4P9OA

Complex of voltage-gated ion channel in a the presence of channel blocking compound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
b'VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 31
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p9oA00
2NLJC 3ASOC 4MVRA 5B1BC 4WFFA 5J9PC 4EKWA 2EIJC 5E1AC 4G28B 2IH3C 2EILC 2QTOA 3SJQC 4GX1A 4BW5A 3LDCA 2HFEC 4R8CA 2A0LA 2HVJC 2X6BA 4RAIA 2ITCC 3FB5C 3E8HA 1P7BA 2EINC 2Q6AA 1ZWIC 3K0GA 3LDDA 4HYOA 4JTDB 4PA9A 3SYAA 4X8AA 2KB1A 2X6AA 5B3SC 4R50A 2H8PC 3LDEA 4WFEA 4QNHB 2WLLB 4PDVA 1R3LC 4MVQA 3ASNC 2X6CA 5EC1C 3RW0A 1BL8A 4LBEC 3E89A 4UUJC 4X88A 3UKMA 4PDLA 4MVMA 4RUFA 1G4YB 4MVZA 1K4DC 1K4CC 2A9HA 3E8GA 4HZ3A 5KUKA 2Q69A 4LCUC 2WLIB 5IY5C 3KG2A 3EFFK 4MW8A 4PDMA 4QE9A 3ZJZA 3OUFA 2HJFC 5EBWC 1ORQC 4X89A 3SYCA 2BOBC 2YEVA 4TWKA 2ZD9A 2HG5C 3X2QC 3UM7A 4PA6A 3E83A 4F4LA 3T4DA 2WLHA 1J95A 2P7TC 4MTOA 2W0FC 4P2ZA 2EIKC 4GX5A 1M57C 4LP8A 4JTCB 3FB8C 3IFXA 3LUTB 4WFGA 5CBHA 3GB7C 3FB7C 3SPIA 4MSWC 3OR7C 3AG4C 2Q68A 4PA4A 1KKDA 3K08A 2DYSC 4XDLA 3IGAC 3SPJA 2A79B 4H33A 4PA7A 3T1CA 4J9ZB 2WLKA 3ZRSA 4ZBMA 2Y69C 4JTAB 2EIMC 4MS2A 3ABMC 3F5WC 3STZC 4MTGA 4RUEA 3AG3C 3SPCA 3PJSK 1R3JC 2WLJA 3F7YC 3HPLC 2WLLA 3BEHA 1XL6A 3R65A 3E8BA 1JVMA 1R3KC 2AHYA 3LNMB 4G27B 5B1AC 4QE7A 1R3IC 3K06A 2DWDC 4KFMA 2OCCC 3STLC 1OCRC 2BOCC 3ABKC 4MW3A 4P30A 5BZBA 2WLIA 3E86A 4GX2A 3RVYA 3ABLC 4DXWA 4J9YB 1QLEC 2IH1C 3SPGA 4PA3A 4P9OA 3K03A 4MVSA 4XDJA 2DYRC 1V55C 4OXSA 3FB6C 4H37A 3VOUA 4CBCA 3OUSA 1LNQA 2R9RB 5EC2C 5KUMA 3TETA 4RO2A 5CBFA 3F7VC 2DWEC 3RBZA 3SYOA 1OCZC 3AG2C 3OGCC 3SYQA 5EBLC 3T4ZA 1S5HC 3K0DA 3T2MA 2ATKC 4PDRA 4MTFA 1V54C 2WLNA 3E8FA 2HVKC 4R6ZA 3SYPA 3OR6C 1XL4A 5EBMC 2K1EA 2AHZA 4GX0A 2JK5C 5EK0A 5CBGA 2Q67A 2ITDC 3K04A 4WFHA 1M56C 2WLMA 4I9WA 2QKSA 3SPHA 3AG1C 3TCUA 2ZXWC 4MVUA 3WG7C 3RVZA 4R7CA 4MVOA 3JYCA 1OCOC 1OCCC 4XDKA 4P9PA
chains in the Genus database with same CATH superfamily
1Q3EA 5KX5B 5B1BC 3CCRV 1XMQB 2EILC 2QTOA 2Y4TA 3CX5F 4H13B 3RYFA 2JS5A 5FNVA 1NH2B 3K0GA 1WB7A 4JZ2A 1V54B 2QKAA 4DR1O 4JYAO 4FFBA 1NVPD 1MABG 4I4TA 5JCOC 5LHGA 1YHQV 4CZZA 1NT2B 2L35A 4NTXA 2Q69A 3EFFK 2ARHA 1X59A 3SYCA 1EBOA 4PJ0Z 3T4DA 2P7TC 3QO7A 1KU9A 3OM3B 4JTCB 5CA0B 3THOA 4UCVA 2RNBA 4B3MO 4GUNA 1L0LH 1SA0B 5J2TB 4YIOA 4YJ2B 3ICXA 5JVDB 1GKFA 5IJ9B 3U0ZA 3LNMB 5C8YB 4DV4B 4E4EA 2CAZC 3ETGA 2Z3YA 2YEVB 1NJIW 1XMOB 4B3RB 5H6QA 4DK0A 3B40A 2R9RB 5EC2C 4U7NA 1S5HC 1XNQB 1KECA 2JDIG 5BXZA 3AEIA 1F51A 4DV2O 3WB1A 3A0BZ 4JF3A 3AG1C 3OGIB 4J42A 1BS3A 3IAYA 3CPWU 4H0LB 1OCOC 3MDSA 1OCCC 3DGEA 4XDKA 3IC7A 2IBZH 2EIJC 5HFLA 2XT9A 4PHZA 5CA0A 4FJCC 1Q82W 1I5YA 4JI4O 2Z5UA 4K8XA 2JEXA 5J2TA 4YJ2A 3CXCU 3ZHRA 5JVDA 5IJ9A 4LR3A 1W0JG 2DJVA 5FL7G 3T1YO 3W7UA 3QF7A 4IYHA 3RYCB 1FFTB 1I0HA 4MW8A 2LW7A 5B1BB 5C8YA 1KP3A 2EILB 4FM2A 2YEVA 1FXKB 3Q4HB 2G38A 4LP8A 4OX9B 2ZIMA 1YCIA 1CXZB 1IZ3A 5CA1B 3LSUA 3E35A 4I7ZB 3EVKA 4DR3B 2V4DA 2WLKA 5KHKA 1FPOA 3DXRB 4DR2B 3ZMSA 1HNZO 4LF9B 2H3OA 4B08A 4DV5B 2YI9A 5IWAO 2LO1A 4JV5B 3P32A 4LF5O 3K06A 4TUYB 1BZKA 3JATB 4P30A 3DC6A 1V55C 3ZHQA 3RFRA 1TA8A 3BA8A 1YTFD 5KUMA 3SYOA 3A8TA 4DV3O 4DR5O 3DSQA 1HNWB 1J5EB 3EHBB 5L3CA 2WLNA 3SYPA 4KHPB 2UXCB 1GH6A 3M7MX 5JJJB 4X66O 3RYCA 1Y67A 1VQNV 4U3JB 1YJNV 1FXKA 2UXBB 1S0VA 3K5NA 1QBZA 4AQYO 1TUEB 4JI8O 2A0LA 4XBFA 1N34B 4HYOA 2Q8VA 4JTDB 5CA1A 3K5OA 1N0NA 5JCOA 2UXNA 3MHHC 4WFEA 1M5IA 3TGUH 4UCSA 1AJPA 3AG1B 4DUYO 1K4CC 1OCOB 1OCCB 2WA4A 2E3CA 5IY5C 3KG2A 3JATA 2EIJB 2IJKA 1VQMV 2ZM6O 1AR4A 1OJHA 3HKBB 3ZHSA 1QU7A 4GYCB 2VQEO 1MZFA 4JYAB 2YS8A 2YC0A 4UVAA 3JD1A 2VWKA 3H1IH 3U11A 4ABMA 2CTPA 2CGOA 3IGAC 1QCEA 3F5WC 1JJ2U 2DQ3A 2IU3A 1JVMA 4DR4O 4I9QA 4LF7O 4NR1A 4GKKO 4U3JA 2QSAA 3JCZA 3BRCA 1G8MA 4MW3A 1EZJA 1VQ7V 2WLIA 4DV6O 4B3MB 5DECA 5H2FZ 3UT5A 1F23A 1Y66A 3FFQA 1M1KW 2LFRA 1ZTEA 1LNQA 4I0XB 4IGGA 2W6JG 3SYQA 3CCQV 1ZX3A 1WN7A 1M56C 4I9WA 4O2BB 1VIBA 4OGQB 1H2NA 2HHHO 3EXAA 1V55B 1PNMA 2Q7GA 3JAWB 4IIJA 1H8EG 2XHBA 4RAIA 1XILA 3FB5C 1P7BA 2Q6AA 4N21A 2ZE6A 5HFMA 4DV2B 5LMUO 1Y76B 1OV9A 3E22A 3AK3A 2R9AA 2WLLB 2XAHA 2AW9A 4X20B 4MT8A 3T1HO 2X6CA 2W6IG 4HBNA 2CGNA 1W59A 4JASA 4L8JA 3C3TA 2IU0A 3ZHVA 3G6EV 1YSCA 4X89A 1YZBA 4JI4B 1K34A 1WJZA 4J7KA 4GX5A 2UUBO 4LF8B 3H1KH 3HKCB 3LNNA 3B2EE 1IDSA 5GW7A 5CBHA 2YXHA 4NTYA 3N2KA 4BIZA 3SJAC 4I0XA 2ZNIA 1DLBA 1P49A 3CS5A 3T1YB 2QM7A 2A06H 1S5JA 5BR8B 1VQ5V 1CEZA 2EIMC 3ZN1A 2ZQMA 1VF5B 5KAIZ 1IXBA 1NS1A 2PZSA 4O2BA 1H2SB 1NU1H 2YXYA 3H1HH 3CRRA 3JAWA 1AI4A 5K1XA 2DE0X 1VF7A 4CBCA 1Y76A 4X20A 3JASB 4Q20A 2AXTZ 1XDCA 1RSOB 1WB8A 2E5LO 3UCSC 1M4UA 2DQ0A 2ADQB 2P6JA 3WU2Z 5LHHA 1N0JA 5L3DA 3JYCA 5FPRA 3OT7A 4ZOLB 4QIWF 3CE2A 1U96A 1NZ6A 3ASOC 4DV0O 4I55A 4DR7O 3ZRWA 4A5UB 4DV3B 2JS3A 4BW5A 1AJNA 2HFEC 3OW2U 2X6BA 2ITCC 1FXVA 2ETNA 3CD6V 4X66B 4TV9B 1P4RA 3NR7A 4I50B 5JWPA 4TT3G 3WB0A 3G67A 3HB3B 4BAYA 3K3WA 2OIGA 3DTUB 3L73H 4MVMA 3CCLV 5EIBD 5BMVB 3G71V 1F7YA 4AQYB 2GHYA 1MNGA 4JI8B 1EZVH 1A32A 1QLNA 2F4VO 4NKGB 3BAAA 4FIPC 2XNDG 4TV8B 1BCCH 4C7UA 1OCZB 1R6TA 3FYIB 4FZ0A 4GKJO 2P90A 1LUVA 3FKSG 4P2ZA 4GLXA 4WFAV 1LR1A 2ZE7A 1XOUA 2YIBD 2ZXWB 3MD0A 3ZIAG 4DV1B 4MS2A 3STZC 3ABMC 4MTGA 2ZM6B 1K5QA 3JD3A 1EN6A 1R3JC 2Q0AA 1RSOA 2X7RB 3HPLC 3G6BA 3GVMA 3NXSA 4KUMA 2QWPB 3JSLA 3M99B 2B1IA 2RQ6A 2Q73A 4YIPA 5FNVB 1F4NA 4CH3A 2HEPA 1QLEC 1NVPB 2HLDG 2MK3A 2RN9A 2F93B 3VQWA 1QQCA 2ZE5A 2EIMB 3J80N 4TV9A 4DR4B 3OGCC 2AZ2A 4I50A 5EBLC 1FJGO 2VQFO 4LF7B 4GKKB 1BMFG 5EK0A 3D3QA 2LFSA 1Y6XA 2ITDC 2X0LA 4DV6B 2F43G 3OTFA 1JOYA 2ADPA 4FLZA 1WP8A 4NVPA 4BIOA 3J81N 2LP7A 4MVUA 3WG7C 5LGNA 1F4MA 4TV8A 4CC6A 3AK2A 2UU9B 2DYSB 2CTRA 2ZT9B 2Y48A 3SJQC 5L3FA 3QTCA 