3GB7C

Potassium channel kcsa-fab complex in li+
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 40
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2009-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3gb7C00
2IH1C 2WLKA 3T2MA 4JTAB 3IGAC 3PJSK 2Q68A 2YEVA 4MVMA 5EBLC 3WG7C 4MVUA 3OUFA 4RO2A 1OCZC 3OUSA 2HVKC 3OGCC 4MS2A 2OCCC 3VOUA 1LNQA 4MW3A 2DYRC 3LUTB 4LP8A 3F7YC 3SPJA 1QLEC 3FB6C 5KUKA 3ABLC 3RBZA 3E8BA 3LNMB 1OCRC 2ITDC 2HJFC 3SPGA 3K04A 4WFEA 5KUMA 4LBEC 2ZD9A 1OCCC 5CBFA 4G28B 2DWEC 4RUEA 2QKSA 2X6AA 2X6BA 4JTCB 3E89A 4X88A 5E1AC 2WLIA 2HG5C 2H8PC 2Q6AA 2KB1A 4EKWA 2ITCC 2WLJA 3AG1C 4PDLA 1R3JC 3STLC 4I9WA 3ASNC 3ABKC 2EINC 4MVQA 4PA4A 4P2ZA 5B1BC 3FB5C 2Q67A 2QTOA 1M56C 1R3LC 4H37A 4R6ZA 1BL8A 3TETA 3E8FA 5B3SC 3FB8C 2AHZA 3TCUA 2BOBC 2WLMA 1M57C 1ZWIC 1R3IC 4ZBMA 3X2QC 2HFEC 3E86A 3SYQA 3K03A 3SYCA 2EIMC 3AG2C 4MVRA 4CBCA 3SPHA 4R7CA 4QNHB 1J95A 2Y69C 1K4CC 4PDRA 4G27B 3IFXA 2NLJC 3OR6C 4R8CA 5EC2C 3SYPA 4F4LA 5EBMC 1V54C 5EBWC 4H33A 4MTGA 3K0GA 3SJQC 3K08A 4MW8A 3K06A 1P7BA 3E8GA 5IY5C 4RAIA 3ABMC 4MTFA 4XDLA 2DYSC 2WLLA 3HPLC 3SPCA 3AG3C 3EFFK 3R65A 3SYOA 2HVJC 4GX1A 1XL6A 3KG2A 4XDKA 3E8HA 3K0DA 3STZC 2A0LA 5EK0A 2WLLB 2JK5C 4PDVA 2BOCC 4J9YB 2K1EA 3AG4C 2Q69A 4P9PA 2P7TC 2A79B 2W0FC 1G4YB 1R3KC 3LDEA 4GX0A 3RW0A 3T4ZA 3UM7A 3T1CA 3T4DA 1JVMA 1S5HC 2DWDC 2EILC 4X8AA 4QE9A 3OR7C 5B1AC 5BZBA 3BEHA 3FB7C 4HYOA 4JTDB 4KFMA 3LDDA 4WFHA 3ZRSA 4MVZA 3RVYA 4PA7A 5CBHA 2R9RB 4XDJA 5CBGA 4PA9A 5J9PC 3RVZA 2A9HA 4MVSA 1ORQC 4X89A 1V55C 1K4DC 4GX5A 4MVOA 3LDCA 4BW5A 4GX2A 4P30A 3F5WC 2ZXWC 2EIJC 4QE7A 4R50A 2X6CA 4MSWC 3UKMA 4RUFA 4HZ3A 4WFFA 2AHYA 3JYCA 4J9ZB 4MTOA 1OCOC 1KKDA 3E83A 4OXSA 4DXWA 4PA6A 2WLHA 4TWKA 3SYAA 2IH3C 2EIKC 4UUJC 3GB7C 5EC1C 2WLNA 4PA3A 1XL4A 2WLIB 2ATKC 4PDMA 4WFGA 3ZJZA 3ASOC 4P9OA 3SPIA 4LCUC 3F7VC
chains in the Genus database with same CATH superfamily
1KP2A 3B4SA 4JYBA 3J80N 3K5NA 4DW0A 2IJKA 3OUFA 2YI9A 2Q0OC 4LFCO 2UU9B 2QM8A 3VQVA 5H5NA 3E8BA 1NTZH 2CK3G 4B3SB 2JDIG 1AVMA 1Q43A 3AG1C 4JI7O 4DV1B 4NVPA 4MVQA 3ABUA 2LGWA 1SF9A 4FLVA 1DK1A 1U96A 4BIUA 4H44B 2L35A 1CXZB 1DF5A 3SPHA 2EJ7A 2NLJC 4I50A 3CCLV 3OW2U 3HKCA 2QKCA 3N2GB 3QNEA 3L72H 2F43G 4MTFA 2P90A 1BHAA 4DO2A 1W0JG 4GX1A 3K0DA 2Z3YA 4EEQA 1IXMA 2R9AA 2ZXWB 2V4DA 1VQNV 1G8MA 1T5EA 1SA0A 3CD6V 4O2AA 3RW0A 2ZE8A 4O4IA 3CCVV 2ZCEA 1K5QA 2JIZG 4KFMA 1GAXA 1OCOB 1VQOV 5LA6B 1E79G 4BW5A 1SKVA 5DN6G 4X66B 4J9ZB 1HP8A 2RDCA 4DXWA 1L8DA 5L3BA 3CYOA 4FIPC 5D5PA 1UPGA 2HHHO 4NTWA 3ZMSA 1SQGA 1HR0O 1OCZC 2H3OA 3VOUA 1LNQA 4J7JA 3FB6C 3RBZA 4FJCC 1PL4A 5KUMA 2OCHA 4JGSA 3HKEB 4I0XA 4OX9B 4CH6A 2D2CB 2ZM6B 2H8PC 3ZRXA 4DK1A 3CCQV 4YHHO 3ABKC 4LF5B 2O57A 2CAZC 3E8FA 1XBLA 3H1IH 1ZL8B 4ZOLB 2BE3A 1V9PA 3BA8A 1V55B 4DUYB 2F1MA 2VRZA 3CHXA 3CJHA 4LF8O 3CRAA 5A2QN 3CRMA 2GSMB 4GT1A 1FXKA 3STZC 5EK0A 1M56B 4PDVA 4GYCB 2W0XA 1JPXA 3CMEV 4LFAB 5DEDA 4I4TB 4KP4A 1BSMA 4NTYA 2W0FC 4GX0A 3B2EE 3DXRA 3T1CA 4H13B 4ZOLA 1S5LZ 4HYOA 4RQFA 3OEHG 5B5EZ 2JGDB 4CS2A 2IJJA 1BS3A 1FJGO 2ZXWC 1XMOB 4MSWC 2C2AA 4XBFA 1OCOC 1MA1A 2CUGA 4LCUC 2NR5A 1JCHA 1GK9A 2Q0AA 5LGNA 2PYJA 1VIBA 2HVKC 1B3QA 3CWBH 4NXNB 2OCCC 3OMNB 1I94O 2Q7GA 1ZSPA 2WA3A 1I0HA 3OAAG 4X64O 3T1HO 4JV5B 4ZKIA 4LF9O 1F4NA 5L3DA 1URFA 5GONA 3ETQA 4FFBA 1AP5A 1EZJA 1FXKB 3D36C 4B08A 3M8AA 4F6RA 4R6ZA 4DRXA 2KQXA 3NR7A 4CC6A 5IY5B 1UFIA 4U7NA 4LF5O 2HHHB 3FAVB 1AROP 2M6YA 4JF3A 4JI3O 3K79A 1NBMG 1J95A 1GKFA 1IX9A 4O4HB 3H01A 1COWG 5EBWC 3OMIB 4J7KA 1XILA 3CE2A 3ASNB 4E2LA 5JCOA 2KKWA 4J9YB 3ZCCA 3ZRVA 2ZM6O 4TUYA 2CTQA 2R9IA 4O2BB 5C8YA 1XEQA 4Q20A 1DTOA 4ZI7A 1AP6A 2Y0IA 4UB8Z 1IBKO 4FLZA 4LFAO 1M57B 3SJCC 3JAWB 5BZBA 3HKDA 4WFHA 4K0KB 3C90A 3ZBHA 4J10A 1JMKC 1Z5WA 4HZ3A 4WFFA 3VBBA 1IZ3A 4PA6A 3CRCA 2WLNA 3K5OA 4DR6O 2ZINA 4TQDA 5LMUO 3LSSA 5JJEB 2YEVA 1WNSA 4DV4B 4DR3B 1RM1B 3H1JH 2QWOB 2QM4A 1S5JA 4UXNA 1W2BU 4DR4B 3RN4A 3ETGA 2JGDA 5LXTB 2JJ2G 4O2AB 3ZMVA 5LYJB 1KB9F 5J2TB 4Z2WA 4DR7B 4GKJB 2OTJV 4U3FH 2ITCC 5GTHZ 4LF7B 4JV5O 3STLC 1D5NA 3RYIA 2AGAA 1XI1A 3TCUA 4J80A 3NXSA 1PKXA 2CTPA 2DW4A 2IM9A 2ZIOA 4RWUA 4JAAA 4ZIBA 4K3AA 2BSKB 3IFXA 3OR6C 2BTQA 5EBMC 3THOA 1V54C 1Q86W 4JZGA 4JI3B 4IL6Z 2P67A 3O65A 2E75B 2DYSB 1NQTA 1SETA 2W6IG 3ZRWA 3W7XA 4EB6B 1SZXA 2Q73A 2P7TC 4HNAB 4UVBA 2OYQA 2ZR3A 1CEZA 3CC4V 5CN0A 2JGUA 3T4DA 4B3TB 2A06H 3W7TA 5IWAB 1J5EO 3FB7C 4MVZA 3WU2Z 3CRRA 3ZN0A 3J7AU 3G67A 4X89A 5JWPA 1I7FA 5BMVB 1YXBA 5KHHA 4I55A 4GX2A 2UXXA 1AB3A 1NR7A 5KHKA 3UKMA 4PI0A 4JI6B 5E79Z 4TWKA 1Q8IA 2LO1A 3A2FA 1AILA 2ZE5A 3SJAC 4HNAA 1TUEB 4N21A 1YF2A 3G80A 1HNZO 3AG2B 4NYKA 1IBKB 4DYLA 2EZPA 1Q82W 2QWRB 2PTMA 1XMQB 3SPJA 1QLEC 3I5DA 3JAWA 2M7WA 1IURA 1JFFA 2MK3A 3TXQA 1AJNA 4LF4O 4O4IB 2WLIA 4LFBB 4CC5A 4KUMA 4DR7O 2Q67A 4WBNB 3JSNA 2QWNB 2ADQB 2FMLA 3RYIB 4O4LA 2BOBC 2HFEC 3CX5F 5LMUB 4AILC 2YS8A 4J11A 2KG7A 1TGOA 3K0GA 1ZLZA 3U11A 4I50B 3U0ZA 3ABMB 4XDLA 3O9OA 1OCCB 1MZFA 2FTKA 4FVMA 4L8JA 2WLLB 5IJ0A 4PJ0Z 1NTKH 2B1GA 5TISZ 1R3KC 3ETEA 3L71H 2ZT9B 2LGQA 1O9GA 4UVAA 1VP7A 1PP9H 4D7TA 3LDDA 5H6RA 4LR3A 4YHHB 4I4TA 4MVSA 2Y4TA 2P4KA 5GW7A 3ML0A 5BXZA 3CS5A 1SQVH 1EBOA 1VF6A 5BMVA 1N0NA 2AHYA 1NT2B 2JS3A 1KBHA 4CH5A 3HKBA 2RNBA 2ATKC 2ETNA 1NU1H 3HB3B 2YC0A 3RGBA 3M99B 2WLKA 3T2MA 2Q68A 1XOUA 1MABG 5IYBO 2H94A 3RWRD 4AQYO 5FLXN 1BQ0A 1QVFU 4B3TO 2DYRC 1AI6A 1SQBH 5KMGB 1J5EB 4DR2B 4WBNA 1MSDA 2CH7A 2ZD9A 3MAQA 3A0HZ 3OFNG 2UUBO 2PZSA 1GTOA 2ADPA 3DGEA 4FLYA 4LF4B 3FKSG 4P2ZA 4GKKO 2OIGA 3CP1A 4TUYB 2CTWA 3ZHSA 1M1KW 1I08A 4AI8A 3KCYA 2QR4A 1DGSA 3H1HH 1FJGB 4JI1O 2LW1A 3E22B 4CBCA 1HNZB 5B1NA 2F95B 4CS3A 5EC2C 4H33A 2DOSA 1KKCA 2HR3A 1Q6UA 3FAVA 5CA3A 