5B5EZ

Crystal structure analysis of photosystem ii complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 26
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b5eZ00
5H2FZ 1S5LZ 4IL6Z 3A0HZ 4UB8Z 5E79Z 5KAIZ 3JCUZ 5GTHZ 3A0BZ 5TISZ 3WU2Z 5B5EZ 5GTIZ 4UB6Z 3KZIZ 5KAFZ 2AXTZ 4PJ0Z 5B66Z
chains in the Genus database with same CATH superfamily
4DV7O 5EYPA 1GN6A 4LNUA 3IC9A 3G80A 3WFVA 5CA0B 2JJ1G 4I50A 2W6IG 4F6EA 1Q90D 2W6JG 2Q8VA 2EILB 3CWBH 3U10A 2RN9A 5A2QN 4MVOA 4QE9A 3K59A 1VQ5V 2EZPA 1FXHA 3HKDA 4DV5B 3JD1A 4LF8B 3L75H 1AJNA 4CZZA 5KUKA 1YZBA 4U7OA 1IXMA 2YS8A 2BSKB 3CRQA 3FD9A 3BY6A 4HZ3A 4DV3B 4DV0O 5F2VO 1Q7YW 2KKWA 1RFYA 1NI8A 3LNMB 1F23A 4DR3O 1XREA 4NXMB 2R9RB 3FX7A 1QLEB 2FYUH 4O2AA 2X0LA 3KCYA 3SJQC 4LFBO 3ZRXA 1JA8A 4DR5O 1QLEC 2CK3G 3ML0A 4HYOA 1PP9H 3QNEA 5BMVB 2GTAA 5JJEB 1ENVA 2PY5A 4R7CA 1OCRC 4DRXA 1SETA 5EC1C 3CXCU 1ZL8A 2QEXV 3HKEA 3QG5A 1MZEA 3F5TA 4LF5O 4HNAA 2PUSA 3JALB 3SPJA 1VQKV 4JYAO 2ZT9B 3A2FA 1SRYA 1V54B 1MZFA 4GZRB 2EINC 2CTQA 2ITDC 4UCVA 5J2UA 1J95A 2YI8A 5EZYB 1AI6A 4JYYA 2AHZA 3DXRA 4X66O 2Y69B 3BA9A 3DC6A 4TWKA 3IC7A 3SPHA 2DQ0A 2WLIB 1S0VA 2N05A 3VOUA 2AXTZ 4JAAA 1S77D 3BPZA 5LMNO 1JMKC 2LFRA 3X2QC 3JARA 3OAAG 1N33O 3M8AA 5CN0A 4W4KA 1EBOA 1VEWA 2YEVB 1QR9A 4DV6B 2D3OW 2XOKG 2UUCO 2RQ6A 3TGUH 1R6NA 1B04A 2LFSA 1SQPH 2HVKC 2VQEB 4UB8Z 2XAGA 3RYHB 2ZXWB 1W0JG 3F7VC 2XUMA 4LFCB 2X6AA 1VF6C 1YJNV 2WLLB 3CC4V 2PI4A 2CH7B 3I55V 2EBOA 3GB7C 1YI2V 5KMGB 4JI8O 5H6QA 4LF6B 4UCTA 4Z2WA 3STZC 4LFAB 3JAWB 4DK1A 4UCRA 2C2AA 3U11A 3TXQA 3H01A 4JI0B 3BABA 3DTUB 1PKXA 5B1OA 1VQ6V 2A3QA 4O4IA 1SQVH 4J7ZA 2DYSC 4GX2A 4O4LA 4MVSA 1R73A 2E5LO 5H6RA 4YY3O 3ZCCA 1N33B 4PA3A 1AR1B 3ETGA 4OPHA 1NBMG 1QLNA 1PL4A 1SZXA 4YY3B 4IGGA 3K57A 2F4VB 1NTKH 1Q6IA 5IYBO 4IIJB 4DR3B 4H13B 3QF7A 1FFTB 3D3QA 1H2NA 2BSKA 4KHPO 5L3CA 1JQ0A 4CC5A 4JZ2A 1K33A 2EX3A 1KKDA 1Q6HA 4NXMO 4EB6A 1PL0A 2W0FC 3D8CA 4PHZA 1SKVA 3ABMC 1UJWB 2AGAA 1NS1A 5EZYA 1NVPB 5E79Z 4LF5B 2F1MA 2IM9A 4MTFA 1KU9A 2ZCEA 1EM1A 3ZMVA 4MS2A 2P67A 1BSMA 1NQTA 4NVPA 4CH4A 2QTSA 3IGAC 3U0ZA 4FFKA 3K5MA 4HNAB 4DO2A 1SA0A 3ICXA 3UT5B 1YCIA 1D5AA 3AK1A 1FXKA 1JJOA 1SQFA 4I9WA 2ETNA 5JVDB 2GDSA 4JI1B 5LL6Y 2X7RB 5IJ0B 1H8HG 1L8DA 5LYJB 1XMQB 5BR8O 3H1LH 1BS3A 2OCCB 1VF5B 3RYFB 2E74B 3NXSA 4H37A 4L8JA 1V9PA 3ZS8C 4X9QA 2CGNA 2OCHA 2JVDA 4J10A 1SERA 1AP5A 4CBCA 4FZ0A 4C7UA 1QNMA 3K5OA 1QBZA 4PDMA 1I7FA 4JI6O 4X66B 4I4TB 1OJHA 2DYRC 3N2GA 4QPJA 2Y0IA 4GUNA 2F23A 3SYOA 4DR6B 4PJ0Z 1OV9A 1WB7A 2YDEA 4DV2O 3K0GA 1AI7A 1XILA 4DK0A 1DK1A 1QVFU 3SJCC 3G6EV 1AI4A 4Q6GA 3CP1A 4LR3A 4QE7A 4GX0A 1EN6A 1IXBA 3LNNA 1K8AW 2VS0A 4PA4A 3FB8C 1EZJA 3ZMZA 3WB1A 1GN2A 5HFMA 2Y4UA 3THOA 4J9ZB 4JI0O 3HPLC 4LF7O 1RSOA 1GK9A 1P49A 4I55A 5B1BC 4LFBB 1AR5A 5LBQA 2LW7A 4PDRA 3WG7B 1E1QG 3K79A 1J5EB 2IJIA 1MG1A 4X20B 1FXKC 2VRZA 4K35A 1AJQA 1TVKA 3ETQA 5LGTA 3CCRV 1YITV 1QQCA 3JSLA 4JF3A 1L1FA 2YIDA 1P7BA 4Z1VA 1Y4MA 4FLZA 1GM7A 1SQBH 4CS3A 5LOVA 2OIGA 3ZMTA 3JCZA 1S76D 5HFLA 3MAQA 2WLKA 2F66C 1LUWA 1JR9A 4DV6O 3RYCA 4TOIA 3CCSV 5BR8B 1WAZA 3O9OA 4CC6A 5IJ0A 3KZIZ 2ARHA 4TUYA 1G8MA 4ZHQA 4B3MB 3LUTB 2MK3A 4JYBA 3OMNB 2Q69A 2FKXA 5KUMA 3RVYA 1SA0B 1I94B 1H2LA 1WB8A 5FPRA 2B1IA 1FJGO 3SYCA 1AJPA 4DV4O 1E79G 2ZE5A 4DUYB 3APOA 2R72A 4WFEA 2CE4A 3VQVA 2WLNA 2ILMA 3P32A 1SQXH 2HLDG 2JDIG 1L0LH 2QKCA 3OGCC 1LR1A 4X89A 3R65A 1FS0G 5JQGA 2Y48A 2YIBD 3T1YB 2UUBO 3ZEDA 4L87A 2K1EA 1WNSA 4GKJO 1Q8IA 4JI5O 1AP6A 4WFHA 5LMUO 5L3GA 4Z1MG 1THZA 1FYJA 2HR3A 1KD1W 1HNZB 3BAAA 3B77A 2ITCC 1B3QA 3BFRA 2GUZB 5BXZA 1NU1H 1BHAA 3TCUA 4BIOA 2A06H 1YVWA 1H2MA 3LSQA 4AI8A 2B1GA 1R3LC 1WA8A 2AZ0A 2QE7G 4WFAV 1IURA 2HJFC 2R70A 2A0LA 4O4JB 3EFFK 2PZSA 3JD3A 2P6JA 5KMGA 5JJNB 4J41A 2UXCO 1DF5A 4OX9O 4FLTA 3J81N 