3GB7C

Potassium channel kcsa-fab complex in li+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gb7C00
4MS2A 2BOCC 3SYPA 4PA9A 1R3JC 2HG5C 4JTCB 4WFFA 3RBZA 2DWDC 2A0LA 4PA4A 2DWEC 2JK5C 2Q68A 3T4ZA 2YEVA 3ABLC 1XL6A 2NLJC 3RVZA 3VOUA 4MVQA 3R65A 3K0DA 2ZXWC 3SPGA 4OXSA 3RW0A 3SPIA 2X6AA 3E83A 1LNQA 1S5HC 5CBFA 4WFHA 1XL4A 1KKDA 2EINC 3F5WC 4MVRA 5EBMC 1V55C 1M57C 5CBHA 3E8HA 4R6ZA 4TWKA 5EC2C 1P7BA 3SYAA 3K04A 2HVJC 1R3LC 4GX5A 3ASNC 4R7CA 4QNHB 2IH3C 3AG3C 1OCOC 4PA7A 4WFEA 3E8BA 4DXWA 3TETA 1OCZC 5EK0A 2WLKA 3AG2C 2EILC 1R3IC 3ABMC 1OCRC 2HFEC 2WLHA 4P9PA 4X89A 3OR6C 4PA3A 3AG1C 1R3KC 1ORQC 4GX1A 3ZRSA 2KB1A 2IH1C 3GB7C 4JTDB 4I9WA 3FB5C 1J95A 4LP8A 3F7VC 1K4CC 3KG2A 3IGAC 1ZWIC 3T4DA 1K4DC 3F7YC 3E89A 3E8GA 4PDRA 3RVYA 3UKMA 2A9HA 3HPLC 2Q69A 2QTOA 2WLLB 3K0GA 3SYCA 2ITCC 2Q6AA 4H33A 1M56C 4UUJC 3SJQC 4EKWA 2ZD9A 5E1AC 4HZ3A 3SYQA 2W0FC 3AG4C 3IFXA 4RAIA 3OGCC 3E86A 4R8CA 2X6BA 4H37A 2BOBC 4MTGA 3EFFK 4BW5A 4RUFA 5EBWC 1OCCC 3SPCA 5EBLC 2AHYA 1V54C 3UM7A 4KFMA 3WG7C 4LCUC 2Y69C 4P2ZA 4QE7A 3K06A 4ZBMA 5EC1C 4LBEC 4MVMA 2WLNA 4PDLA 5B1BC 3ABKC 3SYOA 2WLIB 3LDDA 4MW8A 2ATKC 4P9OA 4JTAB 4J9YB 4F4LA 2X6CA 4G28B 5B1AC 3FB8C 1JVMA 4PA6A 2K1EA 3T1CA 3TCUA 2EIJC 4WFGA 5J9PC 3OUFA 4XDJA 4CBCA 1QLEC 4R50A 3BEHA 3OUSA 4MW3A 3X2QC 3E8FA 2HJFC 4MTOA 4RUEA 2ITDC 3ASOC 4GX2A 2DYRC 4PDMA 4RO2A 1BL8A 4MVUA 2WLMA 4X88A 2R9RB 3SPHA 2OCCC 5CBGA 2EIKC 4P30A 4HYOA 5B3SC 3LDCA 2A79B 2WLIA 5KUKA 2WLJA 2WLLA 4MTFA 2H8PC 2HVKC 4J9ZB 3T2MA 4MSWC 2DYSC 4MVOA 3LUTB 5IY5C 3FB7C 1G4YB 3LDEA 3OR7C 3PJSK 4MVZA 3SPJA 3ZJZA 2QKSA 3JYCA 3K03A 2P7TC 4XDLA 4XDKA 4X8AA 2Q67A 5BZBA 3FB6C 4QE9A 3STLC 2AHZA 2EIMC 4MVSA 3LNMB 4PDVA 3K08A 5KUMA 4G27B 4GX0A 3STZC
chains in the Genus database with same CATH superfamily
4I55B 3SGIA 3RBZA 2UXBO 2NLJC 1Q6IA 1AI6A 4CS2A 5B66Z 5CA3A 4PHZA 1Y66A 5IYDO 1JFFB 2QKAA 4U7NA 1O9HA 4BW9A 4X1KB 4CC6A 5L3BA 5E79Z 4L8JA 4X66B 1N4CA 3K79A 4TWKA 1OJHA 3AG3B 4LF7O 1VQ6V 1GM9A 1OCOC 1QVFU 2ZIOA 3CRAA 3CP1A 4JI1B 4X89A 5LYJA 1SQQH 4G2KA 1M4UA 3GB7C 1N0NA 2BE3A 2A9HA 4UB6Z 4DV5B 3SYCA 2IBZH 5E1AC 3IFXA 5C8YA 1JJOA 1NR1A 2K9PA 1GN2A 4DV3O 2PI5A 1RM1B 1OCCC 2AHYA 3K58A 2JGDA 2OTLV 1D5NA 1TVKB 1MZEA 4OGQB 1YXBA 5EC1C 1GTOA 5B1BC 2WLIB 4DW0A 1DK1A 3JD3A 4UV8A 3ASOB 3E8FA 1FFTB 4FLVA 1SA0A 3I5DA 3L9DA 2QEXV 1I5XA 2DYRB 4X62O 4LF9O 4JZ2A 1UFIA 2QWNB 4X65B 3CS5A 3W7XA 1EZJA 4JI4B 5LP6A 1WB8A 5LMUB 1N32O 3MHHC 4G27B 1DLBA 4DUZO 4TUYB 2BOCC 1XREA 2EX3A 2N74A 4N21A 2AGAA 4TUYA 3HR0A 4YY3O 3AG7A 2X6AA 2UXNA 4BAYA 1Q86W 2FKXA 3WB1A 4J7KA 3RGBA 1N34O 2QWRB 1VF7A 3ABLB 1XEQA 2AZ2A 1DGSA 2HHHO 3K9SA 2WLKA 2QJ1A 1FFXB 3ABMC 1PPJH 1YJ9V 4WBNA 3KZIZ 4D7SA 3ZRSA 2HHHB 1WNSA 2N05A 3E89A 3LNNA 4X1IB 1GN4A 4U3JA 5KHKA 2JJ2G 3T1HO 1AI7A 4YIPA 4BW5A 1KC8W 2GTSA 3SPCA 4N23A 2Y69C 2GV9A 3ABKC 4L87A 4J80A 2RNBA 4UCOA 3P32A 2EIJC 5J9PC 1NZ6A 1B3QA 4X1YB 2E75B 1HW7A 5KA6A 4UCVA 5LA6A 3L70H 2OCCC 4U3JB 5F2VO 4LH7A 5LOVB 4MTFA 4DR2O 4LFBB 3ETQA 2F4VB 2OT5A 5BY1A 3ZJZA 1I08A 3ASNB 1SQXH 2LGQA 2W6IG 1MSDA 3JAWB 5HFMA 3CRMA 2ADQB 4DR7O 3BA8A 1EBOA 1Z5WA 3OAAG 1B06A 4UVBA 4QGPA 4J42A 1L0LH 2R72A 4JI6O 4O4LA 2LO1A 2EIJB 4JI0B 1YZBA 4DYLA 4OXSA 1F23A 2WA4A 3HKCA 5ITZA 1S0VA 1S5HC 2JGUA 4I9QA 3P3NA 1WA8B 4PELA 4O4HA 3JATB 4FLXA 2UUCO 3ASNC 4ABMA 4JZGA 4NVPA 3H1JH 4PA3A 1KECA 5B1NA 4UVCA 3AG1B 4I9WA 3F7VC 3KG2A 1FFXA 1Y6XA 4O4LB 2Q6AA 4IYIA 1M56C 4EKWA 4HZ3A 2QGNA 4XBFA 4RAIA 4H37A 2VS0A 1D5AA 1VQNV 4B3MB 1H2MA 2B1IA 1L8DA 1PNMA 4FLYA 3T1YO 2QWOB 4FLUA 1KB9F 5JQGA 3OTOB 3O9OA 1HWYA 2YI8A 4UVAA 4LH6A 4LWSB 5GONA 1TVKA 3FB8C 1N0JA 2BSKB 4DR3B 1JFFA 2VQFO 3ZEDA 1QLEC 1H8EG 3G80A 4FZ0A 3CCEV 4BIOA 1XMOB 4NXMO 2WPDG 4LNUA 5CBGA 3LDCA 2CDYA 2WLJA 1JJ2U 2P90A 1G8MA 1Q81W 1YTFD 1G4YB 4J10A 3ZN0A 3ZHRA 1PL0A 1IBKB 1IBMO 3K08A 1TUBB 1SZXA 3IC9A 4TV9A 1ROPA 2E74B 2Z3YA 3IJ4A 5LMUO 4IL6Z 4O4HB 5IE9A 1YVWA 3A0RA 3AEIA 3KCYA 4U3FH 1QLEB 4AHCA 3CMEV 1GM8A 4JAUA 4AQYO 5EIBD 1TA8A 1YHQV 4DV4B 4E2LA 3JASA 2QKCA 3QTCA 5C93A 3ZHQA 1YSCA 1F7YA 3E8HA 5AG2A 2HVJC 4R7CA 3PN1A 1T5EA 4JGSA 3M99B 3OMAB 4IIJA 2WLHA 4P9PA 1XMQO 1M5IA 1M90W 4HAMA 4BWAA 3CJHA 2VWJA 3TGUH 3HPLC 3APQA 2A7WA 4UUJC 3AG4C 1NTZH 1AP6A 4BR6A 4TQFA 5LP6B 3UM7A 3WG7C 3HKBA 5KX5A 3AK1A 2WLNA 3JD1A 5IYBO 3P3PA 3K57A 3TCUA 4GUNA 5LHHA 2UUBO 4B7KA 2ITDC 4KUMA 4DR6B 3HKDA 2VQEO 2YICA 3OEHG 4PI0A 1AP5A 1BGYH 5K1XA 2RCVA 4MSWC 3LUTB 2Q9LA 1NS1A 5BXZA 1Q82W 2P7TC 2Y0IA 5BZBA 1ZLZA 3DXRA 3STLC 2UXDO 1IBLO 3CRQA 1Z2GA 1R3JC 5FNVA 2JK5C 4NXNO 3ABLC 3U10A 1R6NA 1F4MA 1YTFB 4DV0O 1YEWA 5JJEB 2YSUB 3HKEB 2HP8A 1RSOA 2XASA 3RW0A 4NXNB 2Q8VA 4NB5A 4CH3A 3ZBHA 1AR5A 4DV2O 1TGOA 1Q3EA 5CBHA 4JYAB 4DRXA 3QO7A 2UXBB 1YITV 4YJ2B 4DV2B 2GUZB 1O9GA 3SJAC 3A8TA 5IWAO 2IJJA 1G6UA 1NI8A 3ZHUA 4X20A 5EYPB 3T4DA 5KLVH 1PV0A 4LFBO 2PF4E 5IWAB 3EVKA 5LMNO 4X64O 4X20B 3SYQA 5DN6G 2QWPB 1RM1C 4MTGA 1NTMH 1SC5B 1RFYA 4EB6B 4O4JA 2ZNIA 3G4SV 2QM8A 1MA1A 1M1KW 4LBEC 2PUSA 4DRXB 3T1YB 5CMUA 4G28B 2K1EA 1ZAUA 3T1CA 4JI8B 3ZCCA 3BCCH 1XBLA 4TV8B 1V54B 3K9AA 4H44B 3MAQA 3K5LA 4TSFG 4GX2A 2DYRC 2F95B 2CGNA 3OGIB 2R9RB 3DTUB 4LFAO 2EIKC 5FPOA 1XMOO 4NXMB 1N33O 1KP2A 3ZMTA 1OCRB 2R9IA 2YIDA 2ZINA 3D36C 4EFEA 4J7JA 3DC5A 1JR9A 4LWSA 5GONB 3H1LH 3SPGA 3RYHA 2BSKA 2O57A 2A0LA 1Q7YW 3CB2A 3KCXA 3JARA 4O4IB 4GT1A 5CA1A 1LNQA 4WBNB 4BIUA 3CSXA 4WCEV 5A9GA 3VQXA 1SQVH 2EIKB 1M9NA 3B40A 3CCRV 4F6RA 4R6ZA 3SYAA 4DV3B 2H3OA 2FB5A 4TQDA 3P30A 3TETA 4FJCC 2RQ6A 2PY5A 1ORQC 4GX1A 4LF9B 3ML0A 3HB3B 4YXWG 3S3XA 5HFLA 4JYBA 1J5EB 1V55B 5LGNA 1N34B 2F1MA 2JS3A 4JAAA 3ZX6A 3L73H 1AI4A 2NNUA 3Q4HB 3JD0A 5J2UB 1I0HA 1Y74A 1A32A 4DV7O 