5GTHZ

Native xfel structure of photosystem ii (dark dataset)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Light-induced structural changes and the site of O=O bond formation in PSII caught by XFEL.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1
total genus 23
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5gthZ00
5TISZ 4IL6Z 5GTHZ 3KZIZ 4UB6Z 5H2FZ 3WU2Z 3JCUZ 4PJ0Z 1S5LZ 5KAIZ 5KAFZ 5B5EZ 3A0BZ 5GTIZ 5B66Z 3A0HZ 4UB8Z 5E79Z 2AXTZ
chains in the Genus database with same CATH superfamily
4ZI7A 4JV5O 3FYIB 4LC1A 2RQ6A 1NZ6A 2QGNA 4QJFB 5BMVB 4JI1O 1N4CA 3C3TA 2OYQA 1VQ7V 4HZ3A 4GX1A 4O4HA 4DW0A 4Q20A 4YY3B 4WFFA 2IU0A 5L3FA 3ETDA 3APOA 2Y4UA 2R9AA 3J81N 5EBLC 1IXMA 2A7WA 3G6EV 4CS2A 2JS3A 3GWKC 3UKMA 5CA0A 1IX9A 3EXAA 4QE9A 3VQXA 5IYDO 5JVDA 1PNMA 5LHGA 4YJ3A 2F66C 4LCUC 3HPLC 1L0LH 1H38A 3A8TA 2WLKA 4MVSA 3TGUH 4NYKA 3FKSG 4CH3A 1YCIA 1COWG 2BCCH 2B1GA 1JFFB 3E2EA 2WA4A 4R8CA 5CBGA 3WU2Z 1GKFA 4FLTA 1BL8A 3AG2C 4YIPA 3J7AU 4O4JB 5GTIZ 5H6RA 1S5LZ 3ML0A 3W7UA 1JCHA 4GUNA 2WLIA 4HYOA 3CRQA 1VQPV 4GCZA 4LF5B 5KLVH 1BE3H 1D5AA 2YIDA 1IBKB 1NKDA 1P4RA 3SR2C 1Y6XA 5KHKA 4DV7O 2DJVA 3N2GB 2VS0A 1THZA 2ODMA 2YI9A 1FXKC 4NXMO 1AJPA 1ENVA 1K34A 5B1BC 3CCSV 2OT5A 1TUBB 4HBNA 1BT8A 2P90A 5F2VO 5LYJB 1ZSPA 5EBMC 4X62O 1YJWV 1RM1B 1SKVA 1OCRC 3DC6A 4GKJB 4UVBA 5JJJB 5BMVA 1JR9A 1HNXB 2UXDO 5EZYB 1R3JC 1BHAA 3H1KH 3B8NA 2CH7B 1Q3EA 4JI2O 1ORQC 3M99B 1U97A 3OMNB 3PJSK 3ZHTA 2Q4PA 3P3NA 4DV0O 3H01A 1TAEA 4LF6O 2Q73A 5KHIA 2QTOA 2HEPA 1OHHG 4QPKA 4X1YB 3FB6C 4DR5O 2R70A 1K9MW 4BW5A 3EHBB 3M7MX 2N74A 3ZN1A 4J41A 2E75B 3RWRD 2KB1A 5J9PC 4CS4A 2QM4A 2H3OA 3B8MA 3IC7A 2IJIA 1AI4A 3ZCCA 2XHBA 4NTXA 4LP8A 3OTFA 2HG5C 2DE0X 2FYUH 3W7SA 4X89A 5GW7A 4ICGA 1PP9H 2A0LA 3LNMB 1QQCA 2LW7A 4ZBMA 3MHSC 1DF4A 4ASUG 2UUAO 4DYLA 3K79A 2DQ0A 3WG7B 2WLNA 3D3IA 3FYEB 3T1YB 2QTSA 3FAVB 1YSCA 4MTOA 2JJ1G 2ZINA 3LDEA 4FLZA 1HNZO 4X1KB 2HJDA 2OCCC 4LF6B 3D36C 2YS8A 3ZRXA 2DWDC 4JI0B 3CCEV 1Y66A 2LFRA 2P67A 4DRXA 5LMNB 1KC8W 4MS2A 4U3FH 4DV3B 2UUAB 2LO1A 1MABG 5B1AC 4MVRA 3G67A 1SQXH 2UXBB 5KMGB 2WLLB 2EINC 2UXCB 4JGSA 4DR7B 4UV8A 3CMAV 4MVQA 4DR2O 1IDSA 2UUBB 2RMKB 2Q5ZA 1AJNA 2VQEB 4JZGA 4R6ZA 2QWOB 3R66A 3OMAB 2OIGA 4MT8A 3D3QA 3STLC 3T4DA 1XDCA 5HFLA 4FJCC 4LWSA 1G6UA 3AG1B 4A5UB 4F6RA 3E89A 5B3SC 3ABKC 1FYJA 2ZT9B 4K8XA 3CC7V 4EB6A 4EFBA 1GRJA 4X65O 2UUBO 4XDKA 2HHHB 1JFFA 3CCRV 1BHBA 3RYFA 3B09A 1HNXO 2UU9O 1XL6A 4FPPA 4GLXA 4X20A 4JI4O 1B3QA 4I9QA 1VQ8V 1FJGO 2F4VO 1J5EO 4OXSA 5L3BA 5BXZA 4YJ2B 4P9PA 1OV9A 2LGQA 1R3KC 5H2FZ 3K06A 4IYHA 3N27A 2Q7EA 4J11A 3ASNB 3HKEA 4DV2B 4X65B 2IW5A 1OCCC 4K0KB 2KG7B 3LSSA 3T1HB 1V54C 2EZPA 4LF4B 3SPCA 3OD4A 1AR4A 3MHHC 3HKBB 1N33O 3JD4A 4CC5A 1M57B 2ZE8A 2CTPA 2AZ2A 3Q4HB 3CPWU 3OMIB 1Q81W 1HDJA 2XT9A 4JI4B 2DW4A 1PNKA 3RYHB 1MOFA 1PD3A 3CCLV 4MSWC 5H6QA 1NT2B 4WFBV 1EN4A 4B3TB 2E5LO 1VARA 1DF5A 5EIBD 2JK5C 3QO8A 1TVKB 1NS1A 4TV8B 2Q69A 3CJHA 1S0VA 1GMGA 4I4TB 3T4ZA 5D5QA 4BIOA 5JCOC 2DN9A 2YXHA 5IJ9A 2IH1C 2RN9A 4DXWA 2QKCA 4LWSB 1CPYA 3F5WC 4B3MB 1AILA 5JH7B 3L75H 1JJ2U 5LYJA 2YICA 3CXHF 3JALB 3RW0A 4BR6A 1N36B 5ITZB 2IJKA 4JI3B 4UVAA 1R6KA 1H8EG 1OCRB 4JTAB 4UUJC 1Y74A 1H8HG 1I0HA 3B4SA 1Q90D 4DV5B 4LF7B 5LA6A 4LF9O 5A9GA 1ZLZA 4LNUB 1WJZA 5J2UA 1MZFA 2ZIOA 3P3PA 3SDLA 3HKCB 1WPBA 4GX0A 2WSSG 2VQEO 4DV6O 5JJNB 2UXNA 4IYIA 4DR4B 3DTUB 4J7ZA 1NH2B 4JF3A 3CX5F 3ICXA 4X88A 3OR6C 3CCUV 1EFRG 4JYCA 1SQFA 2ZNIA 3E8HA 1QLEC 1OZ0A 1EZVH 4PI2A 1SA0B 1M1KW 1L8DA 1Q6HA 1HP8A 4GYCB 4NXNB 3RN4A 3LSQA 1Y4MA 3HKBA 5IYBO 1WA8B 2EIKB 2Q9LA 1VQNV 3ZHUA 4I50B 3MAQA 2FL4A 1CXZB 1H2LA 1QBZA 3CC2V 4LH6A 3SJBC 2OTLV 2YEVA 1IBLO 2Q67A 5KUMA 2WWWA 1PL0A 4PDMA 4FM0A 3TETA 5CMUA 1I5XA 3QTCA 1URFA 3BPZA 5CB4B 2EIJB 4YHHO 1DTOA 1K4DC 2AW9A 1YXBA 