5GTHZ

Native xfel structure of photosystem ii (dark dataset)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
total genus 23
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5gthZ00
2AXTZ 3JCUZ 5GTIZ 3A0HZ 5TISZ 4UB6Z 5GTHZ 5H2FZ 3KZIZ 4PJ0Z 3WU2Z 1S5LZ 4UB8Z 5B66Z 5KAIZ 5B5EZ 5KAFZ 5E79Z 3A0BZ 4IL6Z
chains in the Genus database with same CATH superfamily
5JJJB 4NXNO 3LNNA 3KKYA 2EIJC 3C3TA 3CYOA 1N34O 3DC6A 3ABKB 4JTDB 4LF9O 4BIUA 1K33A 4J41A 4FZ0A 2ZNJA 2OTLV 2EIMB 4I9QA 3ZX6A 2YI8A 1K97A 4D6TH 4K0KB 1LR1A 4WF9V 1KBHA 3RYIA 1FXHA 4J9YB 1V54C 3R66A 3AG4B 1XNQB 5E1AC 3KG2A 5B1BB 5KA5A 4X1IB 2IU3A 2IH3C 3J7AU 1GM7A 1SQVH 3JD4A 3CD6V 1FFXA 2LO1A 1XL6A 3T1CA 1UFIA 3APQA 4BW5A 2LGQA 3EHBB 1MOFA 1Q5OA 5FL7G 1K34A 4MSWC 5GTIZ 3CHXA 3PJSK 3A0HZ 4WBNA 4K0KO 3BCCH 4YHHO 5H2FZ 2AHYA 2VWJA 3CB2A 1NH2D 4GKJB 1XNQO 1GMGA 1KU9A 1OCRB 1RSOA 1QU7A 3ETGA 3F7VC 3JAMN 4BWAA 4JAAA 1AI5A 2AZ2A 1VF5B 1SQPH 1SC5B 3E22A 3O65A 3A0RA 4L87A 2W6JG 2JIZG 2B9ZA 4K35A 1TUEB 2R9IA 2QR4A 3DXRA 2IM9A 1M56C 4I5SA 1E1RG 1GH6A 2K9PA 1VQ6V 4J10A 4DO2A 2Y69B 5B1OA 4GKJO 2BTQB 4UCTA 4PV1B 4D7TA 2EULA 5CBFA 3OMAB 2GDSA 1NR1A 3K08A 2P67A 5J2TA 1S76D 5IJ0B 1Q90D 3K5MA 3WB0A 3B40A 5EBLC 4RQEA 3RN4A 4FFBA 4B3MB 3TJTA 2ADPA 2P6JA 4WFGA 1X59A 1ZL8B 1R3KC 2XTAA 4G27B 1XNRB 4LWSA 1VQMV 3HKEB 4J7ZA 5KX5A 1U97A 2HEPA 3RWRD 2YC0A 5GTHZ 4DR2B 3IGAC 2UU9B 5BZBA 4B3MO 2A3QA 3W7XA 1IVSA 2CTWA 2ZINA 4LNUB 3ZMVA 1JFFB 5IY5B 1XNRO 3ZBHA 2KKWA 2Z0AA 3E86A 2H3OA 1H2MA 5JVDA 3APOA 1AI7A 3E89A 4DR2O 4GX5A 4EFEA 4R50A 5CBGA 2UU9O 3K58A 3T1YB 3LDEA 2FL4A 5IYCO 4WBNB 1YJ9V 1WP8A 3JARB 4PA6A 2DYRB 5CBHA 4I0XB 5LGUA 1FS0G 2YS8A 1MSWD 3IJ4A 4JYBA 4EKWA 3CWBH 4LF4B 3I5DA 1RSOB 1S72V 2JEXA 3N2GA 3JALA 3JCZA 3D8CA 4DV2B 1D5AA 2CAZC 2WWWA 5CB4A 4YY3O 2R9RB 3CCRV 1ZX3A 4I55A 3LUTB 2EIJB 4Z1MG 1W2BU 3DXRB 3T1YO 2WA4A 2XAFA 4KP4A 2E5LB 5LMUB 3STLC 2QM4A 2DQ0A 4LF4O 4PD4F 2L35A 4LBEC 4YIPA 2VWKA 4DV2O 1PKXA 3M8AA 4PDMA 1O9HA 5BXZA 3A8TA 2MW2B 1OCOC 1M9NA 3ZS8C 3HKDA 1QLEC 3B8MA 4CS3A 2OCCB 2E76B 3AG7A 4X89A 3G4SV 4O2AB 3WB1A 2B1GA 2E5LO 5LMUO 2Y48A 4U3JB 2Q67A 1UPGA 3GWKC 3SYOA 1DGSA 1XUQA 2DYSB 5FLXN 4IT5A 2EZPA 2OCHA 3TXSA 3LSQA 2GTAA 1YCIA 4LWSB 5B1AC 4UCRA 4MTXA 2F93B 4O4LA 2ZDIA 4J7JA 5IWAB 4CS4A 1IBLB 3FB7C 3NR7A 2WSSG 4JZGA 3FB5C 3SYAA 1WLEA 1NR7A 2EJRA 4QE9A 5DECA 2OYQA 4ZOLB 1YITV 4J7KA 3E8FA 2KB1A 4DV0B 2GUZB 1ORQC 5H9CA 4UV8A 4FM1A 5LGNA 4PHZA 1B06A 4D7SA 3RYCB 1XBLA 1M56B 3SJAC 1M1KW 1VQLV 1OJHA 1OV9A 4LC1A 2X6CA 1GTOA 4HNAA 4ZKIA 4TWKA 5K1PA 1JR9A 4X1YA 4U7NA 1YJWV 3RVZA 3B4SA 4OXSA 1JJOA 3FFQA 3NXSA 5IE9A 1XOUA 2CTRA 4LF6B 5IWAO 2WLJA 1IBLO 3RBZA 2X7RB 4LF7B 3OMNB 1BS3A 5A2QN 4TV9A 4DV0O 3CJHA 1JX9A 4AQYB 4RAIA 3CCMV 2ZIMA 1JPXA 3ABLB 2Q68A 1YHQV 1DF4A 3ZHUA 2ZD9A 1I5XA 3U0ZA 5A9GA 2KG7B 1SERA 2CGNA 4H13B 1BCCH 1WJZA 3HB3B 4PI0A 4TUYA 3KCXA 1FYJA 4BR6A 4CC5A 4LF6O 1JVMA 5LMNB 1NI8A 4QE7A 2ZE5A 2QWRB 3ABMC 1Q8IA 4LF7O 1FXVA 3SGIA 1CP9A 1K4DC 1E1QG 3OEHG 4AQYO 2QWPB 3FX7A 4JASA 2DOSA 4PDRA 2GBOA 3BA8A 4FM0A 3HR0A 2H8PC 2JGDB 3BY6A 3ZHTA 3AG1C 1B3QA 1E79G 1YZBA 4HZ3A 5LMNO 5KHHA 3G67A 4C7UA 1M93A 1K3EA 2YEVB 3AG2C 2QKSA 3SYPA 1BE3H 5EYPB 4MVZA 3SYCA 3UKMA 1Y6XA 1NZ6A 3TCUA 1Z2GA 1N32B 1XI1A 4O4LB 2E3CA 2HFEC 2HP8A 2LFSA 4TSFG 5L3EA 1J5EB 3L74H 4J9ZB 3EXAA 4FM2A 5EBWC 4LFCB 3K5NA 2F66C 2UXBB 5KAFZ 5LP6A 2HJFC 5C8YB 5KHJA 1I0HA 3CP1A 2AXTZ 2XT9A 2IW5A 2XASA 5GONA 1K5QA 2AGAA 3ZJZA 3T4DA 3BA9A 3UO3A 3ICXA 3X2QC 3F5WC 1N32O 4TQFA 2QSAA 3PN1A 5IYBO 1BMFG 4WFFA 2HG5C 3MAQA 4O2BB 3QG5A 2Q7EA 3K5LA 4YIOA 1J5EO 4LFCO 2UXBO 4MVOA 1R1BA 1SESA 3ETEA 2X0LA 2PI5A 1F51A 1VIBA 2HR3A 1AP5A 1QNMA 3RW0A 3T2MA 2BTQA 1QLEB 4HAMA 3EVKA 1IX9A 1H2KA 2P4VA 2VS0A 4TT3G 3H1LH 1IURA 1NTZH 2RQ6A 1HWYA 