5B5EZ

Crystal structure analysis of photosystem ii complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 26
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b5eZ00
5B5EZ 5H2FZ 5E79Z 5B66Z 5TISZ 5KAIZ 3JCUZ 4UB8Z 3KZIZ 4IL6Z 3WU2Z 1S5LZ 3A0HZ 5GTHZ 5GTIZ 4PJ0Z 3A0BZ 5KAFZ 4UB6Z 2AXTZ
chains in the Genus database with same CATH superfamily
1S0VA 4EFEA 4AHCA 4DUYO 4JV5O 2Y4UA 3G4SV 2JDIG 1JCHA 3JAMN 3HPLC 4NTYA 1AB3A 3B4SA 4DR5B 4QIWF 3G6EV 4LFAO 2VQFB 2HHHB 1AI6A 2QSAA 2E75B 4WFBV 2JJ2G 1BCCH 1VQ8V 1GRJA 1OV9A 2D2CB 3F5WC 3SPGA 2R9IA 1AROP 3ZRXA 4UFZA 3GWOA 1YF2A 4LP8A 2JS5A 4FJCC 4IIJA 2A06H 3EHBB 1N34O 1X59A 1KUQA 5CBFA 3QTCA 3JCZA 2UXCB 1DTOA 3R66A 4LC1A 5FNVA 1J5EO 3SPHA 4R6ZA 4AI8A 2OTJV 4R8CA 4ZI7A 4JI0B 4MVZA 3SJCC 1K33A 4X65B 4FZ1A 5IYBO 5IYZB 1TVKA 3JD0A 4FM1A 3SYQA 4FLWA 3E22B 5DN6G 4BWAA 1D2DA 4IL6Z 1NR1A 4JI5O 1G8MA 4JPRA 5JJEB 1F4MA 1PL0A 1Q5OA 4UB6Z 2A0LA 4DV4O 4DV7B 4HZ3A 4B08A 3GWKC 5L3CA 3ABTA 4MS2A 4JYAO 4B3RO 4UCRA 5BXZA 3BY6A 3K59A 4X89A 3MAQA 1N0NA 4NB5A 1S5LZ 4BW5A 3CCEV 3AG3C 2ZR3A 5KHJA 1KKCA 4DV3B 4O4IB 3UCSC 3OTOB 4FLVA 3KKYA 3JD2A 3K06A 4NXNO 1I5YA 3CRQA 1M9NA 5H6RA 2WSSG 4EB6A 3ABKB 1IXMA 4FMTA 4FFBA 4X9QA 2QKCA 1I08A 2WWWA 4PD4F 1FYJA 4H37A 1EFRG 4JI4B 5KHGA 5LOVB 4J10A 5IDJA 1DK1A 3JYCA 5KMGA 5KHHA 3ZRSA 3G71V 3FB8C 2Z0AA 2X6AA 5K1XA 3IJ4A 4KUMA 2WAMA 4PHZA 4X1KB 4JI7O 3CRMA 5E79Z 4LF4O 1ZSPA 3J7AU 2QKAA 1WNSA 2B5UA 1AP6A 4UCOA 2BTQB 3ABKC 4DV1B 1OCZC 3FB6C 2WLIB 5C93A 1MG1A 5BR8O 1GAXA 5KAFZ 3F7YC 1XQ8A 4JI6B 4FK5C 4J9YB 3T1CA 3HKBB 1H38A 1I5XA 1KKDA 2Q7EA 3FD9A 2CH7A 5F2VO 2GTAA 2JEUA 5B66Z 4PA7A 3Q4HB 1PD3A 2UXXA 1KC8W 1SRYA 4DYLA 1ORQC 3K04A 4KXRA 4DV6O 5CA1B 1YHQV 1RSOB 4LF6B 4X64B 4A5UB 1PKXA 4I55B 1A32A 4I0XA 4X8AA 3SDLA 4Z1VA 3JD4A 4MVRA 5FPRA 2VQEB 1ZAUA 2AZ0A 4DV0O 4BIOA 1MNGA 2OCCB 2QKSA 3QG5A 1NQTA 1XUQA 1VQLV 2VWKA 3P3NA 2HLDG 3VQVA 4FM0A 1FD9A 1F51A 2LQTA 3LNNA 4CH5A 2XASA 4TOIA 2IJIA 4NTWA 4MT8A 3HKEA 4I9QA 5KUKA 1S77D 3N2GA 1URFA 3WB2A 3AG2B 1LNQA 1XMQB 2WA4A 4I4TA 1SKVA 4UCVA 1SZXA 5KHIA 5L3EA 3CCQV 4IIJB 4ZIBA 3A8TA 3ZMZA 2ADPA 2QWOB 1YEWA 3CS5A 4XDKA 3RVZA 3ETEA 2OCCC 3T1HB 1CXZB 1GM9A 4EKWA 2UUAB 5KX5A 2VQFO 4ZI7B 1VMGA 4CH4A 2HHHO 2KQXA 2WLKA 3D36C 3APOA 1SQXH 1RPOA 2YEVA 5K1PA 3K3WA 4DV5B 4PA6A 3CWBH 1UPGA 4N21A 1US6A 2ZCEA 5EC1C 3AG2C 1THZA 3I56V 4ABMA 1K4DC 4JGSA 4YJ2A 2UXCO 3E8GA 4DUZB 4KHPO 3H1HH 3C3TA 1OCOB 5L3GA 1XMOB 2YDEA 1S3JA 1OCRB 4DR1B 1AI5A 3AK1A 3RT3C 2JK5C 4BAYA 1RM1B 2QWQB 2YUAA 4X65O 3TCUA 2JEXA 1XILA 4PDVA 2F23A 2E76B 4Z1MG 4X20A 2G38A 3STLC 5LL6Y 1XI1A 1RFYA 1MA1A 4U7OA 4Q20A 4P9OA 3AEIA 3OFNG 5EK0A 3VQXA 2YIDA 1K4CC 3CRCA 2B1GA 1JPXA 3JSLA 1Q43A 2CTQA 3KCYA 2FYUH 1XBLA 1DLBA 3JAKA 2YS8A 1YTFB 4E4EA 1H2GA 4LF8B 2P22C 2Q73A 2WLNA 4EB6B 5IYZA 1OCRC 1IBMB 1XHZA 2ZE5A 4FFBB 1N33B 5AG2A 2Y0PA 5B3SB 2Q69A 1RM1C 1N36O 2LGQA 4J41A 4HNAB 1R3KC 3CC7V 4DV3O 3FX7A 1K97A 3OTOO 3CCMV 4JTDB 4NVPA 2DWDC 5JQGA 3RGBA 4J7JA 3FYIB 4FVMA 2QM4A 1NVPB 1FFXA 3BEHA 2QTSA 2UUBB 3L72H 4IT5A 3TXSA 2F1MA 4UXNA 2Q68A 1ZTEA 2YXYA 1O9GA 1R6TA 1XL4A 2GHYA 3APQA 3CCVV 1M1KW 1WB8A 1T5EA 1KECA 4WBNA 4O4IA 1KP2A 2P7TC 5B3SC 3DC6A 3CJHB 4LF5O 4D7TA 1M90W 4CS4A 4LR3A 3OMIB 2CH7B 1SQQH 2E5LO 3DXRB 4QPKA 2LO1A 5E1AC 3ZHUA 1WPXA 4RQFA 1Y66A 1BHBA 2EIMB 1WA8B 2B9ZA 3CP1A 1I0HA 4J9ZB 1VIBA 2AGAA 1P4RA 3K9AA 5C8YB 3OEEG 4RQEA 3OM3B 2PYLA 4JYCA 4UV9A 2EX3A 1VQ9V 3F5TA 1FKAO 5CMUA 3OT7A 5JJNB 4U3JA 5CB4A 2CE4A 4X88A 3HB3B 3TXQA 4K35A 1FS0G 4YJ3A 2JJ1G 2ZXWB 4JYBA 2OIEA 5EBMC 4OGQB 2EILB 4LF6O 1IXBA 3ZN0A 1AILA 4JI8B 3O65A 3JCUZ 2WLIA 2YIBD 3QNEA 3WU2Z 2EIMC 1BZKA 4MTOA 1M5IA 1PM9A 1Q86W 2OT5A 1Y74B 1P49A 2ZKOA 2LW7A 3N2GB 2VQEO 1K92A 2XHBA 1PV0A 3Q4HA 4I4TB 2OCHA 3BRCA 4PV1B 2L6LA 2XNDG 