3ZRXA

The high resolution structure of a dimeric hamp-dhp fusion displays strong asymmetry
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 45
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrxA00
2P67A 2WWWA 4KP4A 4JYBA 4MT8A 4LC1A 4BIZA 4FMTA 1JOYA 3P32A 2LFRA 2FTKA 3ZCCA 4JASA 3NXSA 3ZRVA 4FPPA 1F51A 4U7NA 4BIUA 3TK1A 4GT1A 4U7OA 5IDJA 4JYCA 4Q20A 3ZRWB 4ZKIA 5C93A 3ZRXA 1IXMA 4JAVA 5B1NA 3MD0A 4QPKA 4QPJA 2QM8A 3D36A 2QM7A 4MTXA 2LFSA 3A0RA 4JAUA 4I5SA 3DGEA 4GCZA 3ZRWA 5B1OA 2C2AA
chains in the Genus database with same CATH superfamily
2QJ1A 4BIZA 2DYSB 4DV1O 2DYRC 2HFEC 2RCVA 1XMQB 5K1XA 1XHXA 3LDEA 4G27B 5CA0A 2X0LA 2JS3A 2Q69A 4JI5B 2ZDIC 4RUFA 1QVGU 1VF7A 3CJHB 2Q9LA 1BMFG 3CHXA 2YXLA 2ZD9A 2Q7GA 1HR0B 4DR7B 1XBLA 3HR0A 5BXZA 2FTKA 1LUWA 1JFFA 1GN4A 2DQ0A 4PELA 3IGAC 1MZEA 4NR1A 1ZLZA 3APOA 3ETDA 4LF4O 4LF5O 4K8ZA 5D5QA 1AI7A 1OCRB 3I56V 1P4RA 2QEXV 2JGUA 3AK1A 3OMAB 5B1AC 1FXKC 2BOBC 3R66A 2ZKOA 5EYPA 2GDSA 5JH7B 4DV0B 4P9PA 2DWDC 5LGUA 3CC4V 4NTYA 3A0BZ 5L3DA 3RYFA 1G8MA 2WLKA 3EFFK 5C93A 4DV6O 4OX9B 4JAAA 1NR1A 2V1DA 4KXRA 5H6QA 4FJCC 5ITZB 2EX3A 1D5AA 1AJPA 4MS2A 2Y4UA 2UXXA 5JJNB 4MVRA 1FAFA 1VQLV 1EN6A 2JVDA 4OPAA 5FL7G 3T1YB 2QKSA 4I0XA 3CCEV 1QCEA 2EIJB 3CRAA 2ADPA 1MG1A 3ABLB 2PI4A 4B3MB 4YJ3B 2LFSA 2EIKB 4CH5A 3QF7A 2CK3G 4JAUA 3G67A 5JVDB 1YHQV 1VQ6V 2LGWA 5JQGB 1Z5VA 1NTZH 4R7CA 2W0XA 1Y67A 4I55A 1YEWA 4NYKA 1YJ9V 2RDCA 4GZRB 2H94A 4GYCB 2ZE7A 3O65A 3B40A 2BSKA 4HNAB 2FMLA 4X64B 5FNVA 4DR1B 1A32A 2EIMB 1MABG 4X1KB 4DYLA 3JALB 1QHTA 4R50A 3ASOC 3ZBHA 3CB2A 3JSNA 1TVKB 1XILA 2NNUA 3DC6A 4LFBB 4CS3A 4CH4A 1KBHA 3VQVA 4CZZA 2X6AA 1EN4A 1VIBA 4UVBA 3SYCA 2CTWA 4I9QA 3LNNA 4AQYO 2F66C 5IDJA 4JTDB 2DYSC 5IY5C 3L72H 1CP9A 1JVMA 1WPBA 3KCYA 3CCLV 3STZC 4EFBA 2OWOA 3OUFA 4JI2O 4C7UA 4QJFB 5B1OA 5C8YA 3RN4A 2GTSA 2HHHO 4LF7B 4WBNA 1F51A 1IBMB 3E22A 4NTWA 5LYJB 1AP6A 1Q5OA 4X62O 1PNMA 2F43G 5LP6A 2ZXWC 1HW7A 1BE3H 3F5TA 3DTUB 1OCRC 4DR6O 5DN6G 1U96A 4QNHB 5IT9N 3ABUA 3P32A 1N34B 4UV9A 1ZX3A 1VF6C 4JI6B 4DV3B 2F23A 3H9VA 4IHJA 3JAWB 3CMAV 4LFCO 4IYHA 4K35A 1K4CC 4LCUC 1MA1A 4UCTA 4MTOA 4PI0A 2ITCC 4DUZO 2P67A 1NTKH 3K3WA 4MT8A 4CBCA 4DV5O 3JD0A 1E1RG 2YEVA 4WCEV 5GTIZ 2X7RB 4WF9V 4J41A 1YJNV 5IWAO 3FB7C 3O9OA 4FLVA 3CYOA 3N2GB 1W0JG 1IVSA 3OFNG 4EFEA 3CCRV 3M99B 3JASB 2EIJC 2Q8VA 3QO8A 2UXCO 3ABLC 3S3XA 1PL0A 3IC9A 2EIKC 3K5OA 1R1BA 4PV1B 4UXNA 3BCCH 1IBLB 1WB7A 1KB9F 2Y0IA 1Q6HA 3AG1C 4YJ2A 4FIPC 5FLXN 3WG7B 3D36A 3ETEA 3FB5C 1K5QA 2W6IG 5L3FA 4DR5B 2HVKC 5IJ0B 2EIMC 1WB8A 1N32B 3IC7A 3JD3A 1M93A 1S72V 2UUAO 5KA6A 5KMGA 3CCMV 4J7JA 1J5EB 1IXMA 1Y76A 4LF6B 2A06H 4LF8O 1QVFU 3BVOA 4DV4B 2WLLA 1WP7A 2F93B 3L73H 1NH2B 3BA9A 4B3RO 3CRQA 4KFMA 2UUCB 2FB5A 2C2AA 2CGOA 2P22C 3UQ8A 1XNQO 2F1MA 4HYOA 3A8TA 2E5LB 5EZYB 2JEXA 3CS5A 4MVUA 5KAFZ 1FFXB 5KHKA 3MHHC 3SYPA 4O4JB 2OIGA 2F95B 1FPOA 2XAJA 2BE3A 3QO5A 4X9QA 4BWAA 4PD4F 3L74H 1GN6A 4BIUA 3UO2A 4MVSA 1WLEA 2IJKA 4GKJB 5KA5A 4FZ1A 1AILA 4WFGA 5GTHZ 4EKWA 4MVZA 4JI7O 1KUQA 1SETA 4LF9O 1XOUA 1H2GA 5J9PC 5CMUA 1F4MA 1XNRO 4UCUA 1YDXA 1TUBB 4HZ3A 1W59A 3CCJV 3HKBA 1Y74B 3CX5F 3AEIA 3CRCA 4DUYB 4XDKA 2YXHA 3AG7A 5L3BA 3OR6C 4P2ZA 4JI1O 2HKOA 1DK1A 3K59A 3I5DA 3KG2A 3E89A 4YIOA 1XMOO 4X1YB 1KECA 5EC2C 3K08A 2WAMA 3TXQA 1XI1A 4GKKO 3I55V 2XAGA 2EZPA 5L3EA 2X6BA 3W7UA 4JV5O 1FD9A 3DC5A 5BMVB 2PI5A 3WG7C 3DXRA 2XUMA 5IJ9B 5H6RA 1NT2B 4KHPO 4JI3O 4TSFG 1SQVH 4MVMA 4RQFA 1ZTEA 3H01A 3ZJZA 4ZHQA 4CC6A 3THOA 3B8MA 3OTOB 3A0RA 1IBKB 1R6NA 2ZDIA 3B09A 2Q67A 4O2BB 1HNZB 2QKAA 5J2UB 4MTGA 1FKAO 4MVOA 4B3TO 2UXNA 3ZMZA 5JWPA 4Z1VA 2P7TC 3M8AA 1G1XB 5E1AC 1WJZA 3E8BA 5LL6Y 2PUSA 3LSSA 2QTOA 4X66B 3HKEA 1QQCA 5KAIZ 2YSUB 1FXKA 4LC1A 4CC5A 3ZHSA 1DTOA 3NXSA 5KHGA 5JCOC 2P90A 5LMNO 3RW0A 4F6RA 4FFBA 4ASUG 1YXBA 1YCIA 4DR3O 4FM2A 5E79Z 5B5EZ 2QM4A 4GX0A 1L0NH 5LXTB 4UB8Z 3STLC 1VQ9V 2H8PC 1OCZB 1VF5B 5LHGA 2ZE5A 4X8AA 2B1GA 2A79B 4UCSA 4FPPA 4PI2A 5CBFA 3OUSA 3UT5B 1KYOF 5FPOA 3KZIZ 5H5NA 1K8AW 3OGIB 1UJWB 1VEWA 1P7GA 4DV2O 1MNGA 3CE2A 1NR7A 3G80A 2DW4A 1QU7A 1SA0A 2IM9A 2P4VA 5BR8B 1AI5A 2ITDC 2NLJC 1M9NA 5K1PA 1BZKA 1BQZA 1OCOB 5A2QN 3H1HH 1KMIZ 2ODMA 2UUBO 4B7EA 1M57B 2PF4E 4FLZA 1MMMA 1QR8A 1RSOB 2GHYA 3ZN0A 1L1FA 2YDEA 3P30A 4RQEA 2JGDA 3ETQA 4UFZA 2LGQA 2WLIA 2CH7A 4JZGA 3TXSA 1R6KA 1MOFA 4PA4A 3SJQC 1I5XA 2DJVA 3OE7G 5HFMA 4LWSB 3BRCA 3ZRVA 3QG5A 4DRXB 4FFKA 4IYIA 2RN9A 4ZOLB 1KP2A 5CA1B 4PA3A 2CTPA 1S5JA 3MAQA 4QE7A 2ZQMA 3ASOB 4TV9A 2QM8A 1OHHG 4JYAO 2Q7HA 4MTXA 4AI8A 2K9PA 3JCZA 3FFQA 3ZX6A 1SQFA 3E2EA 2WA3A 1V55B 2KKWA 1JA8A 4JI0B 5IY5B 1MSWD 4QIWF 4TWKA 1SQXH 3H1KH 4ICGA 4WFEA 3CJHA 2DQ3A 3FYIB 1D5NA 2RNBA 4NXMB 2PYLA 2X6CA 2QTSA 1VQ5V 4F4LA 3RFRA 1SS3A 1S0VA 3K79A 1GM7A 2XT9A 1EZVH 2R9IA 3VBBA 1R3IC 5GW7A 4JI4O 4UCRA 1H2KA 3IAYA 2ZXWB 3SPIA 4D6TH 1NVPB 3N2KB 5JH7A 1FJGB 3P3NA 2PGGA 2GSMB 1H8EG 2B1IA 2QWRB 1BT8A 1OCZC 3W7SA 4N21A 3ASNC 5IE9A 4CH6A 1B06A 2Y4TA 1UFIA 2QE7G 3GWKC 2LW7A 1K5SA 1Q81W 1HNWO 5B1NA 1IDSA 3WB2A 3CSXA 2AXTZ 2ZINA 4DR4O 1SZXA 2D2CB 3OW2U 3OTFA 1ORQC 4J10A 5D5PA 3UCSC 1O9GA 2EJ7A 4DK0A 4DXWA 3OMIB 4YJ3A 4FLXA 1OJHA 4MSWC 2PY5A 5JVDA 2ATKC 1OCOC 4X65O 2R9AA 1YSCA 5JQGA 2JEUA 3TJTA 1KD1W 2RMKB 2QM7A 1M57C 3A2FA 4HNAA 2CAZC 1NS1A 