4P9OA

Complex of voltage-gated ion channel in a the presence of channel blocking compound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
molecule keywords Ion transport protein
total genus 31
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p9oA00
3RBZA 2JK5C 3T2MA 2EINC 5CBGA 3RW0A 2AHZA 5J9PC 3FB8C 3ABLC 2HG5C 3AG1C 4HZ3A 4DXWA 5BZBA 4WFEA 5KUMA 3SYCA 2WLLA 2A0LA 5CBHA 3ASNC 2ZD9A 5E1AC 4RO2A 1R3IC 2IH3C 2W0FC 3LDDA 1J95A 3PJSK 3SPIA 4PDVA 4MW3A 3SPGA 4PA9A 4LBEC 3UKMA 4F4LA 4P9PA 2WLNA 4EKWA 2WLHA 3RVYA 4H33A 4KFMA 2A79B 3AG2C 1R3KC 1JVMA 4MTGA 2Q69A 4LCUC 4P30A 3FB6C 4JTAB 3E83A 4PDLA 1G4YB 4BW5A 3JYCA 4RUEA 1OCCC 2Q6AA 4MSWC 4JTCB 2WLLB 3TETA 3E8BA 5IY5C 3X2QC 3LDEA 4JTDB 4TWKA 3OGCC 1K4CC 4PDRA 2HVJC 4RUFA 1QLEC 2A9HA 4UUJC 3K03A 2EIJC 3SYOA 4I9WA 2Q68A 1P7BA 4XDKA 3K0GA 3R65A 4ZBMA 5B1BC 3K08A 2WLKA 3RVZA 3SPHA 1LNQA 3T4ZA 5KUKA 2K1EA 5B3SC 4MVZA 2OCCC 1M56C 4MVRA 4MS2A 2ITCC 3K04A 3GB7C 4MTOA 4PA3A 3ZJZA 3T4DA 4R8CA 4CBCA 2DWEC 1R3JC 4GX0A 2WLIA 4QE7A 4MVSA 4WFFA 3E8HA 3EFFK 1OCOC 3LUTB 3K0DA 2WLJA 3OUSA 1XL6A 3STZC 2Q67A 3T1CA 2HFEC 4HYOA 3AG3C 2X6BA 3E8GA 3FB7C 4R6ZA 2KB1A 1ORQC 4G28B 4OXSA 1BL8A 3OR6C 1OCRC 4X88A 3TCUA 4MTFA 3WG7C 3STLC 2X6CA 2ITDC 2YEVA 3OR7C 3OUFA 2AHYA 4XDJA 4R7CA 4QE9A 4MVOA 5EK0A 1KKDA 2Y69C 4X8AA 5CBFA 2H8PC 2ATKC 3F7VC 4GX5A 3AG4C 2EIMC 2QKSA 3SYPA 3ABKC 2P7TC 2ZXWC 3IGAC 4MW8A 2WLIB 4PA4A 3ASOC 4LP8A 4P2ZA 2HJFC 4GX1A 4J9ZB 4MVUA 1XL4A 2DYSC 3F5WC 3SJQC 3IFXA 3F7YC 3FB5C 1S5HC 3KG2A 4X89A 4H37A 2IH1C 5EC2C 2WLMA 3HPLC 4GX2A 5EC1C 3VOUA 4MVMA 2X6AA 4WFHA 1M57C 2BOBC 3SPCA 2HVKC 3E8FA 1V54C 1ZWIC 3BEHA 4P9OA 4RAIA 2NLJC 4R50A 2R9RB 4XDLA 5EBMC 3UM7A 2EILC 3SYQA 4WFGA 5B1AC 2DYRC 4G27B 3SYAA 3K06A 3LNMB 1V55C 1K4DC 2DWDC 3ABMC 5EBLC 3LDCA 4PA6A 3ZRSA 1R3LC 4QNHB 4MVQA 3E86A 4PDMA 4PA7A 2EIKC 4J9YB 3SPJA 1OCZC 5EBWC 3E89A 2BOCC 2QTOA
chains in the Genus database with same CATH superfamily
4BW9A 1YF2A 2ZD9A 4DV7O 1S5JA 1R3IC 2IH3C 2W0FC 1FXVA 4CC6A 2E5LB 2G38A 4QPJA 1SZTA 4KFMA 1FJGO 5LMUO 2BTQA 3OT7A 4MTGA 3L73H 3K5NA 1VARA 4DR5O 4DR1B 4JTCB 3L72H 2OT5A 4DUYB 4FJCC 4DK0A 4FLUA 3SYOA 2NNUA 1O9GA 3W7UA 1GAXA 4OGQB 5KUKA 2WWWA 4I50A 2ITCC 1AP6A 3HKEB 1OHHG 2W6IG 5L3EA 1XMQB 2QWNB 1H38A 1BMFG 4NXNO 2JDIG 4HYOA 3CCRV 4JI2B 4ZKIA 1Q6IA 3O9OA 3QNEA 5DN6G 2QWPB 2UXDO 1AI6A 4I0XB 1ZX3A 1HDJA 2WA3A 2BSKB 1NH2D 4K0KB 2XOKG 3ASOC 2XT9A 2LW1A 3W7WA 2WSSG 3OAAG 4KP4A 3CRMA 2WLMA 2JGDA 4DR2O 5KHIA 2DJVA 4FPPA 4ICGA 3P30A 1HP8A 2KKWA 1HNXB 4TUYA 1K4DC 1MSWD 1XMOO 4DW1A 1FXKA 1DF5A 2EIKB 4JI3B 5B1AB 2UUCO 4I55A 5CBGA 2RQ6A 3H1JH 1VP7A 1H2GA 1NS1A 4JI5B 4IT5A 1BCCH 4FZ1A 2WLNA 3CPWU 2R9AA 4YIPA 1MA1A 2Z5UA 2VWKA 5LYJA 5JCOA 1AROP 1IBLB 2HVJC 2A9HA 2ILMA 4ZOLB 1H2MA 2V1DA 3UT5B 3GWKC 4J80A 1N34O 2QDOA 1NR1A 2UUAO 4YY3O 1K92A 3IAYA 3OEHG 4JYAO 3G67A 3LUTB 3STZC 5GONB 2YDEA 3OFNG 4B3SB 2QSAA 3L9DA 1VQ6V 4I50B 2X6CA 1QNMA 4JZGA 2RJZA 1WLEA 5B3SB 2F66C 4IYIA 4QGPA 1JJ2U 2QKSA 5E79Z 3CCLV 4PA4A 1IBMO 3T1YO 1L0NH 2YEVB 3I56V 1DLBA 1RPRA 4DV6B 5LMNO 4DV5O 1IURA 1IXBA 2X6AA 4UCTA 1AR1B 2GUZA 2Z0AA 1AI5A 3FD9A 1XREA 2IW5A 1GN4A 2EILC 3J7AU 2ZKOA 3SYQA 3ZRWB 1OCRB 4J7KA 1Z5VA 3B8MA 1L1FA 2LFSA 2DWDC 4LNUB 2PI4A 4PA6A 4B3TB 3OTOO 5J2UA 2LW7A 4J9YB 3OE7G 4DV0B 4XBFA 3RYCB 3J81N 3AG7A 3ZX6A 1F7YA 3MHSC 3QF7A 1TGOA 4J7JA 5E1AC 2YC0A 3SR2C 1J95A 4K3AA 1EFRG 1FD9A 1VEWA 4IGGA 2GSMB 5JQGB 1KUQA 5J2UB 1GM8A 1WP8A 3DXRB 4I4TA 1G4YB 5KX5B 4LFBB 1TVKA 2Q6AA 2D3OW 3N2GB 5L3DA 4JI4O 2QE7G 4O4JB 4TWKA 4UCRA 5LOVB 1E1QG 2YIAA 4TV9A 4GKJB 2N05A 3S3WA 4XDKA 1PNMA 1H2LA 4ZBMA 1LNQA 3AK3A 3T4ZA 1QVGU 3OD4A 2AGAA 4F6RA 1YI2V 2UXCO 1K34A 2UUAB 1E79G 1VQNV 5BMVA 3QO8A 4NXNB 4UVAA 2N04A 3K0DA 3U0ZA 4U3JB 2P4KA 3T1HO 1Q8IA 4JI5O 4O2AA 2X6BA 4LF5O 5LMUB 3RT3C 1EBOA 3NXSA 4F6RB 5L3CA 1RP3B 1QU7A 3ZN0A 3F5TA 1PL0A 2H8PC 5FLXN 1K5SA 2XAQA 5KA6A 1V55B 2M7WA 4WF9V 2VQFO 2P7TC 3N2GA 1THZA 2WAMA 5EYPA 1XI1A 3B09A 4GX1A 4UB6Z 3QO5A 2OYQA 1HNWB 3SJQC 1JFFB 4KXRA 2AW9A 1M57C 4W4LA 4O4IA 1JCHA 2YS8A 3RYHA 1EN5A 4DV1B 1UFIA 2YUAA 1JR9A 1Q6HA 1IX9A 4Z1MG 4QNHB 4O2BA 1KYOF 1M5IA 2UUCB 4YJ3A 5EBWC 1I94B 1IBKO 3WFVA 1QHTA 3L75H 1RSOB 4O4IB 4JI8B 1W2BU 1VQ8V 3IJ4A 1XHXA 1RPOA 4NYKA 3AG3B 1KBHA 4EB6B 2HJDA 3PN1A 1K7DA 2XAFA 1K4CC 3A2FA 1SQVH 2EIJC 2JJ2G 4YJ3B 2R70A 1OJHA 1S72V 3K08A 2WLKA 3ABTA 2MK3A 1U96A 1Q86W 2IU0A 1M56C 2CH7B 4KHPB 5IYZB 3G6BA 1Y74A 2ZIOA 4QE7A 4UCSA 2F95B 3EFFK 5IYBO 1NVPD 4LF9B 1FFXA 4JI0O 1UJWB 2P22C 4OXSA 4UV8A 1OCRC 4H0LB 1JMKC 1KQSU 4XDJA 1KC8W 2ZM6B 2GV9A 1FAFA 3CC4V 4X1KA 4J10A 1VQLV 1OV9A 1N34B 5B1NA 1AJNA 2JGDB 2E74B 4DV6O 4P2ZA 3ETEA 1I7FA 3CJHB 1S5LZ 3BCCH 4DR5B 1ZWIC 4LF8O 5IDJA 4FLWA 2EJ7A 2CAZC 1VIBA 1SKVA 5B1AC 1R1BA 3UO3A 3T1HB 2HHHB 2AZ0A 1M57B 4X62B 1CXZB 4L8JA 2AXTZ 1YVWA 1IXMA 4JAUA 2JK5C 1EN4A 1W59A 3ZRWA 1P49A 3G4SV 2Y69B 1SQFA 1X59A 4RWUA 4LF4B 3G71V 4C7UA 4LFBO 4P30A 3A0HZ 3JYCA 3FAVB 3HKDB 3H1HH 3E8BA 5FNVB 3RYHB 4NB5A 5IY5C 3LDEA 2E3CA 1QQCA 4UUJC 1VQKV 2OIGA 1XILA 2BTQB 1GK9A 3R65A 4ASUG 2IU3A 4MVRA 4YJ2B 4LNUA 1SRYA 4DO2A 4B3MO 4NVPA 4PD4F 5LXTA 2GTSA 3E8HA 5DEDA 4X20A 2LGWA 2UU9O 1NT2B 4JI1O 2QA4V 4ZHQB 1WAZA 5LP6B 4X88A 5IWAB 4MTFA 2ZR2A 1M93A 5EK0A 4B3TO 4QE9A 5BR8B 4MTXA 1Q82W 2GTAA 3K79A 4JPRA 1QLEB 1K97A 1CPYA 3DGEA 4Z1VA 1WA8B 3HKDA 1QCEA 1VF6A 1X4TA 4FLTA 1KMIZ 3B77A 3D36A 1QLNA 1S5HC 4TQFA 4EFEA 1H8EG 1V54C 2Q0AA 2AZ2A 1W0JG 4DRXA 1BSMA 1VQOV 3AK1A 4TSFG 1D5AA 2X7RB 4AHCA 5JH7B 3JASB 3I55V 1HW7A 1LUVA 3AK2A 3FYIB 1SQXH 4JI2O 1MMMA 4DV5B 3N2KB 4MVQA 3K9AA 3E86A 4YY3B 4O4HA 4DK1A 3CMAV 5L3FA 1BGYH 3QTCA 5LGUA 5BMVB 3FYEB 4WBNA 3JCUZ 4MW3A 3CCEV 4CS2A 2Y4UA 2QGNA 