5IT9N

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5it9N02
3O65A 4LF4O 1DK1A 4JI3O 4GKJO 1HNXO 1FYJA 4JYAO 4DR3O 5LMNO 4K0KO 3M8AA 4DR1O 5BR8O 1IBLO 4JI1O 4JI2O 2F4VO 2UUCO 2E5LO 3RT3C 4DR5O 4X65O 2UUAO 4JI4O 4NXNO 5IWAO 2DOSA 1G1XB 1XMQO 4DR4O 4KHPO 1XNQO 3T1HO 4LF7O 1YZBA 3J81N 4DUZO 4DR7O 1R6TA 1N36O 4JI6O 4JI0O 4X64O 2ZKOA 4LF6O 2UXBO 1FKAO 5IT9N 4GKKO 5BXZA 4YHHO 4X66O 2AGAA 1IBMO 4JI8O 4NXMO 5FLXN 3R66A 4DR6O 1AILA 4DV7O 4LF5O 2ZM6O 3T1YO 2N74A 1XMOO 1AB3A 4LFBO 2DJVA 4DUYO 2Z0AA 1F7YA 5LMUO 1HNZO 2UXDO 2LW7A 3J7AU 5H5NA 4LFCO 4DV3O 1X59A 2HHHO 4B3TO 4B3RO 2UXCO 4OPHA 1D2DA 4A5UB 1I94O 1N34O 4LF9O 4LFAO 4X62O 3OTOO 2VQFO 4DV5O 4DV2O 1R1BA 3F5TA 4JI5O 5LL6Y 3J80N 2VQEO 4OX9O 1HNWO 3JAMN 4JI7O 1KUQA 2UUBO 2FKXA 4JV5O 1IBKO 4OPAA 1N32O 1XNRO 4B3MO 3SDLA 4LF8O 2UU9O 4YY3O 1XEQA 1A32A 5BY1A 4DR2O 1J5EO 4DV6O 1HR0O 4AQYO 5A2QN 4DV4O 1FJGO 1NS1A 4DV1O 2JRIA 1N33O 4DV0O 4B3SO
chains in the Genus database with same CATH superfamily
4FMTA 4FFKA 2EZOA 1I94B 5JJNB 2EINB 4LF9B 2YEVA 2WAMA 2Y0IA 4JYBA 2PTMA 1YI2V 4YJ3B 1SESA 1QLNA 4Z2WA 3K5MA 3ABMB 1TVKA 2JS5A 4RO2A 2HEPA 4P9PA 2EIKB 4DV2B 2AHZA 4C7UA 1Q8IA 1OCOC 3E8HA 4I0XB 1AILA 3CJHA 3M7MX 4GLXA 4PELA 4DR4B 3JAKA 4DV6B 3OAAG 5KX5B 4LFCO 3JSNA 2ZXWC 1HW7A 3SJBC 2ZINA 1W2BU 3AG1C 4I5SA 4A5UB 1YJNV 1I94O 2QA4V 4X88A 1G4YB 3ICXA 4CC6A 4LF9O 2BTOA 3JAWB 3TXSA 1H2NA 5BR8B 4JI1B 3PJSK 2YI9A 3FFQA 2QM4A 3WB0A 2IM9A 2JGDB 2FTKA 1Q6HA 4X64B 1SQXH 1YF2A 5IJ9B 2XOKG 3CCJV 1AR1B 1AROP 3MHSC 1GH6A 1EFRG 4KXRA 4DV1O 2JRIA 1S77D 2F93B 2CH7B 2JK5C 3AG3C 4MVZA 1SETA 3K3WA 2ZD9A 2Q5ZA 4O4HA 2OYQA 3K0GA 2BE3A 2GTAA 3NXSA 4DR4O 3GWKC 1Q90D 3T1HO 4I9QA 5J9PC 2EULA 3SJCC 5E79Z 5CBHA 2YIAA 2E74B 3IC7A 4DRXB 1OCRC 4X1KA 3STZC 4O2AB 4JTCB 3AK1A 3JYCA 1N33B 4PDVA 2QTSA 2YS8A 1DTOA 1JOYA 1WAZA 3OT7A 2WSSG 1L0LH 3SYAA 4BW5A 3JD4A 1QU7A 4FLVA 5H6QA 4CH4A 1FXVA 2IH1C 2D2CB 1N4CA 1XMQB 4KHPB 2Q8VA 1K33A 2ZQMA 5KAFZ 1AR5A 4YXWG 3I55V 2YXHA 3P30A 1TAEA 3ETQA 2YXLA 3WU2Z 4OGQB 4MVUA 5GW7A 1FFXA 4DR3B 1EBOA 1OCCC 4X66B 5IJ0A 1NH2B 3ZMVA 1S0VA 2ZCEA 1IBKO 1TUBB 1WPXA 3SYPA 1XQ8A 3D3QA 5JQGA 3B8MA 4ZKIA 5EC1C 1VQ8V 2PYLA 5EZYA 1M56B 3OFNG 2ARHA 2V7QG 2EILC 1YXBA 4W4LA 4DW1A 3SR2C 4MTXA 5LHGA 2A06H 2MK3A 4YIPA 1GN4A 1NQTA 1BGYH 3L9DA 1CXZB 4KP4A 1N33O 3EXAA 3JARB 3JALA 3RBZA 5LP6A 1OCZC 4PDLA 1S76D 2LJ2A 2KKWA 4KUMA 4UV8A 2K9PA 4JI5B 1QBZA 1L0NH 4FFBA 2GSMB 4D7SA 1K92A 1KKCA 4BWAA 5KHJA 3MDSA 3L73H 1XMQO 4KHPO 4IHJB 3J81N 3VQXA 3QTCA 1F4MA 4LR3A 3ZRSA 3SJAC 2UXBO 5FNVB 2ATKC 3X2QB 4MVSA 1JVMA 4TQDA 3EVKA 5CBFA 4X66O 3ZEDA 1ZL8A 3MAQA 2GHYA 4FM0A 3IFXA 3APQA 3ZHSA 1K97A 1YHQV 4O4IB 1M5IA 2P90A 4MW3A 4MVQA 1HNZO 1YVWA 1NVPB 4F6RB 3CC4V 3ZIAG 4D7TA 1M9NA 4X20B 4WFAV 3LNNA 1MG1A 3G71V 2PGGA 4J9ZB 5FPOA 3BCCH 2WLLB 2RCVA 1VQ9V 1N34O 4I50A 1US6A 2DYRB 4JI8B 3F5TA 2IJHA 4JI5O 1HNWO 4WBNA 3K9SA 1QVGU 3RYCA 5CA1B 4R8CA 1J95A 1FFTB 3SDLA 5EK0A 3ZHQA 5LGUA 1CPYA 4LF8O 2AHYA 3FX7A 1OJHA 2UXDB 4BR6A 1Y67A 4X1YA 3RW0A 4IIJB 5KA5A 2HLDG 4IT5A 5LA6B 2OCCB 3ABKB 4DUYB 4ZI7B 1IBLO 2KG7B 4JI7B 2CUGA 3HKDA 5K1XA 1UJWB 1K5SA 4X9QA 5L3GA 1GN2A 1URFA 4QNHB 3A2FA 2JVDA 4K3AA 4R50A 1FKAO 1F23A 5EIBC 1Y76A 1N0JA 1B6QA 1VARA 1K4DC 4O2BB 4Z1MG 4JI8O 1AJPA 1XHXA 3JSLA 1P7GA 3R66A 4JI3B 1SA0B 1NR7A 3OE7G 2QDOA 2ITCC 1PNLA 3WFVA 2UU9B 1RPOA 5BZBA 4H33A 2F4VB 2E5LB 4QPKA 3UT5A 4NTYA 4PDRA 1Y74A 1T5EA 1VP7A 3HR0A 2UXDO 2EBOA 2Q7HA 1LUVA 2GUZA 3F7YC 2XTAA 4LH6A 2E76B 2JEUA 3A0BZ 4P2ZA 3Q4HB 5IE9A 3CYOA 1JX9A 1F4NA 4UCUA 1EN4A 4DK1A 4TV8A 1KD1W 3CCMV 4YJ2B 1K4CC 2GBOA 4JI7O 1G8MA 3BVOA 5DM6V 3OTFA 3IJ4A 1IDSA 4G27B 4QJFB 1JMKC 1QR9A 3N2KB 5L3BA 2W6IG 5C8YA 1FS0G 2PUSA 3K5OA 3WB1A 4HYOA 1SZXA 3P3PA 5BMVA 2Q0AA 4B3TB 4ASUG 3KZIZ 4GX5A 3SYOA 5KHGA 3JD1A 1R3IC 4JI3O 1GRJA 1S5JA 1FD9A 2F4VO 2E5LO 2LGWA 1UFIA 5J2TA 1H8EG 4B3MB 3S3WA 3ZHRA 5EYPA 1RM1C 3ZMTA 1N36O 4PJ0Z 2PI5A 2GTSA 3BPZA 5IYCO 3RYFB 2ZNIA 2WLNA 4CS4A 1FJGB 2E75B 3H01A 4I55B 3HKCB 3ZS8C 1ZX3A 4H44B 2HVKC 3T1YO 4X1IB 2ZR2A 5LGNA 1NZ6A 3WG7C 2QWOB 2QWQB 3D3IA 3JCZA 5B5EZ 2EX3A 4EFEA 5C93A 1NTZH 2BSKB 1VQNV 3UO3A 4EB6A 2Y0PA 5H5NA 1WB8A 4I4TB 4AHCA 2EIJB 4UCTA 2R72A 1VF7A 4B3TO 2ETNA 4DV0B 3U0ZA 2B1GA 