5KHIA

Hcn2 cnbd in complex with purine riboside-3', 5'-cyclic monophosphate (cpump)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
total genus 63
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khiA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khiA02
4I09A 1OD5A 1YUDA 4MUVA 4A2UA 5FQ0B 2XKPA 1RGSA 2B9UA 4HVQA 4GULA 5EFUA 4MGKE 2GC3A 3R6SA 1PM7A 5FPZA 5FDBA 5C6CA 4FAHA 3FE5A 2ET1A 4MX3A 1CAVA 4PIXA 3G7DA 1O7FA 4LA2A 3H1YA 4AVAA 5KHHA 3NW4A 5J7MA 4N9IA 5FPXA 2GH2A 4IEVA 3O14A 3IDBB 4YSFA 3UKVA 3RYRA 2XGXA 3UKTA 4AVCA 4ONUA 3M70A 1PMIA 3ES4A 4K8FA 4LEJA 5KHIA 3D0JA 3ETQA 1WA4A 1ZX5A 2VQAA 4XEZA 1FXZA 4N9HA 2EVXA 5I0RA 4JVAA 2D5HA 5KHGA 1Q5OA 4XFHA 3ACLA 2F4PA 3I59A 2WFPA 1ZRDA 2VPVA 2PAKA 3MZHA 2MHFA 1ZNPA 2EAAA 2B5HA 3FHIB 5AVPA 3DL3A 3I59B 4YARA 1OFNA 3OCPA 4BYYA 2IC1A 2ETEA 3LA7A 2UY8A 4RD7A 3LAGA 4CYDA 3CJXA 2B8MA 2XLFA 1Q3EA 2WC2A 2XL7A 3S0MA 4HVOA 3LOIA 3M3IA 4EWAA 3ROUA 2QDRA 2CAVA 2H6CA 3E6DA 4HN0A 2PHLA 4FBFA 5BUVA 2O8QA 3PVBB 2V09A 1SQ4A 1JUHA 2P17A 3C3VA 4XFBA 1ZZ7A 1Q43A 4QM8A 3RZZA 4HMZA 4E2SA 1ZZ9A 3E5UA 3SCGA 1UPIA 1G6NA 4DINB 2PAMA 4XF0A 1DGRA 4O9GA 3GYDA 3H9AA 1NE4A 2I45A 1O5LA 3PLQA 1UD1A 2BYVE 2CAUA 4XFAA 4I3PA 1FT9A 5JSRA 5CADA 4ORFA 4EROA 4EWEA 4QGLA 2QCSB 4AQ6A 1NYWA 3B02A 5I0TA 4PIYA 4UBGA 4KU7A 2XLGA 4I01A 1L3JA 3L2HA 1QXJA 4QX5A 4WZCA 2GZWA 2D93A 2PQQA 1V70A 1SEFA 3IDCB 3OGJA 1CAXB 4LA3A 3UKNA 4XF9A 3OD0A 3LA2A 5FQ0A 4LLOA 2BNMA 1ZZCA 3WW3A 1QY4A 1CAWB 3EO6A 5D1IA 1Y3TA 2HJIA 2DCTA 4YRDA 4Q0QA 1J59A 3D82A 1EP0A 3HT1A 1DZTA 4IETA 4QMAA 3VHRA 1RUOA 2FQPA 5I0UA 1X82A 4XFGA 4MV2A 3OTFA 3EQEA 3RPQA 3WW2A 2GU9A 3BU7A 2PTMA 2CV6A 2H6BA 3DKWA 1IPJA 1NZCA 4HLTA 1VP6A 4JV4A 1O3TA 4UBHA 2K9ZA 1J3PA 1YFXA 2IXIA 4XFIA 4LUKA 4XFFA 2Y0OA 3H7JA 3SHRA 3H1MA 5LEJA 2ET7A 4IEUA 5E16A 2PFWA 1O4TA 4LULA 5LRRA 3JZVA 3ZDSA 4MGIE 3ES1A 5JSOA 3D0SA 4EV0A 4HVRA 4JTNA 3H3ZA 1ZRCA 2OZ6A 1WLTA 5I8TA 1YFWA 3KCCA 4L11A 3RYPA 1H1IA 3HIFA 2E9QA 1VJ2A 3HT2A 5EZWA 1FI2A 2OPKA 1QWRA 3CO2A 1OI6A 1NXMA 1IPKA 3SMHA 3S7IA 2IXJA 3EBRA 4XF3A 4AQ2A 5CVRA 1J3RA 5I91A 2PHDA 4BIFA 3NVCA 4I02A 3H3UA 4KWKA 5FLHA 1O3SA 4YNIA 3FWEA 2C0ZA 4Q0VA 2OYZA 3NL1A 1LRHA 4OFGA 1O3QA 4BH9A 1XRUA 4AXOA 3RDIA 1XE8A 2Q4SA 4KWLA 4IEXA 3LA3A 1X8EA 4XF4A 4KL1A 1VR3A 1X8MA 5F1RA 4B29A 1CX4A 1UW8A 4WBBA 3NJZA 2O1QA 4L2NA 3H8UA 4QXKA 3E5XA 2GC2A 2HKXA 4FAGA 4I0AA 2GC0A 4LTAA 3SXWA 5FCCA 4D7SA 1HW5A 1U12A 3EJKA 3H1WA 3BB6A 1CAXA 1ZZ8A 4X6RB 3WW4A 1OMIA 1UIKA 2ATFA 5BXXA 4LUMA 3ELNA 3KGZA 3DN7A 3OF1A 4Q0SA 3CL1A 2CGPA 1CAWA 1YFYA 2QNKA 4R52A 3QACA 4HSJA 1YWKA 3NSTA 1YFUA 2Q30A 3TNPB 3CEWA 2Q0AA 2FMYA 4ZU7A 1YLLA 4HBNA 2BNNA 3KSCA 4FT8A 2VECA 3GBFA 4Z07A 5I8YA 1RUNA 3CLPA 2QJVA 3H7YA 3MYXA 1ZZBA 2ZCWA 4IEPA 5C8WA 4IESA 3I54A 4R8HA 3BCWA 5JCTA 3CF6E 3MDPA 1EPZA 2GC1A 4Q29A 4JTOA 1LB2A 5J48A 3LWCA 5BV6A 2QVSB 5CU1A 1EY2A 4XETA 4NVPA 4TLFA 3MPBA 3S7EA 3FX3A 1ZZ6A 2XKOA 4QGNA 4XFCA 1O5UA 1SFNA 1X7NA 3HQXA 5HI0A 2K0GA 3E97A 4Z82A 4YYOA 4XF1A 1RL3A 4MH0E 5K8SA 2OA2A 4IEZA 1CAVB 5KHKA 1RC6A 4IEWA 4ZU5A 2D5FA 4WVZA 1LR5A 2PYTA 3WW1A 5KBFA 3EHKA 5LRSA 4Q0UA 1DGWA 2BNOA 4IEOA 3LZZA 4F8AA 2Z2SB 5LEKA 1O3RA 1J58A 2UYAA 2UYBA 3N4MA 5I0SA 4IEYA 3RYKA 1J1LA 5JAXA 3SCFA 1Y9QA 2BEOA 4O9EA 3U11A 2MNGA 3E6CC 5I8SA 4IERA 3BALA 2UY9A 1LKNA 4E2GA 1I6XA 4MGYE 3U0ZA 1H1MA 1J3QA 3IBMA 1CAUA 4E2QA 1CGPA 2PAEA 3H50A 4F7ZA 1DZRA 4ZU4A 1GQGA 4X6QB 5BY5A 4KU8A 3E6BA 3I7DA 1CAUB 2D40A 3ST7A 4I2OA 3BPZA 3TNQA 4OLLA 4BHPA 3E5QA 4J1WA 2XL9A 1UCXA 2ZKLA 4QGMA 4D7TA 3RNSA 3NKTA 3FFQA 4PJYA 1ZRFA 2Z69A 4HZFA 4QM9A 3KGLA 2OZJA 3IIAA 4Q0PA 3QOPA 4AVBA 3DV8A 2PA7A 3U10A 4IEQA 5I93A 1ZREA 3KMHA 2MPFA 2Q1ZB 5JR7B 4P9GA 2EA7A 2XLAA 1EYBA 3SCHA 1WGPA 2IXCA 4I0BA 2N7GA 1I5ZA 1RTVA 4PIZA 4KWJA 2IXKA 1YHFA 2KXLA 4HSLA 1NE6A 1TQ5A 1UIJA 4META 3IWZA 2H0VA 5FLJA 3USSA 5BPXA 1QXRA 2XHKA 3FZ3A 4MGZE 4HN1A 5JSPA 4H7LA 3FJSA 1ZVFA 4UXAA 5KHJA 2IXHA 2BGCA 2GAUA 2IXLA 4MZUA 5E1RA 5T3NA 1XE7A 5J3UA 5FLIA 4J1XA 1GQHA 4EWDA 1ZRRA 3PNAA
chains in the Genus database with same CATH superfamily
5IK5A 3ICXA 4UFIA 1N4CA 4OXSA 2XKPA 3FLRA 1WMFA 5M0TA 4TT3G 4XW3A 1PM7A 2EIDA 1OQ1A 2FDJA 4N7IA 2D44A 4Q4Y2 3T2QA 3IN9A 3RJ2X 1ZL8B 2YFZA 3DXUA 1RIRA 4PA9A 2QTOA 2ZXQA 4AVCA 4COZA 1ZA7A 4JKKA 1RUI2 3M1HA 4CPBA 3ES4A 2HEVF 1FXZA 3CZUA 2Y69B 1G9DA 4AHWA 1LOFA 4NHYA 1YJ9V 1U96A 2XBO2 2PAKA 2LUWA 3MZHA 1QJY3 4LK7A 3SLIA 5L73A 4XDOA 3C7FA 1HNWB 2GBOA 1UYYA 4CCDA 1QJX1 4NWWA 3WNMA 3DPRB 4CYDA 1Z5WA 4CC5A 4XZPA 1OCZB 3ZXFA 2VNVA 1YZBA 4YXWG 4XABA 1COV1 3ZMUA 3VD3A 5LGNA 4JI3O 2R062 3ZO0B 3T08A 2Y33A 3A0RA 1K12A 3INAA 3BODA 1H2SB 4GWJA 4AR2A 1W2BU 3WQ0A 4Q4W1 5EYPA 5CADA 3AG3B 4UCVA 5FYTA 2RS52 5CB7A 2M7WA 2WLNA 1W6QA 5CBGA 1W9TA 2JXAA 3WG7C 5A1FA 3ZN0A 3G67A 2W0XA 2VC9A 1NS1A 3JB8A 3LA2A 4Z1VA 1PKXA 3JBG2 5DUXA 1AYM3 3OGRA 3RT3C 3CRCA 4BXSV 3DYMA 1GSLA 3GNEA 1UFIA 4AFCA 4D3WA 4JZRA 1NTMH 3IAYA 2IFWA 1R64A 4H7MA 5IJ0A 1VBE2 2PGGA 4GKXA 5CISA 4OX9B 1JOPA 3MW2A 3SC7X 2ADDA 4B1LA 3HBZA 2CWSA 1VP6A 4UVAA 5FP7A 2R16A 5DN2A 