4P9OA

Complex of voltage-gated ion channel in a the presence of channel blocking compound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
VGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLESWSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVDAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Ion transport protein
publication title Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism.
pubmed doi rcsb
source organism Magnetococcus sp.
total genus 31
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4p9oA00
4PDLA 2EILC 4JTCB 3SYAA 5IY5C 3FB8C 2HG5C 4DXWA 1OCRC 3SPJA 3ASOC 1XL6A 5KUMA 4JTAB 3SYCA 5J9PC 3KG2A 3F7VC 2OCCC 3SYOA 5EBLC 3SPCA 4P2ZA 3TETA 1ZWIC 2Q67A 3SYQA 4P30A 4J9ZB 4WFEA 4RUEA 2DYRC 1M56C 4MVOA 3RBZA 3SPIA 4OXSA 3T1CA 3F7YC 3ZRSA 1R3LC 4UUJC 1OCCC 2W0FC 3AG3C 3EFFK 1LNQA 3LUTB 2KB1A 4QNHB 4X88A 4MVMA 4P9PA 1J95A 2WLIA 1P7BA 3K06A 4PDVA 3RVZA 2A9HA 3LDDA 3VOUA 3E8HA 3OGCC 4XDLA 3RVYA 4WFGA 4PDMA 3SJQC 3TCUA 2WLJA 2Q6AA 3HPLC 4HYOA 4MTFA 4P9OA 2AHYA 1R3JC 2IH3C 5B3SC 3E89A 1K4DC 1ORQC 3AG2C 3E83A 4GX2A 4JTDB 4LCUC 2HVKC 4RO2A 5BZBA 2EIJC 3OUFA 4R8CA 2HVJC 3SPGA 3E8BA 3ZJZA 4RUFA 3RW0A 4MTOA 3LNMB 3OR7C 3ABMC 2EINC 4RAIA 3JYCA 4KFMA 1V54C 2WLIB 5E1AC 1R3IC 4CBCA 3F5WC 3K0GA 4X8AA 3X2QC 4F4LA 3T4ZA 4MVQA 2Q68A 3FB7C 3R65A 2WLKA 2ZD9A 3FB6C 4GX0A 1G4YB 1KKDA 2BOBC 1M57C 5EK0A 4HZ3A 2X6AA 2X6CA 4BW5A 4R50A 1QLEC 1OCOC 3GB7C 1V55C 3BEHA 4MVSA 3PJSK 4XDKA 2WLLA 2IH1C 3K04A 5CBFA 4PA6A 1R3KC 3E8GA 4I9WA 3E86A 5KUKA 2HFEC 4MVRA 4XDJA 2Y69C 4MS2A 4MSWC 3LDEA 3OR6C 2DYSC 3SPHA 5CBGA 1OCZC 2AHZA 4H37A 2EIKC 4MW3A 5EBWC 3AG1C 3E8FA 2BOCC 2QTOA 3ASNC 5B1AC 3STZC 3ABKC 4PA7A 5CBHA 3FB5C 4LBEC 4MVUA 2P7TC 4GX1A 3OUSA 2A79B 2R9RB 4PA9A 4R6ZA 2WLMA 4PA4A 3T4DA 3WG7C 5EC1C 2ITDC 2WLLB 4LP8A 3T2MA 5EBMC 3K03A 4G27B 2A0LA 4GX5A 3AG4C 2ITCC 3K08A 1K4CC 3IFXA 2WLHA 2ZXWC 5EC2C 2WLNA 3UKMA 2X6BA 2EIMC 4H33A 4J9YB 4PA3A 3K0DA 4MTGA 2Q69A 4X89A 3ABLC 2JK5C 5B1BC 4MVZA 4QE7A 4TWKA 1JVMA 2QKSA 2YEVA 4G28B 4WFFA 3SYPA 2K1EA 4MW8A 4WFHA 3IGAC 2DWEC 2DWDC 4R7CA 2H8PC 1XL4A 3STLC 3UM7A 2HJFC 3LDCA 4PDRA 4EKWA 4QE9A 2ATKC 2NLJC 1BL8A 1S5HC 4ZBMA
chains in the Genus database with same CATH superfamily
4ZOLA 1DTOA 2KQXA 4JYAO 2DE0X 3KKYA 4TUYB 2HR3A 1GM7A 3SYCA 3UO3A 1N36O 5KAIZ 4NXNO 3SYOA 3K58A 2CGNA 3SPCA 1VQ6V 1H2KA 3OT7A 1VEWA 4OXSA 3BRCA 5IJ9B 3OM3B 4QNHB 4X9QA 4J41A 3UQ8A 2RMKB 4CC6A 3A2FA 4UB6Z 3OAAG 3CCSV 2GHYA 4FLVA 1BHAA 2WLJA 1TUEB 4P9OA 3RT3C 3SJCC 2QWNB 1H2SB 1PNMA 3JSNA 4DR1B 2NNUA 3CE2A 1QCEA 2EJRA 3CRCA 1T5EA 2XAJA 4RUFA 4DR5B 5JVDA 1VQ4V 1QVFU 2WLKA 1KKDA 1KP3A 3IJ4A 5LP6C 1GM9A 4J80A 4IIJB 2YICA 5BXZA 3K04A 4LFBO 4AILC 1PP9H 3BHPA 5JQGA 4PI2A 1SKVA 2Y0PA 4MS2A 3N27A 5KMGB 1SESA 2B1GA 2AHZA 4DR2O 5EBWC 4L8JA 3T1YB 3CCLV 4U3JB 3ZRWB 2ZINA 1Y74A 2XNDG 3OUSA 1PNKA 4EB6A 2ZCEA 3QG5A 4JI6B 4I4TB 1K4CC 1H38A 2L6LA 2ZXWC 1FD9A 2GUZB 4JPRA 1HNZO 5LA6B 4DW1A 2F1MA 5B1OA 1BSMA 5FLXN 2QKSA 4DV4B 4JI1O 1XL4A 5HFMA 3SPJA 1WB7A 2JGUA 3ASOC 1F51A 2R9IA 1RSOA 4J11A 1K5SA 1N0JA 4CS2A 1NH2D 2ARHA 4P30A 2FYUH 1JMKC 1RM1C 2QEXV 1QLNA 1B6QA 1WB8A 4DV1B 4MT8A 1P7BA 1G6UA 2XAGA 1FXKA 3OGCC 5H9CA 1MA1A 4O4JB 1Y76B 5LGNA 1MSWD 3AG3B 3JD0A 3A0BZ 4JI0B 4MTOA 1H2MA 4TOIA 2EINC 3JYCA 3IC9A 2HKOA 3T1HO 3JASA 3R65A 1GTOA 1IDSA 3ZMVA 3CJHA 5LYJB 2ADPA 3HR0A 1W59A 1CXZB 1JPXA 4UXNA 4XDKA 3BAAA 3QF7A 5GW7A 2P06A 4CH4A 1L0NH 2VQEB 3JATB 4MSWC 5KHKA 2QTOA 3STZC 3ABKC 4FFBB 1K3EA 4DUZO 4K8XA 4WFAV 1FJGO 4PHZA 1NI8A 1V55B 2X0LA 5C8YB 3ML0A 4UV9A 2ZKOA 4F6RB 4GX5A 1R6KA 4YY3O 1AP6A 2G38A 4DO2A 4WBNA 1N32B 1I08A 4H33A 2ZDIA 4PA3A 5FPOA 1D2DA 3G6BA 1IX9A 3EHBB 3CRAA 1NT2B 1SC5B 4DK1A 1RP3B 5EZYA 1ZL8B 4B7EA 2RDCA 1KQSU 2BSKB 1N33O 4D7TA 1XL6A 3FAVB 3QO7A 3H9VA 4B3RO 3VBBA 3P30A 2Q67A 5LMNB 1XMQB 5JWPA 4RUEA 3SPIA 2CDYA 2UXCB 1ZAUA 1AVMA 1VIBA 1GKFA 1M9NA 3CRQA 4DV5B 5LL6Y 2CUGA 2DMXA 4LF6B 1J95A 1QVGU 2CE4A 3SR2C 3L72H 1P84F 2E76B 3JARA 4WFGA 4FZ1A 2Q6AA 4DV6B 1JJOA 3H1HH 4GX2A 1ORQC 5BMVA 5KHIA 4GKJO 2V1DA 5JCOC 4X1KA 1Z2GA 2DQ3A 3E8BA 4K0KO 2ODMA 2YI9A 1GMGA 1AROP 3J7AU 5HFLA 3HKEA 2W0XA 2IU0A 3TJTA 4HZ3A 2B1IA 5KA5A 1IBKO 4O4IA 2WLLA 2UUBO 4ZI7A 4PA6A 2D2CB 1L8DA 1XI1A 4J7ZA 2P22C 1FPOA 3CCUV 3JAWB 2JIZG 3CCEV 3G67A 4U7OA 1P7GA 2FTKA 2PY5A 1SQQH 2A79B 3HKBA 4IYIA 5LP6B 1U96A 4LWSB 1AILA 4RQEA 1TUBB 2Q4PA 3D36A 3G6EV 4NR1A 1J5EB 4JYAB 4GZRB 1N36B 4X64O 1Q81W 4NXNB 2WLNA 4FIPC 5FNVA 3ZBHA 3E22A 2WA3A 1Q6IA 4UV8A 3E35A 3CPWU 2F23A 4Z2WA 3L74H 4MW8A 3MHSC 3I56V 2DWEC 2E75B 2HJFC 2ATKC 1TAEA 1NZ6A 2ZE5A 3WB2A 4AHCA 4CS4A 2BCCH 2ZE8A 1XILA 4AQYO 2ZXWB 4C7UA 1CP9A 4X66O 4JZ2A 5L3EA 4DV0B 1X59A 4DR4O 4MVOA 2R72A 2W0FC 4NYKA 3BY6A 3LUTB 5E79Z 4ZIBA 3HKCB 4P9PA 2FKXA 4AI8A 3ASOB 1L0LH 5JH7B 4X20A 2VQFO 1FXKC 3B09A 4I55B 5JJEB 2IU3A 4PDMA 3ZMTA 4O4LA 3BCCH 4DR6B 1UJWB 2AHYA 1KECA 4I50A 4E4EA 4FM0A 1IXMA 1BE3H 2ZM6O 1RM1B 4NXMO 4RAIA 4J42A 5E1AC 4CZZA 4CBCA 3A0RA 1Y66A 2B5UA 4BIUA 1RPRA 4UCRA 5K1XA 3FYIB 4JI5O 2QKCA 1VQLV 3CYOA 5LGTA 1VQ5V 4XDJA 1SQBH 1GN2A 2EINB 1HNZB 3N2KB 2L35A 1OCZC 2LFRA 3D3QA 3E8FA 3R66A 4Z1VA 4FLYA 4X1YB 2AZ0A 3JALA 4DUYB 4JI1B 3JCZA 3WG7C 3SJAC 4YJ2B 3RYFB 5IYDO 1HR0O 3VQXA 2QR4A 3IFXA 2ZDIC 5CA0A 1JFFA 2OWOA 2ZIOA 2UXXA 4I0XB 2Z3YA 5FPRA 3KCXA 3ZN0A 2EULA 4LF5B 5ITZA 2Q9LA 4EKWA 1SQGA 3CC4V 3SYAA 3J81N 2N74A 3WU2Z 1NKDA 3KG2A 1M56B 2H94A 1ZWIC 4DRXB 2GTSA 3VQVA 4ASUG 3F7YC 5K1PA 1Z5VA 1NS1A 2F93B 1HNWO 4ZOLB 4YJ3A 4JI7O 2OT5A 5CA1A 2Y4UA 5B3SB 4BIOA 5H2FZ 4U3FH 4HYOA 4JI4O 4I9QA 4FMTA 4IHJB 4UVBA 4B7KA 1CEZA 2KSDA 3SPGA 1I7FA 3ABMC 1PL4A 1SZTA 3ETQA 4YHHO 3JAKB 2JS3A 2UXDO 3T4ZA 1AI7A 2IJHA 4TV9B 4DUZB 1UFIA 4X62B 1AR4A 3DC5A 