4OPHA 3ZHUA 5LOVA 2V1DA 4F6EA 3RYHB 2UUBO 4FVMA 2VS0A 2Y48A 3JATA 4B3MO 2HP8A 4WFEA 1P84F 1KP3A 2AW9A 3AG2B 3E22B 4JTAB 3K57A 5KHIA 1QVFU 3W7SA 4DR2O 2IJIA 3DXRA 4UFZA 1MABG 4ZOLA 4TUYB 5LHIA 1FXKB 3CX5F 1FJGO 1Q5OA 1XI1A 5J2UB 1V55C 3L74H 2JJ1G 4Z1VA 2ILMA 2Z3YA 1GM8A 3ABLC 5L3DA 2LGQA 4PA9A 3ZBHA 4WF9V 2VQEB 2RNBA 4JTDB 3ASOB 4PDMA 3RYIB 2PZSA 3KCYA 1XOUA 5KX5A 1JFFB 2AZ0A 4LFCB 4JAUA 1GK9A 3HKEB 1YTFD 2WLIA 1V54B 1J5EB 1SQGA 1XBLA 3JASB 2CTQA 1GN6A 1CP9A 4FJCC 3ZRWA 4B7KA 4FLXA 3RGBA 4X8AA 4J9YB 3AG4C 2DYSB 2M6YA 4U7NA 1AB3A 1PL0A 5B1AB 2CGNA 4DR1B 3AEIA 4P30A 1R3JC 2Z0AA 4X65B 1Z5WA 5LMUO 1IXMA 2EINC 2XAFA 2VRZA 2UXXA 2BOBC 5IYZA 2Y69C 4DV1B 4B3RO 4MSWC 4UCRA 5KMGA 1SKVA 3K79A 4WFFA 1VQLV 2DQ3A 3KCXA 2IW5A 4U3FH 2MW2B 2IJKA 3ABMC 1S3JA 2VQEO 1R6NA 2PYJA 3H1JH 1N8RW 1N32O 1IX9A 1JPXA 3B77A 3T1HB 2EJRA 1K7DA 3E83A 2RJZA 5ITZA 5IY5B 1W59A 2ZXWB 4RUEA 3M99B 1J5EO 2ZNJA 2PI4A 3SYCA 4I9WA 1PL4A 1VQOV 4ABMA 3IC9A 3K03A 1O9HA 3G80A 1DF5A 5IYDO 3OR6C 4TV9B 5K1PA 5F2VO 2E3CA 3H1KH 3UM7A 2HG5C 4J7KA 3SJQC 4FLTA 1TA8A 3B09A 4LP8A 4DR1O 2WLHA 2DQ0A 4X65O 2P67A 5IWAO 3L71H 5KUKA 5TISZ 1VQMV 2YEVB 5HFLA 1P49A 2QE7G 3JD3A 3G4SV 2QKAA 2Y4UA 1TGOA 1VEWA 1OHHG 2B5UA 1SQFA 2LO1A 1Y6XA 5B3SB 2OCHA 1IBMO 4NXMO 1EN6A 3W7WA 1IBKB 1TVKB 1Q3EA 5JWPA 2QGNA 3H1HH 4JZGA 4LFBO 2QM8A 3OMNB 1BHBA 3CJHB 3N2GB 1X59A 3LSUA 3ASNB 3ZMUA 4LCUC 2IU0A 3VQVA 3JAKB 3QF7A 2OT5A 4FIPC 4DV5O 1Y4MA 4O4LA 1Q7YW 4GX1A 2A7WA 3CRAA 3P32A 3JAMN 1XL6A 1GAXA 2QWPB 1XUQA 4LF5B 4UXNA 4OPAA 4RQFA 1H2MA 3T1CA 3CD6V 4YIOA 4BW9A 3CCRV 2PF4E 4UCVA 1RP3B 1L8DA 1QQCA 3B4SA 2UXBB 2IH3C 2YDEA 2CTRA 1VQ4V 2ZE7A 1WNSA 2UXCB 3CS5A 4RWUA 2F1MA 2RDCA 3K9AA 4MVRA 2CAZC 3ETEA 3HKBA 4TQFA 4PHZA 1NH2D 4HNAA 3OEHG 1HNZB 1XNRB 2EILB 3DC5A 4K8ZA 2P4KA 1Q81W 4O4HB 2P6JA 1OCZB 1HR0B 1N34B 1WA8A 1DLBA 4TT3G 4UVCA 2AGAA 1HNWB 5LYJA 2F66C 2Q7GA 1AI4A 1M90W 3CRMA 4LF5O 2N74A 4X1KB 2Q67A 4LF8B 2LQTA 4JI4B 3K5NA 1U97A 2KSDA 1XILA 4D6TH 2WLJA 5L3FA 2UXCO 1FPOA 1SF9A 2AZ2A 5JVDA 4L87A 2ZE6A 1IBLB 1E79G 4KL1A 2FKXA 3X2QC 3TK1A 1LR1A 2ODMA 2WA3A 1XNRO 1FFXB 3MD0A 1MSWD 5IJ0B 5A9GA 2VWKA 3CRCA 1HR0O 1I5XA 3DGEA 5JQGB 3THOA 1NVPD 3F7VC 3UCSC 3PN1A 2QWNB 1NI8A 3ZRXA 5EZYB 2ZDIC 4B3SO 1OV9A 4ZHQA 2B1IA 2XT9A 1ZLZA 1SQPH 4K0KO 1UPGA 1K8AW 3JD0A 3JALB 4JI4O 5LP6B 2EIMB 2R9RB 2ZIOA 1XNQO 3R65A 4DR7O 4FFBB 5KA6A 4NR1A 3ZHTA 1M57B 2CTPA 4HZ3A 1B04A 4QIWF 5IT9N 3ABTA 2FMLA 5DN6G 4QE7A 1LNQA 2P4VA 4H0LB 1VQKV 4TOIA 4BIOA 5H2FZ 1K34A 1NTMH 2YIDA 3TCUA 1VF6A 2M7WA 4NTWA 5LMNB 2DWDC 2ZIMA 1QCEA 3OR7C 3FAVA 2OCCC 5EIBD 4RQEA 3ABKC 1L1FA 3D36C 1ZL8B 4PA3A 3SYQA 4MVMA 1SQBH 4FLWA 1JQ0A 3LDCA 4PA6A 1F51A 3AK2A 2ZE5A 4FM2A 3BA9A 3H9VA 3SPGA 1MZFA 3CCLV 1QLEB 1M93A 2LP7A 3ML0A 5LL6Y 2PY5A 3E35A 1WB7A 2JIZG 3CHXA 5KLVH 4LWSA 2OWOA 1H38A 5GONA 1NTKH 3U11A 4I50B 2NR5A 1N36B 3RVYA 2WPDG 5CB4A 4WBNB 3BRCA 1IZ3A 3NR7A 1SRYA 4NB5A 4O4JA 3RYCB 5JH7A 5JCOA 5H6RA 2CGOA 5CA3A 4PI0A 1AI6A 3H1LH 4P9OA 3VOUA 3OTOB 3TXQA 3T1YB 4X1YB 5LMNO 3E2EA 1EZJA 3TETA 5KHKA 4J7JA 3CRQA 4J41A 4BAYA 1G1XB 3CB2A 1BCCH 4J42A 1QNMA 3E8GA 4JI6O 4BIUA 3HKDB 3BY6A 1VF6C 4WFGA 2BOCC 4G28B 4GYCB 3K58A 3CWBH 4J11A 4U3JA 2OTLV 4LNUA 1ROPA 4CS3A 2DE0X 1B06A 2UUBB 1KECA 1Y76B 1MSDA 1RSOA 3IGAC 2X0LA 3VBBA 3UKMA 1Q86W 1Z2GA 2BTQA 4AILC 4JI2B 3VQYA 2ZT9B 4NXNB 4QPJA 1JR9A 1ZAUA 4DR2B 1I7FA 1ZWIC 4DO2A 2Q68A 4UV9A 3JCUZ 4XBFA 3APOA 2CTWA 3EFFK 3UT5B 4LF6B 2F95B 4GCZA 1Y74B 2Q4PA 1YJ9V 2DW4A 4JASA 4WCEV 2GUZB 4B08A 3ZX6A 1NU1H 4IL6Z 3OTOO 4CBCA 1RFYA 1XL4A 2C2AA 4IGGA 3K04A 4NYKA 1M1KW 5EBMC 5CA0A 3BEHA 2H3OA 3S3XA 5JCOC 4TV8B 5LXTA 4YY3O 3QVNA 1A32A 2EZPA 1PKXA 5B1BB 5HFMA 1PPJH 4JPRA 3DC6A 4TWKA 3JASA 3HPLC 3CMAV 3ZCCA 1H2GA 3A0HZ 3E89A 5C8YB 3OUFA 4YJ3A 5BMVB 3JD2A 3CCSV 1G6UA 2EIJC 5B1NA 1XHZA 4CH6A 4OX9B 3AG7A 4JI2O 2QM7A 3ZRVA 5LMUB 2RQ6A 4NXNO 3LSSA 1GTOA 2W6JG 4CH5A 2Q73A 3I5DA 4FZ0A 5D5PA 4JI0O 2N05A 4B3RB 4LF6O 1V55B 2OTJV 2QKSA 4I0XA 3D8CA 2D3OW 4H37A 5J2TB 5EC2C 4B7EA 4L8JA 5EYPB 1H2SB 2FL4A 3AG2C 3L72H 3MHHC 4LF4B 3FYEB 5KHHA 2FB5A 1FXKC 1N32B 2HVJC 4KFMA 1H2LA 2QSAA 4XDLA 2UUCB 1GO3F 4HAMA 4DYLA 4XDJA 1QHTA 3JAWA 1THZA 4R7CA 1VMGA 2JS3A 3ASOC 2HJFC 1LUWA 1Q82W 2L35A 3OGIB 