2R9RB 3NR7A 3ZCCA 3Q4HB 4X1KA 4O4LB 3AG1B 1GM8A 1M4UA 4CS2A 3JALA 3HKDB 3SDLA 5FPRA 1DLBA 1TVKA 3K5MA 2FL4A 2ZCEA 4K3AA 3ZRXA 4FM0A 4DR2B 1BL8A 1TAEA 4GX1A 1Y66A 1OV9A 1NH2D 2QSAA 5CN0A 5B1BB 4FZ0A 1V55C 1TA8A 5JJEB 3CD6V 3ABKB 4NXNB 4RWUA 3C3TA 1GRJA 1N33B 4LFAB 3ZMSA 2BSKB 1KQSU 3RGBA 5FNVB 2QWQB 5LYJA 3EXAA 1LUVA 2EJRA 4TOIA 1VMGA 3CCUV 4GX5A 5LHHA 4AHCA 3DSQA 4B3SB 2QGNA 4MTFA 3T4ZA 4IIJA 1K92A 3SYQA 1IZ3A 1E1QG 1NQTA 2YIBD 2DOSA 2XHBA 2Y69B 1NJIW 2A7WA 4UV8A 4HBNA 3SGIA 2UXBB 2F4VB 3JAWA 3BY6A 1B3QA 3FAVB 3ZMVA 4GUNA 2VQFB 2QKCA 1N36B 3RYIB 2MW2B 2JRIA 2PTMA 4NVPA 5LMUO 3QNEA 2P5OA 2ZM6O 3MDSA 1VQNV 1R3LC 4JI8B 1SC5B 5KHHA 1AR1B 1YVWA 5LP6B 3UO3A 4LBEC 4LNUB 5LHIA 1NU1H 3JYCA 3AG3B 3ZIAG 1PPJH 3G6BA 4YHHB 4J9ZB 1WNSA 3JASA 2DWEC 1S5LZ 4FLTA 4JPRA 1KU9A 5LGNA 4DO2A 2CTQA 5IYZA 3VQXA 2UU9B 1RP3B 4WFAV 2EINB 2IU3A 4N23A 1AJNA 3JCUZ 3R65A 3VOUA 1XMQO 5IJ0A 4U7NA 1SKVA 1PNLA 3CRRA 2UXDB 2YEVB 3ZS8C 3BFRA 4JI5O 1F4NA 1Q90D 1HR0O 4DR7O 2IBZH 4FM1A 2VQEB 3AK3A 4YY3B 1R3JC 4TUYB 4PDMA 2ZR2A 4O4IA 3AG4C 4F6EA 3K03A 3CCQV 1I94B 5EBMC 5B1BC 3ZRWB 3CXHF 2QA4V 4DV7B 1QR9A 2YC0A 1RPOA 2A3QA 5EZYA 3ABKC 1IURA 4DK1A 1AJQA 2ZE8A 2XASA 4U3FH 2JJ1G 3RBZA 1FFXA 4H33A 4DV0O 1GN2A 1JR9A 3T1HB 4D7TA 4OX9O 1ZWIC 3U10A 4G28B 4O4HA 1Q7YW 3H1JH 4I50B 5JJJB 1GMGA 1HNXB 4FLYA 2ZE6A 4Z2WA 1VQMV 1X59A 1HDJA 2Y69C 1XDCA 2FKXA 3SYOA 3T1YO 3AG2B 2ZT9B 1OZ0A 4QPKA 1G6UA 1I7FA 2OCHA 2Q7EA 4B3MO 5EK0A 3L9DA 4K0KB 2W6JG 4J7ZA 2BTQB 2GTAA 4WFHA 1GO3F 1TUBA 3CCSV 2CUGA 4GCZA 2XNDG 2ZIMA 3L71H 2GBOA 1CEZA 1SQQH 3H1LH 2LFRA 4DV1B 3JAMN 3SPHA 1AR5A 5LP6C 4X64O 4NTXA 2ZR3A 5LA6B 4K8XA 4IL6Z 4H44B 4DR1O 2EILB 3AG3C 3ZHQA 3MD0A 2A9HA 4OXSA 4X1YA 4O2AB 3QVNA 3T2MA 2XAFA 2Q4PA 4LFBO 1WP8A 1IX9A 2N04A 3FB6C 2YIDA 3G4SV 4PA6A 3GWOA 1L0LH 4X89A 2EINC 2CE4A 5BMVA 4LF4B 4TQDA 4RO2A 5LOVB 4LF5B 3H1IH 1GN3A 5IJ9A 1K33A 1WA8B 4ZIBA 3CXCU 3RYCB 2GUZB 1BQ0A 2V4DA 3G71V 3BA8A 3ZHUA 4LF7O 2AW9A 5EBWC 2Z0AA 1US6A 4QE9A 1IBMO 3P3PA 4XBFA 3B77A 4TV8A 3F7YC 5AG2A 4O2BA 1PP9H 4DV6B 1EBOA 1KC8W 3FD9A 2VRZA 1Q6IA 4OPHA 1T5EA 4PDVA 3CWBH 1X4TA 3CC7V 1PKXA 4UCVA 1K9MW 1ZL8B 1EN5A 1N34O 1VQOV 1Q6UA 2LO1A 3ZEDA 5B3SC 4DV3O 4JI6O 2YIAA 3D36C 2FYUH 4JTCB 5H2FZ 2G38A 3N27A 4U3JB 4L87A 3SJCC 1NVPD 3TGUH 5IYDO 1BS3A 1S5HC 1SF9A 3W7WA 1THZA 1W2BU 5LXTA 1PV0A 1Q43A 5DEDA 4PJ0Z 3JAKB 4WFBV 4A5UB 2MK3A 3CPWU 3ML0A 5LBQA 4ZI7B 3UM7A 1XQ8A 4DW1A 3UT5A 3AG2C 4MW8A 1CXZB 1AB3A 3HKCB 2R70A 4I9WA 1ENVA 1YJWV 3ASNB 5BY1A 1XUQA 1HWYA 1IBLO 4BIOA 3JARB 1NZ6A 4JTAB 4R6ZA 3HKEB 3BABA 4AQYB 3SYAA 3SPJA 2VWJA 5EC1C 4Q6GA 1V9PA 3JD1A 3W7XA 3JD4A 4DR5O 4X1IB 3GB7C 4FFBB 4EB6B 5CB4B 5B66Z 4JI2B 2EILC 4D7SA 2DE0X 3MHSC 1N32O 2Q68A 4UUJC 1RSOA 1K73W 4FMTA 2HHHB 2OT5A 3C90A 1ROPA 2IW5A 1J5EO 1NBMG 3OR7C 4LF6O 4X62B 3M7MX 4NKGB 3SR2C 2VWKA 4LWSA 1MSDA 4DV4O 2AHYA 3E8HA 3SJAC 1NI8A 3T1CA 2O57A 4DRXA 1KP3A 3DGEA 5CA1A 2W0FC 2UUCO 4DR6B 2KSDA 3WU2Z 4FVMA 1XL6A 3RYHB 3B4SA 1EZJA 3JD2A 1L8DA 4E4EA 3GVMA 3CEIA 2E5LO 2OCCB 3K0GA 1N0JA 4DW0A 4XDJA 1G4YB 1OCCB 2DMXA 4UVCA 3BAAA 5GONB 4X20B 2P4KA 4LFCB 3ZHTA 1ZSPA 4E2LA 3LSUA 1Z5WA 5J2TB 2JJ2G 4DUZB 2ARHA 3J80N 4DV5B 4H0LB 2ETNA 4NB5A 3QTCA 2IJIA 5KX5B 4YXWG 1EM1A 2YI9A 1R73A 5IWAB 3JATB 2KB1A 4GKJO 2A0LA 2L35A 1SRYA 4I4TB 4PDRA 3LSQA 1SQBH 3ABTA 1AI4A 3UKMA 3B2EE 2UXCB 2KG7B 4TV9B 1H2LA 3N2KA 2JS5A 4WFFA 1TGOA 4DUYO 1VF6A 1Z2GA 2P06A 1Q82W 2YS8A 1WN7A 4P9OA 5CA0B 1BGYH 2QR4A 3ZN1A 1VQ8V 4B7KA 2UUAB 1YITV 1SERA 2BCCH 5ITZA 5KHJA 2CDYA 2N05A 3SPCA 1YTFD 4JAVA 1JFFB 4LR3A 1FYJA 1Q8IA 4LF8B 4MVQA 2WA4A 1BHBA 3E8GA 2R72A 2XTAA 4B3RB 1H2MA 2ADQB 3ZHRA 1XNQB 1S76D 3WB0A 2E75B 1SZTA 5EYPB 1Q86W 1RPRA 1XEQA 2QWPB 2OTLV 1F23A 3OTOO 3Q4HA 2XAQA 3BHPA 1K7DA 4O4LA 1I0HA 5CBHA 1IBKO 3AK2A 1PNKA 3RYFB 3HKDA 1HNZO 2Q0OC 2WWWA 3WB1A 3CP1A 3LUTB 1JMKC 1XL4A 2OYQA 2Y0PA 2B5UA 5TISZ 4Q20A 2OCCC 2E74B 3K0DA 2HJFC 2WLHA 2ZNIA 2DN9A 2HEPA 3K9AA 1YZBA 1OCCC 4UB6Z 4X66O 1UPGA 4JI7B 3AG4B 3OGCC 4LF9B 4I0XB 1S77D 3K06A 1XNRB 1R6TA 3VQYA 5EIBC 4P30A 1F7YA 2CGNA 4I55B 2IU0A 3F7VC 5CA3A 4RUEA 4KL1A 4JI1B 1DGSA 1B04A 4GLXA 1U97A 1DF4A 5KLVH 1XMOB 1VP7A 1K4DC 2CTRA 4IGGA 2E3CA 2OIEA 2KQXA 3LNMB 1GM9A 4GKKB 2ZIOA 1BHAA 2WLJA 2D3OW 2JIZG 4JV5B 3PN1A 3KKYA 3FAVA 5BR8O 3RYIA 1QLEB 3E35A 4KHPB 1H38A 4JI3B 4JF3A 2N74A 1VQPV 2PYJA 5C8YB 2QWOB 2M6YA 4LNUA 2WSSG 1VQ7V 4WBNB 1YI2V 4CH3A 5HFLA 4IIJB 1YF2A 1O9HA 3FB8C 3E22B 1COWG 1B6QA 1N0NA 3BPZA 5EBLC 3K58A 3N2GA 4YIPA 3ZMUA 1PM9A 2YUAA 3LDCA 3VQWA 1YTFB 4B3TB 2VS0A 4PHZA 2AGAA 4H13B 5CBGA 2IJJA 4Z1MG 5KHIA 2AZ0A 4JI0O 3OMNB 3K04A 4JYBA 4IHJB 4XDLA 1FXHA 2AHZA 1W0KG 5KUMA 1ZUQA 5LMNB 2B9ZA 4UCOA 2RQ6A 3RT3C 4DR3B 4ZKIA 4ZBMA 4TUYA 3D8CA 4NXMO 2BTOA 1WAZA 4CS4A 1N4CA 1J95A 2M7WA 1JCHA 3CMEV 1XREA 4BR6A 2HG5C 1P49A 3ZRWA 2EZOA 5IYZB 1QLNA 2WLNA 1JJ2U 5L3CA 3J7AU 4GT1A 3K9SA 2Z5UA 4FLUA 1ZAUA 1FJGO 3OD4A 4DV2B 5F2VO 3SJBC 2HP8A 2IH1C 4YJ2B 2YI8A 3ZRSA 1H2SB 5B3SB 1D2DA 4PDLA 1WPXA 3OT7A 2Q0AA 4O4JA 3ABMB 4FLWA 1SQPH 2UUBB 4B08A 4I50A 3F5WC 5JCOA 3OM3B 4O4IB 3K5LA 1FS0G 3E83A 4JGSA 4QPJA 2WPDG 1GH6A 1I08A 1I5YA 4BW9A 5KMGB 1Y76B 3JSLA 2HR3A 3ICXA 4UVAA 2YIBA 4J11A 2WLLB 1GAXA 3L75H 4ABMA 2BTQA 2WLMA 3OEHG 3RVZA 1HP8A 1QLEC 5IYCO 4JYCA 4LH6A 2AZ2A 