3M7MX 1KUQA 5D5PA 2QM7A 2DJVA 2IBZH 5IJ0A 1BZKA 4UV9A 2HVJC 5LBQA 2DN9A 3L75H 5D5QA 3AK1A 5B1AB 1ZL8A 1NU1H 4PA4A 1QLNA 1BQZA 4Q20A 1Q6HA 2BOCC 1FXKB 2Z3YA 1AI4A 1NTMH 4QJFB 1RFYA 2N04A 4QIWF 2WAMA 5GW7A 1QR8A 3CE2A 2Y4UA 4PA9A 4DR6B 2EILC 5KUKA 1Y67A 2R72A 1TAEA 2IJJA 2P7TC 1AROP 3E83A 3AG3B 2GTSA 4DV7B 4ZI7B 1H38A 1PP9H 2WLLB 4O4IB 1S5JA 1L0NH 3SPHA 1R73A 2JJ2G 2PGGA 3H1JH 5H5NA 4DR4B 4NKGB 1LNQA 1R6KA 5JCOA 4LNUA 1JFFA 1W0JG 2RCVA 4H44B 1JCHA 2WLHA 5KHIA 3L72H 3OW2U 4LFAB 1JOYA 1KP3A 4CH5A 3ASOC 2A06H 2UUCB 4DR6O 2UUBB 3SYQA 5KA6A 2HJDA 4DV7O 3FAVA 1HNZB 1XREA 3I56V 1THZA 4F4LA 3OFNG 3JARA 2E75B 4MW3A 4DR4O 4ZHQA 4I0XA 5LP6B 3CRCA 1N36B 1YTFD 1PM9A 2ZE6A 2W0FC 1NQTA 5GONB 4LFAO 1ZTEA 2UUCO 3CSXA 2UUBO 3MHHC 1V55B 5JH7A 3OAAG 4DR3B 2YXLA 1RPRA 3TK1A 4QPJA 3QTCA 3SDLA 1G6UA 4PA7A 4TV8B 1XQ8A 4IIJB 3FB8C 1HNZO 2QWNB 1SZTA 3UO2A 4DV4B 4GX1A 1T5EA 1QHTA 2LFRA 1US6A 1DF5A 5IT9N 2EIKC 3OT7A 2BE3A 1N36O 3AG2B 4EB6B 3JCUZ 1PNMA 1ZUQA 2JEUA 2C2AA 3G71V 4JV5B 1B04A 1COWG 4DW1A 4XDJA 3LSSA 3W7TA 2F43G 4E4EA 1SKVA 1Q7YW 1A32A 4DR3O 1SQXH 4O4JB 2CE4A 4FLYA 1B6QA 4CS2A 3SJBC 4KHPB 3K04A 4DV4O 3CXCU 5EZYB 4O2AA 4GZRB 3OMIB 2AZ0A 1VQOV 4U3JA 3OR7C 4ICGA 3STZC 2WLMA 1OCZB 3LDCA 1EN5A 1M5IA 4FLUA 4R8CA 1Q3EA 4JV5O 3JAKB 5KMGB 2XNDG 2XAHA 4GYCB 1R3LC 3CS5A 3ZMSA 2GV9A 1CPYA 4NR1A 4EEQA 4KHPO 3P3PA 4BIZA 4X65B 3ZRVA 2UXCB 4ZOLA 2BTOA 2GUZA 2BCCH 3WB2A 3ZCCA 3Q4HB 1EBOA 2IJKA 3K03A 2V4DA 3RYCA 4DR5B 1NVPB 1WB8A 2PY5A 3K0GA 4MT8A 1PPJH 1DLBA 4X9QA 4WFHA 2ZIOA 4N23A 3GWOA 2F4VB 2PYLA 4DV5B 2QE7G 2UXXA 4X20A 1I94B 2N74A 3G6BA 1KKCA 1TGOA 1WN7A 3CCJV 1JQ0A 4XDLA 4RQFA 2HVKC 4X65O 1RM1C 2UUAB 2PZSA 2UXCO 1S3JA 1OCCC 4CH3A 2P22C 2Q5ZA 3FAVB 4B3RB 1PV0A 1KYOF 1H8EG 3K5OA 1MG1A 4B3SB 1XMOB 1MZEA 3HPLC 4DR5O 4ZHQB 2MK3A 3B8NA 1YJNV 2XAGA 5L3FA 2KG7A 5BMVB 1I5YA 3D36A 3SPCA 4JI2B 2F4VO 1HNXB 3H01A 4DV5O 1EFRG 3N2KA 4AHCA 5KHKA 2WLIB 4U7OA 2EZOA 3BABA 5JH7B 1I94O 3EFFK 5JJEB 1VQNV 2UUAO 1S0VA 4H37A 3E8GA 2YXYA 4LF8B 4UCOA 4B3RO 3ML0A 3ETDA 2EILB 3QNEA 1OZ0A 4PJ0Z 1VQKV 4JTCB 4B3SO 4UCSA 4DUZB 3UT5A 1XMOO 1LUVA 2Q9LA 3VBBA 1GN2A 3K0DA 2JGDA 1ROPA 4Q6GA 3QO8A 3CXHF 1Z5VA 4JI2O 1BT8A 2GHYA 3E2EA 3P30A 3OD4A 1D5NA 1HNXO 3CRRA 3JD2A 5LXTA 2NNUA 1V54B 1M57C 4P9PA 4ABMA 1QBZA 3SJQC 5CMUA 3ASNC 4JTAB 3OE7G 2YEVA 3JD0A 3DSQA 4X8AA 4LF8O 3JD1A 5CA1A 2EX3A 5B66Z 3QO7A 4DUZO 4LCUC 3FKSG 2YICA 3GB7C 4L8JA 5EYPA 1HNWB 1GM9A 2E74B 3JASA 3CC4V 1F23A 2FYUH 3ZIAG 4TOIA 3JATB 3ABTA 5K1XA 3D3QA 5LHGA 2H94A 2G38A 1MNGA 3L73H 1KECA 4X1KB 3L70H 1Q82W 4H0LB 3H1KH 2AW9A 4KFMA 1P84F 4RO2A 2W0XA 4ZBMA 4UVBA 1VQPV 1HNWO 4GKKB 5C8YA 2Q8VA 3E8HA 2HKOA 5IJ9A 4UB8Z 3CPWU 2O57A 3SPJA 2EIKB 3OR6C 1ZAUA 1N8RW 1PL0A 3F7YC 1I08A 4X64B 4B7KA 2NR5A 4O2BA 4X20B 1AI6A 1RPOA 5EIBD 3ABKC 3OUFA 4OX9B 4BAYA 4FFKA 2EIMC 4GLXA 1KB9F 4GKKO 5KAIZ 5H6RA 2HHHB 1SQGA 4WFAV 2M6YA 1BL8A 1XMQB 1FKAO 4NTXA 1Q86W 4GUNA 3BAAA 1M90W 2Q0AA 1QCEA 4E2LA 3HKCB 1QQCA 1ZWIC 5LHHA 2VQEB 2Z5UA 5IDJA 3RFRA 5B1BC 3N2KB 2WLKA 2B1IA 4DV1B 4QPKA 4X64O 1GKFA 1Q43A 2CTQA 1H8HG 2XAJA 2L6LA 1GO3F 5L3GA 4UCUA 3CC2V 1P7BA 4OX9O 2IJIA 2M7WA 5LL6Y 1P4RA 2DWEC 3B09A 1DTOA 1XEQA 2HHHO 5ITZB 3UT5B 3ZHSA 3OGCC 1FXKA 1N0JA 3THOA 1R6NA 4CZZA 1XMQO 1VF6C 2QA4V 3K3WA 2ODMA 1Y74B 3K79A 2VQEO 2JJ1G 1N33B 1AP6A 2ADQB 3ETQA 4FK5C 5LA6B 5LYJB 1OCRC 2UXNA 5LXTB 4DV1O 2JVDA 3D3IA 3TGUH 4ZI7A 3H1HH 3FYIB 4QNHB 3VQXA 2WLLA 4O4IA 3CRQA 5CA1B 1WB7A 5IYDO 2JS3A 4P30A 1EM1A 5EK0A 1OCCB 5FPRA 3MDSA 3S3WA 1VQ8V 5L3CA 3JASB 4XDKA 2GSMB 1N4CA 4GT1A 2OTJV 1R3IC 1N33O 1IZ3A 1AR1B 3BPZA 1NBMG 2CDYA 4UB6Z 1DK1A 1Z5WA 2X6BA 1VQ9V 2ETNA 4CC6A 3ZRWB 1S5LZ 1K5SA 4NB5A 4DV3B 5B1NA 4DYLA 3J81N 1XL4A 4DK0A 5B5EZ 4JYAB 1K92A 1ZLZA 2WPDG 2D3OW 3W7SA 2Q4PA 5IJ9B 