3ZRXA

The high resolution structure of a dimeric hamp-dhp fusion displays strong asymmetry
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
111
structure length
111
Chain Sequence
STITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AF1503 PROTEIN, OSMOLARITY SENSOR PROTEIN ENVZ
publication title Mechanism of Regulation of Receptor Histidine Kinases.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
total genus 45
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3zrxA00
4FPPA 2WWWA 4MTXA 2P67A 3ZRWA 3D36A 2QM7A 4GCZA 4BIZA 3DGEA 4JASA 4MT8A 2C2AA 5B1OA 4QPJA 2LFSA 4JYCA 4I5SA 4FMTA 4JAVA 4U7NA 2QM8A 3MD0A 3ZRXA 4LC1A 3P32A 4U7OA 3ZRWB 4Q20A 1IXMA 4ZKIA 5IDJA 4BIUA 4GT1A 4JYBA 3NXSA 3TK1A 4QPKA 5C93A 3ZCCA 3A0RA 4KP4A 2FTKA 5B1NA 1JOYA 2LFRA 4JAUA 3ZRVA 1F51A
chains in the Genus database with same CATH superfamily
1OJHA 4LH6A 4P9PA 1AROP 3SJQC 2UUAB 3H1KH 2QGNA 3E83A 3I5DA 1N0JA 5LXTA 4DR2O 3QVNA 3JD2A 2ZR2A 1N36B 5BR8B 4I50A 2B9ZA 3FAVA 3ETDA 4WFBV 5JJEB 3D3IA 3ABTA 4U3JB 3B8MA 3AG4C 2P67A 1QU7A 2CGOA 2DJVA 4JYCA 4U7NA 2ZXWC 1N8RW 5KMGB 3HKEB 3GWOA 2LW7A 2WLLB 3ZMVA 4RO2A 3CYOA 2CH7B 3E35A 2OIEA 1KKDA 4MW8A 2BE3A 4NR1A 3T1CA 1J5EB 3CX5F 4PDLA 4G2KA 2JS3A 3JASA 1GAXA 5H5NA 1IXBA 4BWAA 4ZHQA 2OYQA 3RN4A 2ZXWB 1SS3A 2Y4TA 1SQVH 4CH4A 3CCRV 4ZOLB 4EB6B 3L70H 2QKAA 4JI6B 4DV4O 1M56C 2WLJA 4X64O 1KD1W 1NBMG 2CUGA 1URFA 3APOA 1KYOF 3ZRWA 3G4SV 2ZIOA 1G6UA 2QWOB 2Y4UA 3Q4HA 1RFYA 3OR7C 4MVUA 2V1DA 4QE9A 4I55A 3UQ8A 2HHHO 2X7RB 1S5LZ 2VQEO 4F4LA 1Q82W 1VQ8V 1KUQA 4DR4O 1M56B 3AG7A 1AJNA 4PA4A 3GWKC 4TT3G 1DK1A 4MVMA 4MVZA 4JASA 3THOA 4JTAB 4PV1B 2XAFA 3TJTA 1SERA 4DR1B 2DOSA 5L3GA 3K58A 1HNXB 4U3JA 3A2FA 4R7CA 1P7GA 1EN6A 1PNKA 4L8JA 1YSCA 1GO3F 2JJ2G 4DRXA 2IH1C 3OTOO 2X0LA 2Q9LA 4W4LA 3A8TA 2HVKC 5KMGA 3HKEA 2IH3C 2WLLA 4LF7O 1S76D 5TISZ 2HR3A 3L71H 2A0LA 1WNSA 2CH7A 1JFFB 4B3RB 1FXKC 1E1QG 1YTFB 4I9QA 5JH7B 3KCYA 3UO3A 2E5LO 4JTDB 5K1XA 3RFRA 1CP9A 1D5AA 3A0HZ 4DR7O 4HNAB 3T1HO 1QR8A 3ASOC 1VEWA 4ZOLA 4EB6A 4IHJB 3ZJZA 5H9CA 2HHHB 3AG1C 1PP9H 2VQEB 2WAMA 5GW7A 1BMFG 4UCOA 5IY5C 5H2FZ 1XL4A 4F6EA 4QPKA 3AK2A 5GTIZ 2DWEC 4JI5O 3BABA 4LBEC 3UCSC 1AB3A 3FX7A 3CC4V 1TGOA 4RAIA 4DO2A 4KFMA 3ZN0A 5IJ0B 2XUMA 1GN2A 3AG1B 4LF4O 3OTOB 1JA8A 2QEXV 5EC2C 2XAQA 4GYCB 4GX0A 2BSKB 2LW1A 2UXDB 3H9VA 4J7JA 4FM1A 2YC0A 5KHIA 1CEZA 2QSAA 1O9HA 5KUMA 4PA6A 3LDDA 4B7KA 2YIDA 4XBFA 2GDSA 1SA0B 3MD0A 4UCRA 1M4UA 4RUEA 2E5LB 4JYYA 2PF4E 1AILA 2NLJC 1UJWB 2XT9A 4GLXA 1WAZA 4GUNA 4PD4F 3T1HB 1ZLZA 2ZQMA 2IU0A 5EC1C 3CC7V 2ZKOA 2MK3A 3ZMZA 1JFFA 2R9AA 1JX9A 4FPPA 5J2UB 3ETGA 3UO2A 1Y76B 4BW9A 5JH7A 4LFCO 2Q68A 1WLEA 5HFMA 4MVOA 1H8HG 4JI5B 4HNAA 2LGWA 3JCZA 2FMLA 4IHJA 1GN3A 2EIMC 1HR0O 3HPLC 1FJGO 3P3PA 4ABMA 2ZD9A 3E22B 5B1AC 4X89A 3W7TA 1YTFD 4DR6O 4FZ0A 1XHXA 3CPWU 4LF4B 3ZX6A 3KZIZ 4I0XB 2F95B 2XOKG 3ZHTA 1PPJH 2W0XA 2RMKB 4DUYB 2YXYA 4AQYO 4PA7A 3T4DA 2XAHA 4MTGA 5GONB 3CHXA 2PI4A 3A0RA 2EIMB 5IJ0A 1AP6A 2UXXA 3K5OA 2PTMA 4H13B 1COWG 2LFSA 1BT8A 2DYSB 3OTFA 2BSKA 1PL0A 4FJCC 4DV7B 5LL6Y 1HW7A 1RM1C 3OMAB 4JI4O 1FAFA 1ROPA 2EULA 3M99B 1LNQA 2HP8A 1L0LH 4OPHA 2UUCO 1EBOA 4TUYB 4ZI7B 1SA0A 1XOUA 3WU2Z 1M1KW 1K4CC 3IGAC 1FPOA 1XBLA 3HKCB 4FM2A 1VARA 4UCSA 1K34A 5D5QA 2G38A 4FLUA 2QR4A 4DV2O 3L74H 1HR0B 1FJGB 4GKKB 5J2UA 1Y76A 1MZFA 4LF5O 3ABUA 1I0HA 4DR6B 2Q73A 1F4MA 1JQ0A 3RBZA 5IT9N 4IGGA 2KQXA 1AJQA 1ZX3A 2KSDA 1H2MA 1M93A 1GH6A 2ZNJA 4AQYB 1K92A 2JEXA 1R3LC 4DK1A 4DV0O 3OT7A 2JVDA 1K5QA 1IXMA 3E22A 1B04A 3ZMSA 2Z0AA 5C93A 1XUQA 1WP7A 5KLVH 1AI5A 4I0XA 2B1IA 1QQCA 2IJJA 4JI7B 1Y74B 1EN4A 5J2TB 2OIGA 4CS3A 2IW5A 2XNDG 5GONA 4D6TH 4NXMO 4JI4B 3CRRA 2K9PA 1Q86W 2UUCB 2ZCEA 4YY3O 1HWYA 1AP5A 3MDSA 4X9QA 3ZN1A 4LWSB 2P5OA 4I9WA 2AZ2A 3LSQA 2YIBA 3ZBHA 5EIBC 1P4RA 2FKXA 1IBMB 1NKDA 2E75B 2R9RB 1F4NA 1VF5B 2W6JG 3BVOA 2JIZG 4TUYA 4ZI7A 1YIJV 4XDJA 3C3TA 4O2AB 3ETEA 4EKWA 5JCOC 4YHHB 3HKCA 4JPRA 1CXZB 1FD9A 2LP7A 1K73W 2WLIB 3SPIA 4DUZO 2EIKC 4WFFA 4NKGB 1SC5B 3UT5B 1KP3A 2EJRA 2EZOA 4UV8A 1Q6IA 3E89A 2PI5A 2H8PC 4PDVA 3SDLA 4NXNO 1JMKC 5LOVB 3SGIA 5K1PA 1XHZA 1S5HC 1YEWA 3CS5A 2DN9A 3SJBC 4P2ZA 2ZNIA 5KHHA 4UV9A 2WLKA 5LBQA 4JI8B 2RDCA 1SQBH 5LHIA 4NXMB 1QVFU 3VOUA 1MSWD 1B06A 4B3SO 1XMQO 4K8ZA 4YY3B 2F4VO 2PUSA 2ZE6A 3ZHRA 1Y74A 5J2TA 1RPRA 3M7MX 1H38A 1H2LA 4B3TO 2JEUA 3T4ZA 4YIPA 3B77A 2KB1A 5BY1A 3E8HA 5LP6B 3SYAA 2YIAA 3OUSA 4UCVA 2FB5A 3FYIB 1Z5WA 3JSLA 1KMIZ 4LR3A 1BCCH 1R73A 3K0GA 4J9YB 4LWSA 4I7ZB 4DUZB 3CWBH 1E79G 4CS4A 1WA8B 2VRZA 2NN4A 4UXNA 3ZHUA 5B1NA 3R66A 3K79A 4NXNB 4O2AA 2X6CA 3JCUZ 3H1IH 2YUAA 2JK5C 3QF7A 5FNVB 2WLIA 1B3QA 3GB7C 3D8CA 3UT5A 3NXSA 4IL6Z 1LUVA 1IBKO 3CXCU 2XHBA 4K3AA 2AZ0A 2RCVA 5LOVA 1PL4A 4OX9B 4B3SB 4KHPO 1L8DA 3SYCA 2ARHA 3WB1A 1XMQB 4JI1O 1J5EO 3IFXA 1Y67A 4UB8Z 1XMOB 5J9PC 3F5TA 3FB7C 1QBZA 3OMNB 2VWKA 5EIBD 3OMIB 2FTKA 1M57C 4JI6O 3JAKB 4KUMA 2P4KA 1H8EG 3SR2C 5KAFZ 5CA0B 1MNGA 1K33A 3ZMTA 2RJZA 2QKSA 2LGQA 4HBNA 5IYCO 1OCZB 3T1YO 4X1KB 2WLMA 4MW3A 3VQWA 5LP6A 4PI2A 2AHYA 3F5WC 3C90A 4JGSA 2P7TC 3K08A 3CCVV 3TGUH 4QJFB 2CTQA 1I94O 2IU3A 1M57B 1FYJA 1VF6C 2BCCH 4DRXB 1QLEC 4EFEA 1VQ4V 3OEHG 4UB6Z 2NNUA 1GMGA 1WA8A 1S72V 1IBKB 4N21A 1Q6HA 2PY5A 4HYOA 4DR1O 4X62B 1HNXO 4KHPB 4YXWG 1PKXA 2QDOA 4JI1B 2GV9A 1I5XA 