3RYHB 4R8CA 1RSOB 3KKYA 2BOBC 4DK1A 5FLXN 4DV1B 3QO5A 4DR5O 2PI4A 2Y4UA 4HNAA 1ZSPA 2M6YA 1MG1A 4DR5B 1RPRA 1OHHG 3E22A 4HNAB 1AJPA 4JI2O 1ENVA 2B9ZA 4I4TB 3JAWA 5H6QA 3FKSG 3OEEG 3DGEA 4J41A 3VQVA 5KHIA 2HJFC 4JI2B 4DR1O 3H9VA 3CPWU 4J9ZB 3T2MA 3EXAA 4TV9B 5IY5C 2JRIA 5LA6B 4XDLA 4KP4A 4O4JB 4QE9A 2AHZA 4UCTA 1I5YA 3J81N 1P7GA 1CP9A 1H2NA 4UCRA 1E1RG 1HP8A 2LFSA 2BTOA 2YEVB 5FNVB 4LR3A 1ZX3A 1Y76B 1JMKC 2EULA 2DE0X 1IX9A 2H94A 1JQ0A 3SPIA 4KXRA 5CB4B 2EZPA 4QNHB 4GX5A 1JPXA 4WFEA 4GCZA 4JI0O 3JALB 1OCZB 2UUBB 3AG1C 1X4TA 2WAMA 4UB8Z 5LP6C 3CC7V 1W0KG 1SKVA 4EEQA 1PP9H 3IC7A 2WA3A 5BR8B 3QG5A 5L3GA 1VF6C 2E76B 1VQLV 2DYSB 3HKBB 4PD4F 4JV5O 3WFVA 1K8AW 1QNMA 1HNZB 1HDJA 1YIJV 2KKWA 2IU3A 2DMXA 4IHJA 2V1DA 3A0HZ 2YXYA 4K0KB 1MMMA 1W2BU 1EN6A 2ZCEA 4DR7B 2P67A 1CEZA 3OD4A 1JVMA 5IYCO 3HKDB 5DECA 3QO8A 2KQXA 4FLZA 3C90A 1VMGA 3JD4A 5D5QA 4A5UB 1N8RW 2E3CA 1NH2B 3FYIB 4DK0A 5JVDA 2IM9A 4LFCB 3LDEA 3OR7C 2KG7A 1VQ8V 1GAXA 3L71H 2QKSA 2V4DA 3OMIB 1GH6A 5JJNB 1FAFA 1R6KA 2N04A 4ZI7B 4TOIA 2Q5ZA 3SDLA 1NQTA 3N2KA 5B1OA 3VOUA 3A0BZ 3E35A 1HR0B 2CH7B 5ITZB 4JF3A 1XL4A 2CUGA 2XHBA 1URFA 3F5WC 1IBMB 5C8YB 1QBZA 3HKCB 3R66A 3L72H 4HBNA 3BABA 4DXWA 4F6RB 4AILC 5EK0A 4LNUB 3CXHF 3B09A 4ASUG 1MNGA 3K5NA 2Q7EA 3OM3B 1R3KC 1AR4A 1NVPB 4LFAB 1SERA 1EFRG 1ZWIC 1K4DC 4O4IA 1SZTA 3JALA 3UKMA 3H01A 3H1KH 1KBHA 4FMTA 4JI1O 5J2UA 3RT3C 3CC2V 4RUFA 2YIAA 2DOSA 1Q90D 3FX7A 1S5LZ 4Z1VA 4B3SB 1V54C 1FD9A 1WPBA 1FXHA 2QR4A 5IYZA 2GSMB 3LDDA 4B3SO 4C7UA 1KQSU 4PA6A 1X59A 5H9CA 2VRZA 4CBCA 1MOFA 4JI5O 4DO2A 3ABMB 5EZYA 1WAZA 4MW3A 2JVDA 4B3TB 3SR2C 2ZE5A 3CCUV 2GUZA 1Q5OA 3CHXA 2WLMA 4FVMA 5DEDA 1BZKA 2P4VA 3N2GB 4NKGB 2A79B 4DV4O 5IT9N 1G1XB 4UXNA 4DR1B 3PJSK 3UQ8A 3OT7A 4PDVA 2XAQA 2NR5A 1VEWA 2YUAA 2CTWA 2Y69B 2DWDC 1IURA 1UJWB 1XMQB 3ABKB 4MVQA 3CE2A 3CYOA 1EM1A 4I7ZB 3K0DA 4Q6GA 2PYJA 2CTPA 2ZKOA 4Z1MG 2Q0OC 4OX9O 3F5TA 1V55C 4GKKB 3G6EV 2Q4PA 1QQCA 1KU9A 2IH3C 5CN0A 2Q7GA 3OW2U 1MSWD 4DR6O 3LSQA 3NR7A 3ZRWB 3X2QB 2YXHA 2YS8A 4NTYA 1KUQA 3D36A 4O2BB 5KMGA 1CPYA 1JOYA 1WPXA 4B3RO 1SQPH 1WB7A 2QTOA 3RYIA 3ZS8C 5KHGA 1VQ7V 2QTSA 2UXDB 4RQEA 2CH7A 3OE7G 4DV6B 1SQFA 3K5MA 1SRYA 5LYJB 5EBLC 1XQ8A 1FJGO 1YI2V 2XAJA 4UCSA 2XNDG 5LL6Y 1SS3A 3MHSC 1I94B 1VIBA 2DQ0A 2LJ2A 2FMLA 4K0KO 5B5EZ 1IBLB 2RDCA 1N36B 3LSUA 4JI6B 2ETNA 4LC1A 4O2AA 3CRRA 2JGDB 2ZNJA 4YHHO 4RO2A 1BL8A 4X88A 3SPHA 4WF9V 4JAVA 2ZE7A 2Z0AA 3OFNG 4O2BA 5KMGB 1JCHA 2Q67A 4I50B 2XAHA 1MZFA 2Q73A 4GX0A 3B8MA 3STZC 4X64B 5CA0B 4PA4A 2DWEC 1U96A 1XL6A 2FL4A 2ZT9B 5L3EA 3DC6A 4GZRB 2RN9A 3H1HH 1BS3A 1DF4A 2XUMA 1AJQA 3E83A 5GW7A 3RYFB 1YJNV 1KKDA 2EINC 2KG7B 3M8AA 3ZMZA 3W7UA 3TK1A 1SQBH 3B77A 3E22B 4PA7A 2JDIG 3AG2C 2EILC 4DUYO 3JCUZ 3RWRD 3U11A 2A3QA 1Y67A 1Y4MA 5H6RA 1WP7A 3W7TA 1IZ3A 2KB1A 4JTDB 2OYQA 2EBOA 2GHYA 2GBOA 3F7YC 1LUWA 5IJ9B 1FKAO 2F93B 1AVMA 5JCOA 4GKJO 1NH2D 1W59A 1P4RA 3JD2A 1GRJA 4IT5A 2ZD9A 1XNQB 3OMNB 2PYLA 4DR4O 2EINB 1Y76A 4GLXA 4CS3A 2QE7G 4ZBMA 3C3SA 3K3WA 4MVMA 1L1FA 1H2LA 3SYOA 4ZKIA 3ZHTA 5BMVA 2EILB 4X62B 2EJRA 2X6CA 5B1AC 3ZMUA 3RYFA 2AZ0A 1OV9A 1F4NA 4YIOA 1IXMA 1QVGU 1GK9A 2LGWA 1XUQA 3CRCA 4PJ0Z 4NTXA 1S77D 1GO3F 5LXTA 2ZDIC 4ZOLB 3B8NA 4X1IA 1XOUA 3O65A 2BTQA 5KHJA 5IY5B 2VWKA 4DR3O 1GMGA 1P84F 3SPJA 3QF7A 2ZM6B 4XDKA 2BCCH 5J2TB 2Z5UA 4FFKA 2W0XA 4R50A 1K5SA 3BA9A 2DN9A 1F51A 4I5SA 4BIZA 2JJ1G 1IDSA 1OCCB 5GTHZ 2GDSA 1KP3A 1FXKA 4DW1A 2IW5A 3JAKB 2LW1A 4FM2A 2IU0A 1VQOV 4DV7B 1XHXA 4OX9B 1R73A 3FFQA 4DV1O 4JI4O 3CCJV 4CH6A 4I0XB 1OCZC 4IIJB 3VQYA 3ZMSA 4I50A 1UPGA 4YJ3A 3FB5C 4JPRA 4CC5A 4PDRA 2QSAA 2HJDA 3C3TA 1ZL8A 2Q69A 5JH7A 2PTMA 2Y4TA 3OTFA 5JVDB 4JI3B 2VQEB 3ICXA 2P5OA 1H2KA 5JH7B 1E79G 1AI5A 5IJ0A 3D3QA 4FFBB 4KFMA 1M93A 3LSSA 2JEXA 3ZRVA 5BR8O 4K8XA 1LR1A 1BHBA 5CB4A 2XOKG 4IGGA 1B04A 4X1YA 3OUSA 1H38A 5A2QN 2OTJV 4PDMA 3D3IA 5L3FA 1TAEA 2AW9A 2MK3A 4P30A 4HYOA 3E2EA 2H8PC 3ZN1A 1V9PA 4RQFA 4LF6O 1XILA 2WWWA 4MVSA 4FLTA 1K73W 4LF5B 1BE3H 3GWOA 3UCSC 2HG5C 2UUAB 4WFFA 1P49A 5LHGA 5JQGB 2CE4A 1HNXO 1QR8A 1GN6A 3RVZA 4W4LA 3R65A 1R1BA 1NT2B 3RYCB 5LMNB 1FS0G 3DSQA 1PNKA 1FXKC 3ZHSA 1K9MW 2UXCB 3ZIAG 1M57C 1P7BA 3BPZA 1ZL8B 2HEPA 1HNZO 3IAYA 5LBQA 4ZIBA 2CTQA 4KHPB 2Y0PA 4LF4O 1BMFG 1RP3B 3ZRXA 1OCRC 4QPKA 3JASB 3OR6C 2X0LA 1K7DA 2R70A 1XNRB 1BCCH 4I0XA 3BY6A 4LP8A 4LFCO 3WB2A 3K59A 3K0GA 5FL7G 3NXSA 4FPPA 2UU9O 3SJQC 4X66O 3J7AU 4NR1A 1KYOF 1WA8A 3OGCC 2P22C 2X6BA 5H5NA 3CCQV 1N33B 4LF8B 3GVMA 4LCUC 4DR4B 2UXXA 3K06A 1HR0O 3ZHVA 4LF8O 3JSLA 3SJBC 4JTAB 1ZUQA 1K33A 3MDSA 5FPRA 2QM4A 1DTOA 4LF7B 3WU2Z 1VP7A 3DXRB 4MTXA 5L3CA 1D2DA 1VQ9V 3JARB 1Y74B 4JYYA 5B3SC 2WLIA 2WLLA 2ZE8A 3UT5A 4DUYB 2BTQB 4Z2WA 2XTAA 3THOA 2XT9A 3ABUA 4ZOLA 4FLWA 1QHTA 3JSNA 4X8AA 5IJ0B 2X7RB 3OTOO 2EIMC 2YIBD 1S5JA 1NTKH 1WN7A 1TUBA 4K35A 2ZIMA 3SYPA 4B3TO 2PGGA 4K3AA 2YEVA 2R9AA 2F43G 2YIBA 2OIGA 2P06A 4WFBV 1VARA 2W6JG 4B7EA 3W7WA 1NJIW 1COWG 3Q4HA 5CBFA 5B3SB 3QVNA 2LW7A 4J11A 1K3EA 2E5LB 1RPOA 2M7WA 4CH4A 2D2CB 3UT5B 3AG3C 4QIWF 1OCOB 3CXCU 1QU7A 3S3WA 3M7MX 3N2KB 3TJTA 4ICGA 4X1KA 1FYJA 4UCUA 4W4KA 1SF9A 2JIZG 3FAVA 4X9QA 2B1GA 3RVYA 5IYZB 4B08A 4TT3G 4JI5B 1N32B 2ARHA 4GKKO 2YXLA 3D8CA 5B1AB 3B4SA 4ZHQB 4I55A 1KD1W 3E86A 3RYCA 1VQKV 1WP8A 2XAFA 1BHAA 3CCLV 5JCOC 1B6QA 4B3RB 2ATKC 4P9OA 5B1BB 1AILA 3FYEB 4NYKA 2P4KA 4NTWA 4QPJA 3CJHB 4WFGA 5TISZ 1QLNA 2RJZA 1BSMA 4EB6A 3BEHA 5EZYB 4DUZB 4RUEA 3ASOC 2FTKA 2L35A 2D3OW 1KKCA 3RYIB 3WB0A 2KSDA 2DYSC 3CC4V 2LFRA 2GTAA 3FAVB 3N27A 1NR7A 4DV0B 4H0LB 1YDXA 4OPAA 1L0NH 3TXQA 2ODMA 4CS4A 1PM9A 1THZA 1MABG 4MS2A 4YHHB 1CXZB 3A2FA 3FD9A 3T4ZA 4DV6O 1NU1H 4JYCA 1VQMV 1XDCA 2IJKA 4D6TH 1YJWV 