4H33A 2A79B 3FKSG 3U10A 1OZ0A 4J11A 3ZN1A 1Y67A 4K8XA 2NR5A 2F23A 2DQ0A 1EZVH 3OGIB 1WNSA 3K03A 4OX9B 1Y6XA 3RYFA 1B04A 2XNDG 3ZMUA 1HR0B 2VQFB 3BFRA 2M6YA 1I0HA 3CC2V 3JSLA 1M90W 1Q6UA 4DV2B 2R9IA 4ZI7B 4YIOA 3MHHC 1JA8A 4PI2A 4QIWF 2B1GA 2ZE5A 5BY1A 2DW4A 4K0KO 5LHIA 3T1CA 2P5OA 3BHPA 3AG2B 2KB1A 1TUEB 2UUBB 1Q90D 4DV0O 4CS4A 3G80A 1SA0A 1KU9A 2CTWA 2DYRB 4D7TA 1JPXA 1Y76A 4DR6B 3FAVA 5LA6A 2JS5A 1BQZA 4X1YB 2YXHA 3KG2A 1Z2GA 3C3TA 3FB5C 3JATB 2FKXA 3UT5A 2HR3A 2NLJC 5EZYB 1Z5WA 3CCSV 3SYAA 1IZ3A 5KLVH 3CRRA 2BE3A 5EBLC 2CGNA 2ZE6A 3ZRSA 3HB3B 2P4VA 1GH6A 2JRIA 4TOIA 4JI7B 3E35A 3RFRA 3RBZA 1KP3A 5BZBA 1WJZA 3DTUB 3ICXA 2KSDA 1XMQO 4X66B 3EXAA 4FK5C 4UB8Z 5KMGB 1MNGA 2OIEA 1JFFA 4LF8B 1I08A 1SZXA 2P67A 4FLXA 3E22A 4UV9A 2CDYA 4RUEA 3JALA 4KUMA 2Q7HA 1VQ7V 3C3SA 2D2CB 3CS5A 5K1PA 3AG4B 2ETNA 4NR1A 1GO3F 5AG2A 1D2DA 1WPBA 1ZLZA 5H9CA 2OTJV 2PYJA 1F4NA 1JQ0A 4I5SA 2Q67A 3WU2Z 1SS3A 3CRCA 3CJHA 3K3WA 4YXWG 5KHJA 4CH4A 1KKCA 4AILC 3B8NA 1MZFA 4KHPO 4X62O 1RM1B 4JI3O 3F7VC 4X1IB 4H44B 5EZYA 5JJNB 1SC5B 3GWOA 3IGAC 4LF7B 4BR6A 1TVKB 1ZUQA 1S3JA 1OCZB 1XL4A 3IFXA 1TUBB 5B1OA 3ML0A 1NR7A 3E8FA 3JAKA 1V54B 3OMNB 3OM3B 2ZT9B 2P06A 3UM7A 1MSDA 4X65O 4WFGA 4G27B 3AG1B 5KHGA 4PV1B 5IWAO 2A7WA 3ABMC 3JAMN 2YXYA 1R6KA 4DUZO 1IVSA 1IDSA 2F1MA 2Q4PA 4I9QA 2EIMB 4WCEV 4IHJA 2ZNJA 4BAYA 3DSQA 4Q20A 4JI1B 4B3SO 4JAAA 5H6RA 3TJTA 4TUYB 4J42A 5IYDO 1EN6A 2QWQB 3JD0A 1BE3H 2GBOA 3OMIB 4TQDA 3ABKB 3RYCA 3SDLA 4DV1O 1NTZH 4J41A 3SGIA 3JAWA 4IL6Z 5B1BC 5L3BA 2LQTA 4JV5B 4WFBV 3CRAA 3GB7C 3D3IA 5IY5B 3ABLB 2JEUA 2RN9A 1XUQA 2FMLA 3JSNA 4JYAB 3TXQA 2O57A 4DV3B 1ORQC 1FXKB 1H2KA 1XQ8A 3UO2A 3L70H 5KA5A 2YEVA 4NXMB 3OUFA 2AHYA 4MVOA 4UXNA 4D7SA 1YJNV 4FFBB 2YI8A 1H2SB 4NKGB 1FFXB 1PD3A 4GX5A 2W0XA 4GKJO 1ZL8A 4GUNA 1N32O 3CXHF 2ZXWC 5CA3A 4YJ2A 4MVUA 1K73W 3F7YC 5H5NA 2EBOA 4GX2A 2QKCA 2B5UA 4FLVA 5H2FZ 3JAWB 4DR7O 1W0KG 1ZL8B 5IYCO 5EBMC 2ZDIA 2EILB 5EIBD 4I55B 1XMOB 4JI8O 1HWYA 2YXLA 1JJOA 3LNNA 2EX3A 3ZRXA 3JARA 2QR4A 2UXNA 1J5EO 1S0VA 2HP8A 3H1LH 5FL7G 5J9PC 4HZ3A 5CBHA 5KUMA 3M7MX 3ZIAG 3TGUH 1JX9A 3BVOA 5JWPA 3UKMA 1YITV 3JATA 4FZ0A 3RGBA 5L3GA 2PY5A 5GW7A 2B9ZA 3NR7A 4X1YA 1CEZA 4MSWC 4F6EA 3L71H 1N36O 2EJRA 1BQ0A 2JIZG 1GKFA 4JASA 1GM7A 1SA0B 4I9WA 1B6QA 1P7BA 3R66A 2JEXA 2PYLA 1I94O 2L6LA 2V7QG 4FFKA 2ZIMA 4G2KA 4X1IA 1XL6A 5ITZB 2FB5A 3GVMA 3E8GA 3ZHSA 4LF5B 4LF4O 4CH5A 3WG7C 2E76B 5IE9A 2ITDC 4HNAA 2FYUH 4R7CA 3CSXA 1WP7A 3O65A 3CCUV 4GZRB 3JAKB 3K5OA 5FNVA 3ABKC 3BRCA 4LP8A 3CYOA 3RYIB 2ADPA 2F93B 5B5EZ 1ROPA 1N4CA 4OPHA 4MVMA 1AILA 1AVMA 5FPOA 2RCVA 3SPCA 5ITZA 5C8YA 1ZSPA 4PELA 1TA8A 4R50A 2CTRA 4XDLA 4E4EA 3KZIZ 1YEWA 3H9VA 4NTXA 3VQXA 4OPAA 4RQFA 2ADQB 3LNMB 3QO7A 1K8AW 2VRZA 1QR9A 3CD6V 4DR4B 2PTMA 3J80N 4DR2B 4PDMA 4BIZA 2OTLV 2HEPA 3SJBC 4X64O 5GTHZ 4LH6A 5LBQA 3AG1C 2CGOA 2Q8VA 3ABUA 4RO2A 1AJPA 4PDVA 3SPGA 4EEQA 4F4LA 3IC7A 4JGSA 2CTPA 3AG2C 4PDLA 2DE0X 3K5LA 4WBNB 1MABG 1WPXA 2WLLB 1YZBA 2RMKB 1SQQH 4X1KB 4LFAB 3X2QC 3OEEG 3JD4A 4Z2WA 1FPOA 1MZEA 1Y66A 3M8AA 5CN0A 2HKOA 2OCCC 2IJHA 3CCQV 1Q81W 4MS2A 5KHKA 3K04A 4MTOA 1K3EA 3ZJZA 2XASA 4CBCA 4BIUA 3CHXA 1J5EB 2WLIA 2EZOA 3A8TA 4AQYO 3ZRVA 1GN2A 1XNRB 3JCZA 2HFEC 3T1YB 4JYYA 5IYZA 3HKEA 1DK1A 3OR6C 3OR7C 3ZMTA 1WA8A 4DUZB 1SQPH 3U11A 4W4KA 1IBKB 2KQXA 3AG4C 4JF3A 5A2QN 2LFRA 2LGQA 5LGNA 1HR0O 2DYSC 1QBZA 3VOUA 2IH1C 4JI6B 1L0LH 2HVKC 4A5UB 3ZEDA 1RSOA 1ZAUA 4FM0A 2ZE8A 4TV8B 1XNQB 3LDCA 2P6JA 3OW2U 5DECA 1CP9A 1QVFU 3I5DA 2BOCC 2EINC 1LR1A 3RW0A 4JI4B 4GYCB 2Q9LA 3KKYA 3ZMSA 2CUGA 4EB6A 4LF6B 2NN4A 2VS0A 3VQYA 4LBEC 4P9PA 5D5QA 3TK1A 1TUBA 1PV0A 2LO1A 3HKBB 3FB6C 3E83A 4TV8A 4K8ZA 4IHJB 4AI8A 1OCCC 2QKAA 3LSSA 1GM9A 3ZBHA 3OGCC 4PDRA 2OCHA 2K9PA 3RVZA 3K0GA 5J2TA 3G6EV 4HBNA 2X0LA 4MVZA 3K5MA 1HNZO 4PA3A 1XHZA 2Q73A 3CCVV 3RYIA 4ABMA 1R3JC 4EFBA 1KD1W 1NQTA 5LGTA 5KAFZ 1YHQV 2WLJA 3Q4HA 4O4HB 4UCVA 1VQMV 3N2KA 3RWRD 3TCUA 1KECA 2Y4TA 1K9MW 2WPDG 5CA1B 5CA0A 1KKDA 2Y69C 3ETGA 5J2TB 5GONA 2L35A 4FIPC 4X9QA 3CEIA 5BR8O 1GN6A 3OMAB 3JD3A 4UCOA 5F2VO 5C8YB 1V9PA 1N33B 3CX5F 5KMGA 1EZJA 2H3OA 1NU1H 4WFHA 3CC7V 5HFMA 2MW2B 2R9RB 1K5QA 3QVNA 2DYRC 1GRJA 3DC6A 4J7ZA 4QJFB 2CH7A 4ZIBA 4O2BB 1K33A 4LR3A 1UPGA 2JVDA 5LOVA 1VQPV 2Q7EA 4DW0A 2WA4A 4HAMA 3K57A 1F4MA 3ZHUA 4LFCO 3E22B 1M4UA 5IT9N 1YTFD 4LF7O 3JD1A 2EZPA 4LF6O 1Q7YW 1G6UA 1GN3A 3A0BZ 1KB9F 2Q69A 4YHHB 4ZOLA 4JTAB 2V4DA 2DMXA 1F23A 3TETA 1NZ6A 2ZQMA 1EM1A 2YIDA 1H2NA 3EVKA 4DV4O 1QLEC 3CMEV 2ODMA 1R6NA 1BHAA 2QTSA 3K9SA 1VF6C 5CA1A 2EULA 1XNQO 4B3MB 1AR5A 4YHHO 2EIJB 4DYLA 5LP6C 4DR1O 3P3NA 2EINB 2ZM6O 1OCZC 4WFFA 1B3QA 2UU9B 5TISZ 1N0NA 3W7SA 4JYBA 1XEQA 3BPZA 3UCSC 3AG3C 3FFQA 1S77D 4UCUA 4NTYA 2LP7A 3BY6A 2H94A 1SERA 5LA6B 3VBBA 2BCCH 4LFAO 2JJ1G 3RYFB 3TXSA 1P84F 3CWBH 1AP5A 2YIBD 5LXTB 4MW8A 1ZTEA 1SQGA 1BT8A 4D6TH 5IJ0B 1YDXA 2F4VB 3JALB 1A32A 4E2LA 1BHBA 1URFA 4J9ZB 3SYCA 3STLC 5CBFA 5EC1C 2C2AA 3KCXA 3VQWA 2BOBC 3ZCCA 4N21A 4GKKO 4O4LA 5KHHA 3CCMV 3APOA 1PPJH 1JOYA 4ZI7A 3VQVA 4B08A 4FMTA 2ZR3A 3CB2A 2Z3YA 3BEHA 2VQEO 3E89A 3BAAA 1FXHA 2AHZA 1Q5OA 1I5YA 1Y74B 4JYCA 1YJWV 5KX5A 2QJ1A 3SPIA 3ZS8C 2N74A 1H8HG 4EKWA 3B40A 4DR4O 3RVYA 2HLDG 1NI8A 1HNWO 2ZE7A 4LCUC 5LHGA 2CE4A 2Y0PA 2UXBB 3WG7B 4DV3O 2Q68A 4DV4B 3P32A 1VQ9V 4K35A 3BA8A 4R8CA 1IBLO 2PF4E 5JH7A 5BXZA 1R6TA 1DF4A 4X20B 1OCOC 3ZHVA 3WB0A 3D3QA 2PUSA 4JZ2A 2IM9A 2XAGA 1PNKA 4L87A 4TT3G 3FB7C 4G28B 3ZHQA 3K59A 2FL4A 3ASNB 5DM6V 1M56B 4WFAV 4X8AA 1Y76B 2BSKA 4UVCA 1QR8A 2YI9A 3C90A 1N33O 2KG7B 2QM7A 3DC5A 1AJQA 2XAHA 5LYJB 3F5WC 3RN4A 5EC2C 3HPLC 3FX7A 3H1IH 1Y4MA 1YIJV 2IJIA 4U7OA 4P9OA 1VQ4V 2VWJA 4H13B 4GKKB 4B7EA 3CE2A 4FVMA 4LF9O 