3ZRXA

The high resolution structure of a dimeric hamp-dhp fusion displays strong asymmetry
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
b'STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 45
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrxA00
2FTKA 4JAUA 5B1NA 4BIZA 3A0RA 4FPPA 4GCZA 4MT8A 4ZKIA 5C93A 1IXMA 4U7OA 2LFSA 4FMTA 2QM8A 2P67A 4GT1A 4JAVA 4QPKA 3ZRVA 2LFRA 1JOYA 4LC1A 5B1OA 3MD0A 1F51A 3TK1A 4BIUA 4I5SA 3ZRWB 4KP4A 3P32A 4U7NA 4JASA 2C2AA 2QM7A 3ZRXA 3DGEA 4Q20A 4MTXA 3ZRWA 4JYCA 3D36A 4QPJA 3ZCCA 5IDJA 3NXSA 2WWWA 4JYBA
chains in the Genus database with same CATH superfamily
4LH6A 5LYJB 1I0HA 3ZS8C 2A9HA 4JYAB 1I08A 3LSSA 4D7SA 2YI9A 4YJ2B 3RYIB 4X89A 4ZI7A 3J7AU 2QM7A 2QWPB 4HNAA 1US6A 1D2DA 4NTWA 5LOVA 4F6RB 4U3JB 1N34O 4NB5A 4ZIBA 3K5NA 4GKKO 1NQTA 4X62B 2GTAA 1M1KW 3WG7C 1B3QA 2FMLA 2IH1C 1HNZO 1R1BA 4O2AA 1NVPD 5LXTA 2OTLV 3UCSC 1HR0B 4TV9B 2BE3A 2QWQB 2XNDG 3CSXA 1K4DC 2WA4A 4U7OA 2ZNJA 3THOA 4MVMA 5LGNA 2YS8A 4YY3B 4YXWG 1KECA 5B5EZ 3CB2A 2YEVB 5JH7A 4CZZA 1ZL8B 2XAQA 4DV6B 3RT3C 3BAAA 3BA9A 4UCVA 4PA9A 2UXBO 2H94A 3WFVA 4H33A 1VF6C 2P06A 5LP6C 5HFMA 1JFFA 1QCEA 4CH6A 4CH5A 2LW1A 1OCCC 1I5XA 4B3SO 3TGUH 5ITZB 5CA0A 1KQSU 1L8DA 3I5DA 5DEDA 1AI6A 5B3SC 1P7BA 2O57A 2HP8A 5BXZA 4PA3A 3O65A 2JJ2G 5D5PA 3ZMSA 2HFEC 4Z2WA 1AJQA 2QM4A 3P3PA 3HPLC 4CS2A 4DO2A 1Q43A 4X62O 1FXVA 2GDSA 3T4DA 3CRQA 3AG2B 2CE4A 4G2KA 1VQ9V 3ABMB 1MNGA 1K73W 1ZL8A 3VQVA 1IVSA 1VQOV 4FZ1A 5JJJB 5DM6V 3LSQA 1I7FA 2KQXA 4C7UA 5H9CA 1GH6A 1MG1A 1KU9A 3UKMA 5LHIA 5IYCO 4P2ZA 1AVMA 2VRZA 2RQ6A 2W6IG 3L72H 5GW7A 4EFBA 5E1AC 1HDJA 5FL7G 1GM8A 1EBOA 1JMKC 4JI4O 3WB1A 2ZD9A 1OCZC 5KA5A 3BVOA 1BQZA 1F51A 2P4KA 2B1IA 4FJCC 5KX5B 4BW9A 2EJ7A 4LF5O 3QG5A 2OWOA 1H2KA 2ZE8A 1OHHG 1NS1A 1XHXA 1YJNV 2QGNA 3SJQC 3CCVV 2WAMA 5KMGA 3E8HA 3RYHA 3QF7A 5IY5B 5CBGA 5FPOA 4J42A 2Q7HA 2UXCB 1EZVH 4LP8A 3NR7A 1SERA 2F4VO 1RM1C 3SPJA 1H2GA 1X4TA 3PN1A 1S5LZ 3U11A 2MW2B 5CMUA 3G80A 1YF2A 1TVKB 2LFSA 3ETDA 4UUJC 4YJ3A 2P90A 3KG2A 1JX9A 4UCOA 4O4IA 3CMAV 2WLIA 4O4JA 5LL6Y 4JI1B 2Y0IA 1P49A 3E22B 4N23A 5IJ9A 1QLEC 3OAAG 5JWPA 1WP8A 1SA0B 4DV4B 4JI2B 3ZRVA 2PZSA 3RW0A 4TOIA 2VQFB 3CJHB 4DR3B 3M99B 1NTZH 3ZMVA 1YJ9V 4G28B 1OCCB 3JCUZ 3K0GA 3OD4A 5CBHA 1Z5WA 5J2TA 3ZX6A 5H6QA 4D6TH 1N33O 3FAVA 1L0LH 4DXWA 4JI7B 1H38A 3HKCB 3HKBB 3GWOA 4HAMA 3TETA 2JVDA 2GV9A 2IU3A 3B4SA 4N21A 3CRCA 3AK2A 2M7WA 2F23A 4DYLA 4JYBA 3VQYA 1NI8A 2LGWA 4B3TO 1BMFG 3JAWB 4BW5A 3HKEB 4HZ3A 1OCOC 4LF8B 3SYQA 4XDJA 2NNUA 2W0XA 2PTMA 3RN4A 4PHZA 2WLLA 2Q5ZA 5EZYA 2ZKOA 4H44B 3T1YB 4PA6A 4FLWA 3OTOO 1LNQA 3CJHA 2IJKA 2KKWA 5LA6B 5H6RA 3A0RA 4GCZA 1JCHA 3ASOB 1Y67A 1OCZB 3IGAC 1FYJA 2JGDA 2UUBO 2F1MA 1SZXA 1K7DA 4DV4O 1AILA 3A0BZ 3N2KA 4PJ0Z 4TWKA 4LF4O 3K5MA 4DV3B 3HKBA 3W7UA 1N32O 3EFFK 4CC6A 1Y76A 1ZSPA 3B8NA 4CC5A 4WBNB 4DR3O 2BSKB 1IX9A 3FB7C 5IYZB 3BPZA 1NH2B 5L3DA 5EYPB 2X6AA 5FPRA 3KKYA 4ZKIA 4QPKA 4GYCB 1K5QA 4LWSB 4X64B 4LFBB 4F6EA 3DC5A 3LUTB 2FL4A 1Y74A 4ZHQA 3OGIB 3E8FA 4X65O 3WB0A 3AEIA 3VQWA 4B3RB 2ZDIC 1CP9A 3H1KH 4Q20A 3JD2A 3RYCB 3K79A 1IBMB 1BS3A 2ZXWC 1VQ8V 1XILA 2UUCO 1Z2GA 4R6ZA 4BAYA 3L70H 5IE9A 2ZIOA 4ZOLA 3H1HH 1YZBA 3APQA 1AI4A 3D8CA 4W4LA 2HHHB 1E79G 2JEUA 4FVMA 3T1CA 5L3CA 3TK1A 1BSMA 3X2QC 1YIJV 2K1EA 3T1HB 4D7TA 3ZMZA 1BHAA 2YUAA 4WCEV 2C2AA 2KG7A 2EILB 2UU9O 4OX9O 1FKAO 4NYKA 1CPYA 1VF5B 3E2EA 3JAMN 1I94B 3ZCCA 4JAUA 1JVMA 3JALB 1Q6HA 3WB2A 4QJFB 4MTOA 4K0KB 1U97A 2YIBA 2E75B 2UXDB 5CA3A 2UUAB 3JATA 1KBHA 2LP7A 5GONB 5CB4B 4TQDA 3DC6A 4E4EA 5L3FA 3OFNG 4LFAB 3Q4HB 1WPXA 4J7KA 1WJZA 5EK0A 2ADQB 5JVDB 1NT2B 1BT8A 1JQ0A 1THZA 3JASA 1FXKB 1FFTB 1G4YB 3RGBA 3VOUA 1GM7A 1MZEA 3APOA 2A79B 1DF4A 2UXXA 3ICXA 4CBCA 2FB5A 4LH7A 2LJ2A 3ZHQA 1H2LA 4KL1A 1Y66A 5B1NA 3B09A 2QKAA 3K59A 1N34B 1XMQO 3OEHG 1SESA 4NXNO 1E1QG 3K9SA 2H3OA 3QNEA 4KFMA 4FLUA 2CAZC 2N74A 4H13B 5GTIZ 4DR5O 1WNSA 4MVSA 2DE0X 5LMUB 1H2SB 4TV8A 1EM1A 1RFYA 4ZI7B 1BCCH 1ZUQA 5KAIZ 5LMNB 4Z1VA 1JOYA 2DW4A 1XNQO 3ZHSA 1XL4A 4B3MO 2BOBC 4H37A 4HNAB 2HKOA 4I55A 2Q0OC 5J9PC 1L0NH 5KUMA 2JRIA 1YITV 4IYIA 3CE2A 2YC0A 4B7KA 1VQ5V 3CCLV 1F4MA 2EIJC 3KCXA 3H1LH 5D5QA 3OEEG 4GX5A 2Q9LA 4HBNA 2H8PC 2V1DA 4IHJA 4FLTA 4JTDB 2UUAO 3IFXA 5CA1A 4O2AB 5LXTB 1KD1W 4JAAA 4IIJA 4X20B 4LFAO 2UXBB 4G27B 3VBBA 2VS0A 2ZXWB 1EZJA 4FPPA 1RSOA 4B3SB 3IAYA 3CWBH 5JH7B 4J80A 4GX1A 3CC4V 1SQPH 4FLVA 1BQ0A 3OMAB 1MZFA 2XAHA 3X2QB 3S3WA 1KP2A 2GSMB 1V9PA 4FZ0A 2B9ZA 5F2VO 2HJDA 1GN6A 3U10A 5JQGA 1YDXA 1AP5A 4QGPA 2D2CB 1CXZB 2F93B 4DW0A 1JFFB 1XEQA 4JAVA 4WFHA 4GKJO 1EN6A 5IY5C 2DYRC 3FFQA 3RVZA 1I5YA 2RNBA 4UV8A 1OJHA 5CA0B 3L75H 4A5UB 4JASA 2YXLA 2AXTZ 5LMUO 3QO8A 3DGEA 1HP8A 1UFIA 3CRMA 1GMGA 5LMNO 1N36O 1ZX3A 4X9QA 1AR4A 1SF9A 4PELA 3CCUV 4X20A 5EIBD 1M5IA 5IJ0A 5FNVA 4FK5C 4I5SA 2AW9A 1Q6IA 4O4LA 4JI4B 2ODMA 4U7NA 4JZ2A 4YIPA 4X66O 2QDOA 2CTPA 4R50A 4P9OA 1LUVA 4LF5B 3E86A 5LHHA 3IC7A 4RQFA 1ROPA 4TUYA 2V7QG 2R9RB 1G1XB 3UO3A 2EIMC 2CGOA 3L71H 1YI2V 5J2UA 4H0LB 2GBOA 1K92A 4PA4A 3W7SA 3MAQA 1KMIZ 3N2GA 2A3QA 2ZCEA 4NVPA 1GTOA 2YXHA 2WLJA 2IM9A 2PGGA 4O4HA 5H5NA 2F4VB 1RPOA 5B1AB 1DF5A 2LFRA 4EKWA 2P7TC 3C3TA 3OE7G 4DR4B 4DUZO 3AG1B 4LFCB 5KMGB 3CC2V 3RYHB 2EIJB 4K8XA 3BY6A 3F7VC 4WFAV 1YSCA 1TGOA 2P6JA 