1EN6A 1MSWD 2IW5A 2RNBA 5JH7B 3JATB 1AP5A 3OUSA 1BGYH 5IWAB 3WB1A 2UXBB 1Y76B 2BOBC 4L87A 1H8HG 1NH2B 2P5OA 2JGDB 4PDMA 4DR2B 2EILC 2Q8VA 2UXDO 4O4HB 5KX5B 2ZDIA 3H1KH 2CUGA 4N23A 3TGUH 3BAAA 2EJRA 4LFCB 1XMQO 2IJHA 4OX9B 4GLXA 3IC9A 1QBZA 1O9HA 3RFRA 1Y4MA 3CD6V 4WFFA 4UUJC 4YJ2B 3T1HO 3D36A 2K1EA 2WLHA 2Z3YA 3A0RA 2HVKC 4BIZA 1N32B 5CN0A 2ITDC 2BOCC 2WLLA 3P32A 1DGSA 3H1JH 1DF5A 3ICXA 3SJQC 4X20B 3B2EE 1EN5A 3OW2U 4B3MO 3T1YB 4YIOA 3E89A 3J81N 2ODMA 4DW1A 5LMUO 2Q7HA 4TT3G 1NTKH 1NTMH 4TV8B 3FFQA 4I5SA 4DUZO 3KZIZ 2PGGA 1H8EG 3SJBC 1VQKV 1XMOO 4DR1O 3ZBHA 1K5SA 5EIBC 4F4LA 3JAKB 2ARHA 1WB7A 3EFFK 3AG3B 1JQ0A 3FB5C 3BPZA 3WG7B 2P67A 1K9MW 3OGIB 1XNQB 3ASNC 4WF9V 2EULA 1WP7A 4BIUA 1OJHA 5FL7G 2ZT9B 1L1FA 3P3PA 2Y4TA 1ZL8B 2EIKB 2AZ2A 5HFMA 5B1OA 5B1BB 1G6UA 5JQGB 4X62B 2N05A 3RYFA 1FFXB 2GSMB 1YJNV 4XBFA 2PY5A 4K0KB 2ZM6O 4MSWC 2GV9A 3B8NA 4LF9O 5KA5A 1S5HC 1JA8A 1IBMO 1N33O 4DRXA 4NXMB 3WG7C 1VF6C 2QR4A 5DM6V 4WBNB 2UU9O 2O57A 4FZ0A 4WFGA 1NR7A 4LH6A 5KUMA 5D5QA 1W0JG 4U7NA 2EZOA 3ZN1A 3SR2C 3P30A 1AR5A 1N4CA 1OZ0A 2EIKC 4KL1A 2UUBO 1KYOF 5B1BC 5JJJB 2JS3A 4GCZA 1Q3EA 4DO2A 1EZJA 1OCZB 2WLJA 1HNXO 3CCSV 3K5OA 2R72A 1XOUA 4NTXA 4HNAA 3LSQA 1GO3F 4CC6A 3I5DA 2GTSA 2XOKG 1VARA 3E8HA 3M8AA 4LBEC 1GN3A 2IH3C 3ABUA 4X1YA 1VQ5V 4ZKIA 3CCRV 1VQPV 3THOA 4U3JB 4OPAA 5CB4B 5J2UB 2DYRB 2QM7A 2AXTZ 4RUFA 1E1QG 1KMIZ 4YJ3B 4G28B 1SF9A 2YC0A 1PPJH 5GW7A 1QLEB 1XNRB 3IC7A 3HKCA 3DC5A 3SPCA 4KP4A 5A2QN 4MVQA 2FMLA 4IHJB 3CJHA 4FLTA 1NBMG 2KSDA 1AR1B 4O2AB 3U0ZA 2AHYA 1AR4A 3BABA 2EINB 2EJ7A 2CTPA 4JI3B 5LMNB 1CP9A 2ZNIA 3M99B 1NI8A 4W4KA 4F6RA 3DXRA 4DV2B 1FJGB 1IDSA 1TUBB 4LWSA 1HNZO 2DYRC 1GTOA 1WA8A 2LGWA 2Y69B 4PJ0Z 1JJ2U 4GKKB 2VWJA 3K5NA 3WB0A 5C8YA 3E86A 3ASOB 3VOUA 5BMVA 3MHHC 4LFBB 1MZFA 1QLEC 1Z2GA 1B6QA 2FL4A 3SPIA 1QCEA 1PNLA 1BE3H 1S72V 3QO5A 1XL6A 4D6TH 4O4LA 2QWRB 3LDCA 4P2ZA 5CBGA 1TA8A 4BR6A 4NR1A 2EINC 1LR1A 3DTUB 3RW0A 5IWAO 1NJIW 2V1DA 1VP7A 1Q8IA 1V9PA 5KLVH 2Y69C 3CB2A 3E8BA 2Q0OC 1YCIA 2NLJC 1P7GA 4J7ZA 1Y74A 4J80A 4O4JA 3ASOC 2FTKA 3J80N 2WLLB 3UQ8A 4LFCO 3BHPA 1IURA 1ZLZA 2KG7B 3I55V 2ZDIC 1GK9A 3RYCB 1QU7A 3MD0A 5KAIZ 5JH7A 4RO2A 3JATA 3SGIA 4DXWA 2DJVA 2ITCC 2Y0IA 5DECA 4DR3B 5LGTA 3ZRVA 5J2TA 1Y76A 4XDJA 2JGDA 4I9WA 3ETDA 1DF4A 1HNWB 1LUWA 3K0GA 4DR5O 4O4HA 2PUSA 3OMAB 5B1AB 4LF7B 2ZR2A 4FLZA 4B3TB 3IGAC 1OCCB 2AHZA 2RJZA 1J95A 3K58A 1IBLB 2ATKC 2EZPA 3T1YO 4QPJA 5BY1A 5LGNA 1MOFA 3ZIAG 3B40A 4OPHA 2P4VA 1K3EA 1PL4A 1BSMA 3RYFB 4AILC 3ETQA 2XT9A 1H2KA 2ZD9A 3FAVA 4JI0O 4H44B 3RYIB 3VBBA 4PELA 2YIBA 1IBKB 3CCJV 4GKJB 1Q81W 5H6QA 2F95B 1XNQO 1Z5WA 1HR0B 4AQYB 4LCUC 1W59A 5B1AC 5LXTB 4DRXB 4JAVA 3AG7A 3CE2A 4O2BB 2BCCH 1OCCC 1WPBA 4TV8A 2D3OW 1G4YB 1W2BU 2ZINA 1PNKA 1VQNV 3SJAC 4DV7O 4FFKA 4K0KO 4RAIA 4TV9A 2WLMA 3AG4B 4QNHB 4J7KA 1JJOA 3W7TA 4X1IA 1VF6A 4DR7B 3QO8A 4JI5B 1I94B 4HAMA 3HKDA 5LYJB 1OHHG 1G1XB 4DR6B 3CSXA 2CTWA 4NXMO 2IJJA 3KG2A 1VQ4V 1ZL8A 3N27A 2MK3A 3S3WA 1K73W 5EZYB 1SA0A 4JYAB 3L73H 1ZX3A 4X1YB 2C2AA 2HKOA 3SYAA 1BMFG 4LNUA 2PYJA 3STZC 4DR4B 2OYQA 1MABG 3AG4C 5CBHA 3ABLB 4TUYA 3T2MA 4JI4O 4MVMA 3HKCB 1KQSU 3A0BZ 1GM8A 4R7CA 2L35A 2LP7A 3OGCC 3ZHTA 2IBZH 2EIJC 3K5MA 1VF5B 3UO3A 3SYPA 2X6CA 4F6RB 2OWOA 3GVMA 1F23A 2YXLA 4R50A 4ZOLA 1KP3A 4DK1A 4LWSB 2DWEC 4K8XA 2GBOA 1XNRO 4DV1O 4QE7A 2Q4PA 1SQPH 3OUFA 1GN4A 5BMVB 2R9RB 1QHTA 3ABLC 5L3FA 2UUCB 4JI6O 2IM9A 5IYDO 2RN9A 3CPWU 2YXHA 2PF4E 1NT2B 2RDCA 4JI7B 3AK3A 4JI3O 5J2UA 5LMNO 3SPJA 3NXSA 4LF4B 4O4LB 1B06A 4DV2O 3OD4A 2IJKA 1FXVA 2LFSA 2JIZG 1JOYA 4EFBA 2F43G 4CS3A 5BR8B 4D7SA 4GKKO 2Q5ZA 2NNUA 4BW9A 2MW2B 3EXAA 2ILMA 3F7VC 1JR9A 4X64O 5GTHZ 2QM8A 1WLEA 4IHJA 4ZBMA 1X4TA 4O2AA 1K8AW 3ZX6A 2F93B 3PN1A 4PA4A 3AG1B 4O4JB 3A2FA 4E2LA 3CRAA 4DV6B 