3ZRXA

The high resolution structure of a dimeric hamp-dhp fusion displays strong asymmetry
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 45
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrxA00
4KP4A 1IXMA 2WWWA 4MT8A 4I5SA 3TK1A 5IDJA 3A0RA 3NXSA 3ZCCA 4ZKIA 5B1OA 3ZRXA 4BIUA 2QM8A 4QPKA 4GT1A 3P32A 4U7OA 2P67A 3ZRWA 4U7NA 3ZRVA 4JAVA 2QM7A 3D36A 4FMTA 1F51A 4JYBA 4Q20A 2FTKA 4QPJA 4BIZA 4LC1A 2C2AA 2LFSA 3DGEA 4JYCA 1JOYA 4FPPA 4JAUA 2LFRA 5C93A 4JASA 3ZRWB 3MD0A 4MTXA 5B1NA 4GCZA
chains in the Genus database with same CATH superfamily
1XNQO 3JD0A 1NH2D 4BIOA 3G6BA 4JGSA 2W6JG 5LP6C 4PHZA 4K8ZA 2JJ1G 4I0XA 1ZAUA 4YIOA 3VBBA 1I7FA 2EZPA 4YJ3A 3K5NA 2A0LA 3OGIB 4DV3B 5CA0B 2ZNIA 3FYEB 2P06A 4JYYA 5H2FZ 1FJGO 3FYIB 1QHTA 2Q69A 3CWBH 3UKMA 1ZWIC 4X1KB 3DXRA 1KYOF 3A0HZ 3WFVA 1EFRG 2EIMB 2QM7A 5LGTA 2VQEO 5IJ0B 2O57A 5BMVA 4X89A 1I5YA 3BAAA 4OPAA 2Q7EA 4JAUA 2QKAA 2ZDIC 5L3FA 1W59A 5DN6G 1U96A 1DF4A 1TUBA 2OWOA 4FLTA 1PL0A 4O4IB 1JFFA 1N33O 2EIMC 3ZMTA 1OCOB 3CRAA 3PJSK 4FLWA 4H33A 2YS8A 3JAKA 4DR7O 3N2GA 1KBHA 3T2MA 1SS3A 5B3SC 5IJ9B 1R3LC 1HNWO 1ZX3A 3K08A 4MTFA 1GKFA 4MT8A 1VF5B 1QCEA 3FB8C 3CEIA 2JRIA 1HNZB 5CA1A 1OCOC 2WA4A 3W7WA 5LOVB 2Q9LA 4MW8A 4FMTA 1N0JA 1ORQC 4Q20A 4ZI7A 1FFTB 2OIEA 3G80A 1D2DA 4DR6O 1H2GA 1RPRA 3F7YC 1VARA 1K73W 1LNQA 1KU9A 4U3JA 3ZRSA 4HNAA 1I0HA 3UQ8A 4X62O 2CTRA 3HKBB 3JASB 3DTUB 2EBOA 3KCYA 4DR2B 1SRYA 2P7TC 1R6KA 4FIPC 2AGAA 2Y0PA 5IYBO 2UUBO 5EYPA 4YHHB 4X1YB 3BHPA 1JOYA 3AK2A 3L75H 2IH1C 4YJ2B 2YXYA 2HHHB 2X6CA 3OMIB 3F7VC 4LR3A 4DUYO 4NTXA 1JJ2U 3W7TA 1K3EA 5EC2C 2UXBO 1ZSPA 1QVGU 4MVMA 4WF9V 2UXNA 1NT2B 1VF6C 3JD4A 3E83A 4GYCB 3R66A 4DR3B 2VQFB 3OW2U 5J2TB 5JH7A 4K8XA 3H1JH 3X2QB 3GWKC 1SA0B 1BQ0A 4U7NA 4IHJB 1CEZA 2EULA 2ZIOA 4B3MB 4G28B 4IT5A 2NN4A 3ICXA 5C93A 5KX5B 2PGGA 1J95A 5B1NA 1DTOA 1N34O 3H9VA 5KHHA 1YHQV 1A32A 3NXSA 1YI2V 3X2QC 2DYRB 3RGBA 4P30A 4JI3O 2OYQA 1K4DC 1EN5A 2HJDA 4D7SA 2XAJA 4BR6A 4X9QA 1JQ0A 1WPXA 1YTFB 4ZHQA 3IC7A 3DGEA 2ITDC 1VQMV 1B3QA 1W2BU 1M90W 2JDIG 1OV9A 2CH7A 3B40A 4JASA 3OFNG 3B8MA 1Y74A 2UXCO 1AR1B 4LF4B 2DYRC 4FFBB 1B06A 4DW0A 4CZZA 1ZLZA 2IJJA 3OR7C 4DXWA 3CC4V 4O4JB 1XUQA 1NKDA 3BFRA 2XUMA 4BIZA 3ABLB 2ADPA 2DE0X 2LFRA 4DYLA 2F4VO 3QVNA 1FXKA 2XHBA 4JI0B 4ASUG 5LYJA 4JI8O 1NVPB 3Q4HB 2CTWA 2WPDG 1NJIW 4TV8B 1CXZB 3JAWB 3L70H 5EC1C 3SJAC 3RVYA 3I55V 4GX0A 1G8MA 4X20B 5FL7G 4Z2WA 3ABLC 3ABKC 3VQWA 2UU9O 4RUEA 3HPLC 3K9SA 4CH4A 3EVKA 2P4KA 2RQ6A 4L87A 1FS0G 5EZYB 3TJTA 3CCVV 2ZM6B 3LDCA 1YVWA 2YIAA 3B8NA 3E8GA 3ZHUA 3CRCA 2BCCH 1Q5OA 5D5PA 2XTAA 3CCSV 3VOUA 4K3AA 2UUAB 3JSNA 3U10A 3ZN1A 2PF4E 1K5SA 3D8CA 4ZKIA 4JI6O 4OPHA 1YCIA 4UVBA 3UT5B 4LFCB 4X64B 2WLIB 1JX9A 4H44B 4FLUA 2W0XA 4MTOA 5CBHA 1AI5A 4LNUA 2ZR3A 3RYHB 5L3EA 1XOUA 2F23A 4JI7O 2QR4A 2IW5A 2JGDA 3RWRD 2BSKB 3U0ZA 3JCUZ 2E75B 1FXHA 1SKVA 4HAMA 4R8CA 1VQKV 1KC8W 4IIJA 4GKKB 1GTOA 3J81N 4XDJA 5LMUO 4UCRA 1TUEB 1GK9A 1YF2A 1QR8A 2E5LB 3CS5A 1HR0O 2XAHA 4IL6Z 3APOA 3LSUA 1ZL8B 1BHAA 3N2KA 3ZS8C 4GCZA 3CYOA 3OMAB 4X1IB 1MMMA 5KAFZ 3QNEA 3GWOA 4DV6B 2WLLB 4D6TH 3CJHA 3BRCA 4UB6Z 1H2NA 1KMIZ 2IM9A 2Q73A 4XDLA 1P7BA 1Y67A 5J2UA 3CC2V 1Y4MA 5E79Z 3RYFB 2QKCA 1D5AA 3FB6C 3CCMV 4GX2A 4O4LA 1RSOB 2CTPA 2MW2B 2QWNB 3E89A 1OCCB 3ZMUA 3F5TA 5C8YB 1AILA 4KFMA 1LUWA 3EFFK 3SPJA 2WA3A 4OX9O 4CH6A 4DV2O 1VQ4V 4PA3A 2UUCO 5CB4B 2QM4A 3RT3C 2IBZH 3MHSC 1S3JA 1NQTA 1F7YA 4YHHO 4BAYA 5CA3A 3RYCB 5B1AB 1OCCC 5L3GA 1GM7A 3OEEG 2DWEC 1PD3A 1L1FA 2LO1A 2AW9A 5DEDA 1YITV 1NH2B 1K4CC 4YY3B 2HHHO 4JPRA 5IDJA 3FD9A 3CX5F 3CE2A 4QPKA 3K5MA 1XMOO 1VF7A 3CHXA 4MVSA 3JATB 4DV4O 5B1AC 2AZ2A 2Y4TA 1GMGA 3L71H 1GH6A 2B1IA 1BHBA 1VMGA 1XMQO 1K8AW 2JEUA 2ADQB 1QLEB 1B04A 3ABMC 1J5EB 1F23A 2KKWA 1Z5VA 1PNMA 2GUZB 1NZ6A 1P84F 2MK3A 1I94B 5LHIA 4DRXB 2M6YA 3H1HH 3K3WA 5L3BA 4O4HB 1I5XA 3J80N 5LA6A 1L8DA 1NS1A 1BT8A 1E1RG 3DC6A 2ZE7A 1EZVH 1EBOA 1QLEC 4JI4B 3CRRA 2EX3A 1E79G 3B4SA 5GTHZ 3ZMZA 2H8PC 2QA4V 5LBQA 1TAEA 1UFIA 1OCZC 2GBOA 2N74A 1VQPV 3L74H 4TT3G 2UXDB 1B6QA 2Y69B 4I0XB 4LF7B 1DLBA 3CRMA 1WJZA 2DWDC 4LP8A 4I5SA 4D7TA 1PM9A 2ATKC 4GKJO 3AG3C 3ABUA 1Y76A 4TSFG 2F43G 4EKWA 1SQFA 4RO2A 3W7UA 3DXRB 3ABTA 3E8HA 3HKEA 2ZIMA 2Y69C 4FPPA 3WB1A 1X59A 2OIGA 3HB3B 3ZRWB 1WA8A 4F4LA 2V1DA 5BMVB 1FPOA 4KL1A 4DK1A 4AHCA 3RVZA 4F6EA 1FAFA 5KUMA 2NR5A 2GDSA 4LFAO 1TUBB 4NXMB 3K03A 4R50A 1JFFB 3ZMSA 4LFBB 3B77A 4DUZB 2ZNJA 4RUFA 4QJFB 5D5QA 1KB9F 4Z1VA 4DR1O 4LF8O 4EB6A 1MOFA 3JAKB 3J7AU 2QWQB 4CH3A 3N2GB 4UCTA 2G38A 3K5OA 4UB8Z 4WFEA 5H5NA 1GM8A 5BR8B 4QPJA 4LC1A 5JJEB 3K0GA 3OTOB 5CA1B 4JYAB 2ARHA 1WB8A 1K34A 3N27A 4K0KB 4DV7O 2Z0AA 4J42A 4ZI7B 2WSSG 3BCCH 2JGUA 1R3KC 2D2CB 4PELA 3JD2A 1SQBH 3WU2Z 1G1XB 4DV0O 4U3JB 1I08A 4HNAB 1RM1B 1N32B 5KMGA 1CPYA 2PI5A 4G2KA 3IFXA 4LF5O 2N05A 3F5WC 2H3OA 5IYDO 4I55A 3KCXA 1V54B 1OZ0A 2YIDA 5B3SB 1IXMA 1VQ9V 4B3TB 2B9ZA 1RM1C 2R70A 1S76D 2GTAA 4IYHA 5JWPA 1JVMA 1YJ9V 1K33A 5LMNO 2Q7GA 2H94A 2YUAA 1P4RA 1M1KW 4GX1A 4JZGA 4MVRA 1V54C 4PA4A 2LGWA 1M4UA 3ZJZA 1W0KG 1F4MA 2HVKC 4XBFA 1EZJA 3ZCCA 5JCOA 4B7KA 1KP3A 1O9GA 1JJOA 1M9NA 1NR1A 4J80A 5AG2A 3P32A 1IBLO 3K79A 1H2SB 5JH7B 1AJQA 1R3JC 1HWYA 2QTOA 4N23A 4X66B 1SQGA 4P9OA 2EIJB 4UCSA 1IBKB 1Q6HA 4TQFA 1K97A 1S72V 3C3SA 