 5L3FA 3H1KH 3LNMB 1P7BA 3ETDA 5FNVB 1JMKC 4CS3A 2YXLA 3CCVV 5J2TB 4DK1A 4X66B 3AG4B 4DR2B 3B77A 3N2KA 3CYOA 5B1NA 4X1IB 2ZIMA 1KP3A 1SQPH 1GK9A 2L6LA 3CEIA 1YJNV 1KC8W 4BIZA 4LH6A 4JI5O 1I94B 1ZX3A 2QTOA 4FLVA 4YIPA 5J2UA 3ABKC 4I4TA 2LP7A 4FM0A 5B1BC 4ZHQA 3SPCA 4MT8A 1DGSA 3SYAA 2D2CB 4QJFB 1M56B 3E8GA 1SQBH 1M57B 2N05A 2ITCC 5K1XA 4IT5A 5LL6Y 3E86A 2N74A 3TXQA 4B3SB 2A9HA 1EBOA 1Q6UA 1T5EA 2WPDG 2VQEO 3GB7C 3JATB 5KAIZ 3CE2A 4WFHA 1XUQA 3F5WC 4CS4A 4H44B 3ZRWB 3JASB 3ZMSA 3H1LH 5CB4A 4NB5A 5JJJB 1M5IA 2QKCA 4JI7B 1YI2V 1SC5B 4NTWA 2HJFC 5J9PC 4RUFA 2AXTZ 2CDYA 4LP8A 1JFFB 1KP2A 2N04A 5LMUB 4LF6O 1WN7A 2LGQA 1XNRB 1NTKH 4DR3B 1PPJH 3I56V 2YICA 4FFKA 5DECA 1KU9A 2FB5A 3ZHUA 1QLEC 1JVMA 3OW2U 3SPHA 4GCZA 4LFBO 4WFFA 1SETA 3M8AA 1S5JA 3M99B 4DV2B 3DXRA 4UVCA 1YVWA 1BQZA 2AGAA 1HNXB 5GONA 2IH1C 3CRMA 5BMVB 4PA4A 2C2AA 3HKCA 1E79G 2HG5C 5KX5B 2PF4E 5EZYB 5CMUA 2DYRC 2QDOA 3QO7A 3ABLC 2AHZA 5JCOA 3SJCC 3CMAV 3OAAG 2X7RB 2AW9A 4O4JA 4DV3B 2Z3YA 3ML0A 3IFXA 4X64O 4I55B 3WB2A 1K97A 4TQFA 3SJAC 4JV5B 2Q7HA 1XL4A 2A06H 4YXWG 4LWSB 4DV6B 2RDCA 3ZJZA 2UU9O 4K8ZA 2M7WA 4HNAA 4FLUA 2F66C 4EB6A 5JVDA 1FFTB 1TVKB 3H1IH 3X2QB 3BCCH 4JI2B 2ZE5A 4KHPO 2UXDO 1BHAA 1JOYA 2ZKOA 1VMGA 2XASA 3JAMN 5LA6B 4O2AB 4DR1B 1B6QA 4JI4O 2AHYA 2QKAA 4X88A 3RYFB 3CCEV 3A2FA 3UO3A 2BCCH 4UV8A 2OT5A 3CHXA 3RVYA 3C3SA 2XAFA 1VIBA 1FPOA 4I0XB 2ZXWC 3B09A 3RYIB 4YJ3A 4R7CA 1BE3H 2LW7A 5KUKA 1VQOV 1XMQB 4BR6A 3T4DA 3CCRV 1NTZH 2QM4A 1FFXB 2YI9A 4J9YB 2XAHA 3OMNB 3UO2A 2B5UA 2JIZG 5J2TA 5LXTA 1OCCB 1AI6A 4YHHB 4O4IB 2ZR3A 1Q5OA 1HR0B 2HVJC 4I50A 3WFVA 2WLLB 1N32B 5LGNA 4WF9V 4PA9A 1NTMH 1N8RW 1QNMA 4U3JA 5KA5A 3WU2Z 3APQA 3ZHRA 1GH6A 2ADQB 3G67A 4LF5B 2UUCO 3A0BZ 5CA0A 2ZM6B 3QF7A 5GTIZ 3T2MA 3CC4V 2A7WA 2YSUB 1HNWO 2CTRA 4MVUA 4HZ3A 1M4UA 3CMEV 2QR4A 1OCZC 3SGIA 2OCHA 4FIPC 3UKMA 2Z5UA 4CC5A 2QEXV 3EHBB 4IGGA 4UVAA 2WLHA 1Q90D 1R6NA 4JI0O 1GO3F 1H2SB 2V7QG 3RYHB 1XEQA 4DUZB 4TQDA 5FLXN 3CCJV 4IIJA 2Y4UA 5KA6A 3EVKA 3VBBA 4GKJB 5C93A 1HNZO 4YJ2B 2K1EA 1XILA 2E74B 5LGTA 3BA8A 5ITZA 3RT3C 4DW1A 3AK1A 3GWOA 1IBKB 3WG7C 2IJHA 1H8HG 3I5DA 2VQFB 2Q9LA 3J7AU 2YC0A 2B1IA 3CJHA 1N36O 5C8YA 4JZ2A 4X1KB 1GN4A 3IJ4A 1WB8A 1V55C 2B9ZA 4NVPA 3K3WA 3OM3B 3FB5C 4JASA 1J5EO 4WFEA 5EC2C 1OCRC 4PV1B 2DQ0A 2FTKA 1YXBA 2QGNA 3ETQA 3D3IA 2E75B 2W0XA 4JI1O 2EIJC 2P5OA 1NVPB 2EIMC 4OPAA 4QIWF 2UUAO 4J9ZB 1S0VA 2BTQB 4X62O 3PJSK 1R73A 4O4LB 1H2GA 3SYQA 4A5UB 4X65O 2DMXA 2XAGA 3JALA 1QVFU 1WJZA 1VQ7V 2X0LA 2LGWA 2ATKC 5L3EA 2QWQB 5BY1A 5L3CA 5LOVB 2ZINA 2HVKC 2F1MA 2GV9A 3W7XA 3QVNA 1DLBA 2ZNJA 4GX0A 3SPJA 3AG1B 2VRZA 4GLXA 3T1YB 4GUNA 3ZMUA 2Q7EA 3ASOC 1WPBA 3P32A 2H3OA 2CE4A 2CTQA 3C90A 1EN5A 4LFCO 1TUEB 1D2DA 5A2QN 2EINC 1W0KG 1WNSA 2WA3A 3QG5A 3STZC 3KKYA 1SRYA 2ETNA 4KXRA 3OMAB 4FFBB 3S3WA 2HHHB 4JTDB 1N33B 1MA1A 4IHJB 4ABMA 2ADPA 2M6YA 2XAJA 2YI8A 1SF9A 2P6JA 3RYCB 3Q4HB 1F51A 5IYZB 1K9MW 1LNQA 5D5QA 1IBLB 3ZMTA 4LF8O 2OCCC 2CTPA 2DWEC 3A0RA 4B7EA 4ZOLB 1GN3A 2YEVA 1WA8B 3CB2A 3L70H 1Y6XA 5B3SC 5F2VO 1RPOA 4R50A 2AZ0A 4ZBMA 3CCMV 2Q6AA 2G38A 1NR1A 1R3KC 1YF2A 3A0HZ 1G6UA 1QR9A 1SESA 1L1FA 1TGOA 3I55V 3OMIB 3L72H 1XL6A 1K5SA 4X9QA 3ZHVA 2QKSA 1EN6A 4WFBV 1H8EG 2K9PA 1QLEB 3HR0A 2BTOA 2V4DA 1AP5A 3KCXA 5JQGA 1U97A 5DM6V 4JZGA 3OGCC 1VQNV 1XHZA 3BAAA 4X1YB 2DWDC 2IU0A 3K0DA 1PNKA 4O4HA 4FM2A 1EFRG 3JARB 2ZDIC 2F43G 2ZR2A 2ZD9A 5JJEB 2JGDA 2FMLA 4DV5B 2OWOA 1DF4A 2UXCB 2CUGA 3OTOB 2HLDG 4FMTA 4EKWA 3BRCA 1Q6HA 1PKXA 4YY3B 2UUBO 3SDLA 1OV9A 4F4LA 2A0LA 1G4YB 1S76D 5L3GA 1VQ8V 3E35A 1IURA 2HFEC 1Q6IA 4MVQA 2LJ2A 1I7FA 4LR3A 2DQ3A 3W7TA 3SYPA 2ZT9B 3ZMVA 2DW4A 4AQYB 1FJGB 2W0FC 4TWKA 4TV9A 1YTFD 1FXKB 1V54B 2WLNA 1PP9H 3ZN1A 1SA0A 2RCVA 5LHGA 1WB7A 2YIBD 4JI8O 4FPPA 1RFYA 4UCRA 4TSFG 4NXMO 1AJQA 1ZL8A 1VF6C 1K73W 2BOBC 2JEXA 4J7ZA 5LYJB 3B4SA 1HNXO 2ZXWB 2GHYA 1JX9A 1XBLA 2XAQA 2UXBO 2KG7B 3LDDA 4OGQB 2CK3G 4FVMA 3ASNC 2PGGA 4H13B 3DGEA 2YIBA 1YJWV 1MABG 2CH7B 2QWNB 1CEZA 4H0LB 1EM1A 4DV3O 3HKBA 3F7VC 2P67A 2EZPA 2IH3C 2Q0OC 1E1QG 1NH2D 3U10A 3VQVA 4J10A 3L74H 4X20A 4DV7O 2WLIB 3K5MA 2PI4A 4LF9B 4WBNB 4UB6Z 4B3RB 2ITDC 3JAWB 2OTJV 1VQ5V 2LW1A 1QBZA 5LMNB 1M1KW 2CTWA 3MHHC 5LHIA 3CCQV 3K9AA 2UXNA 3C3TA 4JI3B 3J80N 1Y67A 1RSOA 4BW9A 5FPRA 1HW7A 3CCLV 4U7OA 4FLZA 1PNLA 1OCZB 2DOSA 1B04A 2Q8VA 2DYSC 1VF5B 1S5LZ 1BS3A 5LBQA 4LFAB 5IJ9A 3TGUH 3FD9A 1NKDA 4LNUB 3N2GA 4I9QA 4DR7O 4NR1A 4DRXA 2JDIG 5KLVH 4XDLA 2F4VO 1B3QA 1R3IC 3LSQA 1AJNA 4FLWA 2RQ6A 5EK0A 1NI8A 1PM9A 3JCZA 5CN0A 4RAIA 1AROP 5IWAO 5IJ0B 5LP6A 1KMIZ 1V55B 5B1AC 4JYAB 5KHHA 3E22B 4TV8A 5KMGB 2LFRA 3MD0A 1MNGA 4G2KA 1OCRB 4NTYA 4F6RA 1PV0A 3CCUV 4YIOA 2QWPB 2ODMA 1AI4A 1N34B 3OTFA 4MTOA 2Y69C 4JYBA 1XMOB 4LBEC 3SYCA 1Y74A 4QPKA 1Q81W 3BEHA 2ZM6O 1K34A 4GX1A 3T1HO 5B5EZ 1P4RA 1NS1A 1RM1C 1GN2A 3ICXA 4XDJA 5JCOC 1DK1A 3OUFA 3UCSC 1VARA 4QPJA 2QTSA 3IGAC 3H9VA 2P4KA 4DV0O 1R3JC 2ILMA 5FPOA 3SR2C 3T1CA 4PELA 5EC1C 4F6EA 1AR5A 3JAKB 3P30A 1D5NA 3KCYA 1BT8A 1MMMA 1ZAUA 1XQ8A 1LUWA 1JA8A 1TA8A 4JI5B 4I5SA 1WAZA 2R72A 1SS3A 2L35A 3SYOA 4JGSA 1TUBB 4DR6B 1IBKO 2Q68A 5H2FZ 4DK0A 3E8BA 3ASOB 4PDMA 1VQPV 2JEUA 4JTAB 1RPRA 4B3TO 3OFNG 2GTSA 2JGUA 5BR8B 1ZSPA 4JYYA 4P9PA 3UQ8A 2X6BA 3DSQA 1Y76A 1SQGA 2MW2B 3HKEA 4DUYB 4P2ZA 3TJTA 1RP3B 4ZI7B 3OT7A 4ASUG 1Y4MA 3ZHTA 3FKSG 1IZ3A 3E8HA 5EYPA 3K58A 2WLMA 5JH7B 2ZQMA 3IC9A 2EZOA 3K5LA 3ZRSA 1MSDA 2HP8A 4O2BB 5FNVA 