5IT9N

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5it9N02
4DR3O 1HNXO 4JI3O 1J5EO 4JI7O 3J80N 4JYAO 4JI5O 1HNWO 4A5UB 4GKJO 2FKXA 2LW7A 4LF7O 4YHHO 4DV3O 2N74A 5BXZA 2UXCO 4LF4O 4DR2O 1XNRO 1R1BA 2UU9O 2UXBO 2JRIA 1R6TA 3SDLA 2ZKOA 4B3TO 4JI1O 5BY1A 1G1XB 4LF9O 1N34O 4K0KO 1IBMO 4LF8O 4JI2O 3OTOO 4DV0O 1AB3A 4DR7O 1XMQO 4JI8O 4DV7O 4DV1O 1XNQO 1NS1A 4X66O 1F7YA 4OX9O 3T1HO 4DV5O 4DV6O 4YY3O 3JAMN 2HHHO 4X64O 2ZM6O 4JI4O 2AGAA 5A2QN 3R66A 4DV2O 4NXNO 3F5TA 4X62O 4LFCO 2F4VO 1I94O 4NXMO 4DR4O 4DR6O 3J81N 1DK1A 4LFAO 4LF5O 1N36O 1XMOO 4DUZO 4KHPO 2E5LO 4B3RO 3T1YO 2UUAO 4DV4O 1YZBA 1FJGO 4LF6O 5LMNO 5IWAO 1KUQA 3O65A 5BR8O 2UXDO 1FKAO 2Z0AA 4DR1O 1D2DA 1FYJA 3RT3C 1X59A 1AILA 1XEQA 4JV5O 3J7AU 1IBKO 1HNZO 2UUCO 3M8AA 2UUBO 2VQFO 1N33O 4OPHA 1HR0O 4JI0O 1N32O 5LL6Y 1IBLO 4OPAA 4B3MO 4X65O 2VQEO 5FLXN 4GKKO 5IT9N 5LMUO 4JI6O 4LFBO 2DOSA 4B3SO 1A32A 4DR5O 4AQYO 2DJVA 4DUYO 5H5NA
chains in the Genus database with same CATH superfamily
1XNRB 2KQXA 2QM8A 3LNNA 4K8XA 4A5UB 4TUYA 3SJQC 2IBZH 5LBQA 1TAEA 1O9GA 1SQVH 3M99B 4JF3A 2E5LB 5IY5C 1FXKC 3IC7A 1NTZH 4PD4F 1NTMH 4U7NA 1R73A 1IBMO 4TV9A 1Q6HA 3STZC 4PDLA 1M5IA 3G6BA 3OAAG 3CCQV 4DV1O 2GUZB 2DE0X 1Q86W 1YTFB 1I5XA 2JVDA 2ZT9B 3ZN0A 2GDSA 3E86A 1NVPD 4LFAB 2AGAA 3R66A 4X8AA 2XAFA 2FL4A 3B40A 5J2UB 3ETEA 3D36A 4FLVA 1N8RW 2A7WA 5DECA 4X62O 1SS3A 5H6RA 1MNGA 2IJJA 4I50B 1VQ5V 4IIJA 2Q69A 4KFMA 4PA9A 3N2KA 4DV4O 4NTYA 4MVUA 5IWAO 1N0JA 1BHBA 1FKAO 1FXVA 4UCVA 3FB6C 4EB6B 2BTQB 4GUNA 2Q0OC 3HKDB 5IY5B 3NXSA 4I0XA 1PPJH 1N32B 2IH3C 1XEQA 4KUMA 4OGQB 4GT1A 2HKOA 3ZMSA 4I4TA 2QM4A 2ZD9A 1PP9H 3K57A 2EILC 3OUFA 4X1YB 4X1IA 2XUMA 4YIOA 1AJNA 2ZQMA 4F6RB 5FLXN 2DN9A 4JI7B 1OJHA 3IJ4A 2ZNIA 1RSOA 1JFFB 1ZSPA 4MVMA 4DUYO 1RP3B 4LF4B 5LP6B 2JJ2G 2CH7A 3H1JH 1AR5A 3W7WA 4DV2B 2A9HA 3DSQA 4GKJO 2OTJV 2HVJC 2XT9A 1TA8A 2P67A 2IM9A 1JJ2U 2CTWA 2UU9O 4X1KB 1VIBA 5C8YB 4RWUA 1Q6UA 1XUQA 3BFRA 1SA0B 1FJGB 4LF6B 2B1GA 1R6NA 2QWNB 1KP2A 3OTFA 1DF4A 2RMKB 4DV0O 4UVCA 3OW2U 1TUBA 1K4CC 4DV7O 3HKCA 1I5YA 4NXNB 1L0LH 3L70H 4DK1A 5JJJB 3A0BZ 2EILB 2EINC 2GBOA 3FFQA 5A2QN 4W4KA 1VF6A 1R3LC 1QU7A 2UUAB 5B3SC 2LJ2A 3K59A 5CA1B 4MT8A 2A0LA 2XOKG 4DO2A 2YEVB 3APOA 3N2GA 4DRXA 3PN1A 4KHPO 1DLBA 2QTSA 4BWAA 4CH6A 3IAYA 2XAGA 1DTOA 2WA3A 5GTIZ 4IGGA 3E22A 1OCZC 5KUMA 1XQ8A 1D2DA 2QWRB 3RT3C 4TSFG 5KMGB 4JV5O 2XTAA 3J7AU 5BMVA 1AJPA 3DTUB 5J2TA 3H1IH 1G6UA 1K97A 4BAYA 4TV9B 4B3TB 3EVKA 3AK3A 4HYOA 1N34B 4CC5A 4GX0A 4ZI7A 2CGOA 3DXRA 2EINB 4JI3B 3H1KH 4AQYO 3T1HB 4DV6B 1OV9A 1J95A 1TGOA 1HWYA 1AROP 1SETA 5EC1C 5L3DA 3W7XA 4JI4B 1FAFA 2DYSB 2Q73A 2YSUB 3OT7A 1YF2A 5L3BA 2P22C 2P6JA 1Y4MA 3ABUA 2VWKA 4PA4A 4I5SA 4DUZB 3QF7A 2CTPA 1SQQH 4HNAB 3L9DA 4UCTA 1XREA 2QWOB 2PTMA 5E79Z 1FXHA 2XHBA 1XMQO 3CRRA 4I7ZB 3KCXA 5BZBA 1YJNV 2P4KA 4FZ1A 4EKWA 1Q90D 3L75H 4O4JA 2F66C 4I4TB 2YIBD 1MA1A 3K0GA 1GH6A 1M57B 2HR3A 5KHIA 1UFIA 2BOCC 1S5JA 1XOUA 3MAQA 2HP8A 3N27A 4B3RO 3T1YO 3K5MA 3K06A 2IJHA 4P9OA 5FL7G 2CH7B 1VF7A 3OR7C 4ICGA 1L8DA 4JZ2A 4X20A 2AHYA 2JEXA 1YITV 1JR9A 2Z0AA 1FYJA 1N33B 4IYHA 1YCIA 3LSQA 3SGIA 4DR2B 1S5HC 4B3MB 1URFA 2YUAA 4GX1A 4FM2A 4LNUB 3BY6A 1XI1A 3BA8A 2OCCC 5DEDA 5JJEB 1H2KA 3JATB 3H9VA 2Q0AA 5LOVA 2A3QA 2DW4A 1OCOC 1Q6IA 1EN4A 3CCRV 4DV5B 3C3SA 5L3GA 1ZL8B 1QBZA 1GO3F 3J80N 5L3EA 3WU2Z 4NXMB 4JGSA 2IU0A 4YHHO 1Z2GA 1ZWIC 3ZHVA 2OIGA 3E22B 2BSKA 3A0RA 3FD9A 1Q8IA 4R6ZA 4QJFB 4L87A 2CTRA 3L71H 1EBOA 4K3AA 1WP8A 1XNQO 4CZZA 3G71V 1F7YA 4O2BA 4Z1VA 2QDOA 3E35A 3TGUH 1I94B 1B6QA 2OCCB 2YI8A 5F2VO 1F51A 2Q4PA 3ZRSA 1Y76B 3RW0A 1WA8A 2E76B 3ZMUA 1OCOB 3IFXA 2ITCC 4O4IA 3B4SA 4K35A 2F43G 5KAIZ 1MSWD 4B3SB 4J41A 1HDJA 4YJ2A 1AI7A 4R7CA 2QKSA 1BQ0A 2VRZA 1EZVH 2A06H 2RNBA 1CEZA 1EN6A 1P84F 1UJWB 4EFEA 1WPXA 1G4YB 5KX5B 2UUBO 1NZ6A 1TVKA 3K08A 2PGGA 2X6AA 1Y67A 1JA8A 3OTOB 4HAMA 5TISZ 3FYIB 1KECA 4MVOA 5B66Z 4JI6O 1OHHG 1EM1A 5CBHA 4CBCA 2XNDG 4LF7B 1E79G 4LBEC 4DV3B 1Z5WA 2N04A 4TWKA 1VQ8V 5EYPB 2OCHA 5CMUA 2CAZC 1HNWO 3W7SA 2UXCO 3QNEA 5J2UA 2GTSA 1SKVA 4R8CA 4FLUA 3SYCA 3JAKB 3I5DA 4X20B 3OD4A 4RUFA 3T4ZA 5BY1A 2ZE6A 1GM9A 4CS3A 1SQGA 1L0NH 1IZ3A 3SYAA 1NJIW 4LWSB 2ZM6B 3CMAV 1GK9A 3OGIB 1N4CA 1RM1B 4GX5A 3LSUA 3WB1A 