3SJBC 5IDJA 5D5QA 1R6KA 1ORQC 4B3TO 1AVMA 4FLWA 4QGPA 1HR0B 4TUYB 1SQGA 5EC2C 5JVDA 4DUZO 1TUBB 2L35A 1FXKB 3K58A 1B6QA 2UUAO 1VP7A 2YXYA 2YEVA 1ZX3A 2OWOA 5L3EA 4RUFA 1E1RG 4B3RB 1CXZB 1N0NA 1O9GA 1HNXO 2EIKC 1HDJA 3OT7A 1G1XB 3ABKC 4JTAB 1KP2A 1U97A 5GW7A 1IX9A 1H2GA 2IJKA 3QO7A 2QSAA 2ZNIA 3P3PA 1SESA 3ABLB 2UXDO 5IY5C 4YHHB 4UV9A 1VQLV 2OTLV 3HR0A 3AG4C 3OE7G 2UXBO 2QWRB 5KX5B 3ZRVA 1GH6A 3OUSA 4X1YA 2JGUA 4JASA 1WJZA 2A7WA 2X6CA 4LWSA 4NB5A 3JALA 1OZ0A 4DV5O 2QM4A 4GLXA 1IBLB 3P3NA 2DE0X 3EHBB 2JS5A 1XDCA 3H1IH 3K9SA 5JH7A 4DR2O 2DJVA 2B5UA 1YSCA 2ZM6O 4RAIA 2QTOA 5JJJB 2PYJA 2PYLA 4X1KA 1CP9A 1NT2B 1M90W 4IT5A 5CA0A 2GSMB 1EN4A 2GBOA 4J80A 1N32B 4NR1A 3CD6V 3FYIB 5K1PA 1N4CA 3OEEG 2CUGA 4TV9A 2EJRA 1K97A 5H5NA 3T1HB 4K0KB 5B3SB 3CRMA 4JI5B 3RW0A 3K04A 1F4NA 2LW1A 1W2BU 3RYFA 3RYHA 5LYJA 2HEPA 4FLYA 4G2KA 1HNWO 1OCCC 2DN9A 2DWDC 2PTMA 1HWYA 2KG7A 3SYAA 4LH7A 5KHJA 4I50B 2RJZA 3OTOO 2WSSG 2UU9B 2UXNA 2YIAA 3HKBB 2BE3A 4GX5A 4OX9B 1NJIW 1WPBA 2P7TC 2YICA 4TT3G 3B09A 3OMIB 3AG1B 3OTFA 1SC5B 3ZIAG 2RNBA 2X6BA 1ZTEA 4B3MO 5KHHA 2XASA 3AG3B 4CS4A 2Y4TA 3L70H 4J7KA 5IWAO 5IJ9B 2UUCB 3SPGA 5J2UB 3ZHSA 1XBLA 2YSUB 1K4CC 1XMQO 1BQZA 1SS3A 2WWWA 1GN3A 1Q6UA 2ZKOA 2QM8A 1K5QA 1Q3EA 4TV8A 4EKWA 2WAMA 2Q68A 2W0XA 3JAKB 4LH6A 3APQA 4DV0B 1ZL8B 1I5XA 2ZXWC 3MHHC 2EULA 3UCSC 1HR0O 4WFBV 2Q67A 3CRCA 3UO2A 5BZBA 4P2ZA 4O2BB 5CA1A 4MVRA 2QWNB 3N2GB 5IYDO 1PV0A 3E2EA 4UVCA 1LUVA 3JAWA 4KL1A 4BR6A 4WFFA 1FFXA 2YC0A 4JV5B 3KG2A 3G4SV 2QKSA 3OUFA 5EBMC 2ZE8A 5LP6C 1WN7A 5KAIZ 5DN6G 2XT9A 4O4HA 3CCVV 1GM8A 3E22A 4X62O 1EN5A 3N27A 3LDDA 1R3JC 3VQWA 4NXNO 3MHSC 4QIWF 1ROPA 1XOUA 5B1AB 2FL4A 4MW3A 4AHCA 4B3RO 3CC2V 1DGSA 1BGYH 3E8FA 4B3SO 2IJJA 1KB9F 3CEIA 1EFRG 3ZRSA 3H9VA 5LP6A 4J9YB 3OEHG 3TJTA 2QWOB 4QNHB 4XDJA 4YJ3A 5DECA 2NR5A 4FFBA 1IZ3A 4BIUA 5LXTB 3T4ZA 3KCXA 2ZR2A 4DUZB 2JJ2G 1AILA 4CH6A 4XBFA 4D6TH 4I0XB 1RPRA 1F7YA 4BIZA 1OCCB 1ZWIC 5LA6A 3RGBA 2JEXA 3Q4HA 1G4YB 4PD4F 4X65O 2EIMB 3WU2Z 1K3EA 4PA6A 4A5UB 3JASB 3UT5A 1YIJV 1PNKA 5CB4A 4PI0A 3C3TA 1VARA 5DM6V 3UKMA 2QGNA 4JAVA 1S72V 5DEDA 2CTPA 2KB1A 4G28B 4DXWA 4UCUA 1OCOB 2XAFA 4O4IB 1COWG 2BTQB 3TXSA 1R6TA 1M9NA 4X1IA 2CGOA 5LGNA 4FK5C 1JFFB 3H1HH 1M57C 3OM3B 2GUZA 4PELA 5H2FZ 2GV9A 1P84F 4PDVA 4WF9V 1HP8A 1NTMH 4BAYA 4DV1O 4PV1B 4RQFA 3OGIB 4ZI7A 2DYSB 4O4JA 2E3CA 1Q82W 1JFFA 1NTZH 1Q86W 1ZUQA 1K4DC 1Q81W 5IYZB 1YTFD 1KBHA 4J7JA 3I56V 2BOBC 2M6YA 1WLEA 1MSWD 5KAFZ 1N0JA 4D7SA 4LBEC 4X8AA 1XL4A 3AG4B 1VQ8V 3ABMB 3JCUZ 4X64O 1JPXA 3OR6C 4TV8B 3CMAV 2WA3A 3ZBHA 3OTOB 1X4TA 3S3WA 1RM1B 2CH7A 5EBWC 4X88A 4P9PA 3ABUA 2WLIA 4JI6B 3ZN1A 1TGOA 3J7AU 4RO2A 1XL6A 1K7DA 5AG2A 3SJAC 1KKCA 4ZOLB 5FNVB 1BQ0A 1B06A 3K06A 3G6BA 4K8ZA 3BVOA 1I08A 2DMXA 5KA5A 5CBHA 3CE2A 5KHKA 1P4RA 2WLHA 3HKCA 3RT3C 2V1DA 4JI4B 3RYIA 4JI1O 4J42A 1OCOC 5FLXN 1N36B 3B2EE 1AI5A 2XAQA 5FPOA 4K8XA 4YJ2A 1YJ9V 3IFXA 2XTAA 2ZD9A 4ASUG 3ASNB 2LJ2A 4RQEA 4GX1A 2L6LA 2LGWA 3ASNC 1GTOA 2OYQA 2F95B 2JK5C 3CCJV 4B7KA 2QDOA 5JCOA 4LP8A 4UFZA 1IVSA 1PPJH 2UU9O 1FFXB 4DV2B 1KUQA 2AHYA 1ZSPA 2DWEC 2QWPB 2JEUA 2R9IA 3HKDB 3S3XA 4MW8A 2UXDB 1Q43A 3FB6C 3PN1A 4NTWA 3RVZA 1L0NH 1JCHA 1NKDA 4JZGA 2IH3C 1S5JA 3W7UA 2DQ3A 4PA9A 1AROP 5E1AC 1GKFA 3QO8A 4I4TA 5GTIZ 4TQFA 4NXNB 1NH2B 3RWRD 3AG3C 2AZ2A 4X62B 3K0DA 3DGEA 3UQ8A 2ZINA 4X1YB 3F7YC 2CDYA 5KX5A 2QM7A 2Q73A 2EINB 2XNDG 2Q6AA 4JTCB 3OD4A 3E8HA 5A9GA 4JI4O 3GWKC 2EIJC 3PJSK 1DLBA 3O65A 4P9OA 1QR8A 4MT8A 4RUEA 5EBLC 1CPYA 1K34A 3T4DA 3GWOA 5IYCO 3AG1C 3HKBA 2BOCC 2GHYA 2V4DA 4LNUB 4KUMA 1OHHG 3D3IA 4H0LB 1KP3A 4JI7B 4X64B 2F43G 2IJHA 3SGIA 5LHGA 3SYQA 1YHQV 4AQYO 3L74H 3OFNG 5L3FA 2LQTA 3CJHA 2P4VA 4EEQA 4UCOA 1OCZC 3WB2A 1IBKB 2YXLA 4OPAA 1MA1A 1S3JA 4E4EA 3E83A 5KA6A 2HHHB 1RPOA 