5KHIA

Hcn2 cnbd in complex with purine riboside-3', 5'-cyclic monophosphate (cpump)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 63
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khiA02
1RUOA 3WW2A 1NE4A 3RNSA 4KWJA 3IDCB 2FQPA 4WZCA 5KBFA 5I0SA 1ZRDA 5K8SA 3SCGA 1YWKA 1J58A 3UKVA 1YFWA 3WW3A 1YFUA 3E97A 1PM7A 1G6NA 1YHFA 4IEVA 4L11A 4JV4A 2BNMA 3M3IA 5I0RA 2MNGA 3GBFA 3O14A 4QGMA 2ATFA 2GC1A 4R8HA 4E2SA 2OPKA 2OYZA 3IWZA 4KWKA 4Q29A 4O9EA 1EP0A 1ZRCA 4NVPA 1O4TA 3MDPA 2GC3A 3RYPA 2QNKA 3BU7A 1ZZ9A 5JAXA 4EWEA 1H1MA 2H6CA 3PNAA 2CV6A 4UXAA 5BXXA 2O8QA 2UY9A 3EO6A 5D1IA 2I45A 4IEZA 1VP6A 5BV6A 2XGXA 1J3PA 4HN1A 3IDBB 4FAGA 3ZDSA 4E2QA 3BB6A 2Z2SB 1UW8A 4BYYA 2C0ZA 2UYAA 3DKWA 2V09A 2ZCWA 4YSFA 4I2OA 4IEYA 4WVZA 1O3TA 1UPIA 4B29A 4JVAA 5FCCA 4F8AA 3H7JA 5JCTA 1J59A 3KGZA 4N9HA 3EQEA 2PYTA 3DV8A 2BNNA 2XKOA 3IBMA 3GYDA 4AQ2A 4META 1ZZ7A 3HT1A 2DCTA 3EHKA 4XFHA 5HI0A 4HMZA 2QCSB 4HSLA 4XFAA 4MGKE 4Q0VA 1ZX5A 4WBBA 4ZU4A 2H0VA 5KHKA 2Y0OA 2XLGA 3R6SA 1XRUA 1O3QA 4PIXA 2IXIA 5I93A 2PAKA 1X8MA 1ZREA 5I8YA 2GH2A 2IC1A 4I01A 2CGPA 1NZCA 2EA7A 1QXJA 1EY2A 4BH9A 1LRHA 1CAXB 2MHFA 1CGPA 3D0JA 3D82A 2PFWA 1ZZBA 1X82A 2D40A 2IXCA 5J3UA 1RL3A 2XLFA 2P17A 1QXRA 2ETEA 3G7DA 4BHPA 4J1XA 4KL1A 5FPXA 1I5ZA 4XFFA 4QX5A 3DN7A 4KWLA 1IPJA 5T3NA 4QM8A 5C6CA 2IXKA 3FX3A 1FI2A 3U0ZA 3E5UA 2XL7A 1Q43A 3I59B 1RC6A 2UYBA 3LZZA 1ZZ6A 4AVBA 2N7GA 2OA2A 4RD7A 1ZVFA 5JR7B 4IEXA 1DGRA 1CAXA 3E6BA 3QACA 3EBRA 3CLPA 2GC0A 4IEOA 3RPQA 2QDRA 4Z07A 2VPVA 3C3VA 1CAWB 1O3RA 1VR3A 2Q4SA 3LWCA 4O9GA 3ETQA 4KU8A 2GAUA 5CU1A 1QWRA 4QM9A 4LUMA 2B8MA 3I59A 4YARA 1JUHA 2Q0AA 1EPZA 3NW4A 1CAVB 1VJ2A 1Y3TA 2PA7A 2BYVE 3ES4A 1QY4A 2OZ6A 5JSRA 1L3JA 2K0GA 1Y9QA 4EROA 1J3QA 4XF9A 3N4MA 3SHRA 1ZZCA 1H1IA 1J3RA 5FQ0B 3NKTA 1RTVA 3ST7A 1SEFA 4Q0QA 4XFIA 2Z69A 3SCFA 3LA2A 4LLOA 3U10A 5C8WA 4EV0A 4HVOA 3I7DA 4LTAA 4IEUA 2HKXA 3TNPB 4K8FA 4HLTA 1O7FA 4YNIA 1CAWA 1CX4A 1SQ4A 3LA7A 3OGJA 2B9UA 1FXZA 3NJZA 4XF3A 3JZVA 1PMIA 2CAVA 2B5HA 4N9IA 5KHGA 3OD0A 1WLTA 3ES1A 1CAVA 4HSJA 3MYXA 1UCXA 5FDBA 5FLIA 3SXWA 4XEZA 2FMYA 3CF6E 3S7EA 3FE5A 4QGNA 4XF1A 5I8TA 5FQ0A 2D93A 3USSA 3CO2A 1LKNA 1NE6A 2VQAA 1GQGA 4MGZE 1LR5A 4D7TA 4LUKA 3RDIA 1DGWA 2PAEA 4OFGA 2F4PA 3NVCA 4Q0SA 4YYOA 4P9GA 2EAAA 4XFCA 3CL1A 3CEWA 4AVCA 4HBNA 5LEJA 5I8SA 2BEOA 4GULA 3PVBB 5KHHA 2PHLA 4AXOA 3H7YA 5I0UA 1ZRRA 3E5QA 3BALA 1ZNPA 5KHJA 2GU9A 4X6RB 4CYDA 4XFGA 3S7IA 2GC2A 3CJXA 2ET1A 3S0MA 1UIKA 4R52A 2VECA 4IEWA 4I3PA 3I54A 3VHRA 2E9QA 3IIAA 3NSTA 4PJYA 3RYRA 2BNOA 3NL1A 4IEQA 3LAGA 3H50A 3UKTA 4PIYA 5FPZA 1U12A 4D7SA 2XKPA 3LOIA 3WW4A 2K9ZA 3TNQA 2PQQA 4L2NA 3MZHA 2PAMA 1ZRFA 2GZWA 5CADA 1V70A 1YLLA 2ET7A 5EFUA 4DINB 4FAHA 3LA3A 3B02A 5I91A 4FBFA 1Q5OA 5I0TA 3FJSA 3H1MA 5J7MA 5BUVA 4JTOA 3H9AA 3H1YA 4IEPA 1WA4A 3H3UA 3OF1A 4XETA 2XLAA 4Z82A 1TQ5A 4YRDA 4LEJA 5FLJA 4AVAA 4X6QB 5BY5A 3L2HA 3MPBA 1O3SA 5LRSA 3EJKA 3KCCA 2EVXA 1WGPA 2Q1ZB 4LULA 2KXLA 3ELNA 1DZTA 4LA2A 3SCHA 3PLQA 4IESA 3QOPA 1FT9A 5FLHA 2CAUA 2D5HA 5JSOA 3FFQA 3H1WA 4MGIE 3D0SA 2QVSB 2Q30A 3H8UA 1CAUB 1DZRA 1OI6A 5LEKA 5E1RA 4MUVA 3FHIB 4EWDA 4FT8A 1RUNA 2QJVA 3DL3A 4OLLA 3KMHA 1O5LA 4Q0PA 4MZUA 3HT2A 5KHIA 4HZFA 4MV2A 3RZZA 1RGSA 5F1RA 3ACLA 2D5FA 3U11A 5J48A 4E2GA 1I6XA 3KSCA 3FWEA 4H7LA 4PIZA 2ZKLA 4HVRA 4XF4A 2IXJA 4ONUA 2WFPA 5CVRA 4XFBA 1EYBA 4BIFA 2BGCA 4EWAA 3UKNA 2IXHA 4J1WA 4UBGA 3HQXA 4IERA 4ZU7A 1CAUA 3RYKA 1UD1A 2UY8A 3FZ3A 1YUDA 4QGLA 1XE7A 4JTNA 2O1QA 1NXMA 2XHKA 4QXKA 1SFNA 5BPXA 1LB2A 2XL9A 4ZU5A 4ORFA 3ROUA 4KU7A 4F7ZA 2OZJA 3HIFA 1YFYA 4I09A 2PTMA 2MPFA 2PHDA 4HN0A 4Q0UA 5AVPA 3H3ZA 1X7NA 2HJIA 3E6DA 4HVQA 1HW5A 4TLFA 3BCWA 1X8EA 4XF0A 5EZWA 1ZZ8A 5LRRA 1Q3EA 1IPKA 3BPZA 1OFNA 1GQHA 2WC2A 1OD5A 4I0AA 4I0BA 4IETA 4MH0E 3SMHA 3E6CC 2H6BA 4UBHA 1XE8A 3OTFA 3OCPA 1NYWA 3KGLA 4LA3A 4QMAA 5E16A 4I02A 3E5XA 4MX3A 3WW1A 4A2UA 1UIJA 1J1LA 2IXLA 1O5UA 3M70A 1OMIA 5JSPA 4AQ6A 4MGYE 1YFXA
chains in the Genus database with same CATH superfamily
3U07A 3UO2A 4Q8LA 3RNSA 4FM0A 4MHUA 1SFYA 3FFZA 4MTXA 1RIRA 1E5IA 4OYUA 2VZPA 4C7UA 3C8XA 2YU2A 1PGW2 3ZHSA 2VOVA 4M3CB 1EN5A 4E2SA 2Y6HA 2JDIG 1F4HA 2CDPA 3RYPA 5A7OA 3T2TA 3J8F1 4AFAA 2QTWB 4ITCA 2VOXA 1H6XA 3LFMA 1AXKA 4B7EA 4XMIA 4MGTA 5LMNO 1NT2B 4YM3A 3L73H 4R50A 4AGRA 4FOVA 2WO1A 2GHYA 2VQ0A 2J42A 4FAGA 3B9IA 4E2QA 4X20A 1Y74B 3ABMB 2GBOA 4BXSV 4I2OA 1O3TA 5LP6C 3M7MX 4B29A 5FAXA 2ZGPA 1R081 3WHUA 4F8AA 1HNXO 2R073 3VL9A 3WNKA 3EQEA 3ZRSA 1W6PB 4NAMA 3K58A 2BCCH 4HSLA 4PQ9A 2JDMA 3U14A 2LW1A 4AYUA 1TME2 1UMIA 1QDOA 5I93A 4I4TA 2YMZA 3O1TA 3HKEB 5C5UA 2GH2A 2CGPA 1HXS2 3ZN4A 1MABG 2Q67A 4CU7A 1LGNA 1NQJA 1X82A 3TXQA 1RYYA 1S0DA 1XE0A 1Q86W 1BZKA 4XFFA 4FTBA 2HWB1 5BR8B 2WL1A 1K12A 4OMDA 1GUIA 4DEQA 3SJBC 4PJ0Z 3RVYA 4D6RA 1L7LA 3I3MA 4K0KO 1N33O 1RC6A 4LHLA 2WS91 4PDVA 4LF5B 2EIEA 4FTEA 5F6LB 1JJ2U 2QQUA 1DF4A 4IEOA 5JVVA 1WBFA 2VVEA 1VF6A 3DEMA 5IYBO 5KXBA 4X8PA 1K5MA 1RP3B 3GVMA 1DYPA 4B3MO 3K51A 3VBHA 5BMVA 1PMJX 3N9NA 3ES4A 4AI9A 3JQWA 5CBLA 3RZGA 1NQDA 1L3JA 