3ZRXA

The high resolution structure of a dimeric hamp-dhp fusion displays strong asymmetry
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
total genus 45
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrxA00
3MD0A 3ZRWB 5IDJA 4QPKA 4ZKIA 2QM8A 4Q20A 3ZCCA 4MT8A 1IXMA 4I5SA 4QPJA 3D36A 4BIZA 4JAUA 4MTXA 4FMTA 3ZRXA 4FPPA 3ZRVA 2WWWA 5B1NA 4LC1A 4KP4A 4JYCA 2LFRA 5B1OA 4GT1A 5C93A 1JOYA 4JAVA 4BIUA 3DGEA 2C2AA 2QM7A 4U7OA 3TK1A 2P67A 4JASA 4JYBA 1F51A 3A0RA 4GCZA 3ZRWA 2LFSA 2FTKA 3P32A 3NXSA 4U7NA
chains in the Genus database with same CATH superfamily
2Q69A 5KHHA 2P4VA 5IDJA 2E74B 3ZCCA 3CWBH 4FFKA 1JPXA 3VOUA 3G6EV 3K79A 4IIJB 1X59A 4YXWG 1KKDA 1SRYA 4TQDA 4EFBA 1AILA 4LF6O 4JI6O 5EC2C 1VQOV 4UB6Z 2P4KA 1F51A 1IURA 1Q6HA 3ABUA 5EZYA 1WLEA 1BT8A 1RP3B 3SYPA 1GK9A 4DV3B 1N33B 2NLJC 2QR4A 2YC0A 3E35A 4AI8A 1NT2B 1SZTA 5JJJB 5JCOC 1BQZA 2RNBA 4JYCA 3EFFK 1R73A 1FPOA 4HZ3A 3L74H 1YIJV 5LP6A 2KSDA 3VQWA 4I9WA 3BAAA 4MVRA 4PELA 2NR5A 2YI9A 1RM1B 1SQQH 5KUKA 2GTSA 2AGAA 4QJFB 3SR2C 4AILC 4MVUA 3ZBHA 1QBZA 4GX2A 3K0GA 2WLMA 5IY5B 3QG5A 2IM9A 3ETDA 5IYZA 4LF5O 1V54B 3JAKA 4JV5B 3TETA 4C7UA 2G38A 3IC9A 3OFNG 3SYAA 3CCRV 1YVWA 5BR8B 3JYCA 2WLIB 1NR1A 1AP5A 2N05A 1KKCA 1HNWO 1KMIZ 3A0HZ 4ZBMA 2F93B 3FD9A 4P9OA 1HR0B 2KQXA 4MVOA 1Q5OA 4YHHB 5H9CA 3TXSA 2PZSA 4HNAA 1RM1C 5C93A 1ZL8B 2FYUH 2ZQMA 5J2TB 4TV9B 1NZ6A 2IJKA 3JD4A 1WPXA 5B3SB 2P22C 1D2DA 1AR4A 1RPRA 3ETEA 3ZHQA 2JK5C 4OGQB 4O2BA 2HJFC 4BIZA 1R6NA 4DO2A 5TISZ 4GX5A 1GN3A 5GONB 4QE9A 4PA6A 2WLNA 3R66A 4LF9O 4XDLA 4DUZB 4PA7A 1GM7A 3CMEV 2WLKA 1VQ7V 2UXCO 1QVGU 4I5SA 4UV9A 3O65A 2L6LA 5LXTB 2QWQB 4OXSA 4DV4B 1OHHG 5EBWC 1URFA 2GBOA 4X64O 5FNVB 2RDCA 2DMXA 4X1IA 5CA1A 3W7TA 2DOSA 3HKBB 2WA3A 3QO5A 4E4EA 4PA4A 4FFBA 2PY5A 1SA0A 4PDVA 4JYAO 3ZRXA 4IT5A 1BHBA 4R7CA 1GRJA 3MAQA 4UV8A 3RFRA 1XBLA 2OTJV 5LOVB 1NH2B 1Y6XA 2W6JG 4RWUA 1YZBA 5LMNB 3BFRA 4WBNA 1M56B 1W2BU 4ZHQA 4FLWA 1QU7A 4DR7B 4IYHA 2XAFA 3T1HB 2CGNA 3SJCC 1GKFA 3WB1A 2OIGA 3B09A 1P49A 1WJZA 3BPZA 2V7QG 2JS5A 3M99B 4DV2B 3IAYA 1J5EB 4JI3O 2GSMB 4ZKIA 1VQ5V 4J7JA 1Y4MA 1PD3A 3WG7B 4O4LA 1KECA 2OCCC 3RWRD 5IJ9B 3D3QA 1P7BA 3K59A 1KD1W 1DF4A 1XQ8A 5KMGA 2ZDIA 1MZFA 1H38A 2XAHA 3DXRB 2KB1A 3BHPA 4LFAO 2A06H 3JALA 3J80N 2YIAA 3ASNC 3AEIA 1NVPB 1JJ2U 4W4KA 4UCTA 2XOKG 5KA5A 1VQ6V 2HP8A 4O4JB 3EVKA 4WCEV 2DN9A 3L72H 4O2BB 5B1BB 3ZIAG 3CJHA 1JJOA 5KHIA 4O2AA 2YXLA 4JI7B 3UT5A 4XBFA 3KCXA 3CXCU 2FTKA 1N34O 4O2AB 4HNAB 4KHPO 2B1IA 3VQXA 5FLXN 2OCCB 5JVDB 3ZEDA 5DECA 3WG7C 2AZ2A 4PI2A 4FIPC 4CH4A 5IYDO 2CUGA 2EILC 4J9YB 2VQEB 1XNQO 1N0NA 2YDEA 1AROP 3BCCH 3T1YB 4X64B 1AP6A 3ASOC 3LSSA 5DM6V 1R6KA 3HR0A 2ADQB 4PI0A 1XREA 4DR7O 4DXWA 4NXNB 3C3SA 2RJZA 3OAAG 5E1AC 3AG2C 1QQCA 2LFRA 2QJ1A 3JD2A 5CBFA 2PTMA 4X1YA 3SJQC 3FFQA 3P32A 4GKJB 3ZN1A 2XHBA 1ZTEA 1H8EG 2EIMB 2PUSA 1QHTA 5B5EZ 2CDYA 2H94A 3MHSC 3OTOO 3ZMVA 3SPHA 1NH2D 3K03A 4MTGA 2ZNIA 1Q81W 3CCJV 3STLC 3K57A 2Q7HA 1B04A 1D5NA 2CH7A 1Q90D 2AHYA 3UM7A 4JI2O 1A32A 4X20A 4DYLA 1EBOA 4CZZA 3AG7A 2JIZG 4BW9A 4FFBB 2QKAA 3RT3C 4I7ZB 3LUTB 3CS5A 2ZM6O 1Q82W 1E1RG 3FB5C 4NKGB 1NVPD 2JS3A 5IJ9A 5IY5C 5BR8O 4TV9A 4Z1MG 1W0JG 4H0LB 4U7NA 1MOFA 1O9GA 1WNSA 3N2GA 3SYOA 4MVZA 4LR3A 4G27B 4D7SA 3D8CA 2P6JA 2GDSA 4P2ZA 5LP6C 1EN6A 2Z0AA 1YJNV 2ATKC 4HYOA 2HVJC 2F95B 3B2EE 4DV5B 5K1PA 1FFTB 4RUEA 3BRCA 3K06A 5J2UB 3E22B 4LFCB 4DV0O 1OCCB 2Q6AA 4JTAB 2BSKA 2R72A 1Y74B 3RYHB 1L0NH 2N74A 1G6UA 4JI6B 3JARA 2WA4A 2RMKB 1H2MA 1XILA 2FMLA 1SERA 5CA1B 3T1HO 2GHYA 4MT8A 2YXHA 2M7WA 2ETNA 4DV3O 3M8AA 2CTPA 2MW2B 4GUNA 2WWWA 1T5EA 1LUVA 4D6TH 2ZIMA 1I08A 2OCHA 2PYJA 1M90W 4PA9A 3CCLV 3B40A 4PD4F 1FYJA 5KHJA 1IDSA 2E5LB 1TGOA 3DTUB 4TWKA 4QNHB 5LMUB 4JV5O 5CBGA 4J11A 1VQLV 4J10A 3L71H 1M57B 2ZDIC 4Z2WA 2EJ7A 1KQSU 4DR2B 4DR4B 5FL7G 2VQEO 1OCZB 3CXHF 1IVSA 4GLXA 4JAVA 1HW7A 2F1MA 1FXHA 1VF7A 1VEWA 1N32O 1VQMV 1AR1B 4LFBO 3FX7A 5H6QA 3R65A 4DV2O 1SKVA 4B7KA 5JQGA 3PN1A 2AZ0A 2EIMC 4DUYB 1YTFD 1ROPA 4NYKA 3F5TA 3RYHA 3UO3A 4ZI7B 2YIBA 1WB7A 2EILB 1EN5A 4Z1VA 4DV6O 1R6TA 4JI0B 3S3WA 4UB8Z 2X0LA 4KFMA 5BZBA 5KA6A 2A3QA 4FM0A 3G6BA 1GO3F 3DC5A 4LFBB 1RSOB 1K7DA 2EZPA 2Q0OC 1N32B 3WU2Z 2RQ6A 1FXKA 2DJVA 1GN6A 1VMGA 2IJJA 4JI5B 3E8BA 1PL0A 4NTXA 5B1AB 2JGUA 2R9RB 5B1BC 3AG2B 5F2VO 3O9OA 4K0KB 2P06A 2YIBD 5CMUA 2ZIOA 1KYOF 2P67A 4F6RA 2WSSG 3SPIA 4AQYO 3ZRWA 3CCMV 1PNKA 3AG3B 3J7AU 1EN4A 1IBMB 3E22A 3ZN0A 2EIKC 1Y66A 3DSQA 2HLDG 4UUJC 1PL4A 3ZMTA 1TUBB 2Q4PA 3W7XA 3IGAC 4R8CA 5BY1A 3UCSC 1ORQC 3QO8A 1CPYA 1YSCA 4DUYO 5B66Z 1MMMA 1F4NA 1HP8A 4NTYA 3ZHSA 3WB2A 4J80A 1AJQA 3PJSK 1ZLZA 2Q68A 1GMGA 2D2CB 2UUCB 1I7FA 1K5SA 3H9VA 5EK0A 3OM3B 1ZUQA 2W0FC 4LF6B 1KU9A 1FXKC 4I55B 5LMUO 2Z3YA 5LL6Y 3UKMA 2QA4V 3C3TA 1HWYA 1NS1A 2HEPA 4KUMA 4LH7A 4DV1O 1IBKB 2L35A 3ZHTA 5B1NA 2V1DA 1H8HG 4O4JA 4UVBA 1ENVA 1I0HA 3QTCA 5KHGA 2QWRB 3E86A 4K8XA 1HNWB 4LNUA 4ZIBA 4DV7O 1YHQV 4TUYA 5D5QA 2QTSA 2IH3C 3WFVA 1WN7A 3ZMUA 3GVMA 2DYRB 2DW4A 3ETGA 5IWAO 4EFEA 3CD6V 4ICGA 5IE9A 3RYCA 3JCUZ 1K9MW 2Y4TA 4F6RB 1GN2A 1SETA 1G1XB 4LH6A 3W7SA 2DYSB 4Q20A 2F4VO 1FD9A 3JARB 2UU9O 5LYJB 4G2KA 4LF7O 5EBLC 5J9PC 1KB9F 1N4CA 4TV8A 1XHXA 4YY3B 4R6ZA 1S0VA 5KUMA 2K1EA 1VQ9V 1VARA 2ILMA 1U96A 4B3SB 2QGNA 3LDEA 2UXXA 2CAZC 