2X0LA 3CHXA 1TUBA 3CX5F 3TJTA 2CGNA 3ZS8C 3B09A 3H9VA 1H2MA 1VQ7V 4P30A 1N0JA 1NZ6A 5J2TB 4NKGB 1KD1W 1HDJA 1U96A 2DQ0A 2W6JG 2KKWA 2IU3A 3NR7A 2BSKB 3L71H 3QF7A 1NS1A 3CMEV 4GUNA 3H1IH 5J9PC 4DK0A 4YIPA 3MDSA 2QWNB 5LHGA 1EN4A 1FXKA 5CA3A 2DOSA 3AG1C 3X2QB 3RYHA 4IGGA 1AJQA 3SYOA 1SQGA 4Q6GA 4DR3O 2JVDA 4RUEA 2ADQB 2DN9A 3OAAG 1GH6A 3K5LA 2UUAO 3JASB 3K9SA 2H3OA 3ASNB 2X6BA 3FAVB 1U97A 1QNMA 5H5NA 4LF7O 3A0HZ 2A9HA 1E1RG 4GX1A 2PTMA 2ZE6A 2QJ1A 2RMKB 3EVKA 2KG7A 1KB9F 4DV5O 3JSNA 2ZIMA 4H0LB 3RYCA 4PDLA 2W0FC 4B7KA 3LSUA 1HWYA 1Q90D 4IYIA 4U3FH 2YICA 1VQ6V 4GX5A 1WAZA 1UJWB 4RWUA 2LW1A 3X2QC 3K08A 3M7MX 4CH3A 4FPPA 4TV9B 1V54B 1YITV 3ML0A 1B3QA 2LFRA 4K3AA 4QGPA 1IBKO 4X1IB 1M93A 4GKJO 1H2LA 2NN4A 2R9AA 3JD3A 1HR0O 4AQYO 3HKDB 1XREA 3IAYA 3OMNB 4UB8Z 4KHPB 5KA6A 3G80A 4ZHQA 3W7XA 3ZHSA 4JI1B 2V7QG 3LSSA 4PA3A 3CXCU 1SA0B 3QO7A 2HVJC 1RPRA 4QE9A 3TK1A 3CMAV 4FLUA 1WP8A 4H33A 5H2FZ 2XAQA 2VS0A 4GYCB 5IJ0A 3DGEA 3ZRWA 4WFEA 3RYIA 5IE9A 4LF8O 4JI2B 3G67A 4LNUB 1H2NA 4DR7O 2N74A 3DSQA 1QVFU 3B77A 3UM7A 1I94O 1QQCA 1AI4A 2Q6AA 1V54C 4TUYB 4DR6O 5LXTA 2PI5A 4GZRB 4O2BA 1CPYA 5L3DA 2Q9LA 1L0NH 4JAAA 4JASA 3LDEA 4I50B 1KU9A 5JWPA 2F4VB 2ZE7A 2HG5C 2QA4V 1GM7A 1ZUQA 3JARA 2A3QA 2B1IA 1N36B 4PA9A 4DR4O 5EYPB 3FYEB 4I7ZB 4UVAA 1Q6HA 4DW0A 4ZOLB 1QLNA 3BCCH 1SESA 1COWG 3E8FA 5LYJA 2W6IG 5LA6B 2HEPA 2YIAA 4JZ2A 1Q6UA 1Q6IA 2KB1A 4YHHB 1TAEA 1YI2V 3ZMSA 1LUVA 5EZYA 1D5AA 1XEQA 5GONB 2UXNA 4JTAB 3W7UA 2P4KA 5DEDA 4MTXA 2HJDA 1SZTA 4MTGA 1GMGA 1XDCA 5FPOA 2DMXA 4WFAV 3W7SA 2HP8A 1VQOV 2JGUA 5TISZ 4IYHA 1L0LH 3ZCCA 4W4LA 4LF5B 3BA8A 1Z5VA 4CH6A 2A7WA 1FFTB 5ITZA 1SERA 1F7YA 5EC2C 2QWPB 2UUCO 4B3SB 2E5LB 2IU0A 1M4UA 3U11A 1R3JC 2LJ2A 4J42A 2XAHA 4HYOA 5JCOA 2ZIOA 3VQWA 2H94A 2M6YA 4WFHA 2GDSA 1M56B 2YI9A 5LP6A 5LHHA 2HFEC 3U10A 4TWKA 4G27B 4MW8A 5JVDA 4YXWG 2XAFA 2X7RB 4JI8O 1JFFA 3OR6C 1SQBH 2YI8A 1L8DA 2JRIA 1SC5B 2E3CA 1MSDA 4J11A 1VEWA 4FLYA 2QE7G 4LH7A 1FXKB 1MMMA 3ZMVA 3OR7C 1NTZH 3BA9A 4H13B 2Q7GA 4YY3B 3RYHB 3ZMTA 2VRZA 5L3BA 4C7UA 1M56C 4WCEV 2UXBO 3ZMUA 3IFXA 3VQYA 1R3LC 3D3QA 1PP9H 4X66B 1EM1A 5IJ9A 4DR2O 2GUZA 2CDYA 3HR0A 3JAWB 3KCXA 2N04A 1SQFA 2QTOA 1ROPA 1SS3A 3MHSC 4OX9O 3L74H 1Y67A 5EBLC 3LDDA 1JX9A 3CC2V 5KHKA 5LHIA 2CK3G 2YSUB 2CTRA 3H1LH 3JALA 1YDXA 2UXDB 3UT5A 3RVYA 4L8JA 1R1BA 1FXKC 5CA0A 3T4DA 1XHXA 2BTOA 2BSKA 1PNMA 1BQ0A 1N32O 5B5EZ 1BS3A 3UO2A 1RP3B 1YXBA 2R70A 3E83A 3BVOA 3ABMB 3WFVA 1ENVA 5FNVB 1GKFA 1YTFD 4DUYB 3FKSG 1E79G 4JV5B 4CS2A 3T4ZA 3L9DA 3K57A 4ZHQB 4GX2A 4ICGA 5IY5B 4NYKA 3PJSK 4LFAB 2WA3A 2QGNA 2XUMA 4UCTA 3JASA 2DYSB 2XAGA 1TVKB 5BZBA 5IJ0B 1VF7A 4B3MB 3ZRWB 1NVPD 4TSFG 2BE3A 1QR9A 3D3IA 1AJNA 1N34B 2ZE8A 1K7DA 5LMUB 3N2KA 1CEZA 3L70H 5D5PA 3LNMB 1YSCA 4FM2A 4JZGA 2QDOA 1P84F 4JI1O 3ABMC 1J5EB 4X62O 2ZQMA 1H2SB 2PI4A 3B8MA 3CXHF 5LBQA 1BHAA 2F66C 5IY5C 1QR8A 3JARB 4JI2O 5HFLA 2PZSA 2DYSC 2XAJA 1K5QA 2XTAA 4DV4B 2H8PC 1IX9A 4MVUA 2EIJB 4UCUA 2ZM6B 1S76D 1BT8A 4P9PA 4LF9B 1Q7YW 1VQMV 4B3RB 4ASUG 1OCOC 2F4VO 2EBOA 4JF3A 3OE7G 4UVCA 2W0XA 1KBHA 3E22A 2Y48A 4UVBA 4EEQA 3CRRA 2P90A 2UU9B 2FKXA 3S3XA 3W7WA 4MTFA 3SYCA 1R6NA 2DQ3A 3BFRA 4XDLA 4NXNB 1YIJV 2ZNJA 5KMGB 1NKDA 3K79A 1AI7A 1Y6XA 5ITZB 4YHHO 1TGOA 3O9OA 4JTCB 1M57B 4MW3A 4I50A 3ETGA 4PI0A 1FPOA 5A9GA 2HR3A 4CC5A 1F4NA 4UCSA 1UFIA 1WJZA 3L75H 1P7BA 3ZJZA 1GN6A 1HNXB 1SETA 1JMKC 4PI2A 1V55B 2DW4A 5EYPA 2CGOA 4FIPC 1W0KG 5GTIZ 1ZWIC 5LP6B 2CAZC 1IZ3A 3CEIA 2V4DA 5LA6A 1YZBA 4UV8A 5JVDB 1N8RW 3K0DA 4GT1A 4HBNA 3UKMA 1JFFB 2FB5A 1WN7A 3R65A 4B3SO 1BQZA 5GONA 5IT9N 3D8CA 3FB7C 4TQFA 1K34A 1NH2D 1M57C 4KFMA 1FJGO 5H9CA 4TQDA 5LOVA 3RWRD 3C3SA 2P6JA 5JCOC 1YJ9V 1HW7A 3LUTB 2IH1C 1V55C 4K8ZA 3CC4V 3GB7C 3K03A 1FAFA 3RN4A 2Q67A 4I0XB 3E35A 3G6BA 5LP6C 