4YXWG 3CPWU 5EIBD 1JJ2U 1T5EA 2JS3A 4W4LA 3T1CA 4LCUC 1BCCH 2IBZH 1VF7A 2CTRA 3ETDA 4FM1A 4UVAA 3QVNA 2HP8A 1K9MW 4MSWC 4X1KB 3ZJZA 1PNMA 2Q0AA 4LF6O 1FAFA 2ADPA 2RDCA 4JYCA 4WBNA 3AG7A 4N23A 4LFAO 3P30A 1NH2D 4LF8O 1MSDA 2D2CB 3CCQV 3ZHUA 1G6UA 2O57A 3AK2A 4BW9A 3CSXA 2DYRB 4PA7A 4IIJA 4UVBA 3UO3A 3M99B 2DOSA 2WA4A 1J5EO 2YXHA 2Z0AA 3FAVA 1YEWA 1CEZA 1F4MA 2YIBA 1NZ6A 5L3DA 3E35A 5JQGB 4BWAA 1VF6A 4LF4B 4GYCB 1NVPD 4JAUA 2VQEO 1WP7A 1VIBA 2OCCC 1BZKA 5JH7B 1H2KA 2OT5A 1MOFA 4MVZA 3CYOA 4FIPC 3W7WA 3LDEA 5B1BB 4CS2A 3CXHF 4ZI7B 1SZTA 1I5YA 1RP3B 3RBZA 5LMNB 3JARB 1VQ4V 5LHHA 3JASA 4EFBA 4GCZA 1XHXA 3SYPA 4IYIA 2UUAB 1XMOO 4JGSA 2FB5A 5FNVA 4ZHQB 1QVGU 1R3IC 1XNQB 1TUBA 1NR1A 3Q4HB 2NNUA 3H1KH 5BY1A 1VQNV 5ITZB 4ZKIA 1IBMO 2Z5UA 3RYCB 2F4VO 4YJ2B 1DF4A 4TSFG 2Q9LA 2NN4A 2VWKA 5GONA 3FYEB 3ABLC 3W7TA 4XDKA 4B08A 1GO3F 4ABMA 3JAMN 2H3OA 4I5SA 1EZVH 1DTOA 1VQMV 2YUAA 3D36C 1HNXB 3HKEB 2P5OA 1KYOF 1M1KW 4D7TA 1VQ9V 4U3JA 2FTKA 3L9DA 3ZHQA 4AILC 2ZIMA 1Z5WA 5KLVH 5IYZA 1MABG 5CBGA 1H38A 2ZDIC 2P06A 1V54C 3ZHRA 1XQ8A 4GT1A 3R66A 2P22C 4DW1A 1IBLO 1XEQA 4H44B 2Y69C 5IE9A 3TETA 4FJCC 3CCEV 2PF4E 3OW2U 3LSSA 3ABKB 2B9ZA 3WB0A 4KP4A 1JOYA 4NYKA 3A0RA 3ZHVA 2N74A 4O2BA 5CA1B 3CC7V 1US6A 3JYCA 4IHJA 3ZMUA 3X2QB 4HAMA 1URFA 4NTXA 1X59A 1VQ7V 4LF7B 4R6ZA 2XAJA 5D5PA 3UM7A 4UUJC 4MTGA 1YXBA 5B3SC 4O4HB 3FAVB 1YTFB 4NTYA 1S5HC 1F51A 4ZBMA 3AK3A 4NKGB 3AEIA 4GKJB 3B40A 2Z3YA 3L72H 1IBMB 3A0BZ 4MVMA 4U3JB 3STLC 4UV8A 1N8RW 4KHPB 3ETEA 2QKAA 4FFBB 1GMGA 5C93A 2Q7EA 3F5WC 3B8NA 4B3TB 2XHBA 4YIPA 1MNGA 2V7QG 3L73H 5EK0A 4JI2B 2ZDIA 2EJ7A 1UPGA 2P90A 3K9AA 3ASOC 4Q20A 3DC5A 3E86A 3VQXA 1VQPV 2Q7GA 1NR7A 5IJ9A 2RCVA 2ZR3A 1OCRB 2ZNJA 1M5IA 2FMLA 4DR4O 3HB3B 4DR1B 4E2LA 2ATKC 2EIJB 4EB6B 3C3SA 1R3KC 3JD4A 1FPOA 2ZE7A 3GVMA 2Q7HA 4DR4B 4TV9B 3CCUV 4YJ3B 4JV5O 3L71H 5J9PC 3VBBA 3ZRWA 2JGDB 1BE3H 1XNRO 1TVKB 3RN4A 2JRIA 2G38A 5LMUB 5H9CA 2IW5A 2UXBB 1PD3A 5BMVA 4GKKB 2HG5C 2Q5ZA 3AG2B 5EIBC 2HFEC 1U96A 2A79B 2ZQMA 4IHJB 1FKAO 4EFEA 4DR6O 3KKYA 2LO1A 2ZIOA 2LGQA 3JD0A 3AG2C 4JI3O 2OTJV 4I55B 2EILC 2XAHA 1RSOB 2HJDA 3JAKA 4DYLA 1Y6XA 3W7XA 4BW5A 1KQSU 1S5LZ 3FB5C 2HKOA 3EXAA 2YI9A 4DR7O 4DR7B 3MD0A 3K5LA 3K08A 4U3FH 2F93B 5TISZ 1K92A 5IT9N 3B4SA 3FFQA 2QJ1A 5IY5B 3T2MA 5CA3A 4ICGA 2WLMA 5JCOC 3CCLV 4DR2B 4WFGA 1WP8A 4I9QA 1M57B 4PI2A 1XNQO 3M7MX 4JI7O 3SR2C 3E8BA 3RYIB 3ABTA 1XMOB 3NR7A 2CTWA 3HKCB 5EYPB 3JSNA 1YDXA 4JYAB 4UB6Z 4K0KO 3CRAA 1HNWB 2LP7A 3FKSG 2QWQB 4LF9O 3SPCA 4ZOLA 1P7GA 3N2KB 5J2TA 1Y76A 5CMUA 3RFRA 2KSDA 5ITZA 1WPXA 2R9AA 2WPDG 1M56C 1LNQA 3DXRB 2HVJC 4YHHO 4FLUA 2Y0PA 2Q4PA 5K1XA 1Z2GA 1FXVA 4IYHA 1BHBA 1TUEB 2VWJA 4P30A 4R50A 5IWAB 2KG7B 4MTOA 4O4LB 2KQXA 2VQFO 1YF2A 1K73W 4DRXB 3LSUA 1QHTA 3BA8A 2WLJA 1XI1A 2P4KA 1Y67A 1K5SA 2UXXA 4JI3B 2UUBB 1KC8W 4G27B 4FZ1A 4DV1B 4DUYO 4JI8B 1N34B 1N34O 2A9HA 3IJ4A 4LWSB 1W59A 5KHGA 4FLXA 1XNRB 1BMFG 3E8GA 1H8EG 3DSQA 4JPRA 2WLLA 2BCCH 4TQDA 3BRCA 3CX5F 3MDSA 1BT8A 3CRRA 3T1HO 3TK1A 3G67A 1D2DA 3K3WA 2UXCB 2ADQB 2E5LB 4FLVA 2BTQA 1O9HA 2M7WA 4DR5B 3D36A 1SQQH 4HBNA 1SF9A 2QA4V 2ZE6A 3OR7C 4MTXA 3ZMSA 4KXRA 4B7EA 1Y66A 1HNZO 4LF4O 4IL6Z 5CB4B 4XDLA 5B1AC 4X65B 4PDLA 1GN4A 4CH3A 5B5EZ 2H94A 3BHPA 4MVUA 3CMEV 4JI2O 2DW4A 1Q5OA 3SDLA 4X1IB 5CBFA 1Y76B 5J2TB 2E75B 1M56B 3B8MA 4I0XA 4YIOA 2PI5A 1PNLA 2MW2B 2QR4A 1ZAUA 1GAXA 1V55B 2ODMA 1Z5VA 4U7NA 1MMMA 5L3BA 3CB2A 4KFMA 4K3AA 4F6RA 4RWUA 3EVKA 1FJGB 1JVMA 1KMIZ 5GONB 3BCCH 2IH1C 4DR1O 4DV7B 1ZLZA 2K9PA 3G71V 3I5DA 1UFIA 1H2SB 5C8YB 5LHIA 4LC1A 1AR4A 5GTHZ 2E76B 5LA6B 2OIEA 4CH5A 4QJFB 3N2KA 4FM2A 4QPKA 1I0HA 1IBKO 3T1YO 3ZN0A 2PGGA 5FL7G 4O2AB 4ZIBA 1VQOV 5LOVB 2IU0A 4AQYB 2BTOA 5KHIA 1XHZA 4DV3O 4GKKO 5LP6B 5LGUA 1WA8B 1YJWV 4I7ZB 4MVQA 3ASOB 