3CXCU 2EULA 3RYHA 3LSQA 2HEPA 2GTAA 4LH7A 3P32A 3RYCB 4WCEV 3DC5A 3ZMTA 1LUWA 1R6TA 1HNWB 3T4ZA 1ZAUA 3UM7A 3T1HB 2YXYA 4DV3O 2EIJB 4IT5A 2DMXA 5CBHA 5KHJA 5J9PC 1NS1A 5EIBD 1K4DC 2CGNA 3BPZA 1AJQA 2Z5UA 2ZNJA 1FXVA 2CDYA 2A7WA 3SYAA 2UUCB 1B06A 3CPWU 1EFRG 1TUBB 3RYFA 1NH2D 4ZHQA 1WJZA 5DECA 1YSCA 1AJPA 3JD3A 4RO2A 4LFCB 2XAFA 1Y4MA 1NTMH 2PGGA 4BWAA 2PF4E 4TT3G 3BA9A 4AQYB 4EFEA 4X1IA 4LBEC 1YJ9V 3SGIA 1YI2V 2B5UA 1WA8A 2WPDG 5LOVA 4DR2O 2X6AA 3PN1A 4X88A 2XAGA 1FAFA 4FLXA 3S3WA 3UT5A 4PHZA 1PPJH 2ILMA 3RYHB 1QHTA 1JX9A 2DYRB 4JASA 2CE4A 5JJJB 1ZWIC 3E86A 2ZE7A 1QVGU 3K03A 4DRXB 1VMGA 3SDLA 5LHHA 1VQ6V 3L74H 1DF4A 2VS0A 4DR1B 4FFBB 1I5XA 2XASA 3B09A 2QWQB 4GLXA 1AI5A 3K58A 2XOKG 1N33B 1MZEA 4H0LB 3HPLC 1KC8W 3SPCA 2YSUB 3EVKA 5H9CA 3KG2A 4DV7B 2ZR2A 2OTLV 2A0LA 1GMGA 3MHSC 5CMUA 3OTOB 3HR0A 1Q6HA 1SERA 1P7GA 5EIBC 3LNNA 5IDJA 3AK1A 2W6JG 1YIJV 1K5SA 2QGNA 1HNWO 3OEEG 4JI1B 1OCZB 4JI0B 1GO3F 1MMMA 1BCCH 1KECA 4W4LA 4D6TH 1GM7A 5LL6Y 1KKDA 1FYJA 3E83A 3CCMV 3ZIAG 1KP3A 1O9HA 3QTCA 3R66A 1MNGA 4KL1A 3F7VC 5KA5A 1P49A 2GHYA 3AG7A 1IBMO 1YJWV 1KU9A 1SS3A 2WSSG 2P22C 2QSAA 2DN9A 4OGQB 3AK3A 4N23A 4TV8A 1S0VA 1K3EA 2YDEA 3D3QA 4UCRA 1YCIA 3K3WA 1OZ0A 5CBFA 4X1YB 1GRJA 1VQLV 4J7ZA 4FMTA 1KYOF 2UXDB 1F4MA 5LBQA 2KB1A 1XQ8A 5JH7B 4LNUA 1QLNA 2EINC 1WB7A 2E5LO 2UUCO 1M56C 2CTRA 3QO8A 3X2QC 5LP6C 3UCSC 2AZ2A 1ENVA 4MVRA 5FPRA 3SJBC 4R7CA 2F23A 2B1IA 5CA0A 2UXCO 1IXBA 5D5QA 2PYLA 4MW8A 2FYUH 4DR1O 4J41A 5KMGA 4O4LB 1WPXA 4F6EA 2JK5C 1N33O 1E1QG 1ZUQA 4FM0A 3ZHQA 2F4VB 5FNVA 5B1OA 1JA8A 3DC6A 2GBOA 4DV7O 3A0BZ 3LDEA 1Y67A 2LJ2A 4UV8A 2YXHA 3CEIA 1YHQV 1VQ8V 2PI5A 3AG1B 2EJRA 1K34A 4X1KB 3JASA 5KX5A 1VQ5V 3BVOA 3HKCB 1VQ9V 3OE7G 1HWYA 4OXSA 1WA8B 1N36O 2QEXV 3ZJZA 4PDMA 3Q4HB 1RPOA 4X1IB 1BT8A 1XDCA 1EZVH 1SA0B 4U7OA 4QPKA 3B8NA 3QO7A 4A5UB 4PD4F 4NXNO 1IDSA 1I94B 3LUTB 3BY6A 2EILB 4GZRB 5C93A 5KHIA 2OWOA 1QCEA 3LNMB 4B3MO 1VF6C 3JSLA 4YY3O 2ZNIA 1WLEA 2VQFB 3BCCH 1BHBA 4TQFA 5IE9A 4EB6A 3ASNC 1NVPB 5B1BC 4UV9A 1OV9A 2QTOA 1G1XB 3ZX6A 1R3LC 4FFKA 2IJIA 1UJWB 4K35A 2E5LB 3GVMA 2K9PA 4TV9A 3VQXA 2QDOA 2R72A 3P30A 2HKOA 4I7ZB 1R73A 3OM3B 4R8CA 5L3FA 1SESA 3ZN1A 2Z0AA 1TUBA 3RYFB 3SJQC 1QQCA 1QU7A 3DXRB 1FFXB 2OIEA 2RCVA 3E8GA 4RAIA 5IY5C 1S76D 5BY1A 4PELA 5KHGA 1GN6A 3CCUV 1AR1B 1XREA 3B77A 3MHHC 2OT5A 1SQQH 4FPPA 1N0JA 2CGOA 2IJHA 3CRQA 1Q81W 1ZTEA 5LP6A 3CJHB 3D36A 3JCZA 4IYHA 5JVDB 4KHPB 2UUBB 3TGUH 2XAHA 1H2NA 2KSDA 3ZMUA 4K0KO 2EINB 3RYCA 4F6RB 4NXMB 3JARA 4TV8B 3JD2A 3CSXA 4QE7A 1VQ4V 3JALA 4RUFA 1K97A 3ABLB 5LGTA 3MDSA 1B6QA 4DR6B 1YZBA 4FM1A 4I0XB 4UVCA 3PJSK 3CCRV 1N36B 4AHCA 4MVUA 1RFYA 4PV1B 1THZA 3ICXA 3DTUB 4CS4A 1S3JA 3HKDB 1G6UA 1PV0A 4CH3A 2WAMA 3W7SA 3SPGA 1NI8A 4B3RO 4GKJO 2QKSA 2X6BA 3E89A 3A0RA 4UCTA 4LF7O 4EKWA 1GM9A 4IIJB 5JQGB 2WLJA 3OGIB 2VQFO 1BZKA 4FLTA 1WPBA 1GN3A 4PA4A 4JI5O 4DV2B 3JAKA 2L6LA 1R3IC 1WAZA 5BR8B 2NN4A 3L70H 2N74A 2QKAA 4FLWA 4PDRA 3FX7A 4FZ0A 4F4LA 4BAYA 3OMAB 4OPHA 3VQYA 3K08A 1XNQB 1M5IA 1JFFB 5B1AB 1XHZA 2PY5A 1FXKC 2E76B 4HAMA 2DYSC 1QBZA 3EFFK 3R65A 3S3XA 4XDKA 4NTXA 2X7RB 2OCCB 3G4SV 4EFBA 2A79B 5DM6V 1MG1A 1M9NA 3K59A 4UCUA 3G6BA 4E4EA 4X20A 1KD1W 3TXSA 1X59A 5IWAO 1HW7A 2ODMA 3ABKB 4JAVA 4WFAV 1AR4A 1OJHA 4FK5C 4ICGA 4TV9B 3D3IA 3RVZA 1NJIW 2A9HA 4KHPO 3C3TA 1R6KA 1F51A 3A8TA 3LDCA 5A9GA 4DV5O 2FKXA 3D8CA 2EIKC 4LF6O 2BSKA 1H8HG 1Q5OA 4LWSB 5EC1C 4WFGA 3CC2V 1EN4A 1W59A 3APOA 2P06A 1SQXH 3IGAC 4Q6GA 4DV0O 2PUSA 2GTSA 3OGCC 4MS2A 1XMQO 4LP8A 1GN4A 5F2VO 1N8RW 1VF7A 3ABLC 1P84F 2V1DA 3K57A 2ITDC 2RQ6A 4LNUB 3K5LA 2UUAO 1K92A 4RQEA 2DJVA 4G28B 2LFRA 1JR9A 4B3SO 1ZX3A 1Q7YW 1IVSA 5LXTA 2BTQB 3MD0A 1RM1C 5LHIA 1R3JC 4GCZA 2Q7HA 4I55B 4JI7B 1RSOA 4DV1O 1BL8A 4FZ1A 2G38A 4JI0O 3FB8C 5B3SC 3TETA 1N34B 1H8EG 5KX5B 5B3SB 1MOFA 4JI5B 1YDXA 3IC9A 1A32A 1PD3A 4J42A 1YJNV 3WG7B 2GV9A 2P4VA 3CMAV 5JCOC 1OCRB 3WB0A 1VF5B 1BGYH 1DLBA 1XNQO 3U10A 1W0KG 4P9PA 3AEIA 1SQFA 1SC5B 1FXHA 1G4YB 2WWWA 3KZIZ 4DV2O 1YITV 4QJFB 5IT9N 2EILC 2DWDC 4QE9A 5B1AC 1YTFD 3CCEV 5KAFZ 1H2GA 2Q7EA 2UXDO 5IYDO 2Y48A 1H2MA 3RVYA 5J2UB 3JAMN 4PA7A 4Z1VA 3J81N 2QA4V 3BHPA 4JI4B 4DV6O 2E3CA 3DSQA 2YICA 4NB5A 3W7WA 1NVPD 3JD1A 1VQPV 1FD9A 4YJ2B 3H9VA 2IH3C 4UUJC 1EN5A 2B9ZA 3BAAA 2WLIB 3ZHVA 1AR5A 1Y74B 2ZQMA 1K8AW 5L3EA 1HDJA 3HKBB 4X62B 3QVNA 4JTAB 5EBLC 5FL7G 2YIBD 4C7UA 4NKGB 3F7YC 2N05A 1HNXB 4JI8B 5LMNO 2JRIA 4U3JB 1BQZA 3B8MA 5JVDA 1YTFB 3K9SA 3Q4HA 1E1RG 2DWEC 4JTCB 5LP6B 4YJ2A 4DV5B 4QPJA 2JEUA 4GKKB 1K33A 2HP8A 4X1KA 4H37A 1D5AA 3KKYA 5J2UA 2Q4PA 3JD4A 2DE0X 4IIJA 1S72V 1FFXA 2IU3A 4ABMA 1P4RA 5JJNB 4DUYO 4MTGA 4DUZB 5ITZB 4MTXA 3M7MX 3FYIB 4O2BA 5C8YB 2HLDG 3OT7A 4B7KA 2UUAB 4Z1MG 3G71V 3P3PA 2F93B 1EN6A 3AG4C 3RT3C 5KA6A 3F5TA 4WF9V 1Y76B 3ZHUA 2VWJA 3WB1A 2QJ1A 5FPOA 4QGPA 4O4HA 1QNMA 4DV3B 3TK1A 1OHHG 3H1KH 3JD0A 3JCUZ 2VQEB 1NH2B 3I55V 2XUMA 4PA9A 1FPOA 4YJ3B 1VARA 1NZ6A 1PNKA 5K1XA 3G6EV 1D2DA 1U97A 2ZDIC 3F5WC 2IW5A 5JH7A 2EIJC 1VQMV 1R1BA 2X6CA 5HFLA 1XUQA 3H1LH 1V54B 4PA3A 1XL4A 4BR6A 1F7YA 3W7UA 2IH1C 3L73H 3WG7C 2EIMB 3CCSV 1IBLO 3N27A 1M93A 3ZRWB 2PI4A 1FS0G 4L87A 1GM8A 5KUKA 1TA8A 1Q90D 2IU0A 4X64B 5GONB 4IHJB 1K9MW 5E1AC 1KUQA 1QR9A 3JATB 1JOYA 1VQ7V 5AG2A 2JS5A 2ZKOA 4PI2A 4I9QA 4UCSA 1WP7A 5EYPB 2AW9A 3SYQA 4JZ2A 4X62O 3CB2A 3ZHRA 1N4CA 2GDSA 4QNHB 1BMFG 3GWOA 2BTOA 3SYPA 3ZMZA 4JYYA 1TAEA 1Z5VA 4JI8O 3CC7V 1P7BA 5LMNB 3K9AA 2GUZA 2EIKB 3AG3C 1XNRO 1M90W 2HVJC 1XL6A 3E8HA 2Y0PA 1WB8A 1YVWA 4WFBV 3OTOO 1AI4A 2JEXA 4D7SA 2RN9A 3UQ8A 2FL4A 1K7DA 2RJZA 1JVMA 3RFRA 3BEHA 2JVDA 3OTFA 3JASB 2R9RB 5CBGA 4BW9A 3JAKB 4B7EA 1V55C 2Q9LA 2VQEO 4DUZO 4P30A 4BIOA 4NR1A 1QR8A 5LHGA 