1PVC1 3H1MA 3SEEA 4IEUA 2RJ2A 1VQ8V 4X88A 2Q68A 2C6SA 3RYCA 3WDYA 2HBUA 2VOWA 1YFWA 4XMIA 5LBQA 4RGGA 2BOIA 2E9QA 4YM1A 1AR1B 5ITZB 3HKCA 4XYXA 4XF3A 5CYYA 5CVRA 1DQ4A 1NXD1 4A44A 4BDVB 5BNOC 4CEWA 5FLXN 1E5IA 1RUH1 1O3SA 1S55A 4MW8A 1XPWA 1POQA 1HQLA 2C0ZA 3UT5B 1ZBE1 5AFBA 1R083 4AXOA 3W7UA 3FBYA 2GTAA 1BBT3 2YIAA 4L2NA 2XONA 4W4LA 4DR3O 1N34O 4CUAA 4YM0A 3AK3A 1S2BA 1KYOF 3BU0A 1W6PB 5GLTA 2ATFA 3X29B 2HWD1 4MT8A 1YWKA 1K5MC 4F83A 1SZBA 4YY3O 1R091 2OT5A 2LW1A 2DCZA 3ASNC 4FT8A 2VZ3A 2ZX3A 3PMEA 3V0BA 2ZXWC 2JDIG 3OEAA 4XIKA 4N53B 3IMMA 1F2NA 4YZ3A 5C9AC 1F5FA 3CF6E 2VMDA 3ABKB 4FJCC 2GC1A 4ASLA 3N7JA 4PD4F 2WQZC 2QQPA 5BV6A 1CIYA 4M0NA 4XETA 3O65A 2EIMB 1BK1A 4K0KB 3ZKYA 3VDBA 3A0BZ 4MADA 5FY8A 4QKDA 4IIJA 1S2KA 5LP6B 3AP7A 2WLLB 2KG7B 3X2QB 4DEVA 1VBC2 3ZMNA 2Q4PA 1LR5A 2UXXA 4PI2A 5EJ3A 3SH3A 2RJKA 1PO21 1W06A 4JKLA 5LRSA 1W8FA 1HB4A 3K4ZA 4FCAA 2Y26A 2Y48A 1LHUA 2Q8OA 2W3JA 4YZ4A 4PELA 3E8HA 1GFF2 1Y9QA 2HWC2 2Y4TA 2I2SA 2VBPA 4QDRA 2RDRA 3N2GA 3O9OA 3VBSA 5JI9A 4KH9A 1GOHA 2UWBA 3WINE 5B4XA 5DPNA 4ARXA 5DZFA 3BIWE 1LU1A 2EF6A 1M5IA 4ZIBA 3RZJA 1S0CA 2KB1A 4IW3A 2QKCA 4LH6A 4XCBA 4LH7A 3ZHUA 1RUG2 3KGLA 3ECQA 2KKWA 4IEQA 1Y74A 2Q8CA 1OBNA 3KMHA 4LO5B 3HD8B 1JPXA 1AX0A 2P5BA 1MEC1 3OBTA 1S0DA 4I50B 5BPXA 3T1HO 1SFPA 5FZ7A 2JD9A 5LBEA 2R9AA 2CDYA 5C3QA 1HIXA 4PA3A 3FBMA 1XE7A 4SLIA 2ZM6O 3RWKX 2EIKB 1OPMA 2CDOA 4D94A 1OD5A 3AMHA 3W7XA 4YLZA 3WP6A 1Q8VA 4UCOA 3ETGA 1W3VA 2L9LA 2CTVA 1CAVA 2UUCB 3UV9A 5B1AC 3VBHC 4GALA 2AACA 4XHXA 1V9U3 1HWYA 3C7EA 3HBKA 2WNVB 1L7LA 5FY1A 5K0UB 4HNAB 5DDJ1 4W65A 3RYRA 5LZ6A 2PI4A 5A1LA 2Q8VA 3J7NA 4BIOA 1CQ9A 5GZDA 1OURA 5ERLA 2JG8B 5FOJB 1M57C 1ZNPA 2Y0PA 5IYZB 4MVRA 4I0XA 3ZRWB 5BNPA 1Y76B 1XNQB 2JWPA 4Q4X1 1E79G 1AXYA 1NZ6A 1FFXB 1HV0A 4RGAA 1GK9A 4G28B 1A8DA 2UXCO 3ZYFA 2GN7A 3K5NA 2P17A 4QM8A 3LDCA 4X20B 1S1AA 3AKSA 1G6NA 1LHNA 4Q4V3 4FTEA 3FYEB 3IC7A 1VE0A 2JJ6A 3DECA 3M7MX 1HB2A 3CMAV 2QTWB 3JAKB 5ABJA 5FKCA 4DV1B 4QPGC 1YIFA 5EP9A 1UMZA 2D98A 2PHXA 3M3EA 1JYVA 4QX5A 4I9WA 3GHMA 4P9YA 3OD4A 1UX7A 2YV8A 3USUA 1OVSA 4COWA 3A23A 2YXYA 4LF7B 4RO2A 3KQRA 2RS31 3AZXA 4XBFA 2WO3A 3PIGA 1G6UA 5KWRA 3SPHA 3KV9A 3VBOB 1W6NB 2VO5A 5A3NA 1IPJA 2VTFA 3JCUZ 3ENRA 3VBUB 1DDLA 1YFXA 4UFJA 2A3XA 4MHRA 2Y69C 2YFUA 1AR62 3H0OA 2DV9A 2QQVA 1Z78A 3T0BA 1VAVA 5JSOA 4OGQB 4S2DA 1T6GC 4LFAB 5LY2A 1D4M2 1XEQA 4QJFB 1U5XA 2OCHA 3MIGA 1H1IA 1H2MA 4BMBA 1VJ2A 4V2WA 1JOYA 1IPKA 4G2KA 4JI4B 4UFLA 5FNVB 4HK8A 2PHDA 3B3QE 3NVCA 2QWQB 2HH9A 4LHSA 3PURA 1BEV3 1YQ5A 4MXWB 1RSOA 1X8EA 4XF4A 1SCSA 5F1RA 1PPJH 2ZPXA 1CX4A 3AG3C 2O1QA 1AF9A 2AREA 1C4RA 2GC2A 2CTPA 3SPGA 2ADEA 4LTAA 4CU7A 3B5LB 1HW5A 3LEIA 5EQUA 1UAIA 1OQEA 4GB32 5BXXA 2WWUA 3P3PA 3OF1A 3B8NA 1UMIA 4FMTA 1GP5A 3QACA 2WDBA 2XAQA 1BYHA 1KKCA 2HEPA 4I55B 2BNNA 1R6NA 3B2EE 3BN6A 2GHYA 3S57A 2YYOA 2Y60A 4NXMB 5CEHA 2A6XA 1QU7A 3UYJA 4P02B 1WP8A 4R8HA 2YY1A 1QOOA 2GN3A 5GALA 3O12A 2KD7A 3PU3A 3E35A 4JI0O 5A3TA 4TLFA 3MPBA 3KD4A 1CP9A 4A3XA 1XU1A 3LDBA 5IVBA 1QNWA 1TMF1 4CP1A 2OA2A 3BIEA 1SS3A 4C0HA 1RC6A 4J9YB 5BNNA 2BVVA 4Q1PA 2W92A 1N8RW 1SRYA 1WBFA 5CZKA 2ARXA 3HOBA 1RUJ2 2BEOA 2ZGRA 1W03A 2HWB1 3NNMA 2UY9A 1WN7A 3M8LA 5CB4A 4WFFA 4E2QA 1F31A 1UL9A 2E5LO 2Z4FA 5LK7B 1S0JA 2ZGOA 5JVVA 3WG1A 3AMNA 1TVKA 1AYN3 3STLC 1VBD3 1EV11 4QQOA 1G9FA 5C3SA 2DU0A 3FB7C 1UXXX 1WCUA 2ZCEA 5JMCA 3IIAA 3LIGA 3TB0A 5FWEA 3U10A 2Q1ZB 4RQPB 2LGQA 1AVMA 4AEDB 4DV0O 1GTOA 1Q8OA 5H9PA 2IXCA 4PIZA 2KXLA 4IGQA 4IXLA 1RUF3 2JIGA 2C9AA 4JF3A 4CDXA 1MZ5A 5E1AC 3RYHB 4FZ0A 4N53C 2YXLA 1BGYH 4P9WA 1VQ4V 1GLHA 1WW7A 4B8EA 1VAMA 1OA2A 3KG2A 1N1SA 4IUGA 1YJNV 1PVXA 3VN4A 2EIMC 1KC8W 2ZGSA 2IJKA 1DZQA 2VVEA 2VQTA 3HNYM 3P32A 2C5DA 2ENRA 4IV1C 1PZ9A 3ILNA 2WZ8A 4DV5O 3VDDA 2QM4A 3TN93 4C7UA 4QKFA 2JDKA 4CU9A 4YSFA 1WD4A 1MS9A 4GZRB 5GLWA 2GNMA 2PQSA 3IB3A 3IAPA 1ZX5A 4XEZA 4M3CF 3KT4A 2YSUB 1DYOA 3PHMA 1BZKA 3ZKUA 1W2OA 3WFVA 3SH4A 4W50A 3BPSA 1FJGO 5D8AA 5A9GA 2DCKA 2EAAA 2XUMA 3RN4A 5T54A 3AFKA 1RHI1 1VF5B 3Q9OA 3ZMOA 4F6RA 4DV6O 2EICA 2QE7G 2ETNA 2HHHB 1K45A 4UVBA 2R073 1YQCA 1P7BA 4F6EA 1CVNA 1HQNA 2A6VA 2H6CA 4Q4Y3 5FZHA 1HRV2 1PGSA 1H2NA 4XF0A 1R3LC 3G6JB 2AZ5A 3VHNA 5JZGB 2EXKA 4LF8B 1YF2A 4UCSA 4AW7A 4WZCA 2EIKC 1NCRA 3OGJA 1KDKA 1ND3B 2BNMA 1YVWA 5APAA 5ACA2 1BXHA 4O4HA 4WV8A 4NR1A 2LW7A 5CBLA 3H8XA 4DK1A 3HT1A 4QMAA 3JARB 2YDEA 1DZTA 5FO9B 2PELA 1RUOA 1PM9A 2VM9A 2AR6A 3EQEA 3MLJA 1YO8A 2GU9A 2WNVC 2FDGA 5K0UC 2R063 2WJSA 1YDXA 4LIUA 3U14A 1GNZA 1UXZA 2F6BA 5LBBA 1VF6C 1K42A 2JE9A 3AG4C 2VUAA 4A7KA 3KHCA 2X53S 3MW4A 1PZ8A 4EV0A 2RS53 3MLKA 3IT8A 5FY9A 2NQYA 2P06A 5IWAB 4LF4O 1LCLA 1H8TB 1LOGA 2JGDA 3URFA 1FI2A 4BR6A 3BTXA 3BYWA 3JBG3 3KS7A 3WXPA 4NN0A 1TG7A 1Y4MA 1K5SA 2K9PA 4PDRA 3I2HA 5A3WA 1WA8B 1IHMA 5IFTA 1WLWA 2BSKB 1R1A1 1XYOA 1FYJA 5DAXA 3JD3A 5JOYA 4AFAA 4WM7A 2R9RB 3ZVXA 4RUEA 1EM1A 2BWCA 3NJZA 2Q7EA 3MW3A 2VMHA 2FDKA 3LNNA 4O61A 1CR7A 3N3HA 4JRAA 5F37A 3ETPA 5FJKA 3DN7A 4R52A 4QXHA 1DF5A 3VKMA 1SQPH 3JSNA 3ZPYA 1IZ3A 2G4IA 4OMCA 4FLXA 2P5OA 1V54B 