1Q6UA 5HFMA 1M1KW 3LDCA 1AI4A 3HPLC 4O4HA 2CH7B 4K35A 5KLVH 2CTRA 4CH5A 4FVMA 4JPRA 2Q8VA 4X66B 1VIBA 1AR5A 1GM9A 1H2KA 3RN4A 4FLUA 4OX9O 4IYIA 4X1IB 1N34B 1SESA 1IBLO 5L3CA 3VQYA 3W7WA 1AJPA 2OTLV 3F7YC 4XDKA 2XT9A 1E1QG 4X65B 4F6EA 1HNXO 2ZNJA 4LWSB 2P7TC 3TGUH 1WA8B 3FB6C 2VWJA 4H37A 1N8RW 4X8AA 5K1XA 1Y67A 3CCQV 3LDDA 2LP7A 2BTOA 4MW8A 2QEXV 5GONA 4WBNB 2DYRC 2CTWA 4O4LB 5JWPA 1AB3A 3ZRSA 3E2EA 2IBZH 1KC8W 4U3JA 3T2MA 1XNQB 1S77D 1XEQA 4GCZA 3CE2A 3A2FA 5J2TA 4X66O 3ZHVA 4X1YB 3SPCA 4FLXA 1DLBA 1JFFA 3ZJZA 2HVKC 4FMTA 5LP6B 4FLYA 3E8FA 4P30A 3SYCA 4BIOA 2F66C 3A0BZ 3B8NA 4YIPA 2ODMA 1MABG 2QM7A 3ABMC 4IIJA 1MZEA 2YUAA 3RBZA 4MTOA 2HKOA 1KBHA 2ZR2A 2E76B 5LGUA 4DRXB 1OCCC 2Q9LA 1K8AW 3OUFA 5JQGB 4UCOA 5LHGA 4PV1B 4YHHO 3OMAB 2GTAA 4YY3O 2JGDA 3ZMZA 5EIBD 4I50B 4IGGA 1J5EO 3ML0A 4WF9V 2A0LA 3JSLA 4U3FH 4B3RB 3OEHG 5HFLA 3RGBA 3OTFA 1HDJA 2GUZB 4FM2A 3JD3A 3CC4V 5EIBC 2PF4E 1KUQA 2WPDG 4MW3A 1K4CC 4NB5A 4AHCA 4LF4B 2IW5A 4B3TO 2Z5UA 3MD0A 1PNMA 5LBQA 2DQ3A 1XUQA 4LBEC 1JFFB 4JTDB 2XASA 5KHKA 3T1YO 1SQBH 2GUZA 5L3FA 3VQVA 3CRMA 3SDLA 1RPOA 4P9PA 2UUAO 4KXRA 1RFYA 1Y74A 2Q7GA 3H1IH 4DW0A 3TXQA 2BSKB 2VQFO 2ITDC 2EZOA 1TVKB 1ZWIC 1SQPH 1US6A 1IXMA 1B3QA 2X6AA 4TOIA 4UVAA 3CPWU 4J7ZA 1K73W 1E79G 3JASA 1YI2V 1Q43A 5JH7A 1LR1A 5AG2A 5C8YA 1DF5A 3CRCA 2QWOB 1DK1A 2R9AA 3L9DA 1BZKA 1M93A 3FB8C 3G4SV 3CCUV 4JZGA 2YIDA 1IBLB 2AHZA 2IU0A 3I56V 1IXBA 4DW1A 2QWNB 4NTWA 4F4LA 1IBKO 5LHHA 1BMFG 4E2LA 4CS3A 2OIEA 4TV8B 3K5OA 2X6BA 1HNXB 2JVDA 4J7KA 1JVMA 1X4TA 3ABLB 4X9QA 4AQYB 2UUBO 1BS3A 5LYJA 1R3JC 2X7RB 1XMOO 3CC2V 4DV7B 3BEHA 4UXNA 4I9QA 3OTOB 2BOCC 2JGDB 3ABKB 5CA0A 3CJHB 4WFGA 1JR9A 1VQPV 4QGPA 1K33A 1V55B 2Y0IA 4B3TB 2EBOA 4IHJB 4D7TA 4JI4O 5GW7A 1AI6A 1W59A 2XNDG 4QIWF 1QLEC 1PP9H 2HFEC 3U10A 2K9PA 1WA8A 3Q4HB 4TQFA 4J42A 1S76D 3SGIA 4DR5B 2KG7A 4L87A 2RCVA 3STZC 1HNZB 1FXVA 2KG7B 1H2SB 2FB5A 3CP1A 1QR8A 5A2QN 3ZRWB 2B9ZA 5KX5B 2BE3A 1K92A 4JGSA 4FPPA 1NTMH 3UT5B 2UUBB 3CSXA 1BL8A 3MHHC 2B5UA 3SJBC 2EIJB 1FFXB 1Q8IA 3BVOA 2QWPB 3A0RA 1MNGA 4NXMB 3FKSG 2ADPA 4LF8O 2FL4A 3JALB 1M5IA 3A8TA 3K3WA 1F23A 2A9HA 2EIKB 3D36A 4NXNO 1SA0B 2LGWA 2Y69C 1AI7A 1K97A 5L3DA 2UUCO 4I4TB 3VBBA 1O9HA 2EINC 2H8PC 4LWSA 4B3MB 2ZINA 3LNNA 2D3OW 5IT9N 1JMKC 4BR6A 2QSAA 4PDRA 2OWOA 3D3IA 3P30A 4LF4O 1VQ8V 2DWDC 4I50A 1U97A 1M57C 4DR2O 4ABMA 2JDIG 1LNQA 4X89A 3TJTA 2YXYA 3J81N 1H2GA 5LXTA 4LP8A 4FLTA 2ARHA 5KAFZ 4JI2B 3TK1A 3E8GA 1XMQO 4TUYB 1WB8A 4O4HB 3G80A 4JI4B 1H2NA 3HKEB 3BA9A 4MSWC 1YXBA 4PJ0Z 1AI5A 1M4UA 1EZJA 3N2KB 5CBHA 3CB2A 3T4ZA 2LW1A 1XNRB 2XAQA 4ZI7A 1L1FA 4BAYA 4MVSA 3CC7V 5DN6G 4CH6A 3ZMSA 3L73H 4CC5A 3QF7A 2QM8A 4X1KB 1NTZH 2R9IA 3E83A 3QVNA 5LA6B 3ASNB 2B1GA 2ZE5A 4TT3G 1CEZA 4WFFA 2YSUB 2WLIA 1N0JA 2IH1C 4H13B 1YJWV 3IFXA 2LGQA 4PDMA 1OCOC 3F5WC 1PM9A 4LFCO 1V54C 1R3IC 1TUBA 3AK2A 2WLLA 3OR6C 1GAXA 1JQ0A 1BCCH 3JAMN 1S5LZ 4R50A 1Z5VA 4ZOLA 5FPOA 4UFZA 1R3LC 2OYQA 3ASOB 5IYZB 3B4SA 1SZXA 3THOA 3T1CA 1IBMO 5FPRA 3ZS8C 1WP8A 1TA8A 3W7UA 1ZX3A 3U0ZA 1K3EA 4EKWA 1KP2A 4X62B 3K08A 4PDLA 4IHJA 1OZ0A 1MSDA 1S5JA 2FKXA 2HJDA 4LF9B 1DGSA 2Y48A 2E5LO 2ZXWB 2OT5A 1IX9A 5ITZA 2YI8A 2IU3A 2EJRA 5JVDA 1XI1A 1QLNA 3AG4B 1WPBA 4CBCA 3UQ8A 1XHZA 4WFAV 3CCEV 1BQ0A 4DK1A 1NJIW 3N2GB 4Q6GA 4JF3A 1KP3A 3JAKB 4K3AA 1B6QA 2ZE7A 3H1JH 4YJ2A 5IYCO 3OE7G 1K5QA 5IJ0B 2LJ2A 1M9NA 3N2KA 1G4YB 3AK1A 2LO1A 1HR0O 1V9PA 4MVQA 1YITV 1Q86W 1VQNV 4JAAA 3RVZA 4HBNA 3NR7A 2ZR3A 1B06A 3HKDB 1YDXA 3GWOA 4O4IA 4B3MO 2WLLB 1COWG 2QKCA 2QM4A 1VP7A 3BABA 4LNUB 1OCRC 4B3SO 4JTCB 2IJIA 5C8YB 1RSOA 2WLHA 3ZHRA 2Y69B 1QCEA 5KX5A 1F7YA 3X2QB 2GV9A 4DK0A 5IWAB 2IJHA 3IC7A 3HKCB 4GX0A 4DR4O 1EFRG 4OX9B 1Q3EA 2BTQB 1NQTA 3MDSA 3SJAC 3G67A 1FS0G 3H1KH 4UCSA 1Z5WA 1ZL8A 3JATA 1FJGB 4U3JB 1YEWA 5EBMC 1BGYH 1NI8A 5ITZB 2Q7EA 4LF7B 2O57A 3C90A 1XNRO 1ZSPA 1PV0A 2XTAA 4JYYA 1FFXA 2WAMA 3K5LA 3AG3C 4JI1O 4IL6Z 1SQVH 3N27A 3DXRA 1P84F 4JYAB 5BXZA 3FYEB 4DR6O 5DEDA 2XUMA 4FZ0A 2P90A 2MK3A 1WP7A 3X2QC 3OW2U 3APQA 2Y0PA 3CEIA 1BHAA 2E75B 1CXZB 4G28B 2UUAB 3HKCA 1WAZA 2XAGA 4TSFG 4CS2A 1FAFA 1MA1A 3BA8A 3RYCB 1TUEB 3ABTA 1J95A 4JI1B 3WB0A 3CRAA 4WFHA 1N33O 4KL1A 2CGOA 2HR3A 5BMVB 4HAMA 3FYIB 3L75H 3S3XA 1NR7A 2Y4UA 3CMAV 4JASA 2PI5A 1P4RA 2F43G 1YTFB 3U11A 1QR9A 2ZKOA 1N36B 1Q6IA 1DTOA 2A7WA 5LA6A 3GB7C 2UXCB 4FLZA 1OJHA 5EYPB 3JD0A 1QLEB 2QKSA 1Z2GA 5KMGB 4DV0B 4W4LA 5D5PA 1SQGA 3FAVA 1YJ9V 4PA3A 2EINB 1XMQB 4U7OA 4JYBA 4UCUA 1M56C 1SS3A 2QE7G 3OR7C 4JI3B 4B7EA 4GKKB 3NXSA 4FLVA 3CRRA 1XL6A 1MG1A 2UU9B 1P7GA 3HKEA 3GWKC 3P3PA 1HNZO 1K34A 4NXMO 5CB4B 3M7MX 2QDOA 5CB4A 5JCOA 3RYFA 2JJ1G 2UXBO 4GKKO 3HKDA 3OGIB 4O4IB 3B77A 3JASB 2HHHB 1S5HC 3K04A 4RQEA 2PI4A 1CP9A 4MTXA 3T4DA 4CH3A 2HG5C 1AJNA 2WLJA 4YJ3B 1EM1A 2EX3A 4LCUC 4DUZO 1THZA 2CTQA 1N36O 3KZIZ 3D36C 4DR5O 2LFSA 3FAVB 2Q5ZA 2BCCH 4KHPB 1TAEA 3SPGA 2UXBB 4WFEA 3DC6A 4DV1B 2ZCEA 2EULA 3OD4A 1R3KC 3F7VC 5EYPA 4JI8B 4DRXA 3QO7A 4J41A 4ZHQB 5L3EA 5LHIA 3OT7A 4X62O 3UO2A 1JX9A 2NNUA 5H6RA 3RYIA 2UXDO 4BIUA 2W0XA 5GTIZ 1UFIA 2A79B 4NVPA 4OPAA 3CCVV 2ZT9B 4LF8B 2ZXWC 5CA0B 4PHZA 1OCOB 5B3SC 4X1KA 3SYQA 1D5AA 2NN4A 1XOUA 3JAWA 1PKXA 2R70A 1K4DC 1JA8A 1FJGO 5LGTA 3K9AA 1SF9A 3FB7C 5CN0A 2VS0A 2XAJA 3ABMB 5IYBO 3G71V 4OPHA 2BOBC 