5FNVA 3AG4B 4MVQA 1XREA 2HJDA 4QGPA 1K9MW 1QLEB 1MSDA 3JALB 1NQTA 1W0JG 4UVAA 3K9SA 2GTSA 3OW2U 5L3DA 4B3RO 1QLNA 3VQXA 1PV0A 2HFEC 3E2EA 2WPDG 3EVKA 3DC5A 3KG2A 3SPCA 1SF9A 1ZWIC 2VQFO 2UU9B 5CA3A 2D3OW 3N2GB 2YI8A 4KL1A 3T1YB 2Q0AA 4PA3A 1R6KA 3JAKA 3CCLV 5EYPB 1I94B 1KP2A 4J41A 4P9OA 4OPAA 5CBFA 5CA0A 3E86A 2X6AA 4KP4A 2Q67A 1HNWB 4JAAA 5A2QN 2OCCC 3CCQV 1Z2GA 1N33B 5H6QA 5EK0A 4X1KA 4L87A 2HEPA 1VQMV 3IJ4A 1JJ2U 3ASNC 1HDJA 2R72A 1SESA 4Q20A 3AK1A 5JWPA 4DW1A 1BQZA 4K0KO 4JZ2A 5IYDO 1YDXA 3LDCA 3JD4A 1BE3H 4XDKA 3L75H 3W7UA 3E8GA 3OEEG 2UXDO 2IM9A 5E1AC 4JAVA 1U96A 3SPGA 4DXWA 1NT2B 3ASNB 2QWQB 3BCCH 1R3JC 3ABMC 3CP1A 1RPOA 3WFVA 3DC6A 3U0ZA 4ZIBA 2VQFB 3JALA 3K59A 3IC9A 2CTWA 4O2BB 3W7XA 2QM7A 1U97A 4X88A 1VQLV 4F6RB 4X65B 4LFBB 4GZRB 2A9HA 1FXKB 2BOBC 3RT3C 3ABMB 3N2GA 3BA8A 1VQNV 5LMUB 3PN1A 2F66C 3EFFK 4N23A 4A5UB 2QTOA 1G4YB 5EYPA 3ASOB 1M90W 3JAMN 1XQ8A 2EILC 4K0KB 3ICXA 3P32A 4NTWA 2Y48A 2PYJA 2QE7G 3AK3A 3G6BA 1X4TA 5IY5B 1YHQV 1XI1A 4IYIA 4DUYO 2P6JA 1I7FA 1THZA 1K97A 3L72H 4X20B 3RYCB 2V4DA 2JS5A 5H6RA 4G27B 1MZEA 3OUFA 2EILB 5CBHA 1UPGA 2PGGA 5ITZB 2M7WA 4DV7O 3K5MA 5KAIZ 3ZRVA 4BR6A 5KHKA 2JGUA 4JI2O 1DLBA 3S3WA 2GBOA 1YJWV 4TV9B 5KUKA 2HVJC 5KA5A 1EZVH 1VQ7V 3TETA 3EHBB 4ZKIA 4AILC 4O2BA 2QM4A 3BY6A 2E76B 4GKKO 5BMVB 1TVKB 4F6RA 4H44B 2E3CA 5LGUA 3CD6V 1AJPA 1FXKA 1GM8A 5B3SC 1SKVA 4QNHB 1OCOC 4GKJB 3CSXA 4BAYA 5CB4B 5DN6G 3DXRB 4H33A 3U11A 1EFRG 4Z2WA 4LCUC 1SQXH 2UXCB 2JRIA 1YCIA 3BFRA 1NVPB 4R6ZA 2H3OA 1N4CA 3J80N 3WB2A 1NTZH 5B1AB 1R6TA 1KBHA 1X59A 1AI7A 1DF4A 3CB2A 1PD3A 2Q5ZA 4TQDA 5B3SB 5C8YB 4P30A 3MAQA 4ICGA 4JI7O 1IDSA 1OCOB 4J42A 2CDYA 4TSFG 4X66B 3SYPA 4FZ1A 4GX5A 4X20A 3RYCA 4JYAO 4CH3A 1KC8W 2K1EA 1SRYA 1VQ9V 1VIBA 1AR1B 4JI2B 1YVWA 3ZIAG 4YIOA 3RVYA 3HKDB 2V7QG 5ITZA 1QCEA 1SZTA 4J7ZA 4JV5O 1IBMO 3SYOA 2WLNA 1LR1A 1RM1B 3CEIA 4GX1A 1H2KA 4Z1MG 3N2KB 4DYLA 4O4JB 4TV9A 2LO1A 3CE2A 2YS8A 4D7TA 4B7EA 4YHHO 4EEQA 5LMNB 1MG1A 2ETNA 4J9ZB 3TXSA 3O9OA 5KA6A 1EZJA 2EBOA 5BMVA 5CMUA 1TVKA 2EIJC 2ZT9B 1NI8A 1VP7A 3RVZA 2FYUH 3JATB 3AG3C 3CCUV 4J7KA 5CB4A 2QKCA 3G67A 3DXRA 4TOIA 2UUBO 3L9DA 4JI8O 4RQEA 2ZM6B 4BW5A 1OZ0A 4JYAB 3IC7A 2JJ1G 2ZIMA 1XNQB 3W7SA 2EIJB 4LNUB 1WB8A 1GM9A 1PM9A 5B1BC 2D2CB 1N32O 2X6BA 5C8YA 3AG3B 3A0BZ 3K5NA 3QO7A 3G80A 3UM7A 3ZEDA 4GX2A 4JV5B 1HNZO 3SPJA 1K5SA 1PNMA 4R50A 5FPRA 3K0DA 5LGNA 1NJIW 3K9AA 3BRCA 3HKDA 2E74B 5B1BB 4C7UA 1US6A 1OV9A 3ZHSA 4UFZA 1VQOV 4I4TB 1JR9A 2YIBD 3OGIB 5JQGB 2ZDIC 3P3NA 3N2KA 3KKYA 4O4JA 1TUEB 3QG5A 1T5EA 1SQQH 4IYHA 2W6IG 2ATKC 4TQFA 2N74A 2IJIA 1IURA 1M5IA 2UUBB 4G28B 2EIKB 2OTJV 1FKAO 4LFAB 3UKMA 5AG2A 4YJ2B 4DR3B 1YF2A 2YDEA 1VQ6V 4OX9O 1F23A 3JATA 4BIUA 1N32B 2ZE7A 1XMOO 3ZCCA 2Q6AA 2LFRA 1PNLA 3LSSA 1HNZB 1AI6A 3SYQA 5JVDB 4GCZA 1BHAA 4ZBMA 2YXHA 4I5SA 5DM6V 4LNUA 1S77D 3O65A 3TCUA 1G8MA 1EN5A 4HZ3A 2AHZA 4FLVA 4DV6O 1OCCC 2OTLV 4IIJB 5IYZB 2GSMB 4UVCA 5HFLA 4DW0A 3B4SA 1FXHA 4PHZA 2EINC 3FB5C 2F23A 4LC1A 4FFBB 1KECA 5FPOA 4PDMA 1V54C 4I4TA 1GM7A 5KHGA 2QWNB 4O4LB 2Z3YA 5JQGA 2XAJA 3BEHA 1DGSA 3DTUB 4FLXA 4X62O 4X1IB 3APQA 2A06H 2R9IA 3OGCC 1N0NA 4DV5O 3T2MA 2JGDB 3ZMUA 2EINB 5JCOA 1R3IC 3JARB 3CRQA 1V54B 2N05A 3M8AA 5D5PA 2EJ7A 4YJ2A 4CC6A 4LF6O 2ZDIA 3B2EE 1YZBA 3H1LH 2A7WA 3PJSK 1IZ3A 2QJ1A 1W2BU 1ZL8B 3E8FA 1EM1A 1MOFA 2WA3A 2XTAA 3F7VC 3K04A 4EFBA 2UU9O 2Z5UA 2GUZB 4O4HB 4DV6B 1FS0G 3D3QA 1VQKV 5EZYB 3K06A 1GK9A 1H2GA 5JVDA 4QE7A 2ITCC 4MTFA 1GTOA 3OFNG 1JPXA 3LSUA 1QHTA 1HNWO 3OR6C 4WBNB 1S5JA 1N33O 3ZS8C 1Q3EA 1WN7A 4IIJA 5IYZA 5IDJA 2XAGA 3RYIB 3CMEV 1K8AW 2QTSA 3GVMA 4J10A 1KU9A 3OM3B 3EXAA 4FM0A 2YI9A 3ZRSA 4FFBA 1VQ5V 4D7SA 1SQFA 4DV5B 2YSUB 5B1OA 4FLZA 3SJAC 4NTXA 4O4LA 2DQ0A 2ZR3A 3HB3B 1FXVA 1LUWA 3CRAA 4X1IA 4LF6B 1TA8A 3RYFB 5DEDA 2JGDA 2RN9A 1R3KC 1ZAUA 4FLTA 3JARA 1S3JA 3KCXA 2C2AA 3FD9A 4J11A 4DV3O 4JZGA 4TWKA 2KKWA 1RP3B 1Q6UA 4X65O 2Q8VA 3X2QC 4LFBO 2FL4A 1ZL8A 2UXBO 4BIOA 2GHYA 1Q43A 2GUZA 4O4HA 4DR2B 3QO5A 5LMUO 1H2SB 3ETQA 3E8BA 5EZYA 1ENVA 2AXTZ 4FK5C 1FFXB 3CCEV 2R70A 2M6YA 4U7OA 3L73H 1NR1A 5L3FA 1BS3A 2F43G 3X2QB 4E4EA 1KB9F 1Z5VA 3DSQA 4QIWF 4NVPA 4JAUA 4WBNA 2QWRB 3MHHC 1YITV 4XDLA 3VQYA 2OCCB 1TAEA 4E2LA 3RYIA 5JJJB 1H2NA 2VS0A 5EBMC 2WLHA 4UCTA 1VMGA 2O57A 4K35A 4TV8B 4MVRA 1P49A 3TXQA 1BSMA 4PA9A 1NU1H 2L35A 1OHHG 1VF6A 2OWOA 4CBCA 2EZPA 3JSNA 3BA9A 2PYLA 4DV3B 4DV4B 1N34O 4B3MO 3RYFA 5DECA 4NB5A 1IBLO 4X64B 2F1MA 2UXBB 2CTPA 1E1RG 5L3EA 4LH7A 2AW9A 2Q0OC 4CS2A 5LA6B 1IX9A 3DGEA 1K4DC 2ZINA 4LF9O 2YICA 3B8NA 1QVGU 4WFEA 5CBGA 4R8CA 3OAAG 4Q6GA 4DR4B 3LDEA 1YJNV 2AGAA 5IE9A 4GT1A 3TK1A 2LJ2A 4GKJO 1D2DA 1JJOA 1SQGA 1FFXA 2GTAA 5CA1B 2UXCO 3R65A 2BOCC 2RNBA 3QO8A 4AI8A 2DW4A 1TUBB 3I56V 3WB0A 5LYJB 1R1BA 3QNEA 2Y0IA 4H37A 4DV1O 2Q69A 3RYHB 4U3FH 3JD1A 3N27A 3G71V 2ZE5A 4LF7B 1WP8A 1L1FA 1WB7A 3VBBA 3LNMB 1ZSPA 4X66O 2YEVB 3K3WA 2DMXA 3CXHF 1Q7YW 4TV8A 1N34B 4B3MB 1NH2B 1IBLB 3K5LA 2KG7B 3ZRXA 1MMMA 5A9GA 1YI2V 4H0LB 4JF3A 3CRMA 5L3BA 1GKFA 1BL8A 3ML0A 4DR7B 1P84F 1UFIA 3H01A 4FLWA 2BTOA 4LF9B 5IJ9B 4NTYA 1SETA 3HKBB 3S3XA 4LP8A 1BHBA 1BQ0A 1V55C 2BTQB 1KKCA 5BXZA 5LMNO 1Q81W 1A32A 4FLYA 1JCHA 2P06A 1W59A 5FL7G 1WJZA 5LA6A 1Y6XA 4DR5O 5BZBA 4WFAV 3JAWB 3JD0A 3U10A 2PZSA 4X8AA 4X1YB 2DYSC 4DV1B 1V55B 5IYBO 3J7AU 5B66Z 5CA1A 