4EB6A 3LDDA 2KKWA 2BTQA 2QA4V 4QE9A 1XL4A 2HEPA 3VQYA 2Y4UA 3VQWA 3T4DA 3FB5C 1DGSA 1QCEA 4PA6A 4FFKA 3OFNG 2Q67A 1Q3EA 4DR4O 3B8NA 4B7EA 1QVGU 4J11A 4GKKB 5BR8B 2YI9A 2RN9A 3OEHG 4HBNA 4FPPA 4X1YA 1NT2B 4F6RA 3FYEB 3LDCA 3AK2A 2GV9A 5LGTA 3GWKC 1VP7A 1HR0B 5LP6A 1EZJA 2BSKB 2UUCO 3AG7A 1KBHA 4ZOLB 1DF5A 4JAUA 1P7BA 3CC4V 3U10A 4DR5B 3P32A 4X1KA 3UQ8A 5KHGA 1IBLO 5C8YA 4U3FH 2V4DA 2HG5C 2OIEA 3JD3A 1SA0A 1WAZA 5GW7A 1A32A 4ZHQA 2ADPA 1ZTEA 1HNXO 1FPOA 3S3XA 5EIBD 3X2QC 1H38A 4O4IB 3F5WC 2V7QG 4NB5A 3ZMVA 1W2BU 4X62B 3MHSC 2HVKC 2H94A 5LHHA 4LF9B 2RQ6A 3G4SV 2OWOA 2Q68A 5B1AC 2B5UA 5CN0A 4N23A 4WFBV 2QWPB 5CA1A 4X66B 1Y74A 2ODMA 4JI8O 1ENVA 3RWRD 3UO2A 2PUSA 1NS1A 1PL4A 1NVPB 2ZIOA 1TVKB 2YC0A 3AK1A 1B3QA 2HHHO 2ZNJA 2QTOA 2LP7A 1AR1B 2ZDIA 1M4UA 4KP4A 5KMGA 2ZIMA 2F4VO 4MTXA 1N0NA 3OGCC 2WA4A 1IXBA 4B7KA 1M90W 1PKXA 1FFXB 1K4DC 1IXMA 1SESA 3X2QB 3B09A 5L3FA 2DYRB 2PYLA 4PI0A 4W4LA 1GTOA 3O65A 3EXAA 5B1AB 4GKJB 4WF9V 1H2SB 1K34A 4GX2A 2P06A 3SPGA 4EFBA 2N05A 2YIBA 2YDEA 5LP6C 4MVZA 2Y0PA 4JAAA 4L8JA 3JCZA 3SYPA 3ZMZA 1GM8A 4DV0B 2ZR2A 4HNAA 5DM6V 3CRMA 3CC7V 3P3NA 4DV7B 2ZE7A 4DW0A 4UV9A 3DC6A 1K9MW 3UT5A 5JWPA 1PNKA 4X88A 3CCUV 2DQ3A 1ZLZA 1NI8A 1YEWA 5B1BB 2N74A 1IVSA 2WLIB 1XNRO 5JH7B 2JK5C 1JJOA 2BOBC 1R6TA 1WN7A 5IYDO 1XHXA 2K9PA 1WJZA 4JI1O 5LXTB 2NR5A 5KLVH 1H8EG 4K0KO 2EIKC 3JSNA 1VQNV 2EJ7A 3OMIB 1PNMA 4BIUA 2OYQA 2WSSG 1S76D 1H2NA 1GKFA 1KQSU 2QEXV 4JV5B 4ABMA 1YIJV 3JAMN 1JQ0A 4PA7A 3RVYA 3CXCU 2ZDIC 4UCSA 3SJCC 3HKBB 4ZHQB 1AI5A 4LFAO 3K3WA 4LF5O 4LNUA 4J7ZA 1LUWA 4X9QA 4AQYB 3ZHUA 1P7GA 1K5SA 1COWG 3JATA 2Q7GA 4PA3A 1IBKB 4AILC 1ZL8A 5CB4B 3RYHA 5LHGA 1YJWV 2VQEB 1AR4A 1Y74B 2EIKB 2LGWA 2R72A 3P30A 2JJ1G 2DYSC 1PV0A 4FLWA 3SR2C 1N32O 3JCUZ 3SJBC 4GZRB 1XMQB 4MW8A 5IT9N 4G2KA 5HFLA 4FLTA 3CWBH 1H2LA 5B1NA 1NR1A 4UCUA 4JI7O 1SQPH 1VQ7V 4JYAO 2XAHA 1I0HA 1FFTB 2ADQB 4JTCB 1Q43A 1RPRA 2EIMC 5BXZA 3VOUA 3ABKC 4LF4O 5CBFA 2JEUA 5CBGA 1Y76A 5EBWC 3T1YB 1VQ4V 3ASNB 1M57C 2Q9LA 3I56V 1G1XB 4DW1A 2CUGA 1WP7A 4MSWC 2R9AA 4J9ZB 3OEEG 1AB3A 4D7SA 1IDSA 3CE2A 4YJ3A 1XDCA 1G8MA 4FIPC 3LSSA 3RVZA 4YY3O 4DR6B 2EIJC 3FKSG 5LYJA 2IH1C 3AG1B 4NXNO 1K5QA 3F5TA 2R9IA 5KX5A 4JASA 3J81N 1DK1A 3UT5B 2F23A 1XMOO 2UUAO 2E3CA 2Z5UA 2CGNA 1LUVA 2W6IG 5KAFZ 2EIMB 3CC2V 2WLHA 2WWWA 3ABKB 1U96A 3ICXA 3OMNB 1Y66A 2XAQA 2R9RB 3ZCCA 3BPZA 5CA0B 4NYKA 2PY5A 2K1EA 3PJSK 5EYPA 3A2FA 2FTKA 4NKGB 1IX9A 4F4LA 1XBLA 2Q6AA 5IE9A 1OCCC 1THZA 2EIJB 3JAKA 4O2AB 1JOYA 3ZHRA 3LDEA 4JYYA 5LMUO 1XNQB 3ABLC 2EULA 3BA9A 4LWSA 4I55B 1H2GA 4WFGA 2Q8VA 1QR8A 3OR6C 4JI3O 5FPOA 3UCSC 2X7RB 4JI5O 5J9PC 2FKXA 4LH7A 2AXTZ 3TXSA 2ZE8A 3S3WA 1SZXA 4Q6GA 4F6EA 3D8CA 4FFBB 4U7OA 3CRCA 4LF8O 3K5OA 1KYOF 5KHJA 3IC9A 2LQTA 5IDJA 3RYHB 1VMGA 4H37A 4MS2A 5LGNA 4LFCB 5EZYB 4J10A 3ZHQA 1OCCB 5EBLC 4X64O 5GONB 3IGAC 2UUBB 2WLLB 1EFRG 5A9GA 3ZN1A 1H2MA 3ABLB 3BABA 3CXHF 2IU3A 2QR4A 3RYFB 4ZOLA 3ML0A 4JI6B 3ETDA 3ZBHA 1YZBA 3MHHC 5ITZB 1BGYH 3CB2A 2ILMA 1KUQA 4RO2A 3CCVV 3ABTA 1BE3H 2CE4A 1HNWB 4DR1O 3K58A 2A79B 2NNUA 4FZ0A 2UXCB 4X89A 1SF9A 3UKMA 5D5PA 3G6EV 1E1RG 2VQFO 2X6CA 1N33O 2YICA 1I08A 2UXXA 1M9NA 2P7TC 4WCEV 4YJ3B 4B3MO 4X65O 4FK5C 1R3IC 3FB8C 1J5EB 4LFBO 5LYJB 2CTQA 4WFEA 1Q7YW 5KHKA 4DR3O 1T5EA 3B8MA 4PV1B 5IYCO 3E2EA 2E74B 1WNSA 1XHZA 1VARA 3QO5A 1RM1C 3JD1A 4I9WA 4JI2B 3FAVB 4YXWG 4DR7B 2QJ1A 3TJTA 3ZHSA 4J7KA 4OX9B 3HR0A 1TUEB 1FFXA 3Q4HA 4HZ3A 2B1IA 1OCRC 2Q7HA 1LNQA 1B06A 5LHIA 3F7VC 1NTKH 3BRCA 3CHXA 2IW5A 2X0LA 1KC8W 3NR7A 3L72H 2UUCB 2UXNA 4XBFA 1VQPV 4O4HB 5H6QA 2H3OA 5EIBC 1I94O 2FYUH 5LMNB 2F1MA 4UVAA 2AW9A 3G80A 3E8GA 4FM1A 1LR1A 3SYOA 2ZXWB 1S77D 3VQVA 3K5LA 3ZRWA 4P9PA 2UXDO 1K3EA 2LGQA 3HKEA 2F93B 2NLJC 3A8TA 5IJ9B 5FPRA 2P5OA 3G67A 3CPWU 2JS3A 1AILA 4WFFA 3CD6V 4ZKIA 1JPXA 4WFHA 4UUJC 1HNZO 1OCRB 2L6LA 3AG4B 1D5NA 1I7FA 1JVMA 4MTGA 5KUKA 2WLIA 5JH7A 4JI0O 1RFYA 1SRYA 3CYOA 1P4RA 2ZCEA 2ETNA 5LA6B 1KU9A 3GWOA 1NU1H 5LXTA 4B08A 1K92A 2PZSA 1GN6A 4IYIA 4FVMA 4O4LB 1Q82W 3ASOB 4DK0A 1K73W 1CXZB 2NN4A 2EBOA 2WPDG 3SPHA 1R3JC 1KB9F 2VS0A 3TETA 4YIPA 4XDJA 3O9OA 5IYBO 4LF7O 5KHHA 4DV3O 1NR7A 1R1BA 2RJZA 1IBMB 4C7UA 2UXBO 2OTLV 3HKBA 1VQOV 4DV1B 4TV8B 5KA5A 3ETQA 4XDLA 1HP8A 