4X20A 1XUQA 3A0HZ 3LDCA 3JD2A 3E89A 3ZX6A 5JWPA 1GRJA 3J80N 3SPIA 1D5NA 4OXSA 4LFCO 3CHXA 3VQYA 3QTCA 1N32O 2JIZG 2EIMC 3E22B 4DW0A 1I94O 2AW9A 3ZHTA 2JGDA 1OCZB 5B66Z 1AB3A 1HW7A 1M4UA 2Q0OC 1R1BA 4FMTA 3CCMV 3BEHA 2ZM6B 3H1JH 1N36O 3A8TA 1TAEA 2GTSA 3QO5A 4UCSA 4H33A 4R8CA 4LF9B 4N21A 4J11A 3OMAB 3CS5A 4WBNB 2H8PC 1A32A 3FB7C 3W7SA 4F4LA 2IU3A 1KECA 5C8YA 1RM1C 1V55C 2NLJC 3JATA 3K5NA 1Y74B 1PM9A 4OGQB 3IAYA 3ZRWB 1FD9A 3WG7C 4JTDB 4FM0A 2CAZC 2N04A 4FPPA 4F6RB 5B1NA 1TA8A 1Y74A 4WCEV 3JATB 1IDSA 3C90A 4B3SB 1W0KG 2EIKB 2EZOA 4FVMA 2VQFB 4UXNA 1VMGA 1BL8A 4DV4B 3CJHB 2HHHO 1QCEA 1QU7A 1M93A 3K03A 1JX9A 5LXTA 2RMKB 1GM9A
chains in the Genus database with same CATH topology
5H2FZ 1S5LZ 4IL6Z 3A0HZ 4UB8Z 5E79Z 5KAIZ 3JCUZ 5GTHZ 3A0BZ 5TISZ 3WU2Z 5B5EZ 5GTIZ 4UB6Z 3KZIZ 5KAFZ 2AXTZ 4PJ0Z 5B66Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F Z;  1S5L Z;  4IL6 Z;  3A0H Z;  4UB8 Z;  5E79 Z;  5KAI Z;  3JCU Z;  5GTH Z;  3A0B Z;  5TIS Z;  3WU2 Z;  5B5E Z;  5GTI Z;  4UB6 Z;  3KZI Z;  5KAF Z;  2AXT Z;  4PJ0 Z;  5B66 Z; 
#chains in the Genus database with same CATH topology
 4DV7 O;  5EYP A;  1GN6 A;  4LNU A;  3IC9 A;  3G80 A;  3WFV A;  5CA0 B;  2JJ1 G;  4I50 A;  2W6I G;  4F6E A;  1Q90 D;  2W6J G;  2Q8V A;  2EIL B;  3CWB H;  3U10 A;  2RN9 A;  5A2Q N;  4MVO A;  4QE9 A;  3K59 A;  1VQ5 V;  2EZP A;  1FXH A;  3HKD A;  4DV5 B;  3JD1 A;  4LF8 B;  3L75 H;  1AJN A;  4CZZ A;  5KUK A;  1YZB A;  4U7O A;  1IXM A;  2YS8 A;  2BSK B;  3CRQ A;  3FD9 A;  3BY6 A;  4HZ3 A;  4DV3 B;  4DV0 O;  5F2V O;  1Q7Y W;  2KKW A;  1RFY A;  1NI8 A;  3LNM B;  1F23 A;  4DR3 O;  1XRE A;  4NXM B;  2R9R B;  3FX7 A;  1QLE B;  2FYU H;  4O2A A;  2X0L A;  3KCY A;  3SJQ C;  4LFB O;  3ZRX A;  1JA8 A;  4DR5 O;  1QLE C;  2CK3 G;  3ML0 A;  4HYO A;  1PP9 H;  3QNE A;  5BMV B;  2GTA A;  5JJE B;  1ENV A;  2PY5 A;  4R7C A;  1OCR C;  4DRX A;  1SET A;  5EC1 C;  3CXC U;  1ZL8 A;  2QEX V;  3HKE A;  3QG5 A;  1MZE A;  3F5T A;  4LF5 O;  4HNA A;  2PUS A;  3JAL B;  3SPJ A;  1VQK V;  4JYA O;  2ZT9 B;  3A2F A;  1SRY A;  1V54 B;  1MZF A;  4GZR B;  2EIN C;  2CTQ A;  2ITD C;  4UCV A;  5J2U A;  1J95 A;  2YI8 A;  5EZY B;  1AI6 A;  4JYY A;  2AHZ A;  3DXR A;  4X66 O;  2Y69 B;  3BA9 A;  3DC6 A;  4TWK A;  3IC7 A;  3SPH A;  2DQ0 A;  2WLI B;  1S0V A;  2N05 A;  3VOU A;  2AXT Z;  4JAA A;  1S77 D;  3BPZ A;  5LMN O;  1JMK C;  2LFR A;  3X2Q C;  3JAR A;  3OAA G;  1N33 O;  3M8A A;  5CN0 A;  4W4K A;  1EBO A;  1VEW A;  2YEV B;  1QR9 A;  4DV6 B;  2D3O W;  2XOK G;  2UUC O;  2RQ6 A;  3TGU H;  1R6N A;  1B04 A;  2LFS A;  1SQP H;  2HVK C;  2VQE B;  4UB8 Z;  2XAG A;  3RYH B;  2ZXW B;  1W0J G;  3F7V C;  2XUM A;  4LFC B;  2X6A A;  1VF6 C;  1YJN V;  2WLL B;  3CC4 V;  2PI4 A;  2CH7 B;  3I55 V;  2EBO A;  3GB7 C;  1YI2 V;  5KMG B;  4JI8 O;  5H6Q A;  4LF6 B;  4UCT A;  4Z2W A;  3STZ C;  4LFA B;  3JAW B;  4DK1 A;  4UCR A;  2C2A A;  3U11 A;  3TXQ A;  3H01 A;  4JI0 B;  3BAB A;  3DTU B;  1PKX A;  5B1O A;  1VQ6 V;  2A3Q A;  4O4I A;  1SQV H;  4J7Z A;  2DYS C;  4GX2 A;  4O4L A;  4MVS A;  1R73 A;  2E5L O;  5H6R A;  4YY3 O;  3ZCC A;  1N33 B;  4PA3 A;  1AR1 B;  3ETG A;  4OPH A;  1NBM G;  1QLN A;  1PL4 A;  1SZX A;  4YY3 B;  4IGG A;  3K57 A;  2F4V B;  1NTK H;  1Q6I A;  5IYB O;  4IIJ B;  4DR3 B;  4H13 B;  3QF7 A;  1FFT B;  3D3Q A;  1H2N A;  2BSK A;  4KHP O;  5L3C A;  1JQ0 A;  4CC5 A;  4JZ2 A;  1K33 A;  2EX3 A;  1KKD A;  1Q6H A;  4NXM O;  4EB6 A;  1PL0 A;  2W0F C;  3D8C A;  4PHZ A;  1SKV A;  3ABM C;  1UJW B;  2AGA A;  1NS1 A;  5EZY A;  1NVP B;  5E79 Z;  4LF5 B;  2F1M A;  2IM9 A;  4MTF A;  1KU9 A;  2ZCE A;  1EM1 A;  3ZMV A;  4MS2 A;  2P67 A;  1BSM A;  1NQT A;  4NVP A;  4CH4 A;  2QTS A;  3IGA C;  3U0Z A;  4FFK A;  3K5M A;  4HNA B;  4DO2 