2GUZB 5ITZA 5LOVB 2WLHA 3FYEB 3EXAA 3SPIA 2F66C 1IBMB 2LP7A 4QIWF 1KMIZ 3FD9A 3LSUA 1Y76A 3OUSA 4LH6A 3X2QB 2NNUA 2D3OW 3E35A 1N32B 2DQ3A 2ZIMA 2ARHA 2QWPB 1OCRC 4TSFG 2EBOA 2HJFC 5J2TA 4WFEA 3CCJV 5CA0B 4RUEA 1WN7A 3IC7A 5EZYA 2UXBB 4U3JA 1H38A 4CZZA 3VQWA 2AHZA 1M57C 2IBZH 1H2SB 3E2EA 3L9DA 2JJ1G 4MT8A 1PM9A 2YI8A 2AXTZ 2Y69C 1K4CC 5IJ9A 4K8XA 1VEWA 4BIZA 4X20B 1BE3H 1HR0B 2MW2B 4DV0B 3JALB 4YIPA 4JYAO 1SQPH 2Y4UA 2XAJA 5H2FZ 2F4VO 2YIDA 1LR1A 3N2KB 3AG3B 4UCVA 4X8AA 4KXRA 3OR7C 2Q8VA 3L75H 1JJ2U 4X65B 4XDJA 2QTSA 2V7QG 2R70A 4DR5O 3QF7A 1F23A 1N34O 4R50A 4ZHQB 1GH6A 3K5MA 2Q5ZA 3JYCA 5IYZB 4JI6O 4LC1A 4JPRA 5JQGA 1XNRB 1FKAO 1H2KA 3JATA 2CH7B 3ASOC 4P9OA 2EZOA 4LWSA 1Q3EA 4LF8B 4IGGA 4JI2B 1FFTB 5LA6A 3ABTA 5FNVB 1RSOB 1L1FA 1JQ0A 3T1YB 2RMKB 2XAQA 4B3MB 4K8ZA 1Z2GA 4YY3B 3K04A 5LGUA 4YXWG 1N32O 1S77D 1RP3B 1US6A 3N2KA 3IJ4A 2HG5C 5LYJA 3C3SA 3OD4A 4LFBO 4PDLA 4I9WA 4O4JB 4JAUA 2BCCH 2N04A 2UXBO 1PNLA 1K73W 4ZBMA 4I5SA 1XMOO 3P3NA 4JI4O 4DV6B 5HFMA 3EHBB 1Y66A 3ZS8C 5CA1A 3BFRA 2YEVB 5H6QA 1KQSU 1Y6XA 1TVKA 2LW7A 1Y74A 2EX3A 3K06A 1TVKB 3ABMC 1B04A 4OPAA 2QE7G 2WLLA 2YIAA 5IJ0B 3SYOA 3WB2A 5KLVH 4JYCA 1ZL8A 4ASUG 4YIOA 3SR2C 2K1EA 2Q69A 1AI7A 4IYIA 1HNXO 5EZYB 2Y69B 4LF9B 2UXNA 1VQKV 2UU9O 1CPYA 1SZTA 1Q6IA 2E74B 2YXLA 4CH4A 1QLEB 3HKEA 1XHXA 2FB5A 2AZ0A 4FLUA 1CP9A 1NR1A 4NXMO 4DW1A 1H2LA 4GUNA 3FFQA 1RPRA 4FM2A 5GTIZ 3BRCA 2UXCB 3ETDA 4IHJA 3GB7C 4JYAB 1WP8A 5CA1B 1R6NA 1X4TA 3AG4B 4MVMA 3TJTA 3CXHF 5IYZA 2ZE6A 4UB6Z 3UO3A 5B66Z 1NKDA 1L0NH 1PL0A 5KAIZ 3ASOB 4MW3A 5IYCO 4JI2O 3B40A 4O4JA 3WFVA 2QM7A 2WA4A 3BABA 5L3GA 2ZDIA 4X65O 3APQA 1OCCC 4B3RB 1L0LH 4DR5B 3UO2A 2Q6AA 1MSWD 3QG5A 4UCOA 2XTAA 3FB5C 2XT9A 2P5OA 4YJ3A 5CB4A 4HBNA 2WLMA 1YEWA 5BR8O 3SYCA 2EIMC 3AG2C 2KG7B 2VWKA 3AK2A 3KCXA 1JJOA 4G27B 3N2GA 4W4KA 3T1YO 4DV4O 4DR3O 4ZI7B 1EM1A 5EYPA 3ZEDA 3JARB 1GN2A 4DR4O 1IBLB 2BOCC 2YUAA 3ZHTA 5K1PA 1I5YA 2DQ0A 4TOIA 1ROPA 2P6JA 4X1YA 2XHBA 2X0LA 1S5HC 3I56V 3IAYA 4JTDB 3ZRSA 1M4UA 5L3CA 5B1BB 2XNDG 4X66O 2YIBA 1ORQC 4OX9O 4GX5A 4MVOA 4G2KA 1SRYA 3UT5B 3QO5A 2A3QA 5CB4B 2HJDA 4UFZA 4MTOA 4LF6B 3GWKC 1PNMA 5IJ9B 2LFSA 4X9QA 3E22A 1LUVA 2LQTA 4DK0A
chains in the Genus database with same CATH topology
1KP2A 1TUEB 4JYBA 2IH1C 4N21A 3WG7C 2EIMB 3CCSV 4U7OA 4QPKA 3B8NA 3QO7A 2IJKA 3OUFA 3AG2B 3ZRWB 2PI4A 1FS0G 2EZPA 3LUTB 1Q82W 3BY6A 3SPJA 2EILB 2QM8A 5C93A 1QLEC 4L87A 1GM8A 5KUKA 1QCEA 3E8BA 3LNMB 2CK3G 2IU0A 2M7WA 2MK3A 1WLEA 1BHBA 1AJNA 2JDIG 1K9MW 5E1AC 1QR9A 2WLIA 1JOYA 3AG1C 4KUMA 1VQ7V 3ASNC 1NVPB 5B1BC 4MVQA 4UV9A 3ABUA 2Q67A 2QTOA 1R3LC 2IJIA 2BOBC 2HFEC 3SYQA 1UJWB 4BIUA 3P30A 2HKOA 1DF5A 3SPHA 1R73A 4QNHB 3OM3B 1BMFG 3GWOA 4R8CA 2NLJC 5L3FA 1SESA 3SYPA 3ZN1A 3ZMZA 3CCLV 3OW2U 3K0GA 3SJQC 3CC7V 1P7BA 3E8GA 5IY5C 4RAIA 1S76D 3QNEA 2F43G 3K9AA 4MTFA 3ABMB 4XDLA 4PELA 1OCCB 2P90A 1BHAA 2EIKB 3AG3C 4DO2A 1M90W 2FTKA 1W0JG 2HVJC 1XL6A 4GX1A 1AR1B 3E8HA 3K0DA 2Z3YA 3CCUV 3B77A 2WLLB 3MHHC 2OT5A 1IXMA 4WFBV 4FPPA 1AI4A 2IJHA 2JEXA 1Q81W 2B1GA 2ZXWB 1VQNV 1G8MA 1R3KC 3CD6V 3ETEA 1K7DA 3RW0A 3D36A 1JVMA 3JCZA 3CCVV 4UVAA 1K5QA 3BEHA 2JIZG 4KFMA 3LDDA 5H6RA 2XAHA 3ZMUA 2R9RB 1OCOB 5CBGA 1VQOV 2EINB 4MVSA 1V55C 3JD2A 5GW7A 1E79G 3ML0A 4BW5A 4P30A 1EBOA 4QE7A 5DN6G 1VQ4V 1QR8A 5LHGA 4RUFA 1K97A 3ABLB 2AHYA 4J9ZB 4DXWA 2WLHA 5LGTA 3FYEB 5L3BA 1B6QA 2ATKC 3CYOA 3HB3B 4FIPC 3SPIA 3M99B 2LP7A 2WLKA 4QIWF 4UVCA 3T2MA 3PJSK 3CCRV 2Q68A 3ZMSA 4MVUA 1MABG 1THZA 5IYBO 1OCZC 3OUSA 2H94A 3X2QB 2NNUA 3VOUA 1LNQA 2D3OW 3E35A 3DTUB 1QVFU 2DYRC 1S3JA 1AI6A 2DQ3A 3FB6C 3RBZA 2WAMA 3W7SA 4FJCC 1OCRC 4TSFG 2EBOA 2HJFC 3SPGA 4WFEA 5KUMA 3CCJV 2ZD9A 4JGSA 4RUEA 2QKSA 2X6BA 3OFNG 3E89A 3IC7A 2H8PC 3ZRXA 3A0RA 1H38A 4EKWA 1GM9A 3CCQV 2WLJA 1GTOA 3ABKC 3DGEA 4CZZA 3FKSG 4P2ZA 4PA4A 3CP1A 3E8FA 2AHZA 1M57C 1R3IC 1M1KW 3E2EA 2JJ1G 4CBCA 4MT8A 5B1NA 2Y69C 1K4CC 4PDRA 5EC2C 4F4LA 1V55B 4BAYA 4H33A 3OMAB 3K08A 4BIZA 2HR3A 5B1AB 1FXKC 4HAMA 2DYSC 1QBZA 3EFFK 3R65A 5CA3A 2GSMB 4XDKA 4GT1A 1FXKA 3STZC 3CXCU 5EK0A 1M56B 2X7RB 4PDVA 1JPXA 2OCCB 3LSQA 3G4SV 2XAJA 3CMEV 3P32A 4WCEV 4KP4A 2A79B 2W0FC 5DM6V 1MG1A 3AG3B 1M9NA 4GX0A 3ZMTA 3T4ZA 3UM7A 3T1CA 1KD1W 2EIJB 4X8AA 3OR7C 3ABKB 4HYOA 4JAVA 4RQFA 4WFAV 1JJ2U 3OEHG 5CBHA 4FK5C 4XDJA 5J9PC 3D3IA 3RVZA 1NJIW 2A9HA 2IJJA 1R6KA 1K4DC 1F51A 2V7QG 3LDCA 2ZXWC 1F23A 1AJQA 4R50A 2Z5UA 4MSWC 2C2AA 3JYCA 1FXVA 4XBFA 1OCOC 4LC1A 4JPRA 3SYAA 2EIKC 5EC1C 1H8HG 3CPWU 4WFGA 1EFRG 3ASOC 4P9OA 4LCUC 2EZOA 3CC2V 1NH2D 1JCHA 3IGAC 1GK9A 5LGNA 1YSCA 1FFTB 1AJPA 3JD3A 4RO2A 2XAFA 1Y4MA 2HVKC 3ABTA 3OGCC 4MS2A 2OCCC 1L1FA 3OMNB 4LP8A 1JQ0A 2XAQA 4TT3G 1N8RW 3ABLC 2V1DA 3OAAG 2ITDC 3K04A 5LGUA 1K92A 4YXWG 4LBEC 4RQEA 1S77D 1YJ9V 4G28B 1YI2V 2B5UA 2LFRA 4ZKIA 2WPDG 1Q7YW 2X6AA 4X88A 1F4NA 2HG5C 5L3DA 3MD0A 1RM1C 2XAGA 4PDLA 1R3JC 4GCZA 4I9WA 5LHIA 4JAUA 1EZJA 1FXKB 1JX9A 4R6ZA 2DYRB 4JASA 1BL8A 3TETA 5B3SC 1PNLA 3FB8C 1K73W 1H8EG 1ZWIC 4ZBMA 5B3SB 4I5SA 1MOFA 3E86A 1QVGU 3K03A 5IY5B 4U7NA 5HFMA 3EHBB 1Y66A 1AROP 4JF3A 5LHHA 1VQ6V 1DF4A 1NBMG 1J95A 1GKFA 3K79A 2YEVB 5H6QA 3H01A 1KQSU 1COWG 1PD3A 5EBWC 1I5XA 2XASA 1YJNV 3WG7B 3K06A 3OMIB 1AI5A 2XOKG 3ABMC 3CMAV 1OCRB 2QE7G 2WLLA 3HPLC 1KC8W 3ASNB 3SPCA 2YSUB 3SYOA 5H9CA 4E2LA 4JYCA 4ASUG 3KG2A 1DLBA 2ZR2A 2OTLV 2A0LA 1GMGA 4J9YB 3ZCCA 3ZRVA 2K1EA 1W0KG 2Q69A 1AI7A 2R9IA 3MHSC 5CMUA 4P9PA 3AEIA 4Q20A 1DTOA 2Y69B 1FXHA 1G4YB 2WWWA 1SERA 2UXNA 1YITV 1VQKV 5IDJA 1CPYA 1M57B 4QJFB 1SZTA 2DWDC 2EILC 2W6JG 4QE9A 5B1AC 1YIJV 1K5SA 1QLEB 5BZBA 1YTFD 3CCEV 1H2GA 3OEEG 4WFHA 5IYDO 1OCZB 2Y48A 3RVYA 2QA4V 4PA7A 1CP9A 1GO3F 1NR1A 1RPRA 3W7WA 1NVPD 3JD1A 1VQPV 