5IT9N

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'GRMHSKGKGMSSSAIPYSRNAPAWFKGSSDGVVEQIIKYARKGLTPSQIGVLLRDAHGVTQAKVITGNKILRILKSNGLAPEIPEDLYFLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASALVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5it9N02
3OTOO 4JI1O 1XMOO 4JI4O 4DV5O 4DR1O 1FKAO 1HNWO 4LF5O 1XNQO 5BR8O 4DR7O 1N32O 1FYJA 5A2QN 1NS1A 4X65O 4JI3O 4JI2O 2UUBO 1AILA 1XEQA 2UXBO 4X66O 3T1HO 4DV0O 4DR6O 3T1YO 1YZBA 4YY3O 4JV5O 2FKXA 1N34O 1R6TA 4YHHO 4LF7O 1I94O 1KUQA 5H5NA 2JRIA 2UUAO 2HHHO 4JI7O 4DR3O 2AGAA 2ZM6O 1N36O 2UXCO 3SDLA 1IBKO 4NXNO 4A5UB 2UU9O 2UXDO 2LW7A 4JI8O 2VQFO 2DOSA 4B3RO 4LF4O 4LF8O 4DR5O 5FLXN 4K0KO 1A32A 4B3MO 2DJVA 4AQYO 3J81N 4JI6O 4LFAO 5BY1A 4LFCO 2VQEO 2ZKOA 1R1BA 4DR2O 4KHPO 4DV7O 5LL6Y 1J5EO 1N33O 1XMQO 5IT9N 4OPAA 4X62O 2E5LO 1HNXO 3J7AU 4LF6O 1G1XB 3O65A 1D2DA 3R66A 2Z0AA 5BXZA 4JI5O 5IWAO 2F4VO 3M8AA 4DV4O 4B3SO 1DK1A 4DV1O 4X64O 3RT3C 1HR0O 4B3TO 1IBMO 4JYAO 3JAMN 4DV2O 4DUZO 1IBLO 4NXMO 4DR4O 5LMUO 1XNRO 1AB3A 4DUYO 2UUCO 1F7YA 1FJGO 4JI0O 3F5TA 4DV3O 4DV6O 3J80N 4LFBO 4OPHA 5LMNO 4OX9O 4LF9O 4GKJO 1X59A 2N74A 1HNZO 4GKKO
chains in the Genus database with same CATH superfamily
5LGNA 1SC5B 3T1YB 3BHPA 4DR7O 1HW7A 2DWDC 1S5HC 1E1QG 4TV8A 1BQ0A 1QLEB 4DV0O 4DR6O 1VQMV 4TV8B 3SYAA 2UU9B 4E2LA 3FB8C 5B3SC 1L0NH 4D6TH 2QDOA 1HP8A 4Z2WA 3NR7A 3ZS8C 4AQYB 5KUMA 2UXCO 1I08A 4LFCB 2CGNA 2IBZH 3OGCC 1H38A 3OT7A 3L9DA 1XDCA 1NTMH 4LF8O 3D3QA 2XAJA 3J81N 5EYPA 3ABKC 4LF6B 1XL6A 2Q73A 2NN4A 2A06H 1ZAUA 1VQOV 4Q20A 5EYPB 4F4LA 5FPRA 4KHPO 4FVMA 5AG2A 1XMQO 2DYRB 1VQNV 1GN4A 2ITCC 1Y66A 1NVPD 1AVMA 1G1XB 3OW2U 1S0VA 1YF2A 1XNRB 3G6BA 4DUYB 4ICGA 4X1YB 1FJGB 2Z5UA 4B3SO 1AP5A 5IJ9B 4NB5A 4U3FH 4PV1B 3ABLB 4NYKA 1WP8A 3CRQA 2EZOA 3TXSA 3I5DA 1G6UA 2XOKG 5B1BC 1Q82W 3KKYA 1NH2B 3ABLC 1JA8A 4GKJO 3JAWA 2ZIMA 2N74A 4GKKO 5J9PC 2CTRA 2EJ7A 4MVQA 3FKSG 3THOA 5C8YA 4JI7B 3RN4A 2AZ0A 3CSXA 5C8YB 1CP9A 1JFFA 1FFXA 3Q4HB 2L6LA 5K1XA 1JFFB 1FFXB 2UXDB 5LHHA 3MDSA 3ZRXA 1N34O 4F6RA 1I94O 1VQ9V 1TAEA 4K0KB 2HHHO 4F6RB 1MZFA 4B3MB 1S3JA 3D8CA 4O4LA 4DV1B 2P06A 1QU7A 2EX3A 4O4LB 3MHSC 2RN9A 5B66Z 3AG2C 1N8RW 2A3QA 4UVCA 4X9QA 2ZIOA 1WB8A 1JMKC 5EC2C 2IU3A 4LH7A 4FZ1A 2V1DA 1R1BA 3ZCCA 4QE7A 3QO8A 1K8AW 4GYCB 3HR0A 4ZHQA 2YIAA 3GVMA 3QO7A 2E5LO 4I0XA 3N2KA 3EXAA 4ZHQB 1G4YB 4YJ2B 1CXZB 1FXKC 4DV2B 2N05A 1Q81W 3AG1C 4JI5O 4I0XB 3DC6A 3N2KB 2AHYA 4IL6Z 4LCUC 2UUCB 3K06A 3WB2A 3R65A 3K0DA 3B4SA 1BGYH 2WWWA 4N21A 2BE3A 2PYJA 3AG3B 4ZBMA 5JJEB 1SERA 4ABMA 1OCCB 4I7ZB 4DV6O 4CH3A 3AK3A 5LMNO 2N04A 5CBFA 3LNMB 1AR1B 1RM1C 1OCCC 4X1IA 5IYCO 1S77D 2D2CB 3MD0A 4X1IB 4PA3A 1FYJA 3IFXA 3K9AA 2DE0X 2JK5C 3WU2Z 2UUAB 4DR3B 1COWG 1GRJA 2EBOA 2EIMB 3W7TA 2BTOA 4WFEA 3DTUB 1GAXA 3BEHA 1YZBA 4BIUA 4YHHO 2LJ2A 4WF9V 4JI6B 4LFAB 4QIWF 2M7WA 3TCUA 4J9YB 4UXNA 4DRXA 3T1CA 4FLTA 4J10A 4B7EA 2H94A 3BAAA 4DRXB 3CCVV 2BTQA 2OCCC 5JH7A 3UKMA 1PPJH 2BTQB 1KC8W 2W0FC 5JH7B 4X1KA 1P7BA 3ASOB 4NKGB 5LGTA 4X1KB 5IT9N 5KA5A 5KLVH 5B1AC 2QWQB 4JYAB 3CC2V 4MSWC 1OCZC 4FLVA 4DV4O 2E3CA 2ZNJA 2LFSA 3VQWA 1PKXA 4DV1O 1F4MA 2DMXA 4FM0A 1VQKV 1OCRC 1ROPA 3ZHSA 1TUEB 3UQ8A 1QHTA 4JI4B 1US6A 5LOVA 2RCVA 5BR8B 1NJIW 2QKCA 4ZOLA 3B09A 4NTXA 1NH2D 5H6RA 1N32B 5LOVB 1KBHA 2JS5A 1X59A 3U0ZA 1MSDA 2EIKB 5DECA 3AG4B 1NS1A 2YXHA 1QVGU 1UPGA 1K7DA 1Y4MA 4JGSA 3W7XA 1B06A 2BSKA 3JYCA 1N36B 2AZ2A 4B08A 4MVMA 2BSKB 4RUFA 4F6EA 3RFRA 5IY5B 2WLNA 4DR5B 4C7UA 2AGAA 3A0HZ 4UUJC 4TWKA 1AI7A 2V7QG 4HZ3A 4PHZA 4L87A 2DOSA 2PZSA 4FJCC 5FLXN 4J9ZB 3I56V 2RMKB 1EN4A 4MVSA 3OUSA 3CMAV 1AR4A 3E22A 1SQGA 3E83A 1BHAA 2VQEO 4XDLA 1W2BU 3QVNA 3E22B 4P9PA 1KU9A 4WFAV 3ABTA 4Z1MG 3APQA 3E8GA 1J5EO 1JJ2U 4Q6GA 4J7KA 2KQXA 1D5NA 4RWUA 1H8HG 1IBMB 2QTSA 2XHBA 3O65A 2HLDG 3F5WC 1VF7A 4UB6Z 1XQ8A 4KP4A 4NTYA 1BL8A 3ABUA 2BOBC 5C93A 3JAMN 2P22C 5A9GA 1FD9A 5KMGA 4NXMO 1LUVA 4UCOA 5KMGB 4DR7B 1VQ6V 4FM2A 1NZ6A 2QKAA 2ZXWC 2Y0IA 4PA6A 2JJ1G 1M5IA 4HNAA 1M56B 3H9VA 4DV0B 1GO3F 2IH3C 4DR6B 1GH6A 2XT9A 4CH5A 4IT5A 5LBQA 4DXWA 4XDKA 1WN7A 1PNLA 1PL4A 2PI5A 2UXCB 5EBMC 2A9HA 3BRCA 2X6BA 2RNBA 3A2FA 4MTOA 2WLLA 4PELA 4LF8B 4L8JA 2ATKC 4CH4A 1IX9A 2WLLB 4JYCA 5LHIA 1M57C 4NXNO 2ZR3A 4OXSA 3N2GB 1IDSA 1FPOA 2Z3YA 4KHPB 3JD0A 