2JK5C 1WB8A 1WB7A 2OIEA 3BFRA 4J11A 4LF6O 2ZE7A 4PDVA 1Q90D 2ETNA 3FD9A 2Q69A 4KHPB 4X88A 3ZHVA 1IURA 2Y0PA 1QQCA 1KB9F 2F66C 1N0JA 3P3NA 4YJ3B 4EEQA 1SS3A 4MW3A 1W2BU 3SGIA 3CCEV 3E8GA 4O4IB 1YVWA 1R3IC 2WLIB 2CDYA 1S5JA 3ASOC 4O4JB 1AI5A 1Q6UA 3AK1A 1N33B 5CN0A 2DYSB 3ASNB 4EB6A 5KUKA 4RO2A 5IJ9B 3HR0A 1IZ3A 3IJ4A 3A2FA 3CPWU 4DR7O 5AG2A 5BR8O 4FM2A 1Q7YW 3D36A 4FLZA 2DWEC 2VWJA 4MVOA 2AZ2A 3ABKB 2DYRB 3JD3A 4B3TB 1O9GA 2ZR2A 5J2TB 4L87A 3ZN1A 1GAXA 3FAVB 3CX5F 2A06H 4KXRA 2XAJA 2Q67A 5HFLA 4OPHA 4DR4O 3OTOB 2JJ1G 2Q73A 4LFCO 3A8TA 4BIUA 2PYLA 4I7ZB 2UUBB 4AQYO 3H01A 1BZKA 2WLLB 3ABUA 2PY5A 2KSDA 4FIPC 4DV0O 5EZYB 1ORQC 1SQGA 2CTQA 4KHPO 3FB6C 4UCRA 2EIMB 3L9DA 4LF4B 4PDLA 4X1IA 5BY1A 1N32B 1Q3EA 2WSSG 3K0DA 3QVNA 2EILC 2D3OW 3CXHF 5LGTA 4DR2O 1FFXA 2Z3YA 1XBLA 2JGDB 3ZRXA 3BCCH 2WWWA 3ZMTA 1XHZA 1YTFB 1NH2D 1KC8W 3JD1A 1TUEB 3AK3A 2IU0A 4JZGA 1S72V 3AG3C 1PNMA 3N2KB 4K8ZA 2EBOA 2ZIMA 1Y76B 2RCVA 3F7YC 4X65B 4J41A 2R9IA 3T4ZA 3U0ZA 4DV2O 4P9PA 3FX7A 1R6NA 4X8AA 2UUCB 4DV7O 2K9PA 4UFZA 1FXKC 1AP6A 3OW2U 1FJGB 2DQ3A 1IBKO 2Q0AA 1NR7A 2AHZA 3M8AA 1ZLZA 2YXYA 1Y74B 4ZHQB 4OX9B 2UU9B 2BTOA 1SQVH 3MHSC 1D5NA 1W59A 3HKDA 4JYYA 2X0LA 1FXHA 2CK3G 4O2BA 4FM0A 3UO2A 1NU1H 1N0NA 3VQXA 1UPGA 4ZOLB 1YXBA 1PP9H 1Y4MA 4TT3G 1VF6A 4UCSA 4JI0B 1BE3H 1GM9A 4LF9O 1P4RA 5DN6G 2IJHA 3CEIA 1M57B 4X1KA 4DRXB 1VIBA 4JI3O 3LDCA 3HB3B 2KG7B 2HVJC 2L35A 2DWDC 4JI8O 1QVFU 3JARA 4JV5O 2XT9A 1KYOF 1W0KG 5BMVA 3CCMV 3CCJV 4MVZA 1DGSA 3SPIA 2PI5A 1M93A 3H1IH 2Z5UA 3OR6C 2RJZA 2F43G 4HYOA 3G6BA 3JATB 1B04A 1WLEA 4GT1A 2DMXA 3TJTA 4CH4A 5A9GA 1V54B 5IYDO 3L74H 2LO1A 4NKGB 2MK3A 1COWG 3K58A 2ARHA 1M4UA 1AJPA 4ZBMA 1TUBA 3DTUB 1XMQB 2ZNIA 2A0LA 2IW5A 1VQ4V 4NXNB 1U96A 4UCUA 1S76D 3ZRWA 4GX2A 3JASB 3QTCA 1WA8A 1MSDA 1IBLO 5KHJA 1RPRA 4NXMO 2ZM6B 4FFBA 4YHHB 1FJGO 4B08A 3JAKA 4DR5B 2W0FC 2CH7A 1R6KA 4DK1A 4DRXA 1XNQB 4B3MB 2GTSA 2FYUH 5KAFZ 1OV9A 2DJVA 1R3LC 1G8MA 1VQ6V 4Q6GA 3ZIAG 4I0XA 4RWUA 3JCZA 2VQEO 1URFA 1DK1A 4QE9A 4PA7A 2ZE5A 3K5OA 1XI1A 1NKDA 4I4TB 3AG3B 4TSFG 1JJOA 3SYPA 4B7EA 4FM1A 2CTRA 4JI0O 5JJEB 3OGCC 4TV8B 1GN2A 2NN4A 3DXRA 2PUSA 3D3IA 1YJWV 1XMOO 4I55B 2Y4TA 3CC7V 1B6QA 1VMGA 2OCHA 2WLMA 2JDIG 3CHXA 5JJNB 3PJSK 3P32A 4CS3A 2XAFA 4IHJB 1SQQH 3OUFA 2N04A 3OT7A 1BL8A 5CA1B 1M56B 3D3QA 1N8RW 1K4CC 1Q86W 2ZT9B 4LNUA 4IIJB 4LBEC 3ETQA 5EBWC 2IH3C 3GB7C 3EXAA 3JD4A 2QSAA 3B2EE 1JR9A 5TISZ 4MVUA 3UT5A 1HNWO 3CCRV 4GKJB 4NR1A 5DECA 1RSOB 5L3EA 3BRCA 2JS3A 4DV1O 2P4VA 2ZM6O 4I4TA 4YHHO 2XASA 4PV1B 4LR3A 5B1AC 4I9QA 5C8YA 1N36B 1VP7A 1RP3B 5JQGB 3D36C 3AG1C 2OTJV 4JPRA 3CMEV 3FKSG 3K04A 1OCRC 2YIDA 3ABTA 3NXSA 3MDSA 4X66B 1PM9A 2QWNB 3CYOA 2YSUB 4GZRB 3ZJZA 1ZTEA 4X1YA 4WFBV 1QLNA 1YCIA 4I50A 3ZMUA 3G4SV 2ATKC 4XDLA 3KCYA 3AG7A 2R9AA 2X7RB 1EFRG 2Q4PA 2QWRB 1XL6A 4WFFA 5FNVB 5IJ0B 3KZIZ 3L73H 2HVKC 2QTSA 4O4LB 3ZHTA 1F4NA 2ILMA 4DR6O 2PF4E 1S5HC 1ENVA 2EULA 1XREA 4QE7A 1K5SA 1VQKV 1SRYA 4RAIA 2P5OA 3SYOA 2DYSC 3SJCC 2RN9A 3ASNC 1CEZA 3CD6V 4JTCB 3ZN0A 3H1JH 3LSUA 4TUYB 1DTOA 1HNXO 2EJRA 4DUZB 5J2UB 1MABG 4K3AA 4QNHB 1IXMA 5KHGA 1ZWIC 3C90A 4DV5O 3GVMA 3RYFA 3ABKC 5A2QN 3K03A 5B1OA 2RDCA 3N2GB 3ZHRA 4R7CA 1A32A 2CGNA 4O4HB 4LF6B 1J5EB 3LNNA 2QKCA 4F4LA 1D5AA 2EZOA 1P7GA 4Z1MG 2GUZA 1K33A 4DUYO 2B5UA 4TQFA 2RMKB 2BCCH 2YIAA 1K34A 1M90W 3RFRA 5JCOA 2Q8VA 5EC2C 4WFEA 3E83A 1WPBA 2A7WA 3OR7C 1Q81W 2HLDG 3UM7A 3RWRD 1GK9A 4JI6O 2BTQA 3J80N 4DR7B 5BR8B 2ZDIA 2AZ0A 2WA3A 5B1BB 4E2LA 1WN7A 3K3WA 2R72A 1XNRO 1SQBH 1V55C 2N05A 3OM3B 3E8BA 2F95B 4I9WA 5LYJA 3ABLB 3H9VA 2BOCC 2WPDG 5KHHA 4DR1O 4YJ2A 3RYIA 4EB6B 2ITCC 4BIZA 1PNLA 3ZEDA 4U3FH 3AG4C 4XDKA 1VF7A 4F6RA 4U3JA 1EN4A 1VQMV 3W7WA 1H8HG 1LUWA 4IYHA 2E5LO 1E1RG 2P22C 5H2FZ 1OCRB 1AI7A 4QPJA 3K5LA 4PI0A 1VQLV 4JYAO 2OCCB 2EIKB 4AQYB 5CBFA 1AJNA 2E74B 1J5EO 4IGGA 3MD0A 4TV9A 4DV0B 3G71V 1QBZA 4BWAA 2Y69C 3LDDA 4J7ZA 4MVRA 4MTXA 1SZTA 3TCUA 3QO7A 2FTKA 3J81N 2YEVA 1ZAUA 4DR2B 1TAEA 1NVPB 1R73A 1YTFD 1GRJA 1F23A 1HR0O 3K9AA 4OPAA 3SPGA 1K97A 4MTGA 3CXCU 3JSNA 3BA8A 4X1IB 4YY3O 1O9HA 1WAZA 1M57C 2ITDC 1K8AW 2Y48A 1EN5A 4FFKA 4WFGA 1FFXB 5ITZA 1Q8IA 2QE7G 2QR4A 2ZE6A 3E35A 4DK0A 3E89A 4DV2B 3OTFA 4IT5A 3SPCA 2JIZG 4DV7B 4DV6O 5LGUA 2L6LA 1YEWA 1XOUA 2QKSA 3CP1A 3EHBB 1QU7A 2NLJC 4RUEA 5IDJA 1Q5OA 3B40A 2XHBA 1IBKB 1VQNV 1NJIW 5L3GA 2R70A 2HR3A 5C93A 1NTMH 3WG7B 5KLVH 2B1GA 1KKDA 1SETA 2WLHA 1V54C 3O9OA 2UXNA 2CUGA 1SC5B 4PDRA 3ETGA 1NZ6A 2AHYA 1FPOA 3M7MX 1K9MW 4UVAA 3QO5A 1JJ2U 1N4CA 3MHHC 4LF9B 4MVQA 5KA6A 2G38A 3RBZA 3SJBC 4GUNA 4JI3B 3ML0A 4UB6Z 1PV0A 1V55B 4J10A 4JI8B 3HKDB 3OMNB 4JV5B 3SPHA 4O2BB 1MA1A 3FB8C 5KX5A 2NR5A 4RQEA 2ZINA 1PL4A 1MSWD 3AG4B 1YHQV 1Q82W 2Q6AA 3GWKC 1P84F 1W0JG 2YIBD 5LP6B 1AR5A 4X1KB 4OGQB 1XQ8A 1KKCA 3JARB 2DOSA 1SQFA 4JF3A 4J9YB 5BMVB 5LBQA 5B3SB 3BHPA 5K1PA 3BEHA 1GN3A 1M9NA 3LNMB 2IJJA 1R3KC 2OYQA 2WLKA 1IBLB 4ABMA 2QA4V 1H2MA 4NXMB 1Z5VA 1IDSA 4UV9A 3SYCA 2AGAA 1TVKA 3FB5C 3JD0A 3ZHUA 2Y69B 4JTAB 2QWOB 2EZPA 2FKXA 1M56C 3IC9A 2Z0AA 1NR1A 1GO3F 2E3CA 2PYJA 1JPXA 3SR2C 1X59A 3UQ8A 2UXCO 4NTYA 2JGUA 2V4DA 1TUBB 2OT5A 2VQEB 3E22A 3ZRWB 3I56V 1SA0A 1WA8B 5E79Z 3CRRA 1NTKH 3OMIB 4RUFA 4FFBB 4CS4A 4JYCA 3JAKB 1BHBA 5LP6A 3G6EV 1AR1B 2CH7B 2Q7EA 4CH3A 4AI8A 1XMOB 4JGSA 1B06A 