1KECA 4HZ3A 4WFFA 1GM7A 3ETDA 1KKDA 3VBBA 3E83A 4PA6A 3CCMV 2IH3C 3ZIAG 4UUJC 3GB7C 1KP3A 2WLNA 2WLIB 1R6NA 2ZQMA 1K8AW 3F7VC 5KA5A 5L3EA 3AG4B 2GHYA 4JTAB 3LSSA 4MVMA 2YEVA 5EBLC 5FL7G 1RM1B 1YJWV 2WSSG 1NKDA 1PL0A 4N23A 3ASOB 4MW3A 4UXNA 5IYCO 1W2BU 3F7YC 1S0VA 3WFVA 1K3EA 2QM7A 3ETGA 3B8MA 5L3GA 2ZDIA 1YTFB 3K3WA 1OZ0A 2JJ2G 1E1RG 1OCCC 5CBFA 2DWEC 3ZMVA 1VQLV 4JTCB 4FMTA 2OTJV 1F4MA 2Q6AA 5LBQA 2KB1A 1MSWD 2ITCC 4QPJA 3STLC 2JEUA 1QLNA 2EINC 1K33A 3FB5C 1M56C 4H37A 3TCUA 3QO8A 2WLMA 3X2QC 3NXSA 3JD4A 1S72V 1PKXA 2IU3A 3SYCA 2DW4A 1ENVA 2EIMC 3AG2C 4MVRA 4R7CA 1P4RA 4G27B 3IFXA 3OR6C 2B1IA 5EBMC 1V54C 1Q86W 4MTGA 4MTXA 4MW8A 2P67A 3FYIB 2DYSB 2HLDG 1NQTA 4Z1MG 3G71V 1WPXA 1SETA 2W6IG 3ZRWA 3W7XA 2JK5C 2BOCC 3AG4C 1E1QG 5KA6A 1I5YA 5B1OA 4WF9V 2DQ0A 2P7TC 4UVBA 2ZR3A 1CEZA 3CC4V 1ROPA 3LDEA 2P6JA 5CN0A 4UV8A 3T4DA 3TK1A 1OHHG 2X0LA 1S5HC 3JD0A 3I56V 3W7TA 3FB7C 1YHQV 4JTDB 1NH2B 3I55V 1VQ8V 2PI5A 3ZRSA 4MVZA 3ZN0A 3AG1B 4PA9A 2EJRA 5B1BB 2XNDG 4X89A 5L3CA 1K34A 1ORQC 1PNKA 4GX5A 4MVOA 3G6EV 4G2KA 1VQ5V 1SRYA 4GX2A 2ZDIC 3F5WC 2IW5A 3QO5A 2UXXA 2EIJC 1VQMV 1NR7A 2X6CA 3UKMA 1VQ9V 3OE7G 4MTOA 1HWYA 5HFLA 4OXSA 1PNMA 4TWKA 1V54B 2LFSA 4PA3A 3ZJZA 1XL4A 2QEXV 4PDMA 3W7UA 1RPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IH1 C;  2WLK A;  3T2M A;  4JTA B;  3IGA C;  3PJS K;  2Q68 A;  2YEV A;  4MVM A;  5EBL C;  3WG7 C;  4MVU A;  3OUF A;  4RO2 A;  1OCZ C;  3OUS A;  2HVK C;  3OGC C;  4MS2 A;  2OCC C;  3VOU A;  1LNQ A;  4MW3 A;  2DYR C;  3LUT B;  4LP8 A;  3F7Y C;  3SPJ A;  1QLE C;  3FB6 C;  5KUK A;  3ABL C;  3RBZ A;  3E8B A;  3LNM B;  1OCR C;  2ITD C;  2HJF C;  3SPG A;  3K04 A;  4WFE A;  5KUM A;  4LBE C;  2ZD9 A;  1OCC C;  5CBF A;  4G28 B;  2DWE C;  4RUE A;  2QKS A;  2X6A A;  2X6B A;  4JTC B;  3E89 A;  4X88 A;  5E1A C;  2WLI A;  2HG5 C;  2H8P C;  2Q6A A;  2KB1 A;  4EKW A;  2ITC C;  2WLJ A;  3AG1 C;  4PDL A;  1R3J C;  3STL C;  4I9W A;  3ASN C;  3ABK C;  2EIN C;  4MVQ A;  4PA4 A;  4P2Z A;  5B1B C;  3FB5 C;  2Q67 A;  2QTO A;  1M56 C;  1R3L C;  4H37 A;  4R6Z A;  1BL8 A;  3TET A;  3E8F A;  5B3S C;  3FB8 C;  2AHZ A;  3TCU A;  2BOB C;  2WLM A;  1M57 C;  1ZWI C;  1R3I C;  4ZBM A;  3X2Q C;  2HFE C;  3E86 A;  3SYQ A;  3K03 A;  3SYC A;  2EIM C;  3AG2 C;  4MVR A;  4CBC A;  3SPH A;  4R7C A;  4QNH B;  1J95 A;  2Y69 C;  1K4C C;  4PDR A;  4G27 B;  3IFX A;  2NLJ C;  3OR6 C;  4R8C A;  5EC2 C;  3SYP A;  4F4L A;  5EBM C;  1V54 C;  5EBW C;  4H33 A;  4MTG A;  3K0G A;  3SJQ C;  3K08 A;  4MW8 A;  3K06 A;  1P7B A;  3E8G A;  5IY5 C;  4RAI A;  3ABM C;  4MTF A;  4XDL A;  2DYS C;  2WLL A;  3HPL C;  3SPC A;  3AG3 C;  3EFF K;  3R65 A;  3SYO A;  2HVJ C;  4GX1 A;  1XL6 A;  3KG2 A;  4XDK A;  3E8H A;  3K0D A;  3STZ C;  2A0L A;  5EK0 A;  2WLL B;  2JK5 C;  4PDV A;  2BOC C;  4J9Y B;  2K1E A;  3AG4 C;  2Q69 A;  4P9P A;  2P7T C;  2A79 B;  2W0F C;  1G4Y B;  1R3K C;  3LDE A;  4GX0 A;  3RW0 A;  3T4Z A;  3UM7 A;  3T1C A;  3T4D A;  1JVM A;  1S5H C;  2DWD C;  2EIL C;  4X8A A;  4QE9 A;  3OR7 C;  5B1A C;  5BZB A;  3BEH A;  3FB7 C;  4HYO A;  4JTD B;  4KFM A;  3LDD A;  4WFH A;  3ZRS A;  4MVZ A;  3RVY A;  4PA7 A;  5CBH A;  2R9R B;  4XDJ A;  5CBG A;  4PA9 A;  5J9P C;  3RVZ A;  2A9H A;  4MVS A;  1ORQ C;  4X89 A;  1V55 C;  1K4D C;  4GX5 A;  4MVO A;  3LDC A;  4BW5 A;  4GX2 A;  4P30 A;  3F5W C;  2ZXW C;  2EIJ C;  4QE7 A;  4R50 A;  2X6C A;  4MSW C;  3UKM A;  4RUF A;  4HZ3 A;  4WFF A;  2AHY A;  3JYC A;  4J9Z B;  4MTO A;  1OCO C;  1KKD A;  3E83 A;  4OXS A;  4DXW A;  4PA6 A;  2WLH A;  4TWK A;  3SYA A;  2IH3 C;  2EIK C;  4UUJ C;  3GB7 C;  5EC1 C;  2WLN A;  4PA3 A;  1XL4 A;  2WLI B;  2ATK C;  4PDM A;  4WFG A;  3ZJZ A;  3ASO C;  4P9O A;  3SPI A;  4LCU C;  3F7V C; 
#chains in the Genus database with same CATH topology
 1KP2 A;  3B4S A;  4JYB A;  3J80 N;  3K5N A;  4DW0 A;  2IJK A;  3OUF A;  2YI9 A;  2Q0O C;  4LFC O;  2UU9 B;  2QM8 A;  3VQV A;  5H5N A;  3E8B A;  1NTZ H;  2CK3 G;  4B3S B;  2JDI G;  1AVM A;  1Q43 A;  3AG1 C;  4JI7 O;  4DV1 B;  4NVP A;  4MVQ A;  3ABU A;  2LGW A;  1SF9 A;  4FLV A;  1DK1 A;  1U96 A;  4BIU A;  4H44 B;  2L35 A;  1CXZ B;  1DF5 A;  3SPH A;  2EJ7 A;  2NLJ C;  4I50 A;  3CCL V;  3OW2 U;  3HKC A;  2QKC A;  3N2G B;  3QNE A;  3L72 H;  2F43 G;  4MTF A;  2P90 A;  1BHA A;  4DO2 A;  1W0J G;  4GX1 A;  3K0D A;  2Z3Y A;  4EEQ A;  1IXM A;  2R9A A;  2ZXW B;  2V4D A;  1VQN V;  1G8M A;  1T5E A;  1SA0 A;  3CD6 V;  4O2A A;  3RW0 A;  2ZE8 A;  4O4I A;  3CCV V;  2ZCE A;  1K5Q A;  2JIZ G;  4KFM A;  1GAX A;  1OCO B;  1VQO V;  5LA6 B;  1E79 G;  4BW5 A;  1SKV A;  5DN6 G;  4X66 B;  4J9Z B;  1HP8 A;  2RDC A;  4DXW A;  1L8D A;  5L3B A;  3CYO A;  4FIP C;  5D5P A;  1UPG A;  2HHH O;  4NTW A;  3ZMS A;  1SQG A;  1HR0 O;  1OCZ C;  2H3O A;  3VOU A;  1LNQ A;  4J7J A;  3FB6 C;  3RBZ A;  4FJC C;  1PL4 A;  5KUM A;  2OCH A;  4JGS A;  3HKE B;  4I0X A;  4OX9 B;  4CH6 A;  2D2C B;  2ZM6 B;  2H8P C;  3ZRX A;  4DK1 A;  3CCQ V;  4YHH O;  3ABK C;  4LF5 B;  2O57 A;  2CAZ C;  3E8F A;  1XBL A;  3H1I H;  1ZL8 B;  4ZOL B;  2BE3 A;  1V9P A;  3BA8 A;  1V55 B;  4DUY B;  2F1M A;  2VRZ A;  3CHX A;  3CJH A;  4LF8 O;  3CRA A;  5A2Q N;  3CRM A;  2GSM B;  4GT1 A;  1FXK A;  3STZ C;  5EK0 A;  1M56 B;  4PDV A;  4GYC B;  2W0X A;  1JPX A;  3CME V;  4LFA B;  5DED A;  4I4T B;  4KP4 A;  1BSM A;  4NTY A;  2W0F C;  4GX0 A;  3B2E E;  3DXR A;  3T1C A;  4H13 B;  4ZOL A;  1S5L Z;  4HYO A;  4RQF A;  3OEH G;  5B5E Z;  2JGD B;  4CS2 A;  2IJJ A;  1BS3 A;  1FJG O;  2ZXW C;  1XMO B;  4MSW C;  2C2A A;  4XBF A;  1OCO C;  1MA1 A;  2CUG A;  4LCU C;  2NR5 A;  1JCH A;  1GK9 A;  2Q0A A;  5LGN A;  2PYJ A;  1VIB A;  