4O2BA 2IJHA 1NTMH 5DN6G 4UCRA 2QM7A 3F7VC 4DV4O 1FFTB 3B40A 4DR2B 3FAVA 1IZ3A 1KD1W 1U96A 3MDSA 4X62B 5DM6V 3OR7C 3ZN0A 1N32B 4L87A 4QGPA 4BW9A 1OJHA 4MTXA 5JCOA 4TQDA 3CSXA 2V7QG 3RYHA 1UFIA 2BOCC 4F6RB 3QF7A 2YXLA 4JI2B 1KB9F 3TCUA 2LFSA 4KHPO 4LF8B 1VQMV 1K73W 4UFZA 1YDXA 2LP7A 4O4HB 1D2DA 1K5QA 2EX3A 4H37A 1I7FA 4WFAV 4TT3G 1SQPH 2L6LA 2CTWA 1K8AW 1JX9A 1BSMA 1YIJV 3CC4V 2VQFB 3RYFB 4WFGA 5L3EA 1EBOA 2UXBO 2ZE6A 3K9AA 3A0BZ 2K9PA 3VOUA 3E35A 1NBMG 5D5PA 1S5JA 4J10A 1WB8A 4PI0A 1IBLB 4UB8Z 2VWJA 2DYRC 4KL1A 3AG1C 3ZMZA 4GX2A 1Y74B 4Z1VA 5B66Z 1S5HC 1QR8A 1YTFB 1FFXA 1XQ8A 4JASA 1XEQA 5CA3A 3RVYA 1F51A 4JI6O 2AZ0A 3THOA 4I50A 2MW2B 2HLDG 5A2QN 3JAKB 4H44B 5JWPA 3A2FA 4DUZO 1Q82W 4DR6B 1MZEA 3M8AA 4LF4O 3HKCA 4O2AA 1VQ9V 4LF7O 5IT9N 2WPDG 4HNAB 3DXRB 1WAZA 1WLEA 3JATA 2HVKC 4L8JA 4TSFG 2GDSA 5FNVA 2PYJA 4QE7A 4ZHQB 4MW8A 5EC2C 3I56V 3ZMUA 3X2QB 1AR1B 4YXWG 3UCSC 5BR8O 4UCUA 5LP6B 1Q6IA 2JJ2G 2Y69C 1Q5OA 3CEIA 3ASNC 4TUYB 1QCEA 4PJ0Z 3WB1A 1G1XB 1WPXA 1K3EA 1GN2A 1KUQA 1BQZA 5EIBC 4O4LA 4PDVA 3JD1A 2DOSA 2YSUB 3DC5A 5KX5B 1V54B 1T5EA 2B9ZA 5CN0A 3ZMTA 1R3LC 2ZCEA 3IAYA 2K1EA 4D7SA 1TGOA 5LHIA 4IHJA 3JCUZ 2PI5A 1KKDA 1M57C 3ETGA 4Q6GA 4EFEA 1WNSA 3JSNA 4ZOLB 1XNRO 4U7NA 5H5NA 2VRZA 3K0DA 3OE7G 5ITZA 4K8ZA 3W7TA 4G2KA 1KYOF 4N23A 4TQFA 5IY5B 3ABTA 1V55B 3OGIB 2IU3A 2OIEA 2B5UA 1N34B 1MMMA 2ZDIC 4G28B 4OPAA 5LOVA 3KKYA 4DV1O 1TUBA 4U3JB 3H1LH 2R9IA 4P2ZA 2V1DA 4CH4A 2GHYA 2A9HA 1B04A 2RNBA 4DUYO 4X1YA 1JPXA 4XBFA 1GK9A 1P7BA 3ETQA 1WP8A 2EULA 3QVNA 3SGIA 2ADPA 5KA6A 3E8GA 1FAFA 4OGQB 2VWKA 5IWAO 4N21A 3SYOA 3JARB 2CK3G 1ZAUA 4PV1B 2ZXWC 3WB2A 2JGUA 2LGWA 1VF7A 2Y0PA 5EBWC 1KP3A 1AI7A 4LF9B 4MVOA 2OCHA 3AEIA 4U7OA 4DV7B 2XASA 3L9DA 4WBNA 2XUMA 3RVZA 2OTJV 3JSLA 4QNHB 3RBZA 2CTQA 4JV5B 1JA8A 2QSAA 4O4IB 2UXDB 1Q86W 1IURA 4RO2A 3BHPA 3L74H 2JGDB 1NVPB 2F95B 4W4LA 1FS0G 1EZJA 4O4LB 1SA0A 1XHZA 1PL4A 3JAKA 3APQA 2ILMA 3BY6A 1NTKH 3T2MA 3L71H 1HW7A 3EVKA 3OUFA 5K1PA 1N34O 1N8RW 2YUAA 3K58A 4FFKA 3AK3A 2KQXA 4DV3O 1XI1A 3H9VA 1QLNA 5B1NA 3JAMN 1H2SB 4AHCA 3SYAA 3K08A 2Q8VA 5KMGA 4B3SB 2CTRA 1BGYH 3BRCA 2EIJC 4XDJA 1JJOA 4DK1A 1YHQV 4LF8O 5IJ0B 1KMIZ 1PKXA 3N2GA 3LDDA 3CCMV 3TXSA 3ZBHA 1L0NH 1NR7A 3CCVV 3CMEV 4B3MO 4DV5O 1IBMB 4DW1A 5IDJA 2GV9A 1VP7A 4LF5O 5CA1B 1AB3A 2BOBC 1IBKO 4JTCB 4IIJB 4ZOLA 3CYOA 1LUVA 1XNQO 3NXSA 4PELA 2UXXA 3ETEA 3ZX6A 3EFFK 2WLLA 1NVPD 4NTYA 3ZMVA 3GVMA 1UJWB 1SRYA 1GH6A 2IJJA 2ZE5A 5KHJA 3OW2U 4JTDB 3T1YO 1HNWO 2X0LA 3FFQA 4NXNO 5LOVB 4E2LA 4IT5A 1G4YB 5C8YA 3CRCA 3DGEA 1VQLV 1I08A 4ZIBA 1QNMA 2VQFO 2DYSC 2H94A 3GWOA 3T1HO 3HR0A 3JARA 4YJ3B 3F7YC 2DYRB 2YIAA 2Z0AA 3JAWB 4AI8A 3JD3A 3OAAG 4RQFA 2FMLA 4X20B 3W7XA 4PD4F 4Z2WA 3SYQA 3Q4HA 2JVDA 4LFAB 1SZXA 5IYZB 2R9RB 1S3JA 2EJ7A 4B3RB 3FD9A 1Y76B 1SQBH 3DXRA 3BABA 1VQ5V 2PGGA 4I55B 4MTFA 3LDCA 2CGNA 2KKWA 3UQ8A 1PV0A 4I4TA 1DK1A 1F4MA 3ASOB 4W4KA 1YVWA 4DV2O 4OX9B 3ABMC 1XOUA 2Q0AA 2HKOA 1FD9A 5FPRA 3ZRWA 1VIBA 3CP1A 2ZM6O 1AR5A 3U11A 5IJ0A 5LA6B 1WB7A 4GKKO 5LGNA 1BQ0A 5KHHA 2P22C 2LW1A 5H9CA 3JASB 4LNUA 2AGAA 3MD0A 3K5NA 1MSDA 2DMXA 2P7TC 1N0NA 2M6YA 4JAUA 4UV9A 2D3OW 2HFEC 4FMTA 2XNDG 4GT1A 5CA1A 2XAFA 4JYAO 4FZ0A 1H2GA 3GB7C 1YTFD 4HAMA 2EIMB 3AG4B 2JEXA 1MG1A 4UXNA 2YC0A 3K5MA 1TUEB 1OCOB 1WA8A 3QG5A 5B5EZ 5J2UB 2JS5A 2X6CA 3E22B 2DQ3A 4JPRA 3CD6V 3UO3A 3O9OA 3QO5A 3KZIZ 3IC9A 5JVDB 3NR7A 3JYCA 1YEWA 2E5LB 1UPGA 1BMFG 1X4TA 3OM3B 1AROP 4O2BB 3HKDB 4C7UA 4FIPC 2ZM6B 2JGDA 4GKKB 2QM8A 2OWOA 2W6JG 3UT5A 3K5LA 2F43G 3VQYA 1RFYA 2CDYA 2QWPB 2HP8A 1M56C 3FB5C 4NXMB 3T1CA 1J5EB 4JI3O 2OCCB 4JI7O 2F1MA 3CE2A 1F4NA 1NR1A 4JYAB 3CCQV 1P7GA 1GTOA 2E74B 2Q0OC 2EINB 2BTOA 4I55A 1XNQB 3I5DA 4K0KO 5EC1C 1VF6C 3QNEA 5J2TA 1XILA 4R50A 1TA8A 4JI8B 3K0GA 2XAHA 2RCVA 1N33B 3RYIB 4YHHB 