5KHIA

Hcn2 cnbd in complex with purine riboside-3', 5'-cyclic monophosphate (cpump)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 63
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khiA02
3CF6E 2ZKLA 4X6RB 4ONUA 4LULA 1PMIA 2IXKA 3DV8A 4J1XA 4N9HA 5CU1A 4RD7A 1ZREA 1NZCA 3GBFA 3E6CC 3MDPA 3RNSA 1YFWA 3BB6A 5T3NA 3SCGA 3S0MA 3QOPA 3HT1A 3IWZA 3H1WA 5CVRA 4MH0E 1SFNA 4IEUA 3H1YA 3RZZA 1EPZA 1ZZ9A 3NW4A 5BY5A 2XL7A 1LKNA 2BYVE 3ES4A 4LLOA 1X7NA 2K0GA 3IDBB 3E6BA 3NVCA 4H7LA 1EYBA 4TLFA 4XFHA 2FQPA 3LWCA 1O3TA 4XF4A 4XF1A 2PAMA 3NJZA 2I45A 2XKPA 5KHKA 3EO6A 3OGJA 4LA2A 5I8YA 4QGLA 5FDBA 4ORFA 3RYRA 3I54A 1ZZ8A 3E5UA 1GQGA 5JSPA 3H9AA 2XL9A 3E97A 1FI2A 3H3ZA 5C6CA 4MGZE 5KHGA 2D5HA 4LUMA 4XFGA 3U10A 1RL3A 1O7FA 3IIAA 1QXRA 4MGIE 4MZUA 5D1IA 4HLTA 4QGNA 1XE7A 4MV2A 1RTVA 4F8AA 2GC0A 4XEZA 4QM8A 2IXCA 4FAGA 3EQEA 4Q0QA 4XF0A 4R8HA 3E6DA 5KBFA 4XFIA 1J58A 3RYPA 3WW1A 2IXLA 1QXJA 2O1QA 2CV6A 2B5HA 3L2HA 2O8QA 4IEYA 5FPXA 1Q5OA 5FCCA 4AQ6A 4HBNA 1DGWA 2XLAA 2UY8A 5LRSA 3HT2A 4O9EA 4I09A 3WW2A 1J3PA 1YWKA 2Q4SA 3OTFA 2WC2A 3EBRA 4KL1A 1Q3EA 5J7MA 3S7EA 5J48A 2H0VA 2GU9A 2BNNA 2PAEA 2CAUA 3JZVA 4Q0PA 4N9IA 5BPXA 4XFAA 3OCPA 1CAVB 1O4TA 4XF3A 3I59B 4L2NA 2OYZA 4NVPA 5EZWA 3OD0A 2ET1A 1XE8A 1NXMA 4KU8A 1NE6A 4ZU5A 4JV4A 1XRUA 3RYKA 3VHRA 1O5UA 2D40A 4YRDA 4P9GA 4FBFA 4Q0VA 2UY9A 3LA7A 1NE4A 3UKVA 2QNKA 1WA4A 2BGCA 4MGYE 2UYAA 3FWEA 5F1RA 3MYXA 4EWAA 1EY2A 1LB2A 4L11A 1RUNA 5LRRA 2D5FA 5I0RA 4UXAA 3FE5A 3I7DA 1FXZA 4WZCA 4HZFA 3ACLA 5EFUA 2PYTA 3U0ZA 1ZZCA 3C3VA 1TQ5A 3KMHA 2B9UA 4EROA 4LTAA 2GC3A 5J3UA 1YUDA 4I02A 4J1WA 3PNAA 4CYDA 4FT8A 1WLTA 3CLPA 3H8UA 5BUVA 1YFYA 2F4PA 4BHPA 1RUOA 4Q0SA 4WBBA 3DL3A 1ZX5A 2E9QA 4BH9A 3U11A 4HSJA 1SEFA 1DZRA 3UKTA 4HN1A 5E16A 4IERA 4QGMA 4KWJA 4UBHA 4KWKA 4IEQA 4Z07A 2PFWA 3NL1A 4IETA 4YARA 5I0SA 1QWRA 2QCSB 1H1IA 4R52A 5E1RA 4FAHA 1ZZBA 4PIYA 1YFUA 5JAXA 3LA3A 5I8TA 2XGXA 2QJVA 4HVRA 5AVPA 1L3JA 4I2OA 2PAKA 3O14A 4PIZA 4ZU7A 4IEZA 5I0TA 3PVBB 3N4MA 2ATFA 1VJ2A 4QX5A 3R6SA 1I6XA 3NKTA 4LA3A 4E2QA 3FFQA 2N7GA 1CX4A 4E2GA 2D93A 4I3PA 4OFGA 3LA2A 2Y0OA 1FT9A 2DCTA 1ZVFA 2H6BA 2XKOA 3FHIB 1YFXA 4Q0UA 1V70A 2MHFA 4HVQA 2BNOA 5KHHA 1O3QA 4QXKA 1X8EA 4IEPA 1ZZ7A 3ST7A 2GC2A 4IEOA 5LEKA 3DKWA 4YYOA 1OFNA 3LAGA 3HQXA 5FLHA 3B02A 2EAAA 5I8SA 3SCFA 3HIFA 4DINB 4B29A 1RGSA 1YHFA 3D82A 1OD5A 2IXJA 1OMIA 2PTMA 4UBGA 5BV6A 2OZJA 2OPKA 1G6NA 5I0UA 1GQHA 1O5LA 4D7SA 2PQQA 3ELNA 4IEWA 4JTNA 3DN7A 4XFBA 1EP0A 5K8SA 2Q0AA 5KHJA 2GAUA 3EJKA 4MX3A 4JVAA 1CAUA 1X8MA 3BCWA 1CAWB 2OZ6A 3SMHA 3ZDSA 1CAWA 2VQAA 1J3QA 1LR5A 2UYBA 4HVOA 3SXWA 4WVZA 4EWEA 1ZZ6A 1NYWA 4AXOA 2CAVA 5FLIA 2PA7A 4X6QB 3LOIA 3WW4A 1UIJA 1H1MA 2HJIA 4KWLA 2ETEA 3E5QA 5JCTA 4A2UA 4EV0A 2WFPA 4PJYA 4HN0A 3RDIA 1J3RA 3FZ3A 2EA7A 3D0JA 1ZRFA 3MZHA 4HMZA 4BYYA 5HI0A 2ZCWA 2GZWA 4IESA 5BXXA 2ET7A 1UPIA 2MNGA 1O3RA 2BEOA 3FJSA 4AVAA 1UIKA 3SHRA 3QACA 4QMAA 3WW3A 4AVCA 2QDRA 2IXHA 2Z2SB 3H7JA 5CADA 4QM9A 2PHLA 1U12A 2K9ZA 4I0BA 3OF1A 4XFCA 3ROUA 4JTOA 4META 1ZRRA 4XETA 3TNQA 1LRHA 3KSCA 4KU7A 5FLJA 3CJXA 2V09A 1VR3A 3BALA 5C8WA 2BNMA 2IXIA 4YNIA 3H3UA 4XF9A 5FQ0B 3IBMA 5FQ0A 5JSRA 1DGRA 4PIXA 3MPBA 3GYDA 4MUVA 3EHKA 1J59A 1ZNPA 5JR7B 1UD1A 3CL1A 4AVBA 3D0SA 2XHKA 4YSFA 1J1LA 2MPFA 1Y3TA 4I01A 4I0AA 5I93A 4Q29A 1RC6A 1PM7A 4LEJA 4O9GA 1VP6A 3UKNA 1Q43A 4LUKA 3ETQA 1YLLA 2OA2A 4IEXA 2Q1ZB 3H50A 2KXLA 3E5XA 2Q30A 4D7TA 2QVSB 2HKXA 4F7ZA 1X82A 1OI6A 2FMYA 5KHIA 1QY4A 4EWDA 2EVXA 2C0ZA 5JSOA 1UW8A 3CEWA 4IEVA 3S7IA 4HSLA 4AQ2A 3M3IA 3NSTA 5FPZA 3H1MA 2IC1A 1IPKA 2CGPA 3CO2A 3KCCA 2P17A 4K8FA 5I91A 2VECA 1DZTA 4BIFA 2XLGA 3TNPB 4OLLA 3BPZA 4GULA 1O3SA 1SQ4A 2GC1A 1UCXA 4ZU4A 1CAUB 2XLFA 3M70A 1Y9QA 3KGLA 3G7DA 3IDCB 2VPVA 1IPJA 1WGPA 2GH2A 5LEJA 2Z69A 1ZRDA 2PHDA 4MGKE 3SCHA 3PLQA 1CAXB 4XFFA 1CAXA 1I5ZA 1CAVA 3BU7A 4Z82A 3I59A 3USSA 3H7YA 2H6CA 1HW5A 1CGPA 3KGZA 1ZRCA 3ES1A 1JUHA 4E2SA 3RPQA 3FX3A 3LZZA 2B8MA
chains in the Genus database with same CATH superfamily
5L7OC 2B42B 1KD1W 3T1YB 3GALA 4OCTA 1WB8A 4E4SA 1WZXA 4LULA 3VB9A 1JMUB 4DR7B 1VMGA 3BB6A 2P37A 4K7JA 1YCIA 4TSVA 2RDRA 3N2GA 3T4HB 5JMCA 4XUPA 3ZMZA 2Z5WA 3O0XA 5F2VO 4AEJA 2O8OA 4QPJA 1LOBA 1IG0A 1RSOA 4J41A 5KA5A 4L99A 1NI8A 2KKWA 2MW2B 1AYN3 4OULA 1V6KA 4LF9B 1UYXA 4HT1T 4CPBD 3KKYA 5FZBA 4FOYA 2W91A 5KAIZ 2WLLB 1W8ZA 1P7GA 1ULPA 2AGSA 4NAOA 3VD7A 2AACA 5FZ4A 5FZIA 4CTEA 5KHGA 5FXXA 1LUWA 3AK0A 5F2SA 1QMJA 2WNUC 5FZDA 1SPPA 1PVC2 2JDHA 1XMOB 5K0UA 4CZSA 4X8AA 4LBOA 4EN6B 4RFRB 2B39A 4BQWA 3O1MA 4XDKA 4O61A 1KRIA 2CV6A 4O65A 3GJAA 2BWCA 4XOGA 4N7UA 2LW7A 1TGOA 3GZUC 2QM7A 4PLMA 3FFZA 4UCRA 4IE0A 3KS7A 1NH2D 1BEV2 1CIYA 2W46A 2WZR1 1W99A 5J7MA 5B5EZ 4PLOA 3VBUB 3C7HA 1IGOA 3MD0A 3ZHQA 4N9IA 2DYRB 5FUNA 2VCBA 2ADQB 4J80A 4CDQC 4L2NA 1FPN2 5EZWA 3OD0A 2QQMA 3D3IA 5T54A 1K9MW 2X6AA 1S0IA 3VDDC 5FZ1A 1AZDA 1AVBA 4E8DA 1OD3A 1PVC3 2VUJA 5IY5C 2Y64A 2FL4A 3MLJA 3NQHA 4FPHA 5FYUA 1W8FA 5A3UA 2NNUA 1YITV 1S0EA 4OMCA 5FMBA 4UXAA 2YU1A 2JE9A 1IS6A 4CEYA 4DR5O 2JJ1G 3VZJA 4WBBA 