4UCSA 2F43G 4EB6B 2JGDA 1GM7A 4Q6GA 2CK3G 1R1BA 3B40A 3K59A 4PD4F 5JJJB 1BSMA 3GVMA 1V54C 2XASA 4OX9O 2L6LA 1PNMA 1WP7A 5IJ9A 5IWAB 5LGTA 5IDJA 5LOVB 4UB8Z 3BFRA 2Y69B 1GKFA 4DK0A 2YIBA 2DYSC 3RN4A 1OCOB 3FD9A 3JATB 4DW0A 2CH7A 4ICGA 1ZTEA 5B1AC 4TSFG 4DV4O 1VIBA 1VQPV 2DMXA 1IBMB 4NXMB 3CXHF 4UVBA 2CE4A 1COWG 3CCUV 1AI7A 2R9AA 3H1IH 3O65A 4PV1B 4LF4O 3DXRB 2EIKC 3UQ8A 4ZOLB 1FYJA 4LFBB 1H2KA 3CCVV 3W7TA 3M8AA 2UUCO 3RT3C 2DN9A 3HB3B 3ETGA 4DRXA 2X6AA 1H8HG 1DF4A 3AG1B 3CE2A 3N2GA 1BQ0A 2R70A 4O2AA 1S72V 3OW2U 1MOFA 1MNGA 5CMUA 3EHBB 1NKDA 2XAJA 1I08A 4N21A 4AQYB 4JZ2A 4U7OA 4DV5B 4LC1A 2ADQB 1PV0A 3A8TA 5BXZA 3OGCC 1JJ2U 5IY5C 2WLIB 4GKJB 2WLKA 4WFBV 3QO8A 4FLUA 3RVZA 1EM1A 2JGUA 3CC2V 4JGSA 4OXSA 3ZRWB 2Q69A 2P22C 3J7AU 4LF7B 2Q9LA 3CRRA 3AG3B 1PNKA 1IVSA 3K06A 4WFHA 2X6CA 2H94A 4QE9A 4E2LA 1TUBA 2YIBD 4X89A 4J7ZA 1ENVA 4GKKB 2IBZH 5IYZB 1BMFG 4DV2O 3ABUA 3TJTA 3LNMB 5IYBO 5KMGB 2NNUA 4J80A 4GZRB 3T4ZA 5B3SC 4IYHA 1KKDA 1OCRB 4UCOA 1X4TA 1E1RG 1JJOA 4PI2A 4EEQA 3AK3A 3ETDA 1O9GA 3JARA 3CC7V 2GV9A 4DV6O 4AQYO 5A2QN 1YITV 1GN3A 4DV3B 2RN9A 1NJIW 1NS1A 2JJ2G 3SPJA 1OZ0A 5ITZB 3FB8C 2YXYA 1MA1A 4GKJO 1BHAA 1VQ5V 2Q6AA 4IHJA 3ASNC 5BR8O 4JI1O 1K3EA 2XAGA 4QGPA 5FNVA 5L3CA 5DEDA 3SGIA 2Q7EA 3T2MA 3OUSA 4LF7O 1YZBA 1R6TA 1OCCB 3KKYA 4X64O 2DWEC 4GKKO 2Q0OC 3L70H 1QR8A 4O4IA 3ZMZA 2OIEA 1SQQH 3FB7C 5FLXN 2ZDIA 4F6RA 3DSQA 4JYAB 5GTHZ 4FLZA 4X20A 2A0LA 1SQVH 5FPRA 2Y4TA 1S5HC 2WLLA 2JDIG 3OM3B 4DUZB 4DV3O 4RAIA 1YCIA 1GMGA 1M56C 4B3SB 1AI5A 5CA1A 2X6BA 2EJ7A 1V9PA 3W7UA 4K0KB 4CC5A 4G2KA 3SPIA 1K5QA 3TGUH 1HWYA 3OEEG 2KB1A 4AI8A 4DR6B 1KBHA 3CEIA 4DV7B 2ZM6B 3CPWU 3F5WC 1XNQB 4IIJA 2OIGA 1W0KG 4O4LB 4DR7B 2QWRB 3E8FA 5LA6A 4E4EA 4JAVA 3STLC 5GTIZ 2YI8A 4BIZA 3D36A 3OMAB 3U10A 5H9CA 2K1EA 4ZI7A 1EZVH 4ZBMA 3ZMSA 1YEWA 2KG7A 5CN0A 2LW1A 3K0DA 4IYIA 3CXCU 4LFAB 3E8BA 2QEXV 1Q6IA 4JYAO 2JEXA 4DR3O 2XHBA 2P5OA 3CCQV 3CCEV 3OMIB 4JV5B 2P06A 1HDJA 4DXWA 2NLJC 2QJ1A 1BT8A 3HKBB 4O2BA 3WB2A 4DUZO 2XAHA 1WPBA 1AVMA 3C3SA 1SS3A 4F4LA 1SA0A 4HNAB 2VWJA 3VQWA 3I56V 1KQSU 3QO7A 2FYUH 2HFEC 5LBQA 3G6EV 5D5QA 4MTFA 4DR6O 1HNXB 4DV7O 2ZM6O 1WA8B 1NBMG 1VQ6V 2DYRC 2DJVA 4W4KA 1Q43A 1D5NA 4DR5B 5LYJB 2UUAB 4CH3A 3Q4HA 1AJNA 4GUNA 4MT8A 4GX0A 2LFRA 4JAAA 3BHPA 1RPRA 4FM1A 3B2EE 3C3TA 4YJ2A 2XUMA 5LP6C 2EIMC 2WWWA 4LFAO 1P7BA 3CSXA 4MTGA 1M57C 3N2KA 1JA8A 2LFSA 1KYOF 3RFRA 1KUQA 1R6KA 3LSQA 4JV5O 5E1AC 1AP6A 3K08A 5JVDB 4FZ1A 4HBNA 2Z5UA 4JI6B 3LUTB 1XDCA 1MZEA 3QO5A 3O9OA 2HJDA 4MW8A 4PA4A 5KUMA 1KC8W 1ZSPA 5CBGA 5JJEB 3ZHVA 1D5AA 4ZIBA 3T4DA 2XNDG 2WA4A 1PD3A 1GM9A 2RMKB 5FL7G 1HNXO 2VQFB 1K73W 2ZR3A 5EBWC 2YICA 1VQ7V 4N23A 3GB7C 4RUFA 5B66Z 4DR5O 2UUAO 3L75H 1KP2A 2IU3A 4ZHQB 3RYFA 1MMMA 1QLEC 3ZN0A 1VF5B 1NR1A 1YSCA 1B3QA 2YSUB 2H8PC 4XDKA 4I55A 3HKCA 5KAIZ 1TUEB 3K5LA 1K9MW 1YIJV 3FYIB 1DGSA 4NVPA 4X1IA 4Q20A 2V4DA 1M4UA 1WN7A 3G6BA 3G67A 2P7TC 2BSKA 2G38A 3ZJZA 4UVAA 3A0RA 3P3NA 4I4TA 4YY3B 1JCHA 4DUYO 3C90A 5L3EA 2AXTZ 1ORQC 1U96A 1YDXA 1F7YA 1WLEA 4EFBA 2QKCA 3FAVB 3RYHA 3IAYA 4UB6Z 1Y66A 1FAFA 1AR4A 3N27A 2VQFO 4YHHB 2QTOA 2N04A 1RM1B 3E22A 1CEZA 1XMOB 1FXHA 4TUYA 1FXKA 2UU9O 4K8XA 1R73A 4I7ZB 1PM9A 1SC5B 2HR3A 3UO2A 4JI0B 2HKOA 1HP8A 1XEQA 2IJJA 1W0JG 1Z5VA 5J2UA 3KG2A 5BY1A 3CMEV 4LWSB 4JYCA 5GONB 2F23A 2YC0A 2HHHB 4JF3A 3WG7B 4FK5C 5CB4B 3LDEA 2W0FC 4MVOA 3ZN1A 1BZKA 1DK1A 2B9ZA 4O4JB 4EKWA 2ADPA 3RYIA 1KU9A 4X62B 1N0NA 2XAQA 1JFFA 5JH7B 2ITDC 4MS2A 2WLMA 3HKEA 3FKSG 2DOSA 1KMIZ 5EBLC 1AJQA 2NN4A 5LHHA 1BL8A 2ZKOA 3QNEA 1WJZA 1Q6UA 4MTOA 3RWRD 1I5YA 2ZE8A 3QG5A 4K35A 4YHHO 2CDYA 4PA7A 5B1BC 5AG2A 1S5LZ 1IXBA 3DTUB 1EN5A 3W7XA 1BQZA 1XMOO 2QR4A 4R6ZA 4U3JB 1NT2B 1R3KC 5DECA 4GT1A 4LNUB 5B1OA 1YJWV 1AP5A 3GWOA 1IURA 1P4RA 1XREA 1RSOB 2YUAA 1ZUQA 2LW7A 1PP9H 2BCCH 4LBEC 4DV4B 3ABLB 4GX2A 2BTQB 1R3LC 2HHHO 2A9HA 1D2DA 4FLYA 4JYYA 4X62O 3OD4A 4UUJC 1I0HA 2GDSA 3J80N 2O57A 2W0XA 4CZZA 1E1QG 3LDDA 2X7RB 1KB9F 1SZTA 1BE3H 4LH7A 1WP8A 2R9IA 4NTXA 1YTFB 1BS3A 2KQXA 4FPPA 3FB6C 5CA0B 3BA8A 4H13B 3SPCA 4CS2A 4TV9A 3AG4B 4NKGB 3CP1A 5LXTB 3BABA 2A3QA 3BAAA 4J10A 3E86A 3SPHA 2UXNA 3B8NA 3FB5C 2A79B 4DV0O 1SERA
chains in the Genus database with same CATH topology