1GRJA 4MVSA 2ZM6O 4PI0A 5CN0A 2A3QA 3CRCA 1MA1A 1TUBA 3CC2V 3MHSC 1XNQO 5LYJA 3JD3A 2UXNA 4WFGA 3STLC 4CZZA 3RYHA 3STZC 2B1GA 3D36C 4RUFA 2YEVA 1YJ9V 3BAAA 2Q4PA 1Q8IA 3NR7A 2WA4A 1AR4A 2ADQB 3H1JH 1OCRC 4LFCB 2KG7A 4NYKA 4MTXA 1JVMA 4JI3O 2YXLA 1YXBA 4AHCA 3ZHVA 2P4VA 1P7BA 2HG5C 4FMTA 1J95A 4OXSA 2B5UA 1XNRO 3LUTB 2CTRA 1XILA 2ZE8A 1AVMA 1D5NA 5IWAO 5IJ9A 4DR5B 2CAZC 3HKBA 2BTQA 4JI0O 2F93B 1NH2D 4WF9V 3LNNA 1OCRB 4MSWC 1I5YA 1F51A 1XL6A 3CJHB 1QNMA 1NTKH 1S0VA 1BGYH 1W0KG 1K3EA 1Q90D 2DYRC 1KQSU 4OGQB 2IJKA 4LFAO 3HR0A 1DF5A 4DR3O 3JAWA 5KX5B 3P30A 4X1YA 1VF7A 4UUJC 4IT5A 2L6LA 3RGBA 3FB8C 4HAMA 5KHJA 4UCUA 4BIZA 4UVBA 4MT8A 1SQPH 4QPJA 1ORQC 2QM8A 4DK0A 4WCEV 1NVPD 3AEIA 2DYRB 1CPYA 2CE4A 1SZXA 3K57A 1I08A 4O4IB 2P90A 4RQFA 2HLDG 4JI3B 4YJ3B 1L0NH 1JOYA 4FVMA 1BZKA 4DV2B 2HJFC 1XNRB 5E79Z 1Y4MA 4CH5A 5IWAB 1QR9A 2DQ3A 4CC5A 1HP8A 4LF5B 1K7DA 4LF8O 2OCHA 4WFHA 3ABLC 4JI0B 3BHPA 4J80A 5L3CA 3B40A 2P22C 2QA4V 4Z1VA 4W4KA 1ZUQA 2CK3G 3SPHA 3D36A 4DV0B 1VQPV 3I55V 3AG2C 1WPBA 5LHGA 2EX3A 1ZTEA 2VWJA 2HKOA 1Y66A 3H1HH 3CJHA 1RSOB 1Q5OA 3ABLB 5EBWC 2Q7GA 3G6EV 2CGNA 2Q7EA 3WG7C 2Y69C 1NR7A 2ITDC 4MTOA 5LP6C 3JYCA 2WWWA 3QTCA 3W7WA 5GTHZ 3C3SA 3ZHQA 3SJCC 5KX5A 2DWDC 5B5EZ 1AI4A 1F7YA 1WPXA 1O9GA 3B09A 3AG2B 2H94A 3RW0A 2RQ6A 2LQTA 2WSSG 1NTMH 5JJNB 5LXTB 1FFTB 3IAYA 1AR5A 1DTOA 2DE0X 2Y69B 3WG7B 4I50B 3ABKC 3FAVB 1B6QA 1R6NA 2N04A 3FFQA 3K03A 4O4IA 2QWPB 4LF8B 2NR5A 5FLXN 2UUAO 4RWUA 4YJ3A 5F2VO 1XDCA 3CMAV 1V9PA 4JYBA 3RWRD 1OCCB 1N36O 5BR8O 4JTCB 5LHHA 2ODMA 3ABKB 3J81N 1M9NA 2JDIG 3BPZA 1GN4A 1NS1A 4ASUG 4K8XA 4KXRA 2MW2B 3OD4A 3CCMV 4PJ0Z 3JASB 2IJHA 3VQVA 2Q7HA 2ADPA 2OT5A 2Y0PA 4ZHQB 3FYEB 2ILMA 3CCSV 1IVSA 3CCJV 2W0FC 1G1XB 2XASA 3OE7G 3FKSG 4PDRA 1RSOA 1NZ6A 3F7YC 3FB6C 2F4VB 4CH6A 1OCZC 5EBLC 4FFKA 2IBZH 3ZRWB 5LGTA 4B08A 4PELA 3Q4HB 1GN6A 4B3TB 1XEQA 4FIPC 4MS2A 4I55B 2A79B 1MABG
chains in the Genus database with same CATH topology
4CBCA 2EZPA 5B1AB 1KP3A 4P9PA 1AROP 2EJRA 2EZOA 3SJQC 4UV8A 3E89A 2PI5A 1AI7A 1DF4A 2H8PC 1PD3A 3E83A 4PDVA 5B3SB 4P30A 1OCOB 3JD2A 1S5HC 2ZR2A 4TSFG 3SYPA 3ETDA 4GX5A 4WFBV 3D3IA 1E1RG 3ABTA 5L3EA 1KC8W 4P2ZA 2K1EA 1SRYA 1VQ9V 1AR1B 3B8MA 4UV9A 3AG4C 3ZIAG 2WLKA 5LBQA 3RVYA 2P67A 5LHIA 3DGEA 1QVFU 3VOUA 1K4DC 2V7QG 1MSWD 4JYCA 4U7NA 2ZXWC 3B8NA 1N8RW 1QVGU 4WFEA 5CBGA 1QCEA 3GWOA 1SZTA 4R8CA 2WLLB 3OAAG 3LDEA 1YJNV 3SYOA 4GT1A 3ZMVA 2WLNA 1RM1B 3TK1A 4GX1A 4RO2A 4Z1MG 3CYOA 1RPRA 3E35A 1KKDA 1H38A 4MW8A 3T1CA 2JEUA 4PDLA 4G2KA 3R65A 3T4ZA 3B77A 2BOCC 2KB1A 3E8HA 1MG1A 3QO8A 3SYAA 4J9ZB 3OUSA 2DW4A 3I56V 3FYIB 5KA6A 2ZXWB 3QNEA 1EZJA 4H37A 2EBOA 1R73A 3K0GA 2Q69A 4J9YB 3CCRV 5CMUA 3JD1A 3G71V 2EIJC 1M56C 2WLJA 1E79G 3RVZA 1L1FA 3VBBA 3LNMB 4UXNA 3AG3C 5B1NA 2YEVB 3K3WA 3CCUV 1KD1W 1NBMG 3K79A 3ZRWA 3G4SV 1Q7YW 2X6CA 3OR7C 1NH2B 4MVUA 2V1DA 4RQEA 3ZRXA 4QE9A 2JK5C 4BW5A 1YI2V 2WLIA 1OZ0A 3IC7A 2JJ1G 4JF3A 3GB7C 2X7RB 3NXSA 5L3BA 1VQ8V 4F4LA 3W7SA 1Q82W 2EIJB 1GKFA 1BL8A 3ML0A 1GM9A 5B1BC 3CXCU 1M56B 3H01A 2X6BA 3AG3B 1AJNA 3QO7A 4PA4A 1SETA 3UM7A 4TT3G 4LP8A 1BHBA 4GX2A 4MVMA 4MVZA 3SYCA 4JASA 1V55C 4JTAB 3SPJA 1K5SA 1PNMA 1Q81W 3IFXA 2XAFA 1SERA 5L3GA 4R50A 1JCHA 5J9PC 3K0DA 4R7CA 5LGNA 1NJIW 3FB7C 3K9AA 1QBZA 5FL7G 1PNKA 3OMNB 1YSCA 1GO3F 2JJ2G 2IH1C 2X0LA 5B1BB 3OMIB 2FTKA 5BZBA 1M57C 2HVKC 4WFAV 2IH3C 3JD0A 2WLLA 4KUMA 1VQOV 4X8AA 1H8EG 1S76D 2DYSC 1V55B 5IYBO 2ZDIC 2HR3A 1K33A 3ZMTA 2A0LA 2QKSA 1FXKC 1E1QG 1TUEB 1YTFB 5IYCO 1OCZB 4MVSA 2WLMA 4MW3A 5CN0A 2AHYA 3F5WC 4JGSA 2P7TC 2W6IG 3K08A 2ATKC 4JTDB 4QJFB 3CCVV 2IU3A 3CC2V 2IJIA 3MHSC 1M57B 1CP9A 3JD3A 2UXNA 4G28B 4WFGA 3STLC 2EIKB 1QR8A 4CZZA 3ASOC 2OTJV 3ZJZA 3STZC 1QLEC 1VQ4V 3UKMA 3OEHG 5H9CA 2NNUA 3AG1C 2B1GA 1VQ6V 1GMGA 1F23A 4RUFA 1S72V 2YEVA 2WAMA 5GW7A 4N21A 1YJ9V 1BMFG 4BIUA 4HYOA 5IY5C 1XL4A 4QPKA 3ZCCA 2Q6AA 2DWEC 1OCRC 2LFRA 4YXWG 1PKXA 1PNLA 3LSSA 1I5XA 1AI6A 4LBEC 4MTXA 1JVMA 3SYQA 3AG4B 4GCZA 4MVQA 1BHAA 4ZBMA 3CC4V 4RAIA 4DO2A 4KFMA 1K9MW 1P7BA 1QLEB 2HG5C 4FMTA 4I5SA 3ZN0A 5DM6V 1J95A 4OXSA 3AG1B 1NQTA 1W0JG 4UVAA 2B5UA 1S77D 3LUTB 3TCUA 1G8MA 3OW2U 5L3DA 4HZ3A 2AHZA 2QEXV 5EC2C 1OCCC 1QLNA 2XAQA 2OTLV 4GX0A 2HFEC 3E2EA 1NH2D 4WF9V 2WPDG 1OCRB 4MSWC 1F51A 2GSMB 1I5YA 1XL6A 3KG2A 4UVCA 5HFLA 1CEZA 3SPCA 1ZWIC 5KUMA 5CA3A 2D3OW 4PA6A 1S0VA 3LDDA 1W0KG 1K3EA 4XBFA 1FXHA 2EINC 3FB5C 3MD0A 2DYRC 1KQSU 4PA3A 1R6KA 4LC1A 4RUEA 2IJKA 1KECA 1DF5A 4PDMA 1V54C 3CCLV 2NLJC 1UJWB 1KP2A 3P30A 4P9OA 1GM7A 5CBFA 2Z3YA 4UUJC 3E86A 2X6AA 4KP4A 2Q67A 2XAJA 2ZQMA 3BEHA 5EC1C 2IU0A 2OCCC 3FB8C 3DTUB 2MK3A 3ZMZA 3CC7V 4FPPA 4HAMA 1JX9A 3CCQV 3ETGA 5H6QA 4BIZA 2R9IA 4UVBA 5EK0A 4MT8A 2Q68A 4QPJA 3OGCC 4L87A 1ORQC 1WLEA 1VQMV 2QM8A 5HFMA 1JJ2U 3T2MA 3ASNC 3ZMUA 4WCEV 1NVPD 2EINB 3AEIA 4MVOA 2DYRB 1SESA 1CPYA 4Q20A 1R3IC 1H8HG 1V54B 5IYDO 3LDCA 3JCZA 2P90A 2EIMC 3HPLC 2HLDG 4RQFA 3JD4A 4XDKA 1JOYA 2ZD9A 5B1AC 2ZDIA 3PJSK 4X89A 3W7UA 3E8GA 3OEEG 3W7TA 1YTFD 1W2BU 2HJFC 3E8FA 1MOFA 1Y4MA 4JAVA 5E1AC 3CPWU 3F7VC 3K04A 2XOKG 1QR9A 2Z5UA 3SPGA 4DXWA 2DQ3A 3ASNB 1FS0G 1K7DA 1VQKV 4PA7A 3K06A 1R3JC 4WFHA 1GK9A 1H2GA 3ABMC 3ABLC 2XAHA 3T4DA 4MTGA 4QE7A 5L3CA 3CP1A 1RPOA 3WFVA 2PI4A 3A0RA 2EIMB 2ITCC 2QA4V 4MTFA 2UXXA 1GTOA 2CK3G 3SPHA 3OFNG 3W7XA 3D36A 1JPXA 