1NU1H 3ZHUA 5H2FZ 2LW7A 1VQKV 1I94O 3Q4HA 4CC6A 1OV9A 2YEVA 4L8JA 3AG1B 4MVMA 5KAIZ 3QNEA 2ZM6B 3I5DA 1L8DA 4KP4A 3SPJA 2VRZA 1QVFU 1V55C 1XMOB 1FXKB 1H2LA 3APOA 1FKAO 3ABLC 1R1BA 1XDCA 3KG2A 1NBMG 2DE0X 3RW0A 3LNMB 5LOVA 3OMNB 2HHHO 4QPJA 3JATB 4BWAA 3HB3B 5IJ0A 2N04A 4RQFA 1Y76A 3ZX6A 3OEEG 1S72V 5E79Z 4CS4A 4I0XA 5GTHZ 5JJNB 4I4TA 1Y76B 1OCRB 2P5OA 4DR6B 1SQXH 2DWEC 3AK3A 3H1HH 1YF2A 4DR1O 4DV4O 5L3BA 1ZAUA 4EB6A 2X6CA 3LSUA 4JI0O 1MSWD 1Q7YW 2DQ0A 4LFAB 1GH6A 5A9GA 1GN4A 1AVMA 3OGCC 4RAIA 4FK5C 4QE7A 1S3JA 4JI5O 2H3OA 4JAUA 1IZ3A 2DYSC 2EIJC 2Q0AA 1GM8A 3LSQA 4GX1A 4RUFA 3CHXA 1VQ4V 4UVCA 3H1LH 1L0LH 4ZOLB 4EEQA 3K0DA 1LUWA 1VF6A 2AW9A 4GZRB 4N21A 2VQFB 3HKBA 4QPKA 3H01A 2ZE6A 3AG1C 5CA3A 1I5YA 4X65O 2F4VB 3OUSA 1VF5B 4B3RO 3ZRVA 3EHBB 1F4MA 3AG4C 3OMIB 4GT1A 5J2UA 2ITCC 4BW5A 2Q67A 3ICXA 4LF5B 3KCYA 2ZE8A 1EZVH 4H44B 4FZ1A 4MS2A 2VWKA 4DR1B 4DV5O 4JZ2A 5BMVA 1NKDA 1YCIA 5L3GA 3EXAA 4GYCB 4MTFA 2PGGA 3L70H 4XDJA 4UCRA 2F23A 5EZYB 3RVYA 4EB6B 4LC1A 5B1OA 1W0KG 2JEXA 4WFBV 4J9ZB 4DR3O 3E8HA 3DGEA 1BSMA 5JH7B 1SQFA 1BE3H 5LGNA 2RN9A 3B8MA 3ETQA 1PPJH 2CK3G 4X88A 2UXDB 3BY6A 2W6IG 4H33A 1TVKA 1UJWB 1QNMA 5LMNO 1JCHA 4B08A 1UPGA 1VF6C 4NR1A 4YJ2B 4RO2A 4FM1A 4I0XB 2AXTZ 4JI7O 2Q73A 2YS8A 3JAWB 3JCZA 4YIOA 3K58A 2JEUA 2C2AA 3E89A 4X20B 3K9SA 2UXNA 4DR3B 1PNLA 3K5NA 3RYIB 3JD1A 1I5XA 1SC5B 2JJ2G 3P3NA 3JSNA 2KKWA 4A5UB 5JJEB 2ZD9A 1I94B 4ASUG 2V4DA 3IJ4A 1XL4A 2YICA 1JOYA 3ABKC 4I55A 2CE4A 1OCZC 3TCUA 2QTOA 2BTQA 1GTOA 4DV6B 2YEVB 3CRQA 3K5MA 2PYLA 5FNVA 5H5NA 4GKJO 5B1AC 3I55V 4JI8O 4YJ3A 2E3CA 3CYOA 2M6YA 2LQTA 2JRIA 3CCSV 4FJCC 5EC1C 4N23A 3KKYA 1G8MA 3CX5F 4UCVA 4K8ZA 4K0KO 3RYFB 1NTKH
chains in the Genus database with same CATH topology
2Q69A 1PNMA 3MD0A 5LBQA 5IDJA 1FFTB 2DQ3A 4LBEC 4RUEA 4JTDB 2XASA 3ZCCA 3K06A 1JPXA 3VOUA 3G6EV 3FYEB 3K79A 1OCCB 2Q6AA 4JTAB 5L3FA 2P90A 2MK3A 4YXWG 3X2QC 1KKDA 1RPOA 4P9PA 3OW2U 1SRYA 1BHAA 5EC2C 4G28B 1VQOV 1F51A 2XAGA 4TSFG 1TUEB 2EZOA 2ITDC 3ABUA 1WLEA 3ABTA 1SERA 1J95A 1ZWIC 3SYPA 1GK9A 2GHYA 4MT8A 1IXMA 2M7WA 4WFHA 2X6AA 4UVAA 2NLJC 3CPWU 1K73W 1E79G 3E35A 2HR3A 1YI2V 2WWWA 4HAMA 1SZTA 3FYIB 4JYCA 1DF5A 1M90W 3EFFK 1NR7A 4PA9A 3CMAV 3CCLV 1R73A 4JASA 4HZ3A 2PI5A 1P4RA 2F43G 1YIJV 1YTFB 3FB8C 3G4SV 3CCUV 3DTUB 1QR9A 4TWKA 4QNHB 5CBGA 4I9WA 2AHZA 1VQLV 2IU0A 3I56V 1M57B 4F4LA 4MVRA 1DTOA 5LHHA 2ZDIC 3GB7C 4PELA 1BMFG 4E2LA 1RM1B 5KUKA 3JD0A 1QLEB 1KQSU 2QKSA 4QJFB 5FL7G 2X6BA 4MVUA 1OCZB 1QBZA 4GX2A 4JAVA 1JVMA 2WLMA 3ABLB 3K0GA 5IY5B 1YJ9V 4PA3A 2EINB 1FXHA 4U7OA 1R3JC 2X7RB 4JYBA 1M56C 2QE7G 3OR7C 1VQMV 1AR1B 3CC2V 5H6QA 3NXSA 3R65A 3BEHA 2EIMC 3ETDA 4UXNA 1XL6A 1YTFD 1MG1A 1ROPA 1V54B 2BOCC 3ABKB 3TETA 2EILB 4WFGA 1K34A 3OFNG 3SYAA 1VQPV 3CCRV 2X0LA 3JYCA 1K33A 2WLIB 1V55B 4KFMA 5BZBA 5KA6A 1NR1A 1GO3F 2JJ1G 2EBOA 5GW7A 1K7DA 2EZPA 4ZBMA 1AI6A 2XNDG 4QIWF 1QLEC 3B77A 1FXKA 1S5HC 2HFEC 4P9OA 3K04A 2IJJA 4RQEA 2PI4A 3E8BA 1PL0A 1CP9A 4MTXA 5B1AB 3T4DA 2HG5C 2R9RB 4MVOA 1AJNA 5B1BC 5H9CA 3AG2B 1RM1C 5C93A 2WLJA 2ZQMA 5CMUA 1S76D 4LCUC 4L87A 1THZA 2P67A 2IJKA 3JD4A 3STZC 2WSSG 3SPIA 1WPXA 1FXVA 3ZRWA 5B3SB 2LFSA 3CCMV 1RPRA 3ETEA 1PNKA 3CP1A 1QR8A 3AG3B 3ZRWB 3SPGA 4WFEA 2JK5C 2HJFC 1R3KC 3F7VC 3ZN0A 2EIKC 4BIZA 3QO7A 1R6NA 5L3EA 4DO2A 1K92A 4JGSA 5HFMA 4FPPA 5LHIA 4GX5A 1Y66A 2HLDG 4UUJC 1JX9A 2NNUA 5H6RA 1BL8A 3MHHC 3ZMTA 2B5UA 4QE9A 2EIJB 4PA6A 4BIUA 3W7XA 2WLNA 3IGAC 2A79B 4R8CA 1ORQC 3QO8A 4XDLA 1CPYA 1YSCA 3A0RA 4PA7A 3CCVV 3FKSG 2ZXWC 1GM7A 3CMEV 1OCOB 2WLKA 3K3WA 1F4NA 5B3SC 1VQ7V 1QVGU 1F23A 2A9HA 2EIKB 4I5SA 3D36A 4UV9A 3SYQA 2Y69C 1AJQA 3PJSK 1AI7A 2Q68A 1GMGA 1K97A 1PKXA 5L3DA 1K4DC 3VBBA 5LGTA 3K9AA 1K5SA 2EINC 2H8PC 1OHHG 4OXSA 3FB7C 5EBWC 5EK0A 5CN0A 3G71V 2XAJA 3ABMB 5IYBO 3OM3B 2D3OW 2W0FC 2BOBC 4PDRA 1FXKC 3D3IA 3P30A 2Z3YA 3W7TA 1VQ8V 3QO5A 1VQKV 2DWDC 4PA4A 3UKMA 2QA4V 1M57C 2YEVA 2JDIG 1LNQA 4X89A 1HWYA 3AG1B 4KUMA 4MVMA 4PDVA 3ZRXA 3QNEA 1H2GA 5B1NA 4KP4A 2V1DA 1H8HG 1BHBA 4R7CA 3SPJA 1QVFU 4LP8A 1V55C 1ENVA 4UV8A 4UVBA 1FXKB 2OTJV 3TK1A 3E8GA 1NH2B 3ABLC 2W6JG 3E86A 3KG2A 1NBMG 1YHQV 3RW0A 1M56B 2IH3C 1W2BU 3LNMB 3OMNB 3WFVA 4MSWC 4QPJA 3ZMUA 2DYRB 1AI5A 3HB3B 2XAFA 2DW4A 3ETGA 1EZJA 4RQFA 5CBHA 3T4ZA 1GKFA 3CD6V 3OEEG 1S72V 2XAQA 1K9MW 1L1FA 4BAYA 2Z5UA 4MVSA 1NVPB 2V7QG 1SETA 3M99B 1OCRB 3CC7V 5DN6G 3ZMSA 2GSMB 4ZKIA 1VQ5V 2QM8A 3W7SA 2DYSB 1Y4MA 4Q20A 2DWEC 1PD3A 3WG7B 2R9IA 3E83A 1KECA 2OCCC 3ASNB 2B1GA 4G2KA 5EBLC 5L3BA 1P7BA 5J9PC 1KD1W 1DF4A 2ZDIA 4TT3G 1H38A 1CEZA 4WFFA 2XAHA 2X6CA 2YSUB 2WLIA 2KB1A 1MSWD 1Q7YW 4R6ZA 2IH1C 1S0VA 5KUMA 1YJWV 2DQ0A 2K1EA 3IFXA 4PDMA 1VQ9V 1OCOC 3F5WC 3LDEA 2UXXA 1M1KW 3ASNC 3AEIA 3OGCC 3LDCA 4FK5C 4RAIA 1AI4A 1V54C 3HPLC 4QE7A 1JJ2U 1S3JA 2XOKG 1R3IC 5KA5A 1VQ6V 2WLLA 4JPRA 4JAUA 2DYSC 3OR6C 1JQ0A 4WCEV 2EIJC 5B1BB 4R50A 3ZIAG 1GM8A 3LSQA 4GX1A 4RUFA 1GM9A 1VQ4V 4XBFA 4UVCA 1R3LC 3ASOB 3CXCU 2FTKA 3K0DA 4N21A 1SESA 3T1CA 5L3CA 2B1IA 3W7WA 4QPKA 2OCCB 1AJPA 3H01A 2OTLV 3F7YC 4XDKA 3WG7C 3AG1C 1E1QG 1I5YA 5CA3A 4FIPC 3W7UA 3OUSA 5IYDO 1K3EA 3ZRVA 4EKWA 2EILC 2P7TC 3EHBB 4J9YB 1KP2A 1F4MA 3K08A 3AG4C 3OMIB 4GT1A 4PDLA 2ITCC 1AROP 4BW5A 2Q67A 3FB6C 1OZ0A 4H37A 1N8RW 3ASOC 4X8AA 3LSSA 3CCQV 3LDDA 2LP7A 5DM6V 