1XQ8A 5LXTB 1DTOA 2QWOB 2QA4V 4WFBV 1CP9A 1XUQA 2RJZA 2GTSA 4JAVA 5B3SC 4Z2WA 1YJ9V 3LDEA 2HHHB 1H2GA 2OCCB 4CS3A 4B3TB 2NN4A 3ABKB 3K5MA 4RWUA 1Q6UA 4X64O 3E89A 3DC5A 1E1RG 4MVZA 1NKDA 2A9HA 5FLXN 1BQ0A 1THZA 1AROP 1GTOA 3ZEDA 1AP6A 1SF9A 3ZHUA 4UCOA 4K0KO 3BA9A 4LH7A 4ZI7B 4WFGA 2AGAA 3GB7C 2ZR3A 4JI6B 1I08A 3G80A 2R70A 4CS4A 5LA6A 1Y4MA 4H33A 3ZRSA 1HWYA 3L75H 4RUEA 3ETDA 2EZOA 1I5XA 2DWDC 4KFMA 5JQGB 3STLC 1KBHA 4FZ1A 4LFCO 1Q43A 4Z1VA 4J9YB 3N2GA 3FX7A 3JD4A 3SPGA 1WA8B 4TQDA 5LXTA 4XDJA 3CRCA 1Q6IA 3ABMB 1VQPV 3RBZA 3VQXA 1US6A 3AG2C 1HP8A 2UUAB 2KG7B 2NR5A 2Q5ZA 4WFHA 2YXLA 1Z5VA 4J11A 1K92A 2IM9A 3P3PA 3I56V 1GN6A 2M6YA 4U3FH 1ZUQA 2F66C 3K5LA 1BHBA 4ZI7A 3BFRA 4DRXA 2PGGA 3SYAA 2E5LB 3CEIA 4UB8Z 4X8AA 1JPXA 2X6AA 1Q8IA 1L0NH 4LH6A 2IJHA 5EC1C 3FAVB 1HR0O 4UUJC 5A9GA 2PY5A 4LF4O 4DV0B 3WG7B 1PL0A 4DR7B 1E79G 3E8GA 3JAMN 1NH2D 4PDMA 5JQGA 4JYYA 4JI3O 1G1XB 1YTFB 1ZL8B 2QR4A 2XTAA 3UM7A 1VQLV 1WPBA 1BQZA 1WA8A 3LUTB 3ZRVA 1SERA 5B3SB 5LMNO 3FB7C 1VARA 4MSWC 2Q68A 3JCUZ 3K08A 2JGUA 2WA3A 1JQ0A 3TJTA 2KG7A 4JTAB 2F4VB 2D2CB 4GZRB 1FAFA 4NXNO 4FM1A 2Y4UA 4JI7B 3OE7G 3AK1A 1SQFA 4EEQA 2V1DA 1G6UA 4O4LB 2HJDA 4MTXA 3WFVA 3CCVV 4PV1B 1XBLA 1KP2A 4X9QA 2DYRC 4DR6B 1HW7A 5IYDO 4DK1A 3F7VC 1SESA 1D5AA 3K0DA 4FLVA 4FLXA 4PDRA 5KHJA 3FAVA 1MSDA 2YSUB 3OAAG 5JH7B 2JK5C 3LSSA 5CA3A 4QGPA 2CTQA 3ZMZA 5DN6G 4IYIA 4GT1A 1ZL8A 3JD2A 3APOA 1N32B 5E1AC 1FJGB 5H5NA 5IYBO 1NBMG 3ETQA 2HVJC 3L74H 3AG2B 4NYKA 3S3WA 1H2KA 2KB1A 1ZLZA 1R3LC 2LQTA 2VWJA 2QE7G 2BCCH 3C90A 3UKMA 1EN4A 4KP4A 4JGSA 1DF5A 3K79A 1P84F 1TGOA 2WLIB 1PKXA 2BOBC 4O4LA 3UT5B 5DM6V 2ZR2A 2LGWA 3ZS8C 3SPIA 4X64B 3D8CA 1RM1C 3UO2A 1IBKO 4FK5C 5GTIZ 4DV7O 5B1NA 3CCJV 1KC8W 1XEQA 2GSMB 2XAQA 5EIBC 1PL4A 3W7WA 3AG3C 1JMKC 3PJSK 1YI2V 5JH7A 2F95B 1VF6C 3F7YC 2BTQB 1UFIA 4LFAO 3JARA 5A2QN 1RFYA 4DR1B 1B04A 4BW9A 2QGNA 4IIJB 4WBNA 4JAAA 3HKEA 4RQFA 4YHHO 4GX2A 1RPRA 3E22B 1DF4A 4H37A 5CBFA 2RDCA 2P06A 5JJEB 4R6ZA 4LFCB 2PF4E 4BWAA 5B1OA 1DK1A 4UV9A 2WLMA 1PNKA 4EB6B 1JX9A 2DYRB 4MVRA 3N2KB 3CP1A 3I5DA 1AI5A 2LJ2A 4GX1A 2QEXV 4R8CA 5ITZB 1K97A 3RYHA 3A2FA 4ASUG 4R50A 4EFEA 3CCMV 2FL4A 2F23A 3BVOA 2BTQA 1TAEA 1K5SA 1G4YB 4LNUA 4JYCA 4OPHA 3ZJZA 2HJFC 1ORQC 2DOSA 1U97A 5EYPB 1B6QA 4KL1A 4X62O 2BSKA 1HR0B 3SR2C 4CS2A 4LF4B 3CXHF 1MOFA 3SDLA 1BSMA 3SPJA 2QDOA 4B7EA 2A79B 2YI8A 4PA7A 1FFXA 4WCEV 4UCTA 3L71H 1XMQO 2WLJA 2P5OA 1XL6A 1D5NA 1ZAUA 5B1AC 1JFFA 4EB6A 3CRQA 4I55B 2PYJA 3L72H 3ZRWB 2UUCO 1SC5B 1XHXA 5L3GA 1OCRC 2OTLV 1IBLO 2YIAA 1NR7A 2OT5A 3B8NA 5LGTA 3E86A 4FLYA 1S76D 4PA3A 3RWRD 2GBOA 5BY1A 1CPYA 5ITZA 3FB6C 3VBBA 4QPKA 3VOUA 2NNUA 2P22C 2M7WA 1VMGA 5DEDA 5IY5B 3KCYA 2P67A 3H1JH 4TSFG 3KKYA 4BIUA 3CC4V 4GX0A 3QNEA 5CBGA 2XOKG 3HKDB 2A3QA 3JAKB 2ZE8A 3OMAB 1MZEA 3B4SA 5EYPA 1HNZB 4YJ3B 2NLJC 1S72V 2Z0AA 1JA8A 4YY3O 5IWAB 2XUMA 1N33O 2EINC 4LF5B 3FD9A 3JALB 2E76B 3OTOO 2D3OW 1UPGA 2YDEA 2OTJV 3OD4A 4QJFB 1XMOO 4B3RO 4RUFA 1K4DC 5KUKA 3RN4A 4DR5B 5F2VO 5EBWC 1S5LZ 1PP9H 3GWKC 4Q6GA 3X2QC 5L3EA 1XNQO 1J95A 2OIEA 2PI4A 1WPXA 1I94O 1VQ9V 5EZYB 1GM8A 3R66A 1BT8A 1M56B 3AG4C 1ROPA 2CUGA 4JZGA 3UO3A 3ZCCA 1VF6A 3OMNB 4JAUA 2Y0PA 1Q5OA 3P30A 2GDSA 3O65A 1AB3A 3OFNG 4FMTA 1R1BA 1T5EA 2R9IA 1FXHA 2MW2B 3HR0A 2FTKA 1X4TA 3HKDA 1AR5A 1QNMA 3UQ8A 4Z1MG 1XREA 2DN9A 3JAKA 2BOCC 2KQXA 1IBKB 4YJ3A 5BZBA 1AP5A 2E75B 4DUYB 2YIBA 2IH1C 3BABA 4P9OA 3MHSC 2N05A 1AR1B 3JALA 3VQVA 2VQEB 4AILC 2E74B 2WPDG 4O4JB 4DW1A 3B8MA 3CSXA 5B1AB 1BGYH 1WLEA 4YHHB 1OCRB 2EZPA 1FS0G 1K33A 3RVZA 1YJWV 5D5QA 3L70H 1SZTA 3G4SV 4WFFA 4EKWA 4X1KB 2RCVA 4LF9O 4PI0A 5LA6B 5EZYA 5LOVB 4D7SA 3ASNC 4IT5A 1BL8A 4LBEC 4X88A 3CCSV 4LCUC 5L3BA 3N2GB 1YDXA 1KD1W 3OEHG 2DW4A 2ZD9A 4F4LA 2EINB 1XI1A 1Y74B 2EIKC 5J2UB 3FB8C 3W7TA 3K9AA 3P3NA 4LC1A 4W4KA 4PA4A 5IJ0B 3T1CA 1OHHG 1MA1A 2Y69C 4O4JA 5CB4B 2P4KA 4WF9V 4BR6A 3ASOB 3ZX6A 4YXWG 3ZBHA 1SKVA 5LMUB 2K9PA 1R3IC 4X62B 3X2QB 1N34O 2F1MA 5K1PA 2XAJA 5GTHZ 3T1HB 4N23A 4F6RB 4DRXB 4X1KA 4DXWA 2EJ7A 2JRIA 4DUZO 1GM7A 3K03A 3AG4B 3TK1A 4OXSA 5LOVA 1Q86W 5KA6A 3TETA 4QPJA 4X65O 1FXKC 3T2MA 2ATKC 2UUCB 5IYCO 2EBOA 5KA5A 2UUBB 1IBLB 1P7GA 1YEWA 4LF6O 1RPOA 1NTMH 3H1LH 2QKSA 2YUAA 4J7JA 1Q7YW 1JCHA 1XNRO 4O2AB 3LSQA 1S3JA 5CMUA 3E2EA 4B3SO 5LGUA 4MVOA 3SJCC 1PM9A 3GWOA 4RO2A 4P9PA 2WSSG 2HP8A 2CTWA 2IH3C 3B09A 2EJRA 4JI5O 1GN4A 1Y74A 5GONB 5J2UA 5H6RA 1UJWB 4X1IB 3LDDA 1SZXA 2PI5A 1GAXA 1AVMA 5IJ0A 3BPZA 1QHTA 1TVKB 4UCUA 4MVQA 2Q4PA 2ZNJA 5CB4A 3M8AA 3ML0A 2YIDA 4ZKIA 1D2DA 1KYOF 5LHIA 1QLEB 1IBMO 4HZ3A 1LUWA 4QE9A 4YY3B 3A0HZ 2JJ2G 3WB2A 1N33B 1W2BU 3D3IA 3J7AU 4TWKA 3O9OA 4F6RA 3RYIA 3QO8A 1SQGA 3OTOB 1M57C 3CC7V 2BE3A 3IFXA 3K9SA 5KX5A 1COWG 2HKOA 1VQKV 3OR7C 3ASNB 1GK9A 4J41A 4E2LA 3H01A 1ZSPA 4O2AA 1I94B 5KHGA 3W7SA 3OMIB 2EIKB 2CK3G 4AI8A 3RVYA 2ODMA 1GN2A 5GONA 1AILA 2KKWA 4K3AA 4X1IA 4FPPA 2LGQA 2HR3A 3CWBH 2Y69B 1H2MA 1SQPH 1TVKA 2IJIA 4MTFA 3APQA 4GKJB 3SJBC 4CC5A 1O9HA 3K57A 1MG1A 4LF8O 4TQFA 2W0XA 4LFBO 4FVMA 1SA0A 4EFBA 3CCEV 3W7XA 4X1YB 1HDJA 4W4LA 1SS3A 3CRMA 5J9PC 5BR8O 1K9MW 1TUBB 4IL6Z 4O4IB 2ZINA 1XHZA 1ZWIC 1FD9A 4HNAB 3CRAA 1WP7A 2GTAA 1SETA 2H8PC 2OYQA 3QO5A 1L1FA 1GRJA 3JARB 4PDLA 1HNXO 1YXBA 4WBNB 1PNLA 3HKEB 2AZ0A 4UXNA 3OUFA 4NTWA 2A7WA 1K3EA 2VQFB 3QG5A 3ABTA 5FPOA 2HG5C 4PA6A 5KLVH 1MMMA 5JJNB 4CH4A 1EM1A 2Q7HA 4PI2A 5IT9N 1YVWA 3SGIA 2JGDB 4UB6Z 3BHPA 4FFKA 2UXDO 3JSNA 5KHHA 3E8BA 4QE7A 2B5UA 3TXSA 2N04A 2QWQB 4UVBA 1PV0A 4X1YA 4JI1O 1DGSA 1M57B 5LYJB 5IE9A 3RYHB 1TUBA 4G2KA 4UV8A 2DMXA 2XASA 4ZHQB 4O4IA 2QM4A 3OUSA 3Q4HA 4HNAA 4J80A 3ZN0A 2FB5A 4ZIBA 4UVCA 3KCXA 4LNUB 4FLTA 3E8FA 3A0RA 2HVKC 4K0KB 2K1EA 4GCZA 4HAMA 3DXRA 5E79Z 