2M7WA 4QPKA 4GLXA 2DYRC 2KB1A 2PYJA 1SZTA 1MMMA 3E8BA 2ZM6O 2KG7B 2QWQB 5CB4A 1BT8A 1F23A 5B1OA 1GN4A 4J42A 4BR6A 4DV4B 5DN6G 5JVDB 4J7JA 4D7TA 5IWAB 3K5NA 4TQFA 1ORQC 4QIWF 3CCJV 1N36O 1ZAUA 1Z5VA 2VWJA 4MVQA 3CX5F 3FX7A 3KKYA 4MTOA 2HLDG 4U3JB 3VBBA 2JGDB 3W7UA 5BR8O 4RAIA 3AG2B 1KD1W 5HFMA 1SQBH 2YXHA 3JALA 3SJAC 2MK3A 1VEWA 1XL6A 3Q4HB 2GSMB 1W0JG 3BEHA 4FMTA 4JI1B 5K1XA 3ZX6A 4OPHA 3D3IA 4FLXA 1US6A 1HR0O 5B1BC 3WB0A 1MG1A 4K0KB 4DUYB 2EZPA 3RYIB 3RGBA 2YXLA 2EJRA 4DR5O 2C2AA 2F95B 2UU9B 3EHBB 2ATKC 1AI6A 3BHPA 4Q20A 1AVMA 2ZR3A 2WLMA 3E8HA 4R50A 3RBZA 4LF5B 3CCEV 1W59A 3ZRWB 2ZKOA 3ZHTA 3HKEB 4LF9O 5D5QA 2W6JG 1PD3A 3SPIA 2AZ2A 2LO1A 1CPYA 3K79A 2JIZG 2WLJA 3DC5A 4X66O 1W0KG 1YXBA 3ETGA 3JAWB 2JDIG 1SQFA 3T1CA 4JPRA 1YTFD 4KHPB 3QVNA 1FXKB 1EN5A 5CA0A 3ZMTA 4JYBA 2Z3YA 4IHJA 3VQXA 1M56C 2RDCA 1O9HA 2E5LO 1NQTA 4N21A 2AHZA 2IJIA 1P49A 4TT3G 2PI4A 4O2AA 2QSAA 2X6BA 3TXQA 3CSXA 3T2MA 1Q5OA 1GRJA 1RPOA 3A0HZ 4JYAB 3P3PA 4I55A 4DYLA 2XAJA 1K8AW 3I55V 1OZ0A 3GVMA 3BCCH 1BZKA 2YXYA 5IJ0A 2JGUA 1MSDA 3ZIAG 2GHYA 5EBMC 3CJHB 4FFBA 1WPBA 3ASNC 1YVWA 1GN2A 5E1AC 3RYCA 4LC1A 1E1QG 1S3JA 1MZFA 4YY3B 3MD0A 4PDMA 1M56B 3H1HH 5FNVB 1V9PA 1U97A 5EZYA 3U0ZA 3K03A 5GONA 4IL6Z 2BE3A 4H44B 2WLLA 2IJKA 3QO8A 3CP1A 3LUTB 4H33A 1XMOB 1B04A 1MOFA 2JRIA 3AG1C 2Y69C 3RYFA 1H8HG 2GTAA 3APQA 3D36C 1NBMG 4JAVA 2QKCA 4QNHB 3JALB 3CS5A 2Y0IA 3K9AA 2XASA 5ITZA 4P2ZA 2HJFC 4FLYA 2CK3G 2DQ0A 4TUYB 1MZEA 2WAMA 2L35A 4B3RB 1BL8A 4DV2O 4UB8Z 3BAAA 2FMLA 1ZX3A 4NR1A 4QGPA 1K33A 1QQCA 3CCSV 4TOIA 3AG3C 1FD9A 4WBNA 5LMUB 4UVBA 4MW3A 5AG2A 1FJGO 2KSDA 4LF6O 4PELA 1R6KA 1JCHA 3KZIZ 1M1KW 4JI5B 4BIOA 4PDVA 2BCCH 1V55C 2Y69B 3QTCA 5B3SB 1X59A 2OT5A 2EZOA 3L74H 1S72V 4UXNA 4RQFA 2QM7A 1IBKO 1VQ9V 4KXRA 2Y4TA 5JQGA 3SPCA 2H8PC 3WFVA 1QR9A 4IIJB 2PI5A 3FAVA 4JZGA 3N2KB 1QHTA 4G27B 4LF8B 1OCZB 1BHAA 1AJQA 1QLNA 2VQEO 3BVOA 5H2FZ 3MDSA 1K7DA 5KA6A 5H9CA 1YDXA 1YJ9V 2DOSA 4XDKA 4WFAV 1IURA 4YHHB 3UM7A 4CH5A 5H5NA 4I0XB 4X64B 4E4EA 2B9ZA 4H0LB 3FB7C 3C3TA 1BQZA 1JX9A 3AG3B 4IHJB 1L1FA 1ZUQA 4BIZA 4D6TH 3ZJZA 4O4HA 4PJ0Z 2P4VA 2R70A 2QKAA 2LW1A 3ZS8C 4X1IB 4B3TO 1VF6C 1WB7A 3CCLV 4PHZA 1V55B 1RSOB 1Y6XA 5IYZA 5CA3A 1N34O 4RQEA 3JARA 3M7MX 2YIDA 5JCOA 2YS8A 4MVRA 4DR1B 5L3CA 1MABG 3T1HO 3JASA 4DV6O 1S0VA 5IJ0B 1X4TA 3E89A 5IJ9A 4JI4O 3B77A 2VQFB 4JYCA 3E83A 4DR6O 3LNMB 4X65B 1NH2B 3F7YC 3RYCB 2HJDA 4MTFA 4DUZO 5JJNB 4LFBB 2ARHA 1TUBB 1AP6A 3HKCB 4GYCB 4UCRA 5LGUA 3JYCA 4OXSA 5LA6A 4DR3B 4G28B 3AEIA 4O4LA 1JMKC 3RFRA 2WLNA 1KMIZ 4JTDB 4J80A 1F4MA 2PF4E 3HPLC 3JD2A 3B2EE 3N2GB 4KL1A 4DRXB 2D2CB 2ZE5A 1NH2D 2EX3A 5LL6Y 3OMAB 1YI2V 4CH3A 3RN4A 4NVPA 1V54C 2DWDC 4TV8A 4NTXA 5C93A 1WB8A 2DJVA 3E8FA 3JD0A 5BMVB 3WG7C 5J2TB 2O57A 3JSLA 4WBNB 4CS4A 1YHQV 2KG7A 4DR2O 1NKDA 1KP3A 2M6YA 4LH6A 4ZI7B 3SPJA 1QLEC 3R65A 3SDLA 3DXRB 5JVDA 4PI2A 1WLEA 1GN3A 4QPJA 3H1LH 5K1PA 3KCYA 2UXDB 4ZIBA 3THOA 2QGNA 1AP5A 1R3KC 4U3JA 2ZXWC 4UV8A 5JCOC 4LP8A 5JQGB 3HB3B 1HW7A 2JGDA 4GCZA 4CC6A 2W0XA 4DV5O 4DR4B 1HNZB 1PNLA 4PDRA 1KKDA 3ZEDA 1V54B 1SC5B 1VQMV 1GM7A 4LFCO 1AI4A 4JI0B 4NXMO 4JTAB 2RCVA 2ITDC 3AG4C 5GTHZ 2Q5ZA 2JS5A 3WG7B 4H13B 2G38A 3RYIA 2Q7EA 3CRAA 4O4JB 2W0FC 1D5AA 2QE7G 1QLEB 2V1DA 1VQ6V 2MW2B 1M93A 2E75B 3ASOC 3QO7A 1IBLB 2BTOA 3KG2A 2GUZA 1ROPA 2UXBB 3M8AA 5IYZB 3H01A 3CCMV 3JARB 3TCUA 5B5EZ 2D3OW 1HNXB 3UO3A 3JASB 4CS2A 1QVFU 3OE7G 1QNMA 2DWEC 4B3SO 4I50A 2AZ0A 4ASUG 1Q81W 4QE7A 4NTWA 1XILA 1J5EO 4UCOA 4FLZA 4BW5A 4TQDA 3CMEV 2LW7A 3JAWA 3OUSA 4RUEA 3STLC 2Y48A 4DXWA 1FS0G 2WLKA 3HKDA 1N36B 1FXKA 4EEQA 4JI8B 2LFRA 1VQLV 3WB2A 2YIAA 3K9SA 1S5LZ 1KKCA 4K8ZA 5LOVB 1YSCA 4JI2O 2FB5A 3OTOO 2HHHB 4J9YB 3C90A 3GB7C 4FJCC 4DR7O 3EFFK 3CEIA 4OX9O 1CP9A 3ABMC 2F4VB 4LCUC 2P90A 3D3QA 3U11A 1JFFA 2HFEC 3AG2C 3QG5A 4E2LA 3TK1A 4FM0A 1VQKV 1BS3A 4BW9A 4CH4A 1SQXH 4Z1MG 4AHCA 3CJHA 4IT5A 1UPGA 5LMNO 3W7TA 4O2BB 3OM3B 1PL0A 1GAXA 3DGEA 4ZBMA 3K0DA 1SERA 2LFSA 4MVSA 4LR3A 2CDYA 1VF5B 4UFZA 1F4NA 1GMGA 1WA8B 3K04A 5FNVA 3ZRVA 4I9QA 4P30A 5EK0A 4UB6Z 3ZRXA 3ABMB 1PM9A 4OPAA 4YJ2B 4GKKO 5EC2C 1BMFG 1BSMA 4Z2WA 2ZINA 2YEVA 3SYQA 4AI8A 3JD4A 3L73H 2DMXA 1BCCH 3CRQA
chains in the Genus database with same CATH topology
