4P9OA

Complex of voltage-gated ion channel in a the presence of channel blocking compound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
molecule tags Transport protein
total genus 31
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p9oA00
3E86A 2WLLB 4KFMA 2YEVA 3K0DA 4P9OA 4PDRA 3E8FA 4XDLA 3RVYA 3LNMB 2P7TC 3F7VC 4MTOA 3UM7A 4BW5A 4F4LA 3SYPA 2X6AA 2JK5C 1QLEC 2QTOA 3FB5C 4MTFA 2DWDC 2AHYA 4TWKA 4UUJC 3T4DA 4G27B 3SPCA 4GX0A 2A79B 4QE7A 3RW0A 5B1AC 5BZBA 4MVZA 2HVKC 4PA6A 4MVSA 4LBEC 2DYSC 3AG4C 4GX2A 4G28B 3LDDA 1BL8A 3F5WC 5EBWC 2WLMA 4P2ZA 3FB7C 2ZD9A 1R3KC 4JTAB 2IH1C 4R7CA 4PA7A 3FB8C 1OCZC 1ZWIC 3KG2A 3AG1C 4MVMA 3ZRSA 3RBZA 3E8GA 3T4ZA 3IGAC 3TCUA 5IY5C 4PDLA 2EILC 4XDJA 2WLNA 4MTGA 2BOBC 4I9WA 4CBCA 5B1BC 3T2MA 1G4YB 3R65A 5EC2C 4DXWA 2HFEC 5B3SC 4JTDB 3SPIA 2BOCC 4RUEA 1V55C 3F7YC 4MW8A 3OUSA 3X2QC 2QKSA 2WLJA 1J95A 3BEHA 4MVOA 4P9PA 4R8CA 4LCUC 3UKMA 2KB1A 1M57C 4JTCB 3SPGA 3STZC 1KKDA 3K06A 4MVUA 4EKWA 1R3LC 3OR7C 4WFHA 1XL6A 3HPLC 2DWEC 3AG3C 3SYOA 4QNHB 2ITDC 3OGCC 2DYRC 3SYCA 4HZ3A 3ABLC 2X6BA 2HVJC 1OCCC 4MVRA 5EBMC 3ZJZA 4X88A 4X89A 5CBGA 1JVMA 3EFFK 5J9PC 2W0FC 2Q68A 2Q69A 4RUFA 3E83A 4QE9A 3GB7C 2EIMC 4H33A 1OCRC 2X6CA 4MVQA 2A9HA 4MS2A 5CBHA 3LDEA 3E89A 2WLHA 3OR6C 3ABMC 3FB6C 4RAIA 1R3IC 3E8BA 2OCCC 3K0GA 2EIKC 1LNQA 4RO2A 4MSWC 2ITCC 2H8PC 3SPHA 1V54C 2IH3C 4LP8A 3TETA 1K4CC 3ASNC 2WLKA 2HJFC 2A0LA 2Q6AA 3ABKC 3STLC 2HG5C 2NLJC 3LDCA 3E8HA 4GX5A 4J9YB 4PA3A 3OUFA 5KUKA 3WG7C 4H37A 3K04A 4PA9A 1P7BA 4WFGA 4ZBMA 3RVZA 4MW3A 2K1EA 4PDVA 3SJQC 5CBFA 1K4DC 3PJSK 3K03A 5EBLC 2WLLA 3ASOC 4R6ZA 1R3JC 3K08A 1XL4A 5EC1C 4OXSA 2ATKC 4XDKA 1ORQC 3SYQA 2R9RB 2WLIB 4PDMA 5KUMA 4HYOA 4R50A 2WLIA 2ZXWC 5E1AC 2AHZA 4WFFA 2Q67A 2EINC 3JYCA 3LUTB 3SPJA 3SYAA 3VOUA 1S5HC 4GX1A 1M56C 3T1CA 3IFXA 4P30A 5EK0A 2Y69C 4WFEA 3AG2C 4J9ZB 4PA4A 4X8AA 2EIJC 1OCOC
chains in the Genus database with same CATH superfamily
3PN1A 1SKVA 4JI6B 3T1YB 1GM9A 4NKGB 3D3QA 4GCZA 1IXBA 2GBOA 2ZE5A 3OMIB 3RYFA 3BA9A 1HNZB 2OTLV 4B3SB 1HR0O 1K9MW 2QWOB 4G27B 2A79B 3BHPA 4CS4A 1V9PA 4DV6O 2QEXV 4YJ2B 2CGNA 3F5WC 4EEQA 4YY3B 4A5UB 4OX9B 4JTAB 2QDOA 2QJ1A 1F4MA 4X1YA 4X1KA 1NTKH 3QO5A 4F6RB 5JJNB 5LHHA 3RYCB 3R65A 5EC2C 4Q6GA 2OT5A 3CRCA 3ZHQA 1YDXA 4JTDB 4DYLA 5C93A 1P4RA 1HW7A 2VQFO 1SZXA 4MVOA 3BEHA 1CP9A 1OCRB 4CH5A 1NR1A 3K06A 4MVUA 3E35A 3ZMZA 4DR5B 1R3LC 2IW5A 4U3FH 3CCMV 2DYRC 1HNWB 4H0LB 4MVRA 3ASNB 3D36C 4IT5A 5EIBD 4B7EA 3IAYA 2LGWA 2PZSA 4MVQA 3GVMA 3P3PA 2W6JG 3E8BA 5JH7A 1AVMA 1NJIW 3BPZA 4LFCB 3STLC 2NLJC 1VF6A 2ZR3A 5AG2A 2ZDIA 3K04A 1K5SA 4DRXB 1NKDA 5JJJB 4JYYA 1R73A 2FMLA 2BTQA 4ZIBA 4OXSA 3OMNB 4BAYA 3SJAC 3CMAV 2AXTZ 1XI1A 3VQVA 1FS0G 1YJWV 2JS5A 1VF7A 3CCUV 2H3OA 4HZ3A 1F7YA 2IU3A 3LNMB 1OCZB 4JI2B 4BW5A 1QVGU 1N32O 1BHBA 4TV9A 4B3MB 5IY5B 4TWKA 2JGDB 1TA8A 3CRMA 1I08A 2Q7EA 4ZI7B 3SGIA 4QE7A 3CCSV 3CEIA 3BY6A 1V55B 3WU2Z 4FLYA 4JYAO 3X2QB 3CYOA 4DK0A 3FB8C 3VQXA 1SS3A 4TSFG 5LHGA 4DV5O 1Q81W 3CJHA 3CC7V 3L72H 2RCVA 3ZRWB 2AW9A 2B9ZA 2FTKA 2A3QA 1FAFA 3QG5A 3ML0A 5HFLA 4Z1MG 5KA5A 2XTAA 3ZHRA 3OR7C 5LA6A 4NTWA 3HKCA 1NH2D 1SA0B 1L1FA 2QKCA 2QWNB 1V54B 1YCIA 5GTIZ 4U3JB 4K35A 2Q68A 3E22A 2F1MA 3GB7C 3RWRD 1XMQB 2JIZG 3J81N 1W2BU 2JEXA 3CRRA 5DEDA 1BGYH 1AROP 3APOA 1K7DA 4UCSA 3TGUH 2ITCC 2LQTA 1FJGB 4CC5A 4G2KA 1J5EB 3C90A 1IBMO 4UVAA 4J42A 1NVPD 5JVDB 3CCEV 3DXRB 2ODMA 3K08A 2F4VB 2EIJB 3CRQA 1L8DA 1S77D 4I4TB 4EB6A 3ETDA 4J41A 2CTWA 2VQEB 1LR1A 4CZZA 1IBLB 3SJCC 1S72V 5LGUA 3IFXA 4K8ZA 1UJWB 2YIAA 4K8XA 4F6RA 3J7AU 4J80A 1WP7A 2X6AA 2EILB 1RM1B 5BZBA 4MVZA 1FPOA 1AJNA 1R6TA 1THZA 2YUAA 4DR1O 4P2ZA 1EN6A 4JYBA 2CDYA 3KZIZ 5KX5B 4RQFA 2XHBA 2UU9B 3IGAC 4X66B 1AJQA 2Y0IA 2BOBC 4NXNO 4I9WA 3CC2V 3ABLB 3FYEB 5DM6V 4DXWA 5B3SC 3SPIA 5IYZA 4UCUA 3J80N 1WB8A 4WFBV 2ADQB 3D36A 4JI6O 2R72A 1XNRO 3UKMA 3S3XA 3JARB 4B3SO 2Z0AA 3C3SA 1NI8A 1SQPH 3HB3B 4WFHA 1N4CA 1N33B 3OGCC 3JASB 3AK2A 1SQGA 3BRCA 4DRXA 4F6EA 4UV9A 2Q0AA 4OX9O 4L87A 1I0HA 2A9HA 5JCOC 3ZMTA 4X1IA 1Q6HA 1YTFB 4FLXA 1QCEA 3RYHB 1AR4A 3JD0A 2P4VA 2CTRA 5H6RA 4W4KA 2HLDG 1P7BA 5KA6A 3D8CA 3M8AA 4MW3A 4BWAA 1JOYA 2VRZA 2Y69B 1KC8W 3ZHTA 2P06A 4DUYB 4WF9V 3HKEA 1BZKA 4FFBA 3ZEDA 2R9IA 1DLBA 2OTJV 2AZ2A 3CCLV 4ZI7A 2NNUA 2NN4A 2PYLA 3K79A 1BQ0A 3Q4HB 2UXDB 1YITV 2JJ1G 2F23A 4P9OA 4LFCO 4GLXA 2Q73A 4FLZA 2P7TC 1AR1B 1M5IA 1XQ8A 2HHHB 2LGQA 3JATA 4UCVA 1IBKB 3ZRWA 4LF5O 2V7QG 5B1AC 4O4LB 1SQQH 2HEPA 3M7MX 4FLUA 5L3DA 3CSXA 2ZE6A 2QTSA 3FB7C 3QO7A 1SA0A 1Y76A 2YICA 4ZOLB 4PD4F 4B7KA 1PKXA 1Q5OA 1KECA 2FKXA 1JFFB 1QBZA 2GTSA 1AR5A 4BIZA 1N36B 3KCXA 2QKSA 2KQXA 4LCUC 2OCHA 3IC9A 3NR7A 4WCEV 1OZ0A 4O4JB 4HAMA 4I50B 4BR6A 4DW0A 2HVJC 1OCCC 3BAAA 1Y66A 5IT9N 4YIOA 1SRYA 3JD1A 5B5EZ 3IJ4A 3DXRA 4LF4O 3ABMC 4I4TA 4TUYA 1XUQA 1M90W 1SQVH 4LP8A 2ZXWB 1W59A 3OFNG 4JASA 1EZVH 3SJQC 1IURA 2AGAA 5LYJB 2JS3A 5DN6G 5IJ0A 1N34B 3FX7A 2KKWA 3ZHVA 3OGIB 3LSQA 2QSAA 3U11A 5LP6B 2P4KA 3L70H 4JV5O 2ZQMA 5H9CA 1A32A 4J11A 3UM7A 4N23A 1PNKA 1J5EO 3AG1B 4LF7B 4C7UA 1PL0A 1VF5B 1QLEC 3OM3B 3T4DA 2AHYA 3RN4A 1QVFU 3DGEA 4LH6A 4CS3A 1YHQV 1B06A 4B08A 4PJ0Z 1ZSPA 3G4SV 2F4VO 1SESA 1U96A 5CA0B 2WLMA 1M57B 4JI0B 2QM4A 2RQ6A 4JI8O 1I94B 1HNXB 3JASA 3TCUA 1IBLO 2QGNA 4LF9B 5LMNB 1VQNV 1D5AA 1SZTA 1UPGA 2PI5A 1I7FA 2CH7A 4EKWA 5JCOA 2LW1A 3AG3C 2ITDC 4GYCB 1PNLA 4X88A 5J2TA 1FFTB 2YIBA 2Q69A 4DV0B 4XBFA 3E83A 4QE9A 4CC6A 3RFRA 1WA8B 5H5NA 1RSOA 2UU9O 1JCHA 3A0HZ 3FB6C 4RAIA 4O4IB 2V1DA 2CK3G 3VQYA 3CB2A 3TETA 1H2KA 4JI7O 1XMOB 1JR9A 1GN4A 4X64B 2IM9A 3Q4HA 1S0VA 3JAWA 2JEUA 3OTOB 4ZBMA 5B66Z 4JI3B 2AZ0A 1PD3A 4JZGA 3T1HO 1EN4A 1TUEB 1WJZA 4GKJB 1G8MA 4JPRA 4ZHQA 1VQ8V 