2UUAO 3APOA 2ZXWC 1KMIZ 2G38A 2ZE6A 1JA8A 5DM6V 3WG7B 1Q8IA 4CH5A 1W0JG 4FFBA 3SJCC 1E1QG 2F4VO 2ZR2A 5EBMC 3RFRA 3K04A 1BT8A 4YJ3B 3ZMVA 5GTIZ 3CD6V 2HFEC 3ZRWA 1I94O 5JJJB 4CZZA 4Q20A 1GKFA 5CA0A 1EN5A 5KHHA 1SESA 2ITCC 2ZXWB 5H2FZ 3BAAA 1AR1B 4UV9A 3EFFK 4I4TA 4JYAO 3I56V 2UUCB 2YI9A 1IXBA 1S72V 4JI8O 3BRCA 1I7FA 3CCVV 2XAGA 1HNXB 2C2AA 4DR2B 3AK2A 4MW8A 1R6TA 3GWKC 1LUVA 1US6A 5EYPA 1GN3A 3J80N 3OUFA 4XDJA 2ZQMA 3B2EE 4TV8A 4MT8A 2CAZC 4OPHA 2CTRA 4MVUA 3AK3A 4D7TA 1EN4A 1S76D 4B3MO 2OCCB 1AB3A 3FB7C 5LXTB 3N2GA 3JYCA 5KAIZ 2L6LA 2QDOA 4H13B 4GKJB 3LNMB 2FYUH 5KUMA 1BQZA 1DF5A 4FZ1A 2IJHA 4JTCB 3W7SA 2LP7A 2VQFB 2Q68A 1QR9A 5BMVB 2CGOA 2LQTA 4K8ZA 4FIPC 2AXTZ 1NKDA 1Z5VA 3CWBH 3VBBA 1SQGA 1FPOA 4FM1A 3RN4A 5JWPA 2ZM6O 2F23A 4WFHA 1SA0B 1XNQO 1XI1A 5CA1B 2PZSA 3EHBB 5EC2C 3JAMN 1J5EO 2Y48A 1R3LC 2ZDIA 5LOVA 2E5LO 3E8BA 2QA4V 1WJZA 1HNWO 4RWUA 3UO3A 1NBMG 4JI7B 4X65O 4DV5O 1IVSA 1J95A 4IHJB 5KAFZ 1HNWB 2MW2B 4WFAV 4JI7O 2ADPA 3ETGA 3ETDA 3L75H 5LHIA 4PV1B 5KX5B 3U0ZA 5D5PA 3L74H 5EBWC 3TXSA 2JEUA 1PD3A 4AQYB 2ZR3A 2QM7A 2EZOA 2B5UA 3JATA 4F6EA 4F4LA 1AJNA 2OCHA 1K34A 2OWOA 3JAKA 5IJ9A 3G67A 4AI8A 4QJFB 1YCIA 1IBKO 3CCMV 1YF2A 2EIMB 3X2QC 3QNEA 4MTOA 1OZ0A 2F66C 4ZHQA 1H2GA 1VF5B 3G71V 5KUKA 3BFRA 2HVKC 3I55V 1VF6A 4MVOA 2RMKB 2HKOA 1QCEA 1VQPV 5K1PA 1ZTEA 3K03A 3T1HB 4EFBA 1TUEB 5J2TA 3MD0A 2CK3G 4YJ2A 2YC0A 4KL1A 3CEIA 1JX9A 4PA9A 2HR3A 4YY3B 5KA5A 1SETA 3JCZA 1K5QA 3ETEA 1FXKB 1BQ0A 2EJ7A 3BVOA 1GM7A 1K92A 1M57B 4JI3O 4MVRA 2OIEA 1FXVA 1H8HG 1XHZA 1FJGB 3CCSV 2NN4A 4IYHA 2Q7HA 1R3IC 3UO2A 2P6JA 4GYCB 5L3DA 1PNLA 2IH1C 2HLDG 4JASA 1K4CC 1N36O 3IGAC 5LGTA 1PKXA 3E8GA 3VQWA 1S3JA 2JS5A 2WLLB 1VQ5V 2DW4A 3G6BA 4H33A 1PL4A 2W0FC 4KHPO 4LF5O 3ABTA 4LF4B 3AG4B 5IDJA 3H1IH 2Q0AA 4J7ZA 3CMAV 4UFZA 2A06H 1NVPD 4P2ZA 4LF6B 4QE7A 1XNRO 3BHPA 4PDLA 2DQ3A 4O2AB 4J9YB 1M56B 1AROP 5LGUA 2UU9B 2UXCO 1WLEA 1K97A 4PI2A 3AG2B 3CX5F 1Q43A 1Q6HA 2QWQB 2WSSG 4JV5B 4U7OA 4FM0A 1U97A 2IJIA 5EIBC 2DJVA 4FK5C 4E4EA 3K5OA 4MVZA 1EZVH 2YDEA 1H2SB 1VQ4V 3FB6C 2ILMA 4ZI7A 3HKEA 1Q6UA 2V7QG
chains in the Genus database with same CATH topology
3SYPA 1R3JC 3RBZA 2DWDC 1UJWB 2JK5C 2YEVA 3ABLC 2F43G 1R6NA 1F4MA 2NLJC 3ABKB 1AI6A 4MVQA 1YTFB 4WFBV 3CYOA 5CA3A 2YSUB 2W6JG 3K0DA 1Y66A 2XASA 5IYDO 3RW0A 4U7NA 3W7WA 1NJIW 1COWG 4Z1MG 5L3BA 5CBFA 5B3SB 3K79A 1K3EA 1V55C 1RPOA 4TWKA 5CBHA 2M7WA 3G6EV 3AG3B 3QO7A 1VQ6V 1GM9A 2IH3C 5CN0A 3AG3C 1OCOC 1YITV 4QIWF 1QVFU 3OW2U 1OCOB 3CXCU 1MSWD 3CP1A 3LSQA 3ZRWB 2IJJA 4X89A 3X2QB 4G2KA 3GB7C 2JIZG 3D36A 3T4DA 1CPYA 2B1GA 3RVYA 1WPXA 1JOYA 2A9HA 2QTOA 4TT3G 3SYCA 1VQ7V 5B1AB 5E1AC 3SYQA 5DN6G 3IFXA 1KD1W 1NR1A 3E86A 4RQEA 4MTGA 1RM1C 1VQKV 3OE7G 2PI5A 1RM1B 1SRYA 1OCCC 5EBLC 2AHYA 2XAFA 1YI2V 2OTLV 3G4SV 2XAJA 1BHAA 3CCLV 2QM8A 2XNDG 5EC1C 1M1KW 1GTOA 4LBEC 3MHSC 5B1BC 1B6QA 2WLIB 2ATKC 2DQ0A 4P9OA 5B1BB 5CMUA 4G28B 3FYEB 2K1EA 3T1CA 4QPJA 4WFGA 1QLNA 3JD3A 3ZCCA 4UV8A 4LC1A 3BEHA 1V54B 3ASOB 3K9AA 3E8FA 1FFTB 4TSFG 4RUEA 3ASOC 4GX2A 2DYRC 4RO2A 2FTKA 2QEXV 1BL8A 4X88A 2D3OW 2R9RB 3SPHA 1I5XA 2DYRB 3DTUB 2EIKC 4WF9V 4JAVA 1KP2A 2DYSC 3CC4V 2LFRA 3OFNG 3ZMTA 1OCRB 1JCHA 1NR7A 2R9IA 3W7XA 1EZJA 2Q67A 2XAHA 3MHHC 4G27B 1THZA 1DLBA 4GX0A 3B8MA 1MABG 3SPGA 4MS2A 3STZC 2BOCC 2A0LA 4PA4A 2DWEC 3T4ZA 1Q7YW 1XL6A 4JYCA 1VQMV 5L3EA 2IJKA 4N21A 1YJWV 2ZXWC 1DF4A 4GT1A 1AJQA 2X6AA 2UXNA 1LNQA 3E83A 3WG7B 5DM6V 4BIUA 4BAYA 1W0JG 4WCEV 1Q86W 5GW7A 2EIKB 1E1QG 1M9NA 1YJNV 1KKDA 2EINC 2ZR2A 3CCRV 5EBMC 4R6ZA 3SYAA 3ZMZA 3W7UA 3K04A 3TK1A 3ABLB 3B77A 3P30A 4PA7A 3ZMVA 3TETA 4FJCC 2JDIG 2WLKA 3AG2C 2EILC 3CD6V 3ABMC 2HFEC 1YJ9V 3ZRWA 1Y4MA 5H6RA 1ORQC 3W7TA 4GX1A 3ZRSA 2KB1A 3HB3B 3ML0A 4Q20A 4JTDB 4JYBA 5HFLA 4YXWG 2EBOA 2GHYA 1GKFA 1V55B 3F7YC 3E89A 5LGNA 1SESA 1NH2D 2ITCC 2ZXWB 1P4RA 3JD2A 2JJ2G 1AI4A 2NNUA 1AR1B 3JD0A 1AI7A 2ZD9A 3OMNB 4BW5A 1KC8W 4R8CA 2BOBC 4UV9A 3EFFK 2EINB 3I56V 3SPCA 1S72V 3QO5A 4N23A 2Y69C 2PI4A 3CCVV 2QE7G 2XAGA 4ZBMA 2C2AA 3K3WA 4MVMA 1L1FA 1MG1A 3SYOA 3ABKC 4ZKIA 4MW8A 2EILB 1RPRA 1OHHG 2EJRA 2X6CA 4L87A 5B1AC 3ZMUA 1F4NA 1AJPA 3P32A 2EIJC 5J9PC 1ENVA 1IXMA 1QVGU 3OUFA 4XDJA 5H6QA 3FKSG 2ZQMA 1GK9A 3OEEG 3DGEA 4MT8A 2HJFC 1S77D 1GO3F 5KA6A 4MVUA 2ZDIC 2OCCC 1S76D 3B8NA 2OCCB 4MTFA 3CPWU 4J9ZB 3T2MA 5IY5B 1GMGA 2OT5A 3FB7C 5IY5C 3ZJZA 3ASNB 3SPJA 3JYCA 2W6IG 4XDLA 4XDKA 5HFMA 2Z5UA 4KP4A 4QE9A 1EBOA 2AHZA 3OAAG 3LNMB 1I5YA 5KUMA 4UVBA 4R50A 1DF5A 1CP9A 1K5SA 2IJHA 1E1RG 4I5SA 1F51A 2LFSA 4JTCB 3W7SA 2LP7A 2YEVB 2Q68A 2JJ1G 4BIZA 1QR9A 2EIJB 4FIPC 1NKDA 2H94A 4OXSA 1F23A 1OCCB 3VBBA 1JQ0A 3SPIA 1KP3A 1FXKA 2IW5A 1S0VA 1S5HC 4WFHA 2IU0A 4CZZA 1VQOV 4PELA 3EHBB 5EC2C 2EZPA 2Y48A 1R73A 1R3LC 2ZDIA 3ASNC 1JPXA 4GX5A 4QNHB 3CCJV 4WFEA 4GCZA 3E8BA 1OCZC 2QA4V 1OCZB 3ZMSA 1NBMG 4PA3A 1KECA 2WAMA 3AG1C 3CC7V 1W0KG 5B1NA 4UVCA 3AG1B 4I9WA 3FB5C 1J95A 3F7VC 4JPRA 3KG2A 3IC7A 4PDRA 4WFAV 2Q69A 5L3GA 1VQLV 2Q6AA 2DYSB 3ETGA 3ETDA 5LHIA 1M56C 4EKWA 3WFVA 4HZ3A 4XBFA 1K8AW 4RAIA 4H37A 5EBWC 1VQNV 1E79G 1AI5A 2B1IA 1YIJV 2JEUA 4KFMA 1PD3A 2IU3A 1PNMA 2V1DA 3LSSA 2ZR3A 2JEXA 2QM7A 2EZOA 2B5UA 1W2BU 3ZRVA 1HWYA 4UVAA 2P67A 1CEZA 4F4LA 1AJNA 1K34A 3FB8C 1JVMA 1BHBA 5IYCO 2XOKG 1QLEC 3QO8A 4QJFB 1H8EG 3OUSA 3CCMV 1H38A 2EIMB 3X2QC 3CCEV 3QNEA 2OTJV 4MTOA 1OZ0A 2WPDG 4PDMA 3D3IA 5L3FA 1H2GA 3JD4A 5CBGA 2MK3A 4P30A 4HYOA 3G71V 3LDCA 5KUKA 3E2EA 1N8RW 2WLJA 1JJ2U 2P90A 2H8PC 2HVKC 3I55V 1G8MA 1Q81W 1YTFD 1NH2B 3FYIB 4MVOA 3ZN1A 4RQFA 2HKOA 1G4YB 3LDEA 1QCEA 3OR7C 1VQPV 1VQ8V 2QKSA 3K03A 3OMIB 1TUEB 3ZN0A 2WWWA 3MD0A 1PL0A 2CK3G 4MVSA 1R6KA 3K08A 1K73W 1ROPA 1JX9A 3GWOA 2Z3YA 