4DR3O 1HNXO 4JI3O 1J5EO 4JI7O 3J80N 4JYAO 4JI5O 1HNWO 4A5UB 4GKJO 2FKXA 2LW7A 4LF7O 4YHHO 4DV3O 2N74A 5BXZA 2UXCO 4LF4O 4DR2O 1XNRO 1R1BA 2UU9O 2UXBO 2JRIA 1R6TA 3SDLA 2ZKOA 4B3TO 4JI1O 5BY1A 1G1XB 4LF9O 1N34O 4K0KO 1IBMO 4LF8O 4JI2O 3OTOO 4DV0O 1AB3A 4DR7O 1XMQO 4JI8O 4DV7O 4DV1O 1XNQO 1NS1A 4X66O 1F7YA 4OX9O 3T1HO 4DV5O 4DV6O 4YY3O 3JAMN 2HHHO 4X64O 2ZM6O 4JI4O 2AGAA 5A2QN 3R66A 4DV2O 4NXNO 3F5TA 4X62O 4LFCO 2F4VO 1I94O 4NXMO 4DR4O 4DR6O 3J81N 1DK1A 4LFAO 4LF5O 1N36O 1XMOO 4DUZO 4KHPO 2E5LO 4B3RO 3T1YO 2UUAO 4DV4O 1YZBA 1FJGO 4LF6O 5LMNO 5IWAO 1KUQA 3O65A 5BR8O 2UXDO 1FKAO 2Z0AA 4DR1O 1D2DA 1FYJA 3RT3C 1X59A 1AILA 1XEQA 4JV5O 3J7AU 1IBKO 1HNZO 2UUCO 3M8AA 2UUBO 2VQFO 1N33O 4OPHA 1HR0O 4JI0O 1N32O 5LL6Y 1IBLO 4OPAA 4B3MO 4X65O 2VQEO 5FLXN 4GKKO 5IT9N 5LMUO 4JI6O 4LFBO 2DOSA 4B3SO 1A32A 4DR5O 4AQYO 2DJVA 4DUYO 5H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 O;  1HNX O;  4JI3 O;  1J5E O;  4JI7 O;  3J80 N;  4JYA O;  4JI5 O;  1HNW O;  4A5U B;  4GKJ O;  2FKX A;  2LW7 A;  4LF7 O;  4YHH O;  4DV3 O;  2N74 A;  5BXZ A;  2UXC O;  4LF4 O;  4DR2 O;  1XNR O;  1R1B A;  2UU9 O;  2UXB O;  2JRI A;  1R6T A;  3SDL A;  2ZKO A;  4B3T O;  4JI1 O;  5BY1 A;  1G1X B;  4LF9 O;  1N34 O;  4K0K O;  1IBM O;  4LF8 O;  4JI2 O;  3OTO O;  4DV0 O;  1AB3 A;  4DR7 O;  1XMQ O;  4JI8 O;  4DV7 O;  4DV1 O;  1XNQ O;  1NS1 A;  4X66 O;  1F7Y A;  4OX9 O;  3T1H O;  4DV5 O;  4DV6 O;  4YY3 O;  3JAM N;  2HHH O;  4X64 O;  2ZM6 O;  4JI4 O;  2AGA A;  5A2Q N;  3R66 A;  4DV2 O;  4NXN O;  3F5T A;  4X62 O;  4LFC O;  2F4V O;  1I94 O;  4NXM O;  4DR4 O;  4DR6 O;  3J81 N;  1DK1 A;  4LFA O;  4LF5 O;  1N36 O;  1XMO O;  4DUZ O;  4KHP O;  2E5L O;  4B3R O;  3T1Y O;  2UUA O;  4DV4 O;  1YZB A;  1FJG O;  4LF6 O;  5LMN O;  5IWA O;  1KUQ A;  3O65 A;  5BR8 O;  2UXD O;  1FKA O;  2Z0A A;  4DR1 O;  1D2D A;  1FYJ A;  3RT3 C;  1X59 A;  1AIL A;  1XEQ A;  4JV5 O;  3J7A U;  1IBK O;  1HNZ O;  2UUC O;  3M8A A;  2UUB O;  2VQF O;  1N33 O;  4OPH A;  1HR0 O;  4JI0 O;  1N32 O;  5LL6 Y;  1IBL O;  4OPA A;  4B3M O;  4X65 O;  2VQE O;  5FLX N;  4GKK O;  5IT9 N;  5LMU O;  4JI6 O;  4LFB O;  2DOS A;  4B3S O;  1A32 A;  4DR5 O;  4AQY O;  2DJV A;  4DUY O;  5H5N A; 
#chains in the Genus database with same CATH topology
 1XNR B;  2KQX A;  2QM8 A;  3LNN A;  4K8X A;  4A5U B;  4TUY A;  3SJQ C;  2IBZ H;  5LBQ A;  1TAE A;  1O9G A;  1SQV H;  3M99 B;  4JF3 A;  2E5L B;  5IY5 C;  1FXK C;  3IC7 A;  1NTZ H;  4PD4 F;  1NTM H;  4U7N A;  1R73 A;  1IBM O;  4TV9 A;  1Q6H A;  3STZ C;  4PDL A;  1M5I A;  3G6B A;  3OAA G;  3CCQ V;  4DV1 O;  2GUZ B;  2DE0 X;  1Q86 W;  1YTF B;  1I5X A;  2JVD A;  2ZT9 B;  3ZN0 A;  2GDS A;  3E86 A;  1NVP D;  4LFA B;  2AGA A;  3R66 A;  4X8A A;  2XAF A;  2FL4 A;  3B40 A;  5J2U B;  3ETE A;  3D36 A;  4FLV A;  1N8R W;  2A7W A;  5DEC A;  4X62 O;  1SS3 A;  5H6R A;  1MNG A;  2IJJ A;  4I50 B;  1VQ5 V;  4IIJ A;  2Q69 A;  4KFM A;  4PA9 A;  3N2K A;  4DV4 O;  4NTY A;  4MVU A;  5IWA O;  1N0J A;  1BHB A;  1FKA O;  1FXV A;  4UCV A;  3FB6 C;  4EB6 B;  2BTQ B;  4GUN A;  2Q0O C;  3HKD B;  5IY5 B;  3NXS A;  4I0X A;  1PPJ H;  1N32 B;  2IH3 C;  1XEQ A;  4KUM A;  4OGQ B;  4GT1 A;  2HKO A;  3ZMS A;  4I4T A;  2QM4 A;  2ZD9 A;  1PP9 H;  3K57 A;  2EIL C;  3OUF A;  4X1Y B;  4X1I A;  2XUM A;  4YIO A;  1AJN A;  2ZQM A;  4F6R B;  5FLX N;  2DN9 A;  4JI7 B;  1OJH A;  3IJ4 A;  2ZNI A;  1RSO A;  1JFF B;  1ZSP A;  4MVM A;  4DUY O;  1RP3 B;  4LF4 B;  5LP6 B;  2JJ2 G;  2CH7 A;  3H1J H;  1AR5 A;  3W7W A;  4DV2 B;  2A9H A;  3DSQ A;  4GKJ O;  2OTJ V;  2HVJ C;  2XT9 A;  1TA8 A;  2P67 A;  2IM9 A;  1JJ2 U;  2CTW A;  2UU9 O;  4X1K B;  1VIB A;  5C8Y B;  4RWU A;  1Q6U A;  1XUQ A;  3BFR A;  1SA0 B;  1FJG B;  4LF6 B;  2B1G A;  1R6N A;  2QWN B;  1KP2 A;  3OTF A;  1DF4 A;  2RMK B;  4DV0 O;  4UVC A;  3OW2 U;  1TUB A;  1K4C C;  4DV7 O;  3HKC A;  1I5Y A;  4NXN B;  1L0L H;  3L70 H;  4DK1 A;  5JJJ B;  3A0B Z;  2EIL B;  2EIN C;  2GBO A;  3FFQ A;  5A2Q N;  4W4K A;  1VF6 A;  1R3L C;  1QU7 A;  2UUA B;  5B3S C;  2LJ2 A;  3K59 A;  5CA1 B;  4MT8 A;  2A0L A;  2XOK G;  4DO2 A;  2YEV B;  3APO A;  3N2G A;  4DRX A;  3PN1 A;  4KHP O;  1DLB A;  2QTS A;  4BWA A;  4CH6 A;  3IAY A;  2XAG