5BY1A 2CAZC 3CXHF 2V4DA 4NXNB 4B3RO 5BZBA 3QO5A 3KZIZ 2ETNA 4DV5O 2EIJC 3TXSA 3QF7A 3QO7A 4ZHQB 4J9ZB 2Q0OC 4RWUA 2K9PA 4DR4B 2CH7B 4UCVA 3RFRA 4WFHA 1GN4A 1NBMG 4LF6O 3M7MX 1GRJA 3JAMN 3E86A 4JV5O 1Q3EA 3HKCA 3IJ4A 5IE9A 1SQXH 2PUSA 3ZHQA 3ZBHA 1K92A 1HW7A 4TWKA 4FJCC 5IWAB 4PV1B 2BE3A 1N8RW 2EJRA 5KA6A 2ZR2A 4O2AA 2CE4A 1BQZA 4LF9O 2YC0A 1BS3A 3ETEA 1H38A 2VWJA 1Q7YW 4B3SB 5JJJB 2A06H 4NVPA 1YIJV 5HFMA 4JI2B 3HKDA 2ZE5A 3A8TA 4J7KA 5F2VO 1J5EO 4J7JA 1FXKC 1U97A 5A2QN 1HNXO 5K1XA 3I5DA 3WB0A 2HJFC 2C2AA 4JI5O 2YICA 1XL6A 4MSWC 2Q7HA 1M93A 3D3QA 1AJPA 4O2BB 5KHJA 1SC5B 3ZX6A 4HZ3A 2OTJV 1XHZA 4JF3A 5FLXN 2A9HA 1YJWV 2JS3A 3EHBB 4DV1O 3RYIB 4H37A 5LHGA 1WLEA 3I56V 1R1BA 2ZD9A 3ABKB 3MD0A 4BW9A 2BTQA 1P7GA 5GW7A 1FFXA 4EFBA 2JGDB 2DN9A 3LNNA 4KHPB 3K9AA 4TV9A 2CK3G 2WLJA 4J41A 3FKSG 4CC5A 4QIWF 1YEWA 2R9AA 3RW0A 2Y48A 1NTMH 4IIJB 3CCRV 4WCEV 1R6NA 1SA0A 3ZHVA 3S3WA 2E76B 1PP9H 2KQXA 4F6RA 4FLZA 2R9RB 4Z1MG 1QR9A 3CCUV 2XASA 1XHXA 3ZRXA 1GN6A 2Q6AA 3KG2A 1N36B 1MNGA 3ZEDA 4FM0A 3N2KB 3DSQA 2VRZA 3ZHRA 1AVMA 3QTCA 1X4TA 5JVDA 4K35A 2W6IG 2YI8A 3JALA 1NTZH 1LR1A 1NU1H 2QDOA 4FLVA 5JQGB 5J2UB 5KHIA 4OGQB 4FM1A 4ZBMA 4J10A 2YEVB 4DV3O 4O4LB 4FFBA 1VQ8V 5GONA 3MHHC 1QBZA 3FFQA 3NR7A 2ZINA 4P9PA 3VQXA 1UPGA 1FJGB 1PNLA 2VS0A 2R9IA 4QE7A 1PPJH 1Q86W 2RJZA 1MABG 2VQEB 1CP9A 1AB3A 1OCRB 2A3QA 2XAGA 5KLVH 4J11A 3OM3B 2ZE6A 5LXTB 2RNBA 3H1LH 3K57A 1WPBA 3A2FA 3E35A 2FMLA 4FLXA 3AG4B 5EBWC 5IYZA 4H13B 3OEHG 5DM6V 4RQEA 1VQLV 3SYPA 3CPWU 3THOA 2QSAA 1OCRC 2AHZA 4I9QA 1SQPH 4I9WA 4DR7B 4H0LB 4I4TA 1HNWB 3AG4C 3WB2A 3K58A 3ZHSA 3P3NA 4FFKA 3FB7C 1HNZO 1H2LA 2RDCA 2Q67A 3CD6V 3WG7B 4C7UA 5H6RA 2FTKA 1MSDA 5ITZA 1AP5A 1SZXA 4DR6B 2LQTA 1SQQH 4NB5A 2CDYA 2K1EA 1KD1W 4MW3A 1QNMA 4DR2O 5HFLA 5LA6B 2QEXV 3W7SA 3AG2B 3WG7C 2UUBB 2ODMA 1Q43A 3CRQA 1Q90D 2HVJC 2P4VA 1WAZA 1TVKA 3L9DA 3BEHA 3TETA 3JYCA 3MDSA 3CC7V 1TGOA 3TXQA 1M5IA 4PA6A 3FB5C 4YIPA 5B1OA 1VQ7V 3G71V 3ABMB 3AG2C 4DUYB 4FK5C 3S3XA 3T1CA 3RBZA 2VWKA 1XREA 1KP2A 4GLXA 3T1HB 1YZBA 1AI6A 4X1IA 1KECA 1Z5WA 5KA5A 1Y76B 3W7XA 1XI1A 4TUYA 1N4CA 4DR3O 2VQFO 3E22A 3HKEB 3LNMB 4ZIBA 3ML0A 1ZUQA 1IURA 1VEWA 2N04A 4X88A 1DF5A 4HYOA 1IZ3A 2FYUH 4RQFA 3UO3A 1OCZB 3K5LA 2BTOA 2WLHA 4B3MO 1JMKC 4WFFA 4HBNA 2WAMA 2QE7G 2L35A 4UVCA 1S5JA 2CUGA 1N34B 2IH3C 3L73H 1JR9A 4E4EA 4JI3B 2KG7A 1IDSA 5C8YA 1NI8A 3BABA 2QTSA 3TCUA 4EB6B 3AG3B 2LW1A 3FAVA 2ZE8A 2X7RB 3JD3A 2NLJC 5KUKA 1FYJA 4I50A 5FNVA 1PNKA 1JPXA 4YJ3B 2UXCB 4LF4O 3RYCA 1YDXA 2YXLA 1EN6A 5EK0A 3JARA 4J9YB 1QLNA 1S5LZ 2KSDA 2NNUA 2F4VB 4JI0O 1WN7A 3T4ZA 1R73A 4GZRB 5KMGB 2P22C 5KAIZ 3IAYA 5E1AC 4JI8B 3C90A 4I55B 4PA7A 1JCHA 1PL4A 1G6UA 1Q6IA 2X6BA 4MVOA 2YI9A 3SYCA 2UU9B 4LWSA 4WFGA 2GUZA 3H01A 1N36O 1V55C 2XAQA 4GT1A 2WLNA 1VP7A 1Y66A 5JJNB 2ZM6O 4CS3A 4WFAV 2JIZG 2HG5C 3OTFA 5B1BB 1GAXA 2PY5A 2UUAO 4JI6B 3OR6C 4LH7A 1BMFG 4X64O 4LFCO 4AQYB 4W4LA 4R7CA 3B2EE 4UCOA 2F93B 5JCOC 2IU3A 3OE7G 2JEXA 2CGOA 5DECA 4JI7B 5B1BC 1Y6XA 2OT5A 3GB7C 2EJ7A 2DQ3A 5EYPB 4EFEA 4ZOLA 3AK1A 1QQCA 2P6JA 1KQSU 5KHKA 4WBNA 2IJKA 4X65B 2EINB 1GM9A 4GKKO 3ZRWA 4G27B 2A7WA 2JJ2G 3D36A 3ETDA 3ETGA 4DR5B 1VQNV 2EILB 4CC6A 1PV0A 4N21A 2IU0A 5LMUB 1ROPA 1SETA 2E5LO 3UM7A 2JVDA 4U3FH 1NR7A 1HR0B 1BL8A 5LP6A 1BSMA 1MZEA 1S5HC 3ETQA 5FPOA 1XEQA 3HKCB 2HKOA 4JZ2A 2X6AA 2EINC 4QGPA 2HR3A 3PN1A 4R6ZA 1BZKA 4DV6O 2EILC 3H1KH 2XAFA 1H8EG 1WNSA 4O2AB 4NR1A 3ZN0A 2Y0IA 2Z3YA 3U11A 3B09A 2FL4A 3STZC 4KXRA 4BIUA 3M8AA 3GVMA 5EIBC 2QGNA 2P67A 3ZRVA 3CSXA 5CA0A 1F51A 4FZ0A 3CCJV 3HKDB 2ZDIA 2FB5A 1R3IC 2YIBA 4X1KA 3BPZA 3UCSC 4OX9B 4DV2B 4KP4A 5IJ0A 1L0LH 2UUCB 5TISZ 3CMEV 2V7QG 4NTYA 1XNRB 1S77D 1RP3B 1P49A 5LGUA 1Y74B 2EIKB 3JSLA 5EBLC 1GN2A 5B66Z 1MZFA 1L0NH 4O4IA 2YDEA 3CMAV 1ZTEA 4YY3O 5B5EZ 4CS2A 1URFA 3QO8A 1RPOA 2FKXA 2Z5UA 5L3CA 1XMOB 1YJNV 1FXKB 2BTQB 1W0JG 4JAVA 2EIKC 4DV4B 3BVOA 3T1HO 5IJ9A 5LYJB 2P5OA 1FFXB 5LHHA 2E74B 1WB7A 1IXBA 2AHYA 3SJBC 4TV9B 4MVQA 5LOVA 1XMQB 3L72H 1MA1A 2Q68A 2YIBD 4FM2A 2DW4A 4F6RB 4UFZA 1XL4A 4GX5A 3SPCA 1I94O 4NYKA 2M7WA 1PKXA 1IVSA 3HKBA 3JASA 2LJ2A 3STLC 3CXCU 3VQYA 4LBEC 2EZOA 3IGAC 4JI4O 4FZ1A 5JVDB 4X1YA 3BA8A 2CGNA 4QE9A 3JALB 3SDLA 4YJ2A 4CBCA 1VF6A 5CN0A 1GO3F 4J7ZA 4ABMA 5EIBD 1OHHG 2UXDO 1IX9A 4LF7O 2F95B 4JTAB 2ZXWB 1WP7A 3JD1A 4MS2A 2JK5C 4PJ0Z 4X8AA 1FXVA 4B08A 4PI0A 4JI1B 2HP8A 3T1YB 4LNUB 2XT9A 5GONB 2OTLV 3T4DA 4GKJB 4L8JA 2AXTZ 3SPIA 5IYCO 2F66C 2HLDG 1Q6UA 2LFSA 5J2TA 3AG7A 1BGYH 4FVMA 3SPHA 2ZXWC 1KKDA 1HP8A 3K59A 4IYIA 3TGUH 2DOSA 5KHGA 3G67A 2ZT9B 4IHJA 3E2EA 2DMXA 1JA8A 3RN4A 4A5UB 1IBMB 1H8HG 5EBMC 3APQA 5KX5A 3AEIA 2YXHA 4LFAB 5IYZB 5BXZA 4NXMO 2KB1A 3ASNB 4LFBO 4DUZO 5IT9N 4AI8A 1RFYA 2GTSA 4DO2A 4PI2A 5K1PA 3ZHTA 3CJHB 4DR1B 4LF8B 1N0NA 1XNQB 4I4TB 4UV9A 2LGQA 1AP6A 2QM8A 1XILA 4O2BA 5BR8O 3MAQA 1NTKH 3LDEA 2X0LA 3ASNC 4B7EA 4ICGA 3OTOO 4JYAO 4PDRA 1S0VA 4JAAA 4YXWG 4NKGB 4K0KO 2CTQA 4DV7B 2DYSB 4MTXA 3CP1A 3RYIA 3IC9A 4O4JA 5ITZB 2PZSA 2E3CA 3O9OA 3OGCC 3SPGA 4CH5A 4I7ZB 3ZMVA 4AQYO 2WLKA 4DV0B 1N32O 2RMKB 3CCLV 4EEQA 2W0FC 3Q4HA 1H2MA 1Q81W 4LF5B 2DYSC 4IGGA 4TV8A 3JAWA 1FKAO 1HDJA 1M57B 4X20A 3A0RA 1MSWD 4B3TO 1TVKB 2YSUB 4X65O 1N33B 1E1QG 5CBFA 4DR5O 2QWPB 3G4SV 5LMNB 2HEPA 1YTFD 1COWG 1ENVA 4GUNA 