1Z5WA 2QEXV 4LF4O 4CC5A 2PI4A 4X20A 3ZBHA 3E2EA 4X20B 2M6YA 4JZ2A 4QE9A 3L73H 1I7FA 3CCQV 2QTOA 3K0GA 4PD4F 5ITZA 4B3SB 5ITZB 4PDMA 2P4KA 5CB4A 2CTQA 2Q8VA 5CB4B 3QG5A 3C3SA 3ZMUA 1NTKH 3UM7A 4TSFG 5EZYA 1YJWV 4DO2A 4GKJB 1KD1W 5DN6G 4GKKB 4DUZO 5EZYB 1IBLO 1F4NA 4JI0O 1GN6A 1I5XA 2PTMA 4DV3O 1CPYA 4MTXA 3VOUA 4MVUA 1WPBA 2HR3A 1IZ3A 2YEVA 3P30A 3VQVA 3RBZA 2YEVB 1RFYA 3ML0A 4JI1O 1AJQA 4WCEV 3OMIB 4JTAB 4LF5O 1XNQO 2YIBA 3G80A 2YI9A 1N34B 2XAQA 5EBLC 1I94B 1SQPH 1ZX3A 4X65O 4YJ3A 1O9HA 2HHHB 1N0NA 1Q86W 2UUBO 4OGQB 4YJ3B 5EIBC 3JAKA 1MZEA 4RQEA 4CBCA 4JV5O 2Y0PA 3JAKB 1VF6C 1Y74A 3LDDA 3H1LH 1P49A 4R7CA 4D7SA 3ETQA 2LFRA 1R73A 2OT5A 5H6QA 2V4DA 1Y74B 3ZMZA 4KFMA 4IGGA 2YDEA 4MVZA 1XBLA 3E35A 5B3SB 3W7UA 3CCUV 4UCSA 1JPXA 4X89A 1IURA 2R9AA 2A0LA 2D3OW 4UVBA 3K5LA 2E5LB 1BCCH 1TGOA 2P4VA 5F2VO 2WA3A 4JI5B 5KUKA 3OUFA 3CCSV 1B3QA 2X6AA 2QM7A 3ZN1A 3H1HH 3WG7C 1K9MW 1BE3H 2XUMA 4N23A 4X62O 4H13B 3ABKB 4H0LB 2Q7GA 2OCHA 3QF7A 5LA6A 2F4VO 3FAVA 5LA6B 3KZIZ 4DV6B 3ZRVA 3O9OA 3FAVB 1F23A 3G6EV 5J2TA 5LMNB 2JEUA 1QCEA 3ABMC 3L72H 5J2TB 2CK3G 3RYFB 4TT3G 4DK1A 2QWNB 1WPXA 5JQGA 1FS0G 4X1YA 3M7MX 4LF9O 3DC5A 5JQGB 2F95B 1HNZO 5IJ9A 3ZRWA 1H2LA 1Q5OA 2IJIA 2F43G 2ZD9A 1OZ0A 3ZRWB 1FKAO 3OEHG 3B77A 2VWJA 1VP7A 5B1BB 2Y48A 4YHHB 3OR7C 2ZINA 4JI3O 4J80A 1XHZA 1Q6IA 1V54C 2CUGA 2H3OA 3T1HO 3CRRA 1YVWA 2QE7G 3IGAC 1G8MA 4YY3O 2NLJC 2K1EA 3LDEA 4O4HA 4LF7O 3NXSA 1D5AA 4O4HB 3CD6V 1SQFA 3SYPA 3SDLA 4BAYA 1AI5A 1IVSA 3CC7V 3K5OA 3ASNC 1AI6A 2RDCA 3Q4HA 4CS4A 3RW0A 5IDJA 3C90A 3SPIA 2QWPB 2WLHA 4KL1A 4IYHA 2EINB 2WLMA 4TV9A 1FAFA 4DR2O 1EM1A 3CWBH 4FPPA 4TV9B 4W4LA 4DV4B 1NBMG 3FYEB 1JOYA 3OE7G 3AG2B 5H9CA 2EINC 2Q0AA 1V9PA 1ZL8A 1HNXO 5JWPA 5IJ0A 3E86A 1URFA 1ZL8B 1KECA 3RYIA 2OYQA 5IJ0B 4P2ZA 1L0LH 3RYIB 1JQ0A 2A79B 3HB3B 5GONA 4X64O 4BW5A 1NU1H 3ETDA 1FXKA 5CA1A 3DGEA 3AG7A 4B3TO 1BHBA 5JVDA 5GONB 1N4CA 1FXKB 2K9PA 5CA1B 3AG1B 5LMUO 5JVDB 3VQXA 4YJ2A 3CC4V 1H2KA 1SRYA 1FXVA 4IYIA 1B6QA 1QBZA 5IYBO 3B8MA 1XMOO 4U7NA 3M99B 3U11A 1HNWO 1VQPV 1KQSU 2CTPA 2RQ6A 1UJWB 3ETGA 2FB5A 2EZPA 2YIBD 4FIPC 4PDRA 1OHHG 2HJDA 2ZDIC 4ASUG 1NKDA 4JI2O 2GDSA 5KAIZ 3UCSC 1RM1B 1W0JG 2UXBO 4X66O 1XL4A 3JD4A 4HBNA 4P9OA 1K4DC 1KKCA 1E79G 3ZMTA 3ZMVA 2VQEB 1YCIA 2QWOB 3BFRA 1M4UA 4CC6A 1J5EB 4B3RO 1KYOF 4DR4B 1RPRA 1A32A 3CCLV 4K8XA 2LQTA 3P3PA 4UCUA 2VRZA 3BA8A 4GX1A 2BOCC 1FFTB 3UO2A 2WAMA 4JTCB 3J7AU 2OCCB 2OWOA 3R66A 5BXZA 4RUEA 2W6IG 5IWAO 4NXMB 5KA6A 4LBEC 1I0HA 2ADPA 3LSQA 5KHKA 1W59A 2Q7EA 1Q6HA 3ZMSA 5B1AB 2Y4UA 2JS3A 2CTWA 5H2FZ 3K5NA 1LR1A 1AB3A 2KG7A 1MA1A 1OCZB 4MT8A 2ILMA 5KX5A 4MVRA 3SR2C 2KG7B 4K35A 2E74B 4LFBO 5KX5B 1EFRG 4H37A 3CHXA 4OPHA 1RPOA 4HYOA 1OCRB 1EN6A 5L3CA 3ZIAG 1KMIZ 1WNSA 1U97A 1RP3B 5B1OA 3RVZA 4P30A 3BY6A 5A2QN 4IIJA 1EBOA 3IC9A 4QNHB 1WLEA 3A8TA 2Q6AA 4IIJB 3E89A 4R8CA 3PJSK 1JR9A 1XEQA 3C3TA 3G4SV 1WP7A 4NXNB 5IE9A 4I9WA 3CXCU 2DYSB 4U3JA 1NT2B 5E79Z 1XREA 2X0LA 2YS8A 4LF4B 4U3JB 5JCOC 4YIOA 2DYSC 4O2BA 5LGUA 4O4JA 5CMUA 2JGUA 5EC1C 4O2BB 2YIDA 3F7YC 1S5JA 1SKVA 4O4JB 1XILA 1M1KW 2WPDG 1AJNA 2DWEC 2EJRA 1K4CC 2DJVA 2B1IA 3JASA 2ADQB 2MK3A 2QM4A 3K79A 1J95A 1NI8A 3JASB 4DV7O 1ZSPA 1N33O 5DM6V 4WFHA 3GB7C 4I5SA 3BABA 2R9RB 1D2DA 4EFEA 3LUTB 4DUZB 1IBLB 3SYCA 2CE4A 3CPWU 3JALA 3JCUZ 5IYZA 4JI0B 4K8ZA 3RGBA 1DK1A 4DV3B 3JALB 4CS3A 5IYZB 2CH7A 1S72V 5D5PA 2CH7B 1BS3A 3W7SA 4DR4O 4JI1B 1K5QA 1F7YA 4O2AA 4LF5B 1XNQB 4UFZA 4UB8Z 5LP6C 4FFBA 2Y4TA 4O2AB 2PUSA 4OX9O 3N27A 4X65B 4FFBB 2EIJC 2UUBB 3CX5F 2AHZA 3OTOO 2JIZG 4UV8A 1Z2GA 4JV5B 1H2SB 4JASA 4AHCA 1GN2A 4GCZA 2OTJV 2ZXWB 4XDJA 3AK2A 1SQBH 2VS0A 3OR6C 5LYJB 3SYQA 3UT5A 1B04A 1IXMA 1VQ8V 1AILA 4AI8A 2PF4E 1GTOA 5FNVA 1SZTA 1OCOC 1ZTEA 2XAGA 3UT5B 5KHIA 2GBOA 5FNVB 4NVPA 4E4EA 5CN0A 4GZRB 3FB6C 2DQ0A 1SA0A 3TETA 2ZM6O 4QPJA 1JJOA 3HKCA 3BCCH 1SA0B 1WA8A 2Q0OC 1OJHA 3HKCB 1VQLV 3F7VC 1WA8B 2VQFO 3X2QC 4EEQA 2F93B 4X62B 1P84F 4ZI7A 3SJAC 1M57B 3K03A 3T4ZA 4ZI7B 4MVOA 2P90A 2HVJC 3P32A 2F4VB 4XBFA 3N2GA 1JX9A 2A7WA 2YI8A 4GUNA 5EK0A 5EBWC 4QJFB 1O9GA 1SZXA 5BMVA 3CYOA 3MHHC 4I55A 1YI2V 2IJHA 4PDLA 3B8NA 1F51A 2WLJA 5BMVB 4I55B 2R72A 1PM9A 1VARA 3CS5A 3RT3C 2ARHA 4FM1A 2AXTZ 1HR0O 4LF9B 4R50A 2JEXA 2YSUB 5GTIZ 1YXBA 1HNZB 