2YS8A 2Q67A 3UT5B 3H1JH 4UCOA 1SZXA 1SERA 2ZE7A 1L8DA 3CRAA 3NR7A 3MAQA 5K1PA 5EBWC 4PDVA 3CXCU 4X1IA 1ZTEA 3RW0A 1K7DA 1FD9A 2BSKB 1K4DC 1QVGU 4DV4B 5B3SB 4X8AA 3BABA 1S72V 2GSMB 1Q7YW 1P49A 4EFEA 3T1YO 2Y0PA 3FAVB 5GW7A 4BIOA 4NKGB 2D3OW 3RVZA 2YIAA 2YXYA 3K04A 4UVBA 2DE0X 1M57C 4LFBB 4RQEA 3W7SA 1GRJA 2Q73A 3CX5F 1TAEA 4GKKO 3O9OA 1KD1W 1L0LH 1Q3EA 1H2NA 3CRQA 3ZBHA 3HKDB 1E1RG 3JATA 3KG2A 3TCUA 4WCEV 4KP4A 3ZRXA 3ZRWA 5IY5C 3EFFK 3JASA 4K0KO 1JCHA 4N23A 3WB1A 1QR8A 1Q43A 2NR5A 3TETA 3AK3A 5CA1B 2PTMA 2PUSA 2UU9B 3K59A 1G8MA 3FFQA 4FJCC 4GX2A 1AVMA 2LFSA 3IAYA 1JFFA 3ZMZA 1HWYA 4K35A 3TK1A 4P9OA 1P84F 1O9HA 1AR4A 4KHPB 2UXDB 1VQ9V 1SKVA 1QLNA 2XNDG 3GWKC 3H1HH 3B2EE 1L0NH 3JD4A 3K9SA 4TUYB 4JI4B 4B3MB 3KZIZ 2E5LO 1AJPA 4K3AA 3JD0A 1JJ2U 4MTGA 4DR4O 4IYIA 4FLTA 4HAMA 1KYOF 2E3CA 4JF3A 3B8MA 2Q0AA 5BMVA 4TOIA 2QWRB 3K0GA 3L73H 5KX5A 3BA9A 5EZYA 2IJIA 5IE9A 5IYBO 4PDLA 2IU3A 4CBCA 1N4CA 1F7YA 3CC2V 2QWOB 3P3NA 1WP7A 2JVDA 3QTCA 2JJ1G 4I55A 3RWRD 3FX7A 3ASNB 3ETGA 3AK2A 3N2KB 2JK5C 5H6QA 1WPXA 4LWSA 4Z2WA 3QO8A 4B08A 2UXCO 4DYLA 1NU1H 1TVKA 1UFIA 4MTFA 1OHHG 4DV1B 1PNMA 2DN9A 1A32A 3ABKB 5J2UB 4JI6O 4RUEA 4I4TB 3N27A 5B1BB 4BW5A 4ZHQB 5E79Z 4FZ0A 1YDXA 1KKCA 2LQTA 5LA6A 4O2AA 4JAUA 3DC5A 1PD3A 2OYQA 3THOA 1I08A 1R3LC 3RYFA 1HNWB 3OGIB 4I7ZB 2R9RB 2VS0A 1S77D 1Q86W 2QA4V 4AQYO 2IW5A 1JR9A 5CBHA 4JI0B 4IYHA 4I0XA 2XOKG 1YJ9V 4NXNO 3TXSA 2YXHA 3RYIA 1AB3A 3LDEA 2EX3A 5KUMA 2PZSA 2X6AA 3E83A 1IBMO 4LF7B 1FXVA 2DYSB 1FFXA 3D36A 4Z1VA 5L3DA 4G27B 4D7TA 5TISZ 5CB4B 2E76B 1ORQC 3G71V 3G4SV 4X66O 1OCCC 3L71H 4DR2O 3BPZA 3CXHF 1KKDA 2B1GA 1VP7A 4O4IA 3CSXA 3E8FA 2F23A 2WLLA 3AG3C 2NLJC 4EFBA 1W0JG 1J5EB 2QE7G 5DEDA 1Q82W 5LGUA 1I94O 3G80A 4J11A 2EJ7A 1OZ0A 1IDSA 4GZRB 5B1AB 2UUAB 4MVRA 5H6RA 3OE7G 3CS5A 2V1DA 1VF7A 3JYCA 1W2BU 4X62B 3E2EA 1N0NA 3VQXA 1CP9A 3J81N 2RMKB 2WA4A 3DXRB 1S3JA 4UFZA 1XHXA 1OCOC 4X65B 5GONB 4PJ0Z 1D5AA 4OXSA 4B3SO 2Y69B 2CGOA 3ZS8C 3RYHA 3VOUA 1ROPA 3HKCB 5KHIA 3FB6C 3K57A 1RM1B 2DYRB 4R8CA 2XT9A 3ABLB 1US6A 4YJ2A 3K03A 1NJIW 3FB8C 3U11A 4P30A 3PN1A 4O4JB 4KFMA 1MSWD 2Y0IA 1NVPD 3BFRA 3CRRA 2HEPA 2W6IG 4JI7O 4X1KA 2OTLV 2PYJA 4HNAB 4LFCB 3FYIB 5JVDB 4EB6B 1AR1B 5LMUO 1AILA 1W59A 1XNRO 2BE3A 2FKXA 1QCEA 4DR3O 2VWJA 1BHBA 4IL6Z 4CZZA 3L75H 2BTQA 4L87A 4DV2O 4O4LA 1SQFA 1VQ4V 3OUSA 3JD3A 1OJHA 4LF8B 4UCUA 4GYCB 3OR6C 1XMOO 3LSUA 2P06A 4YJ3B 5KHJA 3ABUA 5KHGA 5LOVA 4W4KA 4N21A 3CD6V 1ZUQA 3VQWA 3G6BA 3O65A 3L9DA 3AG1C 1XI1A 4JYCA 5LXTB 2GUZB 1U96A 4JV5O 2FL4A 4B7KA 3JCUZ 2R9AA 4DV6O 4I50B 3CP1A 1AP6A 4BIUA 1YEWA 4U3JB 1QQCA 3OEEG 1F4MA 4DR6O 2GTAA 4JI2O 1VEWA 4OX9B 2IJKA 4PI2A 4QNHB 2P90A 4MSWC 1WLEA 4X89A 4FFBA 5IYCO 4K8XA 1S5HC 5CA0B 1SQQH 2PYLA 4DR1O 2KSDA 4IHJA 3JD2A 1NQTA 5BR8O 5L3BA 1SQVH 2FYUH 4WFAV 5IYDO 3RYCA 3Q4HA 1H38A 5IYZA 5HFMA 4OPHA 4DUYO 4KUMA 2EJRA 1NZ6A 2PY5A 4U3FH 4IIJB 3T4ZA 4ZOLA 2Z0AA 3A8TA 1BL8A 1J95A 4XDKA 5ITZB 4DR5B 1XMQO 1F4NA 1WA8A 5IY5B 1FS0G 5EBLC 2ARHA 3QO5A 2UUBB 3WG7B 3MHSC 3IC7A 2W6JG 1JJOA 1QHTA 1IXMA 3CJHB 5C8YB 4YHHO 5LP6C 5LHHA 4LF4B 1HR0O 2R70A 1GKFA 4NTXA 1N32O 1K5QA 1MG1A 1GM9A 1KECA 4JPRA 2KKWA 4LC1A 4DV4O 2CAZC 3K5OA 3ZHQA 2EIKC 1R6TA 2EIJB 2EIMB 1BMFG 1K33A 1H2LA 4MVSA 1M93A 3W7WA 1HP8A 4JI8B 4LF5O 2YUAA 2NNUA 5BZBA 4NXMB 3HB3B 2WWWA 1FKAO 4ZKIA 1XNQB 1YCIA 3K08A 3SPGA 4PA3A 4X1YA 3JALB 3ZHSA 1X59A 1IXBA 2UXBB 4MVZA 1M90W 3JARA 2EILC 4DUZO 3ABMC 4LCUC 1UPGA 2KB1A 3UM7A 2R9IA 4GKJO 4CH6A 3W7UA 3DC6A 4J42A 1ENVA 1Y66A 3FB7C 2JRIA 4FZ1A 4C7UA 4RQFA 2A79B 1SQXH 4XBFA 1F23A 5IT9N 3MDSA 2VQFO 3ZX6A 1YHQV 4GX5A 3AG2C 2PI5A 1FYJA 4DV7B 4E2LA 4JTCB 1I5YA 4MS2A 2EINB 1IX9A 3ZEDA 1IVSA 2OIEA 1FXKA 1FXKC 4QGPA 1V54C 2VQEB 1YIJV 3ABTA 3B40A 3H01A 1KBHA 5H9CA 4B3MO 1EZVH 2XUMA 2H94A 3RFRA 2GBOA 2O57A 5LYJA 2XTAA 1Z5VA 2OCCB 3WB0A 2KG7A 1Z5WA 1LR1A 4FK5C 3AG4C 3S3XA 1EN4A 3SPIA 4DR7B 1X4TA 2YEVB 2F4VB 1ZWIC 2CH7A 5KHKA 1NBMG 2HR3A 1GMGA 4LF6B 1MZEA 1XDCA 1QU7A 1G1XB 1AI5A 2WAMA 1PL4A 4PA7A 2JJ2G 2GUZA 5IWAB 3DTUB 3D8CA 3CCSV 4E4EA 1M56C 3AG3B 5CBFA 2WLIA 4WBNA 4BWAA 3JAWA 4AILC 4FLXA 3JSLA 4MW3A 4DV1O 4LH7A 4CC6A 1FAFA 2Q69A 5JJNB 2X6CA 1NT2B 2HHHO 3T1HB 5CA3A 1N33O 4CS2A 5JQGB 5A9GA 2ZIOA 1OCOB 1I0HA 1YZBA 3OEHG 2A3QA 3ZIAG 4X64B 4DV0B 3AG7A 4O4HB 1IBLO 3U0ZA 3K06A 1AI7A 2RN9A 2JGDB 4LNUA 1EZJA 4J80A 4LF7O 2F95B 2P22C 5H5NA 4ICGA 2QJ1A 3OR7C 4MTXA 2QM7A 3P3PA 4MW8A 2CGNA 1V9PA 2UXXA 2IJJA 1UJWB 3APOA 5IJ0A 4UCTA 4PHZA 4B3TB 4FLYA 2DJVA 3R66A 3GVMA 3E22A 4JAAA 4RWUA 1VQKV 3SJBC 2QSAA 1Z2GA 2KQXA 5KMGA 4FM1A 1SZTA 5IDJA 4JAVA 5GTHZ 1CXZB 4L8JA 3LUTB 2Q7GA 4TV9B 4H33A 3ZCCA 1WP8A 5CBGA 4J7KA 1SA0B 5DN6G 1GAXA 3CPWU 3F7YC 1BCCH 4J7JA 1ZL8B 5B66Z 3K79A 2ZCEA 2HJDA 2EBOA 3BHPA 1O9GA 4QE9A 4UUJC 1YTFB 1K8AW 4RO2A 3R65A 4ZIBA 3JAKA 1R6KA 3CRCA 1DF5A 4DV5O 4HBNA 2P4VA 3OTOO 1N0JA 3VQYA 1BSMA 1ZLZA 4YY3O 2WLJA 1R1BA 4CH3A 3HKBB 1TUBA 3F5TA 3X2QC 4Q20A 3BVOA 1MZFA 1GTOA 1M9NA 5HFLA 2ZE8A 1JPXA 3RBZA 2UUCB 2EULA 1JQ0A 4X20B 3RN4A 2JS5A 2Q4PA 4WFGA 2IM9A 2GDSA 3ZRVA 4PA6A 2QM8A 4W4LA 1GM8A 1K3EA 5D5PA 4GKKB 3K5NA 1K92A 1NR7A 1FJGO 4H37A 3JSNA 4ZI7A 4DXWA 5EIBD 4D6TH 1KB9F 5EBMC 1RSOB 1NH2B 1BZKA 1HNZB 5JH7A 4MVOA 4CH5A 2H8PC 1VQ6V 3OD4A 4O2BA 4Z1MG 3D36C 2Y4TA 3M7MX 3HPLC 4K0KB 2XHBA 3UT5A 4J41A 5IJ9B 1N36B 1COWG 2YDEA 1MOFA 1Q8IA 3N2GB 2ZNIA 4DRXB 5EIBC 3RGBA 1URFA 2ZE6A 1P7GA 3CWBH 1H2KA 2OIGA 1YITV 2BSKA 2YIDA 4BAYA 4GT1A 3NXSA 2NN4A 5JWPA 4AHCA 3D3QA 1H2MA 4JI1B 3BY6A 3LSSA 3FAVA 5FL7G 5LP6B 4UCVA 1PL0A 4Q6GA 5B1OA 2E5LB 3B8NA 4G28B 4LF9O 4TV8B 1YSCA 4B3RO 4DR4B 4F6RB 1B06A 5LMNO 2EIKB 4EEQA 3E89A 4HYOA 3LDCA 4OX9O 4PI0A 4UXNA 2HKOA 4JI3O 3G6EV 1Y74B 3HKDA 3EXAA 1VQMV 1VQLV 4I9WA 1THZA 4PD4F 4U7NA 1GM7A 3QNEA 2AZ2A 4LFAO 1BGYH 1BQ0A 3FYEB 1DTOA 2ZDIA 4DO2A 2EILB 3AEIA 3ABMB 5CA1A 2F93B 4QE7A 2WSSG 1GN6A 1XOUA 4DR5O 4UCSA 1I5XA 2P7TC 3ETEA 5BXZA 2LO1A 2BOCC 4R6ZA 4JI6B 2JS3A 4PDRA 1CPYA 2MK3A 5AG2A 3AG2B 4D7SA 3LNNA 4DW0A 4TUYA 4CH4A 4LF4O 4JYAO 1FXHA 4TT3G 4MVMA 1HDJA
