5GTHZ

Native xfel structure of photosystem ii (dark dataset)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 23
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5gthZ00
5KAFZ 5GTHZ 4UB6Z 2AXTZ 5GTIZ 5E79Z 5TISZ 4IL6Z 4PJ0Z 3WU2Z 5KAIZ 3KZIZ 5H2FZ 3A0HZ 5B66Z 3A0BZ 1S5LZ 4UB8Z 3JCUZ 5B5EZ
chains in the Genus database with same CATH superfamily
1K5SA 1BS3A 3DXRA 4LF8B 3IC9A 5H5NA 4JI6O 4O2BB 5E79Z 4X65O 4J42A 2QM4A 2V7QG 3EHBB 3SDLA 4DV0B 4K0KO 1YTFD 2Q67A 3NR7A 2UUBB 2UXDB 3FB5C 3B4SA 4CS2A 4TQFA 2DQ3A 1SF9A 3A0HZ 4PDMA 4JAAA 1VQLV 3CRMA 2VS0A 3ASNB 1B6QA 2R9IA 1VF7A 4LF7B 5EYPB 4JYAB 3QF7A 1KU9A 5L3DA 1IZ3A 1S77D 2AXTZ 4DR7O 1E79G 1F4MA 2BCCH 4HNAA 4R50A 2P7TC 2HLDG 4KHPO 3B40A 5KUMA 1GMGA 2Q69A 3CMAV 4B3RO 2JIZG 3ZMTA 2X6BA 2F43G 3W7SA 1J5EO 4Q6GA 3JD0A 1M9NA 3FB8C 3CXHF 2X6AA 4UCTA 2Z0AA 1GAXA 1JVMA 1XNRO 2HHHB 2UXCB 4DR4O 2HVKC 3K3WA 1GTOA 1TGOA 4LF6B 3UQ8A 1MOFA 3CCVV 3GB7C 2HP8A 2Q0OC 2OCCC 5L3FA 1ENVA 5LBQA 4MVRA 3HPLC 4PA6A 5IJ0B 4OGQB 2HJFC 1V55B 1AJQA 2BSKB 2ZINA 4LWSA 2XNDG 2QWNB 4EB6B 3FYIB 1OCCC 4BW9A 2QTSA 1SS3A 2X7RB 4LF9B 5DM6V 4DV4B 4DR3O 4BR6A 1EM1A 3X2QB 1QBZA 3M99B 2YEVB 4PDVA 2F4VB 2CGNA 3OTOB 4N23A 1GH6A 4G2KA 3G71V 4Q20A 2LQTA 4J7JA 4NTWA 4JI1B 2GHYA 1URFA 4I9WA 5C93A 3M8AA 1NI8A 2P90A 1ROPA 4PA3A 1XNQB 1K73W 1IBLB 3LUTB 5JH7B 4W4LA 2LW7A 1JPXA 4P9OA 4KUMA 4NXNB 1XMOO 1SQVH 3E8FA 5LMUO 2Y0PA 4LF5O 1WPBA 3HKCA 2Y69B 1SKVA 1IXBA 5LMNO 3N2GA 5HFLA 4XDKA 1XUQA 4EFEA 1FPOA 1FKAO 1HR0B 2LGWA 5EIBC 4X1YA 4JI0O 4MTXA 5C8YB 1Y66A 1YTFB 4IIJA 3RYFA 2Y0IA 4MVUA 3Q4HA 4LF4B 4B3TB 2JGUA 2DYRC 4I9QA 5B1AC 1ZWIC 3SPJA 3FAVA 3F7YC 3OUFA 5FL7G 3OGCC 1KECA 4MVSA 4QGPA 2KB1A 1LUVA 3ZHUA 3T2MA 2L35A 4WFAV 2IH1C 5CA0A 3T1YO 2WLLB 1TA8A 1WPXA 3FKSG 3JAMN 3ETQA 3RWRD 3SGIA 1VQOV 1P4RA 4WCEV 1N33B 3ZN0A 2FKXA 3VBBA 2IM9A 4JV5O 2LFSA 1VARA 4IT5A 5LXTA 1RM1C 4BW5A 1AR4A 4ZOLB 2ITDC 1NR1A 2QKAA 1FJGB 3DSQA 4O4IB 4JI4O 3LSUA 2NLJC 5D5QA 2RCVA 2Z5UA 3ABUA 4Z1VA 1B3QA 2ZM6B 5BMVA 2P06A 1YI2V 1DTOA 5EBLC 1SZXA 4H44B 4I7ZB 1W0KG 4RO2A 5BZBA 2HVJC 4LNUA 5GONA 4O4LA 5IYDO 1QLEB 1SERA 1QQCA 1VQKV 4J9YB 1I7FA 5FNVB 1X4TA 1YEWA 2VRZA 4LH6A 3SJBC 2EILB 2DYSB 3K06A 1KKCA 5DN6G 4DV6O 3TETA 4TOIA 1FXKB 1BZKA 4NB5A 1IX9A 2PYLA 3VQWA 4GKJB 2QR4A 4E2LA 3R65A 4GCZA 1P84F 3RYIB 1QU7A 4X1IB 2R72A 3QO7A 3FB6C 2Y48A 3BY6A 4RQEA 2GDSA 1KB9F 2ZXWC 3SJQC 4UXNA 3OFNG 1N34O 2IJHA 4QIWF 2CH7A 3H1LH 4ZIBA 2ZDIC 3A0BZ 4UUJC 4WFHA 2E5LB 2Y69C 1FFXA 1IDSA 4D6TH 3GWOA 1TVKB 3AG3B 3IC7A 5CB4A 1XDCA 1NKDA 2GV9A 3ABKC 2ZD9A 2FMLA 1Q5OA 4C7UA 5B3SC 3H1HH 3OMNB 1GN6A 1HNXO 1R3LC 1B06A 2Q8VA 1CEZA 1PV0A 4DV2B 3ICXA 4FLZA 1S5HC 5CBHA 1KP2A 1LUWA 1BL8A 2CTRA 3OEEG 2JS3A 1OCRC 3AEIA 2XASA 3CHXA 5KUKA 4K8ZA 2UUCO 2DOSA 3SPIA 4DRXB 2XAJA 2L6LA 2A79B 4U3JA 1Z2GA 3FB7C 3ZS8C 2A9HA 3VOUA 2M7WA 4LR3A 4WFFA 5JCOC 3NXSA 3LNNA 3D3QA 1Y74A 3WG7B 1K33A 1PKXA 1YJ9V 1L8DA 4JF3A 3JASA 3UKMA 1BGYH 3RN4A 1L1FA 4DV1B 1HW7A 4B3SB 1O9HA 1PL0A 1KC8W 2JGDB 3ZHTA 1QHTA 2CTQA 5A2QN 4MVOA 1EZJA 2VWJA 4JI6B 1D2DA 2EILC 4X65B 1XQ8A 2DYSC 2JRIA 3G6BA 3K08A 3AG2C 2WLKA 3EVKA 1IXMA 4MW3A 1IBMO 1WNSA 5LHGA 1FXKC 1WB8A 4I55A 3OW2U 2YXHA 4R6ZA 3CJHB 3QG5A 1W2BU 1LR1A 2HEPA 4UB8Z 2ZR2A 4XDJA 1SETA 3DXRB 3S3WA 4CH3A 1Z5WA 4JAVA 1YXBA 4WFBV 3W7UA 4DR6B 4OXSA 2W0XA 4H37A 1V54B 1PNLA 1XILA 3ETEA 5JVDA 4YIOA 4B3RB 2B5UA 4PD4F 3K5NA 1VQPV 4OPAA 5B1OA 4DV7O 4DV5B 4NTXA 1VF6A 1EBOA 4HNAB 2O57A 5ITZA 4WF9V 4PDRA 1AR5A 4DR4B 4UVBA 1FFTB 1KKDA 2MW2B 5JQGA 1COWG 4UCUA 1PP9H 4TQDA 2N74A 3AK1A 1Q82W 1K5QA 2UU9O 3CXCU 4ASUG 1GN4A 2CTPA 3CRCA 4FZ0A 1MABG 2PUSA 3ABMC 3WB2A 4D7SA 5CN0A 3SYPA 4DUYO 1Q7YW 3CX5F 2ZE7A 3ZHSA 4B08A 2QWOB 2V4DA 3MDSA 4AQYO 1VEWA 3OD4A 1AI5A 4CH5A 4OX9O 2CAZC 1Q6IA 3QVNA 