A;  1DTO A;  2WA3 A;  5GTI Z;  4IGG A;  3E22 A;  1OCZ C;  5KUM A;  1XQ8 A;  1D2D A;  2QWR B;  3RT3 C;  4TSF G;  5KMG B;  4JV5 O;  2XTA A;  3J7A U;  5BMV A;  1AJP A;  3DTU B;  5J2T A;  3H1I H;  1G6U A;  1K97 A;  4BAY A;  4TV9 B;  4B3T B;  3EVK A;  3AK3 A;  4HYO A;  1N34 B;  4CC5 A;  4GX0 A;  4ZI7 A;  2CGO A;  3DXR A;  2EIN B;  4JI3 B;  3H1K H;  4AQY O;  3T1H B;  4DV6 B;  1OV9 A;  1J95 A;  1TGO A;  1HWY A;  1ARO P;  1SET A;  5EC1 C;  5L3D A;  3W7X A;  4JI4 B;  1FAF A;  2DYS B;  2Q73 A;  2YSU B;  3OT7 A;  1YF2 A;  5L3B A;  2P22 C;  2P6J A;  1Y4M A;  3ABU A;  2VWK A;  4PA4 A;  4I5S A;  4DUZ B;  3QF7 A;  2CTP A;  1SQQ H;  4HNA B;  3L9D A;  4UCT A;  1XRE A;  2QWO B;  2PTM A;  5E79 Z;  1FXH A;  2XHB A;  1XMQ O;  3CRR A;  4I7Z B;  3KCX A;  5BZB A;  1YJN V;  2P4K A;  4FZ1 A;  4EKW A;  1Q90 D;  3L75 H;  4O4J A;  2F66 C;  4I4T B;  2YIB D;  1MA1 A;  3K0G A;  1GH6 A;  1M57 B;  2HR3 A;  5KHI A;  1UFI A;  2BOC C;  1S5J A;  1XOU A;  3MAQ A;  2HP8 A;  3N27 A;  4B3R O;  3T1Y O;  3K5M A;  3K06 A;  2IJH A;  4P9O A;  5FL7 G;  2CH7 B;  1VF7 A;  3OR7 C;  4ICG A;  1L8D A;  4JZ2 A;  4X20 A;  2AHY A;  2JEX A;  1YIT V;  1JR9 A;  2Z0A A;  1FYJ A;  1N33 B;  4IYH A;  1YCI A;  3LSQ A;  3SGI A;  4DR2 B;  1S5H C;  4B3M B;  1URF A;  2YUA A;  4GX1 A;  4FM2 A;  4LNU B;  3BY6 A;  1XI1 A;  3BA8 A;  2OCC C;  5DED A;  5JJE B;  1H2K A;  3JAT B;  3H9V A;  2Q0A A;  5LOV A;  2A3Q A;  2DW4 A;  1OCO C;  1Q6I A;  1EN4 A;  3CCR V;  4DV5 B;  3C3S A;  5L3G A;  1ZL8 B;  1QBZ A;  1GO3 F;  3J80 N;  5L3E A;  3WU2 Z;  4NXM B;  4JGS A;  2IU0 A;  4YHH O;  1Z2G A;  1ZWI C;  3ZHV A;  2OIG A;  3E22 B;  2BSK A;  3A0R A;  3FD9 A;  1Q8I A;  4R6Z A;  4QJF B;  4L87 A;  2CTR A;  3L71 H;  1EBO A;  4K3A A;  1WP8 A;  1XNQ O;  4CZZ A;  3G71 V;  1F7Y A;  4O2B A;  4Z1V A;  2QDO A;  3E35 A;  3TGU H;  1I94 B;  1B6Q A;  2OCC B;  2YI8 A;  5F2V O;  1F51 A;  2Q4P A;  3ZRS A;  1Y76 B;  3RW0 A;  1WA8 A;  2E76 B;  3ZMU A;  1OCO B;  3IFX A;  2ITC C;  4O4I A;  3B4S A;  4K35 A;  2F43 G;  5KAI Z;  1MSW D;  4B3S B;  4J41 A;  1HDJ A;  4YJ2 A;  1AI7 A;  4R7C A;  2QKS A;  1BQ0 A;  2VRZ A;  1EZV H;  2A06 H;  2RNB A;  1CEZ A;  1EN6 A;  1P84 F;  1UJW B;  4EFE A;  1WPX A;  1G4Y B;  5KX5 B;  2UUB O;  1NZ6 A;  1TVK A;  3K08 A;  2PGG A;  2X6A A;  1Y67 A;  1JA8 A;  3OTO B;  4HAM A;  5TIS Z;  3FYI B;  1KEC A;  4MVO A;  5B66 Z;  4JI6 O;  1OHH G;  1EM1 A;  5CBH A;  4CBC A;  2XND G;  4LF7 B;  1E79 G;  4LBE C;  4DV3 B;  1Z5W A;  2N04 A;  4TWK A;  1VQ8 V;  5EYP B;  2OCH A;  5CMU A;  2CAZ C;  1HNW O;  3W7S A;  2UXC O;  3QNE A;  5J2U A;  2GTS A;  1SKV A;  4R8C A;  4FLU A;  3SYC A;  3JAK B;  3I5D A;  4X20 B;  3OD4 A;  4RUF A;  3T4Z A;  5BY1 A;  2ZE6 A;  1GM9 A;  4CS3 A;  1SQG A;  1L0N H;  1IZ3 A;  3SYA A;  1NJI W;  4LWS B;  2ZM6 B;  3CMA V;  1GK9 A;  3OGI B;  1N4C A;  1RM1 B;  4GX5 A;  3LSU A;  3WB1 A;  4EB6 A;  3LDD A;  2KKW A;  2BTQ A;  2QA4 V;  4QE9 A;  1XL4 A;  2HEP A;  3VQY A;  2Y4U A;  3VQW A;  3T4D A;  3FB5 C;  1DGS A;  1QCE A;  4PA6 A;  4FFK A;  3OFN G;  2Q67 A;  1Q3E A;  4DR4 O;  3B8N A;  4B7E A;  1QVG U;  4J11 A;  4GKK B;  5BR8 B;  2YI9 A;  2RN9 A;  3OEH G;  4HBN A;  4FPP A;  4X1Y A;  1NT2 B;  4F6R A;  3FYE B;  3LDC A;  3AK2 A;  2GV9 A;  5LGT A;  3GWK C;  1VP7 A;  1HR0 B;  5LP6 A;  1EZJ A;  2BSK B;  2UUC O;  3AG7 A;  1KBH A;  4ZOL B;  1DF5 A;  4JAU A;  1P7B A;  3CC4 V;  3U10 A;  4DR5 B;  3P32 A;  4X1K A;  3UQ8 A;  5KHG A;  1IBL O;  5C8Y A;  4U3F H;  2V4D A;  2HG5 C;  2OIE A;  3JD3 A;  1SA0 A;  1WAZ A;  5GW7 A;  1A32 A;  4ZHQ A;  2ADP A;  1ZTE A;  1HNX O;  1FPO A;  3S3X A;  5EIB D;  3X2Q C;  1H38 A;  4O4I B;  3F5W C;  2V7Q G;  4NB5 A;  3ZMV A;  1W2B U;  4X62 B;  3MHS C;  2HVK C;  2H94 A;  5LHH A;  4LF9 B;  2RQ6 A;  3G4S V;  2OWO A;  2Q68 A;  5B1A C;  2B5U A;  5CN0 A;  4N23 A;  4WFB V;  2QWP B;  5CA1 A;  4X66 B;  1Y74 A;  2ODM A;  4JI8 O;  1ENV A;  3RWR D;  3UO2 A;  2PUS A;  1NS1 A;  1PL4 A;  1NVP B;  2ZIO A;  1TVK B;  2YC0 A;  3AK1 A;  1B3Q A;  2HHH O;  2ZNJ A;  2QTO A;  2LP7 A;  1AR1 B;  2ZDI A;  1M4U A;  4KP4 A;  5KMG A;  2ZIM A;  2F4V O;  4MTX A;  1N0N A;  3OGC C;  2WA4 A;  1IXB A;  4B7K A;  1M90 W;  1PKX A;  1FFX B;  1K4D C;  1IXM