5KHIA

Hcn2 cnbd in complex with purine riboside-3', 5'-cyclic monophosphate (cpump)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 63
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khiA02
3IWZA 2QJVA 5JCTA 2B8MA 1YFXA 2ATFA 2PAKA 5JSRA 1DGWA 2P17A 4YSFA 3RZZA 4F7ZA 3NW4A 4XFBA 3ELNA 1O5UA 1J3RA 4ORFA 1UIJA 2B5HA 4YNIA 4XF1A 3KCCA 3LOIA 4EWEA 1ZZ7A 4PIYA 1ZREA 4ZU7A 1DZTA 4QGNA 4QM9A 2BYVE 1JUHA 1FT9A 4HVQA 4XF0A 4IEVA 4LLOA 4Q0VA 3EQEA 3PNAA 2EAAA 1O5LA 4Q0QA 4XFIA 4O9GA 2IXHA 1FXZA 1H1IA 5LRRA 3UKVA 1QY4A 4LA2A 4FAGA 1UCXA 1EY2A 3D0SA 5AVPA 4R52A 2I45A 1RL3A 3LWCA 5D1IA 3I7DA 2K9ZA 3R6SA 5JSOA 1VJ2A 1J3PA 3H8UA 1PMIA 1OD5A 4XFAA 1UW8A 1YLLA 4IEXA 3TNQA 4NVPA 3U0ZA 1CX4A 1ZNPA 5EFUA 2V09A 2ZKLA 4XEZA 2PHLA 1ZZ6A 4META 2WC2A 4XFGA 2MPFA 2PTMA 2CGPA 4B29A 1IPJA 2Z69A 3M70A 4Q0UA 3H3ZA 4HLTA 1H1MA 2Q0AA 3SXWA 4MZUA 4KU7A 1ZZCA 3UKTA 1O7FA 1YWKA 3ACLA 1WA4A 2QNKA 4LA3A 4Z82A 2GC1A 1Q3EA 4AVBA 1XE8A 4I02A 3FX3A 1ZZ8A 3MDPA 2BNMA 3SCFA 3SCGA 4AQ2A 5J3UA 3EBRA 4HN0A 2UYAA 3OCPA 5CADA 1J3QA 3C3VA 4XFHA 3FHIB 3BPZA 2PYTA 3BU7A 4WZCA 4IETA 4IEPA 2XKPA 3DKWA 4LTAA 2HJIA 1ZRDA 5KHHA 1UD1A 3E5UA 2WFPA 1O3QA 3DL3A 2EA7A 1I6XA 3H1MA 3GBFA 2XHKA 4IEZA 2PHDA 1DGRA 1CAUA 3CJXA 1O3SA 1EP0A 4HVOA 2Y0OA 5FDBA 3NSTA 4RD7A 4WBBA 3VHRA 3JZVA 2FMYA 3USSA 5I93A 3CLPA 1HW5A 3IDCB 1X8MA 1Y9QA 4LULA 2GZWA 1ZX5A 5JAXA 5EZWA 4CYDA 4KWKA 2IXCA 2D5HA 3FZ3A 3IDBB 4LUMA 4PJYA 4KWLA 4MH0E 2IC1A 4O9EA 2VECA 3ES4A 5I8TA 3ETQA 1CAVB 1SQ4A 4I01A 4BH9A 5HI0A 5FLIA 4IESA 1CAWA 4E2SA 2XLAA 5JSPA 1U12A 4XETA 1ZRRA 3BALA 3BB6A 5KBFA 2CV6A 4YARA 1CGPA 5KHKA 4IEOA 4E2QA 4HSJA 5I0TA 4YYOA 2Z2SB 3NL1A 2GC0A 4MGKE 3H3UA 1QXRA 1XRUA 1G6NA 1Y3TA 1VP6A 3WW2A 1EYBA 2ET7A 4X6RB 4WVZA 1CAUB 2D93A 2OPKA 2F4PA 4AXOA 5BUVA 3O14A 4UXAA 5FPXA 5J48A 1ZZBA 5I8SA 1LRHA 5LEJA 3H1WA 4XFCA 5BV6A 5CU1A 4F8AA 2UYBA 2Q4SA 3NVCA 4I0BA 2D5FA 4MX3A 2D40A 5KHJA 1XE7A 3LAGA 3SHRA 4E2GA 2H6CA 3H50A 4XF3A 3FE5A 1NE6A 4Q0SA 3PVBB 5T3NA 3RYKA 2E9QA 4N9IA 4KL1A 3WW4A 4LUKA 3RNSA 5I8YA 5F1RA 5BY5A 3LZZA 5I91A 4R8HA 5E16A 4N9HA 1FI2A 3WW3A 1GQGA 4DINB 2VPVA 3KSCA 1SFNA 2BGCA 4AQ6A 3EO6A 2OA2A 1RUNA 4QMAA 3LA7A 4JV4A 1UIKA 5BXXA 4HMZA 3RYPA 3ES1A 2OYZA 3CF6E 3CO2A 1QWRA 3D82A 1J1LA 4MGYE 4BYYA 2K0GA 1I5ZA 3KMHA 1J58A 1EPZA 2VQAA 2XL9A 4PIZA 3FWEA 4XF9A 2O1QA 2BNOA 3RPQA 1YHFA 3GYDA 4MV2A 3S0MA 4UBHA 4Q0PA 2UY8A 2GC2A 4JTNA 1RUOA 4QM8A 5C6CA 1YUDA 3OGJA 4QGMA 1NZCA 2BNNA 1LR5A 5KHIA 4MGZE 1Q43A 3N4MA 1WGPA 3HIFA 2XL7A 4FT8A 1NYWA 1YFUA 4ZU5A 3CL1A 4X6QB 3MPBA 1NXMA 3OF1A 4KU8A 4Q29A 4TLFA 3EJKA 5K8SA 5I0SA 1YFYA 5KHGA 2PAMA 2XGXA 3FJSA 2IXJA 2OZ6A 3PLQA 4P9GA 1LKNA 1O4TA 2GU9A 2OZJA 4L11A 1SEFA 5FPZA 1ZRFA 1O3TA 1NE4A 1QXJA 3HT2A 3E6CC 4H7LA 1OI6A 3UKNA 1ZZ9A 3E6DA 2H0VA 2DCTA 3ZDSA 2GH2A 4I0AA 3H7JA 4FBFA 2ETEA 2KXLA 4HBNA 4D7TA 4UBGA 4YRDA 5FCCA 1ZRCA 2B9UA 3D0JA 4IEWA 1VR3A 3H1YA 4HSLA 2PFWA 3TNPB 2HKXA 1ZVFA 5I0UA 4D7SA 5LEKA 2H6BA 3B02A 4I2OA 1UPIA 4IEUA 1X82A 4QX5A 3OD0A 3E5QA 4JVAA 4MGIE 3M3IA 3E6BA 1IPKA 1X8EA 3MZHA 4KWJA 4OLLA 3HT1A 3I59A 2PAEA 2N7GA 3U10A 1L3JA 2GAUA 3I54A 4EROA 4HZFA 2Q30A 4QGLA 1DZRA 4EWAA 2CAVA 3HQXA 3CEWA 2ET1A 4Z07A 2Q1ZB 5FQ0A 4BHPA 4GULA 2IXKA 4HVRA 1CAXA 3NJZA 1X7NA 1V70A 5FLHA 1TQ5A 2XKOA 2XLFA 3IIAA 4L2NA 3E5XA 3U11A 3ST7A 5E1RA 3OTFA 2QDRA 3LA3A 1LB2A 4EWDA 2EVXA 2QVSB 3NKTA 1PM7A 2BEOA 1CAXB 3H9AA 3SCHA 4EV0A 3RYRA 1Q5OA 5I0RA 3RDIA 5CVRA 3EHKA 3L2HA 2GC3A 4HN1A 3DV8A 4PIXA 4OFGA 4IEYA 4XFFA 1OFNA 5C8WA 4LEJA 4IEQA 3KGZA 2IXIA 3ROUA 1RTVA 3E97A 2CAUA 4JTOA 4QXKA 2MHFA 5FQ0B 2MNGA 2XLGA 1CAWB 4K8FA 3LA2A 3FFQA 2UY9A 5BPXA 4J1XA 3BCWA 5FLJA 1CAVA 4MUVA 3I59B 3MYXA 4IERA 3H7YA 1WLTA 3G7DA 4A2UA 4BIFA 5J7MA 1GQHA 3S7EA 3QACA 4I09A 4I3PA 2C0ZA 4AVAA 3KGLA 1J59A 2QCSB 4FAHA 5LRSA 1RGSA 2IXLA 2FQPA 3QOPA 1RC6A 4ONUA 3WW1A 4XF4A 2PA7A 2O8QA 5JR7B 2ZCWA 1O3RA 4J1WA 3SMHA 1OMIA 3IBMA 4AVCA 4ZU4A 1YFWA 2PQQA 3DN7A 3S7IA
chains in the Genus database with same CATH superfamily
2YXHA 2ZACA 1GZWA 5BY1A 2CTQA 4YSFA 2A6YA 1NLQA 2JE7A 5FJKA 3OGGA 2XJTA 3P30A 3NJXA 1DZTA 2W1UA 3OGRA 1V55B 2E51A 1JUHA 1AX1A 3MV01 1JVMA 4P9WA 3Q4HA 1CQ9A 3WVJA 5FMCA 3I2OA 4C8DA 4TXWA 2IXHA 1H1IA 2VULA 4LA2A 4CCCA 5FZFA 1OH4A 3ZXDA 5GONB 3VBFC 2LP7A 2QQIA 1MQTB 1WB7A 2XONA 3RZKA 1UO9A 1VBC3 1MPXA 5DQ0A 5DUWA 2AXTZ 2CGPA 3LDRA 2UUAO 5C3SA 4TOIA 2BSKB 2XJRA 1IPJA 3H3ZA 4DOUA 1YQ2A 2QNKA 3DKQA 3NV2A 4LFBO 4GMP1 5D8AB 3OGVA 5KLVH 3JD73 4JQRA 4P9YA 3HQRA 2LGWA 1C5HA 4KG0A 4P30A 2L6LA 3AZYA 4PA6A 1R091 5CA0A 2WYSA 2RHPA 2EX3A 5LGTA 3HR0A 3CJXA 2EIMC 4FXGB 3B5LB 1G9AA 1NKDA 5F5AA 1NU1H 1LEMA 1C3HA 5L3CA 3WG7C 3ICXA 1JI6A 4GIQA 4W6YA 2WZR3 4LBNA 1VF6A 3ES4A 4J42A 1KDKA 4AAXA 1MACA 1AR5A 2ZE8A 2CGNA 5HI0A 4NAOA 4IESA 5CN0A 1H8TA 3VZMA 3SNMA 1TG7A 3DXRB 4E2QA 4YYOA 1OSGA 3BHPA 2SLIA 5FZ0A 3DTUB 1DU3D 4UV8A 2OYQA 3ZFGC 1G6NA 1KP2A 2CUGA 1UL9A 3DYOA 1EYBA 1R6TA 1X33A 2D93A 1WBFA 2JE8A 4Y1UA 4E9KA 2Y26A 2ZGSA 5FPXA 4WFBV 3ZFEC 5FO7B 2HLDG 3J9SA 4MS2A 4JGZA 4MADA 4MGTA 5KHJA 3FYIB 