1YJWV 1R6KA 5IYCO 4LFBO 5IJ9B 4CBCA 5EIBD 2GUZB 1BL8A 4X1KA 1HP8A 4CZZA 4FLXA 2Q0AA 2RCVA 1HNZB 4Z2WA 1R73A 4F6EA 3ZHQA 2OIGA 1AJPA 3E2EA 2BTQA 1EBOA 2NR5A 1TUEB 4YY3O 4QJFB 3C90A 1EZVH 2P06A 3JALB 2M7WA 3UT5B 3HKBA 3OEHG 4PDRA 3HKEB 5CA0B 4X66O 5LGUA 1D5NA 2HJFC 1GN2A 3H01A 3CYOA 4DV0B 1Q82W 3JD1A 1IVSA 1SQVH 2WPDG 5EBWC 2DE0X 5CA1A 3RBZA 1RSOA 3OTFA 2ZXWC 3CCUV 3CCLV 1YVWA 2E74B 4JYYA 4OXSA 1I7FA 2QEXV 3QVNA 5B1NA 1JVMA 2Z5UA 4MVSA 3ZHVA 1AVMA 1S5JA 4I55A 3ZHRA 2K9PA 2AW9A 4GX0A 1NU1H 1HNWO 2ETNA 2YEVB 3ZEDA 5FLXN 1B04A 1FXHA 3JAWA 2RQ6A 4B3TO 2OTLV 4MVOA 1R3IC 4G2KA 3AK2A 1MZEA 2A79B 4JAUA 4B7EA 3N2KB 1IBLO 3TETA 1QVGU
chains in the Genus database with same CATH topology
5B5EZ 5H2FZ 5E79Z 5B66Z 5TISZ 5KAIZ 3JCUZ 4UB8Z 3KZIZ 4IL6Z 3WU2Z 1S5LZ 3A0HZ 5GTHZ 5GTIZ 4PJ0Z 3A0BZ 5KAFZ 4UB6Z 2AXTZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E Z;  5H2F Z;  5E79 Z;  5B66 Z;  5TIS Z;  5KAI Z;  3JCU Z;  4UB8 Z;  3KZI Z;  4IL6 Z;  3WU2 Z;  1S5L Z;  3A0H Z;  5GTH Z;  5GTI Z;  4PJ0 Z;  3A0B Z;  5KAF Z;  4UB6 Z;  2AXT Z; 
#chains in the Genus database with same CATH topology
 1S0V A;  4EFE A;  4AHC A;  4DUY O;  4JV5 O;  2Y4U A;  3G4S V;  2JDI G;  1JCH A;  3JAM N;  3HPL C;  4NTY A;  1AB3 A;  3B4S A;  4DR5 B;  4QIW F;  3G6E V;  4LFA O;  2VQF B;  2HHH B;  1AI6 A;  2QSA A;  2E75 B;  4WFB V;  2JJ2 G;  1BCC H;  1VQ8 V;  1GRJ A;  1OV9 A;  2D2C B;  3F5W C;  3SPG A;  2R9I A;  1ARO P;  3ZRX A;  4UFZ A;  3GWO A;  1YF2 A;  4LP8 A;  2JS5 A;  4FJC C;  4IIJ A;  2A06 H;  3EHB B;  1N34 O;  1X59 A;  1KUQ A;  5CBF A;  3QTC A;  3JCZ A;  2UXC B;  1DTO A;  3R66 A;  4LC1 A;  5FNV A;  1J5E O;  3SPH A;  4R6Z A;  4AI8 A;  2OTJ V;  4R8C A;  4ZI7 A;  4JI0 B;  4MVZ A;  3SJC C;  1K33 A;  4X65 B;  4FZ1 A;  5IYB O;  5IYZ B;  1TVK A;  3JD0 A;  4FM1 A;  3SYQ A;  4FLW A;  3E22 B;  5DN6 G;  4BWA A;  1D2D A;  4IL6 Z;  1NR1 A;  4JI5 O;  1G8M A;  4JPR A;  5JJE B;  1F4M A;  1PL0 A;  1Q5O A;  4UB6 Z;  2A0L A;  4DV4 O;  4DV7 B;  4HZ3 A;  4B08 A;  3GWK C;  5L3C A;  3ABT A;  4MS2 A;  4JYA O;  4B3R O;  4UCR A;  5BXZ A;  3BY6 A;  3K59 A;  4X89 A;  3MAQ A;  1N0N A;  4NB5 A;  1S5L Z;  4BW5 A;  3CCE V;  3AG3 C;  2ZR3 A;  5KHJ A;  1KKC A;  4DV3 B;  4O4I B;  3UCS C;  3OTO B;  4FLV A;  3KKY A;  3JD2 A;  3K06 A;  4NXN O;  1I5Y A;  3CRQ A;  1M9N A;  5H6R A;  2WSS G;  4EB6 A;  3ABK B;  1IXM A;  4FMT A;  4FFB A;  4X9Q A;  2QKC A;  1I08 A;  2WWW A;  4PD4 F;  1FYJ A;  4H37 A;  1EFR G;  4JI4 B;  5KHG A;  5LOV B;  4J10 A;  5IDJ A;  1DK1 A;  3JYC A;  5KMG A;  5KHH A;  3ZRS A;  3G71 V;  3FB8 C;  2Z0A A;  2X6A A;  5K1X A;  3IJ4 A;  4KUM A;  2WAM A;  4PHZ A;  4X1K B;  4JI7 O;  3CRM A;  5E79 Z;  4LF4 O;  1ZSP A;  3J7A U;  2QKA A;  1WNS A;  2B5U A;  1AP6 A;  4UCO A;  2BTQ B;  3ABK C;  4DV1 B;  1OCZ C;  3FB6 C;  2WLI B;  5C93 A;  1MG1 A;  5BR8 O;  1GAX A;  5KAF Z;  3F7Y C;  1XQ8 A;  4JI6 B;  4FK5 C;  4J9Y B;  3T1C A;  3HKB B;  1H38 A;  1I5X A;  1KKD A;  2Q7E A;  3FD9 A;  2CH7 A;  5F2V O;  2GTA A;  2JEU A;  5B66 Z;  4PA7 A;  3Q4H B;  1PD3 A;  2UXX A;  1KC8 W;  1SRY A;  4DYL A;  1ORQ C;  3K04 A;  4KXR A;  4DV6 O;  5CA1 B;  1YHQ V;  1RSO B;  4LF6 B;  4X64 B;  4A5U B;  1PKX A;  4I55 B;  1A32 A;  4I0X A;  4X8A A;  3SDL A;  4Z1V A;  3JD4 A;  4MVR A;  5FPR A;  2VQE B;  1ZAU A;  2AZ0 A;  4DV0 O;  4BIO A;  1MNG A;  2OCC B;  2QKS A;  3QG5 A;  1NQT A;  1XUQ A;  1VQL V;  2VWK A;  3P3N A;  2HLD G;  3VQV A;  4FM0 A;  1FD9 A;  1F51 A;  2LQT A;  3LNN A;  4CH5 A;  2XAS A;  4TOI A;  2IJI A;  4NTW A;  4MT8 A;  3HKE A;  4I9Q A;  5KUK A;  1S77 D;  3N2G A;  1URF A;  3WB2 A;  3AG2 B;  1LNQ A;  1XMQ B;  2WA4 A;  4I4T A;  1SKV A;  4UCV A;  1SZX A;  5KHI A;  5L3E A;  3CCQ V;  4IIJ B;  4ZIB A;  3A8T A;  3ZMZ A;  2ADP