1R6KA 2Y48A 4MW8A 2QEXV 4MS2A 2ZXWB 2OT5A 2DYRC 2IU3A 2EJRA 1NKDA 5L3GA 4DXWA 1QLNA 4MTFA 4XDJA 3AG4B 3ZRSA 3E2EA 4CBCA 3OAAG 5E1AC 3RVYA 4LC1A 1KC8W 3AG2C 2LFRA 5B1OA 1W0KG 2JEXA 4WFBV 3T2MA 4J9ZB 4WFAV 3CCEV 3E8HA 3DGEA 3JD2A 1NJIW 5CBFA 4JF3A 1S77D 1KP3A 1B6QA 5LGNA 3B8MA 4GCZA 2CK3G 3SJQC 4X88A 5IYCO 3BY6A 3OE7G 3P32A 2W6IG 4H33A 3ZN1A 1K5QA 1H8EG 2EIMB 1UJWB 1M9NA 1JCHA 1G4YB 2H94A 3MHSC 3ZMVA 4RO2A 3SPCA 1DLBA 1Q86W 4MVQA 3ZJZA 3SPHA 1YITV 1VQNV 1NH2D 3RVZA 3K03A 2HVKC 4MTGA 4FMTA 2ZR3A 3E8FA 4P30A 3SYCA 1Q81W 3JCZA 3CCJV 3STLC 3B8NA 3GWOA 2JEUA 1MABG 2C2AA 2QM7A 3ABMC 3E89A 2WLLB 3RBZA 2AHYA 3UM7A 1COWG 4MTOA 2HKOA 2UXNA 2ZR2A 1PNLA 1OCRC 3JD1A 1I5XA 4JTCB 2IJIA 2JJ2G 2WLHA 2Y69B 1QCEA 5LGUA 1EBOA 4CZZA 1OCCC 2JIZG 2ZD9A 1K8AW 3OUFA 3X2QB 5LHGA 4ASUG 3LUTB 1XL4A 2IJHA 3IC7A 1Q82W 1E1RG 3FB5C 4GX0A 1JOYA 1EFRG 3ABKC 3OMAB 1NVPD 5IY5C 1NQTA 3ZMZA 1OCZC 3TCUA 2QTOA 4Z1MG 1W0JG 1GTOA 2YEVB 4U7NA 1MOFA 3ML0A 4WF9V 2A0LA 5B1AC 3OEHG 5HFLA 1FS0G 3I55V 3SYOA 3CYOA 5EBMC 4MVZA 3JD3A 4G27B 3CC4V 3CCSV 4FJCC 5EC1C 2P6JA 4P2ZA 4N23A 2WPDG 4MW3A 1G8MA 1K4CC 1YJNV 2ATKC 2WAMA 4HYOA 2HVJC 2IW5A 3AG3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MD0 A;  3ZRW B;  5IDJ A;  4QPK A;  4ZKI A;  2QM8 A;  4Q20 A;  3ZCC A;  4MT8 A;  1IXM A;  4I5S A;  4QPJ A;  3D36 A;  4BIZ A;  4JAU A;  4MTX A;  4FMT A;  3ZRX A;  4FPP A;  3ZRV A;  2WWW A;  5B1N A;  4LC1 A;  4KP4 A;  4JYC A;  2LFR A;  5B1O A;  4GT1 A;  5C93 A;  1JOY A;  4JAV A;  4BIU A;  3DGE A;  2C2A A;  2QM7 A;  4U7O A;  3TK1 A;  2P67 A;  4JAS A;  4JYB A;  1F51 A;  3A0R A;  4GCZ A;  3ZRW A;  2LFS A;  2FTK A;  3P32 A;  3NXS A;  4U7N A; 
#chains in the Genus database with same CATH topology
 2Q69 A;  5KHH A;  2P4V A;  5IDJ A;  2E74 B;  3ZCC A;  3CWB H;  4FFK A;  1JPX A;  3VOU A;  3G6E V;  3K79 A;  4IIJ B;  1X59 A;  4YXW G;  1KKD A;  1SRY A;  4TQD A;  4EFB A;  1AIL A;  4LF6 O;  4JI6 O;  5EC2 C;  1VQO V;  4UB6 Z;  2P4K A;  1F51 A;  1IUR A;  1Q6H A;  3ABU A;  5EZY A;  1WLE A;  1BT8 A;  1RP3 B;  3SYP A;  1GK9 A;  4DV3 B;  1N33 B;  2NLJ C;  2QR4 A;  2YC0 A;  3E35 A;  4AI8 A;  1NT2 B;  1SZT A;  5JJJ B;  5JCO C;  1BQZ A;  2RNB A;  4JYC A;  3EFF K;  1R73 A;  1FPO A;  4HZ3 A;  3L74 H;  1YIJ V;  5LP6 A;  2KSD A;  3VQW A;  4I9W A;  3BAA A;  4MVR A;  4PEL A;  2NR5 A;  2YI9 A;  1RM1 B;  1SQQ H;  5KUK A;  2GTS A;  2AGA A;  4QJF B;  3SR2 C;  4AIL C;  4MVU A;  3ZBH A;  1QBZ A;  4GX2 A;  3K0G A;  2WLM A;  5IY5 B;  3QG5 A;  2IM9 A;  3ETD A;  5IYZ A;  4LF5 O;  1V54 B;  3JAK A;  4JV5 B;  3TET A;  4C7U A;  2G38 A;  3IC9 A;  3OFN G;  3SYA A;  3CCR V;  1YVW A;  5BR8 B;  3JYC A;  2WLI B;  1NR1 A;  1AP5 A;  2N05 A;  1KKC A;  1HNW O;  1KMI Z;  3A0H Z;  4ZBM A;  2F93 B;  3FD9 A;  4P9O A;  1HR0 B;  2KQX A;  4MVO A;  1Q5O A;  4YHH B;  5H9C A;  3TXS A;  2PZS A;  4HNA A;  1RM1 C;  5C93 A;  1ZL8 B;  2FYU H;  2ZQM A;  5J2T B;  4TV9 B;  1NZ6 A;  2IJK A;  3JD4 A;  1WPX A;  5B3S B;  2P22 C;  1D2D A;  1AR4 A;  1RPR A;  3ETE A;  3ZHQ A;  2JK5 C;  4OGQ B;  4O2B A;  2HJF C;  4BIZ A;  1R6N A;  4DO2 A;  5TIS Z;  4GX5 A;  1GN3 A;  5GON B;  4QE9 A;  4PA6 A;  2WLN A;  3R66 A;  4LF9 O;  4XDL A;  4DUZ B;  4PA7 A;  1GM7 A;  3CME V;  2WLK A;  1VQ7 V;  2UXC O;  1QVG U;  4I5S A;  4UV9 A;  3O65 A;  2L6L A;  5LXT B;  2QWQ B;  4OXS A;  4DV4 B;  1OHH G;  5EBW C;  1URF A;  2GBO A;  4X64 O;  5FNV B;  2RDC A;  2DMX A;  4X1I A;  5CA1 A;  3W7T A;  2DOS A;  3HKB B;  2WA3 A;  3QO5 A;  4E4E A;  4PA4 A;  4FFB A;  2PY5 A;  1SA0 A;  4PDV A;  4JYA O;  3ZRX A;  4IT5 A;  1BHB A;  4R7C A;  1GRJ A;  3MAQ A;  4UV8 A;  3RFR A;  1XBL A;  2OTJ V;  5LOV B;  1NH2 B;  1Y6X A;  2W6J G;  4RWU A;  1YZB A;  5LMN B;  3BFR A;  4WBN A;  1M56 B;  1W2B U;  4ZHQ A;  4FLW A;  1QU7 A;  4DR7 B;  4IYH A;  2XAF A;  3T1H B;  2CGN A;  3SJC C;  1GKF A;  3WB1 A;  2OIG A;  3B09 A;  1P49 A;  1WJZ A;  3BPZ A;  2V7Q G;  2JS5 A;  3M99 B;  4DV2 B;  3IAY A;  1J5E B;  4JI3 O;  2GSM B;  4ZKI A;  1VQ5 V;  4J7J A;  1Y4M A;  1PD3 A;  3WG7 B;  4O4L A;  1KEC A;  2OCC C;  3RWR D;  5IJ9 B;  3D3Q A;  1P7B A;  3K59 A;  1KD1 W;  1DF4 A;  1XQ8 A;  5KMG A;  2ZDI A;  1MZF A;  1H38 A;  2XAH A;  3DXR B;  2KB1 A;  3BHP A;  4LFA O;  2A06 H;  3JAL A;  3J80 N;  2YIA A;  3ASN C;  3AEI A;  1NVP B;  1JJ2 U;  4W4K A;  4UCT A;  2XOK G;  5KA5 A;  1VQ6 V;  2HP8 A;  4O4J B;  3EVK A;  4WCE V;  2DN9 A;  3L72 H;  4O2B B;  5B1B B;  3ZIA G;  3CJH A;  1JJO A;  5KHI A;  4O2A A;  2YXL A;  4JI7 B;  3UT5 A;  4XBF A;  3KCX A;  3CXC U;  2FTK A;  1N34 O;  4O2A B;  4HNA B;  4KHP O;  2B1I A;  3VQX A;  5FLX N;  2OCC B;  5JVD B;  3ZED A;  5DEC A;  3WG7 C;  2AZ2 A;  4PI2 A;  4FIP C;  4CH4 A;  5IYD O;  2CUG A;  2EIL C;  4J9Y B;  2VQE B;  1XNQ O;  1N0N A;  2YDE A;  1ARO P;  3BCC H;  3T1Y B;  4X64 B;  1AP6 A;  3ASO C;  3LSS A;  5DM6 V;  1R6K A;  3HR0 A;  2ADQ B;  4PI0 A;  1XRE A;  4DR7 O;  4DXW A;  4NXN B;  3C3S A;  2RJZ A;  3OAA G;  5E1A C;  3AG2 C;  1QQC A;  2LFR A;  2QJ1 A;  3JD2 A;  5CBF A;  2PTM A;  4X1Y A;  3SJQ C;  3FFQ A;  3P32 A;  4GKJ B;  3ZN1 A;  2XHB A;  1ZTE A;  1H8E G;  2EIM B;  2PUS A;  1QHT A;  5B5E Z;  2CDY A;  2H94 A;  3MHS C;  3OTO O;  3ZMV A;  3SPH A;  1NH2 D;  3K03 A;  4MTG A;  2ZNI A;  1Q81 