1N8RW 1FYJA 1P4RA 5B66Z 2A06H 2DYSB 4FM1A 3BA9A 3ETQA 1LUWA 3LSUA 3IC9A 2QTOA 3T2MA 4AQYB 3FB8C 4WFEA 2WLLA 1XNRO 4FM2A 5LL6Y 3BABA 3LDDA 4PA9A 2GHYA 4FLZA 3CXCU 2F4VO 3SJCC 1PM9A 1YSCA 1GTOA 4TV9B 5IJ0A 1DGSA 3S3XA 1AB3A 1U97A 4B3RB 3HKBA 2GUZB 1HNXO 1OCOB 4CH3A 1VF7A 4PJ0Z 3SPHA 3K58A 5LMNB 1NTKH 5JQGA 5JCOC 2OCCB 2B1IA 1NJIW 1YXBA 5IJ9A 5JJJB 2UXDB 1AI7A 2Q0OC 5JJEB 4LH7A 2XUMA 1GMGA 1WB8A 2UXXA 5CB4A 3ETDA 3X2QB 2E5LO 4KL1A 1FKAO 5CA0B 1B06A 1BL8A 2YSUB 5B1BB 2UXCB 2P90A 3APQA 1AI4A 4O2AB 1PL4A 3ZHTA 4B7KA 4MT8A 4CZZA 1SESA 5CMUA 3SYPA 3AEIA 4I0XA 1R73A 1DTOA 2UXBO 3A0RA 1FFTB 5LHHA 1O9HA 4LFCB 3MDSA 1FJGB 1F51A 3WB2A 4PI0A 4DR7B 1RFYA 1PNLA 2HHHO 4DR6O 1V55C 2ZNIA 2OWOA 3ABMB 2YIBA 1NBMG 3JARB 2VQEB 3THOA 3ASOB 3SPJA 3MD0A 1E1RG 1WN7A 3EHBB 2F43G 3JD2A 4JAVA 3ABLC 2HG5C 1TAEA 2W6JG 2A0LA 1L8DA 3E2EA 3PJSK 1SF9A 2FTKA 3KCYA 4DV7B 1T5EA 1NTMH 3M99B 1M9NA 2QEXV 2CK3G 2WLHA 4JI0B 3MAQA 4LC1A 1R3KC 1JVMA 2CTQA 4JI7O 1XDCA 2QM4A 4DR3O 3QG5A 5EYPB 4JI6O 1P7GA 1PKXA 1COWG 2GDSA 2PZSA 1RM1C 1N0JA 2Q7GA 4RUFA 2LJ2A 2XAJA 3CCJV 4JV5O 1NH2B 1G1XB 2K1EA 5B3SC 5EIBC 4CC5A 2DOSA 3OTOB 2YICA 2Y48A 2BTOA 2KG7A 2XTAA 4GX0A 1PP9H 5K1XA 1YCIA 4DV2O 2Y0IA 2IJKA 1AR4A 4O4LB 1FS0G 3OUSA 1XBLA 4R6ZA 4I7ZB 1D5NA 2QWRB 4NXMO 3OTFA 3ZMVA 4NTWA 1SETA 3JASA 3WB1A 2UUBO 3CRQA 4BWAA 1N32B 4X64B 4PHZA 5CB4B 1WB7A 3UQ8A 2QWOB 1NKDA 4FFBA 2ZCEA 2WLIB 4CS3A 2A3QA 3W7XA 4OX9O 4IYHA 2HJFC 4QPKA 3DXRA 4U7NA 4X89A 4H37A 3Q4HB 4U3JA 4DUYO 1YJ9V 2IJJA 4RQEA 1Q43A 5KAIZ 1VQ5V 3K06A 3ZMZA 1VF5B 3B4SA 5D5PA 4N23A 4ZHQA 1VMGA 2EIKC 4O4JA 3HR0A 2ZXWB 3N27A 4DXWA 2RDCA 4X65B 5A9GA 3ASNC 2RNBA 3D8CA 2PGGA 2E75B 3W7TA 2JGUA 1BS3A 1XOUA 3HKCA 3HKCB 3L74H 1KP2A 1NVPB 1I5XA 1FXKC 4BW5A 1N36B 2PI5A 4U3FH 2IBZH 4B3RO 4JTDB 4DRXB 3H1KH 5FPRA 4LWSA 1G8MA 3B2EE 4UFZA 3H01A 3T4DA 3P3PA 2DWEC 2ZDIC 4FLYA 4MVSA 1M1KW 5H6QA 2XHBA 3LSQA 4UVBA 5JVDA 2DQ3A 4HNAB 4X66O 5IJ9B 2ZINA 1OCCB 1MOFA 1YTFB 2ARHA 5GTIZ 4DR3B 2ATKC 1ENVA 2QM8A 1SQBH 2EIMC 2DN9A 1BZKA 4CH6A 1Q3EA 4GLXA 4I4TB 1IBMB 1HNZB 2Q5ZA 4IIJA 4IIJB 5C93A 4Q6GA 4LWSB 1US6A 4BIOA 4RAIA 2R72A 3ZHRA 4GCZA 3CP1A 5HFLA 5LP6A 1S76D 4GT1A 1R3LC 3SJAC 5JVDB 1MG1A 2JS3A 4PA7A 3D36C
chains in the Genus database with same CATH topology
2JK5C 1FXHA 2AHZA 3ZRWA 5FL7G 5J9PC 1I5YA 4HZ3A 5CBHA 5KUMA 4JYCA 3ZIAG 2Y69B 3G4SV 1YJWV 2ZD9A 1JX9A 1R3IC 2IH3C 2W0FC 1FXVA 3SPIA 3UKMA 1H8HG 1YITV 4QPJA 4EKWA 3RVYA 5L3GA 1SZTA 4KFMA 2HLDG 3G71V 5GW7A 4MTGA 4P30A 4LCUC 3JYCA 5LHGA 1CEZA 4MSWC 4JTCB 2OT5A 3E8BA 5IY5C 3LDEA 2EJRA 2JIZG 4FJCC 1GKFA 4JASA 1GM7A 4UUJC 3SYOA 2NNUA 3WG7B 4I9WA 1VQKV 3W7UA 1B6QA 2Q68A 1P7BA 1GK9A 3R65A 4ASUG 5KUKA 2WWWA 3P32A 2IU3A 1VQ9V 4MVRA 2JEXA 2ITCC 1SRYA 4DO2A 4R8CA 1OHHG 2W6IG 2V7QG 5L3EA 1DF4A 3E8HA 1OCOC 4G2KA 1H38A 1BMFG 2JDIG 1XL6A 2XAGA 1PNKA 4HYOA 4L87A 4TT3G 3CCRV 3E8GA 3FB7C 2QA4V 4G28B 4ZKIA 4X88A 3ASNB 3QNEA 4MTFA 5DN6G 5DM6V 3WG7C 2ZR2A 2ITDC 5EK0A 1M56B 4QE9A 4R7CA 4WFAV 4X8AA 1AI6A 4MTXA 1Q82W 3K79A 3CCUV 4UVCA 1NH2D 1QR8A 4JPRA 1QLEB 1K97A 2XOKG 3ABKC 3DGEA 1CPYA 3ASOC 4LP8A 3CYOA 1QCEA 2QM7A 3B77A 1AJQA 3W7WA 2XAHA 2WSSG 3F5WC 1ROPA 3D36A 3OAAG 5EC2C 1S5HC 4KP4A 1QLNA 2WLMA 3HPLC 4MVMA 1Y4MA 1H8EG 3SPCA 1YIJV 2IJIA 1V54C 4U7OA 4P9OA 4PELA 1VQ4V 4FPPA 1W0JG 4R50A 4XDLA 1VQOV 3P30A 4TSFG 2X7RB 4RQFA 3I55V 3LNMB 3QO7A 1N8RW 1K4DC 1K8AW 1QR9A 1P4RA 3FYIB 3CD6V 1MSWD 1FXKA 4MVQA 1DF5A 3K9AA 2EIKB 3E86A 4PDMA 5B1AB 2DYSB 4BIZA 2OTLV 3CMAV 2QTOA 3T2MA 5L3FA 5CBGA 5LBQA 3FB8C 5LGUA 3AG1C 4WFEA 2WLLA 1H2GA 3ABUA 3FYEB 4RO2A 3LDDA 1AJPA 4PDVA 4MW3A 3SPGA 4PA9A 2GHYA 4F4LA 3CXCU 3CCEV 2WLNA 3IC7A 3CPWU 4H33A 4JGSA 2A79B 3AG2C 3FKSG 1OZ0A 2Z5UA 4PDLA 1YSCA 1GTOA 1AROP 3ZN1A 1MABG 1WPXA 2WLLB 1S0VA 3X2QC 2DQ0A 3OEEG 3JD4A 2HVJC 2A9HA 3K03A 2V1DA 1Y66A 1OCOB 2XNDG 3ZMUA 5CN0A 3SPHA 3CC2V 2HKOA 1NR1A 2OCCC 2IJHA 3CCQV 1Q81W 1M90W 2OCCB 4MS2A 2B1IA 1NJIW 3K04A 4MTOA 1K3EA 3ZJZA 1AI7A 2XASA 4CBCA 1K92A 2R9IA 4BIUA 2WLIA 3OEHG 3MHHC 2EZOA 1GMGA 2UXXA 4QIWF 3LUTB 2B1GA 3ETDA 3X2QB 2DW4A 3ZRVA 5LHIA 3STZC 3JCZA 2HFEC 3T1CA 3OFNG 3AG2B 2KB1A 1BL8A 2YSUB 5B1BB 3OR6C 1TUEB 1VQ6V 2P90A 2X6CA 3OR7C 1AI4A 1WLEA 3ZMTA 5B3SB 4MT8A 1JJ2U 2DYRB 3AG4C 4CZZA 1JPXA 1SESA 2QKSA 5CMUA 4JF3A 3SYPA 3AEIA 3CCLV 1R73A 4PA4A 1DTOA 2LFRA 3A0RA 1FFTB 2YEVB 5LHHA 3I56V 5LGNA 1DLBA 2DYSC 1RPRA 1QBZA 3KG2A 3FB5C 3VOUA 2IH1C 2X6AA 1AR1B 2HVKC 1F51A 1AI5A 2HR3A 2NLJC 2IW5A 1PNLA 2EILC 3SYQA 3CCSV 3ZRWB 3SYAA 1OCRB 1V55C 3B8MA 1L1FA 2LFSA 2DWDC 2PI4A 5EBLC 3LDCA 4PA6A 2P6JA 3ABMB 3ZRSA 3OW2U 1CP9A 1NBMG 3HB3B 3ASOB 4J9YB 3SPJA 1QVFU 3MD0A 3OE7G 3E35A 1E1RG 2BOCC 4XBFA 3EHBB 3RBZA 1KP3A 2EINC 2F43G 3JD2A 4JAVA 3RW0A 3MHSC 3ABLC 2HG5C 5BZBA 2W6JG 2A0LA 3DTUB 5E1AC 3ZMSA 3E2EA 3PJSK 1J95A 2FTKA 1EFRG 4LBEC 4P9PA 3TK1A 3M99B 1M9NA 2GSMB 2CK3G 2WLHA 4FK5C 2QEXV 1GM8A 1R3KC 4LC1A 1JVMA 2P67A 3FB6C 3E83A 1G4YB 4UV9A 4KUMA 4RUEA 1OCCC 2Q6AA 2D3OW 1VQ7V 5L3DA 3LSSA 1PKXA 1GM9A 1COWG 1RM1C 2QE7G 4TWKA 3OGCC 4PDRA 4RUFA 1E1QG 2XAJA 3CCJV 3AG4B 4XDKA 3RVZA 1PNMA 3K0GA 4ZBMA 3G6EV 1LNQA 2X0LA 3T4ZA 1GO3F 2K1EA 5B3SC 1NH2B 4MVZA 1QVGU 1YI2V 4PA3A 2Y48A 3CCVV 1K34A 5H9CA 2OTJV 1R3JC 4GX0A 1E79G 1VQNV 3QO8A 1KD1W 1NQTA 1F4NA 2IJKA 4UVAA 5LGTA 3K0DA 1YHQV 1JQ0A 4I5SA 2WLJA 1FS0G 3OUSA 2Q67A 1VQMV 2X6BA 4R6ZA 3K3WA 4YXWG 1EBOA 3NXSA 3TCUA 1KECA 3ZMVA 5L3CA 1K9MW 2WPDG 3ZN0A 1SETA 3B8NA 1KKDA 2Y69C 1PL0A 3ETGA 2H8PC 1RM1B 3F7VC 1K5SA 4FIPC 2XAQA 5KA6A 1V55B 2M7WA 4WF9V 3OMAB 3GWOA 3JD3A 1NKDA 2P7TC 3IGAC 2WLIB 1THZA 2WAMA 3W7XA 1S3JA 1OCZB 2HJFC 4GX1A 4QPKA 3QO5A 1XL4A 3SJQC 3IFXA 4U7NA 5B1OA 4X89A 4H37A 3ML0A 1EZJA 4WFHA 1M57C 