4JI1B 4TV8A 3H1HH 4KP4A 2CE4A 2ZE7A 4JI5O 1W2BU 5LBQA 1FXKB 3SPIA 2Z5UA 5GTHZ 3CRRA 3IFXA 3N2KB 4FLVA 5B1BB 2WLMA 5LL6Y 4P30A 1Y67A 2ZQMA 1QR9A 1JMKC 3JALA 2KSDA 1FXVA 4DR7O 1S76D 3K9SA 1RM1C 2O57A 2W0XA 4NVPA 4X64B 5FLXN 2P4KA 1F7YA 2EJRA 3L73H 3J80N 3E86A 3OUSA 4DR5B 3AG3C 4B08A 2LJ2A 4XDLA 4D6TH 1KU9A 2W6IG 1NJIW 2R72A 3SPHA 3K3WA 1BS3A 3UM7A 5L3GA 5TISZ 2Y4TA 1N32O 5C8YB 3OT7A 5KA5A 3OEHG 2E3CA 2IBZH 1H2MA 4PHZA 4AQYB 3ZIAG 3D8CA 4NKGB 3BAAA 2YDEA 5LP6A 2DYSB 2WLHA 2EZOA 4QPJA 2QA4V 1GM9A 4CC6A 4UB6Z 1EM1A 2NR5A 3LUTB 1PPJH 1L1FA 2KG7A 3RFRA 2XAJA 5LXTA 1ZTEA 4IHJB 1US6A 4HNAA 2WA3A 1Z5WA 2CUGA 3H1IH 4X1IA 2XAQA 3BEHA 4FLXA 2HHHO 4BIZA 5IYZA 3ZS8C 1YI2V 1DGSA 4DUZB 2MK3A 5BZBA 4I0XA 2QWQB 3TJTA 4CBCA 2Q6AA 1FJGB 3BA9A 5CB4A 1R6NA 4RUFA 2AHZA 4JI6B 4GKJO 1X59A 4AILC 5EK0A 1VMGA 4DK0A 1FXKA 2PTMA 4FZ1A 3WG7C 1XMQB 1TVKA 1SERA 3E8FA 1CP9A 3SPGA 3CJHB 4LH7A 3WB0A 3ASOC 3ZRSA 1RSOB 2PY5A 3PN1A 2LQTA 3VQWA 3ABMB 4TWKA 2A79B 3ABUA 4DV0B 3CB2A 1E1QG 1MA1A 3S3WA 5L3CA 2QKAA 2UUCB 1M90W 1E1RG 4B3TO 4UCVA 3QO7A 4DV4B 2XOKG 1W0KG 2H8PC 4MVMA 2N05A 5AG2A 4U3JA 1KBHA 3CCJV 2ADQB 4WBNB 3I55V 4E4EA 1M5IA 2YXYA 1AJQA 2F4VB 1XL4A 1XMQO 1QLEB 1P84F 3CRAA 1BCCH 2G38A 5B3SB 4WF9V 4P9OA 3HKDA 4LFCB 5GONB 3OTOB 1FKAO 2NLJC 2GBOA 4WFEA 2EIKC 3SJQC 2ZR2A 4K35A 1M93A 2UUCO 4RUEA 3RT3C 1OCOC 5LGTA 1B06A 2D2CB 3UT5B 4J7KA 2N04A 4DR3B 3F5TA 3E22A 4DV6B 5EYPB 4Z1MG 1S77D 1KP2A 1PNLA 4X66O 1VQOV 4LR3A 3B2EE 4JAAA 2YI8A 3JATB 4FM2A 2QWRB 5CA0B 1O9HA 3CRMA 4QIWF 4JAVA 1YF2A 4H13B 1CEZA 1SS3A 3ZEDA 1OCCB 2UXCO 4PDRA 4I7ZB 1HWYA 4DUYB 2P4VA 4LBEC 4PA3A 1BZKA 1VQ6V 1SC5B 3K5OA 4RWUA 4LFCO 1EN5A 1N36O 2PYLA 3ABLB 1ZUQA 4X66B 1M56B 1VQKV 3N2KA 1LNQA 3A0HZ 2YIBA 4DRXB 1OCZC 2XAGA 2WLIB 5B1OA 1XHXA 1NH2D 1AP5A 1Q8IA 4TV9A 1WN7A 3R65A 1ZX3A 3LNNA 3B77A 4RAIA 2PZSA 4X64O 5J2TB 4UCSA 3ZJZA 2CAZC 4LFBB 2QDOA 1VF5B 2P06A 3ZHVA 1QU7A 2E76B 1RSOA 2P6JA 3KCXA 2A06H 1R73A 2GTAA 5JH7A 2ZNJA 4JYYA 4NTWA 1SF9A 3CWBH 4I5SA 2AHYA 4JI5B 2Q7GA 4H0LB 1I94O 4EB6B 4B7EA 3IJ4A 4UVCA 5GONA 2WLJA 1WP7A 1F23A 4PA6A 3BCCH 4J80A 1VEWA 3H1JH 3AG3B 2CH7A 3ZHRA 1XBLA 1IVSA 4B3SO 1Y76A 1ZL8B 3TXQA 4YJ2A 4FLUA 4D7TA 1N0JA 3OFNG 1K97A 1ROPA 3FX7A 2P5OA 2X6BA 2QJ1A 1AI6A 5LP6C 3SYCA 2EILC 3AG7A 3P30A 1Z2GA 3JAWA 2QWNB 2ZKOA 4ZHQA 4JYBA 4CZZA 2ATKC 2Q68A 1B6QA 3FB7C 1GM8A 1YJNV 4FLYA 4TUYA 3P32A 1R3IC 3KG2A 4UCOA 2F23A 1JVMA 2FKXA 2GTSA 5EYPA 1MNGA 1Z5VA 5KX5A 2C2AA 4X1IB 1SQGA 5E79Z 2PI4A 4DR6O 2XTAA 2BTQB 1I5YA 4FFBA 3JD0A 1SESA 3OGCC 4I0XB 4PA7A 4B7KA 2Y48A 4X8AA 5DEDA 4EEQA 1GN3A 4B3RO 1K4CC 4KHPB 3G4SV 1KECA 3LSUA 4DR1B 1EN6A 1HR0B 5IJ9B 5JJEB 2PUSA 5CBHA 2Y0IA 1A32A 1SZTA 3K03A 4IL6Z 3ZHQA 2HR3A 3WFVA 4IGGA 3ZRWB 3SJCC 4KFMA 1Q43A 4J42A 2ARHA 2QE7G 3AK1A 5CBFA 5E1AC 1DLBA 4DO2A 4H33A 1FPOA 3JASA 5FL7G 3K04A 4R7CA 3C90A 4PDLA 4DR1O 1HR0O 2CGOA 3OEEG 3OTOO 1IBMO 3K59A 3E8BA 4WFHA 3RYCB 1ZL8A 1NI8A 3CHXA 2X6AA 1YJ9V 1VQ4V 1XMOO 4KUMA 3JCZA 1G8MA 2M7WA 4YIOA 1RP3B 5BR8B 1W0JG 1QVFU 4F6EA 1O9GA 1K92A 5JQGA 2PF4E 4DV1B 2YIBD 2GUZA 3E83A 4ZI7B 5IYCO 5C93A 2Z3YA 1R1BA 1XREA 2B1IA 2X7RB 3HKEB 4GZRB 2Q7HA 1I94B 3G71V 4O4IA 4NR1A 3AG2B 4CS3A 2BE3A 4BIUA 1NTZH 5LMUO 1K33A 4WCEV 4K3AA 2YEVB 3C3SA 3ZRVA 3ZHSA 2BTQA 2AXTZ 3IGAC 4OPHA 3L70H 3VQVA 1LUWA 5LHHA 2DWEC 2GSMB 2ZIMA 3VBBA 1ZWIC 1XMOB 1P49A 2BSKA 1M9NA 1GAXA 2ZD9A 4DR4O 3X2QC 3BVOA 1KQSU 2Y69B 1JQ0A 1RPOA 2ZR3A 4LFAO 2RJZA 5FPOA 4BAYA 2V4DA 1V9PA 4EKWA 1YZBA 4BWAA 3ABLC 4MTGA 5LGUA 1GN6A 1QHTA 4GX5A 2QR4A 4IIJA 3STZC 3ZMSA 1OCZB 2L35A 1K5SA 3SJAC 4TV9B 3RGBA 3JD2A 1NU1H 2ZDIA 5HFMA 4FLWA 4G27B 3TK1A 3G6BA 3U0ZA 1M4UA 4OX9O 1GO3F 2FB5A 4RQEA 5IY5C 1SETA 1V55C 5KAFZ 3HB3B 4I9WA 5LMUB 1QVGU 2ITCC 4NB5A 1W59A 4JI8O 1J95A 2IH3C 4DR3O 5JQGB 1Q6UA 4JI0O 2JRIA 