2HG5C 1NQTA 4PA9A 4WFFA 5B1OA 5LHGA 2HR3A 5KA5A 1QR8A 1SETA 3A0RA 3JCZA 3RVZA 1K5QA 3VOUA 3AEIA 3E35A 3R65A 1QLEB 3CMEV 1GM8A 4JAUA 3ETEA 1YHQV 4E2LA 1FXKB 1FS0G 1GM7A 4JF3A 1K92A 1FXKC 1PNKA 1XL4A 1K9MW 1M57B 3ZIAG 3F5WC 4MVRA 5C93A 1YSCA 1FXVA 1M57C 1QBZA 3E8HA 1H8HG 1P7BA 2HVJC 5LBQA 3CCSV 4R7CA 4DXWA 4JGSA 1BMFG 5EK0A 3ZRXA 3M99B 4ASUG 1R3IC 1OCRC 3OMAB 4QPKA 2WLHA 2P6JA 4P9PA 3OR6C 5L3DA 2X0LA 1R3KC 1PNLA 3OM3B 1K7DA 1M90W 2IH1C 2HLDG 1NVPB 1SERA 4JASA 3BY6A 4HAMA 4LP8A 1EFRG 1K4CC 3IGAC 1ZWIC 5LGTA 1K4DC 1PKXA 1SZTA 3E8GA 3UKMA 1S3JA 3HPLC 3H01A 2WLLB 3K0GA 5FL7G 1VQ5V 3NXSA 4FPPA 2DW4A 4H33A 4FMTA 4UUJC 3SJQC 2W0FC 3AG4C 3ABTA 3OGCC 2X6BA 3AG4B 5IDJA 3CCQV 3CC2V 4RUFA 3CMAV 1NVPD 1V54C 3UM7A 3WG7C 4LCUC 4P2ZA 2UXXA 1FXHA 4QE7A 3K06A 2WLNA 4PDLA 2GSMB 3LDDA 1KQSU 2DQ3A 4JTAB 4J9YB 1K33A 1M56B 3JD1A 1AROP 4PA6A 5IYBO 5LGUA 5H9CA 3TCUA 1DTOA 1WLEA 1K97A 4CBCA 1MOFA 4DO2A 3AG2B 3ABMB 4MW3A 4MTXA 5L3CA 1VQ9V 5LHHA 2ITDC 2WSSG 4KUMA 4U7OA 3CCUV 2WLMA 2IJIA 5B3SC 3OEHG 2A79B 2WLIA 2WLLA 4FK5C 4MSWC 4UXNA 3LUTB 3ABUA 3PJSK 4MVZA 1Q82W 2P7TC 4X8AA 5BZBA 2X7RB 1VQ4V 3FB6C 3STLC 4PDVA 2EIMC 2XAQA 2V7QG 2Y69B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MS2 A;  2BOC C;  3SYP A;  4PA9 A;  1R3J C;  2HG5 C;  4JTC B;  4WFF A;  3RBZ A;  2DWD C;  2A0L A;  4PA4 A;  2DWE C;  2JK5 C;  2Q68 A;  3T4Z A;  2YEV A;  3ABL C;  1XL6 A;  2NLJ C;  3RVZ A;  3VOU A;  4MVQ A;  3R65 A;  3K0D A;  2ZXW C;  3SPG A;  4OXS A;  3RW0 A;  3SPI A;  2X6A A;  3E83 A;  1LNQ A;  1S5H C;  5CBF A;  4WFH A;  1XL4 A;  1KKD A;  2EIN C;  3F5W C;  4MVR A;  5EBM C;  1V55 C;  1M57 C;  5CBH A;  3E8H A;  4R6Z A;  4TWK A;  5EC2 C;  1P7B A;  3SYA A;  3K04 A;  2HVJ C;  1R3L C;  4GX5 A;  3ASN C;  4R7C A;  4QNH B;  2IH3 C;  3AG3 C;  1OCO C;  4PA7 A;  4WFE A;  3E8B A;  4DXW A;  3TET A;  1OCZ C;  5EK0 A;  2WLK A;  3AG2 C;  2EIL C;  1R3I C;  3ABM C;  1OCR C;  2HFE C;  2WLH A;  4P9P A;  4X89 A;  3OR6 C;  4PA3 A;  3AG1 C;  1R3K C;  1ORQ C;  4GX1 A;  3ZRS A;  2KB1 A;  2IH1 C;  3GB7 C;  4JTD B;  4I9W A;  3FB5 C;  1J95 A;  4LP8 A;  3F7V C;  1K4C C;  3KG2 A;  3IGA C;  1ZWI C;  3T4D A;  1K4D C;  3F7Y C;  3E89 A;  3E8G A;  4PDR A;  3RVY A;  3UKM A;  2A9H A;  3HPL C;  2Q69 A;  2QTO A;  2WLL B;  3K0G A;  3SYC A;  2ITC C;  2Q6A A;  4H33 A;  1M56 C;  4UUJ C;  3SJQ C;  4EKW A;  2ZD9 A;  5E1A C;  4HZ3 A;  3SYQ A;  2W0F C;  3AG4 C;  3IFX A;  4RAI A;  3OGC C;  3E86 A;  4R8C A;  2X6B A;  4H37 A;  2BOB C;  4MTG A;  3EFF K;  4BW5 A;  4RUF A;  5EBW C;  1OCC C;  3SPC A;  5EBL C;  2AHY A;  1V54 C;  3UM7 A;  4KFM A;  3WG7 C;  4LCU C;  2Y69 C;  4P2Z A;  4QE7 A;  3K06 A;  4ZBM A;  5EC1 C;  4LBE C;  4MVM A;  2WLN A;  4PDL A;  5B1B C;  3ABK C;  3SYO A;  2WLI B;  3LDD A;  4MW8 A;  2ATK C;  4P9O A;  4JTA B;  4J9Y B;  4F4L A;  2X6C A;  4G28 B;  5B1A C;  3FB8 C;  1JVM A;  4PA6 A;  2K1E A;  3T1C A;  3TCU A;  2EIJ C;  4WFG A;  5J9P C;  3OUF A;  4XDJ A;  4CBC A;  1QLE C;  4R50 A;  3BEH A;  3OUS A;  4MW3 A;  3X2Q C;  3E8F A;  2HJF C;  4MTO A;  4RUE A;  2ITD C;  3ASO C;  4GX2 A;  2DYR C;  4PDM A;  4RO2 A;  1BL8 A;  4MVU A;  2WLM A;  4X88 A;  2R9R B;  3SPH A;  2OCC C;  5CBG A;  2EIK C;  4P30 A;  4HYO A;  5B3S C;  3LDC A;  2A79 B;  2WLI A;  5KUK A;  2WLJ A;  2WLL A;  4MTF A;  2H8P C;  2HVK C;  4J9Z B;  3T2M A;  4MSW C;  2DYS C;  4MVO A;  3LUT B;  5IY5 C;  3FB7 C;  1G4Y B;  3LDE A;  3OR7 C;  3PJS K;  4MVZ A;  3SPJ A;  3ZJZ A;  2QKS A;  3JYC A;  3K03 A;  2P7T C;  4XDL A;  4XDK A;  4X8A A;  2Q67 A;  5BZB A;  3FB6 C;  4QE9 A;  3STL C;  2AHZ A;  2EIM C;  4MVS A;  3LNM B;  4PDV A;  3K08 A;  5KUM A;  4G27 B;  4GX0 A;  3STZ C; 
#chains in the Genus database with same CATH topology
 4I55 B;  3SGI A;  3RBZ A;  2UXB O;  2NLJ C;  1Q6I A;  1AI6 A;  4CS2 A;  5B66 Z;  5CA3 A;  4PHZ A;  1Y66 A;  5IYD O;  1JFF B;  2QKA A;  4U7N A;  1O9H A;  4BW9 A;  4X1K B;  4CC6 A;  5L3B A;  5E79 Z;  4L8J A;  4X66 B;  1N4C A;  3K79 A;  4TWK A;  1OJH A;  3AG3 B;  4LF7 O;  1VQ6 V;  1GM9 A;  1OCO C;  1QVF U;  2ZIO A;  3CRA A;  3CP1 A;  4JI1 B;  4X89 A;  5LYJ A;  1SQQ H;  4G2K A;  1M4U A;  3GB7 C;  1N0N A;  2BE3 A;  2A9H A;  4UB6 Z;  4DV5 B;  3SYC A;  2IBZ H;  5E1A C;  3IFX A;  5C8Y A;  1JJO A;  1NR1 A;  2K9P A;  1GN2 A;  4DV3 O;  2PI5 A;  1RM1 B;  1OCC C;  2AHY A;  3K58 A;  2JGD A;  2OTL V;  1D5N A;  1TVK B;  1MZE A;  4OGQ B;  1YXB A;  5EC1 C;  1GTO A;  5B1B C;  2WLI B;  4DW0 A;  1DK1 A;  3JD3 A;  4UV8 A;  3ASO B;  3E8F A;  1FFT B;  4FLV A;  1SA0 A;  3I5D A;  3L9D A;  2QEX V;  1I5X A;  2DYR B;  4X62 O;  4LF9 O;  4JZ2 A;  1UFI A;  2QWN B;  4X65 B;  3CS5 A;  3W7X A;  1EZJ A;  4JI4 B;  5LP6 A;  1WB8 A;  5LMU B;  1N32 O;  3MHH C;  4G27 B;  1DLB A;  4DUZ O;  4TUY B;  2BOC C;  1XRE A;  2EX3 A;  2N74 A;  4N21 A;  2AGA A;  4TUY A;  3HR0 A;  4YY3 O;  3AG7 A;  2X6A A;  2UXN A;  4BAY A;  1Q86 W;  2FKX A;  3WB1 A;  4J7K A;  3RGB A;  1N34 O;  2QWR B;  1VF7 A;  3ABL B;  1XEQ A;  2AZ2 A;  1DGS A;  2HHH O;  3K9S A;  2WLK A;  2QJ1 A;  1FFX B;  3ABM C;  1PPJ H;  1YJ9 V;  4WBN A;  3KZI Z;  4D7S A;  3ZRS A;  2HHH B;  1WNS A;  2N05 A;  3E89 A;  3LNN A;  4X1I B;  1GN4 A;  4U3J A;  5KHK A;  2JJ2 G;  3T1H O;  1AI7 A;  4YIP A;  4BW5 A;  1KC8 W;  2GTS A;  3SPC A;  4N23 A;  2Y69 C;  2GV9 A;  3ABK C;  4L87 A;  4J80 A;  2RNB A;  4UCO A;  3P32 A;  2EIJ C;  5J9P C;  1NZ6 A;  1B3Q A;  4X1Y B;  2E75 B;  1HW7 A;  5KA6 A;  4UCV A;  5LA6 A;  3L70 H;  2OCC C;  4U3J B;  5F2V O;  4LH7 A;  5LOV B;  4MTF A;  4DR2 O;  4LFB B;  3ETQ A;  2F4V B;  2OT5 A;  5BY1 A;  3ZJZ A;  1I08 A;  3ASN B;  1SQX H;  2LGQ A;  2W6I G;  1MSD A;  3JAW B;  5HFM