3BABA 1K3EA 1AROP 4JI1O 4I0XB 4J9ZB 1UJWB 3W7XA 1VQPV 1SQXH 3WU2Z 4ASUG 2HEPA 3FYIB 4JI2O 3CCSV 5EC1C 3HKCA 3G67A 2XOKG 2VQFO 3F5WC 2QJ1A 4UXNA 1XDCA 2X6BA 3DXRB 2IJIA 1H8EG 2YI8A 4FLXA 1SKVA 3JAWA 3HKEA 4P30A 4W4KA 3TXQA 1QVGU 1QHTA 4K35A 1MMMA 1RM1B 2LW7A 3C3SA 1HNWB 4IL6Z 4KUMA 1HW7A 4GX0A 4JI7O 4JI5B 3FYEB 5JCOC 2XTAA 4UVCA 4DV1B 2P67A 3STZC 4DW1A 2PI4A 5IWAB 2EINC 1FS0G 2Y4UA 5LA6A 2JS5A 4PD4F 5EBLC 4LNUB 3DSQA 4LF7B 1HWYA 1VEWA 4PI2A 3A0HZ 4LF8O 1QR9A 1PL0A 3JSLA 2GHYA 1QLEB 4AILC 3N27A 2HG5C 1VARA 3UT5B 1H2NA 2QM8A 2X6CA 3ETEA 3CRAA 4GLXA 3T1YO 3R65A 2QTOA 4LCUC 4WF9V 2LQTA 2KB1A 4WBNA 3JYCA 2DN9A 1QNMA 1Y6XA 2BSKA 5C8YB 1FAFA 2ZR3A 3S3XA 3B8MA 5IYZA 2VWKA 5IYBO 1VQ7V 3SYAA 2XUMA 5GTHZ 1MOFA 4MT8A 1TA8A 4L8JA 1DLBA 5EYPA 4UB8Z 2YDEA 2E76B 4UVBA 3I55V 3K57A 3SJAC 2LGQA 3CS5A 5K1XA 4DR6B 1R3JC 2CTWA 1BGYH 4LWSA 4DV3O 3K06A 4QIWF 3EVKA 4X1YB 4I50B 2W6JG 2EX3A 4YIOA 1OCOB 1HNXB 3STLC 1AB3A 2DQ0A 3CCQV 1GN4A 3RYCA 5IT9N 4EFEA 5B1BC 1LR1A 4BR6A 4MS2A 3TXSA 2ZQMA 1IXBA 1PNKA 1PPJH 4DV5B 3K08A 4JI5O 3R66A 3ABLC 5KHKA 1WP7A 3OUSA 4X64O 4LFBO 4NTXA 4OXSA 2M6YA 1J95A 1PD3A 5IWAO 3LDEA 1KUQA 3B77A 4LF7O 4B3RO 4GKKB 2XAGA 1QR8A 1IBMO 3SDLA 3JALA 4DUYB 5EBMC 1OZ0A 3RVYA 4BIOA 4R8CA 3P30A 4ICGA 3T2MA 4XBFA 2WLNA 1FD9A 3RYFB 2HHHO 1HNZB 5LHGA 4PDMA 2OCCC 2EIKC 5GONA 5CB4A 1T5EA 1XUQA 3T1HO 1S77D 4FMTA 1R6TA 1JA8A 4MSWC 4JI6B 5FLXN 5LOVB 3Q4HA 3W7TA 1S0VA 4AHCA 1G6UA 4KP4A 2JEXA 4UCTA 2GUZB 1F7YA 5JVDA 1I94O 1GKFA 2OIGA 4J7JA 1FXKA 1XNRB 5B66Z 4K0KO 5KHIA 3ZRSA 5L3BA 3AG2C 2HJFC 2UXDO 1NBMG 4MW8A 3ABMC 4FLYA 4LC1A 1S3JA 4DR1B 2IBZH 2ADPA 2EINB 2YICA 3ZBHA 2BTQB 5EIBC 1KP3A 2Q7GA 2Q68A 3F5TA 1PKXA 1L1FA 2QEXV 2E5LB 4MTFA 5BZBA
chains in the Genus database with same CATH topology
3T4ZA 2FTKA 4JAUA 2YEVA 1JVMA 4QJFB 4P9PA 1R6NA 4X8AA 2A9HA 1NVPB 4MTOA 3LSSA 1FXKC 1R73A 1YTFD 3OW2U 5CA3A 1F23A 2LP7A 3K9AA 2DQ3A 4X89A 3SPGA 1K97A 2QM7A 4MTGA 3CXCU 1NR7A 5L3FA 2AHZA 3OFNG 1WPXA 5EK0A 3MHSC 1NQTA 1M57C 2ITDC 1JQ0A 1K8AW 2Y48A 1M1KW 2X0LA 3WG7C 1THZA 1FXHA 2CK3G 4WFGA 1FXKB 2QE7G 1FFTB 3E35A 1G4YB 3E89A 2IH1C 3SPCA 3VOUA 2JIZG 1GM7A 1Y4MA 4TT3G 5LGUA 1NVPD 2A79B 1DF4A 2QKSA 2UXXA 4CBCA 2OTLV 3CP1A 3EHBB 2NLJC 4RUEA 1GM9A 5IDJA 1P4RA 1VQNV 2XNDG 5DN6G 1Y66A 1NJIW 1K4DC 2IJHA 5B1NA 5L3GA 2HR3A 1M57B 5C93A 4U7OA 3LDCA 3HB3B 3WG7B 2HVJC 2B1GA 1KKDA 4MVMA 5LGNA 2DWDC 1SETA 2WLHA 1QVFU 1V54C 3OEHG 2UXNA 4YXWG 1KECA 1SESA 1E1QG 4PDRA 1W0KG 3CCMV 3CCJV 4MVZA 2YEVB 3SPIA 4CZZA 3ETGA 3QNEA 4KFMA 2PI5A 2AHYA 2Z5UA 2XAQA 3OR6C 1K9MW 2F43G 4MVSA 4HYOA 4UVAA 1WLEA 4PA9A 3QO5A 4GT1A 1JJ2U 1JOYA 2DW4A 3MHHC 1XL4A 2H94A 5IYDO 1V54B 2BOBC 4H37A 4H33A 4MVQA 3WFVA 2HKOA 5KA6A 3RBZA 5J9PC 5KUMA 3ML0A 1YITV 5HFMA 2MK3A 1COWG 1VQ5V 1V55B 1QCEA 3CCLV 1F4MA 2EIJC 1AJPA 4ZBMA 1OCCC 3DTUB 1I5XA 2A0LA 2IW5A 3OMNB 1VQ4V 3SPHA 3FB8C 1S76D 3ZRWA 4GX2A 3OEEG 4GX5A 1KQSU 4RQEA 2H8PC 2V1DA 1RPRA 1AI6A 1MSWD 5B3SC 4JTDB 1P7BA 3IFXA 3AG4B 1YHQV 1Q82W 4PA3A 2Q6AA 2W0FC 1W0JG 1KD1W 2JJ2G 3ZMSA 1R6KA 2HFEC 1AJQA 4G27B 3HPLC 3VBBA 4DO2A 1R3LC 1FXVA 1G8MA 2ZXWB 3ZIAG 1VQ6V 3JCZA 3T4DA 4QE9A 4JF3A 1EZJA 4J9YB 5LBQA 3AG2B 4FPPA 5B3SB 4PA7A 3BEHA 1M9NA 4G2KA 1VQ9V 3ABMB 3LNMB 4GX1A 2IJJA 1K73W 3CC4V 1R3KC 2WLKA 1VQOV 1NKDA 3OMAB 2QA4V 2XAHA 3AG3B 4TSFG 3X2QB 3LSQA 3SYPA 5DM6V 4UV9A 3OGCC 5H9CA 3SYCA 1KP2A 1MG1A 3FB5C 3JD0A 2GSMB 3UKMA 5LHIA 2Y69B 5IYCO 4P2ZA 4JTAB 2EZPA 1M56C 3D3IA 1YJWV 1NR1A 1GO3F 2W6IG 5GW7A 5E1AC 5FL7G 1JPXA 3CC7V 1GM8A 1EBOA 1B6QA 2WLMA 4JAVA 2JDIG 2ZD9A 4WFHA 1OCZC 5KA5A 5IY5C 2DYRC 2OT5A 3RVZA 1F51A 1I5YA 3PJSK 2B1IA 4FJCC 3ZRWB 3P32A 3I56V 4UV8A 2XAFA 4JASA 3OUFA 3OMIB 4RUFA 1BL8A 3QO8A 3DGEA 1OHHG 1M56B 1YJNV 1N8RW 1GMGA 3SJQC 4JYCA 3CCVV 1BHBA 1K4CC 1Q86W 3G6EV 2WAMA 1AR1B 4PELA 3CCUV 4LBEC 3E8HA 5EBWC 2IH3C 3GB7C 4JGSA 5CBGA 5IY5B 3JD4A 4FK5C 4I5SA 1K3EA 1AROP 4MVUA 4J9ZB 1UJWB 3W7XA 1VQPV 4U7NA 4LP8A 3CCRV 5L3EA 4ASUG 1SERA 4R50A 3FYIB 3SPJA 1RM1C 1H2GA 4P9OA 3CCSV 3E86A 5EC1C 5LHHA 3IC7A 2XOKG 3F5WC 4RQFA 1ROPA 2XASA 5CMUA 2V7QG 2R9RB 2LFSA 3ETDA 5B1AC 4UUJC 4UXNA 2EIMC 2X6BA 2IJIA 1YI2V 1H8EG 2P90A 3KG2A 1JX9A 3AG1C 2OTJV 3CMAV 4JPRA 4P30A 1QVGU 3CMEV 1K92A 3FKSG 4PA4A 2WLIA 3W7SA 1RM1B 3K04A 1OCRC 3ABTA 4KUMA 1GTOA 2WLJA 4GX0A 3NXSA 4N23A 1QLEC 3OAAG 3FYEB 1RPOA 3CYOA 5B1AB 4UVCA 2YSUB 1DF5A 3ZRVA 2P67A 3STZC 2LFRA 3ZJZA 3RW0A 4EKWA 4WFBV 1QLNA 2P7TC 3ZMUA 2EINC 3G4SV 2ATKC 1FS0G 2PI4A 4XDLA 3OE7G 3AG1B 5EBLC 2X7RB 3CC2V 3M99B 1EFRG 3ZMVA 1HWYA 1YJ9V 2EIJB 4G28B 1XL6A 1OCCB 4WFFA 3BY6A 3K0GA 1QR9A 3F7VC 5CBHA 1PL0A 4WFAV 1YSCA 2GHYA 2HVKC 2P6JA 2JK5C 1QLEB 5H6QA 2HG5C 1F4NA 2QM8A 2X6CA 3ETEA 1S5HC 1ENVA 4DXWA 4QE7A 1K5SA 4PDVA 1VQKV 1SRYA 3R65A 4RAIA 2QTOA 2Q69A 4LCUC 4WF9V 3SYOA 4X88A 2DYSC 1H38A 3ASNC 1CEZA 3CD6V 4JTCB 3GWOA 4HAMA 3ZN0A 2KB1A 3TETA 2IU3A 3JYCA 1DTOA 4N21A 2ZR3A 2EJRA 2M7WA 3B8MA 4MW3A 5IYBO 1W2BU 1VQ7V 3SYAA 3CCEV 4JYBA 1MABG 1MOFA 1BMFG 3E8GA 4MT8A 4HZ3A 4BW5A 1OCOC 4QNHB 1IXMA 1R3IC 1ZWIC 3SYQA 1DLBA 2WLIB 4XDJA 2NNUA 3ASOC 3ABKC 3K03A 1AI5A 5B1OA 2WLLA 5CN0A 4UVBA 4R7CA 2DYSB 3I55V 3ASNB 5KUKA 4RO2A 1R3JC 3CPWU 4PA6A 3K06A 4QIWF 4F4LA 1Q7YW 2EZOA 4Z1MG 3D36A 1LNQA 2DWEC 2IJKA 1K33A 2W6JG 5H6RA 3A0RA 1OCOB 4GCZA 