3GB7C

Potassium channel kcsa-fab complex in li+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gb7C00
3T4DA 4R7CA 4GX5A 1LNQA 2A9HA 4JTCB 4P9PA 4BW5A 3LDCA 4MS2A 4R6ZA 1V55C 3E89A 2Q68A 2WLKA 3AG1C 2Q69A 2A79B 3OGCC 4J9YB 5B1AC 4QNHB 4WFHA 3E8BA 2EINC 3K0DA 2X6CA 3PJSK 4MTFA 3RBZA 4GX1A 3AG2C 5KUMA 4JTDB 4WFFA 2ITDC 4LCUC 3SYCA 2IH3C 1P7BA 3UM7A 4MW8A 4MW3A 3BEHA 3SJQC 5EBWC 2WLIA 4GX2A 1OCOC 3F7YC 3SYAA 3SYQA 4CBCA 1QLEC 3FB7C 4KFMA 2HFEC 2IH1C 4MSWC 4PDLA 4GX0A 4XDKA 3K08A 1M56C 3RW0A 4P9OA 3SYPA 4XDJA 3HPLC 4PA4A 4RUFA 4X89A 4X8AA 3K0GA 1ZWIC 1S5HC 4PA6A 3E8HA 4MVZA 4LP8A 1K4CC 3RVZA 2WLLA 2BOBC 2K1EA 2X6AA 2ITCC 4H33A 3F7VC 3OUFA 2WLHA 4ZBMA 3IFXA 2ATKC 3UKMA 2EIJC 2A0LA 5B3SC 4H37A 3ABKC 3OR7C 2Q6AA 3SPJA 1R3IC 3SPGA 3SPIA 2Q67A 3ABLC 4LBEC 3STZC 3LNMB 2BOCC 4MVUA 5E1AC 3STLC 3T2MA 3E83A 3EFFK 4XDLA 4OXSA 2QTOA 4QE7A 1XL4A 3X2QC 4RO2A 3SPCA 2P7TC 2EILC 2WLIB 1ORQC 2QKSA 3GB7C 1XL6A 2WLNA 5CBFA 3OR6C 1OCRC 4HYOA 1OCZC 4J9ZB 5EC2C 1OCCC 4MTGA 4X88A 4P30A 3RVYA 2ZD9A 4MTOA 5BZBA 2W0FC 2DYRC 3ASOC 3FB6C 2DYSC 2NLJC 4PDRA 3ABMC 3VOUA 4RAIA 1G4YB 2HVKC 2ZXWC 4MVQA 2WLLB 4QE9A 3R65A 3KG2A 4UUJC 4R50A 4R8CA 2EIKC 4PA7A 3WG7C 1JVMA 4G28B 2JK5C 5KUKA 1BL8A 4TWKA 4PDMA 1R3KC 5CBHA 1M57C 3K04A 5B1BC 3OUSA 4I9WA 2HVJC 4PDVA 3E86A 4HZ3A 3K06A 3LDEA 5EC1C 2HG5C 3T4ZA 4RUEA 5IY5C 2AHYA 2OCCC 5J9PC 3JYCA 2KB1A 3LUTB 2H8PC 1V54C 4F4LA 5EK0A 3AG3C 4PA3A 2YEVA 3IGAC 5EBMC 3F5WC 3ZJZA 3E8FA 3SYOA 4PA9A 4MVRA 2X6BA 3T1CA 3ZRSA 2WLMA 1K4DC 3LDDA 3SPHA 4WFGA 2EIMC 3FB5C 5CBGA 2WLJA 4WFEA 1R3LC 3ASNC 3K03A 4EKWA 1R3JC 2HJFC 3AG4C 4MVOA 3FB8C 4JTAB 4G27B 4P2ZA 1KKDA 4DXWA 2DWDC 1J95A 2Y69C 3TCUA 3TETA 4MVMA 2R9RB 5EBLC 2AHZA 2DWEC 4MVSA 3E8GA
chains in the Genus database with same CATH superfamily
2N74A 2XNDG 4LF7B 3C3TA 2Y4TA 3LDCA 1Q90D 3OMIB 3P30A 4LNUB 4JI1B 4WFHA 4I0XB 4YY3O 4MTFA 2EBOA 4YIOA 4JTDB 4X64B 3CRRA 4MW8A 2VQFB 2QWNB 4U7NA 3ZCCA 1QLEB 1GM7A 2LJ2A 4CH5A 1XOUA 1K9MW 1AJNA 4P9OA 4X89A 4J7KA 4PA6A 4B3MB 4L87A 4K8ZA 2YUAA 2GV9A 5B66Z 3RVZA 2YIBD 4LWSB 2BOBC 3H01A 4OPHA 5GW7A 1OV9A 1NH2D 1K97A 4W4KA 2Y0IA 4DR1O 4LH6A 3ABKB 3LSSA 3HB3B 3QO8A 4EB6A 4JZ2A 4UVAA 1GN3A 4UVBA 4QE7A 2E5LO 4YJ3B 3G4SV 1HDJA 5D5PA 4I50A 1U97A 2XAGA 1BSMA 5EYPB 3E22B 4YHHO 3OM3B 3RYFA 4H0LB 5KHIA 3ABMB 2ZDIA 3RN4A 3ABTA 4W4LA 4B3TO 1XEQA 3MHHC 4TWKA 4PDMA 1H2MA 3FD9A 2JVDA 2KKWA 3CCMV 1H8EG 3B4SA 5IY5C 3J7AU 4JYAO 2GHYA 1W0JG 4I9QA 2HJDA 2F4VO 4JZGA 3EHBB 3L71H 2V4DA 4FLUA 1JFFB 2AGAA 1Q8IA 3RYCA 3AG4C 3CB2A 4CH3A 1J95A 3ZBHA 2R9RB 2BTOA 1G6UA 4F6RA 1FJGB 1LNQA 2PI5A 1JPXA 4BW5A 1N34O 2R9IA 2CH7A 3M7MX 1FFTB 3OGIB 2W6JG 3AG3B 2P6JA 2EINC 1K3EA 5KUMA 5ITZA 2ITDC 2IJKA 1I94O 1Z5VA 1AR5A 4FZ0A 3K59A 5LOVA 3HKDA 2GTSA 4FK5C 2ZR2A 1S5HC 4QIWF 2W6IG 5BMVA 3Q4HA 2XTAA 5DM6V 4B3RB 4AI8A 2UXBB 2A0LA 4JAVA 2CTWA 4DV0O 1GKFA 3ZRWA 4CC5A 3HKCB 2Q9LA 4YY3B 4LNUA 4JI4O 5CA3A 1VQ7V 2JEXA 5IJ0B 4BIZA 2QKAA 3RYIB 2XAHA 4ZKIA 1K33A 1M9NA 3IC7A 2HHHB 1I0HA 4I55B 2DYRB 1G4YB 4X62O 1Y76B 1SZXA 3G80A 5KUKA 1AROP 2ADQB 3OUSA 2HVJC 1EBOA 3ZMZA 3ZHQA 5JWPA 2Q0AA 3NR7A 1BT8A 5H6QA 3A0BZ 3LUTB 2Q7EA 1GMGA 3AG3C 1SERA 3UT5B 2E5LB 2OCHA 2R72A 3SYOA 4QGPA 1PPJH 1GM8A 1O9HA 2MW2B 3L9DA 4YHHB 3ASNC 2XOKG 1GO3F 4MVOA 5JVDB 4G27B 1JJ2U 5EYPA 3L72H 4TV9A 1H2NA 2EZOA 5DEDA 4G2KA 4XBFA 2VWKA 2DWEC 1XHZA 2M6YA 1SQGA 4NTYA 1GN4A 3T4DA 4D7SA 5L3CA 5J2UB 2UU9B 4DRXA 3OW2U 4GT1A 1S76D 3PJSK 4KL1A 4PD4F 4JYAB 3ZMUA 2F4VB 3SYAA 1E1RG 2BSKA 5FLXN 1SQBH 4PDLA 1SQQH 2WA4A 4NB5A 5B1AB 2BE3A 1GRJA 1JFFA 1K4CC 5BXZA 2LFSA 3F7VC 3OUFA 5CA1B 3CCRV 5CB4B 1N36B 1N34B 2G38A 1E1QG 2YSUB 3LNMB 1Q6HA 4UCUA 2QEXV 3X2QB 3SPCA 3K79A 1I94B 1HNWO 3ZN1A 4JI8O 2ZIOA 4I7ZB 4NXNO 4MTGA 1KECA 3UO3A 1UPGA 5LYJB 1M93A 3CXCU 4FJCC 3B77A 4DK1A 1Y4MA 3WG7B 3N2KA 1FS0G 4YJ2A 4DV0B 4HNAA 4J10A 4A5UB 4JAUA 4KP4A 5EC1C 1RSOB 1YDXA 2WSSG 3JYCA 4FLXA 1NZ6A 2QWOB 4JI4B 4HBNA 4OGQB 5KAIZ 1KMIZ 2X6BA 2YC0A 3ZEDA 3LDDA 2WLJA 4NTXA 4E4EA 4EKWA 4P2ZA 5FPRA 5IJ0A 4X62B 3RYIA 1AI6A 4TSFG 1NH2B 4I55A 5B1AC 4MVSA 3E8GA 3AK1A 4R7CA 4QJFB 2WA3A 4MS2A 3ETDA 1Y76A 2CTPA 1B3QA 4U7OA 2JIZG 2DQ3A 1YJNV 1IBKO 1Q7YW 4PHZA 3H1JH 5EBWC 3SYQA 3ZHRA 4FVMA 1G1XB 3E35A 3OMAB 2VRZA 1DF5A 5GTIZ 1T5EA 3CJHB 2AZ0A 2HP8A 3TXSA 4LP8A 4K0KO 3WFVA 1GTOA 4H37A 2Q6AA 5LGTA 2Q67A 1Q86W 1YF2A 2F66C 1F23A 2OIGA 3DGEA 1WJZA 5J2UA 2YIAA 3EFFK 3I55V 4DV3B 4LFBB 5EIBC 1CPYA 2KG7B 4DW0A 4JYBA 2B1IA 1OCCB 4JI6O 5A2QN 4GZRB 2PYLA 3VBBA 1AI4A 1ZAUA 1U96A 3SGIA 4R8CA 2HEPA 3ZHVA 1JVMA 2JK5C 1W0KG 3THOA 3ETQA 2E75B 5K1PA 2GTAA 4LFCO 4B7KA 2L35A 2ZM6B 4LH7A 3G71V 1SESA 1AR1B 4O2BA 1QR8A 3O65A 3ZHSA 5IJ9A 2YEVA 3CCLV 1HNWB 5KHHA 1KB9F 4QPKA 4JI8B 2ZXWB 3N2GB 4NXNB 3OEHG 1IDSA 5B1NA 4IYIA 1SRYA 4O4LA 2AW9A 4J11A 2XASA 3JARB 2Y69C 1NVPD 2EJRA 1VEWA 2YIDA 2CTRA 3ZMSA 2ETNA 1LR1A 4B3SO 2JJ1G 2Q68A 2Q69A 4X1YB 3VQVA 4GX1A 2BCCH 3OTOO 5JJEB 4JI3O 4MW3A 3C90A 5FNVB 1IBMO 3CSXA 1WP7A 2HFEC 2IH1C 3CD6V 1R73A 3JD4A 2RQ6A 4I5SA 3D8CA 1AP6A 1Q3EA 3K3WA 2B5UA 3ZMVA 3WB0A 1V55B 1ZSPA 2K1EA 1IURA 1PL0A 3JASA 3UKMA 2EIJB 4NXMO 1OHHG 2YIBA 4DV6O 3M99B 1IBKB 1J5EO 3T1YO 3MD0A 4O4JA 5KAFZ 2P4KA 1Z5WA 4PI0A 1EFRG 3OR6C 5EC2C 1VF7A 2IJHA 2UUAO 4PDRA 3OT7A 2YI9A 1VQ9V 2ZXWC 1TVKB 5EZYB 4DV1O 3ABLB 1QHTA 4K0KB 1QBZA 1EN6A 5LMNO 1R3KC 4Z1MG 4TT3G 2B9ZA 1AJQA 1JR9A 1SQPH 1SKVA 4RUEA 2PTMA 3UQ8A 1SA0A 1YSCA 1XNQB 5EBMC 4DV4B 4CH4A 4ASUG 4BIUA 1H2LA 1WPXA 4FM2A 5JH7B 1KKDA 1FXKC 3A8TA 2DOSA 4MTXA 4DV7O 1XI1A 4TQFA 1SQVH 5LHGA 4UCTA 3W7TA 4WBNA 1V55C 5LP6C 1ZX3A 5KHGA 3ETEA 4QNHB 4H44B 5K1XA 2JDIG 1KP3A 3ABUA 4LR3A 3AG2B 3CC2V 3SJQC 3ZRXA 4YXWG 5LGUA 1FFXA 