4HYOA 5FPRA 1RPRA 2KG7B 2DW4A 3JYCA 3OAAG 1SETA 3W7UA 3CE2A 5LOVB 1BSMA 2YEVB 3AG2C 4J9ZB 4X8AA 1OCOC 3DTUB 1O9HA 2G38A 3FAVB 4DR2O 4FK5C 3O65A 1NQTA 3SYPA 1KP3A 4DV2B 2DWDC 1JFFA 1QR8A 2YI8A 4LFAB 2ZCEA 2UUBB 5L3CA 2UXBB 2X7RB 2L6LA 3LDDA 4CH4A 4YHHB 4MTXA 4J10A 1K33A 3JD3A 1SF9A 4KUMA 4LF8B 4O4JA 2F95B 4MVMA 1TVKB 4I50A 3ZN1A 3P3NA 4XDJA 1VQ7V 1SQFA 4CBCA 3CCRV 1MZEA 1P7GA 3G80A 2WA3A 2HP8A 4FJCC 4JYCA 5LMUB 3SPGA 2HHHO 1WLEA 1XHZA 3H01A 2OCCB 1K73W 4LH7A 3DC5A 4GKKB 4AQYO 3CWBH 4X89A 4DV1B 4DV4B 1SERA 2W0FC 3RYIB 1OCRC 4K0KB 5CA1A 1GMGA 1VMGA 4DUZB 2OIEA 2YDEA 1TGOA 1VQLV 4UXNA 4FM1A 1Q82W 1KQSU 3ASNC 2Q6AA 2YXLA 1RFYA 4H37A 3ZX6A 1AI5A 4PELA 3ETGA 5LP6A 3U0ZA 4B3RO 2GUZB 2QM8A 2XNDG 5CBFA 2P22C 2CTPA 1DF4A 1KYOF 2LP7A 5C8YA 4PDMA 5KUMA 1U97A 4I9QA 3HKDA 5IWAO 4R50A 3ZBHA 1BT8A 1XBLA 1VQMV 2Q67A 1JPXA 2QM7A 2XAJA 3OTFA 5CA0A 3W7XA 4P30A 4JAVA 3MAQA 4HNAB 4O2BB 3AG4B 4BW9A 4Z2WA 1Y4MA 3K5NA 4UV8A 3RVYA 1H2NA 1XHXA 4MTOA 5IYDO 2CAZC 1D2DA 4UUJC 5B1BB 2YC0A 3SR2C 3ZIAG 5CN0A 4TT3G 4I55B 3HKBB 4Z1VA 5BXZA 1OCZC 1YVWA 1ZWIC 2BTOA 4FLVA 3GWOA 5IY5C 4RWUA 3VBBA 3CC4V 2OWOA 1GO3F 4JI5B 3RT3C 4I0XA 1M9NA 1V55C 4MW8A 2F43G 2LO1A 3QF7A 3X2QC 1X59A 3W7WA 4O4IA 2YS8A 1H8EG 4D7SA 1EFRG 2XASA 3M99B 1Y6XA 4JI1B 5EBMC 4IIJA 2GV9A 4DR7B 4AHCA 4DR4O 2N04A 3KCYA 3WB2A 1YSCA 4MS2A 1I94O 1HNXO 1VQPV 1QR9A 2D3OW 3ASOB 4DV3B 2UUCB 2HJDA 4LC1A 1V54C 2E5LO 2K9PA 3B4SA 4NYKA 2KG7A 2HJFC 2Y0PA 4X65B 1VQ6V 1O9GA 5E79Z 3OUFA 2O57A 2EINB 4AI8A 3JALB 3N2KA 2RMKB 2XUMA 5FLXN 5BMVA 1VQ5V 4J7JA 1X4TA 4I5SA 2ATKC 2JVDA 3WFVA 4LWSA 1ROPA 1T5EA 4DV0O 2AHZA 5B1OA 4DO2A 1YTFD 5IDJA 2V4DA 5IE9A 1YJNV 1AI6A 2EIJC 2WLLB 2UXXA 4PDRA 1XMOO 4YJ3B 5KHHA 2YIBD 2R70A 3JCZA 3OTOO 3U10A 4FPPA 3G6EV 4JI3O 4PA6A 4CH3A 4JZ2A 3APQA 4G28B 2CE4A 5EBWC 4GKJO 2IH1C 4YJ2A 3MHSC 4DR3B 2XOKG 2EILC 1PV0A 5H2FZ 2Q7HA 2GDSA 5IYCO 3RYIA 1RM1C 2HFEC 3RYCA 2LFRA 2UXCO 5D5QA 4DV7B 3K5LA 4O4HB 3N27A 5A2QN 5FNVB 1FXKB 3ABLC 4UVCA 1ZL8B 2ZM6O 4LF8O 1WPBA 2FYUH 4NVPA 3OR6C 4DR6B 2Q4PA 3BCCH 1IZ3A 4IHJB 1XREA 3T1YO 1YZBA 4X62B 3ZN0A 1HNZO 3ETEA 1QLNA 5J2UB 4PA3A 4QPJA 1YXBA 1Q8IA 1GKFA 1H2GA 2JRIA 3ZRXA 1TUBB 5LMUO 2OYQA 4HNAA 4O2BA 1M56B 4PDVA 3H1KH 3K03A 3OW2U 4R6ZA 4QIWF 4YY3O 2LW7A 2QE7G 3SYQA 2WLIB 4GKKO 2QKAA 4O2AB 1MA1A 1IVSA 1WPXA 4FVMA 2MW2B 3VOUA 1BMFG 1S5HC 3H1JH 1W0JG 2XAGA 2Y69C 2P67A 4JI4B 3VQWA 4KFMA 4DR5O 4F4LA 1XDCA 2JK5C 1MZFA 1HNWO 3B09A 5CA3A 5TISZ 1GK9A 2JGDA 4AILC 1BE3H 1NVPB 5CB4B 3KG2A 3ZCCA 4RQEA 5BR8B 1YIJV 1G4YB 4NXMB 3QNEA 2DQ3A 1P84F 2B1IA 3CCQV 1J95A 3P32A 2KB1A 3CD6V 1HWYA 2PGGA 1BCCH 2DWEC 3N2GB 5JJEB 3JSNA 5CBGA 1S5LZ 4LNUB 4NTXA 2RDCA 1L0NH 4U3JA 4H33A 1B04A 3CX5F 3LDEA 1SC5B 1AB3A 1GAXA 1QQCA 2CUGA 4JI2O 4JI5O 4B3MO 1YI2V 3TK1A 1IDSA 1N0JA 5EZYB 3FKSG 2WA4A 3L71H 2P6JA 1I5XA 3JAKB 1H2LA 1EZJA 1Q6IA 2PTMA 2WLLA 3ZHSA 5EYPB 5EC1C 4YJ3A 5JVDA 4XDKA 1EN5A 1GM8A 1WP8A 2BCCH 2QWPB 2ZXWC 1KMIZ 3A0RA 1B6QA 1R1BA 5GONB 4FZ0A 4UVBA 2DYSB 5KHIA 4E2LA 2QR4A 4FFKA 3RYFB 4XDLA 3E8FA 5KHGA 1Q7YW 1FXVA 2RJZA 3L75H 1ZX3A 5F2VO 2CTQA 3QTCA 5LP6C 5KAFZ 4O4HA 4X1YB 3S3WA 1XMQO 2ZD9A 4X1KB 3AG1C 3RBZA 4BIOA 2OIGA 2PYJA 1KP2A 4MTGA 4UCTA 5KX5A 2PI4A 1FJGO 3T2MA 3ABUA 3UT5B 1AILA 1K8AW 2Y48A 2C2AA 1QNMA 1GN2A 2EIMB 2WLJA 1NU1H 1M57C 3STZC 3K57A 1YF2A 1Q90D 4IHJA 1DF5A 2F93B 5KHKA 1N32B 2Q5ZA 3JARA 3SYOA 1YEWA 4QNHB 5J2UA 3TXSA 1UFIA 3SJBC 3ZMVA 1Q6UA 1FFXB 2VQEO 4PI0A 3JCUZ 3LNNA 1BQZA 3WG7B 2E3CA 1QHTA 2X6CA 4JYAB 2Z3YA 4DR3O 3EVKA 5JH7B 1PNMA 1ENVA 2ILMA 2JDIG 2ZE8A 4IYHA 5LBQA 3ICXA 1COWG 4U7OA 1KU9A 3RYHA 4DV7O 4PA9A 1E79G 1VQ4V 2PY5A 4FM0A 1R3JC 2DJVA 2Q9LA 3DC6A 2R9RB 4X66O 4OPAA 4UB8Z 2NR5A 4GX1A 2N05A 4DR6O 5EK0A 4NTYA 1R6KA 2B1GA 4DK1A 1ZAUA 2M6YA 4TV9B 1N33O 4WBNB 3FB5C 4GX0A 3BVOA 1CPYA 4FMTA 4OGQB 1H2MA 4D7TA 4O4LA 1WB7A 2DQ0A 2P90A 1OJHA 3ZRSA 3E2EA 2ADPA 3T4ZA 3CS5A 3WB0A 4ZOLA 3W7SA 4X20B 2YSUB 4YXWG 2VWJA 1VP7A 4JI4O 4NR1A 3L73H 5LA6B 3HKCB 1GN3A 1RPOA 1Y67A 4DUYO 2EIKB 2L35A 3K9AA 1QU7A 3MDSA 5GTHZ 4TQDA 2R9AA 3E22B 2QA4V 3ABKB 5DECA 3JAKA 1MNGA 2UXDO 1WNSA 1N0NA 4DR1B 5ITZB 4PHZA 4QGPA 1H38A 4ICGA 2OCCC 2WWWA 2QWRB 2YXHA 4KHPB 4NXNB 1B3QA 3I55V 3C3TA 5LL6Y 1IBKO 2HG5C 3ZRVA 3AEIA 1GRJA 2LJ2A 4LFBB 3G67A 1XNRB 4PI2A 4EB6B 1XL4A 2A7WA 5KMGB 4FIPC 5IJ9B 2GHYA 3CRAA 2DMXA 5LYJA 5KHJA 5K1PA 3UQ8A 1US6A 3LUTB 3ZHUA 1N36O 4WFEA 3E86A 1KB9F 1E1QG 1XILA 3D3IA 2YI9A 2E74B 3UT5A 1R6NA 4B3TB 2HVKC 5CMUA 1N8RW 3AG4C 4FM2A 1R3KC 4R7CA 2EX3A 3E8GA 1FFXA 3ZS8C 5B1BC 2DYRB 3H1IH 5IYZB 2YXYA 1Z5WA 3A2FA 2IJIA 3F7YC 4LF6B 2EULA 4ASUG 1N34O 2UUAB 4LF5B 1NTZH 1Y74B 1PL4A 1AJPA 2GTAA 2Y4TA 1EBOA 1SQXH 3CP1A 1NTMH 1VQ9V 4J7KA 1K92A 4TV8B 4X1IB 1WA8A 3ZMSA 3K58A 1WN7A 1LNQA 1OHHG 3JD4A 3L9DA 3SPHA 3CXCU 1M1KW 4LF7O 1MG1A 4GX5A 3WB1A 5KUKA 1CXZB 4JGSA 2W6IG 2D2CB 2DN9A 2ETNA 3RVZA 2K1EA 3ASOC 4EFBA 3ABTA 1BHAA 5IYBO 3B40A 3HKEB 4FFBB 1K5QA 2EJ7A 1ORQC 4JI0O 4WBNA 2EINC 4LF9O 5LMNO 5LXTB 1AI7A 4LF4B 5L3BA 4PA4A 1WAZA 2XAQA 3MHHC 5LOVA 2IJJA 1EM1A 2YEVA 1D5NA 3K0DA 3QO8A 1LUWA 3JATB 4KP4A 3FAVA 4GT1A 1XOUA 2X0LA 4I7ZB 2ZKOA 3K9SA 4UB6Z 4X20A 1MMMA 5EIBC 1G1XB 4ABMA 3A0BZ 3BA8A 1BL8A 1Y76B 4PA7A 4HBNA 3UCSC 1MSWD 2WLNA 1TVKA 2ZNIA 4X64O 3BFRA 3H1LH 5ITZA 4JV5B 1XEQA 3FFQA 5HFMA 4J7ZA 4UCOA 2EJRA 4BIUA 4U7NA 2IBZH 3EXAA 3EFFK 1H2SB 3ETQA 4JAAA 4TUYB 5KMGA 5IJ9A 5KAIZ 1S76D 3SDLA 3CHXA 1R3IC 4JI8B 2ARHA 4RO2A 1FXKC 4MSWC 2W0XA 1NR7A 4DV2O 3E8HA 4LFAO 1I5YA 2WPDG 4J9YB 2UUBO 4IGGA 4WFGA 1HDJA 2UXBO 3JD2A 3PJSK 2ZIOA 2GUZA 5IJ0B 4YHHO 4PV1B 5LGTA 3JSLA 4LR3A 2KSDA 2IU0A 2DE0X 4WFFA 2XAHA 2HR3A 1M56C 1F23A 4KHPO 1FKAO 3THOA 4JI7B 3G6BA 4MTFA 4K3AA 5K1XA 4QPKA 