3STLC 1JCHA 4MVOA 2DQ0A 3ASOB 3CCQV 3ABKB 2B5UA 5B1BC 1OCZB 3IGAC 4MS2A 2DYRB 2ZQMA 3JD3A 1PNKA 2ZR2A 1K34A 1M90W 4L87A 3K08A 3ZN1A 5EC2C 4WFEA 1K7DA 3ABLC 3E83A 3OR7C 3OUSA 1Q81W 2HLDG 3UM7A 1GK9A 4TWKA 2XAJA 2Q67A 4OXSA 1J95A 1PD3A 5HFLA 3W7UA 3EFFK 3LDEA 2ZDIA 2JJ1G 3B8NA 3B77A 5B1BB 3FB7C 4BIUA 4E2LA 2XAGA 1QR8A 3K3WA 1V55C 1NH2B 3OM3B 3E8BA 5EBMC 4I9WA 1OZ0A 5L3DA 3RVYA 3ABLB 3P30A 4R8CA 3T2MA 4XBFA 2WLNA 3H01A 2X6AA 2BOCC 2WLLB 2WPDG 3ABUA 4PDMA 5LHGA 2OCCC 4FIPC 2EIKC 2ITCC 4BIZA 1PNLA 4ZKIA 1ORQC 1S77D 3FB6C 4FMTA 4QPKA 1K5QA 3AG4C 4XDKA 2EIMB 4MSWC 3W7TA 1VQMV 3LUTB 1S0VA 4PDLA 4KP4A 2JEXA 3W7WA 1H8HG 1E1RG 1GKFA 3E8FA 2WSSG 3AEIA 3K0DA 2EILC 2D3OW 2ZDIC 1CP9A 5LGTA 1OCRB 4Q20A 3JD2A 1AI7A 1FXKA 3K79A 2Z3YA 4QPJA 2ZXWC 1VQ8V 1VQLV 4R6ZA 3ZRXA 4BAYA 2WWWA 3ZMTA 1YTFB 2OCCB 3ZRSA 2EIKB 1NH2D 5L3BA 3AG2C 2HJFC 1NBMG 1KC8W 3JD1A 1TUEB 1AI4A 4MW8A 3ABMC 5CBFA 1AJNA 1E79G 2JEUA 4LC1A 2IU0A 1S3JA 3T1CA 3MD0A 5L3CA 3TK1A 1S72V 3AG3C 2EINB 3X2QC 1PNMA 3G71V 1YIJV 1QBZA 2K1EA 3ZMZA 1KP3A 1BHAA 4WCEV 2C2AA 2EILB 2EBOA 2Q68A 2Y69C 1CPYA 1PKXA 3E2EA 3LDDA 4MVRA 4MTXA 1L1FA 1SZTA 2QEXV 3F7YC 3ZCCA 4MTFA 3TCUA 3QO7A 5BZBA 2R9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FTK A;  4JAU A;  5B1N A;  4BIZ A;  3A0R A;  4FPP A;  4GCZ A;  4MT8 A;  4ZKI A;  5C93 A;  1IXM A;  4U7O A;  2LFS A;  4FMT A;  2QM8 A;  2P67 A;  4GT1 A;  4JAV A;  4QPK A;  3ZRV A;  2LFR A;  1JOY A;  4LC1 A;  5B1O A;  3MD0 A;  1F51 A;  3TK1 A;  4BIU A;  4I5S A;  3ZRW B;  4KP4 A;  3P32 A;  4U7N A;  4JAS A;  2C2A A;  2QM7 A;  3ZRX A;  3DGE A;  4Q20 A;  4MTX A;  3ZRW A;  4JYC A;  3D36 A;  4QPJ A;  3ZCC A;  5IDJ A;  3NXS A;  2WWW A;  4JYB A; 
#chains in the Genus database with same CATH topology
 4LH6 A;  5LYJ B;  1I0H A;  3ZS8 C;  2A9H A;  4JYA B;  1I08 A;  3LSS A;  4D7S A;  2YI9 A;  4YJ2 B;  3RYI B;  4X89 A;  4ZI7 A;  3J7A U;  2QM7 A;  2QWP B;  4HNA A;  1US6 A;  1D2D A;  4NTW A;  5LOV A;  4F6R B;  4U3J B;  1N34 O;  4NB5 A;  4ZIB A;  3K5N A;  4GKK O;  1NQT A;  4X62 B;  2GTA A;  1M1K W;  3WG7 C;  1B3Q A;  2FML A;  2IH1 C;  1HNZ O;  1R1B A;  4O2A A;  1NVP D;  5LXT A;  2OTL V;  3UCS C;  1HR0 B;  4TV9 B;  2BE3 A;  2QWQ B;  2XND G;  3CSX A;  1K4D C;  2WA4 A;  4U7O A;  2ZNJ A;  3THO A;  4MVM A;  5LGN A;  2YS8 A;  4YY3 B;  4YXW G;  1KEC A;  5B5E Z;  3CB2 A;  2YEV B;  5JH7 A;  4CZZ A;  1ZL8 B;  2XAQ A;  4DV6 B;  3RT3 C;  3BAA A;  3BA9 A;  4UCV A;  4PA9 A;  2UXB O;  2H94 A;  3WFV A;  4H33 A;  1VF6 C;  2P06 A;  5LP6 C;  5HFM A;  1JFF A;  1QCE A;  4CH6 A;  4CH5 A;  2LW1 A;  1OCC C;  1I5X A;  4B3S O;  3TGU H;  5ITZ B;  5CA0 A;  1KQS U;  1L8D A;  3I5D A;  5DED A;  1AI6 A;  5B3S C;  1P7B A;  2O57 A;  2HP8 A;  5BXZ A;  4PA3 A;  3O65 A;  2JJ2 G;  5D5P A;  3ZMS A;  2HFE C;  4Z2W A;  1AJQ A;  2QM4 A;  3P3P A;  3HPL C;  4CS2 A;  4DO2 A;  1Q43 A;  4X62 O;  1FXV A;  2GDS A;  3T4D A;  3CRQ A;  3AG2 B;  2CE4 A;  4G2K A;  1VQ9 V;  3ABM B;  1MNG A;  1K73 W;  1ZL8 A;  3VQV A;  1IVS A;  1VQO V;  4FZ1 A;  5JJJ B;  5DM6 V;  3LSQ A;  1I7F A;  2KQX A;  4C7U A;  5H9C A;  1GH6 A;  1MG1 A;  1KU9 A;  3UKM A;  5LHI A;  5IYC O;  4P2Z A;  1AVM A;  2VRZ A;  2RQ6 A;  2W6I G;  3L72 H;  5GW7 A;  4EFB A;  5E1A C;  1HDJ A;  5FL7 G;  1GM8 A;  1EBO A;  1JMK C;  4JI4 O;  3WB1 A;  2ZD9 A;  1OCZ C;  5KA5 A;  3BVO A;  1BQZ A;  1F51 A;  2P4K A;  2B1I A;  4FJC C;  5KX5 B;  4BW9 A;  2EJ7 A;  4LF5 O;  3QG5 A;  2OWO A;  1H2K A;  2ZE8 A;  1OHH G;  1NS1 A;  1XHX A;  1YJN V;  2QGN A;  3SJQ C;  3CCV V;  2WAM A;  5KMG A;  3E8H A;  3RYH A;  3QF7 A;  5IY5 B;  5CBG A;  5FPO A;  4J42 A;  2Q7H A;  2UXC B;  1EZV H;  4LP8 A;  3NR7 A;  1SER A;  2F4V O;  1RM1 C;  3SPJ A;  1H2G A;  1X4T A;  3PN1 A;  1S5L Z;  3U11 A;  2MW2 B;  5CMU A;  3G80 A;  1YF2 A;  1TVK B;  2LFS A;  3ETD A;  4UUJ C;  4YJ3 A;  2P90 A;  3KG2 A;  1JX9 A;  4UCO A;  4O4I A;  3CMA V;  2WLI A;  4O4J A;  5LL6 Y;  4JI1 B;  2Y0I A;  1P49 A;  3E22 B;  4N23 A;  5IJ9 A;  1QLE C;  3OAA G;  5JWP A;  1WP8 A;  1SA0 B;  4DV4 B;  4JI2 B;  3ZRV A;  2PZS A;  3RW0 A;  4TOI A;  2VQF B;  3CJH B;  4DR3 B;  3M99 B;  1NTZ H;  3ZMV A;  1YJ9 V;  4G28 B;  1OCC B;  3JCU Z;  3K0G A;  3OD4 A;  5CBH A;  1Z5W A;  5J2T A;  3ZX6 A;  5H6Q A;  4D6T H;  1N33 O;  3FAV A;  1L0L H;  4DXW A;  4JI7 B;  1H38 A;  3HKC B;  3HKB B;  3GWO A;  4HAM A;  3TET A;  2JVD A;  2GV9 A;  2IU3 A;  3B4S A;  4N21 A;  3CRC A;  3AK2 A;  2M7W A;  2F23 A;  4DYL A;  4JYB A;  3VQY A;  1NI8 A;  2LGW A;  4B3T O;  1BMF G;  3JAW B;  4BW5 A;  3HKE B;  4HZ3 A;  1OCO C;  4LF8 B;  3SYQ A;  4XDJ A;  2NNU A;  2W0X A;  2PTM A;  3RN4 A;  4PHZ A;  2WLL A;  2Q5Z A;  5EZY A;  2ZKO A;  4H44 B;  3T1Y B;  4PA6 A;  4FLW A;  3OTO O;  1LNQ A;  3CJH A;  2IJK A;  2KKW A;  5LA6 B;  5H6R A;  3A0R A;  4GCZ A;  1JCH A;  3ASO B;  1Y67 A;  1OCZ B;  3IGA C;  1FYJ A;  2JGD A;  2UUB O;  2F1M A;  1SZX A;  1K7D A;  4DV4 O;  1AIL A;  3A0B Z;  3N2K A;  4PJ0 Z;  4TWK A;  4LF4 O;  3K5M A;  4DV3 B;  3HKB A;  3W7U A;  1N32 O;  3EFF K;  4CC6 A;  1Y76 A;  1ZSP A;  3B8N A;  4CC5 A;  4WBN B;  4DR3 O;  2BSK B;  1IX9 A;  3FB7 C;  5IYZ B;  3BPZ A;  1NH2 B;  5L3D A;  5EYP B;  2X6A A;  5FPR A;  3KKY A;  4ZKI A;  4QPK A;  4GYC B;  1K5Q A;  4LWS B;  4X64 B;  