3KG2A 4EKWA 1JVMA 5GTHZ 4LR3A 3CMEV 1W0KG 2Q68A 1Z5VA 3ZHRA 1DLBA 1K73W 4UCTA 3CE2A 3G71V 3OMAB 3L75H 4JI3B 3LDCA 3CCJV 1KKDA 1SESA 5DEDA 2XAHA 3QTCA 3ZEDA 2ZE7A 3T1HB 4DV5O 4JYBA 3HKBA 4YY3B 4LF7B 3FB7C 5IYDO 1EZVH 3HKBB 1Y76A 3WFVA 3CJHA 1M9NA 2DQ3A 1QLNA 1Y76B 3K3WA 4UCVA 1YIJV 3CJHB 2NR5A 3K59A 4W4KA 3H1JH 4R6ZA 1VMGA 1R6TA 4O4IA 4AILC 1JCHA 3D36C 3BVOA 4PA7A 4O4IB 3L71H 1GN3A 4G2KA 1IBKO 1EZJA 1VF6A 1S76D 3EHBB 3A0BZ 4DR2B 4G28B 4JI8O 3OM3B 3K08A 3SJBC 2PYLA 4FLUA 1R6NA 2WLIA 1HNXB 5BY1A 1GM7A 2WLIB 4JTDB 4PI2A 4J11A 4JZGA 5L3DA 1DTOA 2FTKA 1ORQC 4X64B 4B3TB 3JSNA 3SPCA 3S3XA 2ZE6A 1YTFB 4I4TA 2YICA 5LMUB 2HG5C 4PA4A 2NNUA 2IJKA 3WG7B 5CBHA 4I4TB 3OMNB 1HWYA 1K33A 1R3LC 4BWAA 1HDJA 2H8PC 4BW9A 2LW1A 3ICXA 2WA4A 2R9IA 1XMOB 1NR7A 2LO1A 1P4RA 1HNWB 2QJ1A 4LH6A 3ABMB 5E1AC 3WB0A 4JI2B 3E8FA 1K3EA 1LUWA 2B9ZA 1QLEC 2UXBB 4X66B 4GT1A 4D7TA 1BQZA 3AK1A 4LWSA 1YSCA 1VIBA 3L74H 3RYFA 5B1NA 1LNQA 1QR8A 4LWSB 5LXTA 3APOA 4JAUA 5B5EZ 4PA9A 5KHJA 2VWKA 5LXTB 1VQ7V 1BZKA 4TQDA 2G38A 4B3RB 4X8AA 3KCYA 2YXYA 2C2AA 1V54B 5GW7A 2HJFC 1L1FA 3TJTA 2OIEA 3FX7A 3ZHUA 2DYRC 1I5YA 1Q43A 2ZQMA 1N0JA 2CGOA 1WB7A 2HKOA 4KUMA 5IWAB 3ASNB 5CA3A 1PP9H 2QM8A 3RVYA 2W0XA 5L3EA 1K34A 3DSQA 4JF3A 1PNMA 3VQYA 1TVKA 2P67A 4ZIBA 4MW3A 3JAWB 3U10A 4LFBB 1QVFU 1MMMA 1TVKB 1KP3A 1UFIA 2PGGA 1MOFA 3PN1A 3JD2A 2ODMA 3OGIB 3CCRV 2E76B 2AW9A 2GTSA 2Y69B 4J7ZA 2ITDC 2MW2B 4G27B 3VBBA 3SGIA 2HFEC 2Y69C 1E1RG 4MTGA 2IH1C 1XUQA 4DR1O 3K04A 3FFQA 3CB2A 2HEPA 3TXQA 4DW1A 1X4TA 2HVKC 4UV9A 4DYLA 2IJJA 3JCZA 3LNNA 3SPHA 3T1YO 2ZDIA 3E8HA 2FKXA 3OD4A 1KUQA 4YXWG 1GK9A 3IC7A 1NR1A 2JRIA 3FB5C 5TISZ 2QGNA 5EIBD 3ZJZA 4K3AA 3HKDA 3ZX6A 2P7TC 4I9QA 4IHJA 1R3IC 1SETA 2UU9O 3RYHA 1OV9A 3HKDB 4FK5C 4IHJB 4DV7B 1N33B 3QNEA 5KHGA 3RYHB 3A0RA 4QGPA 3OAAG 4AQYO 2DW4A 3EVKA 1Q7YW 4LFCO 2ZKOA 1YDXA 1M90W 4I50A 5KAFZ 3BA9A 1M93A 1K5SA 2FL4A 3E8BA 4I50B 2DN9A 3EFFK 3SPGA 4J7JA 2P5OA 1TUBA 4LF6O 3AG3C 2GTAA 2Z0AA 1YTFD 1PL0A 2LP7A 4GLXA 1TUBB 3TK1A 4PJ0Z 5JJNB 3JSLA 1AI4A 2QA4V 2Q7HA 1MSWD 4YIPA 1DF4A 2EILB 1XI1A 2QR4A 3K5MA 4UCRA 2JGDA 4OX9B 3FD9A 2B5UA 2JGDB 3OTOB 1XNRO 4DUYO 5KHHA 2EILC 3SJCC 1FJGO 3JATA 1BMFG 3I55V 3J80N 3JATB 1AJPA 1AROP 1QR9A 1YJNV 4RAIA 1VQ4V 2W6JG 1XOUA 1WJZA 2EIMC 3B40A 2F1MA 3GWOA 1CEZA 1SQVH 1SF9A 1DGSA 2O57A 2JDIG 2YUAA 2HP8A 2WLKA 1PNKA 2EULA 3D3IA 4NR1A 3IJ4A 3SJQC 1R6KA 4GX2A 2ZM6B 3G67A 2YXLA 1GMGA 5CA0A 1PV0A 1GKFA 2P6JA 4RO2A 5CA0B 4TOIA 1V55B 2VQFB 1VF5B 5H5NA 4FLWA 3GWKC 4JI7O 2KSDA 1P7GA 5L3GA 1QQCA 1YJ9V 1V55C 1Q3EA 3K58A 2UXDO 2LW7A 5JCOA 4DK0A 3ASOC 4K0KO 4HAMA 4WBNA 4B3MO 3OEEG 5L3FA 2XASA 4WBNB 4ZKIA 2BCCH 5FL7G 4Z1VA 3RWRD 3SPJA 5LL6Y 3SYOA 3BPZA 1EN5A 1NQTA 2X7RB 4OPAA 1MNGA 5J2UA 4BR6A 1HR0B 2Q69A 2RJZA 5J2UB 3HKEA 4QPKA 4ZOLB 4WFFA 3M8AA 3ZRSA 3HKEB 1NTZH 3LSSA 2CDYA 1AP6A 3ZN0A 1H2MA 1VQ5V 2IU0A 2E75B 2Q4PA 4DV2O 4JAAA 2UUCO 4DV5B 2EIKC 4UVAA 5FPOA 3AG4C 4KXRA 3T4DA 1VEWA 2YC0A 4TQFA 3S3WA 3STLC 5LP6A 3CCEV 1MABG 2ZCEA 5LHGA 5IY5C 4PI0A 4EFBA 5LP6B 2WSSG 3HPLC 1Y67A 2EIJB 4J42A 3ZHQA 5JJJB 4LC1A 4EB6A 1ZLZA 1IBKB 4RQFA 3OTFA 2Q9LA 4EB6B 5L3BA 4J41A 2ZE8A 4JI8B 4U7OA 4FZ0A 4MTFA 3CRCA 2XTAA 2UUAO 2JVDA 1ZUQA 4DR3O 3WB1A 4X88A 2GUZA 1OCOB 1DF5A 5LYJA 2GUZB 2L35A 3LSUA 3OFNG 4WFBV 4FLZA 3AEIA 1BSMA 4JI6O 4LFAO 1SQQH 4DW0A 1TA8A 2GSMB 1WAZA 4H33A 4BIZA 4NTWA 2UXNA 2R70A 1L8DA 1Y6XA 3X2QB 5D5QA 3B2EE 2KB1A 3TGUH 1T5EA 2KKWA 1XHXA 2ZR2A 1NVPB 1GM8A 2IW5A 4FLYA 1SQXH 3K9SA 4FFKA 1YITV 3KCXA 5K1PA 4JYAO 4HNAB 2IM9A 1MG1A 2Q5ZA 1U96A 1Q8IA 3ZHVA 2GHYA 1KP2A 1M56C 4GX5A 1Q6UA 2Q67A 1FXHA 2GV9A 3ZHTA 1THZA 2QWRB 1RSOA 5HFLA 2ETNA 1SS3A 2FMLA 4JPRA 3T2MA 2PY5A 3RYCA 1RSOB 2ZE5A 1YEWA 1QNMA 2UXXA 3CCMV 4JI4O 3RYCB 5BR8O 2F66C 3CXHF 3JARA 1N32O 1H8EG 4CH6A 4LP8A 3JARB 2OTLV 1K92A 2JJ2G 1XMQB 2FYUH 3H1IH 1AR5A 3STZC 1K97A 2LGWA 5HFMA 3CRMA 2QSAA 3IAYA 4GX0A 1H2NA 3JD3A 2QKSA 1N36O 3QO5A 4CS2A 4A5UB 1H2GA 1IXBA 3D36A 1GM9A 1R3KC 2ZT9B 4WFGA 4FMTA 4PDVA 4DR5O 3CEIA 1KB9F 2LGQA 4H44B 2XAFA 3W7WA 1Q90D 3UO3A 1PD3A 4MW8A 3MAQA 2B1GA 4CZZA 4FLXA 2XNDG 3JD1A 3CP1A 3ETEA 2OIGA 3FYIB 4B7KA 1ZWIC 2F23A 3P3NA 1R3JC 3K57A 3CRAA 1ENVA 1IBMO 5BZBA 3DXRA 3DXRB 4JAVA 2X6CA 4TUYA 5CBGA 4DR1B 3H1KH 3F5TA 3L70H 1YHQV 1BT8A 2CAZC 4JYYA 4TUYB 4LNUA 3H01A 2ZNIA 4MS2A 4BIOA 4LNUB 1S5LZ