3VQVA 2KKWA 2QSAA 3CCRV 4JTCB 3WG7C 3J81N 1IURA 3VQXA 2QKCA 2JEUA 4DUZO 3C3TA 1RSOA 4LWSB 2ZE5A 2QE7G 2WA4A 4LP8A 4TUYB 2HR3A 4JYBA 2UXXA 2QA4V 1BE3H 3ZBHA 5JWPA 2YSUB 4ZBMA 2UUAO 3RVYA 3WB0A 4LF5B 3APOA 2OIEA 2AHZA 1N8RW 2YUAA 1NBMG 1K97A 3AG4C 2F95B 2UXBO 2OIGA 4XBFA 1H2LA 3LSQA 1OCOC 3B2EE 3MAQA 5JJEB 1Q3EA 1N36O 2XOKG 4L87A 2Q7GA 4B3MO 2GTSA 4FMTA 2HJDA 4DR1O 3HKCB 1NTMH 1SQFA 2VQFO 4FPPA 3WU2Z 4JI3O 3KZIZ 3N2GB 2CUGA 2OWOA 2M6YA 3CSXA 3RT3C 2JJ1G 1BQZA 3UT5A 1V54C 4JI2O 1RPOA 2B9ZA 4X1YB 5IYZA 1AP5A 1X59A 4IIJB 2NN4A 4XDLA 4ZI7A 5IY5B 2R70A 3E83A 4A5UB 2YI8A 3KCXA 3Q4HB 2E76B 5LP6C 1F51A 4IL6Z 3FAVB 5KMGA 1P7GA 2YDEA 3G4SV 3P30A 2WLIA 4O4JA 3BAAA 3ABTA 3L9DA 4J11A 4NXMB 3HKBA 3K9SA 1ZUQA 3R66A 4I0XA 5CA0B 2KG7A 3JD2A 4JTDB 1NH2D 3AG1B 4J9ZB 2IU0A 1KP3A 3T1CA 5LXTB 2Q9LA 3CB2A 3E86A 2OTLV 1R6TA 1VQMV 5L3BA 5IWAB 2P4VA 4DV6B 2QWRB 3GWKC 1GO3F 5BMVB 1JR9A 3OMAB 2NNUA 4H33A 3K9AA 4LNUB 5GONB 4O4LB 1N32O 1HNZO 4X88A 2PZSA 1JA8A 3ZX6A 4UFZA 4QE9A 3CEIA 4G28B 1WN7A 1EN6A 2Y4TA 1XEQA 5L3GA 2ZIMA 1O9GA 4CZZA 2Q4PA 1WAZA 1ZAUA 3H1IH 1UJWB 4X62O 1N34B 5J2TA 2Q0AA 1HNWO 5KA6A 2XT9A 4KP4A 1MG1A 2LW1A 2JJ2G 1MSDA 1YJWV 5IE9A 3L70H 2V1DA 2IH3C 3LDDA 1K7DA 4JI8B 3E8GA 2IJKA 4YY3O 4LFBO 4BWAA 2QM8A 4DW1A 4JZ2A 2AZ0A 1JX9A 4R8CA 2P6JA 1H8HG 4PA4A 2WWWA 4J41A 1MA1A 1M1KW 3CE2A 2CH7B 5LOVA 4TWKA 2JS5A 3ZHRA 5KHKA 5BR8O 1H2NA 1FFXB 1NQTA 4GX1A 5CB4B 3E2EA 2BE3A 4LCUC 1OCZB 4PA9A 4W4KA 3HB3B 4YHHO 2BOCC 2F1MA 5KX5A 1M90W 3U11A 4CC6A 1I08A 4J7KA 2ZCEA 1XOUA 5IY5C 4RAIA 3P32A 2PYJA 4N21A 4TSFG 2IU3A 3CC2V 2WLHA 3E8HA 2GUZA 4Z1MG 2EJRA 2WAMA 2EIMB 3FD9A 5D5PA 1F7YA 5IJ9A 4DV3O 2EBOA 1N4CA 2H94A 3ASNC 4U3JB 2AGAA 4OPHA 3TXSA 2ZT9B 4GZRB 1Q8IA 1R6KA 3LDCA 4NTYA 2RN9A 4AILC 2MK3A 2N05A 2EIJB 1Y74B 4GUNA 3VQYA 3AK3A 3UM7A 2RQ6A 4YIPA 3F5WC 1V9PA 1BHBA 4AHCA 3JASB 3CCEV 1G8MA 3CS5A 4ZHQA 3KKYA 2D3OW 3JAKB 2EIKB 1K9MW 3TCUA 1FD9A 4FVMA 4IYIA 1LNQA 3ZHVA 5EZYA 1YZBA 3BHPA 3SPCA 1TUBA 1H8EG 4J80A 4LF8O 3TK1A 1BT8A 5B1NA 3A2FA 3C3SA 4I55B 2AZ2A 2CGOA 1P49A 2X6CA 1PPJH 5L3CA 1GM7A 1M57B 3ZRVA 1MNGA 4H13B 2EJ7A 3ZCCA 2JDIG 4DV7B 1V55C 3EFFK 4UCVA 1WP7A 4UV9A 1PNKA 1ZTEA 2XAFA 1AROP 2JEXA 3CCLV 1H38A 4UB6Z 1AI7A 3ZMVA 4JYAO 2ADPA 1IVSA 2RDCA 3A8TA 3CPWU 4PHZA 1E1QG 3X2QC 2ZE6A 5JVDB 4JYYA 3RW0A 2LO1A 3CC4V 2DJVA 2UU9B 3K5OA 1M56B 1WP8A 4LFCB 4FFBB 3CCJV 1N0JA 1AB3A 2PTMA 4H0LB 5ITZB 1JCHA 1WLEA 1SQBH 5LGNA 4MTGA 2VQEB 4KFMA 1S5LZ 3W7TA 2HHHO 4O4HA 1KD1W 2UXCO 4OX9B 3B09A 3U10A 5B5EZ 4RWUA 2Y4UA 2YC0A 5J9PC 4QJFB 1L0NH 2K1EA 2PI5A 2XTAA 3ZMSA 3HR0A 1L0LH 4X64O 3ZIAG 3K0DA 2EINB 4DK0A 4JTAB 4ABMA 2OT5A 2XHBA 1DK1A 1CPYA 3E22A 2DWEC 3ML0A 1YDXA 4E4EA 4DV4O 4LH7A 2G38A 5GTIZ 1XMQB 1AILA 2Q68A 4BIUA 4TT3G 2F66C 4K8XA 2ZDIA 2F4VO 3H01A 3BEHA 1VQ4V 1RSOB 3OGIB 5B66Z 3GVMA 2OYQA 3I55V 1S72V 3BA8A 3N27A 2LFRA 1JOYA 1ORQC 3E89A 5HFMA 3ZEDA 1W0JG 1PD3A 1I94B 4IGGA 1IBLO 4QE7A 4I4TA 2VQFB 1ZX3A 4EFBA 4BAYA 4JI3B 2B1IA 4TV8A 5LA6A 1H2KA 1GM9A 1U96A 4GLXA 4PELA 3ABLB 1QLEC 3OEHG 5DECA 3G6EV 1JJOA 1D5AA 1FXHA 1SQXH 2ITCC 2BTQA 4K0KB 4HBNA 2P67A 5JCOA 5K1XA 1SQGA 1ZL8A 3AG7A 2GTAA 1H2MA 1SESA 3JD1A 1VQ5V 1S76D 1YHQV 3UT5B 4MTFA 5IYZB 2RJZA 1M4UA 3BABA 2ETNA 2YIBA 4ZI7B 5GTHZ 3LNMB 1JMKC 4DR7B 1Y76A 4BIZA 5JJNB 4O2AA 1DGSA 4G27B 4KHPB 1N33O 5KMGB 2WLMA 2LJ2A 1GM8A 5H6QA 1WJZA 4FFKA 2WLIB 1JFFA 4FM2A 3QO8A 4F6RA 3HKBB 1AP6A 1R1BA 4UCSA 5FNVA 4FM1A 5FLXN 4I0XB 3RFRA 1I5YA 3B8NA 2KG7B 2JVDA 3LDEA 1J5EB 4HYOA 3OM3B 2KQXA 5LHHA 3L71H 1FXKA 2QJ1A 2QWQB 2Q5ZA 2QM7A 1QVGU 3ETDA 2DQ0A 4CBCA 3AG3C 4HAMA 4X66O 2OCHA 5TISZ 5CA3A 1XNRB 1CP9A 5LYJA 1AI4A 2IW5A 3UCSC 4GX2A 3QO5A 2QEXV 4FK5C 1NTKH 1MSWD 4I50A 3ZN1A 5EIBD 1Q90D 3G67A 4I5SA 4L8JA 2BOBC 3CRQA 2KSDA 1HNWB 2PGGA 2XAHA 