4IHJB 3MAQA 4O4IB 1M56B 2DW4A 3W7XA 3QO5A 5KX5A 4AHCA 2V7QG 3ZN0A 3K9AA 3AG1B 1R6TA 3SPJA 3OR7C 2YDEA 4IGGA 3ABLC 2VS0A 3APOA 3TK1A 2Q5ZA 1FKAO 3U11A 2UXXA 3E83A 3A2FA 4XDLA 3FYEB 1SS3A 3OTOB 4RO2A 3TJTA 1PP9H 1IBMB 1AJPA 3B8MA 5CBFA 5GONA 5JQGA 4CS2A 1JMKC 1QQCA 3F5TA 1OCZC 1PKXA 1NT2B 4X20B 3VOUA 2F23A 2XAQA 1FXKA 2WLLB 1ZUQA 2AZ2A 4PA7A 4JF3A 2UXDO 3K04A 4NXMB 1M4UA 3AK3A 4PDVA 1I7FA 4FIPC 5H2FZ 5LP6A 4NYKA 2EILB 4UV9A 3T1YB 3T4ZA 4X1IB 2OCCC 3W7SA 1RM1B 1BS3A 1S72V 3A0RA 1DTOA 1N0NA 5EK0A 4PA3A 3QVNA 3FKSG 4BAYA 1IBLB 3ASOB 1WP8A 2JGDB 1NQTA 1K5QA 4WFEA 1R3LC 2EIKB 3K03A 5KMGB 5LBQA 1H38A 1R3JC 1I08A 2UUAB 1F4NA 1COWG 1MSDA 2EZPA 1A32A 5LMNB 2O57A 1JOYA 2WLKA 3AG1C 4Q6GA 2A79B 1H2GA 4LC1A 1NTZH 4WFFA 3TXQA 5DECA 1QLEC 1WA8A 2QGNA 4JI0O 4C7UA 4FLWA 2FYUH 1FYJA 3K0GA 4JI7O 2BTQA 5IYDO 5D5QA 4IT5A 4DV7B 3WB2A 3ABKC 3SPIA 2Y4UA 1QLNA 2OT5A 2VWJA 2PUSA 2BOCC 3B2EE 2PZSA 4MVUA 1H2KA 2QTOA 2WPDG 3LSUA 2QWPB 2EILC 2YXLA 5IWAO 1YITV 3OFNG 1M90W 1UFIA 3U0ZA 1N32O 3SJCC 3RVYA 1FPOA 4NKGB 2DQ0A 3BRCA 2Z5UA 3ASOC 1B6QA 1EN4A 5A9GA 5DN6G 3AEIA 3ABMC 1NVPB 4MVQA 2OYQA 4O4IA 4FLZA 4R50A 2EIKC 1PNKA 1VQLV 2E3CA 4DW1A 1GK9A 3QG5A 1Q81W 4UFZA 1IVSA 2UUCO 2R9AA 4I0XA 1NR7A 1Q6IA 2IJJA 1QCEA 4JI5O 3JSLA 1S5JA 4DR3O 3IAYA 3BCCH 2V1DA 3WU2Z 4NTWA 1F4MA 1K73W 2UXCO 4DR1B 1S5LZ 5B1BB 2P4VA 5EBLC 4K8XA 4LWSA 1TA8A 4OX9O 3S3XA 1K8AW 2QM8A 3JCUZ 1K34A 3CRAA 2D3OW 4B08A 3OGCC 2PY5A 5H9CA 1JX9A 4UCOA 3WB1A 4AQYO 1BMFG 1FXHA 2CDYA 4D6TH 4DV5O 2RNBA 4YJ3A 3F7YC 3JATB 3VQWA 2XHBA 3FB7C 4GCZA 1XQ8A 1K7DA 3CRMA 1XHXA 3EXAA 4B3TB 3SYPA 3E22A 1WAZA 3OTFA 2JGDA 4MVZA 4JYYA 4GKKO 1WB7A 2YXHA 3CMEV 2H3OA 4BIOA 1R3IC 1ZTEA 3D36C 4CZZA 2DJVA 3OD4A 2ZKOA 2Q7GA 1XL4A 5AG2A 2L6LA 2YI8A 2X0LA 4JI0B 2F95B 2QKCA 3QF7A 5BZBA 2P90A 2DYRC 1YJWV 3FB6C 1VMGA 1AVMA 4JI7B 3FAVB 1WPBA 3GVMA 5IE9A 1TUBB 2NNUA 4OPAA 5B1BC 3KZIZ 1P49A 4FM1A 1R1BA 5CMUA 3CC7V 1DGSA 4LF5O 3CX5F 4E2LA 1QR9A 1YIJV 3RYHB 1MABG 5IWAB 1BZKA 3MHSC 1N32B 5LGNA 3FB5C 1X59A 3H9VA 1HNZO 4DXWA 4B7EA 2ZE6A 4FFBB 1YEWA 2D2CB 2ZT9B 4YIPA 1GH6A 3D36A 4J9YB 3C3SA 4UXNA 1JQ0A 3BY6A 3HKCA 2UUCB 2YS8A 3MDSA 4O2AB 3K0DA 1KD1W 4CH6A 4D7TA 4JI5B 1Y66A 3FYIB 3RGBA 4CBCA 1VQ6V 3DXRB 4L8JA 4DR3B 2ZINA 1TGOA 5J2TB 5LHHA 1VQKV 3K08A 4X66O 2LW1A 2ODMA 4K35A 1HR0O 2UXCB 4JI2O 3IFXA 4OX9B 2CTQA 1GN6A 3CS5A 2CGOA 3J81N 5E79Z 3D3IA 4AQYB 4RWUA 3ML0A 3X2QC 2WLIB 2EX3A 5JJNB 4WCEV 3UT5A 3ZIAG 4NR1A 3CYOA 1X4TA 1B06A 5HFMA 4PJ0Z 4TOIA 2Q4PA 5JVDA 2Q7HA 3KG2A 3WG7C 5CBHA 2Y0PA 2A7WA 1Z2GA 3ZX6A 1AI7A 5LHIA 3M8AA 2JEUA 4ZI7B 3DC6A 1HNXO 3H1KH 2CK3G 2P22C 4F4LA 3B09A 3F5WC 3CEIA 4FLVA 3ZRSA 4J42A 2NR5A 4FMTA 4PI2A 1EM1A 4N21A 3L75H 3HKEB 2Q8VA 5CA1A 3K58A 5CB4A 4DV2O 4U3JB 4JASA 2W0XA 4X1KB 3OAAG 2X6CA 4ZHQB 4LF5B 5C8YB 1XMQO 1P7BA 3H1LH 1XDCA 1OCOB 2ZIMA 4KFMA 4ZOLB 1PD3A 3CE2A 1SC5B 5H5NA 1HNZB 3QNEA 4IIJB 2Z3YA 5LYJA 1MZFA 4UCSA 2IM9A 3KCYA 1NBMG 1F7YA 2M7WA 4BR6A 3DTUB 1QU7A 3ZRVA 3BA9A 1GN2A 2FMLA 1YJ9V 1K5SA 1RSOA 1XMOO 3RFRA 5LA6B 4JI1O 5KHKA 1L8DA 4DK0A 2KQXA 4PELA 2QKSA 1FAFA 4TUYB 1DK1A 3BAAA 3CRQA 3BHPA 1OCCC 2GSMB 1I5YA 4X66B 4FLYA 2HLDG 2DYSB 2HKOA 1HR0B 3R65A 2CAZC 4JV5O 4JI2B 1NTMH 2IW5A 4EB6B 2C2AA 1CP9A 3K06A 3H1IH 1E79G 5FL7G 2AHYA 1V54B 4IYHA 4I50B 1M1KW 2ZCEA 1R6NA 1RFYA 4NVPA 2LGQA 4WFGA 1HWYA 4UCVA 2FTKA 3RYFB 5KLVH 3BA8A 3CJHA 2DWDC 1M57B 3IJ4A 1YI2V 2CGNA 2A9HA 3I5DA 3B8NA 4JTCB 2FB5A 1NKDA 2OTLV 2P67A 4FPPA 1Q6UA 3KKYA 3OMNB 4DYLA 2ADPA 1SF9A 3UM7A 2LGWA 3BEHA 1VIBA 4Q20A 4JI6B 2KG7A 4DR7O 5FPOA 4ZI7A 3RYCB 4XDJA 1CEZA 4FM0A 1S0VA 2XT9A 1NI8A 2P06A 1EZVH 2Q0OC 2X6AA 4F6RB 4LFCB 3VQYA 1SZTA 3K5MA 2EIJC 1F51A 3G6BA 4UCRA 1KP2A 3JAWB 1BGYH 2CH7B 4DV2B 2QWRB 2FKXA 3STZC 4JAAA 2A3QA 5KHJA 3HKEA 1L0NH 5JCOC 4CS3A 4DR5O 1KKCA 2IBZH 1ROPA 1NTKH 3FFQA 1XMQB 2Y48A 2QTSA 1VQMV 5LOVB 2ZE5A 1XILA 3CWBH 4X88A 2W0FC 3N2GA 4B3SB 3JARA 3Q4HB 4UUJC 3JALB 1SETA 3QTCA 4FLTA 2P5OA 1M57C 1VF6C 5BY1A 3ZRWB 4I9WA 4JPRA 2UXBO 4JI3B 3RT3C 1H8HG 4X1YA 5IY5B 2H94A 1XMOB 2QM7A 2OIEA 5EIBD 5FNVA 4PA9A 4MVRA 2RCVA 3U10A 5LA6A 4J41A 3W7WA 4TUYA 1AB3A 3AG4B 3TCUA 2ILMA 4CS4A 2HHHO 1W59A 5CA0B 4JV5B 4DV6B 5L3EA 1ZL8B 1FXVA 1J5EB 2LFRA 1TAEA 1L0LH 1IXMA 3E8BA 2GUZB 2EINB 2DE0X 5JCOA 2ZR3A 3A0HZ 3AG2C 4WF9V 4J7ZA 2X7RB 5GTHZ 2XUMA 1TUEB 2EIMB 3QO7A 4KHPO 1MA1A 4AILC 1N4CA 1M56C 4LFAO 4DV1B 4PA4A 4UB6Z 2JS3A 3E8HA 4TV9B 4H13B 1XNRO 4H33A 1TVKA 5EZYA 4FFKA 5LXTB 4LF6O 1VF6A 4DRXB 3GWKC 3K5OA 5E1AC 1ZLZA 5C93A 5TISZ 2UU9O 2XAJA 4LF4O 4DR4O 1ORQC 3KCXA 2BSKB 3D3QA 4J7JA 5IYCO 4RQFA 1BQ0A 4DR7B 3SJAC 1BQZA 1WN7A 3TGUH 3JD3A 4DUZO 5JH7A 5B3SB 1PV0A 4QE9A 1G8MA 1LUVA 2RN9A 1D5AA 4TQDA 1N36O 4DR5B 1RM1C 3JAWA 1S77D 1W2BU 1V9PA 3JD0A 3L74H 2WLMA 2N05A 4IHJA 1CXZB 3UO2A 1JCHA 2EIMC 3ASNB 2EJ7A 4JTAB 2RMKB 1VQ5V 2A06H 4JGSA 3P3NA 3N2KB 4YJ2B 4GX5A 2Q73A 4MT8A 3G67A 4HNAB 3JALA 1P4RA 3BABA 3RBZA 2GDSA 1RP3B 4LCUC 3LSQA 2IU3A 4GKJO 1I5XA 3RW0A 2HR3A 3HPLC 2JJ2G 4RUFA 1OZ0A 3G6EV 1YVWA 4X20A 2PYJA 1URFA 3K57A 2UXDB 2WLLA 2JS5A 3CCEV 2WLHA 3I56V 4DO2A 5B3SC 4QPJA 5CA0A 1DF4A 3BVOA 3LNNA 3T2MA 1ZL8A 1Q5OA 4OXSA 2WAMA 4X1IA 1YTFB 4N23A 3HKBB 2GUZA 4KHPB 3CXHF 4Z1VA 1VQNV 5IT9N 1QNMA 3JD2A 2YICA 5LMUO 5L3BA 2ZD9A 4MTOA 4LFAB 3VQXA 5H6RA 2YXYA 3PN1A 5KMGA 4X9QA 2HVKC 1XNRB 1WLEA 1PM9A 2N04A 2UXNA 3K5NA 1NJIW 2ZNIA 4LF6B 3ZS8C 2EULA 3E86A 3S3WA 1THZA 5LXTA 1PNLA 5IYZB 2HG5C 2KB1A 1AI5A 4LF4B 4DR4B 4IL6Z 3E8FA 4DV3O 1MZEA 2QR4A 4LFBO 3SR2C 2DN9A 4DUZB 1XREA 3N27A 1FD9A 4MVMA 1IXBA 1L1FA 3SPHA 4R6ZA 3T1HO 3JSNA 4O2BB 2MK3A 5IJ9B 4JYCA 3W7UA 2YEVB 2ZM6O 5LL6Y 1WB8A 2AXTZ 5BR8O 3CCSV 4MSWC 4GX0A 4XDKA 1GM9A 1OJHA 