3O65A 4LF4O 1DK1A 4JI3O 4GKJO 1HNXO 1FYJA 4JYAO 4DR3O 5LMNO 4K0KO 3M8AA 4DR1O 5BR8O 1IBLO 4JI1O 4JI2O 2F4VO 2UUCO 2E5LO 3RT3C 4DR5O 4X65O 2UUAO 4JI4O 4NXNO 5IWAO 2DOSA 1G1XB 1XMQO 4DR4O 4KHPO 1XNQO 3T1HO 4LF7O 1YZBA 3J81N 4DUZO 4DR7O 1R6TA 1N36O 4JI6O 4JI0O 4X64O 2ZKOA 4LF6O 2UXBO 1FKAO 5IT9N 4GKKO 5BXZA 4YHHO 4X66O 2AGAA 1IBMO 4JI8O 4NXMO 5FLXN 3R66A 4DR6O 1AILA 4DV7O 4LF5O 2ZM6O 3T1YO 2N74A 1XMOO 1AB3A 4LFBO 2DJVA 4DUYO 2Z0AA 1F7YA 5LMUO 1HNZO 2UXDO 2LW7A 3J7AU 5H5NA 4LFCO 4DV3O 1X59A 2HHHO 4B3TO 4B3RO 2UXCO 4OPHA 1D2DA 4A5UB 1I94O 1N34O 4LF9O 4LFAO 4X62O 3OTOO 2VQFO 4DV5O 4DV2O 1R1BA 3F5TA 4JI5O 5LL6Y 3J80N 2VQEO 4OX9O 1HNWO 3JAMN 4JI7O 1KUQA 2UUBO 2FKXA 4JV5O 1IBKO 4OPAA 1N32O 1XNRO 4B3MO 3SDLA 4LF8O 2UU9O 4YY3O 1XEQA 1A32A 5BY1A 4DR2O 1J5EO 4DV6O 1HR0O 4AQYO 5A2QN 4DV4O 1FJGO 1NS1A 4DV1O 2JRIA 1N33O 4DV0O 4B3SO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O65 A;  4LF4 O;  1DK1 A;  4JI3 O;  4GKJ O;  1HNX O;  1FYJ A;  4JYA O;  4DR3 O;  5LMN O;  4K0K O;  3M8A A;  4DR1 O;  5BR8 O;  1IBL O;  4JI1 O;  4JI2 O;  2F4V O;  2UUC O;  2E5L O;  3RT3 C;  4DR5 O;  4X65 O;  2UUA O;  4JI4 O;  4NXN O;  5IWA O;  2DOS A;  1G1X B;  1XMQ O;  4DR4 O;  4KHP O;  1XNQ O;  3T1H O;  4LF7 O;  1YZB A;  3J81 N;  4DUZ O;  4DR7 O;  1R6T A;  1N36 O;  4JI6 O;  4JI0 O;  4X64 O;  2ZKO A;  4LF6 O;  2UXB O;  1FKA O;  5IT9 N;  4GKK O;  5BXZ A;  4YHH O;  4X66 O;  2AGA A;  1IBM O;  4JI8 O;  4NXM O;  5FLX N;  3R66 A;  4DR6 O;  1AIL A;  4DV7 O;  4LF5 O;  2ZM6 O;  3T1Y O;  2N74 A;  1XMO O;  1AB3 A;  4LFB O;  2DJV A;  4DUY O;  2Z0A A;  1F7Y A;  5LMU O;  1HNZ O;  2UXD O;  2LW7 A;  3J7A U;  5H5N A;  4LFC O;  4DV3 O;  1X59 A;  2HHH O;  4B3T O;  4B3R O;  2UXC O;  4OPH A;  1D2D A;  4A5U B;  1I94 O;  1N34 O;  4LF9 O;  4LFA O;  4X62 O;  3OTO O;  2VQF O;  4DV5 O;  4DV2 O;  1R1B A;  3F5T A;  4JI5 O;  5LL6 Y;  3J80 N;  2VQE O;  4OX9 O;  1HNW O;  3JAM N;  4JI7 O;  1KUQ A;  2UUB O;  2FKX A;  4JV5 O;  1IBK O;  4OPA A;  1N32 O;  1XNR O;  4B3M O;  3SDL A;  4LF8 O;  2UU9 O;  4YY3 O;  1XEQ A;  1A32 A;  5BY1 A;  4DR2 O;  1J5E O;  4DV6 O;  1HR0 O;  4AQY O;  5A2Q N;  4DV4 O;  1FJG O;  1NS1 A;  4DV1 O;  2JRI A;  1N33 O;  4DV0 O;  4B3S O; 
#chains in the Genus database with same CATH topology
 4FMT A;  4FFK A;  2EZO A;  1I94 B;  5JJN B;  2EIN B;  4LF9 B;  2YEV A;  2WAM A;  2Y0I A;  4JYB A;  2PTM A;  1YI2 V;  4YJ3 B;  1SES A;  1QLN A;  4Z2W A;  3K5M A;  3ABM B;  1TVK A;  2JS5 A;  4RO2 A;  2HEP A;  4P9P A;  2EIK B;  4DV2 B;  2AHZ A;  4C7U A;  1Q8I A;  1OCO C;  3E8H A;  4I0X B;  1AIL A;  3CJH A;  3M7M X;  4GLX A;  4PEL A;  4DR4 B;  3JAK A;  4DV6 B;  3OAA G;  5KX5 B;  4LFC O;  3JSN A;  2ZXW C;  1HW7 A;  3SJB C;  2ZIN A;  1W2B U;  3AG1 C;  4I5S A;  4A5U B;  1YJN V;  1I94 O;  2QA4 V;  4X88 A;  1G4Y B;  3ICX A;  4CC6 A;  4LF9 O;  2BTO A;  3JAW B;  3TXS A;  1H2N A;  5BR8 B;  4JI1 B;  3PJS K;  2YI9 A;  3FFQ A;  2QM4 A;  3WB0 A;  2IM9 A;  2JGD B;  2FTK A;  1Q6H A;  4X64 B;  1SQX H;  1YF2 A;  5IJ9 B;  2XOK G;  3CCJ V;  1AR1 B;  1ARO P;  3MHS C;  1GH6 A;  1EFR G;  4KXR A;  4DV1 O;  2JRI A;  1S77 D;  2F93 B;  2CH7 B;  2JK5 C;  3AG3 C;  4MVZ A;  1SET A;  3K3W A;  2ZD9 A;  2Q5Z A;  4O4H A;  2OYQ A;  3K0G A;  2BE3 A;  2GTA A;  3NXS A;  4DR4 O;  3GWK C;  1Q90 D;  3T1H O;  4I9Q A;  5J9P C;  2EUL A;  3SJC C;  5E79 Z;  5CBH A;  2YIA A;  2E74 B;  3IC7 A;  4DRX B;  1OCR C;  4X1K A;  3STZ C;  4O2A B;  4JTC B;  3AK1 A;  3JYC A;  1N33 B;  4PDV A;  2QTS A;  2YS8 A;  1DTO A;  1JOY A;  1WAZ A;  3OT7 A;  2WSS G;  1L0L H;  3SYA A;  4BW5 A;  3JD4 A;  1QU7 A;  4FLV A;  5H6Q A;  4CH4 A;  1FXV A;  2IH1 C;  2D2C B;  1N4C A;  1XMQ B;  4KHP B;  2Q8V A;  1K33 A;  2ZQM A;  5KAF Z;  1AR5 A;  4YXW G;  3I55 V;  2YXH A;  3P30 A;  1TAE A;  3ETQ A;  2YXL A;  3WU2 Z;  4OGQ B;  4MVU A;  5GW7 A;  1FFX A;  4DR3 B;  1EBO A;  1OCC C;  4X66 B;  5IJ0 A;  1NH2 B;  3ZMV A;  1S0V A;  2ZCE A;  1IBK O;  1TUB B;  1WPX A;  3SYP A;  1XQ8 A;  3D3Q A;  5JQG A;  3B8M A;  4ZKI A;  5EC1 C;  1VQ8 V;  2PYL A;  5EZY A;  1M56 B;  3OFN G;  2ARH A;  2V7Q G;  2EIL C;  1YXB A;  4W4L A;  4DW1 A;  3SR2 C;  4MTX A;  5LHG A;  2A06 H;  2MK3 A;  4YIP A;  1GN4 A;  1NQT A;  1BGY