5KAIZ 1SQVH 3KCYA 2JIZG 1AVMA 2NN4A 2EBOA 2JEUA 1FFXB 3O65A 2QKSA 4JI7B 3CS5A 4FVMA 3L72H 3SYPA 5LXTB 5KUKA 3RYCA 4PA9A 3CXCU 2ZXWB 4O2AB 3A0RA 4O4JA 3UO2A 4FK5C 1R6TA 1MSWD 5KHGA 2UU9B 2GUZB 5FNVB 2WAMA 2ETNA 4ABMA 4F4LA 4FFBB 1XNRB 1FXHA 1VF6A 4KXRA 4MW3A 1LR1A 2ITDC 2F93B 2EILB 2FTKA 4FM1A 1RPRA 5BY1A 1E79G 4YY3O 3BA8A 2QEXV 5IE9A 1GN4A 2JDIG 1IXBA 4J9ZB 4PA4A 3W7WA 3BFRA 4JZ2A 2A3QA 4MVUA 4X1KA 3G80A 5LMNO 2W0FC 1H2NA 1NQTA 4AQYO 4J7JA 3SPJA 4ZKIA 2HJFC 2HVJC 3U10A 5K1XA 5B1AB 2BSKB 1AP6A 1AI5A 4TOIA 4LFBO 2RDCA 4UCTA 3D36A 1JOYA 1GM7A 4X9QA 4MVZA 5IWAB 3FB8C 1SQQH 5EZYA 3DSQA 1PM9A 4CH6A 2NNUA 3S3XA 1HNWB 3RYIA 1XUQA 4J9YB 3K57A 1H2KA 5L3DA 1HNZB 4CH5A 5DECA 1KKCA 2EIMC 1Q7YW 3AG4C 2IM9A 3ABKB 1K7DA 1D5NA 1YITV 1S72V 3AK2A
chains in the Genus database with same CATH topology
5TISZ 4IL6Z 5GTHZ 3KZIZ 4UB6Z 5H2FZ 3WU2Z 3JCUZ 4PJ0Z 1S5LZ 5KAIZ 5KAFZ 5B5EZ 3A0BZ 5GTIZ 5B66Z 3A0HZ 4UB8Z 5E79Z 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS Z;  4IL6 Z;  5GTH Z;  3KZI Z;  4UB6 Z;  5H2F Z;  3WU2 Z;  3JCU Z;  4PJ0 Z;  1S5L Z;  5KAI Z;  5KAF Z;  5B5E Z;  3A0B Z;  5GTI Z;  5B66 Z;  3A0H Z;  4UB8 Z;  5E79 Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 4ZI7 A;  4JV5 O;  3FYI B;  4LC1 A;  2RQ6 A;  1NZ6 A;  2QGN A;  4QJF B;  5BMV B;  4JI1 O;  1N4C A;  3C3T A;  2OYQ A;  1VQ7 V;  4HZ3 A;  4GX1 A;  4O4H A;  4DW0 A;  4Q20 A;  4YY3 B;  4WFF A;  2IU0 A;  5L3F A;  3ETD A;  3APO A;  2Y4U A;  2R9A A;  3J81 N;  5EBL C;  1IXM A;  2A7W A;  3G6E V;  4CS2 A;  2JS3 A;  3GWK C;  3UKM A;  5CA0 A;  1IX9 A;  3EXA A;  4QE9 A;  3VQX A;  5IYD O;  5JVD A;  1PNM A;  5LHG A;  4YJ3 A;  2F66 C;  4LCU C;  3HPL C;  1L0L H;  1H38 A;  3A8T A;  2WLK A;  4MVS A;  3TGU H;  4NYK A;  3FKS G;  4CH3 A;  1YCI A;  1COW G;  2BCC H;  2B1G A;  1JFF B;  3E2E A;  2WA4 A;  4R8C A;  5CBG A;  3WU2 Z;  1GKF A;  4FLT A;  1BL8 A;  3AG2 C;  4YIP A;  3J7A U;  4O4J B;  5GTI Z;  5H6R A;  1S5L Z;  3ML0 A;  3W7U A;  1JCH A;  4GUN A;  2WLI A;  4HYO A;  3CRQ A;  1VQP V;  4GCZ A;  4LF5 B;  5KLV H;  1BE3 H;  1D5A A;  2YID A;  1IBK B;  1NKD A;  1P4R A;  3SR2 C;  1Y6X A;  5KHK A;  4DV7 O;  2DJV A;  3N2G B;  2VS0 A;  1THZ A;  2ODM A;  2YI9 A;  1FXK C;  4NXM O;  1AJP A;  1ENV A;  1K34 A;  5B1B C;  3CCS V;  2OT5 A;  1TUB B;  4HBN A;  1BT8 A;  2P90 A;  5F2V O;  5LYJ B;  1ZSP A;  5EBM C;  4X62 O;  1YJW V;  1RM1 B;  1SKV A;  1OCR C;  3DC6 A;  4GKJ B;  4UVB A;  5JJJ B;  5BMV A;  1JR9 A;  1HNX B;  2UXD O;  5EZY B;  1R3J C;  1BHA A;  3H1K H;  3B8N A;  2CH7 B;  1Q3E A;  4JI2 O;  1ORQ C;  3M99 B;  1U97 A;  3OMN B;  3PJS K;  3ZHT A;  2Q4P A;  3P3N A;  4DV0 O;  3H01 A;  1TAE A;  4LF6 O;  2Q73 A;  5KHI A;  2QTO A;  2HEP A;  1OHH G;  4QPK A;  4X1Y B;  3FB6 C;  4DR5 O;  2R70 A;  1K9M W;  4BW5 A;  3EHB B;  3M7M X;  2N74 A;  3ZN1 A;  4J41 A;  2E75 B;  3RWR D;  2KB1 A;  5J9P C;  4CS4 A;  2QM4 A;  2H3O A;  3B8M A;  3IC7 A;  2IJI A;  1AI4 A;  3ZCC A;  2XHB A;  4NTX A;  4LP8 A;  3OTF A;  2HG5 C;  2DE0 X;  2FYU H;  3W7S A;  4X89 A;  5GW7 A;  4ICG A;  1PP9 H;  2A0L A;  3LNM B;  1QQC A;  2LW7 A;  4ZBM A;  3MHS C;  1DF4 A;  4ASU G;  2UUA O;  4DYL A;  3K79 A;  2DQ0 A;  3WG7 B;  2WLN A;  3D3I A;  3FYE B;  3T1Y B;  2QTS A;  3FAV B;  1YSC A;  4MTO A;  2JJ1 G;  2ZIN A;  3LDE A;  4FLZ A;  1HNZ O;  4X1K B;  2HJD A;  2OCC C;  4LF6 B;  3D36 C;  2YS8 A;  3ZRX A;  2DWD C;  4JI0 B;  3CCE V;  1Y66 A;  2LFR A;  2P67 A;  4DRX A;  5LMN B;  1KC8 W;  4MS2 A;  4U3F H;  4DV3 B;  2UUA B;  2LO1 A;  1MAB G;  5B1A C;  4MVR A;  3G67 A;  1SQX H;  2UXB B;  5KMG B;  2WLL B;  2EIN C;  2UXC B;  4JGS A;  4DR7 B;  4UV8 A;  3CMA V;  4MVQ A;  4DR2 O;  1IDS A;  2UUB B;  2RMK B;  2Q5Z A;  1AJN A;  2VQE B;  4JZG A;  4R6Z A;  2QWO B;  3R66 A;  3OMA B;  