chains in the Genus database with same CATH topology
4JTDB 3CC7V 2NNUA 1KQSU 5BZBA 3ZN0A 3SJQC 3HB3B 2WWWA 3JD1A 1K4CC 4ZKIA 1KD1W 3STLC 5E1AC 3K08A 2XAJA 2P6JA 3SPGA 1E1RG 2Y48A 3KG2A 1F51A 4UV9A 4PA3A 3TCUA 1K9MW 1LNQA 4MVZA 3ZMTA 4WCEV 2OCCC 4KP4A 2WLKA 1M90W 3ZRXA 2EILC 5L3FA 2DWEC 3A0RA 1P7BA 3ABMC 3ETDA 3LNMB 4LCUC 3EFFK 3ZRWA 5IY5C 3UM7A 2KB1A 2R9IA 3CCVV 2YEVA 3W7UA 3AG4B 1JCHA 1ENVA 4N23A 3B77A 1QR8A 1Y66A 3FB7C 3CYOA 3TETA 5B1NA 4RQFA 2A79B 5B3SC 4XBFA 1F23A 1G8MA 1KP3A 4FJCC 4GX2A 1GK9A 1RPOA 2LFSA 1YHQV 1YJNV 4R50A 1KC8W 4GX5A 4BIZA 4ZBMA 3AG2C 3ZMZA 3CCMV 2Q6AA 1HWYA 2PI5A 2QTOA 1NR1A 3TK1A 4P9OA 4E2LA 1R3KC 3ABKC 4JTCB 2LP7A 5B1BC 1QR9A 1VQ9V 1I5YA 4MS2A 3SPCA 2EINB 2XNDG 4MT8A 3SYAA 1QLNA 4QJFB 1M56B 1SESA 3JD4A 1L1FA 3E8GA 3I55V 1M57B 2ITCC 3OMIB 1FXKA 1XL6A 1FXKC 1AJPA 1K5SA 1V54C 3JD0A 1JJ2U 4MTGA 2QKSA 4WFBV 1YIJV 1H8EG 4HAMA 1QLEB 3ABTA 3E86A 4JF3A 3B8MA 2A9HA 3H01A 5H9CA 1EBOA 5DM6V 3OGCC 1VQNV 2H94A 2WPDG 3GB7C 3K0GA 2IJIA 5IYBO 4PDLA 2IU3A 4CBCA 2DWDC 4WFHA 2IU0A 2OCCB 1PNKA 3F5WC 3K0DA 3CC2V 1EFRG 2ZDIC 4FK5C 3AG4C 3ZRWB 3SPIA 2F43G 2ZR2A 2ZD9A 3ZMSA 1DF4A 2YEVB 2JJ1G 2HLDG 4FMTA 1ZWIC 3ASNB 4EKWA 1NBMG 3ETGA 2HR3A 1YI2V 1PKXA 1GMGA 2JK5C 5H6QA 1WPXA 2HJFC 5J9PC 1AI5A 3QO8A 4RUFA 2WAMA 4PA7A 2JJ2G 4F4LA 2A0LA 1G4YB 1S76D 4LP8A 5L3GA 1VQ8V 3DTUB 1KP2A 3E35A 2HFEC 4MVQA 4MTFA 1OHHG 3CCSV 2DQ3A 1PNMA 1M56C 3W7TA 3AG3B 5CBFA 2WLIA 3ABKB 4RUEA 5B1BB 4BW5A 3SYPA 3I56V 3ZMVA 4MW3A 2DW4A 4JAUA 1QLEC 1JVMA 1PD3A 3OW2U 2W0FC 4TWKA 1R3LC 3SPHA 1YTFD 1FXKB 1V54B 4GCZA 2WLNA 1SETA 2Q69A 4WFFA 3M99B 2X6CA 3ZN1A 5LHGA 2R9RB 4UVCA 1S77D 5CA3A 1Q86W 4FPPA 2QA4V 2IW5A 4TSFG 2IH1C 5CBHA 1AJQA 2XOKG 1YJ9V 4PA4A 2C2AA 1K73W 2BOBC 2JEXA 1E79G 1OCOB 2HG5C 3LDEA 5KUMA 5CMUA 3OEHG 2X6AA 3E83A 3ZIAG 2DYRC 2ZXWB 2GHYA 1JX9A 3QO7A 3ABLC 2AHZA 2XAQA 3CMAV 1FXVA 3LDDA 2CK3G 2DYSB 3ASNC 3OAAG 2X7RB 3K06A 1AI7A 3D36A 2Z3YA 3ML0A 5L3DA 4G27B 1EZJA 3IFXA 3DGEA 1ORQC 3G71V 1MABG 1K97A 1YJWV 3G4SV 1CEZA 1OCCC 1XL4A 1KKDA 4YXWG 2B1GA 3OR7C 4MTXA 3E8FA 2QM7A 3F7VC 2P67A 3ZJZA 4MW8A 2WLLA 3AG3C 2EZPA 2M7WA 2NLJC 2UXXA 2IJJA 1W0JG 1UJWB 1FFTB 2IH3C 1E1QG 2QE7G 1NH2D 3X2QB 1Q82W 5LGUA 2WLIB 2PI4A 1VQKV 2ITDC 1OZ0A 2OTJV 1BHAA 1VQ5V 1JOYA 1SZTA 5IDJA 1QBZA 4JAVA 5B1AB 2XASA 1M1KW 4MVRA 1B6QA 3MHHC 5LHIA 3CCQV 5H6RA 3LUTB 2AHYA 3OE7G 2V1DA 3JYCA 3K9AA 1W2BU 4X88A 3CCEV 2UXNA 3E2EA 4H33A 3ZCCA 1CP9A 5CBGA 5DN6G 4UV8A 2OT5A 3RVYA 1S3JA 3CPWU 2XAFA 1OCOC 3F7YC 4OXSA 2Y69B 3CCLV 2ZXWC 4U7OA 1PNLA 1OCZB 3VOUA 1ROPA 2DYSC 4R7CA 3FB6C 3K79A 5LBQA 1RM1B 2DYRB 4R8CA 5KUKA 3ABLB 2EBOA 1VQOV 3K03A 4QE9A 3T4DA 1NJIW 3CCRV 3FB8C 4UUJC 4P30A 1YTFB 1K8AW 1NKDA 4KFMA 4RO2A 3R65A 1MSWD 1R6KA 4J9YB 1NVPD 1DF5A 2JDIG 2XAHA 3OMNB 4XDLA 2B5UA 2JIZG 1R3IC 3LSQA 1AJNA 1OCCB 2W6IG 1AI6A 2WLJA 2ZR3A 5EK0A 2HVJC 3X2QC 3WFVA 2OTLV 3JCZA 4Q20A 2WLLB 5LGNA 1GTOA 1M9NA 5HFLA 4WF9V 5CN0A 3FYIB 4RAIA 1AR1B 1AROP 4PA9A 1JPXA 1N8RW 3RBZA 1JQ0A 1V55B 5B1AC 5KA5A 4WFGA 1QCEA 2LFRA 3MD0A 3ZRVA 4G2KA 1OCRB 4PA6A 2QM8A 1GM8A 1K3EA 3CCUV 1AI4A 1BHBA 3T2MA 4CZZA 1K92A 1NR7A 3CC4V 4H37A 2YSUB 4MTOA 2Y69C 4JYBA 4MVUA 4HZ3A 3CMEV 1OCZC 4LBEC 4DXWA 3SYCA 4FIPC 3UKMA 2Z5UA 4L87A 4QPKA 2QEXV 3EHBB 5EBMC 1Q81W 3BEHA 4UVAA 2WLHA 1K34A 4GX1A 1NH2B 1VQ4V 1P4RA 1RM1C 3OUSA 1R6NA 1GO3F 3JD3A 4XDJA 4MVOA 2V7QG 3OR6C 2H8PC 3OUFA 1VQ6V 3CCJV 4QPJA 4Z1MG 3ABUA 3IGAC 5KA6A 3VBBA 3HPLC 5C93A 4N21A 2K1EA 1R3JC 5LGTA 3CD6V 1COWG 3T1CA 4PELA 5EC1C 3GWOA 1MOFA 3P30A 3AG1C 3WG7C 2IJHA 1H8HG 4JYCA 1YITV 2B1IA 4I5SA 4BAYA 4GT1A 3NXSA 3SYOA 4JGSA 1V55C 3CP1A 3K3WA 3OM3B 2Q68A 4BIUA 3BY6A 3LSSA 3E8BA 3FB5C 3ASOB 4JASA 5FL7G 4PDMA 4WFEA 1VQPV 2JEUA 4JTAB 5EC2C 1OCRC 1RPRA 2DQ0A 2FTKA 1PL0A 3OFNG 3D3IA 3OEEG 1F4MA 5B1OA 3B8NA 4G28B 2EIJC 2IJKA 1NVPB 4QNHB 2P90A 2EIMC 4P9PA 1YSCA 4MSWC 1WLEA 4X89A 2X6BA 5IYCO 1S5HC 2EIKB 4QIWF 3E89A 4HYOA 3LDCA 4P2ZA 3JD2A 1NQTA 4J9ZB 1S0VA 4UXNA 5L3BA 2HKOA 3PJSK 4ASUG 1R73A 4WFAV 3G6EV 5IYDO 1Y4MA 3FKSG 3E8HA 1H2GA 1VQMV 1H38A 3SYQA 1VQLV 2WLMA 2XAGA 5HFMA 2ZQMA 1QVFU 4I9WA 4KUMA 1VQ7V 1THZA 2EJRA 2EZOA 2X0LA 3ZRSA 4U7NA 2ATKC 5L3EA 1GM7A 3T4ZA 3QNEA 5L3CA 2Q67A 2HVKC 1BL8A 1J95A 4XDKA 1SERA 3FYEB 1DTOA 2ZDIA 4DO2A 2EILB 1F4NA 3W7XA 3AEIA 5IY5B 3ABMB 5EBWC 1FS0G 5EBLC 4PDVA 1DLBA 3QO5A 3CXCU 4GX0A 4QE7A 3SPJA 3AG1B 3WG7B 2WSSG 3RW0A 1K7DA 3MHSC 3IC7A 2W6JG 1IXMA 3ZMUA 3ASOC 1K4DC 1QVGU 1I5XA 2P7TC 3ETEA 5LHHA 5B3SB 2BOCC 3P32A 4X8AA 4R6ZA 1S72V 2GSMB 1Q7YW 1GKFA 4PDRA 1CPYA 1K5QA 2MK3A 1MG1A 1TUEB 1GM9A 1KECA 3AG2B 4JPRA 4LC1A 5GW7A 2D3OW 3RVZA 2EINC 1W0KG 3K04A 2EIKC 1FXHA 2EIJB 4UVBA 3STZC 2EIMB 1BMFG 1M57C 1SRYA 4TT3G 4RQEA 1K33A 3OMAB 4MVSA 4MVMA 3W7SA 3W7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JTD B;  4X88 A;  