4LFB B;  4F6E A;  3DC5 A;  3LUT B;  2FL4 A;  1Y74 A;  4ZHQ A;  3OGI B;  3E8F A;  4X65 O;  3WB0 A;  3AEI A;  3VQW A;  4B3R B;  2ZDI C;  1CP9 A;  3H1K H;  4Q20 A;  3JD2 A;  3RYC B;  3K79 A;  1IBM B;  1BS3 A;  2ZXW C;  1VQ8 V;  1XIL A;  2UUC O;  1Z2G A;  4R6Z A;  4BAY A;  3L70 H;  5IE9 A;  2ZIO A;  4ZOL A;  3H1H H;  1YZB A;  3APQ A;  1AI4 A;  3D8C A;  4W4L A;  2HHH B;  1E79 G;  2JEU A;  4FVM A;  3T1C A;  5L3C A;  3TK1 A;  1BSM A;  3X2Q C;  1YIJ V;  2K1E A;  3T1H B;  4D7T A;  3ZMZ A;  1BHA A;  2YUA A;  4WCE V;  2C2A A;  2KG7 A;  2EIL B;  2UU9 O;  4OX9 O;  1FKA O;  4NYK A;  1CPY A;  1VF5 B;  3E2E A;  3JAM N;  1I94 B;  3ZCC A;  4JAU A;  1JVM A;  3JAL B;  1Q6H A;  3WB2 A;  4QJF B;  4MTO A;  4K0K B;  1U97 A;  2YIB A;  2E75 B;  2UXD B;  5CA3 A;  2UUA B;  3JAT A;  1KBH A;  2LP7 A;  5GON B;  5CB4 B;  4TQD A;  3DC6 A;  4E4E A;  5L3F A;  3OFN G;  4LFA B;  3Q4H B;  1WPX A;  4J7K A;  1WJZ A;  5EK0 A;  2ADQ B;  5JVD B;  1NT2 B;  1BT8 A;  1JQ0 A;  1THZ A;  3JAS A;  1FXK B;  1FFT B;  1G4Y B;  3RGB A;  3VOU A;  1GM7 A;  1MZE A;  3APO A;  2A79 B;  1DF4 A;  2UXX A;  3ICX A;  4CBC A;  2FB5 A;  4LH7 A;  2LJ2 A;  3ZHQ A;  1H2L A;  4KL1 A;  1Y66 A;  5B1N A;  3B09 A;  2QKA A;  3K59 A;  1N34 B;  1XMQ O;  3OEH G;  1SES A;  4NXN O;  1E1Q G;  3K9S A;  2H3O A;  3QNE A;  4KFM A;  4FLU A;  2CAZ C;  2N74 A;  4H13 B;  5GTI Z;  4DR5 O;  1WNS A;  4MVS A;  2DE0 X;  5LMU B;  1H2S B;  4TV8 A;  1EM1 A;  1RFY A;  4ZI7 B;  1BCC H;  1ZUQ A;  5KAI Z;  5LMN B;  4Z1V A;  1JOY A;  2DW4 A;  1XNQ O;  3ZHS A;  1XL4 A;  4B3M O;  2BOB C;  4H37 A;  4HNA B;  2HKO A;  4I55 A;  2Q0O C;  5J9P C;  1L0N H;  5KUM A;  2JRI A;  1YIT V;  4IYI A;  3CE2 A;  2YC0 A;  4B7K A;  1VQ5 V;  3CCL V;  1F4M A;  2EIJ C;  3KCX A;  3H1L H;  5D5Q A;  3OEE G;  4GX5 A;  2Q9L A;  4HBN A;  2H8P C;  2V1D A;  4IHJ A;  4FLT A;  4JTD B;  2UUA O;  3IFX A;  5CA1 A;  4O2A B;  5LXT B;  1KD1 W;  4JAA A;  4IIJ A;  4X20 B;  4LFA O;  2UXB B;  4G27 B;  3VBB A;  2VS0 A;  2ZXW B;  1EZJ A;  4FPP A;  1RSO A;  4B3S B;  3IAY A;  3CWB H;  5JH7 B;  4J80 A;  4GX1 A;  3CC4 V;  1SQP H;  4FLV A;  1BQ0 A;  3OMA B;  1MZF A;  2XAH A;  3X2Q B;  3S3W A;  1KP2 A;  2GSM B;  1V9P A;  4FZ0 A;  2B9Z A;  5F2V O;  2HJD A;  1GN6 A;  3U10 A;  5JQG A;  1YDX A;  1AP5 A;  4QGP A;  2D2C B;  1CXZ B;  2F93 B;  4DW0 A;  1JFF B;  1XEQ A;  4JAV A;  4WFH A;  4GKJ O;  1EN6 A;  5IY5 C;  2DYR C;  3FFQ A;  3RVZ A;  1I5Y A;  2RNB A;  4UV8 A;  1OJH A;  5CA0 B;  3L75 H;  4A5U B;  4JAS A;  2YXL A;  2AXT Z;  5LMU O;  3QO8 A;  3DGE A;  1HP8 A;  1UFI A;  3CRM A;  1GMG A;  5LMN O;  1N36 O;  1ZX3 A;  4X9Q A;  1AR4 A;  1SF9 A;  4PEL A;  3CCU V;  4X20 A;  5EIB D;  1M5I A;  5IJ0 A;  5FNV A;  4FK5 C;  4I5S A;  2AW9 A;  1Q6I A;  4O4L A;  4JI4 B;  2ODM A;  4U7N A;  4JZ2 A;  4YIP A;  4X66 O;  2QDO A;  2CTP A;  4R50 A;  4P9O A;  1LUV A;  4LF5 B;  3E86 A;  5LHH A;  3IC7 A;  4RQF A;  1ROP A;  4TUY A;  2V7Q G;  2R9R B;  1G1X B;  3UO3 A;  2EIM C;  2CGO A;  3L71 H;  1YI2 V;  5J2U A;  4H0L B;  2GBO A;  1K92 A;  4PA4 A;  3W7S A;  3MAQ A;  1KMI Z;  3N2G A;  2A3Q A;  2ZCE A;  4NVP A;  1GTO A;  2YXH A;  2WLJ A;  2IM9 A;  2PGG A;  4O4H A;  5H5N A;  2F4V B;  1RPO A;  5B1A B;  1DF5 A;  2LFR A;  4EKW A;  2P7T C;  3C3T A;  3OE7 G;  4DR4 B;  4DUZ O;  3AG1 B;  4LFC B;  5KMG B;  3CC2 V;  3RYH B;  2EIJ B;  4K8X A;  3BY6 A;  3F7V C;  4WFA V;  1YSC A;  1TGO A;  2P6J A;  2JK5 C;  1WB8 A;  1WB7 A;  2OIE A;  3BFR A;  4J11 A;  4LF6 O;  2ZE7 A;  4PDV A;  1Q90 D;  2ETN A;  3FD9 A;  2Q69 A;  4KHP B;  4X88 A;  3ZHV A;  1IUR A;  2Y0P A;  1QQC A;  1KB9 F;  2F66 C;  1N0J A;  3P3N A;  4YJ3 B;  4EEQ A;  1SS3 A;  4MW3 A;  1W2B U;  3SGI A;  3CCE V;  3E8G A;  4O4I B;  1YVW A;  1R3I C;  2WLI B;  2CDY A;  1S5J A;  3ASO C;  4O4J B;  1AI5 A;  1Q6U A;  3AK1 A;  1N33 B;  5CN0 A;  2DYS B;  3ASN B;  4EB6 A;  5KUK A;  4RO2 A;  5IJ9 B;  3HR0 A;  1IZ3 A;  3IJ4 A;  3A2F A;  3CPW U;  4DR7 O;  5AG2 A;  5BR8 O;  4FM2 A;  1Q7Y W;  3D36 A;  4FLZ A;  2DWE C;  2VWJ A;  4MVO A;  2AZ2 A;  3ABK B;  2DYR B;  3JD3 A;  4B3T B;  1O9G A;  2ZR2 A;  5J2T B;  4L87 A;  3ZN1 A;  1GAX A;  3FAV B;  3CX5 F;  2A06 H;  4KXR A;  2XAJ A;  2Q67 A;  5HFL A;  4OPH A;  4DR4 O;  3OTO B;  2JJ1 G;  2Q73 A;  4LFC O;  3A8T A;  4BIU A;  2PYL A;  4I7Z B;  2UUB B;  4AQY O;  3H01 A;  1BZK A;  2WLL B;  3ABU A;  2PY5 A;  2KSD A;  4FIP C;  4DV0 O;  5EZY B;  1ORQ C;  1SQG A;  2CTQ A;  4KHP O;  3FB6 C;  4UCR A;  2EIM B;  3L9D A;  4LF4 B;  4PDL A;  4X1I A;  5BY1 A;  1N32 B;  1Q3E A;  2WSS G;  3K0D A;  3QVN A;  2EIL C;  2D3O W;  3CXH F;  5LGT A;  4DR2 O;  1FFX A;  2Z3Y A;  1XBL A;  2JGD B;  3ZRX A;  3BCC H;  2WWW A;  3ZMT A;  1XHZ A;  1YTF B;  1NH2 D;  1KC8 W;  3JD1 A;  1TUE B;  3AK3 A;  2IU0 A;  4JZG A;  1S72 V;  3AG3 C;  1PNM A;  3N2K B;  4K8Z A;  2EBO A;  2ZIM A;  1Y76 B;  2RCV A;  3F7Y C;  4X65 B;  4J41 A;  2R9I A;  3T4Z A;  3U0Z A;  4DV2 O;  4P9P A;  3FX7 A;  1R6N A;  4X8A A;  2UUC B;  4DV7 O;  2K9P A;  4UFZ A;  1FXK C;  1AP6 A;  3OW2 U;  1FJG B;  2DQ3 A;  1IBK O;  2Q0A A;  1NR7 A;  2AHZ A;  3M8A A;  1ZLZ A;  2YXY A;  1Y74 B;  4ZHQ B;  4OX9 B;  2UU9 B;  2BTO A;  1SQV H;  3MHS C;  1D5N A;  1W59 A;  3HKD A;  4JYY A;  2X0L A;  1FXH A;  2CK3 G;  4O2B