1FD9A 4LFBO 1JX9A 3K5MA 2IJHA 4DV1O 4DV4O 1MOFA 1NH2B 5B3SB 2UXNA 3K3WA 4K0KO 1Q43A 4DUZO 4I55A 3HKBA 3CXHF 3T1HB 4FLWA 2F66C 3CCJV 3OE7G 2VWKA 4PDLA 1Y74A 3W7TA 2FB5A 3I5DA 5BY1A 2IJKA 4RUEA 4KL1A 4TV8A 2WAMA 4QJFB 1XNQB 2CH7B 4R8CA 4JTCB 1KKDA 2EZOA 4DR2B 3HPLC 2RN9A 3RGBA 4B3TO 5J2TB 2X6BA 3B77A 3BABA 2Y4UA 1DK1A 2BSKB 1JJ2U 4JF3A 1RSOB 3FYIB 1OV9A 5JQGB 1W0KG 3EHBB 1GH6A 2CGOA 4KXRA 2VS0A 1KKCA 2LFSA 2ZR2A 2ZNJA 2XT9A 1AP6A 2IH3C 1K4CC 1E1RG 1M93A 3JAWB 5LXTA 1LUVA 1NT2B 4UFZA 3AK1A 1HR0B 2WSSG 1K3EA 3JAMN 4LF6O 1K4DC 5EBLC 3JALA 1L0LH 4UCRA 3GWKC 4DV6B 4ZHQB 2UUAO 3F5TA 1Z2GA 1TAEA 4D6TH 3DSQA 1HP8A 4AQYB 3MD0A 1PP9H 1RP3B 2ZINA 1JJOA 3T1CA 5B1AB 2H94A 3NXSA 4W4LA 1URFA 4OPHA 5KLVH 1KBHA 2VQFB 3P30A 1Q3EA 4JI1O 3SPCA 3CPWU 3RW0A 1NS1A 4DR7O 4B3RB 3TXQA 2P5OA 4TOIA 2DYSC 2N74A 4GX2A 2A06H 4CS2A 4DV3O 4CH6A 2UUCO 3OD4A 2JGUA 2EBOA 5IWAB 2B5UA 5L3GA 4X65O 1DTOA 4IL6Z 1GN6A 1OCCB 3OT7A 2Q8VA 2MK3A 5H6QA 2XAFA 2BOCC 4GUNA 2Q7GA 1VQKV 3CCVV 1KUQA 3ABMB 5A9GA 3B8NA 1AP5A 3AG7A 1MABG 5FNVA 3ZJZA 3CMEV 1FXKA 2Q0OC 1JVMA 1K97A 5J9PC 4RUFA 5CA1B 5L3FA 1VQOV 2EIMC 3ZMUA 2FL4A 2YIDA 1ZL8A 1FXHA 4DW1A 4GZRB 3E89A 2WLHA 4N21A 3L74H 3K0GA 1AI4A 1ZUQA 1ZTEA 2E75B 2BE3A 1KD1W 2WLKA 2A0LA 2JJ2G 4H44B 1NBMG 3LDCA 1VARA 3WG7C 2DOSA 1YJ9V 5LHIA 3K59A 1JMKC 1Q86W 5GW7A 3KKYA 5LGNA 5C8YB 1TUBA 5L3EA 3OEHG 3HKDB 1VF6C 1S3JA 4JAUA 2ZDIC 1H8HG 2ZE7A 2WLIA 2RNBA 4DV5B 1QLEB 4O2AA 3OMAB 3SPJA 3SYAA 4DR4B 1GTOA 3G71V 1SQBH 1PM9A 4L8JA 4YIPA 3UO3A 4NB5A 1JA8A 2BTQB 5FPOA 3F7VC 4FZ1A 3I56V 2E5LB 1PPJH 2QTOA 5FL7G 1BS3A 1F51A 3HR0A 5JWPA 4MVSA 4LBEC 3R66A 1ZLZA 4FLTA 3A8TA 4E4EA 5CB4A 3IC7A 4X62O 3AG3B 2BSKA 4TQFA 4I0XB 2ZIMA 3B8MA 1VEWA 4X9QA 3B2EE 3AK3A 5JQGA 4IYIA 3H1HH 3OUSA 4P9PA 3UO2A 1IBMB 1K34A 3O9OA 3K5OA 1DGSA 1XL6A 4IIJB 3CJHB 3SYCA 1VIBA 2M7WA 2E76B 1GM7A 2QWQB 4ZKIA 1P49A 3QVNA 3N2GA 4H13B 3OEEG 4LNUA 5CBHA 1IX9A 1IXMA 1S5JA 1JQ0A 2Z5UA 1CEZA 5D5PA 2EIKC 2ZT9B 2H8PC 4MT8A 1MSDA 3ABKC 1G6UA 3TJTA 3LSUA 3LSSA 3N2KB 1XNQO 4EFEA 1NZ6A 5EZYA 2PF4E 2UXCB 5BMVB 2PUSA 3AG2B 1F4NA 1OCOB 4LWSB 5EYPA 4Q20A 2HKOA 3FD9A 5E1AC 5BR8O 4NXMO 5B1NA 1FYJA 1M4UA 2ZM6B 2EZPA 5GONA 2GSMB 4WFAV 3H9VA 1Z5VA
chains in the Genus database with same CATH topology
2XAQA 3MHHC 2IJJA 4KFMA 2YEVA 3K0DA 3QO8A 1GM9A 3UM7A 4N23A 4F4LA 4GCZA 1PNKA 3AG1B 3OMIB 2OTLV 4KP4A 4GT1A 1PL0A 2JK5C 1QLEC 2X0LA 3OM3B 3T4DA 2AHYA 1K9MW 4G27B 5CA3A 1QVFU 1GK9A 3DGEA 2A79B 1YHQV 3G4SV 1SESA 2QEXV 1BL8A 3F5WC 2WLMA 1NVPB 4JTAB 4PA7A 1F4MA 3KG2A 3ZCCA 1M57B 4RQEA 3QO5A 3TCUA 1MSWD 2WLNA 5LHHA 1YIJV 1G4YB 3R65A 3QNEA 5EC2C 2OT5A 2DQ3A 4JTDB 5C93A 2B1IA 1VQNV 3CCQV 1P4RA 4MVOA 5HFMA 1J95A 1CP9A 1OCRB 1SZTA 3BEHA 3P32A 1NR1A 2KB1A 2EJRA 3CD6V 3K06A 2PI5A 4MVUA 4BIUA 3E35A 4U7NA 3ZMZA 4EKWA 1HWYA 1R3LC 2IW5A 2DWEC 3AG3C 2ITDC 3CCMV 2DYRC 1PNLA 4MVRA 3ASNB 4X88A 1FFTB 5CBGA 3EFFK 2Q69A 4XBFA 3E83A 4QE9A 4H33A 4MVQA 3LDEA 2W6JG 1JCHA 1S76D 3FB6C 4RAIA 1R3IC 3E8BA 2V1DA 2CK3G 4RO2A 1FXKC 4MSWC 1NJIW 3TETA 1NR7A 3STLC 1YI2V 3TK1A 2NLJC 2ZR3A 3E8HA 1I5YA 2WPDG 4J9YB 2ZDIA 1S0VA 3FKSG 3K04A 1K5SA 1NKDA 2JEUA 4WFGA 4ZBMA 2P6JA 1I5XA 1EZJA 3JD2A 1R73A 3PJSK 2WLLA 5EC1C 4OXSA 1PD3A 5LGTA 3OMNB 4XDKA 4BAYA 3CMAV 1GM8A 1TUEB 1G8MA 4JPRA 1VQ8V 4HYOA 2ZXWC 2IU0A 1RPRA 3A0RA 1FS0G 4WFFA 1YJWV 2DW4A 3JYCA 3OAAG 1B6QA 1SETA 2XAHA 2HR3A 3W7UA 1M56C 3CCUV 2YEVB 3AG2C 1F23A 4J9ZB 2DYSB 4HZ3A 4UVBA 4X8AA 1OCOC 4E2LA 2IU3A 3DTUB 4XDLA 3E8FA 3LNMB 4FK5C 1OCZB 4BW5A 1QVGU 1BHBA 1NQTA 3SYPA 1Q7YW 1KP3A 4MTFA 1FXVA 4TWKA 2DWDC 5IY5B 1QR8A 4QPKA 1JX9A 2IJHA 5L3CA 4QE7A 1MOFA 3CCSV 1NH2B 5B3SB 2UXNA 3K3WA 2X7RB 3BY6A 1V55B 3LDDA 4MTXA 2ZD9A 3X2QB 3CYOA 1K33A 3FB8C 3JD3A 4KUMA 3CCJV 3AG1C 4TSFG 3OE7G 5LHGA 4MVMA 3ZN1A 1Q81W 3RBZA 3CC7V 4PDLA 4XDJA 1KP2A 4MTGA 1VQ7V 4CBCA 3W7TA 3CCRV 2PI4A 3T2MA 3ABUA 3ZRWB 2FTKA 2IJKA 4RUEA 1K8AW 2Y48A 2WAMA 2C2AA 3ML0A 5HFLA 2WLJA 2EIMB 4R8CA 4QJFB 4FJCC 4JYCA 4Z1MG 1M57C 4JTCB 3SPGA 3STZC 5KA5A 1WLEA 1KKDA 2EZOA 1DF5A 3OR7C 3H01A 3HPLC 2OCCB 3SYOA 4QNHB 1NH2D 1K73W 2X6BA 1L1FA 3ZMVA 1V54B 3B77A 4X89A 1SERA 2W0FC 2Q68A 3WG7B 1JJ2U 4JF3A 3FYIB 3GB7C 1OCRC 2X6CA 1W0KG 2Z3YA 3EHBB 1GMGA 2JIZG 1W2BU 1PNMA 1ENVA 2JDIG 2JEXA 5LBQA 1VQLV 2LFSA 2ZR2A 1COWG 1AROP 4UXNA 1K7DA 2ITCC 1Q82W 1KQSU 2IH3C 1K4CC 3ASNC 2Q6AA 1E1RG 4U7OA 4G2KA 4H37A 4PA9A 1E79G 1AI5A 3ETGA 2WSSG 4PELA 1K3EA 4UVAA 1VQ4V 2QM8A 2XNDG 5CBFA 1K4DC 1NVPD 5EBLC 3CCEV 1R3JC 3K08A 1DF4A 2EIJB 2LP7A 1S77D 2R9RB 4PDMA 5KUMA 3ETDA 4R50A 3MD0A 1VQMV 2Q67A 4CZZA 1JPXA 2QM7A 2XAJA 4GX1A 3T1CA 3W7XA 5B1AB 1S72V 5LGUA 3IFXA 4P30A 5EK0A 2H94A 4JAVA 1UJWB 3NXSA 3AG4B 1Y4MA 1R6KA 2B1GA 4UV8A 3RVYA 3P30A 4MTOA 5IYDO 2X6AA 3FB5C 4UUJC 2EILB 5B1BB 3SPCA 4GX0A 1CPYA 3CPWU 3RW0A 5BZBA 1RM1B 3ZIAG 4FMTA 4MVZA 5CN0A 4TT3G 2DYSC 1AJNA 4GX2A 1THZA 4P2ZA 4JYBA 2DQ0A 2P90A 1OCZC 1ZWIC 3ZRSA 4RQFA 3E2EA 2EBOA 3GWOA 3IGAC 3T4ZA 5IY5C 1AJQA 2BOBC 4I9WA 3VBBA 3CC2V 2B5UA 5L3GA 1DTOA 3CC4V 3ABLB 1GO3F 3FYEB 5DM6V 3W7SA 1OCCB 4DXWA 2YSUB 2MK3A 5H6QA 4YXWG 2XAFA 3SPIA 5B3SC 2BOCC 1M9NA 1V55C 4MW8A 2F43G 3X2QC 4WFBV 3D36A 1VQKV 3UKMA 3W7WA 3CCVV 3ABMB 1RPOA 1H8EG 3HB3B 4WFHA 1EFRG 2XASA 3M99B 2EIKB 3B8NA 3OGCC 3K9AA 3CMEV 1MABG 2QA4V 5EBMC 3ZJZA 1FXKA 3ABKB 4UV9A 1JVMA 1K97A 5J9PC 4RUFA 5L3FA 1VQOV 2EIMC 3ZMUA 4L87A 2A9HA 1YSCA 4MS2A 1FXHA 3ZMTA 3E89A 2WLHA 4N21A 1VQPV 1QR9A 2D3OW 3ASOB 1H38A 3K0GA 1AI4A 2OCCC 2WWWA 4LC1A 1YTFB 1QCEA 1V54C 3I55V 1KD1W 2WLKA 2HJFC 2A0LA 2JJ2G 3JD0A 1VQ6V 1NBMG 2HG5C 5H6RA 3LDCA 3OUFA 3WG7C 1YJ9V 5LHIA 2EINB 2HLDG 3ZRVA 1Q86W 3AEIA 1P7BA 5GW7A 5KA6A 4MW3A 5LGNA 1JOYA 2Y69B 3OEHG 5L3EA 1XL4A 