3AG1 C;  3WG7 C;  2JK5 C;  5BZB A;  4H33 A;  5CBG A;  3SJQ C;  2HJF C;  5J9P C;  1K4C C;  3RVY A;  4RUF A;  1OCO C;  4PA7 A;  4F4L A;  3STL C;  2A0L A;  1G4Y B;  3F7Y C;  4LP8 A;  3K08 A;  4OXS A;  5E1A C;  3SYO A;  2ZXW C;  1V55 C;  3SPG A;  2HFE C;  3KG2 A;  4MVQ A;  2Q68 A;  4PA3 A;  4MTF A;  3VOU A;  3TCU A;  1LNQ A;  3E8B A;  3FB5 C;  2DYS C;  1M56 C;  4R7C A;  3FB6 C;  4MVZ A;  4PDM A;  5CBF A;  2WLI A;  2OCC C;  4WFE A;  2WLK A;  4JTA B;  4RUE A;  1OCR C;  4R8C A;  5EC2 C;  2EIL C;  4BW5 A;  5KUK A;  2DWE C;  3LNM B;  1P7B A;  3ABM C;  4LCU C;  5IY5 C;  3SYP A;  3EFF K;  3UM7 A;  2KB1 A;  3K03 A;  4QE9 A;  3T4D A;  4G28 B;  2EIJ C;  3FB8 C;  4UUJ C;  4P30 A;  4MW3 A;  2EIM C;  4P9P A;  2YEV A;  4MSW C;  4QNH B;  4X89 A;  2X6B A;  4KFM A;  4RO2 A;  3R65 A;  1QLE C;  1JVM A;  2W0F C;  4TWK A;  4J9Y B;  1R3L C;  1S5H C;  3SPH A;  3E89 A;  3FB7 C;  4XDL A;  3TET A;  2WLN A;  2Q69 A;  4WFF A;  1R3I C;  2X6C A;  3LDC A;  4HYO A;  4P2Z A;  2R9R B;  2A79 B;  4J9Z B;  5B3S C;  3PJS K;  2WLJ A;  4GX2 A;  5CBH A;  2IH1 C;  5EK0 A;  2HVJ C;  4R50 A;  3E8H A;  3X2Q C;  4GX5 A;  4ZBM A;  2WLL B;  3AG2 C;  4PA4 A;  3SYQ A;  2Q6A A;  2WLM A;  2BOB C;  2QTO A;  4RAI A;  4P9O A;  2HG5 C;  3LDE A;  1R3K C;  4I9W A;  4PA9 A;  5KUM A;  3RBZ A;  3ABK C;  2X6A A;  3E83 A;  4JTC B;  3ZRS A;  2DYR C;  2ATK C;  5B1A C;  5B1B C;  3ABL C;  2AHZ A;  4MS2 A;  3SPC A;  3T4Z A;  2Q67 A;  3SYA A;  3LDD A;  4WFG A;  3ASN C;  3K06 A;  2HVK C;  3E8G A;  1BL8 A;  1J95 A;  4XDK A;  4PA6 A;  4G27 B;  4EKW A;  2ITC C;  3IFX A;  5EBW C;  1XL6 A;  5EBL C;  4PDV A;  1V54 C;  1ORQ C;  4GX0 A;  4MTG A;  2QKS A;  4QE7 A;  3T2M A;  3SPJ A;  1OCC C;  4H37 A;  4MTO A;  2Y69 C;  3RW0 A;  1XL4 A;  1KKD A;  3E86 A;  4HZ3 A;  4MVU A;  3OR7 C;  1OCZ C;  4LBE C;  4DXW A;  2A9H A;  3SYC A;  3UKM A;  3E8F A;  3F7V C;  5EBM C;  3ASO C;  3BEH A;  3ZJZ A;  1K4D C;  2WLH A;  4MW8 A;  2WLL A;  2P7T C;  3AG3 C;  3OGC C;  4GX1 A;  2BOC C;  2NLJ C;  3OUS A;  4R6Z A;  3GB7 C;  4X8A A;  3K0G A;  4XDJ A;  2IH3 C;  4MVO A;  3OR6 C;  2H8P C;  3OUF A;  4PDR A;  4PDL A;  4CBC A;  2DWD C;  4WFH A;  3K0D A;  2WLI B;  3F5W C;  3IGA C;  3RVZ A;  2EIN C;  3AG4 C;  3HPL C;  3K04 A;  2ITD C;  3SPI A;  2EIK C;  2K1E A;  1R3J C;  2ZD9 A;  3STZ C;  3T1C A;  1M57 C;  5EC1 C;  4MVR A;  4MVS A;  4MVM A;  3LUT B;  2AHY A;  1ZWI C;  3JYC A; 
#chains in the Genus database with same CATH topology
 2Q5Z A;  3CC7 V;  2VWK A;  1Y76 B;  1KQS U;  2RJZ A;  3ZN0 A;  1LUV A;  2RNB A;  3SJQ C;  3HKE B;  2IBZ H;  1N34 O;  1XRE A;  4AI8 A;  3JD1 A;  1K4C C;  4NYK A;  4NXN B;  4UB8 Z;  3STL C;  5E1A C;  5EYP B;  2Y48 A;  4UV9 A;  1IBM B;  1VF6 A;  4KL1 A;  1XNQ O;  5KAF Z;  2WLK A;  1KUQ A;  5L3F A;  3H1K H;  3LNM B;  1P7B A;  3ETD A;  5FNV B;  1JMK C;  4CS3 A;  2YXL A;  3CCV V;  5J2T B;  4DK1 A;  4X66 B;  3AG4 B;  4DR2 B;  3B77 A;  3N2K A;  3CYO A;  5B1N A;  4X1I B;  2ZIM A;  1KP3 A;  1SQP H;  1GK9 A;  2L6L A;  3CEI A;  1YJN V;  1KC8 W;  4BIZ A;  4LH6 A;  4JI5 O;  1I94 B;  1ZX3 A;  2QTO A;  4FLV A;  4YIP A;  5J2U A;  3ABK C;  4I4T A;  2LP7 A;  4FM0 A;  5B1B C;  4ZHQ A;  3SPC A;  4MT8 A;  1DGS A;  3SYA A;  2D2C B;  4QJF B;  1M56 B;  3E8G A;  1SQB H;  1M57 B;  2N05 A;  2ITC C;  5K1X A;  4IT5 A;  5LL6 Y;  3E86 A;  2N74 A;  3TXQ A;  4B3S B;  2A9H A;  1EBO A;  1Q6U A;  1T5E A;  2WPD G;  2VQE O;  3GB7 C;  3JAT B;  5KAI Z;  3CE2 A;  4WFH A;  1XUQ A;  3F5W C;  4CS4 A;  4H44 B;  3ZRW B;  3JAS B;  3ZMS A;  3H1L H;  5CB4 A;  4NB5 A;  5JJJ B;  1M5I A;  2QKC A;  4JI7 B;  1YI2 V;  1SC5 B;  4NTW A;  2HJF C;  5J9P C;  4RUF A;  2AXT Z;  2CDY A;  4LP8 A;  1JFF B;  1KP2 A;  2N04 A;  5LMU B;  4LF6 O;  1WN7 A;  2LGQ A;  1XNR B;  1NTK H;  4DR3 B;  1PPJ H;  3I56 V;  2YIC A;  4FFK A;  5DEC A;  1KU9 A;  2FB5 A;  3ZHU A;  1QLE C;  1JVM A;  3OW2 U;  3SPH A;  4GCZ A;  4LFB O;  4WFF A;  1SET A;  3M8A A;  1S5J A;  3M99 B;  4DV2 B;  3DXR A;  4UVC A;  1YVW A;  1BQZ A;  2AGA A;  1HNX B;  5GON A;  2IH1 C;  3CRM A;  5BMV B;  4PA4 A;  2C2A A;  3HKC A;  1E79 G;  2HG5 C;  5KX5 B;  2PF4 E;  5EZY B;  5CMU A;  2DYR C;  2QDO A;  3QO7 A;  3ABL C;  2AHZ A;  5JCO A;  3SJC C;  3CMA V;  3OAA G;  2X7R B;  2AW9 A;  4O4J A;  4DV3 B;  2Z3Y A;  3ML0 A;  3IFX A;  4X64 O;  4I55 B;  3WB2 A;  1K97 A;  4TQF A;  3SJA C;  4JV5 B;  2Q7H A;  1XL4 A;  2A06 H;  4YXW G;  4LWS B;  4DV6 B;  2RDC A;  3ZJZ A;  2UU9 O;  4K8Z A;  2M7W A;  4HNA A;  4FLU A;  2F66 C;  4EB6 A;  5JVD A;  1FFT B;  1TVK B;  3H1I H;  3X2Q B;  3BCC H;  4JI2 B;  2ZE5 A;  4KHP O;  2UXD O;  1BHA A;  1JOY A;  2ZKO A;  1VMG A;  2XAS A;  3JAM N;  5LA6 B;  4O2A B;  4DR1 B;  1B6Q A;  4JI4 O;  2AHY A;  2QKA A;  4X88 A;  3RYF B;  3CCE V;  3A2F A;  3UO3 A;  2BCC H;  4UV8 A;  2OT5 A;  3CHX A;  3RVY A;  3C3S A;  2XAF A;  1VIB A;  1FPO A;  4I0X B;  2ZXW C;  3B09 A;  3RYI B;  4YJ3 A;  4R7C A;  1BE3 H;  2LW7 A;  5KUK A;  1VQO V;  1XMQ B;  4BR6 A;  3T4D A;  3CCR V;  1NTZ H;  2QM4 A;  1FFX B;  2YI9 A;  4J9Y B;  2XAH A;  3OMN B;  3UO2 A;  2B5U A;  2JIZ G;  5J2T A;  5LXT A;  1OCC B;  1AI6 A;  4YHH B;  4O4I B;  2ZR3 A;  1Q5O A;  1HR0 B;  2HVJ C;  4I50 A;  3WFV A;  2WLL B;  1N32 B;  5LGN A;  4WF9 V;  4PA9 A;  1NTM H;  1N8R W;  1QNM A;  4U3J A;  5KA5 A;  3WU2 Z;  3APQ A;  3ZHR A;  1GH6 A;  2ADQ B;  3G67 A;  4LF5 B;  2UUC O;  3A0B Z;  5CA0 A;  2ZM6 