3MF9A 4CP0A 5CFCC 1RTVA 1G7YA 1EUTA 2VCBA 4ZHQB 2ZHNA 1XL6A 1CAWA 1CX4A 3JAWA 3Q4HA 2UUBO 4NAOA 2E3CA 3JASA 5BY1A 1ULGA 5KUMA 3ZN6A 1W2AX 3VDDB 3O5SA 1OT5A 1STMA 3ES1A 1CAVA 4J25A 3ZRVA 5BNNC 3P5BA 2XJPA 1C5HA 5J2UA 1AYN3 5I8TA 4QQLA 3JU9A 5CA0B 1IS5A 5DABA 2VMHA 2F4PA 4XUOA 4JPRA 3WNXA 3GHMA 2WA4A 3RS6A 1K4DC 2BOIA 5H6QA 1GU3A 5H5NA 1QJY1 2LALA 2PUSA 3WG7B 1XC6A 4AQSA 1LGCA 4LKDA 1ZM1A 3LF7A 1ALYA 4JI1B 3SYPA 2CK3G 2N74A 4O2BB 1DIWA 2JKBA 1JXNA 5B1BB 2ZNIA 3W59A 3A0RA 4RQEA 2UUCO 4OI2A 4J7KA 4IEPA 3UQ8A 3WXPA 2RM23 5EYXA 2FKXA 2Y69B 4Y1VA 4IV1A 2JWPA 3C3SA 3G71V 4CS3A 1FX5A 4Y3OA 5J36A 3SPCA 3ETDA 1V54B 4QX2A 5DXDA 1SZTA 4EN9B 4OQ8A 2FMDA 5CFDC 4MGIE 4UV9A 2BBAA 5FPRA 1CAUB 2VH9A 4O4IB 4FCAA 3EVKA 3UYJA 1IURA 1I7FA 3KMHA 1IG3A 4GH4B 1MEC2 2DVFA 2PHWA 5IYZB 4K8XA 4PI0A 3FWEA 3NNJA 4N53B 4Q2FA 4AILC 2Q8OA 4BLIA 3NAPA 5GONB 5K7PA 4LF9B 1W8TA 5ISLA 3KT7A 1FD9A 2W1UA 4JTNA 1UYYA 4YY3B 2CY6A 3RI9A 1VBB3 3LKJA 5BPXA 3P6BA 4WVMA 3BGAA 2K2SA 4QPGA 1U97A 2PTMA 3VDBA 1KFXL 2XXZA 1SZXA 3VBFB 4ZKIA 2NLJC 3IIIA 4IV3B 3B8MA 1UZYA 1ZZ8A 3UJQA 4L8QA 3MD0A 3SMHA 1Y43B 2WZR1 1FNYA 2VD7A 3WNNA 4K40A 1GICA 2EF6A 1RUE3 1N8RW 1C5IA 1OVPA 1ZRDA 5J2TB 1MA1A 3BA8A 3FB5C 1PM4A 4XPVA 1BEV3 3IC7A 4J80A 2RMU2 5AC91 2VW2A 5EC2C 4XMAA 4AE2A 3O65A 3I2GA 3ZYGA 2MNGA 3LGRA 5IJ0A 1TUEB 1T6GC 5IWAO 1POV0 1REEA 2A3YA 3OT7A 4UFLA 4DYLA 2QQWA 3PU3A 3VBSB 1ENVA 3SEPA 5CAZA 1O4TA 3KV6A 3MW2A 1YYNA 3RYFA 2XBO3 5A1AA 2R32A 4P02B 4HKOA 4LF6O 2LROA 4RS5C 3CC4V 3ETPA 3MIBA 3CIHA 2YICA 5EZYB 3ZDSA 4JDOA 3W20A 1GZ9A 4A6OA 3H7JA 5DN6G 5JCTA 4I50A 2HWC3 4WFBV 5EJZB 4QT6A 2ZE6A 4P9YA 2JENA 3HT1A 2QCSB 2JIZG 2YZ4A 2VW0A 2YIBA 5LHGA 1NS1A 1H0BA 4RQPB 3HPNA 1HV1A 5H2FZ 4DR7O 1R091 2IC1A 5C8YA 4BK5A 5KUKA 5A7NA 1HB2A 4BH9A 4LFBO 3F95A 4UI9L 3WU2Z 3RYIA 2P17A 1OXCA 1OVSA 4JX0A 1J83A 1SF9A 1D2DA 3L72H 4CCJA 1ONAA 4XXAA 4YM2A 3DYPA 1JA8A 4GIQA 1EN6A 4DR6B 4YZ5A 2A73B 3IAPA 1XBFA 4AQYB 4YWAA 3WUDA 4IE0A 2Y33A 1VRH3 5GKAC 1JOPA 4IEXA 5LXTB 1BXHA 2Q5ZA 3WT3A 2PI5A 2GC0A 2WSUA 4BWAA 4HKLA 3MBWA 2OQ7A 3RPQA 1XMOB 4I0XA 4XABA 2JX9A 1YJWV 2X29A 4DV3B 1JYVA 2ZEWA 3HB3B 1W6NB 2FDKA 1AJPA 2ADEA 5AFBA 1B35B 3VL8A 3T1YB 3VBRC 2PHFA 2AZ5A 4MVOA 4UCUA 2Y6GA 3FLTA 1UN1A 1BVP1 1ZZCA 3ZRXA 3NKTA 2WN2A 1SEFA 2FL4A 3E8FA 3WB2A 1X36A 1F15A 2ZR2A 2XJSA 4YXWG 1VQOV 4JAVA 3P32A 4P9WA 3TB0A 1W99A 3IKWA 2YDEA 4CXXA 4K21A 4W4LA 2OWOA 4HNAA 2VTXA 1IOAA 2AZ0A 1PK6B 2DYCA 3B9CA 3TN93 1H8HG 5IAXA 4Z92B 4XJAA 1ULEA 2CU5A 4O2AB 4EN8B 2QM8A 4XXPA 2A1XA 2PYJA 1US6A 1TVKA 1XEQA 4Q6GA 1WCUA 5EIBC 2FDIA 1LEDA 1OKQA 1PO22 4XTPA 4J7ZA 5IDJA 5JIAA 2Q9LA 5HCBA 4ZI7A 1OCCB 2ZE7A 3CRMA 3BIEA 4D6SA 1W0PA 1ZNPA 1DDLA 1YEWA 1W6QB 4CYDA 2QDOA 2P4EA 2VECA 5JCOC 1IVSA 2QM4A 3NSTA 3QH6A 1CX1A 3JBG2 4PF5A 4AVSA 5LGNA 2WT0A 1WW5A 2G38A 2A6YA 3ZIAG 1XI1A 1COV3 3WDVA 2XVLA 4Q4X3 1V70A 1H9WA 3D5OA 2FZ2A 1G9DA 1QLNA 1FMD2 2JD9A 1C57A 3ASNB 3H9AA 2R071 2XLAA 4Z82A 1PO12 1OA4A 1S0CA 1KP2A 3K3NA 3CCRV 3RWKX 1JYIA 4Y22A 2EVXA 1IDSA 3S5AA 2R043 4R4ZA 4JI8O 4AEDC 2A79B 4IYHA 2CAUA 2QR4A 1G8WA 2ZZQA 1JX9A 3AFGA 4N8MA 2ENRA 3VBUC 1RUNA 2QJVA 2RJLA 2JEUA 4CXWA 2VCMA 3WG1A 4OZXA 3U37A 2P7TC 4IGPA 4JI4O 5A3NA 4IL7A 4HVRA 3O12A 3NMBA 4GMP0 4YZ4A 5CVRA 4FTSA 4BQWA 2BGCA 5A6QA 2VMFA 4CP2A 2Z42A 4AFBA 5FOJB 3GZAA 3KM5A 1GNYA 3WY6A 4DXWA 2BDRA 3RZLA 3W7WA 3ROUA 2H8PC 1AR72 3ZHRA 3AMNA 1S0JA 4OPAA 1I0HA 1CR7A 2R9AA 4N43B 5FYCA 4RFT0 5K0UB 3K04A 5HCHA 1UKRA 4FLWA 3BPZA 1OFNA 4QHZA 2DVGA 4EFBA 2PHXA 5JOXA 3H1HH 4YVSA 3T0AA 3CCMV 2YIBD 5FZIA 1ND3C 1VQ5V 1NLSA 3R05A 2NPIA 3CPWU 1TMF2 1GK9A 3ASOC 1NA1A 5A2QN 3WW2A 3OEAA 4H44B 4KUMA 2Q8VA 1YWKA 2VMIA 1J58A 4CCLA 1DFQA 2ZA9A 4E4EA 1AYN1 5C8CA 2CGOA 3C7OA 3D6EA 2DVDA 5E88A 1LECA 1FPN2 5IJ9B 1QJFA 5LBFA 2TEPA 1QJX3 3TYJA 2BOBC 3TEXA 1YCIA 4KWKA 5GALA 5A70A 4Q1PA 4UT5A 4J6GA 2E7AA 1GMMA 3VKNA 3BA9A 2CV6A 1SLAA 2QQNA 2B1GA 1OKOA 4I9QA 4NRMA 1OLQA 2JDUA 4HN1A 1QOTA 3IDBB 2W47A 4DW0A 4XQDA 4JF3A 4MVQA 4LO8A 3W5NA 4M0HA 5C93A 2UXBB 1XU2A 4JVAA 4UCSA 4NTXA 3MEPA 5JXGA 4DUZO 2QWPB 1GWLA 3KZIZ 3NWKA 4NIHA 2RM21 4MVSA 2R6QA 3PVEA 3SYOA 1QQP2 2OIEA 2DCYA 5FZKA 1G6UA 4JYYA 1SQFA 4KXRA 2EA7A 4WVVA 3RZMA 1H8VA 3H1IH 1SA0A 4EKWA 3B5LB 5GJ6A 3B00A 5GM0A 1D5AA 1Y9MA 5FWJA 5LY1A 2NM1A 1PP9H 4KFMA 4GX1A 1RITA 4CSWA 3SH3A 4U7OA 3ZFFB 3BU0A 1O8SA 4UB6Z 2Y38A 1W9SA 1HW7A 1S2EA 3ENRA 4GKJO 4DR1B 2Z5UA 2JG8C 3AG4B 5FY8A 4F6RB 2ADQB 1VBB1 3DXRB 4ES8A 3A4UA 3LPGA 1WMDA 5DUXA 3ATGA 5HFLA 2OCCB 1TME3 1U5XA 4MTFA 4Y24A 1J3RA 2EIGA 4PLOA 1G86A 1HXS3 4AHXA 1RUJ2 4ZXKA 3GALA 3O7OA 2GUZA 4SLIA 4UB8Z 1SQ4A 2WZEA 2QQLA 2CAVA 1RUE1 4DUVA 4TT3G 2V5DA 3OD0A 1CZVA 3ZX7A 1UYPA 3JB8A 5KXDA 4X66O 3ZMOA 2R0HA 4XF1A 5IFPA 2D93A 2K46A 4ISQA 5LK5A 4D6QA 2JG9B 5C5TA 4NIDA 4LK7A 1BEV1 2W46A 3GHNA 4P9GA 3CEWA 1UU4A 3QO7A 2HJFC 3OGGA 3GJAA 2Y6KA 2BV4A 4EQVA 5FPUA 4PDWA 3E5QA 4LITA 2RDSA 1JYTA 4B1MA 5I0DA 5LHHA 1OCRB 2XBO1 2E9QA 4DUWA 3IIAA 1HRI2 4R8CA 3RYRA 1VQMV 2XAQA 2OIIA 2BRTA 3U1XA 2Y4UA 4NHKA 2D6MA 2IM9A 5F3IA 3GJBA 4GJYA 