5BXZA 3JSNA 4X20A 4FLVA 3JATA 3SYOA 3JD3A 1XBLA 3OAAG 5CA1A 2IJJA 5FPOA 4DR3B 5IYCO 3CMEV 5A9GA 3K59A 1FYJA 3P3PA 1AJNA 3J80N 3JARA 3TXQA 4NKGB 1CXZB 5J2TB 2DN9A 3T1HO 5CMUA 1GKFA 3RYHA 2RMKB 2E5LO 2HG5C 3FX7A 3BRCA 2F23A 1XMOB 3H1JH 5LMUB 1SQQH 1Q43A 2W6JG 4DRXA 5LL6Y 2DE0X 5B1BB 2YICA 5LMNB 5LOVB 4ICGA 2DW4A 5IYBO 3DTUB 4DV2O 1VQ7V 4UVAA 3SPGA 4JI0B 3CCMV 4GKKO 4K35A 4LFAO 4DV3B 2FL4A 3D36C 4DR5O 5KX5B 1VIBA 1MZEA 3HKDA 2VWKA 1WA8A 4MVMA 2Z3YA 2D2CB 2RNBA 5KHJA 1RPRA 1OCCB 4FJCC 1EN5A 1NT2B 2GUZB 4NYKA 4FM0A 3ZRWA 3HKEA 3T1YB 1GRJA 3N2KA 4WBNA 5IJ9B 4GX5A 3THOA 3O9OA 1BSMA 3RYFB 2P5OA 2ZNJA 4JV5B 4YJ2A 4X1KA 4CC5A 5EBMC 2R9RB 4LC1A 1G1XB 2CK3G 3K04A 2ADQB 5KAIZ 4JI4B 3JCZA 4TV9A 5KLVH 1KBHA 2CE4A 2UXNA 1MMMA 3SYQA 4X89A 1QNMA 1SA0A 5J2UA 1Q6UA 1D5NA 4J10A 4ZHQB 1BCCH 4Z2WA 2YS8A 4MVQA 1R3IC 3DGEA 5DEDA 3ZMUA 1K4DC 3ZMZA 5EZYB 4UCOA 3K58A 3JCUZ 3L73H 1IBKO 1TUBB 2H3OA 4B7EA 4P9PA 2DYRB 1YJNV 5LP6A 5B1AB 4CS3A 3BCCH 3JYCA 4DR6O 2A06H 3IGAC 3STLC 1Y4MA 1HP8A 1UFIA 1Z5VA 1RM1B 3I5DA 3SR2C 4DV5O 2YXYA 2YIBD 2P22C 4YJ3A 1KMIZ 1A32A 2GSMB 1H2SB 4DR2O 2HKOA 3W7XA 5B1BC 3OTFA 3CRRA 1T5EA 1ZLZA 3JALA 2LP7A 5KAFZ 3AK2A 3JAWA 1AR1B 5EC1C 2JK5C 1HNXB 5GW7A 4X64B 5KHIA 3DC5A 3OE7G 1K34A 3ZRSA 3SJCC 2BTOA 1K8AW 3QTCA 4O4HB 3TJTA 3RYCA 1BMFG 3A0RA 4TUYA 3WFVA 2ATKC 1OJHA 2Q6AA 2UUCB 1WB7A 1RP3B 1RFYA 1SC5B 2QTOA 4PI2A 3T4DA 5L3EA 1Q81W 3CRAA 5BY1A 1Q6HA 5EBWC 4JI7O 2W6IG 1MZFA 4X8AA 3E22B 4UVCA 3F5TA 3CYOA 2B1GA 2ZXWB 3RGBA 4FIPC 4FLWA 1P7BA 2PY5A 1FAFA 4MTOA 2ZNIA 1HDJA 3G80A 3AG1C 4PJ0Z 2CDYA 3U0ZA 3WB1A 4JI5O 1GK9A 3K0GA 3S3XA 1NH2B 3ABKB 3OT7A 4IHJA 4FLUA 5B3SB 1E1RG 1OHHG 4R7CA 1IBMB 1K4CC 4I4TB 2E75B 4O2BA 3TGUH 4TV8B 5LA6B 3T4ZA 4LBEC 1VQ9V 1XHXA 1YCIA 1OCRB 3W7WA 2IJIA 4BIOA 4PV1B 2ZIOA 3SYAA 2XAQA 1K3EA 4RUFA 1FS0G 3I56V 2YI9A 1XHZA 5EYPA 2BTQB 3KG2A 1QLNA 1ZL8B 1GN3A 4U7OA 4D7TA 4DV0O 5KHGA 1B04A 4X9QA 2UUBO 2UXDO 1JQ0A 2ILMA 4NXMO 1NVPD 1XL6A 4P2ZA 1VMGA 1Y76B 1Y67A 4EKWA 1YVWA 3SYCA 4LF7O 2NR5A 4NR1A 4O2AB 4IYHA 4X66B 3MHHC 1S3JA 1SRYA 3M7MX 2ZE8A 2PF4E 4DYLA 1JFFB 3K5MA 1I5XA 4F6RB 5LGTA 1N0NA 3OUSA 3ZHQA 4ZKIA 5IWAO 2XUMA 1J95A 3H1KH 1OZ0A 3AG2B 1M93A 3UO3A 4F6EA 1F23A 2W0FC 1OCZC 4WFEA 4DUYB 2WA3A 4MS2A 5LYJB 1XI1A 3QNEA 1PM9A 1K92A 4FLTA 4AQYB 1R73A 1TAEA 2WLNA 5IJ0A 1S0VA 5JQGB 1Y6XA 4PI0A 4I50B 4EEQA 5H6RA 2BSKA 4EB6A 1SQPH 3FFQA 5F2VO 4GX0A 4UCRA 4LF6O 3IAYA 4RUEA 1VP7A 3CCUV 1DF5A 1G4YB 1OV9A 4CH6A 1YSCA 1S5JA 5E1AC 1G6UA 3T1HB 2ZQMA 2EIMC 2YEVA 3BPZA 4FZ1A 2R9AA 3L75H 4DUZB 4X20B 3JATB 2DMXA 2QWPB 3CD6V 5CA1B 4MVZA 2EZOA 4QPKA 1R3JC 2A0LA 2UUAB 3UO2A 1U97A 2HFEC 4MSWC 3JARB 3CCSV 4LF9O 4JI8O 5JH7A 3APQA 2EIJC 1SZTA 4KXRA 2EZPA 4GYCB 2UXBB 1BQ0A 3OTOO 1XREA 2WLJA 4GKKB 3CCQV 3RYHB 4JI1O 4LFAB 1N36B 2EIKC 2Q7EA 4DR5B 5AG2A 3ABMB 4PDLA 1EFRG 4B3MB 4JPRA 1QR9A 3STZC 4QPJA 5C8YA 5KA5A 5JJJB 3D8CA 1XNQO 4DR1B 3CWBH 1PNMA 3RVZA 2X0LA 1QR8A 3KCYA 2ZKOA 4NXNO 1M5IA 4JI2B 3OR6C 4RQFA 1KYOF 4PA7A 1HR0O 2WLLA 1M57C 1R3KC 4JASA 1HWYA 1QCEA 3HKDB 1WA8B 2ODMA 3JAKA 3B8MA 1NVPB 4LF4O 1H2GA 4DK1A 4B3TO 1THZA 4ZOLA 1NZ6A 2P4KA 3ZRWB 4O4IA 1I0HA 3HKEB 2Q73A 2WPDG 2H8PC 4JZGA 1DLBA 4DW0A 3N2KB 3ASOB 4WBNB 1FXVA 4DXWA 1R6NA 2AHYA 3AG4B 4YJ2B 4X1KB 3PN1A 1M56C 1EN4A 1OCOB 4B7KA 1KQSU 1VF6C 3K79A 5EC2C 4TV9B 2XAGA 4O4JB 1FJGO 1IBKB 1SA0B 3IJ4A 3K5LA 5J2UB 2YIDA 5CBFA 3K57A 2FYUH 3SPHA 2Q7HA 5LHIA 2ZM6O 1N32B 1HNZB 2E3CA 2N04A 3E8BA 2YIAA 4YXWG 5H9CA 1YIJV 1BHAA 4MW8A 5FPRA 4J7ZA 4QNHB 4KL1A 1NU1H 1AVMA 5LGUA 2QDOA 1DF4A 3RYIA 3CC7V 1VF5B 1NR7A 4X1IA 2ARHA 4WFGA 1KUQA 2EINC 4FLYA 3JSLA 2EX3A 4CH4A 1YITV 4FFBA 1US6A 5LP6B 3ETGA 4X62B 2LGQA 3ZJZA 3MHSC 3LSSA 4DR2B 2WSSG 2YXLA 4GKJO 1NTZH 2DWDC 5K1PA 4F4LA 5H2FZ 1AI6A 4U3FH 2K9PA 5IT9N 