5B5EZ

Crystal structure analysis of photosystem ii complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 26
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b5eZ00
5KAIZ 4UB8Z 4UB6Z 5B66Z 5H2FZ 3JCUZ 5B5EZ 4PJ0Z 3A0HZ 5GTIZ 4IL6Z 5GTHZ 5E79Z 2AXTZ 5KAFZ 3WU2Z 1S5LZ 3A0BZ 5TISZ 3KZIZ
chains in the Genus database with same CATH superfamily
3ML0A 1N36O 4ZKIA 2X6BA 2L6LA 3ETDA 4J10A 2XAGA 5B3SC 1FFXA 2YDEA 1PKXA 2N05A 5IT9N 4FLXA 2CTQA 1JVMA 1TUEB 1ROPA 3CCUV 5EYPA 4FFBB 1EZVH 1Q7YW 3FB5C 3ZCCA 2A0LA 4O4IB 3CWBH 4JZGA 4UXNA 3K3WA 5KX5B 3VQYA 3SGIA 4U3FH 3W7SA 4FJCC 4LF9B 3UO2A 1VQPV 2W0XA 2IBZH 5GTHZ 2N74A 1EZJA 4X1YB 3K79A 4KL1A 2F4VB 3CRAA 3FKSG 3ABMB 1SA0A 2AZ2A 2LW7A 5HFMA 1R6KA 2WWWA 1N4CA 3JARB 1S5JA 1E1RG 1FPOA 1M4UA 2YIBA 3U10A 2ZD9A 1AI7A 3BEHA 5IY5B 2PUSA 5FNVA 1S0VA 2QJ1A 4ZHQA 3P32A 4O2BB 1R3KC 3D8CA 4LFBO 4U7NA 3RYHA 2DYRC 3OT7A 1YHQV 2FKXA 1GKFA 2HHHO 2OIGA 4HNAA 1HDJA 4DW1A 4YXWG 4G28B 2QTSA 4QPJA 4ZIBA 2X0LA 1K97A 3LNMB 2RJZA 1K5SA 2VQEB 1HNZO 2M7WA 3AK2A 4ZI7A 3K59A 4B3TO 2E3CA 1OCRB 3OD4A 1LR1A 1YITV 2DN9A 3AG1C 3K5MA 3H1IH 1KP3A 4JI1O 1H38A 1KP2A 2YSUB 1VP7A 1OV9A 4EFEA 1PL0A 2R70A 3CC2V 4DR2B 2EIJC 1MZFA 3X2QB 2H3OA 3DSQA 4O4HA 2UU9O 3CS5A 4QIWF 2DQ0A 4PA4A 2AGAA 5KLVH 4ICGA 1FXKB 1H2GA 1UJWB 3L9DA 4PI0A 4DR7B 4WBNB 1YEWA 4JAUA 4N21A 2UXCB 3TCUA 4QE7A 1M56B 2E74B 2CUGA 3IC9A 1XUQA 2JRIA 1RSOB 1ZUQA 1CPYA 3OR7C 4X1KB 1NS1A 2DWEC 1MABG 2JDIG 3KG2A 2BE3A 5EK0A 2ZKOA 4FZ1A 1YTFB 1HWYA 4I50A 1DF4A 3K9SA 2ZXWB 3OFNG 1M90W 3HB3B 4I9QA 1N32O 5JCOA 1H2KA 4NXNO 3HKCA 3SYCA 3SYAA 3ZHTA 2UUAO 3ZRVA 2VRZA 3JD4A 4GKKO 1QLEC 2YXYA 5IY5C 2Y0PA 3D3QA 1KMIZ 3OUSA 1HR0B 4DV2O 4B08A 1Y74A 2EINC 