1KC8W 1VQ5V 4I5SA 2ATKC 4FIPC 2GHYA 1S3JA 3WFVA 4WF9V 4JAUA 2ZDIC 2R9IA 1H8HG 1ROPA 2WLIA 1DLBA 2OTJV 3CCLV 2NNUA 1QLEB 2AHZA 5B1OA 3LUTB 3OMAB 3SPJA 3SYAA 4DO2A 3K79A 1GTOA 3G71V 1YITV 2JJ1G 1YTFD 5IDJA 1YJNV 4WFEA 1AI6A 2EIJC 3E86A 2WLLB 2UXXA 4P9OA 4PDRA 1E1QG 2P7TC 3F7VC 1AR1B 3D3IA 3I56V 2QTOA 5FL7G 1R6NA 3JCZA 3ZRWA 1F51A 2V7QG 4FPPA 3G6EV 5B1AC 2HVKC 4PA6A 4MVSA 5CMUA 1N8RW 4LBEC 5L3DA 3AG4C 4G28B 5EBWC 3FB7C 1R3KC 2IH1C 4R7CA 3MHSC 3QO7A 2XOKG 3E8GA 2EILC 3IC7A 3AG3B 5B1BC 5IYCO 1PKXA 2DYRB 1KECA 1RM1C 1QBZA 2HFEC 3B8MA 4BIZA 2IJIA 3F7YC 2LFRA 3OUSA 2QKSA 4P9PA 4LCUC 1K34A 4WCEV 1OZ0A 4ASUG 1XL6A 4HAMA 1FXKB 3SYCA 3ABLC 2HVJC 1OCCC 2M7WA 1AJPA 1Y66A 1GM7A 4UVCA 4ZKIA 1EBOA 3OEEG 1SRYA 3JD1A 3CP1A 1VQ9V 1K92A 5CBHA 1IXMA 3OR6C 3ABMC 1JQ0A 2Z5UA 3ZMSA 1CEZA 1M90W 2EIKC 1LNQA 1OHHG 3JD4A 2H8PC 4MT8A 3SPHA 4LP8A 3CXCU 3ZN0A 1M1KW 3ETEA 1QLNA 3ABKC 2ZXWB 1MG1A 3OFNG 4GX5A 4JASA 4PA3A 5KUKA 3LSSA 4QPJA 4JGSA 2W6IG 1GKFA 1H2GA 3ZRXA 3RVZA 1M56B 2K1EA 4PDVA 3SJQC 3K03A 3OW2U 3ASOC 4R6ZA 3ABTA 4PA4A 4QIWF 5IYBO 3AG2B 1BHAA 1F4NA 1K5QA 1OCOB 1ORQC 2QE7G 2WLIB 4Q20A 3SYQA 5DN6G 2HKOA 5E1AC 1WPXA 5B1NA 2EINC 3VOUA 1BMFG 1S5HC 3LSQA 1AI7A 1W0JG 2XAGA 2EZPA 2Y69C 2GSMB 2ZQMA 5L3BA 2P67A 4WFAV 5H9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E86 A;  2WLL B;  4KFM A;  2YEV A;  3K0D A;  4P9O A;  4PDR A;  3E8F A;  4XDL A;  3RVY A;  3LNM B;  2P7T C;  3F7V C;  4MTO A;  3UM7 A;  4BW5 A;  4F4L A;  3SYP A;  2X6A A;  2JK5 C;  1QLE C;  2QTO A;  3FB5 C;  4MTF A;  2DWD C;  2AHY A;  4TWK A;  4UUJ C;  3T4D A;  4G27 B;  3SPC A;  4GX0 A;  2A79 B;  4QE7 A;  3RW0 A;  5B1A C;  5BZB A;  4MVZ A;  2HVK C;  4PA6 A;  4MVS A;  4LBE C;  2DYS C;  3AG4 C;  4GX2 A;  4G28 B;  3LDD A;  1BL8 A;  3F5W C;  5EBW C;  2WLM A;  4P2Z A;  3FB7 C;  2ZD9 A;  1R3K C;  4JTA B;  2IH1 C;  4R7C A;  4PA7 A;  3FB8 C;  1OCZ C;  1ZWI C;  3KG2 A;  3AG1 C;  4MVM A;  3ZRS A;  3RBZ A;  3E8G A;  3T4Z A;  3IGA C;  3TCU A;  5IY5 C;  4PDL A;  2EIL C;  4XDJ A;  2WLN A;  4MTG A;  2BOB C;  4I9W A;  4CBC A;  5B1B C;  3T2M A;  1G4Y B;  3R65 A;  5EC2 C;  4DXW A;  2HFE C;  5B3S C;  4JTD B;  3SPI A;  2BOC C;  4RUE A;  1V55 C;  3F7Y C;  4MW8 A;  3OUS A;  3X2Q C;  2QKS A;  2WLJ A;  1J95 A;  3BEH A;  4MVO A;  4P9P A;  4R8C A;  4LCU C;  3UKM A;  2KB1 A;  1M57 C;  4JTC B;  3SPG A;  3STZ C;  1KKD A;  3K06 A;  4MVU A;  4EKW A;  1R3L C;  3OR7 C;  4WFH A;  1XL6 A;  3HPL C;  2DWE C;  3AG3 C;  3SYO A;  4QNH B;  2ITD C;  3OGC C;  2DYR C;  3SYC A;  4HZ3 A;  3ABL C;  2X6B A;  2HVJ C;  1OCC C;  4MVR A;  5EBM C;  3ZJZ A;  4X88 A;  4X89 A;  5CBG A;  1JVM A;  3EFF K;  5J9P C;  2W0F C;  2Q68 A;  2Q69 A;  4RUF A;  3E83 A;  4QE9 A;  3GB7 C;  2EIM C;  4H33 A;  1OCR C;  2X6C A;  4MVQ A;  2A9H A;  4MS2 A;  5CBH A;  3LDE A;  3E89 A;  2WLH A;  3OR6 C;  3ABM C;  3FB6 C;  4RAI A;  1R3I C;  3E8B A;  2OCC C;  3K0G A;  2EIK C;  1LNQ A;  4RO2 A;  4MSW C;  2ITC C;  2H8P C;  3SPH A;  1V54 C;  2IH3 C;  4LP8 A;  3TET A;  1K4C C;  3ASN C;  2WLK A;  2HJF C;  2A0L A;  2Q6A A;  3ABK C;  3STL C;  2HG5 C;  2NLJ C;  3LDC A;  3E8H A;  4GX5 A;  4J9Y B;  4PA3 A;  3OUF A;  5KUK A;  3WG7 C;  4H37 A;  3K04 A;  4PA9 A;  1P7B A;  4WFG A;  4ZBM A;  3RVZ A;  4MW3 A;  2K1E A;  4PDV A;  3SJQ C;  5CBF A;  1K4D C;  3PJS K;  3K03 A;  5EBL C;  2WLL A;  3ASO C;  4R6Z A;  1R3J C;  3K08 A;  1XL4 A;  5EC1 C;  4OXS A;  2ATK C;  4XDK A;  1ORQ C;  3SYQ A;  2R9R B;  2WLI B;  4PDM A;  5KUM A;  4HYO A;  4R50 A;  2WLI A;  2ZXW C;  5E1A C;  2AHZ A;  4WFF A;  2Q67 A;  2EIN C;  3JYC A;  3LUT B;  3SPJ A;  3SYA A;  3VOU A;  1S5H C;  4GX1 A;  1M56 C;  3T1C A;  3IFX A;  4P30 A;  5EK0 A;  2Y69 C;  4WFE A;  3AG2 C;  4J9Z B;  4PA4 A;  4X8A A;  2EIJ C;  1OCO C; 
#chains in the Genus database with same CATH topology
 3PN1 A;  1SKV A;  4JI6 B;  3T1Y B;  1GM9 A;  4NKG B;  3D3Q A;  4GCZ A;  1IXB A;  2GBO A;  2ZE5 A;  3OMI B;  3RYF A;  3BA9 A;  1HNZ B;  2OTL V;  4B3S B;  1HR0 O;  1K9M W;  2QWO B;  4G27 B;  2A79 B;  3BHP A;  4CS4 A;  1V9P A;  4DV6 O;  2QEX V;  4YJ2 B;  2CGN A;  3F5W C;  4EEQ A;  4YY3 B;  4A5U B;  4OX9 B;  4JTA B;  2QDO A;  2QJ1 A;  1F4M A;  4X1Y A;  4X1K A;  1NTK H;  3QO5 A;  4F6R B;  5JJN B;  5LHH A;  3RYC B;  3R65 A;  5EC2 C;  4Q6G A;  2OT5 A;  3CRC A;  3ZHQ A;  1YDX A;  4JTD B;  4DYL A;  5C93 A;  1P4R A;  1HW7 A;  2VQF O;  1SZX A;  4MVO A;  3BEH A;  1CP9 A;  1OCR B;  4CH5 A;  1NR1 A;  3K06 A;  4MVU A;  3E35 A;  3ZMZ A;  4DR5 B;  1R3L C;  2IW5 A;  4U3F H;  3CCM V;  2DYR C;  1HNW B;  4H0L B;  4MVR A;  3ASN B;  3D36 C;  4IT5 A;  5EIB D;  4B7E A;  3IAY A;  2LGW A;  2PZS A;  4MVQ A;  3GVM A;  3P3P A;  2W6J G;  3E8B A;  5JH7 A;  1AVM A;  1NJI W;  3BPZ A;  4LFC B;  3STL C;  2NLJ C;  1VF6 A;  2ZR3 A;  5AG2 A;  2ZDI A;  3K04 A;  1K5S A;  4DRX B;  1NKD A;  5JJJ B;  4JYY A;  1R73 A;  2FML A;  2BTQ A;  4ZIB A;  4OXS A;  3OMN B;  4BAY A;  3SJA C;  3CMA V;  2AXT Z;  1XI1 A;  3VQV A;  1FS0 G;  1YJW V;  2JS5 A;  1VF7 A;  3CCU V;  2H3O A;  4HZ3 A;  1F7Y A;  2IU3 A;  3LNM B;  1OCZ B;  4JI2 B;  4BW5 A;  1QVG U;  1N32 O;  1BHB A;  4TV9 A;  4B3M B;  5IY5 B;  4TWK A;  2JGD B;  1TA8 A;  3CRM A;  1I08 A;  2Q7E A;  4ZI7 B;  3SGI A;  4QE7 A;  3CCS V;  3CEI A;  3BY6 A;  1V55 B;  3WU2 Z;  4FLY A;  4JYA O;  3X2Q B;  3CYO A;  4DK0 A;  3FB8 C;  3VQX A;  1SS3 A;  4TSF G;  5LHG A;  4DV5 O;  1Q81 W;  3CJH A;  3CC7 V;  3L72 H;  2RCV A;  3ZRW B;  2AW9 A;  2B9Z A;  2FTK A;  2A3Q A;  1FAF A;  3QG5 A;  3ML0 A;  5HFL A;  4Z1M G;  5KA5 A;  2XTA A;  3ZHR A;  3OR7 C;  5LA6 A;  4NTW A;  3HKC A;  1NH2 D;  1SA0 B;  1L1F A;  2QKC A;  2QWN B;  1V54 B;  1YCI A;  5GTI