3CZUA 3ZRWA 4TWKA 4X1KB 2Q68A 3ETGA 1NZIA 4Q1RA 2HWC1 4CP1A 2DCJA 1ND2A 1E57A 4ES9A 2XQXA 2DDUA 2ZAAA 3KCCA 3EMRA 5EV7A 2KD7A 4DR2B 5A3OA 2XAHA 4DR4O 1BQPA 2H0BA 3HNMA 3DXTA 5EXOA 4BZ4A 1UAIA 3TEWA 3C2UA 1DZRA 4P9LA 2FDGA 1S4CA 1W8WA 3FHIB 1VQPV 2HYXA 3NV4A 4K20A 3WDUA 2VZ3A 2D5FA 1W28A 3HMYA 3J7NA 3JAKB 4BLJA 5IATA 4NKGB 1N0NA 4X62B 1W04A 3K5LA 1JPXA 1WBLA 1VRH1 2GP5A 4DK0A 2W5FA 4COYA 2ZOEB 3AKTA 3JALB 1W6MA 4NTYA 1NXMA 1VMJA 2ZXQA 1XQ8A 2Z0AA 4CU8A 3APBA 5JXIA 3HKCA 3WCSA 4F7ZA 3HIFA 2XVGA 3ABUA 2V1DA 1COWG 3VDDC 4ARYA 4DV2B 3K4AA 4MOAA 4CA9A 2Z79A 3RYHB 3S5QA 3RWRD 2YY1A 2OCHA 4CVUA 3N27A 1W8ZA 5L3CA 5CA3A 1N36O 4R6ZA 4GKYA 1OLRA 2W3JA 4DV0O 2DVBA 3WINE 1KMIZ 5D2AA 4A2UA 4YW5A 3ZMZA 4FQ4A 4LBMA 4YGEA 4DV5B 3WG7C 2ZX1A 2Q1FA 3TN91 3JAMN 2FQPA 4WZCA 2OUJA 1NX9A 1MEC3 3IFXA 3M3EA 5JMOA 5F2VO 1FOD2 2VUCA 4IE5A 4IIJB 2P22C 3WW3A 4QJFB 2XB6C 2VNRA 2E32A 1CJDA 4H37A 4JV4A 4UAPA 3OBAA 2EULA 4Q29A 2VVFA 4AF9A 5B1BC 4CZSA 4A5UB 4QDQA 5BNPB 4FFFA 5LWBA 1DQ6A 1RM1B 5CFCA 1GFF2 2DCKA 1HNWO 4GALA 4ZS2A 4OI4A 5T52A 5JQGA 1VP6A 2XWBB 2VNGA 5KXCA 3BB6A 3V0BB 1COV1 1V54C 3DKWA 1CIYA 1IKPA 4UW5A 4Q4X1 4YW2A 2IUWA 5A7WB 3AYDA 1R64A 3I2DA 4D94A 3GYDA 1B06A 2RQ6A 1Q8PA 1NR7A 1F7YA 3BY6A 1IXMA 1Y66A 1H2GA 2DYRB 1JYCA 3E8HA 3DGTA 4ZU4A 2XMLA 5FXZA 4GH4C 4ZBMA 4OHWA 1X8MA 1Y76A 4I01A 3IPVA 2R041 3ZOIA 2RMU3 4QAWA 3HBKA 1FXKB 3D0JA 2UXNA 4X9QA 1DZQA 4W4ZA 4TYSA 2OX0A 3KV4A 4BHPA 4J1XA 5LA0A 4KWLA 5LBBA 5T3NA 4COZA 4YVWB 1M90W 3J7LA 4AVVA 4QPIB 1S0FA 3OR6C 2EIJB 2OA2A 2RDNA 4RD7A 3VBFC 1ZVFA 1M56B 1GOFA 4IV3C 2F43G 3GWKC 1LNSA 1K3IA 1ODMA 1PVXA 3AKSA 2GN7A 4FFGA 3UGFA 3ECQA 1Q8OA 4LP8A 4LE3A 4OUEA 3KZ4C 4K9SA 3ORJA 3K3OA 2YROA 1P8JA 5LA2A 2NP0A 1GN4A 4LF7O 5C9AC 2OZ6A 2E31A 4CDWB 1SKVA 4EROA 3RVZA 4LBQB 3S3XA 3OPTA 2ZGQA 2W92A 5J09A 2WZPP 1DQ4A 4NHYA 2WLKA 1LHWA 5CBFA 1W05A 3W58A 2WLQA 2JDYA 2WLHA 3FL7A 4AEJA 4Z2WA 4P30A 4K3UA 5K4LA 4HT1T 3VBSC 3D4KA 3CCQV 5T54A 1UKGA 4YW7A 1WA8A 1HIXA 4XCAA 4A42A 4XEZA 1PGSA 3BEHA 1THZA 4IGQA 2EALA 4HXCA 1KKCA 5CG8A 4FLTA 4G3YC 1XMQB 3CX5F 5CEHA 2Y64A 1QJX1 2E53A 1ZRRA 2KG7B 5GLTA 5DN2A 4TSVA 4AVTA 3VBOB 3CJXA 3NV2A 4E2LA 2LQTA 3IMNA 3VHPA 4IEWA 4B3RB 3VHRA 1CPNA 5F8PA 2VJXA 3CRRA 2DTYA 3UKTA 4BQ2A 4PA3A 2K9ZA 1XNKA 4RQPC 2VG9A 3I3QA 4JI6B 3V0AA 5I91A 3WQBA 3USUB 2E74B 3R65A 1HNZB 2HP8A 1QNWA 1MVQA 4IUGA 2XHBA 3JD0A 3OF1A 3H3UA 1D5NA 4MT8A 3I5DA 2DV9A 5FPAA 2UUAB 4X6QB 2YFUA 5FYTA 5FPLA 1O3SA 3R4DB 3OEHG 2F4VO 2WLIB 4PA7A 3MUY1 1AR82 2R30A 3AC0A 2IFWA 3S57A 1FAFA 1ORQC 5F5IA 5FZMA 4CDXA 2R1DA 1PO23 1VMGA 2QWQB 1PGW1 2VZTA 2ITCC 2QGNA 5SV5A 4P5HA 4RS5A 5DM6V 1D2SA 5GZCA 4MADA 5JLVA 1R3KC 2M6YA 1PM9A 3FAVA 1W06A 5B1AB 4O4JA 4Q4Y2 3JBG3 4Y20B 1HKDA 1B35C 2JDKA 4J11A 4Z8BA 2BZDA 4XF4A 3FBYA 4BIFA 5LA6B 4FQZA 3JCUZ 2Q73A 2HLDG 1XNTA 1ZA7A 2ZAHA 1FMD3 3WP5A 4UXNA 3ZJZA 3DYOA 1NI8A 2P34A 1PO13 3ETEA 4RR3B 3PVOA 1PK6C 2XQRA 3KKYA 1PZ9A 1TME1 3I2KA 1CWPA 4I0AA 2VAUA 1YO8A 3E6CC 5H9SA 3OCPA 1HXS1 3OG2A 3MLKA 5C71A 2H3OA 3JB4C 3THTA 4RHV2 4YHHO 2IXLA 1JFFB 4D6TH 4DV6B 3I3EA 1H1MA 1BMFG 4KWJA 3SJAC 3PJSK 4NXNO 1W3XA 2J1EA 3RZJA 2DYSB 4MG2A 2W1WA 5A3TA 1LJ7A 1QVGU 1GANA 2LW8A 3E97A 3F5WC 2X5IB 5A3WA 1DP0A 4BK4A 4FJCC 4KHPB 3PTRB 5FKBA 2HWF2 3QBQA 5FZ1A 4CDQC 2GC1A 4QX8A 4L8JA 2P5OA 2C4XA 1ZRCA 1RINA 2J1TA 4Y5SA 3VBRA 1LUWA 2WLJA 1AR73 5A32B 3ASNC 2P1BA 4UXAA 3LDRA 4X8AA 4UVCA 3VZNA 1JYWA 3AFKA 1FAYA 1Q8IA 1W90A 1OLMA 3VZJA 5L9RA 1DTOA 2VOKA 2ZMLA 4TUYA 1UO9A 4BYYA 2WZ8A 2V09A 3FLRA 2ZCWA 2VOTA 1ROPA 2QQKA 5LA1A 4KI5M 1WW7A 1AI7A 4YIOA 1H8TB 5T50A 3INAA 3RQ0A 1VF7A 1OF4A 1TMF3 2BW8A 4BCUA 3LCPA 3FHAA 3LB9A 4J9YB 1VBC2 1ZX5A 1G9BA 2VQEB 5DAQA 3WNMA 2ZGTA 2ZMNA 2Y4TA 3ILFA 3AG1B 4H3WA 1N3QA 3DTUB 3K46A 2FD8A 4AZZA 3ZYRA 3WCRA 5LL6Y 1FPN3 1RPOA 5T5OA 3ZDVA 4K8RB 1XNQB 1URFA 3N3HA 1KFUL 3RRDA 1WB8A 1QXRA 1POV3 4QHBA 5FPXA 1CZSA 1UNBA 4WFFA 1OQEA 1OPOA 1FI2A 4MYEA 4BM8A 4D7YA 1Q43A 1WNSA 4CZZA 2UYBA 3RT3C 1ZZ6A 4BISA 2D97A 3DECA 1VQ4V 2WDBA 3BAAA 2BOJA 4WFHA 3SNMA 1AUYA 5K0UC 2EXIA 3ZX6A 1CIWA 2IJKA 1XNRO 4KU8A 5FUPA 2K9PA 1V6MA 1C8NA 1W9YA 4XYXA 1GKBA 1W2BU 4AEDA 1QQP3 1QY4A 3ABTA 1RB8G 3TAYA 3HQRA 2EX3A 5LP6B 5DUVA 5FZEA 2UXCB 4QE7A 4JRLA 2HWE2 3VKFC 1OHHG 1DGWX 3B7MA 4IEUA 3VBUA 3OMAB 4FOYA 4XDLA 3BOPA 5IK7A 2VBBA 5FMOL 4FFBA 3RG0A 2WABA 4XZUG 2B5HA 2VZRA 4YW6A 4X1IB 1UJWB 1K34A 3ZFEB 3N9QA 1RUC2 4UCOA 3CRQA 3S7EA 1MEC1 3KWVA 5FQ0A 3VB9A 3K3WA 4FIPC 3RDIA 1GLHA 4OFGA 4FLXA 4Q0SA 2RR12 4AVCA 4PDRA 1QOOA 4LF8O 1VALA 4Q5OA 2BEOA 4CUAA 1NTZH 2R0FA 1NCRB 3H7YA 5KMGA 2WQ8A 3A7QA 4YZ2A 5HCFA 3OTOO 2AR6A 3S7IA 3PUSA 4AL9A 3VGIA 3JD72 3OPZA 3QTCA 5EP9A 4R52A 1U0AA 1TUBA 2UXXA 3BRCA 5FRAA 4N7UA 1K5MB 3ZXJA 1IKQA 4IEQA 2Q5TA 1TNRA 1U12A 2VW1A 2CNAA 4QU2A 4PLMA 1S2BA 1RUJ3 1YLLA 1ND3A 4M00A 4ZS3A 1JZ8A 3MICA 3CJHB 2JJ2G 3PJYA 2QE7G 2O0OA 4YRDA 4FOWA 5BR8O 3W7TA 5ABJC 1UX6A 3A0NA 4TQFA 2WAAA 1Q90D 4CU6A 4BQ5A 2DUPA 4TV8A 3HPLC 5LK7B 1DQ5A 3QOPA 3OJBA 1BJQA 2RMU1 1RHI2 4DK1A 3JD1A 3ZPOA 3VN4A 4XTMA 5IT6A 1WMXA 5BNNB 