A;  3CRM A;  2ADQ B;  4DR7 O;  3BA8 A;  1EBO A;  1Z5W A;  3OAA G;  1B06 A;  4UVB A;  4QGP A;  4J42 A;  1L0L H;  2R72 A;  4JI6 O;  4O4L A;  2LO1 A;  2EIJ B;  4JI0 B;  1YZB A;  4DYL A;  4OXS A;  1F23 A;  2WA4 A;  3HKC A;  5ITZ A;  1S0V A;  1S5H C;  2JGU A;  4I9Q A;  3P3N A;  1WA8 B;  4PEL A;  4O4H A;  3JAT B;  4FLX A;  2UUC O;  3ASN C;  4ABM A;  4JZG A;  4NVP A;  3H1J H;  4PA3 A;  1KEC A;  5B1N A;  4UVC A;  3AG1 B;  4I9W A;  3F7V C;  3KG2 A;  1FFX A;  1Y6X A;  4O4L B;  2Q6A A;  4IYI A;  1M56 C;  4EKW A;  4HZ3 A;  2QGN A;  4XBF A;  4RAI A;  4H37 A;  2VS0 A;  1D5A A;  1VQN V;  4B3M B;  1H2M A;  2B1I A;  1L8D A;  1PNM A;  4FLY A;  3T1Y O;  2QWO B;  4FLU A;  1KB9 F;  5JQG A;  3OTO B;  3O9O A;  1HWY A;  2YI8 A;  4UVA A;  4LH6 A;  4LWS B;  5GON A;  1TVK A;  3FB8 C;  1N0J A;  2BSK B;  4DR3 B;  1JFF A;  2VQF O;  3ZED A;  1QLE C;  1H8E G;  3G80 A;  4FZ0 A;  3CCE V;  4BIO A;  1XMO B;  4NXM O;  2WPD G;  4LNU A;  5CBG A;  3LDC A;  2CDY A;  2WLJ A;  1JJ2 U;  2P90 A;  1G8M A;  1Q81 W;  1YTF D;  1G4Y B;  4J10 A;  3ZN0 A;  3ZHR A;  1PL0 A;  1IBK B;  1IBM O;  3K08 A;  1TUB B;  1SZX A;  3IC9 A;  4TV9 A;  1ROP A;  2E74 B;  2Z3Y A;  3IJ4 A;  5LMU O;  4IL6 Z;  4O4H B;  5IE9 A;  1YVW A;  3A0R A;  3AEI A;  3KCY A;  4U3F H;  1QLE B;  4AHC A;  3CME V;  1GM8 A;  4JAU A;  4AQY O;  5EIB D;  1TA8 A;  1YHQ V;  4DV4 B;  4E2L A;  3JAS A;  2QKC A;  3QTC A;  5C93 A;  3ZHQ A;  1YSC A;  1F7Y A;  3E8H A;  5AG2 A;  2HVJ C;  4R7C A;  3PN1 A;  1T5E A;  4JGS A;  3M99 B;  3OMA B;  4IIJ A;  2WLH A;  4P9P A;  1XMQ O;  1M5I A;  1M90 W;  4HAM A;  4BWA A;  3CJH A;  2VWJ A;  3TGU H;  3HPL C;  3APQ A;  2A7W A;  4UUJ C;  3AG4 C;  1NTZ H;  1AP6 A;  4BR6 A;  4TQF A;  5LP6 B;  3UM7 A;  3WG7 C;  3HKB A;  5KX5 A;  3AK1 A;  2WLN A;  3JD1 A;  5IYB O;  3P3P A;  3K57 A;  3TCU A;  4GUN A;  5LHH A;  2UUB O;  4B7K A;  2ITD C;  4KUM A;  4DR6 B;  3HKD A;  2VQE O;  2YIC A;  3OEH G;  4PI0 A;  1AP5 A;  1BGY H;  5K1X A;  2RCV A;  4MSW C;  3LUT B;  2Q9L A;  1NS1 A;  5BXZ A;  1Q82 W;  2P7T C;  2Y0I A;  5BZB A;  1ZLZ A;  3DXR A;  3STL C;  2UXD O;  1IBL O;  3CRQ A;  1Z2G A;  1R3J C;  5FNV A;  2JK5 C;  4NXN O;  3ABL C;  3U10 A;  1R6N A;  1F4M A;  1YTF B;  4DV0 O;  1YEW A;  5JJE B;  2YSU B;  3HKE B;  2HP8 A;  1RSO A;  2XAS A;  3RW0 A;  4NXN B;  2Q8V A;  4NB5 A;  4CH3 A;  3ZBH A;  1AR5 A;  4DV2 O;  1TGO A;  1Q3E A;  5CBH A;  4JYA B;  4DRX A;  3QO7 A;  2UXB B;  1YIT V;  4YJ2 B;  4DV2 B;  2GUZ B;  1O9G A;  3SJA C;  3A8T A;  5IWA O;  2IJJ A;  1G6U A;  1NI8 A;  3ZHU A;  4X20 A;  5EYP B;  3T4D A;  5KLV H;  1PV0 A;  4LFB O;  2PF4 E;  5IWA B;  3EVK A;  5LMN O;  4X64 O;  4X20 B;  3SYQ A;  5DN6 G;  2QWP B;  1RM1 C;  4MTG A;  1NTM H;  1SC5 B;  1RFY A;  4EB6 B;  4O4J A;  2ZNI A;  3G4S V;  2QM8 A;  1MA1 A;  1M1K W;  4LBE C;  2PUS A;  4DRX B;  3T1Y B;  5CMU A;  4G28 B;  2K1E A;  1ZAU A;  3T1C A;  4JI8 B;  3ZCC A;  3BCC H;  1XBL A;  4TV8 B;  1V54 B;  3K9A A;  4H44 B;  3MAQ A;  3K5L A;  4TSF G;  4GX2 A;  2DYR C;  2F95 B;  2CGN A;  3OGI B;  2R9R B;  3DTU B;  4LFA O;  2EIK C;  5FPO A;  1XMO O;  4NXM B;  1N33 O;  1KP2 A;  3ZMT A;  1OCR B;  2R9I A;  2YID A;  2ZIN A;  3D36 C;  4EFE A;  4J7J A;  3DC5 A;  1JR9 A;  4LWS A;  5GON B;  3H1L H;  3SPG A;  3RYH A;  2BSK A;  2O57 A;  2A0L A;  1Q7Y W;  3CB2 A;  3KCX A;  3JAR A;  4O4I B;  4GT1 A;  5CA1 A;  1LNQ A;  4WBN B;  4BIU A;  3CSX A;  4WCE V;  5A9G A;  3VQX A;  1SQV H;  2EIK B;  1M9N A;  3B40 A;  3CCR V;  4F6R A;  4R6Z A;  3SYA A;  4DV3 B;  2H3O A;  2FB5 A;  4TQD A;  3P30 A;  3TET A;  4FJC C;  2RQ6 A;  2PY5 A;  1ORQ C;  4GX1 A;  4LF9 B;  3ML0 A;  3HB3 B;  4YXW G;  3S3X A;  5HFL A;  4JYB A;  1J5E B;  1V55 B;  5LGN A;  1N34 B;  2F1M A;  2JS3 A;  4JAA A;  3ZX6 A;  3L73 H;  1AI4 A;  2NNU A;  3Q4H B;  3JD0 A;  5J2U B;  1I0H A;  1Y74 A;  1A32 A;  4DV7 O;  3RYH B;  4R8C A;  1RSO B;  3KKY A;  2BOB C;  4DK1 A;  5FLX N;  4DV1 B;  3QO5 A;  4DR5 O;  2PI4 A;  2Y4U A;  4HNA A;  1ZSP A;  2M6Y A;  1MG1 A;  4DR5 B;  1RPR A;  1OHH G;  3E22 A;  4HNA B;  1AJP A;  4JI2 O;  1ENV A;  2B9Z A;  4I4T B;  3JAW A;  5H6Q A;  3FKS G;  3OEE G;  3DGE A;  4J41 A;  3VQV A;  5KHI A;  2HJF C;  4JI2 B;  4DR1 O;  3H9V A;  3CPW U;  4J9Z B;  3T2M A;  3EXA A;  4TV9 B;  5IY5 C;  2JRI A;  5LA6 B;  4XDL A;  4KP4 A;  4O4J B;  4QE9 A;  2AHZ A;  4UCT A;  1I5Y A;  3J81 N;  1P7G A;  1CP9 A;  1H2N A;  4UCR A;  1E1R G;  1HP8 A;  2LFS A;  2BTO A;  2YEV B;  5FNV B;  4LR3 A;  1ZX3 A;  1Y76 B;  1JMK C;  2EUL A;  2DE0 X;  1IX9 A;  2H94 A;  1JQ0 A;  3SPI A;  4KXR A;  5CB4 B;  2EZP A;  4QNH B;  4GX5 A;  1JPX A;  4WFE A;  4GCZ A;  4JI0 O;  3JAL B;  1OCZ B;  2UUB B;  3AG1 C;  1X4T A;  2WAM A;  4UB8 Z;  5LP6 C;  3CC7 V;  1W0K G;  1SKV A;  4EEQ A;  1PP9 H;  3IC7 A;  2WA3 A;  5BR8 B;  3QG5 A;  5L3G A;  1VF6 C;  2E76 B;  1VQL V;  2DYS B;  3HKB B;  4PD4 F;  4JV5 O;  3WFV A;  1K8A W;  1QNM A;  1HNZ B;  1HDJ A;  1YIJ V;  2KKW A;  2IU3 A;  2DMX A;  4IHJ A;  2V1D A;  3A0H Z;  2YXY A;  4K0K B;  1MMM A;  1W2B U;  1EN6 A;  2ZCE A;  4DR7 B;  2P67 A;  1CEZ A;  3OD4 A;  1JVM A;  5IYC O;  3HKD B;  5DEC A;  3QO8 A;  2KQX A;  4FLZ A;  3C90 A;  1VMG A;  3JD4 A;  5D5Q A;  4A5U B;  1N8R W;  2E3C A;  1NH2 B;  3FYI B;  4DK0 A;  5JVD A;  2IM9 A;  4LFC B;  3LDE A;  3OR7 C;  2KG7 A;  1VQ8 V;  1GAX A;  3L71 H;  2QKS A;  2V4D A;  3OMI B;  1GH6 A;  5JJN B;  1FAF A;  1R6K A;  2N04 A;  4ZI7 B;  4TOI A;  2Q5Z A;  3SDL A;  1NQT A;  3N2K A;  5B1O A;  3VOU A;  3A0B Z;  3E35 A;  1HR0 B;  2CH7 B;  5ITZ B;  4JF3 A;  1XL4 A;  2CUG A;  2XHB A;  1URF A;  3F5W C;  1IBM B;  5C8Y B;  1QBZ A;  3HKC B;  3R66 A;  3L72 H;  4HBN