Z;  4U3J B;  4K35 A;  2Q68 A;  3E22 A;  2F1M A;  3GB7 C;  3RWR D;  1XMQ B;  2JIZ G;  3J81 N;  1W2B U;  2JEX A;  3CRR A;  5DED A;  1BGY H;  1ARO P;  3APO A;  1K7D A;  4UCS A;  3TGU H;  2ITC C;  2LQT A;  1FJG B;  4CC5 A;  4G2K A;  1J5E B;  3C90 A;  1IBM O;  4UVA A;  4J42 A;  1NVP D;  5JVD B;  3CCE V;  3DXR B;  2ODM A;  3K08 A;  2F4V B;  2EIJ B;  3CRQ A;  1L8D A;  1S77 D;  4I4T B;  4EB6 A;  3ETD A;  4J41 A;  2CTW A;  2VQE B;  1LR1 A;  4CZZ A;  1IBL B;  3SJC C;  1S72 V;  5LGU A;  3IFX A;  4K8Z A;  1UJW B;  2YIA A;  4K8X A;  4F6R A;  3J7A U;  4J80 A;  1WP7 A;  2X6A A;  2EIL B;  1RM1 B;  5BZB A;  4MVZ A;  1FPO A;  1AJN A;  1R6T A;  1THZ A;  2YUA A;  4DR1 O;  4P2Z A;  1EN6 A;  4JYB A;  2CDY A;  3KZI Z;  5KX5 B;  4RQF A;  2XHB A;  2UU9 B;  3IGA C;  4X66 B;  1AJQ A;  2Y0I A;  2BOB C;  4NXN O;  4I9W A;  3CC2 V;  3ABL B;  3FYE B;  5DM6 V;  4DXW A;  5B3S C;  3SPI A;  5IYZ A;  4UCU A;  3J80 N;  1WB8 A;  4WFB V;  2ADQ B;  3D36 A;  4JI6 O;  2R72 A;  1XNR O;  3UKM A;  3S3X A;  3JAR B;  4B3S O;  2Z0A A;  3C3S A;  1NI8 A;  1SQP H;  3HB3 B;  4WFH A;  1N4C A;  1N33 B;  3OGC C;  3JAS B;  3AK2 A;  1SQG A;  3BRC A;  4DRX A;  4F6E A;  4UV9 A;  2Q0A A;  4OX9 O;  4L87 A;  1I0H A;  2A9H A;  5JCO C;  3ZMT A;  4X1I A;  1Q6H A;  1YTF B;  4FLX A;  1QCE A;  3RYH B;  1AR4 A;  3JD0 A;  2P4V A;  2CTR A;  5H6R A;  4W4K A;  2HLD G;  1P7B A;  5KA6 A;  3D8C A;  3M8A A;  4MW3 A;  4BWA A;  1JOY A;  2VRZ A;  2Y69 B;  1KC8 W;  3ZHT A;  2P06 A;  4DUY B;  4WF9 V;  3HKE A;  1BZK A;  4FFB A;  3ZED A;  2R9I A;  1DLB A;  2OTJ V;  2AZ2 A;  3CCL V;  4ZI7 A;  2NNU A;  2NN4 A;  2PYL A;  3K79 A;  1BQ0 A;  3Q4H B;  2UXD B;  1YIT V;  2JJ1 G;  2F23 A;  4P9O A;  4LFC O;  4GLX A;  2Q73 A;  4FLZ A;  2P7T C;  1AR1 B;  1M5I A;  1XQ8 A;  2HHH B;  2LGQ A;  3JAT A;  4UCV A;  1IBK B;  3ZRW A;  4LF5 O;  2V7Q G;  5B1A C;  4O4L B;  1SQQ H;  2HEP A;  3M7M X;  4FLU A;  5L3D A;  3CSX A;  2ZE6 A;  2QTS A;  3FB7 C;  3QO7 A;  1SA0 A;  1Y76 A;  2YIC A;  4ZOL B;  4PD4 F;  4B7K A;  1PKX A;  1Q5O A;  1KEC A;  2FKX A;  1JFF B;  1QBZ A;  2GTS A;  1AR5 A;  4BIZ A;  1N36 B;  3KCX A;  2QKS A;  2KQX A;  4LCU C;  2OCH A;  3IC9 A;  3NR7 A;  4WCE V;  1OZ0 A;  4O4J B;  4HAM A;  4I50 B;  4BR6 A;  4DW0 A;  2HVJ C;  1OCC C;  3BAA A;  1Y66 A;  5IT9 N;  4YIO A;  1SRY A;  3JD1 A;  5B5E Z;  3IJ4 A;  3DXR A;  4LF4 O;  3ABM C;  4I4T A;  4TUY A;  1XUQ A;  1M90 W;  1SQV H;  4LP8 A;  2ZXW B;  1W59 A;  3OFN G;  4JAS A;  1EZV H;  3SJQ C;  1IUR A;  2AGA A;  5LYJ B;  2JS3 A;  5DN6 G;  5IJ0 A;  1N34 B;  3FX7 A;  2KKW A;  3ZHV A;  3OGI B;  3LSQ A;  2QSA A;  3U11 A;  5LP6 B;  2P4K A;  3L70 H;  4JV5 O;  2ZQM A;  5H9C A;  1A32 A;  4J11 A;  3UM7 A;  4N23 A;  1PNK A;  1J5E O;  3AG1 B;  4LF7 B;  4C7U A;  1PL0 A;  1VF5 B;  1QLE C;  3OM3 B;  3T4D A;  2AHY A;  3RN4 A;  1QVF U;  3DGE A;  4LH6 A;  4CS3 A;  1YHQ V;  1B06 A;  4B08 A;  4PJ0 Z;  1ZSP A;  3G4S V;  2F4V O;  1SES A;  1U96 A;  5CA0 B;  2WLM A;  1M57 B;  4JI0 B;  2QM4 A;  2RQ6 A;  4JI8 O;  1I94 B;  1HNX B;  3JAS A;  3TCU A;  1IBL O;  2QGN A;  4LF9 B;  5LMN B;  1VQN V;  1D5A A;  1SZT A;  1UPG A;  2PI5 A;  1I7F A;  2CH7 A;  4EKW A;  5JCO A;  2LW1 A;  3AG3 C;  2ITD C;  4GYC B;  1PNL A;  4X88 A;  5J2T A;  1FFT B;  2YIB A;  2Q69 A;  4DV0 B;  4XBF A;  3E83 A;  4QE9 A;  4CC6 A;  3RFR A;  1WA8 B;  5H5N A;  1RSO A;  2UU9 O;  1JCH A;  3A0H Z;  3FB6 C;  4RAI A;  4O4I B;  2V1D A;  2CK3 G;  3VQY A;  3CB2 A;  3TET A;  1H2K A;  4JI7 O;  1XMO B;  1JR9 A;  1GN4 A;  4X64 B;  2IM9 A;  3Q4H A;  1S0V A;  3JAW A;  2JEU A;  3OTO B;  4ZBM A;  5B66 Z;  4JI3 B;  2AZ0 A;  1PD3 A;  4JZG A;  3T1H O;  1EN4 A;  1TUE B;  1WJZ A;  4GKJ B;  1G8M A;  4JPR A;  4ZHQ A;  1VQ8 V;  4HYO A;  5FPR A;  1RPR A;  2KG7 B;  2DW4 A;  3JYC A;  3OAA G;  1SET A;  3W7U A;  3CE2 A;  5LOV B;  1BSM A;  2YEV B;  3AG2 C;  4J9Z B;  4X8A A;  1OCO C;  3DTU B;  1O9H A;  2G38 A;  3FAV B;  4DR2 O;  4FK5 C;  3O65 A;  1NQT A;  3SYP A;  1KP3 A;  4DV2 B;  2DWD C;  1JFF A;  1QR8 A;  2YI8 A;  4LFA B;  2ZCE A;  2UUB B;  5L3C A;  2UXB B;  2X7R B;  2L6L A;  3LDD A;  4CH4 A;  4YHH B;  4MTX A;  4J10 A;  1K33 A;  3JD3 A;  1SF9 A;  4KUM A;  4LF8 B;  4O4J A;  2F95 B;  4MVM A;  1TVK B;  4I50 A;  3ZN1 A;  3P3N A;  4XDJ A;  1VQ7 V;  1SQF A;  4CBC A;  3CCR V;  1MZE A;  1P7G A;  3G80 A;  2WA3 A;  2HP8 A;  4FJC C;  4JYC A;  5LMU B;  3SPG A;  2HHH O;  1WLE A;  1XHZ A;  3H01 A;  2OCC B;  1K73 W;  4LH7 A;  3DC5 A;  4GKK B;  4AQY O;  3CWB H;  4X89 A;  4DV1 B;  4DV4 B;  1SER A;  2W0F C;  3RYI B;  1OCR C;  4K0K B;  5CA1 A;  1GMG A;  1VMG A;  4DUZ B;  2OIE A;  2YDE A;  1TGO A;  1VQL V;  4UXN A;  4FM1 A;  1Q82 W;  1KQS U;  3ASN C;  2Q6A A;  2YXL A;  1RFY A;  4H37 A;  3ZX6 A;  1AI5 A;  4PEL A;  3ETG A;  5LP6 A;  3U0Z A;  4B3R O;  2GUZ B;  2QM8 A;  2XND G;  5CBF A;  2P22 C;  2CTP A;  1DF4 A;  1KYO F;  2LP7 A;  5C8Y A;  4PDM A;  5KUM A;  1U97 A;  4I9Q A;  3HKD A;  5IWA O;  4R50 A;  3ZBH A;  1BT8 A;  1XBL A;  1VQM V;  2Q67 A;  1JPX A;  2QM7 A;  2XAJ A;  3OTF A;  5CA0 A;  3W7X A;  4P30 A;  4JAV A;  3MAQ A;  4HNA B;  4O2B B;  3AG4 B;  4BW9 A;  4Z2W A;  1Y4M A;  3K5N A;  4UV8 A;  3RVY A;  1H2N A;  1XHX A;  4MTO A;  5IYD O;  2CAZ C;  1D2D A;  4UUJ C;  5B1B B;  2YC0 A;  3SR2 C;  3ZIA G;  5CN0 A;  4TT3 G;  4I55 B;  3HKB B;  4Z1V A;  5BXZ A;  1OCZ C;  1YVW A;  1ZWI C;  2BTO A;  4FLV A;  3GWO A;  5IY5 C;  4RWU A;  3VBB A;  3CC4 V;  2OWO A;  1GO3 F;  4JI5 B;  3RT3 C;  4I0X A;  1M9N A;  1V55 C;  4MW8 A;  2F43 G;  2LO1 A;  3QF7 A;  3X2Q C;  1X59 A;  3W7W A;  4O4I A;  2YS8 A;  1H8E G;  4D7S A;  1EFR G;  2XAS A;  3M99 B;  1Y6X A;  4JI1 B;  5EBM C;  4IIJ A;  2GV9 A;  4DR7 B;  4AHC A;  4DR4 O;  2N04 A;  3KCY A;  3WB2 A;  1YSC A;  4MS2 A;  1I94 O;  1HNX O;  1VQP V;  1QR9 A;  2D3O W;  3ASO B;  4DV3 B;  2UUC B;  2HJD A;  4LC1 A;  1V54 C;  2E5L O;  2K9P A;  3B4S A;  4NYK A;  2KG7 A;  2HJF C;  2Y0P A;  4X65 B;  1VQ6 V;  1O9G A;  5E79 Z;  3OUF A;  2O57 A;  2EIN B;  4AI8 A;  3JAL B;  3N2K A;  2RMK B;  2XUM A;  5FLX N;  5BMV A;  1VQ5 V;  4J7J A;  1X4T A;  4I5S A;  2ATK C;  2JVD A;  3WFV A;  4LWS A;  1ROP A;  1T5E A;  4DV0 O;  2AHZ A;  5B1O A;  4DO2 A;  1YTF D;  5IDJ A;  2V4D A;  5IE9 A;  1YJN V;  1AI6 A;  2EIJ C;  2WLL B;  2UXX A;  4PDR A;  1XMO O;  4YJ3 B;  5KHH A;  2YIB D;  2R70 A;  3JCZ A;  3OTO O;  3U10 A;  4FPP A;  3G6E V;  4JI3 O;  4PA6 A;  4CH3 A;  4JZ2 A;  3APQ A;  4G28 B;  2CE4 A;  5EBW C;  4GKJ O;  2IH1 C;  4YJ2 A;  3MHS C;  4DR3 B;  2XOK G;  2EIL C;  1PV0 A;  5H2F Z;  2Q7H A;  2GDS A;  5IYC O;  3RYI A;  1RM1 C;  2HFE C;  3RYC A;  2LFR A;  2UXC O;  5D5Q A;  4DV7 B;  3K5L A;  4O4H B;  3N27 A;  5A2Q N;  5FNV B;  1FXK B;  3ABL C;  4UVC A;  1ZL8 B;  2ZM6 O;  4LF8 O;  1WPB A;  2FYU H;  4NVP A;  3OR6 C;  4DR6 B;  2Q4P A;  3BCC H;  1IZ3 A;  4IHJ B;  1XRE A;  3T1Y O;  1YZB A;  4X62 B;  3ZN0 A;  1HNZ O;  3ETE A;  1QLN A;  5J2U B;  4PA3 A;  4QPJ A;  1YXB A;  1Q8I A;  1GKF A;  1H2G A;  2JRI A;  3ZRX A;  1TUB B;  5LMU O;  2OYQ A;  4HNA A;  4O2B A;  1M56 B;  4PDV A;  3H1K H;  3K03 A;  3OW2 U;  4R6Z A;  4QIW F;  4YY3 O;  2LW7 A;  2QE7 G;  3SYQ A;  2WLI B;  4GKK O;  2QKA A;  4O2A B;  1MA1 A;  1IVS A;  1WPX A;  4FVM A;  2MW2 B;  3VOU A;  1BMF G;  1S5H C;  3H1J H;  1W0J G;  2XAG A;  2Y69 C;  2P67 A;  4JI4 B;  3VQW A;  4KFM A;  4DR5 O;  4F4L A;  1XDC A;  2JK5 C;  1MZF A;  1HNW O;  3B09 A;  5CA3 A;  5TIS Z;  1GK9 A;  2JGD A;  4AIL C;  1BE3 H;  1NVP B;  5CB4 B;  3KG2 A;  3ZCC A;  4RQE A;  5BR8 B;  1YIJ V;  1G4Y B;  4NXM B;  3QNE A;  2DQ3 A;  1P84 F;  2B1I A;  3CCQ V;  1J95 A;  3P32 A;  2KB1 A;  3CD6 V;  1HWY A;  2PGG A;  1BCC H;  2DWE C;  3N2G B;  5JJE B;  3JSN A;  5CBG A;  1S5L Z;  4LNU B;  4NTX A;  2RDC A;  1L0N H;  4U3J A;  4H33 A;  1B04 A;  3CX5 F;  3LDE A;  1SC5 B;  1AB3 A;  1GAX A;  1QQC A;  2CUG A;  4JI2 O;  4JI5 O;  4B3M O;  1YI2 V;  3TK1 A;  1IDS A;  1N0J A;  5EZY B;  3FKS G;  2WA4 A;  3L71 H;  2P6J A;  1I5X A;  3JAK B;  1H2L A;  1EZJ A;  1Q6I A;  2PTM A;  2WLL A;  3ZHS A;  5EYP B;  5EC1 C;  4YJ3 A;  5JVD A;  4XDK A;  1EN5 A;  1GM8 A;  1WP8 A;  2BCC H;  2QWP B;  2ZXW C;  1KMI Z;  3A0R A;  1B6Q A;  1R1B A;  5GON B;  4FZ0 A;  4UVB A;  2DYS B;  5KHI A;  4E2L A;  2QR4 A;  4FFK A;  3RYF B;  4XDL A;  3E8F A;  5KHG A;  1Q7Y W;  1FXV A;  2RJZ A;  3L75 H;  1ZX3 A;  5F2V O;  2CTQ A;  3QTC A;  5LP6 C;  5KAF Z;  4O4H A;  4X1Y B;  3S3W A;  1XMQ O;  2ZD9 A;  4X1K B;  3AG1 C;  3RBZ A;  4BIO A;  2OIG A;  2PYJ A;  1KP2 A;  4MTG A;  4UCT A;  5KX5 A;  2PI4 A;  1FJG O;  3T2M A;  3ABU A;  3UT5 B;  1AIL A;  1K8A W;  2Y48 A;  2C2A A;  1QNM A;  1GN2 A;  2EIM B;  2WLJ A;  1NU1 H;  1M57 C;  3STZ C;  3K57 A;  1YF2 A;  1Q90 D;  4IHJ A;  1DF5 A;  2F93 B;  5KHK A;  1N32 B;  2Q5Z A;  3JAR A;  3SYO A;  1YEW A;  4QNH B;  5J2U A;  3TXS A;  1UFI A;  3SJB C;  3ZMV A;  1Q6U A;  1FFX B;  2VQE O;  4PI0 A;  3JCU Z;  3LNN A;  1BQZ A;  3WG7 B;  2E3C A;  1QHT A;  2X6C A;  4JYA B;  2Z3Y A;  4DR3 O;  3EVK A;  5JH7 B;  1PNM A;  1ENV A;  2ILM A;  2JDI G;  2ZE8 A;  4IYH A;  5LBQ A;  3ICX A;  1COW G;  4U7O A;  1KU9 A;  3RYH A;  4DV7 O;  4PA9 A;  1E79 G;  1VQ4 V;  2PY5 A;  4FM0 A;  1R3J C;  2DJV A;  2Q9L A;  3DC6 A;  2R9R B;  4X66 O;  4OPA A;  4UB8 Z;  2NR5 A;  4GX1 A;  2N05 A;  4DR6 O;  5EK0 A;  4NTY A;  1R6K A;  2B1G A;  4DK1 A;  1ZAU A;  2M6Y A;  4TV9 B;  1N33 O;  4WBN B;  3FB5 C;  4GX0 A;  3BVO A;  1CPY A;  4FMT A;  4OGQ B;  1H2M A;  4D7T A;  4O4L A;  1WB7 A;  2DQ0 A;  2P90 A;  1OJH A;  3ZRS A;  3E2E A;  2ADP A;  3T4Z A;  3CS5 A;  3WB0 A;  4ZOL A;  3W7S A;  4X20 B;  2YSU B;  4YXW G;  2VWJ A;  1VP7 A;  4JI4 O;  4NR1 A;  3L73 H;  5LA6 B;  3HKC B;  1GN3 A;  1RPO A;  1Y67 A;  4DUY O;  2EIK B;  2L35 A;  3K9A A;  1QU7 A;  3MDS A;  5GTH Z;  4TQD A;  2R9A A;  3E22 B;  2QA4 V;  3ABK B;  5DEC A;  3JAK A;  1MNG A;  2UXD O;  1WNS A;  1N0N A;  4DR1 B;  5ITZ B;  4PHZ A;  4QGP A;  1H38 A;  4ICG A;  2OCC C;  2WWW A;  2QWR B;  2YXH A;  4KHP B;  4NXN B;  1B3Q A;  3I55 V;  3C3T A;  5LL6 Y;  1IBK O;  2HG5 C;  3ZRV A;  3AEI A;  1GRJ A;  2LJ2 A;  4LFB B;  3G67 A;  1XNR B;  4PI2 A;  4EB6 B;  1XL4 A;  2A7W A;  5KMG B;  4FIP C;  5IJ9 B;  2GHY A;  3CRA A;  2DMX A;  5LYJ A;  5KHJ A;  5K1P A;  3UQ8 A;  1US6 A;  3LUT B;  3ZHU A;  1N36 O;  4WFE A;  3E86 A;  1KB9 F;  1E1Q G;  1XIL A;  3D3I A;  2YI9 A;  2E74 B;  3UT5 A;  1R6N A;  4B3T B;  2HVK C;  5CMU A;  1N8R W;  3AG4 C;  4FM2 A;  1R3K C;  4R7C A;  2EX3 A;  3E8G A;  1FFX A;  3ZS8 C;  5B1B C;  2DYR B;  3H1I H;  5IYZ B;  2YXY A;  1Z5W A;  3A2F A;  2IJI A;  3F7Y C;  4LF6 B;  2EUL A;  4ASU G;  1N34 O;  2UUA B;  4LF5 B;  1NTZ H;  1Y74 B;  1PL4 A;  1AJP A;  2GTA A;  2Y4T A;  1EBO A;  1SQX H;  3CP1 A;  1NTM H;  1VQ9 V;  4J7K A;  1K92 A;  4TV8 B;  4X1I B;  1WA8 A;  3ZMS A;  3K58 A;  1WN7 A;  1LNQ A;  1OHH G;  3JD4 A;  3L9D A;  3SPH A;  3CXC U;  1M1K W;  4LF7 O;  1MG1 A;  4GX5 A;  3WB1 A;  5KUK A;  1CXZ B;  4JGS A;  2W6I G;  2D2C B;  2DN9 A;  2ETN A;  3RVZ A;  2K1E A;  3ASO C;  4EFB A;  3ABT A;  1BHA A;  5IYB O;  3B40 A;  3HKE B;  4FFB B;  1K5Q A;  2EJ7 A;  1ORQ C;  4JI0 O;  4WBN A;  2EIN C;  4LF9 O;  5LMN O;  5LXT B;  1AI7 A;  4LF4 B;  5L3B A;  4PA4 A;  1WAZ A;  2XAQ A;  3MHH C;  5LOV A;  2IJJ A;  1EM1 A;  2YEV A;  1D5N A;  3K0D A;  3QO8 A;  1LUW A;  3JAT B;  4KP4 A;  3FAV A;  