2C1FA 4FT8A 3AG4C 2M7WA 2PY5A 2A3WA 4QNHB 1VQNV 3O1MA 4E2GA 3D36C 1HRI3 5FJHA 1QQCA 3DYMA 1UZ0A 1RUF2 2OCCC 1LTEA 4FOQA 3H3LA 1DLLA 4ONUA 4FO9A 4CC6A 2ZEYA 4CPBA 2ZHMA 2IXHA 2RJKA 1RSOA 3ZSJA 4Z1VA 1YI2V 4XDPA 3V64A 3WNOA 3W7XA 1CVNA 3TJTA 3KF5A 3KQ4B 4QX1A 3FUOA 4PDMA 2WPDG 3KD4A 4XIKA 2NZ9A 2MPFA 4QX3A 3TXSA 5E89A 1ULFA 4H2AA 1S76D 4E4SA 1P84F 4TLFA 3S3WA 5H6RA 2LFRA 4N7IA 2D7FA 5JZGC 2JG9C 1XE8A 4IL6Z 3AK1A 4WCEV 2J22A 3E5XA 4MX3A 1IPSA 3A0KA 1ASJ2 4NB5A 4UFKA 5EIBD 1MNGA 5GLVA 4D3WA 2PI4A 4WFGA 1K5JA 4LKFA 2YC0A 4G4FA 4FPCA 5CFDB 2YSUB 4BQ3A 4ZOLB 4UCTA 4X88A 1OCRC 1XOUA 2KQXA 5LMNB 5BNOA 1R6NA 2FBEA 5A33A 2JG8A 5A9GA 4GMP3 5I0RA 4UFMA 3O14A 2E5LO 5CA1B 3N35A 4ZZ5A 4OULA 1RXFA 3ZLIA 3IAYA 4O9EA 1S5JA 3THPA 1HNXB 1C28A 1DF0A 1C8M1 2EINB 1ZZ9A 3WSOA 5IVJA 3WG2A 5BXXA 2UXDO 1GRJA 2X10A 2EIMB 5FP9A 2GMPA 5EQUA 2F66C 3NJXA 1J3PA 3AB0A 1D0GA 2DMXA 1S0VA 2Q8EA 1UW8A 3T30A 3MFCA 2YXLA 3AP5A 3ZKUA 4M3CA 2OXBA 2VQUA 3ACIA 3WNPA 1AJNA 2YI8A 3E22B 2DFCA 5DECA 4RQFA 3K9SA 5GTHZ 4META 1ZZ7A 2DCTA 4GQ7A 4XFHA 3U75A 1RMU2 3JCIA 5F9TA 3OYWB 4YM0A 1FOD3 3S6PA 1S1AA 1XRUA 4K0KB 1E5RA 2BFUS 4C91A 1N33B 3T1LA 4DRVA 1Y74A 3T4HB 3S30A 2ARXA 1JZ2A 4FPLA 1W6OB 1DU3D 2ZD9A 3URFA 3WDXA 2IXCA 3H0OA 5IVCA 3KG2A 1PO21 1GOGA 1W6PA 4UW6A 4CH5A 1BYHA 5FPVA 2GTAA 2JXAA 3DN7A 4MXVA 2ZKOA 2BGOA 2RDQA 4FPEA 4LO5B 2VNOA 1SQVH 3I59B 3LIGA 3OY8B 3HKEA 5C3RA 2N7GA 4HFSA 3JBG1 2W9XA 3BVCA 5DEDA 4XDKA 4JGZC 3WF4A 3EBRA 4P2ZA 2VUDA 1L0LH 1FJGO 1WMFA 1FMD1 3N7JA 2UUBB 2OW4A 4G2KA 2F17A 1PO11 4LUMA 2AENA 4IT5A 2HWD2 4IGOA 1PNMA 1HN1A 1QMJA 2D6NA 3LOBA 4HZ3A 4GZRB 3SHRA 1NVPD 5F7UA 3GM8A 4RSUA 4DNYA 2WNUB 2HKXA 2BOCC 3JZVA 1SQPH 1U96A 4AAXA 3LSSA 3BABA 5F3GA 4NWWA 2HKOA 2VZSA 5BNPC 4WBNB 1YJ9V 3NR7A 4RUEA 3GBGA 1RM1C 4LCUC 5EC1C 5EJ3A 3ZMTA 2KB1A 4ZHQA 4YYOA 4DW1A 1D0HA 3WF0A 5FK8A 3CL1A 4RGAA 3JSNA 4R4XA 3AG7A 2D3RA 1BMV2 1FFTB 2GP3A 2ZE8A 5EPAA 2PHLA 1WCSA 2GNDA 2XJUA 2ZT9B 2UUCB 3VDDA 1VIBA 1N3PA 1AR71 1UIKA 4CPBD 4DEVA 4CDUC 5CMUA 1C1LA 3AXDA 3E35A 1IBKO 4L2NA 1GZWB 3KS7A 1ZRFA 3QLQA 2CUGA 4QHOA 1X50A 4DINB 5B2GB 2WKKA 2PZSA 3HOBA 3FJSA 4C1XA 4A3XA 1H4HA 4QWNA 1WLEA 1NG0A 2P37A 5FLJA 1HQWA 4CS4A 2AUYA 4AVAA 1OCOC 5A3PA 3EJKA 1GR3A 4R9AA 3E1F1 5JJEB 4LBJA 4O2BA 2YIDA 2EXJA 1ENQA 1QVFU 5FXVA 2EIJC 5JJJB 1FT9A 4XE9A 4R9DA 1MQTB 1FPN1 1KDMA 2W95A 2C5DA 3H8UA 2J7MA 1R1BA 1POV1 2ZIMA 2XAJA 5KHIA 5G04L 4AOCA 3KCYA 2DCZA 4MSWC 1ACCA 3VUOA 2DTWA 5JOZA 3F7VC 1MSWD 1N1SA 4CDWC 2XJRA 3E8GA 4FFHA 1DLBA 1IQDC 1QLEB 1CAUA 2B1IA 1V6JA 4BE3A 2LGWA 1YUDA 4BOWA 1JZ6A 4A6SA 4O4IA 2QKDA 1W0JG 4UF0B 5FY1A 1NJIW 4BMEA 5FYIA 1UQXA 3J81N 2OZJA 2BTVC 3VD4A 1MS5A 4ABMA 4GH4A 2CGNA 2CTPA 1V9U2 2BFUL 2I07B 5LGTA 5IYZA 4CUGA 4N53A 4B3NA 2NR5A 1QQP1 1VAVA 1AR83 5FYBA 5GONA 2WC2A 4IETA 4UBHA 2R062 2R9IA 2RG4A 4E9KA 4LA3A 1ZAUA 1W8UA 4YGCA 1WW6A 3DPRB 4Q27A 5D8AC 4GB32 5JDBA 5IWAB 1UIJA 3CMEV 4XUNA 1JODA 4WM8B 5B4XA 5DMYA 4L92A 3N2GB 3VBFA 4KMQA 4S2HA 3VBOC 1AJKA 1V6KA 4IV3A 5CBGA 3UKVA 4Q4Y3 2DQ0A 3GGLA 1G6NA 3BKZA 1BQ0A 4FLZA 3IT8A 3FYEB 5T5PA 2BNMA 1CD3G 4FI9A 1B04A 1TA8A 1OV9A 4DOUA 4LFCB 1V6LA 1F23A 4ZKTB 2ZBJA 5ITZA 1KB9F 1WP8A 2DN9A 4Y1YA 5GZGA 1J5EB 5J2TA 1NTKH 3CU7A 4QE9A 3EO6A 4G9SB 1LOFC 3VDAA 3A23A 2W68A 4I7ZB 1W2UA 1ZSPA 1OF3A 5DAXA 4DR7B 2CDYA 4H0LB 3VKOA 5EHDA 1QHTA 1MZ5A 1RUJ1 3AK2A 3VQYA 1WWYA 3VBSA 4LFBB 4GX0A 1AX0A 4RHV3 3IBMA 1MPXA 2RJZA 2WUHA 4U3JB 1EUUA 1LHNA 2YV8A 4MGKE 1W8OA 4KWUA 3AVSA 4MVRA 2E76B 5EZYA 1KGYA 4PIXA 5B1AC 3SKVA 2IVIB 4FVVA 3D82A 1ZZBA 2HWF3 1NCQC 1MSDA 3G6BA 1M57C 1FS0G 3CCSV 3AX4A 3C3TA 4KNCA 3DKQA 1IPJA 5FP3A 5C6CA 2UWBA 1AI4A 3K4ZA 1CJPA 4RQPA 1F2NA 4RR3C 4A4AA 4WM7B 1ENRA 1HRI1 2JS3A 2VR4A 2OS2A 3CLPA 3ZN0A 3IDAA 4NE9A 1MMMA 2QDNA 3WNLA 4FPHA 1OHFA 3ETQA 5BNQA 1OOPB 4E8DA 1VBC3 4M3CF 5HV0A 2K0GA 2F6BA 1KXGA 3ST7A 5LXTA 2PN5A 5KR7A 1JU3A 4H55A 4BB3A 3JYCA 4J41A 2X5IC 4Y4RA 1SQBH 4YNIA 2WT2A 2A06H 3B4SA 2PQSA 3OGJA 1MZ6A 1W6NA 4PLNA 3AZVA 1YNAA 1B35A 5FZBA 5KHGA 3CC7V 2P6JA 3MYXA 2YC4A 4PELA 2VMGA 4CEYC 3WEZA 3USSA 1O59A 1OCZB 1LR5A 2Q1MA 2Y8KA 4D7TA 1QNYA 3N9OA 1PGL2 2Y0PA 5L7OB 5CB4B 1KJLA 4JHTA 4GMP1 1ZBE2 4HONA 3G6EV 5LEJA 4JGYB 3UNPA 4AXOA 2C2AA 2YS8A 3PTYA 1PK6A 2OT5A 4CE8A 5KHJA 4EYUA 1NZ6A 1H8TC 3MV11 1I9RA 4I5SA 2ET1A 5CKNA 3S0MA 2PF4E 1U5IA 4O2AA 5CISA 2F4LA 5D5QA 4DR5O 3I2JA 2BNOA 1LHUA 2ILMA 5FPZA 3JUUA 3OUSA 3ZFGB 1AILA 3LOIA 2WQZC 2PAMA 4JI2O 1CN1A 2GZWA 1I5YA 3HVDA 4JI8B 2QM7A 3LA3A 2HWE3 4Y5Z0 1Q5OA 1VF5B 4JDNA 4AFDA 1W59A 1EZVH 3WR0A 1BK1A 1W6QA 1WA4A 2VM9A 4C90A 3L2HA 3MPBA 1RUC3 4LQRA 4I30A 4X1YB 1B09A 4LIUA 4PV1B 2QWNB 1FOD1 3NKGA 3FHQA 4JI4B 4MVTA 2D5HA 4O4LB 2RR13 1HLCA 5C33A 1MS8A 5FYHA 4O4HB 1OI6A 3H42B 4CEWB 4UFIA 4P08A 3AK0A 1SESA 1WCDJ 1O5LA 4QX0A 5FIXA 2WQ4A 3JD73 5FMCA 4FLUA 3RZZA 1RGSA 2AREA 4MVUA 1LHVA 5H9PA 4FP2A 1N34O 1TGOA 4OPHA 4JV5O 3UKNA 4B7KA 4AEMA 2VZUA 2BWAA 3RYKA 1PD3A 3ZBHA 3ASIA 4DV4O 5J37A 2IH3C 1FFXB 5GLWA 3HEIA 4A7KA 4CH6A 4JKLA 2Q4PA 1HJFA 1YFYA 1MOFA 1R73A 1WB7A 2PHDA 4LF4O 