1YI2V 4B08A 2OWOA 1H2GA 2LJ2A 4RUFA 1IXMA 3IC7A 3WU2Z 1EZJA 1SZXA 2Q7HA 1VMGA 4YJ3B 2WLNA 1XDCA 4TV8A 4IIJA 5CN0A 5E79Z 4DV3O 4FIPC 4K8ZA 2NN4A 3DTUB 1M4UA 1OCOB 3ASNB 4JYAO 1FFTB 3HKBB 3KZIZ 1AVMA 3ZHQA 1WNSA 4DR1B 4EB6A 3MHSC 1YDXA 4FLWA 4KL1A 4HYOA 5DEDA 1GN4A 2P5OA 3JYCA 1Y66A 1X4TA 4DV6B 4NVPA 1AILA 2DW4A 4O4JA 4IL6Z 1IDSA 2UXDB 2LW1A 2PUSA 5KUMA 2EJ7A 3UM7A 5EZYA 4A5UB 3IAYA 1VP7A 1R3JC 3AK3A 3RYFB 4IHJB 1MA1A 3I55V 4W4KA 4UVAA 1FPOA 2VQFB 4DR1O 3JSNA 2Q73A 2YIDA 4J11A 4JPRA 1PD3A 1VEWA 3JAKA 3ZEDA 5KMGA 4CH4A 2ZE8A 4JZ2A 2XUMA 4X62B 1GN3A 1BHBA 1L1FA 2UXDO 1IBKB 3G80A 2OIEA 4JYCA 4JGSA 2D2CB 1PL4A 4I4TB 4EFBA 3J80N 2WA3A 5DN6G 3Q4HA 1U96A 5FPOA 2VQFO 1S77D 3OUSA 3RYHB 3S3XA 3MD0A 1S5HC 2XOKG 4X62O 3CCSV 4MTOA 1IBKO 4JI4B 2JDIG 4YHHB 1HR0B 3L9DA 5C93A 3TETA 3G6EV 1MSDA 2A7WA 5JJNB 3VQYA 3OTFA 4IYHA 3M99B 1V9PA 3IC9A 3P3NA 1MMMA 3FB6C 3VQWA 3L71H 4O4HB 5B3SC 2DWDC 2OCCC 3CCUV 4I7ZB 4I9WA 1SQBH 2YSUB 3ABMB 2RJZA 4QGPA 5BMVA 3OM3B 3RT3C 2CH7B 3U11A 3AK2A 3ZHVA 5DM6V 2PTMA 4DR7B 1GK9A 2RDCA 2LGWA 2DYSC 3B77A 5J9PC 1ENVA 3ZMZA 4FLZA 4JI4O 2WLIA 4DUYB 1R6TA 4AI8A 1H2NA 5LGTA 3DGEA 4Z1VA 1HR0O 1AJPA 4MTGA 3AG1B 4FLXA 1NKDA 2ZE7A 4JI6B 2ITCC 2YIBA 5KHGA 3WG7C 2AHZA 5J2UB 1HDJA 1K7DA 2ZT9B 3CCLV 3RVYA 1O9GA 5EBMC 1WPBA 3K57A 1AR5A 2P90A 4UUJC 2Q7GA 1AB3A 4DR7O 2ZXWC 4FMTA 4DUYO 3QO5A 4HBNA 1YVWA 1MZFA 4JI7B 2QTSA 2CUGA 1JMKC 4JI6O 2V7QG 4FLTA 5HFLA 4G2KA 2QKCA 4XBFA 2YIAA 4X66B 2F95B 1AR4A 5L3BA 1QR9A 2QJ1A 4LH7A 3ZN0A 2ZR3A 5CA0B 4J42A 1TUBA 2IU0A 3JATA 3ABLC 2CTPA 5KLVH 3JAWB 4F6EA 1QVGU 3FD9A 2JS5A 1LUWA 3SPGA 4X1KA 5LOVB 1KMIZ 3D36C 2ZKOA 3SR2C 4JI7O 1PNKA 3X2QB 1FAFA 5JQGB 3R65A 4X66O 3VQVA 1SA0A 2ARHA 4JI3B 3O9OA 5FNVB 1F4NA 4WFEA 1VARA 1TVKA 1P49A 2NLJC 4OPHA 4TQDA 2Q6AA 4NYKA 1BGYH 4FJCC 5EC1C 3ABUA 4CH6A 4DW0A 3K59A 2OT5A 2PI4A 2Y4TA 2IH1C 3BHPA 4I50A 3RYIB 1SQQH 4LP8A 2ITDC 5BY1A 3K9SA 1F4MA 4JI3O 3KCYA 3BRCA 1FFXB 3VOUA 2F1MA 2R70A 1H2LA 1XHZA 1GM8A 4YY3B 3HKCA 4LR3A 2A79B 4K3AA 4BW9A 3LSUA 2V1DA 4W4LA 2QEXV 3CCVV 3FYEB 3K06A 2RMKB 2KSDA 4F6RA 3SJCC 1WAZA 4DK1A 4JI1B 1IBMB 2P4KA 2KQXA 4MVSA 1PNLA 1FJGB 4B3TB 2ZDIC 1L0LH 5ITZA 2PF4E 4UCVA 1WA8A 1EZVH 2EINC 5BR8B 1Y76A 3E22B 3F5TA 5HFMA 4LF5B 1Y74A 1K9MW 1ZSPA 5IYZA 1AJNA 5LA6A 5LYJA 4DXWA 1KQSU 4H33A 3E8BA 2QKAA 2A0LA 3CRMA 4JI1O 1IBMO 5LHIA 4JI8B 2ZQMA 3CMEV 3ASOB 4OPAA 1FJGO 3CX5F 2YXHA 3ZRSA 4B3TO 3CCQV 4X88A 2IJHA 1I7FA 4KUMA 1GAXA 1SETA 2DQ3A 2ZR2A 3CMAV 1H2SB 4MVQA 5BR8O 1HW7A 3E35A 4MVMA 2EBOA 2N05A 2X6AA 4LF5O 1TUBB 5J2TB 1YEWA 5B3SB 2DMXA 2JRIA 3JSLA 1JA8A 4PI2A 2FKXA 4OGQB 4LH6A 4FFBB 1J95A 1N0NA 4MVUA 3ZRWA 3T4ZA 2YDEA 3AEIA 4JI8O 1VF7A 2VRZA 2ILMA 2F23A 2ZNIA 1Y4MA 3W7WA 1K8AW 3BEHA 2P06A 1SA0B 3IFXA 2QGNA 3RGBA 1CEZA 3LNMB 1UJWB 1WPXA 2XAQA 1JJ2U 1TVKB 3WG7B 3H1IH 3A2FA 1W59A 1URFA 5KX5B 1TA8A 1FXKC 1KKDA 2LQTA 4YJ3A 2B5UA 2QTOA 2BSKA 3C90A 2ZXWB 1MABG 4I50B 4PELA 4JAVA 2JGUA 4MVRA 1VQ7V 3N27A 1K4CC 4RWUA 1K73W 3AG3C 4LFBB 3HKBA 3BVOA 4UFZA 1SQFA 2RNBA 5JVDB 3UCSC 4IYIA 4YJ2A 1XHXA 3AG4C 4YXWG 4DRXA 1CXZB 4AILC 3ZMUA 3LDDA 4F6RB 1QVFU 4N21A 3CCEV 4P9OA 3RYFA 4IHJA 4LFBO 3TXQA 2RN9A 3N2GB 3JALB 2FB5A 1Q6UA 1WA8B 1NVPD 2R9AA 3CEIA 3QF7A 3JD3A 4WCEV 1Y76B 5CB4B 4IGGA 1YF2A 2XHBA 1OHHG 5LP6C 4I55B 5IYZB 3DC5A 4MS2A 1GRJA 4FVMA 4GCZA 4JAUA 4I4TA 1V55C 1FD9A 1NH2B 1YTFB 4R6ZA 2QM8A 2LP7A 4JF3A 2QWOB 5L3DA 4FLVA 2LW7A 3RYHA 2OIGA 1BQ0A 4PA3A 1RM1B 1G4YB 1GN6A 2Y0PA 2YI9A 2Y69C 1YSCA 2FMLA 1NJIW 1W0KG 4PDVA 3HKDB 1IXBA 4JI0B 1EN4A 2DE0X 4KXRA 1YXBA 4JYYA 1SS3A 4P2ZA 3ZMTA 1P7GA 1WP7A 1AJQA 2Q0OC 4MTFA 3OEEG 2YIBD 1SF9A 4X1IA 4O4HA 4GX0A 3ZHRA 4PDLA 4Z2WA 5AG2A 3CRAA 5EIBC 3A0BZ 3ZRXA 4FZ1A 2CH7A 1G8MA 1NT2B 3OTOB 3GVMA 1OCZC 4NTWA 3CC7V 3QVNA 4JI0O 