B;  3QF7 A;  5GTI Z;  3T2M A;  3CC4 V;  2A7W A;  2YSU B;  1HNW O;  2CTR A;  4MVU A;  4HZ3 A;  1M4U A;  3CME V;  2QR4 A;  1OCZ C;  3SGI A;  2OCH A;  4FIP C;  3UKM A;  2Z5U A;  4CC5 A;  2QEX V;  3EHB B;  4IGG A;  4UVA A;  2WLH A;  1Q90 D;  1R6N A;  4JI0 O;  1GO3 F;  1H2S B;  2V7Q G;  3RYH B;  1XEQ A;  4DUZ B;  4TQD A;  5FLX N;  3CCJ V;  4IIJ A;  2Y4U A;  5KA6 A;  3EVK A;  3VBB A;  4GKJ B;  5C93 A;  1HNZ O;  4YJ2 B;  2K1E A;  1XIL A;  2E74 B;  5LGT A;  3BA8 A;  5ITZ A;  3RT3 C;  4DW1 A;  3AK1 A;  3GWO A;  1IBK B;  3WG7 C;  2IJH A;  1H8H G;  3I5D A;  2VQF B;  2Q9L A;  3J7A U;  2YC0 A;  2B1I A;  3CJH A;  1N36 O;  5C8Y A;  4JZ2 A;  4X1K B;  1GN4 A;  3IJ4 A;  1WB8 A;  1V55 C;  2B9Z A;  4NVP A;  3K3W A;  3OM3 B;  3FB5 C;  4JAS A;  1J5E O;  4WFE A;  5EC2 C;  1OCR C;  4PV1 B;  2DQ0 A;  2FTK A;  1YXB A;  2QGN A;  3ETQ A;  3D3I A;  2E75 B;  2W0X A;  4JI1 O;  2EIJ C;  2P5O A;  1NVP B;  2EIM C;  4OPA A;  4QIW F;  2UUA O;  4J9Z B;  1S0V A;  2BTQ B;  4X62 O;  3PJS K;  1R73 A;  4O4L B;  1H2G A;  3SYQ A;  4A5U B;  4X65 O;  2DMX A;  2XAG A;  3JAL A;  1QVF U;  1WJZ A;  1VQ7 V;  2X0L A;  2LGW A;  2ATK C;  5L3E A;  2QWQ B;  5BY1 A;  5L3C A;  5LOV B;  2ZIN A;  2HVK C;  2F1M A;  2GV9 A;  3W7X A;  3QVN A;  1DLB A;  2ZNJ A;  4GX0 A;  3SPJ A;  3AG1 B;  2VRZ A;  4GLX A;  3T1Y B;  4GUN A;  3ZMU A;  2Q7E A;  3ASO C;  1WPB A;  3P32 A;  2H3O A;  2CE4 A;  2CTQ A;  3C90 A;  1EN5 A;  4LFC O;  1TUE B;  1D2D A;  5A2Q N;  2EIN C;  1W0K G;  1WNS A;  2WA3 A;  3QG5 A;  3STZ C;  3KKY A;  1SRY A;  2ETN A;  4KXR A;  3OMA B;  4FFB B;  3S3W A;  2HHH B;  4JTD B;  1N33 B;  1MA1 A;  4IHJ B;  4ABM A;  2ADP A;  2M6Y A;  2XAJ A;  2YI8 A;  1SF9 A;  2P6J A;  3RYC B;  3Q4H B;  1F51 A;  5IYZ B;  1K9M W;  1LNQ A;  5D5Q A;  1IBL B;  3ZMT A;  4LF8 O;  2OCC C;  2CTP A;  2DWE C;  3A0R A;  4B7E A;  4ZOL B;  1GN3 A;  2YEV A;  1WA8 B;  3CB2 A;  3L70 H;  1Y6X A;  5B3S C;  5F2V O;  1RPO A;  4R50 A;  2AZ0 A;  4ZBM A;  3CCM V;  2Q6A A;  2G38 A;  1NR1 A;  1R3K C;  1YF2 A;  3A0H Z;  1G6U A;  1QR9 A;  1SES A;  1L1F A;  1TGO A;  3I55 V;  3OMI B;  3L72 H;  1XL6 A;  1K5S A;  4X9Q A;  3ZHV A;  2QKS A;  1EN6 A;  4WFB V;  1H8E G;  2K9P A;  1QLE B;  3HR0 A;  2BTO A;  2V4D A;  1AP5 A;  3KCX A;  5JQG A;  1U97 A;  5DM6 V;  4JZG A;  3OGC C;  1VQN V;  1XHZ A;  3BAA A;  4X1Y B;  2DWD C;  2IU0 A;  3K0D A;  1PNK A;  4O4H A;  4FM2 A;  1EFR G;  3JAR B;  2ZDI C;  2F43 G;  2ZR2 A;  2ZD9 A;  5JJE B;  2JGD A;  2FML A;  4DV5 B;  2OWO A;  1DF4 A;  2UXC B;  2CUG A;  3OTO B;  2HLD G;  4FMT A;  4EKW A;  3BRC A;  1Q6H A;  1PKX A;  4YY3 B;  2UUB O;  3SDL A;  1OV9 A;  4F4L A;  2A0L A;  1G4Y B;  1S76 D;  5L3G A;  1VQ8 V;  3E35 A;  1IUR A;  2HFE C;  1Q6I A;  4MVQ A;  2LJ2 A;  1I7F A;  4LR3 A;  2DQ3 A;  3W7T A;  3SYP A;  2ZT9 B;  3ZMV A;  2DW4 A;  4AQY B;  1FJG B;  2W0F C;  4TWK A;  4TV9 A;  1YTF D;  1FXK B;  1V54 B;  2WLN A;  1PP9 H;  3ZN1 A;  1SA0 A;  2RCV A;  5LHG A;  1WB7 A;  2YIB D;  4JI8 O;  4FPP A;  1RFY A;  4UCR A;  4TSF G;  4NXM O;  1AJQ A;  1ZL8 A;  1VF6 C;  1K73 W;  2BOB C;  2JEX A;  4J7Z A;  5LYJ B;  3B4S A;  1HNX O;  2ZXW B;  2GHY A;  1JX9 A;  1XBL A;  2XAQ A;  2UXB O;  2KG7 B;  3LDD A;  4OGQ B;  2CK3 G;  4FVM A;  3ASN C;  2PGG A;  4H13 B;  3DGE A;  2YIB A;  1YJW V;  1MAB G;  2CH7 B;  2QWN B;  1CEZ A;  4H0L B;  1EM1 A;  4DV3 O;  3HKB A;  3F7V C;  2P67 A;  2EZP A;  2IH3 C;  2Q0O C;  1E1Q G;  1NH2 D;  3U10 A;  3VQV A;  4J10 A;  3L74 H;  4X20 A;  4DV7 O;  2WLI B;  3K5M A;  2PI4 A;  4LF9 B;  4WBN B;  4UB6 Z;  4B3R B;  2ITD C;  3JAW B;  2OTJ V;  1VQ5 V;  2LW1 A;  1QBZ A;  5LMN B;  1M1K W;  2CTW A;  3MHH C;  5LHI A;  3CCQ V;  3K9A A;  2UXN A;  3C3T A;  4JI3 B;  3J80 N;  1Y67 A;  1RSO A;  4BW9 A;  5FPR A;  1HW7 A;  3CCL V;  4U7O A;  4FLZ A;  1PNL A;  1OCZ B;  2DOS A;  1B04 A;  2Q8V A;  2DYS C;  1VF5 B;  1S5L Z;  1BS3 A;  5LBQ A;  4LFA B;  5IJ9 A;  3TGU H;  3FD9 A;  1NKD A;  4LNU B;  3N2G A;  4I9Q A;  4DR7 O;  4NR1 A;  4DRX A;  2JDI G;  5KLV H;  4XDL A;  2F4V O;  1B3Q A;  1R3I C;  3LSQ A;  1AJN A;  4FLW A;  2RQ6 A;  5EK0 A;  1NI8 A;  1PM9 A;  3JCZ A;  5CN0 A;  4RAI A;  1ARO P;  5IWA O;  5IJ0 B;  5LP6 A;  1KMI Z;  1V55 B;  5B1A C;  4JYA B;  5KHH A;  3E22 B;  4TV8 A;  5KMG B;  2LFR A;  3MD0 A;  1MNG A;  4G2K A;  1OCR B;  4NTY A;  4F6R A;  1PV0 A;  3CCU V;  4YIO A;  2QWP B;  2ODM A;  1AI4 A;  1N34 B;  3OTF A;  4MTO A;  2Y69 C;  4JYB A;  1XMO B;  4LBE C;  3SYC A;  1Y74 A;  4QPK A;  1Q81 W;  3BEH A;  2ZM6 O;  1K34 A;  4GX1 A;  3T1H O;  5B5E Z;  1P4R A;  1NS1 A;  1RM1 C;  1GN2 A;  3ICX A;  4XDJ A;  5JCO C;  1DK1 A;  3OUF A;  3UCS C;  1VAR A;  4QPJ A;  2QTS A;  3IGA C;  3H9V A;  2P4K A;  4DV0 O;  1R3J C;  2ILM A;  5FPO A;  3SR2 C;  3T1C A;  4PEL A;  5EC1 C;  4F6E A;  1AR5 A;  3JAK B;  3P30 A;  1D5N A;  3KCY A;  1BT8 A;  1MMM A;  1ZAU A;  1XQ8 A;  1LUW A;  1JA8 A;  1TA8 A;  4JI5 B;  4I5S A;  1WAZ A;  2R72 A;  1SS3 A;  2L35 A;  3SYO A;  4JGS A;  1TUB B;  4DR6 B;  1IBK O;  2Q68 A;  5H2F Z;  4DK0 A;  3E8B A;  3ASO B;  4PDM A;  1VQP V;  2JEU A;  4JTA B;  1RPR A;  4B3T O;  3OFN G;  2GTS A;  2JGU A;  5BR8 B;  1ZSP A;  4JYY A;  4P9P A;  3UQ8 A;  2X6B A;  3DSQ A;  1Y76 A;  1SQG A;  2MW2 B;  3HKE A;  4DUY B;  4P2Z A;  3TJT A;  1RP3 B;  4ZI7 B;  3OT7 A;  4ASU G;  1Y4M A;  3ZHT A;  3FKS G;  1IZ3 A;  3E8H A;  5EYP A;  3K58 A;  2WLM A;  5JH7 B;  2ZQM