A;  3BAB A;  4DXW A;  4F6R B;  4AIL C;  5EK0 A;  4LNU B;  3CXH F;  3B09 A;  4ASU G;  1MNG A;  3K5N A;  2Q7E A;  3OM3 B;  1R3K C;  1AR4 A;  1NVP B;  4LFA B;  1SER A;  1EFR G;  1ZWI C;  1K4D C;  4O4I A;  1SZT A;  3JAL A;  3UKM A;  3H01 A;  3H1K H;  1KBH A;  4FMT A;  4JI1 O;  5J2U A;  3RT3 C;  3CC2 V;  4RUF A;  2YIA A;  2DOS A;  1Q90 D;  3FX7 A;  1S5L Z;  4Z1V A;  4B3S B;  1V54 C;  1FD9 A;  1WPB A;  1FXH A;  2QR4 A;  5IYZ A;  2GSM B;  3LDD A;  4B3S O;  4C7U A;  1KQS U;  4PA6 A;  1X59 A;  5H9C A;  2VRZ A;  4CBC A;  1MOF A;  4JI5 O;  4DO2 A;  3ABM B;  5EZY A;  1WAZ A;  4MW3 A;  2JVD A;  4B3T B;  3SR2 C;  2ZE5 A;  3CCU V;  2GUZ A;  1Q5O A;  3CHX A;  2WLM A;  4FVM A;  5DED A;  1BZK A;  2P4V A;  3N2G B;  4NKG B;  2A79 B;  4DV4 O;  5IT9 N;  1G1X B;  4UXN A;  4DR1 B;  3PJS K;  3UQ8 A;  3OT7 A;  4PDV A;  2XAQ A;  2NR5 A;  1VEW A;  2YUA A;  2CTW A;  2Y69 B;  2DWD C;  1IUR A;  1UJW B;  1XMQ B;  3ABK B;  4MVQ A;  3CE2 A;  3CYO A;  1EM1 A;  4I7Z B;  3K0D A;  4Q6G A;  2PYJ A;  2CTP A;  2ZKO A;  4Z1M G;  2Q0O C;  4OX9 O;  3F5T A;  1V55 C;  4GKK B;  3G6E V;  2Q4P A;  1QQC A;  1KU9 A;  2IH3 C;  5CN0 A;  2Q7G A;  3OW2 U;  1MSW D;  4DR6 O;  3LSQ A;  3NR7 A;  3ZRW B;  3X2Q B;  2YXH A;  2YS8 A;  4NTY A;  1KUQ A;  3D36 A;  4O2B B;  5KMG A;  1CPY A;  1JOY A;  1WPX A;  4B3R O;  1SQP H;  1WB7 A;  2QTO A;  3RYI A;  3ZS8 C;  5KHG A;  1VQ7 V;  2QTS A;  2UXD B;  4RQE A;  2CH7 A;  3OE7 G;  4DV6 B;  1SQF A;  3K5M A;  1SRY A;  5LYJ B;  5EBL C;  1XQ8 A;  1FJG O;  1YI2 V;  2XAJ A;  4UCS A;  2XND G;  5LL6 Y;  1SS3 A;  3MHS C;  1I94 B;  1VIB A;  2DQ0 A;  2LJ2 A;  2FML A;  4K0K O;  5B5E Z;  1IBL B;  2RDC A;  1N36 B;  3LSU A;  4JI6 B;  2ETN A;  4LC1 A;  4O2A A;  3CRR A;  2JGD B;  2ZNJ A;  4YHH O;  4RO2 A;  1BL8 A;  4X88 A;  3SPH A;  4WF9 V;  4JAV A;  2ZE7 A;  2Z0A A;  3OFN G;  4O2B A;  5KMG B;  1JCH A;  2Q67 A;  4I50 B;  2XAH A;  1MZF A;  2Q73 A;  4GX0 A;  3B8M A;  3STZ C;  4X64 B;  5CA0 B;  4PA4 A;  2DWE C;  1U96 A;  1XL6 A;  2FL4 A;  2ZT9 B;  5L3E A;  3DC6 A;  4GZR B;  2RN9 A;  3H1H H;  1BS3 A;  1DF4 A;  2XUM A;  1AJQ A;  3E83 A;  5GW7 A;  3RYF B;  1YJN V;  1KKD A;  2EIN C;  2KG7 B;  3M8A A;  3ZMZ A;  3W7U A;  3TK1 A;  1SQB H;  3B77 A;  3E22 B;  4PA7 A;  2JDI G;  3AG2 C;  2EIL C;  4DUY O;  3JCU Z;  3RWR D;  3U11 A;  2A3Q A;  1Y67 A;  1Y4M A;  5H6R A;  1WP7 A;  3W7T A;  1IZ3 A;  2KB1 A;  4JTD B;  2OYQ A;  2EBO A;  2GHY A;  2GBO A;  3F7Y C;  1LUW A;  5IJ9 B;  1FKA O;  2F93 B;  1AVM A;  5JCO A;  4GKJ O;  1NH2 D;  1W59 A;  1P4R A;  3JD2 A;  1GRJ A;  4IT5 A;  2ZD9 A;  1XNQ B;  3OMN B;  2PYL A;  4DR4 O;  2EIN B;  1Y76 A;  4GLX A;  4CS3 A;  2QE7 G;  4ZBM A;  3C3S A;  3K3W A;  4MVM A;  1L1F A;  1H2L A;  3SYO A;  4ZKI A;  3ZHT A;  5BMV A;  2EIL B;  4X62 B;  2EJR A;  2X6C A;  5B1A C;  3ZMU A;  3RYF A;  2AZ0 A;  1OV9 A;  1F4N A;  4YIO A;  1IXM A;  1QVG U;  1GK9 A;  2LGW A;  1XUQ A;  3CRC A;  4PJ0 Z;  4NTX A;  1S77 D;  1GO3 F;  5LXT A;  2ZDI C;  4ZOL B;  3B8N A;  4X1I A;  1XOU A;  3O65 A;  2BTQ A;  5KHJ A;  5IY5 B;  2VWK A;  4DR3 O;  1GMG A;  1P84 F;  3SPJ A;  3QF7 A;  2ZM6 B;  4XDK A;  2BCC H;  5J2T B;  2Z5U A;  4FFK A;  2W0X A;  4R50 A;  1K5S A;  3BA9 A;  2DN9 A;  1F51 A;  4I5S A;  4BIZ A;  2JJ1 G;  1IDS A;  1OCC B;  5GTH Z;  2GDS A;  1KP3 A;  1FXK A;  4DW1 A;  2IW5 A;  3JAK B;  2LW1 A;  4FM2 A;  2IU0 A;  1VQO V;  4DV7 B;  1XHX A;  4OX9 B;  1R73 A;  3FFQ A;  4DV1 O;  4JI4 O;  3CCJ V;  4CH6 A;  4I0X B;  1OCZ C;  4IIJ B;  3VQY A;  3ZMS A;  4I50 A;  1UPG A;  4YJ3 A;  3FB5 C;  4JPR A;  4CC5 A;  4PDR A;  2QSA A;  2HJD A;  3C3T A;  1ZL8 A;  2Q69 A;  5JH7 A;  2PTM A;  2Y4T A;  3OTF A;  5JVD B;  4JI3 B;  2VQE B;  3ICX A;  2P5O A;  1H2K A;  5JH7 B;  1E79 G;  1AI5 A;  5IJ0 A;  3D3Q A;  4FFB B;  4KFM A;  1M93 A;  3LSS A;  2JEX A;  3ZRV A;  5BR8 O;  4K8X A;  1LR1 A;  1BHB A;  5CB4 A;  2XOK G;  4IGG A;  1B04 A;  4X1Y A;  3OUS A;  1H38 A;  5A2Q N;  2OTJ V;  4PDM A;  3D3I A;  5L3F A;  1TAE A;  2AW9 A;  2MK3 A;  4P30 A;  4HYO A;  3E2E A;  2H8P C;  3ZN1 A;  1V9P A;  4RQF A;  4LF6 O;  1XIL A;  2WWW A;  4MVS A;  4FLT A;  1K73 W;  4LF5 B;  1BE3 H;  3GWO A;  3UCS C;  2HG5 C;  2UUA B;  4WFF A;  1P49 A;  5LHG A;  5JQG B;  2CE4 A;  1HNX O;  1QR8 A;  1GN6 A;  3RVZ A;  4W4L A;  3R65 A;  1R1B A;  1NT2 B;  3RYC B;  5LMN B;  1FS0 G;  3DSQ A;  1PNK A;  1FXK C;  3ZHS A;  1K9M W;  2UXC B;  3ZIA G;  1M57 C;  1P7B A;  3BPZ A;  1ZL8 B;  2HEP A;  1HNZ O;  3IAY A;  5LBQ A;  4ZIB A;  2CTQ A;  4KHP B;  2Y0P A;  4LF4 O;  1BMF G;  1RP3 B;  3ZRX A;  1OCR C;  4QPK A;  3JAS B;  3OR6 C;  2X0L A;  1K7D A;  2R70 A;  1XNR B;  1BCC H;  4I0X A;  3BY6 A;  4LP8 A;  4LFC O;  3WB2 A;  3K59 A;  3K0G A;  5FL7 G;  3NXS A;  4FPP A;  2UU9 O;  3SJQ C;  4X66 O;  3J7A U;  4NR1 A;  1KYO F;  1WA8 A;  3OGC C;  2P22 C;  2X6B A;  5H5N A;  3CCQ V;  1N33 B;  4LF8 B;  3GVM A;  4LCU C;  4DR4 B;  2UXX A;  3K06 A;  1HR0 O;  3ZHV A;  4LF8 O;  3JSL A;  3SJB C;  4JTA B;  1ZUQ A;  1K33 A;  3MDS A;  5FPR A;  2QM4 A;  1DTO A;  4LF7 B;  3WU2 Z;  1VP7 A;  3DXR B;  4MTX A;  5L3C A;  1D2D A;  1VQ9 V;  3JAR B;  1Y74 B;  4JYY A;  5B3S C;  2WLI A;  2WLL A;  2ZE8 A;  3UT5 A;  4DUY B;  2BTQ B;  4Z2W A;  2XTA A;  3THO A;  2XT9 A;  3ABU A;  4ZOL A;  4FLW A;  1QHT A;  3JSN A;  4X8A A;  5IJ0 B;  2X7R B;  3OTO O;  2EIM C;  2YIB D;  1S5J A;  1NTK H;  1WN7 A;  1TUB A;  4K35 A;  2ZIM A;  3SYP A;  4B3T O;  2PGG A;  4K3A A;  2YEV A;  2R9A A;  2F43 G;  2YIB A;  2OIG A;  2P06 A;  4WFB V;  1VAR A;  2W6J G;  4B7E A;  3W7W A;  1NJI W;  1COW G;  3Q4H A;  5CBF A;  5B3S B;  3QVN A;  2LW7 A;  4J11 A;  1K3E A;  2E5L B;  