3BY6A 4UV8A 1D5NA 3R65A 5EZYA 1M57C 3AK3A 1EM1A 3JCZA 3M99B 2QKSA 2AZ0A 3E8FA 3BA9A 3CB2A 1SF9A 2Q5ZA 5LGNA 2Q8VA 2GHYA 4TUYB 1XDCA 3H1IH 1IBLB 3E22B 4PDLA 1AR5A 4WFBV 3O65A 3SYQA 2QWOB 4BWAA 5JQGA 4X66O 2BOCC 3SR2C 4AILC 3UT5A 2PYLA 2WLIA 1IBKO 1Z2GA 3SYOA 3TK1A 3QG5A 1AR4A 4X62B 2YEVA 1VQ5V 2ZKOA 5L3DA 1NVPD 1K9MW 4P2ZA 3RYHA 4MVUA 2HFEC 4UCUA 3LUTB 4NXNO 3ZIAG 2BSKA 5CMUA 1WP8A 4B3RB 2BOBC 2KG7B 3CCEV 1H2KA 1KKCA 2DQ0A 3UO2A 4DV5B 4TOIA 1MG1A 2GSMB 5H6QA 3FAVB 1VQOV 4DR4O 3SJCC 1GN3A 1XNRO 3SGIA 3KKYA 5LXTA 1AJNA 1LUVA 5FPRA 1O9HA 4I50B 5FNVB 3ASOB 4MTGA 1KUQA 1R6TA 1THZA 4LF6B 1VIBA 1ZL8A 3OUFA 2Y4UA 2UXBB 1M56B 2XNDG 4JV5B 3JARB 1XBLA 1Q8IA 2OCCB 2ZCEA 1Q82W 5IWAO 1YXBA 2PTMA 2WLLA 3LSSA 5LL6Y 3A0BZ 4UXNA 3G6EV 2ZQMA 4U7OA 1WA8B 1K7DA 2RN9A 1TA8A 1V9PA 1SESA 3ASOC 4DW1A 2P90A 2XOKG 4PD4F 4LF9B 3RYFA 1M56C 2A79B 4QNHB 2UXXA 2WLMA 2DJVA 4B3SO 3E8BA 2D3OW 5GTIZ 5J9PC 4NTWA 1EN4A 1RSOA 2OCCC 1SZTA 4FLYA 2ITCC 3K06A 4JI2O 5IY5B 3AG1B 4DK0A 2B1GA 4BW5A 3K04A 5H9CA 3OT7A 4W4KA 3DC5A 4LWSB 4RAIA 3CCQV 1HNXB 4LCUC 4JYBA 5CBGA 4CS4A 2IJIA 3OUSA 4JI5B 5CB4A 3LDDA 4KUMA 2Q4PA 1SERA 1XQ8A 2OCHA 3C3TA 1AROP 3OAAG 5IY5C 2B5UA 2QWRB 3AG1C 2L6LA 3LSQA 1AI4A 2RCVA 2PYJA 1SQVH 1G4YB 4TQDA 4Q6GA 2Q0AA 4JTCB 4DV1B 1BCCH 1US6A 1YSCA 3OD4A 3OMNB 2PI4A 3VQVA 1T5EA 1OJHA 3JATA 2WWWA 4JI1O 3T1YO 1F4NA 1QU7A 2LW7A 3EXAA 3P3PA 1K5QA 4LH6A 4UVAA 2R72A 1V55B 4OXSA 4E2LA 4KHPO 3HR0A 4PA9A 4ZOLB 2GV9A 3K0DA 1QVFU 3SYAA 4WBNB 4JYCA 2IJHA 2F1MA 1DK1A 4PDVA 4JTDB 2JS5A 1AI7A 1IBMO 1FD9A 4UUJC 4DRXA 4PDMA 1BE3H 1DGSA 3FX7A 2QJ1A 5LP6B 3D3IA 4O4HA 1VQ6V 5A9GA 4XDKA 2ILMA 2LP7A 1UJWB 3P30A 3D36C 4MVZA 3SJQC
chains in the Genus database with same CATH topology
4JPRA 3JD0A 5IDJA 1NH2D 3QO8A 1RPOA 4JGSA 2Z5UA 2W6JG 4QPKA 5L3CA 4MVSA 1YJNV 1FXKB 1W0JG 4JAVA 2JJ1G 2EIKC 5B1AC 3VBBA 2EZPA 1GMGA 4ZBMA 2A0LA 5LHHA 2YEVB 1VQ8V 2AHYA 1BHBA 2B1IA 3MHHC 1QBZA 3FYEB 4MVQA 4P9PA 1K8AW 2JEUA 3FYIB 2Q69A 1QLEB 3UKMA 2Q68A 1PNLA 1ZWIC 3ABMC 3WFVA 1EFRG 2R9IA 4QE7A 1F23A 1Q86W 1MABG 2DW4A 2EIMB 2QM7A 5LGTA 1XL4A 1PNMA 4GX5A 3SPCA 1CP9A 2MK3A 4X89A 1OCRB 5LHIA 2XAGA 2M7WA 3OM3B 1I5YA 1PKXA 3K3WA 5L3BA 3STLC 3CXCU 1I5XA 4JAUA 3E35A 2ZDIC 1E1RG 4LBEC 5L3FA 5DN6G 2EZOA 3IGAC 1EBOA 1QLEC 3AG4B 5EBWC 1DF4A 1E79G 4QE9A 1PL0A 3OEHG 5DM6V 4RQEA 3ZMZA 2EIMC 2H8PC 1VQLV 2QA4V 3ZMTA 1OCOB 4CBCA 3SYPA 5LBQA 3CPWU 1OCZC 5CN0A 3PJSK 1GO3F 4H33A 1OCRC 1OHHG 1VQPV 2AHZA 4TT3G 1B6QA 4I9WA 3T2MA 2Y69B 1DLBA 4JTAB 5B3SC 1R3LC 2ZXWB 3AG4C 3JD1A 3K08A 4MTFA 2DWDC 4LP8A 1GKFA 4MT8A 4MS2A 4I5SA 2JK5C 4X8AA 1FXVA 1QCEA 3FB8C 3FB7C 2ATKC 3AG3C 1OCOC 3ABUA 3T4DA 2OTLV 3W7WA 4MW8A 4TSFG 2Q67A 4FMTA 3SPIA 3CD6V 3WG7B 1ORQC 2F43G 4Q20A 2HLDG 1FFTB 5H6RA 2FTKA 4EKWA 5IYCO 4RO2A 3W7UA 2LFSA 3ABTA 3E8HA 2Y69C 4FPPA 3HB3B 1H2GA 3SPHA 2ZXWC 1RPRA 3ZRWB 1KKDA 3F7YC 4F4LA 2V1DA 1K73W 1LNQA 3ZRSA 2K1EA 3E2EA 1KD1W 3DTUB 4MW3A 3RVZA 2EBOA 1H8HG 5HFLA 5KUMA 1SRYA 2QEXV 3W7SA 2P7TC 1R6KA 4FIPC 5EBMC 5IYBO 3AG2B 3WG7C 3AEIA 2HVJC 2KB1A 3K03A 3ASNB 4R50A 1JOYA 3ZMSA 3B77A 2IH1C 4RUFA 3BEHA 3TETA 3JYCA 4QJFB 3CC7V 4DO2A 1MOFA 4PA6A 2X6CA 3FB5C 3OMIB 5B1OA 1VQ7V 3F7VC 4UV9A 3G71V 2QM8A 3ABMB 3AG2C 1JJ2U 4FK5C 4WFEA 1GM8A 3W7TA 3T1CA 3RBZA 3LDEA 1K3EA 1KP2A 5EC2C 2X0LA 3ASNC 4QPJA 4LC1A 1QVGU 1AI6A 3K0GA 4MVMA 4WF9V 4PDRA 1S0VA 4YXWG 2UXNA 3JD4A 1KECA 1K34A 3E83A 5KA5A 2DYSB 4MTXA 3CP1A 3W7XA 2WSSG 3OW2U 3OGCC 1R3KC 3LNMB 4PELA 3JD2A 3ML0A 3SPGA 3X2QB 3ZMVA 2WLKA 4U7NA 1RM1B 4X88A 1DF5A 4HYOA 4RQFA 1CEZA 1OCZB 2WLHA 1CPYA 2PI5A 4G2KA 4WFFA 3CCLV 3IFXA 2W0FC 4G28B 1Q81W 5C93A 2DYSC 2WAMA 3F5WC 5IYDO 2QE7G 1J95A 4UVCA 1V54B 5B1NA 1DTOA 1OZ0A 5B3SB 1IXMA 1M57B 2IH3C 1VQ9V 1YHQV 3A0RA 3NXSA 1YI2V 1MSWD 3X2QC 2DYRB 2YSUB 4P30A 1K4DC 2XAJA 1JQ0A 1RM1C 1S76D 1E1QG 3TCUA 5CBFA 3AG3B 1JVMA 1WPXA 1YTFB 1YJ9V 3G4SV 1K33A 3IC7A 2H94A 2X7RB 1P4RA 3DGEA 1COWG 1ENVA 1M1KW 2ITDC 4GX1A 1VQMV 1YTFD 1W2BU 4MVRA 1M90W 2JDIG 3BY6A 4JASA 4UV8A 3JD3A 2NLJC 3OFNG 5KUKA 1V54C 3R65A 4PA4A 3ZJZA 1W0KG 1M57C 3B8MA 1PNKA 1F4MA 1JPXA 2HVKC 1AR1B 3JCZA 4XBFA 2DYRC 3M99B 1EZJA 3ZCCA 2QKSA 1KP3A 5EK0A 4CZZA 1M9NA 2IJJA 3E8FA 1NR1A 3OR7C 4DXWA 4J9YB 3CC4V 1QLNA 5LGNA 3P32A 2GHYA 1NKDA 3K79A 4PDLA 4BIZA 4WFBV 1AJQA 1R3JC 3ABLB 3SYQA 1HWYA 2QTOA 4N23A 2LFRA 2BOCC 2NNUA 1FXKA 4P9OA 3T4ZA 2EIJB 1R73A 2WLIA 4ASUG 3SYOA 3TK1A 5E1AC 1NVPB 2YEVA 1VQ5V 1K97A 5L3DA 2WPDG 1S72V 1NVPD 4P2ZA 1NJIW 1K9MW 4PA7A 5EC1C 4MVUA 3RVYA 3I55V 1JCHA 2HFEC 4GX0A 1G8MA 3LUTB 5FL7G 3ZIAG 5CMUA 2X6BA 4MVOA 2BOBC 3ABLC 5BZBA 3ABKC 3CCEV 2DQ0A 3QO5A 3SYCA 4RUEA 3HPLC 2EIJC 3QO7A 1MG1A 2GSMB 5H6QA 4WFGA 4J9ZB 1VQOV 4L87A 3H01A 1V55C 2XAQA 1AJNA 1FS0G 4WFHA 4GT1A 2WLNA 1NBMG 3ASOB 1Y66A 4MTGA 3CCVV 1THZA 3LDCA 3OUFA 3E86A 3B8NA 1M56B 2XNDG 3E8GA 4WFAV 2JIZG 1K92A 2HG5C 2OCCB 4TWKA 5B1BB 3CCSV 3VOUA 1Q82W 4FJCC 3LSSA 2WLLA 3ZN1A 1K5SA 4ZKIA 1N8RW 4UXNA 3OR6C 4UVBA 3G6EV 2EJRA 5KA6A 2ZR2A 1BMFG 2ZQMA 3ASOC 1K7DA 4U7OA 2WLIB 4R7CA 1SESA 2P90A 2XOKG 1JX9A 2IU3A 1M56C 2A79B 3ETEA 3OE7G 4QNHB 2UXXA 4MTOA 2WLMA 2JEXA 1H38A 1Q7YW 3E8BA 5CBHA 1AI5A 2D3OW 2ZR3A 5L3EA 5J9PC 2IW5A 2OCCC 2OT5A 1SZTA 3GB7C 5B1BC 2DQ3A 2ITCC 1YIJV 3K06A 5IY5B 5HFMA 3AG1B 2P6JA 1KQSU 2B1GA 