1UU5A 4I4TB 2TBVA 4XAEA 3VBOC 1UYZA 4IEPA 4HANA 4COVA 5JOWA 3VZKA 4YVSC 4R50A 1AL21 2HLEA 2QWNB 2Q7HA 3VBUC 1FOD2 4NROA 5FO7B 4AVTA 4YZ5A 1BCXA 1UMHA 1QBZA 4JV5O 1XNAA 2AEZA 4RS5B 3U4XA 1OCOC 3TXSA 3E97A 2QWPB 2Y8KA 4XF1A 2HWF1 1EFRG 2IU0A 3QO5A 2YGLA 4P14A 4LP8A 3VBBA 2CNAA 5FZFA 1DFQA 3IDAA 1UOBA 4Q0UA 4FO9A 3FL7A 4JI3B 4JI1O 3WHTA 1A34A 2F66C 2ZGPA 1UOGA 1WCSA 5LEKA 1XYNA 1D0GA 3RYKA 4BU2A 2WLIB 3APOA 2EBOA 1S2EA 3OG2A 3GWOA 1QJEA 4QX1A 2RMU1 4XJZA 4ISRA 3VHOA 1LGCA 5JXJA 2BTOA 4GA9A 4DV3B 3WOGA 3ME2A 2RE9A 4K9SA 3WCRA 1SACA 4JGZA 2DURA 4J1WA 2Y6KA 1Q8PA 4UAPA 2Z69A 4Y20B 1W8WA 4P9IA 3O5SA 3OGVA 2JKXA 4YZ2A 1W6MA 5J96B 5A3PA 1W04A 2P90A 5EYPB 1I08A 1GM8A 3K57A 2HWC3 4JI6O 5JSPA 1DCSA 4DV4O 3L9JT 3EB7A 3OUHA 2VVFA 4E2LA 3OMNB 5FPLA 4MUVA 1RP3B 4QX2A 5IAXA 1IKQA 1AP6A 1WWYA 1MS0A 3LKJA 2LALA 1W8OA 1G7YA 2RHPA 1M56B 2NPIA 3SISA 5JIUA 2YZ4A 2GP5A 4S2FA 4JTAB 5IJ0B 4E4DX 2GH2A 3ZHQA 3ZXKA 1PO12 2ZX2A 4H14A 1OCRB 2A3QA 2JDAA 4BQ2A 2WS91 1DF4A 3BRCA 4LKEA 5LA6A 1K9MW 2V4AA 2WLQA 1N34B 1DQ1A 4FQZA 3SPJA 3RYCB 1D4VB 4LLFA 3CNAA 3AC0A 4NHLA 2CHHA 2VU9A 4LPLA 3RJRA 3FB5C 4EB6A 2XJPA 3I2KA 4Y1VA 3HKCB 2A3YA 3MBWA 2NR5A 4YY3B 4HVOA 4RFRB 1VALA 4DR4B 2QDRA 2E6VA 4CEWB 3Q8EA 1OZ0A 4AEDC 5LGUA 2XR4A 4AEJA 3RFRA 2QZ2A 1NY71 2UURA 4JKMA 4E27A 2FTKA 2F1MA 3VHPA 4I3PA 2NN4A 5JSRA 3OY8A 3BOPA 4U3JA 2IVJA 3WP5A 1UYXA 2EXIA 1H8EG 3CWBH 1QXJA 2EILB 1LNSA 1W59A 3BY6A 5B3SB 2P37A 1GM9A 4A6OA 5LA9A 2PLV2 3V65A 3HKDB 4NXNO 3UKMA 1BL8A 3T1LA 1I94O 2E33A 4FOYA 2ADPA 5IUQA 4X65O 2FDIA 4MV2A 3AP6A 4UT5A 1GICA 5FUNA 5J9PC 2CV6A 1HLCA 1STMA 4XUPA 4GLXA 2K9ZA 2P3IA 5CFDA 2DCYA 3SITA 3O1VA 3JZVA 4DRXA 2W39A 4IIJB 4GAZA 1BVP1 3VD7A 1SA0A 2ZX0A 3ZRXA 2Y38A 5EIBD 4NPRA 2VQ0A 2B39A 2OPKA 1OCCB 2WT0A 2EIEA 1BS3A 4B3TO 1K73W 1C1FA 4OHXA 2X05A 4B7KA 2BCCH 2D6NA 4OHWA 2ZHLA 1NT0A 4ATEA 2C2AA 2GNDA 4KWKA 3LSUA 4UF0A 1KRIA 3H01A 3T1MA 1LULA 4IE7A 3T1HB 4O4JA 4HFSA 2QQOA 2NLRA 1OLMA 1XRUA 3RDIA 1MS1A 1IQDC 3OOXA 4IEXA 2VZTA 1VBB1 3F7YC 2GSMB 1OQDA 4QPWA 1EN6A 4NIHA 2QE3A 1C5IA 5JZGC 3LFIA 2X6AA 4P2ZA 5J1XA 4FPLA 4X8PA 1AR63 4JAAA 1ASJ1 2RS13 5A7NA 2QZ3A 2Q7GA 1S76D 3GDBA 2JIZG 3ZYIB 1ALYA 2A9HA 1ND3C 1P8JA 1Y74B 4Q0SA 2VZPA 1CAWA 5FZ6A 2QNKA 1PGW2 4MOAA 1O4ZA 5C5UA 1MQTA 1ACCA 4QPJA 4HBNA 3ITQA 1UY0A 5EK0A 4RAIA 1FPN2 2XQRA 1I5PA 1RUNA 3I54A 5F8PA 5G05L 3BCWA 3ZMZA 5HBAA 3RZGA 2QJ1A 1U5ZA 2GMEA 2N74A 2BW8A 2ZDIC 5FP3A 5FZIA 1VRH1 1BE3H 3RVZA 5IFPA 1LUWA 4YGCA 1QEXA 4ASMB 4QQPA 5KMGA 4FXKB 1NG0A 1CEZA 2J1RA 2RR13 3WDVA 1TVGA 1VQMV 1CAVB 2OCCC 2FMDA 2UXCB 1H8TC 3K4DA 3WW1A 4GB33 2VMFA 4IEOA 3OMAB 3HR0A 4AI9A 5IYCO 4NAOA 2RJZA 2Y6LA 5JUVA 3DXRA 3FAVA 2WZR1 1EBOA 4TWKA 4LR4A 3A7QA 5FYHA 4YGBA 3CHXA 3TGUH 5JQGA 5HCAA 1HR0O 3I2FA 3BCCH 1JZ2A 3JD72 4LOTA 1ZAUA 1H1MA 1KFXL 3IBMA 2WAAA 4JHZA 5H9RA 4MTFA 1AR82 4KU8A 3ZBHA 3OPZA 3AP9A 4I0XB 3AG7A 1CAUB 2P6CA 4DUVA 5BNPB 3WD5A 4O4LA 2OQ7A 3BPZA 4JI8O 3JALA 5JMOA 4XQWA 5H6QA 4LBMA 5H9SA 4UYBA 1ZREA 4EN9B 4UFMA 5L7OA 2QA4V 1MS3A 4JPRA 2FB5A 3PIJA 4HXCA 2ZZQA 2O57A 1V54C 2RM22 4B3MB 2CH7A 2HFEC 3FYIB 2E7TA 5FLJA 1RMU1 1OFSA 1QXRA 3AJZA 2I74A 5ABJB 5GZFA 5I0DA 4XXAA 4COYA 1NU1H 3P1IA 4L0PA 1GMMA 2H0BA 1QHTA 1UYPA 4HVQA 5EFUA 2X7RB 2BPA2 4RS5C 3AK0A 4PLOA 1VQKV 1VQ7V 1ZL8A 3NWKA 2FZ1A 1LR1A 2XUEA 2GSYA 4P9LA 1JI6A 1RFYA 2RDSA 2DF7A 3S5AA 5KA6A 2ITDC 5B5EZ 5IVVA 4O4IB 3ABTA 4FTBA 2D3RA 3VZNA 2DMXA 3WNXA 2BRTA 2VQAA 1GH6A 4MVOA 3CMGA 1M4WA 1WA6X 3KB5A 1DHKB 3MFAA 4JVAA 1K5QA 3E89A 3ACLA 4Y22B 2UUBO 1LOFC 4UXNA 1YHQV 1EPWA 2FD8A 3MF6A 3DL3A 3DPRA 1COV3 1EUUA 1VB4A 4BYYA 2R9IA 4JYBA 3LA7A 1SC5B 2N04A 1ONAA 3LAGA 4M3CE 3DYPA 1OV9A 2XLFA 4NPLA 3C8XA 4RL7A 1MZ6A 4Q4W3 4HN0A 5C93A 2PHUA 1QJZA 3RZMA 4WVVA 3SCGA 1DQ0A 2AEYA 2ZKNA 3OMIB 1UU4A 1DGRA 1GRJA 3UL2A 1RSOB 1Z7S1 4J7KA 3TEZA 5FZCA 5JJJB 4LO8A 4QX3A 1RYYA 5GTIZ 1IS4A 2WO7A 2AYHA 2RDNA 4JI0B 1EN4A 1ENRA 2UXNA 4FFKA 2OWOA 1NT2B 4I01A 4UCRA 4MGSA 1UZ0A 3O1UA 3JQWA 1F4MA 1LEMA 4LLOA 1ZZCA 2HR3A 2VWKA 3OB8A 5AG2A 5FOBB 1KP3A 1X4TA 3OBZA 4XILA 3W21A 2RQ6A 3DCQA 1Q8QA 3OJBA 2ILMA 1M56C 3J8F1 2ARCA 4FFIA 3JB4C 3VHRA 2FQPA 5CFCB 3VQXA 3KV4A 4K7JA 4GX1A 2BGPA 3POSA 1P84F 4FFBA 3AG2B 5G04L 1A3KA 3K0GA 4S2HA 3KZ4C 1OCRC 3GGLA 3RSJA 2E5LB 1ULEA 3OT7A 4FK5C 1RITA 1ZRIA 3ZDSA 1ZSPA 1XXNA 1NH2D 2OUJA 4LXLA 4M00A 4IYIA 1WLTA 2VZRA 1OKOA 4FPOB 3OPWA 1AXZA 2WIIB 4JDOA 3WB0A 2IU3A 3JSLA 2D97A 5L9VA 2MEV1 5CKQA 3CO2A 5BNNB 1XC6A 3RMXA 5ACA3 2Z5UA 3VKOA 1RVF1 3AYCA 4AQ2A 3S5QA 1IURA 1HNZO 2EXJA 3UT5A 4D8MA 4CEWC 1KEXA 1YCIA 2A5ZA 4NOTA 4H44B 2DDUA 2E53A 4Q0VA 3ZCCA 1WZXA 5C4WA 3I56V 4CS3A 5CB4B 1IDSA 4BISA 1XNRO 1NQDA 5C33A 5CA3A 2W87A 3KF5A 5C3OA 3WSOA 3MPPG 3SKVA 4FAGA 3ETDA 4DRRA 1W6PA 1R093 4LKDA 4KFMA 5FCCA 4NHKA 2EILC 4CH6A 5B3SC 2WBKA 3ELNA 4DV5B 2VQUA 3HKEB 3NSTA 4XJ8A 1VIWB 1YFUA 3BAAA 4XUOA 3ETEA 4DO0A 2IJJA 4Z07A 1FAYA 2P3JA 4CDXB 2NLJC 1QJY2 5SV8A 2EJ7A 1N32O 2HWE1 1UPSA 5A6XA 5FYUA 2ZIOA 5KAIZ 1FJGB 3O0XA 1QCEA 1Z5VA 3D8CA 1AX2A 1PO23 1APNA 3OYWA 2QQUA 5LP6A 4EE2A 4DV6B 2B9VA 