A;  4FM0 A;  3UO2 A;  1NU1 H;  1N0N A;  3VQX A;  1UPG A;  4ZOL B;  1YXB A;  1PP9 H;  1Y4M A;  4TT3 G;  1VF6 A;  4UCS A;  4JI0 B;  1BE3 H;  1GM9 A;  4LF9 O;  1P4R A;  5DN6 G;  2IJH A;  3CEI A;  1M57 B;  4X1K A;  4DRX B;  1VIB A;  4JI3 O;  3LDC A;  3HB3 B;  2KG7 B;  2HVJ C;  2L35 A;  2DWD C;  4JI8 O;  1QVF U;  3JAR A;  4JV5 O;  2XT9 A;  1KYO F;  1W0K G;  5BMV A;  3CCM V;  3CCJ V;  4MVZ A;  1DGS A;  3SPI A;  2PI5 A;  1M93 A;  3H1I H;  2Z5U A;  3OR6 C;  2RJZ A;  2F43 G;  4HYO A;  3G6B A;  3JAT B;  1B04 A;  1WLE A;  4GT1 A;  2DMX A;  3TJT A;  4CH4 A;  5A9G A;  1V54 B;  5IYD O;  3L74 H;  2LO1 A;  4NKG B;  2MK3 A;  1COW G;  3K58 A;  2ARH A;  1M4U A;  1AJP A;  4ZBM A;  1TUB A;  3DTU B;  1XMQ B;  2ZNI A;  2A0L A;  2IW5 A;  1VQ4 V;  4NXN B;  1U96 A;  4UCU A;  1S76 D;  3ZRW A;  4GX2 A;  3JAS B;  3QTC A;  1WA8 A;  1MSD A;  1IBL O;  5KHJ A;  1RPR A;  4NXM O;  2ZM6 B;  4FFB A;  4YHH B;  1FJG O;  4B08 A;  3JAK A;  4DR5 B;  2W0F C;  2CH7 A;  1R6K A;  4DK1 A;  4DRX A;  1XNQ B;  4B3M B;  2GTS A;  2FYU H;  5KAF Z;  1OV9 A;  2DJV A;  1R3L C;  1G8M A;  1VQ6 V;  4Q6G A;  3ZIA G;  4I0X A;  4RWU A;  3JCZ A;  2VQE O;  1URF A;  1DK1 A;  4QE9 A;  4PA7 A;  2ZE5 A;  3K5O A;  1XI1 A;  1NKD A;  4I4T B;  3AG3 B;  4TSF G;  1JJO A;  3SYP A;  4B7E A;  4FM1 A;  2CTR A;  4JI0 O;  5JJE B;  3OGC C;  4TV8 B;  1GN2 A;  2NN4 A;  3DXR A;  2PUS A;  3D3I A;  1YJW V;  1XMO O;  4I55 B;  2Y4T A;  3CC7 V;  1B6Q A;  1VMG A;  2OCH A;  2WLM A;  2JDI G;  3CHX A;  5JJN B;  3PJS K;  3P32 A;  4CS3 A;  2XAF A;  4IHJ B;  1SQQ H;  3OUF A;  2N04 A;  3OT7 A;  1BL8 A;  5CA1 B;  1M56 B;  3D3Q A;  1N8R W;  1K4C C;  1Q86 W;  2ZT9 B;  4LNU A;  4IIJ B;  4LBE C;  3ETQ A;  5EBW C;  2IH3 C;  3GB7 C;  3EXA A;  3JD4 A;  2QSA A;  3B2E E;  1JR9 A;  5TIS Z;  4MVU A;  3UT5 A;  1HNW O;  3CCR V;  4GKJ B;  4NR1 A;  5DEC A;  1RSO B;  5L3E A;  3BRC A;  2JS3 A;  4DV1 O;  2P4V A;  2ZM6 O;  4I4T A;  4YHH O;  2XAS A;  4PV1 B;  4LR3 A;  5B1A C;  4I9Q A;  5C8Y A;  1N36 B;  1VP7 A;  1RP3 B;  5JQG B;  3D36 C;  3AG1 C;  2OTJ V;  4JPR A;  3CME V;  3FKS G;  3K04 A;  1OCR C;  2YID A;  3ABT A;  3NXS A;  3MDS A;  4X66 B;  1PM9 A;  2QWN B;  3CYO A;  2YSU B;  4GZR B;  3ZJZ A;  1ZTE A;  4X1Y A;  4WFB V;  1QLN A;  1YCI A;  4I50 A;  3ZMU A;  3G4S V;  2ATK C;  4XDL A;  3KCY A;  3AG7 A;  2R9A A;  2X7R B;  1EFR G;  2Q4P A;  2QWR B;  1XL6 A;  4WFF A;  5FNV B;  5IJ0 B;  3KZI Z;  3L73 H;  2HVK C;  2QTS A;  4O4L B;  3ZHT A;  1F4N A;  2ILM A;  4DR6 O;  2PF4 E;  1S5H C;  1ENV A;  2EUL A;  1XRE A;  4QE7 A;  1K5S A;  1VQK V;  1SRY A;  4RAI A;  2P5O A;  3SYO A;  2DYS C;  3SJC C;  2RN9 A;  3ASN C;  1CEZ A;  3CD6 V;  4JTC B;  3ZN0 A;  3H1J H;  3LSU A;  4TUY B;  1DTO A;  1HNX O;  2EJR A;  4DUZ B;  5J2U B;  1MAB G;  4K3A A;  4QNH B;  1IXM A;  5KHG A;  1ZWI C;  3C90 A;  4DV5 O;  3GVM A;  3RYF A;  3ABK C;  5A2Q N;  3K03 A;  5B1O A;  2RDC A;  3N2G B;  3ZHR A;  4R7C A;  1A32 A;  2CGN A;  4O4H B;  4LF6 B;  1J5E B;  3LNN A;  2QKC A;  4F4L A;  1D5A A;  2EZO A;  1P7G A;  4Z1M G;  2GUZ A;  1K33 A;  4DUY O;  2B5U A;  4TQF A;  2RMK B;  2BCC H;  2YIA A;  1K34 A;  1M90 W;  3RFR A;  5JCO A;  2Q8V A;  5EC2 C;  4WFE A;  3E83 A;  1WPB A;  2A7W A;  3OR7 C;  1Q81 W;  2HLD G;  3UM7 A;  3RWR D;  1GK9 A;  4JI6 O;  2BTQ A;  3J80 N;  4DR7 B;  5BR8 B;  2ZDI A;  2AZ0 A;  2WA3 A;  5B1B B;  4E2L A;  1WN7 A;  3K3W A;  2R72 A;  1XNR O;  1SQB H;  1V55 C;  2N05 A;  3OM3 B;  3E8B A;  2F95 B;  4I9W A;  5LYJ A;  3ABL B;  3H9V A;  2BOC C;  2WPD G;  5KHH A;  4DR1 O;  4YJ2 A;  3RYI A;  4EB6 B;  2ITC C;  4BIZ A;  1PNL A;  3ZED A;  4U3F H;  3AG4 C;  4XDK A;  1VF7 A;  4F6R A;  4U3J A;  1EN4 A;  1VQM V;  3W7W A;  1H8H G;  1LUW A;  4IYH A;  2E5L O;  1E1R G;  2P22 C;  5H2F Z;  1OCR B;  1AI7 A;  4QPJ A;  3K5L A;  4PI0 A;  1VQL V;  4JYA O;  2OCC B;  2EIK B;  4AQY B;  5CBF A;  1AJN A;  2E74 B;  1J5E O;  4IGG A;  3MD0 A;  4TV9 A;  4DV0 B;  3G71 V;  1QBZ A;  4BWA A;  2Y69 C;  3LDD A;  4J7Z A;  4MVR A;  4MTX A;  1SZT A;  3TCU A;  3QO7 A;  2FTK A;  3J81 N;  2YEV A;  1ZAU A;  4DR2 B;  1TAE A;  1NVP B;  1R73 A;  1YTF D;  1GRJ A;  1F23 A;  1HR0 O;  3K9A A;  4OPA A;  3SPG A;  1K97 A;  4MTG A;  3CXC U;  3JSN A;  3BA8 A;  4X1I B;  4YY3 O;  1O9H A;  1WAZ A;  1M57 C;  2ITD C;  1K8A W;  2Y48 A;  1EN5 A;  4FFK A;  4WFG A;  1FFX B;  5ITZ A;  1Q8I A;  2QE7 G;  2QR4 A;  2ZE6 A;  3E35 A;  4DK0 A;  3E89 A;  4DV2 B;  3OTF A;  4IT5 A;  3SPC A;  2JIZ G;  4DV7 B;  4DV6 O;  5LGU A;  2L6L A;  1YEW A;  1XOU A;  2QKS A;  3CP1 A;  3EHB B;  1QU7 A;  2NLJ C;  4RUE A;  5IDJ A;  1Q5O A;  3B40 A;  2XHB A;  1IBK B;  1VQN V;  1NJI W;  5L3G A;  2R70 A;  2HR3 A;  5C93 A;  1NTM H;  3WG7 B;  5KLV H;  2B1G A;  1KKD A;  1SET A;  2WLH A;  1V54 C;  3O9O A;  2UXN A;  2CUG A;  1SC5 B;  4PDR A;  3ETG A;  1NZ6 A;  2AHY A;  1FPO A;  3M7M X;  1K9M W;  4UVA A;  3QO5 A;  1JJ2 U;  1N4C A;  3MHH C;  4LF9 B;  4MVQ A;  5KA6 A;  2G38 A;  3RBZ A;  3SJB C;  4GUN A;  4JI3 B;  3ML0 A;  4UB6 Z;  1PV0 A;  1V55 B;  4J10 A;  4JI8 B;  3HKD B;  3OMN B;  4JV5 B;  3SPH A;  4O2B B;  1MA1 A;  3FB8 C;  5KX5 A;  2NR5 A;  4RQE A;  2ZIN A;  1PL4 A;  1MSW D;  3AG4 B;  1YHQ V;  1Q82 W;  2Q6A A;  3GWK C;  1P84 F;  1W0J G;  2YIB D;  5LP6 B;  