3ZFEC 3MIFA 5FJKA 1D4M1 1X8EA 2BTQB 4BQ4A 5FO9B 1LU2A 4BQYA 4URAA 1Q3EA 2HHHO 2V5YA 2WNVB 1YQ6A 3AZYA 4I0BA 1JCHA 1QCEA 3K5OA 1K97A 3KGLA 4B4QA 3PUIA 1RHI3 2ZJCA 1M06G 3L70H 3MF6A 1O5UA 1AR5A 5HXMA 1NCRC 1NE4A 3H9VA 3C7GA 1AR4A 4CU9A 4N43A 2ZCEA 4AAPA 5K0UA 1K3EA 1N1TA 1YFWA 1K5MC 1RUF3 1DQ1A 1PM7A 4K6BA 4JHZA 2AC1A 5IYCO 2P5BA 4MGSA 3P3PA 2VQFO 3JATB 3CKHA 1PNKA 3T2MA 5B3SC 2JDAA 3KV9A 4LXLA 5FZOB 4EWEA 2IJIA 5DZEA 1BZWA 4XILA 5A1FA 5C3SA 2YXSA 1QR9A 2YXHA 4DRXB 4DR2O 5IJ9A 1E5HA 4ZZ8A 2DFBA 4FFIA 3Q9OA 4QQ2A 1UY2A 1F5JA 3T0BA 2Q8CA 1O4YA 1CP9A 4X65O 1ASJ3 3C7HA 3WB1A 4JI5O 2BTOA 4V2VA 2R16A 2TUNA 3O1RA 5IWFA 2HVJC 4W65A 3M8AA 4EEQA 3Q8CA 2PAKA 4W4KA 2VTFA 5FZAA 1OD3A 1WPXA 5F6KA 2CH7B 1GSLA 4WF9V 1VQKV 2JICA 2MHFA 2WFF3 2EJRA 3H1LH 4GKJB 3D3IA 5FLXN 4DUYO 3LSEA 3OB8A 4UV8A 1BBT2 2ARBA 3OOXA 2JIJA 2UU9O 4QU1A 4Y33A 3SQOA 1N1VA 1TVGA 4A7YA 2IVJA 1V0AA 3R66A 5A3UA 2VVDA 1Z5WA 2VCAA 2WO2A 3QD6A 1SHWB 3K5MA 2B7YA 3ZR6A 1JOYA 1NKDA 1AROP 1JW6A 1CPMA 1UYZA 4DV5O 4Z1MG 1CXZB 3ZYIB 4L99A 1VIWB 1GBGA 1JUHA 1RMU3 3ZFFA 5FTTC 3P30A 4XW3A 2PA7A 4Q4V2 2BYVE 4RFRB 3QF7A 1QBZA 4X66B 1J3QA 3TETA 2QZ3A 1Q81W 4CCOA 1AR81 4LLOA 5C8WA 4RGGA 2ZGOA 2QFEA 1MZFA 4F6RA 4NPLA 4YW4A 2ZPXA 5EYYA 5C3QA 3DXRA 1SDWA 4XUPA 4JTAB 3OFNG 3D36A 1BVVA 2VMEA 1WLTA 5J9PC 2EINC 3WFVA 1M93A 2HJDA 5A6YA 3QH7A 3MDSA 3O1PA 2EIMC 4Q4Y1 2YI9A 2DURA 4QPGC 1I3HA 1HN0A 4Q8KA 4XCBA 1OC1A 1GMGA 2VU9A 3G4SV 1FKAO 2BERA 4GULA 2EXKA 3AMQA 1RUH2 2J1RA 3RJ2X 1U5YA 4OQ9A 4LLFA 2HWD3 5AVAA 4JYAO 1VMFA 2JG9A 1JH5A 5FFOC 4UCRA 3MZHA 3T0DA 1F31A 1YIPA 1O9GA 4E4DX 1JMKC 4DR4B 3HD8B 4WFAV 3K03A 3POSA 3OMIB 2Y6LA 5H9QA 2P06A 1WCQA 3BPSA 1Z2GA 2NMOA 3KHCA 2OTJV 4RHV1 5C9AB 1GV9A 4AHZA 4QX7A 2F95B 3PIGA 1MS0A 1VBD2 2HBUA 1DLCA 1KS4A 3N7MA 2XAGA 4U36A 2Q1ZB 4LULA 5FZFA 4DV7O 1DZTA 2DJVA 3VQXA 3C7EA 2JE9A 3SCHA 4IESA 2WA3A 1NLRA 4DO2A 1S55A 3H1KH 1H38A 4X1KA 2BGPA 2HWF1 5IW0A 3ZHUA 4UW3A 4QGPA 1SBEA 1ULOA 4DR3O 2WWJA 1PIV2 4EWDA 2GALA 5DAWA 3ZPYA 1UYXA 2OT7A 3HT2A 4LK6A 5LGUA 2XWJB 3AP6A 3ZSMA 1JMUB 2HVKC 1JOBA 4QIWF 5F5QA 1LUVA 2LUWA 3Q8BA 1WJZA 3LSUA 1SCRA 5EYPB 4CCMA 3PURA 3W5MA 4JKKA 2RS52 4HPKB 2QQOA 4IERA 2UY8A 2YU1A 4DV0B 4AI2A 1IBLO 5T5JA 2RNBA 2WNUC 5IK5A 5GZDA 4COUA 3HN1A 4U2AA 4EJRA 1LOCA 3ZS8C 2XJTA 2DQ3A 3POJA 1QHDA 3JAKA 4QKBA 3LEMA 1VBC1 3D3QA 3PN1A 2CL2A 5JUVA 3OBZA 4GKKO 2CDOA 4CTEA 1GQHA 3JALA 1MS9A 2JKXA 2R9RB 1XMQO 3OE7G 1YHQV 4NN0A 1HB1A 3WW1A 2YC2A 2WNOA 4R9CA 3HBZA 2Q7EA 1QGLA 3DF0A 1YFXA 1GO3F 3UT5B 3LDBA 4JC1A 5AFEA 3VZLA 1GP6A 3SCGA 3RYHA 4QXHA 2W6IG 1MZEA 3NV1A 1HNWB 1FATA 4N90A 2WWWA 4NROA 4DV1B 4BJ0A 2W6JG 2QKSA 4P9PA 4LWSB 3GBFA 4AG4A 4QKDA 1BK0A 5FZLA 2ZHLA 5FUNA 3F5TA 3OUHA 3JARB 4BQXA 2QNKA 5F5AA 3T4DA 2JB4A 5FZ0A 5IVYA 4KH9A 2YEVB 1V9U3 1OLME 4P9XA 4IIJA 2QQMA 2I45A 5BV6A 3SGIA 3N7KA 1C1FA 2R063 1KS5A 2GMMA 1UPGA 1YXWA 2HWE1 4EB6B 4GB33 4S2FA 2OYQA 3TOJA 4RWUA 1MQTC 2PYTA 4LNUB 3T1HO 4XUTA 5FY7A 5BNPA 1HV0A 4OMCA 4AW7A 5JI9A 3SEEA 2ES3A 1YI7A 4R9BA 5CKQA 4B4RA 1WMEA 5LBQA 5KX5B 3FX7A 5LMUO 1RUC1 2AYHA 2NN4A 4L97A 3V0BA 5IE9A 5JVDB 2ZGNA 3Q8FA 2D3OW 4XZPA 4FZ0A 1CAXB 4NUBA 5A7WA 1XJAA 5J3UA 2RR11 3B93A 1QLEC 2ETEA 4YJ3B 3ZSLA 2JDZA 5KLVH 1BCXA 2GNMA 2EIKB 4JZ2A 5DUWA 4JAUA 2VZOA 5C3OA 3FX3A 1OURA 1LESA 1VLNA 3GZTB 4YGDA 2D44A 1PMHX 3LZZA 4AVBA 4LF7B 4LKEA 4CDQB 1QJZA 1JZ7A 2QQVA 2WBKA 1FXKA 1DK1A 3KCXA 3SPHA 5FY4A 2QSAA 1DYKA 2VZVA 3DPRC 1PX4A 3I2HA 3I2OA 4YVWA 2HBTA 1H2NA 2QEXV 5DAVA 3RJRA 4WM8C 2YUAA 4QM9A 4YARA 4WVWA 4QPIA 2W0FC 1YJNV 4IE4A 3B3QE 4YG3A 5L9VA 2EICA 2EIDA 2YFZA 1HDKA 2ZR3A 2ARCA 1ZX3A 4EV0A 4HVOA 3TNPB 4JGSA 3AZZA 3MGUA 1XYOA 2VC9A 1F51A 4IYIA 2RS12 3VD3A 3AJYA 3I2FA 5FZ4A 5L73A 5GTIZ 2FMYA 4LBQA 3IM0A 5L3FA 2YBSA 1GAXA 1HB4A 3LNMB 1FNZA 1RUF1 4XIOA 3NVCA 3N2KB 3W21A 3EB7A 2X6AA 3WX5A 2G9GA 3I56V 4MS2A 3B2EE 5B1NA 1VB4A 1SQXH 1US3A 2FZ1A 1RUD2 2GU9A 4MXWB 5JI7A 5LYJB 2ZACA 4YVSC 1N32O 1F35A 4I3PA 3I54A 5FZ9A 4NYKA 3IGAC 4BR6A 1JYXA 2F4VB 1NA1C 1XL4A 2FHRA 1BCCH 2W94A 1Q6UA 1F8VA 3B02A 2MEV2 2VTXJ 2V7QG 1Q56A 2R70A 3HKBB 2KG7A 1IS6A 1ZUQA 3OD4A 4NR1A 3H1YA 4COWA 1ASJ1 3VBOA 1W0KG 1TQ5A 3POWA 4OXSA 1NT0A 4XDJA 1YQ8A 3QO5A 5FZDA 4IXLA 1SPPB 2A7AA 3BODA 3SR2C 4EZHA 3T09A 2G9ZA 4JTDB 1UOJA 2ZTNA 1Y7BA 3CD6V 4WM7C 1MS3A 1N1YA 3USUA 3M99B 3L9DA 1ZBE3 3E2EA 3OBRA 5CKMA 4DPNA 4UVBA 1G4YB 4F6EA 1LOFA 3O1VA 4MZUA 2BWCA 1IQAA 2WLIA 1OOPC 5FPOA 3VLBB 4C0BA 2H94A 2A6VA 4ZPIA 4PIZA 4TV9B 1KJRA 2EILB 2A6WA 1DYOA 2UXCO 5A6ZA 1JBCA 4XQWA 1L1FA 1NY72 1UD1A 5LZ6A 3P1IA 4ATEA 3CBNA 4OHZA 5F32A 4YHHB 4CCNA 4JYCA 4JZGA 3T1MA 4DB5A 3GCWA 4I09A 3AYEA 3SYAA 1LU1A 4UWDA 4YLZA 5B4NA 3VKLA 4Y20A 4NXNB 1RMU1 4HVQA 5LA6A 2AEZA 1IPKA 2F23A 3EHBB 4MH0E 1OCZC 3POEA 5E16A 5L19A 1C3HA 5L7OC 2X05A 3DSQA 4FLVA 3BUCA 1W2TA 2F1MA 5F39A 5ABJB 1J1LA 4JGYC 4CS2A 3ZMNA 4RR3A 1ZLZA 1IGOA 1A8MA 4JI0O 2WR9A 5ERLA 3RYCB 5K8SA 4GCZA 4JQRA 1PV0A 2A7WA 3K0GA 1YHFA 3ZFGC 3K77A 1VMHA 4A45A 2RDCA 1SLTA 3SISA 2ATFA 1JFFA 3JXSA 1V9PA 2NQYA 1DBNA 2VS0A 1U5ZA 2ZX2A 