1FXHA 4BW5A 1FXKC 4HAMA 3K04A 2IJKA 4R8CA 5H9CA 2EINB 1VQKV 1KC8W 1GM9A 4RAIA 3ZRWA 4G27B 2JJ2G 3CCQV 3D36A 3ETDA 4LCUC 4JYBA 5CBGA 3ETGA 1VQNV 2HJFC 2IJIA 2EILB 3OUSA 1GTOA 2C2AA 4XDJA 3LDDA 4KUMA 4N21A 1XL6A 2IU0A 4MSWC 1SERA 1TUEB 1ROPA 1GK9A 1SETA 1AJPA 1QR8A 3UM7A 1AROP 1NR7A 2XAHA 3OAAG 1BL8A 5IY5C 2B5UA 1BHAA 1S5HC 4GCZA 3AG1C 3CYOA 3LSQA 1AI4A 4HZ3A 3OMAB 2HKOA 2OTJV 2X6AA 1G4YB 4JF3A 2EINC 2HR3A 2A9HA 4R6ZA 1YJWV 3QNEA 3GWOA 3EHBB 4JTCB 4H37A 5LHGA 2WLLB 2EILC 1WLEA 3I56V 1YSCA 2XAFA 1H8EG 2ZD9A 3ABKB 3OMNB 4XDLA 2PI4A 1P7BA 3ZN0A 3MD0A 3CC2V 1Y4MA 2Z3YA 2WWWA 3FB6C 1F4NA 3STZC 3CCMV 5GW7A 4BIUA 4GX2A 1K5QA 4UVAA 1V55B 4OXSA 2P67A 4E2LA 3ZRVA 4PA9A 3K9AA 2CK3G 2WLJA 1F51A 3K0DA 3CCJV 3E89A 3FKSG 1QVFU 2ZDIA 4QIWF 3SYAA 1OCCB 3ZMUA 4JYCA 3RW0A 2IJHA 2Y48A 4KFMA 1R3IC 3CCRV 3EFFK 3SPJA 4WCEV 4PDVA 1R6NA 4JTDB 1VQ4V 4PA3A 2R9RB 4KP4A 4Z1MG 1AI7A 1QR9A 3CCUV 2XASA 4UUJC 3CMEV 3ZRXA 2V7QG 4PDMA 2Q6AA 3KG2A 1S77D 3MHSC 3D3IA 1S3JA 1NQTA 1VQ6V 4BAYA 5LGUA 2EIKB 5CA3A 5B1AB 1OCCC 5EBLC 5L3GA 4XDKA 1GM7A 3OEEG 2DWEC 1PD3A 1L1FA 2LP7A 1UJWB 3P30A 2W6IG 4MVZA 3SJQC 1YITV 3CMAV 1NH2B 1K4CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KP4 A;  1IXM A;  2WWW A;  4MT8 A;  4I5S A;  3TK1 A;  5IDJ A;  3A0R A;  3NXS A;  3ZCC A;  4ZKI A;  5B1O A;  3ZRX A;  4BIU A;  2QM8 A;  4QPK A;  4GT1 A;  3P32 A;  4U7O A;  2P67 A;  3ZRW A;  4U7N A;  3ZRV A;  4JAV A;  2QM7 A;  3D36 A;  4FMT A;  1F51 A;  4JYB A;  4Q20 A;  2FTK A;  4QPJ A;  4BIZ A;  4LC1 A;  2C2A A;  2LFS A;  3DGE A;  4JYC A;  1JOY A;  4FPP A;  4JAU A;  2LFR A;  5C93 A;  4JAS A;  3ZRW B;  3MD0 A;  4MTX A;  5B1N A;  4GCZ A; 
#chains in the Genus database with same CATH topology
 1XNQ O;  3JD0 A;  1NH2 D;  4BIO A;  3G6B A;  4JGS A;  2W6J G;  5LP6 C;  4PHZ A;  4K8Z A;  2JJ1 G;  4I0X A;  1ZAU A;  4YIO A;  3VBB A;  1I7F A;  2EZP A;  4YJ3 A;  3K5N A;  2A0L A;  3OGI B;  4DV3 B;  5CA0 B;  2ZNI A;  3FYE B;  2P06 A;  4JYY A;  5H2F Z;  1FJG O;  3FYI B;  1QHT A;  2Q69 A;  3CWB H;  3UKM A;  1ZWI C;  4X1K B;  3DXR A;  1KYO F;  3A0H Z;  3WFV A;  1EFR G;  2EIM B;  2QM7 A;  5LGT A;  2VQE O;  5IJ0 B;  2O57 A;  5BMV A;  4X89 A;  1I5Y A;  3BAA A;  4OPA A;  2Q7E A;  4JAU A;  2QKA A;  2ZDI C;  5L3F A;  1W59 A;  5DN6 G;  1U96 A;  1DF4 A;  1TUB A;  2OWO A;  4FLT A;  1PL0 A;  4O4I B;  1JFF A;  1N33 O;  2EIM C;  3ZMT A;  1OCO B;  3CRA A;  3PJS K;  4FLW A;  4H33 A;  2YS8 A;  3JAK A;  4DR7 O;  3N2G A;  1KBH A;  3T2M A;  1SS3 A;  5B3S C;  5IJ9 B;  1R3L C;  1HNW O;  1ZX3 A;  3K08 A;  4MTF A;  1GKF A;  4MT8 A;  1VF5 B;  1QCE A;  3FB8 C;  3CEI A;  2JRI A;  1HNZ B;  5CA1 A;  1OCO C;  2WA4 A;  3W7W A;  5LOV B;  2Q9L A;  4MW8 A;  4FMT A;  1N0J A;  1ORQ C;  4Q20 A;  4ZI7 A;  1FFT B;  2OIE A;  3G80 A;  1D2D A;  4DR6 O;  1H2G A;  1RPR A;  3F7Y C;  1VAR A;  1K73 W;  1LNQ A;  1KU9 A;  4U3J A;  3ZRS A;  4HNA A;  1I0H A;  3UQ8 A;  4X62 O;  2CTR A;  3HKB B;  3JAS B;  3DTU B;  2EBO A;  3KCY A;  4DR2 B;  1SRY A;  2P7T C;  1R6K A;  4FIP C;  2AGA A;  2Y0P A;  5IYB O;  2UUB O;  5EYP A;  4YHH B;  4X1Y B;  3BHP A;  1JOY A;  3AK2 A;  3L75 H;  2IH1 C;  4YJ2 B;  2YXY A;  2HHH B;  2X6C A;  3OMI B;  3F7V C;  4LR3 A;  4DUY O;  4NTX A;  1JJ2 U;  3W7T A;  1K3E A;  5EC2 C;  2UXB O;  1ZSP A;  1QVG U;  4MVM A;  4WF9 V;  2UXN A;  1NT2 B;  1VF6 C;  3JD4 A;  3E83 A;  4GYC B;  3R66 A;  4DR3 B;  2VQF B;  3OW2 U;  5J2T B;  5JH7 A;  4K8X A;  3H1J H;  3X2Q B;  3GWK C;  1SA0 B;  1BQ0 A;  4U7N A;  4IHJ B;  1CEZ A;  2EUL A;  2ZIO A;  4B3M B;  4G28 B;  4IT5 A;  2NN4 A;  3ICX A;  5C93 A;  5KX5 B;  2PGG A;  1J95 A;  5B1N A;  1DTO A;  1N34 O;  3H9V A;  5KHH A;  1YHQ V;  1A32 A;  3NXS A;  1YI2 V;  3X2Q C;  2DYR B;  3RGB A;  4P30 A;  4JI3 O;  2OYQ A;  1K4D C;  1EN5 A;  2HJD A;  4D7S A;  2XAJ A;  4BR6 A;  4X9Q A;  1JQ0 A;  1WPX A;  1YTF B;  4ZHQ A;  3IC7 A;  3DGE A;  2ITD C;  1VQM V;  1B3Q A;  1W2B U;  1M90 W;  2JDI G;  1OV9 A;  2CH7 A;  3B40 A;  4JAS A;  3OFN G;  3B8M A;  1Y74 A;  2UXC O;  1AR1 B;  4LF4 B;  2DYR C;  4FFB B;  1B06 A;  4DW0 A;  4CZZ A;  1ZLZ A;  2IJJ A;  3OR7 C;  4DXW A;  3CC4 V;  4O4J B;  1XUQ A;  1NKD A;  3BFR A;  2XUM A;  4BIZ A;  3ABL B;  2ADP A;  2DE0 X;  2LFR A;  4DYL A;  2F4V O;  3QVN A;  1FXK A;  2XHB A;  4JI0 B;  4ASU G;  5LYJ A;  4JI8 O;  1NVP B;  3Q4H B;  2CTW A;  2WPD G;  1NJI W;  4TV8 B;  1CXZ B;  3JAW B;  3L70 H;  5EC1 C;  3SJA C;  3RVY A;  3I55 V;  4GX0 A;  1G8M A;  4X20 B;  5FL7 G;  4Z2W A;  3ABL C;  3ABK C;  3VQW A;  2UU9 O;  4RUE A;  3HPL C;  3K9S A;  4CH4 A;  3EVK A;  2P4K A;  2RQ6 A;  4L87 A;  1FS0 G;  5EZY B;  3TJT A;  3CCV V;  2ZM6 B;  3LDC A;  1YVW A;  2YIA A;  3B8N A;  3E8G A;  3ZHU A;  3CRC A;  2BCC H;  1Q5O A;  5D5P A;  2XTA A;  3CCS V;  3VOU A;  4K3A A;  2UUA B;  3JSN A;  3U10 A;  3ZN1 A;  2PF4 E;  1K5S A;  3D8C A;  4ZKI A;  4JI6 O;  4OPH A;  1YCI A;  4UVB A;  3UT5 B;  4LFC B;  4X64 B;  2WLI B;  1JX9 A;  4H44 B;  4FLU A;  2W0X A;  4MTO A;  5CBH A;  1AI5 A;  4LNU A;  2ZR3 A;  3RYH B;  5L3E A;  1XOU A;  2F23 A;  4JI7 O;  2QR4 A;  2IW5 A;  2JGD A;  3RWR D;  2BSK B;  3U0Z A;  3JCU Z;  2E75 B;  1FXH A;  1SKV A;  4HAM A;  4R8C A;  1VQK V;  1KC8 W;  4IIJ A;  4GKK B;  1GTO A;  3J81 N;  4XDJ A;  