1O9GA 1EN5A 2FYUH 4DUZB 4B7KA 4PD4F 4R7CA 3BY6A 2BSKB 5LL6Y 4DV1O 4X65B 2QJ1A 4TUYA 4G28B 2GUZB 2IJJA 4JI0O 1BE3H 1WNSA 3ZMTA 1FFXB 4LF6B 1R6KA 1KB9F 2V7QG 3PN1A 5LP6C 1V9PA 1W0KG 1S77D 3K58A 1OZ0A 1XNRB 4FM0A 1NTZH 3CMEV 2JGDA 4B3SB 4J10A 1JFFB 1K8AW 1VEWA 2GV9A 2Q7EA 4JI5B 2L6LA 5LYJA 4OPAA 5B5EZ 1Z2GA 3ETEA 1MSWD 4MTOA 4ZHQA 1K73W 1AI7A 1Q6HA 4DO2A 1SQVH 1GN3A 1IBMB 2H94A 1KKDA 4XDLA 1SQXH 4NXMO 2C2AA 4PELA 5H9CA 2QKCA 2UU9O 1EFRG 4ICGA 2YICA 3BEHA 3R65A 1R3KC 4RQEA 2ZDIC 1JJOA 1NTKH 2VS0A 4DW0A 1M93A 3H9VA 2VRZA 4JI2O 4K35A 3ABLC 4O4HB 4AHCA 4B3TO 1URFA 2GUZA 1WAZA 3HKBA 2XAGA 4MVSA 2OWOA 1M90W 1VP7A 1QR8A 3D36C 1N36O 4JI3B 1OCZC 4D7TA 1QR9A 2Q0OC 5EBMC 3CMAV 3K04A 5LMNB 3TCUA 2ZXWC 4JI6O 1FYJA 1AI6A 2N74A 1RM1B 1Q81W 4J7ZA 1H38A 4NXNB 3LDCA 3AG3B 2P4VA 3IC9A 4IHJB 1YF2A 4LWSB 1IX9A 3IJ4A 4LFBB 2BTOA 1L8DA 4PDVA 1GO3F 3QVNA 3KZIZ 1QVGU 3AG7A 5KMGB 3ZMVA 3CB2A 3JD0A 1IXMA 2UUAO 3E83A 4O4HA 4I5SA 2JIZG 3RT3C 2WAMA 4NB5A 3MAQA 1ENVA 2CDYA 4DV4O 5LP6B 1VQOV 2OCHA 4KXRA 1HNXB 2PUSA 4UCRA 2EULA 4H44B 2DYSC 2ZIOA 4J9ZB 5D5PA 4ZBMA 1KQSU 1GMGA 3SPCA 2WLLA 1BHAA 1NR1A 1YITV 1Z5WA 3ZHTA 5C93A 3OEEG 2OCCC 1PPJH 3CHXA 3ABKC 4FLWA 1KUQA 2LW1A 4L87A 1N8RW 4IHJA 4CH6A 4LWSA 5LBQA 3C3SA 2UXDB 3HKCA 1FKAO 3ZMUA 2ILMA 4K8ZA 5B66Z 2JVDA 2ZCEA 3S3XA 1V54C 1E1QG 2CH7B 3CC2V 3OR6C 1XL4A 4JI1B 2AHZA 1SQQH 2Q67A 5KMGA 1VQ6V 2JEUA 4DV7B 3RGBA 3ABLB 2WWWA 2XAFA 1I7FA 2PYLA 3F5TA 3I55V 3CJHB 5IYZB 1SRYA 2IW5A 5CN0A 4JYBA 3U10A 5LP6A 4LFAB 1AJQA 1IURA 2KSDA 3E8HA 4PA9A 4JI7O 3TXQA 2Q9LA 4D6TH 1KKCA 4QNHB 4OX9O 1Q90D 3RW0A 2UXXA 4DYLA 2EX3A 2QM8A 3JASA 3ZRXA 2Y0IA 4DR3O 3FYEB 4JI0B 4DR6O 4DR2O 1VQ4V 2FMLA 1KMIZ 1IVSA 4DV5O 3L9DA 2WLHA 1JR9A 2W0FC 4JV5O 1R6NA 3RYFB 4ZOLA 5TISZ 1B3QA 2R72A 4TOIA 2QWRB 3BCCH 2PTMA 4FFBB 4I4TB 2QWNB 3CYOA 2CH7A 2ZDIA 1N32O 2ZKOA 2RMKB 3N27A 2AHYA 2O57A 2B9ZA 4G27B 1QVFU 1PD3A 1HNWO 1J5EO 5AG2A 5BMVA 4KHPO 2UXCO 3ABUA 2QTSA 3CJHA 5IYZA 3CCUV 2JJ1G 1N4CA 3B77A 5KHIA 4NXMB 4UFZA 1H2LA 1H8HG 3D36A 1B06A 3K59A 1YIJV 1SQBH 3VQYA 4U7OA 1K7DA 1M9NA 2DWEC 2B1GA 2UXBO 1R73A 3T4ZA 5KAFZ 1RP3B 5IDJA 2FKXA 4FLUA 4JI2B 4JPRA 1GM9A 1VQ8V 1NI8A 3SPHA 4CH5A 3RYIB 1NQTA 4F6EA 2CE4A 1N36B
chains in the Genus database with same CATH topology
3ASOC 2DYRB 4MVRA 5B1BC 5J9PC 3CCRV 3ZRWA 3CP1A 1K9MW 2EILC 2QTOA 1AI5A 4GX1A 4BW5A 1AJNA 2QEXV 2HFEC 4R8CA 3OW2U 1K97A 2X6BA 2ITCC 1FXVA 1NH2B 3K0GA 3CD6V 1ZWIC 1V54B 4ASUG 1P4RA 1SETA 4R50A 2H8PC 1NVPD 1MABG 3QO5A 4TT3G 1L1FA 3CCMV 3HB3B 4BAYA 5LHGA 1YHQV 3K3WA 4CZZA 4PDLA 3DTUB 4MVMA 3CCLV 1K5SA 3G71V 1G4YB 1PNLA 2Q69A 2GHYA 4JYCA 3EFFK 4UXNA 3ZJZA 3OUFA 1QLNA 2HJFC 4FIPC 1K3EA 1ORQC 3ABTA 2XNDG 1EBOA 3SYCA 1OCZB 1B6QA 2HG5C 3FYIB 4PA6A 3T4DA 2P7TC 3QO7A 2P90A 3FKSG 4P2ZA 3OM3B 4JTCB 4WFAV 1MOFA 3SPJA 2ZXWB 2A79B 3MD0A 4PA7A 3ZIAG 4MS2A 3STZC 4WCEV 3ABMC 4MTGA 1K5QA 3JD3A 1GKFA 1R3JC 2X7RB 2WLJA 3HPLC 1XL6A 3E8BA 3LNMB 5B1AC 4QE7A 2B5UA 3ZRWB 3NXSA 5L3GA 4UVBA 1OCRC 3ETGA 4KUMA 3M99B 2OTLV 2Z3YA 2B1IA 1M57B 1NR7A 2YEVB 2OT5A 3B8NA 5LGTA 1NJIW 3E86A 1F4NA 1S76D 1QLEC 4G2KA 4UV8A 1NVPB 2HLDG 4PA3A 2XASA 2MK3A 1CPYA 5H6QA 3FB6C 3VBBA 4QPKA 3VOUA 3OUSA 2NNUA 2R9RB 2EIMB 5EC2C 2M7WA 3ZN0A 4U7NA 4UVCA 3OGCC 5IY5B 5EBLC 1S5HC 2P67A 4TSFG 1KECA 2JDIG 2HVKC 3A0RA 3E8FA 3AEIA 1BMFG 2K1EA 4BIUA 3CC4V 4GCZA 4GX0A 5EK0A 3QNEA 2LFSA 5CBGA 1F51A 2ITDC 2X0LA 4HAMA 2F43G 1JOYA 2XOKG 4JF3A 3AG1C 2LP7A 4MVUA 3CPWU 3WG7C 4R7CA 5LGNA 3BY6A 1F4MA 3OMAB 1OCOC 1OCCC 3DGEA 4XDKA 3IC7A 2NLJC 2DYSB 1S72V 2EIJC 5HFLA 4G28B 2Y48A 2IJJA 3SJQC 5L3FA 1DTOA 4FJCC 3ZMTA 4WFBV 2QA4V 2EINC 1Q82W 1I5YA 1R6KA 1CP9A 2V7QG 1W0KG 2Z5UA 1S77D 4JAVA 5B3SC 1YJ9V 2JEXA 1OZ0A 3LDEA 1H2GA 2OCCB 3CMEV 3ABKB 2D3OW 3CXCU 3E89A 1K8AW 2OTJV 4QJFB 4RUFA 1W0JG 5FL7G 1E1RG 4MVZA 1K4DC 1NKDA 3W7UA 2A9HA 5KUKA 1FFTB 4MW8A 5B1BB 1THZA 1AROP 1GTOA 1KP3A 2EILB 5EBWC 2YEVA 1FXKB 3X2QC 5L3EA 3ETEA 1MSWD 1J95A 4MTOA 4LP8A 2PI4A 1WPXA 1K73W 1VQ9V 1AI7A 4WFGA 1GM8A 3GB7C 4DO2A 2ZR3A 1M56B 3AG4C 2H94A 3E35A 1KKDA 1ROPA 4XDLA 1Y4MA 4H33A 3ZCCA 2WLKA 2C2AA 4PELA 1HWYA 3OMNB 4JAUA 3ZRSA 3ZMSA 3P30A 5H9CA 4RUEA 3ETDA 3OFNG 4FMTA 2EZOA 1EFRG 2R9IA 1FXHA 3BEHA 1I5XA 2FTKA 3R65A 1R3KC 4RQEA 2ZDIC 3P32A 4Z1MG 3K06A 2DWDC 4KFMA 3STLC 2BOCC 4P30A 5BZBA 3ABLC 4J9YB 2IH1C 3JD4A 3SPGA 4P9OA 2XAGA 4MVSA 4XDJA 1V55C 1M90W 3MHSC 1QR8A 1YTFD 3ABMB 5KUMA 1AR1B 1VQPV 3SYOA 3RBZA 1OCZC 3AG2C 2WPDG 1QR9A 3EHBB 5L3CA 2WLNA 3B8MA 3SYPA 5EBMC 5B1AB 1WLEA 3CMAV 3K04A 4WFHA 1OCRB 2EZPA 1FS0G 1K33A 3TCUA 2ZXWC 1VQNV 3RVZA 1YJWV 1AI6A 1RM1B 1K92A 1YJNV 1Q81W 1SZTA 3I56V 1FXKA 3G4SV 4WFFA 4EKWA 1H38A 1BHBA 1S0VA 1QBZA 1TUEB 3LDCA 3AG3B 2A0LA 4XBFA 4HYOA 4JTDB 3SYAA 4X8AA 1JPXA 2X6AA 2UXNA 3MHHC 4WFEA 4PDVA 1GO3F 2IJHA 3ASNC 5EC1C 1AJPA 3AG1B 1BL8A 4LBEC 4UUJC 4X88A 1QVGU 3WG7B 1PL0A 1E79G 1K4CC 1OCOB 3E8GA 1OCCB 3CCSV 1NH2D 4LCUC 3ZMVA 5IY5C 3KG2A 4PDMA 5L3BA 3JD0A 2EIJB 2IJKA 1IXMA 1VQMV 1KD1W 3OEHG 1YTFB 2DW4A 2ZD9A 3UM7A 1VQLV 3E83A 4F4LA 2EINB 4UVAA 4I5SA 3JD1A 2JIZG 2WAMA 2EIKC 1ENVA 3FB8C 3LUTB 3ZRVA 3W7TA 5B3SB 1VQOV 1SERA 3FB7C 3K9AA 4MSWC 4LC1A 2Q68A 4PA4A 3K08A 2DYSC 3IGAC 3T1CA 1OHHG 1JQ0A 4J9ZB 4ZBMA 2Y69C 4JTAB 1QCEA 3F5WC 1KQSU 1GMGA 3SPCA 1JJ2U 4WF9V 3ASOB 2WLLA 4YXWG 2DQ3A 2IU3A 1BHAA 1NR1A 1JVMA 1YITV 1R3IC 3X2QB 5C93A 3OEEG 2OCCC 3OE7G 3JCZA 3ABKC 2XAJA 1G8MA 4MW3A 1EZJA 2V1DA 1VQ7V 4N23A 2WLIA 4MTXA 4DXWA 3WFVA 3CCVV 1GM7A 3K03A 3AG4B 3TK1A 1KP2A 2DYRC 4OXSA 1F23A 1Y66A 4L87A 1N8RW 1M1KW 2LFRA 1Q86W 1LNQA 5KA6A 5IYDO 5LBQA 4QPJA 3TETA 3F7VC 1SESA 3ZMUA 1FXKC 2W6JG 3SYQA 3K0DA 3T2MA 2ATKC 4PDRA 3CCQV 5IYCO 1V54C 2EBOA 1E1QG 2YSUB 3CC2V 