2PTMA 3GB7C 2VWKA 3WFVA 1W0KG 1M90W 3E86A 3G80A 3P32A 5L3BA 5B1AB 5GONB 1LUWA 2QTSA 4JI8O 1MABG 2PF4E 3C3TA 1R6NA 4FLUA 1XMOB 1JJ2U 1N33B 3K03A 4LNUA 5JQGB 2K9PA 1YTFB 5LMUO 2PZSA 1V9PA 4B3RB 1VARA 4LH7A 3O65A 3WB0A 4Q20A 5B1BC 4ICGA 4FZ0A 4DV2O 1SQFA 1JVMA 1Y74B 4WFHA 3CCQV 1ENVA 4EB6B 4QE9A 3U10A 1UPGA 1BL8A 5B5EZ 3ZRVA 4OX9O 2OCCB 3FB8C 2ZNJA 4X65O 5KUMA 4PJ0Z 2OIGA 4Z1MG 4P2ZA 1K5QA 4BW9A 2Q8VA 1QQCA 3QO8A 3ABUA 3UT5A 1RFYA 4GKJB 1HNXO 1OCCC 1PM9A 4H44B 3K59A 2FMLA 3AG7A 4K0KB 4FLWA 4FM1A 2WLIA 1K92A 4DW0A 1K7DA 3RVZA 3LDDA 3OMIB 3TCUA 3CC2V 1EN5A 1SA0A 2JEXA 1N34O 2UUBB 2P6JA 1PKXA 4FM2A 1YDXA 1D5AA 1R3IC 1DK1A 3K0GA 1Q8IA 1BT8A 3LSSA 1SQVH 1FXKB 2CK3G 2X6CA 3HKDA 1E79G 1PPJH 5D5QA 4W4KA 2ZR2A 2XAQA 1THZA 1ZSPA 4Q6GA 2M7WA 3ZHQA 4UCOA 2OTLV 3LDEA 5KX5A 3CC7V 3UO2A 5CBGA 4LF7O 1LR1A 3CP1A 5J2UB 2Q7HA 3K3WA 5CBHA 4LF4B 2RJZA 2JGDB 5DEDA 2E5LO 4PELA 4GX1A 2WPDG 3CJHB 1YHQV 2CH7A 2ITDC 3B77A 2LQTA 2JRIA 3L71H 4ABMA 2A0LA 3JD1A 4UCTA 3OTOO 3DGEA 2XAHA 2AGAA 4QPKA 2QA4V 4J9YB 4CH5A 1OCZB 5IWAO 4DR4B 4MTGA 3ABLC 4DR3O 5LXTA 2CTRA 1Y6XA 3WG7B 3ZHUA 4BWAA 2NLJC 4CH3A 1S5HC 3ZIAG 5IY5C 5D5PA 3RYCA 1S77D 1Q7YW 1Q6HA 2VQFB 5EBLC 4K8ZA 3SYQA 3CCRV 2DYRC 3CXCU 3NXSA 4DV3O 5KHGA 2ZM6B 5EZYB 2YIBD 3K5MA 1LNQA 4NXMB 2OTJV 1GAXA 3E2EA 2DW4A 1Q43A 4FJCC 1I5XA 3K9SA 3MDSA 4JI3O 5LBQA 1YTFD 1XNRO 3AG2B 1YZBA 4H0LB 2EIJB 2CTQA 4LCUC 2Y48A 2QWQB 1V54B 2IBZH 1XUQA 1QHTA 1VQ9V 1E1QG 1GM8A 2HJDA 5J2TA 2Q68A 1G4YB 3JARB 4BW5A 4N23A 2ZR3A 3S3XA 1GN4A 4JAAA 3CEIA 1PL0A 2F4VO 3BA8A 1BZKA 4TUYA 3ZHSA 2A06H 3J80N 2HHHO 4X1KB 4LFAB 1KBHA 3AG1B 1MOFA 3ABMB 3IC7A 4H37A 1BGYH 1M93A 4CS3A 5IJ9A 3H1LH 3BPZA 2UUAB 2F95B 2EZPA 5H6QA 1N8RW 3L70H 4O4IB 2WLLB 3ZHTA 1FFTB 3M99B 1DGSA 3CRMA 2XHBA 3MHHC 2PYJA 3K0DA 4HAMA 3B4SA 4B3TO 2K1EA 3IGAC 1JOYA 3UM7A 1HNWB 4ZBMA 5KAFZ 1NJIW 2ZE6A 2MW2B 2QWPB 5FNVB 3LSUA 4IYHA 4PD4F 4J9ZB 1M56C 5B1BB 4JI4B 1H2NA 1VF6A 1WLEA 2XAFA 5A2QN 3JD2A 4U3JA 2R9AA 3ZRWA 3U11A 1AJQA 2EZOA 1AI5A 1FKAO 2CGOA 2LGWA 1F4MA 4I4TA 1IBLB 5B3SC 4LF9O 2OIEA 1K8AW 4RO2A 2GUZA 3SDLA 1OCCB 5EIBC 4DR7O 1Q90D 5LA6A 3X2QB 1NTKH 1M57B 5AG2A 2R70A 2X7RB 1YXBA 1Y67A 3QTCA 4BR6A 4I50B 5CBFA 4QIWF 3E8GA 5B1NA 4JYYA 3RYIA 2YXYA 5LMUB 4LF8B 1NTZH 1EM1A 5L3FA 3W7XA 3ZMSA 5B1AC 4FLTA 5KA6A 4MVUA 1COWG 4WCEV 2R9RB 1F23A 4PA4A 4UVCA 4MTXA 5EBMC 1QR9A 3B40A 1YITV 1Q82W 3D8CA 4O4JA 1Y76A 5LGUA 1M4UA 1W0JG 3EVKA 4O4HA 4LFCO 2YEVA 1HP8A 1S0VA 2OYQA 4L87A 2KKWA 2V7QG 4JYCA 1DLBA 2WWWA 2CTWA 4PDLA 3CMEV 1BS3A 3OMNB 2OCCC 3TXQA 3VQYA 2YS8A 4O2AB 5CA0B 3G71V 1L1FA 1JFFB 3AK1A 1PNLA 3ABLB 1N34B 1JA8A 3JATA 5IJ0B 4U7NA 4X88A 4FFBA 5IY5B 3ZMUA 1US6A 4FFKA 5C8YA 3RVYA 4KXRA 2DN9A 4F6RA 5IE9A 2DYRB 2FL4A 1YIJV 2AXTZ 1I94O 2HVKC 5IDJA 4YIPA 2ADQB 2VWJA 3H1JH 5CB4A 2YXHA 3WB1A 4KFMA 4YIOA 2LP7A 3ZS8C 1ZL8A 1OZ0A 4GCZA 5CA1B 4GX0A 2E5LB 2ETNA 1OHHG 5CN0A 1VF5B 1YF2A 4JASA 1CPYA 2ZE7A 5B66Z 3OTOB 2BTQA 4LFBB 1WA8B 3ASNB 4TV8A 3BABA 4K3AA 1XOUA 1IVSA 5IWAB 4HNAA 4DR2B 2P7TC 4DR3B 3CRRA 4PA9A 5EC1C 1M1KW 3T2MA 1EN6A 3JCUZ 3AK3A 3S3WA 4N21A 1Y4MA 4TQDA 1XHXA 4ZHQA 2IJIA 3K79A 1RPOA 4G28B 3CCVV 1X4TA 1NQTA 1GN6A 4R7CA 2H8PC 3W7UA 3LDCA 2DOSA 1AP5A 3Q4HA 4LNUB 1OCRC 4IL6Z 4I7ZB 1WN7A 1H8HG 2F66C 3OD4A 1NR1A 3TXSA 1XHZA 2QM7A 4JYBA 1ZX3A 4IGGA 4UUJC 1MZEA 3JAWA 4BIZA 4BAYA 4LH6A 2A3QA 2Z5UA 4DV1O 5LHGA 1SQXH 3CWBH 2P5OA 3RGBA 1XEQA 2QWRB 4OGQB 3AK2A 5LP6A 5EYPB 1QR8A 3E8HA 2YSUB 3DXRB 1BMFG 4DV7O 1WP7A 2MK3A 2F4VB 5IYZB 2IH3C 3AG2C 4JTDB 2HHHB 2LFSA 2EIJC 3FX7A 1VF7A 2W6JG 2HLDG 1PD3A 3IAYA 1V54C 2WLIB 2ZD9A 1S76D 5DECA 3QNEA 1NTMH 3L75H 3T1HB 4DK0A 4NTXA 3D3IA 1XREA 1KYOF 4X1IA 1KMIZ 1SZXA 2UXNA 2VQEO 4I9WA 1XBLA 4MVRA 4I5SA 3OR6C 3SPHA 3FYEB 3AG1C 3RYHA 3CX5F 3K57A 3FB5C 4LBEC 1AR1B 4B3TB 4D6TH 3SGIA 3HKCA 3HKDB 4R6ZA 3T4DA 3AG4B 1R6TA 2JDIG 1FJGB 5JH7A 1N32O 3B8MA 4I55A 3K5NA 5KX5B 4YY3B 2LO1A 2KG7A 1ZTEA 2LW1A 2EIMC 3K5OA 1B06A 2N04A 1IURA 5JVDB 2QWOB 2PUSA 1TVKA 3ICXA 4WFFA 3KZIZ 1YI2V 4TT3G 4EFBA 2CH7B 1KKCA 3ETGA 1XNQO 3SJBC 4JTCB 1GK9A 1VQ7V 2EX3A 3D36C 3ZN1A 5IT9N 4JV5O 1GH6A 2Y0IA 4UCVA 3RBZA 1JCHA 4B3SO 3DC6A 2Q7EA 4DV5O 1ZUQA 3N2KA 1URFA 2QGNA 1D5NA 2YIDA 5TISZ 2YUAA 2ZQMA 2ZIMA 1K97A 4DV6O 1B3QA 4YJ2A 4XDLA 3RYFA 3I5DA 2Q73A 1I0HA 4NKGB 1QNMA 4ZKIA 4FK5C 4R8CA 1FXHA 2RNBA 3ZJZA 3CMAV 2UXBO 1MNGA 2DJVA 5LOVA 2WA4A 4I0XA 4QPJA 3X2QC 1Q86W 3RN4A 1WPBA 2GBOA 1M57C 1VQOV 4WFBV 1OCOC 1RSOB 1HW7A 1Q3EA 1QU7A 4E2LA 2IH1C 2QE7G 1O9HA 1YEWA 3CHXA 1IBKB 4B08A 1I5YA 5KUKA 4JAVA 1SETA 2RCVA 4W4LA 4DRXA 4GUNA 2DYSC 4KL1A 2Q5ZA 3OW2U 2O57A 1QBZA 3UCSC 3W7SA 1J5EO 1WJZA 3AEIA 3JAMN 2XT9A 5A9GA 4RQFA 3DTUB 1BQ0A 1ROPA 3JSLA 5L3DA 4IHJA 4X64B 2LJ2A 3ZMZA 1NR7A 3JASB 1AJNA 3STLC 3BFRA 2UUCO 3JAKA 5GTHZ 4PDRA 4QJFB 3VOUA 3OMAB 4TV9A 1NVPB 1EFRG 3ZRXA 4J10A 4DV0O 5EIBD 3F7VC 3I55V 1FAFA 4AQYB 1K33A 1FXVA 1MG1A 5JCOA 1ZLZA 4X66B 4JF3A 3ZRSA 1I94B 5GONA 2YDEA 4LC1A 1S72V 1M5IA 3ETEA 3OEHG 2YIBA 5GTIZ 1OCRB 4PDVA 2VRZA 4DR6O 2EJ7A 3M7MX 2GV9A 1NU1H 4WBNB 4MTFA 1K4DC 2IW5A 1KB9F 4PI0A 2NN4A 3HB3B 2PI5A 3JD3A 4UCUA 1SF9A 1EZJA 3LNMB 3B8NA 2P90A 2PYLA 1IBMO 1JR9A 2W6IG 3C90A 1K73W 4OPAA 3CS5A 3THOA 4R50A 1QLEC 5BR8O 2JJ2G 1AI6A 5BY1A 1WNSA 2YC0A 4O2BA 2HEPA 1FFXA 4JZGA 4JI5B 1YJWV 1BHBA 4JI2O 2EIKC 4MW3A 4DUYO 4B3MO 3ASNC 3P3NA 3OEEG 3A8TA 2NR5A 4OPHA 5L3GA 4XBFA 3N2GA 1S5JA 2C2AA 3W7WA 2YXLA 3O9OA 2JS5A 2WLHA 3QVNA 3RYIB 5BMVB 4FPPA 1HR0B 1OJHA 3A0HZ 2RN9A 1Q5OA 4LF5O 3HKEB 2Q0OC 4G2KA 4NTWA 4KUMA 2FB5A 3LNNA 4A5UB 4ZI7B 1NBMG 2QSAA 2EIMB 5IYBO 3GWOA 4DV7B 4O4HB 3K9AA 2YEVB 3EXAA 1VQKV 2KB1A 5J2UA 3HKBB 5H6RA 2JGDA 2Y4TA 4EEQA 1MMMA 3KCYA 5CA3A 4UFZA 1F7YA 5KHHA 4JI7B 3FKSG 4IIJA 1R3JC 1Q6UA 3E22B 