2DUQA 5ISLA 4QHBA 4C90A 3ZYHA 3W5NA 1LECA 4ZU5A 2NNUA 5DAPA 3VDDB 3N9MA 2PHFA 1OCCC 1B04A 4IL7A 4X62O 5LA0A 2WLHA 1LOEA 1O3RA 3TEYA 2ZMLA 1ENSA 4PJ0Z 5LASA 4LBEC 1YI2V 2W9XA 4GQ7A 2D43A 3H8OA 4HKWA 3NV1A 2BBVA 1W8HA 2Y4UA 3ZX7A 2J22A 4QX8A 3VBSC 1QLEB 1AYM2 3N7MA 1IOAA 5D8AB 4DYLA 4ZU4A 4RHV2 1WJZA 4FPFA 3HN3A 1PNFA 3MO4A 1FOD3 5FYZA 4Q26A 1LHVA 2D6OX 4QQLA 5LATA 1ULDA 5FUIA 2OPWA 1R73A 3OGCC 2PA7A 2ZNJA 1MVQA 1O59A 3T30A 3J4UH 1BHAA 4ZS2A 4I50A 1BJQA 3HWJA 2E76B 4HSLA 3BOWA 3UO2A 3SJCC 4GX2A 2WFF2 1NTKH 5EYYA 4MGZE 2X8KA 4PQ9A 3FJSA 2WYSA 4UXAA 2FCVA 4A45A 4MZUA 2JDYA 4ZONA 2V4VA 4PDVA 5T5OA 3PNAA 1CD3G 1UY2A 5DAVA 4LF4B 1NKGA 2B9UA 2PHRA 5DDJ3 2JEMA 4BQ4A 5FDBA 1FMD1 5C6CA 3I2DA 2CTRA 1CJPA 4DXRA 2QDOA 1R082 2VCCA 3T2MA 4QIWF 2VOTA 3UKVA 1BBT2 4OZXA 4XUQA 3GHNA 1FYUA 1AR91 3D0JA 1WA4A 2JG8A 4LHLA 4CXYA 1GUIA 2GMPA 1R6KA 2V1DA 1UY3A 4Q4X3 5B4NA 1P4RA 5J2TA 1ULOA 5KHGA 2VULA 4UCTA 5CN0A 1ZRDA 3RYFB 2B5HA 2AUYA 2WNUB 5FAXA 4YARA 3C90A 3OCPA 1FFXA 5BNPC 5J36A 2RV9A 1AHSA 2JGDB 4J25A 1F4AA 1LGNA 2GNTA 4BW9A 1W28A 1H2LA 5FZ3A 2GMMA 3AVRA 1H2GA 2V09A 4GMP1 3RMYA 3TBDA 3ZHRA 3J81N 1RUC2 2OIGA 3JAKA 4W6YA 2WWSA 1QQP2 2WLKA 1KBHA 2W5FA 3ABZA 4YW5A 2XB6C 2Q6AA 4CZSA 2RN9A 3IMNA 5ABJC 5C3RA 2XJSA 5CKMA 3R65A 2MK3A 2VW1A 5FFOC 2PQQA 2QQKA 4K8RB 2JRIA 3UT0A 3AKQA 4GKKB 3IDCB 4LFCO 1OKQA 4BK5A 5F9TA 3GZTB 2R1DA 3THPA 3NO8A 1JS9A 2FBEA 3POJA 3CRQA 2LW8A 3AZVA 4DEQA 4YRDA 2LP7A 3FLTA 3IJ4A 3L74H 5IY5B 1EP0A 3OUFA 4TSFG 5I0UA 1Q90D 4C1XA 2SBAA 3BHPA 3VBUA 1NCQB 2VNGA 5IVYA 1REEA 1DP0A 2BP6A 2HJDA 3L72H 1JHNA 5FY7A 3SHRA 3JU9A 4EKWA 1EAH1 4Y1XA 2ATKC 2CWMA 1OPOA 5GZEA 4HVRA 1P49A 5FPOA 4GKYA 4EQVA 4X66O 1E1QG 4GKJO 3MIFA 3Q8FA 3KCCA 3CXHF 1SBEA 4AHXA 3HT2A 5BY1A 1JH5A 1OI6A 2UWCA 5F32A 4LBNA 1AJQA 1DQ2A 4QKNA 1YQ8A 4CPBD 2JB4A 1KFUL 4WF9V 3TEXA 3I3BA 5B2GB 2EXHA 4MXWA 3FWEA 3NNFA 2HVJC 3NL1A 4JI6B 2NMNA 4LHKA 4DV4B 5GLZA 4KHPB 5FJHA 3RG0A 3RBZA 4IE0A 3E8GA 3T2OA 4KQ7A 2R6QA 4JGZB 1V9U2 4FPGA 1HRI1 3PVOA 3SYPA 3WW4A 1DLLA 2JJ1G 4LUMA 3QLQA 1NI8A 5A33A 3THTA 3ZMTA 4NTYA 2XDVA 3POIA 1K92A 3WP4A 4JAUA 4FTSA 5AC91 3C3TA 1W6MB 4AG4A 2DUPA 3VB9A 1D7PM 3VQWA 4QDSA 2F23A 3PUSA 5FZLA 3N7KA 3FMGA 2CDPA 5KLVH 1AYM1 4Q29A 4AVSA 3WQ7A 1NR7A 1TME1 4NRQA 3CCMV 4BWAA 3FX3A 1YTFB 2XKOA 1R1ZA 3ZLIA 4A7ZA 4JX0A 4Z82A 5F2SA 1SZXA 2G9FA 2ZE8A 1XBLA 3N7LA 5KHKA 4QQ2A 5KBFA 2HWB3 2WAMA 3PUIA 5GZCA 2R49A 1DQ5A 4MS2A 1ULFA 5BNNC 4L99A 4K1YA 2QQMA 1J58A 2UUAO 4R9BA 3CYOA 2OIEA 1AX1A 5LY1A 5LA6B 3ZR6A 3NJYA 4JRLA 3U0ZA 3BUCA 5LA1A 1HV1A 1RUE2 1FFTB 3JATB 3MIDA 5C8YB 4JQRA 5BXZA 4HK9A 2XHBA 2HYXA 3NKGA 4KBBA 3E5QA 5AVAA 1HB1A 4Q8LA 3RNSA 3LUTB 1W8TA 1US3A 4JI2O 4RQPA 2JENA 4GZ9A 4NXNB 1QHDA 2G9ZA 1W0JG 2MPFA 3SH5A 5KUKA 1HW7A 3POWA 1XNTA 5L9RA 3HKBA 1L8DA 2WWJA 5JPNB 1SF9A 4CDXC 3OY8B 5FMOL 4U3JB 3FZ3A 1RINA 2ZR2A 1TE1B 3I3QA 5IJRA 2IXLA 1AUYA 4DV2O 3JD73 3ZYPA 1MA1A 3LPFA 2LFSA 3CKHA 4J6GA 5A32A 1LHWA 4GULA 3QH7A 3K5LA 3MF9A 4HG6B 2BWAA 3ZPOA 4LO6B 2C4XA 4PIXA 4P5HA 2A6YA 5F5AA 3VDDC 5J7MA 3BA8A 1Y9GA 1TUBA 4PDWA 1XNKA 1ULGA 1PMIA 2HEWF 4LEJA 3ETQA 2F95B 1RHI3 1JZ6A 5CFDB 3GB7C 1JHJA 4WFEA 1U97A 3RGBA 4DRXB 1QLEC 2WA4A 1N3PA 1W6OA 4CDUB 5D8AC 2BJSA 3S6PA 5FWJA 3K9SA 1LNQA 1YXBA 1SQGA 4GUNA 5FP9A 1SBDA 4BQ1A 4JAVA 2XL7A 3S0MA 5LBCA 4WM8A 2X6BA 3CRRA 4XDPA 2YC4A 1UZVA 5FYBA 3GALA 1GN6A 1MR5A 2PHLA 3ABUA 4UF0B 3PVBB 3C3VA 3ZXDA 3JYCA 1C5HA 1Y4WA 4E2SA 1ZZ9A 4O4JB 4A5UB 4AQSA 4QU1A 4M3CB 1UD1A 3G6BA 1WMDA 2VY0A 3QD6A 4RN5A 1NUKA 1J5EB 4LF6B 5B1NA 2A1XA 4WCEV 4XTMA 4ZI7B 4NPMA 1L3JA 1ND3A 4AILC 1S5JA 3WDWA 1NCRC 4XF9A 3ZX6A 2WSUA 4INDA 1K4DC 1JMKC 5JXHA 1CAWB 3JARA 4WFAV 3B7MA 3FB6C 3AM2A 4BIZA 3D82A 1PK6A 2BOBC 4MVQA 4GWMA 4AAXA 1LHOA 3T1YO 3T4VA 1QMJA 4KGQA 5EYXA 2Q69A 1HR0B 3ZIXA 1FX5A 5JH7A 1AYN2 3K3WA 2XASA 2WZPP 4JV4A 3O0WA 2UXDO 2DWEC 2D3SA 3M4FA 1S0BA 2W1WA 5KMGB 3RW0A 3WF1A 2JE7A 1W8ZA 3WNNA 4ZHQB 4JI8B 1YJWV 4KUMA 2JG9B 2EAKA 2WNUC 4TXWA 5IDJA 3RI9A 2ZTNA 1BQ0A 3VZOA 2B7YA 3CZJA 2QDNA 1GV9A 3S7IA 4Y1ZA 4BWOA 2G19A 1N36O 5F3IA 3LQCA 2J1TA 2ZIMA 2ZHNA 3IC9A 4IGPA 4DOUA 1WA8A 3DXRB 3FAVB 5B66Z 4JDNA 2OYZA 1SLTA 5JQGB 2ORXA 1C8M2 1VF7A 4LMFA 1K8AW 2X6CA 4WM7C 3QTCA 1QQCA 2VH9A 1ND2A 5E79Z 3TAYA 1XL6A 3FN9A 3DXTA 1PX4A 3JALB 3B40A 3KVBA 3O1RA 5J2UB 2ZMNA 4Q4V1 2RDQA 1UWWA 1YSCA 3VZMA 1VEWA 5F5QA 1XNCA 1XQNA 2W1SA 5JXIA 2E63A 2V7QG 1AP5A 4BCUA 1AL23 1YI9A 2Q30A 3CSXA 4LBJA 1YLLA 4V2VA 4L87A 5IY5C 4UV9A 5I8YA 2CH7B 2DWRA 2QJVA 3H7YA 4LQRA 3ZFEA 4D6TH 1XSRA 2V5YA 2F4VO 2W2IA 4UUJC 2HJFC 2UUBB 1D2QA 1L0LH 5J48A 2HWF3 1IBMB 2RMKB 1US2A 1XMQO 2P3YA 4RS5A 2R072 4YHHO 4X1IB 2IH3C 2JICA 1QJU1 1IPSA 1ZZ6A 4Q8KA 5FYSA 3ZSKA 3MIHA 2ZJCA 3PJYA 3AG1B 1BMV2 3D36A 5K8SA 4GJZA 2PYTA 3LPGA 5FTTC 5EC1C 2WLIA 2CGOA 1NVPB 1H4GA 5GZGA 2EIBA 3N4MA 1S5LZ 5JAXA 1JW6A 4R9CA 2QKAA 4QX0A 4O9EA 4NIIA 4GMP0 3BALA 2B4KA 4UW6A 2ZMKA 2WN2A 3GJAA 4F7ZA 2Q1FA 3WB1A 4JI7O 1UNBA 4AI1A 1LU2A 3FX7A 3CJIA 4OQ8A 4ZZ8A 3THCA 3E1F1 4JGZC 3OR7C 5HXVA 4Y20A 1W3XA 1BKZA 3ZFGB 4YG0A 4Q2FA 1BEV1 