5KHHA 3EXAA 1F4NA 4GT1A 1TVKA 5IDJA 4YY3B 4LFBB 4LFCO 2CTWA 4AI8A 4YJ3B 3J7AU 3H9VA 4NVPA 1VQ6V 4CS4A 3B77A 3BVOA 2PI4A 5BR8B 2FB5A 1EZVH 3FYEB 2VQEO 1W59A 3JALB 4HZ3A 4YHHB 3JAWB 1NJIW 3ABLC 1ZSPA 2FTKA 1NS1A 3DC6A 2F93B 2OTJV 3MD0A 3K03A 4JAUA 4JI7B 1GN2A 3BA9A 4K3AA 1TUEB 3RYCB 4JGSA 1UPGA 1QVFU 4P30A 1Q86W 3RBZA 3C90A 1YF2A 4U7NA 3OR7C 2OCCB 5EK0A 1AJPA 2QKSA 3ASOC 5CBGA 3L74H 1PL4A 1XMQO 4JI5B 3IFXA 2A3QA 2JGDA 3P3NA 3CP1A 2C2AA 3L72H 3F7VC 2IBZH 3E35A 1XL4A 2QGNA 4FLXA 1JJ2U 1VQ8V 2GBOA 2EULA 3JD4A 1I94O 3BFRA 4JYCA 4UV8A 4MT8A 3OMIB 2A7WA 2AW9A 3PJSK 2E74B 3SJAC 4DV1O 1VQNV 2ZR3A 3CJHA 4DO2A 3D36A 4B3SO 3O65A 3ZRXA 4IHJB 3D3IA
chains in the Genus database with same CATH topology
5KAFZ 5GTHZ 4UB6Z 2AXTZ 5GTIZ 5E79Z 5TISZ 4IL6Z 4PJ0Z 3WU2Z 5KAIZ 3KZIZ 5H2FZ 3A0HZ 5B66Z 3A0BZ 1S5LZ 4UB8Z 3JCUZ 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF Z;  5GTH Z;  4UB6 Z;  2AXT Z;  5GTI Z;  5E79 Z;  5TIS Z;  4IL6 Z;  4PJ0 Z;  3WU2 Z;  5KAI Z;  3KZI Z;  5H2F Z;  3A0H Z;  5B66 Z;  3A0B Z;  1S5L Z;  4UB8 Z;  3JCU Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 1K5S A;  1BS3 A;  3DXR A;  4LF8 B;  3IC9 A;  5H5N A;  4JI6 O;  4O2B B;  5E79 Z;  4X65 O;  4J42 A;  2QM4 A;  2V7Q G;  3EHB B;  3SDL A;  4DV0 B;  4K0K O;  1YTF D;  2Q67 A;  3NR7 A;  2UUB B;  2UXD B;  3FB5 C;  3B4S A;  4CS2 A;  4TQF A;  2DQ3 A;  1SF9 A;  3A0H Z;  4PDM A;  4JAA A;  1VQL V;  3CRM A;  2VS0 A;  3ASN B;  1B6Q A;  2R9I A;  1VF7 A;  4LF7 B;  5EYP B;  4JYA B;  3QF7 A;  1KU9 A;  5L3D A;  1IZ3 A;  1S77 D;  2AXT Z;  4DR7 O;  1E79 G;  1F4M A;  2BCC H;  4HNA A;  4R50 A;  2P7T C;  2HLD G;  4KHP O;  3B40 A;  5KUM A;  1GMG A;  2Q69 A;  3CMA V;  4B3R O;  2JIZ G;  3ZMT A;  2X6B A;  2F43 G;  3W7S A;  1J5E O;  4Q6G A;  3JD0 A;  1M9N A;  3FB8 C;  3CXH F;  2X6A A;  4UCT A;  2Z0A A;  1GAX A;  1JVM A;  1XNR O;  2HHH B;  2UXC B;  4DR4 O;  2HVK C;  3K3W A;  1GTO A;  1TGO A;  4LF6 B;  3UQ8 A;  1MOF A;  3CCV V;  3GB7 C;  2HP8 A;  2Q0O C;  2OCC C;  5L3F A;  1ENV A;  5LBQ A;  4MVR A;  3HPL C;  4PA6 A;  5IJ0 B;  4OGQ B;  2HJF C;  1V55 B;  1AJQ A;  2BSK B;  2ZIN A;  4LWS A;  2XND G;  2QWN B;  4EB6 B;  3FYI B;  1OCC C;  4BW9 A;  2QTS A;  1SS3 A;  2X7R B;  4LF9 B;  5DM6 V;  4DV4 B;  4DR3 O;  4BR6 A;  1EM1 A;  3X2Q B;  1QBZ A;  3M99 B;  2YEV B;  4PDV A;  2F4V B;  2CGN A;  3OTO B;  4N23 A;  1GH6 A;  4G2K A;  3G71 V;  4Q20 A;  2LQT A;  4J7J A;  4NTW A;  4JI1 B;  2GHY A;  1URF A;  4I9W A;  5C93 A;  3M8A A;  1NI8 A;  2P90 A;  1ROP A;  4PA3 A;  1XNQ B;  1K73 W;  1IBL B;  3LUT B;  5JH7 B;  4W4L A;  2LW7 A;  1JPX A;  4P9O A;  4KUM A;  4NXN B;  1XMO O;  1SQV H;  3E8F A;  5LMU O;  2Y0P A;  4LF5 O;  1WPB A;  3HKC A;  2Y69 B;  1SKV A;  1IXB A;  5LMN O;  3N2G A;  5HFL A;  4XDK A;  1XUQ A;  4EFE A;  1FPO A;  1FKA O;  1HR0 B;  2LGW A;  5EIB C;  4X1Y A;  4JI0 O;  4MTX A;  5C8Y B;  1Y66 A;  1YTF B;  4IIJ A;  3RYF A;  2Y0I A;  4MVU A;  3Q4H A;  4LF4 B;  4B3T B;  2JGU A;  2DYR C;  4I9Q A;  5B1A C;  1ZWI C;  3SPJ A;  3FAV A;  3F7Y C;  3OUF A;  5FL7 G;  3OGC C;  1KEC A;  4MVS A;  4QGP A;  2KB1 A;  1LUV A;  3ZHU A;  3T2M A;  2L35 A;  4WFA V;  2IH1 C;  5CA0 A;  3T1Y O;  2WLL B;  1TA8 A;  1WPX A;  3FKS G;  3JAM N;  3ETQ A;  3RWR D;  3SGI A;  1VQO V;  1P4R A;  4WCE V;  1N33 B;  3ZN0 A;  2FKX A;  3VBB A;  2IM9 A;  4JV5 O;  2LFS A;  1VAR A;  4IT5 A;  5LXT A;  1RM1 C;  4BW5 A;  1AR4 A;  4ZOL B;  2ITD C;  1NR1 A;  2QKA A;  1FJG B;  3DSQ A;  4O4I B;  4JI4 O;  3LSU A;  2NLJ C;  5D5Q A;  2RCV A;  2Z5U A;  3ABU A;  4Z1V A;  1B3Q A;  2ZM6 B;  5BMV A;  2P06 A;  1YI2 V;  1DTO A;  5EBL C;  1SZX A;  4H44 B;  4I7Z B;  1W0K G;  4RO2 A;  5BZB A;  2HVJ C;  4LNU A;  5GON A;  4O4L A;  5IYD O;  1QLE B;  1SER A;  1QQC