W;  3CCJ V;  3STL C;  3K57 A;  2Q7H A;  1B04 A;  1D5N A;  2CH7 A;  1Q90 D;  2AHY A;  3UM7 A;  4JI2 O;  1A32 A;  4X20 A;  4DYL A;  1EBO A;  4CZZ A;  3AG7 A;  2JIZ G;  4BW9 A;  4FFB B;  2QKA A;  3RT3 C;  4I7Z B;  3LUT B;  3CS5 A;  2ZM6 O;  1Q82 W;  1E1R G;  3FB5 C;  4NKG B;  1NVP D;  2JS3 A;  5IJ9 A;  5IY5 C;  5BR8 O;  4TV9 A;  4Z1M G;  1W0J G;  4H0L B;  4U7N A;  1MOF A;  1O9G A;  1WNS A;  3N2G A;  3SYO A;  4MVZ A;  4LR3 A;  4G27 B;  4D7S A;  3D8C A;  2P6J A;  2GDS A;  4P2Z A;  5LP6 C;  1EN6 A;  2Z0A A;  1YJN V;  2ATK C;  4HYO A;  2HVJ C;  2F95 B;  3B2E E;  4DV5 B;  5K1P A;  1FFT B;  4RUE A;  3BRC A;  3K06 A;  5J2U B;  3E22 B;  4LFC B;  4DV0 O;  1OCC B;  2Q6A A;  4JTA B;  2BSK A;  2R72 A;  1Y74 B;  3RYH B;  1L0N H;  2N74 A;  1G6U A;  4JI6 B;  3JAR A;  2WA4 A;  2RMK B;  1H2M A;  1XIL A;  2FML A;  1SER A;  5CA1 B;  3T1H O;  2GHY A;  4MT8 A;  2YXH A;  2M7W A;  2ETN A;  4DV3 O;  3M8A A;  2CTP A;  2MW2 B;  4GUN A;  2WWW A;  1T5E A;  1LUV A;  4D6T H;  2ZIM A;  1I08 A;  2OCH A;  2PYJ A;  1M90 W;  4PA9 A;  3CCL V;  3B40 A;  4PD4 F;  1FYJ A;  5KHJ A;  1IDS A;  2E5L B;  1TGO A;  3DTU B;  4TWK A;  4QNH B;  5LMU B;  4JV5 O;  5CBG A;  4J11 A;  1VQL V;  4J10 A;  3L71 H;  1M57 B;  2ZDI C;  4Z2W A;  2EJ7 A;  1KQS U;  4DR2 B;  4DR4 B;  5FL7 G;  2VQE O;  1OCZ B;  3CXH F;  1IVS A;  4GLX A;  4JAV A;  1HW7 A;  2F1M A;  1FXH A;  1VF7 A;  1VEW A;  1N32 O;  1VQM V;  1AR1 B;  4LFB O;  3FX7 A;  5H6Q A;  3R65 A;  4DV2 O;  1SKV A;  4B7K A;  5JQG A;  3PN1 A;  2AZ0 A;  2EIM C;  4DUY B;  1YTF D;  1ROP A;  4NYK A;  3F5T A;  3RYH A;  3UO3 A;  4ZI7 B;  2YIB A;  1WB7 A;  2EIL B;  1EN5 A;  4Z1V A;  4DV6 O;  1R6T A;  4JI0 B;  3S3W A;  4UB8 Z;  2X0L A;  4KFM A;  5BZB A;  5KA6 A;  2A3Q A;  4FM0 A;  3G6B A;  1GO3 F;  3DC5 A;  4LFB B;  1RSO B;  1K7D A;  2EZP A;  2Q0O C;  1N32 B;  3WU2 Z;  2RQ6 A;  1FXK A;  2DJV A;  1GN6 A;  1VMG A;  2IJJ A;  4JI5 B;  3E8B A;  1PL0 A;  4NTX A;  5B1A B;  2JGU A;  2R9R B;  5B1B C;  3AG2 B;  5F2V O;  3O9O A;  4K0K B;  2P06 A;  2YIB D;  5CMU A;  2ZIO A;  1KYO F;  2P67 A;  4F6R A;  2WSS G;  3SPI A;  4AQY O;  3ZRW A;  3CCM V;  1PNK A;  3AG3 B;  3J7A U;  1EN4 A;  1IBM B;  3E22 A;  3ZN0 A;  2EIK C;  1Y66 A;  3DSQ A;  2HLD G;  4UUJ C;  1PL4 A;  3ZMT A;  1TUB B;  2Q4P A;  3W7X A;  3IGA C;  4R8C A;  5BY1 A;  3UCS C;  1ORQ C;  3QO8 A;  1CPY A;  1YSC A;  4DUY O;  5B66 Z;  1MMM A;  1F4N A;  1HP8 A;  4NTY A;  3ZHS A;  3WB2 A;  4J80 A;  1AJQ A;  3PJS K;  1ZLZ A;  2Q68 A;  1GMG A;  2D2C B;  2UUC B;  1I7F A;  1K5S A;  3H9V A;  5EK0 A;  3OM3 B;  1ZUQ A;  2W0F C;  4LF6 B;  1KU9 A;  1FXK C;  4I55 B;  5LMU O;  2Z3Y A;  5LL6 Y;  3UKM A;  2QA4 V;  3C3T A;  1HWY A;  1NS1 A;  2HEP A;  4KUM A;  4LH7 A;  4DV1 O;  1IBK B;  2L35 A;  3ZHT A;  5B1N A;  2V1D A;  1H8H G;  4O4J A;  4UVB A;  1ENV A;  1I0H A;  3QTC A;  5KHG A;  2QWR B;  3E86 A;  4K8X A;  1HNW B;  4LNU A;  4ZIB A;  4DV7 O;  1YHQ V;  4TUY A;  5D5Q A;  2QTS A;  2IH3 C;  3WFV A;  1WN7 A;  3ZMU A;  3GVM A;  2DYR B;  2DW4 A;  3ETG A;  5IWA O;  4EFE A;  3CD6 V;  4ICG A;  5IE9 A;  3RYC A;  3JCU Z;  1K9M W;  2Y4T A;  4F6R B;  1GN2 A;  1SET A;  1G1X B;  4LH6 A;  3W7S A;  2DYS B;  4Q20 A;  2F4V O;  1FD9 A;  3JAR B;  2UU9 O;  5LYJ B;  4G2K A;  4LF7 O;  5EBL C;  5J9P C;  1KB9 F;  1N4C A;  4TV8 A;  1XHX A;  4YY3 B;  4R6Z A;  1S0V A;  5KUM A;  2K1E A;  1VQ9 V;  1VAR A;  2ILM A;  1U96 A;  4B3S B;  2QGN A;  3LDE A;  2UXX A;  2CAZ C;  1Q6U A;  5HFM A;  1M1K W;  3LDC A;  1AI4 A;  3HPL C;  4O4H A;  2CH7 B;  4K35 A;  5KLV H;  2CTR A;  4CH5 A;  4FVM A;  4JPR A;  2Q8V A;  4X66 B;  1VIB A;  1AR5 A;  1GM9 A;  1H2K A;  3RN4 A;  4FLU A;  4OX9 O;  4IYI A;  4X1I B;  1N34 B;  1SES A;  1IBL O;  5L3C A;  3VQY A;  3W7W A;  1AJP A;  2OTL V;  3F7Y C;  4XDK A;  2XT9 A;  1E1Q G;  4X65 B;  4F6E A;  1HNX O;  2ZNJ A;  4LWS B;  2P7T C;  3TGU H;  1WA8 B;  3FB6 C;  2VWJ A;  4H37 A;  1N8R W;  4X8A A;  5K1X A;  1Y67 A;  3CCQ V;  3LDD A;  2LP7 A;  2BTO A;  4MW8 A;  2QEX V;  5GON A;  4WBN B;  2DYR C;  2CTW A;  4O4L B;  5JWP A;  1AB3 A;  3ZRS A;  3E2E A;  2IBZ H;  1KC8 W;  4U3J A;  3T2M A;  1XNQ B;  1S77 D;  1XEQ A;  4GCZ A;  3CE2 A;  3A2F A;  5J2T A;  4X66 O;  3ZHV A;  4X1Y B;  3SPC A;  4FLX A;  1DLB A;  1JFF A;  3ZJZ A;  2HVK C;  4FMT A;  5LP6 B;  4FLY A;  3E8F A;  4P30 A;  3SYC A;  4BIO A;  2F66 C;  3A0B Z;  3B8N A;  4YIP A;  2ODM A;  1MAB G;  2QM7 A;  3ABM C;  4IIJ A;  1MZE A;  2YUA A;  3RBZ A;  4MTO A;  2HKO A;  1KBH A;  2ZR2 A;  2E76 B;  5LGU A;  4DRX B;  1OCC C;  2Q9L A;  1K8A W;  3OUF A;  5JQG B;  4UCO A;  5LHG A;  4PV1 B;  4YHH O;  3OMA B;  2GTA A;  4YY3 O;  2JGD A;  3ZMZ A;  5EIB D;  4I50 B;  4IGG A;  1J5E O;  3ML0 A;  4WF9 V;  2A0L A;  3JSL A;  4U3F H;  4B3R B;  3OEH G;  5HFL A;  3RGB A;  3OTF A;  1HDJ A;  2GUZ B;  4FM2 A;  3JD3 A;  3CC4 V;  5EIB C;  2PF4 E;  1KUQ A;  2WPD G;  4MW3 A;  1K4C C;  4NB5 A;  4AHC A;  4LF4 B;  2IW5 A;  4B3T O;  2Z5U A;  3MD0 A;  1PNM A;  5LBQ A;  2DQ3 A;  1XUQ A;  4LBE C;  1JFF B;  4JTD B;  2XAS A;  5KHK A;  3T1Y O;  1SQB H;  2GUZ A;  5L3F A;  3VQV A;  3CRM A;  3SDL A;  1RPO A;  4P9P A;  2UUA O;  4KXR A;  1RFY A;  1Y74 A;  2Q7G A;  3H1I H;  4DW0 A;  3TXQ A;  2BSK B;  2VQF O;  2ITD C;  2EZO