2FTKA 1VQ6V 2R9IA 1SQXH 5LA6A 1M5IA 4JZ2A 4FLUA 3G71V 1VARA 3AG7A 4MW8A 4UCVA 1IURA 5EZYA 5EIBD 4BAYA 2HJDA 4JI0B 5EC1C 4BWAA 1XL6A 1N34B 2P22C 2OTLV 3SPGA 1BQ0A 1Z5VA 2ZT9B 2JGDA 3SPHA 3T4DA 3VQVA 2CAZC 3K03A 4GCZA 1L1FA 1R6NA 1I94O 4U3JA 2LGQA 4MSWC 4FM2A 5L3GA 2CTPA 2BSKA 1S5HC 4X62B 5IJ9B 2UXXA 4G27B 3CX5F 5FPRA 4CH6A 4DV3B 4E4EA 4B7EA 4X65O 2PYLA 2CE4A 4JI2B 5CA0A 1CP9A 1QCEA 1ZL8A 2LGWA 3B09A 5IYZA 1RFYA 2OWOA 4NXMO 4BIOA 3CPWU 3FAVB 1NJIW 1X4TA 5C93A 3BY6A 5LYJB 5LGTA 1JJ2U 5CB4B 5KA6A 1FXKC 4KFMA 1BHAA 3ZBHA 1D5AA 3RYIB 4LF4O 3FYEB 1H2NA 3TXQA 4BIZA 5LP6C 1D2DA 1ZWIC 3JSLA 4YJ2B 2EIMC 1M56C 1YJWV 4LCUC 4YIOA 1I7FA 1PNMA 3QNEA 4LFAB 5E1AC 4CS3A 1U96A 3QG5A 3ZX6A 5LHGA 5IWAB 3EVKA 1P84F 4RWUA 4B3RO 1M57C 4H44B 3HKDB 3OGCC 2UUCB 2AHZA 1TAEA 1IBLB 3T1HO 2QGNA 1NVPB 3WB1A 4PDMA 2B1IA 5C8YA 2AXTZ 4PDVA 3K5LA 4JI5B 3JASB 3JATA 1AJPA 4WFEA 3CCQV 1G1XB 2VS0A 3ZN1A 2QDOA 4Z1MG 1NR1A 4PDLA 4CH3A 4CC6A 2DJVA 2UXDB 3E8HA 4KP4A 5B5EZ 4NKGB 1BS3A 1DLBA 1KU9A 4JYBA 2E76B 1R6TA 4UV9A 5E79Z 2R9RB 3WFVA 1JX9A 4YJ3A 3U11A 4B7KA 3OMIB 2HVKC 4KHPB 3P3PA 2ILMA 1F23A 3ZMZA 3IGAC 5LOVB 5LL6Y 5DN6G 3OEHG 4F4LA 2IU3A 2MK3A 2CK3G 1SZTA 5BMVA 2YEVA 3ZHVA 4YHHB 2CGNA 2PF4E 1KQSU 4RQFA 1SESA 4K8XA 3K08A 1YDXA 4GYCB 3ZMVA 1S77D 4ABMA 1VQ8V 3R65A 4FK5C 2IJKA 2ZE6A 3VQXA 4TT3G 4X66B 4MS2A 1P4RA 5CBGA 3J7AU 1LUVA 1YSCA 3TK1A 4DR5O 2HEPA 1KC8W 2WLNA 2JS5A 1HNXB 1NZ6A 2ZR2A 2UXBO 1GMGA 4DRXB 2Y0IA 2OCCB 3OTOO 5JH7B 5KUMA 3NXSA 5J2TB 4R8CA 4DV4B 4DV0O 2ZE8A 5KHKA 1YJNV 4F6RA 2HLDG 4MT8A 3RGBA 1FFTB 1XMQB 3WU2Z 3M99B 3KCYA 4I55B 4WFFA 1K4CC 1IX9A 1NR7A 3K58A 2QM8A 3RW0A 2HFEC 1Q6HA 5LP6A 5EBLC 2PY5A 3CJHB 4WFHA 1N0JA 3O65A 1AI5A 5KUKA 1Q90D 1QVGU 1VMGA 3AK3A 2VQFO 1VQMV 2Q9LA 2QEXV 1XNRO 5CBHA 2WA4A 4DW0A 3W7XA 4JTAB 3G67A 2IU0A 1N8RW 2E75B 2QTOA 1Y6XA 3TGUH 1FAFA 3UCSC 3K04A 4B3SB 1TUBA 1GN4A 1S3JA 4PDRA 4J41A 1DF5A 1VQ7V 2QR4A 1LUWA 2CGOA 3N2GB 5IE9A 4CS2A 3JD3A 4GKJB 4DV6B 4LF5B 4EKWA 5LXTB 4JYAB 4LNUA 4PD4F 1FXVA 1N33O 3WB2A 2GUZA 2XAJA 3AG2B 1V54C 1Z2GA 1GH6A 1F4NA 3E83A 3BAAA 1V55C 1VQ9V 2EZPA 3FX7A 3PJSK 1FYJA 4IIJA 4JI6B 3HKBB 3ZMUA 3WG7B 5JQGB 1R3LC 3LDEA 2QA4V 4I4TB 1Y66A 1SQBH 2XNDG 2FL4A 2OCCC 1NTMH 1ZLZA 2V7QG 1XMOB 5KMGA 1XL4A 1N0NA 3RFRA 1OCCB 2YXHA 4DO2A 4ZOLB 4J42A 1XHZA 4FLZA 3ZRSA 5JJEB 5CA1A 1F51A 4IHJB 3LNNA 3TJTA 4GX0A 3ZMSA 5F2VO 1FJGO 5IYBO 1NI8A 1K4DC 4X89A 4JTDB 4X1IB 5B1OA 3QF7A 1EFRG 2P4KA 1W0KG 2IM9A 4LP8A 4IT5A 1K8AW 5LGUA 5JWPA 3CCJV 5JVDB 3I56V 2LQTA 2F43G 4H37A 3A8TA 2LW1A 4GX2A 4NTWA 1WA8A 3Q4HB 4X20B 2YIBD 4CH4A 3MHSC 4JV5O 3D3IA 4JYCA 4O2AB 1NTKH 4DR2O 4CC5A 2QKCA 4LWSA 3SDLA 4UV8A 2A79B 4HBNA 1URFA 4OPAA 4K0KB 3B77A 2WLLA 4JF3A 1GN6A 4FLVA 2ZDIA 1K3EA 4CH5A 2IJJA 1YXBA 2X6AA 4ASUG 5LGNA 2ZIMA 3AG2C 2NN4A 2Y4UA 3BHPA 4YJ3B 2ZM6B 4JI4B 1RPOA 2OT5A 4GLXA 1R73A 3UT5B 4LF7O 1ZSPA 1XQ8A 1JFFA 4FM0A 1NTZH 2E5LB 2B1GA 4X64O 3CRMA 1HNWB 1D5NA 1P7GA 5B1NA 4LFCO 3RWRD 4JAAA 3JAKB 2Y48A 2Q8VA 1N36B 1VQNV 2BOBC 4I5SA 3L74H 1DK1A 4JI8O 1Q5OA 2UUBB 1XNQO 2ZE7A 3DXRB 3OTFA 4DUYO 4PI2A 4FIPC 4DR4O 1MZEA 3RT3C 2FMLA 1Q82W 1QHTA 4MTFA 3JAWB 4K3AA 3G6EV 2XHBA 4LC1A 5HFLA 1Q3EA 4E2LA 2JEXA 4HAMA 5IJ0B 1BCCH 4I9WA 1HR0O 2WLIB 3R66A 5J2UA 1FKAO 1EN4A 3DC5A 2PI5A 4H0LB 1XEQA 1Y4MA 3FB7C 3ZEDA 4MVOA 5JJNB 3CD6V 3CC7V 4P30A 1XI1A 2LJ2A 2F93B 4EB6B 3D36C 3GB7C 1SKVA 4MTOA 5BY1A 4QNHB 1SS3A 5B1BB 2R72A 1SQGA 