1RPO A;  2M7W A;  4CH4 A;  2D2C B;  3UT5 B;  3AG3 C;  4QIW F;  1OCO B;  3CXC U;  1QU7 A;  3S3W A;  3M7M X;  3N2K B;  3TJT A;  4ICG A;  4X1K A;  1FYJ A;  4UCU A;  4W4K A;  1SF9 A;  2JIZ G;  3FAV A;  4X9Q A;  2B1G A;  3RVY A;  5IYZ B;  4B08 A;  4TT3 G;  4JI5 B;  1N32 B;  2ARH A;  4GKK O;  2YXL A;  3D8C A;  5B1A B;  3B4S A;  4ZHQ B;  4I55 A;  1KD1 W;  3E86 A;  3RYC A;  1VQK V;  1WP8 A;  2XAF A;  1BHA A;  3CCL V;  5JCO C;  1B6Q A;  4B3R B;  2ATK C;  4P9O A;  5B1B B;  1AIL A;  3FYE B;  4NYK A;  2P4K A;  4NTW A;  4QPJ A;  3CJH B;  4WFG A;  5TIS Z;  1QLN A;  2RJZ A;  1BSM A;  4EB6 A;  3BEH A;  5EZY B;  4DUZ B;  4RUE A;  3ASO C;  2FTK A;  2L35 A;  2D3O W;  1KKC A;  3RYI B;  3WB0 A;  2KSD A;  2DYS C;  3CC4 V;  2LFR A;  2GTA A;  3FAV B;  3N27 A;  1NR7 A;  4DV0 B;  4H0L B;  1YDX A;  4OPA A;  1L0N H;  3TXQ A;  2ODM A;  4CS4 A;  1PM9 A;  1THZ A;  1MAB G;  4MS2 A;  4YHH B;  1CXZ B;  3A2F A;  3FD9 A;  3T4Z A;  4DV6 O;  1NU1 H;  4JYC A;  1VQM V;  1XDC A;  2IJK A;  4D6T H;  1YJW V;  2UUA O;  3APO A;  2ZXW C;  1KMI Z;  2G38 A;  2ZE6 A;  1JA8 A;  5DM6 V;  3WG7 B;  1Q8I A;  4CH5 A;  1W0J G;  4FFB A;  3SJC C;  1E1Q G;  2F4V O;  2ZR2 A;  5EBM C;  3RFR A;  3K04 A;  1BT8 A;  4YJ3 B;  3ZMV A;  5GTI Z;  3CD6 V;  2HFE C;  3ZRW A;  1I94 O;  5JJJ B;  4CZZ A;  4Q20 A;  1GKF A;  5CA0 A;  1EN5 A;  5KHH A;  1SES A;  2ITC C;  2ZXW B;  5H2F Z;  3BAA A;  1AR1 B;  4UV9 A;  3EFF K;  4I4T A;  4JYA O;  3I56 V;  2UUC B;  2YI9 A;  1IXB A;  1S72 V;  4JI8 O;  3BRC A;  1I7F A;  3CCV V;  2XAG A;  1HNX B;  2C2A A;  4DR2 B;  3AK2 A;  4MW8 A;  1R6T A;  3GWK C;  1LUV A;  1US6 A;  5EYP A;  1GN3 A;  3J80 N;  3OUF A;  4XDJ A;  2ZQM A;  3B2E E;  4TV8 A;  4MT8 A;  2CAZ C;  4OPH A;  2CTR A;  4MVU A;  3AK3 A;  4D7T A;  1EN4 A;  1S76 D;  4B3M O;  2OCC B;  1AB3 A;  3FB7 C;  5LXT B;  3N2G A;  3JYC A;  5KAI Z;  2L6L A;  2QDO A;  4H13 B;  4GKJ B;  3LNM B;  2FYU H;  5KUM A;  1BQZ A;  1DF5 A;  4FZ1 A;  2IJH A;  4JTC B;  3W7S A;  2LP7 A;  2VQF B;  2Q68 A;  1QR9 A;  5BMV B;  2CGO A;  2LQT A;  4K8Z A;  4FIP C;  2AXT Z;  1NKD A;  1Z5V A;  3CWB H;  3VBB A;  1SQG A;  1FPO A;  4FM1 A;  3RN4 A;  5JWP A;  2ZM6 O;  2F23 A;  4WFH A;  1SA0 B;  1XNQ O;  1XI1 A;  5CA1 B;  2PZS A;  3EHB B;  5EC2 C;  3JAM N;  1J5E O;  2Y48 A;  1R3L C;  2ZDI A;  5LOV A;  2E5L O;  3E8B A;  2QA4 V;  1WJZ A;  1HNW O;  4RWU A;  3UO3 A;  1NBM G;  4JI7 B;  4X65 O;  4DV5 O;  1IVS A;  1J95 A;  4IHJ B;  5KAF Z;  1HNW B;  2MW2 B;  4WFA V;  4JI7 O;  2ADP A;  3ETG A;  3ETD A;  3L75 H;  5LHI A;  4PV1 B;  5KX5 B;  3U0Z A;  5D5P A;  3L74 H;  5EBW C;  3TXS A;  2JEU A;  1PD3 A;  4AQY B;  2ZR3 A;  2QM7 A;  2EZO A;  2B5U A;  3JAT A;  4F6E A;  4F4L A;  1AJN A;  2OCH A;  1K34 A;  2OWO A;  3JAK A;  5IJ9 A;  3G67 A;  4AI8 A;  4QJF B;  1YCI A;  1IBK O;  3CCM V;  1YF2 A;  2EIM B;  3X2Q C;  3QNE A;  4MTO A;  1OZ0 A;  2F66 C;  4ZHQ A;  1H2G A;  1VF5 B;  3G71 V;  5KUK A;  3BFR A;  2HVK C;  3I55 V;  1VF6 A;  4MVO A;  2RMK B;  2HKO A;  1QCE A;  1VQP V;  5K1P A;  1ZTE A;  3K03 A;  3T1H B;  4EFB A;  1TUE B;  5J2T A;  3MD0 A;  2CK3 G;  4YJ2 A;  2YC0 A;  4KL1 A;  3CEI A;  1JX9 A;  4PA9 A;  2HR3 A;  4YY3 B;  5KA5 A;  1SET A;  3JCZ A;  1K5Q A;  3ETE A;  1FXK B;  1BQ0 A;  2EJ7 A;  3BVO A;  1GM7 A;  1K92 A;  1M57 B;  4JI3 O;  4MVR A;  2OIE A;  1FXV A;  1H8H G;  1XHZ A;  1FJG B;  3CCS V;  2NN4 A;  4IYH A;  2Q7H A;  1R3I C;  3UO2 A;  2P6J A;  4GYC B;  5L3D A;  1PNL A;  2IH1 C;  2HLD G;  4JAS A;  1K4C C;  1N36 O;  3IGA C;  5LGT A;  1PKX A;  3E8G A;  3VQW A;  1S3J A;  2JS5 A;  2WLL B;  1VQ5 V;  2DW4 A;  3G6B A;  4H33 A;  1PL4 A;  2W0F C;  4KHP O;  4LF5 O;  3ABT A;  4LF4 B;  3AG4 B;  5IDJ A;  3H1I H;  2Q0A A;  4J7Z A;  3CMA V;  4UFZ A;  2A06 H;  1NVP D;  4P2Z A;  4LF6 B;  4QE7 A;  1XNR O;  3BHP A;  4PDL A;  2DQ3 A;  4O2A B;  4J9Y B;  1M56 B;  1ARO P;  5LGU A;  2UU9 B;  2UXC O;  1WLE A;  1K97 A;  4PI2 A;  3AG2 B;  3CX5 F;  1Q43 A;  1Q6H A;  2QWQ B;  2WSS G;  4JV5 B;  4U7O A;  4FM0 A;  1U97 A;  2IJI A;  5EIB C;  2DJV A;  4FK5 C;  4E4E A;  3K5O A;  4MVZ A;  1EZV H;  2YDE A;  1H2S B;  1VQ4 V;  3FB6 C;  2ILM A;  4ZI7 A;  3HKE A;  1Q6U A;  2V7Q G; 
#chains in the Genus database with same CATH homology
 3SYP A;  1R3J C;  3RBZ A;  2DWD C;  1UJW B;  2JK5 C;  2YEV A;  3ABL C;  2F43 G;  1R6N A;  1F4M A;  2NLJ C;  3ABK B;  1AI6 A;  4MVQ A;  1YTF B;  4WFB V;  3CYO A;  5CA3 A;  2YSU B;  2W6J G;  3K0D A;  1Y66 A;  2XAS A;  5IYD O;  3RW0 A;  4U7N A;  3W7W A;  1NJI W;  1COW G;  4Z1M G;  5L3B A;  5CBF A;  5B3S B;  3K79 A;  1K3E A;  1V55 C;  1RPO A;  4TWK A;  5CBH A;  2M7W A;  3G6E V;  3AG3 B;  3QO7 A;  1VQ6 V;  1GM9 A;  2IH3 C;  5CN0 A;  3AG3 C;  1OCO C;  1YIT V;  4QIW F;  1QVF U;  3OW2 U;  1OCO B;  3CXC U;  1MSW D;  3CP1 A;  3LSQ A;  3ZRW B;  2IJJ A;  4X89 A;  3X2Q B;  4G2K A;  3GB7 C;  2JIZ G;  3D36 A;  3T4D A;  1CPY A;  2B1G A;  3RVY A;  1WPX A;  1JOY A;  2A9H A;  2QTO A;  4TT3 G;  3SYC A;  1VQ7 V;  5B1A B;  5E1A C;  3SYQ A;  5DN6 G;  3IFX A;  1KD1 W;  1NR1 A;  3E86 A;  4RQE A;  4MTG A;  1RM1 C;  1VQK V;  3OE7 G;  2PI5 A;  1RM1 B;  1SRY A;  1OCC C;  5EBL C;  2AHY A;  2XAF A;  1YI2 V;  2OTL V;  3G4S V;  2XAJ A;  1BHA A;  3CCL V;  2QM8 A;  2XND G;  5EC1 C;  1M1K W;  1GTO A;  4LBE C;  3MHS C;  5B1B C;  1B6Q A;  2WLI B;  2ATK C;  2DQ0 A;  4P9O A;  5B1B B;  5CMU A;  4G28 B;  3FYE B;  2K1E A;  3T1C A;  4QPJ A;  4WFG A;  1QLN A;  3JD3 A;  3ZCC A;  4UV8 A;  4LC1 A;  3BEH A;  1V54 B;  3ASO B;  3K9A A;  3E8F A;  1FFT B;  4TSF G;  4RUE A;  3ASO C;  4GX2 A;  2DYR C;  4RO2 A;  2FTK A;  2QEX V;  1BL8 A;  4X88 A;  2D3O W;  2R9R B;  3SPH A;  