3E35A 1BEV3 3HPLC 2F4VO 1SEFA 1DZRA 5FZ6A 1AI6A 3HKDA 4BXFA 1SLAA 4AHXA 2PFWA 4YARA 3B5LB 3VKNA 1H1IA 5A7OA 3JARA 2Y26A 4BLJA 3DGTA 1FPN3 1XNBA 5LB6A 1PVXA 1JOBA 5F3GA 4IEZA 1PIV2 3PVBB 5A3LA 4IW3A 1TME1 2DCYA 3R6SA 4MTGA 3KWVA 1JJOA 3STLC 1VE0A 3HKBA 4MOAA 2JG8B 4OFGA 3WCSA 4JDNA 4CEWC 4R7CA 2JVDA 1NU1H 1JYTA 4YJ3A 4KFMA 4DV7O 2TNFA 5J9PC 4W6WA 2EIGA 4COWA 1VQKV 3HPNA 4IEOA 4YVWA 3LSSA 2WFF3 5BNNC 1W6OB 2JXAA 1YRZA 2UUAB 1OD5A 2WLJA 1JYCA 4DQAA 1HQLA 3TN93 3NJYA 1NA1B 1EP0A 3RRDA 2VVFA 1O8PA 4S2DA 3N7MA 4Y20A 4B4PA 4O4JB 3J7MA 4YJ2B 1CAWB 4NHMA 3ZDSA 2UYBA 1IX9A 4P9YA 1HRI3 4WVZA 3L75H 1ZZ6A 4GUNA 2CAVA 3GBWA 1AXZA 1VAMA 1DGLA 1AJNA 2RS33 4QU1A 3RSJA 4F6RB 1I5PA 2P90A 4AWDA 3GB7C 2VD7A 4MGSA 4GCZA 4Q1RA 4QPGC 2M6YA 1AR61 5EPAA 2Q7EA 2MNGA 2KA3A 4QKNA 3WW3A 1KP2A 2WAOA 4Q6GA 2B45X 1YI2V 4QDSA 1FS0G 3VBBA 1MG1A 3IMMA 3ROUA 3J7HA 4XETA 2LFSA 5G05L 1K33A 5A1LA 2D6NA 2W1UA 3IBMA 4CUGA 4OHXA 1JZ7A 2A0LA 4Z1MG 1LULA 3DUIA 4N43A 5D8AC 4LQRA 3AFGA 3M3CA 2HEPA 2MPFA 2E26A 4NIDA 1WMDA 5FYHA 1O9GA 3WOGA 3ETQA 1PK6C 5FJHA 1WLDA 2Q30A 1VBC2 2QVSB 1MVEA 1YF2A 1ZTEA 5FUPA 3CMEV 1N3PA 1A34A 2YGLA 3AKQA 3B40A 5FPZA 1EZVH 3H1MA 1V9U1 5H9PA 3DPRC 3RI9A 2GSYA 4K8FA 1KKCA 4K9SA 2WNVA 2VW0A 4X62B 1OCZC 4O7XA 1UY1A 3BPZA 2F17A 4OQ9A 4MADA 2W08A 2JJ6A 2QZ2A 2JX9A 4LWSA 3WB2A 1A3KA 2DWEC 2VPVA 4WM7C 1WGPA 2EXIA 2A7AA 1YXBA 4Q4Y2 4IUGA 2V1DA 2PLV1 3WG4A 1W0NA 3U07A 2JE7A 3AG1C 1XMQO 4LHKA 2EILC 4X6RB 3SJQC 1QEXA 1EFRG 4NPRA 1L7LA 3JD3A 2C4XA 2QGNA 5KAFZ 5T3NA 1G9BA 1HLCA 3HT1A 3X29B 1Y74A 4FPYA 1PO21 4HFSA 3AL6A 1OFSA 5SV5A 1AJQA 4DXSA 1Y4MA 4LFCO 3NNJA 4W4KA 2WWWA 1TNFA 1Z7S1 1RSOB 1LHVA 2B9ZA 4TLFA 1PL0A 5DUWA 5EIBD 1F9KA 1D7PM 5J96B 3ACHA 1PGW2 5IK4A 4FCAA 5CKNA 4Q4Y3 1FD9A 2D3SA 3K0DA 4QGLA 3VHPA 3F2ZA 3Q8CA 3N9PA 3ZSLA 1HJFA 4GB31 4M01A 5LMNO 1VARA 1WUVA 3DC5A 1GUIA 2AR6A 4I0XA 5EIYB 3KT4A 1W90A 1DHKB 2V4DA 1P8JA 3E6DA 4XFIA 3E8FA 2IUWA 3Q4HA 3MIBA 3CC4V 1Q5OA 2D3PA 4FOQA 4AQTA 4CRQA 4LCUC 1AR92 4JZ2A 4DV2B 2P4EA 3CHXA 1OZ0A 5BNQA 1R1A1 3DXTA 2GU9A 2OKXA 2ZAAA 3JZVA 3HKEA 3CWBH 1Y43B 1W05A 4J11A 2YS8A 1Q56A 4XJ8A 2XMLA 2VZUA 3ZIAG 4CU9A 1RVF3 1HNZB 5CBGA 2VJXA 1UQXA 1G9AA 3I2HA 5KX5A 1D4M1 4YRDA 4X20A 1L7QA 4MGYE 4QQPA 5EZYB 4Y22A 5IWAB 4NIGA 3AK3A 3WQBA 3FLPA 3VQVA 3W7SA 3KV6A 1VF6C 3ASIA 3CYOA 2YXHA 3CX5F 1MA1A 4HZFA 4WZCA 4CEYB 4YW4A 2PI5A 2D44A 2EIJB 1TQ5A 3KMHA 3F7VC 2DCJA 1TVGA 4Y24A 3AK1A 2Y8KA 4BIZA 1YIFA 4HSJA 3E8BA 1FFXB 2Q7GA 1Z2GA 3F5WC 5E16A 4IEQA 3V0AB 3U37A 4NO4A 2JGDA 4XJZA 3BVOA 1RUH2 3CCRV 1QWRA 1ZZBA 5DEDA 1QNYA 1RINA 1S2BA 1PP9H 3OY8A 2D7FA 1ENQA 5IJ0A 5M0TA 3SEEA 1PNMA 1M06G 3GZTB 5ANNA 1LHUA 3HKBB 4E2QA 4LO6B 3KF3A 3THPA 2XVGA 2UUBB 3N7JA 4I3PA 2R042 2Y0OA 3T0BA 1URXA 4JYAB 4MTOA 1N33O 1YFXA 3MFCA 1H38A 2QQLA 5FYSA 1AR72 3NNLA 2PI4A 3L74H 3URFA 1LUVA 4R4ZA 4YVWB 4NMIA 4FQZA 1OUXA 3ZFGC 4Y4YA 2ZIMA 3OGSA 3GHMA 1ZWIC 5T5LA 5FWEA 2PTMA 1NUKA 2BP6A 1G6NA 4N53A 3UT0A 4RO2A 2ZD9A 2G1MA 4Y20B 3ZRWA 2ZINA 3VBSA 3KT1A 2VC9A 4JVAA 1A8MA 3WP3A 1IS3A 3U78A 4B3NA 5EV7A 1N34B 3OBRA 1Q82W 4FIPC 3LOBA 1J84A 3ASOC 4UOJA 1DF5A 3WW4A 4WFHA 2R043 4GKYA 1QXPA 1PNLA 1HX6A 2CUGA 4UW4A 4HANA 4NIHA 3LEGA 1PGL1 1AR73 1PPJH 5HI0A 2FCVA 3AG3B 4MT8A 2ZEYA 3NV4A 4UF0A 2ZKOA 2IXHA 2QBXA 3BUCA 4AGVA 4RUFA 1QJU2 2RNBA 5F6LB 3WDYA 1DQ2A 4UFLA 5FQ0A 2VUDA 4N43B 1K4DC 3FHQA 3ON7A 4ES9A 5F39A 1L0NH 4BE3A 2PHXA 1AYM1 2X0LA 3ZXLA 3WF3A 4EB6A 4WFEA 1MQTA 2LGQA 1UF2C 3HKCA 1EUUA 5LBBA 3THDA 2QEXV 4G2KA 2CDYA 1Y9GA 2C0ZA 2YROA 5BNOC 4KXRA 3SDLA 5FPLA 2CGPA 1VQPV 1GOHA 2C5DA 4DXZA 5BMVA 2VECA 1EV12 2F66C 1QJU3 3CSXA 3E83A 1CD3G 3O7OA 2ERFA 3PJYA 2Y69C 3LDEA 3AJZA 4KUMA 4MTFA 1JOYA 3CJHA 5BNPC 5CZKA 1PNFA 5IFPA 3I8TA 1SBEA 2CU5A 4ASUG 5A33A 3T09A 1GWMA 5ANQA 4JGYB 2RDQA 1F4HA 3ZS8C 1O4YA 1UO9A 1JR9A 2GV9A 2XBO1 2HWF3 3NAPC 4GX2A 4DK0A 2L6LA 2J1VA 1BMFG 3ZYRA 1KITA 1NLQA 5LMUB 3J80N 5F2WA 4CDWC 3NKGA 2E32A 2DVFA 3GBFA 4P9XA 3E6CC 5A7QA 3OR6C 3STZC 1Y74B 4QU2A 1XBLA 1H1AA 1UU5A 4P02B 3ZRVA 4ZOLA 3A0KA 1ENSA 1THZA 2WABA 3WXPA 4UFIA 4OX9O 4DV6O 4RR3A 3NJZA 5DPNA 5GALA 5C3RA 3KD4A 1H8HG 1XJAA 1PGSA 2ZABA 3N9OA 4Y4RA 2XL9A 3W7TA 4TQDA 2YDEA 5C6CA 3PMEA 2YC2A 1JPXA 4BK5A 4I0XB 2HVKC 1QIQA 4HLTA 1W9FA 1CQ9A 2GC0A 2V4VA 5CA3A 3G71V 4Y3OA 1AR81 1HN0A 3RVHA 1YTFD 3VBOA 1M1KW 1UU6A 1CEZA 4RWUA 5CA0B 5DAQA 5E1AC 5LHIA 5IYDO 4DV5O 2W94A 4WM8C 3RVZA 1DQ5A 1AP5A 4JV5O 4Z2AA 1KP3A 4Y1XA 4GMP0 4JCKA 2OIEA 1ACCA 1R73A 3A0NA 5A1AA 4AYUA 5B66Z 5ABJC 5JH7A 1M90W 4CH4A 2PAEA 1MZ6A 1QVFU 2RN9A 1R3JC 3NXSA 2RMU2 4JTDB 3FX7A 3NJVA 2OYZA 5T5OA 5H9QA 4LC1A 5DZGA 3DKQA 5KX5B 4ASKA 1W04A 1O5UA 3VHRA 4X20B 3B69A 2RQ6A 2A6WA 4LHLA 4L11A 3IFXA 3QO7A 2BOCC 3FB7C 3L71H 2YIDA 2XNDG 1Q81W 3T1HB 1YXWA 1HB3A 2DUQA 5EFUA 4BB3A 2GC3A 1QH7A 1YUDA 2W0FC 2YIBA 3POIA 4PF5A 1N3OA 1RUE1 5A7PA 4BZ4A 4JI4B 1ZX5A 5KLVH 4FP3A 3BTZA 3UKTA 3KT7A 1MS4A 4AI1A 2R062 4RQFA 4FLTA 2MEV1 5E6HA 3RYHA 2X05A 1BK1A 2QJVA 1IBKB 3OY8B 2ZMLA 5ACA1 3OE7G 1K3IA 3D3AA 4LF8O 3WQ1A 4O4LA 1YYNA 4YG6A 3NKTA 