3PN1A 4MVQA 4MTGA 4DV7O 5L3FA 1NQTA 5EC2C 4DK0A 1VF6C 2ITDC 2Q0AA 4TV8B 2H8PC 2G38A 3LSUA 3OM3B 2M6YA 4O4LB 5H5NA 3W7UA 4X62O 3ZHRA 4LFBB 4PJ0Z 1GK9A 3RYFB 3T2MA 3SJQC 4TUYA 2HHHB 2DE0X 2OYQA 3AG3B 5LMUO 2ITCC 3T1YB 3CP1A 5KA5A 2F1MA 4O4JA 3ABMC 1IBKB 5GONA 1JCHA 1WN7A 5L3BA 2XAFA 3E35A 1F4MA 4AI8A 4L8JA 3ABTA 3WB0A 3SR2C 4DV1O 4PA7A 3UQ8A 2ADPA 3BCCH 1U97A 2V4DA 3LUTB 1XBLA 1HNZB 1HP8A 2P06A 5GTIZ 3ABUA 2DW4A 3B4SA 2JJ1G 4B3TB 3K0DA 1H8EG 2ADQB 3BRCA 4XBFA 2CH7B 4CBCA 4LBEC 4OGQB 1V9PA 3OMAB 4F6EA 1AP6A 4UVCA 4LFAO 2W0FC 4TV9A 3UM7A 2ZNJA 1W59A 2EIKB 4TWKA 3ZRWB 1SQPH 4YY3O 5EBWC 4I0XB 3S3XA 2UU9B 3DC6A 5ITZB 1B06A 3E22B 2UUCO 1VF7A 1E79G 2X7RB 1ZTEA 1MA1A 3BVOA 3GWOA 5BR8O 1Y76A 3P30A 1B04A 3OGIB 1OCRC 3ETEA 2GBOA 3F5WC 2Q7GA 3JALB 4FVMA 4R7CA 4LF8O 1JR9A 1PM9A 4JI7O 3N2KA 1YVWA 4MVRA 3HKEB 3X2QC 2VWJA 1JQ0A 4DUZO 3AG4B 1IBMB 5EBMC 4DYLA 3H1LH 4LR3A 2JIZG 2BTQB 1KKDA 5LMNO 4NYKA 2KG7B 1PPJH 4W4KA 3F7VC 1N32B 4NXNB 1WJZA 3DGEA 2RMKB 2UUAB 3CEIA 2IW5A 4GKKB 1FD9A 3HR0A 1GM9A 2Q5ZA 1GN2A 4PA3A 4DR3O 3H9VA 2P6JA 3FFQA 4H33A 4GZRB 1ENVA 3D36A 2GSMB 1FFXB 3ZJZA 2ARHA 2ZXWC 2QKSA 4X66O 2KQXA 3AG3C 4IL6Z 3MAQA 5LHIA 1BSMA 2ZINA 4PV1B 1VF6A 4FFBA 5B1AB 2N04A 4MW3A 4O4IA 5EYPB 1Q43A 1IXBA 3SJAC 1IVSA 5KX5A 3FB8C 2PTMA 1I94B 4DR1O 3CCLV 1NH2D 4WFBV 4RO2A 1MOFA 4DV4O 2LO1A 1COWG 4RAIA 4WF9V 3JARA 1US6A 5KHHA 4JASA 4OXSA 5KAIZ 4NXMB 4R50A 1SA0B 5A9GA 3P3NA 2JK5C 2Q68A 4O2BA 1NT2B 5FNVB 3ZHSA 1OHHG 1FS0G 2V1DA 4ZHQB 1Q81W 2Q73A 3K5NA 4Q6GA 1QNMA 1AR4A 1IXMA 2ETNA 3RYHB 1BGYH 2W6JG 2QM4A 1TA8A 3ETGA 4HNAB 4FLWA 2ATKC 2A9HA 2B9ZA 1J5EO 1YIJV 2F66C 4B3RB 3AG4C 4B3SO 3BPZA 4DR6B 4ZI7B 1S76D 4UB8Z 3K0GA 2BCCH 2XOKG 