2YXYA 1EFRG 2ILMA 4JYAB 4H37A 3ZHVA 2NR5A 4J7KA 2GV9A 3K5NA 5LA6A 3IFXA 1Y74A 1YIJV 3TETA 4O4HB 4FK5C 4JASA 2JDIG 4O2AA 1PL4A 3CCVV 2LP7A 3X2QB 3FKSG 1V54B 4DR2O 3C3SA 3CRMA 4IT5A 1QNMA 3T4DA 1QBZA 2LJ2A 1P7BA 3E8FA 4I5SA 3J81N 4QGPA 1GKFA 5LOVA 1M56B 1JOYA 2XOKG 1WA8A 5A9GA 1VQ4V 4TT3G 3K57A 4JI4B 1PD3A 3APQA 2HJDA 4L8JA 4NXNO 3WFVA 2GUZA 3L70H 3RYCA 1N33O 3KCXA 4LFAO 4PA9A 1E79G 2K1EA 3FX7A 3HKBB 3HB3B 5IYBO 4OGQB 2IH3C 3CC2V 2QDOA 3A0HZ 3EHBB 1DF5A 4B3SO 2Q73A 4W4KA 5EIBD 2OTJV 5H9CA 4J42A 3S3WA 1K97A 1ZL8A 1HNWB 5J2UA 4GX2A 1H8HG 1Y4MA 5BZBA 1KKDA 2XAHA 1AROP 4DR4B 1RM1B 2UXBO 2F4VO 2YICA 4I7ZB 1LNQA 1K34A 4U3JA 4JZ2A 4W4LA 4AILC 2VQFO 1URFA 3FYEB 1N36O 3DXRB 4X65B 3D3IA 3ABMC 1XHZA 4JI8O 2PZSA 4TV8B 3BEHA 2DYRB 1AVMA 3JAKA 3ZMTA 3RWRD 4ZHQB 1NTMH 4LH7A 2Q5ZA 4ZI7A 1R3KC 2LW1A 2P6JA 2IJHA 1NKDA 4YHHO 1P84F 3HKCA 3TK1A 4U7OA 1AI6A 4EEQA 2H3OA 3PJSK 1M90W 3EVKA 3JARA 1JPXA 2L6LA 2UU9O 2E76B 1MZFA 4J9YB 1JQ0A 3TCUA 4RAIA 2Y48A 2EULA 1CPYA 4X1IA 3ETGA 4EB6A 1KKCA 4G2KA 4HAMA 5CB4A 1M5IA 1GTOA 2UXDO 5B1AB 2ZNJA 1LR1A 1FXKB 1Y6XA 5L3GA 5DECA 1AR4A 3X2QC 4F6RB 1VARA 1V54C 4JYYA 1GK9A 4BW5A 2VQEO 4YY3O 1SESA 2HLDG 1IXBA 1FFTB 1I94O 1M56C 1Q3EA 1BCCH 4DV7O 3RYHA 1JX9A 2HVJC 3U0ZA 3SPGA 2JK5C 4BAYA 5LGTA 4LP8A 1S3JA 1M1KW 3QO7A 4ZOLA 4PA7A 3E86A 5KUKA 5GONA 4MW3A 4X20A 3T1HO 1JJOA 1BSMA 1RFYA 3W7TA 1N8RW 3D3QA 1SA0B 3OAAG 2Z3YA 5J2TA 1FXVA 2RJZA 3LDDA 5LMUB 5KX5A 2ZM6B 5DM6V 3OEEG 2BOCC 4TQFA 1HNXO 3JATA 4KUMA 4KP4A 2NN4A 2EBOA 2Q6AA 4X88A 4I4TA 2V7QG 2JGDB 3RVYA 1RM1C 3IJ4A 1SQGA 2WLIB 2CH7B 1VQKV 2KG7A 2QWNB 3U11A 1H2NA 1TUEB 3G6EV 4K0KO 3B8NA 1AP5A 4J80A 2LQTA 4R8CA 3HPLC 1K3EA
chains in the Genus database with same CATH topology
4H33A 4BIZA 4MTGA 2DYSB 2DYRC 1K4DC 2HFEC 4MVOA 2UXNA 3ZMZA 1ZWIC 2P7TC 4G27B 3LDEA 3LNMB 1GM9A 2X0LA 5E1AC 1BHAA 4G28B 2WLJA 2D3OW 2Q69A 3E8BA 2JIZG 2ZDIC 4RUFA 1QVGU 1Q7YW 3LSSA 1BMFG 2QTOA 2ZD9A 1GMGA 2YSUB 1QLEB 1FXKA 3E35A 4LC1A 1VQMV 2FTKA 4PELA 2DQ0A 1DTOA 3NXSA 1H38A 2Y69C 3IGAC 2P90A 3RW0A 4JF3A 4ASUG 3ETDA 3SYOA 3AG2B 1VQPV 1AI7A 1OCRB 3I56V 1OZ0A 4QPKA 2WSSG 1VQ7V 1P4RA 2QEXV 4GX0A 1YI2V 5EK0A 2W6JG 3STLC 1VQ9V 5HFLA 2H8PC 1OCZB 1GO3F 4WFHA 3OMAB 3CCSV 5B1AC 1FXKC 2BOBC 3FB8C 4GCZA 5LHGA 1COWG 2XNDG 1B6QA 1CEZA 5EBLC 4X8AA 2B1GA 2LFRA 2A79B 4P9PA 4FPPA 2DWDC 5LGUA 3SPHA 3OUSA 5CBFA 3CC4V 3ZMUA 5L3DA 3LDCA 1G8MA 2WLKA 2ZR3A 3EFFK 1YTFB 5C93A 2EILB 3AG3C 1K8AW 1NR1A 2V1DA 3MD0A 1UJWB 2A9HA 4OXSA 5CBGA 2IJJA 3T2MA 1NR7A 2XAFA 5H6QA 4FJCC 2DW4A 4Z1MG 1AJPA 4MS2A 2UXXA 3FB6C 3OMNB 1AI5A 2ITDC 3K04A 4JYBA 2NLJC 1M9NA 4XDLA 1FXHA 4MVRA 2AHZA 1W0KG 5KUMA 3G4SV 1OCOB 4PA6A 3GWOA 4X89A 1VQLV 2EINC 1M57B 4ZKIA 4RO2A 5FL7G 1QR8A 2QKSA 3CCEV 4ZBMA 1QCEA 2GHYA 3ZN0A 2EIJB 1L1FA 1MG1A 3P30A 1K33A 3ABLB 4RQEA 2PI4A 1J95A 2M7WA 2LFSA 2EIKB 1JCHA 3CXCU 2CK3G 3CMEV 4JAUA 2WLIA 1R6KA 2HG5C 1MOFA 4PA4A 3SJQC 3ZRWA 3G71V 1I5XA 1YHQV 1VQ6V 3OE7G 2EZOA 5HFMA 1QLNA 4R7CA 2WLNA 5EBWC 3ZRVA 1YJ9V 1JJ2U 4QE9A 5L3CA 2H94A 4GT1A 1KP2A 4XBFA 3B77A 2Z5UA 3F7YC 4PA3A 1EBOA 2EIMB 4QE7A 1MABG 2ZQMA 3ASOB 1KC8W 2QM8A 1OHHG 4MTXA 4PDVA 4R50A 3ASOC 3JCZA 2NNUA 3CC7V 3E2EA 1PKXA 1V55B 2IH1C 3ZRSA 4CZZA 1K9MW 2X6AA 5B3SB 4PDLA 5IY5B 1MSWD 4QIWF 1VQOV 4TWKA 4UVBA 1WPXA 3SYCA 4WFEA 3ABMB 5B3SC 2DQ3A 3FYIB 5IDJA 4JTDB 2DYSC 5IY5C 3F5WC 1CP9A 3OM3B 4JTCB 1JVMA 1FS0G 3E83A 4JGSA 4QPJA 2WPDG 3CCLV 4L87A 3STZC 1NVPD 1I5YA 2X6CA 3OUFA 5IYDO 1VQ5V 1S5HC 4QJFB 4F4LA 5B1OA 1S0VA 3K79A 1GM7A 3W7WA 1THZA 2R9IA 2HR3A 4UVAA 1W2BU 3VBBA 2WLLB 1R3IC 5GW7A 2WLMA 3OEHG 1F51A 3RVZA 1QLEC 2ZXWB 5IYCO 4JYCA 3SPIA 4WFBV 2MK3A 3CPWU 3ML0A 5LBQA 1NVPB 1PNMA 2F43G 3UM7A 2ZXWC 1EFRG 2GSMB 4H37A 3AG2C 4MW8A 3DTUB 1H8EG 1OCRC 2B1IA 4I9WA 5DN6G 3IFXA 1ENVA 1YJWV 3ASNB 4QNHB 1YIJV 1OCZC 3ABUA 3P32A 3TETA 3W7SA 1HWYA 4FK5C 4JASA 2JDIG 4JTAB 4N21A 3ASNC 4R6ZA 4UV9A 3CCVV 2QE7G 1K5SA 3SYAA 2LP7A 3SPJA 1Q81W 3X2QB 5EC1C 3FKSG 1V54B 3JD1A 5B1NA 3JD4A 3W7XA 3CMAV 3GB7C 3T4DA 1QBZA 1K4CC 2EILC 1P7BA 4LCUC 3E8FA 4I5SA 3MHSC 1GKFA 2Q68A 4MTOA 4UUJC 3OW2U 1M56B 2ITCC 2P67A 1K73W 4MT8A 3K3WA 4CBCA 1JOYA 4FMTA 2XOKG 1ORQC 3JD0A 1E1RG 2YEVA 4WCEV 1VQ4V 2OT5A 4DXWA 2X7RB 3OMIB 4TT3G 1ROPA 4WF9V 1PD3A 1YJNV 2IW5A 4MSWC 1NBMG 3OR7C 3WFVA 3FB7C 2ATKC 1OCOC 1YSCA 3CYOA 2JEUA 1KD1W 1W0JG 2AHYA 3E8HA 2QM7A 1M57C 3T1CA 3OFNG 4PA9A 1E79G 3CCRV 2K1EA 1KP3A 3M99B 2EIJC 3DGEA 2W0FC 3HB3B 3QO8A 5IYBO 3ABLC 1XL6A 1PL0A 1EZJA 2IH3C 3JD2A 3CC2V 2EIKC 2R9RB 3EHBB 3ZCCA 4UXNA 2OCCB 1DF5A 3K0GA 3AG1B 1GM8A 4XDJA 2OTJV 1G4YB 1DLBA 1OCCB 3AG1C 5H9CA 3ZRXA 4UVCA 1K97A 4FIPC 1BL8A 3WG7B 4GX2A 1H8HG 3D36A 3ETEA 1K5QA 2W6IG 3FB5C 5L3FA 2HVKC 1Y4MA 5BZBA 4E2LA 1KKDA 2EIMC 4GX1A 2XAHA 1Y66A 1AROP 2JJ2G 1NH2D 1RM1B 3IC7A 5CN0A 3JD3A 5B1BB 1LNQA 1S72V 1K34A 5KA6A 2IJIA 1V55C 3CCMV 4YXWG 1R73A 3ABKB 3FYEB 3CD6V 1IXMA 2KB1A 2A0LA 1SRYA 3D3IA 3ABMC 1QVFU 2WLLA 4PDRA 3LSQA 3ZMSA 3ABTA 1AI4A 1NH2B 1KQSU 3BEHA 3UKMA 2DYRB 4KFMA 3ZMTA 2C2AA 2EJRA 3CCUV 1R3KC 2P6JA 4GX5A 4HYOA 5LHHA 2IJHA 2JEXA 4MVUA 1NKDA 4MTFA 3T4ZA 3TK1A 4U7OA 4WFFA 1AI6A 1K92A 3SYQA 3MHHC 3PJSK 1E1QG 1M90W 1NQTA 1JPXA 3SYPA 1Q82W 2Y69B 1NJIW 4UV8A 4J9YB 2XAJA 1JQ0A 4P9OA 3TCUA 4RAIA 3QO5A 3ZN1A 2Y48A 1VQ8V 1CPYA 