2P34A 1YJWV 4LLFA 2YI9A 4R9DA 4QDRA 4JDMA 5T55A 5TISZ 2ETNA 1LOFC 4OUMA 1AROP 3FBYA 2QE3A 1UOJA 1OBNA 4K0KB 1RJ8A 1K8AW 3OBZA 4DINB 4EN0A 1KMIZ 2LGWA 2AZ0A 4XILA 5F3CA 2EALA 1OMIA 2O14A 3NV2A 4Q4V1 1GQHA 4FOVA 3UO3A 4XACA 3DN7A 4XFBA 2ZEZA 3G67A 3ZRWB 5A3OA 4UW5A 1X8MA 1IBLB 1X33A 1NLSA 4CU6A 4FM0A 4JC1A 4KP4A 1HDJA 5FXWA 5FLIA 5AC91 1VBE1 1KS5A 5FMOL 2QQWA 2QE7G 3T4DA 3VZLA 3WEZA 3F7YC 2WN3A 3O65A 3BABA 4ATFA 1E79G 4DR6O 4YXWG 4CZZA 3LD8A 1UY3A 2SLIA 5LP6A 2YZ4A 5BXXA 2VG9A 3POJA 4UV8A 4CCDA 3PIGA 3OGVA 4ZS2A 4QMAA 4YW7A 2YBSA 1BVVA 4LO5B 3HR9A 3M4FA 3WDTA 3OF1A 3N35A 3RFRA 4XJ9A 3VV1A 2R0HA 1H4HA 3ZYBA 1U5IA 4CS2A 5FQ0B 3THCA 1PX4A 4RAIA 3JD1A 4MXWA 1S76D 4W8JA 5FP7A 5LGTA 2QR4A 3MHHC 5I93A 4LEJA 4UB8Z 1MQTB 4DXRA 1GQPA 2VMFA 2AUYA 3OPTA 3MUY1 3I2DA 4MVOA 2VNVA 3KCYA 5KHIA 1YO8A 1R6KA 4AHZA 1ND3C 3WHTA 3T1YO 2DVGA 4AQ2A 3OGRA 3MBWA 3L9JT 4L9BA 2D6KA 3CRAA 1SG3A 5BMVB 2P67A 4LF5B 1JI6A 4FPJA 1W8HA 4OLLA 2VO5A 2GC1A 4ZU4A 1C1LA 3UGFA 5GW7A 5LL6Y 2AHZA 4ASLA 2FDJA 3UGHA 5JWPA 1H8VA 4WFFA 2K9PA 1N36B 3WNMA 2WKKA 5LXTA 2WT0A 3CU7A 3BY6A 2JEMA 4TOIA 3JATA 2B4KA 3LZZA 5EC1C 5FKBA 1L7RA 5CU1A 1ZREA 5GONB 4UB6Z 1C8M1 2WLPA 1XMOO 2P3JA 1RUI3 3ZYIB 2DURA 1JYWA 4ZOLB 1I5YA 2UURA 1TG7A 3O1VA 1S5LZ 3OG2A 4X8NA 1K34A 4Q8KA 2OX0A 1Q7YW 1I94B 3T2PA 1UOFA 4XFHA 2ZKNA 3I5DA 3J7LA 5IYZA 4RR3B 4XF1A 4XF4A 3JCUZ 1E1RG 3VBRC 1COV1 3ZBHA 3AP5A 5LGNA 3RYRA 2Q8EA 1GQGA 5B1BC 4WZFA 4YZ3A 5FZ9A 4OUEA 3ZLIA 4E4DX 1YIJV 2GN3A 2Y34A 1RUJ2 2NN8A 4AEDA 2E75B 1VMHA 1TMF2 4MV2A 2GDFA 4QX0A 4D6QA 4I30A 3TAYA 3ZXFA 4LIVA 2VW1A 5K0UC 3L2YA 3R66A 4F4LA 2Y6LA 1JZ5A 5B3SC 3GWKC 5C3SA 1HXS1 3A0RA 4GJZA 4MSWC 3PJSK 1VQ6V 2VTXJ 1G86A 1WA6X 4YW5A 2Q5ZA 3NRUA 3KHCA 1IZ3A 3N2KA 1HB4A 2BNNA 5EXOA 4HNAB 5GLZA 2RR11 2P6HA 3HOBA 3NV1A 2HWB2 2ZGUA 2A9HA 3TEXA 5CB7A 1HNXB 1QOTA 3JD72 4LMFA 4MHUA 1U5XA 4BK4A 1SETA 4FVVA 1QJX2 1WLCA 3WX5A 1TMF3 5FYCA 2A7WA 3G6BA 2Y6KA 4QX8A 5GLUA 1XNTA 1F7YA 4LF7B 3ACLA 3SYPA 4GMP3 5DQ0A 4PHZA 3C3VA 1BBT1 2CTVA 1XQ8A 3BGAA 1QJY3 1IDSA 4P30A 3B8NA 4BQYA 1KC8W 4HPKA 3OYWA 3SNMA 3H1JH 4O4IA 3IC9A 1MACA 4G9SB 5EHDA 3NJXA 3ZMOA 3RYHB 1ZA7A 5FK8A 3AVRA 5I0SA 1UXZA 4LR3A 4LK6A 1WWYA 1UY0A 2HWB3 3ZRXA 4E9KA 5GM0A 3AVSA 3RW0A 3JD73 1ZUQA 4I9WA 1MEC1 3WNPA 4O4LB 1QJX3 3RZGA 1XSRA 1W6NA 1CX4A 1MSDA 2ZHMA 3GGLA 2LM3A 2H6BA 5LA1A 2E7AA 2XAJA 2A79B 4YWAA 3H3LA 2BTQB 4GKJB 4KQ7A 5JMOA 1BK0A 2WS91 2GC2A 5CKMA 3CNAA 1OFNA 2ARBA 3KLSA 5FLHA 3ZIWA 2DU0A 3DYPA 3SCFA 4RHV2 2GP3A 4E27A 5F9TA 3FHAA 5HCAA 4CUAA 3UL2A 2QJ1A 1VB2A 4IL6Z 1SLIA 2Z0AA 2DYCA 2IJHA 5JXJA 2R1BA 2RS12 4CXXA 1ENRA 3QO8A 1O4ZA 4BLIA 4XCBA 3PUSA 2VQAA 2UXDB 4BW9A 5GZEA 2A71A 5E8AA 3VZMA 3I49A 5A3MA 1GOGA 3ZN6A 4Q20A 4UFMA 5IT6A 1W8UA 2LS6A 5L3DA 4Q1PA 1RUG1 3RDIA 4NKGB 4LNVA 5JIAA 1XNAA 4UW6A 2F23A 4BAYA 3WNKA 4RHV3 3K79A 5LYJA 4PBOA 3AP6A 3BTXA 4UFHA 1B09A 2P4KA 3KHBA 2JB8A 2ZHKA 4I0BA 1WMEA 2Y6JA 3LSDA 2P5OA 5C8WA 2Y4TA 2JDNA 5B1OA 3P6BA 3OUHA 3FLTA 4FZ1A 1ZNPA 4MXWB 1A8DA 3CL1A 1STMA 1QLEC 3UGGA 5IAXA 1OCOC 4Y5SA 3W7WA 2YFUA 3JUUA 3OOXA 1OQDA 1QQP2 1EBOA 1NCRC 2VNOA 1F2NA 1RUC2 5DAXA 1UW8A 4Q4W3 3M3QA 3K51A 3CRQA 1R082 3KG2A 1NCQA 2IC1A 4EYUA 1W6MB 2R7EB 3GDBA 3GM8A 5C8YA 3J4UH 1CONA 2P06A 1SBFA 1OCRB 1SCSA 2XLGA 2W0XA 3TNPB 1G4YB 3CRCA 1C8NA 4LNUA 2WNVC 4WFAV 1FMD2 2DUPA 3MHZA 5LY2A 2BSKB 1OQEA 2GH8A 3EMRA 3O1SA 1JCHA 1OA2A 3Q8BA 5GLVA 4M0NA 4TSFG 3PLQA 5LXTB 5E88A 4ZS3A 1OCCB 1GP4A 4MVUA 2VMGA 2RM21 2WWUA 4TXWA 2GALA 1V55C 3JATB 1T6GC 2VBDA 4LE3A 4ISQA 4ONUA 3TK1A 1PMIA 1XI1A 4N9HA 3ZSEA 4AEMA 2VQFB 2KM2A 3UETA 2DBIA 1S55A 4AK3A 1CN1A 4GX0A 1LGCA 2DBNA 4QE7A 2LO1A 1O9HA 3BKZA 1X7NA 2WA4A 4CVUA 2DW4A 4JAUA 3H0OA 1B6QA 3SYQA 4BWAA 5IYZB 4CDUC 4X1YB 3NMBA 4LKFA 3TYJA 2W3JA 5CIRA 5F5IA 4CPBA 4WVVA 3OMIB 3OGIB 4DV2O 3VDCA 1VBD1 1ZZ8A 2VOKA 3VBFB 2RJ2A 4IIJA 3JBG2 1A6CA 2VZRA 1OT5A 1O7FA 1SLTA 1HNZO 1QXRA 3ZYGA 4RGAA 4I9QA 2F1MA 4I4TA 4QM8A 4YM0A 2XJRA 1FXHA 1FV2A 2WAMA 5KWRA 5KR7A 2J1UA 5IWAO 3M3EA 2EIDA 2WWJA 3HEIA 4C8DA 3B8MA 2B5HA 3BVCA 1F15A 5DDJ2 1Q6HA 4WBNA 2IVIB 5AFEA 2XLAA 2UY8A 2L35A 5C3OA 1J3PA 1U5ZA 1KB9F 1RP3B 5FZ7A 2ZGRA 1M56B 1QF3A 2VOTA 3P5BA 5CA6A 3DXUA 2CY6A 2I07B 3BPSA 4EJRA 2VUCA 4X8PA 3CS5A 1AR4A 1T6BX 3LA7A 2WLMA 2DVDA 3W21A 2VS0A 5B1AC 1XNRB 3ML0A 4LR4A 2HEYF 4DPNA 3I7DA 4RQPB 4Q2FA 2UUBO 4HKOA 3EXAA 4OHWA 3CB2A 3M1HA 1D4VB 1NZIA 1ROPA 3WY6A 4CYDA 4JYAO 3ZYPA 3VN4A 1S5JA 3D36A 3T4ZA 4DR3B 1W39A 5FMOS 1MABG 4J7ZA 5L9BA 1YHQV 5IK8A 1KBHA 3GBGA 4BH9A 2A1XA 4O4IB 5JZGA 2ARXA 2YC4A 4DUXA 4UBHA 2HWE3 3SEPA 1XL4A 1AL22 4RFT0 3LA3A 3PUQA 4ITCA 2WO3A 3A0HZ 3SPGA 4BIUA 3O14A 1JTZX 2EZPA 4QX5A 1X4TA 1QU7A 1FKAO 2CTWA 2WYFA 4XTMA 2XAFA 1N34O 3V64A 3SPHA 3LA2A 1HRV2 1PO12 1SQVH 3HNBM 3N3HA 5JJJB 3ZRSA 4IV3B 3DSQA 3JSLA 3QO5A 1MOFA 4GXLA 1IS4A 2VMEA 1UMHA 3HJRA 4C0HA 2DV9A 4MS2A 4FFIA 4B1MA 1QR8A 5FXZA 5FUIA 5C8CB 2ZNJA 1FV3A 4RYDA 5KHJA 1AL23 1EN6A 5JXIA 4N53C 2XHNA 1OLRA 1UZWA 3GHNA 2LUWA 3S57A 1WNSA 3VBSC 4UT5A 4FPKA 4PA4A 1VQ9V 3W59A 2LFRA 1FJGO 1JN2P 1RUD2 