4BIOA 4FPPA 1VF6A 2EINB 2JK5C 5CA3A 1RP3B 5JWPA 4K8XA 2BSKB 2Y0IA 3SPIA 2A9HA 2ZM6B 1SRYA 1Q81W 1KC8W 1VQ4V 2BOBC 3P32A 2HLDG 1M57B 5J2UA 1VQ5V 4U3FH 3WFVA 4NXMB 4G28B 1KP2A 1BHAA 2CK3G 4HNAB 4ASUG 1XILA 3K9AA 4X1YB 1BSMA 3OTOO 2ATKC 2YUAA 3B2EE 4CBCA 3T1HB 2FTKA 3U10A 4ZIBA 4YJ2B 5JCOC 1F7YA 1NTKH 1KD1W 2QDOA 4DRXB 5IY5C 4TV9B 3CJHB 3UQ8A 5TISZ 2ZM6O 1G1XB 1YIJV 4MW8A 4RUEA 3W7UA 4JI5B 2K1EA 5EC2C 1D2DA 4NXMO 2PYJA 4NXNB 2Q69A 5CA0A 5H6QA 1N34B 5F2VO 4NTYA 4TUYB 4GX2A 1Q6IA 4LF9B 3C3SA 4UXNA 2DYRC 4B7EA 3JAWA 4R7CA 3T1HO 4DV6O 3BFRA 2CGOA 3OGIB 5LOVA 1EN6A 4WFBV 2QWQB 3H9VA 1NS1A 2ZCEA 4J80A 4UVCA 3ZN1A 5JQGA 4JI5O 1HP8A 1L8DA 5FNVA 2W6IG 3HKEA
chains in the Genus database with same CATH topology
2AXTZ 3JCUZ 5GTIZ 3A0HZ 5TISZ 4UB6Z 5GTHZ 5H2FZ 3KZIZ 4PJ0Z 3WU2Z 1S5LZ 4UB8Z 5B66Z 5KAIZ 5B5EZ 5KAFZ 5E79Z 3A0BZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT Z;  3JCU Z;  5GTI Z;  3A0H Z;  5TIS Z;  4UB6 Z;  5GTH Z;  5H2F Z;  3KZI Z;  4PJ0 Z;  3WU2 Z;  1S5L Z;  4UB8 Z;  5B66 Z;  5KAI Z;  5B5E Z;  5KAF Z;  5E79 Z;  3A0B Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 5JJJ B;  4NXN O;  3LNN A;  3KKY A;  2EIJ C;  3C3T A;  3CYO A;  1N34 O;  3DC6 A;  3ABK B;  4JTD B;  4LF9 O;  4BIU A;  1K33 A;  4J41 A;  4FZ0 A;  2ZNJ A;  2OTL V;  2EIM B;  4I9Q A;  3ZX6 A;  2YI8 A;  1K97 A;  4D6T H;  4K0K B;  1LR1 A;  4WF9 V;  1KBH A;  3RYI A;  1FXH A;  4J9Y B;  1V54 C;  3R66 A;  3AG4 B;  1XNQ B;  5E1A C;  3KG2 A;  5B1B B;  5KA5 A;  4X1I B;  2IU3 A;  2IH3 C;  3J7A U;  1GM7 A;  1SQV H;  3JD4 A;  3CD6 V;  1FFX A;  2LO1 A;  1XL6 A;  3T1C A;  1UFI A;  3APQ A;  4BW5 A;  2LGQ A;  3EHB B;  1MOF A;  1Q5O A;  5FL7 G;  1K34 A;  4MSW C;  5GTI Z;  3CHX A;  3PJS K;  3A0H Z;  4WBN A;  4K0K O;  3BCC H;  4YHH O;  5H2F Z;  2AHY A;  2VWJ A;  3CB2 A;  1NH2 D;  4GKJ B;  1XNQ O;  1GMG A;  1KU9 A;  1OCR B;  1RSO A;  1QU7 A;  3ETG A;  3F7V C;  3JAM N;  4BWA A;  4JAA A;  1AI5 A;  2AZ2 A;  1VF5 B;  1SQP H;  1SC5 B;  3E22 A;  3O65 A;  3A0R A;  4L87 A;  2W6J G;  2JIZ G;  2B9Z A;  4K35 A;  1TUE B;  2R9I A;  2QR4 A;  3DXR A;  2IM9 A;  1M56 C;  4I5S A;  1E1R G;  1GH6 A;  2K9P A;  1VQ6 V;  4J10 A;  4DO2 A;  2Y69 B;  5B1O A;  4GKJ O;  2BTQ B;  4UCT A;  4PV1 B;  4D7T A;  2EUL A;  5CBF A;  3OMA B;  2GDS A;  1NR1 A;  3K08 A;  2P67 A;  5J2T A;  1S76 D;  5IJ0 B;  1Q90 D;  3K5M A;  3WB0 A;  3B40 A;  5EBL C;  4RQE A;  3RN4 A;  4FFB A;  4B3M B;  3TJT A;  2ADP A;  2P6J A;  4WFG A;  1X59 A;  1ZL8 B;  1R3K C;  2XTA A;  4G27 B;  1XNR B;  4LWS A;  1VQM V;  3HKE B;  4J7Z A;  5KX5 A;  1U97 A;  2HEP A;  3RWR D;  2YC0 A;  5GTH Z;  4DR2 B;  3IGA C;  2UU9 B;  5BZB A;  4B3M O;  2A3Q A;  3W7X A;  1IVS A;  2CTW A;  2ZIN A;  4LNU B;  3ZMV A;  1JFF B;  5IY5 B;  1XNR O;  3ZBH A;  2KKW A;  2Z0A A;  3E86 A;  2H3O A;  1H2M A;  5JVD A;  3APO A;  1AI7 A;  3E89 A;  4DR2 O;  4GX5 A;  4EFE A;  4R50 A;  5CBG A;  2UU9 O;  3K58 A;  3T1Y B;  3LDE A;  2FL4 A;  5IYC O;  4WBN B;  1YJ9 V;  1WP8 A;  3JAR B;  4PA6 A;  2DYR B;  5CBH A;  4I0X B;  5LGU A;  1FS0 G;  2YS8 A;  1MSW D;  3IJ4 A;  4JYB A;  4EKW A;  3CWB H;  4LF4 B;  3I5D A;  1RSO B;  1S72 V;  2JEX A;  3N2G A;  3JAL A;  3JCZ A;  3D8C A;  4DV2 B;  1D5A A;  2CAZ C;  2WWW A;  5CB4 A;  4YY3 O;  2R9R B;  3CCR V;  1ZX3 A;  4I55 A;  3LUT B;  2EIJ B;  4Z1M G;  1W2B U;  3DXR B;  3T1Y O;  2WA4 A;  2XAF A;  4KP4 A;  2E5L B;  5LMU B;  3STL C;  2QM4 A;  2DQ0 A;  4LF4 O;  4PD4 F;  2L35 A;  4LBE C;  4YIP A;  2VWK A;  4DV2 O;  1PKX A;  3M8A A;  4PDM A;  1O9H A;  5BXZ A;  3A8T A;  2MW2 B;  1OCO C;  1M9N A;  3ZS8 C;  3HKD A;  1QLE C;  3B8M A;  4CS3 A;  2OCC B;  2E76 B;  3AG7 A;  4X89 A;  3G4S V;  4O2A B;  3WB1 A;  2B1G A;  2E5L O;  5LMU O;  2Y48 A;  4U3J B;  2Q67 A;  