3ETGA 3BY6A 4G2KA 4HAMA 1YITV 4BIUA 1SERA 4MVSA 3ZMVA 1WLEA 1GTOA 2IJKA 3SPCA 5B1AB 1YTFD 1FXKB 4JAVA 5KA5A 5L3GA 4WFGA 3QNEA 4MVQA 3X2QC 1VQNV 4EKWA 1R3LC 1BHBA 1V54C 3E8GA 4MVZA 1SETA 1GK9A 1AR1B 4BW5A 4LBEC 1SESA 1H2GA 2HLDG 5LHIA 5J9PC 5CMUA 1S76D 1FFTB 3JYCA 1F4MA 3AG3B 3ZIAG 4HZ3A 1M56C 4J9ZB 1SZTA 3CCJV 2DWEC 1Q86W 1RPRA 3AEIA 2OTLV 4JPRA 1F23A 4XDKA 1JX9A 2HVJC 5LGNA 3SPGA 4DO2A 2JK5C 4BAYA 5LGTA 2XAQA 1K7DA 3OR6C 4LP8A 5CBHA 5L3BA 4P2ZA 1S3JA 2HKOA 1PNKA 1M1KW 3QO7A 4PA7A 4WFAV 3E86A 2EINB 2IU3A 2WWWA 1AJNA 3KG2A 3CP1A 3E89A 4N23A 5KUKA 3LUTB 1KECA 3R65A 4MW3A 5EC2C 3VOUA 1XL4A 3K08A 2WAMA 4U7NA 3W7TA 2B5UA 1N8RW 4Q20A 3OAAG 2Z3YA 2OCCC 1PNLA 3K0DA 2HJFC 1FXVA 3I55V 2YEVB 2WLHA 2XAGA 2EZPA 3LDDA 3K9AA 5L3EA 1OCCC 1F4NA 2X6BA 5DM6V 3W7UA 3OEEG 2BOCC 2PI5A 3AG4B 3OGCC 3WG7C 4KUMA 1R3JC 4KP4A 5H6RA 4PDMA 2ZR2A 2EBOA 2Q6AA 4X88A 1S77D 4TSFG 3AG4C 2V7QG 3K06A 3RVYA 4MVMA 4RQFA 1RM1C 3K03A 3CCQV 2WLIB 5EBMC 5B1BC 1VQKV 3ZRWB 3H01A 3ZJZA 2QA4V 4P30A 1QR9A 3B8MA 1RPOA 1TUEB 2IU0A 3G6EV 3F7VC 3B8NA 5CA3A 4RUEA 3ABKC 3A0RA 1AJQA 2XASA 1R6NA 4R8CA 2ZDIA 3HPLC 2JJ1G 3RBZA 2Q67A 1K3EA 1DF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P67 A;  2WWW A;  4KP4 A;  4JYB A;  4MT8 A;  4LC1 A;  4BIZ A;  4FMT A;  1JOY A;  3P32 A;  2LFR A;  2FTK A;  3ZCC A;  4JAS A;  3NXS A;  3ZRV A;  4FPP A;  1F51 A;  4U7N A;  4BIU A;  3TK1 A;  4GT1 A;  4U7O A;  5IDJ A;  4JYC A;  4Q20 A;  3ZRW B;  4ZKI A;  5C93 A;  3ZRX A;  1IXM A;  4JAV A;  5B1N A;  3MD0 A;  4QPK A;  4QPJ A;  2QM8 A;  3D36 A;  2QM7 A;  4MTX A;  2LFS A;  3A0R A;  4JAU A;  4I5S A;  3DGE A;  4GCZ A;  3ZRW A;  5B1O A;  2C2A A; 
#chains in the Genus database with same CATH topology
 2QJ1 A;  4BIZ A;  2DYS B;  4DV1 O;  2DYR C;  2HFE C;  2RCV A;  1XMQ B;  5K1X A;  1XHX A;  3LDE A;  4G27 B;  5CA0 A;  2X0L A;  2JS3 A;  2Q69 A;  4JI5 B;  2ZDI C;  4RUF A;  1QVG U;  1VF7 A;  3CJH B;  2Q9L A;  1BMF G;  3CHX A;  2YXL A;  2ZD9 A;  2Q7G A;  1HR0 B;  4DR7 B;  1XBL A;  3HR0 A;  5BXZ A;  2FTK A;  1LUW A;  1JFF A;  1GN4 A;  2DQ0 A;  4PEL A;  3IGA C;  1MZE A;  4NR1 A;  1ZLZ A;  3APO A;  3ETD A;  4LF4 O;  4LF5 O;  4K8Z A;  5D5Q A;  1AI7 A;  1OCR B;  3I56 V;  1P4R A;  2QEX V;  2JGU A;  3AK1 A;  3OMA B;  5B1A C;  1FXK C;  2BOB C;  3R66 A;  2ZKO A;  5EYP A;  2GDS A;  5JH7 B;  4DV0 B;  4P9P A;  2DWD C;  5LGU A;  3CC4 V;  4NTY A;  3A0B Z;  5L3D A;  3RYF A;  1G8M A;  2WLK A;  3EFF K;  5C93 A;  4DV6 O;  4OX9 B;  4JAA A;  1NR1 A;  2V1D A;  4KXR A;  5H6Q A;  4FJC C;  5ITZ B;  2EX3 A;  1D5A A;  1AJP A;  4MS2 A;  2Y4U A;  2UXX A;  5JJN B;  4MVR A;  1FAF A;  1VQL V;  1EN6 A;  2JVD A;  4OPA A;  5FL7 G;  3T1Y B;  2QKS A;  4I0X A;  3CCE V;  1QCE A;  2EIJ B;  3CRA A;  2ADP A;  1MG1 A;  3ABL B;  2PI4 A;  4B3M B;  4YJ3 B;  2LFS A;  2EIK B;  4CH5 A;  3QF7 A;  2CK3 G;  4JAU A;  3G67 A;  5JVD B;  1YHQ V;  1VQ6 V;  2LGW A;  5JQG B;  1Z5V A;  1NTZ H;  4R7C A;  2W0X A;  1Y67 A;  4I55 A;  1YEW A;  4NYK A;  1YJ9 V;  2RDC A;  4GZR B;  2H94 A;  4GYC B;  2ZE7 A;  3O65 A;  3B40 A;  2BSK A;  4HNA B;  2FML A;  4X64 B;  5FNV A;  4DR1 B;  1A32 A;  2EIM B;  1MAB G;  4X1K B;  4DYL A;  3JAL B;  1QHT A;  4R50 A;  3ASO C;  3ZBH A;  3CB2 A;  3JSN A;  1TVK B;  1XIL A;  2NNU A;  3DC6 A;  4LFB B;  4CS3 A;  4CH4 A;  1KBH A;  3VQV A;  4CZZ A;  2X6A A;  1EN4 A;  1VIB A;  4UVB A;  3SYC A;  2CTW A;  4I9Q A;  3LNN A;  4AQY O;  2F66 C;  5IDJ A;  4JTD B;  2DYS C;  5IY5 C;  3L72 H;  1CP9 A;  1JVM A;  1WPB A;  3KCY A;  3CCL V;  3STZ C;  4EFB A;  2OWO A;  3OUF A;  4JI2 O;  4C7U A;  4QJF B;  5B1O A;  5C8Y A;  3RN4 A;  2GTS A;  2HHH O;  4LF7 B;  4WBN A;  1F51 A;  1IBM B;  3E22 A;  4NTW A;  5LYJ B;  1AP6 A;  1Q5O A;  4X62 O;  1PNM A;  2F43 G;  5LP6 A;  2ZXW C;  1HW7 A;  1BE3 H;  3F5T A;  3DTU B;  1OCR C;  4DR6 O;  5DN6 G;  1U96 A;  4QNH B;  5IT9 N;  3ABU A;  3P32 A;  1N34 B;  4UV9 A;  1ZX3 A;  1VF6 C;  4JI6 B;  4DV3 B;  2F23 A;  3H9V A;  4IHJ A;  3JAW B;  3CMA V;  4LFC O;  4IYH A;  4K35 A;  1K4C C;  4LCU C;  1MA1 A;  4UCT A;  4MTO A;  4PI0 A;  2ITC C;  4DUZ O;  2P67 A;  1NTK H;  3K3W A;  4MT8 A;  4CBC A;  4DV5 O;  3JD0 A;  1E1R G;  2YEV A;  4WCE V;  5GTI Z;  2X7R B;  4WF9 V;  4J41 A;  1YJN V;  5IWA O;  3FB7 C;  3O9O A;  4FLV A;  3CYO A;  3N2G B;  1W0J G;  1IVS A;  3OFN G;  4EFE A;  3CCR V;  3M99 B;  3JAS B;  2EIJ C;  2Q8V A;  3QO8 A;  2UXC O;  3ABL C;  3S3X A;  1PL0 A;  3IC9 A;  2EIK C;  3K5O A;  1R1B A;  4PV1 B;  4UXN A;  3BCC H;  1IBL B;  1WB7 A;  1KB9 F;  2Y0I A;  1Q6H A;  3AG1 C;  4YJ2 A;  4FIP C;  5FLX N;  3WG7 B;  3D36 A;  3ETE A;  3FB5 C;  1K5Q A;  2W6I G;  5L3F A;  4DR5 B;  2HVK C;  5IJ0 B;  2EIM C;  1WB8 A;  1N32 B;  3IC7 A;  3JD3 A;  1M93 A;  1S72 V;  2UUA O;  5KA6 A;  5KMG A;  3CCM V;  4J7J A;  1J5E B;  1IXM A;  1Y76 A;  4LF6 B;  2A06 H;  4LF8 O;  1QVF U;  3BVO A;  4DV4 B;  2WLL A;  1WP7 A;  2F93 B;  3L73 H;  1NH2 B;  3BA9 A;  4B3R O;  3CRQ A;  4KFM A;  2UUC B;  2FB5 A;  2C2A A;  2CGO A;  2P22 C;  3UQ8 A;  1XNQ O;  2F1M A;  4HYO A;  3A8T A;  2E5L B;  5EZY B;  2JEX A;  3CS5 A;  4MVU A;  5KAF Z;  1FFX B;  5KHK A;  3MHH C;  3SYP A;  4O4J B;  2OIG A;  2F95 B;  1FPO A;  2XAJ A;  2BE3 A;  3QO5 A;  4X9Q A;  4BWA A;  4PD4 F;  