2QM7A 4X88A 1COWG 2LFSA 3OR6C 1VQLV 1VQPV 3I55V 2DYSB 3AG2C 5LHGA 1PL0A 4FJCC 2HKOA 1Y66A 2A9HA 1RM1C 1FXKB 5IDJA 2XAGA 3CMEV 1K8AW 3OMAB 2BOBC 1ROPA 3M99B 1LNQA 3ABLB 3ABMB 5EBWC 3G6EV 1EBOA 3OM3B 1VQNV 3WG7C 2Y69C 1NR7A 2ITDC 4MTOA 1M1KW 1K4CC 3IGAC 2WWWA 3JYCA 3ZRSA 1VQ5V 3W7WA 3EFFK 4N23A 2QTOA 1G4YB 2YSUB 2DWDC 3ASOB 5B1OA 1M90W 1AI4A 1K34A 1WPXA 2EILC 2DQ0A 3AG2B 2ZR3A 2H94A 3HB3B 3RW0A 1FXVA 3P32A 2Y48A 2QE7G 2WSSG 5IY5B 1YHQV 1FFTB 3ABUA 2P6JA 1DTOA 3WG7B 2Y69B 1F4MA 1JQ0A 1THZA 3ABKC 1B6QA 3RBZA 1K97A 1R6NA 1R3KC 1AJQA 1S3JA 2C2AA 3K03A 5H6RA 1K92A 2JEXA 1R3LC 4G27B 3OUFA 2EILB 1K5QA 5CBHA 4TWKA 3CMAV 1IXMA 4JYBA 3ZMSA 3X2QC 5C93A 2M7WA 1OCCB 1AI5A 4JTCB 2GHYA 5LHHA 2B1IA 3ZRVA 3ABKB 2IJJA 1M9NA 3QO5A 1DLBA 2JDIG 3E8BA 2IW5A 1ENVA 1YJWV 2XNDG 3CCEV 4FK5C 5KUKA 2HVJC 5KA5A 4ASUG 1VQ7V 3TETA 3EHBB 3CCMV 4U7OA 2IJHA 1Q86W 1NR1A 4ZKIA 2OT5A 3FYEB 5L3FA 3CCSV 2F43G 3X2QB 1HWYA 3BY6A 3CCJV 2W0FC 4QIWF 2XASA 3OE7G 3FKSG 3ZN1A 4JAUA 5LGUA 4I9WA 4PDRA 3LSQA 3MHHC 1AJPA 1YITV 3CD6V 4XDLA 2OCCB 4E2LA 1FXKA 1P4RA 1GM8A 5B3SC 1NKDA 3F7YC 3FB6C 5EBMC 2R9RB 1F4NA 2WLHA 4QNHB 1OCOC 1OCZC 5EBLC 4BAYA 2W6JG 2JIZG 5DN6G 3ZRWB 4H33A 5LGTA 1YIJV 4XDJA 1EFRG 4LCUC 4MVRA 4PELA 3ETEA 4EKWA 1NVPB 4FIPC 4JPRA 4MS2A 4PA9A 4R6ZA 2LP7A 1K73W 1OHHG 2A79B 2WLIB 3SPIA 1MABG 2EIKC 4WFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FPP A;  2WWW A;  4MTX A;  2P67 A;  3ZRW A;  3D36 A;  2QM7 A;  4GCZ A;  4BIZ A;  3DGE A;  4JAS A;  4MT8 A;  2C2A A;  5B1O A;  4QPJ A;  2LFS A;  4JYC A;  4I5S A;  4FMT A;  4JAV A;  4U7N A;  2QM8 A;  3MD0 A;  3ZRX A;  4LC1 A;  3P32 A;  4U7O A;  3ZRW B;  4Q20 A;  1IXM A;  4ZKI A;  5IDJ A;  4BIU A;  4GT1 A;  4JYB A;  3NXS A;  3TK1 A;  4QPK A;  5C93 A;  3ZCC A;  3A0R A;  4KP4 A;  2FTK A;  5B1N A;  1JOY A;  2LFR A;  4JAU A;  3ZRV A;  1F51 A; 
#chains in the Genus database with same CATH topology
 1OJH A;  4LH6 A;  4P9P A;  1ARO P;  3SJQ C;  2UUA B;  3H1K H;  2QGN A;  3E83 A;  3I5D A;  1N0J A;  5LXT A;  4DR2 O;  3QVN A;  3JD2 A;  2ZR2 A;  1N36 B;  5BR8 B;  4I50 A;  2B9Z A;  3FAV A;  3ETD A;  4WFB V;  5JJE B;  3D3I A;  3ABT A;  4U3J B;  3B8M A;  3AG4 C;  2P67 A;  1QU7 A;  2CGO A;  2DJV A;  4JYC A;  4U7N A;  2ZXW C;  1N8R W;  5KMG B;  3HKE B;  3GWO A;  2LW7 A;  2WLL B;  3ZMV A;  4RO2 A;  3CYO A;  2CH7 B;  3E35 A;  2OIE A;  1KKD A;  4MW8 A;  2BE3 A;  4NR1 A;  3T1C A;  1J5E B;  3CX5 F;  4PDL A;  4G2K A;  2JS3 A;  3JAS A;  1GAX A;  5H5N A;  1IXB A;  4BWA A;  4ZHQ A;  2OYQ A;  3RN4 A;  2ZXW B;  1SS3 A;  2Y4T A;  1SQV H;  4CH4 A;  3CCR V;  4ZOL B;  4EB6 B;  3L70 H;  2QKA A;  4JI6 B;  4DV4 O;  1M56 C;  2WLJ A;  4X64 O;  1KD1 W;  1NBM G;  2CUG A;  1URF A;  3APO A;  1KYO F;  3ZRW A;  3G4S V;  2ZIO A;  1G6U A;  2QWO B;  2Y4U A;  3Q4H A;  1RFY A;  3OR7 C;  4MVU A;  2V1D A;  4QE9 A;  4I55 A;  3UQ8 A;  2HHH O;  2X7R B;  1S5L Z;  2VQE O;  4F4L A;  1Q82 W;  1VQ8 V;  1KUQ A;  4DR4 O;  1M56 B;  3AG7 A;  1AJN A;  4PA4 A;  3GWK C;  4TT3 G;  1DK1 A;  4MVM A;  4MVZ A;  4JAS A;  3THO A;  4JTA B;  4PV1 B;  2XAF A;  3TJT A;  1SER A;  4DR1 B;  2DOS A;  5L3G A;  3K58 A;  1HNX B;  4U3J A;  3A2F A;  4R7C A;  1P7G A;  1EN6 A;  1PNK A;  4L8J A;  1YSC A;  1GO3 F;  2JJ2 G;  4DRX A;  2IH1 C;  3OTO O;  2X0L A;  2Q9L A;  4W4L A;  3A8T A;  2HVK C;  5KMG A;  3HKE A;  2IH3 C;  2WLL A;  4LF7 O;  1S76 D;  5TIS Z;  2HR3 A;  3L71 H;  2A0L A;  1WNS A;  2CH7 A;  1JFF B;  4B3R B;  1FXK C;  1E1Q G;  1YTF B;  4I9Q A;  5JH7 B;  3KCY A;  3UO3 A;  2E5L O;  4JTD B;  5K1X A;  3RFR A;  1CP9 A;  1D5A A;  3A0H Z;  4DR7 O;  4HNA B;  3T1H O;  1QR8 A;  3ASO C;  1VEW A;  4ZOL A;  4EB6 A;  4IHJ B;  3ZJZ A;  5H9C A;  2HHH B;  3AG1 C;  1PP9 H;  2VQE B;  2WAM A;  5GW7 A;  1BMF G;  4UCO A;  5IY5 C;  5H2F Z;  1XL4 A;  4F6E A;  4QPK A;  3AK2 A;  5GTI Z;  2DWE C;  4JI5 O;  3BAB A;  4LBE C;  3UCS C;  1AB3 A;  3FX7 A;  3CC4 V;  1TGO A;  4RAI A;  4DO2 A;  4KFM A;  3ZN0 A;  5IJ0 B;  2XUM A;  1GN2 A;  3AG1 B;  4LF4 O;  3OTO B;  1JA8 A;  2QEX V;  5EC2 C;  2XAQ A;  4GYC B;  4GX0 A;  2BSK B;  2LW1 A;  2UXD B;  3H9V A;  4J7J A;  4FM1 A;  2YC0 A;  5KHI A;  1CEZ A;  2QSA A;  1O9H A;  5KUM A;  4PA6 A;  3LDD A;  4B7K A;  2YID A;  4XBF A;  2GDS A;  1SA0 B;  3MD0 A;  4UCR A;  1M4U A;  4RUE A;  2E5L B;  4JYY A;  2PF4 E;  1AIL A;  2NLJ C;  1UJW B;  2XT9 A;  4GLX A;  1WAZ A;  4GUN A;  4PD4 F;  3T1H B;  1ZLZ A;  2ZQM A;  2IU0 A;  5EC1 C;  3CC7 V;  2ZKO A;  2MK3 A;  3ZMZ A;  1JFF A;  2R9A A;  1JX9 A;  4FPP A;  5J2U B;  3ETG A;  3UO2 A;  1Y76 B;  4BW9 A;  5JH7 A;  4LFC O;  2Q68 A;  1WLE A;  5HFM A;  4MVO A;  1H8H G;  4JI5 B;  4HNA A;  2LGW A;  3JCZ A;  2FML A;  4IHJ A;  1GN3 A;  2EIM C;  1HR0 O;  3HPL C;  1FJG O;  3P3P A;  4ABM A;  2ZD9 A;  3E22 B;  5B1A C;  4X89 A;  3W7T A;  1YTF D;  4DR6 O;  4FZ0 A;  1XHX A;  3CPW U;  4LF4 B;  3ZX6 A;  3KZI Z;  4I0X B;  2F95 B;  2XOK G;  3ZHT A;  1PPJ H;  2W0X A;  2RMK B;  4DUY B;  2YXY A;  4AQY O;  4PA7 A;  3T4D A;  2XAH A;  4MTG A;  5GON B;  3CHX A;  2PI4 A;  3A0R A;  2EIM B;  5IJ0 A;  1AP6 A;  2UXX A;  3K5O A;  2PTM A;  4H13 B;  1COW G;  2LFS A;  1BT8 A;  2DYS B;  3OTF A;  2BSK A;  1PL0 A;  4FJC C;  4DV7 B;  5LL6 Y;  1HW7 A;  1RM1 C;  3OMA B;  4JI4 O;  1FAF A;  1ROP A;  2EUL A;  3M99 