1UPG A;  3GWK C;  3SYO A;  1DGS A;  1XUQ A;  2DYS B;  5FLX N;  4IT5 A;  2EZP A;  2OCH A;  3TXS A;  3LSQ A;  2GTA A;  1YCI A;  4LWS B;  5B1A C;  4UCR A;  4MTX A;  2F93 B;  4O4L A;  2ZDI A;  4J7J A;  5IWA B;  4CS4 A;  1IBL B;  3FB7 C;  3NR7 A;  2WSS G;  4JZG A;  3FB5 C;  3SYA A;  1WLE A;  1NR7 A;  2EJR A;  4QE9 A;  5DEC A;  2OYQ A;  4ZOL B;  1YIT V;  4J7K A;  3E8F A;  2KB1 A;  4DV0 B;  2GUZ B;  1ORQ C;  5H9C A;  4UV8 A;  4FM1 A;  5LGN A;  4PHZ A;  1B06 A;  4D7S A;  3RYC B;  1XBL A;  1M56 B;  3SJA C;  1M1K W;  1VQL V;  1OJH A;  1OV9 A;  4LC1 A;  2X6C A;  1GTO A;  4HNA A;  4ZKI A;  4TWK A;  5K1P A;  1JR9 A;  4X1Y A;  4U7N A;  1YJW V;  3RVZ A;  3B4S A;  4OXS A;  1JJO A;  3FFQ A;  3NXS A;  5IE9 A;  1XOU A;  2CTR A;  4LF6 B;  5IWA O;  2WLJ A;  1IBL O;  3RBZ A;  2X7R B;  4LF7 B;  3OMN B;  1BS3 A;  5A2Q N;  4TV9 A;  4DV0 O;  3CJH A;  1JX9 A;  4AQY B;  4RAI A;  3CCM V;  2ZIM A;  1JPX A;  3ABL B;  2Q68 A;  1YHQ V;  1DF4 A;  3ZHU A;  2ZD9 A;  1I5X A;  3U0Z A;  5A9G A;  2KG7 B;  1SER A;  2CGN A;  4H13 B;  1BCC H;  1WJZ A;  3HB3 B;  4PI0 A;  4TUY A;  3KCX A;  1FYJ A;  4BR6 A;  4CC5 A;  4LF6 O;  1JVM A;  5LMN B;  1NI8 A;  4QE7 A;  2ZE5 A;  2QWR B;  3ABM C;  1Q8I A;  4LF7 O;  1FXV A;  3SGI A;  1CP9 A;  1K4D C;  1E1Q G;  3OEH G;  4AQY O;  2QWP B;  3FX7 A;  4JAS A;  2DOS A;  4PDR A;  2GBO A;  3BA8 A;  4FM0 A;  3HR0 A;  2H8P C;  2JGD B;  3BY6 A;  3ZHT A;  3AG1 C;  1B3Q A;  1E79 G;  1YZB A;  4HZ3 A;  5LMN O;  5KHH A;  3G67 A;  4C7U A;  1M93 A;  1K3E A;  2YEV B;  3AG2 C;  2QKS A;  3SYP A;  1BE3 H;  5EYP B;  4MVZ A;  3SYC A;  3UKM A;  1Y6X A;  1NZ6 A;  3TCU A;  1Z2G A;  1N32 B;  1XI1 A;  4O4L B;  2E3C A;  2HFE C;  2HP8 A;  2LFS A;  4TSF G;  5L3E A;  1J5E B;  3L74 H;  4J9Z B;  3EXA A;  4FM2 A;  5EBW C;  4LFC B;  3K5N A;  2F66 C;  2UXB B;  5KAF Z;  5LP6 A;  2HJF C;  5C8Y B;  5KHJ A;  1I0H A;  3CP1 A;  2AXT Z;  2XT9 A;  2IW5 A;  2XAS A;  5GON A;  1K5Q A;  2AGA A;  3ZJZ A;  3T4D A;  3BA9 A;  3UO3 A;  3ICX A;  3X2Q C;  3F5W C;  1N32 O;  4TQF A;  2QSA A;  3PN1 A;  5IYB O;  1BMF G;  4WFF A;  2HG5 C;  3MAQ A;  4O2B B;  3QG5 A;  2Q7E A;  3K5L A;  4YIO A;  1J5E O;  4LFC O;  2UXB O;  4MVO A;  1R1B A;  1SES A;  3ETE A;  2X0L A;  2PI5 A;  1F51 A;  1VIB A;  2HR3 A;  1AP5 A;  1QNM A;  3RW0 A;  3T2M A;  2BTQ A;  1QLE B;  4HAM A;  3EVK A;  1IX9 A;  1H2K A;  2P4V A;  2VS0 A;  4TT3 G;  3H1L H;  1IUR A;  1NTZ H;  2RQ6 A;  1HWY A;  3M7M X;  1KUQ A;  5D5P A;  2QM7 A;  2DJV A;  2IBZ H;  5IJ0 A;  1BZK A;  4UV9 A;  2HVJ C;  5LBQ A;  2DN9 A;  3L75 H;  5D5Q A;  3AK1 A;  5B1A B;  1ZL8 A;  1NU1 H;  4PA4 A;  1QLN A;  1BQZ A;  4Q20 A;  1Q6H A;  2BOC C;  1FXK B;  2Z3Y A;  1AI4 A;  1NTM H;  4QJF B;  1RFY A;  2N04 A;  4QIW F;  2WAM A;  5GW7 A;  1QR8 A;  3CE2 A;  2Y4U A;  4PA9 A;  4DR6 B;  2EIL C;  5KUK A;  1Y67 A;  2R72 A;  1TAE A;  2IJJ A;  2P7T C;  1ARO P;  3E83 A;  3AG3 B;  2GTS A;  4DV7 B;  4ZI7 B;  1H38 A;  1PP9 H;  2WLL B;  4O4I B;  1S5J A;  1L0N H;  3SPH A;  1R73 A;  2JJ2 G;  2PGG A;  3H1J H;  5H5N A;  4DR4 B;  4NKG B;  1LNQ A;  1R6K A;  5JCO A;  4LNU A;  1JFF A;  1W0J G;  2RCV A;  4H44 B;  1JCH A;  2WLH A;  5KHI A;  3L72 H;  3OW2 U;  4LFA B;  1JOY A;  1KP3 A;  4CH5 A;  3ASO C;  2A06 H;  2UUC B;  4DR6 O;  2UUB B;  3SYQ A;  5KA6 A;  2HJD A;  4DV7 O;  3FAV A;  1HNZ B;  1XRE A;  3I56 V;  1THZ A;  4F4L A;  3OFN G;  3JAR A;  2E75 B;  4MW3 A;  4DR4 O;  4ZHQ A;  4I0X A;  5LP6 B;  3CRC A;  1N36 B;  1YTF D;  1PM9 A;  2ZE6 A;  2W0F C;  1NQT A;  5GON B;  4LFA O;  1ZTE A;  2UUC O;  3CSX A;  2UUB O;  3MHH C;  1V55 B;  5JH7 A;  3OAA G;  4DR3 B;  2YXL A;  1RPR A;  3TK1 A;  4QPJ A;  3QTC A;  3SDL A;  1G6U A;  4PA7 A;  4TV8 B;  1XQ8 A;  4IIJ B;  3FB8 C;  1HNZ O;  2QWN B;  1SZT A;  