4MVMA 2WLHA 3L73H 2EJRA 3ZRXA 3E89A 3K06A 3L75H 2Q6AA 5H2FZ 4PA9A 3L71H 2WPDG 1XDCA 2DYSB 1M9NA 1W2BU 4DV5O 3CCMV 1FXKA 1H2SB 4O4HB 3ASNB 4JI3B 4WBNA 1WP7A 2K1EA 2XASA 1AR5A 2L35A 1WAZA 3GWKC 3APQA 1SQFA 2KKWA 4EEQA 4X88A 1YF2A 1OCOB 2W6IG 3T4ZA 3JD2A 3H1JH 1RSOA 1MMMA 4UUJC 4X1KA 5B1AC 1O9GA 4YIPA 2P7TC 2JEUA 1L0LH 4TQFA 2D2CB 5H9CA 3RN4A 2KSDA 3CYOA 5B3SB 5K1XA 4LF6B 4GT1A 1HW7A 1DTOA 4FLYA 4XDKA 1K7DA 4UCRA 4RUEA 1JPXA 1WPBA 4I50B 3B2EE 4BR6A 3ZHQA 3HKCB 1O9HA 4DR5B 2QWOB 3STLC 3CE2A 3EXAA 5CBFA 4J7ZA 2UXBB 2WLKA 5FPOA 4P2ZA 5J9PC 2Y69B 3OTOB 3SPIA 1KECA 3RBZA 3CC4V 1Y74B 4HYOA 4G2KA 2NNUA 1YJ9V 1YCIA 3E2EA 5LA6B 2C2AA 4L87A 1AILA 3IC7A 2PGGA 1GO3F 4N23A 4TOIA 5EZYB 1THZA 3MD0A 5H6RA 1QLNA 3ZN0A 1K9MW 1VQ5V 2YIDA 3G6BA 1OJHA 3JYCA 2HG5C 5FL7G 1SQVH 2JGDB 3ETQA 2IJHA 5IJ9A 4LF9O 4PHZA 2DYRB 2Z3YA 4U3JB 2UXNA 1QU7A 1AR1B 2BSKB 1Q6UA 2PYJA 4NR1A 2F4VO 2CDYA 2NR5A 3OUFA 1XNRB 4MVUA 5BXZA 5CA0B 3FAVA 1ZL8B 5IYZB 3A0HZ 4X9QA 4B3MB 4MVSA 1WLEA 5LYJA 4HZ3A 3IAYA 3RYCA 5CB4A 4K0KO 3H1KH 1PP9H 1L8DA 4GX1A 3GVMA 3KZIZ 5CA3A 3RYIA 2QWNB 3MHHC 1QR9A 4TQDA 1GTOA 4UCUA 3AG1B 4YJ2A 4NB5A 1AJQA 1Q86W 3C90A 1OCOC 2Q7EA 4R6ZA 3OE7G 5D5QA 2EIJB 1JOYA 1NVPD 1OCZB 1MSWD 1M93A 3HKDA 5L3DA 2HVJC 4D6TH 2JS3A 2VQEO 3E8GA 1N33B 2UUBO 1G4YB 2XTAA 2VWKA 1I5XA 1GM8A 5DECA 1VQKV 3FD9A 3E86A 4IYHA 3SYPA 1XOUA 1ORQC 2RDCA 1R1BA 2CTWA 1WP8A 3W7WA 5JCOC 3UO3A 2F95B 3JASA 5C8YB 5AG2A 1JA8A 3LDCA 2HJFC 1ZAUA 2EBOA 3JATB 2WLMA 4WFAV 4LH6A 3A2FA 1H8HG 2YS8A 4U7OA 1T5EA 2Y69C 2FB5A 1SZXA 3CXHF 2A7WA 4AQYB 5KHIA 4OX9B 4DR7O 1VEWA 4P9OA 1JJOA 2HKOA 2Z5UA 2ZE5A 1IDSA 1EN5A 3JCZA 2UXCO 1J95A 2P67A 4GUNA 1PD3A 1DGSA 5LOVA 3FYIB 4J80A 1NH2B 