3OR6C 1XL4A 5KA5A 3OAAG 2AHZA 2JK5C 1RPOA 2Q67A 3LSSA 5CA3A 1M56C 4I9WA 1VQ6V 2JEUA 2QKSA 1Q7YW 1JCHA 3LSQA 1S3JA 5CMUA 3ZMZA 5DN6G 3ABLB 3E2EA 5LGUA 4MVOA 2WWWA 2XAFA 3GWOA 4GT1A 3I55V 4RO2A 1SRYA 4P9PA 2WSSG 1V55B 3JD2A 2IW5A 1PNMA 5E1AC 2IH3C 1H8EG 2EJRA 5CN0A 4JYBA 5IYBO 1NBMG 2HVJC 5H6RA 4RAIA 1UJWB 1AJQA 3AG2B 3FB5C 3E8HA 1P7BA 4PA9A 2Q6AA 3LDDA 4N21A 5HFMA 2PI5A 2KB1A 4QNHB 2WLLB 2XAHA 1R3LC 4MT8A 2QE7G 4MVQA 2X6CA 2W6IG 3RW0A 2UXXA 3ML0A 4JASA 3UKMA 4ZKIA 4KP4A 2QM8A 4JGSA 5LHIA 1QLEB 1DF5A 3K79A 3ZRXA 4HZ3A 2IU0A 2WLIB 3FYEB 3G6EV 4QE9A 2JJ2G 1YSCA 1VQ4V 1W2BU 4X89A 3D3IA 1PKXA 2BOBC 4TWKA 1K34A 5DM6V 2ZR2A 2WLHA 3QO8A 2W0FC 4GX5A 1M57C 1R6NA 3CC7V 3IFXA 5GW7A 1COWG 5CBHA 2HKOA 1VQKV 3SPIA 1RM1C 4BIZA 3OR7C 4FK5C 3ASNB 1DLBA 5B1NA 2QM7A 3CCJV 1KC8W 1VQ5V 1GK9A 3CYOA 1CEZA 2EIMC 2GSMB 2XAQA 2ZQMA 3ZN1A 4E2LA 3H01A 2ZDIA 3AG3C 3W7WA 3PJSK 1YI2V 3F7YC 2AHYA 1QVFU 4G27B 1PD3A 3ABUA 3W7SA 3OMIB 2EIKB 2CK3G 3CCUV 4RQFA 2JJ1G 4GX2A 3RVYA 3B77A 1AI4A 1H8HG 3D36A 1RPRA 1DF4A 1YIJV 4H37A 4FPPA 4CBCA 2HR3A 4U7OA 2Y69B 1K7DA 5CBFA 1M9NA 2DWEC 2B1GA 1R73A 3T4ZA 5IDJA 2IJIA 4MTFA 4Q20A 4R6ZA 4JPRA 1GM9A 5B1OA 1MG1A 4UV9A 1VQ8V 2WLMA 1PNKA 3SPHA 2DQ0A 3CCEV 1NQTA 2P6JA 5LHHA 5L3DA 3W7XA 3JYCA 1JX9A 4QIWF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NLJ C;  3ASO C;  4MVR A;  5B1B C;  4WFF A;  5J9P C;  4EKW A;  2EIJ C;  5E1A C;  4G28 B;  2IH3 C;  2EIL C;  2QTO A;  3SJQ C;  4GX1 A;  4BW5 A;  3LDC A;  2HFE C;  4R8C A;  2A0L A;  2HVJ C;  2X6B A;  4RAI A;  2ITC C;  3FB5 C;  3E8H A;  1P7B A;  2EIN C;  2Q6A A;  1ZWI C;  3K0G A;  3LDD A;  4HYO A;  4JTD B;  4PA9 A;  3SYA A;  4X8A A;  2KB1 A;  2X6A A;  5B3S C;  4R50 A;  2H8P C;  3LDE A;  4WFE A;  4QNH B;  2WLL B;  4PDV A;  1R3L C;  4MVQ A;  3ASN C;  2X6C A;  5EC1 C;  3RW0 A;  1BL8 A;  4LBE C;  3E89 A;  4UUJ C;  4X88 A;  3UKM A;  4PDL A;  4MVM A;  4RUF A;  1G4Y B;  4MVZ A;  1K4D C;  1K4C C;  2A9H A;  3E8G A;  4HZ3 A;  5KUK A;  2Q69 A;  4LCU C;  2WLI B;  5IY5 C;  3KG2 A;  3EFF K;  4MW8 A;  4PDM A;  4QE9 A;  3ZJZ A;  3OUF A;  2HJF C;  5EBW C;  1ORQ C;  4X89 A;  3SYC A;  2BOB C;  2YEV A;  4TWK A;  2ZD9 A;  2HG5 C;  3X2Q C;  3UM7 A;  4PA6 A;  3E83 A;  4F4L A;  3T4D A;  2WLH A;  1J95 A;  2P7T C;  4MTO A;  2W0F C;  4P2Z A;  2EIK C;  4GX5 A;  1M57 C;  4LP8 A;  4JTC B;  3FB8 C;  3IFX A;  3LUT B;  4WFG A;  5CBH A;  3GB7 C;  3FB7 C;  3SPI A;  4MSW C;  3OR7 C;  3AG4 C;  2Q68 A;  4PA4 A;  1KKD A;  3K08 A;  2DYS C;  4XDL A;  3IGA C;  3SPJ A;  2A79 B;  4H33 A;  4PA7 A;  3T1C A;  4J9Z B;  2WLK A;  3ZRS A;  4ZBM A;  2Y69 C;  4JTA B;  2EIM C;  4MS2 A;  3ABM C;  3F5W C;  3STZ C;  4MTG A;  4RUE A;  3AG3 C;  3SPC A;  3PJS K;  1R3J C;  2WLJ A;  3F7Y C;  3HPL C;  2WLL A;  3BEH A;  1XL6 A;  3R65 A;  3E8B A;  1JVM A;  1R3K C;  2AHY A;  3LNM B;  4G27 B;  5B1A C;  4QE7 A;  1R3I C;  3K06 A;  2DWD C;  4KFM A;  2OCC C;  3STL C;  1OCR C;  2BOC C;  3ABK C;  4MW3 A;  4P30 A;  5BZB A;  2WLI A;  3E86 A;  4GX2 A;  3RVY A;  3ABL C;  4DXW A;  4J9Y B;  1QLE C;  2IH1 C;  3SPG A;  4PA3 A;  4P9O A;  3K03 A;  4MVS A;  4XDJ A;  2DYR C;  1V55 C;  4OXS A;  3FB6 C;  4H37 A;  3VOU A;  4CBC A;  3OUS A;  1LNQ A;  2R9R B;  5EC2 C;  5KUM A;  3TET A;  4RO2 A;  5CBF A;  3F7V C;  2DWE C;  3RBZ A;  3SYO A;  1OCZ C;  3AG2 C;  3OGC C;  3SYQ A;  5EBL C;  3T4Z A;  1S5H C;  3K0D A;  3T2M A;  2ATK C;  4PDR A;  4MTF A;  1V54 C;  2WLN A;  3E8F A;  2HVK C;  4R6Z A;  3SYP A;  3OR6 C;  1XL4 A;  5EBM C;  2K1E A;  2AHZ A;  4GX0 A;  2JK5 C;  5EK0 A;  5CBG A;  2Q67 A;  2ITD C;  3K04 A;  4WFH A;  1M56 C;  2WLM A;  4I9W A;  2QKS A;  3SPH A;  3AG1 C;  3TCU A;  2ZXW C;  4MVU A;  3WG7 C;  3RVZ A;  4R7C A;  4MVO A;  3JYC A;  1OCO C;  1OCC C;  4XDK A;  4P9P A; 
#chains in the Genus database with same CATH topology
 1Q3E A;  5KX5 B;  5B1B C;  3CCR V;  1XMQ B;  2EIL C;  2QTO A;  2Y4T A;  3CX5 F;  4H13 B;  3RYF A;  2JS5 A;  5FNV A;  1NH2 B;  3K0G A;  1WB7 A;  4JZ2 A;  1V54 B;  2QKA A;  4DR1 O;  4JYA O;  4FFB A;  1NVP D;  1MAB G;  4I4T A;  5JCO C;  5LHG A;  1YHQ V;  4CZZ A;  1NT2 B;  2L35 A;  4NTX A;  2Q69 A;  3EFF K;  2ARH A;  1X59 A;  3SYC A;  1EBO A;  4PJ0 Z;  3T4D A;  2P7T C;  3QO7 A;  1KU9 A;  3OM3 B;  4JTC B;  5CA0 B;  3THO A;  4UCV A;  2RNB A;  4B3M O;  4GUN A;  1L0L H;  1SA0 B;  5J2T B;  4YIO A;  4YJ2 B;  3ICX A;  5JVD B;  1GKF A;  5IJ9 B;  3U0Z A;  3LNM B;  5C8Y B;  4DV4 B;  4E4E A;  2CAZ C;  3ETG A;  2Z3Y A;  2YEV B;  1NJI W;  1XMO B;  4B3R B;  5H6Q A;  4DK0 A;  3B40 A;  2R9R B;  5EC2 C;  4U7N A;  1S5H C;  1XNQ B;  1KEC A;  2JDI G;  5BXZ A;  3AEI A;  1F51 A;  4DV2 O;  3WB1 A;  3A0B Z;  4JF3 A;  3AG1 C;  3OGI B;  4J42 A;  1BS3 A;  3IAY A;  3CPW U;  4H0L B;  1OCO C;  3MDS A;  1OCC C;  3DGE A;  4XDK A;  3IC7 A;  2IBZ H;  2EIJ C;  5HFL A;  2XT9 A;  4PHZ A;  5CA0 A;  4FJC C;  1Q82 W;  1I5Y A;  4JI4 O;  2Z5U A;  4K8X A;  2JEX A;  5J2T A;  4YJ2 A;  3CXC U;  3ZHR A;  5JVD A;  5IJ9 A;  4LR3 A;  1W0J G;  2DJV A;  5FL7 G;  3T1Y O;  3W7U A;  3QF7 A;  4IYH A;  3RYC B;  1FFT B;  1I0H A;  4MW8 A;  2LW7 A;  5B1B B;  5C8Y A;  1KP3 A;  2EIL B;  4FM2 A;  2YEV A;  1FXK B;  3Q4H B;  2G38 A;  4LP8 A;  4OX9 B;  2ZIM A;  1YCI A;  1CXZ B;  1IZ3 A;  5CA1 B;  3LSU A;  3E35 A;  4I7Z B;  3EVK A;  4DR3 B;  2V4D A;  2WLK A;  5KHK A;  1FPO A;  3DXR B;  4DR2 B;  3ZMS A;  1HNZ O;  4LF9 B;  2H3O A;  4B08 A;  4DV5 B;  2YI9 A;  5IWA O;  2LO1 A;  4JV5 B;  3P32 A;  4LF5 O;  3K06 A;  4TUY B;  1BZK A;  3JAT B;  4P30 A;  3DC6 A;  1V55 C;  3ZHQ A;  3RFR A;  1TA8 A;  3BA8 A;  1YTF D;  5KUM A;  3SYO A;  3A8T A;  4DV3 O;  4DR5 O;  3DSQ A;  1HNW B;  1J5E B;  3EHB B;  