3L74 H;  1GN6 A;  4BIU A;  3UO2 A;  4MVS A;  1WLE A;  2IJK A;  4GKJ B;  5KA5 A;  4FZ1 A;  1AIL A;  4WFG A;  5GTH Z;  4EKW A;  4MVZ A;  4JI7 O;  1KUQ A;  1SET A;  4LF9 O;  1XOU A;  1H2G A;  5J9P C;  5CMU A;  1F4M A;  1XNR O;  4UCU A;  1YDX A;  1TUB B;  4HZ3 A;  1W59 A;  3CCJ V;  3HKB A;  1Y74 B;  3CX5 F;  3AEI A;  3CRC A;  4DUY B;  4XDK A;  2YXH A;  3AG7 A;  5L3B A;  3OR6 C;  4P2Z A;  4JI1 O;  2HKO A;  1DK1 A;  3K59 A;  3I5D A;  3KG2 A;  3E89 A;  4YIO A;  1XMO O;  4X1Y B;  1KEC A;  5EC2 C;  3K08 A;  2WAM A;  3TXQ A;  1XI1 A;  4GKK O;  3I55 V;  2XAG A;  2EZP A;  5L3E A;  2X6B A;  3W7U A;  4JV5 O;  1FD9 A;  3DC5 A;  5BMV B;  2PI5 A;  3WG7 C;  3DXR A;  2XUM A;  5IJ9 B;  5H6R A;  1NT2 B;  4KHP O;  4JI3 O;  4TSF G;  1SQV H;  4MVM A;  4RQF A;  1ZTE A;  3H01 A;  3ZJZ A;  4ZHQ A;  4CC6 A;  3THO A;  3B8M A;  3OTO B;  3A0R A;  1IBK B;  1R6N A;  2ZDI A;  3B09 A;  2Q67 A;  4O2B B;  1HNZ B;  2QKA A;  5J2U B;  4MTG A;  1FKA O;  4MVO A;  4B3T O;  2UXN A;  3ZMZ A;  5JWP A;  4Z1V A;  2P7T C;  3M8A A;  1G1X B;  5E1A C;  1WJZ A;  3E8B A;  5LL6 Y;  2PUS A;  3LSS A;  2QTO A;  4X66 B;  3HKE A;  1QQC A;  5KAI Z;  2YSU B;  1FXK A;  4LC1 A;  4CC5 A;  3ZHS A;  1DTO A;  3NXS A;  5KHG A;  5JCO C;  2P90 A;  5LMN O;  3RW0 A;  4F6R A;  4FFB A;  4ASU G;  1YXB A;  1YCI A;  4DR3 O;  4FM2 A;  5E79 Z;  5B5E Z;  2QM4 A;  4GX0 A;  1L0N H;  5LXT B;  4UB8 Z;  3STL C;  1VQ9 V;  2H8P C;  1OCZ B;  1VF5 B;  5LHG A;  2ZE5 A;  4X8A A;  2B1G A;  2A79 B;  4UCS A;  4FPP A;  4PI2 A;  5CBF A;  3OUS A;  3UT5 B;  1KYO F;  5FPO A;  3KZI Z;  5H5N A;  1K8A W;  3OGI B;  1UJW B;  1VEW A;  1P7G A;  4DV2 O;  1MNG A;  3CE2 A;  1NR7 A;  3G80 A;  2DW4 A;  1QU7 A;  1SA0 A;  2IM9 A;  2P4V A;  5BR8 B;  1AI5 A;  2ITD C;  2NLJ C;  1M9N A;  5K1P A;  1BZK A;  1BQZ A;  1OCO B;  5A2Q N;  3H1H H;  1KMI Z;  2ODM A;  2UUB O;  4B7E A;  1M57 B;  2PF4 E;  4FLZ A;  1MMM A;  1QR8 A;  1RSO B;  2GHY A;  3ZN0 A;  1L1F A;  2YDE A;  3P30 A;  4RQE A;  2JGD A;  3ETQ A;  4UFZ A;  2LGQ A;  2WLI A;  2CH7 A;  4JZG A;  3TXS A;  1R6K A;  1MOF A;  4PA4 A;  3SJQ C;  1I5X A;  2DJV A;  3OE7 G;  5HFM A;  4LWS B;  3BRC A;  3ZRV A;  3QG5 A;  4DRX B;  4FFK A;  4IYI A;  2RN9 A;  4ZOL B;  1KP2 A;  5CA1 B;  4PA3 A;  2CTP A;  1S5J A;  3MAQ A;  4QE7 A;  2ZQM A;  3ASO B;  4TV9 A;  2QM8 A;  1OHH G;  4JYA O;  2Q7H A;  4MTX A;  4AI8 A;  2K9P A;  3JCZ A;  3FFQ A;  3ZX6 A;  1SQF A;  3E2E A;  2WA3 A;  1V55 B;  2KKW A;  1JA8 A;  4JI0 B;  5IY5 B;  1MSW D;  4QIW F;  4TWK A;  1SQX H;  3H1K H;  4ICG A;  4WFE A;  3CJH A;  2DQ3 A;  3FYI B;  1D5N A;  2RNB A;  4NXM B;  2PYL A;  2X6C A;  2QTS A;  1VQ5 V;  4F4L A;  3RFR A;  1SS3 A;  1S0V A;  3K79 A;  1GM7 A;  2XT9 A;  1EZV H;  2R9I A;  3VBB A;  1R3I C;  5GW7 A;  4JI4 O;  4UCR A;  1H2K A;  3IAY A;  2ZXW B;  3SPI A;  4D6T H;  1NVP B;  3N2K B;  5JH7 A;  1FJG B;  3P3N A;  2PGG A;  2GSM B;  1H8E G;  2B1I A;  2QWR B;  1BT8 A;  1OCZ C;  3W7S A;  4N21 A;  3ASN C;  5IE9 A;  4CH6 A;  1B06 A;  2Y4T A;  1UFI A;  2QE7 G;  3GWK C;  2LW7 A;  1K5S A;  1Q81 W;  1HNW O;  5B1N A;  1IDS A;  3WB2 A;  3CSX A;  2AXT Z;  2ZIN A;  4DR4 O;  1SZX A;  2D2C B;  3OW2 U;  3OTF A;  1ORQ C;  4J10 A;  5D5P A;  3UCS C;  1O9G A;  2EJ7 A;  4DK0 A;  4DXW A;  3OMI B;  4YJ3 A;  4FLX A;  1OJH A;  4MSW C;  2PY5 A;  5JVD A;  2ATK C;  1OCO C;  4X65 O;  2R9A A;  1YSC A;  5JQG A;  2JEU A;  3TJT A;  1KD1 W;  2RMK B;  2QM7 A;  1M57 C;  3A2F A;  4HNA A;  2CAZ C;  1NS1 A;  2R9R B;  3NR7 A;  3ZCC A;  3Q4H B;  4X1K A;  4O4L B;  3AG1 B;  1GM8 A;  1M4U A;  4CS2 A;  3JAL A;  3HKD B;  3SDL A;  5FPR A;  1DLB A;  1TVK A;  3K5M A;  2FL4 A;  2ZCE A;  4K3A A;  3ZRX A;  4FM0 A;  4DR2 B;  1BL8 A;  1TAE A;  4GX1 A;  1Y66 A;  1OV9 A;  1NH2 D;  2QSA A;  5CN0 A;  5B1B B;  4FZ0 A;  1V55 C;  1TA8 A;  5JJE B;  3CD6 V;  3ABK B;  4NXN B;  4RWU A;  3C3T A;  1GRJ A;  1N33 B;  4LFA B;  3ZMS A;  2BSK B;  1KQS U;  3RGB A;  5FNV B;  2QWQ B;  5LYJ A;  3EXA A;  1LUV A;  2EJR A;  4TOI A;  1VMG A;  3CCU V;  4GX5 A;  5LHH A;  4AHC A;  3DSQ A;  4B3S B;  2QGN A;  4MTF A;  3T4Z A;  4IIJ A;  1K92 A;  3SYQ A;  1IZ3 A;  1E1Q G;  1NQT A;  2YIB D;  2DOS A;  2XHB A;  2Y69 B;  1NJI W;  2A7W A;  4UV8 A;  4HBN A;  3SGI A;  2UXB B;  2F4V B;  3JAW A;  3BY6 A;  1B3Q A;  3FAV B;  3ZMV A;  4GUN A;  2VQF B;  2QKC A;  1N36 B;  3RYI B;  2MW2 B;  2JRI A;  2PTM A;  4NVP A;  5LMU O;  3QNE A;  2P5O A;  2ZM6 O;  3MDS A;  1VQN V;  1R3L C;  4JI8 B;  1SC5 B;  5KHH A;  1AR1 B;  1YVW A;  5LP6 B;  3UO3 A;  4LBE C;  4LNU B;  5LHI A;  1NU1 H;  3JYC A;  3AG3 B;  3ZIA G;  1PPJ H;  3G6B A;  4YHH B;  4J9Z B;  1WNS A;  3JAS A;  2DWE C;  1S5L Z;  4FLT A;  4JPR A;  1KU9 A;  5LGN A;  4DO2 A;  2CTQ A;  5IYZ A;  3VQX A;  2UU9 B;  1RP3 B;  4WFA V;  2EIN B;  2IU3 A;  4N23 A;  1AJN A;  3JCU Z;  3R65 A;  3VOU A;  1XMQ O;  5IJ0 A;  4U7N A;  1SKV A;  1PNL A;  3CRR A;  2UXD B;  2YEV B;  3ZS8 C;  3BFR A;  4JI5 O;  1F4N A;  1Q90 D;  1HR0 O;  4DR7 O;  2IBZ H;  4FM1 A;  2VQE B;  3AK3 A;  4YY3 B;  1R3J C;  4TUY B;  4PDM A;  2ZR2 A;  4O4I A;  3AG4 C;  4F6E A;  3K03 A;  3CCQ V;  1I94 B;  5EBM C;  5B1B C;  3ZRW B;  3CXH F;  2QA4 V;  4DV7 B;  1QR9 A;  2YC0 A;  1RPO A;  2A3Q A;  5EZY A;  3ABK C;  1IUR A;  4DK1 A;  