2GSMB 4DYLA 1A32A 2DQ0A 5LHHA 2PI4A 3FD9A 5KMGA 4TQFA 4X62O 3CCJV 4F4LA 4X8AA 4PV1B 1NVPD 2H3OA 3FB7C 3H1KH 4UCSA 2CAZC 4YHHB 2BOBC 2UXDB 5EK0A 4KHPO 4MVSA 2XTAA 3PJSK 5L3CA 2HP8A 2A7WA 1S5LZ 1YVWA 5CB4B 3ZCCA 5LHIA 2JEUA 3ZEDA 5DN6G 4KP4A 3LSQA 3MAQA 3ETDA 5H5NA 1VQ8V 4X20B 1OCOB 4JI8B 1XMOO 1G1XB 3P3PA 1XNQB 4O4LB 1BQZA 4G27B 1FYJA 3AG4C 2BTQB 2RQ6A 1XQ8A 2QM8A 1AJPA 1VP7A 2ZT9B 4TV8B 3OTFA 3UKMA 2DYSB 1O9GA 4NTYA 4JV5B 4UB8Z 2Q69A 1W2BU 1WPXA 4HNAB 4B3SB 1H8EG 1B04A 1YCIA 4K35A 4DV2B 3H1IH 2JJ1G 1K34A 1KD1W 2EILC 2F43G 4OX9B 2UU9O 2Q0AA 5IYCO 2JVDA 4X65B 4WFEA 4ZHQB 3T1CA 4FLZA 1GO3F 4GKKO 3TGUH 2WSSG 3JALB 1HNXB 1WAZA 2GTAA 2UXBB 2E74B 4MVMA 3Q4HB 3RWRD 1F4NA 3NR7A 3K06A 1PV0A 4H13B 5LYJA 3OE7G 3SJQC 3OFNG 2EBOA 3ZHRA 3E89A 2XASA 3E83A 5BZBA 3F5TA 1P49A 2QJ1A 3B2EE 3RW0A 3CXHF 3OR7C 2LW7A 5ITZB 1BCCH 1MZFA 2X6AA 3BEHA 1DF5A 4CH6A 2VS0A 4DR1O 2HFEC 4DR5O 2Y69C 4LF4O 1HDJA 3BVOA 1YJNV 3W7TA 4PA7A 4LF7B 4YJ3B 2BE3A 1QLEB 2YIAA 2UUCB 2GDSA 5CMUA 4X1IB 1JX9A 2BSKA 3K5LA 3FAVA 2BTOA 3CD6V 4D7SA 2X6BA 2EIKB 3T1YO 3C3SA 3RYHB 1TGOA 3CCMV 2JK5C 4RWUA 3SYPA 1VQPV 1GRJA 1YSCA 5KHJA 1H2GA 4JI6O 3OUFA 2HG5C 1SQPH 2KG7B 1TA8A 3TETA 5JJJB 1R73A 1TVKB 1HWYA 1IXBA 4DV4O 3EFFK 4DV3B 3BA9A 3QO5A 1IBMB 1G8MA 2A9HA 5BR8B 4WF9V 3HPLC 3PN1A 1SS3A 4JI3B 4JGSA 1XNRB 1AI4A 2HVJC 1VF6C 4UVAA 4IT5A 1YJ9V 4JI2B 2CTPA 1AB3A 3F5WC 4B3MB 1N0NA 2OCHA 4J7JA 2E3CA 1XDCA 4LWSA 3ZHVA 4LFAO 1TUBA 3TK1A 1R3KC 3JD4A 3L73H 3G4SV 2IJJA 3UT5B 1P4RA 4O2AA 4JI0O 1OV9A 3ABKB 3GWKC 5LOVB 2UUAO 3U0ZA 3GVMA 2ZNIA 5IJ0A 1VMGA 2IJKA 5F2VO 2WLMA 4LP8A 1SA0B 3VQWA 1VQMV 1DF4A 3CSXA 4EFEA 5EC2C 1FS0G 1S3JA 2XUMA 2Q7GA 4QE7A 1IZ3A 1EN4A 2PGGA 5JJNB 2AW9A 2P4KA 4HBNA 4GT1A 3CB2A 4DXWA 4JTAB 5J9PC 2WAMA 4FLXA 1AR5A 2QDOA 2XOKG 1GN3A 4GLXA 1SRYA 2V4DA 1R3LC 2P67A 1WA8A 3AG3C 4LR3A 1E1RG 1KUQA 3MD0A 2YI8A 2EILB 1KP2A 1U97A 1IBLO 1EZVH 2AZ2A 4KHPB 3APQA 5DM6V 5LMNO 1XMQO 4NB5A 2N05A 2UXCO 4FVMA 4QGPA 1KU9A 4LF9B 5LXTB 5FL7G 4NVPA 4DR7B 4LF6O 2ILMA 3L9DA 2QM4A 1K9MW 4MVQA 1SERA 4X1YA 3FB6C 3RYCB 1Z5WA 1V55C 1LUVA 4JAUA 4LF8O 2B9ZA 4CC5A 1JQ0A 4F6EA 1NH2B 2M6YA 1H2LA 1KC8W 2BOCC 1WP8A 4J7KA 2Z0AA 1MSDA 3DSQA 1R1BA 1N4CA 3ABTA 3H01A 4O2BB 1EBOA 5EYPA 2IM9A 1FFXB 2ITCC 3K08A 2D3OW 3DXRA 2UU9B 2Y69B 3RFRA 1VQNV 4YXWG 5IYZA 5KLVH 2P4VA 3OGIB 5C93A 4X89A 4MVZA 2QKAA 4TWKA 4TSFG 5J2TB 4GKKB 2DWDC 3ZX6A 4LFCB 3FFQA 2LGQA 3M8AA 3N2GB 4GYCB 3APOA
chains in the Genus database with same CATH topology
4PDLA 3CMEV 3SYAA 1DTOA 3OMNB 3SYCA 2HR3A 1GM7A 1NBMG 1NKDA 3KG2A 2OCCC 3SYOA 1M56B 3SPCA 2H94A 1VQ6V 1ZWIC 2EIMB 5IYBO 3GWOA 3G71V 1L1FA 1PNLA 3ABLB 4ASUG 4OXSA 3F7YC 3K9AA 2YEVB 1VQKV 4U7NA 2KB1A 3OM3B 4QNHB 4X88A 5H6RA 5IY5B 3ZMUA 5CA3A 2OT5A 3OAAG 3CCSV 2GHYA 5B3SB 3RVYA 1BHAA 2WLJA 1TUEB 3FKSG 4HYOA 2DYRB 4P9OA 1YIJV 1R3JC 2GSMB 2HVKC 4FMTA 1PNMA 4UVBA 5IDJA 2NNUA 1CEZA 1QCEA 2EJRA 2DQ0A 2XAJA 3SPGA 4RUFA 5LHHA 2PI4A 3ABMC 1VQ4V 4KFMA 1SZTA 1QVFU 3CCJV 4F4LA 4X8AA 3T4ZA 2LP7A 1NVPD 1AI7A 3FB7C 2IJHA 1OZ0A 4GCZA 4GX0A 2WLKA 1KKDA 1KP3A 2BOBC 1OHHG 5EK0A 5CN0A 4MVSA 3GB7C 1GM9A 3PJSK 5L3CA 4JASA 3WFVA 1CPYA 3K04A 1W0KG 1M90W 3E86A 3P32A 5L3BA 4MS2A 3ASNB 5B1AB 3ZCCA 5LHIA 2JEUA 1SESA 2B1GA 2AHZA 5EBWC 5DN6G 4KP4A 3CCLV 3ZRWB 3LSQA 1MABG 3ETDA 2P7TC 2XNDG 1VQ8V 3OUSA 1OCOB 4PA9A 1PNKA 1R6NA 5EC1C 1M1KW 3T2MA 1JJ2U 3K03A 4G27B 3AG4C 1K4CC 1YTFB 1H38A 2QM8A 1AJPA 2ZXWC 4N21A 4JPRA 3UKMA 2DYSB 1Y4MA 4Q20A 5B1OA 2Q69A 5B1BC 1W2BU 2IJIA 3K79A 1WPXA 1JVMA 1RPOA 2QKSA 1H8EG 4G28B 3CCVV 1NQTA 4WFHA 3CCQV 1ENVA 4R7CA 2H8PC 2JJ1G 1XL4A 3W7UA 3LDCA 1K34A 1KD1W 4QE9A 5HFMA 1BL8A 3ZRVA 3SPJA 2EILC 2OCCB 3FB8C 1OCRC 3ASOC 1F51A 5KUMA 2R9IA 1H8HG 2F43G 4Z1MG 1NR1A 5IYCO 4P2ZA 1K5QA 1K5SA 2QM7A 1NH2D 4P30A 4WFEA 3QO8A 4JYBA 3ABUA 3T1CA 1GO3F 4UUJC 2WSSG 4BIZA 1OCCC 4BAYA 1RM1C 2Z5UA 2QEXV 5LHGA 1QLNA 1B6QA 4MVMA 2WLIA 4MT8A 1P7BA 1F4NA 1K92A 1K7DA 3K06A 3RVZA 3LDDA 3OMIB 1QR8A 2XAGA 3E8HA 1FXKA 3OGCC 3OE7G 3TCUA 5H9CA 3SJQC 3CC2V 2YSUB 1BMFG 3OFNG 2MK3A 2JEXA 2EBOA 2IH3C 3E89A 3AG2C 2XASA 3E83A 4JTDB 5BZBA 2LFSA 5LGNA 1MSWD 2P6JA 2EIJC 3AG3B 1PKXA 3JD0A 3RW0A 2W6JG 2HLDG 4MTOA 3OR7C 2EINC 1PD3A 3JYCA 1V54C 2WLIB 2HKOA 1R3IC 3K0GA 3LSSA 3R65A 2ZD9A 1GTOA 1S76D 1FXKB 2CK3G 3ZMVA 3QNEA 2X6AA 2X6CA 3BEHA 1E79G 1JPXA 1DF5A 4UXNA 4XDKA 2ZR2A 3D3IA 2XAQA 1THZA 2UXNA 5GW7A 4I9WA 2M7WA 2HFEC 4MVRA 4I5SA 2Y69C 2OTLV 4MSWC 3LDEA 3OR6C 3CC7V 3SPHA 5CBGA 3FYEB 1YJNV 3AG1C 3CP1A 3W7TA 2QTOA 3STZC 3K3WA 5CBHA 3ABKC 4PA7A 1K3EA 3FB5C 4LBEC 4PELA 1AR1B 4GX1A 2WPDG 4WFAV 1YHQV 1QLEB 1V55B 4R6ZA 2X0LA 3T4DA 3ML0A 3AG4B 4UV9A 2ITDC 2JDIG 3B77A 5CMUA 1JX9A 3B8MA 4GX5A 1R6KA 2A0LA 3JD1A 3DGEA 2XAHA 4DO2A 4QPKA 2QA4V 3CD6V 2X6BA 2EIMC 4H33A 4J9YB 2ZDIA 1OCZB 4PA3A 2EIKB 4MTGA 3CCMV 3ABLC 2JK5C 3EHBB 3SYPA 1VQPV 4WFFA 1YSCA 1YI2V 3WG7B 4TT3G 1H2GA 3ETGA 2NLJC 3OUFA 1KQSU 1S5HC 4JTCB 1GK9A 3ZIAG 5IY5C 1VQ7V 2HG5C 1XL6A 1S77D 1Q7YW 3QO7A 5EBLC 3ZN1A 3VBBA 3P30A 2Q67A 3SYQA 3TETA 3CCRV 4RUEA 2DYRC 3SPIA 3RBZA 1JCHA 3CXCU 3NXSA 1R73A 1HWYA 1GKFA 1M9NA 3EFFK 1LNQA 3QO5A 2OTJV 1J95A 1QVGU 2ZQMA 3E2EA 1G8MA 2A9HA 1K97A 2DW4A 4FJCC 1I5XA 5LBQA 1YTFD 4XDLA 4WFGA 3AG2B 4WF9V 2Q6AA 3HPLC 2EIJB 4JGSA 4GX2A 1ORQC 1AI4A 4LCUC 2Y48A 2V1DA 4ZKIA 4FK5C 4R8CA 1V54B 1FXHA 2DQ3A 2HVJC 3E8BA 4UVAA 3ZJZA 3CMAV 1YJ9V 1VQ9V 1E1QG 1GM8A 1GMGA 3F5WC 4QPJA 3X2QC 1AROP 1Q86W 2Q68A 5HFLA 2IU0A 1G4YB 1M57C 1VQOV 4HZ3A 4BW5A 2B1IA 4N23A 2ZR3A 1OCOC 5KA5A 4WFBV 1PL0A 3TK1A 2WLLA 2IH1C 2QE7G 4E2LA 4PA6A 1R3KC 3JD4A 5KUKA 1I5YA 3G4SV 2IJJA 4JAVA 1P4RA 1SETA 3CCUV 3AG1B 1MOFA 2JIZG 3CCEV 3ABKB 3ABMB 2DYSC 3IC7A 4H37A 4U7OA 2FTKA 3OW2U 2A79B 2EZPA 1QBZA 5H6QA 1N8RW 3W7SA 