A;  1VQK V;  4J9Y B;  1I7F A;  5FNV B;  1X4T A;  1YEW A;  2VRZ A;  4LH6 A;  3SJB C;  2EIL B;  2DYS B;  3K06 A;  1KKC A;  5DN6 G;  4DV6 O;  3TET A;  4TOI A;  1FXK B;  1BZK A;  4NB5 A;  1IX9 A;  2PYL A;  3VQW A;  4GKJ B;  2QR4 A;  4E2L A;  3R65 A;  4GCZ A;  1P84 F;  3RYI B;  1QU7 A;  4X1I B;  2R72 A;  3QO7 A;  3FB6 C;  2Y48 A;  3BY6 A;  4RQE A;  2GDS A;  1KB9 F;  2ZXW C;  3SJQ C;  4UXN A;  3OFN G;  1N34 O;  2IJH A;  4QIW F;  2CH7 A;  3H1L H;  4ZIB A;  2ZDI C;  3A0B Z;  4UUJ C;  4WFH A;  2E5L B;  2Y69 C;  1FFX A;  1IDS A;  4D6T H;  3GWO A;  1TVK B;  3AG3 B;  3IC7 A;  5CB4 A;  1XDC A;  1NKD A;  2GV9 A;  3ABK C;  2ZD9 A;  2FML A;  1Q5O A;  4C7U A;  5B3S C;  3H1H H;  3OMN B;  1GN6 A;  1HNX O;  1R3L C;  1B06 A;  2Q8V A;  1CEZ A;  1PV0 A;  4DV2 B;  3ICX A;  4FLZ A;  1S5H C;  5CBH A;  1KP2 A;  1LUW A;  1BL8 A;  2CTR A;  3OEE G;  2JS3 A;  1OCR C;  3AEI A;  2XAS A;  3CHX A;  5KUK A;  4K8Z A;  2UUC O;  2DOS A;  3SPI A;  4DRX B;  2XAJ A;  2L6L A;  2A79 B;  4U3J A;  1Z2G A;  3FB7 C;  3ZS8 C;  2A9H A;  3VOU A;  2M7W A;  4LR3 A;  4WFF A;  5JCO C;  3NXS A;  3LNN A;  3D3Q A;  1Y74 A;  3WG7 B;  1K33 A;  1PKX A;  1YJ9 V;  1L8D A;  4JF3 A;  3JAS A;  3UKM A;  1BGY H;  3RN4 A;  1L1F A;  4DV1 B;  1HW7 A;  4B3S B;  1O9H A;  1PL0 A;  1KC8 W;  2JGD B;  3ZHT A;  1QHT A;  2CTQ A;  5A2Q N;  4MVO A;  1EZJ A;  2VWJ A;  4JI6 B;  1D2D A;  2EIL C;  4X65 B;  1XQ8 A;  2DYS C;  2JRI A;  3G6B A;  3K08 A;  3AG2 C;  2WLK A;  3EVK A;  1IXM A;  4MW3 A;  1IBM O;  1WNS A;  5LHG A;  1FXK C;  1WB8 A;  4I55 A;  3OW2 U;  2YXH A;  4R6Z A;  3CJH B;  3QG5 A;  1W2B U;  1LR1 A;  2HEP A;  4UB8 Z;  2ZR2 A;  4XDJ A;  1SET A;  3DXR B;  3S3W A;  4CH3 A;  1Z5W A;  4JAV A;  1YXB A;  4WFB V;  3W7U A;  4DR6 B;  4OXS A;  2W0X A;  4H37 A;  1V54 B;  1PNL A;  1XIL A;  3ETE A;  5JVD A;  4YIO A;  4B3R B;  2B5U A;  4PD4 F;  3K5N A;  1VQP V;  4OPA A;  5B1O A;  4DV7 O;  4DV5 B;  4NTX A;  1VF6 A;  1EBO A;  4HNA B;  2O57 A;  5ITZ A;  4WF9 V;  4PDR A;  1AR5 A;  4DR4 B;  4UVB A;  1FFT B;  1KKD A;  2MW2 B;  5JQG A;  1COW G;  4UCU A;  1PP9 H;  4TQD A;  2N74 A;  3AK1 A;  1Q82 W;  1K5Q A;  2UU9 O;  3CXC U;  4ASU G;  1GN4 A;  2CTP A;  3CRC A;  4FZ0 A;  1MAB G;  2PUS A;  3ABM C;  3WB2 A;  4D7S A;  5CN0 A;  3SYP A;  4DUY O;  1Q7Y W;  3CX5 F;  2ZE7 A;  3ZHS A;  4B08 A;  2QWO B;  2V4D A;  3MDS A;  4AQY O;  1VEW A;  3OD4 A;  1AI5 A;  4CH5 A;  4OX9 O;  2CAZ C;  1Q6I A;  3QVN A;  3VQV A;  2KKW A;  2QSA A;  3CCR V;  4JTC B;  3WG7 C;  3J81 N;  1IUR A;  3VQX A;  2QKC A;  2JEU A;  4DUZ O;  3C3T A;  1RSO A;  4LWS B;  2ZE5 A;  2QE7 G;  2WA4 A;  4LP8 A;  4TUY B;  2HR3 A;  4JYB A;  2UXX A;  2QA4 V;  1BE3 H;  3ZBH A;  5JWP A;  2YSU B;  4ZBM A;  2UUA O;  3RVY A;  3WB0 A;  4LF5 B;  3APO A;  2OIE A;  2AHZ A;  1N8R W;  2YUA A;  1NBM G;  1K97 A;  3AG4 C;  2F95 B;  2UXB O;  2OIG A;  4XBF A;  1H2L A;  3LSQ A;  1OCO C;  3B2E E;  3MAQ A;  5JJE B;  1Q3E A;  1N36 O;  2XOK G;  4L87 A;  2Q7G A;  4B3M O;  2GTS A;  4FMT A;  2HJD A;  4DR1 O;  3HKC B;  1NTM H;  1SQF A;  2VQF O;  4FPP A;  3WU2 Z;  4JI3 O;  3KZI Z;  3N2G B;  2CUG A;  2OWO A;  2M6Y A;  3CSX A;  3RT3 C;  2JJ1 G;  1BQZ A;  3UT5 A;  1V54 C;  4JI2 O;  1RPO A;  2B9Z A;  4X1Y B;  5IYZ A;  1AP5 A;  1X59 A;  4IIJ B;  2NN4 A;  4XDL A;  4ZI7 A;  5IY5 B;  2R70 A;  3E83 A;  4A5U B;  2YI8 A;  3KCX A;  3Q4H B;  2E76 B;  5LP6 C;  1F51 A;  4IL6 Z;  3FAV B;  5KMG A;  1P7G A;  2YDE A;  3G4S V;  3P30 A;  2WLI A;  4O4J A;  3BAA A;  3ABT A;  3L9D A;  4J11 A;  4NXM B;  3HKB A;  3K9S A;  1ZUQ A;  3R66 A;  4I0X A;  5CA0 B;  2KG7 A;  3JD2 A;  4JTD B;  1NH2 D;  3AG1 B;  4J9Z B;  2IU0 A;  1KP3 A;  3T1C A;  5LXT B;  2Q9L A;  3CB2 A;  3E86 A;  2OTL V;  1R6T A;  1VQM V;  5L3B A;  5IWA B;  2P4V