3ZN6B 1HRV3 2HJIA 3D6EA 1QVGU 3ZN5A 1GH6A 4O2BA 3MF9A 2ARAA 4DRVA 1GBGA 2LW1A 1W6QA 3JAMN 5FY1A 1QHTA 2E3CA 4OHZA 5LBCA 2CAZC 2DTYA 3T2QA 4Y33A 4DOUA 4YW6A 1O91A 2XUMA 1XNCA 5LYJB 3AMPA 4XDLA 2OQ6A 3FB5C 1MS3A 1H30A 2EIKB 3H7JA 2UU8A 3OPWA 2ZA9A 3E86A 4LPLA 3K03A 2R16A 3KSCA 1VR3A 3ECQA 2UUCB 3I3QA 1SF9A 2Y0PA 1YJNV 4QPIA 2Z42A 1H8EG 3R4DB 4TWKA 2FCTA 1VQ4V 2UXNA 4I0WB 1RUD3 1VP6A 3DYMA 4JGZB 1B06A 4B7KA 2X6BA 3JAWB 2QQJA 4IEXA 2Q1ZB 2KXLA 2QZ3A 4D7TA 4F7ZA 3RYCA 2BBVA 5IVVA 4ZZ8A 2HEWF 3VQWA 3S7IA 4HSLA 2ZE6A 5LMUO 1ULEA 4FLZA 3RGBA 2XVLA 1GTOA 1I9RA 2O57A 4GT1A 4NYKA 2RVAA 4IE7A 3DCQA 1BEV1 2WZR2 4PI0A 4LNUB 1JW6A 3F5TA 5DUVA 1RM1B 3ZFEC 4AG4A 2Y33A 1UY4A 2A3QA 3SR2C 5KXCA 1PL4A 1VQ5V 2N04A 4HYOA 1SBDA 4G4FA 2CH7A 1VRH2 2Z4FA 2RG4A 2LP7A 2E7QA 2VL4A 2ARCA 2JWPA 4JRLA 2AREA 1KECA 5JR2A 3C3SA 3FBMA 4CDXA 2VTXA 1NZCA 2OTLV 3MDPA 1YFWA 3EXUA 3FD9A 1JMKC 4CP9A 4ICGA 3WT3A 3O1TA 5FZ0A 1UN1A 2WZR3 4XBQA 4YFZA 3CKHA 4DV1B 2JG9A 3NVCA 4DR2B 1UOBA 3RS6A 1GR3A 4ZHQA 4ET7A 4KBBA 4YZ4A 4RS5C 3I4IA 5JXHA 5IJRA 3I55V 2BDRA 1PIV1 3GNEA 5B4XA 3I54A 2EJ7A 5C3QA 4AE2A 1RJ7A 1UZVA 3ZEDA 2WIIB 3H42B 3RQ0A 2C2AA 3QF7A 4PI2A 3WG7B 1V6NA 3ABLC 5DABA 4MVTA 2K1EA 2D97A 2Y48A 2WRAA 4I4TB 3UT5A 2UXCB 3WG3A 2R072 4HK8A 1OA3A 5FKCA 5A9GA 4XBLA 1VAKA 4Y5Z0 4CH3A 3T1HO 4WBNB 3RMYA 5FPXA 5L3EA 4YHHO 3VBOC 3W5MA 1NH2B 4I09A 1OUSA 1VQ7V 5T50A 3EYPA 4UV9A 3IGAC 2XT9A 1W8NA 4XVHA 3S7EA 5ERLA 4PELA 3I2IA 3TEWA 2DTWA 3O1UA 5J09A 1XE8A 1IPSA 1NE6A 4HL0A 2EIMB 2D3RA 1IBKO 3WHUA 5FY5A 1G8MA 2Q67A 1SQXH 5GTHZ 3R65A 1LB2A 1SA0B 4DXTA 4XAEA 5K4LA 2R073 4NRQA 1BQPA 4INDA 5IVEA 5JIUA 1UKGA 2R9IA 3H8UA 1IKPA 3OEHG 1E5HA 3RZKA 3LCPA 2VZOA 3FAVA 3BU0A 5EJZB 3LQCA 4R9AA 4KH9A 4K0KO 3UJQA 1KJLA 3HQRA 5FFOC 2IBZH 4IL7A 4JI6O 1NT2B 4JHTA 4B08A 2CTPA 1QJFA 1GKBA 3I3MA 3D3QA 1KS4A 2C9KA 1PM4A 4NRPA 4PIZA 2FBEA 4XUQA 4EEQA 4L87A 3P32A 1IBLO 5LK7B 1VBC1 3BOWA 2XKOA 4CCMA 4CP0A 3POSA 3ZM8A 1G6UA 1AR63 2BNOA 4QX1A 1R1ZA 4QXBA 2PZSA 2RJLA 2DYSC 3CCEV 3WCRA 1YVWA 4LBNA 4GH4C 1DLBA 1RIRA 3GZEA 1KFUL 1X9TA 5CFCC 1VQLV 2PQQA 5J2UB 1YQ6A 1JODA 4CU7A 3SLIA 4LE4A 3IAYA 2LRPA 3LSEA 4NB5A 4Q4Y1 1LOGA 3WZ1A 4EWEA 4A45A 4I5SA 1NX9A 1JVMA 2QA4V 2VOXA 2HBTA 3F95A 4I3GA 1TVKA 4O2BB 5EBWC 1NS1A 3RYIA 2J1SA 1MPXA 3KM5A 3OW2U 1UMIA 4Q4X1 2ZCWA 4IESA 2ET7A 1ENVA 3FJSA 4AVAA 4W4LA 2JDPA 4OPHA 5LP6C 4BCUA 1C28A 5JVDB 4P14A 1SMVA 3CP1A 4UW3A 1KXGA 1ZRRA 4LF5O 4LIUA 5FLJA 3ABLB 1PGW1 1DTOA 5IWFA 4XF9A 2JD4A 1DZQA 1EZJA 2UWAA 4NROA 1H6YA 4QPIB 3EHKA 5FZ8A 2XWBB 1EAH2 2PLV3 1N1TA 4UFKA 2QTWB 3T1CA 5A3NA 1MNGA 2WLLA 3E22B 4GX1A 2NM1A 2W87A 1N36O 4DIQA 4DY3A 3RYCB 4JI8B 4V2WA 1PO23 1X82A 4WVMB 1JYIA 5JI9A 2E63A 3MW4A 1JHNA 4P08A 1JX9A 3B3QE 2HVJC 3VD5A 1MZ5A 1Z7S3 4IYHA 3SH4A 2ZGOA 4FPGA 3SC7X 4WCEV 2Y6HA 1AR91 5L3FA 2A3WA 1R1A2 2ZHLA 1GM7A 4JAAA 1M93A 1NKDA 2UWCA 2JB4A 4Z2WA 3S3XA 4FTBA 2CH7B 1I94O 4A41A 3MIEA 1FOD2 3PIJA 1C5IA 1CAXA 1QLNA 1I5ZA 5C4WC 3USSA 3MPPG 3QD6A 3INAA 2Y6GA 1X59A 4JZRA 1FATA 2BQPA 3ZXAC 3CCQV 4CDXB 3ZMTA 5FZHA 3M8AA 4XQ4A 2ZS6B 4YW1A 4CP9B 4PD4F 3H1WA 1U97A 4IEUA 3JB8A 2ZR3A 5F5QA 4BDVB 1BCXA 5BY5A 1UZ0A 1XYOA 3ZVXA 4L8QA 5FZAA 4NIIA 2BYVE 3THTA 1CZTA 4LLOA 2G4IA 5GZGA 2F6BA 5LW9A 1R1A3 1GNZA 1DLCA 4ZHQB 1RUH1 3I56V 1L1FA 1O3TA 4BQ4A 1CXZB 2XOKG 1W9SA 3ABMC 2VWKA 1AJPA 3MDSA 3EO6A 2WNOA 2OS2A 4K35A 1D4M3 5JPNB 3ZYFA 3E97A 5IUQA 4Y26A 4LUMA 4XXAA 4NXNO 5FY9A 2VNGA 3U10A 2R041 4LFAB 1W03A 4XDPA 3H1KH 4LF6B 4YZ1A 1LGBA 3UT5B 4LJHA 3WP6A 1JZ3A 2JG8A 2QTSA 1RB8G 4FAGA 1AR71 4AEDC 3T1LA 1LU2A 5KBFA 2E33A 1Q6UA 4LF7O 2JIGA 1EPWA 4AQ6A 1W6OA 1K5JA 5J2TB 1SDWA 1FXKC 1H2NA 3OTFA 1RITA 5F5CA 1OXCA 4FLVA 5IVYA 1AXYA 1CX1A 1NA1A 3K48A 4XFAA 1O4TA 1V6LA 4AVTA 3AG2B 2QWQB 1NXD1 1D5NA 2XVKA 4JV4A 5APAA 3FB6C 2GTSA 2E74B 5JJEB 4NXMB 4U7OA 4PDRA 2WZEA 1ZRIA 5L9RA 1R092 2DOSA 5FLXN 4JAVA 4BQ3A 5FPRA 1XDCA 2B9UA 5A7NA 4EROA 4ZONA 2CHHA 4LO7A 3RYFB 4DYLA 1OH3A 4MXVA 4N90A 2OCCC 1YFYA 1REDA 4BHPA 4MO3M 3PUAA 1QOOA 3AMNA 1QJU1 4BA6A 4ARXA 4QGMA 2EIBA 2CTRA 3A0BZ 2Y0IA 1X36A 4OI4A 3WNXA 5EP9A 5JOWA 3VKOA 3AP7A 4DXWA 4BMEA 2WNUA 4IV1C 1NT0A 5CFDC 1N32B 1KDMA 2OUHA 2YUAA 3PUIA 4U7NA 2UXDO 2Q8CA 5LGUA 4BJ0A 4CCJA 1UMZA 3FHIB 4Q0UA 3SKJE 1AILA 2DWDC 3I3BA 2UU9B 2VOWA 4UI9L 2A06H 4AFMA 4FM1A 1UNBA 5FL7G 3T2MA 1GU3A 2JS5A 3HIFA 1BXHA 5DMYA 1RGSA 1RXFA 1EV11 3Q8EA 1TNRA 4LXLA 4UBGA 1G9CA 1BHAA 4CS4A 4CDQA 4XDOA 1AI7A 1LHWA 3JSNA 1IURA 4W65A 4OHVA 2Q0AA 3CJIC 4KHPB 4HXCA 3ABKC 1WD4A 5DG1A 3AYEA 1XL6A 1RXGA 2WBKA 1AYN2 1AYM3 1POV3 4QD2A 5KMGA 1NY72 1TEIA 2A70A 4J9YB 4XURA 4AF9A 4QHBA 1TVKB 4DB5A 2VY0A 3JD0A 3RYIB 5K7PA 3ZPYA 3D0JA 5FY7A 4AGRA 3IC7A 1UPIA 5LWBA 2BEOA 4X1KB 1B04A 1UPGA 3PVOA 4K1ZA 2DCZA 1Y4WA 2ZXWB 3ABZA 5C9AC 3WNOA 3A7QA 1WBLA 4YGEA 3PJQA 4KMQA 2JKXA 1QQCA 3K3OA 2YHJA 3FMGA 2E5LB 4CEWA 1UD1A 2RDSA 1BHBA 5IVBA 2XBO3 5FY4A 4DR5B 3AKTA 2IJIA 4Q29A 1RC6A 2RJZA 2KQXA 3ZXEA 4QPYA 5JXGA 1N47A 5BNNA 3HBKA 2VTFA 1KDKA 2G9FA 3T08A 2HKXA 1OI6A 1AR82 2GNTA 2WQ8A 5BYNA 1K5MB 1XHZA 