1AR5 A;  4X1K B;  4OGQ B;  1XQ8 A;  1KKC A;  3JAR B;  2DOS A;  1SQF A;  4JF3 A;  4J9Y B;  5BMV B;  5LBQ A;  5B3S B;  3BHP A;  5K1P A;  3BEH A;  1GN3 A;  1M9N A;  3LNM B;  2IJJ A;  1R3K C;  2OYQ A;  2WLK A;  1IBL B;  4ABM A;  2QA4 V;  1H2M A;  4NXM B;  1Z5V A;  1IDS A;  4UV9 A;  3SYC A;  2AGA A;  1TVK A;  3FB5 C;  3JD0 A;  3ZHU A;  2Y69 B;  4JTA B;  2QWO B;  2EZP A;  2FKX A;  1M56 C;  3IC9 A;  2Z0A A;  1NR1 A;  1GO3 F;  2E3C A;  2PYJ A;  1JPX A;  3SR2 C;  1X59 A;  3UQ8 A;  2UXC O;  4NTY A;  2JGU A;  2V4D A;  1TUB B;  2OT5 A;  2VQE B;  3E22 A;  3ZRW B;  3I56 V;  1SA0 A;  1WA8 B;  5E79 Z;  3CRR A;  1NTK H;  3OMI B;  4RUF A;  4FFB B;  4CS4 A;  4JYC A;  3JAK B;  1BHB A;  5LP6 A;  3G6E V;  1AR1 B;  2CH7 B;  2Q7E A;  4CH3 A;  4AI8 A;  1XMO B;  4JGS A;  1B06 A;  3BAB A;  1K3E A;  1ARO P;  4JI1 O;  4I0X B;  4J9Z B;  1UJW B;  3W7X A;  1VQP V;  1SQX H;  3WU2 Z;  4ASU G;  2HEP A;  3FYI B;  4JI2 O;  3CCS V;  5EC1 C;  3HKC A;  3G67 A;  2XOK G;  2VQF O;  3F5W C;  2QJ1 A;  4UXN A;  1XDC A;  2X6B A;  3DXR B;  2IJI A;  1H8E G;  2YI8 A;  4FLX A;  1SKV A;  3JAW A;  3HKE A;  4P30 A;  4W4K A;  3TXQ A;  1QVG U;  1QHT A;  4K35 A;  1MMM A;  1RM1 B;  2LW7 A;  3C3S A;  1HNW B;  4IL6 Z;  4KUM A;  1HW7 A;  4GX0 A;  4JI7 O;  4JI5 B;  3FYE B;  5JCO C;  2XTA A;  4UVC A;  4DV1 B;  2P67 A;  3STZ C;  4DW1 A;  2PI4 A;  5IWA B;  2EIN C;  1FS0 G;  2Y4U A;  5LA6 A;  2JS5 A;  4PD4 F;  5EBL C;  4LNU B;  3DSQ A;  4LF7 B;  1HWY A;  1VEW A;  4PI2 A;  3A0H Z;  4LF8 O;  1QR9 A;  1PL0 A;  3JSL A;  2GHY A;  1QLE B;  4AIL C;  3N27 A;  2HG5 C;  1VAR A;  3UT5 B;  1H2N A;  2QM8 A;  2X6C A;  3ETE A;  3CRA A;  4GLX A;  3T1Y O;  3R65 A;  2QTO A;  4LCU C;  4WF9 V;  2LQT A;  2KB1 A;  4WBN A;  3JYC A;  2DN9 A;  1QNM A;  1Y6X A;  2BSK A;  5C8Y B;  1FAF A;  2ZR3 A;  3S3X A;  3B8M A;  5IYZ A;  2VWK A;  5IYB O;  1VQ7 V;  3SYA A;  2XUM A;  5GTH Z;  1MOF A;  4MT8 A;  1TA8 A;  4L8J A;  1DLB A;  5EYP A;  4UB8 Z;  2YDE A;  2E76 B;  4UVB A;  3I55 V;  3K57 A;  3SJA C;  2LGQ A;  3CS5 A;  5K1X A;  4DR6 B;  1R3J C;  2CTW A;  1BGY H;  4LWS A;  4DV3 O;  3K06 A;  4QIW F;  3EVK A;  4X1Y B;  4I50 B;  2W6J G;  2EX3 A;  4YIO A;  1OCO B;  1HNX B;  3STL C;  1AB3 A;  2DQ0 A;  3CCQ V;  1GN4 A;  3RYC A;  5IT9 N;  4EFE A;  5B1B C;  1LR1 A;  4BR6 A;  4MS2 A;  3TXS A;  2ZQM A;  1IXB A;  1PNK A;  1PPJ H;  4DV5 B;  3K08 A;  4JI5 O;  3R66 A;  3ABL C;  5KHK A;  1WP7 A;  3OUS A;  4X64 O;  4LFB O;  4NTX A;  4OXS A;  2M6Y A;  1J95 A;  1PD3 A;  5IWA O;  3LDE A;  1KUQ A;  3B77 A;  4LF7 O;  4B3R O;  4GKK B;  2XAG A;  1QR8 A;  1IBM O;  3SDL A;  3JAL A;  4DUY B;  5EBM C;  1OZ0 A;  3RVY A;  4BIO A;  4R8C A;  3P30 A;  4ICG A;  3T2M A;  4XBF A;  2WLN A;  1FD9 A;  3RYF B;  2HHH O;  1HNZ B;  5LHG A;  4PDM A;  2OCC C;  2EIK C;  5GON A;  5CB4 A;  1T5E A;  1XUQ A;  3T1H O;  1S77 D;  4FMT A;  1R6T A;  1JA8 A;  4MSW C;  4JI6 B;  5FLX N;  5LOV B;  3Q4H A;  3W7T A;  1S0V A;  4AHC A;  1G6U A;  4KP4 A;  2JEX A;  4UCT A;  2GUZ B;  1F7Y A;  5JVD A;  1I94 O;  1GKF A;  2OIG A;  4J7J A;  1FXK A;  1XNR B;  5B66 Z;  4K0K O;  5KHI A;  3ZRS A;  5L3B A;  3AG2 C;  2HJF C;  2UXD O;  1NBM G;  4MW8 A;  3ABM C;  4FLY A;  4LC1 A;  1S3J A;  4DR1 B;  2IBZ H;  2ADP A;  2EIN B;  2YIC A;  3ZBH A;  2BTQ B;  5EIB C;  1KP3 A;  2Q7G A;  2Q68 A;  3F5T A;  1PKX A;  1L1F A;  2QEX V;  2E5L B;  4MTF A;  5BZB A; 
#chains in the Genus database with same CATH homology
 3T4Z A;  2FTK A;  4JAU A;  2YEV A;  1JVM A;  4QJF B;  4P9P A;  1R6N A;  4X8A A;  2A9H A;  1NVP B;  4MTO A;  3LSS A;  1FXK C;  1R73 A;  1YTF D;  3OW2 U;  5CA3 A;  1F23 A;  2LP7 A;  3K9A A;  2DQ3 A;  4X89 A;  3SPG A;  1K97 A;  2QM7 A;  4MTG A;  3CXC U;  1NR7 A;  5L3F A;  2AHZ A;  3OFN G;  1WPX A;  5EK0 A;  3MHS C;  1NQT A;  1M57 C;  2ITD C;  1JQ0 A;  1K8A W;  2Y48 A;  1M1K W;  2X0L A;  3WG7 C;  1THZ A;  1FXH A;  2CK3 G;  4WFG A;  1FXK B;  2QE7 G;  1FFT B;  3E35 A;  1G4Y B;  3E89 A;  2IH1 C;  3SPC A;  3VOU A;  2JIZ G;  1GM7 A;  1Y4M A;  4TT3 G;  5LGU A;  1NVP D;  2A79 B;  1DF4 A;  2QKS A;  2UXX A;  4CBC A;  2OTL V;  3CP1 A;  3EHB B;  2NLJ C;  4RUE A;  1GM9 A;  5IDJ A;  1P4R A;  1VQN V;  2XND G;  5DN6 G;  1Y66 A;  1NJI W;  1K4D C;  2IJH A;  5B1N A;  5L3G A;  2HR3 A;  1M57 B;  5C93 A;  4U7O A;  3LDC A;  3HB3 B;  3WG7 B;  2HVJ C;  2B1G A;  1KKD A;  4MVM A;  5LGN A;  2DWD C;  1SET A;  2WLH A;  1QVF U;  1V54 C;  3OEH G;  2UXN A;  4YXW G;  1KEC A;  1SES A;  1E1Q G;  4PDR A;  1W0K G;  3CCM V;  3CCJ V;  4MVZ A;  2YEV B;  3SPI A;  4CZZ A;  3ETG A;  3QNE A;  4KFM A;  2PI5 A;  2AHY A;  2Z5U A;  2XAQ A;  3OR6 C;  1K9M W;  2F43 G;  4MVS A;  4HYO A;  4UVA A;  1WLE A;  4PA9 A;  3QO5 A;  4GT1 A;  1JJ2 U;  1JOY A;  2DW4 A;  3MHH C;  1XL4 A;  2H94 A;  5IYD O;  1V54 B;  2BOB C;  4H37 A;  4H33 A;  4MVQ A;  3WFV A;  2HKO A;  5KA6 A;  3RBZ A;  5J9P C;  5KUM A;  3ML0 A;  1YIT V;  5HFM A;  2MK3 A;  1COW G;  1VQ5 V;  1V55 B;  1QCE A;  3CCL V;  1F4M A;  2EIJ C;  1AJP A;  4ZBM A;  1OCC C;  3DTU B;  1I5X A;  2A0L A;  2IW5 A;  3OMN B;  1VQ4 V;  3SPH A;  3FB8 C;  1S76 D;  3ZRW A;  4GX2 A;  3OEE G;  4GX5 A;  1KQS U;  4RQE A;  2H8P C;  2V1D A;  1RPR A;  1AI6 A;  1MSW D;  5B3S C;  4JTD B;  1P7B A;  3IFX A;  3AG4 B;  