A;  1SES A;  3X2Q B;  3B09 A;  5L3F A;  2DYR B;  2PYL A;  4PI0 A;  4W4L A;  1GTO A;  3O65 A;  3EXA A;  5B1A B;  4GKJ B;  4WF9 V;  1H2S B;  1K34 A;  4GX2 A;  2P06 A;  3SPG A;  4EFB A;  2N05 A;  2YIB A;  2YDE A;  5LP6 C;  4MVZ A;  2Y0P A;  4JAA A;  4L8J A;  3JCZ A;  3SYP A;  3ZMZ A;  1GM8 A;  4DV0 B;  2ZR2 A;  4HNA A;  5DM6 V;  3CRM A;  3CC7 V;  3P3N A;  4DV7 B;  2ZE7 A;  4DW0 A;  4UV9 A;  3DC6 A;  1K9M W;  3UT5 A;  5JWP A;  1PNK A;  4X88 A;  3CCU V;  2DQ3 A;  1ZLZ A;  1NI8 A;  1YEW A;  5B1B B;  2N74 A;  1IVS A;  2WLI B;  1XNR O;  5JH7 B;  2JK5 C;  1JJO A;  2BOB C;  1R6T A;  1WN7 A;  5IYD O;  1XHX A;  2K9P A;  1WJZ A;  4JI1 O;  5LXT B;  2NR5 A;  5KLV H;  1H8E G;  4K0K O;  2EIK C;  3JSN A;  1VQN V;  2EJ7 A;  3OMI B;  1PNM A;  4BIU A;  2OYQ A;  2WSS G;  1S76 D;  1H2N A;  1GKF A;  1KQS U;  2QEX V;  4JV5 B;  4ABM A;  1YIJ V;  3JAM N;  1JQ0 A;  4PA7 A;  3RVY A;  3CXC U;  2ZDI C;  4UCS A;  3SJC C;  3HKB B;  4ZHQ B;  1AI5 A;  4LFA O;  3K3W A;  4LF5 O;  4LNU A;  4J7Z A;  1LUW A;  4X9Q A;  4AQY B;  3ZHU A;  1P7G A;  1K5S A;  1COW G;  3JAT A;  2Q7G A;  4PA3 A;  1IBK B;  4AIL C;  1ZL8 A;  5CB4 B;  3RYH A;  5LHG A;  1YJW V;  2VQE B;  1AR4 A;  1Y74 B;  2EIK B;  2LGW A;  2R72 A;  3P30 A;  2JJ1 G;  2DYS C;  1PV0 A;  4FLW A;  3SR2 C;  1N32 O;  3JCU Z;  3SJB C;  4GZR B;  1XMQ B;  4MW8 A;  5IT9 N;  4G2K A;  5HFL A;  4FLT A;  3CWB H;  1H2L A;  5B1N A;  1NR1 A;  4UCU A;  4JI7 O;  1SQP H;  1VQ7 V;  4JYA O;  2XAH A;  1I0H A;  1FFT B;  2ADQ B;  4JTC B;  1Q43 A;  1RPR A;  2EIM C;  5BXZ A;  3VOU A;  3ABK C;  4LF4 O;  5CBF A;  2JEU A;  5CBG A;  1Y76 A;  5EBW C;  3T1Y B;  1VQ4 V;  3ASN B;  1M57 C;  2Q9L A;  3I56 V;  1G1X B;  4DW1 A;  2CUG A;  1WP7 A;  4MSW C;  2R9A A;  4J9Z B;  3OEE G;  1AB3 A;  4D7S A;  1IDS A;  3CE2 A;  4YJ3 A;  1XDC A;  1G8M A;  4FIP C;  3LSS A;  3RVZ A;  4YY3 O;  4DR6 B;  2EIJ C;  3FKS G;  5LYJ A;  2IH1 C;  3AG1 B;  4NXN O;  1K5Q A;  3F5T A;  2R9I A;  5KX5 A;  4JAS A;  3J81 N;  1DK1 A;  3UT5 B;  2F23 A;  1XMO O;  2UUA O;  2E3C A;  2Z5U A;  2CGN A;  1LUV A;  2W6I G;  5KAF Z;  2EIM B;  3CC2 V;  2WLH A;  2WWW A;  3ABK B;  1U96 A;  3ICX A;  3OMN B;  1Y66 A;  2XAQ A;  2R9R B;  3ZCC A;  3BPZ A;  5CA0 B;  4NYK A;  2PY5 A;  2K1E A;  3PJS K;  5EYP A;  3A2F A;  2FTK A;  4NKG B;  1IX9 A;  4F4L A;  1XBL A;  2Q6A A;  5IE9 A;  1OCC C;  1THZ A;  2EIJ B;  3JAK A;  4O2A B;  1JOY A;  3ZHR A;  3LDE A;  4JYY A;  5LMU O;  1XNQ B;  3ABL C;  2EUL A;  3BA9 A;  4LWS A;  4I55 B;  1H2G A;  4WFG A;  2Q8V A;  1QR8 A;  3OR6 C;  4JI3 O;  5FPO A;  3UCS C;  2X7R B;  4JI5 O;  5J9P C;  2FKX A;  4LH7 A;  2AXT Z;  3TXS A;  2ZE8 A;  3S3W A;  1SZX A;  4Q6G A;  4F6E A;  3D8C A;  4FFB B;  4U7O A;  3CRC A;  4LF8 O;  3K5O A;  1KYO F;  5KHJ A;  3IC9 A;  2LQT A;  5IDJ A;  3RYH B;  1VMG A;  4H37 A;  4MS2 A;  5LGN A;  4LFC B;  5EZY B;  4J10 A;  3ZHQ A;  1OCC B;  5EBL C;  4X64 O;  5GON B;  3IGA C;  2UUB B;  2WLL B;  1EFR G;  5A9G A;  3ZN1 A;  1H2M A;  3ABL B;  3BAB A;  3CXH F;  2IU3 A;  2QR4 A;  3RYF B;  4ZOL A;  3ML0 A;  4JI6 B;  3ETD A;  3ZBH A;  1YZB A;  3MHH C;  5ITZ B;  1BGY H;  3CB2 A;  2ILM A;  1KUQ A;  4RO2 A;  3CCV V;  3ABT A;  1BE3 H;  2CE4 A;  1HNW B;  4DR1 O;  3K58 A;  2A79 B;  2NNU A;  4FZ0 A;  2UXC B;  4X89 A;  1SF9 A;  3UKM A;  5D5P A;  3G6E V;  1E1R G;  2VQF O;  2X6C A;  1N33 O;  2YIC A;  1I08 A;  2UXX A;  1M9N A;  2P7T C;  4WCE V;  4YJ3 B;  4B3M O;  4X65 O;  4FK5 C;  1R3I C;  3FB8 C;  1J5E B;  4LFB O;  5LYJ B;  2CTQ A;  4WFE A;  1Q7Y W;  5KHK A;  4DR3 O;  1T5E A;  3B8M A;  4PV1 B;  5IYC O;  3E2E A;  2E74 B;  1WNS A;  1XHZ A;  1VAR A;  3QO5 A;  1RM1 C;  3JD1 A;  4I9W A;  4JI2 B;  3FAV B;  4YXW G;  4DR7 B;  2QJ1 A;  3TJT A;  3ZHS A;  4J7K A;  4OX9 B;  3HR0 A;  1TUE B;  1FFX A;  3Q4H A;  4HZ3 A;  2B1I A;  1OCR C;  2Q7H A;  1LNQ A;  1B06 A;  5LHI A;  3F7V C;  1NTK H;  3BRC A;  3CHX A;  2IW5 A;  2X0L A;  1KC8 W;  3NR7 A;  3L72 H;  2UUC B;  2UXN A;  4XBF A;  1VQP V;  4O4H B;  5H6Q A;  2H3O A;  5EIB C;  1I94 O;  2FYU H;  5LMN B;  2F1M A;  4UVA A;  2AW9 A;  3G80 A;  3E8G A;  4FM1 A;  1LR1 A;  3SYO A;  2ZXW B;  1S77 D;  3VQV A;  3K5L A;  3ZRW A;  4P9P A;  2UXD O;  1K3E A;  2LGQ A;  