3AM2A 3BU7A 2GV9A 1G8MA 3O1UA 5KA6A 3PNAA 4KG8A 2VQTA 1HX6A 4LO6B 3RMYA 2UY9A 5D1IA 4XJWA 5KA5A 3M3CA 4PA9A 3J7MA 4QQOA 2X5IA 2HWD1 3CHXA 5CNAA 5DDJ2 1W9WA 4O7XA 2Z4FA 2JRIA 1FXVA 4M3CE 1R6TA 4BDVB 3ZVXA 1EFRG 1CESA 2XPJA 1R1A2 1QH7A 4N9HA 5A32A 5EJ1B 1SQGA 2JEXA 4YW1A 4CEWC 2VMDA 4HMZA 3WQ0A 3VD9A 4Q0VA 3M8LA 3WP3A 2GSMB 1GM7A 3O1OA 3ABZA 5JZGB 2RS32 4NXMO 3ILRA 3SH4A 2I2SA 2BSKB 1LRHA 3GZEA 1H8TA 3G7DA 1BMV1 4LBQD 1I5ZA 3VQVA 3BN6A 2Y48A 3ABLB 3L2YA 3I55V 1XNRB 2YB7A 3U0ZA 4TWTA 3H8OA 2FDFA 3R4SA 3TWIA 5JOYA 2ZNJA 3SPIA 4HAMA 2BP6A 3ZXGA 3WD5A 1ND2C 1RUG2 1AXZA 4JKMA 5A3MA 4XC9A 1O4ZA 2WNVC 4YIPA 1I1EA 2VZ1A 5KAIZ 1AL22 1IZ3A 4YPJA 4DQAA 5LCWL 3BOWA 1VR3A 3LWCA 1JZ5A 1RVF2 1ZL8A 2GAUA 4CC5A 2WAMA 4QD2A 5CA6A 3NW4A 4LMFA 4JI3O 3CC2V 4RO2A 4XF9A 1XREA 1JHNA 2YYOA 2VUAA 1IS4A 1GNZA 2Z69A 4YFWA 3CYOA 1W8FA 1VBE2 2ZABA 2WIIB 2RCVA 1EV12 2JDHA 1WW4A 1I94O 4LF8B 4PCRA 4DO0A 1AX1A 3NV3A 2Z3YA 2ZINA 2YHJA 1BBT3 4BQ1A 4LPLA 4KGGA 3OTOB 4HSJA 1QF3A 3J80N 3H8XA 3OUFA 5LP6A 3G80A 1OQDA 3NJYA 4UVAA 1LKNA 1N4CA 2AGAA 4B8EA 3AP9A 4JRAA 3LSDA 4OI0A 2PAEA 4P00B 5HFMA 1H2KA 1A3KA 3RWNA 4XFCA 2JS5A 3APOA 2WLLB 1YC61 1N3OA 3B8NA 1SZBA 4X1IA 4HKWA 5F2WA 3ZFEA 2Q7GA 4JGZB 1L7QA 3QG5A 1V9U1 4Q4V3 1PX3A 4B3SB 3LAGA 4PIYA 4UFZA 2LRPA 4D7SA 4XHBA 1WLCA 2E7QA 3I49A 1GZTA 5T5LA 3OUIA 2ZGKA 1OPMA 4FPOB 2Q0OC 1WLWA 1OH3A 2R061 3MFAA 1NCRA 5FZCA 4L0PA 2JGUA 4GB31 2Q8DA 2TBVA 5FXWA 4YJ2B 3GBWA 1S0EA 2B9ZA 1UZZA 2GDSA 3WDWA 3RFRA 1FYUA 3SDLA 2BVBA 5C4WB 1SERA 2ODMA 5FNVB 5JSOA 3CJHA 2QVSB 3NNGA 2QWOB 3VD7A 4CUBA 2VZQA 2DU1A 1RUH3 4QXBA 3DL3A 4GWJA 2ARAA 2IFRA 1K4CC 1XNDA 4I55B 2N04A 5A6XA 4A41A 4CCEA 4JI7O 4ASUG 2EZOA 5A3LA 2P4KA 3U4XA 4EWAA 4XBNA 3M1HA 4UBGA 3HQXA 3LDEA 3LEGA 4QQHA 1UX7A 5JH7B 2V4VA 3FZ3A 4QGLA 1XE7A 5BNNA 4CDUB 4UUJC 4ZU5A 3QCWA 4SBVA 1US2A 2EXHA 3WDTA 2DUQA 1AJQA 3IZOA 5FZGA 1VBD3 4FXKB 3H3ZA 2VBDA 4TZDA 4V2WA 1QXPA 4PT6A 3THDA 5LRRA 1OZ0A 3AMMA 1OFSA 2X8KA 3NXSA 3MIDA 4BWOA 1GP5A 2LGQA 2Y6JA 1DGSA 2C9AA 1OCOB 2E5LB 2AHZA 3RMXA 3AXEA 4RN5A 2CE4A 2HFEC 1PIV3 3WZ1A 2JK5C 4XQ4A 1BGYH 3IDCB 2XUEA 1XPWA 2UXDB 4BPZA 1NAEA 1SG3A 5IT9N 1UXZA 3GF6A 3ZN1A 3O0VA 2CWSA 1JVMA 4IEVA 4FPKA 1T2XA 4EE2A 3T4ZA 2RS53 2WNEA 1WP7A 3ZXDA 3CB2A 1W8HA 2OPKA 3AKPA 1DGLA 5DPNA 1IBMO 1VQLV 5CFDA 4ZOLA 1M5IA 1BLZA 1W9TA 4GT1A 1ZTEA 1NXD1 2ZXWC 1YJKA 2ZKNA 3GZUC 4NIIA 4K35A 1DGRN 1JS9A 1UOFA 2VUJA 5CA1A 4YSFA 1RJ7A 2J1AA 2QZ2A 3K06A 4C8DA 5FCCA 4W8JA 3BTYA 4FLYA 1YI9A 2XKOA 1J95A 1X59A 1GYKA 3EHKA 4HL0A 3STLC 3RGBA 2HYKA 1X33A 3SYCA 5FOBB 2WO7A 2XLGA 1AP5A 4QPJA 4AI3A 2PGGA 1LOGA 5D8AB 5L3EA 4F3JA 1PKXA 2WN3A 1K92A 4UYBA 2RMKB 1PVC2 5CB7A 1PGL1 1CGPA 3E22A 5JMCA 1BS3A 5IVVA 1SDDB 2XH6A 1SLCA 1ZBE1 4Q4W2 4EN0A 2ADPA 1FJGB 2VNVA 5JR2A 4CP9B 4D0QA 2JD4A 4MSVA 3OYWA 4ET7A 4XURA 5ITZB 3HKDB 5FV3A 5LASA 3WG3A 2B4KA 1W6OA 1F4NA 3T2PA 2PLV2 1HRV2 2G1MA 3CJIB 2BPA2 3RN4A 4OUMA 2XONA 1S5LZ 5H9CA 1O3RA 2Y60A 4CDXC 5A80A 5CU1A 4FZ1A 4X64O 3I59A 4HETA 4TN7A 4GWMA 3OY8A 1SMVA 2Q0AA 5LBCA 4CH4A 1VJ2A 1ODNA 5JSRA 3NNFA 1Q8QA 3N4MA 2D2CB 2ZM6O 4L87A 3LA2A 4RYDA 4YG6A 2XNDG 4K8FA 4LFCO 2QQPA 1K7DA 5ACA2 2N05A 3NJZA 5J98B 1QJU2 5FMBA 4DZGA 5LOVB 3POBA 3NJVA 2LW7A 3JCZA 1J5EO 1K33A 2ZMKA 3A21A 2L9LA 3HNBM 1T6BX 3CF6E 4IQPA 2J1SA 2NNUA 1NCQB 3BYWA 3CO2A 3M2MA 1M57B 1IBKB 2KSDA 1M9NA 4OX9O 3CWBH 2WNUA 1G9AA 4BAYA 1E79G 1O91A 1QDCA 2EAAA 3VKMA 4AR2A 4W6WA 1EN4A 4GJZA 5LATA 2UU8A 3MHZA 1VARA 5BYNA 1H4GA 3N36A 1H2LA 4LFAO 2NLRA 4WBNA 2BQPA 3I97A 1UF2C 1JOJA 3KV5A 1BL8A 2FTKA 4D8MA 1AR1B 2PQQA 2WLPA 3MHHC 4IHJB 4PA4A 1GTOA 3MIEA 4XJ9A 4H7MA 3H1MA 5J7MA 4AQTA 5BUVA 1AYM2 3O0WA 5FY0A 1YQCA 2D6KA 1C8M2 4LEJA 1TE1B 3ZYJB 4HYOA 2RS13 2EIKC 3I8TA 4K1YA 1WGPA 1GZWA 2W91A 2RJ2A 1JTZX 2BE3A 2E75B 5GZEA 2VO5A 1QR8A 2JGDB 5D5PA 3D0SA 4OVEA 1UU6A 3LIHA 1A34A 4XHXA 5B66Z 3NNLA 4NHMA 4AK3A 4CEYB 5KXEA 2KKWA 1RUD3 2C26A 2OKXA 1VQ6V 4PD4F 2MW2B 4B08A 3DC6A 4B3TO 3KSCA 2B9VA 2IXJA 4TOIA 3T2OA 1MQTA 1K5SA 4ZU7A 1P7BA 1UZVA 2MEV3 4XJUA 2MK3A 1XB9A 1VQ8V 1XSRA 2V4DA 1A32A 4NPRA 4IDZA 1UMHA 3SC7X 3LDCA 2VRZA 5L9BA 1ZRIA 5EBLC 4LBLA 3OGIB 3JD3A 4ICGA 2FCVA 1OD5A 1QIQA 2ZX4A 2PHTA 1KQRA 3T1CA 1PL4A 5FKCA 4KG0A 4UF0A 3MHSC 3JSLA 5JCOA 1Q82W 3UKMA 5JSPA 1BSMA 4KGQA 1Z5VA 4NTWA 1WPBA 1BBT1 3FLPA 5E1AC 1AR92 4QPYA 1H8EG 5F5CA 1CQ9A 1XU1A 3CQOA 4Y1XA 2XJQA 4NHXA 4J9ZB 4LBOA 1PNGA 4X20B 3DPRA 3H8RA 2RN9A 2GNTA 4QKFA 1EPWA 2V4AA 1HR0O 4FPYA 3JQXA 4WM8A 3OR7C 2E6VA 1S0IA 3K9AA 2GC3A 3DUIA 5LBEA 3WLUA 3N2GA 4RA0A 1R3JC 3ABKB 3CP1A 3FBMA 4TTGA 2LJ2A 5FP7A 3K59A 2PELA 3N7LA 2BU9A 2R49A 4Q4V1 1I5XA 2V73A 4I4TB 1AR62 1EAH2 2QTOA 2DVAA 4LC1A 4M4RA 1CZTA 3KT4A 1PNFA 1ZA4A 2DWDC 2XAFA 2IW5A 1TEIA 2BNNA 4FPJA 3DV8A 2B46X 2JB8A 1I5PA 5HI0A 3MI8A 3OEBA 3OPWA 3CMGA 3QO8A 1ZBA2 2QQJA 1W2OA 1Q6HA 1ZREA 1KQSU 1SBFA 4AFMA 2IWGB 1K42A 3POFA 2EILC 4AFCA 3T4VA 3VBBA 2P3IA 2PFWA 3WQ7A 3M3OA 4ISRA 3G67A 5C7GA 2YPJA 2OVUA 4QX5A 3GWOA 4U3JA 2IH1C 3T2QA 3SH5A 4KBBA 1LGBA 1RUH1 2IXKA 5IK4A 3N9PA 3PMSA 4A44A 2GMEA 2XL7A 