A;  3IC9 A;  2EZO A;  3K5L A;  3ZRS A;  1MSD A;  2HP8 A;  4O2B B;  5FNV A;  2YS8 A;  2Q67 A;  3UT5 B;  3H1J H;  4UCO A;  1SZX A;  1SER A;  2ZE7 A;  1L8D A;  3CRA A;  3NR7 A;  3MAQ A;  5K1P A;  5EBW C;  4PDV A;  3CXC U;  4X1I A;  1ZTE A;  3RW0 A;  1K7D A;  1FD9 A;  2BSK B;  1K4D C;  1QVG U;  4DV4 B;  5B3S B;  4X8A A;  3BAB A;  1S72 V;  2GSM B;  1Q7Y W;  1P49 A;  4EFE A;  3T1Y O;  2Y0P A;  3FAV B;  5GW7 A;  4BIO A;  4NKG B;  2D3O W;  3RVZ A;  2YIA A;  2YXY A;  3K04 A;  4UVB A;  2DE0 X;  1M57 C;  4LFB B;  4RQE A;  3W7S A;  1GRJ A;  2Q73 A;  3CX5 F;  1TAE A;  4GKK O;  3O9O A;  1KD1 W;  1L0L H;  1Q3E A;  1H2N A;  3CRQ A;  3ZBH A;  3HKD B;  1E1R G;  3JAT A;  3KG2 A;  3TCU A;  4WCE V;  4KP4 A;  3ZRX A;  3ZRW A;  5IY5 C;  3EFF K;  3JAS A;  4K0K O;  1JCH A;  4N23 A;  3WB1 A;  1QR8 A;  1Q43 A;  2NR5 A;  3TET A;  3AK3 A;  5CA1 B;  2PTM A;  2PUS A;  2UU9 B;  3K59 A;  1G8M A;  3FFQ A;  4FJC C;  4GX2 A;  1AVM A;  2LFS A;  3IAY A;  1JFF A;  3ZMZ A;  1HWY A;  4K35 A;  3TK1 A;  4P9O A;  1P84 F;  1O9H A;  1AR4 A;  4KHP B;  2UXD B;  1VQ9 V;  1SKV A;  1QLN A;  2XND G;  3GWK C;  3H1H H;  3B2E E;  1L0N H;  3JD4 A;  3K9S A;  4TUY B;  4JI4 B;  4B3M B;  3KZI Z;  2E5L O;  1AJP A;  4K3A A;  3JD0 A;  1JJ2 U;  4MTG A;  4DR4 O;  4IYI A;  4FLT A;  4HAM A;  1KYO F;  2E3C A;  4JF3 A;  3B8M A;  2Q0A A;  5BMV A;  4TOI A;  2QWR B;  3K0G A;  3L73 H;  5KX5 A;  3BA9 A;  5EZY A;  2IJI A;  5IE9 A;  5IYB O;  4PDL A;  2IU3 A;  4CBC A;  1N4C A;  1F7Y A;  3CC2 V;  2QWO B;  3P3N A;  1WP7 A;  2JVD A;  3QTC A;  2JJ1 G;  4I55 A;  3RWR D;  3FX7 A;  3ASN B;  3ETG A;  3AK2 A;  3N2K B;  2JK5 C;  5H6Q A;  1WPX A;  4LWS A;  4Z2W A;  3QO8 A;  4B08 A;  2UXC O;  4DYL A;  1NU1 H;  1TVK A;  1UFI A;  4MTF A;  1OHH G;  4DV1 B;  1PNM A;  2DN9 A;  1A32 A;  3ABK B;  5J2U B;  4JI6 O;  4RUE A;  4I4T B;  3N27 A;  5B1B B;  4BW5 A;  4ZHQ B;  5E79 Z;  4FZ0 A;  1YDX A;  1KKC A;  2LQT A;  5LA6 A;  4O2A A;  4JAU A;  3DC5 A;  1PD3 A;  2OYQ A;  3THO A;  1I08 A;  1R3L C;  3RYF A;  1HNW B;  3OGI B;  4I7Z B;  2R9R B;  2VS0 A;  1S77 D;  1Q86 W;  2QA4 V;  4AQY O;  2IW5 A;  1JR9 A;  5CBH A;  4JI0 B;  4IYH A;  4I0X A;  2XOK G;  1YJ9 V;  4NXN O;  3TXS A;  2YXH A;  3RYI A;  1AB3 A;  3LDE A;  2EX3 A;  5KUM A;  2PZS A;  2X6A A;  3E83 A;  1IBM O;  4LF7 B;  1FXV A;  2DYS B;  1FFX A;  3D36 A;  4Z1V A;  5L3D A;  4G27 B;  4D7T A;  5TIS Z;  5CB4 B;  2E76 B;  1ORQ C;  3G71 V;  3G4S V;  4X66 O;  1OCC C;  3L71 H;  4DR2 O;  3BPZ A;  3CXH F;  1KKD A;  2B1G A;  1VP7 A;  4O4I A;  3CSX A;  3E8F A;  2F23 A;  2WLL A;  3AG3 C;  2NLJ C;  4EFB A;  1W0J G;  1J5E B;  2QE7 G;  5DED A;  1Q82 W;  5LGU A;  1I94 O;  3G80 A;  4J11 A;  2EJ7 A;  1OZ0 A;  1IDS A;  4GZR B;  5B1A B;  2UUA B;  4MVR A;  5H6R A;  3OE7 G;  3CS5 A;  2V1D A;  1VF7 A;  3JYC A;  1W2B U;  4X62 B;  3E2E A;  1N0N A;  3VQX A;  1CP9 A;  3J81 N;  2RMK B;  2WA4 A;  3DXR B;  1S3J A;  4UFZ A;  1XHX A;  1OCO C;  4X65 B;  5GON B;  4PJ0 Z;  1D5A A;  4OXS A;  4B3S O;  2Y69 B;  2CGO A;  3ZS8 C;  3RYH A;  3VOU A;  1ROP A;  3HKC B;  5KHI A;  3FB6 C;  3K57 A;  1RM1 B;  2DYR B;  4R8C A;  2XT9 A;  3ABL B;  1US6 A;  4YJ2 A;  3K03 A;  1NJI W;  3FB8 C;  3U11 A;  4P30 A;  3PN1 A;  4O4J B;  4KFM A;  1MSW D;  2Y0I A;  1NVP D;  3BFR A;  3CRR A;  2HEP A;  2W6I G;  4JI7 O;  4X1K A;  2OTL V;  2PYJ A;  4HNA B;  4LFC B;  3FYI B;  5JVD B;  4EB6 B;  1AR1 B;  5LMU O;  1AIL A;  1W59 A;  1XNR O;  2BE3 A;  2FKX A;  1QCE A;  4DR3 O;  2VWJ A;  1BHB A;  4IL6 Z;  4CZZ A;  3L75 H;  2BTQ A;  4L87 A;  4DV2 O;  4O4L A;  1SQF A;  1VQ4 V;  3OUS A;  3JD3 A;  1OJH A;  4LF8 B;  4UCU A;  4GYC B;  3OR6 C;  1XMO O;  3LSU A;  2P06 A;  4YJ3 B;  5KHJ A;  3ABU A;  5KHG A;  5LOV A;  4W4K A;  4N21 A;  3CD6 V;  1ZUQ A;  3VQW A;  3G6B A;  3O65 A;  3L9D A;  3AG1 C;  1XI1 A;  4JYC A;  5LXT B;  2GUZ B;  1U96 A;  4JV5 O;  2FL4 A;  4B7K A;  3JCU Z;  2R9A A;  4DV6 O;  4I50 B;  3CP1 A;  1AP6 A;  4BIU A;  1YEW A;  4U3J B;  1QQC A;  3OEE G;  1F4M A;  4DR6 O;  2GTA A;  4JI2 O;  1VEW A;  4OX9 B;  2IJK A;  4PI2 A;  4QNH B;  2P90 A;  4MSW C;  1WLE A;  4X89 A;  4FFB A;  5IYC O;  4K8X A;  1S5H C;  5CA0 B;  1SQQ H;  2PYL A;  4DR1 O;  2KSD A;  4IHJ A;  3JD2 A;  1NQT A;  5BR8 O;  5L3B A;  1SQV H;  2FYU H;  4WFA V;  5IYD O;  3RYC A;  3Q4H A;  1H38 A;  5IYZ A;  5HFM A;  4OPH A;  4DUY O;  4KUM A;  2EJR A;  1NZ6 A;  2PY5 A;  4U3F H;  4IIJ B;  3T4Z A;  4ZOL A;  2Z0A A;  3A8T A;  1BL8 A;  1J95 A;  4XDK A;  5ITZ B;  4DR5 B;  1XMQ O;  1F4N A;  1WA8 A;  5IY5 B;  1FS0 G;  5EBL C;  2ARH A;  3QO5 A;  2UUB B;  3WG7 B;  3MHS C;  3IC7 A;  2W6J G;  1JJO A;  1QHT A;  1IXM A;  3CJH B;  5C8Y B;  4YHH O;  5LP6 C;  5LHH A;  4LF4 B;  1HR0 O;  2R70 A;  1GKF A;  4NTX A;  1N32 O;  1K5Q A;  1MG1 A;  1GM9 A;  1KEC A;  4JPR A;  2KKW A;  4LC1 A;  4DV4 O;  2CAZ C;  3K5O A;  3ZHQ A;  2EIK C;  1R6T A;  2EIJ B;  2EIM B;  1BMF G;  1K33 A;  1H2L A;  4MVS A;  1M93 A;  3W7W A;  1HP8 A;  4JI8 B;  4LF5 O;  2YUA A;  2NNU A;  5BZB A;  4NXM B;  3HB3 B;  2WWW A;  1FKA O;  4ZKI A;  1XNQ B;  1YCI A;  3K08 A;  3SPG A;  4PA3 A;  4X1Y A;  3JAL B;  3ZHS A;  1X59 A;  1IXB A;  2UXB B;  4MVZ A;  1M90 W;  3JAR A;  2EIL C;  4DUZ O;  3ABM C;  4LCU C;  1UPG A;  2KB1 A;  3UM7 A;  2R9I A;  4GKJ O;  4CH6 A;  3W7U A;  3DC6 A;  4J42 A;  1ENV A;  1Y66 A;  3FB7 C;  2JRI A;  4FZ1 A;  4C7U A;  4RQF A;  2A79 B;  1SQX H;  