2F4VB 1I3HA 2QE7G 1NCRC 3H50A 3MIDA 5A3OA 1FS0G 3A2FA 5BNPB 4JDMA 1WB8A 3KSCA 1OLMA 2BGCA 3VBSB 1I5XA 4QMAA 1JFFB 3RZMA 3IZOA 1JZ6A 2V4AA 1W8NA 2IFWA 2W2IA 2NLRA 5B3SB 2LO1A 2BNOA 1W0PA 4XAEA 5LHGA 1XL4A 3FAVB 2ZX3A 1ULPA 5C6CA 1LHNA 1W2AX 3WNXA 1LOCA 1K33A 2RDSA 3Q8BA 1FMD3 2FD8A 2GP3A 2D6LX 5IFTA 3CC2V 4CDQB 3BOWA 1A6CA 5L7OA 5FPRA 4O2AB 4TLFA 3EJKA 1Y9MA 5JI9A 4XABA 4DR2O 3CMGA 2OZ6A 1O4TA 2A70A 1RITA 2WZR2 4YZ1A 3E6CC 4DR3B 4B7EA 5F2VO 2F4LA 4WM7C 4Z8BA 2RS13 3X29B 5CFDA 2ZAAA 4OXSA 4RN5A 4IV3A 2ZINA 1RMU3 1H2LA 2KXLA 1ENQA 5FZ7A 4X66O 4YRDA 3LSDA 4BLIA 1VAKA 1PGL2 1WWYA 2H6BA 5K0UA 1UPIA 1W6PB 2KG7B 4PLMA 3U78A 4B1LA 4FFBA 3J7AU 4UWDA 2L35A 1UF2C 2DFBA 2VNVA 4AQSA 1JA8A 3GALA 1PO21 2A7WA 2JK5C 4JV5O 4XBFA 5JZGB 2GNBA 5FZBA 5JCOC 3U11A 3ST7A 3H01A 1JYWA 4CEYC 1W03A 2QVSB 2RMU2 2PHWA 1VBC2 5IK7A 2VW0A 1QLEC 3FHAA 3L2HA 1XNQB 5C3QA 1S0BA 2ZXWB 2ZX0A 1V6OA 1VAVA 5C9AB 3T2TA 5A3TA 3WUCA 3DC6A 4YHHO 2DBIA 5FMDA 1BKZA 3SR2C 4G2KA 4D7YA 2Z4FA 3G7DA 1QF3A 1SBFA 2EXIA 4FFFA 1AR92 4DO2A 1NA1A 1ND2A 3LEMA 1LOEA 2LRPA 1VBE2 3N9NA 2O8QA 5CB4B 3IDAA 4K8RB 1ONAA 2P1BA 4HK9A 2HWB1 4W8JA 2QM8A 4PELA 1M4WA 1IG3A 3AKQA 2RS11 2J1UA 1XL6A 3QF7A 3S7IA 5ABJA 2YIAA 3O1RA 1YFXA 3RYFB 1KXGA 5CKNA 5A32B 4R9BA 5A3MA 1VQ7V 5SV5A 1MS3A 4XFBA 2VMEA 4GALA 2HWE3 4NRQA 5LY2A 1BZKA 2A71A 4IW3A 3BEHA 2D6OX 2VUJA 1DF0A 3POBA 2D97A 3OYWA 1ENRA 1X59A 4FXKB 4FJCC 1AVMA 2IBZH 1LHUA 2VVDA 5GONA 1ASJ2 2P3JA 5AVPA 4LF6O 1AJKA 4QGPA 3OTOB 3I7DA 4UFLA 2R0HA 4P02B 5FP4A 5JIAA 3H8UA 3ZFFA 1OD5A 3L9DA 2D3OW 3AJZA 2P06A 2RDCA 4NAMA 1LOAA 4E4HA 5ABJB 3SGIA 3I5DA 1AR73 4XFGA 3OJBA 1KFUL 3AB0A 4FVVA 5GLVA 1OHHG 5JMCA 3WDTA 2YDEA 1FJGB 4AVBA 3VQYA 1WJZA 4EN6B 4LO7A 1AI5A 4H44B 1UMHA 2JDPA 1J3QA 2FDKA 3AG3C 5J37A 1RB8G 4X1IA 1UD1A 1RVF3 2P5OA 1P7GA 3B8MA 1I6XA 1W05A 2QUOA 5T52A 3PJQA 2B1IA 3FBYA 2P67A 1EP0A 2RJLA 1DTOA 4I30A 2ZT9B 3VHRA 1LHOA 1Z2GA 2DCZA 1CZVA 2WAOA 1FXKC 4NXMB 5JAXA 2PXJA 2IWGB 2R49A 1IBKB 3JU9A 2ZDIA 3ZDVA 4BLJA 1AR61 2W39A 3VD7A 3EVKA 4A7YA 1NJIW 1CAWA 1O6UA 4QIWF 2QDNA 1HLCA 4ES9A 3VZLA 3BB6A 2VQEB 1QJU1 4CP2A 5J09A 3H3UA 4EFEA 4XDKA 2JG9B 3MW3A 1US3A 4X1KB 3O14A 1URXA 1DQ5A 4X88A 5K4LA 1HRV3 5I8SA 2WLKA 1K3IA 3ZHUA 1URFA 5A6YA 4DK1A 2CDPA 5CIRA 3FE5A 3RZHA 1JBCA 4BM8A 1SFNA 5KA5A 3A4UA 1RUNA 3W5MA 1LECA 2VZOA 2J1RA 3WQ0A 1REEA 3KZIZ 3BY6A 2XHNA 4MGYE 1F4HA 1XREA 3OBAA 2Y6LA 5FYSA 1AYM3 3T4HB 1IS4A 2KA3A 4FQZA 2BZDA 3RYHA 2YIBA 4RL7A 4FM1A 3A0NA 4JHZA 1YJNV 4OUEA 2HFEC 1BEV2 1EZVH 3N9PA 2WT2A 4JASA 2XR4A 1B04A 3HKEB 3G6EV 2EIKC 2ZGQA 3TOJA 3VKOA 1XI1A 4IIJA 1NBMG 1J95A 2GU9A 2P6CA 1CN1A 2BGPA 2ZIOA 5FK8A 1WLWA 1JFFA 2FMDA 4YVWC 2RJZA 3CCMV 4NWWA 3D3IA 2VR4A 4M4PA 4YW5A 4D7TA 3WG4A 1ACCA 4CS2A 3VUOA 1YF2A 3E5QA 1OCRB 2ZZQA 2R062 1ROPA 1WCUA 2Q30A 4QGLA 1NVPB 2FBEA 4BMEA 3B69A 4YVSC 4MT8A 3P6BA 2RS31 4LBKA 4RGGA 3R4SA 2WO1A 1EPWA 2JWPA 5FOJB 4I9WA 4FPKA 5BNQA 3CCUV 5JJEB 4DR6O 3KHBA 2UWBA 3O0WA 3E22A 5JUVA 2E31A 2HWC2 2D44A 1S55A 2YB7A 2XG3A 1N1YA 3ZXFA 1K5JA 3B8NA 3Q9OA 3RDIA 3EHKA 3QH7A 2WNUA 1QVFU 1WCDJ 1VQ6V 1US6A 4Y1XA 2VNGA 4BISA 3POWA 4MO3M 1OLME 2UY9A 4DR5B 4N8MA 5ACA1 2VCCA 1GN3A 1CAVA 2R073 3T0DA 5H6RA 4Q4Y3 1I5YA 5C70A 4DV7O 1RVF2 1IBLB 1VMFA 2YBPA 5F7UA 5F5CA 4RR3C 5JXHA 1IS5A 4Y22B 1FOD1 2ZR3A 2FQPA 2J7MA 1IS3A 3MDSA 3TRSB 3WB2A 3T1YO 3OUSA 1YFWA 4XVHA 3K58A 3IWZA 1VLNA 4ASMB 3LFMA 3VBOA 2IH1C 4DEVA 2E33A 3ZYRA 5J2UB 1S0IA 4XF1A 5FZ8A 4FLUA 1D4M1 3GNEA 1O8SA 4R6ZA 3NAPC 4R4XA 5L36A 1S76D 4HK8A 1XJAA 4CDXB 2VXRA 4PDWC 2CH7A 4DRRA 3RQ0A 2QTOA 1XDCA 3Q8CA 4FOWA 1IHMA 4NXNB 4O2BA 2WWSA 5IT9N 4CDUB 4U3JA 3DUIA 2V09A 5FAXA 1QNWA 4LHSA 1IBMB 3J8F2 4QHOA 1HRI3 3FB7C 1H1MA 4LF8O 4DXSA 2J1AA 2AW9A 1JHJA 1GOFA 1K73W 1NCQC 1ZA7A 1E5HA 3K3WA 2ZKNA 1KJRA 3SCFA 2H0BA 3ON7A 1T6BX 1YRZA 3LSUA 3K0GA 2OUJA 3FHIB 5GZCA 5A7NA 2RE9A 4OUSA 3HR9A 4HYOA 3FC0A 1KECA 2DYCA 1ULOA 2ES3A 2WUHA 1W04A 2VQUA 1WCKA 3SEEA 3RZLA 1VRH1 3ZXJA 3I3BA 4HVOA 1VBE1 3MLKA 4N7IA 3LDEA 4W4ZA 4GX1A 2VMFA 1M1KW 4PD4F 1HJFA 2G1MA 4RUEA 1HNZO 2VTFA 1CIYA 2GMMA 5LMNB 1WUVA 4C90A 2IC1A 2WWUA 4LBQA 3K3OA 4O9EA 5FMBA 3OMIB 4QPYA 4QE9A 4Q6GA 1VQMV 2ERFA 1D4M3 3HN3A 2ADDA 5HFMA 4AHXA 1N1SA 4HSJA 1NLSA 5C7GA 2Z2SB 1N33O 1DYOA 1NTMH 1HQLA 1C57A 1GZ9A 4XE9A 2KG7A 4CXWA 4D6QA 4A44A 2VOKA 2W92A 3OY8B 3AP5A 1UZYA 3L70H 2KD7A 2IJKA 3H1WA 3DECA 2UYBA 4OCTA 4UCSA 1F15A 2Y6FA 2VUCA 4JGYA 3ETGA 4XF3A 4Y24A 3RMXA 3AG4B 5EZYA 4FPGA 5JI7A 5FPUA 3LZZA 4NB5A 5DPNA 3OE7G 1QR8A 1U5ZA 2RMU1 2QWRB 1NI8A 4C1WA 3BABA 2RR13 2CU5A 2EXJA 2ZHLA 3CRCA 3T09A 5LW9A 4AFAA 3ACGA 1ZUQA 4KHPB 3OR7C 5C3PA 2O57A 1QMJA 4LK7A 5A6ZA 4OVEA 2ORXA 1DYPA 2KQXA 4K9SA 3FAVA 2NLJC 3W7WA 2F17A 4KUMA 4FT8A 1R1BA 2ORZA 5FP7A 3T1CA 2Z42A 3BIEA 2XJSA 4YZ4A 1YEWA 4J41A 2C26A 2ZGKA 3K79A 4CCOA 3AL5A 1G8WA 2FZ2A 5EV7A 2RVAA 1BVVA 3I97A 4MVMA 1E5SA 1WLEA 3S30A 5DEDA 4O4IB 3FYEB 2QR4A 3V0BB 2E32A 3AYDA 3ETDA 4UW5A 1DLLA 3ZYHA 2YY1A 1MMMA 5CAZA 4IEWA 3ZYJB 2YXLA 3OGIB 2IJIA 5I0UA 4D7SA 4EN7B 1OD3A 5FWJA 4QU1A 4TN7A 3E6BA 