chains in the Genus database with same CATH topology
3OTOO 4JI1O 1XMOO 4JI4O 4DV5O 4DR1O 1FKAO 1HNWO 4LF5O 1XNQO 5BR8O 4DR7O 1N32O 1FYJA 5A2QN 1NS1A 4X65O 4JI3O 4JI2O 2UUBO 1AILA 1XEQA 2UXBO 4X66O 3T1HO 4DV0O 4DR6O 3T1YO 1YZBA 4YY3O 4JV5O 2FKXA 1N34O 1R6TA 4YHHO 4LF7O 1I94O 1KUQA 5H5NA 2JRIA 2UUAO 2HHHO 4JI7O 4DR3O 2AGAA 2ZM6O 1N36O 2UXCO 3SDLA 1IBKO 4NXNO 4A5UB 2UU9O 2UXDO 2LW7A 4JI8O 2VQFO 2DOSA 4B3RO 4LF4O 4LF8O 4DR5O 5FLXN 4K0KO 1A32A 4B3MO 2DJVA 4AQYO 3J81N 4JI6O 4LFAO 5BY1A 4LFCO 2VQEO 2ZKOA 1R1BA 4DR2O 4KHPO 4DV7O 5LL6Y 1J5EO 1N33O 1XMQO 5IT9N 4OPAA 4X62O 2E5LO 1HNXO 3J7AU 4LF6O 1G1XB 3O65A 1D2DA 3R66A 2Z0AA 5BXZA 4JI5O 5IWAO 2F4VO 3M8AA 4DV4O 4B3SO 1DK1A 4DV1O 4X64O 3RT3C 1HR0O 4B3TO 1IBMO 4JYAO 3JAMN 4DV2O 4DUZO 1IBLO 4NXMO 4DR4O 5LMUO 1XNRO 1AB3A 4DUYO 2UUCO 1F7YA 1FJGO 4JI0O 3F5TA 4DV3O 4DV6O 3J80N 4LFBO 4OPHA 5LMNO 4OX9O 4LF9O 4GKJO 1X59A 2N74A 1HNZO 4GKKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO O;  4JI1 O;  1XMO O;  4JI4 O;  4DV5 O;  4DR1 O;  1FKA O;  1HNW O;  4LF5 O;  1XNQ O;  5BR8 O;  4DR7 O;  1N32 O;  1FYJ A;  5A2Q N;  1NS1 A;  4X65 O;  4JI3 O;  4JI2 O;  2UUB O;  1AIL A;  1XEQ A;  2UXB O;  4X66 O;  3T1H O;  4DV0 O;  4DR6 O;  3T1Y O;  1YZB A;  4YY3 O;  4JV5 O;  2FKX A;  1N34 O;  1R6T A;  4YHH O;  4LF7 O;  1I94 O;  1KUQ A;  5H5N A;  2JRI A;  2UUA O;  2HHH O;  4JI7 O;  4DR3 O;  2AGA A;  2ZM6 O;  1N36 O;  2UXC O;  3SDL A;  1IBK O;  4NXN O;  4A5U B;  2UU9 O;  2UXD O;  2LW7 A;  4JI8 O;  2VQF O;  2DOS A;  4B3R O;  4LF4 O;  4LF8 O;  4DR5 O;  5FLX N;  4K0K O;  1A32 A;  4B3M O;  2DJV A;  4AQY O;  3J81 N;  4JI6 O;  4LFA O;  5BY1 A;  4LFC O;  2VQE O;  2ZKO A;  1R1B A;  4DR2 O;  4KHP O;  4DV7 O;  5LL6 Y;  1J5E O;  1N33 O;  1XMQ O;  5IT9 N;  4OPA A;  4X62 O;  2E5L O;  1HNX O;  3J7A U;  4LF6 O;  1G1X B;  3O65 A;  1D2D A;  3R66 A;  2Z0A A;  5BXZ A;  4JI5 O;  5IWA O;  2F4V O;  3M8A A;  4DV4 O;  4B3S O;  1DK1 A;  4DV1 O;  4X64 O;  3RT3 C;  1HR0 O;  4B3T O;  1IBM O;  4JYA O;  3JAM N;  4DV2 O;  4DUZ O;  1IBL O;  4NXM O;  4DR4 O;  5LMU O;  1XNR O;  1AB3 A;  4DUY O;  2UUC O;  1F7Y A;  1FJG O;  4JI0 O;  3F5T A;  4DV3 O;  4DV6 O;  3J80 N;  4LFB O;  4OPH A;  5LMN O;  4OX9 O;  4LF9 O;  4GKJ O;  1X59 A;  2N74 A;  1HNZ O;  4GKK O; 
#chains in the Genus database with same CATH topology
 5LGN A;  1SC5 B;  3T1Y B;  3BHP A;  4DR7 O;  1HW7 A;  2DWD C;  1S5H C;  1E1Q G;  4TV8 A;  1BQ0 A;  1QLE B;  4DV0 O;  4DR6 O;  1VQM V;  4TV8 B;  3SYA A;  2UU9 B;  4E2L A;  3FB8 C;  5B3S C;  1L0N H;  4D6T H;  2QDO A;  1HP8 A;  4Z2W A;  3NR7 A;  3ZS8 C;  4AQY B;  5KUM A;  2UXC O;  1I08 A;  4LFC B;  2CGN A;  2IBZ H;  3OGC C;  1H38 A;  3OT7 A;  3L9D A;  1XDC A;  1NTM H;  4LF8 O;  3D3Q A;  2XAJ A;  3J81 N;  5EYP A;  3ABK C;  4LF6 B;  1XL6 A;  2Q73 A;  2NN4 A;  2A06 H;  1ZAU A;  1VQO V;  4Q20 A;  5EYP B;  4F4L A;  5FPR A;  4KHP O;  4FVM A;  5AG2 A;  1XMQ O;  2DYR B;  1VQN V;  1GN4 A;  2ITC C;  1Y66 A;  1NVP D;  1AVM A;  1G1X B;  3OW2 U;  1S0V A;  1YF2 A;  1XNR B;  3G6B A;  4DUY B;  4ICG A;  4X1Y B;  1FJG B;  2Z5U A;  4B3S O;  1AP5 A;  5IJ9 B;  4NB5 A;  4U3F H;  4PV1 B;  3ABL B;  4NYK A;  1WP8 A;  3CRQ A;  2EZO A;  3TXS A;  3I5D A;  1G6U A;  2XOK G;  5B1B C;  1Q82 W;  3KKY A;  1NH2 B;  3ABL C;  1JA8 A;  4GKJ O;  3JAW A;  2ZIM A;  2N74 A;  4GKK O;  5J9P C;  2CTR A;  2EJ7 A;  4MVQ A;  3FKS G;  3THO A;  5C8Y A;  4JI7 B;  3RN4 A;  2AZ0 A;  3CSX A;  5C8Y B;  1CP9 A;  1JFF A;  1FFX A;  3Q4H B;  2L6L A;  5K1X A;  1JFF B;  1FFX B;  2UXD B;  5LHH A;  3MDS A;  3ZRX A;  1N34 O;  4F6R A;  1I94 O;  1VQ9 V;  1TAE A;  4K0K B;  2HHH O;  4F6R B;  1MZF A;  4B3M B;  1S3J A;  3D8C A;  4O4L A;  4DV1 B;  2P06 A;  1QU7 A;  2EX3 A;  4O4L B;  3MHS C;  2RN9 A;  5B66 Z;  3AG2 C;  1N8R W;  2A3Q A;  4UVC A;  4X9Q A;  2ZIO A;  1WB8 A;  1JMK C;  5EC2 C;  2IU3 A;  4LH7 A;  4FZ1 A;  2V1D A;  1R1B A;  3ZCC A;  4QE7 A;  3QO8 A;  1K8A W;  4GYC B;  3HR0 A;  4ZHQ A;  2YIA A;  3GVM A;  3QO7 A;  2E5L O;  4I0X A;  3N2K A;  3EXA A;  4ZHQ B;  1G4Y B;  4YJ2 B;  1CXZ B;  1FXK C;  4DV2 B;  2N05 A;  1Q81 W;  3AG1 C;  4JI5 O;  4I0X B;  3DC6 A;  3N2K B;  2AHY A;  4IL6 