2IJKA 2WLMA 4RQEA 3AEIA 2WLLB 4LP8A 3D36A 3G6EV 4RQFA 1VQMV 1DF4A 1FFTB 3M99B 3DTUB 1ROPA 5EC2C 1Q81W 2WLNA 1FS0G 4FIPC 5L3DA 1S3JA 3MHHC 4UV8A 3E35A 3CPWU 3K0DA 4HAMA 4QE7A 3ZMZA 1NR7A 2K1EA 4MW8A 3IGAC 3MHSC 3I56V 2DWEC 1AJNA 3STLC 1JOYA 3UM7A 2HJFC 4QJFB 4PDRA 4GT1A 3VOUA 2ATKC 3OMAB 4ZBMA 1NVPB 4DXWA 1NJIW 1EFRG 3ZRXA 4JTAB 5J9PC 2ZXWB 2WAMA 3F7VC 1CP9A 3I55V 5L3EA 1K33A 1FXVA 1MG1A 4J9ZB 2XOKG 4MVOA 1M56C 5B1BB 4JF3A 1SRYA 3ZRSA 1WLEA 2XAFA 1R3LC 2P67A 2W0FC 3AG3C 3BY6A 4LC1A 3LUTB 1E1RG 1S72V 3MD0A 3JD2A 3ETEA 3OEHG 4P9PA 3ZRWA 2EILB 1OCRB 3ASOB 1AJQA 4PDVA 2EZOA 1AI5A 1KP2A 1FXKC 2IU3A 4PDMA 5DM6V 3ZMTA 1F4MA 4MTFA 1UJWB 2AHYA 5B3SC 1K4DC 1KECA 1K8AW 2IW5A 4RO2A 1IXMA 1OCCB 3HB3B 1RM1B 2PI5A 3JD3A 3X2QB 1EZJA 5FL7G 3LNMB 3B8NA 4RAIA 2P90A 5E1AC 4CZZA 4CBCA 3A0RA 1Y66A 2B5UA 1K9MW 1M57B 1RPRA 4BIUA 4MVQA 1SERA 2W6IG 3FB6C 1K73W 3FYIB 2X7RB 1QLEC 4R50A 1V55C 2JJ2G 1AI6A 4JAUA 1VQLV 5CBFA 4QIWF 3CYOA 3E8GA 5LGTA 1YJWV 5B1NA 4XDJA 1VQ5V 1BHBA 1JQ0A 1NH2B 5L3FA 3W7XA 2EINB 3ZMSA 1OCZC 2EIKC 2LFRA 4MW3A 1KC8W 3E8FA 2BOCC 3ASNC 5B1AC 3OEEG 5KA6A 4MVUA 1COWG 4WCEV 2R9RB 1F23A 3JCZA 3WG7C 5L3GA 4PA4A 4XBFA 3ABTA 4MTXA 4UVCA 3H01A 1EBOA 5EBMC 2C2AA 3W7WA 5IYDO 1QR9A 2ITCC 3K08A 1YITV 2D3OW 3IFXA 2WLHA 1Q82W 4FPPA 2Y69B 1VQNV 4YXWG 5LGUA 2ZDIC 5C93A 1W0JG 4X89A 4MVZA 4TWKA 2UXXA 2YEVA 4TSFG 2Z3YA 3ZN0A 1S0VA 2DWDC 4L87A 4G2KA 2V7QG 4JYCA 1DLBA 2WWWA 4EKWA 3CC4V 4KUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDL A;  2EIL C;  4JTC B;  3SYA A;  5IY5 C;  3FB8 C;  2HG5 C;  4DXW A;  1OCR C;  3SPJ A;  3ASO C;  1XL6 A;  5KUM A;  4JTA B;  3SYC A;  5J9P C;  3KG2 A;  3F7V C;  2OCC C;  3SYO A;  5EBL C;  3SPC A;  4P2Z A;  3TET A;  1ZWI C;  2Q67 A;  3SYQ A;  4P30 A;  4J9Z B;  4WFE A;  4RUE A;  2DYR C;  1M56 C;  4MVO A;  3RBZ A;  3SPI A;  4OXS A;  3T1C A;  3F7Y C;  3ZRS A;  1R3L C;  4UUJ C;  1OCC C;  2W0F C;  3AG3 C;  3EFF K;  1LNQ A;  3LUT B;  2KB1 A;  4QNH B;  4X88 A;  4MVM A;  4P9P A;  1J95 A;  2WLI A;  1P7B A;  3K06 A;  4PDV A;  3RVZ A;  2A9H A;  3LDD A;  3VOU A;  3E8H A;  3OGC C;  4XDL A;  3RVY A;  4WFG A;  4PDM A;  3SJQ C;  3TCU A;  2WLJ A;  2Q6A A;  3HPL C;  4HYO A;  4MTF A;  4P9O A;  2AHY A;  1R3J C;  2IH3 C;  5B3S C;  3E89 A;  1K4D C;  1ORQ C;  3AG2 C;  3E83 A;  4GX2 A;  4JTD B;  4LCU C;  2HVK C;  4RO2 A;  5BZB A;  2EIJ C;  3OUF A;  4R8C A;  2HVJ C;  3SPG A;  3E8B A;  3ZJZ A;  4RUF A;  3RW0 A;  4MTO A;  3LNM B;  3OR7 C;  3ABM C;  2EIN C;  4RAI A;  3JYC A;  4KFM A;  1V54 C;  2WLI B;  5E1A C;  1R3I C;  4CBC A;  3F5W C;  3K0G A;  4X8A A;  3X2Q C;  4F4L A;  3T4Z A;  4MVQ A;  2Q68 A;  3FB7 C;  3R65 A;  2WLK A;  2ZD9 A;  3FB6 C;  4GX0 A;  1G4Y B;  1KKD A;  2BOB C;  1M57 C;  5EK0 A;  4HZ3 A;  2X6A A;  2X6C A;  4BW5 A;  4R50 A;  1QLE C;  1OCO C;  3GB7 C;  1V55 C;  3BEH A;  4MVS A;  3PJS K;  4XDK A;  2WLL A;  2IH1 C;  3K04 A;  5CBF A;  4PA6 A;  1R3K C;  3E8G A;  4I9W A;  3E86 A;  5KUK A;  2HFE C;  4MVR A;  4XDJ A;  2Y69 C;  4MS2 A;  4MSW C;  3LDE A;  3OR6 C;  2DYS C;  3SPH A;  5CBG A;  1OCZ C;  2AHZ A;  4H37 A;  2EIK C;  4MW3 A;  5EBW C;  3AG1 C;  3E8F A;  2BOC C;  2QTO A;  3ASN C;  5B1A C;  3STZ C;  3ABK C;  4PA7 A;  5CBH A;  3FB5 C;  4LBE C;  4MVU A;  2P7T C;  4GX1 A;  3OUS A;  2A79 B;  2R9R B;  4PA9 A;  4R6Z A;  2WLM A;  4PA4 A;  3T4D A;  3WG7 C;  5EC1 C;  2ITD C;  2WLL B;  4LP8 A;  3T2M A;  5EBM C;  3K03 A;  4G27 B;  2A0L A;  4GX5 A;  3AG4 C;  2ITC C;  3K08 A;  1K4C C;  3IFX A;  2WLH A;  2ZXW C;  5EC2 C;  2WLN A;  3UKM A;  2X6B A;  2EIM C;  4H33 A;  4J9Y B;  4PA3 A;  3K0D A;  4MTG A;  2Q69 A;  4X89 A;  3ABL C;  2JK5 C;  5B1B C;  4MVZ A;  4QE7 A;  4TWK A;  1JVM A;  2QKS A;  2YEV A;  4G28 B;  4WFF A;  3SYP A;  2K1E A;  4MW8 A;  4WFH A;  3IGA C;  2DWE C;  2DWD C;  4R7C A;  2H8P C;  1XL4 A;  3STL C;  3UM7 A;  2HJF C;  3LDC A;  4PDR A;  4EKW A;  4QE9 A;  2ATK C;  2NLJ C;  1BL8 A;  1S5H C;  4ZBM A; 
#chains in the Genus database with same CATH topology
 4ZOL A;  1DTO A;  2KQX A;  4JYA O;  2DE0 X;  3KKY A;  4TUY B;  2HR3 A;  1GM7 A;  3SYC A;  3UO3 A;  1N36 O;  5KAI Z;  4NXN O;  3SYO A;  3K58 A;  2CGN A;  3SPC A;  1VQ6 V;  1H2K A;  3OT7 A;  1VEW A;  4OXS A;  3BRC A;  5IJ9 B;  3OM3 B;  4QNH B;  4X9Q A;  4J41 A;  3UQ8 A;  2RMK B;  4CC6 A;  3A2F A;  4UB6 Z;  3OAA G;  3CCS V;  2GHY A;  4FLV A;  1BHA A;  2WLJ A;  1TUE B;  4P9O A;  3RT3 C;  3SJC C;  2QWN B;  1H2S B;  1PNM A;  3JSN A;  4DR1 B;  2NNU A;  3CE2 A;  1QCE A;  2EJR A;  3CRC A;  1T5E A;  2XAJ A;  4RUF A;  4DR5 B;  5JVD A;  1VQ4 V;  1QVF U;  2WLK A;  1KKD A;  1KP3 A;  3IJ4 A;  5LP6 C;  1GM9 A;  4J80 A;  4IIJ B;  2YIC A;  5BXZ A;  3K04 A;  4LFB O;  4AIL C;  1PP9 H;  3BHP A;  5JQG A;  4PI2 A;  1SKV A;  2Y0P A;  4MS2 A;  3N27 A;  5KMG B;  1SES A;  2B1G A;  2AHZ A;  4DR2 O;  5EBW C;  4L8J A;  3T1Y B;  3CCL V;  4U3J B;  3ZRW B;  2ZIN A;  1Y74 A;  2XND G;  3OUS A;  1PNK A;  4EB6 A;  2ZCE A;  3QG5 A;  4JI6 B;  4I4T B;  1K4C C;  1H38 A;  2L6L A;  2ZXW C;  1FD9 A;  2GUZ B;  4JPR A;  1HNZ O;  5LA6 B;  4DW1 A;  2F1M A;  5B1O A;  1BSM A;  5FLX N;  2QKS A;  4DV4 B;  4JI1 O;  1XL4 A;  5HFM A;  3SPJ A;  1WB7 A;  2JGU A;  3ASO C;  1F51 A;  2R9I A;  1RSO A;  4J11 A;  1K5S A;  1N0J A;  4CS2 A;  1NH2 D;  2ARH A;  4P30 A;  2FYU H;  1JMK C;  1RM1 C;  2QEX V;  1QLN A;  1B6Q A;  1WB8 A;  4DV1 B;  4MT8 A;  1P7B A;  1G6U A;  2XAG A;  1FXK A;  3OGC C;  5H9C A;  1MA1 A;  4O4J B;  1Y76 B;  5LGN A;  1MSW D;  3AG3 B;  3JD0 A;  3A0B Z;  4JI0 B;  4MTO A;  1H2M A;  4TOI A;  2EIN C;  3JYC A;  3IC9 A;  2HKO A;  3T1H O;  3JAS A;  3R65 A;  1GTO A;  1IDS A;  3ZMV A;  3CJH A;  5LYJ B;  2ADP A;  3HR0 A;  1W59 A;  1CXZ B;  