3CC7V 1NR7A 3E8FA 1JCHA 1V54B 3OMNB 3OM3B 5HFMA 1YJ9V 2R9RB 1K5QA 2IJJA 3UM7A 4RQEA 4WFGA 1VQ5V 2DYRC 4G27B 3K06A 3AG1B 3ZMZA 4QJFB 3ABMC 4Z1MG 4N23A 1R6KA 1K33A 4QNHB 2EIKC 5EBWC 2ZXWB 1VQPV 4DXWA 3WFVA 2EIMB 3ASNC 4HAMA 4WCEV 1F4MA 3W7TA 4BAYA 1YTFD 1W2BU 3JD1A 2EZPA 4Q20A 1Q7YW 1VQ8V 1RPOA 1KP2A 3AG3B 1NVPB 2Q69A 1I5XA 4JTAB 1FXKC 5H6RA 4BW5A 5IYDO 2PI5A 1F23A 3JD0A 3TETA 1K7DA 2ZQMA 2XAFA 3OMIB 4JTDB 1K4CC 3ABKB 1QLEC 3CMEV 2EIJC 2JJ2G 1R6NA 1S72V 5B1BC 3K08A 2WLKA 1G8MA 5L3BA 3ABTA 1BHAA 2MK3A 1Q86W 4WFBV 2IU0A 1M56C 3H01A 3GB7C 2EIJB 3D3IA 5IY5B 3T4DA 3ABLB 2JEUA 2DWEC 2ZDIC 4QE7A 2EINB 4MVSA 1OCZC 4WFFA 1M1KW 5H6QA 3EFFK 5IYBO 1NVPD 3W7SA 3LSQA 4JYBA 4UVBA 3AG3C 1S77D 2DQ3A 1UJWB 1ORQC 2LP7A 3BY6A 4OXSA 4UV8A 1FXKB 1OCRC 1OCCB 2H94A 1SERA 1MOFA 1YTFB 5KA5A 1KQSU 2YEVA 4XDJA 3OUFA 2AHYA 4MVOA 4UXNA 3VBBA 2JJ1G 1YJNV 1KC8W 2ATKC 1PD3A 4GX5A 1ENVA 2QM8A 2EIMC 3CC4V 1VQLV 2ZXWC 4MW8A 5B1NA 1AJNA 5CA3A 4P2ZA 4E2LA 1BHBA 4J9ZB 4MVUA 3ETEA 3STLC 3SYCA 3F7YC 5CBFA 1K73W 5EC1C 5C93A 2EBOA 4GX2A 2B5UA 2C2AA 2BOBC 3ZCCA 1ZWIC 4N21A 4RAIA 1W0KG 5IDJA 3CCMV 5IYCO 5EBMC 1JOYA 5B1AC 2ZDIA 4GCZA 2EILB 3CP1A 5HFLA 1HWYA 1M57B 1S76D 4GT1A 3ZRXA 4FMTA 1R3LC 2UXNA 1MG1A 4PA7A 2ZR3A 2Z3YA 3BEHA 3E89A 1IXMA 4JAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RBZ A;  2JK5 C;  3T2M A;  2EIN C;  5CBG A;  3RW0 A;  2AHZ A;  5J9P C;  3FB8 C;  3ABL C;  2HG5 C;  3AG1 C;  4HZ3 A;  4DXW A;  5BZB A;  4WFE A;  5KUM A;  3SYC A;  2WLL A;  2A0L A;  5CBH A;  3ASN C;  2ZD9 A;  5E1A C;  4RO2 A;  1R3I C;  2IH3 C;  2W0F C;  3LDD A;  1J95 A;  3PJS K;  3SPI A;  4PDV A;  4MW3 A;  3SPG A;  4PA9 A;  4LBE C;  3UKM A;  4F4L A;  4P9P A;  2WLN A;  4EKW A;  2WLH A;  3RVY A;  4H33 A;  4KFM A;  2A79 B;  3AG2 C;  1R3K C;  1JVM A;  4MTG A;  2Q69 A;  4LCU C;  4P30 A;  3FB6 C;  4JTA B;  3E83 A;  4PDL A;  1G4Y B;  4BW5 A;  3JYC A;  4RUE A;  1OCC C;  2Q6A A;  4MSW C;  4JTC B;  2WLL B;  3TET A;  3E8B A;  5IY5 C;  3X2Q C;  3LDE A;  4JTD B;  4TWK A;  3OGC C;  1K4C C;  4PDR A;  2HVJ C;  4RUF A;  1QLE C;  2A9H A;  4UUJ C;  3K03 A;  2EIJ C;  3SYO A;  4I9W A;  2Q68 A;  1P7B A;  4XDK A;  3K0G A;  3R65 A;  4ZBM A;  5B1B C;  3K08 A;  2WLK A;  3RVZ A;  3SPH A;  1LNQ A;  3T4Z A;  5KUK A;  2K1E A;  5B3S C;  4MVZ A;  2OCC C;  1M56 C;  4MVR A;  4MS2 A;  2ITC C;  3K04 A;  3GB7 C;  4MTO A;  4PA3 A;  3ZJZ A;  3T4D A;  4R8C A;  4CBC A;  2DWE C;  1R3J C;  4GX0 A;  2WLI A;  4QE7 A;  4MVS A;  4WFF A;  3E8H A;  3EFF K;  1OCO C;  3LUT B;  3K0D A;  2WLJ A;  3OUS A;  1XL6 A;  3STZ C;  2Q67 A;  3T1C A;  2HFE C;  4HYO A;  3AG3 C;  2X6B A;  3E8G A;  3FB7 C;  4R6Z A;  2KB1 A;  1ORQ C;  4G28 B;  4OXS A;  1BL8 A;  3OR6 C;  1OCR C;  4X88 A;  3TCU A;  4MTF A;  3WG7 C;  3STL C;  2X6C A;  2ITD C;  2YEV A;  3OR7 C;  3OUF A;  2AHY A;  4XDJ A;  4R7C A;  4QE9 A;  4MVO A;  5EK0 A;  1KKD A;  2Y69 C;  4X8A A;  5CBF A;  2H8P C;  2ATK C;  3F7V C;  4GX5 A;  3AG4 C;  2EIM C;  2QKS A;  3SYP A;  3ABK C;  2P7T C;  2ZXW C;  3IGA C;  4MW8 A;  2WLI B;  4PA4 A;  3ASO C;  4LP8 A;  4P2Z A;  2HJF C;  4GX1 A;  4J9Z B;  4MVU A;  1XL4 A;  2DYS C;  3F5W C;  3SJQ C;  3IFX A;  3F7Y C;  3FB5 C;  1S5H C;  3KG2 A;  4X89 A;  4H37 A;  2IH1 C;  5EC2 C;  2WLM A;  3HPL C;  4GX2 A;  5EC1 C;  3VOU A;  4MVM A;  2X6A A;  4WFH A;  1M57 C;  2BOB C;  3SPC A;  2HVK C;  3E8F A;  1V54 C;  1ZWI C;  3BEH A;  4P9O A;  4RAI A;  2NLJ C;  4R50 A;  2R9R B;  4XDL A;  5EBM C;  3UM7 A;  2EIL C;  3SYQ A;  4WFG A;  5B1A C;  2DYR C;  4G27 B;  3SYA A;  3K06 A;  3LNM B;  1V55 C;  1K4D C;  2DWD C;  3ABM C;  5EBL C;  3LDC A;  4PA6 A;  3ZRS A;  1R3L C;  4QNH B;  4MVQ A;  3E86 A;  4PDM A;  4PA7 A;  2EIK C;  4J9Y B;  3SPJ A;  1OCZ C;  5EBW C;  3E89 A;  2BOC C;  2QTO A; 
#chains in the Genus database with same CATH topology
 4BW9 A;  1YF2 A;  2ZD9 A;  4DV7 O;  1S5J A;  1R3I C;  2IH3 C;  2W0F C;  1FXV A;  4CC6 A;  2E5L B;  2G38 A;  4QPJ A;  1SZT A;  4KFM A;  1FJG O;  5LMU O;  2BTQ A;  3OT7 A;  4MTG A;  3L73 H;  3K5N A;  1VAR A;  4DR5 O;  4DR1 B;  4JTC B;  3L72 H;  2OT5 A;  4DUY B;  4FJC C;  4DK0 A;  4FLU A;  3SYO A;  2NNU A;  1O9G A;  3W7U A;  1GAX A;  4OGQ B;  5KUK A;  2WWW A;  4I50 A;  2ITC C;  1AP6 A;  3HKE B;  1OHH G;  2W6I G;  5L3E A;  1XMQ B;  2QWN B;  1H38 A;  1BMF G;  4NXN O;  2JDI G;  4HYO A;  3CCR V;  4JI2 B;  4ZKI A;  1Q6I A;  3O9O A;  3QNE A;  5DN6 G;  2QWP B;  2UXD O;  1AI6 A;  4I0X B;  1ZX3 A;  1HDJ A;  2WA3 A;  2BSK B;  1NH2 D;  4K0K B;  2XOK G;  3ASO C;  2XT9 A;  2LW1 A;  3W7W A;  2WSS G;  3OAA G;  4KP4 A;  3CRM A;  2WLM A;  2JGD A;  4DR2 O;  5KHI A;  2DJV A;  4FPP A;  4ICG A;  3P30 A;  1HP8 A;  2KKW A;  1HNX B;  4TUY A;  1K4D C;  1MSW D;  1XMO O;  4DW1 A;  1FXK A;  1DF5 A;  2EIK B;  4JI3 B;  5B1A B;  2UUC O;  4I55 A;  5CBG A;  2RQ6 A;  3H1J H;  1VP7 A;  1H2G A;  1NS1 A;  4JI5 B;  4IT5 A;  1BCC H;  4FZ1 A;  2WLN A;  3CPW U;  2R9A A;  4YIP A;  1MA1 A;  2Z5U A;  2VWK A;  5LYJ A;  5JCO A;  1ARO P;  1IBL B;  2HVJ C;  2A9H A;  2ILM A;  4ZOL B;  1H2M A;  2V1D A;  3UT5 B;  3GWK C;  4J80 A;  1N34 O;  2QDO A;  1NR1 A;  2UUA O;  4YY3 O;  1K92 A;  3IAY A;  3OEH G;  4JYA O;  3G67 A;  3LUT B;  3STZ C;  5GON B;  2YDE A;  3OFN G;  4B3S B;  2QSA A;  3L9D A;  1VQ6 V;  4I50 B;  2X6C A;  1QNM A;  4JZG A;  2RJZ A;  1WLE A;  5B3S B;  2F66 C;  4IYI A;  4QGP A;  1JJ2 U;  2QKS A;  5E79 Z;  3CCL V;  4PA4 A;  1IBM O;  3T1Y O;  1L0N H;  2YEV B;  3I56 V;  1DLB A;  1RPR A;  4DV6 B;  5LMN O;  4DV5 O;  1IUR A;  1IXB A;  2X6A A;  4UCT A;  1AR1 B;  2GUZ A;  2Z0A A;  1AI5 A;  3FD9 A;  1XRE A;  2IW5 A;  1GN4 A;  2EIL C;  3J7A U;  2ZKO A;  3SYQ A;  3ZRW B;  