3UO2 A;  4DV4 B;  4GX1 A;  1T5E A;  1QHT A;  2LFR A;  1US6 A;  1DF5 A;  5IT9 N;  2EIK C;  3OT7 A;  2BE3 A;  1N36 O;  3AG2 B;  4EB6 B;  3JCU Z;  1PNM A;  1ZUQ A;  2JEU A;  2C2A A;  3G71 V;  4JV5 B;  1B04 A;  1COW G;  4DW1 A;  4XDJ A;  3LSS A;  3W7T A;  2F43 G;  4E4E A;  1SKV A;  1Q7Y W;  1A32 A;  4DR3 O;  1SQX H;  4O4J B;  2CE4 A;  4FLY A;  1B6Q A;  4CS2 A;  3SJB C;  4KHP B;  3K04 A;  4DV4 O;  3CXC U;  5EZY B;  4O2A A;  4GZR B;  3OMI B;  2AZ0 A;  1VQO V;  4U3J A;  3OR7 C;  4ICG A;  3STZ C;  2WLM A;  1OCZ B;  3LDC A;  1EN5 A;  1M5I A;  4FLU A;  4R8C A;  1Q3E A;  4JV5 O;  3JAK B;  5KMG B;  2XND G;  2XAH A;  4GYC B;  1R3L C;  3CS5 A;  3ZMS A;  2GV9 A;  1CPY A;  4NR1 A;  4EEQ A;  4KHP O;  3P3P A;  4BIZ A;  4X65 B;  3ZRV A;  2UXC B;  4ZOL A;  2BTO A;  2GUZ A;  2BCC H;  3WB2 A;  3ZCC A;  3Q4H B;  1EBO A;  2IJK A;  3K03 A;  2V4D A;  3RYC A;  4DR5 B;  1NVP B;  1WB8 A;  2PY5 A;  3K0G A;  4MT8 A;  1PPJ H;  1DLB A;  4X9Q A;  4WFH A;  2ZIO A;  4N23 A;  3GWO A;  2F4V B;  2PYL A;  4DV5 B;  2QE7 G;  2UXX A;  4X20 A;  1I94 B;  2N74 A;  3G6B A;  1KKC A;  1TGO A;  1WN7 A;  3CCJ V;  1JQ0 A;  4XDL A;  4RQF A;  2HVK C;  4X65 O;  1RM1 C;  2UUA B;  2PZS A;  2UXC O;  1S3J A;  1OCC C;  4CH3 A;  2P22 C;  2Q5Z A;  3FAV B;  4B3R B;  1PV0 A;  1KYO F;  1H8E G;  3K5O A;  1MG1 A;  4B3S B;  1XMO B;  1MZE A;  3HPL C;  4DR5 O;  4ZHQ B;  2MK3 A;  3B8N A;  1YJN V;  2XAG A;  5L3F A;  2KG7 A;  5BMV B;  1I5Y A;  3D36 A;  3SPC A;  4JI2 B;  2F4V O;  1HNX B;  3H01 A;  4DV5 O;  1EFR G;  3N2K A;  4AHC A;  5KHK A;  2WLI B;  4U7O A;  2EZO A;  3BAB A;  5JH7 B;  1I94 O;  3EFF K;  5JJE B;  1VQN V;  2UUA O;  1S0V A;  4H37 A;  3E8G A;  2YXY A;  4LF8 B;  4UCO A;  4B3R O;  3ML0 A;  3ETD A;  2EIL B;  3QNE A;  1OZ0 A;  4PJ0 Z;  1VQK V;  4JTC B;  4B3S O;  4UCS A;  4DUZ B;  3UT5 A;  1XMO O;  1LUV A;  2Q9L A;  3VBB A;  1GN2 A;  3K0D A;  2JGD A;  1ROP A;  4Q6G A;  3QO8 A;  3CXH F;  1Z5V A;  4JI2 O;  1BT8 A;  2GHY A;  3E2E A;  3P30 A;  3OD4 A;  1D5N A;  1HNX O;  3CRR A;  3JD2 A;  5LXT A;  2NNU A;  1V54 B;  1M57 C;  4P9P A;  4ABM A;  1QBZ A;  3SJQ C;  5CMU A;  3ASN C;  4JTA B;  3OE7 G;  2YEV A;  3JD0 A;  3DSQ A;  4X8A A;  4LF8 O;  3JD1 A;  5CA1 A;  2EX3 A;  5B66 Z;  3QO7 A;  4DUZ O;  4LCU C;  3FKS G;  2YIC A;  3GB7 C;  4L8J A;  5EYP A;  1HNW B;  1GM9 A;  2E74 B;  3JAS A;  3CC4 V;  1F23 A;  2FYU H;  3ZIA G;  4TOI A;  3JAT B;  3ABT A;  5K1X A;  3D3Q A;  5LHG A;  2H94 A;  2G38 A;  1MNG A;  3L73 H;  1KEC A;  4X1K B;  3L70 H;  1Q82 W;  4H0L B;  3H1K H;  2AW9 A;  4KFM A;  1P84 F;  4RO2 A;  2W0X A;  4ZBM A;  4UVB A;  1VQP V;  1HNW O;  4GKK B;  5C8Y A;  2Q8V A;  3E8H A;  2HKO A;  5IJ9 A;  4UB8 Z;  3CPW U;  2O57 A;  3SPJ A;  2EIK B;  3OR6 C;  1ZAU A;  1N8R W;  1PL0 A;  3F7Y C;  1I08 A;  4X64 B;  4B7K A;  2NR5 A;  4O2B A;  4X20 B;  1AI6 A;  1RPO A;  5EIB D;  3ABK C;  3OUF A;  4OX9 B;  4BAY A;  4FFK A;  2EIM C;  4GLX A;  1KB9 F;  4GKK O;  5KAI Z;  5H6R A;  2HHH B;  1SQG A;  4WFA V;  2M6Y A;  1BL8 A;  1XMQ B;  1FKA O;  4NTX A;  1Q86 W;  4GUN A;  3BAA A;  1M90 W;  2Q0A A;  1QCE A;  4E2L A;  3HKC B;  1QQC A;  1ZWI C;  5LHH A;  2VQE B;  2Z5U A;  5IDJ A;  3RFR A;  5B1B C;  3N2K B;  2WLK A;  2B1I A;  4DV1 B;  4QPK A;  4X64 O;  1GKF A;  1Q43 A;  2CTQ A;  1H8H G;  2XAJ A;  2L6L A;  1GO3 F;  5L3G A;  4UCU A;  3CC2 V;  1P7B A;  4OX9 O;  2IJI A;  2M7W A;  5LL6 Y;  1P4R A;  2DWE C;  3B09 A;  1DTO A;  1XEQ A;  2HHH O;  5ITZ B;  3UT5 B;  3ZHS A;  3OGC C;  1FXK A;  1N0J A;  3THO A;  1R6N A;  4CZZ A;  1XMQ O;  1VF6 C;  2QA4 V;  3K3W A;  2ODM A;  1Y74 B;  3K79 A;  2VQE O;  2JJ1 G;  1N33 B;  1AP6 A;  2ADQ B;  3ETQ A;  4FK5 C;  5LA6 B;  5LYJ B;  1OCR C;  2UXN A;  5LXT B;  4DV1 O;  2JVD A;  3D3I A;  3TGU H;  