4U36A 5G04L 1W6MA 4NPRA 1JZ4A 2N7GA 4UFIA 1BCCH 1VQLV 3I54A 4B3RB 4HZFA 2A75A 4AI0A 1GAXA 1C4RA 1D0HA 3HQXA 4XTMA 5FZKA 1NR1A 1SLLA 2Q1ZB 1RVF1 4XPVA 5JR2A 1LOGA 4D6RA 2GNDA 3MF9A 3ZMNA 2N04A 1OV9A 4BA6A 5FLHA 2XLFA 1KB9F 4EYUA 1TME2 1VEWA 2XOMA 3LUTB 1FXVA 2A79B 1UKRA 3NKTA 5DMYA 2BEOA 1T2XA 5EPAA 1WD3A 3LGRA 4PDLA 2IU0A 1OCZB 3ZN4A 5DM6V 3VBUC 3WV6A 2YI8A 4UF0B 2CAUA 2Z79A 5FY8A 5CBLA 3AP7A 4FPHA 4TTGA 5FQ0B 3HAGA 3JCIA 2ZEYA 4SBVA 3CCLV 3M3OA 2ZPXA 4KG8A 5L3EA 2DFCA 2P37A 3CEIA 4MUVA 1SRYA 4GQ7A 1W28A 5FZMA 5G05L 4EEQA 1GQHA 2NN8A 1Z0HA 1ULDA 2LFSA 3WT3A 2X6AA 5LK7B 3UCSC 3KGLA 4XUNA 2K46A 2BTOA 2FTKA 4K20A 5LZ6A 4ONUA 2QDOA 5JR7B 5FLXN 4I0XB 1OUSA 4EN0A 4PDRA 4PV1B 2WQZC 1HQWA 4CEYB 2LALA 5CKMA 2VQ0A 3LCPA 1AR62 4CE8A 4DPNA 4FAGA 3H1JH 5FZ4A 3JSLA 2JD4A 4W6XA 2LTNA 3G6JB 1SDDB 2P17A 1LU2A 1GR3A 2JB8A 5EIYB 4KGQA 2XPJA 4PCRA 1WZXA 2NQYA 3I2JA 2WNOA 3TEWA 4U7NA 2EAAA 4V2WA 1YTFD 1IKPA 5APAA 2BW8A 1R083 5JQGB 5BR8O 2PHRA 2B7YA 4AEJA 1CEZA 5C71A 4O4JB 5IJRA 1Q6HA 3B94A 3H0OA 2YBSA 3VL9A 1QLNA 5IJ9A 1LENA 3KS7A 4AI2A 2UXCB 4MXVA 4RGAA 1HJGA 2A7AA 3VBUA 2X05A 2GC1A 1N34B 3U4XA 1XE0A 4FZ0A 3JAWB 1PL0A 4EZHA 3LPGA 1XBFA 1QQP2 3SYPA 3RSJA 3MIEA 1L0LH 1RM1C 3OCPA 3E89A 2R1BA 1XPWA 4FLTA 4TV8A 3N9LA 3IMNA 4NHXA 2ZNIA 4KFMA 1BS3A 2DVAA 2EA7A 2WS93 4X65B 1B06A 1FOD2 3HOBA 4X62B 4JI8B 4DV1O 3JYCA 2WDBA 3V0AB 1H9WA 3U37A 1ZX5A 4QX1A 1XMQB 5FUPA 5EZYB 2EIJC 4B08A 3W58A 1RHI1 1Y76A 2WWWA 4BAYA 1GNZA 1V6LA 2GALA 2ZQMA 2FCTA 4LHLA 5KXBA 4DV6O 2W68A 1YXBA 3AVRA 3BALA 3WCRA 3KLSA 2E3CA 2TEPA 2VNOA 1B3QA 4A42A 4DR7O 4W65A 4Q8KA 3I3MA 2QQJA 2OPKA 5FPOA 2WA3A 2FCVA 2A9HA 2HYKA 4GMP0 3GZAA 1CZTA 2W1QA 1QQCA 1PVC2 1HW7A 2FDGA 2D40A 4DIQA 1W2NA 1ULFA 3RNSA 2CE4A 3IPVB 5C8CA 4O61A 3WW3A 4NMIA 2E7QA 3POSA 3I2HA 5LATA 1L8DA 4C7UA 2ZMNA 2P34A 1XYOA 4AI1A 2G4IA 2B39A 2WS91 1I7FA 1YIFA 1RUI3 3KMHA 2JENA 3T08A 3I8TA 4PIZA 4K3UA 3AK3A 1Q8QA 4XC9A 1UPSA 2EXHA 1JYVA 4UCOA 1L7RA 4FPPA 1RUJ3 4PDWB 2XBO3 4IHJB 4AW7A 5DUXA 2W08A 2XOKG 4BQ4A 3KV5A 1Y43B 3ZIWA 1RSOB 3N4MA 2DUOA 4I50A 3WF1A 2OS2A 1J5EB 2RM23 4X6QB 3MPBA 1BHBA 2KSDA 3T2PA 4CUBA 3KB5A 4OGQB 5LASA 5EC1C 4PQQA 2OW4A 1OZ0A 3PVOA 4YW2A 4R9CA 1JS9A 2PAMA 2C5DA 2JGUA 2CH7B 1FPN3 4JI6B 2XQXA 2EIGA 4C91A 4LIUA 3HT2A 2ZGRA 5GALA 3FB5C 1W99A 2YG0A 1M5IA 4LFAB 3UNPA 1MEC2 1GTOA 3ZSJA 4COVA 2JG8A 2YICA 1UN1A 2AREA 4IHJA 5DAXA 1HNZB 1MEC1 5H9RA 4YHHB 1ST8A 1AYN3 2ARCA 5J9PC 3WQ1A 3HT1A 4PBPA 4RA0A 3TXQA 1D4M2 5CA3A 4TV9A 3THTA 1S5JA 4XURA 3SJBC 2VQFB 3CZJA 5CKQA 4GULA 3M7MX 1S0DA 4WFAV 5FPLA 3KCYA 5T55A 2XKOA 3VV1A 2X29A 4NWVA 1K92A 3G4SV 2QDRA 2CGOA 3K04A 1PV0A 2A0LA 1R3JC 4J25A 3VDAA 2QWQB 1R3LC 3VDDB 5I0RA 2XAJA 1RJ8A 4YM2A 1W2TA 4XDLA 4FLXA 4RS5C 1UY2A 1N32B 4XIOA 1BMV2 2VW2A 1GBGA 4LOTA 4WM8A 5CBGA 2XLGA 1BK1A 2V7QG 1OCRC 5FLJA 4TSFG 3RYCA 4OUMA 3AMQA 3MYXA 4Y26A 4NIIA 3VKFC 1H8EG 3UJQA 1LGCA 1W9WA 1ZBA1 2ETNA 2QCSB 4JI4O 2MEV1 4E4SA 4P08A 3G67A 1GM7A 2JDNA 2JECA 3C7OA 1HX6A 4D94A 1VPHA 3ACHA 2X5IA 2YPJA 2I74A 2BTQA 4I4TA 3OB8A 1EV13 1UZWA 3ORJA 4YM1A 1XILA 1WW6A 5JSRA 4OI4A 3NNJA 5IVJA 4X66B 2WINB 5FZ1A 3ABKB 5C93A 4QPIC 4BMBA 3WDUA 4ZZ8A 5C3OA 3NW4A 5LP6A 3VD3A 4Y5SA 4YNIA 1UOGA 1ZZ7A 2XUMA 5IJ0A 2PF4E 1NR7A 4XF0A 2GN3A 5A70A 4XUOA 3J7LA 1CPYA 3WDXA 2PLV3 1E57A 1OA4A 5A6XA 3WG1A 5BNOA 1WMFA 1PK6A 4YPJA 2R9AA 3UM7A 1GNYA 3HKEA 1ZSPA 5FPBA 4H37A 3CCSV 3AK1A 5KC5A 1GKBA 4JRLA 3BCCH 4FM0A 1HNXO 1GZTA 3K59A 2Q73A 2Z69A 4AEDB 2LUWA 3M70A 1YJKA 4N43A 4HLTA 2D3SA 4QDSA 1OOPA 4SLIA 2LW7A 1O7FA 2PUSA 1W39A 1XE8A 3K2OA 2C24A 2FDJA 2UYAA 3I2GA 1UQXA 4JI3B 5C33A 3T4ZA 4Q4V2 5LGNA 4YJ3A 4YZ5A 1SLCA 3A7QA 3K5OA 2B4KA 4QQHA 1RUF3 3NNLA 4BQYA 2FMLA 4XCBA 5F3IA 2XJPA 1EBOA 1TME1 4H2AA 4YW7A 3C7HA 2QKCA 2EBOA 4X65O 3FMGA 2X6BA 2RS51 1OF4A 1F51A 4DR1O 5LMUB 2GV9A 4BWAA 3JD3A 1UZ0A 3VDBA 3KWVA 3PIJA 1Y6XA 2DCKA 1PO22 3RT3C 5KBFA 4YARA 1O91A 5DN2A 1Y3TA 1SZTA 4FZ1A 1C1FA 2P22C 2QWOB 2WLLA 3BUCA 4CCKA 4LPLA 1ZZBA 4UYBA 3N9MA 1THZA 1XNRB 2WN3A 2GMEA 4XUPA 3B00A 1W6PA 3SHRA 4LMFA 3Q8AA 1LOFC 3TAYA 5CBFA 3PHMA 4UT5A 2VRZA 4AG4A 3JD0A 3RZJA 4Q4Y2 3GF6A 5FZ6A 5C5UA 1HKDA 3CU7A 5CISA 4HMZA 4CH6A 3ZX6A 3D82A 2X53S 4RQPA 2OQ6A 3ABTA 5GW7A 2AH2A 3GYDA 4QX0A 4JI7B 3ZYGA 1TVGA 1AR72 1VBB1 2E5LO 3B7MA 5FXXA 1H2SB 1GK9A 5D5QA 5FO9B 3OG2A 1BEV3 2DV9A 3ZN6B 1ZBE1 2I2SA 3OF1A 3R4UA 4P9JA 4BJ0A 4Q29A 3M3EA 5K8SA 1B6QA 4CEYA 3MF6A 4M3CA 2WLPA 4K8ZA 1W8WA 1W3VA 5JJNB 1KITA 3TB0A 2VL4A 1AZDA 3UGFA 1QLEB 1OI6A 5J98B 4Y4RA 1JN2P 3HKDA 3CMEV 4FTSA 3IN9A 3KG2A 3PJYA 3H7JA 4I9QA 1PGL1 2B9ZA 2WLMA 3AX4A 4HBNA 4UBGA 5FCCA 1EN4A 4IV1C 1ASJ1 1VALA 5C8CC 2DTWA 4IE6A 1AF9A 4AQYO 1S3JA 3H42B 4W4LA 4QPJA 2E74B 5EBLC 1QJY1 2AZ5A 4EKWA 4KBBA 2ZKOA 3ZSEA 4EWAA 1YO8A 5LK5A 3A0KA 1KKCA 1COV2 3CJIA 4AR2A 4M4RA 1ZL8B 3TXSA 1PMHX 4DRXB 4FLVA 1VBD2 5CZKA 3BAAA 3ZR5A 3OTFA 4DV2O 3LA3A 2JICA 3DEMA 1FNYA 2EVXA 4O65A 5FZ9A 3RYRA 2PLV2 4HKLA 5CVRA 2YYOA 3VZJA 3KT4A 4PIXA 4RR3A 2WKKA 5JPMB 4PHZA 1BXHA 1UOBA 5FZAA 4TZDA 1TVKA 1POV1 3NNGA 1QQP1 1CPMA 