4GT1 A;  1XOU A;  2X0L A;  4I7Z B;  2ZKO A;  3K9S A;  4UB6 Z;  4X20 A;  1MMM A;  5EIB C;  1G1X B;  4ABM A;  3A0B Z;  3BA8 A;  1BL8 A;  1Y76 B;  4PA7 A;  4HBN A;  3UCS C;  1MSW D;  2WLN A;  1TVK A;  2ZNI A;  4X64 O;  3BFR A;  3H1L H;  5ITZ A;  4JV5 B;  1XEQ A;  3FFQ A;  5HFM A;  4J7Z A;  4UCO A;  2EJR A;  4BIU A;  4U7N A;  2IBZ H;  3EXA A;  3EFF K;  1H2S B;  3ETQ A;  4JAA A;  4TUY B;  5KMG A;  5IJ9 A;  5KAI Z;  1S76 D;  3SDL A;  3CHX A;  1R3I C;  4JI8 B;  2ARH A;  4RO2 A;  1FXK C;  4MSW C;  2W0X A;  1NR7 A;  4DV2 O;  3E8H A;  4LFA O;  1I5Y A;  2WPD G;  4J9Y B;  2UUB O;  4IGG A;  4WFG A;  1HDJ A;  2UXB O;  3JD2 A;  3PJS K;  2ZIO A;  2GUZ A;  5IJ0 B;  4YHH O;  4PV1 B;  5LGT A;  3JSL A;  4LR3 A;  2KSD A;  2IU0 A;  2DE0 X;  4WFF A;  2XAH A;  2HR3 A;  1M56 C;  1F23 A;  4KHP O;  1FKA O;  3THO A;  4JI7 B;  3G6B A;  4MTF A;  4K3A A;  5K1X A;  4QPK A;  1FD9 A;  4LFB O;  1JX9 A;  3K5M A;  2IJH A;  4DV1 O;  4DV4 O;  1MOF A;  1NH2 B;  5B3S B;  2UXN A;  3K3W A;  4K0K O;  1Q43 A;  4DUZ O;  4I55 A;  3HKB A;  3CXH F;  3T1H B;  4FLW A;  2F66 C;  3CCJ V;  3OE7 G;  2VWK A;  4PDL A;  1Y74 A;  3W7T A;  2FB5 A;  3I5D A;  5BY1 A;  2IJK A;  4RUE A;  4KL1 A;  4TV8 A;  2WAM A;  4QJF B;  1XNQ B;  2CH7 B;  4R8C A;  4JTC B;  1KKD A;  2EZO A;  4DR2 B;  3HPL C;  2RN9 A;  3RGB A;  4B3T O;  5J2T B;  2X6B A;  3B77 A;  3BAB A;  2Y4U A;  1DK1 A;  2BSK B;  1JJ2 U;  4JF3 A;  1RSO B;  3FYI B;  1OV9 A;  5JQG B;  1W0K G;  3EHB B;  1GH6 A;  2CGO A;  4KXR A;  2VS0 A;  1KKC A;  2LFS A;  2ZR2 A;  2ZNJ A;  2XT9 A;  1AP6 A;  2IH3 C;  1K4C C;  1E1R G;  1M93 A;  3JAW B;  5LXT A;  1LUV A;  1NT2 B;  4UFZ A;  3AK1 A;  1HR0 B;  2WSS G;  1K3E A;  3JAM N;  4LF6 O;  1K4D C;  5EBL C;  3JAL A;  1L0L H;  4UCR A;  3GWK C;  4DV6 B;  4ZHQ B;  2UUA O;  3F5T A;  1Z2G A;  1TAE A;  4D6T H;  3DSQ A;  1HP8 A;  4AQY B;  3MD0 A;  1PP9 H;  1RP3 B;  2ZIN A;  1JJO A;  3T1C A;  5B1A B;  2H94 A;  3NXS A;  4W4L A;  1URF A;  4OPH A;  5KLV H;  1KBH A;  2VQF B;  3P30 A;  1Q3E A;  4JI1 O;  3SPC A;  3CPW U;  3RW0 A;  1NS1 A;  4DR7 O;  4B3R B;  3TXQ A;  2P5O A;  4TOI A;  2DYS C;  2N74 A;  4GX2 A;  2A06 H;  4CS2 A;  4DV3 O;  4CH6 A;  2UUC O;  3OD4 A;  2JGU A;  2EBO A;  5IWA B;  2B5U A;  5L3G A;  4X65 O;  1DTO A;  4IL6 Z;  1GN6 A;  1OCC B;  3OT7 A;  2Q8V A;  2MK3 A;  5H6Q A;  2XAF A;  2BOC C;  4GUN A;  2Q7G A;  1VQK V;  3CCV V;  1KUQ A;  3ABM B;  5A9G A;  3B8N A;  1AP5 A;  3AG7 A;  1MAB G;  5FNV A;  3ZJZ A;  3CME V;  1FXK A;  2Q0O C;  1JVM A;  1K97 A;  5J9P C;  4RUF A;  5CA1 B;  5L3F A;  1VQO V;  2EIM C;  3ZMU A;  2FL4 A;  2YID A;  1ZL8 A;  1FXH A;  4DW1 A;  4GZR B;  3E89 A;  2WLH A;  4N21 A;  3L74 H;  3K0G A;  1AI4 A;  1ZUQ A;  1ZTE A;  2E75 B;  2BE3 A;  1KD1 W;  2WLK A;  2A0L A;  2JJ2 G;  4H44 B;  1NBM G;  3LDC A;  1VAR A;  3WG7 C;  2DOS A;  1YJ9 V;  5LHI A;  3K59 A;  1JMK C;  1Q86 W;  5GW7 A;  3KKY A;  5LGN A;  5C8Y B;  1TUB A;  5L3E A;  3OEH G;  3HKD B;  1VF6 C;  1S3J A;  4JAU A;  2ZDI C;  1H8H G;  2ZE7 A;  2WLI A;  2RNB A;  4DV5 B;  1QLE B;  4O2A A;  3OMA B;  3SPJ A;  3SYA A;  4DR4 B;  1GTO A;  3G71 V;  1SQB H;  1PM9 A;  4L8J A;  4YIP A;  3UO3 A;  4NB5 A;  1JA8 A;  2BTQ B;  5FPO A;  3F7V C;  4FZ1 A;  3I56 V;  2E5L B;  1PPJ H;  2QTO A;  5FL7 G;  1BS3 A;  1F51 A;  3HR0 A;  5JWP A;  4MVS A;  4LBE C;  3R66 A;  1ZLZ A;  4FLT A;  3A8T A;  4E4E A;  5CB4 A;  3IC7 A;  4X62 O;  3AG3 B;  2BSK A;  4TQF A;  4I0X B;  2ZIM A;  3B8M A;  1VEW A;  4X9Q A;  3B2E E;  3AK3 A;  5JQG A;  4IYI A;  3H1H H;  3OUS A;  4P9P A;  3UO2 A;  1IBM B;  1K34 A;  3O9O A;  3K5O A;  1DGS A;  1XL6 A;  4IIJ B;  3CJH B;  3SYC A;  1VIB A;  2M7W A;  2E76 B;  1GM7 A;  2QWQ B;  4ZKI A;  1P49 A;  3QVN A;  3N2G A;  4H13 B;  3OEE G;  4LNU A;  5CBH A;  1IX9 A;  1IXM A;  1S5J A;  1JQ0 A;  2Z5U A;  1CEZ A;  5D5P A;  2EIK C;  2ZT9 B;  2H8P C;  4MT8 A;  1MSD A;  3ABK C;  1G6U A;  3TJT A;  3LSU A;  3LSS A;  3N2K B;  1XNQ O;  4EFE A;  1NZ6 A;  5EZY A;  2PF4 E;  2UXC B;  5BMV B;  2PUS A;  3AG2 B;  1F4N A;  1OCO B;  4LWS B;  5EYP A;  4Q20 A;  2HKO A;  3FD9 A;  5E1A C;  5BR8 O;  4NXM O;  5B1N A;  1FYJ A;  1M4U A;  2ZM6 B;  2EZP A;  5GON A;  2GSM B;  4WFA V;  3H9V A;  1Z5V A; 
#chains in the Genus database with same CATH homology
 2XAQ A;  3MHH C;  2IJJ A;  4KFM A;  2YEV A;  3K0D A;  3QO8 A;  1GM9 A;  3UM7 A;  4N23 A;  4F4L A;  4GCZ A;  1PNK A;  3AG1 B;  3OMI B;  2OTL V;  4KP4 A;  4GT1 A;  1PL0 A;  2JK5 C;  1QLE C;  2X0L A;  3OM3 B;  3T4D A;  2AHY A;  1K9M W;  4G27 B;  5CA3 A;  1QVF U;  1GK9 A;  3DGE A;  2A79 B;  1YHQ V;  3G4S V;  1SES A;  2QEX V;  1BL8 A;  3F5W C;  2WLM A;  1NVP B;  4JTA B;  4PA7 A;  1F4M A;  3KG2 A;  3ZCC A;  1M57 B;  4RQE A;  3QO5 A;  3TCU A;  1MSW D;  2WLN A;  5LHH A;  1YIJ V;  1G4Y B;  3R65 A;  3QNE A;  5EC2 C;  2OT5 A;  2DQ3 A;  4JTD B;  5C93 A;  2B1I A;  1VQN V;  3CCQ V;  1P4R A;  4MVO A;  5HFM A;  1J95 A;  1CP9 A;  1OCR B;  1SZT A;  3BEH A;  3P32 A;  1NR1 A;  2KB1 A;  2EJR A;  3CD6 V;  3K06 A;  2PI5 A;  4MVU A;  4BIU A;  3E35 A;  4U7N A;  3ZMZ A;  4EKW A;  1HWY A;  1R3L C;  2IW5 A;  2DWE C;  3AG3 C;  2ITD C;  3CCM V;  2DYR C;  1PNL A;  4MVR A;  3ASN B;  4X88 A;  1FFT B;  5CBG A;  3EFF K;  2Q69 A;  4XBF A;  3E83 A;  4QE9 A;  4H33 A;  4MVQ A;  3LDE A;  2W6J G;  1JCH A;  1S76 D;  3FB6 C;  4RAI A;  1R3I C;  3E8B A;  2V1D A;  2CK3 G;  4RO2 A;  1FXK C;  4MSW C;  1NJI W;  3TET A;  1NR7 A;  3STL C;  1YI2 V;  3TK1 A;  2NLJ C;  2ZR3 A;  3E8H A;  1I5Y A;  2WPD G;  4J9Y B;  2ZDI A;  1S0V A;  3FKS G;  3K04 A;  1K5S A;  1NKD A;  2JEU A;  4WFG A;  4ZBM A;  2P6J A;  1I5X A;  1EZJ A;  3JD2 A;  1R73 A;  3PJS K;  2WLL A;  