1JPX A;  4UXN A;  4XDK A;  3BAA A;  3QF7 A;  5GW7 A;  2P06 A;  4CH4 A;  1L0N H;  2VQE B;  3JAT B;  4MSW C;  5KHK A;  2QTO A;  3STZ C;  3ABK C;  4FFB B;  1K3E A;  4DUZ O;  4K8X A;  4WFA V;  1FJG O;  4PHZ A;  1NI8 A;  1V55 B;  2X0L A;  5C8Y B;  3ML0 A;  4UV9 A;  2ZKO A;  4F6R B;  4GX5 A;  1R6K A;  4YY3 O;  1AP6 A;  2G38 A;  4DO2 A;  4WBN A;  1N32 B;  1I08 A;  4H33 A;  2ZDI A;  4PA3 A;  5FPO A;  1D2D A;  3G6B A;  1IX9 A;  3EHB B;  3CRA A;  1NT2 B;  1SC5 B;  4DK1 A;  1RP3 B;  5EZY A;  1ZL8 B;  4B7E A;  2RDC A;  1KQS U;  2BSK B;  1N33 O;  4D7T A;  1XL6 A;  3FAV B;  3QO7 A;  3H9V A;  4B3R O;  3VBB A;  3P30 A;  2Q67 A;  5LMN B;  1XMQ B;  5JWP A;  4RUE A;  3SPI A;  2CDY A;  2UXC B;  1ZAU A;  1AVM A;  1VIB A;  1GKF A;  1M9N A;  3CRQ A;  4DV5 B;  5LL6 Y;  2CUG A;  2DMX A;  4LF6 B;  1J95 A;  1QVG U;  2CE4 A;  3SR2 C;  3L72 H;  1P84 F;  2E76 B;  3JAR A;  4WFG A;  4FZ1 A;  2Q6A A;  4DV6 B;  1JJO A;  3H1H H;  4GX2 A;  1ORQ C;  5BMV A;  5KHI A;  4GKJ O;  2V1D A;  5JCO C;  4X1K A;  1Z2G A;  2DQ3 A;  3E8B A;  4K0K O;  2ODM A;  2YI9 A;  1GMG A;  1ARO P;  3J7A U;  5HFL A;  3HKE A;  2W0X A;  2IU0 A;  3TJT A;  4HZ3 A;  2B1I A;  5KA5 A;  1IBK O;  4O4I A;  2WLL A;  2UUB O;  4ZI7 A;  4PA6 A;  2D2C B;  1L8D A;  1XI1 A;  4J7Z A;  2P22 C;  1FPO A;  3CCU V;  3JAW B;  2JIZ G;  3CCE V;  3G67 A;  4U7O A;  1P7G A;  2FTK A;  2PY5 A;  1SQQ H;  2A79 B;  3HKB A;  4IYI A;  5LP6 B;  1U96 A;  4LWS B;  1AIL A;  4RQE A;  1TUB B;  2Q4P A;  3D36 A;  3G6E V;  4NR1 A;  1J5E B;  4JYA B;  4GZR B;  1N36 B;  4X64 O;  1Q81 W;  4NXN B;  2WLN A;  4FIP C;  5FNV A;  3ZBH A;  3E22 A;  2WA3 A;  1Q6I A;  4UV8 A;  3E35 A;  3CPW U;  2F23 A;  4Z2W A;  3L74 H;  4MW8 A;  3MHS C;  3I56 V;  2DWE C;  2E75 B;  2HJF C;  2ATK C;  1TAE A;  1NZ6 A;  2ZE5 A;  3WB2 A;  4AHC A;  4CS4 A;  2BCC H;  2ZE8 A;  1XIL A;  4AQY O;  2ZXW B;  4C7U A;  1CP9 A;  4X66 O;  4JZ2 A;  5L3E A;  4DV0 B;  1X59 A;  4DR4 O;  4MVO A;  2R72 A;  2W0F C;  4NYK A;  3BY6 A;  3LUT B;  5E79 Z;  4ZIB A;  3HKC B;  4P9P A;  2FKX A;  4AI8 A;  3ASO B;  1L0L H;  5JH7 B;  4X20 A;  2VQF O;  1FXK C;  3B09 A;  4I55 B;  5JJE B;  2IU3 A;  4PDM A;  3ZMT A;  4O4L A;  3BCC H;  4DR6 B;  1UJW B;  2AHY A;  1KEC A;  4I50 A;  4E4E A;  4FM0 A;  1IXM A;  1BE3 H;  2ZM6 O;  1RM1 B;  4NXM O;  4RAI A;  4J42 A;  5E1A C;  4CZZ A;  4CBC A;  3A0R A;  1Y66 A;  2B5U A;  4BIU A;  1RPR A;  4UCR A;  5K1X A;  3FYI B;  4JI5 O;  2QKC A;  1VQL V;  3CYO A;  5LGT A;  1VQ5 V;  4XDJ A;  1SQB H;  1GN2 A;  2EIN B;  1HNZ B;  3N2K B;  2L35 A;  1OCZ C;  2LFR A;  3D3Q A;  3E8F A;  3R66 A;  4Z1V A;  4FLY A;  4X1Y B;  2AZ0 A;  3JAL A;  4DUY B;  4JI1 B;  3JCZ A;  3WG7 C;  3SJA C;  4YJ2 B;  3RYF B;  5IYD O;  1HR0 O;  3VQX A;  2QR4 A;  3IFX A;  2ZDI C;  5CA0 A;  1JFF A;  2OWO A;  2ZIO A;  2UXX A;  4I0X B;  2Z3Y A;  5FPR A;  3KCX A;  3ZN0 A;  2EUL A;  4LF5 B;  5ITZ A;  2Q9L A;  4EKW A;  1SQG A;  3CC4 V;  3SYA A;  3J81 N;  2N74 A;  3WU2 Z;  1NKD A;  3KG2 A;  1M56 B;  2H94 A;  1ZWI C;  4DRX B;  2GTS A;  3VQV A;  4ASU G;  3F7Y C;  5K1P A;  1Z5V A;  1NS1 A;  2F93 B;  1HNW O;  4ZOL B;  4YJ3 A;  4JI7 O;  2OT5 A;  5CA1 A;  2Y4U A;  5B3S B;  4BIO A;  5H2F Z;  4U3F H;  4HYO A;  4JI4 O;  4I9Q A;  4FMT A;  4IHJ B;  4UVB A;  4B7K A;  1CEZ A;  2KSD A;  3SPG A;  1I7F A;  3ABM C;  1PL4 A;  1SZT A;  3ETQ A;  4YHH O;  3JAK B;  2JS3 A;  2UXD O;  3T4Z A;  1AI7 A;  2IJH A;  4TV9 B;  4DUZ B;  1UFI A;  4X62 B;  1AR4 A;  3DC5 A;  2PTM A;  3GB7 C;  2VWK A;  3WFV A;  1W0K G;  1M90 W;  3E86 A;  3G80 A;  3P32 A;  5L3B A;  5B1A B;  5GON B;  1LUW A;  2QTS A;  4JI8 O;  1MAB G;  2PF4 E;  3C3T A;  1R6N A;  4FLU A;  1XMO B;  1JJ2 U;  1N33 B;  3K03 A;  4LNU A;  5JQG B;  2K9P A;  1YTF B;  5LMU O;  2PZS A;  1V9P A;  4B3R B;  1VAR A;  4LH7 A;  3O65 A;  3WB0 A;  4Q20 A;  5B1B C;  4ICG A;  4FZ0 A;  4DV2 O;  1SQF A;  1JVM A;  1Y74 B;  4WFH A;  3CCQ V;  1ENV A;  4EB6 B;  4QE9 A;  3U10 A;  1UPG A;  1BL8 A;  5B5E Z;  3ZRV A;  4OX9 O;  2OCC B;  3FB8 C;  2ZNJ A;  4X65 O;  5KUM A;  4PJ0 Z;  2OIG A;  4Z1M G;  4P2Z A;  1K5Q A;  4BW9 A;  2Q8V A;  1QQC A;  3QO8 A;  3ABU A;  3UT5 A;  1RFY A;  4GKJ B;  1HNX O;  1OCC C;  1PM9 A;  4H44 B;  3K59 A;  2FML A;  3AG7 A;  4K0K B;  4FLW A;  4FM1 A;  2WLI A;  1K92 A;  4DW0 A;  1K7D A;  3RVZ A;  3LDD A;  3OMI B;  3TCU A;  3CC2 V;  1EN5 A;  1SA0 A;  2JEX A;  1N34 O;  2UUB B;  2P6J A;  1PKX A;  4FM2 A;  1YDX A;  1D5A A;  1R3I C;  1DK1 A;  3K0G A;  1Q8I A;  1BT8 A;  3LSS A;  1SQV H;  1FXK B;  2CK3 G;  2X6C A;  3HKD A;  1E79 G;  1PPJ H;  5D5Q A;  4W4K A;  2ZR2 A;  2XAQ A;  1THZ A;  1ZSP A;  4Q6G A;  2M7W A;  3ZHQ A;  4UCO A;  2OTL V;  3LDE A;  5KX5 A;  3CC7 V;  3UO2 A;  5CBG A;  4LF7 O;  1LR1 A;  3CP1 A;  5J2U B;  2Q7H A;  3K3W A;  5CBH A;  4LF4 B;  2RJZ A;  2JGD B;  5DED A;  2E5L O;  4PEL A;  4GX1 A;  2WPD G;  3CJH B;  1YHQ V;  2CH7 A;  2ITD C;  3B77 A;  2LQT A;  2JRI A;  3L71 H;  4ABM A;  2A0L A;  3JD1 A;  4UCT A;  3OTO O;  3DGE A;  2XAH A;  2AGA A;  4QPK A;  2QA4 V;  4J9Y B;  4CH5 A;  1OCZ B;  5IWA O;  4DR4 B;  4MTG A;  3ABL C;  4DR3 O;  5LXT A;  2CTR A;  1Y6X A;  3WG7 B;  3ZHU A;  4BWA A;  2NLJ C;  4CH3 A;  1S5H C;  3ZIA G;  5IY5 C;  5D5P A;  3RYC A;  1S77 D;  1Q7Y W;  1Q6H A;  2VQF B;  5EBL C;  4K8Z A;  3SYQ A;  3CCR V;  2DYR C;  3CXC U;  3NXS A;  4DV3 O;  5KHG A;  2ZM6 B;  5EZY B;  2YIB D;  3K5M A;  1LNQ A;  4NXM B;  2OTJ V;  1GAX A;  3E2E A;  2DW4 A;  1Q43 A;  4FJC C;  1I5X A;  3K9S A;  3MDS A;  4JI3 O;  5LBQ A;  1YTF D;  1XNR O;  3AG2 B;  1YZB A;  4H0L B;  2EIJ B;  2CTQ A;  4LCU C;  2Y48 A;  2QWQ B;  1V54 B;  2IBZ H;  1XUQ A;  1QHT A;  1VQ9 V;  1E1Q G;  1GM8 A;  2HJD A;  5J2T A;  2Q68 