Z;  4LCU C;  2UUC B;  3K06 A;  3WB2 A;  3R65 A;  3K0D A;  3B4S A;  1BGY H;  2WWW A;  4N21 A;  2BE3 A;  2PYJ A;  3AG3 B;  4ZBM A;  5JJE B;  1SER A;  4ABM A;  1OCC B;  4I7Z B;  4DV6 O;  4CH3 A;  3AK3 A;  5LMN O;  2N04 A;  5CBF A;  3LNM B;  1AR1 B;  1RM1 C;  1OCC C;  4X1I A;  5IYC O;  1S77 D;  2D2C B;  3MD0 A;  4X1I B;  4PA3 A;  1FYJ A;  3IFX A;  3K9A A;  2DE0 X;  2JK5 C;  3WU2 Z;  2UUA B;  4DR3 B;  1COW G;  1GRJ A;  2EBO A;  2EIM B;  3W7T A;  2BTO A;  4WFE A;  3DTU B;  1GAX A;  3BEH A;  1YZB A;  4BIU A;  4YHH O;  2LJ2 A;  4WF9 V;  4JI6 B;  4LFA B;  4QIW F;  2M7W A;  3TCU A;  4J9Y B;  4UXN A;  4DRX A;  3T1C A;  4FLT A;  4J10 A;  4B7E A;  2H94 A;  3BAA A;  4DRX B;  3CCV V;  2BTQ A;  2OCC C;  5JH7 A;  3UKM A;  1PPJ H;  2BTQ B;  1KC8 W;  2W0F C;  5JH7 B;  4X1K A;  1P7B A;  3ASO B;  4NKG B;  5LGT A;  4X1K B;  5IT9 N;  5KA5 A;  5KLV H;  5B1A C;  2QWQ B;  4JYA B;  3CC2 V;  4MSW C;  1OCZ C;  4FLV A;  4DV4 O;  2E3C A;  2ZNJ A;  2LFS A;  3VQW A;  1PKX A;  4DV1 O;  1F4M A;  2DMX A;  4FM0 A;  1VQK V;  1OCR C;  1ROP A;  3ZHS A;  1TUE B;  3UQ8 A;  1QHT A;  4JI4 B;  1US6 A;  5LOV A;  2RCV A;  5BR8 B;  1NJI W;  2QKC A;  4ZOL A;  3B09 A;  4NTX A;  1NH2 D;  5H6R A;  1N32 B;  5LOV B;  1KBH A;  2JS5 A;  1X59 A;  3U0Z A;  1MSD A;  2EIK B;  5DEC A;  3AG4 B;  1NS1 A;  2YXH A;  1QVG U;  1UPG A;  1K7D A;  1Y4M A;  4JGS A;  3W7X A;  1B06 A;  2BSK A;  3JYC A;  1N36 B;  2AZ2 A;  4B08 A;  4MVM A;  2BSK B;  4RUF A;  4F6E A;  3RFR A;  5IY5 B;  2WLN A;  4DR5 B;  4C7U A;  2AGA A;  3A0H Z;  4UUJ C;  4TWK A;  1AI7 A;  2V7Q G;  4HZ3 A;  4PHZ A;  4L87 A;  2DOS A;  2PZS A;  4FJC C;  5FLX N;  4J9Z B;  3I56 V;  2RMK B;  1EN4 A;  4MVS A;  3OUS A;  3CMA V;  1AR4 A;  3E22 A;  1SQG A;  3E83 A;  1BHA A;  2VQE O;  4XDL A;  1W2B U;  3QVN A;  3E22 B;  4P9P A;  1KU9 A;  4WFA V;  3ABT A;  4Z1M G;  3APQ A;  3E8G A;  1J5E O;  1JJ2 U;  4Q6G A;  4J7K A;  2KQX A;  1D5N A;  4RWU A;  1H8H G;  1IBM B;  2QTS A;  2XHB A;  3O65 A;  2HLD G;  3F5W C;  1VF7 A;  4UB6 Z;  1XQ8 A;  4KP4 A;  4NTY A;  1BL8 A;  3ABU A;  2BOB C;  5C93 A;  3JAM N;  2P22 C;  5A9G A;  1FD9 A;  5KMG A;  4NXM O;  1LUV A;  4UCO A;  5KMG B;  4DR7 B;  1VQ6 V;  4FM2 A;  1NZ6 A;  2QKA A;  2ZXW C;  2Y0I A;  4PA6 A;  2JJ1 G;  1M5I A;  4HNA A;  1M56 B;  3H9V A;  4DV0 B;  1GO3 F;  2IH3 C;  4DR6 B;  1GH6 A;  2XT9 A;  4CH5 A;  4IT5 A;  5LBQ A;  4DXW A;  4XDK A;  1WN7 A;  1PNL A;  1PL4 A;  2PI5 A;  2UXC B;  5EBM C;  2A9H A;  3BRC A;  2X6B A;  2RNB A;  3A2F A;  4MTO A;  2WLL A;  4PEL A;  4LF8 B;  4L8J A;  2ATK C;  4CH4 A;  1IX9 A;  2WLL B;  4JYC A;  5LHI A;  1M57 C;  4NXN O;  2ZR3 A;  4OXS A;  3N2G B;  1IDS A;  1FPO A;  2Z3Y A;  4KHP B;  3JD0 A;  1Z5W A;  2QEX V;  4LF4 O;  4CC5 A;  2PI4 A;  4X20 A;  3ZBH A;  3E2E A;  4X20 B;  2M6Y A;  4JZ2 A;  4QE9 A;  3L73 H;  1I7F A;  3CCQ V;  2QTO A;  3K0G A;  4PD4 F;  5ITZ A;  4B3S B;  5ITZ B;  4PDM A;  2P4K A;  5CB4 A;  2CTQ A;  2Q8V A;  5CB4 B;  3QG5 A;  3C3S A;  3ZMU A;  1NTK H;  3UM7 A;  4TSF G;  5EZY A;  1YJW V;  4DO2 A;  4GKJ B;  1KD1 W;  5DN6 G;  4GKK B;  4DUZ O;  5EZY B;  1IBL O;  1F4N A;  4JI0 O;  1GN6 A;  1I5X A;  2PTM A;  4DV3 O;  1CPY A;  4MTX A;  3VOU A;  4MVU A;  1WPB A;  2HR3 A;  1IZ3 A;  2YEV A;  3P30 A;  3VQV A;  3RBZ A;  2YEV B;  1RFY A;  3ML0 A;  4JI1 O;  1AJQ A;  4WCE V;  3OMI B;  4JTA B;  4LF5 O;  1XNQ O;  2YIB A;  3G80 A;  2YI9 A;  1N34 B;  2XAQ A;  5EBL C;  1I94 B;  1SQP H;  1ZX3 A;  4X65 O;  4YJ3 A;  1O9H A;  2HHH B;  1N0N A;  1Q86 W;  2UUB O;  4OGQ B;  4YJ3 B;  5EIB C;  3JAK A;  1MZE A;  4RQE A;  4CBC A;  4JV5 O;  2Y0P A;  3JAK B;  1VF6 C;  1Y74 A;  3LDD A;  3H1L H;  1P49 A;  4R7C A;  4D7S A;  3ETQ A;  2LFR A;  1R73 A;  2OT5 A;  5H6Q A;  2V4D A;  1Y74 B;  3ZMZ A;  4KFM A;  4IGG A;  2YDE A;  4MVZ A;  1XBL A;  3E35 A;  5B3S B;  3W7U A;  3CCU V;  4UCS A;  1JPX A;  4X89 A;  1IUR A;  2R9A A;  2A0L A;  2D3O W;  4UVB A;  3K5L A;  2E5L B;  1BCC H;  1TGO A;  2P4V A;  5F2V O;  2WA3 A;  4JI5 B;  5KUK A;  3OUF A;  3CCS V;  1B3Q A;  2X6A A;  2QM7 A;  3ZN1 A;  3H1H H;  3WG7 C;  1K9M W;  1BE3 H;  2XUM A;  4N23 A;  4X62 O;  4H13 B;  3ABK B;  4H0L B;  2Q7G A;  2OCH A;  3QF7 A;  5LA6 A;  2F4V O;  3FAV A;  5LA6 B;  3KZI Z;  