3FFQA 1G9CA 1SQQH 2H8PC 5T5LA 4D7YA 2LS6A 5I93A 4A4AA 3B8MA 1WUVA 1PGL1 4JASA 4DQAA 1HNWO 3JCIA 2WRAA 3ABMB 2RVAA 3C7OA 1W9SA 3M7AA 1I5ZA 3T2TA 4WFHA 4HAMA 4CRQA 4OMDA 3L2YA 3BTZA 4YVWA 4D6SA 4BW5A 1GN4A 1XMOO 2BGCA 5FMDA 1G9BA 4GWIA 4O65A 5E8AA 4UWDA 4RHV3 3L9DA 5GJ6A 5HV0A 4TQFA 3NV2A 3CEIA 4X8AA 1F9KA 1KKDA 3FE5A 1JU4A 2ET1A 1OT5A 1O7FA 3B01A 5JR2A 4GXLA 3VL9A 4AVAA 1HNZB 5A7WA 5FK8A 3RI8A 3VUOA 2ZZJA 1QJFA 4FFBB 3ZHTA 1OLQA 1KMIZ 2WABA 1Q56A 5KXEA 5L36A 1HXS2 4CU6A 3M70A 4DO2A 2Q9LA 5KHIA 1PP9H 1GZWB 3CCLV 5LYJA 1XNRB 1JA8A 5L3GA 3SJBC 1IG3A 4NAMA 2WFF3 4OX9O 4FPJA 3L75H 4A6SA 1VBA1 1JOJA 1KS5A 1IGOA 1RJ8A 3U75A 4OYUA 2YGMA 4E4EA 4RD7A 2B8MA 3B4SA 5DAQA 1HQWA 4QKBA 1Q3EA 2WC2A 3P6BA 4P9JA 2XG3A 1BHGA 1SLBA 2H3OA 3E6DA 4FBFA 1FV3A 2YEVA 4FI9A 3KF3A 5C4WB 3LD8A 1N32B 1VBD1 3O1TA 1A6CA 1W8NA 2LO1A 1WCKA 3PTRB 2XJQA 2QKDA 2QCSB 3BGAA 4PA4A 2WUHA 1H8HG 4DIQA 1L7RA 5LCWL 4FP2A 3W20A 3L2HA 1I3HA 2VXRA 4SBVA 3CB2A 1RUF1 4NE9A 3WW3A 1QY4A 1JFFA 3HKDA 5A3UA 1SZTA 4H2AA 4GYCB 3MUZ1 2W47A 4URTA 4X62B 1HDJA 5D5PA 5F6LB 4OI1A 4DR7O 1G8MA 3C7GA 1X82A 3OTFA 4FPHA 4YFWA 3RPQA 2WT1A 4ZS3A 3BU7A 1ZX3A 3DKWA 4CCCA 1SMVA 3O1OA 4LR3A 1RUC3 1WP7A 2VVDA 1J3PA 5FZOB 3HNMA 5CFDC 4R9DA 1QQP3 3K48A 3ZEDA 3OYWB 1SPPA 2PFWA 4NUBA 3TN91 5F2WA 1FXKA 3ES1A 1DGRN 5FYIA 1W0KG 5C70A 4L11A 2DQ0A 2B1IA 3K03A 3M3CA 1D2SA 2LROA 2IXJA 2OQ6A 2VL4A 4RFT0 1VBB3 4WZFA 2UU8A 5A7QA 4Y33A 1KB9F 3APBA 1O3QA 1VQ5V 1PIV2 3CCQV 1ASJ3 4QAWA 2WQ8A 2Z42A 4OI4A 3FD9A 5FL7G 3E22A 4QE9A 4Y4RA 2ERFA 3H8UA 4Q4Y1 4S2GA 2BGOA 4PLMA 1DLBA 5H2FZ 4DR2B 1VP7A 4X6RB 3T2PA 1THZA 2K1EA 2OX0A 1N3QA 1RUI1 1YFYA 3ZXGA 3VKFC 5JCOC 3RVHA 1SQBH 1UY1A 4BQYA 3O0VA 4I9QA 1MQTC 3MLLA 1K97A 4R7CA 2VECA 1VRH3 1LOAA 1T5EA 4IE4A 2YIDA 2VD7A 2XBO1 1F5JA 5KC6A 1F8VA 5A3LA 3FKSG 4AVVA 3T3YA 1GO3F 3HNBM 2E75B 2WWWA 1EY2A 4DMIA 1BQPA 2CAZC 2W95A 3A2FA 2WLJA 1Y7BA 4HYOA 1X7NA 3B93A 4WBNA 1PV0A 2VOKA 4TSVA 1ENXA 2R061 2XJTA 5H5NA 1WCQA 5EBMC 2D5FA 3K2OA 4WVZA 4XBNA 5CG8A 2DVBA 1ROPA 1YJKA 1W2UA 2A6WA 1KITA 3LSQA 1RXFA 4CDQA 2VOXA 5A7PA 3F7VC 2RS51 1J84A 3SCFA 4CUBA 2UUCO 3ZDVA 3OGSA 5I8SA 1CIWA 5J2TB 1UN1A 1I6XA 1J3QA 5E6HA 3QF7A 1BVVA 3IFXA 1CAUA 1GOFA 3JBG1 1JVMA 3EHBB 3OBRA 5HXMA 4LFCB 2D40A 4UW5A 1X33A 2BOCC 2J42A 3W58A 2OYQA 2R042 5FZGA 2J1VA 1VBE1 4GX0A 4IQPA 5DG1A 3SDLA 1V6OA 2KM2A 4C91A 1KS4A 3DV8A 1RM1B 1RMU3 5FYMA 2QWOB 1BZWA 5L7OC 4LBQB 2X10A 1AR72 5HV4A 4FVVA 4META 1GWKA 4U7NA 3ALQA 5FZ9A 4BA6A 1PL0A 3POBA 4AI2A 5IVJA 1K3EA 3T4HB 1OHFA 3IM0A 4EWDA 5IYBO 4TWTA 4X66B 1RUE3 4K6BA 3VBFB 4C1WA 4TYSA 4OPAA 4QPYA 1ZTEA 4WVWA 4XXPA 4YG3A 4FM2A 3AG1C 4CU8A 3ZFFA 3CPWU 2EINB 3LEKA 3F95A 2ZGLA 1IVSA 1X50A 3KV5A 5SV5A 3ZSJA 5A2QN 4O4IA 1B06A 3J7MA 1DGSA 5TSWA 4LF7O 3DC6A 4JYAO 4URAA 2Q5TA 2DUOA 1DLCA 2RS12 1RUD2 4Y22A 2QM7A 3BTYA 2EVXA 1NQJA 1WD3A 4C0BA 4LO4B 3LB9A 2MHFA 3VZJA 5AVPA 4AQYO 3DPRC 3J7HA 3FHQA 1HKDA 2ZE5A 4XCAA 1GZTA 1OCZC 1OC1A 1ZUQA 4MYEA 3ZFGC 4GD4A 3WQBA 1NJIW 1FV2A 1NOVA 1GN3A 1Z7S3 5LOVB 2JK5C 3ROUA 3BABA 2OTLV 2CAVA 4YWAA 1ODNA 3ZN5A 2E7QA 2V72A 2A7WA 2O0OA 3A4UA 3JUUA 3ABMC 4DINB 4MGQA 3AB0A 4FPKA 2YG0A 2RR12 1O4YA 1WLDA 1B35A 3RYIB 3W59A 3T4DA 4Z1MG 1VBC1 1LEDA 2DFBA 5I0TA 2IJHA 2UXBB 2OVUA 3MAQA 1FATA 5GONA 3J8F3 4N43A 2AZ2A 4NYKA 3QH6A 1JCHA 2GUZA 5T5PA 4DFSA 5FREA 4IHJA 3TXQA 2HJIA 5A33B 2HWC1 5FBJA 5CFCA 4LC1A 5KXBA 4ZXKA 1UZWA 2UUAB 3ZN1A 1ENQA 4QQHA 2B5UA 4HONA 4CA9A 5LW9A 1ZBA2 4LF5O 1NZCA 3MI8A 1O3TA 1YTFD 1OD3A 3SYCA 5F3CA 3WNKA 4NXMO 4XFFA 5FZMA 3H7JA 5HFMA 2HBTA 2ITCC 1RUG1 1O9GA 4YW3A 4BLJA 3GBWA 1RVF3 3SR2C 4CBCA 3QO8A 2K46A 3VDAA 1ZRCA 4P08A 2UU9O 2OS2A 3RYPA 2YBPA 4MW3A 3JAWA 2JDZA 4DR5O 1KDMA 1AILA 3SKJE 1H38A 4E4HA 3GCXA 3BFRA 2P22C 1W2TA 1POV1 5I91A 2XPJA 1VQPV 1PNGA 4EN6B 4X8NA 1VIBA 5FLHA 3MEPA 3H1LH 4XHBA 2ZX4A 1LRHA 5C4WC 4LE4A 3LA3A 2YXHA 4YZ1A 4DV2B 2CSGA 2FDFA 1WPBA 4EZ4A 4PA6A 2R72A 5FYCA 3BB6A 1CAXA 2WO2A 3OR6C 1ST8A 2P1BA 1SQFA 3HKEA 4OI0A 2YU1A 3OTOB 2V73A 2CGPA 2EIJB 1IS3A 3AXEA 3W7SA 5JIAA 1IBLO 2FMYA 1N0JA 1QJX2 1K5MB 3HKBB 3N9OA 3OPTA 3DKQA 2QQWA 1GKBA 4TQDA 1MS8A 4MXVA 3ABKC 1COV2 3LNMB 4FLTA 2D6MA 3MDPA 4PBOA 5C9AB 3M2MA 2NMOA 1C8M3 4AI0A 4Q4W2 4J7JA 2BDRA 5A32B 4RUFA 2PHWA 5LP6C 5EXOA 3X2QC 3AKRA 3LEMA 4UOJA 2BZDA 4J11A 1AJNA 5GLUA 4UB6Z 5D2AA 2RJLA 4TUYA 4MG2A 4IEWA 2VR4A 5EIBC 3CBNA 3ZJZA 4GIQA 2ZNIA 2ZABA 2R0HA 4D6QA 2QBXA 1DGWA 3K3NA 1X59A 1TUBB 4PDWB 3LDKA 2ZBJA 2KR2A 1YIPA 2VBBA 4J80A 4DUZB 5IK8A 3I8TA 4UI9L 3ZHSA 1ZWIC 4FOVA 2XNDG 5LMUB 4XAAA 2GALA 5CBHA 2DOSA 4IERA 4HZ3A 1R6TA 2YMZA 1CGPA 5BYNA 5L3BA 1W6OB 2P6JA 1GQGA 1JR9A 3BVOA 4CCLA 1WLEA 1N1TA 4RR3A 4BHPA 2R7EB 4YW7A 4B3SO 1S4CA 2JDUA 4WM8B 4HZFA 1M06G 3D6EA 2BFUS 1GR3A 3D3QA 2BBAA 1H4HA 2YIBA 1K4CC 2VE1A 1AR61 3AYEA 1UKRA 1TQ5A 4MVMA 3IWZA 1YC61 3A21A 5A7SA 2UXDB 3OFNG 5FPBA 4LFBB 1D4M1 3NAPA 3CQOA 1V00A 4FOWA 1RUH2 2GAUA 1FMD3 1ZBE2 5DZGA 2W1QA 3IDEA 4GJYA 1XYPA 1AXKA 3UGGA 2XWJB 1HJFA 3VDCA 3OW2U 4MGKE 3PN1A 4E4ZA 1V6NA 4AGGA 4LF8O 1OOPA 2QFEA 1ENVA 3CC2V 1TZOA 3LSSA 