A;  1G4Y B;  3JAR B;  4BW5 A;  4N23 A;  2ZR3 A;  3S3X A;  1GN4 A;  4JAA A;  3CEI A;  1PL0 A;  2F4V O;  3BA8 A;  1BZK A;  4TUY A;  3ZHS A;  2A06 H;  3J80 N;  2HHH O;  4X1K B;  4LFA B;  1KBH A;  3AG1 B;  1MOF A;  3ABM B;  3IC7 A;  4H37 A;  1BGY H;  1M93 A;  4CS3 A;  5IJ9 A;  3H1L H;  3BPZ A;  2UUA B;  2F95 B;  2EZP A;  5H6Q A;  1N8R W;  3L70 H;  4O4I B;  2WLL B;  3ZHT A;  1FFT B;  3M99 B;  1DGS A;  3CRM A;  2XHB A;  3MHH C;  2PYJ A;  3K0D A;  4HAM A;  3B4S A;  4B3T O;  2K1E A;  3IGA C;  1JOY A;  3UM7 A;  1HNW B;  4ZBM A;  5KAF Z;  1NJI W;  2ZE6 A;  2MW2 B;  2QWP B;  5FNV B;  3LSU A;  4IYH A;  4PD4 F;  4J9Z B;  1M56 C;  5B1B B;  4JI4 B;  1H2N A;  1VF6 A;  1WLE A;  2XAF A;  5A2Q N;  3JD2 A;  4U3J A;  2R9A A;  3ZRW A;  3U11 A;  1AJQ A;  2EZO A;  1AI5 A;  1FKA O;  2CGO A;  2LGW A;  1F4M A;  4I4T A;  1IBL B;  5B3S C;  4LF9 O;  2OIE A;  1K8A W;  4RO2 A;  2GUZ A;  3SDL A;  1OCC B;  5EIB C;  4DR7 O;  1Q90 D;  5LA6 A;  3X2Q B;  1NTK H;  1M57 B;  5AG2 A;  2R70 A;  2X7R B;  1YXB A;  1Y67 A;  3QTC A;  4BR6 A;  4I50 B;  5CBF A;  4QIW F;  3E8G A;  5B1N A;  4JYY A;  3RYI A;  2YXY A;  5LMU B;  4LF8 B;  1NTZ H;  1EM1 A;  5L3F A;  3W7X A;  3ZMS A;  5B1A C;  4FLT A;  5KA6 A;  4MVU A;  1COW G;  4WCE V;  2R9R B;  1F23 A;  4PA4 A;  4UVC A;  4MTX A;  5EBM C;  1QR9 A;  3B40 A;  1YIT V;  1Q82 W;  3D8C A;  4O4J A;  1Y76 A;  5LGU A;  1M4U A;  1W0J G;  3EVK A;  4O4H A;  4LFC O;  2YEV A;  1HP8 A;  1S0V A;  2OYQ A;  4L87 A;  2KKW A;  2V7Q G;  4JYC A;  1DLB A;  2WWW A;  2CTW A;  4PDL A;  3CME V;  1BS3 A;  3OMN B;  2OCC C;  3TXQ A;  3VQY A;  2YS8 A;  4O2A B;  5CA0 B;  3G71 V;  1L1F A;  1JFF B;  3AK1 A;  1PNL A;  3ABL B;  1N34 B;  1JA8 A;  3JAT A;  5IJ0 B;  4U7N A;  4X88 A;  4FFB A;  5IY5 B;  3ZMU A;  1US6 A;  4FFK A;  5C8Y A;  3RVY A;  4KXR A;  2DN9 A;  4F6R A;  5IE9 A;  2DYR B;  2FL4 A;  1YIJ V;  2AXT Z;  1I94 O;  2HVK C;  5IDJ A;  4YIP A;  2ADQ B;  2VWJ A;  3H1J H;  5CB4 A;  2YXH A;  3WB1 A;  4KFM A;  4YIO A;  2LP7 A;  3ZS8 C;  1ZL8 A;  1OZ0 A;  4GCZ A;  5CA1 B;  4GX0 A;  2E5L B;  2ETN A;  1OHH G;  5CN0 A;  1VF5 B;  1YF2 A;  4JAS A;  1CPY A;  2ZE7 A;  5B66 Z;  3OTO B;  2BTQ A;  4LFB B;  1WA8 B;  3ASN B;  4TV8 A;  3BAB A;  4K3A A;  1XOU A;  1IVS A;  5IWA B;  4HNA A;  4DR2 B;  2P7T C;  4DR3 B;  3CRR A;  4PA9 A;  5EC1 C;  1M1K W;  3T2M A;  1EN6 A;  3JCU Z;  3AK3 A;  3S3W A;  4N21 A;  1Y4M A;  4TQD A;  1XHX A;  4ZHQ A;  2IJI A;  3K79 A;  1RPO A;  4G28 B;  3CCV V;  1X4T A;  1NQT A;  1GN6 A;  4R7C A;  2H8P C;  3W7U A;  3LDC A;  2DOS A;  1AP5 A;  3Q4H A;  4LNU B;  1OCR C;  4IL6 Z;  4I7Z B;  1WN7 A;  1H8H G;  2F66 C;  3OD4 A;  1NR1 A;  3TXS A;  1XHZ A;  2QM7 A;  4JYB A;  1ZX3 A;  4IGG A;  4UUJ C;  1MZE A;  3JAW A;  4BIZ A;  4BAY A;  4LH6 A;  2A3Q A;  2Z5U A;  4DV1 O;  5LHG A;  1SQX H;  3CWB H;  2P5O A;  3RGB A;  1XEQ A;  2QWR B;  4OGQ B;  3AK2 A;  5LP6 A;  5EYP B;  1QR8 A;  3E8H A;  2YSU B;  3DXR B;  1BMF G;  4DV7 O;  1WP7 A;  2MK3 A;  2F4V B;  5IYZ B;  2IH3 C;  3AG2 C;  4JTD B;  2HHH B;  2LFS A;  2EIJ C;  3FX7 A;  1VF7 A;  2W6J G;  2HLD G;  1PD3 A;  3IAY A;  1V54 C;  2WLI B;  2ZD9 A;  1S76 D;  5DEC A;  3QNE A;  1NTM H;  3L75 H;  3T1H B;  4DK0 A;  4NTX A;  3D3I A;  1XRE A;  1KYO F;  4X1I A;  1KMI Z;  1SZX A;  2UXN A;  2VQE O;  4I9W A;  1XBL A;  4MVR A;  4I5S A;  3OR6 C;  3SPH A;  3FYE B;  3AG1 C;  3RYH A;  3CX5 F;  3K57 A;  3FB5 C;  4LBE C;  1AR1 B;  4B3T B;  4D6T H;  3SGI A;  3HKC A;  3HKD B;  4R6Z A;  3T4D A;  3AG4 B;  1R6T A;  2JDI G;  1FJG B;  5JH7 A;  1N32 O;  3B8M A;  4I55 A;  3K5N A;  5KX5 B;  4YY3 B;  2LO1 A;  2KG7 A;  1ZTE A;  2LW1 A;  2EIM C;  3K5O A;  1B06 A;  2N04 A;  1IUR A;  5JVD B;  2QWO B;  2PUS A;  1TVK A;  3ICX A;  4WFF A;  3KZI Z;  1YI2 V;  4TT3 G;  4EFB A;  2CH7 B;  1KKC A;  3ETG A;  1XNQ O;  3SJB C;  4JTC B;  1GK9 A;  1VQ7 V;  2EX3 A;  3D36 C;  3ZN1 A;  5IT9 N;  4JV5 O;  1GH6 A;  2Y0I A;  4UCV A;  3RBZ A;  1JCH A;  4B3S O;  3DC6 A;  2Q7E A;  4DV5 O;  1ZUQ A;  3N2K A;  1URF A;  2QGN A;  1D5N A;  2YID A;  5TIS Z;  2YUA A;  2ZQM A;  2ZIM A;  1K97 A;  4DV6 O;  1B3Q A;  4YJ2 A;  4XDL A;  3RYF A;  3I5D A;  2Q73 A;  1I0H A;  4NKG B;  1QNM A;  4ZKI A;  4FK5 C;  4R8C A;  1FXH A;  2RNB A;  3ZJZ A;  3CMA V;  2UXB O;  1MNG A;  2DJV A;  5LOV A;  2WA4 A;  4I0X A;  4QPJ A;  3X2Q C;  1Q86 W;  3RN4 A;  1WPB A;  2GBO A;  1M57 C;  1VQO V;  4WFB V;  1OCO C;  1RSO B;  1HW7 A;  1Q3E A;  1QU7 A;  4E2L A;  2IH1 C;  2QE7 G;  1O9H A;  1YEW A;  3CHX A;  1IBK B;  4B08 A;  1I5Y A;  5KUK A;  4JAV A;  1SET A;  2RCV A;  4W4L A;  4DRX A;  4GUN A;  2DYS C;  4KL1 A;  2Q5Z A;  3OW2 U;  2O57 A;  1QBZ A;  3UCS C;  3W7S A;  1J5E O;  1WJZ A;  3AEI A;  3JAM N;  2XT9 A;  5A9G A;  4RQF A;  3DTU B;  1BQ0 A;  1ROP A;  3JSL A;  5L3D A;  4IHJ A;  4X64 B;  2LJ2 A;  3ZMZ A;  1NR7 A;  3JAS B;  1AJN A;  3STL C;  3BFR A;  2UUC O;  3JAK A;  5GTH Z;  4PDR A;  4QJF B;  3VOU A;  3OMA B;  4TV9 A;  1NVP B;  1EFR G;  3ZRX A;  4J10 A;  4DV0 O;  5EIB D;  3F7V C;  3I55 V;  1FAF A;  4AQY B;  1K33 A;  1FXV A;  1MG1 A;  5JCO A;  1ZLZ A;  4X66 B;  4JF3 A;  3ZRS A;  1I94 B;  5GON A;  2YDE A;  4LC1 A;  1S72 V;  1M5I A;  3ETE A;  3OEH G;  2YIB A;  5GTI Z;  1OCR B;  4PDV A;  2VRZ A;  4DR6 O;  2EJ7 A;  3M7M X;  2GV9 A;  1NU1 H;  4WBN B;  4MTF A;  1K4D C;  2IW5 A;  1KB9 F;  4PI0 A;  2NN4 A;  3HB3 B;  2PI5 A;  3JD3 A;  4UCU A;  1SF9 A;  1EZJ A;  3LNM B;  3B8N A;  2P90 A;  2PYL A;  1IBM O;  1JR9 A;  2W6I G;  3C90 A;  1K73 W;  4OPA A;  3CS5 A;  3THO A;  4R50 A;  1QLE C;  5BR8 O;  2JJ2 G;  1AI6 A;  5BY1 A;  1WNS A;  2YC0 A;  4O2B A;  2HEP A;  1FFX A;  4JZG A;  4JI5 B;  1YJW V;  1BHB A;  4JI2 O;  2EIK C;  4MW3 A;  4DUY