5L3CA 4RUFA 3WG7C 4DXWA 1QLEB 1KD1W 1BL8A 2LP7A 5FLXN 2O57A 1RM1B 5IDJA 4MVZA 2A3QA 1FJGB 5A2QN 2EINB 5KAFZ 5BMVB 5EIBC 2YEVB 4GX5A 1XREA 3FB6C 1AP5A 3T1YO 2BOCC 1IBKO 4BW5A 1OCCC 2DWDC 1BE3H 1YZBA 4NVPA 3RVYA 2QWRB 2P5OA 2PI4A 4JAVA 1Q8IA 3CCRV 4DRXA 3JSNA 3L72H 5JH7A 2PZSA 3AEIA 5J2TA 2Q0OC 3QVNA 3APOA 3B8NA 1AI4A 1SF9A 4FMTA 5D5PA 2XAQA 4JV5B 1BT8A 3ASOB 4F6RB 1NBMG 4JI0O 4I55A 1N34O 1QBZA 1OCZC 1K5QA 3JD1A 4RQEA 3VBBA 2P4VA 3CJHA 3HPLC 4XDLA 2DOSA 3S3WA 2IH3C 5LP6B 5GW7A 1WB7A 4J7KA 2EIMB 4DV3O 2YXLA 3BA8A 1RP3B 3UKMA 4JI2O 3CSXA 3E8FA 4LF7B 4FPPA 1Z5WA 1AB3A 1GM7A 4X64B 1SETA 2A06H 1PL4A 3C3SA 4LFCB 3CCEV 1M57B 3STZC 3F5TA 1ZX3A 4UCTA 1S72V 3W7TA 1IBMO 5B66Z 2NLJC 3DTUB 3K5OA 1UFIA 1XHXA 4MTXA 4JI8B 5LHHA 4QGPA 1TUBB 1XNQB 4DUYB 2R9AA 4CZZA 3N2GA 4DR4B 1QQCA 4JI1B 3SJCC 2BTOA 4D7SA 1BQZA 1VIBA 4JYYA 2K9PA 1MNGA 3O9OA 5IWAO 2OIEA 4OPHA 4X8AA 5LXTA 1XILA 1RM1C 1I08A 1WPXA 4DK1A 2D3OW 1AROP 1IBLO 4LNUB 2H94A 4J9ZB 2X6CA 4J9YB 3SPCA 2IJIA 4Q20A 3IFXA 2GUZB 3HKBA 5KHJA 3KCXA 4JI5O 3A0RA 5JQGA 4FM1A 2YC0A 4IGGA 1E1QG 4IIJB 3ABKB 2WSSG 4I4TA 4DV7B 2WAMA 4PELA 2ZNIA 3I55V 2QWPB 2OCHA 3G80A 3OAAG 1UPGA 5DEDA 3CXCU 2UXDO 3F7YC 2XAHA 2QKAA 1KYOF 1R3IC 3CRQA 1SRYA 1B6QA 3K9AA 2EZOA 5KMGB 4BW9A 2JGUA 1RPRA 3LDDA 4ZOLA 5LMUB 4KHPO 1F7YA 1TVKA 3ASOC 2GTAA 5JJJB 5B1BC 4QPKA 2GV9A 3QTCA 4KUMA 3CCVV 4AILC 3RYCB 4DV1B 4IHJA 4EFBA 4NTYA 3CMEV 4PA6A 3VQWA 5CA1B 1I5YA 1P7BA 4YHHO 1NKDA 4DV2B 4H13B 4KXRA 3JAMN 3M8AA 4X1IA 1WB8A 3K57A 1GRJA 3L70H 1AJNA 2EILB 1EBOA 2ZQMA 5L3EA 5JVDA 1FXHA 2RNBA 3KKYA 4NTXA 4YY3B 2Z0AA 3LSSA 1M1KW 4XDJA 2QE7G 1HNXO 4JPRA 4DR6O 1NU1H 2Y4TA 1CXZB 2HR3A 4FLTA 4J11A 5BR8B 3CHXA 1K92A 3Q4HA 