2GNMA 1PX3A 1JMKC 4KWUA 5IAXA 1TGOA 2DE0X 3OUIA 5BPXA 3VBHA 1PIV3 5FXVA 4HETA 2RS32 2WNVC 5IYDO 4FCAA 2LQTA 4NROA 4DXTA 1RFYA 4DY3A 2EINB 3AZWA 4HAMA 4EZ4A 1XOUA 2JS5A 4TV8B 3M8AA 3H3LA 4AQYB 3WF0A 1YQCA 2AACA 3IBMA 2XMLA 5IT6A 2QJVA 5FMOS 1XHXA 2PAKA 4GKJB 1DGWA 4LF9O 1EUTA 5A7OA 4GB33 5LHHA 5C4WB 4Y33A 3N2GA 1GYKA 4ORFA 4DW0A 5A7WB 1PNLA 4KI5M 2GUZB 3N2KB 1Q81W 2BYVE 2QQOA 3T1HB 4WVMB 4O4JA 3ZRWA 5EXOA 5GJ6A 3UKVA 1T5EA 3D0SA 3SYOA 1HXS1 1M57B 3VGIA 1GICA 3L72H 2XAFA 3LDKA 1D0GA 4RGKA 2WA4A 1LAJA 1HR0O 2J22A 3ZXLA 3FHQA 2VQTA 2ZKLA 1H9PA 2C2AA 1C8M1 1S72V 3JARB 2MPFA 2XJQA 1V54C 4X20B 2WRAA 4FPCA 4TUYB 2Q0AA 4BDVB 4LFCO 1JOJA 3GCWA 2P4EA 2BNMA 4PDWA 3FKSG 4EQVA 2HEPA 4RHV1 3A8TA 1FJGO 4ES8A 3RVZA 2PI5A 1R1A3 4IEPA 1ZRDA 1K5MB 5E79Z 2WFPA 3W7UA 3TJTA 4MGQA 3GBFA 3O12A 4Q5OA 2ARHA 2W3JA 1ENXA 3MPPG 5FDBA 2AGSA 4PT6A 2D7FA 2IXCA 2OTJV 2WZPP 4CEWA 1KP3A 1UOJA 3EMRA 1PK6C 1O4YA 4UF0A 3CJHB 3ETQA 1CAVB 3IMMA 2OQ7A 4JKLA 4BH9A 5FYCA 3ZKUA 5KR7A 3E8GA 4NR1A 1CGPA 1XYPA 5H9QA 4CTEA 1M57C 2JDZA 3RBZA 5K0UB 2Q6AA 1KS5A 3O1PA 2QM7A 1FD9A 3STZC 3HNBM 3S6PA 3SYCA 5HCHA 5IAVA 4GD4A 2Q5TA 4MVRA 2TBVA 3NVCA 1AR83 3AG1C 5B4NA 4LO4B 1LGNA 2H6CA 4YFWA 4LT5A 5A7QA 4Q0SA 3PVBB 1P49A 4YJ3B 4QWNA 4A45A 5I91A 2VCAA 4O7XA 3CRAA 4OHYA 5SV8A 5D8AC 2XUEA 4X20A 4BIUA 3EO6A 5FPVA 1N47A 3ZHRA 4DV0B 2ZMKA 3LA7A 3V65A 1QJZA 2QKDA 4LE4A 3CCRV 1GNHA 5KXDA 3K5NA 2O1QA 3WNNA 3QD6A 1PHMA 5LYJB 2R063 2HEVF 4B3MO 2DCJA 4CP0A 4CUGA 1AJNA 1YUDA 3OGJA 1ODNA 4ITCA 5LA1A 5BNPC 2AGAA 2WO7A 2Q8VA 1WMEA 4Q4W1 3AMNA 2O0OA 1VBE3 4HKOA 4ZXKA 4XW3A 3JALB 3NWKA 3KV4A 3GWKC 3CS5A 5IJ9B 3TEZA 3ZRSA 5FRAA 4I55B 1AI4A 1AYN2 3JALA 3WUDA 5CG9A 1ZBA2 2C4XA 2HWB3 3MD0A 4TQFA 2BPA2 1AYN1 4BQXA 4ZHQA 1MEC3 4CPBA 4FFKA 1R64A 3E6DA 2FKXA 1C8NA 5DUUA 1JR9A 1PNKA 1QJY3 4DY5A 1RUD2 4QB2A 1B35A 4KNCA 4CC5A 1UU6A 1QJX1 4FP2A 3NV1A 1M93A 3MW2A 2Q8EA 2XT9A 2WBKA 1KUQA 4QX5A 3ACIA 3OD0A 2JKBA 2EIKB 5LBCA 5D5PA 3AM2A 2EILC 4MHUA 2O8OA 2JJ2G 2ET1A 4Z07A 5LB6A 1H8TB 5IY5B 4CDQC 3OAAG 1OCCC 1NKGA 2J1SA 5EK0A 3ILRA 3MIFA 1U5IA 4N53C 3P3NA 3IKWA 4EWDA 3T2QA 4L8QA 4X8PA 1Q5OA 2GSYA 4AL9A 3AZXA 1XNTA 2R043 2YC4A 5A3UA 1Q90D 4MXWA 1VBB2 3DV8A 4GH4C 2B45X 4YVWB 2FZ1A 1IXMA 1MABG 3CQOA 1S5HC 3AK2A 3MO4A 2D6MA 2ZIMA 4RO2A 1DQ4A 3R4DB 2XNDG 4JTOA 4GAZA 4LKFA 4LFAO 2MHFA 2UXBB 5JOXA 3FFQA 1O8PA 3VZNA 4J1XA 5FP9A 5HCBA 4MVZA 3RYIA 4P2ZA 3NJVA 1PGW2 4CP9A 1Z78A 3RZGA 1VQ5V 4URTA 3QO8A 1MNGA 1TA8A 5IUQA 3UESA 1V54B 1RC6A 3HPLC 4CC6A 1C5IA 3CCEV 2ZCWA 1FFTB 1DFQA 1OPOA 3W21A 3H9VA 5F3CA 3VZOA 2DVBA 4J1WA 5LA0A 4CCMA 4B7KA 2PQQA 4AWDA 1RPOA 3DYPA 5E89A 2Y8KA 3N7JA 4NIAA 2DYRC 3RVHA 5A1AA 3Q4HB 4CH3A 3JARA 2YXSA 3K46A 1ZM1A 4YLZA 1C28A 1W6OA 5JJJB 4XAAA 4FI9A 2NMNA 4GUNA 3CCJV 1LNQA 2UXBO 4Q0VA 3GM8A 4GJYA 1OPMA 3PNAA 4OZXA 1O5LA 4TLGA 2JGDB 1NVPD 3PMEA 1C8M3 1JODA 1TNRA 5FKBA 5D1IA 2K9ZA 1BSMA 1NCRA 4YM0A 3QG5A 1YLLA 2IW5A 3J8F1 2XWJB 5KX5A 2RG4A 5EFUA 1P7BA 4YW6A 3GZEA 3M8LA 3RS6A 1ZZ6A 3WDYA 2W0FC 2ZGUA 4B29A 2HHHO 4DR4B 2YHJA 3ML0A 3IT8A 3K03A 2RDRA 4KU7A 3LFIA 2H8PC 4OYUA 4JPRA 2ZEXA 4OHXA 3AZVA 5DN6G 2C6SA 3MUZ1 4YG0A 5LYJA 4CP9B 5DAWA 1QNYA 2DQ3A 1QHDA 4YWAA 4IETA 1HRV2 2OCCC 3B93A 2DURA 3PDQA 2OIGA 1VF6C 2K2SA 3APBA 4IEZA 3ZN0A 4BCUA 3O1MA 1IXBA 1Y7BA 2UXXA 1RUC1 1Y4MA 4CZSA 2IJHA 4QDRA 3L74H 4LF6B 2B5UA 4KWKA 1H30A 3WINE 2QFEA 1W9SA 1W0OA 2BWAA 2VCMA 4XQDA 4P00B 2EXKA 2PLV1 4MH0E 3VDDC 2VECA 4LNUA 4LF5B 1HB4A 5LMNO 2PI4A 5FLIA 2GN7A 4XETA 1IKQA 1RUD3 2EIMB 1WW4A 3GBGA 5LP6C 1OLRA 3WY6A 4WVZA 3A0HZ 1NZIA 1QJY2 4B3SB 4EB6A 3KF3A 4Q4W2 4UXAA 1H38A 3FLTA 1Z7S1 1DQ2A 4GWNA 3TYJA 3MLJA 3ASOB 5DAPA 1ULCA 4AVTA 2BOIA 5E6HA 2P3IA 1G1XB 4E27A 2OXBA 1ZBA3 2HWB2 1VBD1 2D2CB 4DINB 4TWTA 3T1LA 3RFRA 3FUOA 2W94A 1UY1A 1MS4A 4QB1A 2OYZA 4JYAO 1J1LA 4HT1T 3WFVA 4NXMO 3VBSC 4BYYA 1TUBB 1EPZA 2XL9A 3JCZA 1SBEA 5KUKA 4MVUA 4JRAA 2HG5C 1DGRN 2VCBA 3MLLA 1RUOA 2WZEA 5A33A 4CDWA 4OPAA 2R0FA 5AC91 4QGMA 4PLNA 5FY0A 4JTAB 1ENVA 1PZ8A 4JZ2A 4XACA 1HXS3 1HXS2 2WNVB 4DK0A 4UXNA 1H8HG 1CD3G 5K0UC 1UX7A 3MIGA 3FUQA 3O0VA 4AVVA 3OUJA 2JGDA 4IDZA 1NOVA 4UOJA 2ATKC 1OC1A 1YFYA 4BOWA 4A7KA 4J10A 2DUQA 1RUJ1 2EZPA 4QDQA 3T4VA 1K4DC 2VMHA 4L11A 4R7CA 1W6OB 3MI8A 2VM9A 3WHTA 1JU4A 4LFCB 1DGSA 5B1BB 2GH2A 3OEBA 3CX5F 1VRBA 1OH3A 1JYXA 2XB6C 4HKWA 3VQXA 1LULA 4C1XA 3HWJA 3ABLB 2NN4A 4LF5O 1JOPA 2JD9A 3PVEA 3U10A 4PDVA 1STMA 2JG9C 2RJ2A 4ARYA 4DV6B 3ABLC 5FIXA 4R50A 4PA4A 2ZR2A 4LH6A 4GA9A 4X1KA 4GKKO 4BPZA 1SERA 3ZFFC 3D36A 2UU9B 1CJDA 2M7WA 2ZHMA 3SCHA 4EV0A 2A3WA 3MIHA 4OHVA 3UJOA 3VBHB 2YI9A 4JQTA 5H2FZ 3GHMA 2JVDA 4I3GA 4IEYA 5LGUA 3MHHC 1S0GA 4WBNA 2ODMA 2QQWA 3E8HA 1TVKB 1SZXA 3FFZA 4E8CA 3PIGA 3UGGA 3ZXAC 1GN2A 3K3NA 2Q1MA 1VP7A 4ZS2A 4W4KA 4K1ZA 3I2FA 4NO4A 1YYNA 1MS5A 3RWKX 5FYVA 4QQLA 1BVP1 4YGDA 1QJEA 5FY5A 1GP6A 2RS53 4FAHA 1SQFA 3I2KA 2F93B 2CDYA 2HWD3 5IVFA 5LOVB 2WL1A 3FN9A 2Y69B 2XHBA 5L73A 4LF4B 5FV3A 2B8MA 1LHVA 3K75B 2JE9A 3LEIA 4NRPA 4TT3G 1W8TA 1DYKA 4ET7A 2VXJA 1K3EA 1UIJA 2Q8CA 1FFXA 2O14A 