1OCR B;  4J7K A;  1Z5V A;  3B8M A;  1L1F A;  2LFS A;  2DWD C;  4LNU B;  2PI4 A;  4PA6 A;  4B3T B;  3OTO O;  5J2U A;  2LW7 A;  4J9Y B;  3OE7 G;  4DV0 B;  4XBF A;  3RYC B;  3J81 N;  3AG7 A;  3ZX6 A;  1F7Y A;  3MHS C;  3QF7 A;  1TGO A;  4J7J A;  5E1A C;  2YC0 A;  3SR2 C;  1J95 A;  4K3A A;  1EFR G;  1FD9 A;  1VEW A;  4IGG A;  2GSM B;  5JQG B;  1KUQ A;  5J2U B;  1GM8 A;  1WP8 A;  3DXR B;  4I4T A;  1G4Y B;  5KX5 B;  4LFB B;  1TVK A;  2Q6A A;  2D3O W;  3N2G B;  5L3D A;  4JI4 O;  2QE7 G;  4O4J B;  4TWK A;  4UCR A;  5LOV B;  1E1Q G;  2YIA A;  4TV9 A;  4GKJ B;  2N05 A;  3S3W A;  4XDK A;  1PNM A;  1H2L A;  4ZBM A;  1LNQ A;  3AK3 A;  3T4Z A;  1QVG U;  3OD4 A;  2AGA A;  4F6R A;  1YI2 V;  2UXC O;  1K34 A;  2UUA B;  1E79 G;  1VQN V;  5BMV A;  3QO8 A;  4NXN B;  4UVA A;  2N04 A;  3K0D A;  3U0Z A;  4U3J B;  2P4K A;  3T1H O;  1Q8I A;  4JI5 O;  4O2A A;  2X6B A;  4LF5 O;  5LMU B;  3RT3 C;  1EBO A;  3NXS A;  4F6R B;  5L3C A;  1RP3 B;  1QU7 A;  3ZN0 A;  3F5T A;  1PL0 A;  2H8P C;  5FLX N;  1K5S A;  2XAQ A;  5KA6 A;  1V55 B;  2M7W A;  4WF9 V;  2VQF O;  2P7T C;  3N2G A;  1THZ A;  2WAM A;  5EYP A;  1XI1 A;  3B09 A;  4GX1 A;  4UB6 Z;  3QO5 A;  2OYQ A;  1HNW B;  3SJQ C;  1JFF B;  4KXR A;  2AW9 A;  1M57 C;  4W4L A;  4O4I A;  1JCH A;  2YS8 A;  3RYH A;  1EN5 A;  4DV1 B;  1UFI A;  2YUA A;  1JR9 A;  1Q6H A;  1IX9 A;  4Z1M G;  4QNH B;  4O2B A;  1KYO F;  1M5I A;  2UUC B;  4YJ3 A;  5EBW C;  1I94 B;  1IBK O;  3WFV A;  1QHT A;  3L75 H;  1RSO B;  4O4I B;  4JI8 B;  1W2B U;  1VQ8 V;  3IJ4 A;  1XHX A;  1RPO A;  4NYK A;  3AG3 B;  1KBH A;  4EB6 B;  2HJD A;  3PN1 A;  1K7D A;  2XAF A;  1K4C C;  3A2F A;  1SQV H;  2EIJ C;  2JJ2 G;  4YJ3 B;  2R70 A;  1OJH A;  1S72 V;  3K08 A;  2WLK A;  3ABT A;  2MK3 A;  1U96 A;  1Q86 W;  2IU0 A;  1M56 C;  2CH7 B;  4KHP B;  5IYZ B;  3G6B A;  1Y74 A;  2ZIO A;  4QE7 A;  4UCS A;  2F95 B;  3EFF K;  5IYB O;  1NVP D;  4LF9 B;  1FFX A;  4JI0 O;  1UJW B;  2P22 C;  4OXS A;  4UV8 A;  1OCR C;  4H0L B;  1JMK C;  1KQS U;  4XDJ A;  1KC8 W;  2ZM6 B;  2GV9 A;  1FAF A;  3CC4 V;  4X1K A;  4J10 A;  1VQL V;  1OV9 A;  1N34 B;  5B1N A;  1AJN A;  2JGD B;  2E74 B;  4DV6 O;  4P2Z A;  3ETE A;  1I7F A;  3CJH B;  1S5L Z;  3BCC H;  4DR5 B;  1ZWI C;  4LF8 O;  5IDJ A;  4FLW A;  2EJ7 A;  2CAZ C;  1VIB A;  1SKV A;  5B1A C;  1R1B A;  3UO3 A;  3T1H B;  2HHH B;  2AZ0 A;  1M57 B;  4X62 B;  1CXZ B;  4L8J A;  2AXT Z;  1YVW A;  1IXM A;  4JAU A;  2JK5 C;  1EN4 A;  1W59 A;  3ZRW A;  1P49 A;  3G4S V;  2Y69 B;  1SQF A;  1X59 A;  4RWU A;  4LF4 B;  3G71 V;  4C7U A;  4LFB O;  4P30 A;  3A0H Z;  3JYC A;  3FAV B;  3HKD B;  3H1H H;  3E8B A;  5FNV B;  3RYH B;  4NB5 A;  5IY5 C;  3LDE A;  2E3C A;  1QQC A;  4UUJ C;  1VQK V;  2OIG A;  1XIL A;  2BTQ B;  1GK9 A;  3R65 A;  4ASU G;  2IU3 A;  4MVR A;  4YJ2 B;  4LNU A;  1SRY A;  4DO2 A;  4B3M O;  4NVP A;  4PD4 F;  5LXT A;  2GTS A;  3E8H A;  5DED A;  4X20 A;  2LGW A;  2UU9 O;  1NT2 B;  4JI1 O;  2QA4 V;  4ZHQ B;  1WAZ A;  5LP6 B;  4X88 A;  5IWA B;  4MTF A;  2ZR2 A;  1M93 A;  5EK0 A;  4B3T O;  4QE9 A;  5BR8 B;  4MTX A;  1Q82 W;  2GTA A;  3K79 A;  4JPR A;  1QLE B;  1K97 A;  1CPY A;  3DGE A;  4Z1V A;  1WA8 B;  3HKD A;  1QCE A;  1VF6 A;  1X4T A;  4FLT A;  1KMI Z;  3B77 A;  3D36 A;  1QLN A;  1S5H C;  4TQF A;  4EFE A;  1H8E G;  1V54 C;  2Q0A A;  2AZ2 A;  1W0J G;  4DRX A;  1BSM A;  1VQO V;  3AK1 A;  4TSF G;  1D5A A;  2X7R B;  4AHC A;  5JH7 B;  3JAS B;  3I55 V;  1HW7 A;  1LUV A;  3AK2 A;  3FYI B;  1SQX H;  4JI2 O;  1MMM A;  4DV5 B;  3N2K B;  4MVQ A;  3K9A A;  3E86 A;  4YY3 B;  4O4H A;  4DK1 A;  3CMA V;  5L3F A;  1BGY H;  3QTC A;  5LGU A;  5BMV B;  3FYE B;  4WBN A;  3JCU Z;  4MW3 A;  3CCE V;  4CS2 A;  2Y4U A;  2QGN A;  4H33 A;  2A79 B;  3FKS G;  3U10 A;  1OZ0 A;  4J11 A;  3ZN1 A;  1Y67 A;  4K8X A;  2NR5 A;  2F23 A;  2DQ0 A;  1EZV H;  3OGI B;  1WNS A;  3K03 A;  4OX9 B;  1Y6X A;  3RYF A;  1B04 A;  2XND G;  3ZMU A;  1HR0 B;  2VQF B;  3BFR A;  2M6Y A;  1I0H A;  3CC2 V;  3JSL A;  1M90 W;  1Q6U A;  4DV2 B;  2R9I A;  4ZI7 B;  4YIO A;  3MHH C;  1JA8 A;  4PI2 A;  4QIW F;  2B1G A;  2ZE5 A;  5BY1 A;  2DW4 A;  4K0K O;  5LHI A;  3T1C A;  2P5O A;  3BHP A;  3AG2 B;  2KB1 A;  1TUE B;  2UUB B;  1Q90 D;  4DV0 O;  4CS4 A;  3G80 A;  1SA0 A;  1KU9 A;  2CTW A;  2DYR B;  4D7T A;  1JPX A;  1Y76 A;  4DR6 B;  3FAV A;  5LA6 A;  2JS5 A;  1BQZ A;  4X1Y B;  2YXH A;  3KG2 A;  1Z2G A;  3C3T A;  3FB5 C;  3JAT B;  2FKX A;  3UT5 A;  2HR3 A;  2NLJ C;  5EZY B;  1Z5W A;  3CCS V;  3SYA A;  1IZ3 A;  5KLV H;  3CRR A;  2BE3 A;  5EBL C;  2CGN A;  2ZE6 A;  3ZRS A;  3HB3 B;  2P4V A;  1GH6 A;  2JRI A;  4TOI A;  4JI7 B;  3E35 A;  3RFR A;  3RBZ A;  1KP3 A;  5BZB A;  1WJZ A;  3DTU B;  3ICX A;  2KSD A;  1XMQ O;  4X66 B;  3EXA A;  4FK5 C;  4UB8 Z;  5KMG B;  1MNG A;  2OIE A;  1JFF A;  4LF8 B;  1I08 A;  1SZX A;  2P67 A;  4FLX A;  3E22 A;  4UV9 A;  2CDY A;  4RUE A;  3JAL A;  4KUM A;  2Q7H A;  1VQ7 V;  3C3S A;  2D2C B;  3CS5 A;  5K1P A;  3AG4 B;  2ETN A;  4NR1 A;  1GO3 F;  5AG2 A;  1D2D A;  1WPB A;  1ZLZ A;  5H9C A;  2OTJ V;  2PYJ A;  1F4N A;  1JQ0 A;  4I5S A;  2Q67 A;  3WU2 Z;  1SS3 A;  3CRC A;  3CJH A;  3K3W A;  4YXW G;  5KHJ A;  4CH4 A;  1KKC A;  4AIL C;  3B8N A;  1MZF A;  4KHP O;  4X62 O;  1RM1 B;  4JI3 O;  3F7V C;  4X1I B;  4H44 B;  5EZY A;  5JJN B;  1SC5 B;  3GWO A;  3IGA C;  4LF7 B;  4BR6 A;  1TVK B;  1ZUQ A;  1S3J A;  1OCZ B;  1XL4 A;  3IFX A;  1TUB B;  5B1O A;  3ML0 A;  1NR7 A;  3E8F A;  3JAK A;  1V54 B;  3OMN B;  3OM3 B;  2ZT9 B;  2P06 A;  3UM7 A;  1MSD A;  4X65 O;  4WFG A;  4G27 B;  3AG1 B;  5KHG A;  4PV1 B;  5IWA O;  2A7W A;  3ABM C;  3JAM N;  2YXY A;  1R6K A;  4DUZ O;  