4XBF A;  1F23 A;  5IT9 N;  3MDS A;  2VQF O;  3ZX6 A;  1YHQ V;  4GX5 A;  3AG2 C;  2PI5 A;  1FYJ A;  4DV7 B;  4E2L A;  4JTC B;  1I5Y A;  4MS2 A;  2EIN B;  1IX9 A;  3ZED A;  1IVS A;  2OIE A;  1FXK A;  1FXK C;  4QGP A;  1V54 C;  2VQE B;  1YIJ V;  3ABT A;  3B40 A;  3H01 A;  1KBH A;  5H9C A;  4B3M O;  1EZV H;  2XUM A;  2H94 A;  3RFR A;  2GBO A;  2O57 A;  5LYJ A;  2XTA A;  1Z5V A;  2OCC B;  3WB0 A;  2KG7 A;  1Z5W A;  1LR1 A;  4FK5 C;  3AG4 C;  3S3X A;  1EN4 A;  3SPI A;  4DR7 B;  1X4T A;  2YEV B;  2F4V B;  1ZWI C;  2CH7 A;  5KHK A;  1NBM G;  2HR3 A;  1GMG A;  4LF6 B;  1MZE A;  1XDC A;  1QU7 A;  1G1X B;  1AI5 A;  2WAM A;  1PL4 A;  4PA7 A;  2JJ2 G;  2GUZ A;  5IWA B;  3DTU B;  3D8C A;  3CCS V;  4E4E A;  1M56 C;  3AG3 B;  5CBF A;  2WLI A;  4WBN A;  4BWA A;  3JAW A;  4AIL C;  4FLX A;  3JSL A;  4MW3 A;  4DV1 O;  4LH7 A;  4CC6 A;  1FAF A;  2Q69 A;  5JJN B;  2X6C A;  1NT2 B;  2HHH O;  3T1H B;  5CA3 A;  1N33 O;  4CS2 A;  5JQG B;  5A9G A;  2ZIO A;  1OCO B;  1I0H A;  1YZB A;  3OEH G;  2A3Q A;  3ZIA G;  4X64 B;  4DV0 B;  3AG7 A;  4O4H B;  1IBL O;  3U0Z A;  3K06 A;  1AI7 A;  2RN9 A;  2JGD B;  4LNU A;  1EZJ A;  4J80 A;  4LF7 O;  2F95 B;  2P22 C;  5H5N A;  4ICG A;  2QJ1 A;  3OR7 C;  4MTX A;  2QM7 A;  3P3P A;  4MW8 A;  2CGN A;  1V9P A;  2UXX A;  2IJJ A;  1UJW B;  3APO A;  5IJ0 A;  4UCT A;  4PHZ A;  4B3T B;  4FLY A;  2DJV A;  3R66 A;  3GVM A;  3E22 A;  4JAA A;  4RWU A;  1VQK V;  3SJB C;  2QSA A;  1Z2G A;  2KQX A;  5KMG A;  4FM1 A;  1SZT A;  5IDJ A;  4JAV A;  5GTH Z;  1CXZ B;  4L8J A;  3LUT B;  2Q7G A;  4TV9 B;  4H33 A;  3ZCC A;  1WP8 A;  5CBG A;  4J7K A;  1SA0 B;  5DN6 G;  1GAX A;  3CPW U;  3F7Y C;  1BCC H;  4J7J A;  1ZL8 B;  5B66 Z;  3K79 A;  2ZCE A;  2HJD A;  2EBO A;  3BHP A;  1O9G A;  4QE9 A;  4UUJ C;  1YTF B;  1K8A W;  4RO2 A;  3R65 A;  4ZIB A;  3JAK A;  1R6K A;  3CRC A;  1DF5 A;  4DV5 O;  4HBN A;  2P4V A;  3OTO O;  1N0J A;  3VQY A;  1BSM A;  1ZLZ A;  4YY3 O;  2WLJ A;  1R1B A;  4CH3 A;  3HKB B;  1TUB A;  3F5T A;  3X2Q C;  4Q20 A;  3BVO A;  1MZF A;  1GTO A;  1M9N A;  5HFL A;  2ZE8 A;  1JPX A;  3RBZ A;  2UUC B;  2EUL A;  1JQ0 A;  4X20 B;  3RN4 A;  2JS5 A;  2Q4P A;  4WFG A;  2IM9 A;  2GDS A;  3ZRV A;  4PA6 A;  2QM8 A;  4W4L A;  1GM8 A;  1K3E A;  5D5P A;  4GKK B;  3K5N A;  1K92 A;  1NR7 A;  1FJG O;  4H37 A;  3JSN A;  4ZI7 A;  4DXW A;  5EIB D;  4D6T H;  1KB9 F;  5EBM C;  1RSO B;  1NH2 B;  1BZK A;  1HNZ B;  5JH7 A;  4MVO A;  4CH5 A;  2H8P C;  1VQ6 V;  3OD4 A;  4O2B A;  4Z1M G;  3D36 C;  2Y4T A;  3M7M X;  3HPL C;  4K0K B;  2XHB A;  3UT5 A;  4J41 A;  5IJ9 B;  1N36 B;  1COW G;  2YDE A;  1MOF A;  1Q8I A;  3N2G B;  2ZNI A;  4DRX B;  5EIB C;  3RGB A;  1URF A;  2ZE6 A;  1P7G A;  3CWB H;  1H2K A;  2OIG A;  1YIT V;  2BSK A;  2YID A;  4BAY A;  4GT1 A;  3NXS A;  2NN4 A;  5JWP A;  4AHC A;  3D3Q A;  1H2M A;  4JI1 B;  3BY6 A;  3LSS A;  3FAV A;  5FL7 G;  5LP6 B;  4UCV A;  1PL0 A;  4Q6G A;  5B1O A;  2E5L B;  3B8N A;  4G28 B;  4LF9 O;  4TV8 B;  1YSC A;  4B3R O;  4DR4 B;  4F6R B;  1B06 A;  5LMN O;  2EIK B;  4EEQ A;  3E89 A;  4HYO A;  3LDC A;  4OX9 O;  4PI0 A;  4UXN A;  2HKO A;  4JI3 O;  3G6E V;  1Y74 B;  3HKD A;  3EXA A;  1VQM V;  1VQL V;  4I9W A;  1THZ A;  4PD4 F;  4U7N A;  1GM7 A;  3QNE A;  2AZ2 A;  4LFA O;  1BGY H;  1BQ0 A;  3FYE B;  1DTO A;  2ZDI A;  4DO2 A;  2EIL B;  3AEI A;  3ABM B;  5CA1 A;  2F93 B;  4QE7 A;  2WSS G;  1GN6 A;  1XOU A;  4DR5 O;  4UCS A;  1I5X A;  2P7T C;  3ETE A;  5BXZ A;  2LO1 A;  2BOC C;  4R6Z A;  4JI6 B;  2JS3 A;  4PDR A;  1CPY A;  2MK3 A;  5AG2 A;  3AG2 B;  4D7S A;  3LNN A;  4DW0 A;  4TUY A;  4CH4 A;  4LF4 O;  4JYA O;  1FXH A;  4TT3 G;  4MVM A;  1HDJ A; 
#chains in the Genus database with same CATH homology
 4JTD B;  3CC7 V;  2NNU A;  1KQS U;  5BZB A;  3ZN0 A;  3SJQ C;  3HB3 B;  2WWW A;  3JD1 A;  1K4C C;  4ZKI A;  1KD1 W;  3STL C;  5E1A C;  3K08 A;  2XAJ A;  2P6J A;  3SPG A;  1E1R G;  2Y48 A;  3KG2 A;  1F51 A;  4UV9 A;  4PA3 A;  3TCU A;  1K9M W;  1LNQ A;  4MVZ A;  3ZMT A;  4WCE V;  2OCC C;  4KP4 A;  2WLK A;  1M90 W;  3ZRX A;  2EIL C;  5L3F A;  2DWE C;  3A0R A;  1P7B A;  3ABM C;  3ETD A;  3LNM B;  4LCU C;  3EFF K;  3ZRW A;  5IY5 C;  3UM7 A;  2KB1 A;  2R9I A;  3CCV V;  2YEV A;  3W7U A;  3AG4 B;  1JCH A;  1ENV A;  4N23 A;  3B77 A;  1QR8 A;  1Y66 A;  3FB7 C;  3CYO A;  3TET A;  5B1N A;  4RQF A;  2A79 B;  5B3S C;  4XBF A;  1F23 A;  1G8M A;  1KP3 A;  4FJC C;  4GX2 A;  1GK9 A;  1RPO A;  2LFS A;  1YHQ V;  1YJN V;  4R50 A;  1KC8 W;  4GX5 A;  4BIZ A;  4ZBM A;  3AG2 C;  3ZMZ A;  3CCM V;  2Q6A A;  1HWY A;  2PI5 A;  2QTO A;  1NR1 A;  3TK1 A;  4P9O A;  4E2L A;  1R3K C;  3ABK C;  4JTC B;  2LP7 A;  5B1B C;  1QR9 A;  1VQ9 V;  1I5Y A;  4MS2 A;  3SPC A;  2EIN B;  2XND G;  4MT8 A;  3SYA A;  1QLN A;  4QJF B;  1M56 B;  1SES A;  3JD4 A;  1L1F A;  3E8G A;  3I55 V;  1M57 B;  2ITC C;  3OMI B;  1FXK A;  1XL6 A;  1FXK C;  1AJP A;  1K5S A;  1V54 C;  3JD0 A;  1JJ2 U;  4MTG A;  2QKS A;  4WFB V;  1YIJ V;  1H8E G;  4HAM A;  1QLE B;  3ABT A;  3E86 A;  4JF3 A;  3B8M A;  2A9H A;  3H01 A;  5H9C A;  1EBO A;  5DM6 V;  3OGC C;  1VQN V;  2H94 A;  2WPD G;  3GB7 C;  3K0G A;  2IJI A;  5IYB O;  4PDL A;  2IU3 A;  4CBC A;  2DWD C;  4WFH A;  2IU0 A;  2OCC B;  1PNK A;  3F5W C;  3K0D A;  3CC2 V;  1EFR G;  2ZDI C;  4FK5 C;  3AG4 C;  3ZRW B;  3SPI A;  2F43 G;  2ZR2 A;  2ZD9 A;  3ZMS A;  1DF4 A;  2YEV B;  