B;  1LNQ A;  2HP8 A;  1L0L H;  4OPH A;  2UUC O;  1EBO A;  4TUY B;  4ZI7 B;  1SA0 A;  1XOU A;  3WU2 Z;  1M1K W;  1K4C C;  3IGA C;  1FPO A;  1XBL A;  3HKC B;  4FM2 A;  1VAR A;  4UCS A;  1K34 A;  5D5Q A;  2G38 A;  4FLU A;  2QR4 A;  4DV2 O;  3L74 H;  1HR0 B;  1FJG B;  4GKK B;  5J2U A;  1Y76 A;  1MZF A;  4LF5 O;  3ABU A;  1I0H A;  4DR6 B;  2Q73 A;  1F4M A;  1JQ0 A;  3RBZ A;  5IT9 N;  4IGG A;  2KQX A;  1AJQ A;  1ZX3 A;  2KSD A;  1H2M A;  1M93 A;  1GH6 A;  2ZNJ A;  4AQY B;  1K92 A;  2JEX A;  1R3L C;  4DK1 A;  4DV0 O;  3OT7 A;  2JVD A;  1K5Q A;  1IXM A;  3E22 A;  1B04 A;  3ZMS A;  2Z0A A;  5C93 A;  1XUQ A;  1WP7 A;  5KLV H;  1AI5 A;  4I0X A;  2B1I A;  1QQC A;  2IJJ A;  4JI7 B;  1Y74 B;  1EN4 A;  5J2T B;  2OIG A;  4CS3 A;  2IW5 A;  2XND G;  5GON A;  4D6T H;  4NXM O;  4JI4 B;  3CRR A;  2K9P A;  1Q86 W;  2UUC B;  2ZCE A;  4YY3 O;  1HWY A;  1AP5 A;  3MDS A;  4X9Q A;  3ZN1 A;  4LWS B;  2P5O A;  4I9W A;  2AZ2 A;  3LSQ A;  2YIB A;  3ZBH A;  5EIB C;  1P4R A;  2FKX A;  1IBM B;  1NKD A;  2E75 B;  2R9R B;  1F4N A;  1VF5 B;  2W6J G;  3BVO A;  2JIZ G;  4TUY A;  4ZI7 A;  1YIJ V;  4XDJ A;  3C3T A;  4O2A B;  3ETE A;  4EKW A;  5JCO C;  4YHH B;  3HKC A;  4JPR A;  1CXZ B;  1FD9 A;  2LP7 A;  1K73 W;  2WLI B;  3SPI A;  4DUZ O;  2EIK C;  4WFF A;  4NKG B;  1SC5 B;  3UT5 B;  1KP3 A;  2EJR A;  2EZO A;  4UV8 A;  1Q6I A;  3E89 A;  2PI5 A;  2H8P C;  4PDV A;  3SDL A;  4NXN O;  1JMK C;  5LOV B;  3SGI A;  5K1P A;  1XHZ A;  1S5H C;  1YEW A;  3CS5 A;  2DN9 A;  3SJB C;  4P2Z A;  2ZNI A;  5KHH A;  4UV9 A;  2WLK A;  5LBQ A;  4JI8 B;  2RDC A;  1SQB H;  5LHI A;  4NXM B;  1QVF U;  3VOU A;  1MSW D;  1B06 A;  4B3S O;  1XMQ O;  4K8Z A;  4YY3 B;  2F4V O;  2PUS A;  2ZE6 A;  3ZHR A;  1Y74 A;  5J2T A;  1RPR A;  3M7M X;  1H38 A;  1H2L A;  4B3T O;  2JEU A;  3T4Z A;  4YIP A;  3B77 A;  2KB1 A;  5BY1 A;  3E8H A;  5LP6 B;  3SYA A;  2YIA A;  3OUS A;  4UCV A;  2FB5 A;  3FYI B;  1Z5W A;  3JSL A;  1KMI Z;  4LR3 A;  1BCC H;  1R73 A;  3K0G A;  4J9Y B;  4LWS A;  4I7Z B;  4DUZ B;  3CWB H;  1E79 G;  4CS4 A;  1WA8 B;  2VRZ A;  2NN4 A;  4UXN A;  3ZHU A;  5B1N A;  3R66 A;  3K79 A;  4NXN B;  4O2A A;  2X6C A;  3JCU Z;  3H1I H;  2YUA A;  2JK5 C;  3QF7 A;  5FNV B;  2WLI A;  1B3Q A;  3GB7 C;  3D8C A;  3UT5 A;  3NXS A;  4IL6 Z;  1LUV A;  1IBK O;  3CXC U;  2XHB A;  4K3A A;  2AZ0 A;  2RCV A;  5LOV A;  1PL4 A;  4OX9 B;  4B3S B;  4KHP O;  1L8D A;  3SYC A;  2ARH A;  3WB1 A;  1XMQ B;  4JI1 O;  1J5E O;  3IFX A;  1Y67 A;  4UB8 Z;  1XMO B;  5J9P C;  3F5T A;  3FB7 C;  1QBZ A;  3OMN B;  2VWK A;  5EIB D;  3OMI B;  2FTK A;  1M57 C;  4JI6 O;  3JAK B;  4KUM A;  2P4K A;  1H8E G;  3SR2 C;  5KAF Z;  5CA0 B;  1MNG A;  1K33 A;  3ZMT A;  2RJZ A;  2QKS A;  2LGQ A;  4HBN A;  5IYC O;  1OCZ B;  3T1Y O;  4X1K B;  2WLM A;  4MW3 A;  3VQW A;  5LP6 A;  4PI2 A;  2AHY A;  3F5W C;  3C90 A;  4JGS A;  2P7T C;  3K08 A;  3CCV V;  3TGU H;  4QJF B;  2CTQ A;  1I94 O;  2IU3 A;  1M57 B;  1FYJ A;  1VF6 C;  2BCC H;  4DRX B;  1QLE C;  4EFE A;  1VQ4 V;  3OEH G;  4UB6 Z;  2NNU A;  1GMG A;  1WA8 A;  1S72 V;  1IBK B;  4N21 A;  1Q6H A;  2PY5 A;  4HYO A;  4DR1 O;  4X62 B;  1HNX O;  4KHP B;  4YXW G;  1PKX A;  2QDO A;  4JI1 B;  2GV9 A;  1I5X A;  5FNV A;  3AG4 B;  4MVQ A;  1XRE A;  2HJD A;  4QGP A;  1K9M W;  1QLE B;  1MSD A;  3JAL B;  1NQT A;  1W0J G;  4UVA A;  3K9S A;  2GTS A;  3OW2 U;  5L3D A;  4B3R O;  1QLN A;  3VQX A;  1PV0 A;  2HFE C;  3E2E A;  2WPD G;  3EVK A;  3DC5 A;  3KG2 A;  3SPC A;  1SF9 A;  1ZWI C;  2VQF O;  2UU9 B;  5CA3 A;  2D3O W;  3N2G B;  2YI8 A;  4KL1 A;  3T1Y B;  2Q0A A;  4PA3 A;  1R6K A;  3JAK A;  3CCL V;  5EYP B;  1I94 B;  1KP2 A;  4J41 A;  4P9O A;  4OPA A;  5CBF A;  5CA0 A;  3E86 A;  2X6A A;  4KP4 A;  2Q67 A;  1HNW B;  4JAA A;  5A2Q N;  2OCC C;  3CCQ V;  1Z2G A;  1N33 B;  5H6Q A;  5EK0 A;  4X1K A;  4L87 A;  2HEP A;  1VQM V;  3IJ4 A;  1JJ2 U;  3ASN C;  1HDJ A;  2R72 A;  1SES A;  4Q20 A;  3AK1 A;  5JWP A;  4DW1 A;  1BQZ A;  4K0K O;  4JZ2 A;  5IYD O;  1YDX A;  3LDC A;  3JD4 A;  1BE3 H;  4XDK A;  3L75 H;  3W7U A;  3E8G A;  3OEE G;  2UXD O;  2IM9 A;  5E1A C;  4JAV A;  1U96 A;  3SPG A;  4DXW A;  1NT2 B;  3ASN B;  2QWQ B;  3BCC H;  1R3J C;  3ABM C;  3CP1 A;  1RPO A;  3WFV A;  3DC6 A;  3U0Z A;  4ZIB A;  2VQF B;  3JAL A;  3K59 A;  3IC9 A;  2CTW A;  4O2B B;  3W7X A;  2QM7 A;  1U97 A;  4X88 A;  1VQL V;  4F6R B;  4X65 B;  4LFB B;  4GZR B;  2A9H A;  1FXK B;  2BOB C;  3RT3 C;  3ABM B;  3N2G A;  3BA8 A;  1VQN V;  5LMU B;  3PN1 A;  2F66 C;  3EFF K;  4N23 A;  4A5U B;  2QTO A;  1G4Y B;  5EYP A;  3ASO B;  1M90 W;  3JAM N;  1XQ8 A;  2EIL C;  4K0K B;  3ICX A;  3P32 A;  4NTW A;  2Y48 A;  2PYJ A;  2QE7 G;  3AK3 A;  3G6B A;  1X4T A;  5IY5 B;  1YHQ V;  1XI1 A;  4IYI A;  4DUY O;  2P6J A;  1I7F A;  1THZ A;  1K97 A;  3L72 H;  4X20 B;  3RYC B;  2V4D A;  2JS5 A;  5H6R A;  4G27 B;  1MZE A;  3OUF A;  2EIL B;  5CBH A;  1UPG A;  2PGG A;  5ITZ B;  2M7W A;  4DV7 O;  3K5M A;  5KAI Z;  3ZRV A;  4BR6 A;  5KHK A;  2JGU A;  4JI2 O;  1DLB A;  3S3W A;  2GBO A;  1YJW V;  4TV9 B;  5KUK A;  2HVJ C;  5KA5 A;  1EZV H;  1VQ7 V;  3TET A;  3EHB B;  4ZKI A;  4AIL C;  4O2B A;  2QM4 A;  3BY6 A;  2E76 B;  4GKK O;  5BMV B;  1TVK B;  4F6R A;  4H44 B;  2E3C A;  5LGU A;  3CD6 V;  1AJP A;  1FXK A;  