5LMU O;  4UCR A;  1TUE B;  1GK9 A;  1YF2 A;  1QR8 A;  2E5L B;  3CS5 A;  1HR0 O;  2XAH A;  4IL6 Z;  3APO A;  3LSU A;  1ZL8 B;  1BHA A;  3N2K A;  3ZS8 C;  4GCZ A;  3CYO A;  3OMA B;  4X1I B;  1MMM A;  5KAF Z;  3QNE A;  3GWO A;  4DV6 B;  2WLL B;  4D6T H;  3CJH A;  3BRC A;  4UB6 Z;  1H2N A;  1KMI Z;  2IM9 A;  2Q73 A;  4XDL A;  1P7B A;  1Y67 A;  5J2U A;  3CC2 V;  1Y4M A;  5E79 Z;  3RYF B;  2QKC A;  1D5A A;  3FB6 C;  3CCM V;  4GX2 A;  4O4L A;  1RSO B;  2CTP A;  2MW2 B;  2QWN B;  3E89 A;  1OCC B;  3ZMU A;  3F5T A;  5C8Y B;  1AIL A;  4KFM A;  1LUW A;  3EFF K;  3SPJ A;  2WA3 A;  4OX9 O;  4CH6 A;  4DV2 O;  1VQ4 V;  4PA3 A;  2UUC O;  5CB4 B;  2QM4 A;  3RT3 C;  2IBZ H;  3MHS C;  1S3J A;  1NQT A;  1F7Y A;  4YHH O;  4BAY A;  5CA3 A;  3RYC B;  5B1A B;  1OCC C;  5L3G A;  1GM7 A;  3OEE G;  2DWE C;  1PD3 A;  1L1F A;  2LO1 A;  2AW9 A;  5DED A;  1YIT V;  1NH2 B;  1K4C C;  4YY3 B;  2HHH O;  4JPR A;  5IDJ A;  3FD9 A;  3CX5 F;  3CE2 A;  4QPK A;  3K5M A;  1XMO O;  1VF7 A;  3CHX A;  4MVS A;  3JAT B;  4DV4 O;  5B1A C;  2AZ2 A;  2Y4T A;  1GMG A;  3L71 H;  1GH6 A;  2B1I A;  1BHB A;  1VMG A;  1XMQ O;  1K8A W;  2JEU A;  2ADQ B;  1QLE B;  1B04 A;  3ABM C;  1J5E B;  1F23 A;  2KKW A;  1Z5V A;  1PNM A;  2GUZ B;  1NZ6 A;  1P84 F;  2MK3 A;  1I94 B;  5LHI A;  4DRX B;  2M6Y A;  3H1H H;  3K3W A;  5L3B A;  4O4H B;  1I5X A;  3J80 N;  5LA6 A;  1L8D A;  1NS1 A;  1BT8 A;  1E1R G;  3DC6 A;  2ZE7 A;  1EZV H;  1EBO A;  1QLE C;  4JI4 B;  3CRR A;  2EX3 A;  1E79 G;  3B4S A;  5GTH Z;  3ZMZ A;  2H8P C;  2QA4 V;  5LBQ A;  1TAE A;  1UFI A;  1OCZ C;  2GBO A;  2N74 A;  1VQP V;  3L74 H;  4TT3 G;  2UXD B;  1B6Q A;  2Y69 B;  4I0X B;  4LF7 B;  1DLB A;  3CRM A;  1WJZ A;  2DWD C;  4LP8 A;  4I5S A;  4D7T A;  1PM9 A;  2ATK C;  4GKJ O;  3AG3 C;  3ABU A;  1Y76 A;  4TSF G;  2F43 G;  4EKW A;  1SQF A;  4RO2 A;  3W7U A;  3DXR B;  3ABT A;  3E8H A;  3HKE A;  2ZIM A;  2Y69 C;  4FPP A;  3WB1 A;  1X59 A;  2OIG A;  3HB3 B;  3ZRW B;  1WA8 A;  4F4L A;  2V1D A;  5BMV B;  1FPO A;  4KL1 A;  4DK1 A;  4AHC A;  3RVZ A;  4F6E A;  1FAF A;  5KUM A;  2NR5 A;  2GDS A;  4LFA O;  1TUB B;  4NXM B;  3K03 A;  4R50 A;  1JFF B;  3ZMS A;  4LFB B;  3B77 A;  4DUZ B;  2ZNJ A;  4RUF A;  4QJF B;  5D5Q A;  1KB9 F;  4Z1V A;  4DR1 O;  4LF8 O;  4EB6 A;  1MOF A;  3JAK B;  3J7A U;  2QWQ B;  4CH3 A;  3N2G B;  4UCT A;  2G38 A;  3K5O A;  4UB8 Z;  4WFE A;  5H5N A;  1GM8 A;  5BR8 B;  4QPJ A;  4LC1 A;  5JJE B;  3K0G A;  3OTO B;  5CA1 B;  4JYA B;  2ARH A;  1WB8 A;  1K34 A;  3N27 A;  4K0K B;  4DV7 O;  2Z0A A;  4J42 A;  4ZI7 B;  2WSS G;  3BCC H;  2JGU A;  1R3K C;  2D2C B;  4PEL A;  3JD2 A;  1SQB H;  3WU2 Z;  1G1X B;  4DV0 O;  4U3J B;  1I08 A;  4HNA B;  1RM1 B;  1N32 B;  5KMG A;  1CPY A;  2PI5 A;  4G2K A;  3IFX A;  4LF5 O;  2N05 A;  3F5W C;  2H3O A;  5IYD O;  4I55 A;  3KCX A;  1V54 B;  1OZ0 A;  2YID A;  5B3S B;  1IXM A;  1VQ9 V;  4B3T B;  2B9Z A;  1RM1 C;  2R70 A;  1S76 D;  2GTA A;  4IYH A;  5JWP A;  1JVM A;  1YJ9 V;  1K33 A;  5LMN O;  2Q7G A;  2H94 A;  2YUA A;  1P4R A;  1M1K W;  4GX1 A;  4JZG A;  4MVR A;  1V54 C;  4PA4 A;  2LGW A;  1M4U A;  3ZJZ A;  1W0K G;  1F4M A;  2HVK C;  4XBF A;  1EZJ A;  3ZCC A;  5JCO A;  4B7K A;  1KP3 A;  1O9G A;  1JJO A;  1M9N A;  1NR1 A;  4J80 A;  5AG2 A;  3P32 A;  1IBL O;  3K79 A;  1H2S B;  5JH7 B;  1AJQ A;  1R3J C;  1HWY A;  2QTO A;  4N23 A;  4X66 B;  1SQG A;  4P9O A;  2EIJ B;  4UCS A;  1IBK B;  1Q6H A;  4TQF A;  1K97 A;  1S72 V;  3C3S A;  5BY1 A;  2CAZ C;  3CXH F;  2V4D A;  4NXN B;  4B3R O;  5BZB A;  3QO5 A;  3KZI Z;  2ETN A;  4DV5 O;  2EIJ C;  3TXS A;  3QF7 A;  3QO7 A;  4ZHQ B;  4J9Z B;  2Q0O C;  4RWU A;  2K9P A;  4DR4 B;  2CH7 B;  4UCV A;  3RFR A;  4WFH A;  1GN4 A;  1NBM G;  4LF6 O;  3M7M X;  1GRJ A;  3JAM N;  3E86 A;  4JV5 O;  1Q3E A;  3HKC A;  3IJ4 A;  5IE9 A;  1SQX H;  2PUS A;  3ZHQ A;  3ZBH A;  1K92 A;  1HW7 A;  4TWK A;  4FJC C;  5IWA B;  4PV1 B;  2BE3 A;  1N8R W;  2EJR A;  5KA6 A;  2ZR2 A;  4O2A A;  2CE4 A;  1BQZ A;  4LF9 O;  2YC0 A;  1BS3 A;  3ETE A;  1H38 A;  2VWJ A;  1Q7Y W;  4B3S B;  5JJJ B;  2A06 H;  4NVP A;  1YIJ V;  5HFM A;  4JI2 B;  3HKD A;  2ZE5 A;  3A8T A;  4J7K A;  5F2V O;  1J5E O;  4J7J A;  1FXK C;  1U97 A;  5A2Q N;  1HNX O;  5K1X A;  3I5D A;  3WB0 A;  2HJF C;  2C2A A;  4JI5 O;  2YIC A;  1XL6 A;  4MSW C;  2Q7H A;  1M93 A;  3D3Q A;  1AJP A;  4O2B B;  5KHJ A;  1SC5 B;  3ZX6 A;  4HZ3 A;  2OTJ V;  1XHZ A;  4JF3 A;  5FLX N;  2A9H A;  1YJW V;  2JS3 A;  3EHB B;  4DV1 O;  3RYI B;  4H37 A;  5LHG A;  1WLE A;  3I56 V;  1R1B A;  2ZD9 A;  3ABK B;  3MD0 A;  4BW9 A;  2BTQ A;  1P7G A;  5GW7 A;  1FFX A;  4EFB A;  2JGD B;  2DN9 A;  3LNN A;  4KHP B;  3K9A A;  4TV9 A;  2CK3 G;  2WLJ A;  4J41 A;  3FKS G;  4CC5 A;  4QIW F;  1YEW A;  2R9A A;  3RW0 A;  2Y48 A;  1NTM H;  4IIJ B;  3CCR V;  4WCE V;  1R6N A;  1SA0 A;  3ZHV A;  3S3W A;  2E76 B;  1PP9 H;  2KQX A;  4F6R A;  4FLZ A;  2R9R B;  4Z1M G;  1QR9 A;  3CCU V;  2XAS A;  1XHX A;  3ZRX A;  1GN6 A;  2Q6A A;  3KG2 A;  1N36 B;  1MNG A;  3ZED A;  4FM0 A;  3N2K B;  3DSQ A;  2VRZ A;  3ZHR A;  1AVM A;  3QTC A;  1X4T A;  5JVD A;  4K35 A;  2W6I G;  2YI8 A;  3JAL A;  1NTZ H;  1LR1 A;  1NU1 H;  2QDO A;  4FLV A;  5JQG B;  5J2U B;  5KHI A;  4OGQ B;  4FM1 A;  