A;  1TVK B;  1ZWI C;  1SQP H;  1US6 A;  1IXM A;  1B3Q A;  2X6A A;  4TOI A;  4UVA A;  3CPW U;  4J7Z A;  1K73 W;  1E79 G;  3JAS A;  1YI2 V;  1Q43 A;  5JH7 A;  1LR1 A;  5AG2 A;  5C8Y A;  1DF5 A;  3CRC A;  2QWO B;  1DK1 A;  2R9A A;  3L9D A;  1BZK A;  1M93 A;  3FB8 C;  3G4S V;  3CCU V;  4JZG A;  2YID A;  1IBL B;  2AHZ A;  2IU0 A;  3I56 V;  1IXB A;  4DW1 A;  2QWN B;  4NTW A;  4F4L A;  1IBK O;  5LHH A;  1BMF G;  4E2L A;  4CS3 A;  2OIE A;  4TV8 B;  3K5O A;  2X6B A;  1HNX B;  2JVD A;  4J7K A;  1JVM A;  1X4T A;  3ABL B;  4X9Q A;  4AQY B;  2UUB O;  1BS3 A;  5LYJ A;  1R3J C;  2X7R B;  1XMO O;  3CC2 V;  4DV7 B;  3BEH A;  4UXN A;  4I9Q A;  3OTO B;  2BOC C;  2JGD B;  3ABK B;  5CA0 A;  3CJH B;  4WFG A;  1JR9 A;  1VQP V;  4QGP A;  1K33 A;  1V55 B;  2Y0I A;  4B3T B;  2EBO A;  4IHJ B;  4D7T A;  4JI4 O;  5GW7 A;  1AI6 A;  1W59 A;  2XND G;  4QIW F;  1QLE C;  1PP9 H;  2HFE C;  3U10 A;  2K9P A;  1WA8 A;  3Q4H B;  4TQF A;  4J42 A;  1S76 D;  3SGI A;  4DR5 B;  2KG7 A;  4L87 A;  2RCV A;  3STZ C;  1HNZ B;  1FXV A;  2KG7 B;  1H2S B;  2FB5 A;  3CP1 A;  1QR8 A;  5A2Q N;  3ZRW B;  2B9Z A;  5KX5 B;  2BE3 A;  1K92 A;  4JGS A;  4FPP A;  1NTM H;  3UT5 B;  2UUB B;  3CSX A;  1BL8 A;  3MHH C;  2B5U A;  3SJB C;  2EIJ B;  1FFX B;  1Q8I A;  3BVO A;  2QWP B;  3A0R A;  1MNG A;  4NXM B;  3FKS G;  2ADP A;  4LF8 O;  2FL4 A;  3JAL B;  1M5I A;  3A8T A;  3K3W A;  1F23 A;  2A9H A;  2EIK B;  3D36 A;  4NXN O;  1SA0 B;  2LGW A;  2Y69 C;  1AI7 A;  1K97 A;  5L3D A;  2UUC O;  4I4T B;  3VBB A;  1O9H A;  2EIN C;  2H8P C;  4LWS A;  4B3M B;  2ZIN A;  3LNN A;  2D3O W;  5IT9 N;  1JMK C;  4BR6 A;  2QSA A;  4PDR A;  2OWO A;  3D3I A;  3P30 A;  4LF4 O;  1VQ8 V;  2DWD C;  4I50 A;  1U97 A;  1M57 C;  4DR2 O;  4ABM A;  2JDI G;  1LNQ A;  4X89 A;  3TJT A;  2YXY A;  3J81 N;  1H2G A;  5LXT A;  4LP8 A;  4FLT A;  2ARH A;  5KAF Z;  4JI2 B;  3TK1 A;  3E8G A;  1XMQ O;  4TUY B;  1WB8 A;  4O4H B;  3G80 A;  4JI4 B;  1H2N A;  3HKE B;  3BA9 A;  4MSW C;  1YXB A;  4PJ0 Z;  1AI5 A;  1M4U A;  1EZJ A;  3N2K B;  5CBH A;  3CB2 A;  3T4Z A;  2LW1 A;  1XNR B;  2XAQ A;  4ZI7 A;  1L1F A;  4BAY A;  4MVS A;  3CC7 V;  5DN6 G;  4CH6 A;  3ZMS A;  3L73 H;  4CC5 A;  3QF7 A;  2QM8 A;  4X1K B;  1NTZ H;  2R9I A;  3E83 A;  3QVN A;  5LA6 B;  3ASN B;  2B1G A;  2ZE5 A;  4TT3 G;  1CEZ A;  4WFF A;  2YSU B;  2WLI A;  1N0J A;  2IH1 C;  4H13 B;  1YJW V;  3IFX A;  2LGQ A;  4PDM A;  1OCO C;  3F5W C;  1PM9 A;  4LFC O;  1V54 C;  1R3I C;  1TUB A;  3AK2 A;  2WLL A;  3OR6 C;  1GAX A;  1JQ0 A;  1BCC H;  3JAM N;  1S5L Z;  4R50 A;  1Z5V A;  4ZOL A;  5FPO A;  4UFZ A;  1R3L C;  2OYQ A;  3ASO B;  5IYZ B;  3B4S A;  1SZX A;  3THO A;  3T1C A;  1IBM O;  5FPR A;  3ZS8 C;  1WP8 A;  1TA8 A;  3W7U A;  1ZX3 A;  3U0Z A;  1K3E A;  4EKW A;  1KP2 A;  4X62 B;  3K08 A;  4PDL A;  4IHJ A;  1OZ0 A;  1MSD A;  1S5J A;  2FKX A;  2HJD A;  4LF9 B;  1DGS A;  2Y48 A;  2E5L O;  2ZXW B;  2OT5 A;  1IX9 A;  5ITZ A;  2YI8 A;  2IU3 A;  2EJR A;  5JVD A;  1XI1 A;  1QLN A;  3AG4 B;  1WPB A;  4CBC A;  3UQ8 A;  1XHZ A;  4WFA V;  3CCE V;  1BQ0 A;  4DK1 A;  1NJI W;  3N2G B;  4Q6G A;  4JF3 A;  1KP3 A;  3JAK B;  4K3A A;  1B6Q A;  2ZE7 A;  3H1J H;  4YJ2 A;  5IYC O;  3OE7 G;  1K5Q A;  5IJ0 B;  2LJ2 A;  1M9N A;  3N2K A;  1G4Y B;  3AK1 A;  2LO1 A;  1HR0 O;  1V9P A;  4MVQ A;  1YIT V;  1Q86 W;  1VQN V;  4JAA A;  3RVZ A;  4HBN A;  3NR7 A;  2ZR3 A;  1B06 A;  3HKD B;  1YDX A;  3GWO A;  4O4I A;  4B3M O;  2WLL B;  1COW G;  2QKC A;  2QM4 A;  1VP7 A;  3BAB A;  4LNU B;  1OCR C;  4B3S O;  4JTC B;  2IJI A;  5C8Y B;  1RSO A;  2WLH A;  3ZHR A;  2Y69 B;  1QCE A;  5KX5 A;  1F7Y A;  3X2Q B;  2GV9 A;  4DK0 A;  5IWA B;  2IJH A;  3IC7 A;  3HKC B;  4GX0 A;  4DR4 O;  1EFR G;  4OX9 B;  1Q3E A;  2BTQ B;  1NQT A;  3MDS A;  3SJA C;  3G67 A;  1FS0 G;  3H1K H;  4UCS A;  1Z5W A;  1ZL8 A;  3JAT A;  1FJG B;  4U3J B;  1YEW A;  5EBM C;  1BGY H;  1NI8 A;  5ITZ B;  2Q7E A;  4LF7 B;  2O57 A;  3C90 A;  1XNR O;  1ZSP A;  1PV0 A;  2XTA A;  4JYY A;  1FFX A;  2WAM A;  3K5L A;  3AG3 C;  4JI1 O;  4IL6 Z;  1SQV H;  3N27 A;  3DXR A;  1P84 F;  4JYA B;  5BXZ A;  3FYE B;  4DR6 O;  5DED A;  2XUM A;  4FZ0 A;  2P90 A;  2MK3 A;  1WP7 A;  3X2Q C;  3OW2 U;  3APQ A;  2Y0P A;  3CEI A;  1BHA A;  2E75 B;  1CXZ B;  4G28 B;  2UUA B;  3HKC A;  1WAZ A;  2XAG A;  4TSF G;  4CS2 A;  1FAF A;  1MA1 A;  3BA8 A;  3RYC B;  1TUE B;  3ABT A;  1J95 A;  4JI1 B;  3WB0 A;  3CRA A;  4WFH A;  1N33 O;  4KL1 A;  2CGO A;  2HR3 A;  5BMV B;  4HAM A;  3FYI B;  3L75 H;  3S3X A;  1NR7 A;  2Y4U A;  3CMA V;  4JAS A;  2PI5 A;  1P4R A;  2F43 G;  1YTF B;  3U11 A;  1QR9 A;  2ZKO A;  1N36 B;  1Q6I A;  1DTO A;  2A7W A;  5LA6 A;  3GB7 C;  2UXC B;  4FLZ A;  1OJH A;  5EYP B;  3JD0 A;  1QLE B;  2QKS A;  1Z2G A;  5KMG B;  4DV0 B;  4W4L A;  5D5P A;  1SQG A;  3FAV A;  1YJ9 V;  4PA3 A;  2EIN B;  1XMQ B;  4U7O A;  4JYB A;  4UCU A;  1M56 C;  1SS3 A;  2QE7 G;  3OR7 C;  4JI3 B;  4B7E A;  4GKK B;  3NXS A;  4FLV A;  3CRR A;  1XL6 A;  1MG1 A;  2UU9 B;  1P7G A;  3HKE A;  3GWK C;  3P3P A;  1HNZ O;  1K34 A;  4NXM O;  5CB4 B;  3M7M X;  2QDO A;  5CB4 A;  5JCO A;  3RYF A;  2JJ1 G;  2UXB O;  4GKK O;  3HKD A;  3OGI B;  4O4I B;  3B77 A;  3JAS B;  2HHH B;  1S5H C;  3K04 A;  4RQE A;  