1GM8 A;  5B3S C;  1SKV A;  4QNH B;  1OCO C;  4GKJ B;  3CSX A;  4BAY A;  5CB4 B;  5DN6 G;  3DXR B;  4H33 A;  3U11 A;  1EFR G;  4Z2W A;  4LCU C;  1SQX H;  2UXC B;  2JRI A;  1YCI A;  3BFR A;  1NVP B;  4R6Z A;  2H3O A;  1N4C A;  3J80 N;  3WB2 A;  1NTZ H;  5B1A B;  1R6T A;  1KBH A;  1X59 A;  1AI7 A;  1DF4 A;  3CB2 A;  1PD3 A;  2Q5Z A;  4TQD A;  5B3S B;  5C8Y B;  4P30 A;  3MAQ A;  4ICG A;  4JI7 O;  1IDS A;  1OCO B;  4J42 A;  2CDY A;  4TSF G;  4X66 B;  3SYP A;  4FZ1 A;  4GX5 A;  4X20 A;  3RYC A;  4JYA O;  4CH3 A;  1KC8 W;  2K1E A;  1SRY A;  1VQ9 V;  1VIB A;  1AR1 B;  4JI2 B;  1YVW A;  3ZIA G;  4YIO A;  3RVY A;  3HKD B;  2V7Q G;  5ITZ A;  1QCE A;  1SZT A;  4J7Z A;  4JV5 O;  1IBM O;  3SYO A;  2WLN A;  1LR1 A;  1RM1 B;  3CEI A;  4GX1 A;  1H2K A;  4Z1M G;  3N2K B;  4DYL A;  4O4J B;  4TV9 A;  2LO1 A;  3CE2 A;  2YS8 A;  4D7T A;  4B7E A;  4YHH O;  4EEQ A;  5LMN B;  1MG1 A;  2ETN A;  4J9Z B;  3TXS A;  3O9O A;  5KA6 A;  1EZJ A;  2EBO A;  5BMV A;  5CMU A;  1TVK A;  2EIJ C;  2ZT9 B;  1NI8 A;  1VP7 A;  3RVZ A;  2FYU H;  3JAT B;  3AG3 C;  3CCU V;  4J7K A;  5CB4 A;  2QKC A;  3G67 A;  3DXR A;  4TOI A;  2UUB O;  3L9D A;  4JI8 O;  4RQE A;  2ZM6 B;  4BW5 A;  1OZ0 A;  4JYA B;  3IC7 A;  2JJ1 G;  2ZIM A;  1XNQ B;  3W7S A;  2EIJ B;  4LNU B;  1WB8 A;  1GM9 A;  1PM9 A;  5B1B C;  2D2C B;  1N32 O;  2X6B A;  5C8Y A;  3AG3 B;  3A0B Z;  3K5N A;  3QO7 A;  3G80 A;  3UM7 A;  3ZED A;  4GX2 A;  4JV5 B;  1HNZ O;  3SPJ A;  1K5S A;  1PNM A;  4R50 A;  5FPR A;  3K0D A;  5LGN A;  1NJI W;  3K9A A;  3BRC A;  3HKD A;  2E74 B;  5B1B B;  4C7U A;  1US6 A;  1OV9 A;  3ZHS A;  4UFZ A;  1VQO V;  4I4T B;  1JR9 A;  2YIB D;  3OGI B;  5JQG B;  2ZDI C;  3P3N A;  3N2K A;  3KKY A;  4O4J A;  1TUE B;  3QG5 A;  1T5E A;  1SQQ H;  4IYH A;  2W6I G;  2ATK C;  4TQF A;  2N74 A;  2IJI A;  1IUR A;  1M5I A;  2UUB B;  4G28 B;  2EIK B;  2OTJ V;  1FKA O;  4LFA B;  3UKM A;  5AG2 A;  4YJ2 B;  4DR3 B;  1YF2 A;  2YDE A;  1VQ6 V;  4OX9 O;  1F23 A;  3JAT A;  4BIU A;  1N32 B;  2ZE7 A;  1XMO O;  3ZCC A;  2Q6A A;  2LFR A;  1PNL A;  3LSS A;  1HNZ B;  1AI6 A;  3SYQ A;  5JVD B;  4GCZ A;  1BHA A;  4ZBM A;  2YXH A;  4I5S A;  5DM6 V;  4LNU A;  1S77 D;  3O65 A;  3TCU A;  1G8M A;  1EN5 A;  4HZ3 A;  2AHZ A;  4FLV A;  4DV6 O;  1OCC C;  2OTL V;  4IIJ B;  5IYZ B;  2GSM B;  4UVC A;  5HFL A;  4DW0 A;  3B4S A;  1FXH A;  4PHZ A;  2EIN C;  3FB5 C;  2F23 A;  4LC1 A;  4FFB B;  1KEC A;  5FPO A;  4PDM A;  1V54 C;  4I4T A;  1GM7 A;  5KHG A;  2QWN B;  4O4L B;  2Z3Y A;  5JQG A;  2XAJ A;  3BEH A;  1DGS A;  3DTU B;  4FLX A;  4X62 O;  4X1I B;  3APQ A;  2A06 H;  2R9I A;  3OGC C;  1N0N A;  4DV5 O;  3T2M A;  2JGD B;  3ZMU A;  2EIN B;  5JCO A;  1R3I C;  3JAR B;  3CRQ A;  1V54 B;  2N05 A;  3M8A A;  5D5P A;  2EJ7 A;  4YJ2 A;  4CC6 A;  4LF6 O;  2ZDI A;  3B2E E;  1YZB A;  3H1L H;  2A7W A;  3PJS K;  1IZ3 A;  2QJ1 A;  1W2B U;  1ZL8 B;  3E8F A;  1EM1 A;  1MOF A;  2WA3 A;  2XTA A;  3F7V C;  3K04 A;  4EFB A;  2UU9 O;  2Z5U A;  2GUZ B;  4O4H B;  4DV6 B;  1FS0 G;  3D3Q A;  1VQK V;  5EZY B;  3K06 A;  1GK9 A;  1H2G A;  5JVD A;  4QE7 A;  2ITC C;  4MTF A;  1GTO A;  3OFN G;  1JPX A;  3LSU A;  1QHT A;  1HNW O;  3OR6 C;  4WBN B;  1S5J A;  1N33 O;  3ZS8 C;  1Q3E A;  1WN7 A;  4IIJ A;  5IYZ A;  5IDJ A;  2XAG A;  3RYI B;  3CME V;  1K8A W;  2QTS A;  3GVM A;  4J10 A;  1KU9 A;  3OM3 B;  3EXA A;  4FM0 A;  2YI9 A;  3ZRS A;  4FFB A;  1VQ5 V;  4D7S A;  1SQF A;  4DV5 B;  2YSU B;  5B1O A;  4FLZ A;  3SJA C;  4NTX A;  4O4L A;  2DQ0 A;  2ZR3 A;  3HB3 B;  1FXV A;  1LUW A;  3CRA A;  4X1I A;  4LF6 B;  1TA8 A;  3RYF B;  5DED A;  2JGD A;  2RN9 A;  1R3K C;  1ZAU A;  4FLT A;  3JAR A;  1S3J A;  3KCX A;  2C2A A;  3FD9 A;  4J11 A;  4DV3 O;  4JZG A;  4TWK A;  2KKW A;  1RP3 B;  1Q6U A;  4X65 O;  2Q8V A;  3X2Q C;  4LFB O;  2FL4 A;  1ZL8 A;  2UXB O;  4BIO A;  2GHY A;  1Q43 A;  2GUZ A;  4O4H A;  4DR2 B;  3QO5 A;  5LMU O;  1H2S B;  3ETQ A;  3E8B A;  5EZY A;  1ENV A;  2AXT Z;  4FK5 C;  1FFX B;  3CCE V;  2R70 A;  2M6Y A;  4U7O A;  3L73 H;  1NR1 A;  5L3F A;  1BS3 A;  2F43 G;  3X2Q B;  4E4E A;  1KB9 F;  1Z5V A;  3DSQ A;  4QIW F;  4NVP A;  4JAU A;  4WBN A;  2QWR B;  3MHH C;  1YIT V;  4XDL A;  3VQY A;  2OCC B;  1TAE A;  4E2L A;  3RYI A;  5JJJ B;  1H2N A;  2VS0 A;  5EBM C;  2WLH A;  4UCT A;  1VMG A;  2O57 A;  4K35 A;  4TV8 B;  4MVR A;  1P49 A;  3TXQ A;  1BSM A;  4PA9 A;  1NU1 H;  2L35 A;  1OHH G;  1VF6 A;  2OWO A;  4CBC A;  2EZP A;  3JSN A;  3BA9 A;  2PYL A;  4DV3 B;  4DV4 B;  1N34 O;  4B3M O;  3RYF A;  5DEC A;  4NB5 A;  1IBL O;  4X64 B;  2F1M A;  2UXB B;  2CTP A;  1E1R G;  5L3E A;  4LH7 A;  2AW9 A;  2Q0O C;  4CS2 A;  5LA6 B;  1IX9 A;  3DGE A;  1K4D C;  2ZIN A;  4LF9 O;  2YIC A;  3B8N A;  1QVG U;  4WFE A;  5CBG A;  4R8C A;  3OAA G;  4Q6G A;  4DR4 B;  3LDE A;  1YJN V;  2AGA A;  5IE9 A;  4GT1 A;  3TK1 A;  2LJ2 A;  4GKJ O;  1D2D A;  1JJO A;  1SQG A;  1FFX A;  2GTA A;  5CA1 B;  2UXC O;  3R65 A;  2BOC C;  2RNB A;  3QO8 A;  4AI8 A;  2DW4 A;  1TUB B;  3I56 V;  3WB0 A;  5LYJ B;  1R1B A;  3QNE A;  2Y0I A;  4H37 A;  4DV1 O;  2Q69 A;  3RYH B;  4U3F H;  3JD1 A;  3N27 A;  3G71 V;  2ZE5 A;  4LF7 B;  1WP8 A;  1L1F A;  1WB7 A;  3VBB A;  3LNM B;  1ZSP A;  4X66 O;  2YEV B;  3K3W A;  2DMX A;  3CXH F;  1Q7Y W;  4TV8 A;  1N34 