5EC1 C;  4OXS A;  1PD3 A;  5LGT A;  3OMN B;  4XDK A;  4BAY A;  3CMA V;  1GM8 A;  1TUE B;  1G8M A;  4JPR A;  1VQ8 V;  4HYO A;  2ZXW C;  2IU0 A;  1RPR A;  3A0R A;  1FS0 G;  4WFF A;  1YJW V;  2DW4 A;  3JYC A;  3OAA G;  1B6Q A;  1SET A;  2XAH A;  2HR3 A;  3W7U A;  1M56 C;  3CCU V;  2YEV B;  3AG2 C;  1F23 A;  4J9Z B;  2DYS B;  4HZ3 A;  4UVB A;  4X8A A;  1OCO C;  4E2L A;  2IU3 A;  3DTU B;  4XDL A;  3E8F A;  3LNM B;  4FK5 C;  1OCZ B;  4BW5 A;  1QVG U;  1BHB A;  1NQT A;  3SYP A;  1Q7Y W;  1KP3 A;  4MTF A;  1FXV A;  4TWK A;  2DWD C;  5IY5 B;  1QR8 A;  4QPK A;  1JX9 A;  2IJH A;  5L3C A;  4QE7 A;  1MOF A;  3CCS V;  1NH2 B;  5B3S B;  2UXN A;  3K3W A;  2X7R B;  3BY6 A;  1V55 B;  3LDD A;  4MTX A;  2ZD9 A;  3X2Q B;  3CYO A;  1K33 A;  3FB8 C;  3JD3 A;  4KUM A;  3CCJ V;  3AG1 C;  4TSF G;  3OE7 G;  5LHG A;  4MVM A;  3ZN1 A;  1Q81 W;  3RBZ A;  3CC7 V;  4PDL A;  4XDJ A;  1KP2 A;  4MTG A;  1VQ7 V;  4CBC A;  3W7T A;  3CCR V;  2PI4 A;  3T2M A;  3ABU A;  3ZRW B;  2FTK A;  2IJK A;  4RUE A;  1K8A W;  2Y48 A;  2WAM A;  2C2A A;  3ML0 A;  5HFL A;  2WLJ A;  2EIM B;  4R8C A;  4QJF B;  4FJC C;  4JYC A;  4Z1M G;  1M57 C;  4JTC B;  3SPG A;  3STZ C;  5KA5 A;  1WLE A;  1KKD A;  2EZO A;  1DF5 A;  3OR7 C;  3H01 A;  3HPL C;  2OCC B;  3SYO A;  4QNH B;  1NH2 D;  1K73 W;  2X6B A;  1L1F A;  3ZMV A;  1V54 B;  3B77 A;  4X89 A;  1SER A;  2W0F C;  2Q68 A;  3WG7 B;  1JJ2 U;  4JF3 A;  3FYI B;  3GB7 C;  1OCR C;  2X6C A;  1W0K G;  2Z3Y A;  3EHB B;  1GMG A;  2JIZ G;  1W2B U;  1PNM A;  1ENV A;  2JDI G;  2JEX A;  5LBQ A;  1VQL V;  2LFS A;  2ZR2 A;  1COW G;  1ARO P;  4UXN A;  1K7D A;  2ITC C;  1Q82 W;  1KQS U;  2IH3 C;  1K4C C;  3ASN C;  2Q6A A;  1E1R G;  4U7O A;  4G2K A;  4H37 A;  4PA9 A;  1E79 G;  1AI5 A;  3ETG A;  2WSS G;  4PEL A;  1K3E A;  4UVA A;  1VQ4 V;  2QM8 A;  2XND G;  5CBF A;  1K4D C;  1NVP D;  5EBL C;  3CCE V;  1R3J C;  3K08 A;  1DF4 A;  2EIJ B;  2LP7 A;  1S77 D;  2R9R B;  4PDM A;  5KUM A;  3ETD A;  4R50 A;  3MD0 A;  1VQM V;  2Q67 A;  4CZZ A;  1JPX A;  2QM7 A;  2XAJ A;  4GX1 A;  3T1C A;  3W7X A;  5B1A B;  1S72 V;  5LGU A;  3IFX A;  4P30 A;  5EK0 A;  2H94 A;  4JAV A;  1UJW B;  3NXS A;  3AG4 B;  1Y4M A;  1R6K A;  2B1G A;  4UV8 A;  3RVY A;  3P30 A;  4MTO A;  5IYD O;  2X6A A;  3FB5 C;  4UUJ C;  2EIL B;  5B1B B;  3SPC A;  4GX0 A;  1CPY A;  3CPW U;  3RW0 A;  5BZB A;  1RM1 B;  3ZIA G;  4FMT A;  4MVZ A;  5CN0 A;  4TT3 G;  2DYS C;  1AJN A;  4GX2 A;  1THZ A;  4P2Z A;  4JYB A;  2DQ0 A;  2P90 A;  1OCZ C;  1ZWI C;  3ZRS A;  4RQF A;  3E2E A;  2EBO A;  3GWO A;  3IGA C;  3T4Z A;  5IY5 C;  1AJQ A;  2BOB C;  4I9W A;  3VBB A;  3CC2 V;  2B5U A;  5L3G A;  1DTO A;  3CC4 V;  3ABL B;  1GO3 F;  3FYE B;  5DM6 V;  3W7S A;  1OCC B;  4DXW A;  2YSU B;  2MK3 A;  5H6Q A;  4YXW G;  2XAF A;  3SPI A;  5B3S C;  2BOC C;  1M9N A;  1V55 C;  4MW8 A;  2F43 G;  3X2Q C;  4WFB V;  3D36 A;  1VQK V;  3UKM A;  3W7W A;  3CCV V;  3ABM B;  1RPO A;  1H8E G;  3HB3 B;  4WFH A;  1EFR G;  2XAS A;  3M99 B;  2EIK B;  3B8N A;  3OGC C;  3K9A A;  3CME V;  1MAB G;  2QA4 V;  5EBM C;  3ZJZ A;  1FXK A;  3ABK B;  4UV9 A;  1JVM A;  1K97 A;  5J9P C;  4RUF A;  5L3F A;  1VQO V;  2EIM C;  3ZMU A;  4L87 A;  2A9H A;  1YSC A;  4MS2 A;  1FXH A;  3ZMT A;  3E89 A;  2WLH A;  4N21 A;  1VQP V;  1QR9 A;  2D3O W;  3ASO B;  1H38 A;  3K0G A;  1AI4 A;  2OCC C;  2WWW A;  4LC1 A;  1YTF B;  1QCE A;  1V54 C;  3I55 V;  1KD1 W;  2WLK A;  2HJF C;  2A0L A;  2JJ2 G;  3JD0 A;  1VQ6 V;  1NBM G;  2HG5 C;  5H6R A;  3LDC A;  3OUF A;  3WG7 C;  1YJ9 V;  5LHI A;  2EIN B;  2HLD G;  3ZRV A;  1Q86 W;  3AEI A;  1P7B A;  5GW7 A;  5KA6 A;  4MW3 A;  5LGN A;  1JOY A;  2Y69 B;  3OEH G;  5L3E A;  1XL4 A;  1KC8 W;  1VQ5 V;  4I5S A;  2ATK C;  4FIP C;  2GHY A;  1S3J A;  3WFV A;  4WF9 V;  4JAU A;  2ZDI C;  2R9I A;  1H8H G;  1ROP A;  2WLI A;  1DLB A;  2OTJ V;  3CCL V;  2NNU A;  1QLE B;  2AHZ A;  5B1O A;  3LUT B;  3OMA B;  3SPJ A;  3SYA A;  4DO2 A;  3K79 A;  1GTO A;  3G71 V;  1YIT V;  2JJ1 G;  1YTF D;  5IDJ A;  1YJN V;  4WFE A;  1AI6 A;  2EIJ C;  3E86 A;  2WLL B;  2UXX A;  4P9O A;  4PDR A;  1E1Q G;  2P7T C;  3F7V C;  1AR1 B;  3D3I A;  3I56 V;  2QTO A;  5FL7 G;  1R6N A;  3JCZ A;  3ZRW A;  1F51 A;  2V7Q G;  4FPP A;  3G6E V;  5B1A C;  2HVK C;  4PA6 A;  4MVS A;  5CMU A;  1N8R W;  4LBE C;  5L3D A;  3AG4 C;  4G28 B;  5EBW C;  3FB7 C;  1R3K C;  2IH1 C;  4R7C A;  3MHS C;  3QO7 A;  2XOK G;  3E8G A;  2EIL C;  3IC7 A;  3AG3 B;  5B1B C;  5IYC O;  1PKX A;  2DYR B;  1KEC A;  1RM1 C;  1QBZ A;  2HFE C;  3B8M A;  4BIZ A;  2IJI A;  3F7Y C;  2LFR A;  3OUS A;  2QKS A;  4P9P A;  4LCU C;  1K34 A;  4WCE V;  1OZ0 A;  4ASU G;  1XL6 A;  4HAM A;  1FXK B;  3SYC A;  3ABL C;  2HVJ C;  1OCC C;  2M7W A;  1AJP A;  1Y66 A;  1GM7 A;  4UVC A;  4ZKI A;  1EBO A;  3OEE G;  1SRY A;  3JD1 A;  3CP1 A;  1VQ9 V;  1K92 A;  5CBH A;  1IXM A;  3OR6 C;  3ABM C;  1JQ0 A;  2Z5U A;  3ZMS A;  1CEZ A;  1M90 W;  2EIK C;  1LNQ A;  1OHH G;  3JD4 A;  2H8P C;  4MT8 A;  3SPH A;  4LP8 A;  3CXC U;  3ZN0 A;  1M1K W;  3ETE A;  1QLN A;  3ABK C;  2ZXW B;  1MG1 A;  3OFN G;  4GX5 A;  4JAS A;  4PA3 A;  5KUK A;  3LSS A;  4QPJ A;  4JGS A;  2W6I G;  1GKF A;  1H2G A;  3ZRX A;  3RVZ A;  1M56 B;  2K1E A;  4PDV A;  3SJQ C;  3K03 A;  3OW2 U;  3ASO C;  4R6Z A;  3ABT A;  4PA4 A;  4QIW F;  5IYB O;  3AG2 B;  1BHA A;  1F4N A;  1K5Q A;  1OCO B;  1ORQ C;  2QE7 G;  2WLI B;  4Q20 A;  3SYQ A;  5DN6 G;  2HKO A;  5E1A C;  1WPX A;  5B1N A;  2EIN C;  3VOU A;  1BMF G;  1S5H C;  3LSQ A;  1AI7 A;  1W0J G;  2XAG A;  2EZP A;  2Y69 C;  2GSM B;  2ZQM A;  5L3B A;  2P67 A;  4WFA V;  5H9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...