A;  4DV6 B;  2QWR B;  3GWK C;  1GO3 F;  5BMV B;  1JR9 A;  3OMA B;  2NNU A;  4H33 A;  3K9A A;  4LNU B;  5GON B;  4O4L B;  1N32 O;  1HNZ O;  4X88 A;  2PZS A;  1JA8 A;  3ZX6 A;  4UFZ A;  4QE9 A;  3CEI A;  4G28 B;  1WN7 A;  1EN6 A;  2Y4T A;  1XEQ A;  5L3G A;  2ZIM A;  1O9G A;  4CZZ A;  2Q4P A;  1WAZ A;  1ZAU A;  3H1I H;  1UJW B;  4X62 O;  1N34 B;  5J2T A;  2Q0A A;  1HNW O;  5KA6 A;  2XT9 A;  4KP4 A;  1MG1 A;  2LW1 A;  2JJ2 G;  1MSD A;  1YJW V;  5IE9 A;  3L70 H;  2V1D A;  2IH3 C;  3LDD A;  1K7D A;  4JI8 B;  3E8G A;  2IJK A;  4YY3 O;  4LFB O;  4BWA A;  2QM8 A;  4DW1 A;  4JZ2 A;  2AZ0 A;  1JX9 A;  4R8C A;  2P6J A;  1H8H G;  4PA4 A;  2WWW A;  4J41 A;  1MA1 A;  1M1K W;  3CE2 A;  2CH7 B;  5LOV A;  4TWK A;  2JS5 A;  3ZHR A;  5KHK A;  5BR8 O;  1H2N A;  1FFX B;  1NQT A;  4GX1 A;  5CB4 B;  3E2E A;  2BE3 A;  4LCU C;  1OCZ B;  4PA9 A;  4W4K A;  3HB3 B;  4YHH O;  2BOC C;  2F1M A;  5KX5 A;  1M90 W;  3U11 A;  4CC6 A;  1I08 A;  4J7K A;  2ZCE A;  1XOU A;  5IY5 C;  4RAI A;  3P32 A;  2PYJ A;  4N21 A;  4TSF G;  2IU3 A;  3CC2 V;  2WLH A;  3E8H A;  2GUZ A;  4Z1M G;  2EJR A;  2WAM A;  2EIM B;  3FD9 A;  5D5P A;  1F7Y A;  5IJ9 A;  4DV3 O;  2EBO A;  1N4C A;  2H94 A;  3ASN C;  4U3J B;  2AGA A;  4OPH A;  3TXS A;  2ZT9 B;  4GZR B;  1Q8I A;  1R6K A;  3LDC A;  4NTY A;  2RN9 A;  4AIL C;  2MK3 A;  2N05 A;  2EIJ B;  1Y74 B;  4GUN A;  3VQY A;  3AK3 A;  3UM7 A;  2RQ6 A;  4YIP A;  3F5W C;  1V9P A;  1BHB A;  4AHC A;  3JAS B;  3CCE V;  1G8M A;  3CS5 A;  4ZHQ A;  3KKY A;  2D3O W;  3JAK B;  2EIK B;  1K9M W;  3TCU A;  1FD9 A;  4FVM A;  4IYI A;  1LNQ A;  3ZHV A;  5EZY A;  1YZB A;  3BHP A;  3SPC A;  1TUB A;  1H8E G;  4J80 A;  4LF8 O;  3TK1 A;  1BT8 A;  5B1N A;  3A2F A;  3C3S A;  4I55 B;  2AZ2 A;  2CGO A;  1P49 A;  2X6C A;  1PPJ H;  5L3C A;  1GM7 A;  1M57 B;  3ZRV A;  1MNG A;  4H13 B;  2EJ7 A;  3ZCC A;  2JDI G;  4DV7 B;  1V55 C;  3EFF K;  4UCV A;  1WP7 A;  4UV9 A;  1PNK A;  1ZTE A;  2XAF A;  1ARO P;  2JEX A;  3CCL V;  1H38 A;  4UB6 Z;  1AI7 A;  3ZMV A;  4JYA O;  2ADP A;  1IVS A;  2RDC A;  3A8T A;  3CPW U;  4PHZ A;  1E1Q G;  3X2Q C;  2ZE6 A;  5JVD B;  4JYY A;  3RW0 A;  2LO1 A;  3CC4 V;  2DJV A;  2UU9 B;  3K5O A;  1M56 B;  1WP8 A;  4LFC B;  4FFB B;  3CCJ V;  1N0J A;  1AB3 A;  2PTM A;  4H0L B;  5ITZ B;  1JCH A;  1WLE A;  1SQB H;  5LGN A;  4MTG A;  2VQE B;  4KFM A;  1S5L Z;  3W7T A;  2HHH O;  4O4H A;  1KD1 W;  2UXC O;  4OX9 B;  3B09 A;  3U10 A;  5B5E Z;  4RWU A;  2Y4U A;  2YC0 A;  5J9P C;  4QJF B;  1L0N H;  2K1E A;  2PI5 A;  2XTA A;  3ZMS A;  3HR0 A;  1L0L H;  4X64 O;  3ZIA G;  3K0D A;  2EIN B;  4DK0 A;  4JTA B;  4ABM A;  2OT5 A;  2XHB A;  1DK1 A;  1CPY A;  3E22 A;  2DWE C;  3ML0 A;  1YDX A;  4E4E A;  4DV4 O;  4LH7 A;  2G38 A;  5GTI Z;  1XMQ B;  1AIL A;  2Q68 A;  4BIU A;  4TT3 G;  2F66 C;  4K8X A;  2ZDI A;  2F4V O;  3H01 A;  3BEH A;  1VQ4 V;  1RSO B;  3OGI B;  5B66 Z;  3GVM A;  2OYQ A;  3I55 V;  1S72 V;  3BA8 A;  3N27 A;  2LFR A;  1JOY A;  1ORQ C;  3E89 A;  5HFM A;  3ZED A;  1W0J G;  1PD3 A;  1I94 B;  4IGG A;  1IBL O;  4QE7 A;  4I4T A;  2VQF B;  1ZX3 A;  4EFB A;  4BAY A;  4JI3 B;  2B1I A;  4TV8 A;  5LA6 A;  1H2K A;  1GM9 A;  1U96 A;  4GLX A;  4PEL A;  3ABL B;  1QLE C;  3OEH G;  5DEC A;  3G6E V;  1JJO A;  1D5A A;  1FXH A;  1SQX H;  2ITC C;  2BTQ A;  4K0K B;  4HBN A;  2P67 A;  5JCO A;  5K1X A;  1SQG A;  1ZL8 A;  3AG7 A;  2GTA A;  1H2M A;  1SES A;  3JD1 A;  1VQ5 V;  1S76 D;  1YHQ V;  3UT5 B;  4MTF A;  5IYZ B;  2RJZ A;  1M4U A;  3BAB A;  2ETN A;  2YIB A;  4ZI7 B;  5GTH Z;  3LNM B;  1JMK C;  4DR7 B;  1Y76 A;  4BIZ A;  5JJN B;  4O2A A;  1DGS A;  4G27 B;  4KHP B;  1N33 O;  5KMG B;  2WLM A;  2LJ2 A;  1GM8 A;  5H6Q A;  1WJZ A;  4FFK A;  2WLI B;  1JFF A;  4FM2 A;  3QO8 A;  