B;  4B3M B;  1NH2 B;  1IBL B;  3K5L A;  2KG7 B;  3ZRX A;  1MMM A;  5A9G A;  1YI2 V;  4H0L B;  4JF3 A;  3CRM A;  5L3B A;  1GKF A;  1BL8 A;  3ML0 A;  4DR7 B;  1P84 F;  1UFI A;  3H01 A;  4FLW A;  2BTO A;  4LF9 B;  5IJ9 B;  4NTY A;  1SET A;  3HKB B;  3S3X A;  4LP8 A;  1BHB A;  1BQ0 A;  1V55 C;  2BTQ B;  1KKC A;  5BXZ A;  5LMN O;  1Q81 W;  1A32 A;  4FLY A;  1JCH A;  2P06 A;  1W59 A;  5FL7 G;  1WJZ A;  5LA6 A;  1Y6X A;  4DR5 O;  5BZB A;  4WFA V;  3JAW B;  3JD0 A;  3U10 A;  2PZS A;  4X8A A;  4X1Y B;  2DYS C;  4DV1 B;  1V55 B;  5IYB O;  3J7A U;  5B66 Z;  5CA1 A;  1GRJ A;  4MVS A;  2ZM6 O;  4PI0 A;  5CN0 A;  2A3Q A;  3CRC A;  1MA1 A;  1TUB A;  3CC2 V;  3MHS C;  1XNQ O;  5LYJ A;  3JD3 A;  2UXN A;  4WFG A;  3STL C;  4CZZ A;  3RYH A;  3STZ C;  2B1G A;  3D36 C;  4RUF A;  2YEV A;  1YJ9 V;  3BAA A;  2Q4P A;  1Q8I A;  3NR7 A;  2WA4 A;  1AR4 A;  2ADQ B;  3H1J H;  1OCR C;  4LFC B;  2KG7 A;  4NYK A;  4MTX A;  1JVM A;  4JI3 O;  2YXL A;  1YXB A;  4AHC A;  3ZHV A;  2P4V A;  1P7B A;  2HG5 C;  4FMT A;  1J95 A;  4OXS A;  2B5U A;  1XNR O;  3LUT B;  2CTR A;  1XIL A;  2ZE8 A;  1AVM A;  1D5N A;  5IWA O;  5IJ9 A;  4DR5 B;  2CAZ C;  3HKB A;  2BTQ A;  4JI0 O;  2F93 B;  1NH2 D;  4WF9 V;  3LNN A;  1OCR B;  4MSW C;  1I5Y A;  1F51 A;  1XL6 A;  3CJH B;  1QNM A;  1NTK H;  1S0V A;  1BGY H;  1W0K G;  1K3E A;  1Q90 D;  2DYR C;  1KQS U;  4OGQ B;  2IJK A;  4LFA O;  3HR0 A;  1DF5 A;  4DR3 O;  3JAW A;  5KX5 B;  3P30 A;  4X1Y A;  1VF7 A;  4UUJ C;  4IT5 A;  2L6L A;  3RGB A;  3FB8 C;  4HAM A;  5KHJ A;  4UCU A;  4BIZ A;  4UVB A;  4MT8 A;  1SQP H;  4QPJ A;  1ORQ C;  2QM8 A;  4DK0 A;  4WCE V;  1NVP D;  3AEI A;  2DYR B;  1CPY A;  2CE4 A;  1SZX A;  3K57 A;  1I08 A;  4O4I B;  2P90 A;  4RQF A;  2HLD G;  4JI3 B;  4YJ3 B;  1L0N H;  1JOY A;  4FVM A;  1BZK A;  4DV2 B;  2HJF C;  1XNR B;  5E79 Z;  1Y4M A;  4CH5 A;  5IWA B;  1QR9 A;  2DQ3 A;  4CC5 A;  1HP8 A;  4LF5 B;  1K7D A;  4LF8 O;  2OCH A;  4WFH A;  3ABL C;  4JI0 B;  3BHP A;  4J80 A;  5L3C A;  3B40 A;  2P22 C;  2QA4 V;  4Z1V A;  4W4K A;  1ZUQ A;  2CK3 G;  3SPH A;  3D36 A;  4DV0 B;  1VQP V;  3I55 V;  3AG2 C;  1WPB A;  5LHG A;  2EX3 A;  1ZTE A;  2VWJ A;  2HKO A;  1Y66 A;  3H1H H;  3CJH A;  1RSO B;  1Q5O A;  3ABL B;  5EBW C;  2Q7G A;  3G6E V;  2CGN A;  2Q7E A;  3WG7 C;  2Y69 C;  1NR7 A;  2ITD C;  4MTO A;  5LP6 C;  3JYC A;  2WWW A;  3QTC A;  3W7W A;  5GTH Z;  3C3S A;  3ZHQ A;  3SJC C;  5KX5 A;  2DWD C;  5B5E Z;  1AI4 A;  1F7Y A;  1WPX A;  1O9G A;  3B09 A;  3AG2 B;  2H94 A;  3RW0 A;  2RQ6 A;  2LQT A;  2WSS G;  1NTM H;  5JJN B;  5LXT B;  1FFT B;  3IAY A;  1AR5 A;  1DTO A;  2DE0 X;  2Y69 B;  3WG7 B;  4I50 B;  3ABK C;  3FAV B;  1B6Q A;  1R6N A;  2N04 A;  3FFQ A;  3K03 A;  4O4I A;  2QWP B;  4LF8 B;  2NR5 A;  5FLX N;  2UUA O;  4RWU A;  4YJ3 A;  5F2V O;  1XDC A;  3CMA V;  1V9P A;  4JYB A;  3RWR D;  1OCC B;  1N36 O;  5BR8 O;  4JTC B;  5LHH A;  2ODM A;  3ABK B;  3J81 N;  1M9N A;  2JDI G;  3BPZ A;  1GN4 A;  1NS1 A;  4ASU G;  4K8X A;  4KXR A;  2MW2 B;  3OD4 A;  3CCM V;  4PJ0 Z;  3JAS B;  2IJH A;  3VQV A;  2Q7H A;  2ADP A;  2OT5 A;  2Y0P A;  4ZHQ B;  3FYE B;  2ILM A;  3CCS V;  1IVS A;  3CCJ V;  2W0F C;  1G1X B;  2XAS A;  3OE7 G;  3FKS G;  4PDR A;  1RSO A;  1NZ6 A;  3F7Y C;  3FB6 C;  2F4V B;  4CH6 A;  1OCZ C;  5EBL C;  4FFK A;  2IBZ H;  3ZRW B;  5LGT A;  4B08 A;  4PEL A;  3Q4H B;  1GN6 A;  4B3T B;  1XEQ A;  4FIP C;  4MS2 A;  4I55 B;  2A79 B;  1MAB G; 
#chains in the Genus database with same CATH homology
 4CBC A;  2EZP A;  5B1A B;  1KP3 A;  4P9P A;  1ARO P;  2EJR A;  2EZO A;  3SJQ C;  4UV8 A;  3E89 A;  2PI5 A;  1AI7 A;  1DF4 A;  2H8P C;  1PD3 A;  3E83 A;  4PDV A;  5B3S B;  4P30 A;  1OCO B;  3JD2 A;  1S5H C;  2ZR2 A;  4TSF G;  3SYP A;  3ETD A;  4GX5 A;  4WFB V;  3D3I A;  1E1R G;  3ABT A;  5L3E A;  1KC8 W;  4P2Z A;  2K1E A;  1SRY A;  1VQ9 V;  1AR1 B;  3B8M A;  4UV9 A;  3AG4 C;  3ZIA G;  2WLK A;  5LBQ A;  3RVY A;  2P67 A;  5LHI A;  3DGE A;  1QVF U;  3VOU A;  1K4D C;  2V7Q G;  1MSW D;  4JYC A;  4U7N A;  2ZXW C;  3B8N A;  1N8R W;  1QVG U;  4WFE A;  5CBG A;  1QCE A;  3GWO A;  1SZT A;  4R8C A;  2WLL B;  3OAA G;  3LDE A;  1YJN V;  3SYO A;  4GT1 A;  3ZMV A;  2WLN A;  1RM1 B;  3TK1 A;  4GX1 A;  4RO2 A;  4Z1M G;  3CYO A;  1RPR A;  3E35 A;  1KKD A;  1H38 A;  4MW8 A;  3T1C A;  2JEU A;  4PDL A;  4G2K A;  3R65 A;  3T4Z A;  3B77 A;  2BOC C;  2KB1 A;  3E8H A;  1MG1 A;  3QO8 A;  3SYA A;  4J9Z B;  3OUS A;  2DW4 A;  3I56 V;  3FYI B;  5KA6 A;  2ZXW B;  3QNE A;  1EZJ A;  4H37 A;  2EBO A;  1R73 A;  3K0G A;  2Q69 A;  4J9Y B;  3CCR V;  5CMU A;  3JD1 A;  3G71 V;  2EIJ C;  1M56 C;  2WLJ A;  1E79 G;  3RVZ A;  1L1F A;  3VBB A;  3LNM B;  4UXN A;  3AG3 C;  5B1N A;  2YEV B;  3K3W A;  3CCU V;  1KD1 W;  1NBM G;  3K79 A;  3ZRW A;  3G4S V;  1Q7Y W;  2X6C A;  3OR7 C;  1NH2 B;  4MVU A;  2V1D A;  4RQE A;  3ZRX A;  4QE9 A;  2JK5 C;  4BW5 A;  1YI2 V;  2WLI A;  1OZ0 A;  3IC7 A;  2JJ1 G;  4JF3 A;  3GB7 C;  2X7R B;  3NXS A;  5L3B A;  1VQ8 V;  4F4L A;  3W7S A;  1Q82 W;  2EIJ B;  1GKF A;  1BL8 A;  3ML0 A;  1GM9 A;  5B1B C;  3CXC U;  1M56 B;  3H01 A;  2X6B A;  3AG3 B;  1AJN A;  3QO7 A;  4PA4 A;  1SET A;  3UM7 A;  4TT3 G;  4LP8 A;  1BHB A;  4GX2 A;  4MVM A;  4MVZ A;  3SYC A;  4JAS A;  1V55 C;  4JTA B;  