A;  2QWO B;  1YEW A;  3CS5 A;  4XDK A;  3RVZ A;  3ETE A;  2OCC C;  3T1H B;  1CXZ B;  1GM9 A;  4EKW A;  2UUA B;  5KX5 A;  2VQF O;  4ZI7 B;  1VMG A;  4CH4 A;  2HHH O;  2KQX A;  2WLK A;  3D36 C;  3APO A;  1SQX H;  1RPO A;  2YEV A;  5K1P A;  3K3W A;  4DV5 B;  4PA6 A;  3CWB H;  1UPG A;  4N21 A;  1US6 A;  2ZCE A;  5EC1 C;  3AG2 C;  1THZ A;  3I56 V;  4ABM A;  1K4D C;  4JGS A;  4YJ2 A;  2UXC O;  3E8G A;  4DUZ B;  4KHP O;  3H1H H;  3C3T A;  1OCO B;  5L3G A;  1XMO B;  2YDE A;  1S3J A;  1OCR B;  4DR1 B;  1AI5 A;  3AK1 A;  3RT3 C;  2JK5 C;  4BAY A;  1RM1 B;  2QWQ B;  2YUA A;  4X65 O;  3TCU A;  2JEX A;  1XIL A;  4PDV A;  2F23 A;  2E76 B;  4Z1M G;  4X20 A;  2G38 A;  3STL C;  5LL6 Y;  1XI1 A;  1RFY A;  1MA1 A;  4U7O A;  4Q20 A;  4P9O A;  3AEI A;  3OFN G;  5EK0 A;  3VQX A;  2YID A;  1K4C C;  3CRC A;  2B1G A;  1JPX A;  3JSL A;  1Q43 A;  2CTQ A;  3KCY A;  2FYU H;  1XBL A;  1DLB A;  3JAK A;  2YS8 A;  1YTF B;  4E4E A;  1H2G A;  4LF8 B;  2P22 C;  2Q73 A;  2WLN A;  4EB6 B;  5IYZ A;  1OCR C;  1IBM B;  1XHZ A;  2ZE5 A;  4FFB B;  1N33 B;  5AG2 A;  2Y0P A;  5B3S B;  2Q69 A;  1RM1 C;  1N36 O;  2LGQ A;  4J41 A;  4HNA B;  1R3K C;  3CC7 V;  4DV3 O;  3FX7 A;  1K97 A;  3OTO O;  3CCM V;  4JTD B;  4NVP A;  2DWD C;  5JQG A;  3RGB A;  4J7J A;  3FYI B;  4FVM A;  2QM4 A;  1NVP B;  1FFX A;  3BEH A;  2QTS A;  2UUB B;  3L72 H;  4IT5 A;  3TXS A;  2F1M A;  4UXN A;  2Q68 A;  1ZTE A;  2YXY A;  1O9G A;  1R6T A;  1XL4 A;  2GHY A;  3APQ A;  3CCV V;  1M1K W;  1WB8 A;  1T5E A;  1KEC A;  4WBN A;  4O4I A;  1KP2 A;  2P7T C;  5B3S C;  3DC6 A;  3CJH B;  4LF5 O;  4D7T A;  1M90 W;  4CS4 A;  4LR3 A;  3OMI B;  2CH7 B;  1SQQ H;  2E5L O;  3DXR B;  4QPK A;  2LO1 A;  5E1A C;  3ZHU A;  1WPX A;  4RQF A;  1Y66 A;  1BHB A;  2EIM B;  1WA8 B;  2B9Z A;  3CP1 A;  1I0H A;  4J9Z B;  1VIB A;  2AGA A;  1P4R A;  3K9A A;  5C8Y B;  3OEE G;  4RQE A;  3OM3 B;  2PYL A;  4JYC A;  4UV9 A;  2EX3 A;  1VQ9 V;  3F5T A;  1FKA O;  5CMU A;  3OT7 A;  5JJN B;  4U3J A;  5CB4 A;  2CE4 A;  4X88 A;  3HB3 B;  3TXQ A;  4K35 A;  1FS0 G;  4YJ3 A;  2JJ1 G;  2ZXW B;  4JYB A;  2OIE A;  5EBM C;  4OGQ B;  2EIL B;  4LF6 O;  1IXB A;  3ZN0 A;  1AIL A;  4JI8 B;  3O65 A;  3JCU Z;  2WLI A;  2YIB D;  3QNE A;  3WU2 Z;  2EIM C;  1BZK A;  4MTO A;  1M5I A;  1PM9 A;  1Q86 W;  2OT5 A;  1Y74 B;  1P49 A;  2ZKO A;  2LW7 A;  3N2G B;  2VQE O;  1K92 A;  2XHB A;  1PV0 A;  3Q4H A;  4I4T B;  2OCH A;  3BRC A;  4PV1 B;  2L6L A;  2XND G;  1EN6 A;  1MSW D;  2IW5 A;  2RNB A;  5JH7 B;  3JAT B;  1AP5 A;  3OUS A;  1BGY H;  5IWA B;  3WB1 A;  2UXB B;  1Y76 B;  2BOB C;  4L87 A;  1H8H G;  1NH2 B;  2P5O A;  2JGD B;  4PDM A;  4DR2 B;  2EIL C;  2Q8V A;  2UXD O;  4O4H B;  5KX5 B;  2ZDI A;  3H1K H;  2CUG A;  4N23 A;  3TGU H;  3BAA A;  2EJR A;  4LFC B;  1XMQ O;  2IJH A;  4OX9 B;  4GLX A;  3IC9 A;  1QBZ A;  1O9H A;  3RFR A;  1Y4M A;  3CD6 V;  4WFF A;  4UUJ C;  4YJ2 B;  3T1H O;  3D36 A;  2K1E A;  2WLH A;  2Z3Y A;  3A0R A;  2HVK C;  4BIZ A;  1N32 B;  5CN0 A;  2ITD C;  2BOC C;  2WLL A;  3P32 A;  1DGS A;  3H1J H;  1DF5 A;  3ICX A;  3SJQ C;  4X20 B;  3B2E E;  1EN5 A;  3OW2 U;  4B3M O;  3T1Y B;  4YIO A;  3E89 A;  3J81 N;  2ODM A;  4DW1 A;  5LMU O;  2Q7H A;  4TT3 G;  1NTK H;  1NTM H;  4TV8 B;  3FFQ A;  4I5S A;  4DUZ O;  3KZI Z;  2PGG A;  1H8E G;  3SJB C;  1VQK V;  1XMO O;  4DR1 O;  3ZBH A;  1K5S A;  5EIB C;  4F4L A;  3JAK B;  2ARH A;  1WB7 A;  3EFF K;  3AG3 B;  1JQ0 A;  3FB5 C;  3BPZ A;  3WG7 B;  2P67 A;  1K9M W;  3OGI B;  1XNQ B;  3ASN C;  4WF9 V;  2EUL A;  1WP7 A;  4BIU A;  1OJH A;  5FL7 G;  2ZT9 B;  1L1F A;  3P3P A;  2Y4T A;  1ZL8 B;  2EIK B;  2AZ2 A;  5HFM A;  5B1O A;  5B1B B;  1G6U A;  5JQG B;  4X62 B;  2N05 A;  3RYF A;  1FFX B;  2GSM B;  1YJN V;  4XBF A;  2PY5 