4DV6 B;  3ZRV A;  3O9O A;  3FAV B;  1F23 A;  3G6E V;  5J2T A;  5LMN B;  2JEU A;  1QCE A;  3ABM C;  3L72 H;  5J2T B;  2CK3 G;  3RYF B;  4TT3 G;  4DK1 A;  2QWN B;  1WPX A;  5JQG A;  1FS0 G;  4X1Y A;  3M7M X;  4LF9 O;  3DC5 A;  5JQG B;  2F95 B;  1HNZ O;  5IJ9 A;  3ZRW A;  1H2L A;  1Q5O A;  2IJI A;  2F43 G;  2ZD9 A;  1OZ0 A;  3ZRW B;  1FKA O;  3OEH G;  3B77 A;  2VWJ A;  1VP7 A;  5B1B B;  2Y48 A;  4YHH B;  3OR7 C;  2ZIN A;  4JI3 O;  4J80 A;  1XHZ A;  1Q6I A;  1V54 C;  2CUG A;  2H3O A;  3T1H O;  3CRR A;  1YVW A;  2QE7 G;  3IGA C;  1G8M A;  4YY3 O;  2NLJ C;  2K1E A;  3LDE A;  4O4H A;  4LF7 O;  3NXS A;  1D5A A;  4O4H B;  3CD6 V;  1SQF A;  3SYP A;  3SDL A;  4BAY A;  1AI5 A;  1IVS A;  3CC7 V;  3K5O A;  3ASN C;  1AI6 A;  2RDC A;  3Q4H A;  4CS4 A;  3RW0 A;  5IDJ A;  3C90 A;  3SPI A;  2QWP B;  2WLH A;  4KL1 A;  4IYH A;  2EIN B;  2WLM A;  4TV9 A;  1FAF A;  4DR2 O;  1EM1 A;  3CWB H;  4FPP A;  4TV9 B;  4W4L A;  4DV4 B;  1NBM G;  3FYE B;  1JOY A;  3OE7 G;  3AG2 B;  5H9C A;  2EIN C;  2Q0A A;  1V9P A;  1ZL8 A;  1HNX O;  5JWP A;  5IJ0 A;  3E86 A;  1URF A;  1ZL8 B;  1KEC A;  3RYI A;  2OYQ A;  5IJ0 B;  4P2Z A;  1L0L H;  3RYI B;  1JQ0 A;  2A79 B;  3HB3 B;  5GON A;  4X64 O;  4BW5 A;  1NU1 H;  3ETD A;  1FXK A;  5CA1 A;  3DGE A;  3AG7 A;  4B3T O;  1BHB A;  5JVD A;  5GON B;  1N4C A;  1FXK B;  2K9P A;  5CA1 B;  3AG1 B;  5LMU O;  5JVD B;  3VQX A;  4YJ2 A;  3CC4 V;  1H2K A;  1SRY A;  1FXV A;  4IYI A;  1B6Q A;  1QBZ A;  5IYB O;  3B8M A;  1XMO O;  4U7N A;  3M99 B;  3U11 A;  1HNW O;  1VQP V;  1KQS U;  2CTP A;  2RQ6 A;  1UJW B;  3ETG A;  2FB5 A;  2EZP A;  2YIB D;  4FIP C;  4PDR A;  1OHH G;  2HJD A;  2ZDI C;  4ASU G;  1NKD A;  4JI2 O;  2GDS A;  5KAI Z;  3UCS C;  1RM1 B;  1W0J G;  2UXB O;  4X66 O;  1XL4 A;  3JD4 A;  4HBN A;  4P9O A;  1K4D C;  1KKC A;  1E79 G;  3ZMT A;  3ZMV A;  2VQE B;  1YCI A;  2QWO B;  3BFR A;  1M4U A;  4CC6 A;  1J5E B;  4B3R O;  1KYO F;  4DR4 B;  1RPR A;  1A32 A;  3CCL V;  4K8X A;  2LQT A;  3P3P A;  4UCU A;  2VRZ A;  3BA8 A;  4GX1 A;  2BOC C;  1FFT B;  3UO2 A;  2WAM A;  4JTC B;  3J7A U;  2OCC B;  2OWO A;  3R66 A;  5BXZ A;  4RUE A;  2W6I G;  5IWA O;  4NXM B;  5KA6 A;  4LBE C;  1I0H A;  2ADP A;  3LSQ A;  5KHK A;  1W59 A;  2Q7E A;  1Q6H A;  3ZMS A;  5B1A B;  2Y4U A;  2JS3 A;  2CTW A;  5H2F Z;  3K5N A;  1LR1 A;  1AB3 A;  2KG7 A;  1MA1 A;  1OCZ B;  4MT8 A;  2ILM A;  5KX5 A;  4MVR A;  3SR2 C;  2KG7 B;  4K35 A;  2E74 B;  4LFB O;  5KX5 B;  1EFR G;  4H37 A;  3CHX A;  4OPH A;  1RPO A;  4HYO A;  1OCR B;  1EN6 A;  5L3C A;  3ZIA G;  1KMI Z;  1WNS A;  1U97 A;  1RP3 B;  5B1O A;  3RVZ A;  4P30 A;  3BY6 A;  5A2Q N;  4IIJ A;  1EBO A;  3IC9 A;  4QNH B;  1WLE A;  3A8T A;  2Q6A A;  4IIJ B;  3E89 A;  4R8C A;  3PJS K;  1JR9 A;  1XEQ A;  3C3T A;  3G4S V;  1WP7 A;  4NXN B;  5IE9 A;  4I9W A;  3CXC U;  2DYS B;  4U3J A;  1NT2 B;  5E79 Z;  1XRE A;  2X0L A;  2YS8 A;  4LF4 B;  4U3J B;  5JCO C;  4YIO A;  2DYS C;  4O2B A;  5LGU A;  4O4J A;  5CMU A;  2JGU A;  5EC1 C;  4O2B B;  2YID A;  3F7Y C;  1S5J A;  1SKV A;  4O4J B;  1XIL A;  1M1K W;  2WPD G;  1AJN A;  2DWE C;  2EJR A;  1K4C C;  2DJV A;  2B1I A;  3JAS A;  2ADQ B;  2MK3 A;  2QM4 A;  3K79 A;  1J95 A;  1NI8 A;  3JAS B;  4DV7 O;  1ZSP A;  1N33 O;  5DM6 V;  4WFH A;  3GB7 C;  4I5S A;  3BAB A;  2R9R B;  1D2D A;  4EFE A;  3LUT B;  4DUZ B;  1IBL B;  3SYC A;  2CE4 A;  3CPW U;  3JAL A;  3JCU Z;  5IYZ A;  4JI0 B;  4K8Z A;  3RGB A;  1DK1 A;  4DV3 B;  3JAL B;  4CS3 A;  5IYZ B;  2CH7 A;  1S72 V;  5D5P A;  2CH7 B;  1BS3 A;  3W7S A;  4DR4 O;  4JI1 B;  1K5Q A;  1F7Y A;  4O2A A;  4LF5 B;  1XNQ B;  4UFZ A;  4UB8 Z;  5LP6 C;  4FFB A;  2Y4T A;  4O2A B;  2PUS A;  4OX9 O;  3N27 A;  4X65 B;  4FFB B;  2EIJ C;  2UUB B;  3CX5 F;  2AHZ A;  3OTO O;  2JIZ G;  4UV8 A;  1Z2G A;  4JV5 B;  1H2S B;  4JAS A;  4AHC A;  1GN2 A;  4GCZ A;  2OTJ V;  2ZXW B;  4XDJ A;  3AK2 A;  1SQB H;  2VS0 A;  3OR6 C;  5LYJ B;  3SYQ A;  3UT5 A;  1B04 A;  1IXM A;  1VQ8 V;  1AIL A;  4AI8 A;  2PF4 E;  1GTO A;  5FNV A;  1SZT A;  1OCO C;  1ZTE A;  2XAG A;  3UT5 B;  5KHI A;  2GBO A;  5FNV B;  4NVP A;  4E4E A;  5CN0 A;  4GZR B;  3FB6 C;  2DQ0 A;  1SA0 A;  3TET A;  2ZM6 O;  4QPJ A;  1JJO A;  3HKC A;  3BCC H;  1SA0 B;  1WA8 