O;  4B3M O;  3ASN C;  3P3N A;  3OEE G;  3A8T A;  2NR5 A;  4OPH A;  5L3G A;  4XBF A;  3N2G A;  1S5J A;  2C2A A;  3W7W A;  2YXL A;  3O9O A;  2JS5 A;  2WLH A;  3QVN A;  3RYI B;  5BMV B;  4FPP A;  1HR0 B;  1OJH A;  3A0H Z;  2RN9 A;  1Q5O A;  4LF5 O;  3HKE B;  2Q0O C;  4G2K A;  4NTW A;  4KUM A;  2FB5 A;  3LNN A;  4A5U B;  4ZI7 B;  1NBM G;  2QSA A;  2EIM B;  5IYB O;  3GWO A;  4DV7 B;  4O4H B;  3K9A A;  2YEV B;  3EXA A;  1VQK V;  2KB1 A;  5J2U A;  3HKB B;  5H6R A;  2JGD A;  2Y4T A;  4EEQ A;  1MMM A;  3KCY A;  5CA3 A;  4UFZ A;  1F7Y A;  5KHH A;  4JI7 B;  3FKS G;  4IIJ A;  1R3J C;  1Q6U A;  3E22 B;  2GSM B;  4DYL A;  1A32 A;  2DQ0 A;  5LHH A;  2PI4 A;  3FD9 A;  5KMG A;  4TQF A;  4X62 O;  3CCJ V;  4F4L A;  4X8A A;  4PV1 B;  1NVP D;  2H3O A;  3FB7 C;  3H1K H;  4UCS A;  2CAZ C;  4YHH B;  2BOB C;  2UXD B;  5EK0 A;  4KHP O;  4MVS A;  2XTA A;  3PJS K;  5L3C A;  2HP8 A;  2A7W A;  1S5L Z;  1YVW A;  5CB4 B;  3ZCC A;  5LHI A;  2JEU A;  3ZED A;  5DN6 G;  4KP4 A;  3LSQ A;  3MAQ A;  3ETD A;  5H5N A;  1VQ8 V;  4X20 B;  1OCO B;  4JI8 B;  1XMO O;  1G1X B;  3P3P A;  1XNQ B;  4O4L B;  1BQZ A;  4G27 B;  1FYJ A;  3AG4 C;  2BTQ B;  2RQ6 A;  1XQ8 A;  2QM8 A;  1AJP A;  1VP7 A;  2ZT9 B;  4TV8 B;  3OTF A;  3UKM A;  2DYS B;  1O9G A;  4NTY A;  4JV5 B;  4UB8 Z;  2Q69 A;  1W2B U;  1WPX A;  4HNA B;  4B3S B;  1H8E G;  1B04 A;  1YCI A;  4K35 A;  4DV2 B;  3H1I H;  2JJ1 G;  1K34 A;  1KD1 W;  2EIL C;  2F43 G;  4OX9 B;  2UU9 O;  2Q0A A;  5IYC O;  2JVD A;  4X65 B;  4WFE A;  4ZHQ B;  3T1C A;  4FLZ A;  1GO3 F;  4GKK O;  3TGU H;  2WSS G;  3JAL B;  1HNX B;  1WAZ A;  2GTA A;  2UXB B;  2E74 B;  4MVM A;  3Q4H B;  3RWR D;  1F4N A;  3NR7 A;  3K06 A;  1PV0 A;  4H13 B;  5LYJ A;  3OE7 G;  3SJQ C;  3OFN G;  2EBO A;  3ZHR A;  3E89 A;  2XAS A;  3E83 A;  5BZB A;  3F5T A;  1P49 A;  2QJ1 A;  3B2E E;  3RW0 A;  3CXH F;  3OR7 C;  2LW7 A;  5ITZ B;  1BCC H;  1MZF A;  2X6A A;  3BEH A;  1DF5 A;  4CH6 A;  2VS0 A;  4DR1 O;  2HFE C;  4DR5 O;  2Y69 C;  4LF4 O;  1HDJ A;  3BVO A;  1YJN V;  3W7T A;  4PA7 A;  4LF7 B;  4YJ3 B;  2BE3 A;  1QLE B;  2YIA A;  2UUC B;  2GDS A;  5CMU A;  4X1I B;  1JX9 A;  2BSK A;  3K5L A;  3FAV A;  2BTO A;  3CD6 V;  4D7S A;  2X6B A;  2EIK B;  3T1Y O;  3C3S A;  3RYH B;  1TGO A;  3CCM V;  2JK5 C;  4RWU A;  3SYP A;  1VQP V;  1GRJ A;  1YSC A;  5KHJ A;  1H2G A;  4JI6 O;  3OUF A;  2HG5 C;  1SQP H;  2KG7 B;  1TA8 A;  3TET A;  5JJJ B;  1R73 A;  1TVK B;  1HWY A;  1IXB A;  4DV4 O;  3EFF K;  4DV3 B;  3BA9 A;  3QO5 A;  1IBM B;  1G8M A;  2A9H A;  5BR8 B;  4WF9 V;  3HPL C;  3PN1 A;  1SS3 A;  4JI3 B;  4JGS A;  1XNR B;  1AI4 A;  2HVJ C;  1VF6 C;  4UVA A;  4IT5 A;  1YJ9 V;  4JI2 B;  2CTP A;  1AB3 A;  3F5W C;  4B3M B;  1N0N A;  2OCH A;  4J7J A;  2E3C A;  1XDC A;  4LWS A;  3ZHV A;  4LFA O;  1TUB A;  3TK1 A;  1R3K C;  3JD4 A;  3L73 H;  3G4S V;  2IJJ A;  3UT5 B;  1P4R A;  4O2A A;  4JI0 O;  1OV9 A;  3ABK B;  3GWK C;  5LOV B;  2UUA O;  3U0Z A;  3GVM A;  2ZNI A;  5IJ0 A;  1VMG A;  2IJK A;  5F2V O;  2WLM A;  4LP8 A;  1SA0 B;  3VQW A;  1VQM V;  1DF4 A;  3CSX A;  4EFE A;  5EC2 C;  1FS0 G;  1S3J A;  2XUM A;  2Q7G A;  4QE7 A;  1IZ3 A;  1EN4 A;  2PGG A;  5JJN B;  2AW9 A;  2P4K A;  4HBN A;  4GT1 A;  3CB2 A;  4DXW A;  4JTA B;  5J9P C;  2WAM A;  4FLX A;  1AR5 A;  2QDO A;  2XOK G;  1GN3 A;  4GLX A;  1SRY A;  2V4D A;  1R3L C;  2P67 A;  1WA8 A;  3AG3 C;  4LR3 A;  1E1R G;  1KUQ A;  3MD0 A;  2YI8 A;  2EIL B;  1KP2 A;  1U97 A;  1IBL O;  1EZV H;  2AZ2 A;  4KHP B;  3APQ A;  5DM6 V;  5LMN O;  1XMQ O;  4NB5 A;  2N05 A;  2UXC O;  4FVM A;  4QGP A;  1KU9 A;  4LF9 B;  5LXT B;  5FL7 G;  4NVP A;  4DR7 B;  4LF6 O;  2ILM A;  3L9D A;  2QM4 A;  1K9M W;  4MVQ A;  1SER A;  4X1Y A;  3FB6 C;  3RYC B;  1Z5W A;  1V55 C;  1LUV A;  4JAU A;  4LF8 O;  2B9Z A;  4CC5 A;  1JQ0 A;  4F6E A;  1NH2 B;  2M6Y A;  1H2L A;  1KC8 W;  2BOC C;  1WP8 A;  4J7K A;  2Z0A A;  1MSD A;  3DSQ A;  1R1B A;  1N4C A;  3ABT A;  3H01 A;  4O2B B;  1EBO A;  5EYP A;  2IM9 A;  1FFX B;  2ITC C;  3K08 A;  2D3O W;  3DXR A;  2UU9 B;  2Y69 B;  3RFR A;  1VQN V;  4YXW G;  5IYZ A;  5KLV H;  2P4V A;  3OGI B;  5C93 A;  4X89 A;  4MVZ A;  2QKA A;  4TWK A;  4TSF G;  5J2T B;  4GKK B;  2DWD C;  3ZX6 A;  4LFC B;  3FFQ A;  2LGQ A;  3M8A A;  3N2G B;  4GYC B;  3APO A; 
#chains in the Genus database with same CATH homology
 4PDL A;  3CME V;  3SYA A;  1DTO A;  3OMN B;  3SYC A;  2HR3 A;  1GM7 A;  1NBM G;  1NKD A;  3KG2 A;  2OCC C;  3SYO A;  1M56 B;  3SPC A;  2H94 A;  1VQ6 V;  1ZWI C;  2EIM B;  5IYB O;  3GWO A;  3G71 V;  1L1F A;  1PNL A;  3ABL B;  4ASU G;  4OXS A;  3F7Y C;  3K9A A;  2YEV B;  1VQK V;  4U7N A;  2KB1 A;  3OM3 B;  4QNH B;  4X88 A;  5H6R A;  5IY5 B;  3ZMU A;  5CA3 A;  2OT5 A;  3OAA G;  3CCS V;  2GHY A;  5B3S B;  3RVY A;  1BHA A;  2WLJ A;  1TUE B;  3FKS G;  4HYO A;  2DYR B;  4P9O A;  1YIJ V;  1R3J C;  2GSM B;  2HVK C;  4FMT A;  1PNM A;  4UVB A;  5IDJ A;  2NNU A;  1CEZ A;  1QCE A;  2EJR A;  2DQ0 A;  2XAJ A;  3SPG A;  4RUF A;  5LHH A;  2PI4 A;  3ABM C;  1VQ4 V;  4KFM A;  1SZT A;  1QVF U;  3CCJ V;  4F4L A;  4X8A A;  3T4Z A;  2LP7 A;  1NVP D;  1AI7 A;  3FB7 C;  2IJH A;  1OZ0 A;  4GCZ A;  4GX0 A;  2WLK A;  1KKD A;  1KP3 A;  2BOB C;  1OHH G;  5EK0 A;  5CN0 A;  4MVS A;  3GB7 C;  1GM9 A;  3PJS K;  5L3C A;  4JAS A;  3WFV A;  1CPY A;  3K04 A;  1W0K G;  1M90 W;  3E86 A;  3P32 A;  5L3B A;  4MS2 A;  3ASN B;  5B1A B;  3ZCC A;  5LHI A;  2JEU A;  1SES A;  2B1G A;  2AHZ A;  5EBW C;  5DN6 G;  4KP4 A;  3CCL V;  3ZRW B;  3LSQ A;  1MAB G;  3ETD A;  2P7T C;  2XND G;  1VQ8 V;  3OUS A;  1OCO B;  4PA9 A;  1PNK A;  1R6N A;  5EC1 C;  1M1K W;  3T2M A;  1JJ2 U;  3K03 A;  4G27 B;  3AG4 C;  1K4C C;  1YTF B;  