1I5X A;  2DYR B;  3DTU B;  2EIK C;  4WF9 V;  4JAV A;  1KP2 A;  2DYS C;  3CC4 V;  2LFR A;  3OFN G;  3ZMT A;  1OCR B;  1JCH A;  1NR7 A;  2R9I A;  3W7X A;  1EZJ A;  2Q67 A;  2XAH A;  3MHH C;  4G27 B;  1THZ A;  1DLB A;  4GX0 A;  3B8M A;  1MAB G;  3SPG A;  4MS2 A;  3STZ C;  2BOC C;  2A0L A;  4PA4 A;  2DWE C;  3T4Z A;  1Q7Y W;  1XL6 A;  4JYC A;  1VQM V;  5L3E A;  2IJK A;  4N21 A;  1YJW V;  2ZXW C;  1DF4 A;  4GT1 A;  1AJQ A;  2X6A A;  2UXN A;  1LNQ A;  3E83 A;  3WG7 B;  5DM6 V;  4BIU A;  4BAY A;  1W0J G;  4WCE V;  1Q86 W;  5GW7 A;  2EIK B;  1E1Q G;  1M9N A;  1YJN V;  1KKD A;  2EIN C;  2ZR2 A;  3CCR V;  5EBM C;  4R6Z A;  3SYA A;  3ZMZ A;  3W7U A;  3K04 A;  3TK1 A;  3ABL B;  3B77 A;  3P30 A;  4PA7 A;  3ZMV A;  3TET A;  4FJC C;  2JDI G;  2WLK A;  3AG2 C;  2EIL C;  3CD6 V;  3ABM C;  2HFE C;  1YJ9 V;  3ZRW A;  1Y4M A;  5H6R A;  1ORQ C;  3W7T A;  4GX1 A;  3ZRS A;  2KB1 A;  3HB3 B;  3ML0 A;  4Q20 A;  4JTD B;  4JYB A;  5HFL A;  4YXW G;  2EBO A;  2GHY A;  1GKF A;  1V55 B;  3F7Y C;  3E89 A;  5LGN A;  1SES A;  1NH2 D;  2ITC C;  2ZXW B;  1P4R A;  3JD2 A;  2JJ2 G;  1AI4 A;  2NNU A;  1AR1 B;  3JD0 A;  1AI7 A;  2ZD9 A;  3OMN B;  4BW5 A;  1KC8 W;  4R8C A;  2BOB C;  4UV9 A;  3EFF K;  2EIN B;  3I56 V;  3SPC A;  1S72 V;  3QO5 A;  4N23 A;  2Y69 C;  2PI4 A;  3CCV V;  2QE7 G;  2XAG A;  4ZBM A;  2C2A A;  3K3W A;  4MVM A;  1L1F A;  1MG1 A;  3SYO A;  3ABK C;  4ZKI A;  4MW8 A;  2EIL B;  1RPR A;  1OHH G;  2EJR A;  2X6C A;  4L87 A;  5B1A C;  3ZMU A;  1F4N A;  1AJP A;  3P32 A;  2EIJ C;  5J9P C;  1ENV A;  1IXM A;  1QVG U;  3OUF A;  4XDJ A;  5H6Q A;  3FKS G;  2ZQM A;  1GK9 A;  3OEE G;  3DGE A;  4MT8 A;  2HJF C;  1S77 D;  1GO3 F;  5KA6 A;  4MVU A;  2ZDI C;  2OCC C;  1S76 D;  3B8N A;  2OCC B;  4MTF A;  3CPW U;  4J9Z B;  3T2M A;  5IY5 B;  1GMG A;  2OT5 A;  3FB7 C;  5IY5 C;  3ZJZ A;  3ASN B;  3SPJ A;  3JYC A;  2W6I G;  4XDL A;  4XDK A;  5HFM A;  2Z5U A;  4KP4 A;  4QE9 A;  1EBO A;  2AHZ A;  3OAA G;  3LNM B;  1I5Y A;  5KUM A;  4UVB A;  4R50 A;  1DF5 A;  1CP9 A;  1K5S A;  2IJH A;  1E1R G;  4I5S A;  1F51 A;  2LFS A;  4JTC B;  3W7S A;  2LP7 A;  2YEV B;  2Q68 A;  2JJ1 G;  4BIZ A;  1QR9 A;  2EIJ B;  4FIP C;  1NKD A;  2H94 A;  4OXS A;  1F23 A;  1OCC B;  3VBB A;  1JQ0 A;  3SPI A;  1KP3 A;  1FXK A;  2IW5 A;  1S0V A;  1S5H C;  4WFH A;  2IU0 A;  4CZZ A;  1VQO V;  4PEL A;  3EHB B;  5EC2 C;  2EZP A;  2Y48 A;  1R73 A;  1R3L C;  2ZDI A;  3ASN C;  1JPX A;  4GX5 A;  4QNH B;  3CCJ V;  4WFE A;  4GCZ A;  3E8B A;  1OCZ C;  2QA4 V;  1OCZ B;  3ZMS A;  1NBM G;  4PA3 A;  1KEC A;  2WAM A;  3AG1 C;  3CC7 V;  1W0K G;  5B1N A;  4UVC A;  3AG1 B;  4I9W A;  3FB5 C;  1J95 A;  3F7V C;  4JPR A;  3KG2 A;  3IC7 A;  4PDR A;  4WFA V;  2Q69 A;  5L3G A;  1VQL V;  2Q6A A;  2DYS B;  3ETG A;  3ETD A;  5LHI A;  1M56 C;  4EKW A;  3WFV A;  4HZ3 A;  4XBF A;  1K8A W;  4RAI A;  4H37 A;  5EBW C;  1VQN V;  1E79 G;  1AI5 A;  2B1I A;  1YIJ V;  2JEU A;  4KFM A;  1PD3 A;  2IU3 A;  1PNM A;  2V1D A;  3LSS A;  2ZR3 A;  2JEX A;  2QM7 A;  2EZO A;  2B5U A;  1W2B U;  3ZRV A;  1HWY A;  4UVA A;  2P67 A;  1CEZ A;  4F4L A;  1AJN A;  1K34 A;  3FB8 C;  1JVM A;  1BHB A;  5IYC O;  2XOK G;  1QLE C;  3QO8 A;  4QJF B;  1H8E G;  3OUS A;  3CCM V;  1H38 A;  2EIM B;  3X2Q C;  3CCE V;  3QNE A;  2OTJ V;  4MTO A;  1OZ0 A;  2WPD G;  4PDM A;  3D3I A;  5L3F A;  1H2G A;  3JD4 A;  5CBG A;  2MK3 A;  4P30 A;  4HYO A;  3G71 V;  3LDC A;  5KUK A;  3E2E A;  1N8R W;  2WLJ A;  1JJ2 U;  2P90 A;  2H8P C;  2HVK C;  3I55 V;  1G8M A;  1Q81 W;  1YTF D;  1NH2 B;  3FYI B;  4MVO A;  3ZN1 A;  4RQF A;  2HKO A;  1G4Y B;  3LDE A;  1QCE A;  3OR7 C;  1VQP V;  1VQ8 V;  2QKS A;  3K03 A;  3OMI B;  1TUE B;  3ZN0 A;  2WWW A;  3MD0 A;  1PL0 A;  2CK3 G;  4MVS A;  1R6K A;  3K08 A;  1K73 W;  1ROP A;  1JX9 A;  3GWO A;  2Z3Y A;  2HG5 C;  1NQT A;  4PA9 A;  4WFF A;  5B1O A;  5LHG A;  2HR3 A;  5KA5 A;  1QR8 A;  1SET A;  3A0R A;  3JCZ A;  3RVZ A;  1K5Q A;  3VOU A;  3AEI A;  3E35 A;  3R65 A;  1QLE B;  3CME V;  1GM8 A;  4JAU A;  3ETE A;  1YHQ V;  4E2L A;  1FXK B;  1FS0 G;  1GM7 A;  4JF3 A;  1K92 A;  1FXK C;  1PNK A;  1XL4 A;  1K9M W;  1M57 B;  3ZIA G;  3F5W C;  4MVR A;  5C93 A;  1YSC A;  1FXV A;  1M57 C;  1QBZ A;  3E8H A;  1H8H G;  1P7B A;  2HVJ C;  5LBQ A;  3CCS V;  4R7C A;  4DXW A;  4JGS A;  1BMF G;  5EK0 A;  3ZRX A;  3M99 B;  4ASU G;  1R3I C;  1OCR C;  3OMA B;  4QPK A;  2WLH A;  2P6J A;  4P9P A;  3OR6 C;  5L3D A;  2X0L A;  1R3K C;  1PNL A;  3OM3 B;  1K7D A;  1M90 W;  2IH1 C;  2HLD G;  1NVP B;  1SER A;  4JAS A;  3BY6 A;  4HAM A;  4LP8 A;  1EFR G;  1K4C C;  3IGA C;  1ZWI C;  5LGT A;  1K4D C;  1PKX A;  1SZT A;  3E8G A;  3UKM A;  1S3J A;  3HPL C;  3H01 A;  2WLL B;  3K0G A;  5FL7 G;  1VQ5 V;  3NXS A;  4FPP A;  2DW4 A;  4H33 A;  4FMT A;  4UUJ C;  3SJQ C;  2W0F C;  3AG4 C;  3ABT A;  3OGC C;  2X6B A;  3AG4 B;  5IDJ A;  3CCQ V;  3CC2 V;  4RUF A;  3CMA V;  1NVP D;  1V54 C;  3UM7 A;  3WG7 C;  4LCU C;  4P2Z A;  2UXX A;  1FXH A;  4QE7 A;  3K06 A;  2WLN A;  4PDL A;  2GSM B;  3LDD A;  1KQS U;  2DQ3 A;  4JTA B;  4J9Y B;  1K33 A;  1M56 B;  3JD1 A;  1ARO P;  4PA6 A;  5IYB O;  5LGU A;  5H9C A;  3TCU A;  1DTO A;  1WLE A;  1K97 A;  4CBC A;  1MOF A;  4DO2 A;  3AG2 B;  3ABM B;  4MW3 A;  4MTX A;  5L3C A;  1VQ9 V;  5LHH A;  2ITD C;  2WSS G;  4KUM A;  4U7O A;  3CCU V;  2WLM A;  2IJI A;  5B3S C;  3OEH G;  2A79 B;  2WLI A;  2WLL A;  4FK5 C;  4MSW C;  4UXN A;  3LUT B;  3ABU A;  3PJS K;  4MVZ A;  1Q82 W;  2P7T C;  4X8A A;  5BZB A;  2X7R B;  1VQ4 V;  3FB6 C;  3STL C;  4PDV A;  2EIM C;  2XAQ A;  2V7Q G;  2Y69 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...