H;  3L9D A;  1CXZ B;  4KP4 A;  1N33 O;  3EXA A;  3JAR B;  3JAL A;  3RBZ A;  5LP6 A;  1OCZ C;  4PDL A;  1S76 D;  2LJ2 A;  2KKW A;  4KUM A;  4UV8 A;  2K9P A;  4JI5 B;  1QBZ A;  1L0N H;  4FFB A;  2GSM B;  4D7S A;  1K92 A;  1KKC A;  4BWA A;  5KHJ A;  3MDS A;  3L73 H;  1XMQ O;  4KHP O;  4IHJ B;  3J81 N;  3VQX A;  3QTC A;  1F4M A;  4LR3 A;  3ZRS A;  3SJA C;  2UXB O;  5FNV B;  2ATK C;  3X2Q B;  4MVS A;  1JVM A;  4TQD A;  3EVK A;  5CBF A;  4X66 O;  3ZED A;  1ZL8 A;  3MAQ A;  2GHY A;  4FM0 A;  3IFX A;  3APQ A;  3ZHS A;  1K97 A;  1YHQ V;  4O4I B;  1M5I A;  2P90 A;  4MW3 A;  4MVQ A;  1HNZ O;  1YVW A;  1NVP B;  4F6R B;  3CC4 V;  3ZIA G;  4D7T A;  1M9N A;  4X20 B;  4WFA V;  3LNN A;  1MG1 A;  3G71 V;  2PGG A;  4J9Z B;  5FPO A;  3BCC H;  2WLL B;  2RCV A;  1VQ9 V;  1N34 O;  4I50 A;  1US6 A;  2DYR B;  4JI8 B;  3F5T A;  2IJH A;  4JI5 O;  1HNW O;  4WBN A;  3K9S A;  1QVG U;  3RYC A;  5CA1 B;  4R8C A;  1J95 A;  1FFT B;  3SDL A;  5EK0 A;  3ZHQ A;  5LGU A;  1CPY A;  4LF8 O;  2AHY A;  3FX7 A;  1OJH A;  2UXD B;  4BR6 A;  1Y67 A;  4X1Y A;  3RW0 A;  4IIJ B;  5KA5 A;  2HLD G;  4IT5 A;  5LA6 B;  2OCC B;  3ABK B;  4DUY B;  4ZI7 B;  1IBL O;  2KG7 B;  4JI7 B;  2CUG A;  3HKD A;  5K1X A;  1UJW B;  1K5S A;  4X9Q A;  5L3G A;  1GN2 A;  1URF A;  4QNH B;  3A2F A;  2JVD A;  4K3A A;  4R50 A;  1FKA O;  1F23 A;  5EIB C;  1Y76 A;  1N0J A;  1B6Q A;  1VAR A;  1K4D C;  4O2B B;  4Z1M G;  4JI8 O;  1AJP A;  1XHX A;  3JSL A;  1P7G A;  3R66 A;  4JI3 B;  1SA0 B;  1NR7 A;  3OE7 G;  2QDO A;  2ITC C;  1PNL A;  3WFV A;  2UU9 B;  1RPO A;  5BZB A;  4H33 A;  2F4V B;  2E5L B;  4QPK A;  3UT5 A;  4NTY A;  4PDR A;  1Y74 A;  1T5E A;  1VP7 A;  3HR0 A;  2UXD O;  2EBO A;  2Q7H A;  1LUV A;  2GUZ A;  3F7Y C;  2XTA A;  4LH6 A;  2E76 B;  2JEU A;  3A0B Z;  4P2Z A;  3Q4H B;  5IE9 A;  3CYO A;  1JX9 A;  1F4N A;  4UCU A;  1EN4 A;  4DK1 A;  4TV8 A;  1KD1 W;  3CCM V;  4YJ2 B;  1K4C C;  2GBO A;  4JI7 O;  1G8M A;  3BVO A;  5DM6 V;  3OTF A;  3IJ4 A;  1IDS A;  4G27 B;  4QJF B;  1JMK C;  1QR9 A;  3N2K B;  5L3B A;  2W6I G;  5C8Y A;  1FS0 G;  2PUS A;  3K5O A;  3WB1 A;  4HYO A;  1SZX A;  3P3P A;  5BMV A;  2Q0A A;  4B3T B;  4ASU G;  3KZI Z;  4GX5 A;  3SYO A;  5KHG A;  3JD1 A;  1R3I C;  4JI3 O;  1GRJ A;  1S5J A;  1FD9 A;  2F4V O;  2E5L O;  2LGW A;  1UFI A;  5J2T A;  1H8E G;  4B3M B;  3S3W A;  3ZHR A;  5EYP A;  1RM1 C;  3ZMT A;  1N36 O;  4PJ0 Z;  2PI5 A;  2GTS A;  3BPZ A;  5IYC O;  3RYF B;  2ZNI A;  2WLN A;  4CS4 A;  1FJG B;  2E75 B;  3H01 A;  4I55 B;  3HKC B;  3ZS8 C;  1ZX3 A;  4H44 B;  2HVK C;  3T1Y O;  4X1I B;  2ZR2 A;  5LGN A;  1NZ6 A;  3WG7 C;  2QWO B;  2QWQ B;  3D3I A;  3JCZ A;  5B5E Z;  2EX3 A;  4EFE A;  5C93 A;  1NTZ H;  2BSK B;  1VQN V;  3UO3 A;  4EB6 A;  2Y0P A;  5H5N A;  1WB8 A;  4I4T B;  4AHC A;  2EIJ B;  4UCT A;  2R72 A;  1VF7 A;  4B3T O;  2ETN A;  4DV0 B;  3U0Z A;  2B1G A;  4OPH A;  3ZHU A;  5LOV A;  2V1D A;  4F6E A;  3RYH B;  2UUB O;  4FVM A;  2VS0 A;  2Y48 A;  3JAT A;  4B3M O;  2HP8 A;  4WFE A;  1P84 F;  1KP3 A;  2AW9 A;  3AG2 B;  3E22 B;  4JTA B;  3K57 A;  5KHI A;  1QVF U;  3W7S A;  4DR2 O;  2IJI A;  3DXR A;  4UFZ A;  1MAB G;  4ZOL A;  4TUY B;  5LHI A;  1FXK B;  3CX5 F;  1FJG O;  1Q5O A;  1XI1 A;  5J2U B;  1V55 C;  3L74 H;  2JJ1 G;  4Z1V A;  2ILM A;  2Z3Y A;  1GM8 A;  3ABL C;  5L3D A;  2LGQ A;  4PA9 A;  3ZBH A;  4WF9 V;  2VQE B;  2RNB A;  4JTD B;  3ASO B;  4PDM A;  3RYI B;  2PZS A;  3KCY A;  1XOU A;  5KX5 A;  1JFF B;  2AZ0 A;  4LFC B;  4JAU A;  1GK9 A;  3HKE B;  1YTF D;  2WLI A;  1V54 B;  1J5E B;  1SQG A;  1XBL A;  3JAS B;  2CTQ A;  1GN6 A;  1CP9 A;  4FJC C;  3ZRW A;  4B7K A;  4FLX A;  3RGB A;  4X8A A;  4J9Y B;  3AG4 C;  2DYS B;  2M6Y A;  4U7N A;  1AB3 A;  1PL0 A;  5B1A B;  2CGN A;  4DR1 B;  3AEI A;  4P30 A;  1R3J C;  2Z0A A;  4X65 B;  1Z5W A;  5LMU O;  1IXM A;  2EIN C;  2XAF A;  2VRZ A;  2UXX A;  2BOB C;  5IYZ A;  2Y69 C;  4DV1 B;  4B3R O;  4MSW C;  4UCR A;  5KMG A;  1SKV A;  3K79 A;  4WFF A;  1VQL V;  2DQ3 A;  3KCX A;  2IW5 A;  4U3F H;  2MW2 B;  2IJK A;  3ABM C;  1S3J A;  2VQE O;  1R6N A;  2PYJ A;  3H1J H;  1N8R W;  1N32 O;  1IX9 A;  1JPX A;  3B77 A;  3T1H B;  2EJR A;  1K7D A;  3E83 A;  2RJZ A;  5ITZ A;  5IY5 