5L3C A;  2WLN A;  3SYP A;  4KHP B;  2UXC B;  1GH6 A;  3M7M X;  5JJJ B;  4X66 O;  3RYC A;  1Y67 A;  1VQN V;  4U3J B;  1YJN V;  1FXK A;  2UXB B;  1S0V A;  3K5N A;  1QBZ A;  4AQY O;  1TUE B;  4JI8 O;  2A0L A;  4XBF A;  1N34 B;  4HYO A;  2Q8V A;  4JTD B;  5CA1 A;  3K5O A;  1N0N A;  5JCO A;  2UXN A;  3MHH C;  4WFE A;  1M5I A;  3TGU H;  4UCS A;  1AJP A;  3AG1 B;  4DUY O;  1K4C C;  1OCO B;  1OCC B;  2WA4 A;  2E3C A;  5IY5 C;  3KG2 A;  3JAT A;  2EIJ B;  2IJK A;  1VQM V;  2ZM6 O;  1AR4 A;  1OJH A;  3HKB B;  3ZHS A;  1QU7 A;  4GYC B;  2VQE O;  1MZF A;  4JYA B;  2YS8 A;  2YC0 A;  4UVA A;  3JD1 A;  2VWK A;  3H1I H;  3U11 A;  4ABM A;  2CTP A;  2CGO A;  3IGA C;  1QCE A;  3F5W C;  1JJ2 U;  2DQ3 A;  2IU3 A;  1JVM A;  4DR4 O;  4I9Q A;  4LF7 O;  4NR1 A;  4GKK O;  4U3J A;  2QSA A;  3JCZ A;  3BRC A;  1G8M A;  4MW3 A;  1EZJ A;  1VQ7 V;  2WLI A;  4DV6 O;  4B3M B;  5DEC A;  5H2F Z;  3UT5 A;  1F23 A;  1Y66 A;  3FFQ A;  1M1K W;  2LFR A;  1ZTE A;  1LNQ A;  4I0X B;  4IGG A;  2W6J G;  3SYQ A;  3CCQ V;  1ZX3 A;  1WN7 A;  1M56 C;  4I9W A;  4O2B B;  1VIB A;  4OGQ B;  1H2N A;  2HHH O;  3EXA A;  1V55 B;  1PNM A;  2Q7G A;  3JAW B;  4IIJ A;  1H8E G;  2XHB A;  4RAI A;  1XIL A;  3FB5 C;  1P7B A;  2Q6A A;  4N21 A;  2ZE6 A;  5HFM A;  4DV2 B;  5LMU O;  1Y76 B;  1OV9 A;  3E22 A;  3AK3 A;  2R9A A;  2WLL B;  2XAH A;  2AW9 A;  4X20 B;  4MT8 A;  3T1H O;  2X6C A;  2W6I G;  4HBN A;  2CGN A;  1W59 A;  4JAS A;  4L8J A;  3C3T A;  2IU0 A;  3ZHV A;  3G6E V;  1YSC A;  4X89 A;  1YZB A;  4JI4 B;  1K34 A;  1WJZ A;  4J7K A;  4GX5 A;  2UUB O;  4LF8 B;  3H1K H;  3HKC B;  3LNN A;  3B2E E;  1IDS A;  5GW7 A;  5CBH A;  2YXH A;  4NTY A;  3N2K A;  4BIZ A;  3SJA C;  4I0X A;  2ZNI A;  1DLB A;  1P49 A;  3CS5 A;  3T1Y B;  2QM7 A;  2A06 H;  1S5J A;  5BR8 B;  1VQ5 V;  1CEZ A;  2EIM C;  3ZN1 A;  2ZQM A;  1VF5 B;  5KAI Z;  1IXB A;  1NS1 A;  2PZS A;  4O2B A;  1H2S B;  1NU1 H;  2YXY A;  3H1H H;  3CRR A;  3JAW A;  1AI4 A;  5K1X A;  2DE0 X;  1VF7 A;  4CBC A;  1Y76 A;  4X20 A;  3JAS B;  4Q20 A;  2AXT Z;  1XDC A;  1RSO B;  1WB8 A;  2E5L O;  3UCS C;  1M4U A;  2DQ0 A;  2ADQ B;  2P6J A;  3WU2 Z;  5LHH A;  1N0J A;  5L3D A;  3JYC A;  5FPR A;  3OT7 A;  4ZOL B;  4QIW F;  3CE2 A;  1U96 A;  1NZ6 A;  3ASO C;  4DV0 O;  4I55 A;  4DR7 O;  3ZRW A;  4A5U B;  4DV3 B;  2JS3 A;  4BW5 A;  1AJN A;  2HFE C;  3OW2 U;  2X6B A;  2ITC C;  1FXV A;  2ETN A;  3CD6 V;  4X66 B;  4TV9 B;  1P4R A;  3NR7 A;  4I50 B;  5JWP A;  4TT3 G;  3WB0 A;  3G67 A;  3HB3 B;  4BAY A;  3K3W A;  2OIG A;  3DTU B;  3L73 H;  4MVM A;  3CCL V;  5EIB D;  5BMV B;  3G71 V;  1F7Y A;  4AQY B;  2GHY A;  1MNG A;  4JI8 B;  1EZV H;  1A32 A;  1QLN A;  2F4V O;  4NKG B;  3BAA A;  4FIP C;  2XND G;  4TV8 B;  1BCC H;  4C7U A;  1OCZ B;  1R6T A;  3FYI B;  4FZ0 A;  4GKJ O;  2P90 A;  1LUV A;  3FKS G;  4P2Z A;  4GLX A;  4WFA V;  1LR1 A;  2ZE7 A;  1XOU A;  2YIB D;  2ZXW B;  3MD0 A;  3ZIA G;  4DV1 B;  4MS2 A;  3STZ C;  3ABM C;  4MTG A;  2ZM6 B;  1K5Q A;  3JD3 A;  1EN6 A;  1R3J C;  2Q0A A;  1RSO A;  2X7R B;  3HPL C;  3G6B A;  3GVM A;  3NXS A;  4KUM A;  2QWP B;  3JSL A;  3M99 B;  2B1I A;  2RQ6 A;  2Q73 A;  4YIP A;  5FNV B;  1F4N A;  4CH3 A;  2HEP A;  1QLE C;  1NVP B;  2HLD G;  2MK3 A;  2RN9 A;  2F93 B;  3VQW A;  1QQC A;  2ZE5 A;  2EIM B;  3J80 N;  4TV9 A;  4DR4 B;  3OGC C;  2AZ2 A;  4I50 A;  5EBL C;  1FJG O;  2VQF O;  4LF7 B;  4GKK B;  1BMF G;  5EK0 A;  3D3Q A;  2LFS A;  1Y6X A;  2ITD C;  2X0L A;  4DV6 B;  2F43 G;  3OTF A;  1JOY A;  2ADP A;  4FLZ A;  1WP8 A;  4NVP A;  4BIO A;  3J81 N;  2LP7 A;  4MVU A;  3WG7 C;  5LGN A;  1F4M A;  4TV8 A;  4CC6 A;  3AK2 A;  2UU9 B;  2DYS B;  2CTR A;  2ZT9 B;  2Y48 A;  3SJQ C;  5L3F A;  3QTC A;  1XQ8 A;  5LXT B;  1DTO A;  2QWO B;  2QA4 V;  4WFB V;  1CP9 A;  1XUQ A;  2RJZ A;  2GTS A;  4JAV A;  5B3S C;  4Z2W A;  1YJ9 V;  3LDE A;  2HHH B;  1H2G A;  2OCC B;  4CS3 A;  4B3T B;  2NN4 A;  3ABK B;  3K5M A;  4RWU A;  1Q6U A;  4X64 O;  3E89 A;  3DC5 A;  1E1R G;  4MVZ A;  1NKD A;  2A9H A;  5FLX N;  1BQ0 A;  1THZ A;  1ARO P;  1GTO A;  3ZED A;  1AP6 A;  1SF9 A;  3ZHU A;  4UCO A;  4K0K O;  3BA9 A;  4LH7 A;  4ZI7 B;  4WFG A;  2AGA A;  3GB7 C;  2ZR3 A;  4JI6 B;  1I08 A;  3G80 A;  2R70 A;  4CS4 A;  5LA6 A;  1Y4M A;  4H33 A;  3ZRS A;  1HWY A;  3L75 H;  4RUE A;  3ETD A;  2EZO A;  1I5X A;  2DWD C;  4KFM A;  5JQG B;  3STL C;  1KBH A;  4FZ1 A;  4LFC O;  1Q43 A;  4Z1V A;  4J9Y B;  3N2G A;  3FX7 A;  3JD4 A;  3SPG A;  1WA8 B;  4TQD A;  5LXT A;  4XDJ A;  3CRC A;  1Q6I A;  3ABM B;  1VQP V;  3RBZ A;  3VQX A;  1US6 A;  3AG2 C;  1HP8 A;  2UUA B;  2KG7 B;  2NR5 A;  2Q5Z A;  4WFH A;  2YXL A;  1Z5V A;  4J11 A;  1K92 A;  2IM9 A;  3P3P A;  3I56 V;  1GN6 A;  2M6Y A;  4U3F H;  1ZUQ A;  2F66 C;  3K5L A;  1BHB A;  4ZI7 A;  3BFR A;  4DRX A;  2PGG A;  3SYA A;  2E5L B;  3CEI A;  4UB8 Z;  4X8A A;  1JPX A;  2X6A A;  1Q8I A;  1L0N H;  4LH6 A;  2IJH A;  5EC1 C;  3FAV B;  1HR0 O;  4UUJ C;  5A9G A;  2PY5 A;  4LF4 O;  4DV0 B;  3WG7 B;  1PL0 A;  4DR7 B;  1E79 G;  3E8G A;  3JAM N;  1NH2 D;  4PDM A;  5JQG A;  4JYY A;  4JI3 O;  1G1X B;  1YTF B;  1ZL8 B;  2QR4 A;  2XTA A;  3UM7 A;  1VQL V;  1WPB A;  1BQZ A;  1WA8 A;  3LUT B;  3ZRV A;  1SER A;  5B3S B;  5LMN O;  3FB7 C;  1VAR A;  4MSW C;  2Q68 A;  3JCU Z;  3K08 A;  2JGU A;  2WA3 A;  1JQ0 A;  3TJT A;  2KG7 A;  4JTA B;  2F4V B;  2D2C B;  4GZR B;  1FAF A;  4NXN O;  4FM1 A;  2Y4U A;  4JI7 B;  3OE7 G;  3AK1 A;  1SQF A;  4EEQ A;  2V1D A;  1G6U A;  4O4L B;  2HJD A;  4MTX A;  3WFV A;  3CCV V;  4PV1 B;  1XBL A;  1KP2 A;  4X9Q A;  2DYR C;  4DR6 B;  1HW7 A;  5IYD O;  4DK1 A;  3F7V C;  1SES A;  1D5A A;  3K0D A;  4FLV A;  4FLX A;  