2HVK C;  1B3Q A;  3CWB H;  4NXN B;  2OCC C;  3OMN B;  1I94 O;  2Q7G A;  1ZSP A;  2WA3 A;  1I0H A;  3OAA G;  4X64 O;  3T1H O;  4JV5 B;  4ZKI A;  4LF9 O;  1F4N A;  5L3D A;  1URF A;  5GON A;  3ETQ A;  4FFB A;  1AP5 A;  1EZJ A;  1FXK B;  3D36 C;  4B08 A;  3M8A A;  4F6R A;  4R6Z A;  4DRX A;  2KQX A;  3NR7 A;  4CC6 A;  5IY5 B;  1UFI A;  4U7N A;  4LF5 O;  2HHH B;  3FAV B;  1ARO P;  2M6Y A;  4JF3 A;  4JI3 O;  3K79 A;  1NBM G;  1J95 A;  1GKF A;  1IX9 A;  4O4H B;  3H01 A;  1COW G;  5EBW C;  3OMI B;  4J7K A;  1XIL A;  3CE2 A;  3ASN B;  4E2L A;  5JCO A;  2KKW A;  4J9Y B;  3ZCC A;  3ZRV A;  2ZM6 O;  4TUY A;  2CTQ A;  2R9I A;  4O2B B;  5C8Y A;  1XEQ A;  4Q20 A;  1DTO A;  4ZI7 A;  1AP6 A;  2Y0I A;  4UB8 Z;  1IBK O;  4FLZ A;  4LFA O;  1M57 B;  3SJC C;  3JAW B;  5BZB A;  3HKD A;  4WFH A;  4K0K B;  3C90 A;  3ZBH A;  4J10 A;  1JMK C;  1Z5W A;  4HZ3 A;  4WFF A;  3VBB A;  1IZ3 A;  4PA6 A;  3CRC A;  2WLN A;  3K5O A;  4DR6 O;  2ZIN A;  4TQD A;  5LMU O;  3LSS A;  5JJE B;  2YEV A;  1WNS A;  4DV4 B;  4DR3 B;  1RM1 B;  3H1J H;  2QWO B;  2QM4 A;  1S5J A;  4UXN A;  1W2B U;  4DR4 B;  3RN4 A;  3ETG A;  2JGD A;  5LXT B;  2JJ2 G;  4O2A B;  3ZMV A;  5LYJ B;  1KB9 F;  5J2T B;  4Z2W A;  4DR7 B;  4GKJ B;  2OTJ V;  4U3F H;  2ITC C;  5GTH Z;  4LF7 B;  4JV5 O;  3STL C;  1D5N A;  3RYI A;  2AGA A;  1XI1 A;  3TCU A;  4J80 A;  3NXS A;  1PKX A;  2CTP A;  2DW4 A;  2IM9 A;  2ZIO A;  4RWU A;  4JAA A;  4ZIB A;  4K3A A;  2BSK B;  3IFX A;  3OR6 C;  2BTQ A;  5EBM C;  3THO A;  1V54 C;  1Q86 W;  4JZG A;  4JI3 B;  4IL6 Z;  2P67 A;  3O65 A;  2E75 B;  2DYS B;  1NQT A;  1SET A;  2W6I G;  3ZRW A;  3W7X A;  4EB6 B;  1SZX A;  2Q73 A;  2P7T C;  4HNA B;  4UVB A;  2OYQ A;  2ZR3 A;  1CEZ A;  3CC4 V;  5CN0 A;  2JGU A;  3T4D A;  4B3T B;  2A06 H;  3W7T A;  5IWA B;  1J5E O;  3FB7 C;  4MVZ A;  3WU2 Z;  3CRR A;  3ZN0 A;  3J7A U;  3G67 A;  4X89 A;  5JWP A;  1I7F A;  5BMV B;  1YXB A;  5KHH A;  4I55 A;  4GX2 A;  2UXX A;  1AB3 A;  1NR7 A;  5KHK A;  3UKM A;  4PI0 A;  4JI6 B;  5E79 Z;  4TWK A;  1Q8I A;  2LO1 A;  3A2F A;  1AIL A;  2ZE5 A;  3SJA C;  4HNA A;  1TUE B;  4N21 A;  1YF2 A;  3G80 A;  1HNZ O;  3AG2 B;  4NYK A;  1IBK B;  4DYL A;  2EZP A;  1Q82 W;  2QWR B;  2PTM A;  1XMQ B;  3SPJ A;  1QLE C;  3I5D A;  3JAW A;  2M7W A;  1IUR A;  1JFF A;  2MK3 A;  3TXQ A;  1AJN A;  4LF4 O;  4O4I B;  2WLI A;  4LFB B;  4CC5 A;  4KUM A;  4DR7 O;  2Q67 A;  4WBN B;  3JSN A;  2QWN B;  2ADQ B;  2FML A;  3RYI B;  4O4L A;  2BOB C;  2HFE C;  3CX5 F;  5LMU B;  4AIL C;  2YS8 A;  4J11 A;  2KG7 A;  1TGO A;  3K0G A;  1ZLZ A;  3U11 A;  4I50 B;  3U0Z A;  3ABM B;  4XDL A;  3O9O A;  1OCC B;  1MZF A;  2FTK A;  4FVM A;  4L8J A;  2WLL B;  5IJ0 A;  4PJ0 Z;  1NTK H;  2B1G A;  5TIS Z;  1R3K C;  3ETE A;  3L71 H;  2ZT9 B;  2LGQ A;  1O9G A;  4UVA A;  1VP7 A;  1PP9 H;  4D7T A;  3LDD A;  5H6R A;  4LR3 A;  4YHH B;  4I4T A;  4MVS A;  2Y4T A;  2P4K A;  5GW7 A;  3ML0 A;  5BXZ A;  3CS5 A;  1SQV H;  1EBO A;  1VF6 A;  5BMV A;  1N0N A;  2AHY A;  1NT2 B;  2JS3 A;  1KBH A;  4CH5 A;  3HKB A;  2RNB A;  2ATK C;  2ETN A;  1NU1 H;  3HB3 B;  2YC0 A;  3RGB A;  3M99 B;  2WLK A;  3T2M A;  2Q68 A;  1XOU A;  1MAB G;  5IYB O;  2H94 A;  3RWR D;  4AQY O;  5FLX N;  1BQ0 A;  1QVF U;  4B3T O;  2DYR C;  1AI6 A;  1SQB H;  5KMG B;  1J5E B;  4DR2 B;  4WBN A;  1MSD A;  2CH7 A;  2ZD9 A;  3MAQ A;  3A0H Z;  3OFN G;  2UUB O;  2PZS A;  1GTO A;  2ADP A;  3DGE A;  4FLY A;  4LF4 B;  3FKS G;  4P2Z A;  4GKK O;  2OIG A;  3CP1 A;  4TUY B;  2CTW A;  3ZHS A;  1M1K W;  1I08 A;  4AI8 A;  3KCY A;  2QR4 A;  1DGS A;  3H1H H;  1FJG B;  4JI1 O;  2LW1 A;  3E22 B;  4CBC A;  1HNZ B;  5B1N A;  2F95 B;  4CS3 A;  5EC2 C;  4H33 A;  2DOS A;  1KKC A;  2HR3 A;  1Q6U A;  3FAV A;  5CA3 A;  3CXC U;  2EUL A;  3RYH A;  3LSQ A;  2HEP A;  2GTA A;  4LH7 A;  3P32 A;  3RYC B;  4WCE V;  3DC5 A;  3ZMT A;  1LUW A;  1R6T A;  1HNW B;  3T4Z A;  1ZAU A;  3UM7 A;  3T1H B;  2YXY A;  4DV3 O;  2EIJ B;  4IT5 A;  2DMX A;  5CBH A;  5KHJ A;  5J9P C;  1NS1 A;  5EIB D;  1K4D C;  2CGN A;  3BPZ A;  1AJQ A;  2Z5U A;  2ZNJ A;  1FXV A;  2CDY A;  2A7W A;  3SYA A;  2UUC B;  1B06 A;  3CPW U;  1EFR G;  1TUB B;  3RYF A;  1NH2 D;  4ZHQ A;  1WJZ A;  5DEC A;  1YSC A;  1AJP A;  3JD3 A;  4RO2 A;  4LFC B;  2XAF A;  1Y4M A;  1NTM H;  2PGG A;  4BWA A;  2PF4 E;  4TT3 G;  3BA9 A;  4AQY B;  4EFE A;  4X1I A;  4LBE C;  1YJ9 V;  3SGI A;  1YI2 V;  2B5U A;  1WA8 A;  2WPD G;  5LOV A;  4DR2 O;  2X6A A;  3PN1 A;  4X88 A;  2XAG A;  1FAF A;  4FLX A;  3S3W A;  3UT5 A;  4PHZ A;  1PPJ H;  2ILM A;  3RYH B;  1QHT A;  1JX9 A;  2DYR B;  4JAS A;  2CE4 A;  5JJJ B;  1ZWI C;  3E86 A;  2ZE7 A;  1QVG U;  3K03 A;  4DRX B;  1VMG A;  3SDL A;  5LHH A;  1VQ6 V;  3L74 H;  1DF4 A;  2VS0 A;  4DR1 B;  4FFB B;  1I5X A;  2XAS A;  3B09 A;  2QWQ B;  4GLX A;  1AI5 A;  3K58 A;  2XOK G;  1N33 B;  1MZE A;  4H0L B;  3HPL C;  1KC8 W;  3SPC A;  2YSU B;  3EVK A;  5H9C A;  3KG2 A;  4DV7 B;  2ZR2 A;  2OTL V;  2A0L A;  1GMG A;  3MHS C;  5CMU A;  3OTO B;  3HR0 A;  1Q6H A;  1SER A;  1P7G A;  5EIB C;  3LNN A;  5IDJ A;  3AK1 A;  2W6J G;  1YIJ V;  1K5S A;  2QGN A;  1HNW O;  3OEE G;  4JI1 B;  1OCZ B;  4JI0 B;  1GO3 F;  1MMM A;  1BCC H;  1KEC A;  4W4L A;  4D6T H;  1GM7 A;  5LL6 Y;  1KKD A;  1FYJ A;  3E83 A;  3CCM V;  3ZIA G;  1KP3 A;  1O9H A;  3QTC A;  3R66 A;  1MNG A;  4KL1 A;  3F7V C;  5KA5 A;  1P49 A;  2GHY A;  3AG7 A;  1IBM O;  1YJW V;  1KU9 A;  1SS3 A;  2WSS G;  2P22 C;  2QSA A;  2DN9 A;  4OGQ B;  3AK3 A;  4N23 A;  4TV8 A;  1S0V A;  1K3E A;  2YDE A;  3D3Q A;  4UCR A;  1YCI A;  3K3W A;  1OZ0 A;  5CBF A;  4X1Y B;  1GRJ A;  1VQL V;  4J7Z A;  4FMT A;  1KYO F;  2UXD