4ZBM A;  4J10 A;  2YEV B;  4DV3 O;  4O4L B;  4FFB A;  1VQ8 V;  5GON A;  3MHH C;  1QBZ A;  3FFQ A;  3NR7 A;  2ZIN A;  4P9P A;  3VQX A;  1UPG A;  1FJG B;  1PNL A;  2VS0 A;  2R9I A;  4QE7 A;  1PPJ H;  1Q86 W;  2RJZ A;  1MAB G;  2VQE B;  1CP9 A;  1AB3 A;  1OCR B;  2A3Q A;  2XAG A;  5KLV H;  4J11 A;  3OM3 B;  2ZE6 A;  5LXT B;  2RNB A;  3H1L H;  3K57 A;  1WPB A;  3A2F A;  3E35 A;  2FML A;  4FLX A;  3AG4 B;  5EBW C;  5IYZ A;  4H13 B;  3OEH G;  5DM6 V;  4RQE A;  1VQL V;  3SYP A;  3CPW U;  3THO A;  2QSA A;  1OCR C;  2AHZ A;  4I9Q A;  1SQP H;  4I9W A;  4DR7 B;  4H0L B;  4I4T A;  1HNW B;  3AG4 C;  3WB2 A;  3K58 A;  3ZHS A;  3P3N A;  4FFK A;  3FB7 C;  1HNZ O;  1H2L A;  2RDC A;  2Q67 A;  3CD6 V;  3WG7 B;  4C7U A;  5H6R A;  2FTK A;  1MSD A;  5ITZ A;  1AP5 A;  1SZX A;  4DR6 B;  2LQT A;  1SQQ H;  4NB5 A;  2CDY A;  2K1E A;  1KD1 W;  4MW3 A;  1QNM A;  4DR2 O;  5HFL A;  5LA6 B;  2QEX V;  3W7S A;  3AG2 B;  3WG7 C;  2UUB B;  2ODM A;  1Q43 A;  3CRQ A;  1Q90 D;  2HVJ C;  2P4V A;  1WAZ A;  1TVK A;  3L9D A;  3BEH A;  3TET A;  3JYC A;  3MDS A;  3CC7 V;  1TGO A;  3TXQ A;  1M5I A;  4PA6 A;  3FB5 C;  4YIP A;  5B1O A;  1VQ7 V;  3G71 V;  3ABM B;  3AG2 C;  4DUY B;  4FK5 C;  3S3X A;  3T1C A;  3RBZ A;  2VWK A;  1XRE A;  1KP2 A;  4GLX A;  3T1H B;  1YZB A;  1AI6 A;  4X1I A;  1KEC A;  1Z5W A;  5KA5 A;  1Y76 B;  3W7X A;  1XI1 A;  4TUY A;  1N4C A;  4DR3 O;  2VQF O;  3E22 A;  3HKE B;  3LNM B;  4ZIB A;  3ML0 A;  1ZUQ A;  1IUR A;  1VEW A;  2N04 A;  4X88 A;  1DF5 A;  4HYO A;  1IZ3 A;  2FYU H;  4RQF A;  3UO3 A;  1OCZ B;  3K5L A;  2BTO A;  2WLH A;  4B3M O;  1JMK C;  4WFF A;  4HBN A;  2WAM A;  2QE7 G;  2L35 A;  4UVC A;  1S5J A;  2CUG A;  1N34 B;  2IH3 C;  3L73 H;  1JR9 A;  4E4E A;  4JI3 B;  2KG7 A;  1IDS A;  5C8Y A;  1NI8 A;  3BAB A;  2QTS A;  3TCU A;  4EB6 B;  3AG3 B;  2LW1 A;  3FAV A;  2ZE8 A;  2X7R B;  3JD3 A;  2NLJ C;  5KUK A;  1FYJ A;  4I50 A;  5FNV A;  1PNK A;  1JPX A;  4YJ3 B;  2UXC B;  4LF4 O;  3RYC A;  1YDX A;  2YXL A;  1EN6 A;  5EK0 A;  3JAR A;  4J9Y B;  1QLN A;  1S5L Z;  2KSD A;  2NNU A;  2F4V B;  4JI0 O;  1WN7 A;  3T4Z A;  1R73 A;  4GZR B;  5KMG B;  2P22 C;  5KAI Z;  3IAY A;  5E1A C;  4JI8 B;  3C90 A;  4I55 B;  4PA7 A;  1JCH A;  1PL4 A;  1G6U A;  1Q6I A;  2X6B A;  4MVO A;  2YI9 A;  3SYC A;  2UU9 B;  4LWS A;  4WFG A;  2GUZ A;  3H01 A;  1N36 O;  1V55 C;  2XAQ A;  4GT1 A;  2WLN A;  1VP7 A;  1Y66 A;  5JJN B;  2ZM6 O;  4CS3 A;  4WFA V;  2JIZ G;  2HG5 C;  3OTF A;  5B1B B;  1GAX A;  2PY5 A;  2UUA O;  4JI6 B;  3OR6 C;  4LH7 A;  1BMF G;  4X64 O;  4LFC O;  4AQY B;  4W4L A;  4R7C A;  3B2E E;  4UCO A;  2F93 B;  5JCO C;  2IU3 A;  3OE7 G;  2JEX A;  2CGO A;  5DEC A;  4JI7 B;  5B1B C;  1Y6X A;  2OT5 A;  3GB7 C;  2EJ7 A;  2DQ3 A;  5EYP B;  4EFE A;  4ZOL A;  3AK1 A;  1QQC A;  2P6J A;  1KQS U;  5KHK A;  4WBN A;  2IJK A;  4X65 B;  2EIN B;  1GM9 A;  4GKK O;  3ZRW A;  4G27 B;  2A7W A;  2JJ2 G;  3D36 A;  3ETD A;  3ETG A;  4DR5 B;  1VQN V;  2EIL B;  4CC6 A;  1PV0 A;  4N21 A;  2IU0 A;  5LMU B;  1ROP A;  1SET A;  2E5L O;  3UM7 A;  2JVD A;  4U3F H;  1NR7 A;  1HR0 B;  1BL8 A;  5LP6 A;  1BSM A;  1MZE A;  1S5H C;  3ETQ A;  5FPO A;  1XEQ A;  3HKC B;  2HKO A;  4JZ2 A;  2X6A A;  2EIN C;  4QGP A;  2HR3 A;  3PN1 A;  4R6Z A;  1BZK A;  4DV6 O;  2EIL C;  3H1K H;  2XAF A;  1H8E G;  1WNS A;  4O2A B;  4NR1 A;  3ZN0 A;  2Y0I A;  2Z3Y A;  3U11 A;  3B09 A;  2FL4 A;  3STZ C;  4KXR A;  4BIU A;  3M8A A;  3GVM A;  5EIB C;  2QGN A;  2P67 A;  3ZRV A;  3CSX A;  5CA0 A;  1F51 A;  4FZ0 A;  3CCJ V;  3HKD B;  2ZDI A;  2FB5 A;  1R3I C;  2YIB A;  4X1K A;  3BPZ A;  3UCS C;  4OX9 B;  4DV2 B;  4KP4 A;  5IJ0 A;  1L0L H;  2UUC B;  5TIS Z;  3CME V;  2V7Q G;  4NTY A;  1XNR B;  1S77 D;  1RP3 B;  1P49 A;  5LGU A;  1Y74 B;  2EIK B;  3JSL A;  5EBL C;  1GN2 A;  5B66 Z;  1MZF A;  1L0N H;  4O4I A;  2YDE A;  3CMA V;  1ZTE A;  4YY3 O;  5B5E Z;  4CS2 A;  1URF A;  3QO8 A;  1RPO A;  2FKX A;  2Z5U A;  5L3C A;  1XMO B;  1YJN V;  1FXK B;  2BTQ B;  1W0J G;  4JAV A;  2EIK C;  4DV4 B;  3BVO A;  3T1H O;  5IJ9 A;  5LYJ B;  2P5O A;  1FFX B;  5LHH A;  2E74 B;  1WB7 A;  1IXB A;  2AHY A;  3SJB C;  4TV9 B;  4MVQ A;  5LOV A;  1XMQ B;  3L72 H;  1MA1 A;  2Q68 A;  2YIB D;  4FM2 A;  2DW4 A;  4F6R B;  4UFZ A;  1XL4 A;  4GX5 A;  3SPC A;  1I94 O;  4NYK A;  2M7W A;  1PKX A;  1IVS A;  3HKB A;  3JAS A;  2LJ2 A;  3STL C;  3CXC U;  3VQY A;  4LBE C;  2EZO A;  3IGA C;  4JI4 O;  4FZ1 A;  5JVD B;  4X1Y A;  3BA8 A;  2CGN A;  4QE9 A;  3JAL B;  3SDL A;  4YJ2 A;  4CBC A;  1VF6 A;  5CN0 A;  1GO3 F;  4J7Z A;  4ABM A;  5EIB D;  1OHH G;  2UXD O;  1IX9 A;  4LF7 O;  2F95 B;  4JTA B;  2ZXW B;  1WP7 A;  3JD1 A;  4MS2 A;  2JK5 C;  4PJ0 Z;  4X8A A;  1FXV A;  4B08 A;  4PI0 A;  4JI1 B;  2HP8 A;  3T1Y B;  4LNU B;  2XT9 A;  5GON B;  2OTL V;  3T4D A;  4GKJ B;  4L8J A;  2AXT Z;  3SPI A;  5IYC O;  2F66 C;  2HLD G;  1Q6U A;  2LFS A;  5J2T A;  3AG7 A;  1BGY H;  4FVM A;  3SPH A;  2ZXW C;  1KKD A;  1HP8 A;  3K59 A;  4IYI A;  3TGU H;  2DOS A;  5KHG A;  3G67 A;  2ZT9 B;  4IHJ A;  3E2E A;  2DMX A;  1JA8 A;  3RN4 A;  4A5U B;  1IBM B;  1H8H G;  5EBM C;  3APQ A;  5KX5 A;  3AEI A;  2YXH A;  4LFA B;  5IYZ B;  5BXZ A;  4NXM O;  2KB1 A;  3ASN B;  4LFB O;  4DUZ O;  5IT9 