A;  1SA0 A;  3ICX A;  3UT5 B;  1YCI A;  1D5A A;  3AK1 A;  1FXK A;  1JJO A;  1SQF A;  4I9W A;  2ETN A;  5JVD B;  2GDS A;  4JI1 B;  5LL6 Y;  2X7R B;  5IJ0 B;  1H8H G;  1L8D A;  5LYJ B;  1XMQ B;  5BR8 O;  3H1L H;  1BS3 A;  2OCC B;  1VF5 B;  3RYF B;  2E74 B;  3NXS A;  4H37 A;  4L8J A;  1V9P A;  3ZS8 C;  4X9Q A;  2CGN A;  2OCH A;  2JVD A;  4J10 A;  1SER A;  1AP5 A;  4CBC A;  4FZ0 A;  4C7U A;  1QNM A;  3K5O A;  1QBZ A;  4PDM A;  1I7F A;  4JI6 O;  4X66 B;  4I4T B;  1OJH A;  2DYR C;  3N2G A;  4QPJ A;  2Y0I A;  4GUN A;  2F23 A;  3SYO A;  4DR6 B;  4PJ0 Z;  1OV9 A;  1WB7 A;  2YDE A;  4DV2 O;  3K0G A;  1AI7 A;  1XIL A;  4DK0 A;  1DK1 A;  1QVF U;  3SJC C;  3G6E V;  1AI4 A;  4Q6G A;  3CP1 A;  4LR3 A;  4QE7 A;  4GX0 A;  1EN6 A;  1IXB A;  3LNN A;  1K8A W;  2VS0 A;  4PA4 A;  3FB8 C;  1EZJ A;  3ZMZ A;  3WB1 A;  1GN2 A;  5HFM A;  2Y4U A;  3THO A;  4J9Z B;  4JI0 O;  3HPL C;  4LF7 O;  1RSO A;  1GK9 A;  1P49 A;  4I55 A;  5B1B C;  4LFB B;  1AR5 A;  5LBQ A;  2LW7 A;  4PDR A;  3WG7 B;  1E1Q G;  3K79 A;  1J5E B;  2IJI A;  1MG1 A;  4X20 B;  1FXK C;  2VRZ A;  4K35 A;  1AJQ A;  1TVK A;  3ETQ A;  5LGT A;  3CCR V;  1YIT V;  1QQC A;  3JSL A;  4JF3 A;  1L1F A;  2YID A;  1P7B A;  4Z1V A;  1Y4M A;  4FLZ A;  1GM7 A;  1SQB H;  4CS3 A;  5LOV A;  2OIG A;  3ZMT A;  3JCZ A;  1S76 D;  5HFL A;  3MAQ A;  2WLK A;  2F66 C;  1LUW A;  1JR9 A;  4DV6 O;  3RYC A;  4TOI A;  3CCS V;  5BR8 B;  1WAZ A;  3O9O A;  4CC6 A;  5IJ0 A;  3KZI Z;  2ARH A;  4TUY A;  1G8M A;  4ZHQ A;  4B3M B;  3LUT B;  2MK3 A;  4JYB A;  3OMN B;  2Q69 A;  2FKX A;  5KUM A;  3RVY A;  1SA0 B;  1I94 B;  1H2L A;  1WB8 A;  5FPR A;  2B1I A;  1FJG O;  3SYC A;  1AJP A;  4DV4 O;  1E79 G;  2ZE5 A;  4DUY B;  3APO A;  2R72 A;  4WFE A;  2CE4 A;  3VQV A;  2WLN A;  2ILM A;  3P32 A;  1SQX H;  2HLD G;  2JDI G;  1L0L H;  2QKC A;  3OGC C;  1LR1 A;  4X89 A;  3R65 A;  1FS0 G;  5JQG A;  2Y48 A;  2YIB D;  3T1Y B;  2UUB O;  3ZED A;  4L87 A;  2K1E A;  1WNS A;  4GKJ O;  1Q8I A;  4JI5 O;  1AP6 A;  4WFH A;  5LMU O;  5L3G A;  4Z1M G;  1THZ A;  1FYJ A;  2HR3 A;  1KD1 W;  1HNZ B;  3BAA A;  3B77 A;  2ITC C;  1B3Q A;  3BFR A;  2GUZ B;  5BXZ A;  1NU1 H;  1BHA A;  3TCU A;  4BIO A;  2A06 H;  1YVW A;  1H2M A;  3LSQ A;  4AI8 A;  2B1G A;  1R3L C;  1WA8 A;  2AZ0 A;  2QE7 G;  4WFA V;  1IUR A;  2HJF C;  2R70 A;  2A0L A;  4O4J B;  3EFF K;  2PZS A;  3JD3 A;  2P6J A;  5KMG A;  5JJN B;  4J41 A;  2UXC O;  1DF5 A;  4OX9 O;  4FLT A;  3J81 N;  3SJB C;  5IDJ A;  5D5Q A;  1R6K A;  1ORQ C;  4B3T O;  1AVM A;  4FLW A;  4QGP A;  1HR0 B;  4TUY B;  1SQG A;  5EC2 C;  5JVD A;  4DUZ O;  1TUB B;  2L35 A;  1FXK B;  3K58 A;  1B6Q A;  2UUA O;  1VP7 A;  2YXY A;  2YEV A;  1ZX3 A;  2OWO A;  5L3E A;  4RUF A;  1E1R G;  4B3R B;  1CXZ B;  1N0N A;  1O9G A;  1HNX O;  2EIK C;  1HDJ A;  3OT7 A;  1G1X B;  3ABK C;  4JTA B;  1KP2 A;  1U97 A;  5GW7 A;  1IX9 A;  1H2G A;  2IJK A;  3QO7 A;  2QSA A;  2ZNI A;  3P3P A;  1SES A;  3ABL B;  2UXD O;  5IY5 C;  4YHH B;  4UV9 A;  1VQL V;  2OTL V;  3HR0 A;  3AG4 C;  3OE7 G;  2UXB O;  2QWR B;  5KX5 B;  3ZRV A;  1GH6 A;  3OUS A;  4X1Y A;  2JGU A;  4JAS A;  1WJZ A;  2A7W A;  2X6C A;  4LWS A;  4NB5 A;  3JAL A;  1OZ0 A;  4DV5 O;  2QM4 A;  4GLX A;  1IBL B;  3P3N A;  2DE0 X;  3EHB B;  2JS5 A;  1XDC A;  3H1I H;  3K9S A;  5JH7 A;  4DR2 O;  2DJV A;  2B5U A;  1YSC A;  2ZM6 O;  4RAI A;  2QTO A;  5JJJ B;  2PYJ A;  2PYL A;  4X1K A;  1CP9 A;  1NT2 B;  1M90 W;  4IT5 A;  5CA0 A;  2GSM B;  1EN4 A;  2GBO A;  4J80 A;  1N32 B;  4NR1 A;  3CD6 V;  3FYI B;  5K1P A;  1N4C A;  3OEE G;  2CUG A;  4TV9 A;  2EJR A;  1K97 A;  5H5N A;  3T1H B;  4K0K B;  5B3S B;  3CRM A;  4JI5 B;  3RW0 A;  3K04 A;  1F4N A;  2LW1 A;  1W2B U;  3RYF A;  3RYH A;  5LYJ A;  2HEP A;  4FLY A;  4G2K