1IVS A;  1IDS A;  2F1M A;  2Q4P A;  4I9Q A;  2EIM B;  4WCE V;  4IHJ A;  2ZNJ A;  4BAY A;  3DSQ A;  4Q20 A;  4JI1 B;  4B3S O;  4JAA A;  5H6R A;  3TJT A;  4TUY B;  4J42 A;  5IYD O;  1EN6 A;  2QWQ B;  3JD0 A;  1BE3 H;  2GBO A;  3OMI B;  4TQD A;  3ABK B;  3RYC A;  3SDL A;  4DV1 O;  1NTZ H;  4J41 A;  3SGI A;  3JAW A;  4IL6 Z;  5B1B C;  5L3B A;  2LQT A;  4JV5 B;  4WFB V;  3CRA A;  3GB7 C;  3D3I A;  5IY5 B;  3ABL B;  2JEU A;  2RN9 A;  1XUQ A;  2FML A;  3JSN A;  4JYA B;  3TXQ A;  2O57 A;  4DV3 B;  1ORQ C;  1FXK B;  1H2K A;  1XQ8 A;  3UO2 A;  3L70 H;  5KA5 A;  2YEV A;  4NXM B;  3OUF A;  2AHY A;  4MVO A;  4UXN A;  4D7S A;  1YJN V;  4FFB B;  2YI8 A;  1H2S B;  4NKG B;  1FFX B;  1PD3 A;  4GX5 A;  2W0X A;  4GKJ O;  1ZL8 A;  4GUN A;  1N32 O;  3CXH F;  2ZXW C;  5CA3 A;  4YJ2 A;  4MVU A;  1K73 W;  3F7Y C;  5H5N A;  2EBO A;  4GX2 A;  2QKC A;  2B5U A;  4FLV A;  5H2F Z;  3JAW B;  4DR7 O;  1W0K G;  1ZL8 B;  5IYC O;  5EBM C;  2ZDI A;  2EIL B;  5EIB D;  4I55 B;  1XMO B;  4JI8 O;  1HWY A;  2YXL A;  1JJO A;  3LNN A;  2EX3 A;  3ZRX A;  3JAR A;  2QR4 A;  2UXN A;  1J5E O;  1S0V A;  2HP8 A;  3H1L H;  5FL7 G;  5J9P C;  4HZ3 A;  5CBH A;  5KUM A;  3M7M X;  3ZIA G;  3TGU H;  1JX9 A;  3BVO A;  5JWP A;  3UKM A;  1YIT V;  3JAT A;  4FZ0 A;  3RGB A;  5L3G A;  2PY5 A;  5GW7 A;  2B9Z A;  3NR7 A;  4X1Y A;  1CEZ A;  4MSW C;  4F6E A;  3L71 H;  1N36 O;  2EJR A;  1BQ0 A;  2JIZ G;  1GKF A;  4JAS A;  1GM7 A;  1SA0 B;  4I9W A;  1B6Q A;  1P7B A;  3R66 A;  2JEX A;  2PYL A;  1I94 O;  2L6L A;  2V7Q G;  4FFK A;  2ZIM A;  4G2K A;  4X1I A;  1XL6 A;  5ITZ B;  2FB5 A;  3GVM A;  3E8G A;  3ZHS A;  4LF5 B;  4LF4 O;  4CH5 A;  3WG7 C;  2E76 B;  5IE9 A;  2ITD C;  4HNA A;  2FYU H;  4R7C A;  3CSX A;  1WP7 A;  3O65 A;  3CCU V;  4GZR B;  3JAK B;  3K5O A;  5FNV A;  3ABK C;  3BRC A;  4LP8 A;  3CYO A;  3RYI B;  2ADP A;  2F93 B;  5B5E Z;  1ROP A;  1N4C A;  4OPH A;  4MVM A;  1AIL A;  1AVM A;  5FPO A;  2RCV A;  3SPC A;  5ITZ A;  5C8Y A;  1ZSP A;  4PEL A;  1TA8 A;  4R50 A;  2CTR A;  4XDL A;  4E4E A;  3KZI Z;  1YEW A;  3H9V A;  4NTX A;  3VQX A;  4OPA A;  4RQF A;  2ADQ B;  3LNM B;  3QO7 A;  1K8A W;  2VRZ A;  1QR9 A;  3CD6 V;  4DR4 B;  2PTM A;  3J80 N;  4DR2 B;  4PDM A;  4BIZ A;  2OTL V;  2HEP A;  3SJB C;  4X64 O;  5GTH Z;  4LH6 A;  5LBQ A;  3AG1 C;  2CGO A;  2Q8V A;  3ABU A;  4RO2 A;  1AJP A;  4PDV A;  3SPG A;  4EEQ A;  4F4L A;  3IC7 A;  4JGS A;  2CTP A;  3AG2 C;  4PDL A;  2DE0 X;  3K5L A;  4WBN B;  1MAB G;  1WPX A;  2WLL B;  1YZB A;  2RMK B;  1SQQ H;  4X1K B;  4LFA B;  3X2Q C;  3OEE G;  3JD4 A;  4Z2W A;  1FPO A;  1MZE A;  1Y66 A;  3M8A A;  5CN0 A;  2HKO A;  2OCC C;  2IJH A;  3CCQ V;  1Q81 W;  4MS2 A;  5KHK A;  3K04 A;  4MTO A;  1K3E A;  3ZJZ A;  2XAS A;  4CBC A;  4BIU A;  3CHX A;  1J5E B;  2WLI A;  2EZO A;  3A8T A;  4AQY O;  3ZRV A;  1GN2 A;  1XNR B;  3JCZ A;  2HFE C;  3T1Y B;  4JYY A;  5IYZ A;  3HKE A;  1DK1 A;  3OR6 C;  3OR7 C;  3ZMT A;  1WA8 A;  4DUZ B;  1SQP H;  3U11 A;  4W4K A;  1IBK B;  2KQX A;  3AG4 C;  4JF3 A;  5A2Q N;  2LFR A;  2LGQ A;  5LGN A;  1HR0 O;  2DYS C;  1QBZ A;  3VOU A;  2IH1 C;  4JI6 B;  1L0L H;  2HVK C;  4A5U B;  3ZED A;  1RSO A;  1ZAU A;  4FM0 A;  2ZE8 A;  4TV8 B;  1XNQ B;  3LDC A;  2P6J A;  3OW2 U;  5DEC A;  1CP9 A;  1QVF U;  3I5D A;  2BOC C;  2EIN C;  1LR1 A;  3RW0 A;  4JI4 B;  4GYC B;  2Q9L A;  3KKY A;  3ZMS A;  2CUG A;  4EB6 A;  4LF6 B;  2NN4 A;  2VS0 A;  3VQY A;  4LBE C;  4P9P A;  5D5Q A;  3TK1 A;  1TUB A;  1PV0 A;  2LO1 A;  3HKB B;  3FB6 C;  3E83 A;  4TV8 A;  4K8Z A;  4IHJ B;  4AI8 A;  1OCC C;  2QKA A;  3LSS A;  1GM9 A;  3ZBH A;  3OGC C;  4PDR A;  2OCH A;  2K9P A;  3RVZ A;  3K0G A;  5J2T A;  3G6E V;  4HBN A;  2X0L A;  4MVZ A;  3K5M A;  1HNZ O;  4PA3 A;  1XHZ A;  2Q73 A;  3CCV V;  3RYI A;  4ABM A;  1R3J C;  4EFB A;  1KD1 W;  1NQT A;  5LGT A;  5KAF Z;  1YHQ V;  2WLJ A;  3Q4H A;  4O4H B;  4UCV A;  1VQM V;  3N2K A;  3RWR D;  3TCU A;  1KEC A;  2Y4T A;  1K9M W;  2WPD G;  5CA1 B;  5CA0 A;  1KKD A;  2Y69 C;  3ETG A;  5J2T B;  5GON A;  2L35 A;  4FIP C;  4X9Q A;  3CEI A;  5BR8 O;  1GN6 A;  3OMA B;  3JD3 A;  4UCO A;  5F2V O;  5C8Y B;  1V9P A;  1N33 B;  3CX5 F;  5KMG A;  1EZJ A;  2H3O A;  1NU1 H;  4WFH A;  3CC7 V;  5HFM A;  2MW2 B;  2R9R B;  1K5Q A;  3QVN A;  2DYR C;  1GRJ A;  3DC6 A;  4J7Z A;  4QJF B;  2CH7 A;  4ZIB A;  4O2B B;  1K33 A;  4LR3 A;  1UPG A;  2JVD A;  5LOV A;  1VQP V;  2Q7E A;  4DW0 A;  2WA4 A;  4HAM A;  3K57 A;  1F4M A;  3ZHU A;  4LFC O;  3E22 B;  1M4U A;  5IT9 N;  1YTF D;  4LF7 O;  3JD1 A;  2EZP A;  4LF6 O;  1Q7Y W;  1G6U A;  1GN3 A;  3A0B Z;  1KB9 F;  2Q69 A;  4YHH B;  4ZOL A;  4JTA B;  2V4D A;  2DMX A;  1F23 A;  3TET A;  1NZ6 A;  2ZQM A;  1EM1 A;  2YID A;  1H2N A;  3EVK A;  4DV4 O;  1QLE C;  3CME V;  2ODM A;  1R6N A;  1BHA A;  2QTS A;  3K9S A;  1VF6 C;  5CA1 A;  2EUL A;  1XNQ O;  4B3M B;  1AR5 A;  4YHH O;  2EIJ B;  4DYL A;  5LP6 C;  4DR1 O;  3P3N A;  2EIN B;  2ZM6 O;  1OCZ C;  4WFF A;  1B3Q A;  2UU9 B;  5TIS Z;  1N0N A;  3W7S A;  4JYB A;  1XEQ A;  3BPZ A;  3UCS C;  3AG3 C;  3FFQ A;  1S77 D;  4UCU A;  4NTY A;  2LP7 A;  3BY6 A;  2H94 A;  1SER A;  5LA6 B;  3VBB A;  2BCC H;  4LFA O;  2JJ1 G;  3RYF B;  3TXS A;  1P84 F;  3CWB H;  1AP5 A;  2YIB D;  5LXT B;  4MW8 A;  1ZTE A;  1SQG A;  1BT8 A;  4D6T H;  5IJ0 B;  1YDX A;  2F4V B;  3JAL B;  1A32 A;  4E2L A;  1BHB A;  1URF A;  4J9Z B;  3SYC A;  3STL C;  5CBF A;  5EC1 C;  2C2A A;  3KCX A;  3VQW A;  2BOB C;  3ZCC A;  4N21 A;  4GKK O;  4O4L A;  5KHH A;  3CCM V;  3APO A;  1PPJ H;  1JOY A;  4ZI7 A;  3VQV A;  4B08 A;  4FMT A;  2ZR3 A;  3CB2 A;  2Z3Y A;  3BEH A;  2VQE O;  3E89 A;  3BAA A;  1FXH A;  