4ZI7 A;  3H1H H;  3FYI B;  4QNH B;  3VQX A;  2WLL A;  4O4I A;  3CRQ A;  5CA1 B;  1WB7 A;  5IYD O;  2JS3 A;  4P30 A;  1EM1 A;  5EK0 A;  1OCC B;  5FPR A;  3MDS A;  3S3W A;  1VQ8 V;  5L3C A;  3JAS B;  4XDK A;  2GSM B;  1N4C A;  4GT1 A;  2OTJ V;  1R3I C;  1N33 O;  1IZ3 A;  1AR1 B;  3BPZ A;  1NBM G;  2CDY A;  4UB6 Z;  1DK1 A;  1Z5W A;  2X6B A;  1VQ9 V;  2ETN A;  4CC6 A;  3ZRW B;  1S5L Z;  1K5S A;  4NB5 A;  4DV3 B;  5B1N A;  4DYL A;  3J81 N;  1XL4 A;  4DK0 A;  5B5E Z;  4JYA B;  1K92 A;  1ZLZ A;  2WPD G;  2D3O W;  3W7S A;  2Q4P A;  5IJ9 B;  1YI2 V;  4B08 A;  2OWO A;  1H2G A;  2LJ2 A;  4RUF A;  1IXM A;  3IC7 A;  3WU2 Z;  1EZJ A;  1SZX A;  2Q7H A;  1VMG A;  4YJ3 B;  2WLN A;  1XDC A;  4TV8 A;  4IIJ A;  5CN0 A;  5E79 Z;  4DV3 O;  4FIP C;  4K8Z A;  2NN4 A;  3DTU B;  1M4U A;  1OCO B;  3ASN B;  4JYA O;  1FFT B;  3HKB B;  3KZI Z;  1AVM A;  3ZHQ A;  1WNS A;  4DR1 B;  4EB6 A;  3MHS C;  1YDX A;  4FLW A;  4KL1 A;  4HYO A;  5DED A;  1GN4 A;  2P5O A;  3JYC A;  1Y66 A;  1X4T A;  4DV6 B;  4NVP A;  1AIL A;  2DW4 A;  4O4J A;  4IL6 Z;  1IDS A;  2UXD B;  2LW1 A;  2PUS A;  5KUM A;  2EJ7 A;  3UM7 A;  5EZY A;  4A5U B;  3IAY A;  1VP7 A;  1R3J C;  3AK3 A;  3RYF B;  4IHJ B;  1MA1 A;  3I55 V;  4W4K A;  4UVA A;  1FPO A;  2VQF B;  4DR1 O;  3JSN A;  2Q73 A;  2YID A;  4J11 A;  4JPR A;  1PD3 A;  1VEW A;  3JAK A;  3ZED A;  5KMG A;  4CH4 A;  2ZE8 A;  4JZ2 A;  2XUM A;  4X62 B;  1GN3 A;  1BHB A;  1L1F A;  2UXD O;  1IBK B;  3G80 A;  2OIE A;  4JYC A;  4JGS A;  2D2C B;  1PL4 A;  4I4T B;  4EFB A;  3J80 N;  2WA3 A;  5DN6 G;  3Q4H A;  1U96 A;  5FPO A;  2VQF O;  1S77 D;  3OUS A;  3RYH B;  3S3X A;  3MD0 A;  1S5H C;  2XOK G;  4X62 O;  3CCS V;  4MTO A;  1IBK O;  4JI4 B;  2JDI G;  4YHH B;  1HR0 B;  3L9D A;  5C93 A;  3TET A;  3G6E V;  1MSD A;  2A7W A;  5JJN B;  3VQY A;  3OTF A;  4IYH A;  3M99 B;  1V9P A;  3IC9 A;  3P3N A;  1MMM A;  3FB6 C;  3VQW A;  3L71 H;  4O4H B;  5B3S C;  2DWD C;  2OCC C;  3CCU V;  4I7Z B;  4I9W A;  1SQB H;  2YSU B;  3ABM B;  2RJZ A;  4QGP A;  5BMV A;  3OM3 B;  3RT3 C;  2CH7 B;  3U11 A;  3AK2 A;  3ZHV A;  5DM6 V;  2PTM A;  4DR7 B;  1GK9 A;  2RDC A;  2LGW A;  2DYS C;  3B77 A;  5J9P C;  1ENV A;  3ZMZ A;  4FLZ A;  4JI4 O;  2WLI A;  4DUY B;  1R6T A;  4AI8 A;  1H2N A;  5LGT A;  3DGE A;  4Z1V A;  1HR0 O;  1AJP A;  4MTG A;  3AG1 B;  4FLX A;  1NKD A;  2ZE7 A;  4JI6 B;  2ITC C;  2YIB A;  5KHG A;  3WG7 C;  2AHZ A;  5J2U B;  1HDJ A;  1K7D A;  2ZT9 B;  3CCL V;  3RVY A;  1O9G A;  5EBM C;  1WPB A;  3K57 A;  1AR5 A;  2P90 A;  4UUJ C;  2Q7G A;  1AB3 A;  4DR7 O;  2ZXW C;  4FMT A;  4DUY O;  3QO5 A;  4HBN A;  1YVW A;  1MZF A;  4JI7 B;  2QTS A;  2CUG A;  1JMK C;  4JI6 O;  2V7Q G;  4FLT A;  5HFL A;  4G2K A;  2QKC A;  4XBF A;  2YIA A;  4X66 B;  2F95 B;  1AR4 A;  5L3B A;  1QR9 A;  2QJ1 A;  4LH7 A;  3ZN0 A;  2ZR3 A;  5CA0 B;  4J42 A;  1TUB A;  2IU0 A;  3JAT A;  3ABL C;  2CTP A;  5KLV H;  3JAW B;  4F6E A;  1QVG U;  3FD9 A;  2JS5 A;  1LUW A;  3SPG A;  4X1K A;  5LOV B;  1KMI Z;  3D36 C;  2ZKO A;  3SR2 C;  4JI7 O;  1PNK A;  3X2Q B;  1FAF A;  5JQG B;  3R65 A;  4X66 O;  3VQV A;  1SA0 A;  2ARH A;  4JI3 B;  3O9O A;  5FNV B;  1F4N A;  4WFE A;  1VAR A;  1TVK A;  1P49 A;  2NLJ C;  4OPH A;  4TQD A;  2Q6A A;  4NYK A;  1BGY H;  4FJC C;  5EC1 C;  3ABU A;  4CH6 A;  4DW0 A;  3K59 A;  2OT5 A;  2PI4 A;  2Y4T A;  2IH1 C;  3BHP A;  4I50 A;  3RYI B;  1SQQ H;  4LP8 A;  2ITD C;  5BY1 A;  3K9S A;  1F4M A;  4JI3 O;  3KCY A;  3BRC A;  1FFX B;  3VOU A;  2F1M A;  2R70 A;  1H2L A;  1XHZ A;  1GM8 A;  4YY3 B;  3HKC A;  4LR3 A;  2A79 B;  4K3A A;  4BW9 A;  3LSU A;  2V1D A;  4W4L A;  2QEX V;  3CCV V;  3FYE B;  3K06 A;  2RMK B;  2KSD A;  4F6R A;  3SJC C;  1WAZ A;  4DK1 A;  4JI1 B;  1IBM B;  2P4K A;  2KQX A;  