B;  1W59 A;  2ZXW B;  4RUE A;  3M99 B;  1J5E O;  2ZNJ A;  2PI4 A;  3SYC A;  4I9W A;  1PL4 A;  1VQO V;  4ABM A;  3IC9 A;  3K03 A;  1O9H A;  3G80 A;  1DF5 A;  5IYD O;  3OR6 C;  4TV9 B;  5K1P A;  5F2V O;  2E3C A;  3H1K H;  3UM7 A;  2HG5 C;  4J7K A;  3SJQ C;  4FLT A;  1TA8 A;  3B09 A;  4LP8 A;  4DR1 O;  2WLH A;  2DQ0 A;  4X65 O;  2P67 A;  5IWA O;  3L71 H;  5KUK A;  5TIS Z;  1VQM V;  2YEV B;  5HFL A;  1P49 A;  2QE7 G;  3JD3 A;  3G4S V;  2QKA A;  2Y4U A;  1TGO A;  1VEW A;  1OHH G;  2B5U A;  1SQF A;  2LO1 A;  1Y6X A;  5B3S B;  2OCH A;  1IBM O;  4NXM O;  1EN6 A;  3W7W A;  1IBK B;  1TVK B;  1Q3E A;  5JWP A;  2QGN A;  3H1H H;  4JZG A;  4LFB O;  2QM8 A;  3OMN B;  1BHB A;  3CJH B;  3N2G B;  1X59 A;  3LSU A;  3ASN B;  3ZMU A;  4LCU C;  2IU0 A;  3VQV A;  3JAK B;  3QF7 A;  2OT5 A;  4FIP C;  4DV5 O;  1Y4M A;  4O4L A;  1Q7Y W;  4GX1 A;  2A7W A;  3CRA A;  3P32 A;  3JAM N;  1XL6 A;  1GAX A;  2QWP B;  1XUQ A;  4LF5 B;  4UXN A;  4OPA A;  4RQF A;  1H2M A;  3T1C A;  3CD6 V;  4YIO A;  4BW9 A;  3CCR V;  2PF4 E;  4UCV A;  1RP3 B;  1L8D A;  1QQC A;  3B4S A;  2UXB B;  2IH3 C;  2YDE A;  2CTR A;  1VQ4 V;  2ZE7 A;  1WNS A;  2UXC B;  3CS5 A;  4RWU A;  2F1M A;  2RDC A;  3K9A A;  4MVR A;  2CAZ C;  3ETE A;  3HKB A;  4TQF A;  4PHZ A;  1NH2 D;  4HNA A;  3OEH G;  1HNZ B;  1XNR B;  2EIL B;  3DC5 A;  4K8Z A;  2P4K A;  1Q81 W;  4O4H B;  2P6J A;  1OCZ B;  1HR0 B;  1N34 B;  1WA8 A;  1DLB A;  4TT3 G;  4UVC A;  2AGA A;  1HNW B;  5LYJ A;  2F66 C;  2Q7G A;  1AI4 A;  1M90 W;  3CRM A;  4LF5 O;  2N74 A;  4X1K B;  2Q67 A;  4LF8 B;  2LQT A;  4JI4 B;  3K5N A;  1U97 A;  2KSD A;  1XIL A;  4D6T H;  2WLJ A;  5L3F A;  2UXC O;  1FPO A;  1SF9 A;  2AZ2 A;  5JVD A;  4L87 A;  2ZE6 A;  1IBL B;  1E79 G;  4KL1 A;  2FKX A;  3X2Q C;  3TK1 A;  1LR1 A;  2ODM A;  2WA3 A;  1XNR O;  1FFX B;  3MD0 A;  1MSW D;  5IJ0 B;  5A9G A;  2VWK A;  3CRC A;  1HR0 O;  1I5X A;  3DGE A;  5JQG B;  3THO A;  1NVP D;  3F7V C;  3UCS C;  3PN1 A;  2QWN B;  1NI8 A;  3ZRX A;  5EZY B;  2ZDI C;  4B3S O;  1OV9 A;  4ZHQ A;  2B1I A;  2XT9 A;  1ZLZ A;  1SQP H;  4K0K O;  1UPG A;  1K8A W;  3JD0 A;  3JAL B;  4JI4 O;  5LP6 B;  2EIM B;  2R9R B;  2ZIO A;  1XNQ O;  3R65 A;  4DR7 O;  4FFB B;  5KA6 A;  4NR1 A;  3ZHT A;  1M57 B;  2CTP A;  4HZ3 A;  1B04 A;  4QIW F;  5IT9 N;  3ABT A;  2FML A;  5DN6 G;  4QE7 A;  1LNQ A;  2P4V A;  4H0L B;  1VQK V;  4TOI A;  4BIO A;  5H2F Z;  1K34 A;  1NTM H;  2YID A;  3TCU A;  1VF6 A;  2M7W A;  4NTW A;  5LMN B;  2DWD C;  2ZIM A;  1QCE A;  3OR7 C;  3FAV A;  2OCC C;  5EIB D;  4RQE A;  3ABK C;  1L1F A;  3D36 C;  1ZL8 B;  4PA3 A;  3SYQ A;  4MVM A;  1SQB H;  4FLW A;  1JQ0 A;  3LDC A;  4PA6 A;  1F51 A;  3AK2 A;  2ZE5 A;  4FM2 A;  3BA9 A;  3H9V A;  3SPG A;  1MZF A;  3CCL V;  1QLE B;  1M93 A;  2LP7 A;  3ML0 A;  5LL6 Y;  2PY5 A;  3E35 A;  1WB7 A;  2JIZ G;  3CHX A;  5KLV H;  4LWS A;  2OWO A;  1H38 A;  5GON A;  1NTK H;  3U11 A;  4I50 B;  2NR5 A;  1N36 B;  3RVY A;  2WPD G;  5CB4 A;  4WBN B;  3BRC A;  1IZ3 A;  3NR7 A;  1SRY A;  4NB5 A;  4O4J A;  3RYC B;  5JH7 A;  5JCO A;  5H6R A;  2CGO A;  5CA3 A;  4PI0 A;  1AI6 A;  3H1L H;  4P9O A;  3VOU A;  3OTO B;  3TXQ A;  3T1Y B;  4X1Y B;  5LMN O;  3E2E A;  1EZJ A;  3TET A;  5KHK A;  4J7J A;  3CRQ A;  4J41 A;  4BAY A;  1G1X B;  3CB2 A;  1BCC H;  4J42 A;  1QNM A;  3E8G A;  4JI6 O;  4BIU A;  3HKD B;  3BY6 A;  1VF6 C;  4WFG A;  2BOC C;  4G28 B;  4GYC B;  3K58 A;  3CWB H;  4J11 A;  4U3J A;  2OTL V;  4LNU A;  1ROP A;  4CS3 A;  2DE0 X;  1B06 A;  2UUB B;  1KEC A;  1Y76 B;  1MSD A;  1RSO A;  3IGA C;  2X0L A;  3VBB A;  3UKM A;  1Q86 W;  1Z2G A;  2BTQ A;  4AIL C;  4JI2 B;  3VQY A;  2ZT9 B;  4NXN B;  4QPJ A;  1JR9 A;  1ZAU A;  4DR2 B;  1I7F A;  1ZWI C;  4DO2 A;  2Q68 A;  4UV9 A;  3JCU Z;  4XBF A;  3APO A;  2CTW A;  3EFF K;  3UT5 B;  4LF6 B;  2F95 B;  4GCZ A;  1Y74 B;  2Q4P A;  1YJ9 V;  2DW4 A;  4JAS A;  4WCE V;  2GUZ B;  4B08 A;  3ZX6 A;  1NU1 H;  4IL6 Z;  3OTO O;  4CBC A;  1RFY A;  1XL4 A;  2C2A A;  4IGG A;  3K04 A;  4NYK A;  1M1K W;  5EBM C;  5CA0 A;  3BEH A;  2H3O A;  3S3X A;  5JCO C;  4TV8 B;  5LXT A;  4YY3 O;  3QVN A;  1A32 A;  2EZP A;  1PKX A;  5B1B B;  5HFM A;  1PPJ H;  4JPR A;  3DC6 A;  4TWK A;  3JAS