2AHZ A;  1Q5O A;  1I5Y A;  1Y74 B;  4JYC A;  1YJW V;  5KX5 A;  2QJ1 A;  3SPI A;  3ZS8 C;  2N74 A;  1H8H G;  4EKW A;  3B40 A;  4DR4 O;  3RVY A;  2HLD G;  1NI8 A;  1HNW O;  2ZE7 A;  4LCU C;  5LHG A;  2CE4 A;  2Y0P A;  2UXB B;  3WG7 B;  4DV3 O;  2Q68 A;  4DV4 B;  3P32 A;  1VQ9 V;  4K35 A;  3BA8 A;  4R8C A;  1IBL O;  2PF4 E;  5JH7 A;  5BXZ A;  1R6T A;  1DF4 A;  4X20 B;  1OCO C;  3ZHV A;  3WB0 A;  3D3Q A;  2PUS A;  4JZ2 A;  2IM9 A;  2XAG A;  1PNK A;  4L87 A;  4TT3 G;  3FB7 C;  4G28 B;  3ZHQ A;  3K59 A;  2FL4 A;  3ASN B;  5DM6 V;  1M56 B;  4WFA V;  4X8A A;  1Y76 B;  2BSK A;  4UVC A;  1QR8 A;  2YI9 A;  3C90 A;  1N33 O;  2KG7 B;  2QM7 A;  3DC5 A;  1AJQ A;  2XAH A;  5LYJ B;  3F5W C;  3RN4 A;  5EC2 C;  3HPL C;  3FX7 A;  3H1I H;  1Y4M A;  1YIJ V;  2IJI A;  4U7O A;  4P9O A;  1VQ4 V;  2VWJ A;  4H13 B;  4GKK B;  4B7E A;  3CE2 A;  4FVM A;  4LF9 O;  1N8R W;  1FYJ A;  1P4R A;  5B66 Z;  2A06 H;  2DYS B;  4FM1 A;  3BA9 A;  3ETQ A;  1LUW A;  3LSU A;  3IC9 A;  2QTO A;  3T2M A;  4AQY B;  3FB8 C;  4WFE A;  2WLL A;  1XNR O;  4FM2 A;  5LL6 Y;  3BAB A;  3LDD A;  4PA9 A;  2GHY A;  4FLZ A;  3CXC U;  2F4V O;  3SJC C;  1PM9 A;  1YSC A;  1GTO A;  4TV9 B;  5IJ0 A;  1DGS A;  3S3X A;  1AB3 A;  1U97 A;  4B3R B;  3HKB A;  2GUZ B;  1HNX O;  1OCO B;  4CH3 A;  1VF7 A;  4PJ0 Z;  3SPH A;  3K58 A;  5LMN B;  1NTK H;  5JQG A;  5JCO C;  2OCC B;  2B1I A;  1NJI W;  1YXB A;  5IJ9 A;  5JJJ B;  2UXD B;  1AI7 A;  2Q0O C;  5JJE B;  4LH7 A;  2XUM A;  1GMG A;  1WB8 A;  2UXX A;  5CB4 A;  3ETD A;  3X2Q B;  2E5L O;  4KL1 A;  1FKA O;  5CA0 B;  1B06 A;  1BL8 A;  2YSU B;  5B1B B;  2UXC B;  2P90 A;  3APQ A;  1AI4 A;  4O2A B;  1PL4 A;  3ZHT A;  4B7K A;  4MT8 A;  4CZZ A;  1SES A;  5CMU A;  3SYP A;  3AEI A;  4I0X A;  1R73 A;  1DTO A;  2UXB O;  3A0R A;  1FFT B;  5LHH A;  1O9H A;  4LFC B;  3MDS A;  1FJG B;  1F51 A;  3WB2 A;  4PI0 A;  4DR7 B;  1RFY A;  1PNL A;  2HHH O;  4DR6 O;  1V55 C;  2ZNI A;  2OWO A;  3ABM B;  2YIB A;  1NBM G;  3JAR B;  2VQE B;  3THO A;  3ASO B;  3SPJ A;  3MD0 A;  1E1R G;  1WN7 A;  3EHB B;  2F43 G;  3JD2 A;  4JAV A;  3ABL C;  2HG5 C;  1TAE A;  2W6J G;  2A0L A;  1L8D A;  3E2E A;  3PJS K;  1SF9 A;  2FTK A;  3KCY A;  4DV7 B;  1T5E A;  1NTM H;  3M99 B;  1M9N A;  2QEX V;  2CK3 G;  2WLH A;  4JI0 B;  3MAQ A;  4LC1 A;  1R3K C;  1JVM A;  2CTQ A;  4JI7 O;  1XDC A;  2QM4 A;  4DR3 O;  3QG5 A;  5EYP B;  4JI6 O;  1P7G A;  1PKX A;  1COW G;  2GDS A;  2PZS A;  1RM1 C;  1N0J A;  2Q7G A;  4RUF A;  2LJ2 A;  2XAJ A;  3CCJ V;  4JV5 O;  1NH2 B;  1G1X B;  2K1E A;  5B3S C;  5EIB C;  4CC5 A;  2DOS A;  3OTO B;  2YIC A;  2Y48 A;  2BTO A;  2KG7 A;  2XTA A;  4GX0 A;  1PP9 H;  5K1X A;  1YCI A;  4DV2 O;  2Y0I A;  2IJK A;  1AR4 A;  4O4L B;  1FS0 G;  3OUS A;  1XBL A;  4R6Z A;  4I7Z B;  1D5N A;  2QWR B;  4NXM O;  3OTF A;  3ZMV A;  4NTW A;  1SET A;  3JAS A;  3WB1 A;  2UUB O;  3CRQ A;  4BWA A;  1N32 B;  4X64 B;  4PHZ A;  5CB4 B;  1WB7 A;  3UQ8 A;  2QWO B;  1NKD A;  4FFB A;  2ZCE A;  2WLI B;  4CS3 A;  2A3Q A;  3W7X A;  4OX9 O;  4IYH A;  2HJF C;  4QPK A;  3DXR A;  4U7N A;  4X89 A;  4H37 A;  3Q4H B;  4U3J A;  4DUY O;  1YJ9 V;  2IJJ A;  4RQE A;  1Q43 A;  5KAI Z;  1VQ5 V;  3K06 A;  3ZMZ A;  1VF5 B;  3B4S A;  5D5P A;  4N23 A;  4ZHQ A;  1VMG A;  2EIK C;  4O4J A;  3HR0 A;  2ZXW B;  3N27 A;  4DXW A;  2RDC A;  4X65 B;  5A9G A;  3ASN C;  2RNB A;  3D8C A;  2PGG A;  2E75 B;  3W7T A;  2JGU A;  1BS3 A;  1XOU A;  3HKC A;  3HKC B;  3L74 H;  1KP2 A;  1NVP B;  1I5X A;  1FXK C;  4BW5 A;  1N36 B;  2PI5 A;  4U3F H;  2IBZ H;  4B3R O;  4JTD B;  4DRX B;  3H1K H;  5FPR A;  4LWS A;  1G8M A;  3B2E E;  4UFZ A;  3H01 A;  3T4D A;  3P3P A;  2DWE C;  2ZDI C;  4FLY A;  4MVS A;  1M1K W;  5H6Q A;  2XHB A;  3LSQ A;  4UVB A;  5JVD A;  2DQ3 A;  4HNA B;  4X66 O;  5IJ9 B;  2ZIN A;  1OCC B;  1MOF A;  1YTF B;  2ARH A;  5GTI Z;  4DR3 B;  2ATK C;  1ENV A;  2QM8 A;  1SQB H;  2EIM C;  2DN9 A;  1BZK A;  4CH6 A;  1Q3E A;  4GLX A;  4I4T B;  1IBM B;  1HNZ B;  2Q5Z A;  4IIJ A;  4IIJ B;  5C93 A;  4Q6G A;  4LWS B;  1US6 A;  4BIO A;  4RAI A;  2R72 A;  3ZHR A;  4GCZ A;  3CP1 A;  5HFL A;  5LP6 A;  1S76 D;  4GT1 A;  1R3L C;  3SJA C;  5JVD B;  1MG1 A;  2JS3 A;  4PA7 A;  3D36 C; 
#chains in the Genus database with same CATH homology
 2JK5 C;  1FXH A;  2AHZ A;  3ZRW A;  5FL7 G;  5J9P C;  1I5Y A;  4HZ3 A;  5CBH A;  5KUM A;  4JYC A;  3ZIA G;  2Y69 B;  3G4S V;  1YJW V;  2ZD9 A;  1JX9 A;  1R3I C;  2IH3 C;  2W0F C;  1FXV A;  3SPI A;  3UKM A;  1H8H G;  1YIT V;  4QPJ A;  4EKW A;  3RVY A;  5L3G A;  1SZT A;  4KFM A;  2HLD G;  3G71 V;  5GW7 A;  4MTG A;  4P30 A;  4LCU C;  3JYC A;  5LHG A;  1CEZ A;  4MSW C;  4JTC B;  2OT5 A;  3E8B A;  5IY5 C;  3LDE A;  2EJR A;  2JIZ G;  4FJC C;  1GKF A;  4JAS A;  1GM7 A;  4UUJ C;  3SYO A;  2NNU A;  3WG7 B;  4I9W A;  1VQK V;  3W7U A;  1B6Q A;  2Q68 A;  1P7B A;  1GK9 A;  3R65 A;  4ASU G;  5KUK A;  2WWW A;  3P32 A;  2IU3 A;  1VQ9 V;  4MVR A;  2JEX A;  2ITC C;  1SRY A;  4DO2 A;  4R8C A;  1OHH G;  2W6I G;  2V7Q G;  5L3E A;  1DF4 A;  3E8H A;  1OCO C;  4G2K A;  1H38 A;  1BMF G;  2JDI G;  1XL6 A;  2XAG A;  1PNK A;  4HYO A;  4L87 A;  4TT3 G;  3CCR V;  3E8G A;  3FB7 C;  2QA4 V;  4G28 B;  4ZKI A;  4X88 A;  3ASN B;  3QNE A;  4MTF A;  5DN6 G;  5DM6 V;  3WG7 C;  2ZR2 A;  2ITD C;  5EK0 A;  1M56 B;  4QE9 A;  4R7C A;  4WFA V;  4X8A A;  1AI6 A;  4MTX A;  1Q82 W;  3K79 A;  3CCU V;  4UVC A;  1NH2 D;  1QR8 A;  4JPR A;  1QLE B;  1K97 A;  2XOK G;  3ABK C;  3DGE A;  1CPY A;  3ASO C;  4LP8 A;  3CYO A;  1QCE A;  2QM7 A;  3B77 A;  1AJQ A;  3W7W A;  2XAH A;  2WSS G;  3F5W C;  1ROP A;  3D36 A;  3OAA G;  5EC2 C;  1S5H C;  4KP4 A;  1QLN