A;  4K0K B;  2ZM6 O;  4MSW C;  2GV9 A;  3B8N A;  4LF9 O;  5KA5 A;  1S5H C;  1JA8 A;  1IBM O;  1N33 O;  4DRX A;  4NXM B;  3WG7 C;  1VF6 C;  2QR4 A;  5DM6 V;  4WBN B;  2UU9 O;  2O57 A;  4FZ0 A;  4WFG A;  1NR7 A;  4LH6 A;  5KUM A;  5D5Q A;  1W0J G;  4U7N A;  2EZO A;  3ZN1 A;  3SR2 C;  3P30 A;  1AR5 A;  1N4C A;  1OZ0 A;  2EIK C;  4KL1 A;  2UUB O;  1KYO F;  5B1B C;  5JJJ B;  2JS3 A;  4GCZ A;  1Q3E A;  4DO2 A;  1EZJ A;  1OCZ B;  2WLJ A;  1HNX O;  3CCS V;  3K5O A;  2R72 A;  1XOU A;  4NTX A;  4HNA A;  3LSQ A;  1GO3 F;  4CC6 A;  3I5D A;  2GTS A;  2XOK G;  1VAR A;  3E8H A;  3M8A A;  4LBE C;  1GN3 A;  2IH3 C;  3ABU A;  4X1Y A;  1VQ5 V;  4ZKI A;  3CCR V;  1VQP V;  3THO A;  4U3J B;  4OPA A;  5CB4 B;  5J2U B;  2DYR B;  2QM7 A;  2AXT Z;  4RUF A;  1E1Q G;  1KMI Z;  4YJ3 B;  4G28 B;  1SF9 A;  2YC0 A;  1PPJ H;  5GW7 A;  1QLE B;  1XNR B;  3IC7 A;  3HKC A;  3DC5 A;  3SPC A;  4KP4 A;  5A2Q N;  4MVQ A;  2FML A;  4IHJ B;  3CJH A;  4FLT A;  1NBM G;  2KSD A;  1AR1 B;  4O2A B;  3U0Z A;  2AHY A;  1AR4 A;  3BAB A;  2EIN B;  2EJ7 A;  2CTP A;  4JI3 B;  5LMN B;  1CP9 A;  2ZNI A;  3M99 B;  1NI8 A;  4W4K A;  4F6R A;  3DXR A;  4DV2 B;  1FJG B;  1IDS A;  1TUB B;  4LWS A;  1HNZ O;  2DYR C;  1GTO A;  1WA8 A;  2LGW A;  2Y69 B;  4PJ0 Z;  1JJ2 U;  4GKK B;  2VWJ A;  3K5N A;  3WB0 A;  5C8Y A;  3E86 A;  3ASO B;  3VOU A;  5BMV A;  3MHH C;  4LFB B;  1MZF A;  1QLE C;  1Z2G A;  1B6Q A;  2FL4 A;  3SPI A;  1QCE A;  1PNL A;  1BE3 H;  1S72 V;  3QO5 A;  1XL6 A;  4D6T H;  4O4L A;  2QWR B;  3LDC A;  4P2Z A;  5CBG A;  1TA8 A;  4BR6 A;  4NR1 A;  2EIN C;  1LR1 A;  3DTU B;  3RW0 A;  5IWA O;  1NJI W;  2V1D A;  1VP7 A;  1Q8I A;  1V9P A;  5KLV H;  2Y69 C;  3CB2 A;  3E8B A;  2Q0O C;  1YCI A;  2NLJ C;  1P7G A;  4J7Z A;  1Y74 A;  4J80 A;  4O4J A;  3ASO C;  2FTK A;  3J80 N;  2WLL B;  3UQ8 A;  4LFC O;  3BHP A;  1IUR A;  1ZLZ A;  2KG7 B;  3I55 V;  2ZDI C;  1GK9 A;  3RYC B;  1QU7 A;  3MD0 A;  5KAI Z;  5JH7 A;  4RO2 A;  3JAT A;  3SGI A;  4DXW A;  2DJV A;  2ITC C;  2Y0I A;  5DEC A;  4DR3 B;  5LGT A;  3ZRV A;  5J2T A;  1Y76 A;  4XDJ A;  2JGD A;  4I9W A;  3ETD A;  1DF4 A;  1HNW B;  1LUW A;  3K0G A;  4DR5 O;  4O4H A;  2PUS A;  3OMA B;  5B1A B;  4LF7 B;  2ZR2 A;  4FLZ A;  4B3T B;  3IGA C;  1OCC B;  2AHZ A;  2RJZ A;  1J95 A;  3K58 A;  1IBL B;  2ATK C;  2EZP A;  3T1Y O;  4QPJ A;  5BY1 A;  5LGN A;  1MOF A;  3ZIA G;  3B40 A;  4OPH A;  2P4V A;  1K3E A;  1PL4 A;  1BSM A;  3RYF B;  4AIL C;  3ETQ A;  2XT9 A;  1H2K A;  2ZD9 A;  3FAV A;  4JI0 O;  4H44 B;  3RYI B;  3VBB A;  4PEL A;  2YIB A;  1IBK B;  3CCJ V;  4GKJ B;  1Q81 W;  5H6Q A;  2F95 B;  1XNQ O;  1Z5W A;  1HR0 B;  4AQY B;  4LCU C;  1W59 A;  5B1A C;  5LXT B;  4DRX B;  4JAV A;  3AG7 A;  3CE2 A;  4O2B B;  2BCC H;  1OCC C;  1WPB A;  4TV8 A;  2D3O W;  1G4Y B;  1W2B U;  2ZIN A;  1PNK A;  1VQN V;  3SJA C;  4DV7 O;  4FFK A;  4K0K O;  4RAI A;  4TV9 A;  2WLM A;  3AG4 B;  4QNH B;  4J7K A;  1JJO A;  3W7T A;  4X1I A;  1VF6 A;  4DR7 B;  3QO8 A;  4JI5 B;  1I94 B;  4HAM A;  3HKD A;  5LYJ B;  1OHH G;  1G1X B;  4DR6 B;  3CSX A;  2CTW A;  4NXM O;  2IJJ A;  3KG2 A;  1VQ4 V;  1ZL8 A;  3N27 A;  2MK3 A;  3S3W A;  1K73 W;  5EZY B;  1SA0 A;  4JYA B;  3L73 H;  1ZX3 A;  4X1Y B;  2C2A A;  2HKO A;  3SYA A;  1BMF G;  4LNU A;  2PYJ A;  3STZ C;  4DR4 B;  2OYQ A;  1MAB G;  3AG4 C;  5CBH A;  3ABL B;  4TUY A;  3T2M A;  4JI4 O;  4MVM A;  3HKC B;  1KQS U;  3A0B Z;  1GM8 A;  4R7C A;  2L35 A;  2LP7 A;  3OGC C;  3ZHT A;  2IBZ H;  2EIJ C;  3K5M A;  1VF5 B;  3UO3 A;  3SYP A;  2X6C A;  4F6R B;  2OWO A;  3GVM A;  1F23 A;  2YXL A;  4R50 A;  4ZOL A;  1KP3 A;  4DK1 A;  4LWS B;  2DWE C;  4K8X A;  2GBO A;  1XNR O;  4DV1 O;  4QE7 A;  2Q4P A;  1SQP H;  3OUF A;  1GN4 A;  5BMV B;  2R9R B;  1QHT