1AJQ A;  2ZE8 A;  2XAS A;  4U3F H;  2JJ1 G;  3RBZ A;  1FFX A;  4H33 A;  4DV0 O;  1GN2 A;  1JR9 A;  3T1H B;  4D7T A;  4OX9 O;  1ZWI C;  3U10 A;  4G28 B;  4O4H A;  1Q7Y W;  3H1J H;  4I50 B;  5JJJ B;  1GMG A;  1HNX B;  4FLY A;  2ZE6 A;  4Z2W A;  1VQM V;  1X59 A;  1HDJ A;  2Y69 C;  1XDC A;  2FKX A;  3SYO A;  3T1Y O;  3AG2 B;  2ZT9 B;  1OZ0 A;  4QPK A;  1G6U A;  1I7F A;  2OCH A;  2Q7E A;  4B3M O;  5EK0 A;  3L9D A;  4K0K B;  2W6J G;  4J7Z A;  2BTQ B;  2GTA A;  4WFH A;  1GO3 F;  1TUB A;  3CCS V;  2CUG A;  4GCZ A;  2XND G;  2ZIM A;  3L71 H;  2GBO A;  1CEZ A;  1SQQ H;  3H1L H;  2LFR A;  4DV1 B;  3JAM N;  3SPH A;  1AR5 A;  5LP6 C;  4X64 O;  4NTX A;  2ZR3 A;  5LA6 B;  4K8X A;  4IL6 Z;  4H44 B;  4DR1 O;  2EIL B;  3AG3 C;  3ZHQ A;  3MD0 A;  2A9H A;  4OXS A;  4X1Y A;  4O2A B;  3QVN A;  3T2M A;  2XAF A;  2Q4P A;  4LFB O;  1WP8 A;  1IX9 A;  2N04 A;  3FB6 C;  2YID A;  3G4S V;  4PA6 A;  3GWO A;  1L0L H;  4X89 A;  2EIN C;  2CE4 A;  5BMV A;  4LF4 B;  4TQD A;  4RO2 A;  5LOV B;  4LF5 B;  3H1I H;  1GN3 A;  5IJ9 A;  1K33 A;  1WA8 B;  4ZIB A;  3CXC U;  3RYC B;  2GUZ B;  1BQ0 A;  2V4D A;  3G71 V;  3BA8 A;  3ZHU A;  4LF7 O;  2AW9 A;  5EBW C;  2Z0A A;  1US6 A;  4QE9 A;  1IBM O;  3P3P A;  4XBF A;  3B77 A;  4TV8 A;  3F7Y C;  5AG2 A;  4O2B A;  1PP9 H;  4DV6 B;  1EBO A;  1KC8 W;  3FD9 A;  2VRZ A;  1Q6I A;  4OPH A;  1T5E A;  4PDV A;  3CWB H;  1X4T A;  3CC7 V;  1PKX A;  4UCV A;  1K9M W;  1ZL8 B;  1EN5 A;  1N34 O;  1VQO V;  1Q6U A;  2LO1 A;  3ZED A;  5B3S C;  4DV3 O;  4JI6 O;  2YIA A;  3D36 C;  2FYU H;  4JTC B;  5H2F Z;  2G38 A;  3N27 A;  4U3J B;  4L87 A;  3SJC C;  1NVP D;  3TGU H;  5IYD O;  1BS3 A;  1S5H C;  1SF9 A;  3W7W A;  1THZ A;  1W2B U;  5LXT A;  1PV0 A;  1Q43 A;  5DED A;  4PJ0 Z;  3JAK B;  4WFB V;  4A5U B;  2MK3 A;  3CPW U;  3ML0 A;  5LBQ A;  4ZI7 B;  3UM7 A;  1XQ8 A;  4DW1 A;  3UT5 A;  3AG2 C;  4MW8 A;  1CXZ B;  1AB3 A;  3HKC B;  2R70 A;  4I9W A;  1ENV A;  1YJW V;  3ASN B;  5BY1 A;  1XUQ A;  1HWY A;  1IBL O;  4BIO A;  3JAR B;  1NZ6 A;  4JTA B;  4R6Z A;  3HKE B;  3BAB A;  4AQY B;  3SYA A;  3SPJ A;  2VWJ A;  5EC1 C;  4Q6G A;  1V9P A;  3JD1 A;  3W7X A;  3JD4 A;  4DR5 O;  4X1I B;  3GB7 C;  4FFB B;  4EB6 B;  5CB4 B;  5B66 Z;  4JI2 B;  2EIL C;  4D7S A;  2DE0 X;  3MHS C;  1N32 O;  2Q68 A;  4UUJ C;  1RSO A;  1K73 W;  4FMT A;  2HHH B;  2OT5 A;  3C90 A;  1ROP A;  2IW5 A;  1J5E O;  1NBM G;  3OR7 C;  4LF6 O;  4X62 B;  3M7M X;  4NKG B;  3SR2 C;  2VWK A;  4LWS A;  1MSD A;  4DV4 O;  2AHY A;  3E8H A;  3SJA C;  1NI8 A;  3T1C A;  2O57 A;  4DRX A;  1KP3 A;  3DGE A;  5CA1 A;  2W0F C;  2UUC O;  4DR6 B;  2KSD A;  3WU2 Z;  4FVM A;  1XL6 A;  3RYH B;  3B4S A;  1EZJ A;  3JD2 A;  1L8D A;  4E4E A;  3GVM A;  3CEI A;  2E5L O;  2OCC B;  3K0G A;  1N0J A;  4DW0 A;  4XDJ A;  1G4Y B;  1OCC B;  2DMX A;  4UVC A;  3BAA A;  5GON B;  4X20 B;  2P4K A;  4LFC B;  3ZHT A;  1ZSP A;  4E2L A;  3LSU A;  1Z5W A;  5J2T B;  2JJ2 G;  4DUZ B;  2ARH A;  3J80 N;  4DV5 B;  4H0L B;  2ETN A;  4NB5 A;  3QTC A;  2IJI A;  5KX5 B;  4YXW G;  1EM1 A;  2YI9 A;  1R73 A;  5IWA B;  3JAT B;  2KB1 A;  4GKJ O;  2A0L A;  2L35 A;  1SRY A;  4I4T B;  4PDR A;  3LSQ A;  1SQB H;  3ABT A;  1AI4 A;  3UKM A;  3B2E E;  2UXC B;  2KG7 B;  4TV9 B;  1H2L A;  3N2K A;  2JS5 A;  4WFF A;  1TGO A;  4DUY O;  1VF6 A;  1Z2G A;  2P06 A;  1Q82 W;  2YS8 A;  1WN7 A;  4P9O A;  5CA0 B;  1BGY H;  2QR4 A;  3ZN1 A;  1VQ8 V;  4B7K A;  2UUA B;  1YIT V;  1SER A;  2BCC H;  5ITZ A;  5KHJ A;  2CDY A;  2N05 A;  3SPC A;  1YTF D;  4JAV A;  1JFF B;  4LR3 A;  1FYJ A;  1Q8I A;  4LF8 B;  4MVQ A;  2WA4 A;  1BHB A;  3E8G A;  2R72 A;  2XTA A;  4B3R B;  1H2M A;  2ADQ B;  3ZHR A;  1XNQ B;  1S76 D;  3WB0 A;  2E75 B;  1SZT A;  5EYP B;  1Q86 W;  1RPR A;  1XEQ A;  2QWP B;  2OTL V;  1F23 A;  3OTO O;  3Q4H A;  2XAQ A;  3BHP A;  1K7D A;  4O4L A;  1I0H A;  5CBH A;  1IBK O;  3AK2 A;  1PNK A;  3RYF B;  3HKD A;  1HNZ O;  2Q0O C;  2WWW A;  3WB1 A;  3CP1 A;  3LUT B;  1JMK C;  1XL4 A;  2OYQ A;  2Y0P A;  2B5U A;  5TIS Z;  4Q20 A;  2OCC C;  2E74 B;  3K0D A;  2HJF C;  2WLH A;  2ZNI A;  2DN9 A;  2HEP A;  3K9A A;  1YZB A;  1OCC C;  4UB6 Z;  4X66 O;  1UPG A;  4JI7 B;  3AG4 B;  3OGC C;  4LF9 B;  4I0X B;  1S77 D;  3K06 A;  1XNR B;  1R6T A;  3VQY A;  5EIB C;  4P30 A;  1F7Y A;  2CGN A;  4I55 B;  2IU0 A;  3F7V C;  5CA3 A;  4RUE A;  4KL1 A;  4JI1 B;  1DGS A;  1B04 A;  4GLX A;  1U97 A;  1DF4 A;  5KLV H;  1XMO B;  1VP7 A;  1K4D C;  2CTR A;  4IGG A;  2E3C A;  2OIE A;  2KQX A;  3LNM B;  1GM9 A;  4GKK B;  2ZIO A;  1BHA A;  2WLJ A;  2D3O W;  2JIZ G;  4JV5 B;  3PN1 A;  3KKY A;  3FAV A;  5BR8 O;  3RYI A;  1QLE B;  3E35 A;  4KHP B;  1H38 A;  4JI3 B;  4JF3 A;  2N74 A;  1VQP V;  2PYJ A;  5C8Y B;  2QWO B;  2M6Y A;  4LNU A;  2WSS G;  1VQ7 V;  4WBN B;  1YI2 V;  4CH3 A;  5HFL A;  4IIJ B;  1YF2 A;  1O9H A;  3FB8 C;  3E22 B;  1COW G;  1B6Q A;  1N0N A;  3BPZ A;  5EBL C;  3K58 A;  3N2G A;  4YIP A;  3ZMU A;  1PM9 A;  2YUA A;  3LDC A;  3VQW A;  1YTF B;  4B3T B;  2VS0 A;  4PHZ A;  2AGA A;  4H13 B;  5CBG A;  2IJJ A;  4Z1M G;  5KHI A;  2AZ0 A;  4JI0 O;  3OMN B;  3K04 A;  4JYB A;  4IHJ B;  4XDL A;  1FXH A;  2AHZ A;  1W0K G;  5KUM A;  1ZUQ A;  5LMN B;  2B9Z A;  4UCO A;  2RQ6 A;  3RT3 C;  4DR3 