2A5ZA 4YGBA 3VOUA 2NR5A 5FZCA 5FNVA 2VQFO 4YZ2A 2ZMNA 5IFTA 4QKDA 3UM7A 1NCQC 4YM3A 4GULA 4QWNA 2ZNIA 4QJFB 2XJQA 3C7OA 4XJUA 1M9NA 1W2OA 5GTIZ 1ZX3A 1W8WA 4CXWA 3IDCB 2R9AA 2RV9A 2RMU1 1D0GA 3ZHSA 5IYYA 3M8LA 1XNQB 2ITDC 2E6VA 2Y4UA 1CR7A 4ABMA 1CAXB 4AEKA 4XFFA 3BU7A 2R9RB 5EC2C 1JU3A 4CCKA 2CNAA 2HH9A 1XHXA 4MYEA 3ES1A 5J98B 4MGTA 1AR83 3DV8A 3ASNB 1FYUA 1DF0A 1SZTA 1YI7A 5EZYA 3S0MA 5IK5A 1MZFA 5DZEA 1UOGA 3VBHB 1XPWA 2XHBA 4QQ2A 4IV1B 1B35C 4CSWA 2WFF2 3PU3A 1ZBE2 2NPIA 2R061 4KNCA 2HR3A 1FFXA 2NP0A 1NVPD 2PAMA 3TN92 3V0AA 2W6IG 1W06A 4AI3A 3G80A 4A7KA 4MW8A 3OGJA 1M57C 2E7TA 5JLVA 4B4QA 3K58A 4DV4B 4XIKA 2OVUA 3OUJA 1JU4A 3VKLA 1HRI2 5B4NA 1RTVA 1CPNA 3WV6A 2RS32 3EQEA 3J9SA 4OUSA 4YZ5A 1YTFB 4ASMB 3W58A 1PKXA 1J58A 1RUE3 3WF2A 1QR9A 3N9MA 4P5YA 3L2HA 4FTEA 2O8QA 1K45A 2VBBA 3ME2A 1KJRA 1DGWA 1ZBE3 4LKDA 2VCCA 1GZTA 2MEV3 4IGPA 4NRMA 1G1XB 1WA8B 4DR3O 4FLWA 5H9CA 4XZPA 4JI3B 5J48A 5ACA3 3CCVV 3SITA 3BAAA 4X65B 1V54C 5L7OB 2ZGMA 1HB1A 4K21A 2ET1A 3J8F2 3MV01 4D94A 4EN7B 3HNYM 3ZN1A 2B9VA 3MIDA 4KGGA 1OOPC 3FWEA 2OXBA 2OIGA 5BY1A 4RGGA 3GZAA 1VRBA 3AG4C 3CXCU 5JDBA 1BQZA 5C9AB 1F5FA 1WLTA 1DFQA 1SDDB 3RI8A 4MSVA 4OYUA 1UFIA 3POGA 3APQA 3DL3A 3U11A 3D36C 1DLLA 5FYBA 3PTYA 3ZO0B 1NQTA 5CBHA 4CH5A 4LO4B 5JZGC 3JU9A 4FAHA 1YFUA 1P4RA 2JRIA 3E89A 2WNUB 1OURA 3J8F3 1VBE3 1AR5A 5K1PA 3V65A 1BZKA 3FFQA 1S0JA 1XOUA 4K8ZA 4ZKTB 2VVDA 1V6IA 2JE8A 4OZOA 1J95A 5ITZB 2KD7A 2GUZA 1CIWA 4MG2A 5F37A 4LH7A 4BPZA 2WNEA 3ZOIA 5LEKA 4DRRA 4GAZA 3B02A 5I8SA 4CE8A 4B29A 1GK9A 2FMLA 1ENXA 1UL9A 2OZJA 1LECA 4HG6B 1IXBA 4CDQB 4YM1A 3IDAA 1YNAA 4OI1A 2WZ8A 2GMPA 3VDDB 3ETGA 4DR1B 5IY5B 4B1LA 3OBTA 2NMOA 4ZXEA 2UUCO 4LK7A 5KMGB 2PA7A 4JGYA 2YPDA 4DFSA 2WLQA 1GRJA 1UKRA 1XB9A 2WSSG 5F5AA 2WFPA 2W52A 4X88A 1DYPA 1US3A 2UXBB 2YIBD 3AMQA 2WLKA 2EA7A 4QXCA 3MZHA 2J1RA 2AENA 4K40A 5IVFA 3V0BA 3UCSC 1JBCA 4FPPA 1RHI2 1ND2C 1LCLA 1S0FA 4B3RB 4UVAA 3A4UA 3X2QC 2AW9A 3OMNB 3HWJA 2OT5A 4DW1A 3KV4A 4XFCA 4EE2A 1XQNA 3N36A 1VBA2 3TNQA 3M2MA 4TYSA 2BGOA 3ZSJA 1CWPA 5AFBA 4CEWB 3USUA 4TZDA 5F6KA 1RUJ1 3JB4C 1RVF2 2EINC 4LUKA 4FOWA 3T0DA 1AJKA 5BNNB 3H50A 2XDVA 1TMF1 1CPYA 3ZFGA 2Z5UA 5JOXA 4DMIA 1UXXX 5FZMA 1HJGA 4KWUA 1AP6A 4TV9A 1H6XA 4EWDA 3CZJA 2AEYA 3E8HA 4QHOA 1RHI3 1LAJA 1BT8A 5FNVB 1IKQA 3O5SA 3DYOA 5CA0A 1UPSA 4M3CB 2ZDIC 2LJ2A 5FBZA 4YGCA 2DQ0A 1VBA3 3ZFFC 4HKLA 3MO4A 1CAUB 1COV3 2XLFA 2X5IC 4Z92B 4R50A 1OKOA 4DV1O 3LIHA 3BFRA 1HQWA 2GH2A 4DR2O 2HWB1 1C4RA 4A4AA 2Z69A 1B3QA 1BJQA 1Q8IA 2G9ZA 1LGNA 2EF6A 1QJX1 4QPGB 3FX3A 4X64B 3Q9OA 1O8SA 1Y67A 4FPEA 3VDAA 2GSMB 3SCGA 1J5EO 4EN9B 4K20A 3ZHVA 3VQYA 3LDDA 3LEMA 4FPLA 1ZZ9A 2Y60A 4LORA 4GKKO 2UXCO 3T3YA 4JQRA 1NTMH 4IHJA 3ES4A 3CRRA 5LATA 1M4UA 5D8AB 5GZDA 1H8TC 2ZX2A 3OEBA 4H7LA 5CG9A 2RR13 1L0LH 1F4NA 2QQIA 3I97A 3SQOA 4XMAA 4AI2A 4AZZA 1PK6B 1GZWB 4BISA 4C7UA 3RZMA 3OUFA 2ZEWA 4QX2A 3BODA 5CBLA 2W92A 5DAPA 4ZY9A 4PA3A 1ZM1A 3DPRB 1TA8A 4QGNA 3LEIA 5FYZA 4QE9A 1JYNA 2IXCA 5CB4B 1AI4A 2V73A 1I08A 1PNGA 2A75A 1OCZB 4R8HA 3R4SA 4UFJA 2CL2A 4QDQA 4UCOA 3RYPA 4PDWC 4RHV1 5BNPA 2W1SA 5FCCA 4WM7B 1PNKA 4URTA 2X6CA 2ZR2A 4O2AA 2XONA 3D5OA 5KC5A 2JIJA 2G9GA 3VDBA 4K8XA 3WW2A 5F32A 1YWKA 3EBRA 2VMHA 2RS11 1OHFA 3AZYA 2VM9A 3GCWA 3WSOA 2PELA 1XYPA 3AG1B 5DZFA 5LK5A 2EILB 3NAPA 1R3LC 4TUYB 1RUF2 3QCWA 4AVSA 3OMAB 4X1IA 4LBQD 5F1RA 3ZDVA 4TN7A 1RUNA 3FC0A 2W6JG 2D5FA 5I0RA 2WS93 3MLKA 1GAXA 1Q8QA 3HD8B 3LNNA 5FZOB 4R8CA 2DVAA 1WPBA 3ENRA 3O1RA 4K8RB 2E9QA 3AX4A 2DF7A 3MF6A 4A3XA 2NN4A 1QNMA 1XYNA 4JASA 3ILRA 4Q27A 4N7IA 1R3IC 1LOAA 1SLBA 2YBKA 4HAMA 1DG6A 5T52A 5AVPA 4G3YC 2ZIOA 2ZGTA 5H6QA 1EN5A 4O4HA 4MVQA 1RUF3 3WD5A 1C1FA 2MK3A 3IAQA 2Q9LA 5BR8B 4WV8A 5CG8A 4Z8BA 2R1DA 1VIBA 4S2FA 4JPRA 4B3SB 1QQP1 5KUMA 4S2HA 3TWIA 1DBNA 2GUZB 1RUC1 2HWF2 3CC2V 1JA8A 2WLNA 1OLMA 1R081 4YYOA 3LAGA 3K3NA 4NOTA 3B7MA 1PV0A 2PXJA 5ABJA 1VBB2 3OGGA 4NHYA 2BE3A 1ASJ2 1AJOA 3AK2A 5G04L 3K3WA 1FMD1 4RL7A 2AYHA 4XABA 3RZHA 2GHYA 3BYWA 2ZE8A 2ZE7A 3GVMA 1VQ8V 1KFXL 2PHFA 1MSWD 1JYXA 2Q8OA 4FP2A 1J3QA 5FZLA 2AZ2A 1SQQH 1N1SA 2XQXA 3IM0A 1UIJA 3HB3B 4CUBA 2DE0X 4NWWA 2BOJA 2ADEA 4HN0A 4M4RA 1N8RW 2J42A 2VZ1A 3CCLV 4J25A 1VALA 5GONA 3OJBA 2GZWA 3V0BB 2ATKC 5CISA 3KZ4C 1VBB3 3SHRA 1ASJ3 2QDRA 3L70H 2ADDA 1WKYA 4HONA 4K3AA 5J1XA 3P1IA 2PHLA 2FMDA 2FD8A 2VXJA 5FK7A 4JTOA 3WVJA 4M00A 3BCCH 4TQFA 1DQ6A 2V09A 4CCEA 3H8RA 4FM2A 4YNIA 2R72A 1FNYA 4P00B 4CCOA 4XDQA 1W3XA 1LEMA 2C1FA 4RGKA 3ZN0A 1GMMA 4LITA 3C8XA 4BXSV 3USUB 2HWD2 1J1LA 3JBG1 2B46X 3APOA 4PDWB 1LOFA 2Q0OC 2WUHA 3BA9A 2OA2A 1QDOA 1SCRA 5C5UA 3ZMNA 3ZFGB 2VQ0A 1ODMA 2ZE5A 1QY4A 4TV9B 3OTOB 2AZ5A 1XE0A 2A6ZA 3UK9A 4DS0A 2IW5A 3VZOA 3N9LA 5DDJ1 1FAYA 4OMDA 4E4ZA 2FDGA 2JDIG 5FWJA 1WW5A 2W68A 3NR7A 1VEWA 4EN8B 2PQSA 1SZXA 1WW7A 4N8MA 5FOJB 4M3CF 3C7EA 3ASOB 1CJPA 2HYXA 3HQUA 2VH9A 2FDKA 1GLHA 1VB4A 1K92A 3FYIB 4HNAA 3J7AU 1AB3A 2HWD3 3MI8A 3CMGA 3ICXA 4CA9A 4ZBMA 3WF0A 3VBUC 2V7QG 3KGZA 2DYRC 3RPQA 2B8MA 1MMMA 1AX1A 3K75B 1GV9A 2IXKA 2ORZA 1V6MA 1CZVA 2Q1FA 