2XXZA 1AR93 1N36B 5L3DA 1W0OA 3LDEA 4LA2A 1PK6B 3GZEA 3CJHA 3AYAA 5FPXA 3O14A 1GMGA 2PN5A 3VBHB 2E31A 3I4IA 3CC4V 1WB7A 4IT5A 2HWD2 4HOOA 5JH7B 1GN2A 4BJ0A 3CCVV 3KT7A 4ATFA 4ZBMA 1R092 2ZEXA 1MS5A 2JG8C 2ZAHA 4JYCA 3I3MA 3RYFA 3WVJA 3UCSC 3CCRV 2WNUA 2ID4A 4GB31 4BQ3A 2VPVA 2WN3A 2P67A 1FPOA 2JEUA 3I59B 3B94A 4H3WA 4XJUA 2FYUH 4D0QA 2VBDA 1MOFA 1DF0A 1QF3A 3THOA 4KWUA 3ZXAC 4EWAA 1NA1A 2A70A 4EZHA 3LE0A 1VMGA 1RM1C 5FZAA 4XFBA 1ZZ7A 1PNLA 3E5UA 4JTDB 2F4VB 1I1EA 4M4PA 2PAMA 1PO22 3H9AA 1NE4A 5J98B 1O5LA 4R4ZA 2PYLA 1HXS3 2WO1A 3WUCA 4ORFA 1XMQB 4YHHB 1ND2B 1XHZA 2YUEA 2CUGA 1TA8A 2AH2A 4RQEA 2VUCA 1N1YA 2QKSA 1F7YA 4FLUA 1GZ9A 4FM0A 4CCMA 3CCJV 2DVGA 3MV11 1VPHA 1RUJ1 2EINC 1OLRA 1W2AX 4OUEA 3AKTA 5IVCA 1JMUB 3EXAA 5TISZ 2WT2A 1NCQA 4O7XA 3ZFEB 1Q86W 1EAH3 5LK5A 4RA0A 1DBNA 4YGDA 3CU7A 5FKBA 2BQPA 2Z0AA 5IW0A 4NTXA 4JI7B 2HG5C 4CCNA 2AHYA 1MEC2 4IV3A 1XB9A 2ET7A 4AEMA 3R66A 3T0AA 4LULA 1JTZX 4ASUG 5FZ1A 3WU2Z 4MGIE 3GWKC 1URXA 4AF9A 5CAZA 3H8RA 5I8TA 2FCUA 5FZ8A 4X1YA 5HFLA 4EN7B 1NVPD 2ZGTA 4Y4YA 3VQVA 4MHUA 1N47A 3K46A 4DY5A 4AE2A 3NV4A 1MZFA 5JLVA 3APQA 5FY5A 1XMOB 1HRI3 2Z5WA 4MTXA 4P00B 5DDJ2 5IE9A 2B1GA 2ZHKA 5K7PA 2VWJA 3CJIB 4X9QA 4JGYA 2HKXA 4XACA 3Q4HB 1H30A 3H42B 2GC0A 4IDZA 3CC7V 1U12A 1HP8A 3EJKA 2Q73A 5AC93 1S3JA 1TAEA 1WNSA 5FYYA 2MW2B 3DYOA 3HMYA 1JOBA 4DV3O 5L3CA 3G80A 4DY3A 2WSVA 1QOTA 4Q4X2 2IJIA 2G38A 2XVKA 1K5JA 5LGTA 4LBLA 2A73B 2E7AA 3RZKA 4BOWA 2X5IA 1TME3 1MS4A 4HT1T 4YVWB 4NIDA 5FZ0A 5EC2C 2DTYA 1DGLA 2BERA 1US6A 1Q6IA 4JTOA 4DXSA 1PIV3 5C8CA 5CU1A 4CP9A 4H33A 3ZN6B 2GNBA 4L8JA 3ABLB 2WPDG 4TV8A 4NB5A 2M6YA 4QD2A 4MVUA 1HRV1 1JYTA 3PVEA 1YYNA 4CP0A 1UZYA 1VQOV 4Y26A 3UK9A 2W0FC 5A7WB 5AFEA 1B6QA 3SQOA 2JEXA 2E26A 4A3ZA 5CBFA 3ZMVA 4IEYA 3UJQA 5EBLC 4DXWA 3I3DA 3BVCA 2K2SA 3SEPA 5LYJB 4DR3B 2RS32 3I3EA 2W46A 4WVMA 4AZZA 2ES3A 3JATA 3DGEA 1S0IA 5C8YA 1O8SA 1TNFA 5KA5A 1C28A 5ACA1 3CX5F 4Y3OA 5BY5A 5LBFA 4KG8A 1Q6HA 3VBRA 3C7HA 3JXSA 3MICA 4J41A 1KJLA 3C3SA 4UFHA 5A70A 4RQPC 4Q0PA 5DEDA 3QOPA 3F5WC 3JASA 2JKBA 2L35A 4DR7B 3ACIA 2YEVB 3B69A 5JR7B 3THDA 2EIJC 4MTOA 1SLCA 1E57A 4UW3A 1CX1A 3ZIWA 4KWJA 2W6JG 4CH4A 3UQ8A 4DR4O 3RWNA 1JYNA 4Y5Z0 5J37A 3M8AA 1ZVFA 5KHJA 1NAEA 2V4DA 5HCHA 2EZOA 2AC1A 1YI7A 1LENA 3OBAA 4GH4B 1JFFB 2GC3A 3ZM8A 5LL6Y 1SDDB 2R043 4XTPA 1WB8A 4FAHA 5DM6V 4LCUC 1XL4A 4M0HA 4IV1B 4OQ9A 5B1BB 3IDBB 1MPXA 5IATA 4XJAA 5ANNA 4PDWC 4XBQA 1AJOA 4U7OA 4F3JA 1POV0 4ARYA 1AR73 3WNLA 4E9KA 1UOFA 2YI8A 5IWFA 4CDUA 2D5HA 4P5YA 1SPPB 2HLDG 2GV9A 3KHBA 4HPKB 3FC0A 1FXKB 4BAYA 4QWNA 4ZXEA 1LAJA 5FPVA 4ICGA 1OFNA 2ZGUA 4O2AA 2ETEA 3GZUC 5CA1B 1GBGA 2AENA 1B09A 4LKFA 3M3IA 4WM8C 4ET7A 3KCXA 2O8QA 1TMF2 3TK1A 4M3CA 4D6RA 2LJ2A 1JN2P 1FOD1 3OEEG 2WSSG 2ZM6B 1J1TA 3KM5A 4FVMA 1LUVA 4KNCA 3W9AA 2GDFA 2CAUA 4B1MA 4I3GA 2IVIB 3E22B 1Z2GA 4ZI7A 4QGLA 1RUD3 4PA7A 2HWB2 2RCVA 5FZDA 2DJVA 5JCOA 5FQ0A 2VUJA 2ARBA 4NJ4A 2EJRA 3LDRA 5FZBA 1V6LA 5FY4A 4CUCA 4J9ZB 2YPJA 1EZVH 5HPOA 3DUIA 3JAMN 1EV12 3WDTA 2QQNA 3A0NA 1PK6C 4AI3A 3BI3A 3WZ1A 4XFGA 1G1XB 4AGRA 4LITA 3WQ1A 5E89A 2LM3A 3D3AA 3A0KA 5FYVA 4JC1A 1C1LA 1HDKA 2BTVC 4K8ZA 5EPAA 1V55B 3B77A 2IXIA 4XE9A 1Y6XA 1VMFA 3WB2A 1F4NA 3B00A 4ZHQA 5LEJA 2VAUA 3VD5A 3I2GA 4Q20A 5LRRA 1YNAA 2JG9A 1JXNA 3S30A 3AG4B 4WBNB 2QEXV 2DBIA 2Q1MA 1WMEA 1OXCA 5F5IA 2DN9A 5EZWA 1J95A 3MIBA 4LHNA 3ZRVA 4RWUA 3VKLA 1G86A 1M9NA 1UQXA 3EBRA 4CDQB 4YJ2A 3HN1A 2XAJA 3UESA 1QOSA 2OUHA 2V5DA 4LF9O 4KWLA 1ZBA3 2ZE7A 3K08A 5FRAA 1JBCA 1ZLZA 3POFA 4B3RO 2XVGA 1CWPA 4YIOA 5DUUA 3IGAC 1ND2C 5J2UA 4I0AA 2TNFA 3SXWA 4CXWA 3H1WA 1E5HA 2YS8A 2ZEZA 3PDQA 1PO11 4LBQD 3KGZA 4DW0A 4EFEA 3CL1A 3JD0A 2WLMA 1RHI2 4HSJA 5H6RA 2P34A 4H55A 2GDSA 1S0GA 5JDBA 3P5BA 3TJTA 5KC5A 1QGLA 4FP3A 3CEWA 4Y24A 4JYAB 2BTQB 4XPVA 4ASKA 1ZZBA 1QJU3 3ZFEC 2Q0OC 1GNHA 2JS3A 1JODA 2JX9A 3PU8A 4X1IA 4FPEA 3GCWA 3Q8BA 3OAAG 2A79B 4YVSB 3V64A 1QR8A 4B3MO 2JB8A 2W52A 4AQYB 3EVKA 4CDWA 2ZGQA 3WP3A 3WHUA 5FBZA 4KG0A 1G4YB 3ZFFB 2QM8A 3D36C 1OCOB 2ZA9A 3WF0A 4IEZA 2DYRB 1ZYBA 3TWIA 3EHKA 1HX6A 3M99B 1XREA 2BNOA 2XT9A 4A41A 4F8AA 4NHXA 2UYBA 1SLIA 3LEGA 1NKDA 1QJX3 2CY6A 1NLQA 3ASIA 2NM1A 1XUQA 3L70H 4DV7O 1M4UA 1M90W 5IJ9B 4ITCA 5FP8A 2WAOA 4U2AA 1UY4A 5L19A 3I2OA 3ZFGA 4E8DA 3CJIC 2PLV1 3ACFA 1GNYA 1WW5A 5CG9A 1Q7YW 3JD1A 5JOZA 3CP1A 3FUQA 2P2KA 3V56A 2XL9A 4LORA 1K3IA 4B4PA 4QM9A 2W94A 4CC6A 5KX5A 3VD9A 3GJBA 1V6IA 2AGAA 4QX7A 4OHYA 3W7WA 4YGEA 1P7GA 1C3HA 1LOCA 1EYBA 1ULPA 2YXSA 4LF5B 2N7GA 1YIJV 1XHXA 2TEPA 1D0HA 5GM0A 5CMUA 4EYUA 1UO9A 2F4LA 2RG4A 3OM3B 4HN1A 4YVWC 1B35B 4OVEA 3AP4A 1ODMA 2IXHA 3EMRA 5KUMA 1YQ6A 3TCUA 2DE0X 4TV9A 4CUGA 5GONB 4N43B 4CCEA 1R1A2 3G6EV 2GUZB 2DW4A 2UU9B 4QE7A 2E51A 3ABLC 1IS6A 1GWLA 4DR5B 2DBNA 2FKXA 3R6SA 4IHJB 1WCDJ 1H8VA 1PVC3 3G7DA 3H1YA 1EN5A 5F7UA 4N9IA 5H9QA 1NH2B 4QB6A 1GZWA 2A7AA 4LKSA 1KU9A 3IPVA 4R9AA 2A71A 3WG3A 1VBA3 4YFZA 4Y5TA 3SPIA 2BFUL 4N9HA 5LXTB 5I0RA 1K34A 2P3KA 4FQ4A 3DF0A 4DNYA 5LA2A 3ATGA 2XMLA 1RUH3 2CTQA 1IX9A 1UPGA 1AL22 1PGW1 5F6KA 1ZBE3 3F5TA 3JAWB 