B;  4ZKI A;  4ZBM A;  4TUY A;  3D8C A;  4NXM O;  2BTO A;  1WAZ A;  4CS4 A;  1N4C A;  1J95 A;  2M7W A;  1JCH A;  3CME V;  1XRE A;  4BR6 A;  2HG5 C;  1P49 A;  3ZRW A;  2EZO A;  5IYZ B;  1QLN A;  2WLN A;  1JJ2 U;  5L3C A;  3J7A U;  4GT1 A;  3K9S A;  2Z5U A;  4FLU A;  1ZAU A;  1FJG O;  3OD4 A;  4DV2 B;  5F2V O;  3SJB C;  2HP8 A;  2IH1 C;  4YJ2 B;  2YI8 A;  3ZRS A;  1H2S B;  5B3S B;  1D2D A;  4PDL A;  1WPX A;  3OT7 A;  2Q0A A;  4O4J A;  3ABM B;  4FLW A;  1SQP H;  2UUB B;  4B08 A;  4I50 A;  3F5W C;  5JCO A;  3OM3 B;  4O4I B;  3K5L A;  1FS0 G;  3E83 A;  4JGS A;  4QPJ A;  2WPD G;  1GH6 A;  1I08 A;  1I5Y A;  4BW9 A;  5KMG B;  1Y76 B;  3JSL A;  2HR3 A;  3ICX A;  4UVA A;  2YIB A;  4J11 A;  2WLL B;  1GAX A;  3L75 H;  4ABM A;  2BTQ A;  2WLM A;  3OEH G;  3RVZ A;  1HP8 A;  1QLE C;  5IYC O;  4JYC A;  4LH6 A;  2AZ2 A;  2YXY A;  1EFR G;  2ILM A;  4JYA B;  4H37 A;  3ZHV A;  2NR5 A;  4J7K A;  2GV9 A;  3K5N A;  5LA6 A;  3IFX A;  1Y74 A;  1YIJ V;  3TET A;  4O4H B;  4FK5 C;  4JAS A;  2JDI G;  4O2A A;  1PL4 A;  3CCV V;  2LP7 A;  3X2Q B;  3FKS G;  1V54 B;  4DR2 O;  3C3S A;  3CRM A;  4IT5 A;  1QNM A;  3T4D A;  1QBZ A;  2LJ2 A;  1P7B A;  3E8F A;  4I5S A;  3J81 N;  4QGP A;  1GKF A;  5LOV A;  1M56 B;  1JOY A;  2XOK G;  1WA8 A;  5A9G A;  1VQ4 V;  4TT3 G;  3K57 A;  4JI4 B;  1PD3 A;  3APQ A;  2HJD A;  4L8J A;  4NXN O;  3WFV A;  2GUZ A;  3L70 H;  3RYC A;  1N33 O;  3KCX A;  4LFA O;  4PA9 A;  1E79 G;  2K1E A;  3FX7 A;  3HKB B;  3HB3 B;  5IYB O;  4OGQ B;  2IH3 C;  3CC2 V;  2QDO A;  3A0H Z;  3EHB B;  1DF5 A;  4B3S O;  2Q73 A;  4W4K A;  5EIB D;  2OTJ V;  5H9C A;  4J42 A;  3S3W A;  1K97 A;  1ZL8 A;  1HNW B;  5J2U A;  4GX2 A;  1H8H G;  1Y4M A;  5BZB A;  1KKD A;  2XAH A;  1ARO P;  4DR4 B;  1RM1 B;  2UXB O;  2F4V O;  2YIC A;  4I7Z B;  1LNQ A;  1K34 A;  4U3J A;  4JZ2 A;  4W4L A;  4AIL C;  2VQF O;  1URF A;  3FYE B;  1N36 O;  3DXR B;  4X65 B;  3D3I A;  3ABM C;  1XHZ A;  4JI8 O;  2PZS A;  4TV8 B;  3BEH A;  2DYR B;  1AVM A;  3JAK A;  3ZMT A;  3RWR D;  4ZHQ B;  1NTM H;  4LH7 A;  2Q5Z A;  4ZI7 A;  1R3K C;  2LW1 A;  2P6J A;  2IJH A;  1NKD A;  4YHH O;  1P84 F;  3HKC A;  3TK1 A;  4U7O A;  1AI6 A;  4EEQ A;  2H3O A;  3PJS K;  1M90 W;  3EVK A;  3JAR A;  1JPX A;  2L6L A;  2UU9 O;  2E76 B;  1MZF A;  4J9Y B;  1JQ0 A;  3TCU A;  4RAI A;  2Y48 A;  2EUL A;  1CPY A;  4X1I A;  3ETG A;  4EB6 A;  1KKC A;  4G2K A;  4HAM A;  5CB4 A;  1M5I A;  1GTO A;  2UXD O;  5B1A B;  2ZNJ A;  1LR1 A;  1FXK B;  1Y6X A;  5L3G A;  5DEC A;  1AR4 A;  3X2Q C;  4F6R B;  1VAR A;  1V54 C;  4JYY A;  1GK9 A;  4BW5 A;  2VQE O;  4YY3 O;  1SES A;  2HLD G;  1IXB A;  1FFT B;  1I94 O;  1M56 C;  1Q3E A;  1BCC H;  4DV7 O;  3RYH A;  1JX9 A;  2HVJ C;  3U0Z A;  3SPG A;  2JK5 C;  4BAY A;  5LGT A;  4LP8 A;  1S3J A;  1M1K W;  3QO7 A;  4ZOL A;  4PA7 A;  3E86 A;  5KUK A;  5GON A;  4MW3 A;  4X20 A;  3T1H O;  1JJO A;  1BSM A;  1RFY A;  3W7T A;  1N8R W;  3D3Q A;  1SA0 B;  3OAA G;  2Z3Y A;  5J2T A;  1FXV A;  2RJZ A;  3LDD A;  5LMU B;  5KX5 A;  2ZM6 B;  5DM6 V;  3OEE G;  2BOC C;  4TQF A;  1HNX O;  3JAT A;  4KUM A;  4KP4 A;  2NN4 A;  2EBO A;  2Q6A A;  4X88 A;  4I4T A;  2V7Q G;  2JGD B;  3RVY A;  1RM1 C;  3IJ4 A;  1SQG A;  2WLI B;  2CH7 B;  1VQK V;  2KG7 A;  2QWN B;  3U11 A;  1H2N A;  1TUE B;  3G6E V;  4K0K O;  3B8N A;  1AP5 A;  4J80 A;  2LQT A;  4R8C A;  3HPL C;  1K3E A; 
#chains in the Genus database with same CATH homology
 4H33 A;  4BIZ A;  4MTG A;  2DYS B;  2DYR C;  1K4D C;  2HFE C;  4MVO A;  2UXN A;  3ZMZ A;  1ZWI C;  2P7T C;  4G27 B;  3LDE A;  3LNM B;  1GM9 A;  2X0L A;  5E1A C;  1BHA A;  4G28 B;  2WLJ A;  2D3O W;  2Q69 A;  3E8B A;  2JIZ G;  2ZDI C;  4RUF A;  1QVG U;  1Q7Y W;  3LSS A;  1BMF G;  2QTO A;  2ZD9 A;  1GMG A;  2YSU B;  1QLE B;  1FXK A;  3E35 A;  4LC1 A;  1VQM V;  2FTK A;  4PEL A;  2DQ0 A;  1DTO A;  3NXS A;  1H38 A;  2Y69 C;  3IGA C;  2P90 A;  3RW0 A;  4JF3 A;  4ASU G;  3ETD A;  3SYO A;  3AG2 B;  1VQP V;  1AI7 A;  1OCR B;  3I56 V;  1OZ0 A;  4QPK A;  2WSS G;  1VQ7 V;  1P4R A;  2QEX V;  4GX0 A;  1YI2 V;  5EK0 A;  2W6J G;  3STL C;  1VQ9 V;  5HFL A;  2H8P C;  1OCZ B;  1GO3 F;  4WFH A;  3OMA B;  3CCS V;  5B1A C;  1FXK C;  2BOB C;  3FB8 C;  4GCZ A;  5LHG A;  1COW G;  2XND G;  1B6Q A;  1CEZ A;  5EBL C;  4X8A A;  2B1G A;  2LFR A;  2A79 B;  4P9P A;  4FPP A;  2DWD C;  5LGU A;  3SPH A;  3OUS A;  5CBF A;  3CC4 V;  3ZMU A;  5L3D A;  3LDC A;  1G8M A;  2WLK A;  2ZR3 A;  3EFF K;  1YTF B;  5C93 A;  2EIL B;  3AG3 C;  1K8A W;  1NR1 A;  2V1D A;  3MD0 A;  1UJW B;  2A9H A;  4OXS A;  5CBG A;  2IJJ A;  3T2M A;  1NR7 A;  2XAF A;  5H6Q A;  4FJC C;  2DW4 A;  4Z1M G;  1AJP A;  4MS2 A;  2UXX A;  3FB6 C;  3OMN B;  1AI5 A;  2ITD C;  3K04 A;  4JYB A;  2NLJ C;  1M9N A;  4XDL A;  1FXH A;  4MVR A;  2AHZ A;  1W0K G;  5KUM A;  3G4S V;  1OCO B;  4PA6 A;  3GWO A;  4X89 A;  1VQL V;  2EIN C;  1M57 B;  4ZKI A;  4RO2 A;  5FL7 G;  1QR8 A;  2QKS A;  3CCE V;  4ZBM A;  1QCE A;  2GHY A;  3ZN0 A;  2EIJ B;  1L1F A;  1MG1 A;  3P30 A;  1K33 A;  3ABL B;  4RQE A;  2PI4 A;  1J95 A;  2M7W A;  2LFS A;  2EIK B;  1JCH A;  3CXC U;  2CK3 G;  3CME V;  4JAU A;  2WLI A;  1R6K A;  2HG5 C;  1MOF A;  4PA4 A;  3SJQ C;  3ZRW A;  3G71 V;  1I5X A;  1YHQ V;  1VQ6 V;  