1F51A 5FZGA 3VL9A 4ZI7B 4LFAO 4DV0B 5A7WB 3MV11 4LF6O 4AQYB 2V72A 3H1YA 3NW4A 3OFNG 5JOZA 4IHJB 2ZX3A 2QTOA 4DO2A 1OVSA 1ULCA 2HJFC 1LHOA 1LKNA 5LBFA 2GDSA 4IGGA 1OQ1A 1WCUA 3E6BA 4PV1B 3JQXA 3A23A 3VD3A 1AL21 3DC6A 5A80A 4MVRA 4WVWA 3JQWA 2OYQA 4EKWA 5GZFA 4FFKA 1SQFA 4J42A 1LTEA 5LZ6A 3UYJA 3H9AA 1UYYA 4YG3A 1K5QA 1ND3A 4H55A 1UU4A 5BNOB 2Y6FA 1W6PB 4MZUA 3U4XA 1HRV1 3UO2A 1PO11 1W9TA 4LBJA 4XEZA 4L97A 5EBLC 3K5LA 5FYYA 4NXMO 4Q0QA 2BFUL 1KEXA 3ATGA 2YGMA 3QH6A 4OGQB 2Y69B 4P9IA 1HV0A 2JG8C 1M4WA 2AEZA 2BTQA 1QCEA 4LHSA 5BNPB 1HV1A 2DCKA 4TTGA 2WO2A 3K4ZA 4O2AB 4LF4B 4LOSA 4PDVA 4O9EA 2YFZA 2GNDA 2HWC2 2FKXA 4KL1A 1Q3EA 4F6EA 4M3CE 2D2CB 2R6QA 5IT9N 2CAUA 4Q0PA 2ZACA 2NQYA 1W9YA 1VIWB 3MICA 1CAVB 1JJ2U 3NAPB 1MS1A 3I59B 5DECA 2LTNA 4NVPA 1S0DA 1NA1C 4CDWB 4ZU5A 4AFCA 4COUA 5A3TA 3RYKA 5CKQA 4PA9A 4X1IB 2D40A 1RUD1 4Q0VA 3A8TA 2QDNA 3KB5A 1GM8A 2C24A 2UYAA 4FMTA 1N32O 4XIOA 3RT3C 2IM9A 5IJ9B 2ZZQA 3WP5A 4XHXA 1N0JA 2WAAA 4MLOA 1YQCA 3QH7A 2EICA 3U0ZA 3U14A 3PNAA 4QQOA 5FXVA 4MVZA 2P6CA 4YVSC 4Q0SA 2A6VA 2UU9O 5LA2A 1GSLA 3VBRA 2A6YA 2HWC3 2PGGA 1AX2A 1KQRA 3O0WA 2X09A 1HDKA 1HB2A 3LSQA 2YEVB 1OPOA 4BWOA 4AGGA 3THOA 2DVBA 1H2SB 3QTCA 2CWMA 2XJVA 4I2OA 2YMZA 1OKQA 4O4HB 4KHPO 5JCOA 1I6XA 2W2IA 4LA3A 2Q1MA 5EYPA 1H4GA 3TCUA 1IBMO 3E2EA 2D93A 3RN4A 3JD2A 2A3YA 3CQOA 4ZHNA 5JUVA 1R1BA 5IATA 4WM8B 3JD4A 2MHFA 2ZGKA 4I50A 1S5HC 1O3QA 1IG3A 3RJRA 2JGUA 1X8EA 4AW7A 3PVEA 4EZ4A 5ABJB 2EZOA 2WLHA 1RUI2 1W6MA 5BV6A 4DR7O 2BOIA 4NE9A 1QNWA 4JI1B 5C71A 3HN1A 5FV3A 1YIPA 2BVBA 2RS52 4Y1VA 4WFGA 3AZWA 5K8SA 3POBA 1F5JA 3EJKA 1ZBA2 1L8DA 3PURA 2HYKA 2EAKA 2ZPXA 4QNHB 2DUOA 1VRH1 5CYYA 2BSKA 2EBOA 4QPKA 4QQLA 1UX7A 2WSUA 4N21A 4LF9O 2I2SA 1QJZA 2E5LO 1H1MA 2WO1A 1P7BA 2ETEA 5FYTA 4A2UA 3SJAC 1C3HA 2WLIB 3ZSMA 5ISLA 1IXMA 3J81N 1BCCH 4HMZA 3H1IH 4NTXA 5A3PA 5JPMB 4JI5B 2RMKB 1K5SA 2L9LA 4D3WA 4RSUA 1O6UA 2AC1A 1NQJA 1EUTA 3PU8A 1NQDA 4B8EA 2RS53 3SPCA 4QIWF 3ZMUA 4JKMA 2JKBA 1ZBA3 3C7GA 3IIIA 4OVEA 3BALA 1NKGA 2WQ4A 5JSRA 1DGRA 2EIEA 5LA6A 3Q8AA 4X1YA 3RVYA 1J59A 3VUOA 4CBCA 2ID4A 4HK9A 3OEAA 1DDLA 2VQTA 3K9AA 2QQKA 1XILA 1XNQO 2BU9A 4O9GA 1S2EA 4FVMA 3VBFA 1W0OA 4GKXA 3KV5A 3B2EE 4C1XA 1QOSA 2R071 5HV4A 4N23A 3OSDA 2IJKA 1SERA 4IEVA 1R64A 3NSTA 2BJSA 4JTCB 1DU3D 1ULDA 2YV8A 4XBNA 2P17A 4CCNA 4DV3B 2XOMA 4CCLA 1O3SA 1AL0G 1QJY2 4C0BA 4CP1A 3O1OA 3MW3A 1PIV3 3EVKA 4XDJA 5FO7B 3N9QA 1Z78A 3SCHA 3R4UA 1W0PA 3WU2Z 4KG8A 3W9AA 5DAWA 3A22A 5FZKA 3UQ8A 4K6BA 1YQ2A 4X66B 5D21A 5TSWA 2P3KA 3BTAA 4YVSB 3CF6E 1K3EA 1A32A 4DV4O 4GZ9A 1DCSA 3C90A 5H5NA 5FTTC 4AI9A 2WN2A 4XUNA 2PYJA 3OAAG 5LHHA 4RQPA 2CDPA 4FFBB 1W3VA 1S0GA 4H3WA 1NR1A 1G9DA 1MR5A 3POFA 2F43G 4CEYC 2EIJC 3AKPA 2CK3G 1Q8PA 1EYBA 2VWJA 2TEPA 3VKMA 2DWRA 2DDUA 3NO8A 2UUAO 2IH3C 3CEIA 4P9WA 4JI3O 4IQPA 1HNWB 1IS5A 3O9OA 1AVMA 1W2UA 5CA1B 1NCRA 1ND3B 4X65O 5GKAC 2ZM6B 1GWKA 1E5RA 4MGQA 3BHPA 1NG0A 1XE7A 3ETEA 4XF0A 1CPMA 3BA8A 2W1QA 4MVMA 4NAMA 1Q8SA 4IV3A 3WW1A 2PY5A 3U4SA 1XNKA 2IVJA 1IHMA 2WT2A 4BU2A 4HBNA 2EXHA 5JVVA 5EWSA 1GN3A 4YVWC 3LGRA 1GZCA 2XXZA 4G27B 1C57A 5C8CA 3BIWE 3ABTA 3PHMA 2JEXA 5D5PA 1GYKA 1RMU2 2WSVA 5DM6V 2YXLA 3IDEA 4FXKB 2DN9A 4FI9A 3B77A 4NTWA 3LUTB 3OT7A 2QWNB 1VBC3 1XBFA 4XC9A 1VF7A 4B7EA 2B1IA 2ZX4A 4JQTA 5JI7A 3H8OA 3R0RA 3N2GB 4Q4X2 4ATEA 2XAQA 1SZBA 4LFBB 3SYCA 4NWVA 4S2GA 4J1WA 4FT8A 4IE6A 3CE2A 4Q4W2 4CDUA 1XNDA 5FMCA 3VBRB 3JYCA 2D6MA 2IU3A 3B9IA 3AG3C 5B1BB 4IGQA 2XPJA 5IK7A 3C7FA 5E1RA 4OHYA 2P3IA 5FOBB 2XGXA 4Y1ZA 1L3JA 4RUEA 1BGYH 4X62O 1RMU3 4CC5A 1EAH1 1MS5A 4ZZ5A 1D2QA 4CP2A 5GLWA 3WDVA 1VAVA 5IVCA 2M7WA 4DR1O 1SPPB 1XC6A 2DFBA 2WDBA 5HBAA 5K0UB 5EYPB 4GQ7A 5LOVA 4N43C 5B3SB 3RJ2X 4AHYA 4JGSA 1D2DA 3CC7V 3MFAA 3S3WA 4JGZA 3JAWA 1JHJA 4IGOA 4Q4X3 5I0DA 4I50B 4HVQA 3ACGA 3V56A 4DUZB 3PVNA 3T0AA 5KC6A 2X53S 4JYCA 1N1VA 2UXBO 5C93A 4SLIA 3L73H 1TZOA 2J1AA 4KBZA 3DGEA 4IEWA 4UCUA 4JTNA 2P1BA 4IXLA 4B3RO 4EFBA 1OLQA 1PX3A 5L3BA 5DXDA 3U1XA 1LU1A 4XJAA 2OZ6A 1FOD1 1UY2A 3HVDA 1K73W 1W8OA 1NYWA 3CCUV 4X6QB 4F3JA 4GIQA 2DFCA 3IT8A 4H37A 4DUYB 2W1WA 2HEVF 3E5QA 2GNBA 4JGYC 2WJSA 5GZCA 4E4HA 3CZUA 1I7FA 2YXYA 1UJWB 1V00A 1LEDA 5FP4A 4YY3B 1K42A 1GP6A 1ZA4A 3K08A 5SV8A 3RMXA 1G8WA 2BCCH 1AR93 4JKKA 5H2FZ 3HKDB 3WUDA 4PBPA 2OWOA 2EXJA 2JS3A 3ZPOA 2H3OA 2VULA 3JARB 4META 1UZYA 4V1PA 1OSGA 4COZA 4KU7A 2IXIA 3H3UA 1BMV2 5LA6B 2VZSA 3MPBA 4PIXA 3GYDA 2QQUA 2Z3YA 5FBJA 4LP8A 4AVBA 3K9SA 4Q26A 1Y3TA 4GYCB 1RYYA 2P7TC 1CZSA 4QX3A 3VGIA 4YJ3B 1PMHX 2A73B 2PHTA 5E89A 2HLEA 5F8PA 1Z5VA 2EVXA 3ZCCA 4X64O 1DQ4A 2GN7A 1ZLZA 2VCMA 5A32A 2FDIA 1OLME 5IE9A 5IAVA 5FO8B 2RDNA 4PQQA 2HJDA 1PMJX 4OXSA 1DZTA 4RA0A 3QG5A 1RUH3 2RHPA 1G7YA 3K77A 4DEQA 1ST8A 1GZ9A 1SQ4A 2NZ9A 2X8KA 2B1GA 1UCXA 4XCAA 2BFUS 4FK5C 4JI7B 4BMBA 4COVA 2J22A 2KSDA 2HWE2 1DQ0A 4A3ZA 1IPJA 3KCXA 5LEJA 3AP4A 1JS9A 5JJNB 3WQ0A 1SQGA 4UFZA 3KVBA 4Z82A 4CC6A 3H7YA 4A42A 3H01A 4W50A 1MS8A 5FPVA 3KQ4B 1R091 2ZKLA 1W2NA 3W7UA 4QB6A 4YIOA 2WYSA 4RD7A 3RNSA 3SGIA 1I1EA 5A3WA 1SA0A 3HMYA 5H9RA 4J7KA 