4MVS A;  1PNL A;  1FJG B;  4B3T B;  2ZDI C;  1L0L H;  5ITZ A;  2PF4 E;  4UCV A;  1WA8 A;  1EZV H;  2EIN C;  5BR8 B;  1Y76 A;  3E22 B;  3F5T A;  5HFM A;  4LF5 B;  1Y74 A;  1K9M W;  1ZSP A;  5IYZ A;  1AJN A;  5LA6 A;  5LYJ A;  4DXW A;  1KQS U;  4H33 A;  3E8B A;  2QKA A;  2A0L A;  3CRM A;  4JI1 O;  1IBM O;  5LHI A;  4JI8 B;  2ZQM A;  3CME V;  3ASO B;  4OPA A;  1FJG O;  3CX5 F;  2YXH A;  3ZRS A;  4B3T O;  3CCQ V;  4X88 A;  2IJH A;  1I7F A;  4KUM A;  1GAX A;  1SET A;  2DQ3 A;  2ZR2 A;  3CMA V;  1H2S B;  4MVQ A;  5BR8 O;  1HW7 A;  3E35 A;  4MVM A;  2EBO A;  2N05 A;  2X6A A;  4LF5 O;  1TUB B;  5J2T B;  1YEW A;  5B3S B;  2DMX A;  2JRI A;  3JSL A;  1JA8 A;  4PI2 A;  2FKX A;  4OGQ B;  4LH6 A;  4FFB B;  1J95 A;  1N0N A;  4MVU A;  3ZRW A;  3T4Z A;  2YDE A;  3AEI A;  4JI8 O;  1VF7 A;  2VRZ A;  2ILM A;  2F23 A;  2ZNI A;  1Y4M A;  3W7W A;  1K8A W;  3BEH A;  2P06 A;  1SA0 B;  3IFX A;  2QGN A;  3RGB A;  1CEZ A;  3LNM B;  1UJW B;  1WPX A;  2XAQ A;  1JJ2 U;  1TVK B;  3WG7 B;  3H1I H;  3A2F A;  1W59 A;  1URF A;  5KX5 B;  1TA8 A;  1FXK C;  1KKD A;  2LQT A;  4YJ3 A;  2B5U A;  2QTO A;  2BSK A;  3C90 A;  2ZXW B;  1MAB G;  4I50 B;  4PEL A;  4JAV A;  2JGU A;  4MVR A;  1VQ7 V;  3N27 A;  1K4C C;  4RWU A;  1K73 W;  3AG3 C;  4LFB B;  3HKB A;  3BVO A;  4UFZ A;  1SQF A;  2RNB A;  5JVD B;  3UCS C;  4IYI A;  4YJ2 A;  1XHX A;  3AG4 C;  4YXW G;  4DRX A;  1CXZ B;  4AIL C;  3ZMU A;  3LDD A;  4F6R B;  1QVF U;  4N21 A;  3CCE V;  4P9O A;  3RYF A;  4IHJ A;  4LFB O;  3TXQ A;  2RN9 A;  3N2G B;  3JAL B;  2FB5 A;  1Q6U A;  1WA8 B;  1NVP D;  2R9A A;  3CEI A;  3QF7 A;  3JD3 A;  4WCE V;  1Y76 B;  5CB4 B;  4IGG A;  1YF2 A;  2XHB A;  1OHH G;  5LP6 C;  4I55 B;  5IYZ B;  3DC5 A;  4MS2 A;  1GRJ A;  4FVM A;  4GCZ A;  4JAU A;  4I4T A;  1V55 C;  1FD9 A;  1NH2 B;  1YTF B;  4R6Z A;  2QM8 A;  2LP7 A;  4JF3 A;  2QWO B;  5L3D A;  4FLV A;  2LW7 A;  3RYH A;  2OIG A;  1BQ0 A;  4PA3 A;  1RM1 B;  1G4Y B;  1GN6 A;  2Y0P A;  2YI9 A;  2Y69 C;  1YSC A;  2FML A;  1NJI W;  1W0K G;  4PDV A;  3HKD B;  1IXB A;  4JI0 B;  1EN4 A;  2DE0 X;  4KXR A;  1YXB A;  4JYY A;  1SS3 A;  4P2Z A;  3ZMT A;  1P7G A;  1WP7 A;  1AJQ A;  2Q0O C;  4MTF A;  3OEE G;  2YIB D;  1SF9 A;  4X1I A;  4O4H A;  4GX0 A;  3ZHR A;  4PDL A;  4Z2W A;  5AG2 A;  3CRA A;  5EIB C;  3A0B Z;  3ZRX A;  4FZ1 A;  2CH7 A;  1G8M A;  1NT2 B;  3OTO B;  3GVM A;  1OCZ C;  4NTW A;  3CC7 V;  3QVN A;  4JI0 O;  4BIO A;  4FPP A;  1VF6 A;  2EIN B;  2JK5 C;  5CA3 A;  1RP3 B;  5JWP A;  4K8X A;  2BSK B;  2Y0I A;  3SPI A;  2A9H A;  2ZM6 B;  1SRY A;  1Q81 W;  1KC8 W;  1VQ4 V;  2BOB C;  3P32 A;  2HLD G;  1M57 B;  5J2U A;  1VQ5 V;  4U3F H;  3WFV A;  4NXM B;  4G28 B;  1KP2 A;  1BHA A;  2CK3 G;  4HNA B;  4ASU G;  1XIL A;  3K9A A;  4X1Y B;  1BSM A;  3OTO O;  2ATK C;  2YUA A;  3B2E E;  4CBC A;  3T1H B;  2FTK A;  3U10 A;  4ZIB A;  4YJ2 B;  5JCO C;  1F7Y A;  1NTK H;  1KD1 W;  2QDO A;  4DRX B;  5IY5 C;  4TV9 B;  3CJH B;  3UQ8 A;  5TIS Z;  2ZM6 O;  1G1X B;  1YIJ V;  4MW8 A;  4RUE A;  3W7U A;  4JI5 B;  2K1E A;  5EC2 C;  1D2D A;  4NXM O;  2PYJ A;  4NXN B;  2Q69 A;  5CA0 A;  5H6Q A;  1N34 B;  5F2V O;  4NTY A;  4TUY B;  4GX2 A;  1Q6I A;  4LF9 B;  3C3S A;  4UXN A;  2DYR C;  4B7E A;  3JAW A;  4R7C A;  3T1H O;  4DV6 O;  3BFR A;  2CGO A;  3OGI B;  5LOV A;  1EN6 A;  4WFB V;  2QWQ B;  3H9V A;  1NS1 A;  2ZCE A;  4J80 A;  4UVC A;  3ZN1 A;  5JQG A;  4JI5 O;  1HP8 A;  1L8D A;  5FNV A;  2W6I G;  3HKE A; 
#chains in the Genus database with same CATH homology
 2AXT Z;  3JCU Z;  5GTI Z;  3A0H Z;  5TIS Z;  4UB6 Z;  5GTH Z;  5H2F Z;  3KZI Z;  4PJ0 Z;  3WU2 Z;  1S5L Z;  4UB8 Z;  5B66 Z;  5KAI Z;  5B5E Z;  5KAF Z;  5E79 Z;  3A0B Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...