B;  1F4M A;  5LBQ A;  2KB1 A;  1XQ8 A;  5JH7 B;  4LNU A;  1QLN A;  2EIN C;  1WB7 A;  2E5L O;  2UUC O;  1M56 C;  2CTR A;  3QO8 A;  3X2Q C;  5LP6 C;  3UCS C;  2AZ2 A;  1ENV A;  4MVR A;  5FPR A;  3SJB C;  4R7C A;  2F23 A;  2B1I A;  5CA0 A;  2UXC O;  1IXB A;  5D5Q A;  2PYL A;  4MW8 A;  2FYU H;  4DR1 O;  4J41 A;  5KMG A;  4O4L B;  1WPX A;  4F6E A;  2JK5 C;  1N33 O;  1E1Q G;  1ZUQ A;  4FM0 A;  3ZHQ A;  2F4V B;  5FNV A;  5B1O A;  1JA8 A;  3DC6 A;  2GBO A;  4DV7 O;  3A0B Z;  3LDE A;  1Y67 A;  2LJ2 A;  4UV8 A;  2YXH A;  3CEI A;  1YHQ V;  1VQ8 V;  2PI5 A;  3AG1 B;  2EJR A;  1K34 A;  4X1K B;  3JAS A;  5KX5 A;  1VQ5 V;  3BVO A;  3HKC B;  1VQ9 V;  3OE7 G;  1HWY A;  4OXS A;  1WA8 B;  1N36 O;  2QEX V;  3ZJZ A;  4PDM A;  3Q4H B;  1RPO A;  4X1I B;  1BT8 A;  1XDC A;  1EZV H;  1SA0 B;  4U7O A;  4QPK A;  3B8N A;  3QO7 A;  4A5U B;  4PD4 F;  4NXN O;  1IDS A;  1I94 B;  3LUT B;  3BY6 A;  2EIL B;  4GZR B;  5C93 A;  5KHI A;  2OWO A;  1QCE A;  3LNM B;  4B3M O;  1VF6 C;  3JSL A;  4YY3 O;  2ZNI A;  1WLE A;  2VQF B;  3BCC H;  1BHB A;  4TQF A;  5IE9 A;  4EB6 A;  3ASN C;  1NVP B;  5B1B C;  4UV9 A;  1OV9 A;  2QTO A;  1G1X B;  3ZX6 A;  1R3L C;  4FFK A;  2IJI A;  1UJW B;  4K35 A;  2E5L B;  3GVM A;  2K9P A;  4TV9 A;  3VQX A;  2QDO A;  2R72 A;  3P30 A;  2HKO A;  4I7Z B;  1R73 A;  3OM3 B;  4R8C A;  5L3F A;  1SES A;  3ZN1 A;  2Z0A A;  1TUB A;  3RYF B;  3SJQ C;  1QQC A;  1QU7 A;  3DXR B;  1FFX B;  2OIE A;  2RCV A;  3E8G A;  4RAI A;  5IY5 C;  1S76 D;  5BY1 A;  4PEL A;  5KHG A;  1GN6 A;  3CCU V;  1AR1 B;  1XRE A;  3B77 A;  3MHH C;  2OT5 A;  1SQQ H;  4FPP A;  1N0J A;  2CGO A;  2IJH A;  3CRQ A;  1Q81 W;  1ZTE A;  5LP6 A;  3CJH B;  3D36 A;  3JCZ A;  4IYH A;  5JVD B;  4KHP B;  2UUB B;  3TGU H;  2XAH A;  1H2N A;  2KSD A;  3ZMU A;  4K0K O;  2EIN B;  3RYC A;  4F6R B;  4NXM B;  3JAR A;  4TV8 B;  3JD2 A;  3CSX A;  4QE7 A;  1VQ4 V;  3JAL A;  4RUF A;  1K97 A;  3ABL B;  5LGT A;  3MDS A;  1B6Q A;  4DR6 B;  1YZB A;  4FM1 A;  4I0X B;  4UVC A;  3PJS K;  3CCR V;  1N36 B;  4AHC A;  4MVU A;  1RFY A;  4PV1 B;  1THZ A;  3ICX A;  3DTU B;  4CS4 A;  1S3J A;  3HKD B;  1G6U A;  1PV0 A;  4CH3 A;  2WAM A;  3W7S A;  3SPG A;  1NI8 A;  4B3R O;  4GKJ O;  2QKS A;  2X6B A;  3E89 A;  3A0R A;  4UCT A;  4LF7 O;  4EKW A;  1GM9 A;  4IIJ B;  5JQG B;  2WLJ A;  3OGI B;  2VQF O;  1BZK A;  4FLT A;  1WPB A;  1GN3 A;  4PA4 A;  4JI5 O;  4DV2 B;  3JAK A;  2L6L A;  1R3I C;  1WAZ A;  5BR8 B;  2NN4 A;  3L70 H;  2N74 A;  2QKA A;  4FLW A;  4PDR A;  3FX7 A;  4FZ0 A;  4F4L A;  4BAY A;  3OMA B;  4OPH A;  3VQY A;  3K08 A;  1XNQ B;  1M5I A;  1JFF B;  5B1A B;  1XHZ A;  2PY5 A;  1FXK C;  2E76 B;  4HAM A;  2DYS C;  1QBZ A;  3EFF K;  3R65 A;  3S3X A;  4XDK A;  4NTX A;  2X7R B;  2OCC B;  3G4S V;  4EFB A;  2A79 B;  5DM6 V;  1MG1 A;  1M9N A;  3K59 A;  4UCU A;  3G6B A;  4E4E A;  4X20 A;  1KD1 W;  3TXS A;  1X59 A;  5IWA O;  1HW7 A;  2ODM A;  3ABK B;  4JAV A;  4WFA V;  1AR4 A;  1OJH A;  4FK5 C;  4ICG A;  4TV9 B;  3D3I A;  3RVZ A;  1NJI W;  2A9H A;  4KHP O;  3C3T A;  1R6K A;  1F51 A;  3A8T A;  3LDC A;  5A9G A;  4DV5 O;  2FKX A;  3D8C A;  2EIK C;  4LF6 O;  2BSK A;  1H8H G;  1Q5O A;  4LWS B;  5EC1 C;  4WFG A;  3CC2 V;  1EN4 A;  1W59 A;  3APO A;  2P06 A;  1SQX H;  3IGA C;  4Q6G A;  4DV0 O;  2PUS A;  2GTS A;  3OGC C;  4MS2 A;  1XMQ O;  4LP8 A;  1GN4 A;  5F2V O;  1N8R W;  1VF7 A;  3ABL C;  1P84 F;  2V1D A;  3K57 A;  2ITD C;  2RQ6 A;  4LNU B;  3K5L A;  2UUA O;  1K92 A;  4RQE A;  2DJV A;  4G28 B;  2LFR A;  1JR9 A;  4B3S O;  1ZX3 A;  1Q7Y W;  1IVS A;  5LXT A;  2BTQ B;  3MD0 A;  1RM1 C;  5LHI A;  1R3J C;  4GCZ A;  2Q7H A;  4I55 B;  4JI7 B;  1RSO A;  4DV1 O;  1BL8 A;  4FZ1 A;  2G38 A;  4JI0 O;  3FB8 C;  5B3S C;  3TET A;  1N34 B;  1H8E G;  5KX5 B;  5B3S B;  1MOF A;  4JI5 B;  1YDX A;  3IC9 A;  1A32 A;  1PD3 A;  4J42 A;  1YJN V;  3WG7 B;  2GV9 A;  2P4V A;  3CMA V;  5JCO C;  1OCR B;  3WB0 A;  1VF5 B;  1BGY H;  1DLB A;  1XNQ O;  3U10 A;  1W0K G;  4P9P A;  3AEI A;  1SQF A;  1SC5 B;  1FXH A;  1G4Y B;  2WWW A;  3KZI Z;  4DV2 O;  1YIT V;  4QJF B;  5IT9 N;  2EIL C;  2DWD C;  4QE9 A;  5B1A C;  1YTF D;  3CCE V;  5KAF Z;  1H2G A;  2Q7E A;  2UXD O;  5IYD O;  2Y48 A;  1H2M A;  3RVY A;  5J2U B;  3JAM N;  4PA7 A;  4Z1V A;  3J81 N;  2QA4 V;  3BHP A;  4JI4 B;  4DV6 O;  2E3C A;  3DSQ A;  2YIC A;  4NB5 A;  3W7W A;  1NVP D;  3JD1 A;  1VQP V;  1FD9 A;  4YJ2 B;  3H9V A;  2IH3 C;  4UUJ C;  1EN5 A;  2B9Z A;  3BAA A;  2WLI B;  3ZHV A;  1AR5 A;  1Y74 B;  2ZQM A;  1K8A W;  5L3E A;  1HDJ A;  3HKB B;  4X62 B;  3QVN A;  4JTA B;  5EBL C;  5FL7 G;  2YIB D;  4C7U A;  4NKG B;  3F7Y C;  2N05 A;  1HNX B;  4JI8 B;  5LMN O;  2JRI A;  4U3J B;  1BQZ A;  3B8M A;  5JVD A;  1YTF B;  3K9S A;  3Q4H A;  1E1R G;  2DWE C;  4JTC B;  5LP6 B;  4YJ2 A;  4DV5 B;  4QPJ A;  2JEU A;  4GKK B;  1K33 A;  2HP8 A;  4X1K A;  4H37 A;  1D5A A;  3KKY A;  5J2U A;  2Q4P A;  3JD4 A;  2DE0 X;  4IIJ A;  1S72 V;  1FFX A;  2IU3 A;  4ABM A;  1P4R A;  5JJN B;  4DUY O;  4MTG A;  4DUZ B;  5ITZ B;  4MTX A;  3M7M X;  3FYI B;  4O2B A;  5C8Y B;  2HLD G;  3OT7 A;  4B7K A;  2UUA B;  4Z1M G;  3G71 V;  3P3P A;  2F93 B;  1EN6 A;  3AG4 C;  3RT3 C;  5KA6 A;  3F5T A;  4WF9 V;  1Y76 B;  3ZHU A;  2VWJ A;  3WB1 A;  2QJ1 A;  5FPO A;  4QGP A;  4O4H A;  1QNM A;  4DV3 B;  3TK1 A;  1OHH G;  3H1K H;  3JD0 A;  3JCU Z;  2VQE B;  1NH2 B;  3I55 V;  2XUM A;  4PA9 A;  1FPO A;  4YJ3 B;  1VAR A;  1NZ6 A;  1PNK A;  5K1X A;  3G6E V;  1D2D A;  1U97 A;  2ZDI C;  3F5W C;  2IW5 A;  5JH7 A;  2EIJ C;  1VQM V;  1R1B A;  2X6C A;  5HFL A;  1XUQ A;  3H1L H;  1V54 B;  4PA3 A;  1XL4 A;  4BR6 A;  1F7Y A;  3W7U A;  2IH1 C;  