A;  2WLM A;  3HPL C;  4MVM A;  1Y4M A;  1H8E G;  3SPC A;  1YIJ V;  2IJI A;  1V54 C;  4U7O A;  4P9O A;  4PEL A;  1VQ4 V;  4FPP A;  1W0J G;  4R50 A;  4XDL A;  1VQO V;  3P30 A;  4TSF G;  2X7R B;  4RQF A;  3I55 V;  3LNM B;  3QO7 A;  1N8R W;  1K4D C;  1K8A W;  1QR9 A;  1P4R A;  3FYI B;  3CD6 V;  1MSW D;  1FXK A;  4MVQ A;  1DF5 A;  3K9A A;  2EIK B;  3E86 A;  4PDM A;  5B1A B;  2DYS B;  4BIZ A;  2OTL V;  3CMA V;  2QTO A;  3T2M A;  5L3F A;  5CBG A;  5LBQ A;  3FB8 C;  5LGU A;  3AG1 C;  4WFE A;  2WLL A;  1H2G A;  3ABU A;  3FYE B;  4RO2 A;  3LDD A;  1AJP A;  4PDV A;  4MW3 A;  3SPG A;  4PA9 A;  2GHY A;  4F4L A;  3CXC U;  3CCE V;  2WLN A;  3IC7 A;  3CPW U;  4H33 A;  4JGS A;  2A79 B;  3AG2 C;  3FKS G;  1OZ0 A;  2Z5U A;  4PDL A;  1YSC A;  1GTO A;  1ARO P;  3ZN1 A;  1MAB G;  1WPX A;  2WLL B;  1S0V A;  3X2Q C;  2DQ0 A;  3OEE G;  3JD4 A;  2HVJ C;  2A9H A;  3K03 A;  2V1D A;  1Y66 A;  1OCO B;  2XND G;  3ZMU A;  5CN0 A;  3SPH A;  3CC2 V;  2HKO A;  1NR1 A;  2OCC C;  2IJH A;  3CCQ V;  1Q81 W;  1M90 W;  2OCC B;  4MS2 A;  2B1I A;  1NJI W;  3K04 A;  4MTO A;  1K3E A;  3ZJZ A;  1AI7 A;  2XAS A;  4CBC A;  1K92 A;  2R9I A;  4BIU A;  2WLI A;  3OEH G;  3MHH C;  2EZO A;  1GMG A;  2UXX A;  4QIW F;  3LUT B;  2B1G A;  3ETD A;  3X2Q B;  2DW4 A;  3ZRV A;  5LHI A;  3STZ C;  3JCZ A;  2HFE C;  3T1C A;  3OFN G;  3AG2 B;  2KB1 A;  1BL8 A;  2YSU B;  5B1B B;  3OR6 C;  1TUE B;  1VQ6 V;  2P90 A;  2X6C A;  3OR7 C;  1AI4 A;  1WLE A;  3ZMT A;  5B3S B;  4MT8 A;  1JJ2 U;  2DYR B;  3AG4 C;  4CZZ A;  1JPX A;  1SES A;  2QKS A;  5CMU A;  4JF3 A;  3SYP A;  3AEI A;  3CCL V;  1R73 A;  4PA4 A;  1DTO A;  2LFR A;  3A0R A;  1FFT B;  2YEV B;  5LHH A;  3I56 V;  5LGN A;  1DLB A;  2DYS C;  1RPR A;  1QBZ A;  3KG2 A;  3FB5 C;  3VOU A;  2IH1 C;  2X6A A;  1AR1 B;  2HVK C;  1F51 A;  1AI5 A;  2HR3 A;  2NLJ C;  2IW5 A;  1PNL A;  2EIL C;  3SYQ A;  3CCS V;  3ZRW B;  3SYA A;  1OCR B;  1V55 C;  3B8M A;  1L1F A;  2LFS A;  2DWD C;  2PI4 A;  5EBL C;  3LDC A;  4PA6 A;  2P6J A;  3ABM B;  3ZRS A;  3OW2 U;  1CP9 A;  1NBM G;  3HB3 B;  3ASO B;  4J9Y B;  3SPJ A;  1QVF U;  3MD0 A;  3OE7 G;  3E35 A;  1E1R G;  2BOC C;  4XBF A;  3EHB B;  3RBZ A;  1KP3 A;  2EIN C;  2F43 G;  3JD2 A;  4JAV A;  3RW0 A;  3MHS C;  3ABL C;  2HG5 C;  5BZB A;  2W6J G;  2A0L A;  3DTU B;  5E1A C;  3ZMS A;  3E2E A;  3PJS K;  1J95 A;  2FTK A;  1EFR G;  4LBE C;  4P9P A;  3TK1 A;  3M99 B;  1M9N A;  2GSM B;  2CK3 G;  2WLH A;  4FK5 C;  2QEX V;  1GM8 A;  1R3K C;  4LC1 A;  1JVM A;  2P67 A;  3FB6 C;  3E83 A;  1G4Y B;  4UV9 A;  4KUM A;  4RUE A;  1OCC C;  2Q6A A;  2D3O W;  1VQ7 V;  5L3D A;  3LSS A;  1PKX A;  1GM9 A;  1COW G;  1RM1 C;  2QE7 G;  4TWK A;  3OGC C;  4PDR A;  4RUF A;  1E1Q G;  2XAJ A;  3CCJ V;  3AG4 B;  4XDK A;  3RVZ A;  1PNM A;  3K0G A;  4ZBM A;  3G6E V;  1LNQ A;  2X0L A;  3T4Z A;  1GO3 F;  2K1E A;  5B3S C;  1NH2 B;  4MVZ A;  1QVG U;  1YI2 V;  4PA3 A;  2Y48 A;  3CCV V;  1K34 A;  5H9C A;  2OTJ V;  1R3J C;  4GX0 A;  1E79 G;  1VQN V;  3QO8 A;  1KD1 W;  1NQT A;  1F4N A;  2IJK A;  4UVA A;  5LGT A;  3K0D A;  1YHQ V;  1JQ0 A;  4I5S A;  2WLJ A;  1FS0 G;  3OUS A;  2Q67 A;  1VQM V;  2X6B A;  4R6Z A;  3K3W A;  4YXW G;  1EBO A;  3NXS A;  3TCU A;  1KEC A;  3ZMV A;  5L3C A;  1K9M W;  2WPD G;  3ZN0 A;  1SET A;  3B8N A;  1KKD A;  2Y69 C;  1PL0 A;  3ETG A;  2H8P C;  1RM1 B;  3F7V C;  1K5S A;  4FIP C;  2XAQ A;  5KA6 A;  1V55 B;  2M7W A;  4WF9 V;  3OMA B;  3GWO A;  3JD3 A;  1NKD A;  2P7T C;  3IGA C;  2WLI B;  1THZ A;  2WAM A;  3W7X A;  1S3J A;  1OCZ B;  2HJF C;  4GX1 A;  4QPK A;  3QO5 A;  1XL4 A;  3SJQ C;  3IFX A;  4U7N A;  5B1O A;  4X89 A;  4H37 A;  3ML0 A;  1EZJ A;  4WFH A;  1M57 C;  3CC7 V;  1NR7 A;  3E8F A;  1JCH A;  1V54 B;  3OMN B;  3OM3 B;  5HFM A;  1YJ9 V;  2R9R B;  1K5Q A;  2IJJ A;  3UM7 A;  4RQE A;  4WFG A;  1VQ5 V;  2DYR C;  4G27 B;  3K06 A;  3AG1 B;  3ZMZ A;  4QJF B;  3ABM C;  4Z1M G;  4N23 A;  1R6K A;  1K33 A;  4QNH B;  2EIK C;  5EBW C;  2ZXW B;  1VQP V;  4DXW A;  3WFV A;  2EIM B;  3ASN C;  4HAM A;  4WCE V;  1F4M A;  3W7T A;  4BAY A;  1YTF D;  1W2B U;  3JD1 A;  2EZP A;  4Q20 A;  1Q7Y W;  1VQ8 V;  1RPO A;  1KP2 A;  3AG3 B;  1NVP B;  2Q69 A;  1I5X A;  4JTA B;  1FXK C;  5H6R A;  4BW5 A;  5IYD O;  2PI5 A;  1F23 A;  3JD0 A;  3TET A;  1K7D A;  2ZQM A;  2XAF A;  3OMI B;  4JTD B;  1K4C C;  3ABK B;  1QLE C;  3CME V;  2EIJ C;  2JJ2 G;  1R6N A;  1S72 V;  5B1B C;  3K08 A;  2WLK A;  1G8M A;  5L3B A;  3ABT A;  1BHA A;  2MK3 A;  1Q86 W;  4WFB V;  2IU0 A;  1M56 C;  3H01 A;  3GB7 C;  2EIJ B;  3D3I A;  5IY5 B;  3T4D A;  3ABL B;  2JEU A;  2DWE C;  2ZDI C;  4QE7 A;  2EIN B;  4MVS A;  1OCZ C;  4WFF A;  1M1K W;  5H6Q A;  3EFF K;  5IYB O;  1NVP D;  3W7S A;  3LSQ A;  4JYB A;  4UVB A;  3AG3 C;  1S77 D;  2DQ3 A;  1UJW B;  1ORQ C;  2LP7 A;  3BY6 A;  4OXS A;  4UV8 A;  1FXK B;  1OCR C;  1OCC B;  2H94 A;  1SER A;  1MOF A;  1YTF B;  5KA5 A;  1KQS U;  2YEV A;  4XDJ A;  3OUF A;  2AHY A;  4MVO A;  4UXN A;  3VBB A;  2JJ1 G;  1YJN V;  1KC8 W;  2ATK C;  1PD3 A;  4GX5 A;  1ENV A;  2QM8 A;  2EIM C;  3CC4 V;  1VQL V;  2ZXW C;  4MW8 A;  5B1N A;  1AJN A;  5CA3 A;  4P2Z A;  4E2L A;  1BHB A;  4J9Z B;  4MVU A;  3ETE A;  3STL C;  3SYC A;  3F7Y C;  5CBF A;  1K73 W;  5EC1 C;  5C93 A;  2EBO A;  4GX2 A;  2B5U A;  2C2A A;  2BOB C;  3ZCC A;  1ZWI C;  4N21 A;  4RAI A;  1W0K G;  5IDJ A;  3CCM V;  5IYC O;  5EBM C;  1JOY A;  5B1A C;  2ZDI A;  4GCZ A;  2EIL B;  3CP1 A;  5HFL A;  1HWY A;  1M57 B;  1S76 D;  4GT1 A;  3ZRX A;  4FMT A;  1R3L C;  2UXN A;  1MG1 A;  4PA7 A;  2ZR3 A;  2Z3Y A;  3BEH A;  3E89 A;  1IXM A;  4JAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...