1H38 A;  2QM8 A;  1AJP A;  2ZXW C;  4N21 A;  4JPR A;  3UKM A;  2DYS B;  1Y4M A;  4Q20 A;  5B1O A;  2Q69 A;  5B1B C;  1W2B U;  2IJI A;  3K79 A;  1WPX A;  1JVM A;  1RPO A;  2QKS A;  1H8E G;  4G28 B;  3CCV V;  1NQT A;  4WFH A;  3CCQ V;  1ENV A;  4R7C A;  2H8P C;  2JJ1 G;  1XL4 A;  3W7U A;  3LDC A;  1K34 A;  1KD1 W;  4QE9 A;  5HFM A;  1BL8 A;  3ZRV A;  3SPJ A;  2EIL C;  2OCC B;  3FB8 C;  1OCR C;  3ASO C;  1F51 A;  5KUM A;  2R9I A;  1H8H G;  2F43 G;  4Z1M G;  1NR1 A;  5IYC O;  4P2Z A;  1K5Q A;  1K5S A;  2QM7 A;  1NH2 D;  4P30 A;  4WFE A;  3QO8 A;  4JYB A;  3ABU A;  3T1C A;  1GO3 F;  4UUJ C;  2WSS G;  4BIZ A;  1OCC C;  4BAY A;  1RM1 C;  2Z5U A;  2QEX V;  5LHG A;  1QLN A;  1B6Q A;  4MVM A;  2WLI A;  4MT8 A;  1P7B A;  1F4N A;  1K92 A;  1K7D A;  3K06 A;  3RVZ A;  3LDD A;  3OMI B;  1QR8 A;  2XAG A;  3E8H A;  1FXK A;  3OGC C;  3OE7 G;  3TCU A;  5H9C A;  3SJQ C;  3CC2 V;  2YSU B;  1BMF G;  3OFN G;  2MK3 A;  2JEX A;  2EBO A;  2IH3 C;  3E89 A;  3AG2 C;  2XAS A;  3E83 A;  4JTD B;  5BZB A;  2LFS A;  5LGN A;  1MSW D;  2P6J A;  2EIJ C;  3AG3 B;  1PKX A;  3JD0 A;  3RW0 A;  2W6J G;  2HLD G;  4MTO A;  3OR7 C;  2EIN C;  1PD3 A;  3JYC A;  1V54 C;  2WLI B;  2HKO A;  1R3I C;  3K0G A;  3LSS A;  3R65 A;  2ZD9 A;  1GTO A;  1S76 D;  1FXK B;  2CK3 G;  3ZMV A;  3QNE A;  2X6A A;  2X6C A;  3BEH A;  1E79 G;  1JPX A;  1DF5 A;  4UXN A;  4XDK A;  2ZR2 A;  3D3I A;  2XAQ A;  1THZ A;  2UXN A;  5GW7 A;  4I9W A;  2M7W A;  2HFE C;  4MVR A;  4I5S A;  2Y69 C;  2OTL V;  4MSW C;  3LDE A;  3OR6 C;  3CC7 V;  3SPH A;  5CBG A;  3FYE B;  1YJN V;  3AG1 C;  3CP1 A;  3W7T A;  2QTO A;  3STZ C;  3K3W A;  5CBH A;  3ABK C;  4PA7 A;  1K3E A;  3FB5 C;  4LBE C;  4PEL A;  1AR1 B;  4GX1 A;  2WPD G;  4WFA V;  1YHQ V;  1QLE B;  1V55 B;  4R6Z A;  2X0L A;  3T4D A;  3ML0 A;  3AG4 B;  4UV9 A;  2ITD C;  2JDI G;  3B77 A;  5CMU A;  1JX9 A;  3B8M A;  4GX5 A;  1R6K A;  2A0L A;  3JD1 A;  3DGE A;  2XAH A;  4DO2 A;  4QPK A;  2QA4 V;  3CD6 V;  2X6B A;  2EIM C;  4H33 A;  4J9Y B;  2ZDI A;  1OCZ B;  4PA3 A;  2EIK B;  4MTG A;  3CCM V;  3ABL C;  2JK5 C;  3EHB B;  3SYP A;  1VQP V;  4WFF A;  1YSC A;  1YI2 V;  3WG7 B;  4TT3 G;  1H2G A;  3ETG A;  2NLJ C;  3OUF A;  1KQS U;  1S5H C;  4JTC B;  1GK9 A;  3ZIA G;  5IY5 C;  1VQ7 V;  2HG5 C;  1XL6 A;  1S77 D;  1Q7Y W;  3QO7 A;  5EBL C;  3ZN1 A;  3VBB A;  3P30 A;  2Q67 A;  3SYQ A;  3TET A;  3CCR V;  4RUE A;  2DYR C;  3SPI A;  3RBZ A;  1JCH A;  3CXC U;  3NXS A;  1R73 A;  1HWY A;  1GKF A;  1M9N A;  3EFF K;  1LNQ A;  3QO5 A;  2OTJ V;  1J95 A;  1QVG U;  2ZQM A;  3E2E A;  1G8M A;  2A9H A;  1K97 A;  2DW4 A;  4FJC C;  1I5X A;  5LBQ A;  1YTF D;  4XDL A;  4WFG A;  3AG2 B;  4WF9 V;  2Q6A A;  3HPL C;  2EIJ B;  4JGS A;  4GX2 A;  1ORQ C;  1AI4 A;  4LCU C;  2Y48 A;  2V1D A;  4ZKI A;  4FK5 C;  4R8C A;  1V54 B;  1FXH A;  2DQ3 A;  2HVJ C;  3E8B A;  4UVA A;  3ZJZ A;  3CMA V;  1YJ9 V;  1VQ9 V;  1E1Q G;  1GM8 A;  1GMG A;  3F5W C;  4QPJ A;  3X2Q C;  1ARO P;  1Q86 W;  2Q68 A;  5HFL A;  2IU0 A;  1G4Y B;  1M57 C;  1VQO V;  4HZ3 A;  4BW5 A;  2B1I A;  4N23 A;  2ZR3 A;  1OCO C;  5KA5 A;  4WFB V;  1PL0 A;  3TK1 A;  2WLL A;  2IH1 C;  2QE7 G;  4E2L A;  4PA6 A;  1R3K C;  3JD4 A;  5KUK A;  1I5Y A;  3G4S V;  2IJJ A;  4JAV A;  1P4R A;  1SET A;  3CCU V;  3AG1 B;  1MOF A;  2JIZ G;  3CCE V;  3ABK B;  3ABM B;  2DYS C;  3IC7 A;  4H37 A;  4U7O A;  2FTK A;  3OW2 U;  2A79 B;  2EZP A;  1QBZ A;  5H6Q A;  1N8R W;  3W7S A;  2IJK A;  2WLM A;  4RQE A;  3AEI A;  2WLL B;  4LP8 A;  3D36 A;  3G6E V;  4RQF A;  1VQM V;  1DF4 A;  1FFT B;  3M99 B;  3DTU B;  1ROP A;  5EC2 C;  1Q81 W;  2WLN A;  1FS0 G;  4FIP C;  5L3D A;  1S3J A;  3MHH C;  4UV8 A;  3E35 A;  3CPW U;  3K0D A;  4HAM A;  4QE7 A;  3ZMZ A;  1NR7 A;  2K1E A;  4MW8 A;  3IGA C;  3MHS C;  3I56 V;  2DWE C;  1AJN A;  3STL C;  1JOY A;  3UM7 A;  2HJF C;  4QJF B;  4PDR A;  4GT1 A;  3VOU A;  2ATK C;  3OMA B;  4ZBM A;  1NVP B;  4DXW A;  1NJI W;  1EFR G;  3ZRX A;  4JTA B;  5J9P C;  2ZXW B;  2WAM A;  3F7V C;  1CP9 A;  3I55 V;  5L3E A;  1K33 A;  1FXV A;  1MG1 A;  4J9Z B;  2XOK G;  4MVO A;  1M56 C;  5B1B B;  4JF3 A;  1SRY A;  3ZRS A;  1WLE A;  2XAF A;  1R3L C;  2P67 A;  2W0F C;  3AG3 C;  3BY6 A;  4LC1 A;  3LUT B;  1E1R G;  1S72 V;  3MD0 A;  3JD2 A;  3ETE A;  3OEH G;  4P9P A;  3ZRW A;  2EIL B;  1OCR B;  3ASO B;  1AJQ A;  4PDV A;  2EZO A;  1AI5 A;  1KP2 A;  1FXK C;  2IU3 A;  4PDM A;  5DM6 V;  3ZMT A;  1F4M A;  4MTF A;  1UJW B;  2AHY A;  5B3S C;  1K4D C;  1KEC A;  1K8A W;  2IW5 A;  4RO2 A;  1IXM A;  1OCC B;  3HB3 B;  1RM1 B;  2PI5 A;  3JD3 A;  3X2Q B;  1EZJ A;  5FL7 G;  3LNM B;  3B8N A;  4RAI A;  2P90 A;  5E1A C;  4CZZ A;  4CBC A;  3A0R A;  1Y66 A;  2B5U A;  1K9M W;  1M57 B;  1RPR A;  4BIU A;  4MVQ A;  1SER A;  2W6I G;  3FB6 C;  1K73 W;  3FYI B;  2X7R B;  1QLE C;  4R50 A;  1V55 C;  2JJ2 G;  1AI6 A;  4JAU A;  1VQL V;  5CBF A;  4QIW F;  3CYO A;  3E8G A;  5LGT A;  1YJW V;  5B1N A;  4XDJ A;  1VQ5 V;  1BHB A;  1JQ0 A;  1NH2 B;  5L3F A;  3W7X A;  2EIN B;  3ZMS A;  1OCZ C;  2EIK C;  2LFR A;  4MW3 A;  1KC8 W;  3E8F A;  2BOC C;  3ASN C;  5B1A C;  3OEE G;  5KA6 A;  4MVU A;  1COW G;  4WCE V;  2R9R B;  1F23 A;  3JCZ A;  3WG7 C;  5L3G A;  4PA4 A;  4XBF A;  3ABT A;  4MTX A;  4UVC A;  3H01 A;  1EBO A;  5EBM C;  2C2A A;  3W7W A;  5IYD O;  1QR9 A;  2ITC C;  3K08 A;  1YIT V;  2D3O W;  3IFX A;  2WLH A;  1Q82 W;  4FPP A;  2Y69 B;  1VQN V;  4YXW G;  5LGU A;  2ZDI C;  5C93 A;  1W0J G;  4X89 A;  4MVZ A;  4TWK A;  2UXX A;  2YEV A;  4TSF G;  2Z3Y A;  3ZN0 A;  1S0V A;  2DWD C;  4L87 A;  4G2K A;  2V7Q G;  4JYC A;  1DLB A;  2WWW A;  4EKW A;  3CC4 V;  4KUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...