4PDR A;  5KHJ A;  3FAV A;  1MSD A;  2YSU B;  3OAA G;  5JH7 B;  2JK5 C;  3LSS A;  5CA3 A;  4QGP A;  2CTQ A;  3ZMZ A;  5DN6 G;  4IYI A;  4GT1 A;  1ZL8 A;  3JD2 A;  3APO A;  1N32 B;  5E1A C;  1FJG B;  5H5N A;  5IYB O;  1NBM G;  3ETQ A;  2HVJ C;  3L74 H;  3AG2 B;  4NYK A;  3S3W A;  1H2K A;  2KB1 A;  1ZLZ A;  1R3L C;  2LQT A;  2VWJ A;  2QE7 G;  2BCC H;  3C90 A;  3UKM A;  1EN4 A;  4KP4 A;  4JGS A;  1DF5 A;  3K79 A;  1P84 F;  1TGO A;  2WLI B;  1PKX A;  2BOB C;  4O4L A;  3UT5 B;  5DM6 V;  2ZR2 A;  2LGW A;  3ZS8 C;  3SPI A;  4X64 B;  3D8C A;  1RM1 C;  3UO2 A;  1IBK O;  4FK5 C;  5GTI Z;  4DV7 O;  5B1N A;  3CCJ V;  1KC8 W;  1XEQ A;  2GSM B;  2XAQ A;  5EIB C;  1PL4 A;  3W7W A;  3AG3 C;  1JMK C;  3PJS K;  1YI2 V;  5JH7 A;  2F95 B;  1VF6 C;  3F7Y C;  2BTQ B;  1UFI A;  4LFA O;  3JAR A;  5A2Q N;  1RFY A;  4DR1 B;  1B04 A;  4BW9 A;  2QGN A;  4IIJ B;  4WBN A;  4JAA A;  3HKE A;  4RQF A;  4YHH O;  4GX2 A;  1RPR A;  3E22 B;  1DF4 A;  4H37 A;  5CBF A;  2RDC A;  2P06 A;  5JJE B;  4R6Z A;  4LFC B;  2PF4 E;  4BWA A;  5B1O A;  1DK1 A;  4UV9 A;  2WLM A;  1PNK A;  4EB6 B;  1JX9 A;  2DYR B;  4MVR A;  3N2K B;  3CP1 A;  3I5D A;  1AI5 A;  2LJ2 A;  4GX1 A;  2QEX V;  4R8C A;  5ITZ B;  1K97 A;  3RYH A;  3A2F A;  4ASU G;  4R50 A;  4EFE A;  3CCM V;  2FL4 A;  2F23 A;  3BVO A;  2BTQ A;  1TAE A;  1K5S A;  1G4Y B;  4LNU A;  4JYC A;  4OPH A;  3ZJZ A;  2HJF C;  1ORQ C;  2DOS A;  1U97 A;  5EYP B;  1B6Q A;  4KL1 A;  4X62 O;  2BSK A;  1HR0 B;  3SR2 C;  4CS2 A;  4LF4 B;  3CXH F;  1MOF A;  3SDL A;  1BSM A;  3SPJ A;  2QDO A;  4B7E A;  2A79 B;  2YI8 A;  4PA7 A;  1FFX A;  4WCE V;  4UCT A;  3L71 H;  1XMQ O;  2WLJ A;  2P5O A;  1XL6 A;  1D5N A;  1ZAU A;  5B1A C;  1JFF A;  4EB6 A;  3CRQ A;  4I55 B;  2PYJ A;  3L72 H;  3ZRW B;  2UUC O;  1SC5 B;  1XHX A;  5L3G A;  1OCR C;  2OTL V;  1IBL O;  2YIA A;  1NR7 A;  2OT5 A;  3B8N A;  5LGT A;  3E86 A;  4FLY A;  1S76 D;  4PA3 A;  3RWR D;  2GBO A;  5BY1 A;  1CPY A;  5ITZ A;  3FB6 C;  3VBB A;  4QPK A;  3VOU A;  2NNU A;  2P22 C;  2M7W A;  1VMG A;  5DED A;  5IY5 B;  3KCY A;  2P67 A;  3H1J H;  4TSF G;  3KKY A;  4BIU A;  3CC4 V;  4GX0 A;  3QNE A;  5CBG A;  2XOK G;  3HKD B;  2A3Q A;  3JAK B;  2ZE8 A;  3OMA B;  1MZE A;  3B4S A;  5EYP A;  1HNZ B;  4YJ3 B;  2NLJ C;  1S72 V;  2Z0A A;  1JA8 A;  4YY3 O;  5IWA B;  2XUM A;  1N33 O;  2EIN C;  4LF5 B;  3FD9 A;  3JAL B;  2E76 B;  3OTO O;  2D3O W;  1UPG A;  2YDE A;  2OTJ V;  3OD4 A;  4QJF B;  1XMO O;  4B3R O;  4RUF A;  1K4D C;  5KUK A;  3RN4 A;  4DR5 B;  5F2V O;  5EBW C;  1S5L Z;  1PP9 H;  3GWK C;  4Q6G A;  3X2Q C;  5L3E A;  1XNQ O;  1J95 A;  2OIE A;  2PI4 A;  1WPX A;  1I94 O;  1VQ9 V;  5EZY B;  1GM8 A;  3R66 A;  1BT8 A;  1M56 B;  3AG4 C;  1ROP A;  2CUG A;  4JZG A;  3UO3 A;  3ZCC A;  1VF6 A;  3OMN B;  4JAU A;  2Y0P A;  1Q5O A;  3P30 A;  2GDS A;  3O65 A;  1AB3 A;  3OFN G;  4FMT A;  1R1B A;  1T5E A;  2R9I A;  1FXH A;  2MW2 B;  3HR0 A;  2FTK A;  1X4T A;  3HKD A;  1AR5 A;  1QNM A;  3UQ8 A;  4Z1M G;  1XRE A;  2DN9 A;  3JAK A;  2BOC C;  2KQX A;  1IBK B;  4YJ3 A;  5BZB A;  1AP5 A;  2E75 B;  4DUY B;  2YIB A;  2IH1 C;  3BAB A;  4P9O A;  3MHS C;  2N05 A;  1AR1 B;  3JAL A;  3VQV A;  2VQE B;  4AIL C;  2E74 B;  2WPD G;  4O4J B;  4DW1 A;  3B8M A;  3CSX A;  5B1A B;  1BGY H;  1WLE A;  4YHH B;  1OCR B;  2EZP A;  1FS0 G;  1K33 A;  3RVZ A;  1YJW V;  5D5Q A;  3L70 H;  1SZT A;  3G4S V;  4WFF A;  4EKW A;  4X1K B;  2RCV A;  4LF9 O;  4PI0 A;  5LA6 B;  5EZY A;  5LOV B;  4D7S A;  3ASN C;  4IT5 A;  1BL8 A;  4LBE C;  4X88 A;  3CCS V;  4LCU C;  5L3B A;  3N2G B;  1YDX A;  1KD1 W;  3OEH G;  2DW4 A;  2ZD9 A;  4F4L A;  2EIN B;  1XI1 A;  1Y74 B;  2EIK C;  5J2U B;  3FB8 C;  3W7T A;  3K9A A;  3P3N A;  4LC1 A;  4W4K A;  4PA4 A;  5IJ0 B;  3T1C A;  1OHH G;  1MA1 A;  2Y69 C;  4O4J A;  5CB4 B;  2P4K A;  4WF9 V;  4BR6 A;  3ASO B;  3ZX6 A;  4YXW G;  3ZBH A;  1SKV A;  5LMU B;  2K9P A;  1R3I C;  4X62 B;  3X2Q B;  1N34 O;  2F1M A;  5K1P A;  2XAJ A;  5GTH Z;  3T1H B;  4N23 A;  4F6R B;  4DRX B;  4X1K A;  4DXW A;  2EJ7 A;  2JRI A;  4DUZ O;  1GM7 A;  3K03 A;  3AG4 B;  3TK1 A;  4OXS A;  5LOV A;  1Q86 W;  5KA6 A;  3TET A;  4QPJ A;  4X65 O;  1FXK C;  3T2M A;  2ATK C;  2UUC B;  5IYC O;  2EBO A;  5KA5 A;  2UUB B;  1IBL B;  1P7G A;  1YEW A;  4LF6 O;  1RPO A;  1NTM H;  3H1L H;  2QKS A;  2YUA A;  4J7J A;  1Q7Y W;  1JCH A;  1XNR O;  4O2A B;  3LSQ A;  1S3J A;  5CMU A;  3E2E A;  4B3S O;  5LGU A;  4MVO A;  3SJC C;  1PM9 A;  3GWO A;  4RO2 A;  4P9P A;  2WSS G;  2HP8 A;  2CTW A;  2IH3 C;  3B09 A;  2EJR A;  4JI5 O;  1GN4 A;  1Y74 A;  5GON B;  5J2U A;  5H6R A;  1UJW B;  4X1I B;  3LDD A;  1SZX A;  2PI5 A;  1GAX A;  1AVM A;  5IJ0 A;  3BPZ A;  1QHT A;  1TVK B;  4UCU A;  4MVQ A;  2Q4P A;  2ZNJ A;  5CB4 A;  3M8A A;  3ML0 A;  2YID A;  4ZKI A;  1D2D A;  1KYO F;  5LHI A;  1QLE B;  1IBM O;  4HZ3 A;  1LUW A;  4QE9 A;  4YY3 B;  3A0H Z;  2JJ2 G;  3WB2 A;  1N33 B;  1W2B U;  3D3I A;  3J7A U;  4TWK A;  3O9O A;  4F6R A;  3RYI A;  3QO8 A;  1SQG A;  3OTO B;  1M57 C;  3CC7 V;  2BE3 A;  3IFX A;  3K9S A;  5KX5 A;  1COW G;  2HKO A;  1VQK V;  3OR7 C;  3ASN B;  1GK9 A;  4J41 A;  4E2L A;  3H01 A;  1ZSP A;  4O2A A;  1I94 B;  5KHG A;  3W7S A;  3OMI B;  2EIK B;  2CK3 G;  4AI8 A;  3RVY A;  2ODM A;  1GN2 A;  5GON A;  1AIL A;  2KKW A;  4K3A A;  4X1I A;  4FPP A;  2LGQ A;  2HR3 A;  3CWB H;  2Y69 B;  1H2M A;  1SQP H;  1TVK A;  2IJI A;  4MTF A;  3APQ A;  4GKJ B;  3SJB C;  4CC5 A;  1O9H A;  3K57 A;  1MG1 A;  4LF8 O;  4TQF A;  2W0X A;  4LFB O;  4FVM A;  1SA0 A;  4EFB A;  3CCE V;  3W7X A;  4X1Y B;  1HDJ A;  4W4L A;  1SS3 A;  3CRM A;  5J9P C;  5BR8 O;  1K9M W;  1TUB B;  4IL6 Z;  