3VBHB 5BMVB 2YIAA 2ZGSA 2E7TA 3CCLV 3B77A 3IB3A 4MTGA 4CUCA 5JR7B 5DDJ3 5B3SB 5E8AA 5LA9A 1Y9GA 1AVMA 2JJ1G 4QDRA 4ZONA 5JOWA 3OEEG 1DG6A 1R1A3 2YBPA 1CAWB 4RUFA 3JAWB 3Q4HB 2VMCA 5A7PA 4TSFG 2AGSA 3TEZA 3JASB 3ZN6B 1QWRA 2WYSA 2AHYA 4E27A 1UY0A 4GLXA 1X9TA 1CAVB 4WM7A 4LF5O 2JECA 1VBD1 5FREA 2RS33 3SYQA 3X2QC 2XHNA 5J2UB 3F2ZA 4MHRA 1FXHA 1AI5A 4HG6B 3VZOA 1M4WA 4FSJA 5BXZA 1FXZA 3CNAA 1XUQA 1YXBA 1PMIA 1OOPA 3ZYHA 4N9IA 3AZWA 2XJVA 5IY5B 1PIV1 4QXCA 4C0HA 1WN7A 5FDBA 4AGVA 4DR5B 1NE6A 4W6XA 1BHGA 4MGZE 4LUKA 2DBNA 1RUG3 3MW4A 1H6YA 4JI2B 4HANA 3LNNA 5G05L 2ZGLA 1KP3A 1AL23 2JDNA 2RS51 5KHHA 2OTLV 1RVF3 3M7AA 3POGA 2I74A 4GX5A 4IV1B 1D7PM 1MVEA 2ATKC 4PJYA 1PL0A 2D3PA 2CAZC 4JTCB 2XKPA 2GDFA 5L7OA 5CB4A 3VV1A 1GN3A 1GN6A 1VBE3 4JGYA 1EV13 3PJQA 5KC5A 5BNOC 1XILA 5DZGA 2ZDIC 3OGCC 2CWMA 3ABLC 1W2NA 4JI1O 3FKSG 4DXSA 3CE2A 5LRSA 1UXXX 3ZFGA 3AK3A 2ZHKA 2VWKA 2ZQMA 1EM1A 1SS3A 2AACA 2ZZJA 4LA2A 4K3AA 1N34B 3BCCH 2WFF2 5FLHA 4JV5B 1O6UA 4OGQB 2O8OA 3ZXAC 5T55A 3KF3A 3NAPB 3W7SA 5FYSA 3MV01 3M3QA 2CHHA 1AP6A 2QUOA 2IJHA 4JCKA 1JN2P 4DV4B 5GZFA 3L9JT 4MUVA 2DBIA 4W50A 4GKXA 4WVMB 2W87A 4MV2A 1BKZA 4QPGB 4X1YA 3A22A 3E8BA 4AHWA 4XJ8A 3TCUA 5AG2A 4DFSA 1YRZA 1C4RA 1I6XA 1UWWA 4LF4B 1OUXA 2PMWB 1QU7A 2WFPA 4O4LA 2HHHB 1KKDA 4NRQA 4O4HA 4CEWA 2O1QA 2XHKA 3K5NA 3CCUV 3AMPA 3ABMC 2VOWA 4LO4B 4AI1A 5FP8A 1LB2A 2XL9A 2IU3A 4RAIA 2X0LA 4EN7B 2EIBA 3UETA 1XYPA 4CXYA 5FZ6A 5AVPA 4GYCB 1YTFD 1FYJA 5F37A 1SCSA 1DF5A 4H33A 4LF9O 1PZ7A 3ZR5A 3ACGA 4QMAA 2WINB 4YY3O 4E4ZA 5IJ0B 3NQHA 2RV9A 1FFXA 2VQFB 1K73W 2L35A 1E1RG 3OBTA 4B3MB 1NU1H 1Z7S2 1QEXA 2JVDA 3AL6A 5I0SA 3RYFB 1AHSA 2BTQA 1E1QG 2IU0A 3ZHVA 3J7AU 1L7RA 2WNVA 4NOTA 3OAAG 4JAAA 2WLMA 4GD4A 3LDDA 3GDBA 2QJ1A 2IBZH 2VCCA 4L11A 2ID4A 2UWAA 5FWEA 1K8AW 3VDCA 1G1XB 1NOVA 3IWZA 4N21A 4I50B 2WO3A 3MDPA 4X65B 1VBA2 3PDQA 3MUZ1 4JI5B 2LTNA 1GNHA 5BZBA 3THCA 3Q8AA 2GNBA 5IK8A 4NJ4A 1VPHA 2Z2SB 3ZIXA 5C8YB 4MW3A 5C4WC 3JATA 1LR1A 1UPIA 5FZHA 5LW9A 1GZCA 1JHJA 2QWRB 4OI1A 5FZOA 4LE4A 4WFEA 2Y34A 3B01A 3RYIB 4DUYB 1H2MA 4Y26A 3ME2A 3DC5A 4LR4A 1RUI2 1H2SB 5CZKA 5KC6A 5FO8B 2HH9A 4YG0A 2A6XA 4JYBA 1XOYA 4WBBA 1GP4A 2UU9B 3MW3A 1NR1A 2RS11 4DRXA 1O3QA 2DW4A 3WP4A 2JE8A 1KBHA 5CIRA 5I8YA 1NZCA 1KC8W 3AZXA 1S3JA 4ASLA 3POIA 4QB6A 1MR5A 3L75H 1RFYA 4R7CA 3QNEA 4COVA 1LCLA 1XDCA 1FV2A 4I0XB 4PF1A 2E63A 1KDKA 2VBPA 4M0NA 4FFKA 4LH7A 3SJQC 4UFJA 1RUD1 1PZ8A 1RXGA 5CA0A 4CCDA 5DZFA 1AL0G 3UO3A 2CH7A 3OGRA 1DGRA 3K2OA 2A71A 1SLBA 3QACA 1O8PA 4J42A 4FK5C 4NHLA 1R1ZA 4S2GA 2QDRA 2MEV1 3WDYA 3CXCU 2Q4SA 1TMF1 3J8F2 2AH2A 4HNAB 3V56A 4DR6O 2A6ZA 2WT1A 4ZIBA 1GOHA 4AQYO 5H9RA 1ULDA 2ZEZA 3THOA 1Y9QA 1YIJV 1AVBA 2Y69C 4LBEC 3RW0A 1REFA 4YW3A 3OUJA 4N23A 4GWIA 4DV1O 5IVBA 5GLZA 2DU0A 1PVC3 1TVKB 1R082 4S2DA 3ZYBA 3N9MA 4LR3A 1XMOO 1YIFA 1O7FA 5IHRA 2CYFA 2P6CA 4Q4W3 3LA7A 1F4MA 2A3QA 4DV3O 4ZI7B 5APAA 3V65A 2IZWA 3AG2B 4TQDA 4Q26A 3RZKA 2GSYA 1V6IA 3PUAA 3T1YO 2A0LA 1XYNA 4Y4YA 3IN9A 4E8CA 4GWNA 3SPJA 3FE5A 1D4M2 1D2QA 4JYAB 1UMZA 1GQGA 4P9OA 1UY1A 2JE7A 1DQ2A 2PLV3 1HRV3 5CBHA 4N53C 3GNEA 4HBNA 4BW5A 1NY71 3CEIA 5HCAA 2HWB2 3UL2A 2RDRA 3PUQA 4PBOA 2YGLA 2GC2A 1L8DA 4MGQA 5L3BA 4KP4A 2WS92 3LEKA 1XHXA 3AG3B 3NL1A 4Y22B 1HJGA 5FMDA 3TNQA 2W0XA 2FMLA 3SLIA 4DV7B 2YBKA 5CADA 3LEIA 5EFUA 3WVJA 4FXGB 5J96B 3PU8A 4FBFA 5DAPA 2C6SA 1LENA 5ACA3 4XETA 1QJU3 4DR3B 1GWMA 3WF2A 3ZYPA 3ZN5A 4DY3A 4LF6B 2DWEC 2A5ZA 1MG1A 2E26A 3AP7A 2LO1A 3WQ1A 3FFQA 1YTFB 2Q6AA 3VD5A 3GXUA 3RI8A 2XR4A 3CJIC 1XNBA 1IBLB 5C9AA 3HR9A 3A8TA 4HK8A 1KUQA 4OLLA 3O9OA 3WV6A 4OHYA 4HZFA 1UY3A 3ACLA 4QB1A 1OA3A 3AKQA 1AF9A 2Y0IA 2UURA 4H7LA 2O57A 2EZPA 1OH4A 3HNYM 2HLEA 4GKKB 2WAOA 5DDJ1 1UOGA 2ARHA 2Z5WA 5FYZA 3VZMA 2LS6A 1ULPA 1QJY2 4YVSB 1LULA 1R1A1 4QXKA 1AYM3 4KU7A 4IGGA 3EXAA 1C8M3 1NA1B 2CTRA 1SFPA 4Q0UA 1REDA 1XNAA 3E6DA 1HW5A 1OSGA 5EZWA 2A75A 3BVOA 5HBAA 2RS31 5EYPA 5C8CB 4HPKA 4U3FH 3FYIB 3A0BZ 1V6NA 3UM7A 1V00A 1SACA 5JIUA 5FK7A 3WP6A 2P90A 3EYPA 3LPFA 4AQ6A 3A0HZ 1N47A 1RUOA 4BIZA 4NIGA 5KBFA 4DIQA 1W39A 1KRIA 5SV8A 2SLIA 5DQ0A 2FB5A 3AEIA 2JDPA 3J7HA 2B42B 3ML0A 5JXHA 4LHNA 5D21A 4EN6B 4NIAA 3O0XA 2OQ6A 1RUG1 1LOBA 2D6OX 1HWYA 1AL21 5E6HA 1EP0A 1VQ7V 4NVPA 3UT5A 4QDSA 3WOGA 3T1HB 1KU9A 2PYLA 1RVF1 3ZO0B 2VY0A 3B09A 2TNFA 5FMOS 4NWVA 2W08A 3SPGA 4LBNA 5LMUB 2XGXA 1WAZA 5FBJA 3HAGA 3K75B 3OSDA 4I3GA 4LWSA 2ZIOA 2QBXA 4CRQA 4DUXA 1OQ1A 4FPGA 1IX9A 4QPWA 3MIGA 1SA0B 3CCVV 2JIGA 1VBE1 3ON7A 1N0JA 1J59A 1EV11 3JARA 2D6LX 4UCVA 4DXTA 3EXUA 4XBQA 1VP7A 4MLOA 3G6JB 2YEVA 4XFAA 5IYDO 1JR9A 2ZX3A 1KYOF 1AR93 2X53S 5KHKA 3R6SA 3HJRA 1NBMG 3H01A 4F83A 4BW9A 4JASA 3NNMA 2WZR2 3M4FA 5F3CA 2AW9A 4MTOA 1QXJA 3N9LA 2UXBO 4EB6A 1V55B 2P2KA 1RL3A 4LNUA 5HXVA 2Y6FA 1TAEA 3AP4A 4AEKA 4P9JA 1XQNA 4LKSA 1WCKA 4URTA 4QM8A 4XDOA 5KX5A 4I9WA 1IG0A 2W1QA 1G9CA 2X6BA 2BVVA 3STZC 1OCCC 3E5UA 2W52A 2OPWA 4NPMA 5JVDA 4O61A 5AC92 2XASA 3PUHA 2ZE5A 2ADDA 5FUIA 1AR63 2PXJA 1CAXA 1EAH3 4AHYA 3E6BA 4FM1A 2J1UA 3BHPA 1LOAA 1NUKA 1VB2A 1JI6A 4YJ3A 