4TV8B 1RPRA 1Y6XA 4O4LB 4WFAV 3SJBC 5KA5A 3R66A 1ZWIC 2LQTA 2F1MA 2ATKC 4U3FH 4ICGA 4DR6O 2JGUA 1R6KA 5L3GA 2RDCA 1O9GA 1YZBA 1QVGU 1HP8A 3B40A 2WLNA 4GKJB 2QSAA 2IU0A 5L3FA 5L3DA 4DUYO 3JAKB 4P30A 4X65O 1VQ4V 4LF8O 1VARA 2F43G 1LUWA 3JASB 1BL8A 2GBOA 1VQ8V 2R70A 3AK2A 5IYBO 4DV5B 4O4JB 1VP7A 2K9PA 1K92A 1KQSU 1H2SB 1BHAA 4KXRA 3CMAV 3JATA 1MNGA 3T1CA 2VQEO 1K4DC 5LMUB 1KYOF 1N0JA 3CCVV 1Y74B 3HKBA 3IC9A 2QDOA 4GKKB 1PL4A 3FB8C 3DSQA 2Y69B 1PNMA 1KBHA 1JA8A 2ZQMA 3CP1A 2AHZA 3DC5A 4O4HB 3AG7A 2QWQB 3CCUV 1RPOA 1UJWB 4HAMA 1KUQA 2QE7G 1S3JA 3H1HH 2DMXA 2IH3C 1SA0B 3ICXA 1VQOV 1Q82W 2CUGA 4UVCA 1VF5B 2LP7A 4GX2A 4UV8A 5IYZA 4K3AA 3E2EA 1XNQO 4DV4O 2ARHA 1EZJA 3CPWU 4X8AA 3CRCA 1BE3H 1JJOA 1MOFA 3CC4V 3NXSA 3FAVA 4BW9A 1IZ3A 3JCZA 4WBNB 1N33O 1TUBA 2UUBO 3JD1A 3SPGA 2E74B 1MG1A 2QM4A 3EVKA 4LBEC 3L70H 3T1HB 3O9OA 3OE7G 4CC6A 1MSWD 2ZNJA 3GWOA 3HR0A 3GB7C 5BR8B 4DR2O 1XL6A 1FFXB 4GUNA 3RYHA 1XUQA 1BCCH 3JAMN 4Z2WA 1AILA 4J9ZB 4I4TB 3ZHTA 5KX5B 2NLJC 4GLXA 4LF9O 4RAIA 1KU9A 4GYCB 3RWRD 4TV8A 1D5NA 4UB8Z 3FX7A 2NN4A 4FFBA 4G28B 2PI4A 4LF7O 4DR6B 4HZ3A 5B1OA 3P3PA 4EFEA 4O2AA 1OCRB 4X64O 4J80A 2XAFA 1ENVA 3APQA 2B1GA 2VQFO 3IGAC 1P84F 2Z0AA 5GONB 3ZJZA 4F6EA 5JQGB 3ETGA 3DXRA 4EFBA 5J2TA 5IDJA 4DUYB 5CBGA 4X65B 3K9SA 1N8RW 4B3MO 4LF8B 1FXKB 1YHQV 1KC8W 1YCIA 3JAKA 2QJ1A 3ZHUA 4P9PA 3E89A 5LP6B 3BFRA 2PF4E 4BWAA 3BPZA 1YTFD 5F2VO 3SYCA 2LO1A 2PGGA 3CHXA 2WLIA 1OCOC 3P32A 1AP5A 2VQEB 1NS1A 2KSDA 2WWWA 1IBLO 3ZMTA 1B04A 2CE4A 1MMMA 2F93B 4FZ1A 2FL4A 1NU1H 1DLBA 5CN0A 1GAXA 3CCQV 1US6A 2ITCC 1Y74A 4ZBMA 4KUMA 1HW7A 1QVFU 1HNXB 4ZIBA 2QA4V 3SDLA 4O4HA 3STLC 4EEQA 2OWOA 3K5LA 1YXBA 2P7TC 2ZE8A 1NR1A 1WA8B 1OCRC 1P7GA 4HYOA 2LW7A 2OTJV 1Y67A 1D2DA 3J80N 1IX9A 1OCZB 1BHBA 2BTQB 2DYSC 1EN5A 5HFLA 1Q43A 1FJGO 1VQPV 1N33B 1SQFA 2IJIA 2UUBB 5ITZB 4U3JA 3UCSC 5JJJB 3LDEA 4X1KA 4PV1B 1XBLA 2OCCB 5J9PC 4ZHQA 2H8PC 1V54C 5C8YA 1M5IA 3HKDB 4DR2B 2JRIA 4ABMA 4RQEA 4ZOLA 5BMVB 1AR4A 1WNSA 3CCJV 3OEEG 2HJFC 2ZDIC 3L73H 4LF9B 2RJZA 5KA6A 3TETA 4IIJA 2E76B 2ZE7A 4I4TA 1SQXH 4WFBV 5B5EZ 4B3RO
chains in the Genus database with same CATH topology
2XNDG 4GX5A 2JJ1G 3LDCA 4MT8A 2Q68A 3OMIB 2Q69A 3D36A 3P30A 4J9YB 4WFHA 4UXNA 1JQ0A 3BY6A 1P4RA 1KD1W 4MTFA 3K0DA 2EBOA 3RBZA 4GX1A 4JTDB 4LCUC 1Y66A 3LSQA 3FYIB 2IU3A 4MW8A 4MW3A 4CBCA 1VQ6V 4U7NA 3ZCCA 1QLEB 1GM7A 2HFEC 2IH1C 3CD6V 1R73A 3JD4A 1I5XA 5LHHA 1VQKV 1K9MW 3K08A 4I5SA 1AJNA 3RW0A 4P9OA 2HR3A 3HPLC 2JJ2G 3K3WA 4RUFA 4X89A 1OZ0A 3G6EV 4PA6A 2B5UA 4L87A 3ZMVA 1V55B 3RVZA 2WLLA 2BOBC 2K1EA 3H01A 5GW7A 3CCEV 1NH2D 2WLHA 1K97A 1PL0A 3IFXA 3I56V 3UKMA 2EIJB 4DO2A 5B3SC 3ABKB 1OHHG 3LSSA 3HB3B 4QPJA 3QO8A 3M99B 1DF4A 4UVAA 3T2MA 3MD0A 3D3IA 4UVBA 4OXSA 2WAMA 4QE7A 1YTFB 3ML0A 3X2QC 4N23A 2WLIB 3G4SV 4WCEV 3ZIAG 1EFRG 3OR6C 1VQNV 2XAGA 3CYOA 3JD2A 5L3BA 5EC2C 2ZD9A 4MTOA 5HFMA 3OM3B 2IJHA 5H6RA 4PDRA 3ABMB 2ZDIA 1VQ9V 2HVKC 2ZXWC 3ABTA 3KG2A 3ABLB 1QBZA 3WG7C 1WLEA 3MHHC 2UXNA 4TWKA 4PDMA 1R3KC 5CBHA 1NJIW 1AI7A 3E86A 4TT3G 4Z1MG 5LHIA 1THZA 1AJQA 3CCMV 2JEUA 1PNLA 1H8EG 2HG5C 4RUEA 5IY5C 2KB1A 2GHYA 1AI5A 2CK3G 1W0JG 4F4LA 1YSCA 5EBMC 3EHBB 3F5WC 3E8FA 3ZRSA 4ASUG 4BIUA 1WPXA 3AG4C 4FMTA 1KKDA 1FXKC 1J95A 4MTXA 4MVMA 2R9RB 4N21A 1L1FA 3SPHA 5LHGA 3W7TA 1LNQA 2PI5A 1JPXA 4BW5A 4R6ZA 1V55C 2R9IA 3ETEA 1FFTB 4JASA 4QNHB 2W6JG 3AG3B 2P6JA 2MK3A 2JDIG 2EINC 1K3EA 2X6CA 3OAAG 4JYCA 1KP3A 3ABUA 5KUMA 3AG2B 2ITDC 3CC2V 3W7UA 2YEVB 1P7BA 2IJKA 3SJQC 3ZRXA 1OCOB 4YXWG 5LGUA 3CCSV 4KFMA 1PD3A 4MSWC 4GX0A 4XDKA 1GM9A 1M56B 4WFAV 1RPRA 2DW4A 3W7XA 3QO5A 5KA5A 4FK5C 2ZR2A 3QNEA 1ZWIC 1S5HC 2V7QG 2Z3YA 3ZN0A 4QIWF 3K9AA 2W6IG 3AG1B 1NBMG 5DM6V 2M7WA 2ATKC 2A0LA 3DTUB 4JAVA 3SPJA 3OR7C 3ZRVA 1GKFA 3ABLC 3ZRWA 1R6KA 5L3GA 3TK1A 2UXXA 3E83A 1YJ9V 1QVGU 1K5SA 4XDLA 3FYEB 4RO2A 4PELA 2QKSA 5CA3A 2WLNA 1AJPA 3B8MA 5CBFA 1VQ7V 2JEXA 4BIZA 2IU0A 5L3FA 2XAHA 5L3DA 1OCZC 4ZKIA 1OCCC 1K33A 2GSMB 1I5YA 1M9NA 3IC7A 4P30A 1PKXA 2DYRB 1VQ4V 2HLDG 3VOUA 2DYSB 1G4YB 2HKOA 2XAQA 1FXKA 2F43G 2WLLB 3R65A 4PA7A 4JF3A 5KUKA 1BL8A 1AROP 3K04A 2IW5A 3OUSA 2HVJC 1EBOA 4FIPC 4PDVA 2C2AA 1CP9A 3ZMZA 1VQ8V 3K06A 5IYBO 2EILB 4UV9A 1E79G 5FL7G 3T4ZA 2AHYA 2OCCC 3W7SA 5H6QA 1RM1B 1S72V 3LUTB 3A0RA 1DTOA 1GMGA 1V54B 5EK0A 3AG3C 4PA3A 1K92A 1KQSU 1SERA 1BHAA 1M1KW 3FKSG 4BAYA 1R6NA 3CMAV 3SYOA 3ASOB 3T1CA 1K4DC 1NQTA 4WFGA 1GM8A 1HWYA 1K5QA 2FTKA 3CCVV 4WFEA 1R3LC 2EIKB 3ASNC 3K03A 2XOKG 5LBQA 1H38A 1R3JC 1GO3F 3FB8C 4MVOA 4G27B 1JJ2U 2DWDC 2Y69B 1M57B 1F4NA 1PNMA 1COWG 2EZOA 4G2KA 4XBFA 2ZQMA 2EZPA 2AHZA 2DWEC 3CP1A 1YI2V 3T4DA 4JTCB 2A9HA 5L3CA 3B8NA 1JOYA 1NKDA 2OTLV 2P67A 2WLKA 3AG1C 2A79B 1RPOA 3CCUV 3OW2U 1UJWB 4GT1A 4FPPA 4HAMA 3OMNB 1H2GA 1S76D 4LC1A 3PJSK 2QE7G 1S3JA 4WFFA 2IH3C 3UM7A 3ZMUA 3BEHA 1VQOV 1Q82W 4UVCA 4GX2A 2LP7A 4Q20A 4UV8A 3SYAA 1E1RG 1QLEC 4PDLA 3E2EA 4XDJA 1CEZA 1EZJA 3CPWU 5B1AB 4X8AA 3K0GA 1S0VA 1MOFA 5IYDO 3NXSA 3CC4V 1K4CC 2X6AA 2LFSA 3F7VC 3OUFA 3JCZA 3CCRV 1SZTA 2EIJC 1F51A 3ABKC 1KP2A 3SPIA 3JD1A 3SPGA 1MG1A 4LBEC 1QLNA 1E1QG 2YSUB 2OT5A 3STZC 3LNMB 2BOCC 4MVUA 3OE7G 1MSWD 3GWOA 2QTOA 1ROPA 2WPDG 2QEXV 3X2QB 3SPCA 3K79A 2Y48A 2EILC 3GB7C 1XL6A 1VQMV 1YITV 3OFNG 1M90W 3ZN1A 4J9ZB 4MTGA 3RVYA 1KECA 4X88A 2W0FC 2DQ0A 2Z5UA 3ASOC 1B6QA 5DN6G 2NLJC 3AEIA 3ABMC 4RAIA 1NVPB 4MVQA 3CXCU 4UUJC 4FJCC 4R50A 2EIKC 3B77A 1Y4MA 1PNKA 3WG7B 2PI4A 4G28B 1SETA 1FS0G 1VQLV 1M57C 1GK9A 3ZRWB 4I9WA 4HZ3A 1Q81W 4JPRA 5B1OA 4JAUA 4KP4A 1NR7A 2IJJA 5EC1C 1H8HG 5IY5B 1QCEA 2WSSG 1OCRB 2H94A 3JYCA 2XAFA 1ENVA 2QM7A 2B1GA 3IGAC 3ZJZA 4PA9A 4MVRA 2X6BA 3ETGA 3LDDA 2V1DA 5IDJA 5CBGA 2WLJA 4EKWA 