4DV0B 1XDCA 5EBWC 1S5HC 5K1XA 1FPN1 3K51A 2XAFA 1IBLB 5FK7A 1S0EA 4RYDA 4FIPC 5LB6A 4Q27A 2HWF2 2P7TC 1Q43A 2VUDA 2R0FA 1UPIA 3ZYJB 2LFRA 1X36A 4FXGB 4JQTA 4O9GA 3K59A 2I45A 1KXGA 5A3MA 4NRMA 3DEMA 2DVAA 2HWD3 1QKQA 3LSEA 5C5TA 1BSMA 2WR9A 4AQ6A 4PIYA 4UBGA 1CONA 1QLNA 2XLGA 2RMU2 1RB8G 4NO4A 2X09A 2PYJA 1CAXB 3AL6A 1R3IC 3MHHC 4GH4C 5DUWA 3EO6A 1OSGA 1GU3A 4XMAA 3JD71 4DRVA 2XH6A 4DPNA 1VLNA 2WQ4A 3GXUA 5B1BC 3WW2A 3FB8C 4JYYA 2PTMA 1AR81 5HCFA 5FZOA 2PZSA 1RPOA 1UF2C 3R4SA 5A1AA 3O1MA 4B08A 1JYXA 3LDDA 3QG5A 2Y0OA 4BQWA 2ZAAA 5E16A 1BCCH 4OUSA 3WG2A 3JQXA 1I9RA 3UGFA 1FXKC 1MZEA 4COUA 1L0NH 4B3SB 5LHHA 3IZOA 5IAVA 4R6ZA 4TUYB 4Y1UA 1G8WA 3HIFA 4AHYA 2OKXA 4UB8Z 4D69A 4XC9A 1W9FA 5IYYA 1VRBA 2RM21 1N3OA 5C7GA 3VL8A 1AL0G 1QH6A 1J3RA 1JYWA 1Y43B 2WINB 1SQXH 2Y34A 3NR7A 3W5MA 3T0DA 3WT3A 1PM4A 1L7QA 2Q4SA 3TRSB 2B46X 1F51A 5A6YA 3L71H 2P6HA 3KQ4B 3T1CA 4B29A 1JZ7A 4U3FH 1OA3A 1UW8A 2GH8A 2WS92 3LFMA 4PBPA 1RUI3 4RR3B 1F4HA 4ABMA 4QGPA 4CCOA 1XU2A 3LIHA 1MEC3 4AK3A 1C8NA 4CEYB 4IGOA 4ES8A 2YICA 1CZTA 2C26A 3VOUA 5DZEA 4K40A 2AHZA 1Q8IA 2XBO3 4LWSA 5C3PA 4PLNA 5JJNB 3VZLA 4ZU7A 2ZACA 1PNKA 1PZ7A 5IVEA 2UWAA 1KP2A 2J1SA 2ZCWA 4ZHNA 1LJ7A 4Z8BA 5JCTA 3NAPB 3E8BA 1SG3A 2XAGA 3BEHA 2ZGNA 1NY72 2D6KA 1JZ4A 1V55C 2C1FA 3WG4A 3TOJA 5JJEB 2ARAA 1KQSU 5CA0A 3KVAA 1O5UA 1DTOA 1WLCA 2K0GA 2XTAA 2CTWA 4H0LB 1OOPB 4YJ3B 2ZEYA 2FMLA 1KECA 3CJHB 3RRDA 1Q82W 2OCCB 2VOVA 4QPIA 2VCMA 1IBKO 4CDQC 2RNBA 1Y9MA 1W0NA 4HL0A 5IHRA 3WX5A 3AEIA 1J1LA 1S0VA 4O2BA 4ZKIA 3U11A 2MNGA 2WYFA 2VCBA 3HQUA 2VQEO 1VBE3 1GANA 4TTGA 1HB3A 1QH7A 3ZS8C 3E6BA 1H2KA 4CH3A 3I2IA 4I2OA 1OUSA 3RZHA 4OLLA 3U4SA 4OZOA 3PJQA 1SLLA 1H9WA 3P3NA 3I2JA 4PQQA 2QQJA 3H9VA 4GCZA 1NA1B 4IYHA 1GZCA 5FZ4A 4LBQA 2WA3A 2R32A 2XLAA 1OH4A 4AYUA 3VKNA 1AJPA 1WGPA 1RTVA 2W6IG 1YHFA 3PVNA 1UIJA 3POEA 4JV5B 2H0VA 1XSQA 1IG0A 2RS33 1VQNV 5FIXA 5EZYA 3WNOA 1HN0A 2JD4A 4DUWA 3VBFA 1O91A 1GQHA 2JDPA 1M1KW 4I09A 2BVBA 1WMXA 3R4UA 5FY0A 4MO3M 3LOBA 2J1AA 1VBB2 2WNEA 4JI1B 1RGSA 3ZFFC 1W9WA 4UVCA 3C2UA 4AL9A 1MG1A 2DYRC 1R3KC 1ASJ2 4GKKO 4H37A 1WKYA 3VV1A 2HKOA 1QIQA 1Y66A 2AW9A 2VZ1A 4FLYA 3VLBB 4BQXA 1FXHA 4IV3B 4B3NA 2LQTA 1SHWB 4FLWA 2F4PA 4AOCA 3AJYA 5FXZA 3I49A 3D3IA 1R1BA 1JZ5A 3BKZA 4NIGA 1R3JC 4MLOA 1XJAA 1SDWA 1A32A 4X1YB 2IC1A 1AZDA 1VRH2 4DR1O 5LOVA 1VQ9V 1MNGA 2DYSB 4L92A 1QJY1 2W1UA 4Q5OA 2ZGKA 5BUVA 3M3QA 1AROP 1SQ4A 1RPRA 1XNBA 4HMZA 1H0BA 1VBC3 4OI2A 4L9BA 4YG6A 2HYKA 3NNGA 3I97A 4I0WB 2J1EA 1CPYA 4XFAA 1QR9A 3RYIA 1FT9A 3H3LA 1C57A 1LGBA 3AMMA 4EROA 4EWEA 4CCJA 2VQFO 2VJXA 5A7OA 1B35C 1NYWA 4JGYB 2WZR2 4X1KA 3HPNA 4X64O 4KHPO 2GZWA 1W6QB 2D93A 1LTEA 3OD0A 4N43C 1N1VA 3S3XA 5IT9N 2JDHA 4N90A 4DUYO 5GLVA 1Y3TA 2L6LA 5FXVA 3MDSA 4FFGA 2DVFA 2YROA 3V0AA 5CFCC 4XDLA 5FV3A 3UNPA 3CMEV 5T52A 4IETA 1GM7A 4A7YA 1OF3A 3F2ZA 3AG2C 1M93A 1Y67A 2X5IB 5F3GA 2VXJA 4BLIA 2VMEA 2D3OW 4FSJA 1RUG3 1TMF3 1DIWA 1W39A 4RHV1 2YB7A 3N9PA 2EALA 2IFRA 5C8CB 4V1PA 4DB5A 2XQXA 4CP9B 1V6KA 2BOJA 2VTXJ 4TV8B 5FZEA 1RMU2 1FS0G 2BU9A 3T09A 3K5MA 2C24A 2ZT9B 1POV3 5BMVA 3H3ZA 3AK1A 2OZ6A 2QR4A 4QNHB 3Q8AA 1JQ0A 3GM8A 1NXMA 1I5YA 4ZOLA 4G27B 3ZHVA 1CESA 2QGNA 1U0AA 2WFF1 1PX3A 3Q8CA 3N9NA 5BNOA 4G4FA 2AXTZ 1OF4A 4FZ1A 3E86A 1EV13 2BUKA 4YNIA 4CZZA 2CGNA 4WVMB 1QNMA 3QCWA 2E32A 4BQ5A 2WNOA 4YM2A 1MSDA 3HEIA 1N0NA 1GP4A 1H9PA 2YUAA 2D7FA 3VBRB 4NTWA 3WF3A 4DR6O 1XOUA 2EX3A 2D3PA 1R081 3KV6A 3J80N 2VZVA 5BZBA 4W4KA 1I94B 1JJ2U 2VMIA 4X65B 1BBT1 5GTHZ 5L3EA 4MVSA 1YEWA 3U37A 3JASB 5KXDA 5IYDO 3CRAA 4GX5A 4Q6GA 4J42A 4JI5O 1K5MA 1YJLA 2Q0AA 2HP8A 1MABG 1XBFA 2HEYF 1PD3A 1ZA4A 3GBFA 5T50A 3NV3A 2QWRB 5K1PA 4G9SB 4IE6A 3VGIA 3MYXA 4BE3A 4BB3A 5C8WA 5C9AA 3CDZB 2RDCA 3V0BB 1EPZA 3NNLA 1E5RA 4PDLA 1F35A 2VW2A 2QVSB 3ILRA 3CCEV 1Z7S2 4XFCA 4B3TB 5F3EA 2ORZA 4YYOA 1OHHG 1RUC1 2HVKC 1QQP1 1BK0A 3LF7A 3JD2A 4GT1A 4YM3A 1LODA 1H6YA 2UYAA 2AZ0A 4QB2A 2XHNA 1GAXA 2A75A 1LESA 2OT7A 1V6MA 5FXWA 3J8F2 1Q8SA 1LKNA 3NNJA 4MGYE 2BV4A 3NXSA 3ML0A 2P4VA 2PAEA 4FLZA 4JHTA 3N2GB 5JWPA 3VBSB 4X6QB 4IE5A 1OUXA 4O2AB 1T6BX 4E4SA 3TNQA 4RR3C 4AQTA 5BR8O 2ZKLA 3N2KA 4D7TA 3FLPA 5FUPA 1WAZA 4CEYC 5A80A 2VMCA 4K8XA 2W08A 3EFFK 4NMIA 5DABA 3QVNA 3VQYA 1D4M3 2EA7A 2PF4E 3KKYA 5EJZB 2VMGA 2MEV2 4ZPIA 5CA6A 2EULA 2IW5A 1RVF2 2JJ2G 2XHKA 3K5OA 4H7LA 3OEBA 4LNUA 3NAPC 5H9CA 1MACA 5J3UA 4LK6A 5FLIA 4P9PA 1FNYA 1HJGA 3ZSLA 4CE8A 1DQ6A 1N33O 1AR4A 4A2UA 5FQ0B 1MMMA 1J5EO 2VZUA 4LF6O 1NZIA 2PI5A 4ZZ5A 3AMQA 3K77A 2VZSA 1OOPC 4TN7A 3VBHA 5KHHA 1MVEA 2B9ZA 1F23A 1A8MA 4JCKA 1IS5A 4ZKTB 5FMOS 4LF9B 4ONUA 3RWRD 3SJQC 4K8FA 4DW1A 2IM9A 4YPJA 3MUY1 3T4ZA 1NX9A 2J7MA 1V9U1 2B45X 4B3RB 1Q5OA 2FHRA 3I59A 4Q1RA 2Z3YA 2P4KA 3CRMA 3POYA 1BLZA 2HWE2 5LMNO 3AX4A 4N7UA 4AI8A 4Y1YA 1R1A3 1O9HA 3RVYA 3GBGA 2ADQB 4LT5A 1QNYA 2Y6JA 3LOIA 2XJUA 5JVDA 1NA1C 1FD9A 2NZ9A 3MFCA 4JDMA 4MTGA 4YJ2B 1UX6A 3O1PA 4LNVA 1B3QA 4MSVA 4QB1A 2OXBA 4W6WA 4XURA 3GYDA 2C9KA 3PLQA 2VS0A 1FNZA 2BYVE 1A78A 3CD6V 1NBMG 5D5QA 5A6QA 4QPGA 3FHAA 1RUJ3 1QXPA 2IBZH 1URFA 1HNXO 4M4RA 