N;  4AI8 A;  1RFY A;  2GTS A;  4DO2 A;  4PI2 A;  5K1P A;  3ZHT A;  3CJH B;  4DR1 B;  4LF8 B;  1N0N A;  1XNQ B;  4I4T B;  4UV9 A;  2LGQ A;  1AP6 A;  2QM8 A;  1XIL A;  4O2B A;  5BR8 O;  3MAQ A;  1NTK H;  3LDE A;  2X0L A;  3ASN C;  4B7E A;  4ICG A;  3OTO O;  4JYA O;  4PDR A;  1S0V A;  4JAA A;  4YXW G;  4NKG B;  4K0K O;  2CTQ A;  4DV7 B;  2DYS B;  4MTX A;  3CP1 A;  3RYI A;  3IC9 A;  4O4J A;  5ITZ B;  2PZS A;  2E3C A;  3O9O A;  3OGC C;  3SPG A;  4CH5 A;  4I7Z B;  3ZMV A;  4AQY O;  2WLK A;  4DV0 B;  1N32 O;  2RMK B;  3CCL V;  4EEQ A;  2W0F C;  3Q4H A;  1H2M A;  1Q81 W;  4LF5 B;  2DYS C;  4IGG A;  4TV8 A;  3JAW A;  1FKA O;  1HDJ A;  1M57 B;  4X20 A;  3A0R A;  1MSW D;  4B3T O;  1TVK B;  2YSU B;  4X65 O;  1N33 B;  1E1Q G;  5CBF A;  4DR5 O;  2QWP B;  3G4S V;  5LMN B;  2HEP A;  1YTF D;  1COW G;  1ENV A;  4GUN A;  3BY6 A;  4UV8 A;  1D5N A;  3R65 A;  5EZY A;  1M57 C;  3AK3 A;  1EM1 A;  3JCZ A;  3M99 B;  2QKS A;  2AZ0 A;  3E8F A;  3BA9 A;  3CB2 A;  1SF9 A;  2Q5Z A;  5LGN A;  2Q8V A;  2GHY A;  4TUY B;  1XDC A;  3H1I H;  1IBL B;  3E22 B;  4PDL A;  1AR5 A;  4WFB V;  3O65 A;  3SYQ A;  2QWO B;  4BWA A;  5JQG A;  4X66 O;  2BOC C;  3SR2 C;  4AIL C;  3UT5 A;  2PYL A;  2WLI A;  1IBK O;  1Z2G A;  3SYO A;  3TK1 A;  3QG5 A;  1AR4 A;  4X62 B;  2YEV A;  1VQ5 V;  2ZKO A;  5L3D A;  1NVP D;  1K9M W;  4P2Z A;  3RYH A;  4MVU A;  2HFE C;  4UCU A;  3LUT B;  4NXN O;  3ZIA G;  2BSK A;  5CMU A;  1WP8 A;  4B3R B;  2BOB C;  2KG7 B;  3CCE V;  1H2K A;  1KKC A;  2DQ0 A;  3UO2 A;  4DV5 B;  4TOI A;  1MG1 A;  2GSM B;  5H6Q A;  3FAV B;  1VQO V;  4DR4 O;  3SJC C;  1GN3 A;  1XNR O;  3SGI A;  3KKY A;  5LXT A;  1AJN A;  1LUV A;  5FPR A;  1O9H A;  4I50 B;  5FNV B;  3ASO B;  4MTG A;  1KUQ A;  1R6T A;  1THZ A;  4LF6 B;  1VIB A;  1ZL8 A;  3OUF A;  2Y4U A;  2UXB B;  1M56 B;  2XND G;  4JV5 B;  3JAR B;  1XBL A;  1Q8I A;  2OCC B;  2ZCE A;  1Q82 W;  5IWA O;  1YXB A;  2PTM A;  2WLL A;  3LSS A;  5LL6 Y;  3A0B Z;  4UXN A;  3G6E V;  2ZQM A;  4U7O A;  1WA8 B;  1K7D A;  2RN9 A;  1TA8 A;  1V9P A;  1SES A;  3ASO C;  4DW1 A;  2P90 A;  2XOK G;  4PD4 F;  4LF9 B;  3RYF A;  1M56 C;  2A79 B;  4QNH B;  2UXX A;  2WLM A;  2DJV A;  4B3S O;  3E8B A;  2D3O W;  5GTI Z;  5J9P C;  4NTW A;  1EN4 A;  1RSO A;  2OCC C;  1SZT A;  4FLY A;  2ITC C;  3K06 A;  4JI2 O;  5IY5 B;  3AG1 B;  4DK0 A;  2B1G A;  4BW5 A;  3K04 A;  5H9C A;  3OT7 A;  4W4K A;  3DC5 A;  4LWS B;  4RAI A;  3CCQ V;  1HNX B;  4LCU C;  4JYB A;  5CBG A;  4CS4 A;  2IJI A;  3OUS A;  4JI5 B;  5CB4 A;  3LDD A;  4KUM A;  2Q4P A;  1SER A;  1XQ8 A;  2OCH A;  3C3T A;  1ARO P;  3OAA G;  5IY5 C;  2B5U A;  2QWR B;  3AG1 C;  2L6L A;  3LSQ A;  1AI4 A;  2RCV A;  2PYJ A;  1SQV H;  1G4Y B;  4TQD A;  4Q6G A;  2Q0A A;  4JTC B;  4DV1 B;  1BCC H;  1US6 A;  1YSC A;  3OD4 A;  3OMN B;  2PI4 A;  3VQV A;  1T5E A;  1OJH A;  3JAT A;  2WWW A;  4JI1 O;  3T1Y O;  1F4N A;  1QU7 A;  2LW7 A;  3EXA A;  3P3P A;  1K5Q A;  4LH6 A;  4UVA A;  2R72 A;  1V55 B;  4OXS A;  4E2L A;  4KHP O;  3HR0 A;  4PA9 A;  4ZOL B;  2GV9 A;  3K0D A;  1QVF U;  3SYA A;  4WBN B;  4JYC A;  2IJH A;  2F1M A;  1DK1 A;  4PDV A;  4JTD B;  2JS5 A;  1AI7 A;  1IBM O;  1FD9 A;  4UUJ C;  4DRX A;  4PDM A;  1BE3 H;  1DGS A;  3FX7 A;  2QJ1 A;  5LP6 B;  3D3I A;  4O4H A;  1VQ6 V;  5A9G A;  4XDK A;  2ILM A;  2LP7 A;  1UJW B;  3P30 A;  3D36 C;  4MVZ A;  3SJQ C; 
#chains in the Genus database with same CATH homology
 4JPR A;  3JD0 A;  5IDJ A;  1NH2 D;  3QO8 A;  1RPO A;  4JGS A;  2Z5U A;  2W6J G;  4QPK A;  5L3C A;  4MVS A;  1YJN V;  1FXK B;  1W0J G;  4JAV A;  2JJ1 G;  2EIK C;  5B1A C;  3VBB A;  2EZP A;  1GMG A;  4ZBM A;  2A0L A;  5LHH A;  2YEV B;  1VQ8 V;  2AHY A;  1BHB A;  2B1I A;  3MHH C;  1QBZ A;  3FYE B;  4MVQ A;  4P9P A;  1K8A W;  2JEU A;  3FYI B;  2Q69 A;  1QLE B;  3UKM A;  2Q68 A;  1PNL A;  1ZWI C;  3ABM C;  3WFV A;  1EFR G;  2R9I A;  4QE7 A;  1F23 A;  1Q86 W;  1MAB G;  2DW4 A;  2EIM B;  2QM7 A;  5LGT A;  1XL4 A;  1PNM A;  4GX5 A;  3SPC A;  1CP9 A;  2MK3 A;  4X89 A;  1OCR B;  5LHI A;  2XAG A;  2M7W A;  3OM3 B;  1I5Y A;  1PKX A;  3K3W A;  5L3B A;  3STL C;  3CXC U;  1I5X A;  4JAU A;  3E35 A;  2ZDI C;  1E1R G;  4LBE C;  5L3F A;  5DN6 G;  2EZO A;  3IGA C;  1EBO A;  1QLE C;  3AG4 B;  5EBW C;  1DF4 A;  1E79 G;  4QE9 A;  1PL0 A;  3OEH G;  5DM6 V;  4RQE A;  3ZMZ A;  2EIM C;  2H8P C;  1VQL V;  2QA4 V;  3ZMT A;  1OCO B;  4CBC A;  3SYP A;  5LBQ A;  3CPW U;  1OCZ C;  5CN0 A;  3PJS K;  1GO3 F;  4H33 A;  1OCR C;  1OHH G;  1VQP V;  2AHZ A;  4TT3 G;  1B6Q A;  4I9W A;  3T2M A;  2Y69 B;  1DLB A;  4JTA B;  5B3S C;  1R3L C;  2ZXW B;  3AG4 C;  3JD1 A;  3K08 A;  4MTF A;  2DWD C;  4LP8 A;  1GKF A;  4MT8 A;  4MS2 A;  4I5S A;  2JK5 C;  4X8A A;  1FXV A;  1QCE A;  3FB8 C;  3FB7 C;  2ATK C;  3AG3 C;  1OCO C;  3ABU A;  3T4D A;  2OTL V;  3W7W A;  4MW8 A;  4TSF G;  2Q67 A;  4FMT A;  3SPI A;  3CD6 V;  3WG7 B;  1ORQ C;  2F43 G;  4Q20 A;  2HLD G;  1FFT B;  5H6R A;  2FTK A;  4EKW A;  5IYC O;  4RO2 A;  3W7U A;  2LFS A;  3ABT A;  3E8H A;  2Y69 C;  4FPP A;  3HB3 B;  1H2G A;  3SPH A;  2ZXW C;  1RPR A;  3ZRW B;  1KKD A;  3F7Y C;  4F4L A;  2V1D A;  1K73 W;  1LNQ A;  3ZRS A;  2K1E A;  3E2E A;  1KD1 W;  3DTU B;  4MW3 A;  3RVZ A;  2EBO A;  