2PI4 A;  1CP9 A;  4MTX A;  3T4D A;  4CH3 A;  2HG5 C;  1AJN A;  2WLJ A;  4YJ3 B;  1EM1 A;  2EX3 A;  4LCU C;  4DUZ O;  1THZ A;  2CTQ A;  1N36 O;  3KZI Z;  3D36 C;  4DR5 O;  2LFS A;  3FAV B;  2Q5Z A;  2BCC H;  4KHP B;  1TAE A;  3SPG A;  2UXB B;  4WFE A;  3DC6 A;  4DV1 B;  2ZCE A;  2EUL A;  3OD4 A;  1R3K C;  3F7V C;  5EYP A;  4JI8 B;  4DRX A;  3QO7 A;  4J41 A;  4ZHQ B;  5L3E A;  5LHI A;  3OT7 A;  4X62 O;  3UO2 A;  1JX9 A;  2NNU A;  5H6R A;  3RYI A;  2UXD O;  4BIU A;  2W0X A;  5GTI Z;  1UFI A;  2A79 B;  4NVP A;  4OPA A;  3CCV V;  2ZT9 B;  4LF8 B;  2ZXW C;  5CA0 B;  4PHZ A;  1OCO B;  5B3S C;  4X1K A;  3SYQ A;  1D5A A;  2NN4 A;  1XOU A;  3JAW A;  1PKX A;  2R70 A;  1K4D C;  1JA8 A;  1FJG O;  5LGT A;  3K9A A;  1SF9 A;  3FB7 C;  5CN0 A;  2VS0 A;  2XAJ A;  3ABM B;  5IYB O;  3G71 V;  4OPH A;  2BOB C;  1NU1 H;  3ZHU A;  5H2F Z;  2LW7 A;  1VQK V;  1I94 O;  3Q4H A;  4CC6 A;  1OV9 A;  2YEV A;  4L8J A;  3AG1 B;  4MVM A;  5KAI Z;  3QNE A;  2ZM6 B;  3I5D A;  1L8D A;  4KP4 A;  3SPJ A;  2VRZ A;  1QVF U;  1V55 C;  1XMO B;  1FXK B;  1H2L A;  3APO A;  1FKA O;  3ABL C;  1R1B A;  1XDC A;  3KG2 A;  1NBM G;  2DE0 X;  3RW0 A;  3LNM B;  5LOV A;  3OMN B;  2HHH O;  4QPJ A;  3JAT B;  4BWA A;  3HB3 B;  5IJ0 A;  2N04 A;  4RQF A;  1Y76 A;  3ZX6 A;  3OEE G;  1S72 V;  5E79 Z;  4CS4 A;  4I0X A;  5GTH Z;  5JJN B;  4I4T A;  1Y76 B;  1OCR B;  2P5O A;  4DR6 B;  1SQX H;  2DWE C;  3AK3 A;  3H1H H;  1YF2 A;  4DR1 O;  4DV4 O;  5L3B A;  1ZAU A;  4EB6 A;  2X6C A;  3LSU A;  4JI0 O;  1MSW D;  1Q7Y W;  2DQ0 A;  4LFA B;  1GH6 A;  5A9G A;  1GN4 A;  1AVM A;  3OGC C;  4RAI A;  4FK5 C;  4QE7 A;  1S3J A;  4JI5 O;  2H3O A;  4JAU A;  1IZ3 A;  2DYS C;  2EIJ C;  2Q0A A;  1GM8 A;  3LSQ A;  4GX1 A;  4RUF A;  3CHX A;  1VQ4 V;  4UVC A;  3H1L H;  1L0L H;  4ZOL B;  4EEQ A;  3K0D A;  1LUW A;  1VF6 A;  2AW9 A;  4GZR B;  4N21 A;  2VQF B;  3HKB A;  4QPK A;  3H01 A;  2ZE6 A;  3AG1 C;  5CA3 A;  1I5Y A;  4X65 O;  2F4V B;  3OUS A;  1VF5 B;  4B3R O;  3ZRV A;  3EHB B;  1F4M A;  3AG4 C;  3OMI B;  4GT1 A;  5J2U A;  2ITC C;  4BW5 A;  2Q67 A;  3ICX A;  4LF5 B;  3KCY A;  2ZE8 A;  1EZV H;  4H44 B;  4FZ1 A;  4MS2 A;  2VWK A;  4DR1 B;  4DV5 O;  4JZ2 A;  5BMV A;  1NKD A;  1YCI A;  5L3G A;  3EXA A;  4GYC B;  4MTF A;  2PGG A;  3L70 H;  4XDJ A;  4UCR A;  2F23 A;  5EZY B;  3RVY A;  4EB6 B;  4LC1 A;  5B1O A;  1W0K G;  2JEX A;  4WFB V;  4J9Z B;  4DR3 O;  3E8H A;  3DGE A;  1BSM A;  5JH7 B;  1SQF A;  1BE3 H;  5LGN A;  2RN9 A;  3B8M A;  3ETQ A;  1PPJ H;  2CK3 G;  4X88 A;  2UXD B;  3BY6 A;  2W6I G;  4H33 A;  1TVK A;  1UJW B;  1QNM A;  5LMN O;  1JCH A;  4B08 A;  1UPG A;  1VF6 C;  4NR1 A;  4YJ2 B;  4RO2 A;  4FM1 A;  4I0X B;  2AXT Z;  4JI7 O;  2Q73 A;  2YS8 A;  3JAW B;  3JCZ A;  4YIO A;  3K58 A;  2JEU A;  2C2A A;  3E89 A;  4X20 B;  3K9S A;  2UXN A;  4DR3 B;  1PNL A;  3K5N A;  3RYI B;  3JD1 A;  1I5X A;  1SC5 B;  2JJ2 G;  3P3N A;  3JSN A;  2KKW A;  4A5U B;  5JJE B;  2ZD9 A;  1I94 B;  4ASU G;  2V4D A;  3IJ4 A;  1XL4 A;  2YIC A;  1JOY A;  3ABK C;  4I55 A;  2CE4 A;  1OCZ C;  3TCU A;  2QTO A;  2BTQ A;  1GTO A;  4DV6 B;  2YEV B;  3CRQ A;  3K5M A;  2PYL A;  5FNV A;  5H5N A;  4GKJ O;  5B1A C;  3I55 V;  4JI8 O;  4YJ3 A;  2E3C A;  3CYO A;  2M6Y A;  2LQT A;  2JRI A;  3CCS V;  4FJC C;  5EC1 C;  4N23 A;  3KKY A;  1G8M A;  3CX5 F;  4UCV A;  4K8Z A;  4K0K O;  3RYF B;  1NTK H; 
#chains in the Genus database with same CATH homology
 2Q69 A;  1PNM A;  3MD0 A;  5LBQ A;  5IDJ A;  1FFT B;  2DQ3 A;  4LBE C;  4RUE A;  4JTD B;  2XAS A;  3ZCC A;  3K06 A;  1JPX A;  3VOU A;  3G6E V;  3FYE B;  3K79 A;  1OCC B;  2Q6A A;  4JTA B;  5L3F A;  2P90 A;  2MK3 A;  4YXW G;  3X2Q C;  1KKD A;  1RPO A;  4P9P A;  3OW2 U;  1SRY A;  1BHA A;  5EC2 C;  4G28 B;  1VQO V;  1F51 A;  2XAG A;  4TSF G;  1TUE B;  2EZO A;  2ITD C;  3ABU A;  1WLE A;  3ABT A;  1SER A;  1J95 A;  1ZWI C;  3SYP A;  1GK9 A;  2GHY A;  4MT8 A;  1IXM A;  2M7W A;  4WFH A;  2X6A A;  4UVA A;  2NLJ C;  3CPW U;  1K73 W;  1E79 G;  3E35 A;  2HR3 A;  1YI2 V;  2WWW A;  4HAM A;  1SZT A;  3FYI B;  4JYC A;  1DF5 A;  1M90 W;  3EFF K;  1NR7 A;  4PA9 A;  3CMA V;  3CCL V;  1R73 A;  4JAS A;  4HZ3 A;  2PI5 A;  1P4R A;  2F43 G;  1YIJ V;  1YTF B;  3FB8 C;  3G4S V;  3CCU V;  3DTU B;  1QR9 A;  4TWK A;  4QNH B;  5CBG A;  4I9W A;  2AHZ A;  1VQL V;  2IU0 A;  3I56 V;  1M57 B;  4F4L A;  4MVR A;  1DTO A;  5LHH A;  2ZDI C;  3GB7 C;  4PEL A;  1BMF G;  4E2L A;  1RM1 B;  5KUK A;  3JD0 A;  1QLE B;  1KQS U;  2QKS A;  4QJF B;  5FL7 G;  2X6B A;  4MVU A;  1OCZ B;  1QBZ A;  4GX2 A;  4JAV A;  1JVM A;  2WLM A;  3ABL B;  3K0G A;  5IY5 B;  1YJ9 V;  4PA3 A;  2EIN B;  1FXH A;  4U7O A;  1R3J C;  2X7R B;  4JYB A;  1M56 C;  2QE7 G;  3OR7 C;  1VQM V;  1AR1 B;  3CC2 V;  5H6Q A;  3NXS A;  3R65 A;  3BEH A;  2EIM C;  3ETD A;  4UXN A;  1XL6 A;  1YTF D;  1MG1 A;  1ROP A;  1V54 B;  2BOC C;  3ABK B;  3TET A;  2EIL B;  4WFG A;  1K34 A;  3OFN G;  3SYA A;  1VQP V;  3CCR V;  2X0L A;  3JYC A;  1K33 A;  2WLI B;  1V55 B;  4KFM A;  5BZB A;  5KA6 A;  1NR1 A;  1GO3 F;  2JJ1 G;  2EBO A;  5GW7 A;  1K7D A;  2EZP A;  4ZBM A;  1AI6 A;  2XND G;  4QIW F;  1QLE C;  3B77 A;  1FXK A;  1S5H C;  2HFE C;  4P9O A;  3K04 A;  2IJJ A;  4RQE A;  2PI4 A;  3E8B A;  