2OIG A;  4MT8 A;  3D3Q A;  3STL C;  3T4D A;  1XDC A;  5HFL A;  4FJC C;  4LWS A;  1G6U A;  3AG1 B;  4A5U B;  4F6R A;  3E89 A;  5B3S C;  3ABK C;  1FYJ A;  2ZT9 B;  4K8X A;  3CC7 V;  4EB6 A;  4EFB A;  1GRJ A;  4X65 O;  2UUB O;  4XDK A;  2HHH B;  1JFF A;  3CCR V;  1BHB A;  3RYF A;  3B09 A;  1HNX O;  2UU9 O;  1XL6 A;  4FPP A;  4GLX A;  4X20 A;  4JI4 O;  1B3Q A;  4I9Q A;  1VQ8 V;  1FJG O;  2F4V O;  1J5E O;  4OXS A;  5L3B A;  5BXZ A;  4YJ2 B;  4P9P A;  1OV9 A;  2LGQ A;  1R3K C;  5H2F Z;  3K06 A;  4IYH A;  3N27 A;  2Q7E A;  4J11 A;  3ASN B;  3HKE A;  4DV2 B;  4X65 B;  2IW5 A;  1OCC C;  4K0K B;  2KG7 B;  3LSS A;  3T1H B;  1V54 C;  2EZP A;  4LF4 B;  3SPC A;  3OD4 A;  1AR4 A;  3MHH C;  3HKB B;  1N33 O;  3JD4 A;  4CC5 A;  1M57 B;  2ZE8 A;  2CTP A;  2AZ2 A;  3Q4H B;  3CPW U;  3OMI B;  1Q81 W;  1HDJ A;  2XT9 A;  4JI4 B;  2DW4 A;  1PNK A;  3RYH B;  1MOF A;  1PD3 A;  3CCL V;  4MSW C;  5H6Q A;  1NT2 B;  4WFB V;  1EN4 A;  4B3T B;  2E5L O;  1VAR A;  1DF5 A;  5EIB D;  2JK5 C;  3QO8 A;  1TVK B;  1NS1 A;  4TV8 B;  2Q69 A;  3CJH A;  1S0V A;  1GMG A;  4I4T B;  3T4Z A;  5D5Q A;  4BIO A;  5JCO C;  2DN9 A;  2YXH A;  5IJ9 A;  2IH1 C;  2RN9 A;  4DXW A;  2QKC A;  4LWS B;  1CPY A;  3F5W C;  4B3M B;  1AIL A;  5JH7 B;  3L75 H;  1JJ2 U;  5LYJ A;  2YIC A;  3CXH F;  3JAL B;  3RW0 A;  4BR6 A;  1N36 B;  5ITZ B;  2IJK A;  4JI3 B;  4UVA A;  1R6K A;  1H8E G;  1OCR B;  4JTA B;  4UUJ C;  1Y74 A;  1H8H G;  1I0H A;  3B4S A;  1Q90 D;  4DV5 B;  4LF7 B;  5LA6 A;  4LF9 O;  5A9G A;  1ZLZ A;  4LNU B;  1WJZ A;  5J2U A;  1MZF A;  2ZIO A;  3P3P A;  3SDL A;  3HKC B;  1WPB A;  4GX0 A;  2WSS G;  2VQE O;  4DV6 O;  5JJN B;  2UXN A;  4IYI A;  4DR4 B;  3DTU B;  4J7Z A;  1NH2 B;  4JF3 A;  3CX5 F;  3ICX A;  4X88 A;  3OR6 C;  3CCU V;  1EFR G;  4JYC A;  1SQF A;  2ZNI A;  3E8H A;  1QLE C;  1OZ0 A;  1EZV H;  4PI2 A;  1SA0 B;  1M1K W;  1L8D A;  1Q6H A;  1HP8 A;  4GYC B;  4NXN B;  3RN4 A;  3LSQ A;  1Y4M A;  3HKB A;  5IYB O;  1WA8 B;  2EIK B;  2Q9L A;  1VQN V;  3ZHU A;  4I50 B;  3MAQ A;  2FL4 A;  1CXZ B;  1H2L A;  1QBZ A;  3CC2 V;  4LH6 A;  3SJB C;  2OTL V;  2YEV A;  1IBL O;  2Q67 A;  5KUM A;  2WWW A;  1PL0 A;  4PDM A;  4FM0 A;  3TET A;  5CMU A;  1I5X A;  3QTC A;  1URF A;  3BPZ A;  5CB4 B;  2EIJ B;  4YHH O;  1DTO A;  1K4D C;  2AW9 A;  1YXB A;  4O2B A;  2IJH A;  1NTM H;  5DN6 G;  4UCR A;  2QM7 A;  3F7V C;  4DV4 O;  1FFT B;  3B40 A;  4DR2 B;  3FAV A;  1IZ3 A;  1KD1 W;  1U96 A;  3MDS A;  4X62 B;  5DM6 V;  3OR7 C;  3ZN0 A;  1N32 B;  4L87 A;  4QGP A;  4BW9 A;  1OJH A;  4MTX A;  5JCO A;  4TQD A;  3CSX A;  2V7Q G;  3RYH A;  1UFI A;  2BOC C;  4F6R B;  3QF7 A;  2YXL A;  4JI2 B;  1KB9 F;  3TCU A;  2LFS A;  4KHP O;  4LF8 B;  1VQM V;  1K73 W;  4UFZ A;  1YDX A;  2LP7 A;  4O4H B;  1D2D A;  1K5Q A;  2EX3 A;  4H37 A;  1I7F A;  4WFA V;  4TT3 G;  1SQP H;  2L6L A;  2CTW A;  1K8A W;  1JX9 A;  1BSM A;  1YIJ V;  3CC4 V;  2VQF B;  3RYF B;  4WFG A;  5L3E A;  1EBO A;  2UXB O;  2ZE6 A;  3K9A A;  3A0B Z;  2K9P A;  3VOU A;  3E35 A;  1NBM G;  5D5P A;  1S5J A;  4J10 A;  1WB8 A;  4PI0 A;  1IBL B;  4UB8 Z;  2VWJ A;  2DYR C;  4KL1 A;  3AG1 C;  3ZMZ A;  4GX2 A;  1Y74 B;  4Z1V A;  5B66 Z;  1S5H C;  1QR8 A;  1YTF B;  1FFX A;  1XQ8 A;  4JAS A;  1XEQ A;  5CA3 A;  3RVY A;  1F51 A;  4JI6 O;  2AZ0 A;  3THO A;  4I50 A;  2MW2 B;  2HLD G;  5A2Q N;  3JAK B;  4H44 B;  5JWP A;  3A2F A;  4DUZ O;  1Q82 W;  4DR6 B;  1MZE A;  3M8A A;  4LF4 O;  3HKC A;  4O2A A;  1VQ9 V;  4LF7 O;  5IT9 N;  2WPD G;  4HNA B;  3DXR B;  1WAZ A;  1WLE A;  3JAT A;  2HVK C;  4L8J A;  4TSF G;  2GDS A;  5FNV A;  2PYJ A;  4QE7 A;  4ZHQ B;  4MW8 A;  5EC2 C;  3I56 V;  3ZMU A;  3X2Q B;  1AR1 B;  4YXW G;  3UCS C;  5BR8 O;  4UCU A;  5LP6 B;  1Q6I A;  2JJ2 G;  2Y69 C;  1Q5O A;  3CEI A;  