3W7WA 1N8RW 3AG4B 4P2ZA 1F4MA 1K73W 1FXKB 3TCUA 1YHQV 1KC8W 5B1BB 5EBLC 1AI6A 4TSFG 1NH2B 1K8AW 5B1AC 4MVSA 3E8GA 2QM8A 4QJFB 4R7CA 5L3EA 1FXVA 4P9PA 1K34A 4MS2A 3ETDA 3E89A 2LFRA 2D3OW 3OGCC 4U7OA 1IXMA 2JIZG 2DQ3A 5H9CA 1YJNV 3E8BA 1YTFD 1JX9A 1Q7YW 2EINB 2ZR3A 3AG2C 4WF9V 3SYCA 1BMFG 2X7RB 1FXHA 1TUEB 2EIMB 5EBWC 3QO7A 2WLIA 1OCOC 3F7YC 3SYQA 3FB7C 3P32A 4GCZA 1K7DA 3E35A 1M56C 3OMAB 2WWWA 3SYPA 3ZMTA 4PA4A 1DF5A 3E8HA 1DLBA 5CN0A 4MVZA 3CCQV 4LP8A 2ITCC 4H33A 3WFVA 4ZBMA 3CMEV 4KUMA 1GTOA 4H37A 2Q6AA 5LGTA 1R3IC 2Q67A 4CZZA 1QVFU 1Q86W 2QA4V 1F23A 5E1AC 3STLC 3DGEA 5C93A 3EFFK 3I55V 2XAJA 1XL4A 1ORQC 2P7TC 1CPYA 1NR1A 4JYBA 5IYCO 4RQFA 1OCRC 4HYOA 2OTJV 2X0LA 1OCZB 2B1IA 1OCCB 5BZBA 2P90A 3JD3A 2DYRC 1YJWV 1BHBA 3FB6C 2DYSC 3VBBA 5HFLA 5B3SB 1AI4A 4QE9A 1G8MA 4R8CA 1JVMA 2JK5C 1W0KG 1VQPV 2NNUA 5B1BC 2IJIA 5CMUA 3CC7V 3LDEA 3G71V 1SESA 1AR1B 1QR8A 2OCCB 5J9PC 1RM1C 2H8PC 1V54C 2YEVA 3CCLV 1W2BU 1S77D 4E2LA 1QR9A 1YIJV 1MABG 3JD0A 4RQEA 4QPKA 2WLMA 3MHSC 1JCHA 2ZXWB 2EIMC 5LGNA 3FB5C 3OEHG 5B1NA 3OEEG 3CCJV 1SRYA 3ASNB 2HJFC 2ZDIC 4JTAB 2XASA 4DXWA 2Y69C 5KA6A 3TETA 1NVPD 2EJRA 1VQ5V 3ZMSA 4WFBV 4JGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4D A;  4R7C A;  4GX5 A;  1LNQ A;  2A9H A;  4JTC B;  4P9P A;  4BW5 A;  3LDC A;  4MS2 A;  4R6Z A;  1V55 C;  3E89 A;  2Q68 A;  2WLK A;  3AG1 C;  2Q69 A;  2A79 B;  3OGC C;  4J9Y B;  5B1A C;  4QNH B;  4WFH A;  3E8B A;  2EIN C;  3K0D A;  2X6C A;  3PJS K;  4MTF A;  3RBZ A;  4GX1 A;  3AG2 C;  5KUM A;  4JTD B;  4WFF A;  2ITD C;  4LCU C;  3SYC A;  2IH3 C;  1P7B A;  3UM7 A;  4MW8 A;  4MW3 A;  3BEH A;  3SJQ C;  5EBW C;  2WLI A;  4GX2 A;  1OCO C;  3F7Y C;  3SYA A;  3SYQ A;  4CBC A;  1QLE C;  3FB7 C;  4KFM A;  2HFE C;  2IH1 C;  4MSW C;  4PDL A;  4GX0 A;  4XDK A;  3K08 A;  1M56 C;  3RW0 A;  4P9O A;  3SYP A;  4XDJ A;  3HPL C;  4PA4 A;  4RUF A;  4X89 A;  4X8A A;  3K0G A;  1ZWI C;  1S5H C;  4PA6 A;  3E8H A;  4MVZ A;  4LP8 A;  1K4C C;  3RVZ A;  2WLL A;  2BOB C;  2K1E A;  2X6A A;  2ITC C;  4H33 A;  3F7V C;  3OUF A;  2WLH A;  4ZBM A;  3IFX A;  2ATK C;  3UKM A;  2EIJ C;  2A0L A;  5B3S C;  4H37 A;  3ABK C;  3OR7 C;  2Q6A A;  3SPJ A;  1R3I C;  3SPG A;  3SPI A;  2Q67 A;  3ABL C;  4LBE C;  3STZ C;  3LNM B;  2BOC C;  4MVU A;  5E1A C;  3STL C;  3T2M A;  3E83 A;  3EFF K;  4XDL A;  4OXS A;  2QTO A;  4QE7 A;  1XL4 A;  3X2Q C;  4RO2 A;  3SPC A;  2P7T C;  2EIL C;  2WLI B;  1ORQ C;  2QKS A;  3GB7 C;  1XL6 A;  2WLN A;  5CBF A;  3OR6 C;  1OCR C;  4HYO A;  1OCZ C;  4J9Z B;  5EC2 C;  1OCC C;  4MTG A;  4X88 A;  4P30 A;  3RVY A;  2ZD9 A;  4MTO A;  5BZB A;  2W0F C;  2DYR C;  3ASO C;  3FB6 C;  2DYS C;  2NLJ C;  4PDR A;  3ABM C;  3VOU A;  4RAI A;  1G4Y B;  2HVK C;  2ZXW C;  4MVQ A;  2WLL B;  4QE9 A;  3R65 A;  3KG2 A;  4UUJ C;  4R50 A;  4R8C A;  2EIK C;  4PA7 A;  3WG7 C;  1JVM A;  4G28 B;  2JK5 C;  5KUK A;  1BL8 A;  4TWK A;  4PDM A;  1R3K C;  5CBH A;  1M57 C;  3K04 A;  5B1B C;  3OUS A;  4I9W A;  2HVJ C;  4PDV A;  3E86 A;  4HZ3 A;  3K06 A;  3LDE A;  5EC1 C;  2HG5 C;  3T4Z A;  4RUE A;  5IY5 C;  2AHY A;  2OCC C;  5J9P C;  3JYC A;  2KB1 A;  3LUT B;  2H8P C;  1V54 C;  4F4L A;  5EK0 A;  3AG3 C;  4PA3 A;  2YEV A;  3IGA C;  5EBM C;  3F5W C;  3ZJZ A;  3E8F A;  3SYO A;  4PA9 A;  4MVR A;  2X6B A;  3T1C A;  3ZRS A;  2WLM A;  1K4D C;  3LDD A;  3SPH A;  4WFG A;  2EIM C;  3FB5 C;  5CBG A;  2WLJ A;  4WFE A;  1R3L C;  3ASN C;  3K03 A;  4EKW A;  1R3J C;  2HJF C;  3AG4 C;  4MVO A;  3FB8 C;  4JTA B;  4G27 B;  4P2Z A;  1KKD A;  4DXW A;  2DWD C;  1J95 A;  2Y69 C;  3TCU A;  3TET A;  4MVM A;  2R9R B;  5EBL C;  2AHZ A;  2DWE C;  4MVS A;  3E8G A; 
#chains in the Genus database with same CATH topology
 2N74 A;  2XND G;  4LF7 B;  3C3T A;  2Y4T A;  3LDC A;  1Q90 D;  3OMI B;  3P30 A;  4LNU B;  4JI1 B;  4WFH A;  4I0X B;  4YY3 O;  4MTF A;  2EBO A;  4YIO A;  4JTD B;  4X64 B;  3CRR A;  4MW8 A;  2VQF B;  2QWN B;  4U7N A;  3ZCC A;  1QLE B;  1GM7 A;  2LJ2 A;  4CH5 A;  1XOU A;  1K9M W;  1AJN A;  4P9O A;  4X89 A;  4J7K A;  4PA6 A;  4B3M B;  4L87 A;  4K8Z A;  2YUA A;  2GV9 A;  5B66 Z;  3RVZ A;  2YIB D;  4LWS B;  2BOB C;  3H01 A;  4OPH A;  5GW7 A;  1OV9 A;  1NH2 D;  1K97 A;  4W4K A;  2Y0I A;  4DR1 O;  4LH6 A;  3ABK B;  3LSS A;  3HB3 B;  3QO8 A;  4EB6 A;  4JZ2 A;  4UVA A;  1GN3 A;  4UVB A;  4QE7 A;  2E5L O;  4YJ3 B;  3G4S V;  1HDJ A;  5D5P A;  4I50 A;  1U97 A;  2XAG A;  1BSM A;  5EYP B;  3E22 B;  4YHH O;  3OM3 B;  3RYF A;  4H0L B;  5KHI A;  3ABM B;  2ZDI A;  3RN4 A;  3ABT A;  4W4L A;  4B3T O;  1XEQ A;  3MHH C;  4TWK A;  4PDM A;  1H2M A;  3FD9 A;  2JVD A;  2KKW A;  3CCM V;  1H8E G;  3B4S A;  5IY5 C;  3J7A U;  4JYA O;  2GHY A;  1W0J G;  4I9Q A;  2HJD A;  2F4V O;  4JZG A;  3EHB B;  3L71 H;  2V4D A;  4FLU A;  1JFF B;  2AGA A;  1Q8I A;  3RYC A;  3AG4 C;  3CB2 A;  4CH3 A;  1J95 A;  3ZBH A;  2R9R B;  2BTO A;  1G6U A;  4F6R A;  1FJG B;  1LNQ A;  2PI5 A;  1JPX A;  4BW5 A;  1N34 O;  2R9I A;  2CH7 A;  3M7M X;  1FFT B;  3OGI B;  2W6J G;  3AG3 B;  2P6J A;  2EIN C;  1K3E A;  5KUM A;  5ITZ A;  2ITD C;  2IJK A;  1I94 O;  1Z5V A;  1AR5 A;  4FZ0 A;  3K59 A;  5LOV A;  3HKD A;  2GTS A;  4FK5 C;  2ZR2 A;  1S5H C;  4QIW F;  2W6I G;  5BMV A;  3Q4H A;  2XTA A;  5DM6 V;  4B3R B;  4AI8 A;  2UXB B;  2A0L A;  4JAV A;  2CTW A;  4DV0 O;  1GKF A;  3ZRW A;  4CC5 A;  3HKC B;  2Q9L A;  4YY3 B;  4LNU A;  4JI4 O;  5CA3 A;  1VQ7 V;  2JEX A;  5IJ0 B;  4BIZ A;  2QKA A;  3RYI B;  2XAH A;  4ZKI A;  1K33 A;  1M9N A;  3IC7 A;  2HHH B;  1I0H A;  4I55 B;  2DYR B;  1G4Y B;  4X62 O;  1Y76 B;  1SZX A;  3G80 A;  5KUK A;  1ARO P;  2ADQ B;  3OUS A;  2HVJ C;  1EBO A;  3ZMZ A;  3ZHQ A;  5JWP A;  2Q0A A;  3NR7 A;  1BT8 A;  5H6Q A;  3A0B Z;  3LUT B;  2Q7E A;  1GMG A;  3AG3 C;  1SER A;  3UT5 B;  2E5L B;  2OCH A;  2R72 A;  3SYO A;  4QGP A;  1PPJ H;  1GM8 A;  1O9H A;  2MW2 B;  3L9D A;  4YHH B;  3ASN C;  2XOK G;  1GO3 F;  4MVO A;  5JVD B;  4G27 B;  1JJ2 U;  5EYP A;  3L72 H;  4TV9 A;  1H2N A;  2EZO A;  5DED A;  4G2K A;  4XBF A;  2VWK A;  2DWE C;  1XHZ A;  2M6Y A;  1SQG A;  4NTY A;  1GN4 A;  3T4D A;  4D7S A;  5L3C A;  5J2U B;  2UU9 B;  4DRX A;  3OW2 U;  4GT1 A;  1S76 D;  3PJS K;  4KL1 A;  4PD4 F;  4JYA B;  3ZMU A;  2F4V B;  3SYA A;  1E1R G;  2BSK A;  5FLX N;  1SQB H;  4PDL A;  1SQQ H;  2WA4 A;  4NB5 A;  5B1A B;  2BE3 A;  1GRJ A;  1JFF A;  1K4C C;  5BXZ A;  2LFS A;  3F7V C;  3OUF A;  5CA1 B;  3CCR V;  5CB4 B;  1N36 B;  1N34 B;  2G38 A;  1E1Q G;  2YSU B;  3LNM B;  1Q6H A;  4UCU A;  2QEX V;  3X2Q B;  3SPC A;  3K79 A;  1I94 B;  1HNW O;  3ZN1 A;  4JI8 O;  2ZIO A;  4I7Z B;  4NXN O;  4MTG A;  1KEC A;  3UO3 A;  1UPG A;  5LYJ B;  1M93 A;  3CXC U;  4FJC C;  3B77 A;  4DK1 A;  1Y4M A;  3WG7 B;  3N2K A;  1FS0 G;  4YJ2 A;  4DV0 B;  4HNA A;  4J10 A;  4A5U B;  4JAU A;  4KP4 A;  5EC1 C;  1RSO B;  1YDX A;  2WSS G;  3JYC A;  4FLX A;  1NZ6 A;  2QWO B;  4JI4 B;  4HBN A;  4OGQ B;  5KAI Z;  1KMI Z;  2X6B A;  2YC0 A;  3ZED A;  3LDD A;  2WLJ A;  4NTX A;  4E4E A;  4EKW A;  4P2Z A;  5FPR A;  5IJ0 A;  4X62 B;  3RYI A;  1AI6 A;  4TSF G;  1NH2 B;  4I55 A;  5B1A C;  4MVS A;  3E8G A;  3AK1 A;  4R7C A;  4QJF B;  2WA3 A;  4MS2 A;  3ETD A;  1Y76 A;  2CTP A;  1B3Q A;  4U7O A;  2JIZ G;  2DQ3 A;  1YJN V;  1IBK O;  1Q7Y W;  4PHZ A;  3H1J H;  5EBW C;  3SYQ A;  3ZHR A;  4FVM A;  1G1X B;  3E35 A;  3OMA B;  2VRZ A;  1DF5 A;  5GTI Z;  1T5E A;  3CJH B;  2AZ0 A;  2HP8 A;  3TXS A;  4LP8 A;  4K0K O;  3WFV A;  1GTO A;  4H37 A;  2Q6A A;  5LGT A;  2Q67 A;  1Q86 W;  1YF2 A;  2F66 C;  1F23 A;  2OIG A;  3DGE A;  1WJZ A;  5J2U A;  2YIA A;  3EFF K;  3I55 V;  4DV3 B;  4LFB B;  5EIB C;  1CPY A;  2KG7 B;  4DW0 A;  4JYB A;  2B1I A;  1OCC B;  4JI6 O;  5A2Q N;  4GZR B;  2PYL A;  3VBB A;  1AI4 A;  1ZAU A;  1U96 A;  3SGI A;  4R8C A;  2HEP A;  3ZHV A;  1JVM A;  2JK5 C;  1W0K G;  3THO A;  3ETQ A;  2E75 B;  5K1P A;  2GTA A;  4LFC O;  4B7K A;  2L35 A;  2ZM6 B;  4LH7 A;  3G71 V;  1SES A;  1AR1 B;  4O2B A;  1QR8 A;  3O65 A;  3ZHS A;  5IJ9 A;  2YEV A;  3CCL V;  1HNW B;  5KHH A;  1KB9 F;  4QPK A;  4JI8 B;  2ZXW B;  3N2G B;  4NXN B;  3OEH G;  1IDS A;  5B1N A;  4IYI A;  1SRY A;  4O4L A;  2AW9 A;  4J11 A;  2XAS A;  3JAR B;  2Y69 C;  1NVP D;  2EJR A;  1VEW A;  2YID A;  2CTR A;  3ZMS A;  2ETN A;  1LR1 A;  4B3S O;  2JJ1 G;  2Q68 A;  2Q69 A;  4X1Y B;  3VQV A;  4GX1 A;  2BCC H;  3OTO O;  5JJE B;  4JI3 O;  4MW3 A;  3C90 A;  5FNV B;  1IBM O;  3CSX A;  1WP7 A;  2HFE C;  2IH1 C;  3CD6 V;  1R73 A;  3JD4 A;  2RQ6 A;  4I5S A;  3D8C A;  1AP6 A;  1Q3E A;  3K3W A;  2B5U A;  3ZMV A;  3WB0 A;  1V55 B;  1ZSP A;  2K1E A;  1IUR A;  1PL0 A;  3JAS A;  3UKM A;  2EIJ B;  4NXM O;  1OHH G;  2YIB A;  4DV6 O;  3M99 B;  1IBK B;  1J5E O;  3T1Y O;  3MD0 A;  4O4J A;  5KAF Z;  2P4K A;  1Z5W A;  4PI0 A;  1EFR G;  3OR6 C;  5EC2 C;  1VF7 A;  2IJH A;  2UUA O;  4PDR A;  3OT7 A;  2YI9 A;  1VQ9 V;  2ZXW C;  1TVK B;  5EZY B;  4DV1 O;  3ABL B;  1QHT A;  4K0K B;  1QBZ A;  1EN6 A;  5LMN O;  1R3K C;  4Z1M G;  4TT3 G;  2B9Z A;  1AJQ A;  1JR9 A;  1SQP H;  1SKV A;  4RUE A;  2PTM A;  3UQ8 A;  1SA0 A;  1YSC A;  1XNQ B;  5EBM C;  4DV4 B;  4CH4 A;  4ASU G;  4BIU A;  1H2L A;  1WPX A;  4FM2 A;  5JH7 B;  1KKD A;  1FXK C;  3A8T A;  2DOS A;  4MTX A;  4DV7 O;  1XI1 A;  4TQF A;  1SQV H;  5LHG A;  4UCT A;  3W7T A;  4WBN A;  1V55 C;  5LP6 C;  1ZX3 A;  5KHG A;  3ETE A;  4QNH B;  4H44 B;  5K1X A;  2JDI G;  1KP3 A;  3ABU A;  4LR3 A;  3AG2 B;  3CC2 V;  3SJQ C;  3ZRX A;  4YXW G;  5LGU A;  1FFX A;  4IHJ B;  3MAQ A;  4O4I B;  1M56 B;  2DW4 A;  3W7X A;  3QO5 A;  5KX5 A;  4AHC A;  2V7Q G;  3ZN0 A;  3K9A A;  3AG1 B;  1R6T A;  3SPJ A;  3OR7 C;  2YDE A;  4IGG A;  3ABL C;  2VS0 A;  3APO A;  3TK1 A;  2Q5Z A;  1FKA O;  3U11 A;  2UXX A;  3E83 A;  3A2F A;  4XDL A;  3FYE B;  1SS3 A;  3OTO B;  4RO2 A;  3TJT A;  1PP9 H;  1IBM B;  1AJP A;  3B8M A;  5CBF A;  5GON A;  5JQG A;  4CS2 A;  1JMK C;  1QQC A;  3F5T A;  1OCZ C;  1PKX A;  1NT2 B;  4X20 B;  3VOU A;  2F23 A;  2XAQ A;  1FXK A;  2WLL B;  1ZUQ A;  2AZ2 A;  4PA7 A;  4JF3 A;  2UXD O;  3K04 A;  4NXM B;  1M4U A;  3AK3 A;  4PDV A;  1I7F A;  4FIP C;  5H2F Z;  5LP6 A;  4NYK A;  2EIL B;  4UV9 A;  3T1Y B;  3T4Z A;  4X1I B;  2OCC C;  3W7S A;  1RM1 B;  1BS3 A;  1S72 V;  3A0R A;  1DTO A;  1N0N A;  5EK0 A;  4PA3 A;  3QVN A;  3FKS G;  4BAY A;  1IBL B;  3ASO B;  1WP8 A;  2JGD B;  1NQT A;  1K5Q A;  4WFE A;  1R3L C;  2EIK B;  3K03 A;  5KMG B;  5LBQ A;  1H38 A;  1R3J C;  1I08 A;  2UUA B;  1F4N A;  1COW G;  1MSD A;  2EZP A;  1A32 A;  5LMN B;  2O57 A;  1JOY A;  2WLK A;  3AG1 C;  4Q6G A;  2A79 B;  1H2G A;  4LC1 A;  1NTZ H;  4WFF A;  3TXQ A;  5DEC A;  1QLE C;  1WA8 A;  2QGN A;  4JI0 O;  4C7U A;  4FLW A;  2FYU H;  1FYJ A;  3K0G A;  4JI7 O;  2BTQ A;  5IYD O;  5D5Q A;  4IT5 A;  4DV7 B;  3WB2 A;  3ABK C;  3SPI A;  2Y4U A;  1QLN A;  2OT5 A;  2VWJ A;  2PUS A;  2BOC C;  3B2E E;  2PZS A;  4MVU A;  1H2K A;  2QTO A;  2WPD G;  3LSU A;  2QWP B;  2EIL C;  2YXL A;  5IWA O;  1YIT V;  3OFN G;  1M90 W;  1UFI A;  3U0Z A;  1N32 O;  3SJC C;  3RVY A;  1FPO A;  4NKG B;  2DQ0 A;  3BRC A;  2Z5U A;  3ASO C;  1B6Q A;  1EN4 A;  5A9G A;  5DN6 G;  3AEI A;  3ABM C;  1NVP B;  4MVQ A;  2OYQ A;  4O4I A;  4FLZ A;  4R50 A;  2EIK C;  1PNK A;  1VQL V;  2E3C A;  4DW1 A;  1GK9 A;  3QG5 A;  1Q81 