4F6R A;  3HKB B;  1AP6 A;  1R1B A;  4UCS A;  5FNV A;  4FM1 A;  5FLX N;  4I0X B;  3RFR A;  1I5Y A;  3B8N A;  2KG7 B;  2JVD A;  3LDE A;  1J5E B;  4HYO A;  3OM3 B;  2KQX A;  5LHH A;  3L71 H;  1FXK A;  2QJ1 A;  2QWQ B;  2Q5Z A;  2QM7 A;  1QVG U;  3ETD A;  2DQ0 A;  4CBC A;  3AG3 C;  4HAM A;  4X66 O;  2OCH A;  5TIS Z;  5CA3 A;  1XNR B;  1CP9 A;  5LYJ A;  1AI4 A;  2IW5 A;  3UCS C;  4GX2 A;  3QO5 A;  2QEX V;  4FK5 C;  1NTK H;  1MSW D;  4I50 A;  3ZN1 A;  5EIB D;  1Q90 D;  3G67 A;  4I5S A;  4L8J A;  2BOB C;  3CRQ A;  2KSD A;  1HNW B;  2PGG A;  2XAH A;  5BXZ A;  3JSN A;  4X20 A;  4FLV A;  3JAT A;  3SYO A;  3JD3 A;  1XBL A;  3OAA G;  5CA1 A;  2IJJ A;  5FPO A;  4DR3 B;  5IYC O;  3CME V;  5A9G A;  3K59 A;  1FYJ A;  3P3P A;  1AJN A;  3J80 N;  3JAR A;  3TXQ A;  4NKG B;  1CXZ B;  5J2T B;  2DN9 A;  3T1H O;  5CMU A;  1GKF A;  3RYH A;  2RMK B;  2E5L O;  2HG5 C;  3FX7 A;  3BRC A;  2F23 A;  1XMO B;  3H1J H;  5LMU B;  1SQQ H;  1Q43 A;  2W6J G;  4DRX A;  5LL6 Y;  2DE0 X;  5B1B B;  2YIC A;  5LMN B;  5LOV B;  4ICG A;  2DW4 A;  5IYB O;  3DTU B;  4DV2 O;  1VQ7 V;  4UVA A;  3SPG A;  4JI0 B;  3CCM V;  4GKK O;  4K35 A;  4LFA O;  4DV3 B;  2FL4 A;  3D36 C;  4DR5 O;  5KX5 B;  1VIB A;  1MZE A;  3HKD A;  2VWK A;  1WA8 A;  4MVM A;  2Z3Y A;  2D2C B;  2RNB A;  5KHJ A;  1RPR A;  1OCC B;  4FJC C;  1EN5 A;  1NT2 B;  2GUZ B;  4NYK A;  4FM0 A;  3ZRW A;  3HKE A;  3T1Y B;  1GRJ A;  3N2K A;  4WBN A;  5IJ9 B;  4GX5 A;  3THO A;  3O9O A;  1BSM A;  3RYF B;  2P5O A;  2ZNJ A;  4JV5 B;  4YJ2 A;  4X1K A;  4CC5 A;  5EBM C;  2R9R B;  4LC1 A;  1G1X B;  2CK3 G;  3K04 A;  2ADQ B;  5KAI Z;  4JI4 B;  3JCZ A;  4TV9 A;  5KLV H;  1KBH A;  2CE4 A;  2UXN A;  1MMM A;  3SYQ A;  4X89 A;  1QNM A;  1SA0 A;  5J2U A;  1Q6U A;  1D5N A;  4J10 A;  4ZHQ B;  1BCC H;  4Z2W A;  2YS8 A;  4MVQ A;  1R3I C;  3DGE A;  5DED A;  3ZMU A;  1K4D C;  3ZMZ A;  5EZY B;  4UCO A;  3K58 A;  3JCU Z;  3L73 H;  1IBK O;  1TUB B;  2H3O A;  4B7E A;  4P9P A;  2DYR B;  1YJN V;  5LP6 A;  5B1A B;  4CS3 A;  3BCC H;  3JYC A;  4DR6 O;  2A06 H;  3IGA C;  3STL C;  1Y4M A;  1HP8 A;  1UFI A;  1Z5V A;  1RM1 B;  3I5D A;  3SR2 C;  4DV5 O;  2YXY A;  2YIB D;  2P22 C;  4YJ3 A;  1KMI Z;  1A32 A;  2GSM B;  1H2S B;  4DR2 O;  2HKO A;  3W7X A;  5B1B C;  3OTF A;  3CRR A;  1T5E A;  1ZLZ A;  3JAL A;  2LP7 A;  5KAF Z;  3AK2 A;  3JAW A;  1AR1 B;  5EC1 C;  2JK5 C;  1HNX B;  5GW7 A;  4X64 B;  5KHI A;  3DC5 A;  3OE7 G;  1K34 A;  3ZRS A;  3SJC C;  2BTO A;  1K8A W;  3QTC A;  4O4H B;  3TJT A;  3RYC A;  1BMF G;  3A0R A;  4TUY A;  3WFV A;  2ATK C;  1OJH A;  2Q6A A;  2UUC B;  1WB7 A;  1RP3 B;  1RFY A;  1SC5 B;  2QTO A;  4PI2 A;  3T4D A;  5L3E A;  1Q81 W;  3CRA A;  5BY1 A;  1Q6H A;  5EBW C;  4JI7 O;  2W6I G;  1MZF A;  4X8A A;  3E22 B;  4UVC A;  3F5T A;  3CYO A;  2B1G A;  2ZXW B;  3RGB A;  4FIP C;  4FLW A;  1P7B A;  2PY5 A;  1FAF A;  4MTO A;  2ZNI A;  1HDJ A;  3G80 A;  3AG1 C;  4PJ0 Z;  2CDY A;  3U0Z A;  3WB1 A;  4JI5 O;  1GK9 A;  3K0G A;  3S3X A;  1NH2 B;  3ABK B;  3OT7 A;  4IHJ A;  4FLU A;  5B3S B;  1E1R G;  1OHH G;  4R7C A;  1IBM B;  1K4C C;  4I4T B;  2E75 B;  4O2B A;  3TGU H;  4TV8 B;  5LA6 B;  3T4Z A;  4LBE C;  1VQ9 V;  1XHX A;  1YCI A;  1OCR B;  3W7W A;  2IJI A;  4BIO A;  4PV1 B;  2ZIO A;  3SYA A;  2XAQ A;  1K3E A;  4RUF A;  1FS0 G;  3I56 V;  2YI9 A;  1XHZ A;  5EYP A;  2BTQ B;  3KG2 A;  1QLN A;  1ZL8 B;  1GN3 A;  4U7O A;  4D7T A;  4DV0 O;  5KHG A;  1B04 A;  4X9Q A;  2UUB O;  2UXD O;  1JQ0 A;  2ILM A;  4NXM O;  1NVP D;  1XL6 A;  4P2Z A;  1VMG A;  1Y76 B;  1Y67 A;  4EKW A;  1YVW A;  3SYC A;  4LF7 O;  2NR5 A;  4NR1 A;  4O2A B;  4IYH A;  4X66 B;  3MHH C;  1S3J A;  1SRY A;  3M7M X;  2ZE8 A;  2PF4 E;  4DYL A;  1JFF B;  3K5M A;  1I5X A;  4F6R B;  5LGT A;  