A;  2Q0O C;  1OJH A;  3HKC B;  1VQL V;  3F7V C;  1WA8 B;  2VQF O;  3X2Q C;  4EEQ A;  2F93 B;  4X62 B;  1P84 F;  4ZI7 A;  3SJA C;  1M57 B;  3K03 A;  3T4Z A;  4ZI7 B;  4MVO A;  2P90 A;  2HVJ C;  3P32 A;  2F4V B;  4XBF A;  3N2G A;  1JX9 A;  2A7W A;  2YI8 A;  4GUN A;  5EK0 A;  5EBW C;  4QJF B;  1O9G A;  1SZX A;  5BMV A;  3CYO A;  3MHH C;  4I55 A;  1YI2 V;  2IJH A;  4PDL A;  3B8N A;  1F51 A;  2WLJ A;  5BMV B;  4I55 B;  2R72 A;  1PM9 A;  1VAR A;  3CS5 A;  3RT3 C;  2ARH A;  4FM1 A;  2AXT Z;  1HR0 O;  4LF9 B;  4R50 A;  2JEX A;  2YSU B;  5GTI Z;  1YXB A;  1HNZ B;  3KG2 A;  4EKW A;  1JVM A;  5GTH Z;  4LR3 A;  3CME V;  1W0K G;  2Q68 A;  1Z5V A;  3ZHR A;  1DLB A;  1K73 W;  4UCT A;  3CE2 A;  3G71 V;  3OMA B;  3L75 H;  4JI3 B;  3LDC A;  3CCJ V;  1KKD A;  1SES A;  5DED A;  2XAH A;  3QTC A;  3ZED A;  2ZE7 A;  3T1H B;  4DV5 O;  4JYB A;  3HKB A;  4YY3 B;  4LF7 B;  3FB7 C;  5IYD O;  1EZV H;  3HKB B;  1Y76 A;  3WFV A;  3CJH A;  1M9N A;  2DQ3 A;  1QLN A;  1Y76 B;  3K3W A;  4UCV A;  1YIJ V;  3CJH B;  2NR5 A;  3K59 A;  4W4K A;  3H1J H;  4R6Z A;  1VMG A;  1R6T A;  4O4I A;  4AIL C;  1JCH A;  3D36 C;  3BVO A;  4PA7 A;  4O4I B;  3L71 H;  1GN3 A;  4G2K A;  1IBK O;  1EZJ A;  1VF6 A;  1S76 D;  3EHB B;  3A0B Z;  4DR2 B;  4G28 B;  4JI8 O;  3OM3 B;  3K08 A;  3SJB C;  2PYL A;  4FLU A;  1R6N A;  2WLI A;  1HNX B;  5BY1 A;  1GM7 A;  2WLI B;  4JTD B;  4PI2 A;  4J11 A;  4JZG A;  5L3D A;  1DTO A;  2FTK A;  1ORQ C;  4X64 B;  4B3T B;  3JSN A;  3SPC A;  3S3X A;  2ZE6 A;  1YTF B;  4I4T A;  2YIC A;  5LMU B;  2HG5 C;  4PA4 A;  2NNU A;  2IJK A;  3WG7 B;  5CBH A;  4I4T B;  3OMN B;  1HWY A;  1K33 A;  1R3L C;  4BWA A;  1HDJ A;  2H8P C;  4BW9 A;  2LW1 A;  3ICX A;  2WA4 A;  2R9I A;  1XMO B;  1NR7 A;  2LO1 A;  1P4R A;  1HNW B;  2QJ1 A;  4LH6 A;  3ABM B;  5E1A C;  3WB0 A;  4JI2 B;  3E8F A;  1K3E A;  1LUW A;  2B9Z A;  1QLE C;  2UXB B;  4X66 B;  4GT1 A;  4D7T A;  1BQZ A;  3AK1 A;  4LWS A;  1YSC A;  1VIB A;  3L74 H;  3RYF A;  5B1N A;  1LNQ A;  1QR8 A;  4LWS B;  5LXT A;  3APO A;  4JAU A;  5B5E Z;  4PA9 A;  5KHJ A;  2VWK A;  5LXT B;  1VQ7 V;  1BZK A;  4TQD A;  2G38 A;  4B3R B;  4X8A A;  3KCY A;  2YXY A;  2C2A A;  1V54 B;  5GW7 A;  2HJF C;  1L1F A;  3TJT A;  2OIE A;  3FX7 A;  3ZHU A;  2DYR C;  1I5Y A;  1Q43 A;  2ZQM A;  1N0J A;  2CGO A;  1WB7 A;  2HKO A;  4KUM A;  5IWA B;  3ASN B;  5CA3 A;  1PP9 H;  2QM8 A;  3RVY A;  2W0X A;  5L3E A;  1K34 A;  3DSQ A;  4JF3 A;  1PNM A;  3VQY A;  1TVK A;  2P67 A;  4ZIB A;  4MW3 A;  3JAW B;  3U10 A;  4LFB B;  1QVF U;  1MMM A;  1TVK B;  1KP3 A;  1UFI A;  2PGG A;  1MOF A;  3PN1 A;  3JD2 A;  2ODM A;  3OGI B;  3CCR V;  2E76 B;  2AW9 A;  2GTS A;  2Y69 B;  4J7Z A;  2ITD C;  2MW2 B;  4G27 B;  3VBB A;  3SGI A;  2HFE C;  2Y69 C;  1E1R G;  4MTG A;  2IH1 C;  1XUQ A;  4DR1 O;  3K04 A;  3FFQ A;  3CB2 A;  2HEP A;  3TXQ A;  4DW1 A;  1X4T A;  2HVK C;  4UV9 A;  4DYL A;  2IJJ A;  3JCZ A;  3LNN A;  3SPH A;  3T1Y O;  2ZDI A;  3E8H A;  2FKX A;  3OD4 A;  1KUQ A;  4YXW G;  1GK9 A;  3IC7 A;  1NR1 A;  2JRI A;  3FB5 C;  5TIS Z;  2QGN A;  5EIB D;  3ZJZ A;  4K3A A;  3HKD A;  3ZX6 A;  2P7T C;  4I9Q A;  4IHJ A;  1R3I C;  1SET A;  2UU9 O;  3RYH A;  1OV9 A;  3HKD B;  4FK5 C;  4IHJ B;  4DV7 B;  1N33 B;  3QNE A;  5KHG A;  3RYH B;  3A0R A;  4QGP A;  3OAA G;  4AQY O;  2DW4 A;  3EVK A;  1Q7Y W;  4LFC O;  2ZKO A;  1YDX A;  1M90 W;  4I50 A;  5KAF Z;  3BA9 A;  1M93 A;  1K5S A;  2FL4 A;  3E8B A;  4I50 B;  2DN9 A;  3EFF K;  3SPG A;  4J7J A;  2P5O A;  1TUB A;  4LF6 O;  3AG3 C;  2GTA A;  2Z0A A;  1YTF D;  1PL0 A;  2LP7 A;  4GLX A;  1TUB B;  3TK1 A;  4PJ0 Z;  5JJN B;  3JSL A;  1AI4 A;  2QA4 V;  2Q7H A;  1MSW D;  4YIP A;  1DF4 A;  2EIL B;  1XI1 A;  2QR4 A;  3K5M A;  4UCR A;  2JGD A;  4OX9 B;  3FD9 A;  2B5U A;  2JGD B;  3OTO B;  1XNR O;  4DUY O;  5KHH A;  2EIL C;  3SJC C;  1FJG O;  3JAT A;  1BMF G;  3I55 V;  3J80 N;  3JAT B;  1AJP A;  1ARO P;  1QR9 A;  1YJN V;  4RAI A;  1VQ4 V;  2W6J G;  1XOU A;  1WJZ A;  2EIM C;  3B40 A;  2F1M A;  3GWO A;  1CEZ A;  1SQV H;  1SF9 A;  1DGS A;  2O57 A;  2JDI G;  2YUA A;  2HP8 A;  2WLK A;  1PNK A;  2EUL A;  3D3I A;  4NR1 A;  3IJ4 A;  3SJQ C;  1R6K A;  4GX2 A;  2ZM6 B;  3G67 A;  2YXL A;  1GMG A;  5CA0 A;  