A;  1HNW O;  1OCC C;  2DN9 A;  2DWD C;  2PTM A;  1HWY A;  2KG7 A;  3SYA A;  4LH7 A;  5KHJ A;  4I50 B;  2RJZ A;  3OTO O;  2WSS G;  2UU9 B;  2UXN A;  2YIA A;  3HKB B;  2BE3 A;  4GX5 A;  4OX9 B;  1NJI W;  1WPB A;  2P7T C;  2YIC A;  4TT3 G;  3B09 A;  3OMI B;  3AG1 B;  3OTF A;  1SC5 B;  3ZIA G;  2RNB A;  2X6B A;  1ZTE A;  4B3M O;  5KHH A;  2XAS A;  3AG3 B;  4CS4 A;  2Y4T A;  3L70 H;  4J7K A;  5IWA O;  5IJ9 B;  2UUC B;  3SPG A;  5J2U B;  3ZHS A;  1XBL A;  2YSU B;  1K4C C;  1XMQ O;  1BQZ A;  1SS3 A;  2WWW A;  1GN3 A;  1Q6U A;  2ZKO A;  2QM8 A;  1K5Q A;  1Q3E A;  4TV8 A;  4EKW A;  2WAM A;  2Q68 A;  2W0X A;  3JAK B;  4LH6 A;  3APQ A;  4DV0 B;  1ZL8 B;  1I5X A;  2ZXW C;  3MHH C;  2EUL A;  3UCS C;  1HR0 O;  4WFB V;  2Q67 A;  3CRC A;  3UO2 A;  5BZB A;  4P2Z A;  4O2B B;  5CA1 A;  4MVR A;  2QWN B;  3N2G B;  5IYD O;  1PV0 A;  3E2E A;  4UVC A;  1LUV A;  3JAW A;  4KL1 A;  4BR6 A;  4WFF A;  1FFX A;  2YC0 A;  4JV5 B;  3KG2 A;  3G4S V;  2QKS A;  3OUF A;  5EBM C;  2ZE8 A;  5LP6 C;  1WN7 A;  5KAI Z;  5DN6 G;  2XT9 A;  4O4H A;  3CCV V;  1GM8 A;  3E22 A;  4X62 O;  1EN5 A;  3N27 A;  3LDD A;  1R3J C;  3VQW A;  4NXN O;  3MHS C;  4QIW F;  1ROP A;  1XOU A;  5B1A B;  2FL4 A;  4MW3 A;  4AHC A;  4B3R O;  3CC2 V;  1DGS A;  1BGY H;  3E8F A;  4B3S O;  2IJJ A;  1KB9 F;  3CEI A;  1EFR G;  3ZRS A;  3H9V A;  5LP6 A;  4J9Y B;  3OEH G;  3TJT A;  2QWO B;  4QNH B;  4XDJ A;  4YJ3 A;  5DEC A;  2NR5 A;  4FFB A;  1IZ3 A;  4BIU A;  5LXT B;  3T4Z A;  3KCX A;  2ZR2 A;  4DUZ B;  2JJ2 G;  1AIL A;  4CH6 A;  4XBF A;  4D6T H;  4I0X B;  1RPR A;  1F7Y A;  4BIZ A;  1OCC B;  1ZWI C;  5LA6 A;  3RGB A;  2JEX A;  3Q4H A;  1G4Y B;  4PD4 F;  4X65 O;  2EIM B;  3WU2 Z;  1K3E A;  4PA6 A;  4A5U B;  3JAS B;  3UT5 A;  1YIJ V;  1PNK A;  5CB4 A;  4PI0 A;  3C3T A;  1VAR A;  5DM6 V;  3UKM A;  2QGN A;  4JAV A;  1S72 V;  5DED A;  2CTP A;  2KB1 A;  4G28 B;  4DXW A;  4UCU A;  1OCO B;  2XAF A;  4O4I B;  1COW G;  2BTQ B;  3TXS A;  1R6T A;  1M9N A;  4X1I A;  2CGO A;  5LGN A;  4FK5 C;  1JFF B;  3H1H H;  1M57 C;  3OM3 B;  2GUZ A;  4PEL A;  5H2F Z;  2GV9 A;  1P84 F;  4PDV A;  4WF9 V;  1HP8 A;  1NTM H;  4BAY A;  4DV1 O;  4PV1 B;  4RQF A;  3OGI B;  4ZI7 A;  2DYS B;  4O4J A;  2E3C A;  1Q82 W;  1JFF A;  1NTZ H;  1Q86 W;  1ZUQ A;  1K4D C;  1Q81 W;  5IYZ B;  1YTF D;  1KBH A;  4J7J A;  3I56 V;  2BOB C;  2M6Y A;  1WLE A;  1MSW D;  5KAF Z;  1N0J A;  4D7S A;  4LBE C;  4X8A A;  1XL4 A;  3AG4 B;  1VQ8 V;  3ABM B;  3JCU Z;  4X64 O;  1JPX A;  3OR6 C;  4TV8 B;  3CMA V;  2WA3 A;  3ZBH A;  3OTO B;  1X4T A;  3S3W A;  1RM1 B;  2CH7 A;  5EBW C;  4X88 A;  4P9P A;  3ABU A;  2WLI A;  4JI6 B;  3ZN1 A;  1TGO A;  3J7A U;  4RO2 A;  1XL6 A;  1K7D A;  5AG2 A;  3SJA C;  1KKC A;  4ZOL B;  5FNV B;  1BQ0 A;  1B06 A;  3K06 A;  3G6B A;  4K8Z A;  3BVO A;  1I08 A;  2DMX A;  5KA5 A;  5CBH A;  3CE2 A;  5KHK A;  1P4R A;  2WLH A;  3HKC A;  3RT3 C;  2V1D A;  4JI4 B;  3RYI A;  4JI1 O;  4J42 A;  1OCO C;  5FLX N;  1N36 B;  3B2E E;  1AI5 A;  2XAQ A;  5FPO A;  4K8X A;  4YJ2 A;  1YJ9 V;  3IFX A;  2XTA A;  2ZD9 A;  4ASU G;  3ASN B;  2LJ2 A;  4RQE A;  4GX1 A;  2L6L A;  2LGW A;  3ASN C;  1GTO A;  2OYQ A;  2F95 B;  2JK5 C;  3CCJ V;  4B7K A;  2QDO A;  5JCO A;  4LP8 A;  4UFZ A;  1IVS A;  1PPJ H;  2UU9 O;  1FFX B;  4DV2 B;  1KUQ A;  2AHY A;  1ZSP A;  2DWE C;  2QWP B;  2JEU A;  2R9I A;  3HKD B;  3S3X A;  4MW8 A;  2UXD B;  1Q43 A;  3FB6 C;  3PN1 A;  4NTW A;  3RVZ A;  1L0N H;  1JCH A;  1NKD A;  4JZG A;  2IH3 C;  1S5J A;  3W7U A;  2DQ3 A;  4PA9 A;  1ARO P;  5E1A C;  1GKF A;  3QO8 A;  4I4T A;  5GTI Z;  4TQF A;  4NXN B;  1NH2 B;  3RWR D;  3AG3 C;  2AZ2 A;  4X62 B;  3K0D A;  3DGE A;  3UQ8 A;  2ZIN A;  4X1Y B;  3F7Y C;  2CDY A;  5KX5 A;  2QM7 A;  2Q73 A;  2EIN