A;  3ABL C;  5L3F A;  2UUC B;  4JI6 O;  2IM9 A;  5IYD O;  2RN9 A;  3CPW U;  2YXH A;  2PF4 E;  1NT2 B;  2RDC A;  4JI7 B;  3AK3 A;  4JI3 O;  5J2U A;  5LMN O;  3SPJ A;  3NXS A;  4LF4 B;  4O4L B;  1B06 A;  4DV2 O;  3OD4 A;  2IJK A;  1FXV A;  2LFS A;  2JIZ G;  1JOY A;  4EFB A;  2F43 G;  4CS3 A;  5BR8 B;  4D7S A;  4GKK O;  2Q5Z A;  2NNU A;  4BW9 A;  2MW2 B;  3EXA A;  2ILM A;  3F7V C;  1JR9 A;  4X64 O;  5GTH Z;  2QM8 A;  1WLE A;  4IHJ A;  4ZBM A;  1X4T A;  4O2A A;  1K8A W;  3ZX6 A;  2F93 B;  3PN1 A;  4PA4 A;  3AG1 B;  4O4J B;  3A2F A;  4E2L A;  3CRA A;  4DV6 B;  2X0L A;  3CHX A;  1TUB A;  3CX5 F;  3TJT A;  2CGN A;  3ZS8 C;  3B09 A;  3H9V A;  1H2M A;  1VQ7 V;  4P30 A;  1N0J A;  1NZ6 A;  5J2T B;  4NKG B;  1KD1 W;  1HDJ A;  1U96 A;  2DQ0 A;  2W6J G;  2KKW A;  2IU3 A;  3NR7 A;  2BSK B;  3L71 H;  3QF7 A;  1NS1 A;  3CME V;  4GUN A;  3H1I H;  5J9P C;  4DK0 A;  4YIP A;  3MDS A;  2QWN B;  5LHG A;  1EN4 A;  1FXK A;  5CA3 A;  2DOS A;  3AG1 C;  3X2Q B;  3RYH A;  4IGG A;  1AJQ A;  3SYO A;  1SQG A;  4Q6G A;  4DR3 O;  2JVD A;  4RUE A;  2ADQ B;  2DN9 A;  3OAA G;  1GH6 A;  3K5L A;  2UUA O;  3JAS B;  3K9S A;  2H3O A;  3ASN B;  2X6B A;  3FAV B;  1U97 A;  1QNM A;  5H5N A;  4LF7 O;  3A0H Z;  2A9H A;  1E1R G;  4GX1 A;  2PTM A;  2ZE6 A;  2QJ1 A;  2RMK B;  3EVK A;  2KG7 A;  1KB9 F;  4DV5 O;  3JSN A;  2ZIM A;  4H0L B;  3RYC A;  4PDL A;  2W0F C;  4B7K A;  3LSU A;  1HWY A;  1Q90 D;  4IYI A;  4U3F H;  2YIC A;  1VQ6 V;  4GX5 A;  1WAZ A;  1UJW B;  4RWU A;  2LW1 A;  3X2Q C;  3K08 A;  3M7M X;  4CH3 A;  4FPP A;  4TV9 B;  1V54 B;  1YIT V;  3ML0 A;  1B3Q A;  2LFR A;  4K3A A;  4QGP A;  1IBK O;  4X1I B;  1M93 A;  4GKJ O;  1H2L A;  2NN4 A;  2R9A A;  3JD3 A;  1HR0 O;  4AQY O;  3HKD B;  1XRE A;  3IAY A;  3OMN B;  4UB8 Z;  4KHP B;  5KA6 A;  3G80 A;  4ZHQ A;  3W7X A;  3ZHS A;  4JI1 B;  2V7Q G;  3LSS A;  4PA3 A;  3CXC U;  1SA0 B;  3QO7 A;  2HVJ C;  1RPR A;  4QE9 A;  3TK1 A;  3CMA V;  4FLU A;  1WP8 A;  4H33 A;  5H2F Z;  2XAQ A;  2VS0 A;  4GYC B;  5IJ0 A;  3DGE A;  3ZRW A;  4WFE A;  3RYI A;  5IE9 A;  4LF8 O;  4JI2 B;  3G67 A;  4LNU B;  1H2N A;  4DR7 O;  2N74 A;  3DSQ A;  1QVF U;  3B77 A;  3UM7 A;  1I94 O;  1QQC A;  1AI4 A;  2Q6A A;  1V54 C;  4TUY B;  4DR6 O;  5LXT A;  2PI5 A;  4GZR B;  4O2B A;  1CPY A;  5L3D A;  2Q9L A;  1L0N H;  4JAA A;  4JAS A;  3LDE A;  4I50 B;  1KU9 A;  5JWP A;  2F4V B;  2ZE7 A;  2HG5 C;  2QA4 V;  1GM7 A;  1ZUQ A;  3JAR A;  2A3Q A;  2B1I A;  1N36 B;  4PA9 A;  4DR4 O;  5EYP B;  3FYE B;  4I7Z B;  4UVA A;  1Q6H A;  4DW0 A;  4ZOL B;  1QLN A;  3BCC H;  1SES A;  1COW G;  3E8F A;  5LYJ A;  2W6I G;  5LA6 B;  2HEP A;  2YIA A;  4JZ2 A;  1Q6U A;  1Q6I A;  2KB1 A;  4YHH B;  1TAE A;  1YI2 V;  3ZMS A;  1LUV A;  5EZY A;  1D5A A;  1XEQ A;  5GON B;  2UXN A;  4JTA B;  3W7U A;  2P4K A;  5DED A;  4MTX A;  2HJD A;  1SZT A;  4MTG A;  1GMG A;  1XDC A;  5FPO A;  2DMX A;  4WFA V;  3W7S A;  2HP8 A;  1VQO V;  2JGU A;  5TIS Z;  4IYH A;  1L0L H;  3ZCC A;  4W4L A;  4LF5 B;  3BA8 A;  1Z5V A;  4CH6 A;  2A7W A;  1FFT B;  5ITZ A;  1SER A;  1F7Y A;  5EC2 C;  2QWP B;  2UUC O;  4B3S B;  2E5L B;  2IU0 A;  1M4U A;  3U11 A;  1R3J C;  2LJ2 A;  4J42 A;  2XAH A;  4HYO A;  5JCO A;  2ZIO A;  3VQW A;  2H94 A;  2M6Y A;  4WFH A;  2GDS A;  1M56 B;  2YI9 A;  5LP6 A;  5LHH A;  2HFE C;  3U10 A;  4TWK A;  4G27 B;  4MW8 A;  5JVD A;  4YXW G;  2XAF A;  2X7R B;  4JI8 O;  1JFF A;  3OR6 C;  1SQB H;  2YI8 A;  1L8D A;  2JRI A;  1SC5 B;  2E3C A;  1MSD A;  4J11 A;  1VEW A;  4FLY A;  2QE7 G;  4LH7 A;  1FXK B;  1MMM A;  3ZMV A;  3OR7 C;  1NTZ H;  3BA9 A;  4H13 B;  2Q7G A;  4YY3 B;  3RYH B;  3ZMT A;  2VRZ A;  5L3B A;  4C7U A;  1M56 C;  4WCE V;  2UXB O;  3ZMU A;  3IFX A;  3VQY A;  1R3L C;  3D3Q A;  1PP9 H;  4X66 