3HKE A;  2F93 B;  2NLJ C;  3A8T A;  5IJ9 B;  5FPR A;  2P5O A;  3G67 A;  3CPW U;  2JS3 A;  1AIL A;  4WFF A;  3CD6 V;  4ZKI A;  1JPX A;  4WFH A;  4UUJ C;  1HNZ O;  1OCR B;  2L6L A;  3AG4 B;  1D5N A;  1I7F A;  1JVM A;  4MTG A;  5KUK A;  2WLI A;  5JH7 A;  4JI0 O;  1RFY A;  1SRY A;  3CYO A;  1P4R A;  2ZCE A;  2ETN A;  5LA6 B;  1KU9 A;  3GWO A;  1NU1 H;  5LXT A;  4B08 A;  1K92 A;  2PZS A;  1GN6 A;  4IYI A;  4FVM A;  4O4L B;  1Q82 W;  3ASO B;  4DK0 A;  1K73 W;  1CXZ B;  2NN4 A;  2EBO A;  2WPD G;  3SPH A;  1R3J C;  1KB9 F;  2VS0 A;  3TET A;  4YIP A;  4XDJ A;  3O9O A;  5IYB O;  4LF7 O;  5KHH A;  4DV3 O;  1NR7 A;  1R1B A;  2RJZ A;  1IBM B;  4C7U A;  2UXB O;  2OTL V;  3HKB A;  1VQO V;  4DV1 B;  4TV8 B;  5KA5 A;  3ETQ A;  4XDL A;  1HP8 A;  2M7W A;  4QPK A;  4GLX A;  2DYR C;  2KB1 A;  2PYJ A;  1SZT A;  1MMM A;  3E8B A;  2ZM6 O;  2KG7 B;  2QWQ B;  5CB4 A;  1BT8 A;  1F23 A;  5B1O A;  1GN4 A;  4J42 A;  4BR6 A;  4DV4 B;  5DN6 G;  5JVD B;  4J7J A;  4D7T A;  5IWA B;  3K5N A;  4TQF A;  1ORQ C;  4QIW F;  3CCJ V;  1N36 O;  1ZAU A;  1Z5V A;  2VWJ A;  4MVQ A;  3CX5 F;  3FX7 A;  3KKY A;  4MTO A;  2HLD G;  4U3J B;  3VBB A;  2JGD B;  3W7U A;  5BR8 O;  4RAI A;  3AG2 B;  1KD1 W;  5HFM A;  1SQB H;  2YXH A;  3JAL A;  3SJA C;  2MK3 A;  1VEW A;  1XL6 A;  3Q4H B;  2GSM B;  1W0J G;  3BEH A;  4FMT A;  4JI1 B;  5K1X A;  3ZX6 A;  4OPH A;  3D3I A;  4FLX A;  1US6 A;  1HR0 O;  5B1B C;  3WB0 A;  1MG1 A;  4K0K B;  4DUY B;  2EZP A;  3RYI B;  3RGB A;  2YXL A;  2EJR A;  4DR5 O;  2C2A A;  2F95 B;  2UU9 B;  3EHB B;  2ATK C;  1AI6 A;  3BHP A;  4Q20 A;  1AVM A;  2ZR3 A;  2WLM A;  3E8H A;  4R50 A;  3RBZ A;  4LF5 B;  3CCE V;  1W59 A;  3ZRW B;  2ZKO A;  3ZHT A;  3HKE B;  4LF9 O;  5D5Q A;  2W6J G;  1PD3 A;  3SPI A;  2AZ2 A;  2LO1 A;  1CPY A;  3K79 A;  2JIZ G;  2WLJ A;  3DC5 A;  4X66 O;  1W0K G;  1YXB A;  3ETG A;  3JAW B;  2JDI G;  1SQF A;  3T1C A;  4JPR A;  1YTF D;  4KHP B;  3QVN A;  1FXK B;  1EN5 A;  5CA0 A;  3ZMT A;  4JYB A;  2Z3Y A;  4IHJ A;  3VQX A;  1M56 C;  2RDC A;  1O9H A;  2E5L O;  1NQT A;  4N21 A;  2AHZ A;  2IJI A;  1P49 A;  4TT3 G;  2PI4 A;  4O2A A;  2QSA A;  2X6B A;  3TXQ A;  3CSX A;  3T2M A;  1Q5O A;  1GRJ A;  1RPO A;  3A0H Z;  4JYA B;  3P3P A;  4I55 A;  4DYL A;  2XAJ A;  1K8A W;  3I55 V;  1OZ0 A;  3GVM A;  3BCC H;  1BZK A;  2YXY A;  5IJ0 A;  2JGU A;  1MSD A;  3ZIA G;  2GHY A;  5EBM C;  3CJH B;  4FFB A;  1WPB A;  3ASN C;  1YVW A;  1GN2 A;  5E1A C;  3RYC A;  4LC1 A;  1E1Q G;  1S3J A;  1MZF A;  4YY3 B;  3MD0 A;  4PDM A;  1M56 B;  3H1H H;  5FNV B;  1V9P A;  1U97 A;  5EZY A;  3U0Z A;  3K03 A;  5GON A;  4IL6 Z;  2BE3 A;  4H44 B;  2WLL A;  2IJK A;  3QO8 A;  3CP1 A;  3LUT B;  4H33 A;  1XMO B;  1B04 A;  1MOF A;  2JRI A;  3AG1 C;  2Y69 C;  3RYF A;  1H8H G;  2GTA A;  3APQ A;  3D36 C;  1NBM G;  4JAV A;  2QKC A;  4QNH B;  3JAL B;  3CS5 A;  2Y0I A;  3K9A A;  2XAS A;  5ITZ A;  4P2Z A;  2HJF C;  4FLY A;  2CK3 G;  2DQ0 A;  4TUY B;  1MZE A;  2WAM A;  2L35 A;  4B3R B;  1BL8 A;  4DV2 O;  4UB8 Z;  3BAA A;  2FML A;  1ZX3 A;  4NR1 A;  4QGP A;  1K33 A;  1QQC A;  3CCS V;  4TOI A;  3AG3 C;  1FD9 A;  4WBN A;  5LMU B;  4UVB A;  4MW3 A;  5AG2 A;  1FJG O;  2KSD A;  4LF6 O;  4PEL A;  1R6K A;  1JCH A;  3KZI Z;  1M1K W;  4JI5 B;  4BIO A;  4PDV A;  2BCC H;  1V55 C;  2Y69 B;  3QTC A;  5B3S B;  1X59 A;  2OT5 A;  2EZO A;  3L74 H;  1S72 V;  4UXN A;  4RQF A;  2QM7 A;  1IBK O;  1VQ9 V;  4KXR A;  2Y4T A;  5JQG A;  3SPC A;  2H8P C;  3WFV A;  1QR9 A;  4IIJ B;  2PI5 A;  3FAV A;  4JZG A;  3N2K B;  1QHT A;  4G27 B;  4LF8 B;  1OCZ B;  1BHA A;  1AJQ A;  1QLN A;  2VQE O;  3BVO A;  5H2F Z;  3MDS A;  1K7D A;  5KA6 A;  5H9C A;  1YDX A;  1YJ9 V;  2DOS A;  4XDK A;  4WFA V;  1IUR A;  4YHH B;  3UM7 A;  4CH5 A;  5H5N A;  4I0X B;  4X64 B;  4E4E A;  2B9Z A;  4H0L B;  3FB7 C;  3C3T A;  1BQZ A;  1JX9 A;  3AG3 B;  4IHJ B;  1L1F A;  1ZUQ A;  4BIZ A;  4D6T H;  3ZJZ A;  4O4H A;  4PJ0 Z;  2P4V A;  2R70 A;  2QKA A;  2LW1 A;  3ZS8 C;  4X1I B;  4B3T O;  1VF6 C;  1WB7 A;  3CCL V;  4PHZ A;  1V55 B;  1RSO B;  1Y6X A;  5IYZ A;  5CA3 A;  1N34 O;  4RQE A;  3JAR A;  3M7M X;  2YID A;  5JCO A;  2YS8 A;  4MVR A;  4DR1 B;  5L3C A;  1MAB G;  3T1H O;  3JAS A;  