4PJ0Z 4JKLA 4EZHA 3B01A 2ENRA 2XL7A 4HOOA 3HN3A 4B4RA 3BN6A 2FTKA 2Q4PA 1QLEB 1FJGB 2I45A 2WINB 1OCOB 4LA2A 3MHSC 2ZAHA 4ZKIA 4YG0A 4AI8A 2IFWA 3E8GA 1Y6XA 1POV1 2PHWA 3JALA 4BQ5A 4F83A 1NCRB 1CESA 2UXXA 4C90A 5HFMA 4AQSA 4XXPA 2FCUA 3IIAA 1WMXA 4IE4A 3W20A 4K3UA 4F8AA 5HXVA 1ALYA 3CIHA 1OH4A 3CD6V 2WNVB 3KZIZ 3FUOA 1M5IA 3APBA 3ZFEA 4MTXA 5J36A 2QQOA 4U3JA 3OPZA 4BR6A 4LWSB 4CH6A 2VW2A 2VMCA 2WC2A 3PL0A 5J2UA 2ZXQA 1Y66A 2H0VA 1HKDA 4GX5A 1V55B 1HIXA 4GJYA 4DEVA 3OCPA 1AYN1 4XF3A 4XPVA 2JENA 4LBEC 2PHUA 2Q68A 2WT1A 1S0BA 3LPFA 1NY71 3WB0A 3JASA 4P9GA 4FBFA 2QQVA 2BGCA 2X7RB 4D69A 4J10A 3FL7A 3SISA 4URAA 5BR8O 4YFWA 3TEYA 4JTAB 3FE5A 3ZMSA 3G4SV 1ZZCA 4B3SO 4LTAA 1EV13 4I02A 4QB2A 4SBVA 4CDUB 2GP5A 1N1YA 4RS5A 3KF5A 4KWJA 4KWKA 5LHGA 2VGDA 5JVDA 4WFBV 2KB1A 5JAXA 3SYAA 3WNLA 4FFHA 4EFEA 2PAKA 3ILNA 3SJCC 4D0QA 4ZU7A 3BEHA 2OCHA 2D98A 3K46A 2VZPA 5HCBA 3LEKA 5F3IA 2XAGA 4KGQA 2N7GA 1GMGA 5A6YA 5LOVB 1WB7A 3E22A 1ULGA 3O12A 1BHGA 1PVC1 1ZVFA 2N05A 3D4KA 3WLUA 3K06A 3Q4HB 1APNA 3ST7A 4WVMA 1AUYA 1MQTC 2VRZA 2VU9A 5HXMA 4IYIA 3D82A 2AGAA 3AMMA 3HBZA 5A7SA 1HR0B 4H13B 1S0CA 4YPJA 3SKVA 1GN4A 5IVJA 3HKEB 2F93B 4UCSA 2GAUA 4P9PA 3OUIA 1V6OA 1DK1A 3RBZA 2XTAA 3TB0A 5B1AB 1UWWA 1DGRN 3GF6A 2ZQMA 4H33A 1MVQA 1WD3A 3SYOA 1FPN1 1C5HA 4X9QA 5L3GA 3UESA 2G38A 4Y22B 4IT5A 5L3CA 1REFA 3ZYJB 1HQNA 2UWBA 3LF7A 4KWLA 3I2JA 4YHHB 4PJYA 2AXTZ 3FZ3A 2BOBC 4U3FH 1ODNA 4BQ2A 2ZZJA 1ZRFA 3K0GA 4AL9A 2G19A 3K5OA 3WNNA 2QWRB 2QKCA 2ZJCA 1O3RA 3TRSB 3OTOO 2PUSA 1LOCA 5EK0A 2WFF1 1YJLA 4DZGA 1ZBE1 2JGDB 5L19A 4YIPA 2YY1A 1WMFA 2H8PC 2RMU3 1HWYA 3TN91 4XTPA 3CJXA 2BTVC 4JRAA 1T5EA 1H2MA 5IJ0B 3S30A 4AFBA 4UXNA 2HHHB 1JFFA 5K9YA 1VLNA 1JZ4A 4B3TB 1JOPA 1XOYA 3AC0A 4RR3C 1TAEA 1TME2 1OPMA 4I0AA 1HRI1 1S1AA 1RPOA 2VQEB 2EX3A 2VUAA 4GH4A 1F8VA 2RS31 5DG2A 5D5QA 3ZR5A 5CFCA 1NTKH 3OBAA 2CTQA 5JSOA 3I2GA 2JECA 4NJ4A 5A32B 4JI6B 4DR4B 4N53B 2RCVA 4DV0O 2R063 3LNMB 3LDKA 4K1YA 4NPLA 3W7XA 4AQYO 4TV8A 5C3PA 1H2LA 3VBSB 5B2GB 4DY5A 5J2TA 3M70A 5FJKA 5A1FA 2IJJA 3WR0A 4XHBA 4JI4O 1Y7BA 5IW0A 3WDWA 2YUEA 4GALA 4PLNA 3J7NA 1ZRDA 3J8F1 4QAWA 3MIFA 4MGKE 2E53A 3ZHTA 3P3PA 1TME3 1MZEA 2P5BA 2ZGNA 2DMXA 1ZRCA 4NTYA 1GM9A 3ZX6A 4MW3A 1NTZH 4E2SA 1Z0HA 2W39A 4J1XA 3RWNA 1BE3H 2JICA 1I0HA 3HNMA 1E5IA 3IWZA 1JZ6A 4UF0B 3POEA 1AR62 5IHRA 2ZT9B 1IQAA 1YEWA 1LENA 3RYFA 3K2OA 4PA7A 1XUQA 3LWCA 1NVPB 4AFAA 4LF4O 4PT6A 5KXBA 4OZXA 4D8MA 4XE9A 1DGWX 1H2KA 4JI0B 3JALB 3K59A 4EB6B 3Q8FA 3HKCB 4XFGA 2NMNA 1RL3A 5L9VA 3G6EV 2BUKA 2XH6A 4FTSA 4L92A 5HFLA 3QLQA 3TETA 2KG7A 3IN9A 4AHCA 4OI0A 2IXLA 4X89A 2O1QA 2ZBJA 4UVBA 1V9U2 1V0AA 3ZFEB 3AMHA 3I2FA 1TUBA 4HZ3A 5FYIA 5LBQA 4XQWA 4U3JB 4BQXA 5CMUA 1OC1A 3CJHB 1Q86W 3JAKA 4YLZA 2IZWA 2FDHA 5C4WA 3ZX7A 5A33B 5CN0A 4GWMA 3S5AA 5BPXA 3UJOA 3FUQA 3N27A 4FSJA 4KU8A 2V4AA 1WP7A 3B9CA 3JASB 2PLV2 1NE4A 4LBQA 3M7MX 1W28A 2J1TA 1WA4A 1WCKA 3NNFA 4J9ZB 1O59A 4U2AA 4Z1VA 1KGYA 1T2XA 2ITCC 4LT5A 3AEIA 3FKSG 1QBZA 3WF1A 1PO22 1V9U3 5J3UA 1COWG 1RHI1 1GNYA 5A70A 1RUOA 4RS5B 5DAVA 4FLYA 3OB8A 3PUHA 4HN1A 4X1KA 4DUWA 1Z7S2 2WR9A 3LFMA 1VBA1 5FPBA 3LDBA 2H94A 1W8TA 4AOCA 2QWPB 5FYMA 4PIYA 4JI1O 4LH6A 1Q6IA 3WB1A 4CS3A 4LBMA 3GXUA 2V5DA 3ACIA 5D2AA 5FZFA 3AG7A 3GCXA 5I0TA 5K1XA 4GB32 1RVF1 3GWOA 3RWKX 2IH1C 1P84F 2QFEA 4D6TH 5JCOC 5A6QA 1WPXA 1HP8A 1QKQA 3FN9A 3VBOB 2K2SA 3ZSKA 5GJ6A 1FXKA 1D2SA 3K4DA 1N3QA 1FXVA 1K5MA 5FY8A 1R6TA 2CGNA 2VZVA 2IXJA 2WWSA 1REEA 2OPKA 4JI5O 5JH7B 1VF5B 1ZYBA 1SKVA 2BBAA 4NXNB 4ES8A 1OCRC 1W2AX 1YSCA 3SMHA 3T1MA 1RUJ3 1ZL8A 4GB33 3ZXDA 2GNMA 4LBKA 1BL8A 3AYAA 1H0BA 4LO8A 1D4M2 1OVPA 3OEEG 2R30A 3AXEA 1OCCC 3OR7C 5IYBO 1WLWA 4BYYA 3AYCA 5DN6G 3DF0A 1YI9A 2QSAA 2KR2A 1A78A 3B00A 3VBHA 2VNRA 1BSMA 4AVCA 1SESA 3I3EA 1Q90D 2PYLA 3RG0A 3IMNA 4IV1A 5CFDA 3N7KA 2PF4E 3LKJA 4JI2B 4DV3O 4AR2A 3TEZA 1J83A 2WA3A 2JEUA 4A6OA 3AJYA 1JFFB 3TBDA 5JR7B 1AHSA 4FPFA 4I01A 4GA9A 4W6XA 2DYSB 4FPCA 2YXSA 1I5XA 1AR1B 4GH4B 4ZXKA 1JYVA 4X66O 1OF4A 3VBFC 1HNXO 5FZ3A 5CFCB 5JOYA 1JZ8A 1GOFA 2WQZC 5FP9A 3BI3A 3MW2A 3CJIA 2ZX0A 1VPHA 4I55A 2W95A 2YICA 3ZKYA 4A7YA 1I3HA 5FR3A 4TV8B 2VE1A 1ONAA 1E57A 1PD3A 2ZGLA 4TLGA 1WA8A 3P3NA 4DRXA 4DUVA 4D6RA 4BW5A 4JDOA 3SH5A 2PHDA 1RUF1 3ORJA 5L7OA 2QM4A 4IDZA 5L36A 4MHRA 4UCVA 1HW5A 4A44A 5B1NA 1M56C 1CGPA 3IB3A 2ILMA 1HNWO 1GKFA 1GWLA 3BTYA 5LP6B 3CXHF 2ZM6O 2EXKA 3T2OA 4BM8A 1PGL2 4LBLA 5CVRA 3ZXGA 2VZ3A 2OTJV 5C9AA 2DJVA 3K04A 4AI0A 1ULOA 1ZAUA 4DK1A 3OUSA 4RQPC 1XXNA 3R05A 3M7AA 2K0GA 3IDBB 4GKJO 2RS13 1W0JG 5DUUA 2NLRA 2TBVA 2D43A 3ZMVA 3IKWA 2AHYA 2FQPA 2XKPA 5KHKA 2F4LA 4FFGA 4FO9A 4B3MB 5HPOA 2D6OX 2TUNA 4ORFA 1NLRA 3U75A 2GTAA 4XUOA 1AI5A 2Z79A 1H9WA 1KUQA 2EJRA 1AYM2 4AAXA 3MGUA 4MGIE 5D1IA 4PDLA 2ZX1A 4UUJC 1LJ7A 2HWF1 2ARHA 2KG7B 1KD7A 2EULA 5ITZA 5FZEA 5F7UA 1VP7A 1TUBB 2VR4A 3N9NA 1VBB1 3MEPA 1URFA 1ASJ1 3VZNA 2GBOA 4IV3C 3ZKUA 4LFBO 3WP4A 4H7MA 2HG5C 4KG0A 1Q8VA 3JAKB 1FAFA 5H6RA 4J6GA 3P30A 4AILC 5C4WB 3VDDA 3VLBB 3ACFA 5C8CC 1NXMA 2CSGA 1QU0A 4M0HA 1QQP3 4LBQB 2UY9A 