3ZYGA 2DTWA 3USUB 2XAHA 3AXDA 3HAGA 3LGRA 4XBLA 2CK3G 5DAWA 1NCQC 4KI5M 2OW4A 2O14A 4UFKA 1RUE1 1W2NA 2H6BA 3MHZA 3ZXLA 4DV7B 4HLTA 4CH5A 2ZQMA 4NWVA 5T55A 4UBHA 3UM7A 2NYYA 1AI4A 4IV3C 4CDWB 3E2EA 1RJ7A 4XDJA 4AGVA 3ZOIA 3D0SA 3RS6A 1PNMA 4AHCA 2RMU3 3MIEA 3AYDA 5GW7A 3WY6A 1IBMO 1VARA 1OVPA 1DU3D 2LTNA 5FO8B 1GKFA 4YW2A 2A06H 2DWDC 2ZX1A 4B7EA 2W68A 2DYSC 1OLME 1I0HA 1GYKA 1AB3A 1FMD2 4GWNA 3WEZA 4H13B 2DCJA 4CS2A 4BH9A 4DXTA 1EUTA 4KL1A 2DVDA 2FL4A 1X8MA 3K79A 3Q4HA 1YRZA 3PMSA 4UW4A 2YU2A 2WKKA 1AR92 2I07B 2VTXA 4QXKA 3E5XA 4LIVA 4TZDA 4JGYC 5FXXA 3N35A 3U07A 2ZINA 1ZZ8A 3UO3A 2XOMA 4PCRA 4OCTA 3WDXA 4FPCA 5KX5B 1U5IA 5FPAA 4OHZA 4XUTA 2LRPA 2X0LA 4ISQA 3TNPB 3HJRA 4KP4A 2D2CB 2DYCA 2PHTA 2ARHA 2ZOEB 3DSQA 3WR0A 3NJXA 5E88A 2X5IC 4CS4A 3GZAA 3CCUV 2XWBB 5IK7A 1SBFA 3IIIA 3ZN6A 1HRV3 4TV9B 5C8CC 1S77D 3A0HZ 2Y6GA 3S7EA 3P30A 4QGNA 3IAQA 1W05A 3STZC 3CE2A 2WS93 1DYKA 1VMJA 4DS0A 3WF2A 3PUAA 3SGIA 4OPHA 4NHMA 1W90A 1CXZB 1O8PA 4C8DA 4XZUG 3HPLC 3DTUB 5ITZA 5K9YA 1E1RG 3IPVB 1IQAA 2YHJA 1XNDA 2YC0A 3B9IA 4QT6A 4EFBA 3ASOB 2CL2A 4P9XA 1NTZH 4E2GA 4BPZA 1EZJA 4RSUA 4KBZA 1DZRA 2TUNA 4LO7A 3I7DA 2OIIA 5IK4A 3VBRC 3PUQA 1UCXA 1TUEB 1Q81W 1NLRA 2SLIA 5EHDA 1TVKB 3TYJA 4HKLA 1EAH2 3NKTA 4EJRA 4QU2A 1Q6UA 4AVBA 3OUJA 5T5JA 1AYN1 3UGHA 1G9AA 4XIOA 3POGA 3OEHG 4KXRA 4I5SA 2JGUA 3ZYBA 2D6LX 2OTJV 4X89A 4I0BA 1COWG 1JZ3A 3R05A 1BHBA 3CS5A 4DUXA 2IXKA 3U78A 3MV01 4NRPA 3WNPA 2EZPA 4N53A 5F39A 3K06A 2BE3A 2EIGA 4PV1B 3NQHA 2NN8A 3WCSA 2E3CA 3ZSEA 1J83A 2KQXA 4J1XA 1I7FA 1ZRRA 4GH4A 1YUDA 1AI7A 4P9OA 2JECA 1YQ2A 3AKPA 2R70A 3KCYA 1KD1W 3K4AA 5FPZA 2VCAA 1FXVA 2WLLA 2KG7A 3M3OA 4IV1A 4MX3A 1KQRA 3ACHA 1SQVH 1HRI2 3NW4A 4OUMA 5ANQA 2VG9A 1MSWD 1C8M1 4IEVA 2Q67A 3AZWA 5JI7A 2X29A 3B9CA 1SERA 4DK0A 1AI5A 1U5YA 3UKTA 1XILA 1XOYA 2YI9A 3CCSV 5AC92 4HPKA 1VQLV 5K4LA 3MD0A 3AVSA 4CDUC 2F43G 4G3YC 4Z2WA 5D21A 1KGYA 3FHIB 3PTYA 1I5XA 4K0KO 1K33A 5CA1A 5F5CA 3UJOA 2UY8A 4AWDA 1TME2 3D4KA 1LOBA 2P4EA 2WLPA 5DQ0A 4F6RB 3KZIZ 4AFMA 1WBLA 2Z79A 3KWVA 1UOJA 3J7AU 3EYPA 2FCTA 1JUHA 3ZSMA 1WW6A 3RZZA 5KR7A 2R071 2Y0IA 3WUDA 5F2VO 3AL5A 1WW4A 1BMV1 3DC5A 4K3AA 4A42A 1SETA 3B02A 4RGKA 1WPXA 1V70A 4LA3A 4K35A 2Y6FA 5A6ZA 2ZR3A 3MGUA 1NCRB 2JIJA 3NMBA 5D1IA 4LWSB 2YIBD 1YXWA 2DCTA 4Q0QA 3GF6A 4LBOA 1J59A 4O4HB 1IBKB 4DR2O 4LOSA 1BT8A 3OUSA 4UV8A 2WNVA 4CP2A 5K0UA 4HNAA 2CU5A 2N05A 4EN8B 4QXCA 1SCRA 5BNQA 2VQEB 5LHGA 1DG6A 4PF1A 1VF6A 5KAFZ 4XFIA 4ZY9A 2DU1A 2VGDA 3KLSA 1AJKA 4W6XA 5CA0B 2NP0A 2JG9C 3K04A 3ON7A 4JTNA 2WZR3 3K75B 5IYZA 3J7LA 3ZRWA 4E8CA 1Y76A 2R30A 1QWRA 1W8UA 2D6PA 3RQ0A 3SMHA 5CNAA 4QPIB 2PXJA 5DN6G 3AFGA 3SNMA 4I02A 1L1FA 3U1XA 5EWSA 4O2BB 4X20A 4K1ZA 4WFGA 4AAPA 4OFGA 4YW4A 1TGOA 3OSDA 5CIRA 1F15A 1VR3A 5DXDA 2JE8A 3WF4A 5HCBA 1PO13 4WBBA 4WM7B 3B09A 3ZN4A 4D7SA 1GOGA 1JUIA 3JCZA 4Z2AA 1OMIA 1XNQO 3J26N 3BA9A 1V0AA 3HVDA 3CIHA 1HXS1 5DG2A 1SLAA 1AVBA 1RXGA 4TOIA 1E5SA 2BTQA 4AEKA 3BTAA 2E74B 3VBOA 1W6NA 5FR3A 1OH3A 3J9SA 2YC2A 3CXCU 4FFHA 3G4SV 3HR9A 4YVSA 2ZGMA 5EZYB 5EIYB 4NKGB 3ZR5A 3ILFA 4GKJB 1LB2A 2A0LA 4LJHA 3LWCA 2LGWA 5J09A 3K3OA 5EV7A 5C71A 4CTEA 4DV1O 3WDUA 4CDWC 4IGGA 5HI0A 1GWMA 1O6UA 4DR1B 2JS5A 1DK1A 4JGSA 4MH0E 1XQ8A 4XVHA 4CSWA 4PT6A 1PHMA 3HQRA 4HETA 2KSDA 2Z2SB 5FNVA 4FFFA 1H6XA 5LWBA 4XUNA 1W0PA 2YBSA 1W99A 4CVUA 3E6CC 2PLV3 1D5NA 4OHVA 4ES9A 5IJ9A 2VQFB 2ZHMA 4BXFA 4N21A 1OJHA 1SESA 5FMBA 3UETA 1V6JA 1KUQA 4RQFA 4X64B 2FZ2A 4QPKA 4HKOA 3H1KH 5FP4A 3ST7A 1ZM1A 4KGGA 2IH1C 1QDOA 1XE0A 1CJDA 4LFAO 3SJAC 4DUYB 4DXZA 1QDCA 2Y64A 4AFBA 4PJYA 3LSDA 2PMWB 1PMJX 3QO7A 3SYQA 4YW6A 3TETA 2Q5ZA 4P9GA 4QDQA 4JI4O 4AFDA 2YPDA 4I55A 1NR1A 3KT1A 3WLUA 1GP6A 3AZYA 5DECA 1NE6A 2JDNA 4BIUA 3ACGA 5A3OA 4IL6Z 1UJWB 3WV6A 3QBQA 1OA4A 5E1RA 4X1KB 2JDMA 3WG7B 3G71V 2CYFA 4I30A 3USSA 4J10A 4WFBV 4W8JA 2GTSA 2WZEA 4UFZA 1TNRA 1VAKA 2VRZA 4K20A 2VNOA 1JZ8A 1W9YA 3V0AB 2UXBO 1ORQC 1K7DA 3N9LA 1PIV1 4JZ2A 2VZQA 4Q4V2 2H94A 4XDQA 2XGXA 5EJ1B 4QHZA 5IVFA 2XOKG 2IZWA 3K58A 3IKWA 4QHOA 5LXTA 2MEV3 4DZGA 4K21A 1Z0HA 2A6ZA 1IXMA 3ASOC 1T2XA 3E8FA 4XFHA 3R0RA 4QXBA 4JI2B 4DR6B 2WFPA 1FPN3 2ODMA 2ZEWA 4CXXA 2DFCA 5BMVB 1QU0A 1D2DA 1PMHX 3E83A 2AGSA 3PUHA 3OUIA 4ZOLB 3CJXA 4JI5B 4FPYA 1QJU2 1UU6A 4UCUA 4EB6B 4BM8A 1KJRA 3HB3B 5BNOB 3O1SA 4AEDA 2IUWA 1FAFA 1FKAO 2IWGB 2B42B 1CPMA 1CZSA 3K9AA 1TEIA 3RYHA 3AP5A 3ZYRA 3W7TA 1VQ6V 5IT6A 4R8CA 4KU7A 1JYCA 4B4RA 4XQ4A 1SEFA 3ZIAG 3UKNA 2VNRA 5L9BA 3A8TA 2HWE3 2ZKOA 3N9QA 3OGIB 1NQTA 2QUOA 2VZOA 4K3UA 1AR83 3ASNB 5GKAC 4JZGA 3N27A 3H1JH 1BEV2 2ZXWB 3ORJA 3OTOO 3EXUA 1DGWX 1PGL2 2JVDA 2G9GA 4TLGA 3L73H 2R041 2XVLA 3MHSC 4Y5SA 4L97A 1AI6A 5JOXA 4LUKA 4AHZA 5JXGA 1O4TA 2CE4A 4YW1A 2RM23 5LHIA 3H1HH 5BR8B 4FPPA 2FDHA 1XI1A 1IKPA 3OGGA 2QQIA 3O7OA 3I5DA 1JX9A 1SA0B 1BQZA 1AR71 1HN1A 2GP3A 5FMCA 2Q8DA 4BZ4A 3A22A 1BMFG 4MGTA 2Q8EA 4EEQA 4BIFA 5FZKA 3H3UA 4M01A 3AMPA 4PF5A 1JJOA 2R1BA 4F4LA 2G1MA 2ZS6B 1CN1A 1XE8A 1GQPA 5JPMB 3OE7G 3PL0A 1V9PA 3ZMSA 1ULCA 4BK4A 4DUZO 3K0DA 5JZGA 3ZXEA 5FPRA 1S0FA 1N33