W;  4UFZ A;  1IVS A;  2UUC O;  2R9A A;  4I0X A;  1NR7 A;  1Q6I A;  2IJJ A;  1QCE A;  4JI5 O;  3JSL A;  1S5J A;  4DR3 O;  3IAY A;  3BCC H;  2V1D A;  3WU2 Z;  4NTW A;  1F4M A;  1K73 W;  2UXC O;  4DR1 B;  1S5L Z;  5B1B B;  2P4V A;  5EBL C;  4K8X A;  4LWS A;  1TA8 A;  4OX9 O;  3S3X A;  1K8A W;  2QM8 A;  3JCU Z;  1K34 A;  3CRA A;  2D3O W;  4B08 A;  3OGC C;  2PY5 A;  5H9C A;  1JX9 A;  4UCO A;  3WB1 A;  4AQY O;  1BMF G;  1FXH A;  2CDY A;  4D6T H;  4DV5 O;  2RNB A;  4YJ3 A;  3F7Y C;  3JAT B;  3VQW A;  2XHB A;  3FB7 C;  4GCZ A;  1XQ8 A;  1K7D A;  3CRM A;  1XHX A;  3EXA A;  4B3T B;  3SYP A;  3E22 A;  1WAZ A;  3OTF A;  2JGD A;  4MVZ A;  4JYY A;  4GKK O;  1WB7 A;  2YXH A;  3CME V;  2H3O A;  4BIO A;  1R3I C;  1ZTE A;  3D36 C;  4CZZ A;  2DJV A;  3OD4 A;  2ZKO A;  2Q7G A;  1XL4 A;  5AG2 A;  2L6L A;  2YI8 A;  2X0L A;  4JI0 B;  2F95 B;  2QKC A;  3QF7 A;  5BZB A;  2P90 A;  2DYR C;  1YJW V;  3FB6 C;  1VMG A;  1AVM A;  4JI7 B;  3FAV B;  1WPB A;  3GVM A;  5IE9 A;  1TUB B;  2NNU A;  4OPA A;  5B1B C;  3KZI Z;  1P49 A;  4FM1 A;  1R1B A;  5CMU A;  3CC7 V;  1DGS A;  4LF5 O;  3CX5 F;  4E2L A;  1QR9 A;  1YIJ V;  3RYH B;  1MAB G;  5IWA B;  1BZK A;  3MHS C;  1N32 B;  5LGN A;  3FB5 C;  1X59 A;  3H9V A;  1HNZ O;  4DXW A;  4B7E A;  2ZE6 A;  4FFB B;  1YEW A;  2D2C B;  2ZT9 B;  4YIP A;  1GH6 A;  3D36 A;  4J9Y B;  3C3S A;  4UXN A;  1JQ0 A;  3BY6 A;  3HKC A;  2UUC B;  2YS8 A;  3MDS A;  4O2A B;  3K0D A;  1KD1 W;  4CH6 A;  4D7T A;  4JI5 B;  1Y66 A;  3FYI B;  3RGB A;  4CBC A;  1VQ6 V;  3DXR B;  4L8J A;  4DR3 B;  2ZIN A;  1TGO A;  5J2T B;  5LHH A;  1VQK V;  3K08 A;  4X66 O;  2LW1 A;  2ODM A;  4K35 A;  1HR0 O;  2UXC B;  4JI2 O;  3IFX A;  4OX9 B;  2CTQ A;  1GN6 A;  3CS5 A;  2CGO A;  3J81 N;  5E79 Z;  3D3I A;  4AQY B;  4RWU A;  3ML0 A;  3X2Q C;  2WLI B;  2EX3 A;  5JJN B;  4WCE V;  3UT5 A;  3ZIA G;  4NR1 A;  3CYO A;  1X4T A;  1B06 A;  5HFM A;  4PJ0 Z;  4TOI A;  2Q4P A;  5JVD A;  2Q7H A;  3KG2 A;  3WG7 C;  5CBH A;  2Y0P A;  2A7W A;  1Z2G A;  3ZX6 A;  1AI7 A;  5LHI A;  3M8A A;  2JEU A;  4ZI7 B;  3DC6 A;  1HNX O;  3H1K H;  2CK3 G;  2P22 C;  4F4L A;  3B09 A;  3F5W C;  3CEI A;  4FLV A;  3ZRS A;  4J42 A;  2NR5 A;  4FMT A;  4PI2 A;  1EM1 A;  4N21 A;  3L75 H;  3HKE B;  2Q8V A;  5CA1 A;  3K58 A;  5CB4 A;  4DV2 O;  4U3J B;  4JAS A;  2W0X A;  4X1K B;  3OAA G;  2X6C A;  4ZHQ B;  4LF5 B;  5C8Y B;  1XMQ O;  1P7B A;  3H1L H;  1XDC A;  1OCO B;  2ZIM A;  4KFM A;  4ZOL B;  1PD3 A;  3CE2 A;  1SC5 B;  5H5N A;  1HNZ B;  3QNE A;  4IIJ B;  2Z3Y A;  5LYJ A;  1MZF A;  4UCS A;  2IM9 A;  3KCY A;  1NBM G;  1F7Y A;  2M7W A;  4BR6 A;  3DTU B;  1QU7 A;  3ZRV A;  3BA9 A;  1GN2 A;  2FML A;  1YJ9 V;  1K5S A;  1RSO A;  1XMO O;  3RFR A;  5LA6 B;  4JI1 O;  5KHK A;  1L8D A;  4DK0 A;  2KQX A;  4PEL A;  2QKS A;  1FAF A;  4TUY B;  1DK1 A;  3BAA A;  3CRQ A;  3BHP A;  1OCC C;  2GSM B;  1I5Y A;  4X66 B;  4FLY A;  2HLD G;  2DYS B;  2HKO A;  1HR0 B;  3R65 A;  2CAZ C;  4JV5 O;  4JI2 B;  1NTM H;  2IW5 A;  4EB6 B;  2C2A A;  1CP9 A;  3K06 A;  3H1I H;  1E79 G;  5FL7 G;  2AHY A;  1V54 B;  4IYH A;  4I50 B;  1M1K W;  2ZCE A;  1R6N A;  1RFY A;  4NVP A;  2LGQ A;  4WFG A;  1HWY A;  4UCV A;  2FTK A;  3RYF B;  5KLV H;  3BA8 A;  3CJH A;  2DWD C;  1M57 B;  3IJ4 A;  1YI2 V;  2CGN A;  2A9H A;  3I5D A;  3B8N A;  4JTC B;  2FB5 A;  1NKD A;  2OTL V;  2P67 A;  4FPP A;  1Q6U A;  3KKY A;  3OMN B;  4DYL A;  2ADP A;  1SF9 A;  3UM7 A;  2LGW A;  3BEH A;  1VIB A;  4Q20 A;  4JI6 B;  2KG7 A;  4DR7 O;  5FPO A;  4ZI7 A;  3RYC B;  4XDJ A;  1CEZ A;  4FM0 A;  1S0V A;  2XT9 A;  1NI8 A;  2P06 A;  1EZV H;  2Q0O C;  2X6A A;  4F6R B;  4LFC B;  3VQY A;  1SZT A;  3K5M A;  2EIJ C;  1F51 A;  3G6B A;  4UCR A;  1KP2 A;  3JAW B;  1BGY H;  2CH7 B;  4DV2 B;  2QWR B;  2FKX A;  3STZ C;  4JAA A;  2A3Q A;  5KHJ A;  3HKE A;  1L0N H;  5JCO C;  4CS3 A;  4DR5 O;  1KKC A;  2IBZ H;  1ROP A;  1NTK H;  3FFQ A;  1XMQ B;  2Y48 A;  2QTS A;  1VQM V;  5LOV B;  2ZE5 A;  1XIL A;  3CWB H;  4X88 A;  2W0F C;  3N2G A;  4B3S B;  3JAR A;  3Q4H B;  4UUJ C;  3JAL B;  1SET A;  3QTC A;  4FLT A;  2P5O A;  1M57 C;  1VF6 C;  5BY1 A;  3ZRW B;  4I9W A;  4JPR A;  2UXB O;  4JI3 B;  3RT3 C;  1H8H G;  4X1Y A;  5IY5 B;  2H94 A;  1XMO B;  2QM7 A;  2OIE A;  5EIB D;  5FNV A;  4PA9 A;  4MVR A;  2RCV A;  3U10 A;  5LA6 A;  4J41 A;  3W7W A;  4TUY A;  1AB3 A;  3AG4 B;  3TCU A;  2ILM A;  4CS4 A;  2HHH O;  1W59 A;  5CA0 B;  4JV5 B;  4DV6 B;  5L3E A;  1ZL8 B;  1FXV A;  1J5E B;  2LFR A;  1TAE A;  1L0L H;  1IXM A;  3E8B A;  2GUZ B;  2EIN B;  2DE0 X;  5JCO A;  2ZR3 A;  3A0H Z;  3AG2 C;  4WF9 V;  4J7Z A;  2X7R B;  5GTH Z;  2XUM A;  1TUE B;  2EIM B;  3QO7 A;  4KHP O;  1MA1 A;  4AIL C;  1N4C A;  1M56 C;  4LFA O;  4DV1 B;  4PA4 A;  4UB6 Z;  2JS3 A;  3E8H A;  4TV9 B;  4H13 B;  1XNR O;  4H33 A;  1TVK A;  5EZY A;  4FFK A;  5LXT B;  4LF6 O;  1VF6 A;  4DRX B;  3GWK C;  3K5O A;  5E1A C;  1ZLZ A;  5C93 A;  5TIS Z;  2UU9 O;  2XAJ A;  4LF4 O;  4DR4 O;  1ORQ C;  3KCX A;  2BSK B;  3D3Q A;  4J7J A;  5IYC O;  4RQF A;  1BQ0 A;  4DR7 B;  3SJA C;  1BQZ A;  1WN7 A;  3TGU H;  3JD3 A;  4DUZ O;  5JH7 A;  5B3S B;  1PV0 A;  4QE9 A;  1G8M A;  1LUV A;  2RN9 A;  1D5A A;  4TQD A;  1N36 O;  4DR5 B;  1RM1 C;  3JAW A;  1S77 D;  1W2B U;  1V9P A;  3JD0 A;  3L74 H;  2WLM A;  2N05 A;  4IHJ A;  1CXZ B;  3UO2 A;  1JCH A;  2EIM C;  3ASN B;  2EJ7 A;  4JTA B;  2RMK B;  1VQ5 V;  2A06 H;  4JGS A;  3P3N A;  3N2K B;  4YJ2 B;  4GX5 A;  2Q73 A;  4MT8 A;  3G67 A;  4HNA B;  3JAL A;  1P4R A;  3BAB A;  3RBZ A;  2GDS A;  1RP3 B;  4LCU C;  3LSQ A;  2IU3 A;  4GKJ O;  1I5X A;  3RW0 A;  2HR3 A;  3HPL C;  2JJ2 G;  