4O4I B;  2ZIN A;  1XHZ A;  1ZWI C;  1FD9 A;  4HNA B;  3CRA A;  1WP7 A;  2GTA A;  1SET A;  2H8P C;  2OYQ A;  3QO5 A;  1L1F A;  1GRJ A;  3JAR B;  4PDL A;  1HNX O;  1YXB A;  4WBN B;  1PNL A;  3HKE B;  2AZ0 A;  4UXN A;  3OUF A;  4NTW A;  2A7W A;  1K3E A;  2VQF B;  3QG5 A;  3ABT A;  5FPO A;  2HG5 C;  4PA6 A;  5KLV H;  1MMM A;  5JJN B;  4CH4 A;  1EM1 A;  2Q7H A;  4PI2 A;  5IT9 N;  1YVW A;  3SGI A;  2JGD B;  4UB6 Z;  3BHP A;  4FFK A;  2UXD O;  3JSN A;  5KHH A;  3E8B A;  4QE7 A;  2B5U A;  3TXS A;  2N04 A;  2QWQ B;  4UVB A;  1PV0 A;  4X1Y A;  4JI1 O;  1DGS A;  1M57 B;  5LYJ B;  5IE9 A;  3RYH B;  1TUB A;  4G2K A;  4UV8 A;  2DMX A;  2XAS A;  4ZHQ B;  4O4I A;  2QM4 A;  3OUS A;  3Q4H A;  4HNA A;  4J80 A;  3ZN0 A;  2FB5 A;  4ZIB A;  4UVC A;  3KCX A;  4LNU B;  4FLT A;  3E8F A;  3A0R A;  2HVK C;  4K0K B;  2K1E A;  4GCZ A;  4HAM A;  3DXR A;  5E79 Z;  1O9G A;  1EN5 A;  2FYU H;  4DUZ B;  4B7K A;  4PD4 F;  4R7C A;  3BY6 A;  2BSK B;  5LL6 Y;  4DV1 O;  4X65 B;  2QJ1 A;  4TUY A;  4G28 B;  2GUZ B;  2IJJ A;  4JI0 O;  1BE3 H;  1WNS A;  3ZMT A;  1FFX B;  4LF6 B;  1R6K A;  1KB9 F;  2V7Q G;  3PN1 A;  5LP6 C;  1V9P A;  1W0K G;  1S77 D;  3K58 A;  1OZ0 A;  1XNR B;  4FM0 A;  1NTZ H;  3CME V;  2JGD A;  4B3S B;  4J10 A;  1JFF B;  1K8A W;  1VEW A;  2GV9 A;  2Q7E A;  4JI5 B;  2L6L A;  5LYJ A;  4OPA A;  5B5E Z;  1Z2G A;  3ETE A;  1MSW D;  4MTO A;  4ZHQ A;  1K73 W;  1AI7 A;  1Q6H A;  4DO2 A;  1SQV H;  1GN3 A;  1IBM B;  2H94 A;  1KKD A;  4XDL A;  1SQX H;  4NXM O;  2C2A A;  4PEL A;  5H9C A;  2QKC A;  2UU9 O;  1EFR G;  4ICG A;  2YIC A;  3BEH A;  3R65 A;  1R3K C;  4RQE A;  2ZDI C;  1JJO A;  1NTK H;  2VS0 A;  4DW0 A;  1M93 A;  3H9V A;  2VRZ A;  4JI2 O;  4K35 A;  3ABL C;  4O4H B;  4AHC A;  4B3T O;  1URF A;  2GUZ A;  1WAZ A;  3HKB A;  2XAG A;  4MVS A;  2OWO A;  1M90 W;  1VP7 A;  1QR8 A;  3D36 C;  1N36 O;  4JI3 B;  1OCZ C;  4D7T A;  1QR9 A;  2Q0O C;  5EBM C;  3CMA V;  3K04 A;  5LMN B;  3TCU A;  2ZXW C;  4JI6 O;  1FYJ A;  1AI6 A;  2N74 A;  1RM1 B;  1Q81 W;  4J7Z A;  1H38 A;  4NXN B;  3LDC A;  3AG3 B;  2P4V A;  3IC9 A;  4IHJ B;  1YF2 A;  4LWS B;  1IX9 A;  3IJ4 A;  4LFB B;  2BTO A;  1L8D A;  4PDV A;  1GO3 F;  3QVN A;  3KZI Z;  1QVG U;  3AG7 A;  5KMG B;  3ZMV A;  3CB2 A;  3JD0 A;  1IXM A;  2UUA O;  3E83 A;  4O4H A;  4I5S A;  2JIZ G;  3RT3 C;  2WAM A;  4NB5 A;  3MAQ A;  1ENV A;  2CDY A;  4DV4 O;  5LP6 B;  1VQO V;  2OCH A;  4KXR A;  1HNX B;  2PUS A;  4UCR A;  2EUL A;  4H44 B;  2DYS C;  2ZIO A;  4J9Z B;  5D5P A;  4ZBM A;  1KQS U;  1GMG A;  3SPC A;  2WLL A;  1BHA A;  1NR1 A;  1YIT V;  1Z5W A;  3ZHT A;  5C93 A;  3OEE G;  2OCC C;  1PPJ H;  3CHX A;  3ABK C;  4FLW A;  1KUQ A;  2LW1 A;  4L87 A;  1N8R W;  4IHJ A;  4CH6 A;  4LWS A;  5LBQ A;  3C3S A;  2UXD B;  3HKC A;  1FKA O;  3ZMU A;  2ILM A;  4K8Z A;  5B66 Z;  2JVD A;  2ZCE A;  3S3X A;  1V54 C;  1E1Q G;  2CH7 B;  3CC2 V;  3OR6 C;  1XL4 A;  4JI1 B;  2AHZ A;  1SQQ H;  2Q67 A;  5KMG A;  1VQ6 V;  2JEU A;  4DV7 B;  3RGB A;  3ABL B;  2WWW A;  2XAF A;  1I7F A;  2PYL A;  3F5T A;  3I55 V;  3CJH B;  5IYZ B;  1SRY A;  2IW5 A;  5CN0 A;  4JYB A;  3U10 A;  5LP6 A;  4LFA B;  1AJQ A;  1IUR A;  2KSD A;  3E8H A;  4PA9 A;  4JI7 O;  3TXQ A;  2Q9L A;  4D6T H;  1KKC A;  4QNH B;  4OX9 O;  1Q90 D;  3RW0 A;  2UXX A;  4DYL A;  2EX3 A;  2QM8 A;  3JAS A;  3ZRX A;  2Y0I A;  4DR3 O;  3FYE B;  4JI0 B;  4DR6 O;  4DR2 O;  1VQ4 V;  2FML A;  1KMI Z;  1IVS A;  4DV5 O;  3L9D A;  2WLH A;  1JR9 A;  2W0F C;  4JV5 O;  1R6N A;  3RYF B;  4ZOL A;  5TIS Z;  1B3Q A;  2R72 A;  4TOI A;  2QWR B;  3BCC H;  2PTM A;  4FFB B;  4I4T B;  2QWN B;  3CYO A;  2CH7 A;  2ZDI A;  1N32 O;  2ZKO A;  2RMK B;  3N27 A;  2AHY A;  2O57 A;  2B9Z A;  4G27 B;  1QVF U;  1PD3 A;  1HNW O;  1J5E O;  5AG2 A;  5BMV A;  4KHP O;  2UXC O;  3ABU A;  2QTS A;  3CJH A;  5IYZ A;  3CCU V;  2JJ1 G;  1N4C A;  3B77 A;  5KHI A;  4NXM B;  4UFZ A;  1H2L A;  1H8H G;  3D36 A;  1B06 A;  3K59 A;  1YIJ V;  1SQB H;  3VQY A;  4U7O A;  1K7D A;  1M9N A;  2DWE C;  2B1G A;  2UXB O;  1R73 A;  3T4Z A;  5KAF Z;  1RP3 B;  5IDJ A;  2FKX A;  4FLU A;  4JI2 B;  4JPR A;  1GM9 A;  1VQ8 V;  1NI8 A;  3SPH A;  4CH5 A;  3RYI B;  1NQT A;  4F6E A;  2CE4 A;  1N36 B; 
#chains in the Genus database with same CATH homology
 3ASO C;  2DYR B;  4MVR A;  5B1B C;  5J9P C;  3CCR V;  3ZRW A;  3CP1 A;  1K9M W;  2EIL C;  2QTO A;  1AI5 A;  4GX1 A;  4BW5 A;  1AJN A;  2QEX V;  2HFE C;  4R8C A;  3OW2 U;  1K97 A;  2X6B A;  2ITC C;  1FXV A;  1NH2 B;  3K0G A;  3CD6 V;  1ZWI C;  1V54 B;  4ASU G;  1P4R A;  1SET A;  4R50 A;  2H8P C;  1NVP D;  1MAB G;  3QO5 A;  4TT3 G;  1L1F A;  3CCM V;  3HB3 B;  4BAY A;  5LHG A;  1YHQ V;  3K3W A;  4CZZ A;  4PDL A;  3DTU B;  4MVM A;  3CCL V;  1K5S A;  3G71 V;  1G4Y B;  1PNL A;  2Q69 A;  2GHY A;  4JYC A;  3EFF K;  4UXN A;  3ZJZ A;  3OUF A;  1QLN A;  2HJF C;  4FIP C;  1K3E A;  1ORQ C;  3ABT A;  2XND G;  1EBO A;  3SYC A;  1OCZ B;  1B6Q A;  2HG5 C;  3FYI B;  4PA6 A;  3T4D A;  2P7T C;  3QO7 A;  2P90 A;  3FKS G;  4P2Z A;  3OM3 B;  4JTC B;  4WFA V;  1MOF A;  3SPJ A;  2ZXW B;  2A79 B;  3MD0 A;  4PA7 A;  3ZIA G;  4MS2 A;  3STZ C;  4WCE V;  3ABM C;  4MTG A;  1K5Q A;  3JD3 A;  1GKF A;  1R3J C;  2X7R B;  2WLJ A;  3HPL C;  1XL6 A;  3E8B A;  3LNM B;  5B1A C;  4QE7 A;  2B5U A;  3ZRW B;  3NXS A;  5L3G A;  4UVB A;  1OCR C;  3ETG A;  4KUM A;  3M99 B;  2OTL V;  2Z3Y A;  2B1I A;  1M57 B;  1NR7 A;  2YEV B;  2OT5 A;  3B8N A;  5LGT A;  1NJI W;  3E86 A;  1F4N A;  1S76 D;  1QLE C;  4G2K A;  4UV8 A;  1NVP B;  2HLD G;  4PA3 A;  2XAS A;  2MK3 A;  1CPY A;  5H6Q A;  3FB6 C;  3VBB A;  4QPK A;  3VOU A;  3OUS A;  2NNU A;  2R9R B;  2EIM B;  