1N0N A;  3OUS A;  3ZHQ A;  4ZKI A;  5IWA O;  2XUM A;  1J95 A;  3H1K H;  1OZ0 A;  3AG2 B;  1M93 A;  3UO3 A;  4F6E A;  1F23 A;  2W0F C;  1OCZ C;  4WFE A;  4DUY B;  2WA3 A;  4MS2 A;  5LYJ B;  1XI1 A;  3QNE A;  1PM9 A;  1K92 A;  4FLT A;  4AQY B;  1R73 A;  1TAE A;  2WLN A;  5IJ0 A;  1S0V A;  5JQG B;  1Y6X A;  4PI0 A;  4I50 B;  4EEQ A;  5H6R A;  2BSK A;  4EB6 A;  1SQP H;  3FFQ A;  5F2V O;  4GX0 A;  4UCR A;  4LF6 O;  3IAY A;  4RUE A;  1VP7 A;  3CCU V;  1DF5 A;  1G4Y B;  1OV9 A;  4CH6 A;  1YSC A;  1S5J A;  5E1A C;  1G6U A;  3T1H B;  2ZQM A;  2EIM C;  2YEV A;  3BPZ A;  4FZ1 A;  2R9A A;  3L75 H;  4DUZ B;  4X20 B;  3JAT B;  2DMX A;  2QWP B;  3CD6 V;  5CA1 B;  4MVZ A;  2EZO A;  4QPK A;  1R3J C;  2A0L A;  2UUA B;  3UO2 A;  1U97 A;  2HFE C;  4MSW C;  3JAR B;  3CCS V;  4LF9 O;  4JI8 O;  5JH7 A;  3APQ A;  2EIJ C;  1SZT A;  4KXR A;  2EZP A;  4GYC B;  2UXB B;  1BQ0 A;  3OTO O;  1XRE A;  2WLJ A;  4GKK B;  3CCQ V;  3RYH B;  4JI1 O;  4LFA B;  1N36 B;  2EIK C;  2Q7E A;  4DR5 B;  5AG2 A;  3ABM B;  4PDL A;  1EFR G;  4B3M B;  4JPR A;  1QR9 A;  3STZ C;  4QPJ A;  5C8Y A;  5KA5 A;  5JJJ B;  3D8C A;  1XNQ O;  4DR1 B;  3CWB H;  1PNM A;  3RVZ A;  2X0L A;  1QR8 A;  3KCY A;  2ZKO A;  4NXN O;  1M5I A;  4JI2 B;  3OR6 C;  4RQF A;  1KYO F;  4PA7 A;  1HR0 O;  2WLL A;  1M57 C;  1R3K C;  4JAS A;  1HWY A;  1QCE A;  3HKD B;  1WA8 B;  2ODM A;  3JAK A;  3B8M A;  1NVP B;  4LF4 O;  1H2G A;  4DK1 A;  4B3T O;  1THZ A;  4ZOL A;  1NZ6 A;  2P4K A;  3ZRW B;  4O4I A;  1I0H A;  3HKE B;  2Q73 A;  2WPD G;  2H8P C;  4JZG A;  1DLB A;  4DW0 A;  3N2K B;  3ASO B;  4WBN B;  1FXV A;  4DXW A;  1R6N A;  2AHY A;  3AG4 B;  4YJ2 B;  4X1K B;  3PN1 A;  1M56 C;  1EN4 A;  1OCO B;  4B7K A;  1KQS U;  1VF6 C;  3K79 A;  5EC2 C;  4TV9 B;  2XAG A;  4O4J B;  1FJG O;  1IBK B;  1SA0 B;  3IJ4 A;  3K5L A;  5J2U B;  2YID A;  5CBF A;  3K57 A;  2FYU H;  3SPH A;  2Q7H A;  5LHI A;  2ZM6 O;  1N32 B;  1HNZ B;  2E3C A;  2N04 A;  3E8B A;  2YIA A;  4YXW G;  5H9C A;  1YIJ V;  1BHA A;  4MW8 A;  5FPR A;  4J7Z A;  4QNH B;  4KL1 A;  1NU1 H;  1AVM A;  5LGU A;  2QDO A;  1DF4 A;  3RYI A;  3CC7 V;  1VF5 B;  1NR7 A;  4X1I A;  2ARH A;  4WFG A;  1KUQ A;  2EIN C;  4FLY A;  3JSL A;  2EX3 A;  4CH4 A;  1YIT V;  4FFB A;  1US6 A;  5LP6 B;  3ETG A;  4X62 B;  2LGQ A;  3ZJZ A;  3MHS C;  3LSS A;  4DR2 B;  2WSS G;  2YXL A;  4GKJ O;  1NTZ H;  2DWD C;  5K1P A;  4F4L A;  5H2F Z;  1AI6 A;  4U3F H;  2K9P A;  5IT9 N;  5KHH A;  3EXA A;  1F4N A;  4GT1 A;  1TVK A;  5IDJ A;  4YY3 B;  4LFB B;  4LFC O;  2CTW A;  4AI8 A;  4YJ3 B;  3J7A U;  3H9V A;  4NVP A;  1VQ6 V;  4CS4 A;  3B77 A;  3BVO A;  2PI4 A;  5BR8 B;  2FB5 A;  1EZV H;  3FYE B;  2VQE O;  1W59 A;  3JAL B;  4HZ3 A;  4YHH B;  3JAW B;  1NJI W;  3ABL C;  1ZSP A;  2FTK A;  1NS1 A;  3DC6 A;  2F93 B;  2OTJ V;  3MD0 A;  3K03 A;  4JAU A;  4JI7 B;  1GN2 A;  3BA9 A;  4K3A A;  1TUE B;  3RYC B;  4JGS A;  1UPG A;  1QVF U;  4P30 A;  1Q86 W;  3RBZ A;  3C90 A;  1YF2 A;  4U7N A;  3OR7 C;  2OCC B;  5EK0 A;  1AJP A;  2QKS A;  3ASO C;  5CBG A;  3L74 H;  1PL4 A;  1XMQ O;  4JI5 B;  3IFX A;  2A3Q A;  2JGD A;  3P3N A;  3CP1 A;  2C2A A;  3L72 H;  3F7V C;  2IBZ H;  3E35 A;  1XL4 A;  2QGN A;  4FLX A;  1JJ2 U;  1VQ8 V;  2GBO A;  2EUL A;  3JD4 A;  1I94 O;  3BFR A;  4JYC A;  4UV8 A;  4MT8 A;  3OMI B;  2A7W A;  2AW9 A;  3PJS K;  2E74 B;  3SJA C;  4DV1 O;  1VQN V;  2ZR3 A;  3CJH A;  4DO2 A;  3D36 A;  4B3S O;  3O65 A;  3ZRX A;  4IHJ B;  3D3I A; 
#chains in the Genus database with same CATH homology
 5KAF Z;  5GTH Z;  4UB6 Z;  2AXT Z;  5GTI Z;  5E79 Z;  5TIS Z;  4IL6 Z;  4PJ0 Z;  3WU2 Z;  5KAI Z;  3KZI Z;  5H2F Z;  3A0H Z;  5B66 Z;  3A0B Z;  1S5L Z;  4UB8 Z;  3JCU Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...