1H8H G;  5HFL A;  5KUM A;  1SRY A;  2QEX V;  3W7S A;  2P7T C;  1R6K A;  4FIP C;  5EBM C;  5IYB O;  3AG2 B;  3WG7 C;  3AEI A;  2HVJ C;  2KB1 A;  3K03 A;  3ASN B;  4R50 A;  1JOY A;  3ZMS A;  3B77 A;  2IH1 C;  4RUF A;  3BEH A;  3TET A;  3JYC A;  4QJF B;  3CC7 V;  4DO2 A;  1MOF A;  4PA6 A;  2X6C A;  3FB5 C;  3OMI B;  5B1O A;  1VQ7 V;  3F7V C;  4UV9 A;  3G71 V;  2QM8 A;  3ABM B;  3AG2 C;  1JJ2 U;  4FK5 C;  4WFE A;  1GM8 A;  3W7T A;  3T1C A;  3RBZ A;  3LDE A;  1K3E A;  1KP2 A;  5EC2 C;  2X0L A;  3ASN C;  4QPJ A;  4LC1 A;  1QVG U;  1AI6 A;  3K0G A;  4MVM A;  4WF9 V;  4PDR A;  1S0V A;  4YXW G;  2UXN A;  3JD4 A;  1KEC A;  1K34 A;  3E83 A;  5KA5 A;  2DYS B;  4MTX A;  3CP1 A;  3W7X A;  2WSS G;  3OW2 U;  3OGC C;  1R3K C;  3LNM B;  4PEL A;  3JD2 A;  3ML0 A;  3SPG A;  3X2Q B;  3ZMV A;  2WLK A;  4U7N A;  1RM1 B;  4X88 A;  1DF5 A;  4HYO A;  4RQF A;  1CEZ A;  1OCZ B;  2WLH A;  1CPY A;  2PI5 A;  4G2K A;  4WFF A;  3CCL V;  3IFX A;  2W0F C;  4G28 B;  1Q81 W;  5C93 A;  2DYS C;  2WAM A;  3F5W C;  5IYD O;  2QE7 G;  1J95 A;  4UVC A;  1V54 B;  5B1N A;  1DTO A;  1OZ0 A;  5B3S B;  1IXM A;  1M57 B;  2IH3 C;  1VQ9 V;  1YHQ V;  3A0R A;  3NXS A;  1YI2 V;  1MSW D;  3X2Q C;  2DYR B;  2YSU B;  4P30 A;  1K4D C;  2XAJ A;  1JQ0 A;  1RM1 C;  1S76 D;  1E1Q G;  3TCU A;  5CBF A;  3AG3 B;  1JVM A;  1WPX A;  1YTF B;  1YJ9 V;  3G4S V;  1K33 A;  3IC7 A;  2H94 A;  2X7R B;  1P4R A;  3DGE A;  1COW G;  1ENV A;  1M1K W;  2ITD C;  4GX1 A;  1VQM V;  1YTF D;  1W2B U;  4MVR A;  1M90 W;  2JDI G;  3BY6 A;  4JAS A;  4UV8 A;  3JD3 A;  2NLJ C;  3OFN G;  5KUK A;  1V54 C;  3R65 A;  4PA4 A;  3ZJZ A;  1W0K G;  1M57 C;  3B8M A;  1PNK A;  1F4M A;  1JPX A;  2HVK C;  1AR1 B;  3JCZ A;  4XBF A;  2DYR C;  3M99 B;  1EZJ A;  3ZCC A;  2QKS A;  1KP3 A;  5EK0 A;  4CZZ A;  1M9N A;  2IJJ A;  3E8F A;  1NR1 A;  3OR7 C;  4DXW A;  4J9Y B;  3CC4 V;  1QLN A;  5LGN A;  3P32 A;  2GHY A;  1NKD A;  3K79 A;  4PDL A;  4BIZ A;  4WFB V;  1AJQ A;  1R3J C;  3ABL B;  3SYQ A;  1HWY A;  2QTO A;  4N23 A;  2LFR A;  2BOC C;  2NNU A;  1FXK A;  4P9O A;  3T4Z A;  2EIJ B;  1R73 A;  2WLI A;  4ASU G;  3SYO A;  3TK1 A;  5E1A C;  1NVP B;  2YEV A;  1VQ5 V;  1K97 A;  5L3D A;  2WPD G;  1S72 V;  1NVP D;  4P2Z A;  1NJI W;  1K9M W;  4PA7 A;  5EC1 C;  4MVU A;  3RVY A;  3I55 V;  1JCH A;  2HFE C;  4GX0 A;  1G8M A;  3LUT B;  5FL7 G;  3ZIA G;  5CMU A;  2X6B A;  4MVO A;  2BOB C;  3ABL C;  5BZB A;  3ABK C;  3CCE V;  2DQ0 A;  3QO5 A;  3SYC A;  4RUE A;  3HPL C;  2EIJ C;  3QO7 A;  1MG1 A;  2GSM B;  5H6Q A;  4WFG A;  4J9Z B;  1VQO V;  4L87 A;  3H01 A;  1V55 C;  2XAQ A;  1AJN A;  1FS0 G;  4WFH A;  4GT1 A;  2WLN A;  1NBM G;  3ASO B;  1Y66 A;  4MTG A;  3CCV V;  1THZ A;  3LDC A;  3OUF A;  3E86 A;  3B8N A;  1M56 B;  2XND G;  3E8G A;  4WFA V;  2JIZ G;  1K92 A;  2HG5 C;  2OCC B;  4TWK A;  5B1B B;  3CCS V;  3VOU A;  1Q82 W;  4FJC C;  3LSS A;  2WLL A;  3ZN1 A;  1K5S A;  4ZKI A;  1N8R W;  4UXN A;  3OR6 C;  4UVB A;  3G6E V;  2EJR A;  5KA6 A;  2ZR2 A;  1BMF G;  2ZQM A;  3ASO C;  1K7D A;  4U7O A;  2WLI B;  4R7C A;  1SES A;  2P90 A;  2XOK G;  1JX9 A;  2IU3 A;  1M56 C;  2A79 B;  3ETE A;  3OE7 G;  4QNH B;  2UXX A;  4MTO A;  2WLM A;  2JEX A;  1H38 A;  1Q7Y W;  3E8B A;  5CBH A;  1AI5 A;  2D3O W;  2ZR3 A;  5L3E A;  5J9P C;  2IW5 A;  2OCC C;  2OT5 A;  1SZT A;  3GB7 C;  5B1B C;  2DQ3 A;  2ITC C;  1YIJ V;  3K06 A;  5IY5 B;  5HFM A;  3AG1 B;  2P6J A;  1KQS U;  2B1G A;  1FXH A;  4BW5 A;  1FXK C;  4HAM A;  3K04 A;  2IJK A;  4R8C A;  5H9C A;  2EIN B;  1VQK V;  1KC8 W;  1GM9 A;  4RAI A;  3ZRW A;  4G27 B;  2JJ2 G;  3CCQ V;  3D36 A;  3ETD A;  4LCU C;  4JYB A;  5CBG A;  3ETG A;  1VQN V;  2HJF C;  2IJI A;  2EIL B;  3OUS A;  1GTO A;  2C2A A;  4XDJ A;  3LDD A;  4KUM A;  4N21 A;  1XL6 A;  2IU0 A;  4MSW C;  1SER A;  1TUE B;  1ROP A;  1GK9 A;  1SET A;  1AJP A;  1QR8 A;  3UM7 A;  1ARO P;  1NR7 A;  2XAH A;  3OAA G;  1BL8 A;  5IY5 C;  2B5U A;  1BHA A;  1S5H C;  4GCZ A;  3AG1 C;  3CYO A;  3LSQ A;  1AI4 A;  4HZ3 A;  3OMA B;  2HKO A;  2OTJ V;  2X6A A;  1G4Y B;  4JF3 A;  2EIN C;  2HR3 A;  2A9H A;  4R6Z A;  1YJW V;  3QNE A;  3GWO A;  3EHB B;  4JTC B;  4H37 A;  5LHG A;  2WLL B;  2EIL C;  1WLE A;  3I56 V;  1YSC A;  2XAF A;  1H8E G;  2ZD9 A;  3ABK B;  3OMN B;  4XDL A;  2PI4 A;  1P7B A;  3ZN0 A;  3MD0 A;  3CC2 V;  1Y4M A;  2Z3Y A;  2WWW A;  3FB6 C;  1F4N A;  3STZ C;  3CCM V;  5GW7 A;  4BIU A;  4GX2 A;  1K5Q A;  4UVA A;  1V55 B;  4OXS A;  2P67 A;  4E2L A;  3ZRV A;  4PA9 A;  3K9A A;  2CK3 G;  2WLJ A;  1F51 A;  3K0D A;  3CCJ V;  3E89 A;  3FKS G;  1QVF U;  2ZDI A;  4QIW F;  3SYA A;  1OCC B;  3ZMU A;  4JYC A;  3RW0 A;  2IJH A;  2Y48 A;  4KFM A;  1R3I C;  3CCR V;  3EFF K;  3SPJ A;  4WCE V;  4PDV A;  1R6N A;  4JTD B;  1VQ4 V;  4PA3 A;  2R9R B;  4KP4 A;  4Z1M G;  1AI7 A;  1QR9 A;  3CCU V;  2XAS A;  4UUJ C;  3CME V;  3ZRX A;  2V7Q G;  4PDM A;  2Q6A A;  3KG2 A;  1S77 D;  3MHS C;  3D3I A;  1S3J A;  1NQT A;  1VQ6 V;  4BAY A;  5LGU A;  2EIK B;  5CA3 A;  5B1A B;  1OCC C;  5EBL C;  5L3G A;  4XDK A;  1GM7 A;  3OEE G;  2DWE C;  1PD3 A;  1L1F A;  2LP7 A;  1UJW B;  3P30 A;  2W6I G;  4MVZ A;  3SJQ C;  1YIT V;  3CMA V;  1NH2 B;  1K4C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...