5FZIA 3R0RA 2ZOEB 1SFPA 1BEV1 4HVQA 2N05A 3HJRA 3FB6C 3K57A 1XOYA 1FXZA 3NNFA 4K21A 1W6QB 2RS52 4CSWA 3ZMSA 1NT2B 2HWC1 2PHXA 4FOQA 2AEZA 5LBFA 4LORA 5DG2A 4JGZC 1NH2B 5I0DA 1IBKO 4IEXA 1K42A 3N7LA 3CD6V 1FFXB 4M3CE 1QJX2 2PTMA 3POYA 2V72A 3WZ1A 1ZZCA 1WA4A 1UYZA 1WLDA 1N32O 2X5IB 4BU2A 4B3TB 1IOAA 2JDKA 1Q8PA 5F6LB 2R061 3SISA 4BWOA 4X1YA 2AEYA 2WT0A 4YIPA 4RQPB 4P14A 4NIGA 3POFA 5KHHA 3E5UA 2FL4A 3DXUA 4DQAA 4JDOA 1H1AA 1SPPA 5EJ3A 4XBNA 1BBT1 2QQUA 5F3GA 5CG8A 4HNAA 1OFSA 4M01A 4PBOA 4J7KA 2FMYA 1WLCA 3NR7A 3AP4A 2E7TA 1X8MA 4YVSA 2MEV3 5FUNA 3NJYA 1GP4A 1FKAO 4CH4A 3R66A 1COV3 4GX2A 4IGPA 4U2AA 4C0BA 1JYNA 1R1A2 2CK3G 4DR7B 1CIWA 5ISLA 1Q6UA 3E1F1 5A2QN 1CJPA 3AKPA 5JXJA 4WVVA 3L2YA 4IV3C 3UKMA 4LITA 3I49A 2WIIB 1JZ2A 5LA6B 4AXOA 3C7GA 2F66C 1QU7A 1WP8A 2VZQA 4K3AA 4EN8B 3GDBA 4FTBA 1LRHA 5IATA 5BV6A 2BTVC 3WNKA 2JRIA 3UO3A 2BGOA 2D5FA 1GKFA 1I94B 2VOWA 3N7KA 4QD2A 5FJHA 5T3NA 5BNOC 5AC93 3JAWA 5BY5A 1MVQA 1COWG 1F4NA 1NH2D 3VHOA 4ARXA 2X0LA 5EBWC 1XNCA 2VC9A 2P7TC 3ES1A 1CONA 3CF6E 4UI9L 3OBRA 4Y20B 2K0GA 1MZ6A 1BT8A 4LC1A 1I9RA 4XXPA 1HRV1 1WA8B 1QJU3 2UY8A 2DVGA 2GC2A 4JTNA 2VOXA 4L99A 1AP5A 4GKYA 3AP6A 3B01A 1MS8A 5KHIA 1DCSA 4CDUA 2ZGTA 4AHCA 2HJDA 1RUC2 4AGVA 1NQDA 1M56B 3LIGA 2WNUC 1YFUA 3CL1A 1K7DA 4S2GA 1HN1A 1D2DA 2F6BA 1X4TA 2GBOA 4HZ3A 4N53A 5KAIZ 3C90A 2XGXA 5FZEA 4WM7A 3N2KA 3ZXGA 5CB7A 2WLQA 2AENA 4XQ4A 5LCWL 4L97A 1W0NA 2A6ZA 2E53A 3KV9A 2PFWA 5LEKA 1SQGA 1NCQB 3VOUA 4BQ1A 4IEUA 4YW4A 1F35A 3LDCA 5F5IA 4JAUA 1H6YA 4QPGB 2Y0PA 3WDWA 1FXKB 1AR82 4I4TB 1DZRA 5FL7G 4LO5B 3WP4A 2CAVA 1BGYH 1AR81 1O4ZA 3CDZB 2Y64A 4H14A 4BQ5A 5FQ0A 4CS4A 3NJZA 3ZYPA 1PGSA 1DQ6A 3FB8C 5M0TA 5GTIZ 1GH6A 1LB2A 1F5JA 2G38A 2QQPA 1KFXL 4IGOA 4Q4X2 2JB4A 1NG0A 3HKBA 3JQXA 1SS3A 2YFUA 4GKKB 1TUEB 3OPWA 5FY7A 4W6WA 4F6RA 1OFNA 1GWLA 3VB9A 5C4WC 3CRRA 4E4DX 3E97A 4XJWA 4XBLA 3ZPYA 4R4ZA 1Q8VA 4XBQA 2MNGA 3I55V 3F5WC 4CXXA 5LL6Y 4KBZA 4ASUG 4LF7O 2VMIA 5AVAA 2DW4A 3WP3A 1QDOA 1UYXA 4A2UA 3LEKA 3QACA 4I09A 1ZTEA 1DF4A 1C8M2 1H8TC 1J59A 1MZEA 4QPGA 2JDAA 2WFF3 1IBMO 4M00A 3OGCC 3JASB 1NCQA 1ZRIA 3CCQV 1M90W 2BOBC 3TN93 4HPKA 3H8OA 4KP4A 2B1GA 4DUYB 3ZRWB 1AL22 2BSKA 4LHKA 4FPYA 1J3RA 1PK6B 3L73H 4RFRB 4I55A 3K06A 1W6QA 1FT9A 4CU9A 2Q9LA 1SLAA 3A23A 4Q0QA 5IJ0B 2PHTA 4JGSA 3K0DA 3OEHG 5IHRA 4HPKB 3LWCA 5LP6B 3I3QA 1UY0A 4O4LB 3WR0A 1R1ZA 1VJ2A 1YDXA 4O2BB 1F7YA 4FPLA 4AOCA 4MSWC 4NVPA 4E2LA 3LF7A 2W9XA 3MW4A 4Q2FA 1NT0A 4GCZA 1VRH3 1OJHA 2G9GA 4FLYA 2NR5A 3ZIXA 4B3NA 1QJX3 3BTYA 4HOOA 4N7UA 1HDKA 1GFF2 3ILFA 4WVMA 4B4RA 4JI3O 2YUEA 2UUCO 2YMZA 3LQCA 1RIRA 1DP0A 1Q7YW 1R082 3LIHA 4Z92B 1VBA1 1RUE3 5ITZB 1WNSA 1JW6A 3SDLA 5IVYA 4OMCA 5ACA3 4GWJA 4F6RB 3AYEA 3K5MA 4AYUA 4BE3A 4YG6A 1DGRA 3AG4C 4RD7A 4GX0A 4DUYO 5EBMC 5C8CB 5I93A 1Y9QA 5DDJ3 1W8ZA 5CYYA 3FZ3A 3O1UA 1YI2V 1AILA 4LOSA 3E35A 2BUKA 2YC0A 1A34A 4JGZB 3ZMZA 3OSDA 1HN0A 1KQSU 4A6OA 3AC0A 4JTDB 1REDA 4L8JA 2W1SA 3UYJA 4CEWB 2F43G 2E76B 4P9IA 1IQDC 3H1KH 3WQ7A 1X9TA 1LCLA 5I0TA 1UAIA 2JEUA 2GC0A 4MGKE 1XRUA 2IUWA 1VP6A 4JAAA 4M0HA 4ZONA 1UU4A 4X6RB 1ZLZA 5CEHA 2AYHA 1F23A 2VQFO 5IYZA 2UWAA 1F9KA 1UZZA 1TMF3 5FZGA 1K5MA 5LEJA 1O9HA 5FUIA 4F6EA 2JIZG 1G6UA 4UCRA 5BYNA 1VMHA 4WFEA 1FOD3 4G27B 4KL1A 2DVFA 5F1RA 2VU9A 4QX7A 2DU0A 1RP3B 1ORQC 3GJAA 2V5DA 2R72A 2E5LB 1I5ZA 1FXKA 2OKXA 1WW5A 1UY4A 1ENSA 1MS1A 4FMTA 3EB7A 4AFMA 1HV1A 3GBWA 5LY1A 2KB1A 3OT7A 4DUWA 2W6JG 4FP3A 3AYCA 3T2MA 3ZX7A 4H33A 2A5ZA 4LFBB 4WFGA 3GWOA 1Y66A 3HIFA 4OULA 3J4UH 5CNAA 3ZXKA 2LGQA 4ZU5A 3WF4A 3VBRB 4UVAA 2WABA 1W2OA 5JVVA 3DPRA 4CPBD 1XB9A 5HPOA 1WN7A 1OBNA 3RVYA 1VB4A 1VMGA 1UU5A 4XHXA 1WA6X 3NAPB 3NRUA 5C5TA 1DK1A 1QXJA 4XJ8A 1VQPV 4RYDA 3USUB 2A3XA 1OQ1A 2GDFA 4I0AA 5KXEA 4UCVA 1GLHA 3CXCU 3WD5A 4XDJA 1ZRCA 1DHKB 3AG7A 2VBBA 1JZ7A 4LJHA 4BXFA 4Y22A 1KU9A 5JDBA 5DZGA 3B02A 4I2OA 4XIKA 3PJSK 5IVVA 1OQEA 5GLUA 1HB2A 5IYCO 4ZOLB 4XUTA 1ND2B 1EFRG 1BCXA 3WHUA 1QGLA 1H2MA 3ZKYA 4JGYB 1PNFA 3K51A 4QX2A 2EJ7A 4R9DA 2WQ8A 1CAXA 3R65A 3KVBA 4QQPA 2VZVA 1M9NA 4CS3A 4XMIA 4DUVA 3H8RA 5JIUA 2P4KA 4DV5B 4QXBA 2R1DA 2CWMA 4RS5A 3RRDA 1N33B 3KF5A 1WCSA 4QB6A 2BFUS 5JLVA 3W7SA 4NTWA 2OWOA 4WBNB 4OI1A 2J1EA 1NXD1 4OFGA 5LA6A 5JOZA 2PZSA 1LGBA 3GB7C 2ZS6B 1TMF2 4LEJA 1IS6A 1XMOB 4FFHA 2UXNA 4V2VA 3BRCA 3ABMC 1JZ8A 4X1YB 5H9SA 1JUIA 2E75B 1CAWB 4IE5A 4DR3O 1VQKV 4J9ZB 3VBOC 4C0HA 3ZVXA 2Q5ZA 2JS3A 2JX9A 1KC8W 2WLJA 1B35B 3CRMA 4N43B 2FHRA 3INAA 2XVKA 3WG3A 5IY5C 2C0ZA 3T0AA 2VNRA 4DS0A 4YVSB 1QU0A 4AE2A 2XASA 3CWBH 2HEWF 2NPIA 4P9OA 1MSWD 5FK7A 1FXHA 1D2SA 3DGEA 3BA9A 1K45A 2HBTA 4AHZA 5KMGA 1F4MA 5BNOB 3OEEG 2UXDB 4EFBA 3DPRB 1QH7A 4BK4A 5KX5B 5ANQA 5FZOB 1WW7A 4ABMA 4Z1VA 1F31A 1W2BU 4M3CB 5DXDA 3WQBA 3ELNA 1R3KC 4H3WA 3JD2A 4EWEA 2JDIG 2OCCB 3D8CA 1DLCA 1ZX3A 4IEVA 3JAKA 4K1YA 1W06A 4O4LA 1GP5A 4RUFA 1J1TA 1SLIA 3SPGA 5FOBB 3RYHB 2D3RA 1R093 3N3HA 3QVNA 4XOGA 1N3QA 1W6NB 5FKCA 1TZOA 1WA8A 3RG0A 4TWKA 2DCYA 2WYFA 1E1RG 1ZNPA 3ZMUA 5FZCA 5JMOA 2W47A 4DFSA 3RI9A 3O65A 1FX5A 2OIIA 2N74A 1AI6A 3GHNA 3OBTA 5BMVA 2ZTNA 5EQUA 2ADQB 3IFXA 4R9AA 1YQ6A 4MZUA 3ACLA 1YWKA 4LA3A 5L7OC 4WV8A 4ZS3A 4H0LB 3IDEA 3O1VA 1ZZ8A 1XUQA 4LF8B 4AQ2A 1Z5VA 5J3UA 2EICA 3C3VA 4CUCA 2ZGOA 5FTTC 2VBPA 2IJJA 4RQFA 1SBDA 4LTAA 3THCA 2QZ3A 5BNPA 3LOBA 2Q8DA 3AVSA 3DL3A 1R3IC 4UUJC 3STLC 3AFGA 2NNUA 1CAUA 1O3SA 3GJBA 4DNYA 5L3GA 3BTXA 4J6GA 1K12A 2ZM6O 2YV8A 1UXXX 2OT7A 1JXNA 4XILA 1E1QG 4LO8A 4LLFA 3O0XA 3G6BA 2W46A 4L87A 2CDOA 4K8XA 2A06H 2EILB 3RI8A 5I8TA 1DF5A 3FLRA 1BMV1 2BE3A 3SPJA 3WDVA 4ISQA 3ZJZA 1W90A 2HWE1 3HKBB 2W87A 1BZWA 4QPWA 4AHYA 2IU3A 4DUZB 3ZFEA 2DYRB 1IPSA 2WWJA 5ITZA 1JZ5A 4FOVA 4YGCA 5EP9A 2UURA 1LUVA 4ZOLA 1ZL8A 1MVEA 2ZXQA 2LW1A 1KBHA 2NM1A 4COWA 4DYLA 1YJWV 1RUJ2 5FO8B 4ZHNA 2Q4PA 4I0BA 3A0RA 1ZA4A 4CCEA 4HL0A 4Q4X3 4B1MA 3ZIAG 1H0BA 1NE6A 3HD8B 3W59A 4QU2A 3NNMA 4BW9A 3JQWA 3WW4A 4MVQA 5CA0B 1QVGU 2WO2A 4BQWA 5JZGA 2VPVA 4IE0A 1OOPB 2H3OA 1VE0A 4LKSA 3USUA 3AG3B 2JG8C 4AFCA 1XNDA 4Q4X1 1AR4A 2QQKA 2VE1A 4CDWC 1UFIA 3VL8A 1SA0B 2A3QA 3RPQA 4FFBB 3O1OA 3ZFFB 4M0NA 1QBZA 1HRI1 2W6IG 5H9PA 4LNVA 5BMVB 1AROP 1HB1A 1SLTA 4QM8A 5K1PA 4CH5A 4IV3B 3PVNA 3PURA 3SJAC 5F2WA 4A4AA 4PA9A 4X8AA 1DQ0A 2F95B 1FATA 2Q7GA 4XYXA 2ZM6B 4OPHA 2YU2A 2VW1A 4NHMA 4O4HA 3FLPA 4NJ4A 1WMDA 3AKRA 3PLQA 5K1XA 3B09A 2VVEA 4UW6A 1ZRFA 3TN92 3ECQA 3UKNA 2LJ2A 2VTXJ 2W91A 2H0VA 2RR12 2K9PA 1NLRA 2RDNA 4DO0A 4UW4A 1WBLA 1PO23 4CDWB 5A33B 5TSWA 1V0AA 2HKXA 5IVEA 3H1HH 3DXTA 3NV3A 3I59A 4QKDA 1JMUB 2WQ4A 4LKDA 3VHNA 3Q8EA 4YM3A 1POQA 1L3JA 5EJ1B 4KGGA 3IM0A 3WNOA 3J80N 4V1PA 3LNNA 1V6KA 4JAVA 2BVVA 1YXWA 1QJU2 3F7VC 3ABZA 1H8VA 1X7NA 4CU8A 3CJIC 4L0PA 5GLZA 3VHPA 1A8DA 1QNMA 5C8YA 3ZFGA 3CC4V 1S0CA 1LUWA 3VLBB 5J36A 3UV9A 1VQ9V 3VZKA 4QQ2A 1OURA 1SQXH 4MTOA 2WZR1 3D6EA 3IC9A 4CZZA 3KGZA 3ROUA 2QQVA 2D43A 3ASNB 1CVNA 2CNAA 1RUG2 4GB32 3CHXA 2ZNJA 4NKGB 3BOPA 1RUG1 4X9QA 3ASNC 3C7EA 1P84F 3I59B 1S1AA 1XSQA 2PMWB 2NMOA 2Y48A 4UFHA 2R32A 4UW3A 4WFHA 3POEA 3AXEA 3L9JT 4N53B 5GLWA 4A3XA 5JVDB 1OT5A 3J7HA 3SQOA 1JHNA 4JYYA 4D6TH 2GTAA 1FV3A 3AMPA 1VBC1 3KQ4B 3MV11 1CXZB 3VBRC 3LB9A 3MHZA 4O2AA 2QQNA 1WPBA 1L0NH 3UT5A 3LOIA 4PIYA 1VIWB 3RMYA 4LLOA 5B1NA 4OQ8A 5LRRA 4LF7B 1K4CC 3QCWA 3C2UA 2JIGA 1EY2A 1RL3A 3MGUA 5A7WA 5IK5A 1PKXA 5IVCA 4YJ2A 2IVJA 1R1A1 2ZAHA 1Y74A 3JD1A 4PI0A 2EIBA 4GT1A 1VBD3 3FBMA 5GM0A 3SPHA 4XEZA 2WSUA 3AYAA 1VMJA 1QIQA 5IVBA 2YUAA 1AYM1 1A78A 2DUPA 1VF5B 1KQRA 5D21A 2FB5A 4JV5B 3SITA 2ITCC 3SXWA 3ZM8A 2VQEO 3WG7B 1SC5B 3EXUA 1N34O 4HONA 2A6XA 1FV2A 4HN0A 3OMNB 3JXSA 4QPGC 4P9XA 5CADA 3WP6A 2HH9A 5AFEA 1FYUA 3BU7A 5B1AC 3RWRD 3ABUA 3S3WA 4XJAA 1GZWB 2RN9A 2L9LA 5J2TB 4QPKA 2V73A 3WF2A 3TK1A 1NY71 1O3QA 1TAEA 3H1MA 2V1DA 3JD4A 3SPIA 1XMQO 2JDMA 4YVWA 5EYXA 4UFKA 5EHDA 2YZ4A 1YSCA 2WLIB 4WBBA 3KKYA 1N4CA 3URFA 4S2HA 4CYDA 4LWSB 2LM3A 5FY9A 4ATFA 5ERLA 4AGRA 4RWUA 4RHV2 1L1FA 4XXAA 1XYNA 3F95A 3PUAA 1PVC1 4I01A 2BDRA 3UETA 2JJ1G 2VOTA 1SPPB 4IEOA 2ARAA 4Q26A 3VDDA 4NE9A 2VMGA 4Y1YA 1CAUB 3E2EA 2ADEA 2F4PA 3WEZA 2WS92 3ACFA 2IFRA 1H2NA 4XFCA 3KT1A 1GO3F 4X62O 3QBQA 2Y6HA 4GWMA 1PPJH 5D8AA 4N9IA 4LUKA 4N9HA 1FI2A 3NAPA 3AMHA 4Q1PA 3H1IH 1O9GA 1UYPA 4JI0B 4FFGA 1UIKA 3KHCA 5BXXA 1D2QA 4K35A 3F2ZA 3VBRA 2WPDG 4FPJA 4TUYA 3G71V 4ZPIA 3ZR6A 1RXFA 4MV2A 2ZD9A 2ZX4A 1AXKA 5FBJA 4J11A 4FSJA 4HFSA 4U3FH 4MGZE 4XTPA 3K4DA 5B66Z 2DJVA 2IZWA 5FP3A 5FREA 4FVMA 2PHUA 4AFBA 4UAPA 3A0BZ 2Z0AA 1KD7A 4DB5A 2WNVA 4E4EA 5KHGA 1MG1A 3GGLA 2VY0A 2R7EB 1J83A 3AEIA 5A3LA 1EN6A 5L9BA 2XAHA 2GUZA 4LP8A 4S2DA 2HWE2 4J80A 1KJLA 1UPGA 4CU7A 4UFZA 2ZCEA 5EJZB 4Q27A 4FBFA 3QO5A 1DGLA 1QOTA 3UK9A 2B9UA 4RQEA 3B77A 4A41A 3DCQA 5KXCA 1Z5WA 2HWD1 2DWEC 1E5RA 1Q82W 4AK3A 1RJ7A 5JXIA 1YQ8A 2PAEA 2FDIA 1HNXB 2GAUA 4X64B 1K5MC 1ZAUA 4DV4B 4UFJA 4IQPA 5L9VA 3BFRA 2HBUA 4HVRA 1S0VA 1SHWB 2HVJC 1TE1B 1JH5A 3ILNA 4L2NA 3E5XA 4EJRA 5BXZA 5C8YB 3ZFGB 4BW5A 5GLTA 3WF3A 2A73B 2YXYA 1OXCA 4XJ9A 2UUBO 2VWKA 3W5NA 4QPIB 3K08A 3POGA 3L75H 4JTCB 2HLEA 3WCSA 4NHYA 4RR3B 3T1MA 3U75A 2MW2B 1BBT2 5DECA 3LDDA 4NN0A 5C8WA 3S5QA 3O1SA 1AJPA 4UB8Z 3U07A 4HNAB 1LJ7A 1MS0A 4DV1B 3OPZA 2XVGA 3ZN5A 3C3TA 3BCWA 1PMJX 5J2TA 4IERA 1QOOA 4MGSA 3S7EA 4I3PA 1Q86W 3B4SA 3OMAB 1AVBA 1SQPH 4KXRA 4LF4O 1D5NA 4AZZA 2IXLA 3QOPA 4MTFA 3OGSA 4XF4A 1S2KA 2YGMA 3APOA 4BIZA 5LA2A 4CEWC 1W8OA 1HRI2 1RMU1 4LIVA 2VMDA 4LBOA 2VGDA 4PI2A 3LSEA 5H5NA 2WAMA 4F7ZA 2WSVA 2VMCA 2VS0A 1BL8A 5FYBA 3T4DA 3VBBA 1QXPA 1V9PA 3KCCA 4AILC 4QM9A 1WMXA 4ISRA 3PU3A 4YW1A 3KCXA 4CCNA 4FLZA 4XFIA 2C9KA 1FAYA 1NCRB 4JHTA 1DDLA 1OA2A 1RUF1 1LOFA 3MFCA 3R6SA 2DVDA 4UB6Z 3OM3B 5B2GB 3OEAA 2VZ3A 5FYTA 5FZLA 1PMIA 2ZGPA 3O1TA 5JOYA 2BVBA 3ZMVA 2PQSA 2X7RB 1GM8A 3ZHVA 2EZOA 2JDUA 4D69A 2P3YA 1P4RA 1SDWA 3I3EA 1S0EA 4Y20A 1PNMA 3C8XA 5DAVA 3W9AA 3S3XA 2XTAA 3HN1A 1TME3 5GKAC 3DYMA 3DKWA 2HJIA 4OI2A 4IL6Z 5EIBC 1PIV1 3WB0A 4JKMA 1X36A 2HVKC 2Y0OA 4ZBMA 4QPIA 1MSDA 4MOAA 3AFKA 4XCAA 4Y5TA 3JAMN 1N36B 1V9U1 1Y76B 2XJUA 2D5HA 4LUMA 4PJYA 1AL0G 3OOXA 1W59A 3UQ8A 3CJHA 5CBHA 1JOYA 1EV11 2EIDA 3O9OA 3CMAV 1A32A 4IV1A 3ENRA 3M4FA 2BCCH 2RMU3 