3SPJ A;  1K5S A;  1PNM A;  1Q81 W;  3IFX A;  2XAF A;  1SER A;  5L3G A;  4R50 A;  1JCH A;  5J9P C;  3K0D A;  4R7C A;  5LGN A;  1NJI W;  3FB7 C;  3K9A A;  1QBZ A;  5FL7 G;  1PNK A;  3OMN B;  1YSC A;  1GO3 F;  2JJ2 G;  2IH1 C;  2X0L A;  5B1B B;  3OMI B;  2FTK A;  5BZB A;  1M57 C;  2HVK C;  4WFA V;  2IH3 C;  3JD0 A;  2WLL A;  4KUM A;  1VQO V;  4X8A A;  1H8E G;  1S76 D;  2DYS C;  1V55 B;  5IYB O;  2ZDI C;  2HR3 A;  1K33 A;  3ZMT A;  2A0L A;  2QKS A;  1FXK C;  1E1Q G;  1TUE B;  1YTF B;  5IYC O;  1OCZ B;  4MVS A;  2WLM A;  4MW3 A;  5CN0 A;  2AHY A;  3F5W C;  4JGS A;  2P7T C;  2W6I G;  3K08 A;  2ATK C;  4JTD B;  4QJF B;  3CCV V;  2IU3 A;  3CC2 V;  2IJI A;  3MHS C;  1M57 B;  1CP9 A;  3JD3 A;  2UXN A;  4G28 B;  4WFG A;  3STL C;  2EIK B;  1QR8 A;  4CZZ A;  3ASO C;  2OTJ V;  3ZJZ A;  3STZ C;  1QLE C;  1VQ4 V;  3UKM A;  3OEH G;  5H9C A;  2NNU A;  3AG1 C;  2B1G A;  1VQ6 V;  1GMG A;  1F23 A;  4RUF A;  1S72 V;  2YEV A;  2WAM A;  5GW7 A;  4N21 A;  1YJ9 V;  1BMF G;  4BIU A;  4HYO A;  5IY5 C;  1XL4 A;  4QPK A;  3ZCC A;  2Q6A A;  2DWE C;  1OCR C;  2LFR A;  4YXW G;  1PKX A;  1PNL A;  3LSS A;  1I5X A;  1AI6 A;  4LBE C;  4MTX A;  1JVM A;  3SYQ A;  3AG4 B;  4GCZ A;  4MVQ A;  1BHA A;  4ZBM A;  3CC4 V;  4RAI A;  4DO2 A;  4KFM A;  1K9M W;  1P7B A;  1QLE B;  2HG5 C;  4FMT A;  4I5S A;  3ZN0 A;  5DM6 V;  1J95 A;  4OXS A;  3AG1 B;  1NQT A;  1W0J G;  4UVA A;  2B5U A;  1S77 D;  3LUT B;  3TCU A;  1G8M A;  3OW2 U;  5L3D A;  4HZ3 A;  2AHZ A;  2QEX V;  5EC2 C;  1OCC C;  1QLN A;  2XAQ A;  2OTL V;  4GX0 A;  2HFE C;  3E2E A;  1NH2 D;  4WF9 V;  2WPD G;  1OCR B;  4MSW C;  1F51 A;  2GSM B;  1I5Y A;  1XL6 A;  3KG2 A;  4UVC A;  5HFL A;  1CEZ A;  3SPC A;  1ZWI C;  5KUM A;  5CA3 A;  2D3O W;  4PA6 A;  1S0V A;  3LDD A;  1W0K G;  1K3E A;  4XBF A;  1FXH A;  2EIN C;  3FB5 C;  3MD0 A;  2DYR C;  1KQS U;  4PA3 A;  1R6K A;  4LC1 A;  4RUE A;  2IJK A;  1KEC A;  1DF5 A;  4PDM A;  1V54 C;  3CCL V;  2NLJ C;  1UJW B;  1KP2 A;  3P30 A;  4P9O A;  1GM7 A;  5CBF A;  2Z3Y A;  4UUJ C;  3E86 A;  2X6A A;  4KP4 A;  2Q67 A;  2XAJ A;  2ZQM A;  3BEH A;  5EC1 C;  2IU0 A;  2OCC C;  3FB8 C;  3DTU B;  2MK3 A;  3ZMZ A;  3CC7 V;  4FPP A;  4HAM A;  1JX9 A;  3CCQ V;  3ETG A;  5H6Q A;  4BIZ A;  2R9I A;  4UVB A;  5EK0 A;  4MT8 A;  2Q68 A;  4QPJ A;  3OGC C;  4L87 A;  1ORQ C;  1WLE A;  1VQM V;  2QM8 A;  5HFM A;  1JJ2 U;  3T2M A;  3ASN C;  3ZMU A;  4WCE V;  1NVP D;  2EIN B;  3AEI A;  4MVO A;  2DYR B;  1SES A;  1CPY A;  4Q20 A;  1R3I C;  1H8H G;  1V54 B;  5IYD O;  3LDC A;  3JCZ A;  2P90 A;  2EIM C;  3HPL C;  2HLD G;  4RQF A;  3JD4 A;  4XDK A;  1JOY A;  2ZD9 A;  5B1A C;  2ZDI A;  3PJS K;  4X89 A;  3W7U A;  3E8G A;  3OEE G;  3W7T A;  1YTF D;  1W2B U;  2HJF C;  3E8F A;  1MOF A;  1Y4M A;  4JAV A;  5E1A C;  3CPW U;  3F7V C;  3K04 A;  2XOK G;  1QR9 A;  2Z5U A;  3SPG A;  4DXW A;  2DQ3 A;  3ASN B;  1FS0 G;  1K7D A;  1VQK V;  4PA7 A;  3K06 A;  1R3J C;  4WFH A;  1GK9 A;  1H2G A;  3ABM C;  3ABL C;  2XAH A;  3T4D A;  4MTG A;  4QE7 A;  5L3C A;  3CP1 A;  1RPO A;  3WFV A;  2PI4 A;  3A0R A;  2EIM B;  2ITC C;  2QA4 V;  4MTF A;  2UXX A;  1GTO A;  2CK3 G;  3SPH A;  3OFN G;  3W7X A;  3D36 A;  1JPX A;  2QM7 A;  4X88 A;  1COW G;  2LFS A;  3OR6 C;  1VQL V;  1VQP V;  3I55 V;  2DYS B;  3AG2 C;  5LHG A;  1PL0 A;  4FJC C;  2HKO A;  1Y66 A;  2A9H A;  1RM1 C;  1FXK B;  5IDJ A;  2XAG A;  3CME V;  1K8A W;  3OMA B;  2BOB C;  1ROP A;  3M99 B;  1LNQ A;  3ABL B;  3ABM B;  5EBW C;  3G6E V;  1EBO A;  3OM3 B;  1VQN V;  3WG7 C;  2Y69 C;  1NR7 A;  2ITD C;  4MTO A;  1M1K W;  1K4C C;  3IGA C;  2WWW A;  3JYC A;  3ZRS A;  1VQ5 V;  3W7W A;  3EFF K;  4N23 A;  2QTO A;  1G4Y B;  2YSU B;  2DWD C;  3ASO B;  5B1O A;  1M90 W;  1AI4 A;  1K34 A;  1WPX A;  2EIL C;  2DQ0 A;  3AG2 B;  2ZR3 A;  2H94 A;  3HB3 B;  3RW0 A;  1FXV A;  3P32 A;  2Y48 A;  2QE7 G;  2WSS G;  5IY5 B;  1YHQ V;  1FFT B;  3ABU A;  2P6J A;  1DTO A;  3WG7 B;  2Y69 B;  1F4M A;  1JQ0 A;  1THZ A;  3ABK C;  1B6Q A;  3RBZ A;  1K97 A;  1R6N A;  1R3K C;  1AJQ A;  1S3J A;  2C2A A;  3K03 A;  5H6R A;  1K92 A;  2JEX A;  1R3L C;  4G27 B;  3OUF A;  2EIL B;  1K5Q A;  5CBH A;  4TWK A;  3CMA V;  1IXM A;  4JYB A;  3ZMS A;  3X2Q C;  5C93 A;  2M7W A;  1OCC B;  1AI5 A;  4JTC B;  2GHY A;  5LHH A;  2B1I A;  3ZRV A;  3ABK B;  2IJJ A;  1M9N A;  3QO5 A;  1DLB A;  2JDI G;  3E8B A;  2IW5 A;  1ENV A;  1YJW V;  2XND G;  3CCE V;  4FK5 C;  5KUK A;  2HVJ C;  5KA5 A;  4ASU G;  1VQ7 V;  3TET A;  3EHB B;  3CCM V;  4U7O A;  2IJH A;  1Q86 W;  1NR1 A;  4ZKI A;  2OT5 A;  3FYE B;  5L3F A;  3CCS V;  2F43 G;  3X2Q B;  1HWY A;  3BY6 A;  3CCJ V;  2W0F C;  4QIW F;  2XAS A;  3OE7 G;  3FKS G;  3ZN1 A;  4JAU A;  5LGU A;  4I9W A;  4PDR A;  3LSQ A;  3MHH C;  1AJP A;  1YIT V;  3CD6 V;  4XDL A;  2OCC B;  4E2L A;  1FXK A;  1P4R A;  1GM8 A;  5B3S C;  1NKD A;  3F7Y C;  3FB6 C;  5EBM C;  2R9R B;  1F4N A;  2WLH A;  4QNH B;  1OCO C;  1OCZ C;  5EBL C;  4BAY A;  2W6J G;  2JIZ G;  5DN6 G;  3ZRW B;  4H33 A;  5LGT A;  1YIJ V;  4XDJ A;  1EFR G;  4LCU C;  4MVR A;  4PEL A;  3ETE A;  4EKW A;  1NVP B;  4FIP C;  4JPR A;  4MS2 A;  4PA9 A;  4R6Z A;  2LP7 A;  1K73 W;  1OHH G;  2A79 B;  2WLI B;  3SPI A;  1MAB G;  2EIK C;  4WFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...