3ASN C;  4TUY B;  1QCE A;  4PJ0 Z;  3WB1 A;  1G1X B;  1WPX A;  1K3E A;  1GN2 A;  1KUQ A;  1BQZ A;  5EIB C;  4O4L A;  4PDV A;  3JD1 A;  2DOS A;  2YSU B;  3DC5 A;  5KX5 B;  1V54 B;  1T5E A;  2B9Z A;  5CN0 A;  3ZMT A;  1R3L C;  2ZCE A;  3IAY A;  2K1E A;  4D7S A;  1TGO A;  5LHI A;  4IHJ A;  3JCU Z;  2PI5 A;  1KKD A;  1M57 C;  3ETG A;  4Q6G A;  4EFE A;  1WNS A;  3JSN A;  4ZOL B;  1XNR O;  4U7N A;  5H5N A;  2VRZ A;  3K0D A;  3OE7 G;  5ITZ A;  4K8Z A;  3W7T A;  4G2K A;  1KYO F;  4N23 A;  4TQF A;  5IY5 B;  3ABT A;  1V55 B;  3OGI B;  2IU3 A;  2OIE A;  2B5U A;  1N34 B;  1MMM A;  2ZDI C;  4G28 B;  4OPA A;  5LOV A;  3KKY A;  4DV1 O;  1TUB A;  4U3J B;  3H1L H;  2R9I A;  4P2Z A;  2V1D A;  4CH4 A;  2GHY A;  2A9H A;  1B04 A;  2RNB A;  4DUY O;  4X1Y A;  1JPX A;  4XBF A;  1GK9 A;  1P7B A;  3ETQ A;  1WP8 A;  2EUL A;  3QVN A;  3SGI A;  2ADP A;  5KA6 A;  3E8G A;  1FAF A;  4OGQ B;  2VWK A;  5IWA O;  4N21 A;  3SYO A;  3JAR B;  2CK3 G;  1ZAU A;  4PV1 B;  2ZXW C;  3WB2 A;  2JGU A;  2LGW A;  1VF7 A;  2Y0P A;  5EBW C;  1KP3 A;  1AI7 A;  4LF9 B;  4MVO A;  2OCH A;  3AEI A;  4U7O A;  4DV7 B;  2XAS A;  3L9D A;  4WBN A;  2XUM A;  3RVZ A;  2OTJ V;  3JSL A;  4QNH B;  3RBZ A;  2CTQ A;  4JV5 B;  1JA8 A;  2QSA A;  4O4I B;  2UXD B;  1Q86 W;  1IUR A;  4RO2 A;  3BHP A;  3L74 H;  2JGD B;  1NVP B;  2F95 B;  4W4L A;  1FS0 G;  1EZJ A;  4O4L B;  1SA0 A;  1XHZ A;  1PL4 A;  3JAK A;  3APQ A;  2ILM A;  3BY6 A;  1NTK H;  3T2M A;  3L71 H;  1HW7 A;  3EVK A;  3OUF A;  5K1P A;  1N34 O;  1N8R W;  2YUA A;  3K58 A;  4FFK A;  3AK3 A;  2KQX A;  4DV3 O;  1XI1 A;  3H9V A;  1QLN A;  5B1N A;  3JAM N;  1H2S B;  4AHC A;  3SYA A;  3K08 A;  2Q8V A;  5KMG A;  4B3S B;  2CTR A;  1BGY H;  3BRC A;  2EIJ C;  4XDJ A;  1JJO A;  4DK1 A;  1YHQ V;  4LF8 O;  5IJ0 B;  1KMI Z;  1PKX A;  3N2G A;  3LDD A;  3CCM V;  3TXS A;  3ZBH A;  1L0N H;  1NR7 A;  3CCV V;  3CME V;  4B3M O;  4DV5 O;  1IBM B;  4DW1 A;  5IDJ A;  2GV9 A;  1VP7 A;  4LF5 O;  5CA1 B;  1AB3 A;  2BOB C;  1IBK O;  4JTC B;  4IIJ B;  4ZOL A;  3CYO A;  1LUV A;  1XNQ O;  3NXS A;  4PEL A;  2UXX A;  3ETE A;  3ZX6 A;  3EFF K;  2WLL A;  1NVP D;  4NTY A;  3ZMV A;  3GVM A;  1UJW B;  1SRY A;  1GH6 A;  2IJJ A;  2ZE5 A;  5KHJ A;  3OW2 U;  4JTD B;  3T1Y O;  1HNW O;  2X0L A;  3FFQ A;  4NXN O;  5LOV B;  4E2L A;  4IT5 A;  1G4Y B;  5C8Y A;  3CRC A;  3DGE A;  1VQL V;  1I08 A;  4ZIB A;  1QNM A;  2VQF O;  2DYS C;  2H94 A;  3GWO A;  3T1H O;  3HR0 A;  3JAR A;  4YJ3 B;  3F7Y C;  2DYR B;  2YIA A;  2Z0A A;  3JAW B;  4AI8 A;  3JD3 A;  3OAA G;  4RQF A;  2FML A;  4X20 B;  3W7X A;  4PD4 F;  4Z2W A;  3SYQ A;  3Q4H A;  2JVD A;  4LFA B;  1SZX A;  5IYZ B;  2R9R B;  1S3J A;  2EJ7 A;  4B3R B;  3FD9 A;  1Y76 B;  1SQB H;  3DXR A;  3BAB A;  1VQ5 V;  2PGG A;  4I55 B;  4MTF A;  3LDC A;  2CGN A;  2KKW A;  3UQ8 A;  1PV0 A;  4I4T A;  1DK1 A;  1F4M A;  3ASO B;  4W4K A;  1YVW A;  4DV2 O;  4OX9 B;  3ABM C;  1XOU A;  2Q0A A;  2HKO A;  1FD9 A;  5FPR A;  3ZRW A;  1VIB A;  3CP1 A;  2ZM6 O;  1AR5 A;  3U11 A;  5IJ0 A;  5LA6 B;  1WB7 A;  4GKK O;  5LGN A;  1BQ0 A;  5KHH A;  2P22 C;  2LW1 A;  5H9C A;  3JAS B;  4LNU A;  2AGA A;  3MD0 A;  3K5N A;  1MSD A;  2DMX A;  2P7T C;  1N0N A;  2M6Y A;  4JAU A;  4UV9 A;  2D3O W;  2HFE C;  4FMT A;  2XND G;  4GT1 A;  5CA1 A;  2XAF A;  4JYA O;  4FZ0 A;  1H2G A;  3GB7 C;  1YTF D;  4HAM A;  2EIM B;  3AG4 B;  2JEX A;  1MG1 A;  4UXN A;  2YC0 A;  3K5M A;  1TUE B;  1OCO B;  1WA8 A;  3QG5 A;  5B5E Z;  5J2U B;  2JS5 A;  2X6C A;  3E22 B;  2DQ3 A;  4JPR A;  3CD6 V;  3UO3 A;  3O9O A;  3QO5 A;  3KZI Z;  3IC9 A;  5JVD B;  3NR7 A;  3JYC A;  1YEW A;  2E5L B;  1UPG A;  1BMF G;  1X4T A;  3OM3 B;  1ARO P;  4O2B B;  3HKD B;  4C7U A;  4FIP C;  2ZM6 B;  2JGD A;  4GKK B;  2QM8 A;  2OWO A;  2W6J G;  