1PL0 A;  1CP9 A;  4MTX A;  5B1A B;  3T4D A;  2HG5 C;  2R9R B;  4MVO A;  1AJN A;  5B1B C;  5H9C A;  3AG2 B;  1RM1 C;  5C93 A;  2WLJ A;  2ZQM A;  5CMU A;  1S76 D;  4LCU C;  4L87 A;  1THZ A;  2P67 A;  2IJK A;  3JD4 A;  3STZ C;  2WSS G;  3SPI A;  1WPX A;  1FXV A;  3ZRW A;  5B3S B;  2LFS A;  3CCM V;  1RPR A;  3ETE A;  1PNK A;  3CP1 A;  1QR8 A;  3AG3 B;  3ZRW B;  3SPG A;  4WFE A;  2JK5 C;  2HJF C;  1R3K C;  3F7V C;  3ZN0 A;  2EIK C;  4BIZ A;  3QO7 A;  1R6N A;  5L3E A;  4DO2 A;  1K92 A;  4JGS A;  5HFM A;  4FPP A;  5LHI A;  4GX5 A;  1Y66 A;  2HLD G;  4UUJ C;  1JX9 A;  2NNU A;  5H6R A;  1BL8 A;  3MHH C;  3ZMT A;  2B5U A;  4QE9 A;  2EIJ B;  4PA6 A;  4BIU A;  3W7X A;  2WLN A;  3IGA C;  2A79 B;  4R8C A;  1ORQ C;  3QO8 A;  4XDL A;  1CPY A;  1YSC A;  3A0R A;  4PA7 A;  3CCV V;  3FKS G;  2ZXW C;  1GM7 A;  3CME V;  1OCO B;  2WLK A;  3K3W A;  1F4N A;  5B3S C;  1VQ7 V;  1QVG U;  1F23 A;  2A9H A;  2EIK B;  4I5S A;  3D36 A;  4UV9 A;  3SYQ A;  2Y69 C;  1AJQ A;  3PJS K;  1AI7 A;  2Q68 A;  1GMG A;  1K97 A;  1PKX A;  5L3D A;  1K4D C;  3VBB A;  5LGT A;  3K9A A;  1K5S A;  2EIN C;  2H8P C;  1OHH G;  4OXS A;  3FB7 C;  5EBW C;  5EK0 A;  5CN0 A;  3G71 V;  2XAJ A;  3ABM B;  5IYB O;  3OM3 B;  2D3O W;  2W0F C;  2BOB C;  4PDR A;  1FXK C;  3D3I A;  3P30 A;  2Z3Y A;  3W7T A;  1VQ8 V;  3QO5 A;  1VQK V;  2DWD C;  4PA4 A;  3UKM A;  2QA4 V;  1M57 C;  2YEV A;  2JDI G;  1LNQ A;  4X89 A;  1HWY A;  3AG1 B;  4KUM A;  4MVM A;  4PDV A;  3ZRX A;  3QNE A;  1H2G A;  5B1N A;  4KP4 A;  2V1D A;  1H8H G;  1BHB A;  4R7C A;  3SPJ A;  1QVF U;  4LP8 A;  1V55 C;  1ENV A;  4UV8 A;  4UVB A;  1FXK B;  2OTJ V;  3TK1 A;  3E8G A;  1NH2 B;  3ABL C;  2W6J G;  3E86 A;  3KG2 A;  1NBM G;  1YHQ V;  3RW0 A;  1M56 B;  2IH3 C;  1W2B U;  3LNM B;  3OMN B;  3WFV A;  4MSW C;  4QPJ A;  3ZMU A;  2DYR B;  1AI5 A;  3HB3 B;  2XAF A;  2DW4 A;  3ETG A;  1EZJ A;  4RQF A;  5CBH A;  3T4Z A;  1GKF A;  3CD6 V;  3OEE G;  1S72 V;  2XAQ A;  1K9M W;  1L1F A;  4BAY A;  2Z5U A;  4MVS A;  1NVP B;  2V7Q G;  1SET A;  3M99 B;  1OCR B;  3CC7 V;  5DN6 G;  3ZMS A;  2GSM B;  4ZKI A;  1VQ5 V;  2QM8 A;  3W7S A;  2DYS B;  1Y4M A;  4Q20 A;  2DWE C;  1PD3 A;  3WG7 B;  2R9I A;  3E83 A;  1KEC A;  2OCC C;  3ASN B;  2B1G A;  4G2K A;  5EBL C;  5L3B A;  1P7B A;  5J9P C;  1KD1 W;  1DF4 A;  2ZDI A;  4TT3 G;  1H38 A;  1CEZ A;  4WFF A;  2XAH A;  2X6C A;  2YSU B;  2WLI A;  2KB1 A;  1MSW D;  1Q7Y W;  4R6Z A;  2IH1 C;  1S0V A;  5KUM A;  1YJW V;  2DQ0 A;  2K1E A;  3IFX A;  4PDM A;  1VQ9 V;  1OCO C;  3F5W C;  3LDE A;  2UXX A;  1M1K W;  3ASN C;  3AEI A;  3OGC C;  3LDC A;  4FK5 C;  4RAI A;  1AI4 A;  1V54 C;  3HPL C;  4QE7 A;  1JJ2 U;  1S3J A;  2XOK G;  1R3I C;  5KA5 A;  1VQ6 V;  2WLL A;  4JPR A;  4JAU A;  2DYS C;  3OR6 C;  1JQ0 A;  4WCE V;  2EIJ C;  5B1B B;  4R50 A;  3ZIA G;  1GM8 A;  3LSQ A;  4GX1 A;  4RUF A;  1GM9 A;  1VQ4 V;  4XBF A;  4UVC A;  1R3L C;  3ASO B;  3CXC U;  2FTK A;  3K0D A;  4N21 A;  1SES A;  3T1C A;  5L3C A;  2B1I A;  3W7W A;  4QPK A;  2OCC B;  1AJP A;  3H01 A;  2OTL V;  3F7Y C;  4XDK A;  3WG7 C;  3AG1 C;  1E1Q G;  1I5Y A;  5CA3 A;  4FIP C;  3W7U A;  3OUS A;  5IYD O;  1K3E A;  3ZRV A;  4EKW A;  2EIL C;  2P7T C;  3EHB B;  4J9Y B;  1KP2 A;  1F4M A;  3K08 A;  3AG4 C;  3OMI B;  4GT1 A;  4PDL A;  2ITC C;  1ARO P;  4BW5 A;  2Q67 A;  3FB6 C;  1OZ0 A;  4H37 A;  1N8R W;  3ASO C;  4X8A A;  3LSS A;  3CCQ V;  3LDD A;  2LP7 A;  5DM6 V;  1R6K A;  2Y48 A;  4MW8 A;  2QEX V;  4MS2 A;  2ZXW B;  2OT5 A;  2DYR C;  2IU3 A;  2EJR A;  1NKD A;  5L3G A;  4DXW A;  1QLN A;  4MTF A;  4XDJ A;  3AG4 B;  3ZRS A;  3E2E A;  4CBC A;  3OAA G;  5E1A C;  3RVY A;  4LC1 A;  1KC8 W;  3AG2 C;  2LFR A;  5B1O A;  1W0K G;  2JEX A;  4WFB V;  3T2M A;  4J9Z B;  4WFA V;  3CCE V;  3E8H A;  3DGE A;  3JD2 A;  1NJI W;  5CBF A;  4JF3 A;  1S77 D;  1KP3 A;  1B6Q A;  5LGN A;  3B8M A;  4GCZ A;  2CK3 G;  3SJQ C;  4X88 A;  5IYC O;  3BY6 A;  3OE7 G;  3P32 A;  2W6I G;  4H33 A;  3ZN1 A;  1K5Q A;  1H8E G;  2EIM B;  1UJW B;  1M9N A;  1JCH A;  1G4Y B;  2H94 A;  3MHS C;  3ZMV A;  4RO2 A;  3SPC A;  1DLB A;  1Q86 W;  4MVQ A;  3ZJZ A;  3SPH A;  1YIT V;  1VQN V;  1NH2 D;  3RVZ A;  3K03 A;  2HVK C;  4MTG A;  4FMT A;  2ZR3 A;  3E8F A;  4P30 A;  3SYC A;  1Q81 W;  3JCZ A;  3CCJ V;  3STL C;  3B8N A;  3GWO A;  2JEU A;  1MAB G;  2C2A A;  2QM7 A;  3ABM C;  3E89 A;  2WLL B;  3RBZ A;  2AHY A;  3UM7 A;  1COW G;  4MTO A;  2HKO A;  2UXN A;  2ZR2 A;  1PNL A;  1OCR C;  3JD1 A;  1I5X A;  4JTC B;  2IJI A;  2JJ2 G;  2WLH A;  2Y69 B;  1QCE A;  5LGU A;  1EBO A;  4CZZ A;  1OCC C;  2JIZ G;  2ZD9 A;  1K8A W;  3OUF A;  3X2Q B;  5LHG A;  4ASU G;  3LUT B;  1XL4 A;  2IJH A;  3IC7 A;  1Q82 W;  1E1R G;  3FB5 C;  4GX0 A;  1JOY A;  1EFR G;  3ABK C;  3OMA B;  1NVP D;  5IY5 C;  1NQT A;  3ZMZ A;  1OCZ C;  3TCU A;  2QTO A;  4Z1M G;  1W0J G;  1GTO A;  2YEV B;  4U7N A;  1MOF A;  3ML0 A;  4WF9 V;  2A0L A;  5B1A C;  3OEH G;  5HFL A;  1FS0 G;  3I55 V;  3SYO A;  3CYO A;  5EBM C;  4MVZ A;  3JD3 A;  4G27 B;  3CC4 V;  3CCS V;  4FJC C;  5EC1 C;  2P6J A;  4P2Z A;  4N23 A;  2WPD G;  4MW3 A;  1G8M A;  1K4C C;  1YJN V;  2ATK C;  2WAM A;  4HYO A;  2HVJ C;  2IW5 A;  3AG3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...