3OE7 G;  2EZO A;  5HFM A;  1QLN A;  4R7C A;  2WLN A;  5EBW C;  3ZRV A;  1YJ9 V;  1JJ2 U;  4QE9 A;  5L3C A;  2H94 A;  4GT1 A;  1KP2 A;  4XBF A;  3B77 A;  2Z5U A;  3F7Y C;  4PA3 A;  1EBO A;  2EIM B;  4QE7 A;  1MAB G;  2ZQM A;  3ASO B;  1KC8 W;  2QM8 A;  1OHH G;  4MTX A;  4PDV A;  4R50 A;  3ASO C;  3JCZ A;  2NNU A;  3CC7 V;  3E2E A;  1PKX A;  1V55 B;  2IH1 C;  3ZRS A;  4CZZ A;  1K9M W;  2X6A A;  5B3S B;  4PDL A;  5IY5 B;  1MSW D;  4QIW F;  1VQO V;  4TWK A;  4UVB A;  1WPX A;  3SYC A;  4WFE A;  3ABM B;  5B3S C;  2DQ3 A;  3FYI B;  5IDJ A;  4JTD B;  2DYS C;  5IY5 C;  3F5W C;  1CP9 A;  3OM3 B;  4JTC B;  1JVM A;  1FS0 G;  3E83 A;  4JGS A;  4QPJ A;  2WPD G;  3CCL V;  4L87 A;  3STZ C;  1NVP D;  1I5Y A;  2X6C A;  3OUF A;  5IYD O;  1VQ5 V;  1S5H C;  4QJF B;  4F4L A;  5B1O A;  1S0V A;  3K79 A;  1GM7 A;  3W7W A;  1THZ A;  2R9I A;  2HR3 A;  4UVA A;  1W2B U;  3VBB A;  2WLL B;  1R3I C;  5GW7 A;  2WLM A;  3OEH G;  1F51 A;  3RVZ A;  1QLE C;  2ZXW B;  5IYC O;  4JYC A;  3SPI A;  4WFB V;  2MK3 A;  3CPW U;  3ML0 A;  5LBQ A;  1NVP B;  1PNM A;  2F43 G;  3UM7 A;  2ZXW C;  1EFR G;  2GSM B;  4H37 A;  3AG2 C;  4MW8 A;  3DTU B;  1H8E G;  1OCR C;  2B1I A;  4I9W A;  5DN6 G;  3IFX A;  1ENV A;  1YJW V;  3ASN B;  4QNH B;  1YIJ V;  1OCZ C;  3ABU A;  3P32 A;  3TET A;  3W7S A;  1HWY A;  4FK5 C;  4JAS A;  2JDI G;  4JTA B;  4N21 A;  3ASN C;  4R6Z A;  4UV9 A;  3CCV V;  2QE7 G;  1K5S A;  3SYA A;  2LP7 A;  3SPJ A;  1Q81 W;  3X2Q B;  5EC1 C;  3FKS G;  1V54 B;  3JD1 A;  5B1N A;  3JD4 A;  3W7X A;  3CMA V;  3GB7 C;  3T4D A;  1QBZ A;  1K4C C;  2EIL C;  1P7B A;  4LCU C;  3E8F A;  4I5S A;  3MHS C;  1GKF A;  2Q68 A;  4MTO A;  4UUJ C;  3OW2 U;  1M56 B;  2ITC C;  2P67 A;  1K73 W;  4MT8 A;  3K3W A;  4CBC A;  1JOY A;  4FMT A;  2XOK G;  1ORQ C;  3JD0 A;  1E1R G;  2YEV A;  4WCE V;  1VQ4 V;  2OT5 A;  4DXW A;  2X7R B;  3OMI B;  4TT3 G;  1ROP A;  4WF9 V;  1PD3 A;  1YJN V;  2IW5 A;  4MSW C;  1NBM G;  3OR7 C;  3WFV A;  3FB7 C;  2ATK C;  1OCO C;  1YSC A;  3CYO A;  2JEU A;  1KD1 W;  1W0J G;  2AHY A;  3E8H A;  2QM7 A;  1M57 C;  3T1C A;  3OFN G;  4PA9 A;  1E79 G;  3CCR V;  2K1E A;  1KP3 A;  3M99 B;  2EIJ C;  3DGE A;  2W0F C;  3HB3 B;  3QO8 A;  5IYB O;  3ABL C;  1XL6 A;  1PL0 A;  1EZJ A;  2IH3 C;  3JD2 A;  3CC2 V;  2EIK C;  2R9R B;  3EHB B;  3ZCC A;  4UXN A;  2OCC B;  1DF5 A;  3K0G A;  3AG1 B;  1GM8 A;  4XDJ A;  2OTJ V;  1G4Y B;  1DLB A;  1OCC B;  3AG1 C;  5H9C A;  3ZRX A;  4UVC A;  1K97 A;  4FIP C;  1BL8 A;  3WG7 B;  4GX2 A;  1H8H G;  3D36 A;  3ETE A;  1K5Q A;  2W6I G;  3FB5 C;  5L3F A;  2HVK C;  1Y4M A;  5BZB A;  4E2L A;  1KKD A;  2EIM C;  4GX1 A;  2XAH A;  1Y66 A;  1ARO P;  2JJ2 G;  1NH2 D;  1RM1 B;  3IC7 A;  5CN0 A;  3JD3 A;  5B1B B;  1LNQ A;  1S72 V;  1K34 A;  5KA6 A;  2IJI A;  1V55 C;  3CCM V;  4YXW G;  1R73 A;  3ABK B;  3FYE B;  3CD6 V;  1IXM A;  2KB1 A;  2A0L A;  1SRY A;  3D3I A;  3ABM C;  1QVF U;  2WLL A;  4PDR A;  3LSQ A;  3ZMS A;  3ABT A;  1AI4 A;  1NH2 B;  1KQS U;  3BEH A;  3UKM A;  2DYR B;  4KFM A;  3ZMT A;  2C2A A;  2EJR A;  3CCU V;  1R3K C;  2P6J A;  4GX5 A;  4HYO A;  5LHH A;  2IJH A;  2JEX A;  4MVU A;  1NKD A;  4MTF A;  3T4Z A;  3TK1 A;  4U7O A;  4WFF A;  1AI6 A;  1K92 A;  3SYQ A;  3MHH C;  3PJS K;  1E1Q G;  1M90 W;  1NQT A;  1JPX A;  3SYP A;  1Q82 W;  2Y69 B;  1NJI W;  4UV8 A;  4J9Y B;  2XAJ A;  1JQ0 A;  4P9O A;  3TCU A;  4RAI A;  3QO5 A;  3ZN1 A;  2Y48 A;  1VQ8 V;  1CPY A;  3ETG A;  3BY6 A;  4G2K A;  4HAM A;  1YIT V;  4BIU A;  1SER A;  4MVS A;  3ZMV A;  1WLE A;  1GTO A;  2IJK A;  3SPC A;  5B1A B;  1YTF D;  1FXK B;  4JAV A;  5KA5 A;  5L3G A;  4WFG A;  3QNE A;  4MVQ A;  3X2Q C;  1VQN V;  4EKW A;  1R3L C;  1BHB A;  1V54 C;  3E8G A;  4MVZ A;  1SET A;  1GK9 A;  1AR1 B;  4BW5 A;  4LBE C;  1SES A;  1H2G A;  2HLD G;  5LHI A;  5J9P C;  5CMU A;  1S76 D;  1FFT B;  3JYC A;  1F4M A;  3AG3 B;  3ZIA G;  4HZ3 A;  1M56 C;  4J9Z B;  1SZT A;  3CCJ V;  2DWE C;  1Q86 W;  1RPR A;  3AEI A;  2OTL V;  4JPR A;  1F23 A;  4XDK A;  1JX9 A;  2HVJ C;  5LGN A;  3SPG A;  4DO2 A;  2JK5 C;  4BAY A;  5LGT A;  2XAQ A;  1K7D A;  3OR6 C;  4LP8 A;  5CBH A;  5L3B A;  4P2Z A;  1S3J A;  2HKO A;  1PNK A;  1M1K W;  3QO7 A;  4PA7 A;  4WFA V;  3E86 A;  2EIN B;  2IU3 A;  2WWW A;  1AJN A;  3KG2 A;  3CP1 A;  3E89 A;  4N23 A;  5KUK A;  3LUT B;  1KEC A;  3R65 A;  4MW3 A;  5EC2 C;  3VOU A;  1XL4 A;  3K08 A;  2WAM A;  4U7N A;  3W7T A;  2B5U A;  1N8R W;  4Q20 A;  3OAA G;  2Z3Y A;  2OCC C;  1PNL A;  3K0D A;  2HJF C;  1FXV A;  3I55 V;  2YEV B;  2WLH A;  2XAG A;  2EZP A;  3LDD A;  3K9A A;  5L3E A;  1OCC C;  1F4N A;  2X6B A;  5DM6 V;  3W7U A;  3OEE G;  2BOC C;  2PI5 A;  3AG4 B;  3OGC C;  3WG7 C;  4KUM A;  1R3J C;  4KP4 A;  5H6R A;  4PDM A;  2ZR2 A;  2EBO A;  2Q6A A;  4X88 A;  1S77 D;  4TSF G;  3AG4 C;  2V7Q G;  3K06 A;  3RVY A;  4MVM A;  4RQF A;  1RM1 C;  3K03 A;  3CCQ V;  2WLI B;  5EBM C;  5B1B C;  1VQK V;  3ZRW B;  3H01 A;  3ZJZ A;  2QA4 V;  4P30 A;  1QR9 A;  3B8M A;  1RPO A;  1TUE B;  2IU0 A;  3G6E V;  3F7V C;  3B8N A;  5CA3 A;  4RUE A;  3ABK C;  3A0R A;  1AJQ A;  2XAS A;  1R6N A;  4R8C A;  2ZDI A;  3HPL C;  2JJ1 G;  3RBZ A;  2Q67 A;  1K3E A;  1DF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...