3UT5 A;  3K5L A;  2F43 G;  3VQY A;  1RFY A;  2CDY A;  2QWP B;  2HP8 A;  1M56 C;  3FB5 C;  4NXM B;  3T1C A;  1J5E B;  4JI3 O;  2OCC B;  4JI7 O;  2F1M A;  3CE2 A;  1F4N A;  1NR1 A;  4JYA B;  3CCQ V;  1P7G A;  1GTO A;  2E74 B;  2Q0O C;  2EIN B;  2BTO A;  4I55 A;  1XNQ B;  3I5D A;  4K0K O;  5EC1 C;  1VF6 C;  3QNE A;  5J2T A;  1XIL A;  4R50 A;  1TA8 A;  4JI8 B;  3K0G A;  2XAH A;  2RCV A;  1N33 B;  3RYI B;  4YHH B;  4JI1 B;  4TV8 A;  3H1H H;  4KP4 A;  2CE4 A;  2ZE7 A;  4JI5 O;  1W2B U;  5LBQ A;  1FXK B;  3SPI A;  2Z5U A;  5GTH Z;  3CRR A;  3IFX A;  3N2K B;  4FLV A;  5B1B B;  2WLM A;  5LL6 Y;  4P30 A;  1Y67 A;  2ZQM A;  1QR9 A;  1JMK C;  3JAL A;  2KSD A;  1FXV A;  4DR7 O;  1S76 D;  3K9S A;  1RM1 C;  2O57 A;  2W0X A;  4NVP A;  4X64 B;  5FLX N;  2P4K A;  1F7Y A;  2EJR A;  3L73 H;  3J80 N;  3E86 A;  3OUS A;  4DR5 B;  3AG3 C;  4B08 A;  2LJ2 A;  4XDL A;  4D6T H;  1KU9 A;  2W6I G;  1NJI W;  2R72 A;  3SPH A;  3K3W A;  1BS3 A;  3UM7 A;  5L3G A;  5TIS Z;  2Y4T A;  1N32 O;  5C8Y B;  3OT7 A;  5KA5 A;  3OEH G;  2E3C A;  2IBZ H;  1H2M A;  4PHZ A;  4AQY B;  3ZIA G;  3D8C A;  4NKG B;  3BAA A;  2YDE A;  5LP6 A;  2DYS B;  2WLH A;  2EZO A;  4QPJ A;  2QA4 V;  1GM9 A;  4CC6 A;  4UB6 Z;  1EM1 A;  2NR5 A;  3LUT B;  1PPJ H;  1L1F A;  2KG7 A;  3RFR A;  2XAJ A;  5LXT A;  1ZTE A;  4IHJ B;  1US6 A;  4HNA A;  2WA3 A;  1Z5W A;  2CUG A;  3H1I H;  4X1I A;  2XAQ A;  3BEH A;  4FLX A;  2HHH O;  4BIZ A;  5IYZ A;  3ZS8 C;  1YI2 V;  1DGS A;  4DUZ B;  2MK3 A;  5BZB A;  4I0X A;  2QWQ B;  3TJT A;  4CBC A;  2Q6A A;  1FJG B;  3BA9 A;  5CB4 A;  1R6N A;  4RUF A;  2AHZ A;  4JI6 B;  4GKJ O;  1X59 A;  4AIL C;  5EK0 A;  1VMG A;  4DK0 A;  1FXK A;  2PTM A;  4FZ1 A;  3WG7 C;  1XMQ B;  1TVK A;  1SER A;  3E8F A;  1CP9 A;  3SPG A;  3CJH B;  4LH7 A;  3WB0 A;  3ASO C;  3ZRS A;  1RSO B;  2PY5 A;  3PN1 A;  2LQT A;  3VQW A;  3ABM B;  4TWK A;  2A79 B;  3ABU A;  4DV0 B;  3CB2 A;  1E1Q G;  1MA1 A;  3S3W A;  5L3C A;  2QKA A;  2UUC B;  1M90 W;  1E1R G;  4B3T O;  4UCV A;  3QO7 A;  4DV4 B;  2XOK G;  1W0K G;  2H8P C;  4MVM A;  2N05 A;  5AG2 A;  4U3J A;  1KBH A;  3CCJ V;  2ADQ B;  4WBN B;  3I55 V;  4E4E A;  1M5I A;  2YXY A;  1AJQ A;  2F4V B;  1XL4 A;  1XMQ O;  1QLE B;  1P84 F;  3CRA A;  1BCC H;  2G38 A;  5B3S B;  4WF9 V;  4P9O A;  3HKD A;  4LFC B;  5GON B;  3OTO B;  1FKA O;  2NLJ C;  2GBO A;  4WFE A;  2EIK C;  3SJQ C;  2ZR2 A;  4K35 A;  1M93 A;  2UUC O;  4RUE A;  3RT3 C;  1OCO C;  5LGT A;  1B06 A;  2D2C B;  3UT5 B;  4J7K A;  2N04 A;  4DR3 B;  3F5T A;  3E22 A;  4DV6 B;  5EYP B;  4Z1M G;  1S77 D;  1KP2 A;  1PNL A;  4X66 O;  1VQO V;  4LR3 A;  3B2E E;  4JAA A;  2YI8 A;  3JAT B;  4FM2 A;  2QWR B;  5CA0 B;  1O9H A;  3CRM A;  4QIW F;  4JAV A;  1YF2 A;  4H13 B;  1CEZ A;  1SS3 A;  3ZED A;  1OCC B;  2UXC O;  4PDR A;  4I7Z B;  1HWY A;  4DUY B;  2P4V A;  4LBE C;  4PA3 A;  1BZK A;  1VQ6 V;  1SC5 B;  3K5O A;  4RWU A;  4LFC O;  1EN5 A;  1N36 O;  2PYL A;  3ABL B;  1ZUQ A;  4X66 B;  1M56 B;  1VQK V;  3N2K A;  1LNQ A;  3A0H Z;  2YIB A;  4DRX B;  1OCZ C;  2XAG A;  2WLI B;  5B1O A;  1XHX A;  1NH2 D;  1AP5 A;  1Q8I A;  4TV9 A;  1WN7 A;  3R65 A;  1ZX3 A;  3LNN A;  3B77 A;  4RAI A;  2PZS A;  4X64 O;  5J2T B;  4UCS A;  3ZJZ A;  2CAZ C;  4LFB B;  2QDO A;  1VF5 B;  2P06 A;  3ZHV A;  1QU7 A;  2E76 B;  1RSO A;  2P6J A;  3KCX A;  2A06 H;  1R73 A;  2GTA A;  5JH7 A;  2ZNJ A;  4JYY A;  4NTW A;  1SF9 A;  3CWB H;  4I5S A;  2AHY A;  4JI5 B;  2Q7G A;  4H0L B;  1I94 O;  4EB6 B;  4B7E A;  3IJ4 A;  4UVC A;  5GON A;  2WLJ A;  1WP7 A;  1F23 A;  4PA6 A;  3BCC H;  4J80 A;  1VEW A;  3H1J H;  3AG3 B;  2CH7 A;  3ZHR A;  1XBL A;  1IVS A;  4B3S O;  1Y76 A;  1ZL8 B;  3TXQ A;  4YJ2 A;  4FLU A;  4D7T A;  1N0J A;  3OFN G;  1K97 A;  1ROP A;  3FX7 A;  2P5O A;  