B;  2XND G;  2Q6A A;  4JTC B;  3OD4 A;  3E8H A;  5A9G A;  4JI4 O;  3GWK C;  2EIJ C;  3PJS K;  1DLB A;  3O65 A;  4P9O A;  1QR8 A;  4MT8 A;  4RUE A;  5EBL C;  1CPY A;  1K34 A;  3T4D A;  3GWO A;  5IYC O;  3AG1 C;  3HKB A;  2BOC C;  2GHY A;  2V4D A;  4LNU B;  4KUM A;  1OHH G;  3D3I A;  4H0L B;  1KP3 A;  4JI7 B;  4X64 B;  2F43 G;  2IJH A;  3SGI A;  5LHG A;  3SYQ A;  1YHQ V;  4AQY O;  3L74 H;  3OFN G;  5L3F A;  2LQT A;  3CJH A;  2P4V A;  4EEQ A;  4UCO A;  1OCZ C;  3WB2 A;  1IBK B;  2YXL A;  4OPA A;  1MA1 A;  1S3J A;  4E4E A;  3E83 A;  5KA6 A;  2HHH B;  1RPO A;  4YXW G;  3CPW U;  5EIB D;  1JJ2 U;  1T5E A;  2JS3 A;  4W4L A;  3T1C A;  4LCU C;  1BCC H;  2IBZ H;  1VF7 A;  2CTR A;  3ETD A;  4FM1 A;  4UVA A;  3QVN A;  2HP8 A;  1K9M W;  4MSW C;  4X1K B;  3ZJZ A;  1PNM A;  2Q0A A;  4LF6 O;  1FAF A;  2ADP A;  2RDC A;  4JYC A;  4WBN A;  3AG7 A;  4N23 A;  4LFA O;  3P30 A;  1NH2 D;  4LF8 O;  1MSD A;  2D2C B;  3CCQ V;  3ZHU A;  1G6U A;  2O57 A;  3AK2 A;  4BW9 A;  3CSX A;  2DYR B;  4PA7 A;  4IIJ A;  4UVB A;  3UO3 A;  3M99 B;  2DOS A;  2WA4 A;  1J5E O;  2YXH A;  2Z0A A;  3FAV A;  1YEW A;  1CEZ A;  1F4M A;  2YIB A;  1NZ6 A;  5L3D A;  3E35 A;  5JQG B;  4BWA A;  1VF6 A;  4LF4 B;  4GYC B;  1NVP D;  4JAU A;  2VQE O;  1WP7 A;  1VIB A;  2OCC C;  1BZK A;  5JH7 B;  1H2K A;  2OT5 A;  1MOF A;  4MVZ A;  3CYO A;  4FIP C;  3W7W A;  3LDE A;  5B1B B;  4CS2 A;  3CXH F;  4ZI7 B;  1SZT A;  1I5Y A;  1RP3 B;  3RBZ A;  5LMN B;  3JAR B;  1VQ4 V;  5LHH A;  3JAS A;  4EFB A;  4GCZ A;  1XHX A;  3SYP A;  4IYI A;  2UUA B;  1XMO O;  4JGS A;  2FB5 A;  5FNV A;  4ZHQ B;  1QVG U;  1R3I C;  1XNQ B;  1TUB A;  1NR1 A;  3Q4H B;  2NNU A;  3H1K H;  5BY1 A;  1VQN V;  5ITZ B;  4ZKI A;  1IBM O;  2Z5U A;  3RYC B;  2F4V O;  4YJ2 B;  1DF4 A;  4TSF G;  2Q9L A;  2NN4 A;  2VWK A;  5GON A;  3FYE B;  3ABL C;  3W7T A;  4XDK A;  4B08 A;  1GO3 F;  4ABM A;  3JAM N;  2H3O A;  4I5S A;  1EZV H;  1DTO A;  1VQM V;  2YUA A;  3D36 C;  1HNX B;  3HKE B;  2P5O A;  1KYO F;  1M1K W;  4D7T A;  1VQ9 V;  4U3J A;  2FTK A;  3L9D A;  3ZHQ A;  4AIL C;  2ZIM A;  1Z5W A;  5KLV H;  5IYZ A;  1MAB G;  5CBG A;  1H38 A;  2ZDI C;  2P06 A;  1V54 C;  3ZHR A;  1XQ8 A;  4GT1 A;  3R66 A;  2P22 C;  4DW1 A;  1IBL O;  1XEQ A;  4H44 B;  2Y69 C;  5IE9 A;  3TET A;  4FJC C;  3CCE V;  2PF4 E;  3OW2 U;  3LSS A;  3ABK B;  2B9Z A;  3WB0 A;  4KP4 A;  1JOY A;  4NYK A;  3A0R A;  3ZHV A;  2N74 A;  4O2B A;  5CA1 B;  3CC7 V;  1US6 A;  3JYC A;  4IHJ A;  3ZMU A;  3X2Q B;  4HAM A;  1URF A;  4NTX A;  1X59 A;  1VQ7 V;  4LF7 B;  4R6Z A;  2XAJ A;  5D5P A;  3UM7 A;  4UUJ C;  4MTG A;  1YXB A;  5B3S C;  4O4H B;  3FAV B;  1YTF B;  4NTY A;  1S5H C;  1F51 A;  4ZBM A;  3AK3 A;  4NKG B;  3AEI A;  4GKJ B;  3B40 A;  2Z3Y A;  3L72 H;  1IBM B;  3A0B Z;  4MVM A;  4U3J B;  3STL C;  4UV8 A;  1N8R W;  4KHP B;  3ETE A;  2QKA A;  4FFB B;  1GMG A;  5C93 A;  2Q7E A;  3F5W C;  3B8N A;  4B3T B;  2XHB A;  4YIP A;  1MNG A;  2V7Q G;  3L73 H;  5EK0 A;  4JI2 B;  2ZDI A;  2EJ7 A;  1UPG A;  2P90 A;  3K9A A;  3ASO C;  4Q20 A;  3DC5 A;  3E86 A;  3VQX A;  1VQP V;  2Q7G A;  1NR7 A;  5IJ9 A;  2RCV A;  2ZR3 A;  1OCR B;  2ZNJ A;  1M5I A;  2FML A;  4DR4 O;  3HB3 B;  4DR1 B;  4E2L A;  2ATK C;  2EIJ B;  4EB6 B;  3C3S A;  1R3K C;  3JD4 A;  1FPO A;  2ZE7 A;  3GVM A;  2Q7H A;  4DR4 B;  4TV9 B;  3CCU V;  4YJ3 B;  4JV5 O;  3L71 H;  5J9P C;  3VBB A;  3ZRW A;  2JGD B;  1BE3 H;  1XNR O;  1TVK B;  3RN4 A;  2JRI A;  2G38 A;  5LMU B;  5H9C A;  2IW5 A;  2UXB B;  1PD3 A;  5BMV A;  4GKK B;  2HG5 C;  2Q5Z A;  3AG2 B;  5EIB C;  2HFE C;  1U96 A;  2A79 B;  2ZQM A;  4IHJ B;  1FKA O;  4EFE A;  4DR6 O;  3KKY A;  2LO1 A;  2ZIO A;  2LGQ A;  3JD0 A;  3AG2 C;  4JI3 O;  2OTJ V;  4I55 B;  2EIL C;  2XAH A;  1RSO B;  