1SC5B 4G28B 3TOJA 1RUC3 2XBO2 5LRRA 3PMSA 1R083 3S5QA 1FXZA 1KYOF 1B35A 4NHLA 5EYXA 4W4ZA 2VZTA 4WF9V 4FFFA 2E76B 5LA9A 1E1QG 3CLPA 5BUVA 5AVAA 3EB7A 2FHRA 3ABMB 4DUZO 4H2AA 1FMD3 1WJZA 4LHNA 2OIIA 3VKFC 2ZCEA 1HW7A 3NNGA 4V2VA 1KU9A 4DW0A 3NL1A 3E1F1 4IETA 3RZLA 4XW3A 1OF3A 1Y76A 5DN2A 2EIKC 4HVRA 1DF4A 4BIOA 2Q69A 2HWD1 2YB7A 2YU2A 4AEDB 3AP9A 2C6SA 3H8XA 3FB8C 3IJ4A 5HCFA 1F31A 2PHRA 2FDFA 4CCCA 5HCHA 2Y38A 1V70A 3SJBC 1F4AA 4DUYO 4QXKA 1XREA 4IEPA 2JDMA 3AKRA 1FXKB 4JGZC 4R9BA 2F4VB 3B09A 3J26N 3ZHRA 4P9OA 2LROA 2BRTA 1LODA 5FAXA 2CYFA 4YY3O 2Q8DA 5FP3A 3N2KB 4NR1A 2JDAA 1SFPA 4M3CA 3WFVA 2BVVA 4MX3A 4P9JA 4OI2A 3CCMV 2HKOA 1CAUA 2WZPP 1OOPA 4IE5A 1UZZA 5BXZA 3JBG3 1JZ2A 1ZL8B 1EN4A 1RM1C 4UAPA 3A2FA 2VVEA 4DV7B 3PDQA 3WG2A 1US6A 4QPGA 3LSUA 2HLDG 2OCCB 4Q8LA 2JDKA 5JCTA 4EV0A 2YBPA 5FREA 4YGDA 1F35A 3NNMA 5DDJ3 1OV9A 4DNYA 2LALA 3IAPA 4Y1UA 2ZGSA 4HPKB 3CMAV 3OYWB 5C33A 4QQHA 4E8CA 1F4MA 1CVNA 1RUE2 1X9PA 2C9AA 4COYA 4PDMA 1K97A 1U12A 5CFDB 5H9SA 1KQSU 2VZQA 3L9DA 3MLLA 3FYEB 3UKMA 3MIGA 5D8AA 2MEV2 1FNZA 2K46A 3RZJA 4MUVA 5ACA2 2BPA2 2RE9A 3JCZA 1WCDJ 1AXKA 4JI7O 1YQ8A 1PK6A 1W6NB 1GZWA 4GD4A 3UV9A 1NAEA 1GN6A 1W2BU 3ZXKA 1G9FA 4L8JA 3E5XA 1XU1A 2FMYA 3MIHA 2WPDG 3KVAA 3DPRA 2JDZA 4J7JA 3WG7C 5CB4A 1SQBH 1XNRO 4P5HA 3CJIB 4GLXA 3KCCA 3ABKB 1ZSPA 4I55B 3T4VA 3MUZ1 4BIFA 1H2GA 2WO7A 4Q4V2 2HWC1 1WCQA 1VMJA 4WM7A 5LCWL 4ARYA 3DTUB 4NN0A 3KGLA 3AKSA 2VCAA 1W59A 4DRXB 2XB6C 5FY0A 1UYPA 2P4VA 3SPJA 5LA0A 1PO13 5AC92 1VBE2 4TUYA 2QQPA 3T30A 3FLRA 2N74A 1LNSA 4E4EA 1ND2A 3QVNA 1CJDA 1ULFA 5L73A 2P6JA 2EIMC 1VQMV 5GLTA 3QOPA 1OA4A 4AVVA 1VQNV 1EPZA 2ZOEB 3TGUH 4R9CA 4PQ9A 3B94A 5FZOA 4PCRA 5IDJA 2NLJC 2ZEXA 4Q4V3 2XJTA 1FPOA 2D6LX 2JDYA 1HN1A 3AFKA 3HAGA 2J1EA 1NR7A 3WG1A 3VHOA 4JZGA 4QPWA 3ILFA 4E2LA 2QWOB 5I8YA 5CEHA 3CCSV 4JHZA 4CU8A 1DGSA 1XMQB 3E5UA 5JSPA 1FI2A 3DXRA 4MGZE 5AC93 3EHBB 2Q5TA 2D5HA 2D3OW 2YIAA 1S0VA 1POQA 1NBMG 1V9PA 1R6NA 3LDCA 4KI5M 1S77D 2FYUH 3G6JB 2Q6AA 4LFCB 1NCQB 2R49A 2ZDIA 4JX0A 4A7ZA 5C8YB 2LQTA 3IPVA 2XUEA 3ZFFA 1IQDC 3I2OA 2X5IA 1RUI1 1F23A 3TJTA 3EFFK 1SS3A 1YC61 2RS51 3N7LA 1BQ0A 2Q4SA 3AZVA 2YPJA 1ZBA1 3B93A 4QT6A 4XMIA 1ORQC 3WDUA 2P22C 1XSQA 2ODMA 5LMNB 3ITQA 1AX0A 1DIWA 5CAZA 3K5NA 2JK5C 2OT7A 4XJWA 2BW8A 1U96A 1TE1B 3VL8A 3DEMA 4HKWA 3UKVA 2VMDA 1VF6A 2QNKA 1UAIA 3MYXA 1PHMA 3H1LH 4P9LA 5EBMC 1YDXA 2CGOA 2BWAA 2HP8A 1B35B 4JYYA 3LE0A 2PYTA 4C1WA 1C8M2 1H8TA 1SLCA 1BLZA 5KXDA 2F4PA 3C2UA 5FMDA 3M3OA 2DQ3A 2CDOA 1MS9A 4Q5OA 1N4CA 2F95B 1M57B 1WAZA 3AXDA 4QKBA 1K7DA 1VRH3 4HETA 1Y76B 2QCSB 2Q7HA 1LESA 1HR0O 4XAAA 1DQ1A 4A6SA 2XJUA 1COV2 2E31A 1SACA 4IIJB 3SPIA 1QDCA 2BV4A 1J5EB 4H14A 1JOJA 4NIAA 4GKKB 4QPIC 2ZMKA 4PDWA 2DCTA 4NUBA 2XWJB 4ISRA 3ETPA 5KHHA 1C8M3 2ORXA 1ZZ7A 1MS0A 2QKAA 3DKWA 3HQXA 4R6ZA 4QKFA 4GMP1 2JJ2G 4PF1A 1FYJA 4JYBA 1HXS2 2IWGB 2YG0A 1VMFA 3M99B 1H9PA 2BTOA 5I0UA 1V54B 1QJY1 1O5LA 4D7SA 1NJIW 1GNHA 4XUTA 3OGCC 2QKDA 2FZ2A 4UVCA 1OOPB 2C26A 2RR12 5J37A 2J7MA 1PM9A 3SXWA 2D6PA 3AG4B 1D0HA 2DU1A 2XAHA 1S3JA 1QH6A 1N33B 3JD71 2HHHO 2BGPA 2YC0A 4MVSA 1JUIA 4B3TO 3C3TA 2R70A 2VQEO 3AYDA 1YJKA 4YM2A 3S6PA 5FPAA 4M4PA 1YJ9V 1WW4A 4QGPA 4ZI7A 3AM2A 1BBT2 1HXS3 5A7WA 4CDXC 1UIKA 5JZGB 3QACA 2RDCA 5KA6A 2JDUA 1D5AA 2Z2SB 4QB1A 1XEQA 4QM9A 4BQ1A 4DR4O 2VXRA 2K9ZA 1SHWB 1X50A 4CUCA 3ABUA 2P2KA 2BNMA 1WW6A 2JG9C 1BYHA 4GWIA 3T2TA 1DYKA 1DYOA 3D0SA 3ZJZA 5EIBC 4YSFA 1W0KG 1MEC2 1JH5A 3WINE 1PM7A 2ZGPA 3UKNA 1POV0 5C70A 2QM8A 3NWKA 3W5NA 5BNOA 2AH2A 5IYCO 3H9VA 1W6PA 3OD4A 2O0OA 4NHXA 1GO3F 3M3IA 3RWRD 1BBT3 2WS92 1EM1A 3CO2A 5I91A 2PMWB 5FIXA 4BOWA 1LOEA 3TXSA 2JD9A 1IOAA 5AG2A 1QGLA 4XYXA 4CXYA 2VBPA 1Y9QA 3G7DA 4A5UB 5FP8A 1BS3A 1UYZA 5FYVA 3A21A 4QHZA 5JQGA 1RMU1 1UX6A 5CNAA 1JQ0A 1MEC3 1CAVA 1IVSA 3I59A 2H6CA 3KV9A 2XG3A 2ZGQA 1WCSA 4FPOB 4CDWA 2OPWA 4JI0O 1W6QB 3AG2C 1ND2B 2XASA 1S4CA 2X29A 2Q8VA 1CP9A 3X2QB 1RUG2 1VQOV 2QQNA 5IJ9A 5C7GA 4TWTA 1TUEB 4MH0E 1SFNA 5HV0A 4AHWA 2IU0A 3RZZA 3WF4A 2R32A 4Q4W1 4ZPIA 2W5FA 2RJKA 2JIZG 1WLEA 4H0LB 4QX7A 5FRAA 3AL5A 2FB5A 1NOVA 1FFTB 3KQRA 3ZR6A 5T5PA 1U5YA 3LIGA 2EINB 2Q73A 1GN2A 4FQ4A 1V6JA 5E79Z 2YEVA 4R4XA 2BERA 3JCIA 5FDBA 3CBNA 3ZXJA 3H3ZA 3DXRB 5DUXA 5LASA 2XJSA 5FPOA 3I3DA 4LKEA 3ZIXA 2VOVA 2FZ1A 4C91A 1US2A 1RUG3 2ES3A 2BZDA 2NYYA 3ZN4A 1Y9MA 3POWA 1DP0A 2OQ7A 5A2QN 5A6XA 4WM8A 3GJBA 3IPVB 3ZFFB 4Y5TA 1QXJA 2A3XA 3AZXA 4OX9B 4IEYA 2X5IB 3K57A 4OQ8A 1JXNA 2CE4A 5KUKA 4DV6B 4H44B 1Z5WA 1QHDA 5LRSA 1P49A 3HT2A 3WQ7A 3ALQA 2IFRA 5FPUA 2YYOA 1NZ6A 2LW8A 1KKDA 2XQRA 2OUJA 1PZ8A 4GWJA 3LB9A 1EAH3 3VBUA 4XQDA 1S72V 1GANA 2OW4A 3UNPA 3I2KA 1XU2A 4TT3G 1XRUA 4D7YA 2RM22 1SRYA 3ETDA 4W6YA 1PZ9A 4EWAA 1GFF2 1EY2A 3AB0A 2PN5A 3JXSA 1WN7A 1YQ5A 3TXQA 4DV5B 2WLIA 5T5JA 1H8TB 4JV5B 5CBFA 2HBUA 2YI8A 3DECA 2JG9B 4JI8O 2ADPA 4FLXA 4LOTA 4IERA 2H0BA 2QKSA 1J1TA 4Z07A 3CRMA 5EJ1B 3B4SA 1SQPH 4FJCC 1FOD3 4R52A 1BMV1 2CWSA 1YZBA 5I8TA 1FX5A 2V5YA 4OPAA 4FLUA 2X10A 1SFYA 1AF9A 2ZXWC 4GZRB 3D8CA 3N4MA 1VBD2 2RM23 2ATFA 1VJ2A 2I74A