1PV0 A;  1GKF A;  2P6J A;  4RO2 A;  5CA0 B;  4TOI A;  1V55 B;  2VQF B;  1VF5 B;  5H5N A;  4FLW A;  3GWK C;  4JI7 O;  2KSD A;  1P7G A;  5L3G A;  1QQC A;  1YJ9 V;  1V55 C;  1Q3E A;  3K58 A;  2UXD O;  2LW7 A;  5JCO A;  4DK0 A;  3ASO C;  4K0K O;  4HAM A;  4WBN A;  4B3M O;  3OEE G;  5L3F A;  2XAS A;  4WBN B;  4ZKI A;  2BCC H;  5FL7 G;  4Z1V A;  3RWR D;  3SPJ A;  5LL6 Y;  3SYO A;  3BPZ A;  1EN5 A;  1NQT A;  2X7R B;  4OPA A;  1MNG A;  5J2U A;  4BR6 A;  1HR0 B;  2Q69 A;  2RJZ A;  5J2U B;  3HKE A;  4QPK A;  4ZOL B;  4WFF A;  3M8A A;  3ZRS A;  3HKE B;  1NTZ H;  3LSS A;  2CDY A;  1AP6 A;  3ZN0 A;  1H2M A;  1VQ5 V;  2IU0 A;  2E75 B;  2Q4P A;  4DV2 O;  4JAA A;  2UUC O;  4DV5 B;  2EIK C;  4UVA A;  5FPO A;  3AG4 C;  4KXR A;  3T4D A;  1VEW A;  2YC0 A;  4TQF A;  3S3W A;  3STL C;  5LP6 A;  3CCE V;  1MAB G;  2ZCE A;  5LHG A;  5IY5 C;  4PI0 A;  4EFB A;  5LP6 B;  2WSS G;  3HPL C;  1Y67 A;  2EIJ B;  4J42 A;  3ZHQ A;  5JJJ B;  4LC1 A;  4EB6 A;  1ZLZ A;  1IBK B;  4RQF A;  3OTF A;  2Q9L A;  4EB6 B;  5L3B A;  4J41 A;  2ZE8 A;  4JI8 B;  4U7O A;  4FZ0 A;  4MTF A;  3CRC A;  2XTA A;  2UUA O;  2JVD A;  1ZUQ A;  4DR3 O;  3WB1 A;  4X88 A;  2GUZ A;  1OCO B;  1DF5 A;  5LYJ A;  2GUZ B;  2L35 A;  3LSU A;  3OFN G;  4WFB V;  4FLZ A;  3AEI A;  1BSM A;  4JI6 O;  4LFA O;  1SQQ H;  4DW0 A;  1TA8 A;  2GSM B;  1WAZ A;  4H33 A;  4BIZ A;  4NTW A;  2UXN A;  2R70 A;  1L8D A;  1Y6X A;  3X2Q B;  5D5Q A;  3B2E E;  2KB1 A;  3TGU H;  1T5E A;  2KKW A;  1XHX A;  2ZR2 A;  1NVP B;  1GM8 A;  2IW5 A;  4FLY A;  1SQX H;  3K9S A;  4FFK A;  1YIT V;  3KCX A;  5K1P A;  4JYA O;  4HNA B;  2IM9 A;  1MG1 A;  2Q5Z A;  1U96 A;  1Q8I A;  3ZHV A;  2GHY A;  1KP2 A;  1M56 C;  4GX5 A;  1Q6U A;  2Q67 A;  1FXH A;  2GV9 A;  3ZHT A;  1THZ A;  2QWR B;  1RSO A;  5HFL A;  2ETN A;  1SS3 A;  2FML A;  4JPR A;  3T2M A;  2PY5 A;  3RYC A;  1RSO B;  2ZE5 A;  1YEW A;  1QNM A;  2UXX A;  3CCM V;  4JI4 O;  3RYC B;  5BR8 O;  2F66 C;  3CXH F;  3JAR A;  1N32 O;  1H8E G;  4CH6 A;  4LP8 A;  3JAR B;  2OTL V;  1K92 A;  2JJ2 G;  1XMQ B;  2FYU H;  3H1I H;  1AR5 A;  3STZ C;  1K97 A;  2LGW A;  5HFM A;  3CRM A;  2QSA A;  3IAY A;  4GX0 A;  1H2N A;  3JD3 A;  2QKS A;  1N36 O;  3QO5 A;  4CS2 A;  4A5U B;  1H2G A;  1IXB A;  3D36 A;  1GM9 A;  1R3K C;  2ZT9 B;  4WFG A;  4FMT A;  4PDV A;  4DR5 O;  3CEI A;  1KB9 F;  2LGQ A;  4H44 B;  2XAF A;  3W7W A;  1Q90 D;  3UO3 A;  1PD3 A;  4MW8 A;  3MAQ A;  2B1G A;  4CZZ A;  4FLX A;  2XND G;  3JD1 A;  3CP1 A;  3ETE A;  2OIG A;  3FYI B;  4B7K A;  1ZWI C;  2F23 A;  3P3N A;  1R3J C;  3K57 A;  3CRA A;  1ENV A;  1IBM O;  5BZB A;  3DXR A;  3DXR B;  4JAV A;  2X6C A;  4TUY A;  5CBG A;  4DR1 B;  3H1K H;  3F5T A;  3L70 H;  1YHQ V;  1BT8 A;  2CAZ C;  4JYY A;  4TUY B;  4LNU A;  3H01 A;  2ZNI A;  4MS2 A;  4BIO A;  4LNU B;  1S5L Z; 
#chains in the Genus database with same CATH homology
 3OTO O;  4JI1 O;  1XMO O;  4JI4 O;  4DV5 O;  4DR1 O;  1FKA O;  1HNW O;  4LF5 O;  1XNQ O;  5BR8 O;  4DR7 O;  1N32 O;  1FYJ A;  5A2Q N;  1NS1 A;  4X65 O;  4JI3 O;  4JI2 O;  2UUB O;  1AIL A;  1XEQ A;  2UXB O;  4X66 O;  3T1H O;  4DV0 O;  4DR6 O;  3T1Y O;  1YZB A;  4YY3 O;  4JV5 O;  2FKX A;  1N34 O;  1R6T A;  4YHH O;  4LF7 O;  1I94 O;  1KUQ A;  5H5N A;  2JRI A;  2UUA O;  2HHH O;  4JI7 O;  4DR3 O;  2AGA A;  2ZM6 O;  1N36 O;  2UXC O;  3SDL A;  1IBK O;  4NXN O;  4A5U B;  2UU9 O;  2UXD O;  2LW7 A;  4JI8 O;  2VQF O;  2DOS A;  4B3R O;  4LF4 O;  4LF8 O;  4DR5 O;  5FLX N;  4K0K O;  1A32 A;  4B3M O;  2DJV A;  4AQY O;  3J81 N;  4JI6 O;  4LFA O;  5BY1 A;  4LFC O;  2VQE O;  2ZKO A;  1R1B A;  4DR2 O;  4KHP O;  4DV7 O;  5LL6 Y;  1J5E O;  1N33 O;  1XMQ O;  5IT9 N;  4OPA A;  4X62 O;  2E5L O;  1HNX O;  3J7A U;  4LF6 O;  1G1X B;  3O65 A;  1D2D A;  3R66 A;  2Z0A A;  5BXZ A;  4JI5 O;  5IWA O;  2F4V O;  3M8A A;  4DV4 O;  4B3S O;  1DK1 A;  4DV1 O;  4X64 O;  3RT3 C;  1HR0 O;  4B3T O;  1IBM O;  4JYA O;  3JAM N;  4DV2 O;  4DUZ O;  1IBL O;  4NXM O;  4DR4 O;  5LMU O;  1XNR O;  1AB3 A;  4DUY O;  2UUC O;  1F7Y A;  1FJG O;  4JI0 O;  3F5T A;  4DV3 O;  4DV6 O;  3J80 N;  4LFB O;  4OPH A;  5LMN O;  4OX9 O;  4LF9 O;  4GKJ O;  1X59 A;  2N74 A;  1HNZ O;  4GKK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...