2HJD A;  3JAK A;  4DYL A;  1Y6X A;  3W7X A;  4BW5 A;  1KQS U;  1S5L Z;  3FB5 C;  2HKO A;  3EXA A;  2YI9 A;  4DR7 O;  4DR7 B;  3MD0 A;  3K5L A;  3K08 A;  4U3F H;  2F93 B;  5TIS Z;  1K92 A;  5IT9 N;  3B4S A;  3FFQ A;  2QJ1 A;  5IY5 B;  3T2M A;  5CA3 A;  4ICG A;  2WLM A;  5JCO C;  3CCL V;  4DR2 B;  4WFG A;  1WP8 A;  4I9Q A;  1M57 B;  4PI2 A;  1XNQ O;  3M7M X;  4JI7 O;  3SR2 C;  3E8B A;  3RYI B;  3ABT A;  1XMO B;  3NR7 A;  2CTW A;  3HKC B;  5EYP B;  3JSN A;  1YDX A;  4JYA B;  4UB6 Z;  4K0K O;  3CRA A;  1HNW B;  2LP7 A;  3FKS G;  2QWQ B;  4LF9 O;  3SPC A;  4ZOL A;  1P7G A;  3N2K B;  5J2T A;  1Y76 A;  5CMU A;  3RFR A;  2KSD A;  5ITZ A;  1WPX A;  2R9A A;  2WPD G;  1M56 C;  1LNQ A;  3DXR B;  2HVJ C;  4YHH O;  4FLU A;  2Y0P A;  2Q4P A;  5K1X A;  1Z2G A;  1FXV A;  4IYH A;  1BHB A;  1TUE B;  2VWJ A;  4P30 A;  4R50 A;  5IWA B;  2KG7 B;  4MTO A;  4O4L B;  2KQX A;  2VQF O;  1YF2 A;  1K73 W;  4DRX B;  3LSU A;  1QHT A;  3BA8 A;  2WLJ A;  1XI1 A;  2P4K A;  1Y67 A;  1K5S A;  2UXX A;  4JI3 B;  2UUB B;  1KC8 W;  4G27 B;  4FZ1 A;  4DV1 B;  4DUY O;  4JI8 B;  1N34 B;  1N34 O;  2A9H A;  3IJ4 A;  4LWS B;  1W59 A;  5KHG A;  4FLX A;  1XNR B;  1BMF G;  3E8G A;  1H8E G;  3DSQ A;  4JPR A;  2WLL A;  2BCC H;  4TQD A;  3BRC A;  3CX5 F;  3MDS A;  1BT8 A;  3CRR A;  3T1H O;  3TK1 A;  3G67 A;  1D2D A;  3K3W A;  2UXC B;  2ADQ B;  2E5L B;  4FLV A;  2BTQ A;  1O9H A;  2M7W A;  4DR5 B;  3D36 A;  1SQQ H;  4HBN A;  1SF9 A;  2QA4 V;  2ZE6 A;  3OR7 C;  4MTX A;  3ZMS A;  4KXR A;  4B7E A;  1Y66 A;  1HNZ O;  4LF4 O;  4IL6 Z;  5CB4 B;  4XDL A;  5B1A C;  4X65 B;  4PDL A;  1GN4 A;  4CH3 A;  5B5E Z;  2H94 A;  3BHP A;  4MVU A;  3CME V;  4JI2 O;  2DW4 A;  1Q5O A;  3SDL A;  4X1I B;  5CBF A;  1Y76 B;  5J2T B;  2E75 B;  1M56 B;  3B8M A;  4I0X A;  4YIO A;  2PI5 A;  1PNL A;  2MW2 B;  2QR4 A;  1ZAU A;  1GAX A;  1V55 B;  2ODM A;  1Z5V A;  4U7N A;  1MMM A;  5L3B A;  3CB2 A;  4KFM A;  4K3A A;  4F6R A;  4RWU A;  3EVK A;  1FJG B;  1JVM A;  1KMI Z;  5GON B;  3BCC H;  2IH1 C;  4DR1 O;  4DV7 B;  1ZLZ A;  2K9P A;  3G71 V;  3I5D A;  1UFI A;  1H2S B;  5C8Y B;  5LHI A;  4LC1 A;  1AR4 A;  5GTH Z;  2E76 B;  5LA6 B;  2OIE A;  4CH5 A;  4QJF B;  3N2K A;  4FM2 A;  4QPK A;  1I0H A;  1IBK O;  3T1Y O;  3ZN0 A;  2PGG A;  5FL7 G;  4O2A B;  4ZIB A;  1VQO V;  5LOV B;  2IU0 A;  4AQY B;  2BTO A;  5KHI A;  1XHZ A;  4DV3 O;  4GKK O;  5LP6 B;  5LGU A;  1WA8 B;  1YJW V;  4I7Z B;  4MVQ A;  3ASO B;  4X20 A;  1XUQ A;  3A0H Z;  3LDC A;  3JD2 A;  3E89 A;  3ZX6 A;  5JWP A;  1GRJ A;  3J80 N;  3SPI A;  1D5N A;  4OXS A;  4LFC O;  3CHX A;  3VQY A;  3QTC A;  1N32 O;  2JIZ G;  2EIM C;  3E22 B;  4DW0 A;  1I94 O;  2AW9 A;  3ZHT A;  2JGD A;  1OCZ B;  5B66 Z;  1AB3 A;  1HW7 A;  1M4U A;  2Q0O C;  1R1B A;  4FMT A;  3CCM V;  3BEH A;  2ZM6 B;  3H1J H;  1N36 O;  3A8T A;  1TAE A;  2GTS A;  3QO5 A;  4UCS A;  4H33 A;  4R8C A;  4LF9 B;  4N21 A;  4J11 A;  3OMA B;  3CS5 A;  4WBN B;  2H8P C;  1A32 A;  3FB7 C;  3W7S A;  4F4L A;  2IU3 A;  1KEC A;  5C8Y A;  1RM1 C;  1V55 C;  2NLJ C;  3JAT A;  3K5N A;  1Y74 B;  1PM9 A;  4OGQ B;  3IAY A;  3ZRW B;  1FD9 A;  3WG7 C;  4JTD B;  4FM0 A;  2CAZ C;  2N04 A;  4FPP A;  4F6R B;  5B1N A;  1TA8 A;  1Y74 A;  4WCE V;  3JAT B;  1IDS A;  3C90 A;  4B3S B;  1W0K G;  2EIK B;  2EZO A;  4FVM A;  2VQF B;  4UXN A;  1VMG A;  1BL8 A;  4DV4 B;  3CJH B;  2HHH O;  1QCE A;  1QU7 A;  1M93 A;  3K03 A;  1JX9 A;  5LXT A;  2RMK B;  1GM9 A; 
#chains in the Genus database with same CATH homology
 5H2F Z;  1S5L Z;  4IL6 Z;  3A0H Z;  4UB8 Z;  5E79 Z;  5KAI Z;  3JCU Z;  5GTH Z;  3A0B Z;  5TIS Z;  3WU2 Z;  5B5E Z;  5GTI Z;  4UB6 Z;  3KZI Z;  5KAF Z;  2AXT Z;  4PJ0 Z;  5B66 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...