1QXRA 1RUC3 2V5YA 4BQ2A 2ET7A 3CC7V 3CCVV 4TYSA 2GH8A 4FM2A 1PO13 1PP9H 2WNUB 3PTRB 4RAIA 2OPWA 2VD7A 4RQPC 1IBLO 4BR6A 1AR63 4QT6A 4N90A 3SH4A 1S0FA 3ZRVA 3ZHSA 2R16A 3HKDB 4MSVA 4PQ9A 2J1TA 3EXAA 1GOGA 2JG8B 4GMP3 5I8YA 2VH9A 3WSOA 5E16A 1AXZA 4IIJB 1I08A 1OQDA 1EAH2 3TEYA 4D0QA 2UU9O 2Q8OA 5A3PA 3RYPA 5FZHA 3P32A 2VUDA 4JI5B 3BVOA 1Z7S2 3ASOC 2P4VA 2RDQA 2KR2A 4O4HB 4UBHA 4Q0PA 3QH6A 4GJZA 4O4IA 5DZFA 3SJQC 2XAQA 4CDXA 2BBAA 2NP0A 3AK0A 1VB2A 1QEXA 3BTZA 2YS8A 1WGPA 2VO5A 1M4UA 1I0HA 1W8UA 2CTPA 2RNBA 1BYHA 1OCCB 1RSOA 4JYCA 2A6VA 1NX9A 2VWJA 2UUCB 1NXMA 3ABMB 5F39A 3AMMA 5I0SA 3OYWB 2Q69A 1LODA 3AKSA 4FPOB 4LO6B 1AL21 1GSLA 2YIDA 4P9GA 2UXDO 3BPSA 1LKNA 3GCXA 1OCZC 1GOHA 1NE4A 4H7LA 3CRQA 1ZZ9A 4LCUC 3MHSC 1WCQA 3VBSA 2XDVA 2ENRA 4NIHA 4AEDC 5C9AC 3CP1A 3QTCA 3CYOA 1VQOV 3H1YA 3RJRA 5A6QA 2QE3A 1CPNA 2OX0A 1NY72 1WPXA 4AVSA 4JVAA 4LHNA 2QWNB 1K5QA 5AG2A 2V4DA 2RM22 1X9PA 3VKLA 1ND3C 1YC61 1EM1A 1DGWX 4NHLA 1B35C 2EIJB 3VBFB 1R73A 4XHBA 2ZE6A 3CE2A 1TQ5A 1Y9GA 1V6MA 1FYJA 1LHWA 1BHGA 4NIDA 1VBA2 5DUVA 1H4HA 1JYIA 1PM7A 4AGGA 3DPRC 2XH6A 2PGGA 2YEVB 4AI9A 3ABKC 2PY5A 2X6CA 4N21A 2HWC3 2WLLB 4AAPA 1G9FA 5JWPA 2AZ0A 4A5UB 1XQNA 2JDYA 1GN6A 3IAQA 2VBDA 1NQTA 3AP9A 5DZEA 4JI5O 1S5LZ 4I5SA 2SBAA 1KGYA 3BA8A 4JI2B 1YCIA 2Y38A 3LA2A 4WF9V 3ZO0B 5KC6A 1RUF2 4LK6A 1SLBA 5J7MA 3SKVA 5JH7A 1BBT3 2JIJA 1KDMA 4LBQD 1IVSA 2VAUA 2CYFA 4LBMA 4JKKA 1JQ0A 4B3MB 4IGGA 5ANNA 4K0KB 1S2BA 4QKBA 4JI1O 1OF3A 5J96B 2HHHB 4DR4O 5E1AC 3T0BA 2ZE7A 3K77A 2X8KA 2WLNA 2QKSA 4X1IB 1Q8SA 4WM7B 3LE0A 1CR7A 1TNFA 2WFF1 1DQ1A 2WN2A 3PN1A 2BBVA 1MQTA 1D5AA 1A8MA 2WFF2 3D3QA 4K40A 1PD3A 1ZREA 1QHTA 2R30A 4JDNA 4MW8A 3UT0A 2R071 3X2QB 5BR8B 1UX6A 2Y33A 2I45A 1ULEA 1GRJA 3AJYA 5JSOA 1UMZA 1V6NA 2QBXA 5T5PA 1AR1B 5T5JA 4ASKA 3SPCA 4ICGA 3R05A 3I2DA 1UW8A 3VQWA 5FP8A 4DV5O 4F83A 4JI4B 1CX4A 2WSSG 3ZMTA 1AB3A 1JCHA 1XSRA 3W20A 1MOFA 5LHIA 1EAH3 2P6HA 5FYMA 2OVUA 3J26N 4DUZO 3UKTA 2HWD2 4Z82A 4B3SO 2VVFA 4I02A 4ZY9A 3OY8A 3TCUA 1ZBE2 4ZI7B 2HWF3 2H94A 1BQ0A 4P9PA 2WT1A 4LXLA 4QXHA 3EBRA 2VZPA 4IYHA 4OI0A 2XKPA 2BERA 2ZEWA 1YITV 1OKOA 3I3DA 2RS33 5IDJA 3PMSA 4D3WA 3OW2U 4IV1B 4PF1A 3PTYA 1SF9A 2XXZA 4CCLA 4OHWA 1K5SA 2E63A 4LH7A 3H1LH 3MFAA 2ZABA 4DW1A 3AKTA 4LBQB 3WX5A 4EB6B 2CHHA 3E86A 1OHFA 3J81N 3NO8A 3I56V 4Z2AA 4U7OA 3ME2A 1SQ4A 1W0KG 5FYHA 5FXWA 4QQOA 4B3TO 4E2SA 2EAKA 1HIXA 1NUKA 4NPMA 2VZRA 1BJQA 1OUXA 2VZ1A 4GWIA 3WP5A 1SETA 4LNUB 5F2SA 2ID4A 2XQRA 4IE7A 1GQPA 4WVWA 1NTZH 4GKXA 1YIPA 1PL4A 2QJ1A 1J5EO 1W2UA 5CU1A 3HNMA 2Q4SA 2HYXA 5H9CA 3OTOO 4LBJA 4E2GA 3VBFA 3ZHQA 1N3OA 1GM9A 4A3ZA 3LPFA 1T6GC 2PHFA 1PO11 3EHBB 4G3YC 1GQGA 2WO3A 4AQ6A 4RHV3 3Q8FA 4AEDA 1RMU2 1AYM2 2R70A 4TV9B 3CB2A 4QX3A 1VQ4V 4ZHQB 1UKGA 2VQAA 5DG1A 1FPN1 1CWPA 3ZLIA 1F4AA 5F8PA 1U0AA 4Q4W3 1Z7S3 1YHFA 1ZYBA 3P3PA 1HB3A 5CFCA 3PUIA 3ZYIB 2R9RB 4YG3A 3OUFA 3JD71 4BXSV 4DV2B 1C1LA 3HQUA 2YU1A 5B5EZ 2RM21 5C4WA 4CUAA 1N0NA 5F37A 1QH6A 4TQDA 4QJFB 4FPEA 2BV4A 1H4GA 3K48A 3WOGA 3M99B 1TUBA 1YVWA 4U3JB 1FMD2 3NKGA 4GX5A 2UU8A 4H13B 1FPOA 3BGAA 5B3SC 5A32A 4XDOA 5L19A 3FJSA 5DDJ2 1D7PM 4DR1B 1S4CA 5FYIA 1O3TA 2Q7HA 4JZRA 1U97A 2AR6A 5B4XA 1I94O 2IH3C 2DCTA 5GTHZ 4DV0O 4MVTA 3ZDSA 1B09A 3B9CA 3JAKB 5F5QA 4Z2WA 5FXZA 3ALQA 4TSVA 4DR5O 2YBKA 1UZVA 2QA4V 5KA6A 1X82A 4QKFA 4B8EA 3D4KA 4MGIE 4Q4V3 3VBOB 4N23A 4AEKA 2ZDIC 4QAWA 2KM2A 3RYCB 1YNAA 4N43C 1QDCA 3U14A 3D36C 2KKWA 3SEPA 4BHPA 4LF9B 1E5IA 1SCRA 1KKDA 1RPRA 3RYIB 1V70A 3IIAA 2JEMA 5A7SA 5ABJC 2Q68A 1QQP3 1BK0A 1POV3 2DDUA 3ATGA 2QEXV 1G9DA 1PGW1 1HNWB 1JYTA 1Q6IA 4LR3A 4ZXEA 2ZX2A 2GMPA 1K97A 4RFT0 3DGTA 3I4IA 3SC7X 1QKQA 4BZ4A 2P5BA 1XNQO 1G9BA 4URAA 5FZDA 4QHBA 4JI2O 3LEGA 3ASIA 4JGYC 1RTVA 3OPTA 2AUYA 4QXKA 1UYYA 5IWAO 3A21A 4K8FA 4LE3A 1R6KA 1NAEA 3H7YA 1WLTA 2ARXA 1M56C 2DTYA 3TGUH 3MEPA 1S2EA 1RUH3 5LRSA 5FPAA 2AHZA 3WW1A 4YY3O 1GMMA 2PA7A 3JSNA 2WLIA 5LBQA 1NQJA 3N9QA 3VKMA 3T30A 2OTLV 1W8HA 5F6KA 2Y6JA 3OBZA 2GHYA 4NHKA 4XDPA 3BU0A 4QNHB 4DZGA 1EN5A 1MZ5A 3RZZA 5K7PA 3DC5A 2Z5UA 3M7AA 1OLQA 4B4PA 5J1XA 1AI7A 2XBO1 4GB31 1R092 4AF9A 2D6PA 4CP1A 3EQEA 4BQ3A 4I50B 2DYSC 2Y6GA 1ND2C 1QY4A 3SYQA 5HXVA 2GTSA 4R52A 2VG9A 1H2KA 2F4VO 1VBB3 1F8VA 3N2GB 1XQ8A 3KT7A 2IVIB 1Y74B 2E26A 1JYCA 1J3PA 3B3QE 1CZSA 4XFAA 4FFIA 4Q20A 1VRH2 2PHLA 3JB4C 5A3NA 2YC2A 1L7QA 4META 1X50A 3MUY1 3JASA 4AEMA 1GUIA 5CFCB 3HPNA 2W1WA 3LSSA 4YGEA 5IW0A 3PUSA 4MG2A 1CP9A 3GZUC 3MDPA 1AX2A 1QR9A 3BPZA 2TUNA 3EFFK 3HVDA 1W9YA 4LBLA 3IC7A 3NQHA 3WNLA 3TWIA 3IAYA 2P6JA 4DV7B 1DIWA 3LKJA 3NSTA 4NYKA 4GKJO 2F23A 2HKOA 3USSA 3K4ZA 3CLPA 1HW5A 3U4SA 4FTEA 2GZWA 1OCOC 2CTVA 4JI0O 4K7JA 4KHPO 1N0JA 1IG0A 3KZ4C 1Q8OA 3CSXA 4GXLA 4GLXA 2Y69C 2XWBB 3IAPA 5T5OA 5AC92 4MVOA 3O5SA 4LR4A 1U12A 2W5FA 1ZRRA 2FYUH 1SG3A 2BWCA 4GH4B 3P5BA 1E79G 1XC6A 3V64A 3V0AA 5D2AA 1XEQA 2GP5A 3D5OA 4QX8A 4XUQA 3WW2A 2W95A 1JZ3A 2GSMB 2ZMLA 5EIBD 2QGNA 4QKNA 4L9BA 3TEXA 2ZHNA 5IWFA 1PZ7A 1SQQH 1JPXA 5T5LA 4UFMA 3GXUA 3NXSA 4HXCA 4Q4V1 1YTFB 1FMD1 4IXLA 3HBKA 3V0BA 4OX9O 