A;  3HPL C;  3CMA V;  3ZCC A;  1H2G A;  3A0H Z;  3E89 A;  5C8Y B;  3OUF A;  4YJ3 A;  5BMV B;  3JD2 A;  3CCS V;  1G6U A;  2EIJ C;  5B1N A;  1XHZ A;  4CH6 A;  4OX9 B;  3AG7 A;  4JI2 O;  2QM7 A;  3ZRV A;  5LMU B;  2RQ6 A;  4NXN O;  3LSS A;  1GTO A;  2W6J G;  4CH5 A;  2Q73 A;  3I5D A;  4FZ0 A;  5D5P A;  4JI0 O;  2N05 A;  4B3R B;  4LF6 O;  1V55 B;  2OTJ V;  2QKS A;  4I0X A;  3D8C A;  2D3O W;  4H37 A;  5J2T B;  5EC2 C;  4B7E A;  4L8J A;  5EYP B;  1H2S B;  2FL4 A;  3AG2 C;  3L72 H;  3MHH C;  4LF4 B;  3FYE B;  5KHH A;  2FB5 A;  1FXK C;  1N32 B;  2HVJ C;  4KFM A;  1H2L A;  2QSA A;  4XDL A;  2UUC B;  1GO3 F;  4HAM A;  4DYL A;  4XDJ A;  1QHT A;  3JAW A;  1THZ A;  4R7C A;  1VMG A;  2JS3 A;  3ASO C;  2HJF C;  1LUW A;  1Q82 W;  2L35 A;  3OGI B;  4UCS A;  2F43 G;  4EB6 B;  2JGD A;  1GM7 A;  4Q6G A;  2CK3 G;  1R1B A;  3B40 A;  3K59 A;  4PD4 F;  5JJJ B;  1BSM A;  3GVM A;  1V54 C;  2XAS A;  4OX9 O;  2L6L A;  1PNM A;  1WP7 A;  5IJ9 A;  5IWA B;  5LGT A;  5IDJ A;  5LOV B;  4UB8 Z;  3BFR A;  2Y69 B;  1GKF A;  4DK0 A;  2YIB A;  2DYS C;  3RN4 A;  1OCO B;  3FD9 A;  3JAT B;  4DW0 A;  2CH7 A;  4ICG A;  1ZTE A;  5B1A C;  4TSF G;  4DV4 O;  1VIB A;  1VQP V;  2DMX A;  1IBM B;  4NXM B;  3CXH F;  4UVB A;  2CE4 A;  1COW G;  3CCU V;  1AI7 A;  2R9A A;  3H1I H;  3O65 A;  4PV1 B;  4LF4 O;  3DXR B;  2EIK C;  3UQ8 A;  4ZOL B;  1FYJ A;  4LFB B;  1H2K A;  3CCV V;  3W7T A;  3M8A A;  2UUC O;  3RT3 C;  2DN9 A;  3HB3 B;  3ETG A;  4DRX A;  2X6A A;  1H8H G;  1DF4 A;  3AG1 B;  3CE2 A;  3N2G A;  1BQ0 A;  2R70 A;  4O2A A;  1S72 V;  3OW2 U;  1MOF A;  1MNG A;  5CMU A;  3EHB B;  1NKD A;  2XAJ A;  1I08 A;  4N21 A;  4AQY B;  4JZ2 A;  4U7O A;  4DV5 B;  4LC1 A;  2ADQ B;  1PV0 A;  3A8T A;  5BXZ A;  3OGC C;  1JJ2 U;  5IY5 C;  2WLI B;  4GKJ B;  2WLK A;  4WFB V;  3QO8 A;  4FLU A;  3RVZ A;  1EM1 A;  2JGU A;  3CC2 V;  4JGS A;  4OXS A;  3ZRW B;  2Q69 A;  2P22 C;  3J7A U;  4LF7 B;  2Q9L A;  3CRR A;  3AG3 B;  1PNK A;  1IVS A;  3K06 A;  4WFH A;  2X6C A;  2H94 A;  4QE9 A;  4E2L A;  1TUB A;  2YIB D;  4X89 A;  4J7Z A;  1ENV A;  4GKK B;  2IBZ H;  5IYZ B;  1BMF G;  4DV2 O;  3ABU A;  3TJT A;  3LNM B;  5IYB O;  5KMG B;  2NNU A;  4J80 A;  4GZR B;  3T4Z A;  5B3S C;  4IYH A;  1KKD A;  1OCR B;  4UCO A;  1X4T A;  1E1R G;  1JJO A;  4PI2 A;  4EEQ A;  3AK3 A;  3ETD A;  1O9G A;  3JAR A;  3CC7 V;  2GV9 A;  4DV6 O;  4AQY O;  5A2Q N;  1YIT V;  1GN3 A;  4DV3 B;  2RN9 A;  1NJI W;  1NS1 A;  2JJ2 G;  3SPJ A;  1OZ0 A;  5ITZ B;  3FB8 C;  2YXY A;  1MA1 A;  4GKJ O;  1BHA A;  1VQ5 V;  2Q6A A;  4IHJ A;  3ASN C;  5BR8 O;  4JI1 O;  1K3E A;  2XAG A;  4QGP A;  5FNV A;  5L3C A;  5DED A;  3SGI A;  2Q7E A;  3T2M A;  3OUS A;  4LF7 O;  1YZB A;  1R6T A;  1OCC B;  3KKY A;  4X64 O;  2DWE C;  4GKK O;  2Q0O C;  3L70 H;  1QR8 A;  4O4I A;  3ZMZ A;  2OIE A;  1SQQ H;  3FB7 C;  5FLX N;  2ZDI A;  4F6R A;  3DSQ A;  4JYA B;  5GTH Z;  4FLZ A;  4X20 A;  2A0L A;  1SQV H;  5FPR A;  2Y4T A;  1S5H C;  2WLL A;  2JDI G;  3OM3 B;  4DUZ B;  4DV3 O;  4RAI A;  1YCI A;  1GMG A;  1M56 C;  4B3S B;  1AI5 A;  5CA1 A;  2X6B A;  2EJ7 A;  1V9P A;  3W7U A;  4K0K B;  4CC5 A;  4G2K A;  3SPI A;  1K5Q A;  3TGU H;  1HWY A;  3OEE G;  2KB1 A;  4AI8 A;  4DR6 B;  1KBH A;  3CEI A;  4DV7 B;  2ZM6 B;  3CPW U;  3F5W C;  1XNQ B;  4IIJ A;  2OIG A;  1W0K G;  4O4L B;  4DR7 B;  2QWR B;  3E8F A;  5LA6 A;  4E4E A;  4JAV A;  3STL C;  5GTI Z;  2YI8 A;  4BIZ A;  3D36 A;  3OMA B;  3U10 A;  5H9C A;  2K1E A;  4ZI7 A;  1EZV H;  4ZBM A;  3ZMS A;  1YEW A;  2KG7 A;  5CN0 A;  2LW1 A;  3K0D A;  4IYI A;  3CXC U;  4LFA B;  3E8B A;  2QEX V;  1Q6I A;  4JYA O;  2JEX A;  4DR3 O;  2XHB A;  2P5O A;  3CCQ V;  3CCE V;  3OMI B;  4JV5 B;  2P06 A;  1HDJ A;  4DXW A;  2NLJ C;  2QJ1 A;  1BT8 A;  3HKB B;  4O2B A;  3WB2 A;  4DUZ O;  2XAH A;  1WPB A;  1AVM A;  3C3S A;  1SS3 A;  4F4L A;  1SA0 A;  4HNA B;  2VWJ A;  3VQW A;  3I56 V;  1KQS U;  3QO7 A;  2FYU H;  2HFE C;  5LBQ A;  3G6E V;  5D5Q A;  4MTF A;  4DR6 O;  1HNX B;  4DV7 O;  2ZM6 O;  1WA8 B;  1NBM G;  1VQ6 V;  2DYR C;  2DJV A;  4W4K A;  1Q43 A;  1D5N A;  4DR5 B;  5LYJ B;  2UUA B;  4CH3 A;  3Q4H A;  1AJN A;  4GUN A;  4MT8 A;  4GX0 A;  2LFR A;  4JAA A;  3BHP A;  1RPR A;  