4RUF A;  1OZ0 A;  3G6E V;  1YVW A;  4X20 A;  2PYJ A;  1URF A;  3K57 A;  2UXD B;  2WLL A;  2JS5 A;  3CCE V;  2WLH A;  3I56 V;  4DO2 A;  5B3S C;  4QPJ A;  5CA0 A;  1DF4 A;  3BVO A;  3LNN A;  3T2M A;  1ZL8 A;  1Q5O A;  4OXS A;  2WAM A;  4X1I A;  1YTF B;  4N23 A;  3HKB B;  2GUZ A;  4KHP B;  3CXH F;  4Z1V A;  1VQN V;  5IT9 N;  1QNM A;  3JD2 A;  2YIC A;  5LMU O;  5L3B A;  2ZD9 A;  4MTO A;  4LFA B;  3VQX A;  5H6R A;  2YXY A;  3PN1 A;  5KMG A;  4X9Q A;  2HVK C;  1XNR B;  1WLE A;  1PM9 A;  2N04 A;  2UXN A;  3K5N A;  1NJI W;  2ZNI A;  4LF6 B;  3ZS8 C;  2EUL A;  3E86 A;  3S3W A;  1THZ A;  5LXT A;  1PNL A;  5IYZ B;  2HG5 C;  2KB1 A;  1AI5 A;  4LF4 B;  4DR4 B;  4IL6 Z;  3E8F A;  4DV3 O;  1MZE A;  2QR4 A;  4LFB O;  3SR2 C;  2DN9 A;  4DUZ B;  1XRE A;  3N27 A;  1FD9 A;  4MVM A;  1IXB A;  1L1F A;  3SPH A;  4R6Z A;  3T1H O;  3JSN A;  4O2B B;  2MK3 A;  5IJ9 B;  4JYC A;  3W7U A;  2YEV B;  2ZM6 O;  5LL6 Y;  1WB8 A;  2AXT Z;  5BR8 O;  3CCS V;  4MSW C;  4GX0 A;  4XDK A;  1GM9 A;  1OJH A;  4TV8 B;  1RPR A;  1Y6X A;  4O4L B;  4WFA V;  3SJB C;  5KA5 A;  3R66 A;  1ZWI C;  2LQT A;  2F1M A;  2ATK C;  4U3F H;  4ICG A;  4DR6 O;  2JGU A;  1R6K A;  5L3G A;  2RDC A;  1O9G A;  1YZB A;  1QVG U;  1HP8 A;  3B40 A;  2WLN A;  4GKJ B;  2QSA A;  2IU0 A;  5L3F A;  5L3D A;  4DUY O;  3JAK B;  4P30 A;  4X65 O;  1VQ4 V;  4LF8 O;  1VAR A;  2F43 G;  1LUW A;  3JAS B;  1BL8 A;  2GBO A;  1VQ8 V;  2R70 A;  3AK2 A;  5IYB O;  4DV5 B;  4O4J B;  1VP7 A;  2K9P A;  1K92 A;  1KQS U;  1H2S B;  1BHA A;  4KXR A;  3CMA V;  3JAT A;  1MNG A;  3T1C A;  2VQE O;  1K4D C;  5LMU B;  1KYO F;  1N0J A;  3CCV V;  1Y74 B;  3HKB A;  3IC9 A;  2QDO A;  4GKK B;  1PL4 A;  3FB8 C;  3DSQ A;  2Y69 B;  1PNM A;  1KBH A;  1JA8 A;  2ZQM A;  3CP1 A;  2AHZ A;  3DC5 A;  4O4H B;  3AG7 A;  2QWQ B;  3CCU V;  1RPO A;  1UJW B;  4HAM A;  1KUQ A;  2QE7 G;  1S3J A;  3H1H H;  2DMX A;  2IH3 C;  1SA0 B;  3ICX A;  1VQO V;  1Q82 W;  2CUG A;  4UVC A;  1VF5 B;  2LP7 A;  4GX2 A;  4UV8 A;  5IYZ A;  4K3A A;  3E2E A;  1XNQ O;  4DV4 O;  2ARH A;  1EZJ A;  3CPW U;  4X8A A;  3CRC A;  1BE3 H;  1JJO A;  1MOF A;  3CC4 V;  3NXS A;  3FAV A;  4BW9 A;  1IZ3 A;  3JCZ A;  4WBN B;  1N33 O;  1TUB A;  2UUB O;  3JD1 A;  3SPG A;  2E74 B;  1MG1 A;  2QM4 A;  3EVK A;  4LBE C;  3L70 H;  3T1H B;  3O9O A;  3OE7 G;  4CC6 A;  1MSW D;  2ZNJ A;  3GWO A;  3HR0 A;  3GB7 C;  5BR8 B;  4DR2 O;  1XL6 A;  1FFX B;  4GUN A;  3RYH A;  1XUQ A;  1BCC H;  3JAM N;  4Z2W A;  1AIL A;  4J9Z B;  4I4T B;  3ZHT A;  5KX5 B;  2NLJ C;  4GLX A;  4LF9 O;  4RAI A;  1KU9 A;  4GYC B;  3RWR D;  4TV8 A;  1D5N A;  4UB8 Z;  3FX7 A;  2NN4 A;  4FFB A;  4G28 B;  2PI4 A;  4LF7 O;  4DR6 B;  4HZ3 A;  5B1O A;  3P3P A;  4EFE A;  4O2A A;  1OCR B;  4X64 O;  4J80 A;  2XAF A;  1ENV A;  3APQ A;  2B1G A;  2VQF O;  3IGA C;  1P84 F;  2Z0A A;  5GON B;  3ZJZ A;  4F6E A;  5JQG B;  3ETG A;  3DXR A;  4EFB A;  5J2T A;  5IDJ A;  4DUY B;  5CBG A;  4X65 B;  3K9S A;  1N8R W;  4B3M O;  4LF8 B;  1FXK B;  1YHQ V;  1KC8 W;  1YCI A;  3JAK A;  2QJ1 A;  3ZHU A;  4P9P A;  3E89 A;  5LP6 B;  3BFR A;  2PF4 E;  4BWA A;  3BPZ A;  1YTF D;  5F2V O;  3SYC A;  2LO1 A;  2PGG A;  3CHX A;  2WLI A;  1OCO C;  3P32 A;  1AP5 A;  2VQE B;  1NS1 A;  2KSD A;  2WWW A;  1IBL O;  3ZMT A;  1B04 A;  2CE4 A;  1MMM A;  2F93 B;  4FZ1 A;  2FL4 A;  1NU1 H;  1DLB A;  5CN0 A;  1GAX A;  3CCQ V;  1US6 A;  2ITC C;  1Y74 A;  4ZBM A;  4KUM A;  1HW7 A;  1QVF U;  1HNX B;  4ZIB A;  2QA4 V;  3SDL A;  4O4H A;  3STL C;  4EEQ A;  2OWO A;  3K5L A;  1YXB A;  2P7T C;  2ZE8 A;  1NR1 A;  1WA8 B;  1OCR C;  1P7G A;  4HYO A;  2LW7 A;  2OTJ V;  1Y67 A;  1D2D A;  3J80 N;  1IX9 A;  1OCZ B;  1BHB A;  2BTQ B;  2DYS C;  1EN5 A;  5HFL A;  1Q43 A;  1FJG O;  1VQP V;  1N33 B;  1SQF A;  2IJI A;  2UUB B;  5ITZ B;  4U3J A;  3UCS C;  5JJJ B;  3LDE A;  4X1K A;  4PV1 B;  1XBL A;  2OCC B;  5J9P C;  4ZHQ A;  2H8P C;  1V54 C;  5C8Y A;  1M5I A;  3HKD B;  4DR2 B;  2JRI A;  4ABM A;  4RQE A;  4ZOL A;  5BMV B;  1AR4 A;  1WNS A;  3CCJ V;  3OEE G;  2HJF C;  2ZDI C;  3L73 H;  4LF9 B;  2RJZ A;  5KA6 A;  3TET A;  4IIJ A;  2E76 B;  2ZE7 A;  4I4T A;  1SQX H;  4WFB V;  5B5E Z;  4B3R O; 
#chains in the Genus database with same CATH homology
 2XND G;  4GX5 A;  2JJ1 G;  3LDC A;  4MT8 A;  2Q68 A;  3OMI B;  2Q69 A;  3D36 A;  3P30 A;  4J9Y B;  4WFH A;  4UXN A;  1JQ0 A;  3BY6 A;  1P4R A;  1KD1 W;  4MTF A;  3K0D A;  2EBO A;  3RBZ A;  4GX1 A;  4JTD B;  4LCU C;  1Y66 A;  3LSQ A;  3FYI B;  2IU3 A;  4MW8 A;  4MW3 A;  4CBC A;  1VQ6 V;  4U7N A;  3ZCC A;  1QLE B;  1GM7 A;  2HFE C;  2IH1 C;  3CD6 V;  1R73 A;  3JD4 A;  1I5X A;  5LHH A;  1VQK V;  1K9M W;  3K08 A;  4I5S A;  1AJN A;  3RW0 A;  4P9O A;  2HR3 A;  3HPL C;  2JJ2 G;  3K3W A;  4RUF A;  4X89 A;  1OZ0 A;  3G6E V;  4PA6 A;  2B5U A;  4L87 A;  3ZMV A;  1V55 B;  3RVZ A;  2WLL A;  2BOB C;  2K1E A;  3H01 A;  5GW7 A;  3CCE V;  1NH2 D;  2WLH A;  1K97 A;  1PL0 A;  3IFX A;  3I56 V;  3UKM A;  2EIJ B;  4DO2 A;  5B3S C;  3ABK B;  1OHH G;  3LSS A;  3HB3 B;  4QPJ A;  3QO8 A;  3M99 B;  1DF4 A;  4UVA A;  3T2M A;  3MD0 A;  3D3I A;  4UVB A;  4OXS A;  2WAM A;  4QE7 A;  1YTF B;  3ML0 A;  3X2Q C;  4N23 A;  2WLI B;  3G4S V;  4WCE V;  3ZIA G;  1EFR G;  3OR6 C;  1VQN V;  2XAG A;  3CYO A;  3JD2 A;  5L3B A;  5EC2 C;  2ZD9 A;  4MTO A;  5HFM A;  3OM3 B;  2IJH A;  5H6R A;  4PDR A;  3ABM B;  2ZDI A;  1VQ9 V;  2HVK C;  2ZXW C;  3ABT A;  3KG2 A;  3ABL B;  1QBZ A;  3WG7 C;  1WLE A;  3MHH C;  2UXN A;  4TWK A;  4PDM A;  1R3K C;  5CBH A;  1NJI W;  1AI7 A;  3E86 A;  4TT3 G;  4Z1M G;  5LHI A;  1THZ A;  1AJQ A;  3CCM V;  2JEU A;  1PNL A;  1H8E G;  2HG5 C;  