1YHQ V;  1Q82 W;  4PA3 A;  2Q6A A;  2W0F C;  1W0J G;  1KD1 W;  2JJ2 G;  3ZMS A;  1R6K A;  2HFE C;  1AJQ A;  4G27 B;  3HPL C;  3VBB A;  4DO2 A;  1R3L C;  1FXV A;  1G8M A;  2ZXW B;  3ZIA G;  1VQ6 V;  3JCZ A;  3T4D A;  4QE9 A;  4JF3 A;  1EZJ A;  4J9Y B;  5LBQ A;  3AG2 B;  4FPP A;  5B3S B;  4PA7 A;  3BEH A;  1M9N A;  4G2K A;  1VQ9 V;  3ABM B;  3LNM B;  4GX1 A;  2IJJ A;  1K73 W;  3CC4 V;  1R3K C;  2WLK A;  1VQO V;  1NKD A;  3OMA B;  2QA4 V;  2XAH A;  3AG3 B;  4TSF G;  3X2Q B;  3LSQ A;  3SYP A;  5DM6 V;  4UV9 A;  3OGC C;  5H9C A;  3SYC A;  1KP2 A;  1MG1 A;  3FB5 C;  3JD0 A;  2GSM B;  3UKM A;  5LHI A;  2Y69 B;  5IYC O;  4P2Z A;  4JTA B;  2EZP A;  1M56 C;  3D3I A;  1YJW V;  1NR1 A;  1GO3 F;  2W6I G;  5GW7 A;  5E1A C;  5FL7 G;  1JPX A;  3CC7 V;  1GM8 A;  1EBO A;  1B6Q A;  2WLM A;  4JAV A;  2JDI G;  2ZD9 A;  4WFH A;  1OCZ C;  5KA5 A;  5IY5 C;  2DYR C;  2OT5 A;  3RVZ A;  1F51 A;  1I5Y A;  3PJS K;  2B1I A;  4FJC C;  3ZRW B;  3P32 A;  3I56 V;  4UV8 A;  2XAF A;  4JAS A;  3OUF A;  3OMI B;  4RUF A;  1BL8 A;  3QO8 A;  3DGE A;  1OHH G;  1M56 B;  1YJN V;  1N8R W;  1GMG A;  3SJQ C;  4JYC A;  3CCV V;  1BHB A;  1K4C C;  1Q86 W;  3G6E V;  2WAM A;  1AR1 B;  4PEL A;  3CCU V;  4LBE C;  3E8H A;  5EBW C;  2IH3 C;  3GB7 C;  4JGS A;  5CBG A;  5IY5 B;  3JD4 A;  4FK5 C;  4I5S A;  1K3E A;  1ARO P;  4MVU A;  4J9Z B;  1UJW B;  3W7X A;  1VQP V;  4U7N A;  4LP8 A;  3CCR V;  5L3E A;  4ASU G;  1SER A;  4R50 A;  3FYI B;  3SPJ A;  1RM1 C;  1H2G A;  4P9O A;  3CCS V;  3E86 A;  5EC1 C;  5LHH A;  3IC7 A;  2XOK G;  3F5W C;  4RQF A;  1ROP A;  2XAS A;  5CMU A;  2V7Q G;  2R9R B;  2LFS A;  3ETD A;  5B1A C;  4UUJ C;  4UXN A;  2EIM C;  2X6B A;  2IJI A;  1YI2 V;  1H8E G;  2P90 A;  3KG2 A;  1JX9 A;  3AG1 C;  2OTJ V;  3CMA V;  4JPR A;  4P30 A;  1QVG U;  3CME V;  1K92 A;  3FKS G;  4PA4 A;  2WLI A;  3W7S A;  1RM1 B;  3K04 A;  1OCR C;  3ABT A;  4KUM A;  1GTO A;  2WLJ A;  4GX0 A;  3NXS A;  4N23 A;  1QLE C;  3OAA G;  3FYE B;  1RPO A;  3CYO A;  5B1A B;  4UVC A;  2YSU B;  1DF5 A;  3ZRV A;  2P67 A;  3STZ C;  2LFR A;  3ZJZ A;  3RW0 A;  4EKW A;  4WFB V;  1QLN A;  2P7T C;  3ZMU A;  2EIN C;  3G4S V;  2ATK C;  1FS0 G;  2PI4 A;  4XDL A;  3OE7 G;  3AG1 B;  5EBL C;  2X7R B;  3CC2 V;  3M99 B;  1EFR G;  3ZMV A;  1HWY A;  1YJ9 V;  2EIJ B;  4G28 B;  1XL6 A;  1OCC B;  4WFF A;  3BY6 A;  3K0G A;  1QR9 A;  3F7V C;  5CBH A;  1PL0 A;  4WFA V;  1YSC A;  2GHY A;  2HVK C;  2P6J A;  2JK5 C;  1QLE B;  5H6Q A;  2HG5 C;  1F4N A;  2QM8 A;  2X6C A;  3ETE A;  1S5H C;  1ENV A;  4DXW A;  4QE7 A;  1K5S A;  4PDV A;  1VQK V;  1SRY A;  3R65 A;  4RAI A;  2QTO A;  2Q69 A;  4LCU C;  4WF9 V;  3SYO A;  4X88 A;  2DYS C;  1H38 A;  3ASN C;  1CEZ A;  3CD6 V;  4JTC B;  3GWO A;  4HAM A;  3ZN0 A;  2KB1 A;  3TET A;  2IU3 A;  3JYC A;  1DTO A;  4N21 A;  2ZR3 A;  2EJR A;  2M7W A;  3B8M A;  4MW3 A;  5IYB O;  1W2B U;  1VQ7 V;  3SYA A;  3CCE V;  4JYB A;  1MAB G;  1MOF A;  1BMF G;  3E8G A;  4MT8 A;  4HZ3 A;  4BW5 A;  1OCO C;  4QNH B;  1IXM A;  1R3I C;  1ZWI C;  3SYQ A;  1DLB A;  2WLI B;  4XDJ A;  2NNU A;  3ASO C;  3ABK C;  3K03 A;  1AI5 A;  5B1O A;  2WLL A;  5CN0 A;  4UVB A;  4R7C A;  2DYS B;  3I55 V;  3ASN B;  5KUK A;  4RO2 A;  1R3J C;  3CPW U;  4PA6 A;  3K06 A;  4QIW F;  4F4L A;  1Q7Y W;  2EZO A;  4Z1M G;  3D36 A;  1LNQ A;  2DWE C;  2IJK A;  1K33 A;  2W6J G;  5H6R A;  3A0R A;  1OCO B;  4GCZ A;  3STL C;  1JCH A;  4MVO A;  2DQ0 A;  3ASO B;  3CCQ V;  3ABK B;  2B5U A;  5B1B C;  1OCZ B;  3IGA C;  4MS2 A;  2DYR B;  2ZQM A;  3JD3 A;  1PNK A;  2ZR2 A;  1K34 A;  1M90 W;  4L87 A;  3K08 A;  3ZN1 A;  5EC2 C;  4WFE A;  1K7D A;  3ABL C;  3E83 A;  3OR7 C;  3OUS A;  1Q81 W;  2HLD G;  3UM7 A;  1GK9 A;  4TWK A;  2XAJ A;  2Q67 A;  4OXS A;  1J95 A;  1PD3 A;  5HFL A;  3W7U A;  3EFF K;  3LDE A;  2ZDI A;  2JJ1 G;  3B8N A;  3B77 A;  5B1B B;  3FB7 C;  4BIU A;  4E2L A;  2XAG A;  1QR8 A;  3K3W A;  1V55 C;  1NH2 B;  3OM3 B;  3E8B A;  5EBM C;  4I9W A;  1OZ0 A;  5L3D A;  3RVY A;  3ABL B;  3P30 A;  4R8C A;  3T2M A;  4XBF A;  2WLN A;  3H01 A;  2X6A A;  2BOC C;  2WLL B;  2WPD G;  3ABU A;  4PDM A;  5LHG A;  2OCC C;  4FIP C;  2EIK C;  2ITC C;  4BIZ A;  1PNL A;  4ZKI A;  1ORQ C;  1S77 D;  3FB6 C;  4FMT A;  4QPK A;  1K5Q A;  3AG4 C;  4XDK A;  2EIM B;  4MSW C;  3W7T A;  1VQM V;  3LUT B;  1S0V A;  4PDL A;  4KP4 A;  2JEX A;  3W7W A;  1H8H G;  1E1R G;  1GKF A;  3E8F A;  2WSS G;  3AEI A;  3K0D A;  2EIL C;  2D3O W;  2ZDI C;  1CP9 A;  5LGT A;  1OCR B;  4Q20 A;  3JD2 A;  1AI7 A;  1FXK A;  3K79 A;  2Z3Y A;  4QPJ A;  2ZXW C;  1VQ8 V;  1VQL V;  4R6Z A;  3ZRX A;  4BAY A;  2WWW A;  3ZMT A;  1YTF B;  2OCC B;  3ZRS A;  2EIK B;  1NH2 D;  5L3B A;  3AG2 C;  2HJF C;  1NBM G;  1KC8 W;  3JD1 A;  1TUE B;  1AI4 A;  4MW8 A;  3ABM C;  5CBF A;  1AJN A;  1E79 G;  2JEU A;  4LC1 A;  2IU0 A;  1S3J A;  3T1C A;  3MD0 A;  5L3C A;  3TK1 A;  1S72 V;  3AG3 C;  2EIN B;  3X2Q C;  1PNM A;  3G71 V;  1YIJ V;  1QBZ A;  2K1E A;  3ZMZ A;  1KP3 A;  1BHA A;  4WCE V;  2C2A A;  2EIL B;  2EBO A;  2Q68 A;  2Y69 C;  1CPY A;  1PKX A;  3E2E A;  3LDD A;  4MVR A;  4MTX A;  1L1F A;  1SZT A;  2QEX V;  3F7Y C;  3ZCC A;  4MTF A;  3TCU A;  3QO7 A;  5BZB A;  2R9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...