2JJ1 G;  2HLD G;  4FMT A;  1ZWI C;  3ASN B;  4EKW A;  1NBM G;  3ETG A;  2HR3 A;  1YI2 V;  1PKX A;  1GMG A;  2JK5 C;  5H6Q A;  1WPX A;  2HJF C;  5J9P C;  1AI5 A;  3QO8 A;  4RUF A;  2WAM A;  4PA7 A;  2JJ2 G;  4F4L A;  2A0L A;  1G4Y B;  1S76 D;  4LP8 A;  5L3G A;  1VQ8 V;  3DTU B;  1KP2 A;  3E35 A;  2HFE C;  4MVQ A;  4MTF A;  1OHH G;  3CCS V;  2DQ3 A;  1PNM A;  1M56 C;  3W7T A;  3AG3 B;  5CBF A;  2WLI A;  3ABK B;  4RUE A;  5B1B B;  4BW5 A;  3SYP A;  3I56 V;  3ZMV A;  4MW3 A;  2DW4 A;  4JAU A;  1QLE C;  1JVM A;  1PD3 A;  3OW2 U;  2W0F C;  4TWK A;  1R3L C;  3SPH A;  1YTF D;  1FXK B;  1V54 B;  4GCZ A;  2WLN A;  1SET A;  2Q69 A;  4WFF A;  3M99 B;  2X6C A;  3ZN1 A;  5LHG A;  2R9R B;  4UVC A;  1S77 D;  5CA3 A;  1Q86 W;  4FPP A;  2QA4 V;  2IW5 A;  4TSF G;  2IH1 C;  5CBH A;  1AJQ A;  2XOK G;  1YJ9 V;  4PA4 A;  2C2A A;  1K73 W;  2BOB C;  2JEX A;  1E79 G;  1OCO B;  2HG5 C;  3LDE A;  5KUM A;  5CMU A;  3OEH G;  2X6A A;  3E83 A;  3ZIA G;  2DYR C;  2ZXW B;  2GHY A;  1JX9 A;  3QO7 A;  3ABL C;  2AHZ A;  2XAQ A;  3CMA V;  1FXV A;  3LDD A;  2CK3 G;  2DYS B;  3ASN C;  3OAA G;  2X7R B;  3K06 A;  1AI7 A;  3D36 A;  2Z3Y A;  3ML0 A;  5L3D A;  4G27 B;  1EZJ A;  3IFX A;  3DGE A;  1ORQ C;  3G71 V;  1MAB G;  1K97 A;  1YJW V;  3G4S V;  1CEZ A;  1OCC C;  1XL4 A;  1KKD A;  4YXW G;  2B1G A;  3OR7 C;  4MTX A;  3E8F A;  2QM7 A;  3F7V C;  2P67 A;  3ZJZ A;  4MW8 A;  2WLL A;  3AG3 C;  2EZP A;  2M7W A;  2NLJ C;  2UXX A;  2IJJ A;  1W0J G;  1UJW B;  1FFT B;  2IH3 C;  1E1Q G;  2QE7 G;  1NH2 D;  3X2Q B;  1Q82 W;  5LGU A;  2WLI B;  2PI4 A;  1VQK V;  2ITD C;  1OZ0 A;  2OTJ V;  1BHA A;  1VQ5 V;  1JOY A;  1SZT A;  5IDJ A;  1QBZ A;  4JAV A;  5B1A B;  2XAS A;  1M1K W;  4MVR A;  1B6Q A;  3MHH C;  5LHI A;  3CCQ V;  5H6R A;  3LUT B;  2AHY A;  3OE7 G;  2V1D A;  3JYC A;  3K9A A;  1W2B U;  4X88 A;  3CCE V;  2UXN A;  3E2E A;  4H33 A;  3ZCC A;  1CP9 A;  5CBG A;  5DN6 G;  4UV8 A;  2OT5 A;  3RVY A;  1S3J A;  3CPW U;  2XAF A;  1OCO C;  3F7Y C;  4OXS A;  2Y69 B;  3CCL V;  2ZXW C;  4U7O A;  1PNL A;  1OCZ B;  3VOU A;  1ROP A;  2DYS C;  4R7C A;  3FB6 C;  3K79 A;  5LBQ A;  1RM1 B;  2DYR B;  4R8C A;  5KUK A;  3ABL B;  2EBO A;  1VQO V;  3K03 A;  4QE9 A;  3T4D A;  1NJI W;  3CCR V;  3FB8 C;  4UUJ C;  4P30 A;  1YTF B;  1K8A W;  1NKD A;  4KFM A;  4RO2 A;  3R65 A;  1MSW D;  1R6K A;  4J9Y B;  1NVP D;  1DF5 A;  2JDI G;  2XAH A;  3OMN B;  4XDL A;  2B5U A;  2JIZ G;  1R3I C;  3LSQ A;  1AJN A;  1OCC B;  2W6I G;  1AI6 A;  2WLJ A;  2ZR3 A;  5EK0 A;  2HVJ C;  3X2Q C;  3WFV A;  2OTL V;  3JCZ A;  4Q20 A;  2WLL B;  5LGN A;  1GTO A;  1M9N A;  5HFL A;  4WF9 V;  5CN0 A;  3FYI B;  4RAI A;  1AR1 B;  1ARO P;  4PA9 A;  1JPX A;  1N8R W;  3RBZ A;  1JQ0 A;  1V55 B;  5B1A C;  5KA5 A;  4WFG A;  1QCE A;  2LFR A;  3MD0 A;  3ZRV A;  4G2K A;  1OCR B;  4PA6 A;  2QM8 A;  1GM8 A;  1K3E A;  3CCU V;  1AI4 A;  1BHB A;  3T2M A;  4CZZ A;  1K92 A;  1NR7 A;  3CC4 V;  4H37 A;  2YSU B;  4MTO A;  2Y69 C;  4JYB A;  4MVU A;  4HZ3 A;  3CME V;  1OCZ C;  4LBE C;  4DXW A;  3SYC A;  4FIP C;  3UKM A;  2Z5U A;  4L87 A;  4QPK A;  2QEX V;  3EHB B;  5EBM C;  1Q81 W;  3BEH A;  4UVA A;  2WLH A;  1K34 A;  4GX1 A;  1NH2 B;  1VQ4 V;  1P4R A;  1RM1 C;  3OUS A;  1R6N A;  1GO3 F;  3JD3 A;  4XDJ A;  4MVO A;  2V7Q G;  3OR6 C;  2H8P C;  3OUF A;  1VQ6 V;  3CCJ V;  4QPJ A;  4Z1M G;  3ABU A;  3IGA C;  5KA6 A;  3VBB A;  3HPL C;  5C93 A;  4N21 A;  2K1E A;  1R3J C;  5LGT A;  3CD6 V;  1COW G;  3T1C A;  4PEL A;  5EC1 C;  3GWO A;  1MOF A;  3P30 A;  3AG1 C;  3WG7 C;  2IJH A;  1H8H G;  4JYC A;  1YIT V;  2B1I A;  4I5S A;  4BAY A;  4GT1 A;  3NXS A;  3SYO A;  4JGS A;  1V55 C;  3CP1 A;  3K3W A;  3OM3 B;  2Q68 A;  4BIU A;  3BY6 A;  3LSS A;  3E8B A;  3FB5 C;  3ASO B;  4JAS A;  5FL7 G;  4PDM A;  4WFE A;  1VQP V;  2JEU A;  4JTA B;  5EC2 C;  1OCR C;  1RPR A;  2DQ0 A;  2FTK A;  1PL0 A;  3OFN G;  3D3I A;  3OEE G;  1F4M A;  5B1O A;  3B8N A;  4G28 B;  2EIJ C;  2IJK A;  1NVP B;  4QNH B;  2P90 A;  2EIM C;  4P9P A;  1YSC A;  4MSW C;  1WLE A;  4X89 A;  2X6B A;  5IYC O;  1S5H C;  2EIK B;  4QIW F;  3E89 A;  4HYO A;  3LDC A;  4P2Z A;  3JD2 A;  1NQT A;  4J9Z B;  1S0V A;  4UXN A;  5L3B A;  2HKO A;  3PJS K;  4ASU G;  1R73 A;  4WFA V;  3G6E V;  5IYD O;  1Y4M A;  3FKS G;  3E8H A;  1H2G A;  1VQM V;  1H38 A;  3SYQ A;  1VQL V;  2WLM A;  2XAG A;  5HFM A;  2ZQM A;  1QVF U;  4I9W A;  4KUM A;  1VQ7 V;  1THZ A;  2EJR A;  2EZO A;  2X0L A;  3ZRS A;  4U7N A;  2ATK C;  5L3E A;  1GM7 A;  3T4Z A;  3QNE A;  5L3C A;  2Q67 A;  2HVK C;  1BL8 A;  1J95 A;  4XDK A;  1SER A;  3FYE B;  1DTO A;  2ZDI A;  4DO2 A;  2EIL B;  1F4N A;  3W7X A;  3AEI A;  5IY5 B;  3ABM B;  5EBW C;  1FS0 G;  5EBL C;  4PDV A;  1DLB A;  3QO5 A;  3CXC U;  4GX0 A;  4QE7 A;  3SPJ A;  3AG1 B;  3WG7 B;  2WSS G;  3RW0 A;  1K7D A;  3MHS C;  3IC7 A;  2W6J G;  1IXM A;  3ZMU A;  3ASO C;  1K4D C;  1QVG U;  1I5X A;  2P7T C;  3ETE A;  5LHH A;  5B3S B;  2BOC C;  3P32 A;  4X8A A;  4R6Z A;  1S72 V;  2GSM B;  1Q7Y W;  1GKF A;  4PDR A;  1CPY A;  1K5Q A;  2MK3 A;  1MG1 A;  1TUE B;  1GM9 A;  1KEC A;  3AG2 B;  4JPR A;  4LC1 A;  5GW7 A;  2D3O W;  3RVZ A;  2EIN C;  1W0K G;  3K04 A;  2EIK C;  1FXH A;  2EIJ B;  4UVB A;  3STZ C;  2EIM B;  1BMF G;  1M57 C;  1SRY A;  4TT3 G;  4RQE A;  1K33 A;  3OMA B;  4MVS A;  4MVM A;  3W7S A;  3W7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...