4RUE A;  5IY5 C;  2KB1 A;  2GHY A;  1AI5 A;  2CK3 G;  1W0J G;  4F4L A;  1YSC A;  5EBM C;  3EHB B;  3F5W C;  3E8F A;  3ZRS A;  4ASU G;  4BIU A;  1WPX A;  3AG4 C;  4FMT A;  1KKD A;  1FXK C;  1J95 A;  4MTX A;  4MVM A;  2R9R B;  4N21 A;  1L1F A;  3SPH A;  5LHG A;  3W7T A;  1LNQ A;  2PI5 A;  1JPX A;  4BW5 A;  4R6Z A;  1V55 C;  2R9I A;  3ETE A;  1FFT B;  4JAS A;  4QNH B;  2W6J G;  3AG3 B;  2P6J A;  2MK3 A;  2JDI G;  2EIN C;  1K3E A;  2X6C A;  3OAA G;  4JYC A;  1KP3 A;  3ABU A;  5KUM A;  3AG2 B;  2ITD C;  3CC2 V;  3W7U A;  2YEV B;  1P7B A;  2IJK A;  3SJQ C;  3ZRX A;  1OCO B;  4YXW G;  5LGU A;  3CCS V;  4KFM A;  1PD3 A;  4MSW C;  4GX0 A;  4XDK A;  1GM9 A;  1M56 B;  4WFA V;  1RPR A;  2DW4 A;  3W7X A;  3QO5 A;  5KA5 A;  4FK5 C;  2ZR2 A;  3QNE A;  1ZWI C;  1S5H C;  2V7Q G;  2Z3Y A;  3ZN0 A;  4QIW F;  3K9A A;  2W6I G;  3AG1 B;  1NBM G;  5DM6 V;  2M7W A;  2ATK C;  2A0L A;  3DTU B;  4JAV A;  3SPJ A;  3OR7 C;  3ZRV A;  1GKF A;  3ABL C;  3ZRW A;  1R6K A;  5L3G A;  3TK1 A;  2UXX A;  3E83 A;  1YJ9 V;  1QVG U;  1K5S A;  4XDL A;  3FYE B;  4RO2 A;  4PEL A;  2QKS A;  5CA3 A;  2WLN A;  1AJP A;  3B8M A;  5CBF A;  1VQ7 V;  2JEX A;  4BIZ A;  2IU0 A;  5L3F A;  2XAH A;  5L3D A;  1OCZ C;  4ZKI A;  1OCC C;  1K33 A;  2GSM B;  1I5Y A;  1M9N A;  3IC7 A;  4P30 A;  1PKX A;  2DYR B;  1VQ4 V;  2HLD G;  3VOU A;  2DYS B;  1G4Y B;  2HKO A;  2XAQ A;  1FXK A;  2F43 G;  2WLL B;  3R65 A;  4PA7 A;  4JF3 A;  5KUK A;  1BL8 A;  1ARO P;  3K04 A;  2IW5 A;  3OUS A;  2HVJ C;  1EBO A;  4FIP C;  4PDV A;  2C2A A;  1CP9 A;  3ZMZ A;  1VQ8 V;  3K06 A;  5IYB O;  2EIL B;  4UV9 A;  1E79 G;  5FL7 G;  3T4Z A;  2AHY A;  2OCC C;  3W7S A;  5H6Q A;  1RM1 B;  1S72 V;  3LUT B;  3A0R A;  1DTO A;  1GMG A;  1V54 B;  5EK0 A;  3AG3 C;  4PA3 A;  1K92 A;  1KQS U;  1SER A;  1BHA A;  1M1K W;  3FKS G;  4BAY A;  1R6N A;  3CMA V;  3SYO A;  3ASO B;  3T1C A;  1K4D C;  1NQT A;  4WFG A;  1GM8 A;  1HWY A;  1K5Q A;  2FTK A;  3CCV V;  4WFE A;  1R3L C;  2EIK B;  3ASN C;  3K03 A;  2XOK G;  5LBQ A;  1H38 A;  1R3J C;  1GO3 F;  3FB8 C;  4MVO A;  4G27 B;  1JJ2 U;  2DWD C;  2Y69 B;  1M57 B;  1F4N A;  1PNM A;  1COW G;  2EZO A;  4G2K A;  4XBF A;  2ZQM A;  2EZP A;  2AHZ A;  2DWE C;  3CP1 A;  1YI2 V;  3T4D A;  4JTC B;  2A9H A;  5L3C A;  3B8N A;  1JOY A;  1NKD A;  2OTL V;  2P67 A;  2WLK A;  3AG1 C;  2A79 B;  1RPO A;  3CCU V;  3OW2 U;  1UJW B;  4GT1 A;  4FPP A;  4HAM A;  3OMN B;  1H2G A;  1S76 D;  4LC1 A;  3PJS K;  2QE7 G;  1S3J A;  4WFF A;  2IH3 C;  3UM7 A;  3ZMU A;  3BEH A;  1VQO V;  1Q82 W;  4UVC A;  4GX2 A;  2LP7 A;  4Q20 A;  4UV8 A;  3SYA A;  1E1R G;  1QLE C;  4PDL A;  3E2E A;  4XDJ A;  1CEZ A;  1EZJ A;  3CPW U;  5B1A B;  4X8A A;  3K0G A;  1S0V A;  1MOF A;  5IYD O;  3NXS A;  3CC4 V;  1K4C C;  2X6A A;  2LFS A;  3F7V C;  3OUF A;  3JCZ A;  3CCR V;  1SZT A;  2EIJ C;  1F51 A;  3ABK C;  1KP2 A;  3SPI A;  3JD1 A;  3SPG A;  1MG1 A;  4LBE C;  1QLN A;  1E1Q G;  2YSU B;  2OT5 A;  3STZ C;  3LNM B;  2BOC C;  4MVU A;  3OE7 G;  1MSW D;  3GWO A;  2QTO A;  1ROP A;  2WPD G;  2QEX V;  3X2Q B;  3SPC A;  3K79 A;  2Y48 A;  2EIL C;  3GB7 C;  1XL6 A;  1VQM V;  1YIT V;  3OFN G;  1M90 W;  3ZN1 A;  4J9Z B;  4MTG A;  3RVY A;  1KEC A;  4X88 A;  2W0F C;  2DQ0 A;  2Z5U A;  3ASO C;  1B6Q A;  5DN6 G;  2NLJ C;  3AEI A;  3ABM C;  4RAI A;  1NVP B;  4MVQ A;  3CXC U;  4UUJ C;  4FJC C;  4R50 A;  2EIK C;  3B77 A;  1Y4M A;  1PNK A;  3WG7 B;  2PI4 A;  4G28 B;  1SET A;  1FS0 G;  1VQL V;  1M57 C;  1GK9 A;  3ZRW B;  4I9W A;  4HZ3 A;  1Q81 W;  4JPR A;  5B1O A;  4JAU A;  4KP4 A;  1NR7 A;  2IJJ A;  5EC1 C;  1H8H G;  5IY5 B;  1QCE A;  2WSS G;  1OCR B;  2H94 A;  3JYC A;  2XAF A;  1ENV A;  2QM7 A;  2B1G A;  3IGA C;  3ZJZ A;  4PA9 A;  4MVR A;  2X6B A;  3ETG A;  3LDD A;  2V1D A;  5IDJ A;  5CBG A;  2WLJ A;  4EKW A;  3W7W A;  1N8R W;  3AG4 B;  4P2Z A;  1F4M A;  1K73 W;  1FXK B;  3TCU A;  1YHQ V;  1KC8 W;  5B1B B;  5EBL C;  1AI6 A;  4TSF G;  1NH2 B;  1K8A W;  5B1A C;  4MVS A;  3E8G A;  2QM8 A;  4QJF B;  4R7C A;  5L3E A;  1FXV A;  4P9P A;  1K34 A;  4MS2 A;  3ETD A;  3E89 A;  2LFR A;  2D3O W;  3OGC C;  4U7O A;  1IXM A;  2JIZ G;  2DQ3 A;  5H9C A;  1YJN V;  3E8B A;  1YTF D;  1JX9 A;  1Q7Y W;  2EIN B;  2ZR3 A;  3AG2 C;  4WF9 V;  3SYC A;  1BMF G;  2X7R B;  1FXH A;  1TUE B;  2EIM B;  5EBW C;  3QO7 A;  2WLI A;  1OCO C;  3F7Y C;  3SYQ A;  3FB7 C;  3P32 A;  4GCZ A;  1K7D A;  3E35 A;  1M56 C;  3OMA B;  2WWW A;  3SYP A;  3ZMT A;  4PA4 A;  1DF5 A;  3E8H A;  1DLB A;  5CN0 A;  4MVZ A;  3CCQ V;  4LP8 A;  2ITC C;  4H33 A;  3WFV A;  4ZBM A;  3CME V;  4KUM A;  1GTO A;  4H37 A;  2Q6A A;  5LGT A;  1R3I C;  2Q67 A;  4CZZ A;  1QVF U;  1Q86 W;  2QA4 V;  1F23 A;  5E1A C;  3STL C;  3DGE A;  5C93 A;  3EFF K;  3I55 V;  2XAJ A;  1XL4 A;  1ORQ C;  2P7T C;  1CPY A;  1NR1 A;  4JYB A;  5IYC O;  4RQF A;  1OCR C;  4HYO A;  2OTJ V;  2X0L A;  1OCZ B;  2B1I A;  1OCC B;  5BZB A;  2P90 A;  3JD3 A;  2DYR C;  1YJW V;  1BHB A;  3FB6 C;  2DYS C;  3VBB A;  5HFL A;  5B3S B;  1AI4 A;  4QE9 A;  1G8M A;  4R8C A;  1JVM A;  2JK5 C;  1W0K G;  1VQP V;  2NNU A;  5B1B C;  2IJI A;  5CMU A;  3CC7 V;  3LDE A;  3G71 V;  1SES A;  1AR1 B;  1QR8 A;  2OCC B;  5J9P C;  1RM1 C;  2H8P C;  1V54 C;  2YEV A;  3CCL V;  1W2B U;  1S77 D;  4E2L A;  1QR9 A;  1YIJ V;  1MAB G;  3JD0 A;  4RQE A;  4QPK A;  2WLM A;  3MHS C;  1JCH A;  2ZXW B;  2EIM C;  5LGN A;  3FB5 C;  3OEH G;  5B1N A;  3OEE G;  3CCJ V;  1SRY A;  3ASN B;  2HJF C;  2ZDI C;  4JTA B;  2XAS A;  4DXW A;  2Y69 C;  5KA6 A;  3TET A;  1NVP D;  2EJR A;  1VQ5 V;  3ZMS A;  4WFB V;  4JGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...