B;  1EM1 A;  5IJ9 A;  4DR2 O;  2GUZ A;  2CDY A;  3HR0 A;  3JAW B;  3KCX A;  2N04 A;  1SQF A;  2QTO A;  1ROP A;  1SS3 A;  3MHS C;  4OX9 O;  3L74 H;  1Y67 A;  5EBL C;  3LDD A;  1JX9 A;  3CC2 V;  5KHK A;  5LHI A;  2CK3 G;  2YSU B;  2CTR A;  3H1L H;  3JAL A;  1YDX A;  2UXD B;  3UT5 A;  3RVY A;  4L8J A;  1R1B A;  1FXK C;  5CA0 A;  3T4D A;  1XHX A;  2BTO A;  2BSK A;  1PNM A;  1BQ0 A;  1N32 O;  5B5E Z;  1BS3 A;  3UO2 A;  1RP3 B;  1YXB A;  2R70 A;  3E83 A;  3BVO A;  3ABM B;  3WFV A;  1ENV A;  5FNV B;  1GKF A;  1YTF D;  4DUY B;  3FKS G;  1E79 G;  4JV5 B;  4CS2 A;  3T4Z A;  3L9D A;  3K57 A;  4ZHQ B;  4GX2 A;  4ICG A;  5IY5 B;  4NYK A;  3PJS K;  4LFA B;  2WA3 A;  2QGN A;  2XUM A;  4UCT A;  3JAS A;  2DYS B;  2XAG A;  1TVK B;  5BZB A;  5IJ0 B;  1VF7 A;  4B3M B;  3ZRW B;  1NVP D;  4TSF G;  2BE3 A;  1QR9 A;  3D3I A;  1AJN A;  1N34 B;  2ZE8 A;  1K7D A;  5LMU B;  3N2K A;  1CEZ A;  3L70 H;  5D5P A;  3LNM B;  1YSC A;  4FM2 A;  4JZG A;  2QDO A;  1P84 F;  4JI1 O;  3ABM C;  1J5E B;  4X62 O;  2ZQM A;  1H2S B;  2PI4 A;  3B8M A;  3CXH F;  5LBQ A;  1BHA A;  2F66 C;  5IY5 C;  1QR8 A;  3JAR B;  4JI2 O;  5HFL A;  2PZS A;  2DYS C;  2XAJ A;  1K5Q A;  2XTA A;  4DV4 B;  2H8P C;  1IX9 A;  4MVU A;  2EIJ B;  4UCU A;  2ZM6 B;  1S76 D;  1BT8 A;  4P9P A;  4LF9 B;  1Q7Y W;  1VQM V;  4B3R B;  4ASU G;  1OCO C;  2F4V O;  2EBO A;  4JF3 A;  3OE7 G;  4UVC A;  2W0X A;  1KBH A;  3E22 A;  2Y48 A;  4UVB A;  4EEQ A;  3CRR A;  2P90 A;  2UU9 B;  2FKX A;  3S3X A;  3W7W A;  4MTF A;  3SYC A;  1R6N A;  2DQ3 A;  3BFR A;  4XDL A;  4NXN B;  1YIJ V;  2ZNJ A;  5KMG B;  1NKD A;  3K79 A;  1AI7 A;  1Y6X A;  5ITZ B;  4YHH O;  1TGO A;  3O9O A;  4JTC B;  1M57 B;  4MW3 A;  4I50 A;  3ETG A;  4PI0 A;  1FPO A;  5A9G A;  2HR3 A;  4CC5 A;  1F4N A;  4UCS A;  1UFI A;  1WJZ A;  3L75 H;  1P7B A;  3ZJZ A;  1GN6 A;  1HNX B;  1SET A;  1JMK C;  4PI2 A;  1V55 B;  2DW4 A;  5EYP A;  2CGO A;  4FIP C;  1W0K G;  5GTI Z;  1ZWI C;  5LP6 B;  2CAZ C;  1IZ3 A;  3CEI A;  2V4D A;  5LA6 A;  1YZB A;  4UV8 A;  5JVD B;  1N8R W;  3K0D A;  4GT1 A;  4HBN A;  3UKM A;  1JFF B;  2FB5 A;  1WN7 A;  3R65 A;  4B3S O;  1BQZ A;  5GON A;  5IT9 N;  3D8C A;  3FB7 C;  4TQF A;  1K34 A;  1NH2 D;  1M57 C;  4KFM A;  1FJG O;  5H9C A;  4TQD A;  5LOV A;  3RWR D;  3C3S A;  2P6J A;  5JCO C;  1YJ9 V;  1HW7 A;  3LUT B;  2IH1 C;  1V55 C;  4K8Z A;  3CC4 V;  3GB7 C;  3K03 A;  1FAF A;  3RN4 A;  2Q67 A;  4I0X B;  3E35 A;  3G6B A;  5LP6 C;  1YJW V;  1R6K A;  5IYC O;  4LFB O;  5IJ9 B;  4CBC A;  5EIB D;  2GUZ B;  1BL8 A;  4X1K A;  1HP8 A;  4CZZ A;  4FLX A;  2Q0A A;  2RCV A;  1HNZ B;  4Z2W A;  1R73 A;  4F6E A;  3ZHQ A;  2OIG A;  1AJP A;  3E2E A;  2BTQ A;  1EBO A;  2NR5 A;  1TUE B;  4YY3 O;  4QJF B;  3C90 A;  1EZV H;  2P06 A;  3JAL B;  2M7W A;  3UT5 B;  3HKB A;  3OEH G;  4PDR A;  3HKE B;  5CA0 B;  4X66 O;  5LGU A;  1D5N A;  2HJF C;  1GN2 A;  3H01 A;  3CYO A;  4DV0 B;  1Q82 W;  3JD1 A;  1IVS A;  1SQV H;  2WPD G;  5EBW C;  2DE0 X;  5CA1 A;  3RBZ A;  1RSO A;  3OTF A;  2ZXW C;  3CCU V;  3CCL V;  1YVW A;  2E74 B;  4JYY A;  4OXS A;  1I7F A;  2QEX V;  3QVN A;  5B1N A;  1JVM A;  2Z5U A;  4MVS A;  3ZHV A;  1AVM A;  1S5J A;  4I55 A;  3ZHR A;  2K9P A;  2AW9 A;  4GX0 A;  1NU1 H;  1HNW O;  2ETN A;  2YEV B;  3ZED A;  5FLX N;  1B04 A;  1FXH A;  3JAW A;  2RQ6 A;  4B3T O;  2OTL V;  4MVO A;  1R3I C;  4G2K A;  3AK2 A;  1MZE A;  2A79 B;  4JAU A;  4B7E A;  3N2K B;  1IBL O;  3TET A;  1QVG U; 
#chains in the Genus database with same CATH homology
 5B5E Z;  5H2F Z;  5E79 Z;  5B66 Z;  5TIS Z;  5KAI Z;  3JCU Z;  4UB8 Z;  3KZI Z;  4IL6 Z;  3WU2 Z;  1S5L Z;  3A0H Z;  5GTH Z;  5GTI Z;  4PJ0 Z;  3A0B Z;  5KAF Z;  4UB6 Z;  2AXT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...