3L73 H;  3WG7 C;  2EIM B;  3CCS V;  1IBL O;  3N27 A;  1M93 A;  3ZRW B;  2PI4 A;  1FS0 G;  4L87 A;  1GM8 A;  5KUK A;  1TA8 A;  1Q90 D;  2IU0 A;  4X64 B;  5GON B;  4IHJ B;  1K9M W;  5E1A C;  1KUQ A;  1QR9 A;  3JAT B;  1JOY A;  1VQ7 V;  5AG2 A;  2JS5 A;  2ZKO A;  4PI2 A;  4I9Q A;  4UCS A;  1WP7 A;  5EYP B;  2AW9 A;  3SYQ A;  4JZ2 A;  4X62 O;  3CB2 A;  3ZHR A;  1N4C A;  2GDS A;  4QNH B;  1BMF G;  3GWO A;  2BTO A;  3SYP A;  3ZMZ A;  4JYY A;  1TAE A;  1Z5V A;  4JI8 O;  3CC7 V;  1P7B A;  5LMN B;  3K9A A;  2GUZ A;  2EIK B;  3AG3 C;  1XNR O;  1M90 W;  2HVJ C;  1XL6 A;  3E8H A;  2Y0P A;  1WB8 A;  1YVW A;  4WFB V;  3OTO O;  1AI4 A;  2JEX A;  4D7S A;  2RN9 A;  3UQ8 A;  2FL4 A;  1K7D A;  2RJZ A;  1JVM A;  3RFR A;  3BEH A;  2JVD A;  3OTF A;  3JAS B;  2R9R B;  5CBG A;  4BW9 A;  3JAK B;  4B7E A;  1V55 C;  2Q9L A;  2VQE O;  4DUZ O;  4P30 A;  4BIO A;  4NR1 A;  1QR8 A;  5LHG A;  2GUZ B;  5ITZ A;  5LOV B;  2WLH A;  3FYE B;  3EXA A;  3SPI A;  2F66 C;  1IBM B;  2LP7 A;  4QIW F;  1KMI Z;  3FD9 A;  3LSU A;  1Y76 A;  3OUS A;  4LH6 A;  3X2Q B;  2NNU A;  2D3O W;  3E35 A;  1N32 B;  2DQ3 A;  2ZIM A;  2ARH A;  2QWP B;  1OCR C;  4TSF G;  2EBO A;  2HJF C;  5J2T A;  4WFE A;  3CCJ V;  5CA0 B;  4RUE A;  1WN7 A;  3IC7 A;  5EZY A;  2UXB B;  4U3J A;  1H38 A;  4CZZ A;  3VQW A;  2AHZ A;  1M57 C;  2IBZ H;  1H2S B;  3E2E A;  3L9D A;  2JJ1 G;  4MT8 A;  1PM9 A;  2YI8 A;  2AXT Z;  2Y69 C;  1K4C C;  5IJ9 A;  4K8X A;  1VEW A;  4BIZ A;  4X20 B;  1BE3 H;  1HR0 B;  2MW2 B;  4DV0 B;  3JAL B;  4YIP A;  4JYA O;  1SQP H;  2Y4U A;  2XAJ A;  5H2F Z;  2F4V O;  2YID A;  1LR1 A;  3N2K B;  3AG3 B;  4UCV A;  4X8A A;  4KXR A;  3OR7 C;  2Q8V A;  3L75 H;  1JJ2 U;  4X65 B;  4XDJ A;  2QTS A;  2V7Q G;  2R70 A;  4DR5 O;  3QF7 A;  1F23 A;  1N34 O;  4R50 A;  4ZHQ B;  1GH6 A;  3K5M A;  2Q5Z A;  3JYC A;  5IYZ B;  4JI6 O;  4LC1 A;  4JPR A;  5JQG A;  1XNR B;  1FKA O;  1H2K A;  3JAT A;  2CH7 B;  3ASO C;  4P9O A;  2EZO A;  4LWS A;  1Q3E A;  4LF8 B;  4IGG A;  4JI2 B;  1FFT B;  5LA6 A;  3ABT A;  5FNV B;  1RSO B;  1L1F A;  1JQ0 A;  3T1Y B;  2RMK B;  2XAQ A;  4B3M B;  4K8Z A;  1Z2G A;  4YY3 B;  3K04 A;  5LGU A;  4YXW G;  1N32 O;  1S77 D;  1RP3 B;  1US6 A;  3N2K A;  3IJ4 A;  2HG5 C;  5LYJ A;  3C3S A;  3OD4 A;  4LFB O;  4PDL A;  4I9W A;  4O4J B;  4JAU A;  2BCC H;  2N04 A;  2UXB O;  1PNL A;  1K73 W;  4ZBM A;  4I5S A;  1XMO O;  3P3N A;  4JI4 O;  4DV6 B;  5HFM A;  3EHB B;  1Y66 A;  3ZS8 C;  5CA1 A;  3BFR A;  2YEV B;  5H6Q A;  1KQS U;  1Y6X A;  1TVK A;  2LW7 A;  1Y74 A;  2EX3 A;  3K06 A;  1TVK B;  3ABM C;  1B04 A;  4OPA A;  2QE7 G;  2WLL A;  2YIA A;  5IJ0 B;  3SYO A;  3WB2 A;  5KLV H;  4JYC A;  1ZL8 A;  4ASU G;  4YIO A;  3SR2 C;  2K1E A;  2Q69 A;  1AI7 A;  4IYI A;  1HNX O;  5EZY B;  2Y69 B;  4LF9 B;  2UXN A;  1VQK V;  2UU9 O;  1CPY A;  1SZT A;  1Q6I A;  2E74 B;  2YXL A;  4CH4 A;  1QLE B;  3HKE A;  1XHX A;  2FB5 A;  2AZ0 A;  4FLU A;  1CP9 A;  1NR1 A;  4NXM O;  4DW1 A;  1H2L A;  4GUN A;  3FFQ A;  1RPR A;  4FM2 A;  5GTI Z;  3BRC A;  2UXC B;  3ETD A;  4IHJ A;  3GB7 C;  4JYA B;  1WP8 A;  5CA1 B;  1R6N A;  1X4T A;  3AG4 B;  4MVM A;  3TJT A;  3CXH F;  5IYZ A;  2ZE6 A;  4UB6 Z;  3UO3 A;  5B66 Z;  1NKD A;  1L0N H;  1PL0 A;  5KAI Z;  3ASO B;  4MW3 A;  5IYC O;  4JI2 O;  3B40 A;  4O4J A;  3WFV A;  2QM7 A;  2WA4 A;  3BAB A;  5L3G A;  2ZDI A;  4X65 O;  3APQ A;  1OCC C;  4B3R B;  1L0L H;  4DR5 B;  3UO2 A;  2Q6A A;  1MSW D;  3QG5 A;  4UCO A;  2XTA A;  3FB5 C;  2XT9 A;  2P5O A;  4YJ3 A;  5CB4 A;  4HBN A;  2WLM A;  1YEW A;  5BR8 O;  3SYC A;  2EIM C;  3AG2 C;  2KG7 B;  2VWK A;  3AK2 A;  3KCX A;  1JJO A;  4G27 B;  3N2G A;  4W4K A;  3T1Y O;  4DV4 O;  4DR3 O;  4ZI7 B;  1EM1 A;  5EYP A;  3ZED A;  3JAR B;  1GN2 A;  4DR4 O;  1IBL B;  2BOC C;  2YUA A;  3ZHT A;  5K1P A;  1I5Y A;  2DQ0 A;  4TOI A;  1ROP A;  2P6J A;  4X1Y A;  2XHB A;  2X0L A;  1S5H C;  3I56 V;  3IAY A;  4JTD B;  3ZRS A;  1M4U A;  5L3C A;  5B1B B;  2XND G;  4X66 O;  2YIB A;  1ORQ C;  4OX9 O;  4GX5 A;  4MVO A;  4G2K A;  1SRY A;  3UT5 B;  3QO5 A;  2A3Q A;  5CB4 B;  2HJD A;  4UFZ A;  4MTO A;  4LF6 B;  3GWK C;  1PNM A;  5IJ9 B;  2LFS A;  4X9Q A;  3E22 A;  1LUV A;  2LQT A;  4DK0 A; 
#chains in the Genus database with same CATH homology
 1KP2 A;  1TUE B;  4JYB A;  2IH1 C;  4N21 A;  3WG7 C;  2EIM B;  3CCS V;  4U7O A;  4QPK A;  3B8N A;  3QO7 A;  2IJK A;  3OUF A;  3AG2 B;  3ZRW B;  2PI4 A;  1FS0 G;  2EZP A;  3LUT B;  1Q82 W;  3BY6 A;  3SPJ A;  2EIL B;  2QM8 A;  5C93 A;  1QLE C;  4L87 A;  1GM8 A;  5KUK A;  1QCE A;  3E8B A;  3LNM B;  2CK3 G;  2IU0 A;  2M7W A;  2MK3 A;  1WLE A;  1BHB A;  1AJN A;  2JDI G;  1K9M W;  5E1A C;  1QR9 A;  2WLI A;  1JOY A;  3AG1 C;  4KUM A;  1VQ7 V;  3ASN C;  1NVP B;  5B1B C;  4MVQ A;  4UV9 A;  3ABU A;  2Q67 A;  2QTO A;  1R3L C;  2IJI A;  2BOB C;  2HFE C;  3SYQ A;  1UJW B;  4BIU A;  3P30 A;  2HKO A;  1DF5 A;  3SPH A;  1R73 A;  4QNH B;  3OM3 B;  1BMF G;  3GWO A;  4R8C A;  2NLJ C;  5L3F A;  1SES A;  3SYP A;  3ZN1 A;  3ZMZ A;  3CCL V;  3OW2 U;  3K0G A;  3SJQ C;  3CC7 V;  1P7B A;  3E8G A;  5IY5 C;  4RAI A;  1S76 D;  3QNE A;  2F43 G;  3K9A A;  4MTF A;  3ABM B;  4XDL A;  4PEL A;  1OCC B;  2P90 A;  1BHA A;  2EIK B;  3AG3 C;  4DO2 A;  1M90 W;  2FTK A;  1W0J G;  2HVJ C;  1XL6 A;  4GX1 A;  1AR1 B;  3E8H A;  3K0D A;  2Z3Y A;  3CCU V;  3B77 A;  2WLL B;  3MHH C;  2OT5 A;  1IXM A;  4WFB V;  4FPP A;  1AI4 A;  2IJH A;  2JEX A;  1Q81 W;  2B1G A;  2ZXW B;  1VQN V;  1G8M A;  1R3K C;  3CD6 V;  3ETE A;  1K7D A;  3RW0 A;  3D36 A;  1JVM A;  3JCZ A;  3CCV V;  4UVA A;  1K5Q A;  3BEH A;  2JIZ G;  4KFM A;  3LDD A;  5H6R A;  2XAH A;  3ZMU A;  