4DV6 O;  1S0V A;  5IJ0 B;  1X4T A;  3E89 A;  5IJ9 A;  4JI4 O;  3B77 A;  2VQF B;  4JYC A;  3E83 A;  4DR6 O;  3LNM B;  4X65 B;  1NH2 B;  3F7Y C;  3RYC B;  2HJD A;  4MTF A;  4DUZ O;  5JJN B;  4LFB B;  2ARH A;  1TUB B;  1AP6 A;  3HKC B;  4GYC B;  4UCR A;  5LGU A;  3JYC A;  4OXS A;  5LA6 A;  4DR3 B;  4G28 B;  3AEI A;  4O4L A;  1JMK C;  3RFR A;  2WLN A;  1KMI Z;  4JTD B;  4J80 A;  1F4M A;  2PF4 E;  3HPL C;  3JD2 A;  3B2E E;  3N2G B;  4KL1 A;  4DRX B;  2D2C B;  2ZE5 A;  1NH2 D;  2EX3 A;  5LL6 Y;  3OMA B;  1YI2 V;  4CH3 A;  3RN4 A;  4NVP A;  1V54 C;  2DWD C;  4TV8 A;  4NTX A;  5C93 A;  1WB8 A;  2DJV A;  3E8F A;  3JD0 A;  5BMV B;  3WG7 C;  5J2T B;  2O57 A;  3JSL A;  4WBN B;  4CS4 A;  1YHQ V;  2KG7 A;  4DR2 O;  1NKD A;  1KP3 A;  2M6Y A;  4LH6 A;  4ZI7 B;  3SPJ A;  1QLE C;  3R65 A;  3SDL A;  3DXR B;  5JVD A;  4PI2 A;  1WLE A;  1GN3 A;  4QPJ A;  3H1L H;  5K1P A;  3KCY A;  2UXD B;  4ZIB A;  3THO A;  2QGN A;  1AP5 A;  1R3K C;  4U3J A;  2ZXW C;  4UV8 A;  5JCO C;  4LP8 A;  5JQG B;  3HB3 B;  1HW7 A;  2JGD A;  4GCZ A;  4CC6 A;  2W0X A;  4DV5 O;  4DR4 B;  1HNZ B;  1PNL A;  4PDR A;  1KKD A;  3ZED A;  1V54 B;  1SC5 B;  1VQM V;  1GM7 A;  4LFC O;  1AI4 A;  4JI0 B;  4NXM O;  4JTA B;  2RCV A;  2ITD C;  3AG4 C;  5GTH Z;  2Q5Z A;  2JS5 A;  3WG7 B;  4H13 B;  2G38 A;  3RYI A;  2Q7E A;  3CRA A;  4O4J B;  2W0F C;  1D5A A;  2QE7 G;  1QLE B;  2V1D A;  1VQ6 V;  2MW2 B;  1M93 A;  2E75 B;  3ASO C;  3QO7 A;  1IBL B;  2BTO A;  3KG2 A;  2GUZ A;  1ROP A;  2UXB B;  3M8A A;  5IYZ B;  3H01 A;  3CCM V;  3JAR B;  3TCU A;  5B5E Z;  2D3O W;  1HNX B;  3UO3 A;  3JAS B;  4CS2 A;  1QVF U;  3OE7 G;  1QNM A;  2DWE C;  4B3S O;  4I50 A;  2AZ0 A;  4ASU G;  1Q81 W;  4QE7 A;  4NTW A;  1XIL A;  1J5E O;  4UCO A;  4FLZ A;  4BW5 A;  4TQD A;  3CME V;  2LW7 A;  3JAW A;  3OUS A;  4RUE A;  3STL C;  2Y48 A;  4DXW A;  1FS0 G;  2WLK A;  3HKD A;  1N36 B;  1FXK A;  4EEQ A;  4JI8 B;  2LFR A;  1VQL V;  3WB2 A;  2YIA A;  3K9S A;  1S5L Z;  1KKC A;  4K8Z A;  5LOV B;  1YSC A;  4JI2 O;  2FB5 A;  3OTO O;  2HHH B;  4J9Y B;  3C90 A;  3GB7 C;  4FJC C;  4DR7 O;  3EFF K;  3CEI A;  4OX9 O;  1CP9 A;  3ABM C;  2F4V B;  4LCU C;  2P90 A;  3D3Q A;  3U11 A;  1JFF A;  2HFE C;  3AG2 C;  3QG5 A;  4E2L A;  3TK1 A;  4FM0 A;  1VQK V;  1BS3 A;  4BW9 A;  4CH4 A;  1SQX H;  4Z1M G;  4AHC A;  3CJH A;  4IT5 A;  1UPG A;  5LMN O;  3W7T A;  4O2B B;  3OM3 B;  1PL0 A;  1GAX A;  3DGE A;  4ZBM A;  3K0D A;  1SER A;  2LFS A;  4MVS A;  4LR3 A;  2CDY A;  1VF5 B;  4UFZ A;  1F4N A;  1GMG A;  1WA8 B;  3K04 A;  5FNV A;  3ZRV A;  4I9Q A;  4P30 A;  5EK0 A;  4UB6 Z;  3ZRX A;  3ABM B;  1PM9 A;  4OPA A;  4YJ2 B;  4GKK O;  5EC2 C;  1BMF G;  1BSM A;  4Z2W A;  2ZIN A;  2YEV A;  3SYQ A;  4AI8 A;  3JD4 A;  3L73 H;  2DMX A;  1BCC H;  3CRQ A; 
#chains in the Genus database with same CATH homology
 4DR3 O;  1HNX O;  4JI3 O;  1J5E O;  4JI7 O;  3J80 N;  4JYA O;  4JI5 O;  1HNW O;  4A5U B;  4GKJ O;  2FKX A;  2LW7 A;  4LF7 O;  4YHH O;  4DV3 O;  2N74 A;  5BXZ A;  2UXC O;  4LF4 O;  4DR2 O;  1XNR O;  1R1B A;  2UU9 O;  2UXB O;  2JRI A;  1R6T A;  3SDL A;  2ZKO A;  4B3T O;  4JI1 O;  5BY1 A;  1G1X B;  4LF9 O;  1N34 O;  4K0K O;  1IBM O;  4LF8 O;  4JI2 O;  3OTO O;  4DV0 O;  1AB3 A;  4DR7 O;  1XMQ O;  4JI8 O;  4DV7 O;  4DV1 O;  1XNQ O;  1NS1 A;  4X66 O;  1F7Y A;  4OX9 O;  3T1H O;  4DV5 O;  4DV6 O;  4YY3 O;  3JAM N;  2HHH O;  4X64 O;  2ZM6 O;  4JI4 O;  2AGA A;  5A2Q N;  3R66 A;  4DV2 O;  4NXN O;  3F5T A;  4X62 O;  4LFC O;  2F4V O;  1I94 O;  4NXM O;  4DR4 O;  4DR6 O;  3J81 N;  1DK1 A;  4LFA O;  4LF5 O;  1N36 O;  1XMO O;  4DUZ O;  4KHP O;  2E5L O;  4B3R O;  3T1Y O;  2UUA O;  4DV4 O;  1YZB A;  1FJG O;  4LF6 O;  5LMN O;  5IWA O;  1KUQ A;  3O65 A;  5BR8 O;  2UXD O;  1FKA O;  2Z0A A;  4DR1 O;  1D2D A;  1FYJ A;  3RT3 C;  1X59 A;  1AIL A;  1XEQ A;  4JV5 O;  3J7A U;  1IBK O;  1HNZ O;  2UUC O;  3M8A A;  2UUB O;  2VQF O;  1N33 O;  4OPH A;  1HR0 O;  4JI0 O;  1N32 O;  5LL6 Y;  1IBL O;  4OPA A;  4B3M O;  4X65 O;  2VQE O;  5FLX N;  4GKK O;  5IT9 N;  5LMU O;  4JI6 O;  4LFB O;  2DOS A;  4B3S O;  1A32 A;  4DR5 O;  4AQY O;  2DJV A;  4DUY O;  5H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...