1W0OA 2NN8A 3SKJE 2FYUH 3W7UA 4FPFA 4Z07A 1OBNA 4H14A 2VPVA 4DMIA 2DF7A 1CONA 2QA4V 2GUZB 3PVNA 4IE7A 2E33A 3K57A 2YXYA 5FZ7A 4B4PA 2B8MA 3AKRA 1ZBA3 3UGGA 4CDQA 2F93B 1WA6X 1H1IA 1IHMA 4AHCA 1PNLA 4Q0QA 4XFIA 1QKQA 5IUQA 4LO7A 4E4HA 5FYMA 2RE9A 4DR1O 5GLUA 1QNMA 3I7DA 1XXNA 4LTAA 3K08A 4XF3A 4HOOA 4PDWB 3UCSC 1POQA 4IW3A 1APNA 1UCXA 2D98A 1N32B 3ZKYA 4OHVA 3ABKC 1R092 3MAQA 3ZMUA 2VQAA 1EBOA 3IC9A 4BIUA 1DGWA 4K8ZA 5K1XA 3I2IA 1UY4A 5J1XA 2GN3A 1TG7A 3IDEA 3PVBB 5FBZA 1P7GA 3ZRWB 1QOSA 4XAAA 2W39A 5CYYA 2O14A 3QVNA 3BALA 4PHZA 4AGGA 4XFGA 1UZWA 1TNFA 1ND2B 1ZL8B 4U7NA 2NMNA 3OW2U 2QE3A 3N2KA 2C24A 1DQ0A 2BUKA 4N43C 3OGVA 5B5EZ 1K5QA 4M01A 2PHRA 4A7ZA 4JTOA 5K1PA 1IXBA 4YZ1A 2SBAA 4MXWA 5LYJA 1Y4MA 1VF6C 3BTAA 1SC5B 1PHMA 3ZSKA 2W2IA 1XBLA 4JDMA 1R3LC 3VBHC 1LNQA 1YJLA 4MVZA 3PLQA 1MACA 3H1WA 2VXJA 3VOUA 3OMNB 3AYCA 1W8NA 3HKBA 1W6MB 1W0NA 3J9SA 1BHBA 4DUZB 3ZYFA 1P49A 1R6KA 3HKCB 1WUVA 2RVAA 1KD7A 4OHXA 5E79Z 1MS4A 1SPPA 3U11A 3PMEA 1SBDA 1SQQH 3AMHA 1SLIA 1X9PA 2X6CA 2B45X 5TSWA 4GA9A 1JJOA 4EFEA 2P3KA 3C7FA 1BE3H 3CDZB 1S0GA 4YFZA 4AI8A 2KM2A 2HEWF 3LUTB 2ZS6B 2BJSA 3PL0A 1IS3A 5IJRA 2EAKA 4ORFA 4LH6A 1I08A 3ZMVA 5KAFZ 3K48A 1SLLA 3U4SA 4JI0B 4XBLA 4HN0A 5IY5C 5EBWC 2D6PA 4X62O 4TV9A 4XF0A 3TEYA 2R72A 2Q7HA 3VHOA 1Q8VA 1WKYA 3OTFA 1PVC1 1S5HC 3WG4A 2ERFA 1D4VB 3K0DA 2R072 1KEXA 1X4TA 4Q4W1 5FYYA 5FP4A 1WZXA 4DV2O 4JQTA 1Q6IA 3P3NA 2OIGA 5CFCB 2YG0A 3CZJA 4EZ4A 4IV1C 2UWCA 1F4AA 4B3SO 4M4PA 5JQGB 1YFUA 4WZFA 3L71H 4G28B 1H30A 4ASKA 1YF2A 2A9HA 1Z0HA 4BA6A 1GM8A 3FB8C 4QKNA 4PI2A 3M3IA 3ZFFC 5A7SA 4QGMA 2PLV1 5ABJA 1HRV1 2OYZA 4BIOA 2KR2A 4LORA 5JAXA 3RYCA 1FV3A 3ZHTA 1S0BA 3WF3A 1ST8A 2O8QA 3ZSEA 1Y4WA 3I4IA 4IEZA 2C9KA 2XG3A 3UK9A 3X29B 4NXMB 5JJNB 1Y76B 4X89A 3IPVB 2C0ZA 2UYAA 2ZGRA 2FCTA 1W03A 3T3YA 4JZRA 2LM3A 3MO4A 4GXLA 3SJCC 3NAPC 3W9AA 4GX2A 2WWUA 5FXXA 1B3QA 1HDJA 3K79A 1M4UA 5ACA1 1QJU1 4RGKA 5B1OA 1Z7S3 5F3EA 1QH6A 3I3DA 2GTSA 2H0VA 2B5UA 2QKAA 3TGUH 1RPRA 1W9FA 3IMMA 1OA2A 2QKCA 2EJ7A 4Y1UA 5FYVA 2D40A 2W1SA 3VZKA 4YGBA 1MS1A 3MIHA 3ACHA 3IAQA 1LHOA 1VBA3 2X09A 1BHAA 2WSSG 4UFHA 5JZGA 3LE0A 2A3XA 1AYN2 2RHPA 3E83A 1G9FA 4JI3B 2AZ2A 2QQIA 2BSKA 3ALQA 1Q7YW 1JZ4A 3MLLA 2CSGA 1NQTA 2ZDIA 3KT1A 4PA6A 4INDA 1JQ0A 3C3VA 5JPNB 5F2SA 1I94B 1AYM1 4BU2A 2ZXWB 1RUI3 4UOJA 4MO3M 2LFSA 4ZY9A 1EPZA 3FN9A 1WA8B 2P67A 3A2FA 5DG2A 2ITDC 4DS0A 5GW7A 1K9MW 2ZGUA 4NRPA 1TZOA 1VE0A 4P5YA 4HLTA 3TK1A 1KECA 4B1LA 2B9UA 4AI0A 2RM22 4DRRA 3R0RA 3ZEDA 5FLIA 4TLGA 3SXWA 1UOBA 4BMBA 4QGNA 3KQRA 3R4UA 2LP7A 1N36B 4XUQA 4I0WB 4LJHA 2JEMA 3OM3B 3FUQA 3DXUA 3V0AB 5I8SA 4LBKA 4G27B 2IJJA 1AI6A 2K1EA 3NRUA 4DXRA 3J8F3 4X6RB 3VHNA 4LOTA 1Y67A 4NO4A 1URXA 3KHBA 5IVFA 5FL7G 3DGEA 1YDXA 3J26N 1A8DA 4XBFA 3H50A 2ORXA 5ANQA 1E5SA 3WW4A 2BBVA 3BI3A 5FO7B 5IYYA 1L0NH 2ET7A 3ZXKA 1R083 4CDXB 5DUUA 2WLLA 1LEMA 5I0TA 5JXJA 1YZBA 3B94A 1VBB2 1CPYA 5EIYB 3WHTA 1M1KW 1LAJA 4B3RO 4JGZA 4RS5B 5DG1A 4LHSA 1AR91 3FAVB 4O4JB 3ELNA 1D4M3 3RBZA 5LHIA 4JI7B 4JI6O 1K45A 2HR3A 3RZHA 2DUOA 5FZ8A 4HK9A 3SITA 4KBZA 2G19A 2DOSA 2Q30A 1VAKA 4PDLA 1HNZO 3FD9A 2ETNA 3E89A 2QTSA 5LEKA 5HV4A 1RUE2 2HWB3 5E1RA 4YJ2A 2UUAO 1H9PA 4Q0PA 3GCXA 5ANNA 2WS93 4XAEA 3BFRA 4XOGA 1LODA 4Z2AA 5C4WA 1BEV2 2ZKLA 1W3VA 1GM9A 2CTQA 4XFBA 5FNVA 3LDKA 4OUSA 3C90A 1B6QA 1V6OA 1AR61 1EAH1 2KA3A 3CRCA 3UT0A 4L9BA 4DXZA 1ZWIC 4FVMA 1SFNA 3AVRA 3UV9A 1NH2D 1A78A 2HG5C 3D3AA 1J1TA 2XBO2 4I55A 3AG2C 4QB2A 1GQPA 3CCJV 1O9HA 4YM1A 2P4VA 1VAMA 1X7NA 2HJIA 3ZMSA 4FP3A 3BCWA 1ZBA1 2HEYF 4P9IA 3B69A 2B39A 3PHMA 4GAZA 2HEPA 1JZ3A 2DYRC 2R1BA 5FPBA 1HP8A 2H6BA 3D8CA 3KLSA 5JH7A 1NYWA 5KWRA 5FY9A 1BT8A 4CDUA 1JYNA 1VQ9V 2HWC2 3M70A 5C70A 1OMIA 2VGDA 1UPSA 3NO8A 1FXKC 2ZGMA 3JD71 3K4DA 3ZHQA 5FZ3A 3VBRB 1OJHA 2J1VA 1IBMB 5C3PA 3FC0A 4CBCA 2X7RB 4YVWC 3PIJA 3CS5A 3AG3C 2VL4A 1OUSA 4QPIC 4TUYB 2FDHA 1EZJA 1Z78A 4GZ9A 1AX2A 1M56C 1ZYBA 1QJY3 4R8HA 4ATFA 2VE1A 4DV6O 4O65A 5K9YA 4V1PA 3CMAV 1KD1W 4YZ3A 4TXWA 2H6CA 3HQUA 2WJSA 1Y6XA 3F7YC 3FB7C 2A70A 3KVAA 1YITV 3DCQA 3LQCA 2D43A 4KQ7A 2WYFA 4FM2A 4K1ZA 3KB5A 1NKGA 1VRH2 2AEYA 1AXYA 2XT9A 4KHPO 5LB6A 1RHI1 1LOEA 4IEYA 1WLDA 4WVZA 1R3IC 3JD2A 2XUMA 3KGZA 4ZHNA 5A7QA 2WRAA 3UJOA 3FMGA 4AQ2A 2YGMA 1UFIA 4CDWA 5IVEA 5HPOA 4WV8A 5M0TA 2XTAA 2Y0OA 3LD8A 1ENXA 2IXIA 2DE0X 2G4IA 3RVHA 1EY2A 3LFIA 2VXRA 1VEWA 3WB0A 4F4LA 1AZDA 2YPDA 2ZX0A 2XLFA 1HQNA 2ORZA 4KL1A 5LY2A 3AL5A 4Y1ZA 4J7JA 5FY5A 3TN92 1H1AA 1SETA 4FPPA 2VQEO 2ZEXA 1KITA 4X64B 3ZXEA 2XOMA 5D8AA 3HR0A 2G9FA 4PBPA 4AEDB 4OCTA 3H1JH 4XJZA 2ZM6B 1XNQO 2D3SA 2VULA 3B40A 5C8CC 1PPJH 1RJ8A 1QU0A 3VBUB 1F9KA 1GKFA 3JD4A 2L6LA 4CP9A 3UESA 4O9GA 4RL7A 4FFBB 4XACA 1DHKB 4LHKA 3HKDA 1Y3TA 4LNVA 3E86A 5FQ0B 1COV2 1T5EA 1S72V 3MPPG 2PHUA 3SCFA 4Q4X2 2WZR3 4DY5A 3MLJA 3POYA 1FPOA 3CJIA 3U10A 2FCUA 4QPKA 2WFF1 3AYAA 2Y26A 4OX9B 3ILNA 1WD4A 4NMIA 3OGSA 1P4RA 1JUIA 1Q8SA 3ZXFA 1AB3A 1GWKA 2GH8A 2YUEA 5EBMC 5KMGB 3L74H 5A1LA 1XHZA 4LFAB 5CN0A 1S2KA 2CTVA 1J84A 1TUBB 4LOSA 3ACFA 3FB6C 4XVHA 2R042 1ENSA 2R7EB