2X6B A;  2QJ1 A;  1AI6 A;  5LP6 C;  3SYC A;  2EIL C;  3AG7 A;  3P30 A;  1Z2G A;  3JAW A;  2QWN B;  2ZKO A;  4ZHQ A;  4JYB A;  4CZZ A;  2ATK C;  2Q68 A;  1B6Q A;  3FB7 C;  1GM8 A;  1YJN V;  4FLY A;  4TUY A;  3P32 A;  1R3I C;  3KG2 A;  4UCO A;  2F23 A;  1JVM A;  2FKX A;  2GTS A;  5EYP A;  1MNG A;  1Z5V A;  5KX5 A;  2C2A A;  4X1I B;  1SQG A;  5E79 Z;  2PI4 A;  4DR6 O;  2XTA A;  2BTQ B;  1I5Y A;  4FFB A;  3JD0 A;  1SES A;  3OGC C;  4I0X B;  4PA7 A;  4B7K A;  2Y48 A;  4X8A A;  5DED A;  4EEQ A;  1GN3 A;  4B3R O;  1K4C C;  4KHP B;  3G4S V;  1KEC A;  3LSU A;  4DR1 B;  1EN6 A;  1HR0 B;  5IJ9 B;  5JJE B;  2PUS A;  5CBH A;  2Y0I A;  1A32 A;  1SZT A;  3K03 A;  4IL6 Z;  3ZHQ A;  2HR3 A;  3WFV A;  4IGG A;  3ZRW B;  3SJC C;  4KFM A;  1Q43 A;  4J42 A;  2ARH A;  2QE7 G;  3AK1 A;  5CBF A;  5E1A C;  1DLB A;  4DO2 A;  4H33 A;  1FPO A;  3JAS A;  5FL7 G;  3K04 A;  4R7C A;  3C90 A;  4PDL A;  4DR1 O;  1HR0 O;  2CGO A;  3OEE G;  3OTO O;  1IBM O;  3K59 A;  3E8B A;  4WFH A;  3RYC B;  1ZL8 A;  1NI8 A;  3CHX A;  2X6A A;  1YJ9 V;  1VQ4 V;  1XMO O;  4KUM A;  3JCZ A;  1G8M A;  2M7W A;  4YIO A;  1RP3 B;  5BR8 B;  1W0J G;  1QVF U;  4F6E A;  1O9G A;  1K92 A;  5JQG A;  2PF4 E;  4DV1 B;  2YIB D;  2GUZ A;  3E83 A;  4ZI7 B;  5IYC O;  5C93 A;  2Z3Y A;  1R1B A;  1XRE A;  2B1I A;  2X7R B;  3HKE B;  4GZR B;  2Q7H A;  1I94 B;  3G71 V;  4O4I A;  4NR1 A;  3AG2 B;  4CS3 A;  2BE3 A;  4BIU A;  1NTZ H;  5LMU O;  1K33 A;  4WCE V;  4K3A A;  2YEV B;  3C3S A;  3ZRV A;  3ZHS A;  2BTQ A;  2AXT Z;  3IGA C;  4OPH A;  3L70 H;  3VQV A;  1LUW A;  5LHH A;  2DWE C;  2GSM B;  2ZIM A;  3VBB A;  1ZWI C;  1XMO B;  1P49 A;  2BSK A;  1M9N A;  1GAX A;  2ZD9 A;  4DR4 O;  3X2Q C;  3BVO A;  1KQS U;  2Y69 B;  1JQ0 A;  1RPO A;  2ZR3 A;  4LFA O;  2RJZ A;  5FPO A;  4BAY A;  2V4D A;  1V9P A;  4EKW A;  1YZB A;  4BWA A;  3ABL C;  4MTG A;  5LGU A;  1GN6 A;  1QHT A;  4GX5 A;  2QR4 A;  4IIJ A;  3STZ C;  3ZMS A;  1OCZ B;  2L35 A;  1K5S A;  3SJA C;  4TV9 B;  3RGB A;  3JD2 A;  1NU1 H;  2ZDI A;  5HFM A;  4FLW A;  4G27 B;  3TK1 A;  3G6B A;  3U0Z A;  1M4U A;  4OX9 O;  1GO3 F;  2FB5 A;  4RQE A;  5IY5 C;  1SET A;  1V55 C;  5KAF Z;  3HB3 B;  4I9W A;  5LMU B;  1QVG U;  2ITC C;  4NB5 A;  1W59 A;  4JI8 O;  1J95 A;  2IH3 C;  4DR3 O;  5JQG B;  1Q6U A;  4JI0 O;  2JRI A;  5KAI Z;  1SQV H;  3KCY A;  2JIZ G;  1AVM A;  2NN4 A;  2EBO A;  2JEU A;  1FFX B;  3O65 A;  2QKS A;  4JI7 B;  3CS5 A;  4FVM A;  3L72 H;  3SYP A;  5LXT B;  5KUK A;  3RYC A;  4PA9 A;  3CXC U;  2ZXW B;  4O2A B;  3A0R A;  4O4J A;  3UO2 A;  4FK5 C;  1R6T A;  1MSW D;  5KHG A;  2UU9 B;  2GUZ B;  5FNV B;  2WAM A;  2ETN A;  4ABM A;  4F4L A;  4FFB B;  1XNR B;  1FXH A;  1VF6 A;  4KXR A;  4MW3 A;  1LR1 A;  2ITD C;  2F93 B;  2EIL B;  2FTK A;  4FM1 A;  1RPR A;  5BY1 A;  1E79 G;  4YY3 O;  3BA8 A;  2QEX V;  5IE9 A;  1GN4 A;  2JDI G;  1IXB A;  4J9Z B;  4PA4 A;  3W7W A;  3BFR A;  4JZ2 A;  2A3Q A;  4MVU A;  4X1K A;  3G80 A;  5LMN O;  2W0F C;  1H2N A;  1NQT A;  4AQY O;  4J7J A;  3SPJ A;  4ZKI A;  2HJF C;  2HVJ C;  3U10 A;  5K1X A;  5B1A B;  2BSK B;  1AP6 A;  1AI5 A;  4TOI A;  4LFB O;  2RDC A;  4UCT A;  3D36 A;  1JOY A;  1GM7 A;  4X9Q A;  4MVZ A;  5IWA B;  3FB8 C;  1SQQ H;  5EZY A;  3DSQ A;  1PM9 A;  4CH6 A;  2NNU A;  3S3X A;  1HNW B;  3RYI A;  1XUQ A;  4J9Y B;  3K57 A;  1H2K A;  5L3D A;  1HNZ B;  4CH5 A;  5DEC A;  1KKC A;  2EIM C;  1Q7Y W;  3AG4 C;  2IM9 A;  3ABK B;  1K7D A;  1D5N A;  1YIT V;  1S72 V;  3AK2 A; 
#chains in the Genus database with same CATH homology
 5TIS Z;  4IL6 Z;  5GTH Z;  3KZI Z;  4UB6 Z;  5H2F Z;  3WU2 Z;  3JCU Z;  4PJ0 Z;  1S5L Z;  5KAI Z;  5KAF Z;  5B5E Z;  3A0B Z;  5GTI Z;  5B66 Z;  3A0H Z;  4UB8 Z;  5E79 Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...