5EC2 C;  2M7W A;  3ZN0 A;  4U7N A;  4UVC A;  3OGC C;  5IY5 B;  5EBL C;  1S5H C;  2P67 A;  4TSF G;  1KEC A;  2JDI G;  2HVK C;  3A0R A;  3E8F A;  3AEI A;  1BMF G;  2K1E A;  4BIU A;  3CC4 V;  4GCZ A;  4GX0 A;  5EK0 A;  3QNE A;  2LFS A;  5CBG A;  1F51 A;  2ITD C;  2X0L A;  4HAM A;  2F43 G;  1JOY A;  2XOK G;  4JF3 A;  3AG1 C;  2LP7 A;  4MVU A;  3CPW U;  3WG7 C;  4R7C A;  5LGN A;  3BY6 A;  1F4M A;  3OMA B;  1OCO C;  1OCC C;  3DGE A;  4XDK A;  3IC7 A;  2NLJ C;  2DYS B;  1S72 V;  2EIJ C;  5HFL A;  4G28 B;  2Y48 A;  2IJJ A;  3SJQ C;  5L3F A;  1DTO A;  4FJC C;  3ZMT A;  4WFB V;  2QA4 V;  2EIN C;  1Q82 W;  1I5Y A;  1R6K A;  1CP9 A;  2V7Q G;  1W0K G;  2Z5U A;  1S77 D;  4JAV A;  5B3S C;  1YJ9 V;  2JEX A;  1OZ0 A;  3LDE A;  1H2G A;  2OCC B;  3CME V;  3ABK B;  2D3O W;  3CXC U;  3E89 A;  1K8A W;  2OTJ V;  4QJF B;  4RUF A;  1W0J G;  5FL7 G;  1E1R G;  4MVZ A;  1K4D C;  1NKD A;  3W7U A;  2A9H A;  5KUK A;  1FFT B;  4MW8 A;  5B1B B;  1THZ A;  1ARO P;  1GTO A;  1KP3 A;  2EIL B;  5EBW C;  2YEV A;  1FXK B;  3X2Q C;  5L3E A;  3ETE A;  1MSW D;  1J95 A;  4MTO A;  4LP8 A;  2PI4 A;  1WPX A;  1K73 W;  1VQ9 V;  1AI7 A;  4WFG A;  1GM8 A;  3GB7 C;  4DO2 A;  2ZR3 A;  1M56 B;  3AG4 C;  2H94 A;  3E35 A;  1KKD A;  1ROP A;  4XDL A;  1Y4M A;  4H33 A;  3ZCC A;  2WLK A;  2C2A A;  4PEL A;  1HWY A;  3OMN B;  4JAU A;  3ZRS A;  3ZMS A;  3P30 A;  5H9C A;  4RUE A;  3ETD A;  3OFN G;  4FMT A;  2EZO A;  1EFR G;  2R9I A;  1FXH A;  3BEH A;  1I5X A;  2FTK A;  3R65 A;  1R3K C;  4RQE A;  2ZDI C;  3P32 A;  4Z1M G;  3K06 A;  2DWD C;  4KFM A;  3STL C;  2BOC C;  4P30 A;  5BZB A;  3ABL C;  4J9Y B;  2IH1 C;  3JD4 A;  3SPG A;  4P9O A;  2XAG A;  4MVS A;  4XDJ A;  1V55 C;  1M90 W;  3MHS C;  1QR8 A;  1YTF D;  3ABM B;  5KUM A;  1AR1 B;  1VQP V;  3SYO A;  3RBZ A;  1OCZ C;  3AG2 C;  2WPD G;  1QR9 A;  3EHB B;  5L3C A;  2WLN A;  3B8M A;  3SYP A;  5EBM C;  5B1A B;  1WLE A;  3CMA V;  3K04 A;  4WFH A;  1OCR B;  2EZP A;  1FS0 G;  1K33 A;  3TCU A;  2ZXW C;  1VQN V;  3RVZ A;  1YJW V;  1AI6 A;  1RM1 B;  1K92 A;  1YJN V;  1Q81 W;  1SZT A;  3I56 V;  1FXK A;  3G4S V;  4WFF A;  4EKW A;  1H38 A;  1BHB A;  1S0V A;  1QBZ A;  1TUE B;  3LDC A;  3AG3 B;  2A0L A;  4XBF A;  4HYO A;  4JTD B;  3SYA A;  4X8A A;  1JPX A;  2X6A A;  2UXN A;  3MHH C;  4WFE A;  4PDV A;  1GO3 F;  2IJH A;  3ASN C;  5EC1 C;  1AJP A;  3AG1 B;  1BL8 A;  4LBE C;  4UUJ C;  4X88 A;  1QVG U;  3WG7 B;  1PL0 A;  1E79 G;  1K4C C;  1OCO B;  3E8G A;  1OCC B;  3CCS V;  1NH2 D;  4LCU C;  3ZMV A;  5IY5 C;  3KG2 A;  4PDM A;  5L3B A;  3JD0 A;  2EIJ B;  2IJK A;  1IXM A;  1VQM V;  1KD1 W;  3OEH G;  1YTF B;  2DW4 A;  2ZD9 A;  3UM7 A;  1VQL V;  3E83 A;  4F4L A;  2EIN B;  4UVA A;  4I5S A;  3JD1 A;  2JIZ G;  2WAM A;  2EIK C;  1ENV A;  3FB8 C;  3LUT B;  3ZRV A;  3W7T A;  5B3S B;  1VQO V;  1SER A;  3FB7 C;  3K9A A;  4MSW C;  4LC1 A;  2Q68 A;  4PA4 A;  3K08 A;  2DYS C;  3IGA C;  3T1C A;  1OHH G;  1JQ0 A;  4J9Z B;  4ZBM A;  2Y69 C;  4JTA B;  1QCE A;  3F5W C;  1KQS U;  1GMG A;  3SPC A;  1JJ2 U;  4WF9 V;  3ASO B;  2WLL A;  4YXW G;  2DQ3 A;  2IU3 A;  1BHA A;  1NR1 A;  1JVM A;  1YIT V;  1R3I C;  3X2Q B;  5C93 A;  3OEE G;  2OCC C;  3OE7 G;  3JCZ A;  3ABK C;  2XAJ A;  1G8M A;  4MW3 A;  1EZJ A;  2V1D A;  1VQ7 V;  4N23 A;  2WLI A;  4MTX A;  4DXW A;  3WFV A;  3CCV V;  1GM7 A;  3K03 A;  3AG4 B;  3TK1 A;  1KP2 A;  2DYR C;  4OXS A;  1F23 A;  1Y66 A;  4L87 A;  1N8R W;  1M1K W;  2LFR A;  1Q86 W;  1LNQ A;  5KA6 A;  5IYD O;  5LBQ A;  4QPJ A;  3TET A;  3F7V C;  1SES A;  3ZMU A;  1FXK C;  2W6J G;  3SYQ A;  3K0D A;  3T2M A;  2ATK C;  4PDR A;  3CCQ V;  5IYC O;  1V54 C;  2EBO A;  1E1Q G;  2YSU B;  3CC2 V;  3OR6 C;  1XL4 A;  5KA5 A;  3OAA G;  2AHZ A;  2JK5 C;  1RPO A;  2Q67 A;  3LSS A;  5CA3 A;  1M56 C;  4I9W A;  1VQ6 V;  2JEU A;  2QKS A;  1Q7Y W;  1JCH A;  3LSQ A;  1S3J A;  5CMU A;  3ZMZ A;  5DN6 G;  3ABL B;  3E2E A;  5LGU A;  4MVO A;  2WWW A;  2XAF A;  3GWO A;  4GT1 A;  3I55 V;  4RO2 A;  1SRY A;  4P9P A;  2WSS G;  1V55 B;  3JD2 A;  2IW5 A;  1PNM A;  5E1A C;  2IH3 C;  1H8E G;  2EJR A;  5CN0 A;  4JYB A;  5IYB O;  1NBM G;  2HVJ C;  5H6R A;  4RAI A;  1UJW B;  1AJQ A;  3AG2 B;  3FB5 C;  3E8H A;  1P7B A;  4PA9 A;  2Q6A A;  3LDD A;  4N21 A;  5HFM A;  2PI5 A;  2KB1 A;  4QNH B;  2WLL B;  2XAH A;  1R3L C;  4MT8 A;  2QE7 G;  4MVQ A;  2X6C A;  2W6I G;  3RW0 A;  2UXX A;  3ML0 A;  4JAS A;  3UKM A;  4ZKI A;  4KP4 A;  2QM8 A;  4JGS A;  5LHI A;  1QLE B;  1DF5 A;  3K79 A;  3ZRX A;  4HZ3 A;  2IU0 A;  2WLI B;  3FYE B;  3G6E V;  4QE9 A;  2JJ2 G;  1YSC A;  1VQ4 V;  1W2B U;  4X89 A;  3D3I A;  1PKX A;  2BOB C;  4TWK A;  1K34 A;  5DM6 V;  2ZR2 A;  2WLH A;  3QO8 A;  2W0F C;  4GX5 A;  1M57 C;  1R6N A;  3CC7 V;  3IFX A;  5GW7 A;  1COW G;  5CBH A;  2HKO A;  1VQK V;  3SPI A;  1RM1 C;  4BIZ A;  3OR7 C;  4FK5 C;  3ASN B;  1DLB A;  5B1N A;  2QM7 A;  3CCJ V;  1KC8 W;  1VQ5 V;  1GK9 A;  3CYO A;  1CEZ A;  2EIM C;  2GSM B;  2XAQ A;  2ZQM A;  3ZN1 A;  4E2L A;  3H01 A;  2ZDI A;  3AG3 C;  3W7W A;  3PJS K;  1YI2 V;  3F7Y C;  2AHY A;  1QVF U;  4G27 B;  1PD3 A;  3ABU A;  3W7S A;  3OMI B;  2EIK B;  2CK3 G;  3CCU V;  4RQF A;  2JJ1 G;  4GX2 A;  3RVY A;  3B77 A;  1AI4 A;  1H8H G;  3D36 A;  1RPR A;  1DF4 A;  1YIJ V;  4H37 A;  4FPP A;  4CBC A;  2HR3 A;  4U7O A;  2Y69 B;  1K7D A;  5CBF A;  1M9N A;  2DWE C;  2B1G A;  1R73 A;  3T4Z A;  5IDJ A;  2IJI A;  4MTF A;  4Q20 A;  4R6Z A;  4JPR A;  1GM9 A;  5B1O A;  1MG1 A;  4UV9 A;  1VQ8 V;  2WLM A;  1PNK A;  3SPH A;  2DQ0 A;  3CCE V;  1NQT A;  2P6J A;  5LHH A;  5L3D A;  3W7X A;  3JYC A;  1JX9 A;  4QIW F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...