3K9SA 3ZCCA 1PM4A 1RUH1 3RYKA 2E9QA 2LW8A 3P1IA 4DXRA 3ZSLA 5B1BC 3AG2C 1YJ9V 1HDJA 1UY3A 5IFPA 1AR93 4DRVA 5LXTA 3S5AA 4ZI7A 1QWRA 2ADPA 3CO2A 1ZBE3 3WNPA 1J58A 3M3QA 4DV3O 2AZ2A 3RN4A 4YW3A 4XF9A 5IYYA 5HFLA 2JDHA 4COZA 2FDFA 1W8FA 3ZN1A 2P2KA 2HEYF 5JQGA 3J7MA 5IK4A 3THPA 2JEXA 1U5YA 1NZCA 4LKEA 3KD4A 1LR5A 1Q43A 4NTYA 4QHZA 1KRIA 4Q4Y1 4PJ0Z 5F3EA 5L3DA 2ZJCA 4K0KO 5A9GA 4MVSA 2R6QA 2YFZA 3BN6A 3F7YC 3N9OA 2CAZC 1UNBA 1ODMA 3RWNA 5LOVA 2ZBJA 5HBAA 3VKNA 1AUYA 2YPDA 2OZJA 3TETA 1SEFA 5FPZA 1R6NA 1BLZA 2JXAA 1HP8A 3OR6C 5F32A 1AHSA 1GANA 3UO2A 2EINC 2C9AA 2ETEA 2VOVA 5DABA 1QOSA 3D0JA 4HSLA 2OIEA 4S2FA 3HKCB 2R9IA 5HV4A 1X8EA 3MZHA 1CESA 4EN9B 5FBZA 4EROA 3HMYA 3CEWA 1OVPA 1AJQA 2PYJA 2V4VA 3GVMA 2QZ2A 5CB4A 3LDBA 2OCHA 3E8BA 2ZXWC 4CCDA 4UCUA 2QTSA 5E1RA 5JXGA 5BNNC 1NTKH 2AHYA 4H55A 2G9FA 3HNYM 3C3SA 3JATB 4WZFA 2Y4TA 5E88A 2J1VA 3MBWA 1F2NA 4IUGA 4BK5A 1G8MA 4MTGA 3IJ4A 4XFFA 3ETEA 4JI6O 1LEDA 3J8F3 2YEVA 1VQ8V 2QWPB 4F4LA 1XNKA 3JCUZ 1N1TA 5CFCC 5JPNB 1DZQA 3NMBA 2QSAA 1EUUA 3I2IA 1W9TA 4COYA 4YZ2A 4OQ9A 1MS9A 3LNMB 2EF6A 3T3YA 5CA6A 2ILMA 4GZ9A 1LNSA 4CXYA 1Q56A 1N36O 3POJA 3AG2B 4JYBA 1ND3A 5ACA2 3CBNA 4RSUA 5FFOC 4MYEA 3W7TA 4E4ZA 3JB8A 2EJRA 5GZGA 2ZGLA 1VQNV 4MW3A 1KEXA 3ZOIA 3NV4A 1IGOA 2UUAB 3SMHA 4XMAA 4ZU4A 4F3JA 2F1MA 1PM9A 1YI9A 3DN7A 3T1YB 1JU3A 5JCTA 5EWSA 1XNRO 1RHI2 2NZ9A 3FD9A 3ZXEA 4FLWA 3HKCA 1IX9A 3J7NA 2Z3YA 2Y4UA 3X2QC 4UVCA 4ZU7A 2ZHKA 3BI3A 4XJUA 2ZA9A 5AFBA 5BNNB 5FY1A 1XMOO 2PN5A 5FYYA 1RUD1 5CFDB 4O9GA 1SA0A 4P9LA 4X8NA 1SQVH 3DF0A 3CPWU 2CSGA 1UCXA 2YGLA 4JI7O 1OCOB 3ZN6A 3JBG2 1U96A 4OHZA 1HR0B 1VF7A 3TNQA 4JYAB 3U0ZA 1XNAA 5CA1B 3UT5B 2PELA 4CDQA 3HBZA 1IDSA 1G86A 5L3BA 2WC2A 3CKHA 4D6SA 1G4YB 3WU2Z 4WFFA 3OFNG 1J84A 1RUI1 3M1HA 1RUG3 2WNEA 2RV9A 2HWF2 2P90A 4JF3A 2ZEZA 1NA1B 5J2UA 1YHQV 1ASJ3 3SCGA 5FY4A 2EIEA 4Y5Z0 3JD72 2YSUB 4WZCA 4I0XA 3ZFEB 5A1FA 3BYWA 5FZOA 4Y4YA 5FNVB 3DXRA 1RYYA 5KUMA 2E6VA 2YROA 2XHKA 3KVAA 5LXTB 1W9FA 4A6SA 2FCUA 4WM8B 5A80A 1EAH1 1RM1B 3CIHA 2VZTA 4UVBA 5EZWA 2WAAA 4ZZ5A 1BHAA 3BVCA 1SACA 5FR3A 1YIJV 1V6IA 2JG9A 5JH7B 3E22B 4KWLA 2BU9A 1GZCA 5TISZ 3QLQA 1GMGA 1O59A 1TEIA 3WG2A 4X89A 2WR9A 2EALA 2QKAA 1UMIA 1TMF1 1XU2A 1BMFG 1SFYA 4COUA 3V56A 2W52A 5GZDA 5KHKA 2VTXA 3NL1A 1MQTC 4YY3B 2DWDC 1KD1W 3QO7A 2HR3A 1UJWB 2QM4A 4MTXA 1P8JA 1NZ6A 5J48A 1PIV2 4I0WB 4KQ7A 1S0JA 4D8MA 5KWRA 4UV9A 2DN9A 4MX3A 5IE9A 2AC1A 1XE7A 3T2OA 2OUHA 2HP8A 3BTAA 4LWSA 1V9U2 1LOBA 3KM5A 4R8HA 3ZYFA 1W6MB 5EYPA 3KV6A 1QJFA 3U1XA 1XXNA 1WD4A 1POV0 2DWRA 3T1HO 2Y6KA 2OA2A 3LD8A 2CTRA 1W6NA 3QNEA 4YFZA 1WP7A 2GDSA 3E83A 2RCVA 3IB3A 4NUBA 4ZKTB 3FWEA 3THOA 2BQPA 1AL23 1XNBA 4WM8C 3VN4A 3S0MA 2VZUA 2XBO2 2DOSA 3PUQA 4IL7A 2BNNA 3IGAC 2ZE5A 4IE4A 4Q8LA 2ARBA 3ETPA 2R041 3UL2A 2CY6A 2WZ8A 4BIOA 4IYIA 4KH9A 1A3KA 1GWKA 1APNA 5KMGB 1SZBA 1PVC3 4AFDA 5E8AA 3ZRXA 4Y3OA 5BNNA 2D6KA 4PLOA 4DXWA 2LROA 3VBHC 4XJZA 5FZ3A 2J42A 1DBNA 1OA3A 2RS12 3SJCC 4JX0A 4FQ4A 1M06G 3IPVA 5LWBA 1I1EA 2ZX1A 1VR3A 2D3PA 3VDCA 4JI8O 3MICA 2OT5A 1ZVFA 1ZWIC 3K4AA 3EYPA 1RXGA 1I5PA 1ALYA 4YXWG 3M3IA 1IPKA 4OLLA 5A1LA 4DXZA 1K9MW 3SH5A 3TN91 5JVDA 5HCAA 4B3RO 1LESA 3ZMOA 3AZZA 4MXWB 2DU1A 2TNFA 4PF5A 5FYUA 2DQ0A 2C1FA 5LBBA 5EYPB 2IXKA 3ZEDA 3MIBA 1PO12 4DV4O 1AJOA 4NXNO 4RS5B 1BE3H 3ZPOA 4X64O 3WXPA 2PYLA 5H6QA 4R8CA 4XQWA 1JX9A 4NPLA 2WLHA 1OKQA 3N36A 1CAXB 3H9AA 1WKYA 4ATEA 4P5HA 4ZIBA 4AI8A 2GC3A 4HN1A 3RJ2X 1W0JG 5IYZB 2WJSA 4OX9B 1Q8IA 2Y34A 2UWCA 2UUBB 2IXIA 2E7AA 1GWMA 2R072 3CJIB 1FNZA 2CTWA 4GZRB 2BOCC 4OMDA 3H8XA 3N7MA 1LU1A 1REFA 4IT5A 3N27A 2W0XA 2B9VA 5L9RA 4XZUG 4DV3B 2M6YA 1GN4A 5LMUO 4AVAA 1PX4A 4G28B 2VUAA 1RGSA 3VBUB 3O7OA 2RMKB 5FWEA 1US2A 3FL7A 4AVCA 2XVLA 3KQRA 1R081 4FO9A 5FYZA 1W3XA 3N35A 1UWWA 2ATFA 2D6NA 1PNGA 4LQRA 2QQMA 4E8DA 2I07B 1O5UA 3E8FA 2B5HA 4Z1MG 4JZGA 4QGNA 5B1OA 2G19A 1JOBA 5GZEA 5IWAB 1DLBA 1Y67A 2RQ6A 4DMIA 2ZGNA 1Y4WA 3AG1B 3RYFA 2BP6A 3S57A 3CZUA 5CA1A 4AHWA 4WCEV 1U5XA 3ZSKA 1RUH2 3PU8A 1S77D 3THDA 2UXCO 2CWSA 3VD4A 3D3AA 3GZTB 2VZSA 3VD5A 5HV0A 2RR11 5L3FA 4INDA 1D4VB 4DUXA 4CU6A 2X5IC 3B2EE 4YZ3A 4CA9A 4Q0UA 3MAQA 1Q3EA 1N1VA 2MK3A 3FX3A 3TBDA 2A3YA 4Y1ZA 1L7LA 4XFHA 2PYTA 1FAFA 4DR2B 4ASLA 3RW0A 1N3PA 2Q7EA 4CDUC 4JC1A 4QE7A 5C9AA 1IQAA 1IZ3A 1VAMA 4OZOA 1V6JA 1XBLA 1G7YA 2PHDA 4PDMA 5DAQA 1VARA 2D98A 1AR91 4J9YB 4CRQA 1YI7A 3JZVA 2BFUL 3IDCB 1COV1 4LULA 1LR1A 2QQLA 5T50A 3ZYBA 4PA7A 4K6BA 1N8RW 2X09A 4B4QA 5FMOL 3IDBB 4CCJA 2G9ZA 1ND3B 2EULA 1EV12 2DMXA 1AP6A 5K9YA 3OD4A 3JUUA 1DG6A 4GH4A 1JJ2U 3VD9A 3IIIA 2XLAA 5JSPA 2JJ6A 5HCFA 2K1EA 3B40A 3BIWE 2CV6A 2BRTA 3W7XA 2A1XA 5GZFA 5JCOA 4JI1B 1XHZA 4EE2A 2B46X 4P5YA 5BUVA 2A6WA 3LSQA 3DSQA 2B42B 2JKXA 4F8AA 5KAFZ 1IURA 3M2MA 1AXYA 2P3KA 1XU1A 2ITDC 3M3CA 3LAGA 1AR71 2Y0IA 2XJVA 4BB3A 1F5FA 4J7JA 1HNWO 4HG6B 5JOWA 1GU3A 1HWYA 4AQTA 2Q1FA 4JV4A 2HWF1 4G9SB 2ZGMA 1LTEA 2XAGA 4ZKIA 4FPFA 2LS6A 1HQNA 1HV0A 1NS1A 1JTZX 3VQVA 1JJOA 3ZSMA 4DEQA 2Q67A 2DF7A 4IGQA 1YZBA 2Q0OC 4H7MA 1MZFA 1YJLA 1AX0A 3FX7A 5IYBO 2FDHA