4FM1 A;  3B2E E;  3C3T A;  4YJ2 A;  2XUM A;  5LP6 C;  2EIM C;  2WWW A;  4LFA O;  1P7B A;  3CSX A;  4MTG A;  1M57 C;  3N2K A;  1JA8 A;  2LFS A;  1KYO F;  3RFR A;  1KUQ A;  1R6K A;  3LSQ A;  4JV5 O;  5E1A C;  1AP6 A;  3K08 A;  5JVD B;  4FZ1 A;  4HBN A;  2Z5U A;  4JI6 B;  3LUT B;  1XDC A;  1MZE A;  3QO5 A;  3O9O A;  2HJD A;  4MW8 A;  4PA4 A;  5KUM A;  1KC8 W;  1ZSP A;  5CBG A;  5JJE B;  3ZHV A;  1D5A A;  4ZIB A;  3T4D A;  2XND G;  2WA4 A;  1PD3 A;  1GM9 A;  2RMK B;  5FL7 G;  1HNX O;  2VQF B;  1K73 W;  2ZR3 A;  5EBW C;  2YIC A;  1VQ7 V;  4N23 A;  3GB7 C;  4RUF A;  5B66 Z;  4DR5 O;  2UUA O;  3L75 H;  1KP2 A;  2IU3 A;  4ZHQ B;  3RYF A;  1MMM A;  1QLE C;  3ZN0 A;  1VF5 B;  1NR1 A;  1YSC A;  1B3Q A;  2YSU B;  2H8P C;  4XDK A;  4I55 A;  3HKC A;  5KAI Z;  1TUE B;  3K5L A;  1K9M W;  1YIJ V;  3FYI B;  1DGS A;  4NVP A;  4X1I A;  4Q20 A;  2V4D A;  1M4U A;  1WN7 A;  3G6B A;  3G67 A;  2P7T C;  2BSK A;  2G38 A;  3ZJZ A;  4UVA A;  3A0R A;  3P3N A;  4I4T A;  4YY3 B;  1JCH A;  4DUY O;  3C90 A;  5L3E A;  2AXT Z;  1ORQ C;  1U96 A;  1YDX A;  1F7Y A;  1WLE A;  4EFB A;  2QKC A;  3FAV B;  3RYH A;  3IAY A;  4UB6 Z;  1Y66 A;  1FAF A;  1AR4 A;  3N27 A;  2VQF O;  4YHH B;  2QTO A;  2N04 A;  1RM1 B;  3E22 A;  1CEZ A;  1XMO B;  1FXH A;  4TUY A;  1FXK A;  2UU9 O;  4K8X A;  1R73 A;  4I7Z B;  1PM9 A;  1SC5 B;  2HR3 A;  3UO2 A;  4JI0 B;  2HKO A;  1HP8 A;  1XEQ A;  2IJJ A;  1W0J G;  1Z5V A;  5J2U A;  3KG2 A;  5BY1 A;  3CME V;  4LWS B;  4JYC A;  5GON B;  2F23 A;  2YC0 A;  2HHH B;  4JF3 A;  3WG7 B;  4FK5 C;  5CB4 B;  3LDE A;  2W0F C;  4MVO A;  3ZN1 A;  1BZK A;  1DK1 A;  2B9Z A;  4O4J B;  4EKW A;  2ADP A;  3RYI A;  1KU9 A;  4X62 B;  1N0N A;  2XAQ A;  1JFF A;  5JH7 B;  2ITD C;  4MS2 A;  2WLM A;  3HKE A;  3FKS G;  2DOS A;  1KMI Z;  5EBL C;  1AJQ A;  2NN4 A;  5LHH A;  1BL8 A;  2ZKO A;  3QNE A;  1WJZ A;  1Q6U A;  4MTO A;  3RWR D;  1I5Y A;  2ZE8 A;  3QG5 A;  4K35 A;  4YHH O;  2CDY A;  4PA7 A;  5B1B C;  5AG2 A;  1S5L Z;  1IXB A;  3DTU B;  1EN5 A;  3W7X A;  1BQZ A;  1XMO O;  2QR4 A;  4R6Z A;  4U3J B;  1NT2 B;  1R3K C;  5DEC A;  4GT1 A;  4LNU B;  5B1O A;  1YJW V;  1AP5 A;  3GWO A;  1IUR A;  1P4R A;  1XRE A;  1RSO B;  2YUA A;  1ZUQ A;  2LW7 A;  1PP9 H;  2BCC H;  4LBE C;  4DV4 B;  3ABL B;  4GX2 A;  2BTQ B;  1R3L C;  2HHH O;  2A9H A;  1D2D A;  4FLY A;  4JYY A;  4X62 O;  3OD4 A;  4UUJ C;  1I0H A;  2GDS A;  3J80 N;  2O57 A;  2W0X A;  4CZZ A;  1E1Q G;  3LDD A;  2X7R B;  1KB9 F;  1SZT A;  1BE3 H;  4LH7 A;  1WP8 A;  2R9I A;  4NTX A;  1YTF B;  1BS3 A;  2KQX A;  4FPP A;  3FB6 C;  5CA0 B;  3BA8 A;  4H13 B;  3SPC A;  4CS2 A;  4TV9 A;  3AG4 B;  4NKG B;  3CP1 A;  5LXT B;  3BAB A;  2A3Q A;  3BAA A;  4J10 A;  3E86 A;  3SPH A;  2UXN A;  3B8N A;  3FB5 C;  2A79 B;  4DV0 O;  1SER A; 
#chains in the Genus database with same CATH homology
 3O65 A;  4LF4 O;  1DK1 A;  4JI3 O;  4GKJ O;  1HNX O;  1FYJ A;  4JYA O;  4DR3 O;  5LMN O;  4K0K O;  3M8A A;  4DR1 O;  5BR8 O;  1IBL O;  4JI1 O;  4JI2 O;  2F4V O;  2UUC O;  2E5L O;  3RT3 C;  4DR5 O;  4X65 O;  2UUA O;  4JI4 O;  4NXN O;  5IWA O;  2DOS A;  1G1X B;  1XMQ O;  4DR4 O;  4KHP O;  1XNQ O;  3T1H O;  4LF7 O;  1YZB A;  3J81 N;  4DUZ O;  4DR7 O;  1R6T A;  1N36 O;  4JI6 O;  4JI0 O;  4X64 O;  2ZKO A;  4LF6 O;  2UXB O;  1FKA O;  5IT9 N;  4GKK O;  5BXZ A;  4YHH O;  4X66 O;  2AGA A;  1IBM O;  4JI8 O;  4NXM O;  5FLX N;  3R66 A;  4DR6 O;  1AIL A;  4DV7 O;  4LF5 O;  2ZM6 O;  3T1Y O;  2N74 A;  1XMO O;  1AB3 A;  4LFB O;  2DJV A;  4DUY O;  2Z0A A;  1F7Y A;  5LMU O;  1HNZ O;  2UXD O;  2LW7 A;  3J7A U;  5H5N A;  4LFC O;  4DV3 O;  1X59 A;  2HHH O;  4B3T O;  4B3R O;  2UXC O;  4OPH A;  1D2D A;  4A5U B;  1I94 O;  1N34 O;  4LF9 O;  4LFA O;  4X62 O;  3OTO O;  2VQF O;  4DV5 O;  4DV2 O;  1R1B A;  3F5T A;  4JI5 O;  5LL6 Y;  3J80 N;  2VQE O;  4OX9 O;  1HNW O;  3JAM N;  4JI7 O;  1KUQ A;  2UUB O;  2FKX A;  4JV5 O;  1IBK O;  4OPA A;  1N32 O;  1XNR O;  4B3M O;  3SDL A;  4LF8 O;  2UU9 O;  4YY3 O;  1XEQ A;  1A32 A;  5BY1 A;  4DR2 O;  1J5E O;  4DV6 O;  1HR0 O;  4AQY O;  5A2Q N;  4DV4 O;  1FJG O;  1NS1 A;  4DV1 O;  2JRI A;  1N33 O;  4DV0 O;  4B3S O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...