2R9R B;  1OCO B;  5CBG A;  1VQO V;  2EIN B;  4MVS A;  1V55 C;  3JD2 A;  5GW7 A;  1E79 G;  3ML0 A;  4BW5 A;  4P30 A;  1EBO A;  4QE7 A;  5DN6 G;  1VQ4 V;  1QR8 A;  5LHG A;  4RUF A;  1K97 A;  3ABL B;  2AHY A;  4J9Z B;  4DXW A;  2WLH A;  5LGT A;  3FYE B;  5L3B A;  1B6Q A;  2ATK C;  3CYO A;  3HB3 B;  4FIP C;  3SPI A;  3M99 B;  2LP7 A;  2WLK A;  4QIW F;  4UVC A;  3T2M A;  3PJS K;  3CCR V;  2Q68 A;  3ZMS A;  4MVU A;  1MAB G;  1THZ A;  5IYB O;  1OCZ C;  3OUS A;  2H94 A;  3X2Q B;  2NNU A;  3VOU A;  1LNQ A;  2D3O W;  3E35 A;  3DTU B;  1QVF U;  2DYR C;  1S3J A;  1AI6 A;  2DQ3 A;  3FB6 C;  3RBZ A;  2WAM A;  3W7S A;  4FJC C;  1OCR C;  4TSF G;  2EBO A;  2HJF C;  3SPG A;  4WFE A;  5KUM A;  3CCJ V;  2ZD9 A;  4JGS A;  4RUE A;  2QKS A;  2X6B A;  3OFN G;  3E89 A;  3IC7 A;  2H8P C;  3ZRX A;  3A0R A;  1H38 A;  4EKW A;  1GM9 A;  3CCQ V;  2WLJ A;  1GTO A;  3ABK C;  3DGE A;  4CZZ A;  3FKS G;  4P2Z A;  4PA4 A;  3CP1 A;  3E8F A;  2AHZ A;  1M57 C;  1R3I C;  1M1K W;  3E2E A;  2JJ1 G;  4CBC A;  4MT8 A;  5B1N A;  2Y69 C;  1K4C C;  4PDR A;  5EC2 C;  4F4L A;  1V55 B;  4BAY A;  4H33 A;  3OMA B;  3K08 A;  4BIZ A;  2HR3 A;  5B1A B;  1FXK C;  4HAM A;  2DYS C;  1QBZ A;  3EFF K;  3R65 A;  5CA3 A;  2GSM B;  4XDK A;  4GT1 A;  1FXK A;  3STZ C;  3CXC U;  5EK0 A;  1M56 B;  2X7R B;  4PDV A;  1JPX A;  2OCC B;  3LSQ A;  3G4S V;  2XAJ A;  3CME V;  3P32 A;  4WCE V;  4KP4 A;  2A79 B;  2W0F C;  5DM6 V;  1MG1 A;  3AG3 B;  1M9N A;  4GX0 A;  3ZMT A;  3T4Z A;  3UM7 A;  3T1C A;  1KD1 W;  2EIJ B;  4X8A A;  3OR7 C;  3ABK B;  4HYO A;  4JAV A;  4RQF A;  4WFA V;  1JJ2 U;  3OEH G;  5CBH A;  4FK5 C;  4XDJ A;  5J9P C;  3D3I A;  3RVZ A;  1NJI W;  2A9H A;  2IJJ A;  1R6K A;  1K4D C;  1F51 A;  2V7Q G;  3LDC A;  2ZXW C;  1F23 A;  1AJQ A;  4R50 A;  2Z5U A;  4MSW C;  2C2A A;  3JYC A;  1FXV A;  4XBF A;  1OCO C;  4LC1 A;  4JPR A;  3SYA A;  2EIK C;  5EC1 C;  1H8H G;  3CPW U;  4WFG A;  1EFR G;  3ASO C;  4P9O A;  4LCU C;  2EZO A;  3CC2 V;  1NH2 D;  1JCH A;  3IGA C;  1GK9 A;  5LGN A;  1YSC A;  1FFT B;  1AJP A;  3JD3 A;  4RO2 A;  2XAF A;  1Y4M A;  2HVK C;  3ABT A;  3OGC C;  4MS2 A;  2OCC C;  1L1F A;  3OMN B;  4LP8 A;  1JQ0 A;  2XAQ A;  4TT3 G;  1N8R W;  3ABL C;  2V1D A;  3OAA G;  2ITD C;  3K04 A;  5LGU A;  1K92 A;  4YXW G;  4LBE C;  4RQE A;  1S77 D;  1YJ9 V;  4G28 B;  1YI2 V;  2B5U A;  2LFR A;  4ZKI A;  2WPD G;  1Q7Y W;  2X6A A;  4X88 A;  1F4N A;  2HG5 C;  5L3D A;  3MD0 A;  1RM1 C;  2XAG A;  4PDL A;  1R3J C;  4GCZ A;  4I9W A;  5LHI A;  4JAU A;  1EZJ A;  1FXK B;  1JX9 A;  4R6Z A;  2DYR B;  4JAS A;  1BL8 A;  3TET A;  5B3S C;  1PNL A;  3FB8 C;  1K73 W;  1H8E G;  1ZWI C;  4ZBM A;  5B3S B;  4I5S A;  1MOF A;  3E86 A;  1QVG U;  3K03 A;  5IY5 B;  4U7N A;  5HFM A;  3EHB B;  1Y66 A;  1ARO P;  4JF3 A;  5LHH A;  1VQ6 V;  1DF4 A;  1NBM G;  1J95 A;  1GKF A;  3K79 A;  2YEV B;  5H6Q A;  3H01 A;  1KQS U;  1COW G;  1PD3 A;  5EBW C;  1I5X A;  2XAS A;  1YJN V;  3WG7 B;  3K06 A;  3OMI B;  1AI5 A;  2XOK G;  3ABM C;  3CMA V;  1OCR B;  2QE7 G;  2WLL A;  3HPL C;  1KC8 W;  3ASN B;  3SPC A;  2YSU B;  3SYO A;  5H9C A;  4E2L A;  4JYC A;  4ASU G;  3KG2 A;  1DLB A;  2ZR2 A;  2OTL V;  2A0L A;  1GMG A;  4J9Y B;  3ZCC A;  3ZRV A;  2K1E A;  1W0K G;  2Q69 A;  1AI7 A;  2R9I A;  3MHS C;  5CMU A;  4P9P A;  3AEI A;  4Q20 A;  1DTO A;  2Y69 B;  1FXH A;  1G4Y B;  2WWW A;  1SER A;  2UXN A;  1YIT V;  1VQK V;  5IDJ A;  1CPY A;  1M57 B;  4QJF B;  1SZT A;  2DWD C;  2EIL C;  2W6J G;  4QE9 A;  5B1A C;  1YIJ V;  1K5S A;  1QLE B;  5BZB A;  1YTF D;  3CCE V;  1H2G A;  3OEE G;  4WFH A;  5IYD O;  1OCZ B;  2Y48 A;  3RVY A;  2QA4 V;  4PA7 A;  1CP9 A;  1GO3 F;  1NR1 A;  1RPR A;  3W7W A;  1NVP D;  3JD1 A;  1VQP V;  1KEC A;  4HZ3 A;  4WFF A;  1GM7 A;  3ETD A;  1KKD A;  3VBB A;  3E83 A;  4PA6 A;  3CCM V;  2IH3 C;  3ZIA G;  4UUJ C;  3GB7 C;  1KP3 A;  2WLN A;  2WLI B;  1R6N A;  2ZQM A;  1K8A W;  3F7V C;  5KA5 A;  5L3E A;  3AG4 B;  2GHY A;  4JTA B;  3LSS A;  4MVM A;  2YEV A;  5EBL C;  5FL7 G;  1RM1 B;  1YJW V;  2WSS G;  1NKD A;  1PL0 A;  4N23 A;  3ASO B;  4MW3 A;  4UXN A;  5IYC O;  1W2B U;  3F7Y C;  1S0V A;  3WFV A;  1K3E A;  2QM7 A;  3ETG A;  3B8M A;  5L3G A;  2ZDI A;  1YTF B;  3K3W A;  1OZ0 A;  2JJ2 G;  1E1R G;  1OCC C;  5CBF A;  2DWE C;  3ZMV A;  1VQL V;  4JTC B;  4FMT A;  2OTJ V;  1F4M A;  2Q6A A;  5LBQ A;  2KB1 A;  1MSW D;  2ITC C;  4QPJ A;  3STL C;  2JEU A;  1QLN A;  2EIN C;  1K33 A;  3FB5 C;  1M56 C;  4H37 A;  3TCU A;  3QO8 A;  2WLM A;  3X2Q C;  3NXS A;  3JD4 A;  1S72 V;  1PKX A;  2IU3 A;  3SYC A;  2DW4 A;  1ENV A;  2EIM C;  3AG2 C;  4MVR A;  4R7C A;  1P4R A;  4G27 B;  3IFX A;  3OR6 C;  2B1I A;  5EBM C;  1V54 C;  1Q86 W;  4MTG A;  4MTX A;  4MW8 A;  2P67 A;  3FYI B;  2DYS B;  2HLD G;  1NQT A;  4Z1M G;  3G71 V;  1WPX A;  1SET A;  2W6I G;  3ZRW A;  3W7X A;  2JK5 C;  2BOC C;  3AG4 C;  1E1Q G;  5KA6 A;  1I5Y A;  5B1O A;  4WF9 V;  2DQ0 A;  2P7T C;  4UVB A;  2ZR3 A;  1CEZ A;  3CC4 V;  1ROP A;  3LDE A;  2P6J A;  5CN0 A;  4UV8 A;  3T4D A;  3TK1 A;  1OHH G;  2X0L A;  1S5H C;  3JD0 A;  3I56 V;  3W7T A;  3FB7 C;  1YHQ V;  4JTD B;  1NH2 B;  3I55 V;  1VQ8 V;  2PI5 A;  3ZRS A;  4MVZ A;  3ZN0 A;  3AG1 B;  4PA9 A;  2EJR A;  5B1B B;  2XND G;  4X89 A;  5L3C A;  1K34 A;  1ORQ C;  1PNK A;  4GX5 A;  4MVO A;  3G6E V;  4G2K A;  1VQ5 V;  1SRY A;  4GX2 A;  2ZDI C;  3F5W C;  2IW5 A;  3QO5 A;  2UXX A;  2EIJ C;  1VQM V;  1NR7 A;  2X6C A;  3UKM A;  1VQ9 V;  3OE7 G;  4MTO A;  1HWY A;  5HFL A;  4OXS A;  1PNM A;  4TWK A;  1V54 B;  2LFS A;  4PA3 A;  3ZJZ A;  1XL4 A;  2QEX V;  4PDM A;  3W7U A;  1RPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...