2QM7A 3B8MA 3G4SV 4X20A 4X1YA 2EJ7A 1WA8B 4O2AA 3CRCA 4LF8B 3CB2A 1H2MA 4X65B 1AVMA 4JI7B 1SQQH 1YI2V 4ZBMA 1LNQA 1XMQO 1EN6A 2EIKC 3ZS8C 4BIUA 1IZ3A 3ABLB 4LWSB 2QSAA 4DUZB 4JI3O 3H1HH 3I5DA 2WLLB 2HP8A 5LMNB 4CS4A 1EM1A 3J81N 3A0BZ 4LF4B 5TISZ 3UT5A 1H2LA 5IYDO 3MDSA 3IJ4A 3ABKC 3THOA 1JFFB 1W0JG 2EULA 3JAKA 4DR3B 1OZ0A 4LF6O 4I7ZB 2RCVA 4A5UB 4Z2WA 4J7JA 1QVFU 2CTRA 3DXRA 3OEEG 3SJBC 4D7TA 3CRRA 1V54B 3T1HB 1PV0A 1BZKA 3N27A 3ICXA 4TSFG 1QR8A 5LBQA 1V55B 3BA9A 4UVBA 5DM6V 3JAWA 4JGSA 3OMNB 4QJFB 2Q67A 2DMXA 2B5UA 5H6QA 5IJ0A 2WLIA 4GKJO 1GN3A 3RVZA 4DV6O 4LF5O 2Q4PA 4JYAO 2JVDA 5J2UB 4DR1B 2WA3A 2AHYA 2KB1A 3EFFK 1PNKA 1KUQA 2IH1C 4UB6Z 3EHBB 4EB6A 1P49A 1VQ4V 3B40A 2ODMA 2EILC 2RN9A 4JI6O 2WLJA 3SYOA 2OTJV 4JTCB 1YTFD 4Z1VA 2LFSA 1CEZA 4TV8A 4UFZA 3AK1A 3J80N 1KKCA 2ZCEA 2Q69A 4O4LA 4K8ZA 4WFGA 1XMOO 4AHCA 4FZ0A 1R3JC 5IYCO 3RYFA 4LH7A 2AZ0A 2GTSA 2P90A 4QE9A 4K35A 4UVAA 4TUYB 3LSQA 2XUMA 4B3MO 1J5EB 5CN0A 1SERA 4O4JB 5GONB 1G8MA 3ZHUA 5CMUA 3ABLC 2YUAA 1K33A 1MSDA 1VQLV 3H01A 3U0ZA 3OW2U 1BHBA 2LFRA 2ZDIC 2CH7A 3TETA 1L0NH 2Q7HA 1S5LZ 3ZIAG 2GHYA 2YI9A 5KHGA 5BZBA 1KBHA 2ZIOA 4DV0B 1KB9F 3BABA 3JD0A 1BMFG 1G6UA 3ZRWA 4TV9B 1SC5B 3T1CA 4WCEV 3NR7A 4I0XA 3OR6C 5ITZA 3QO5A 2QWQB 4DV5B 1K34A 3E22A 3BFRA 1Q6IA 1I0HA 1TGOA 1AI6A 2EX3A 1VF5B 3VOUA 1MG1A 1Y76B 3JALA 2YIAA 3QO7A 3ZMTA 1JMKC 2AW9A 3QO8A 2YI8A 2VQFB 1A32A 3SPJA 3SYQA 3JCUZ 3HKEA 2F23A 2ZR3A 3N2KB 2DYSC 4FFKA 1WNSA 2MW2B 2GDSA 2RQ6A 4P9PA 3CMAV 4AQYO 2BTQA 4OX9O 3M7MX 3ASNC 2XT9A 1B3QA 2KG7A 1PNLA 4W4LA 3E8BA 1K73W 1GAXA 1VQOV 3CCSV 4UCOA 4UCSA 2ZM6O 4JI4O 2FYUH 1TVKB 1Y67A 2E5LO 2JJ2G 2YICA 3C3TA 1HNWO 4C7UA 2DQ3A 1X59A 5K1PA 3TXSA 4IYIA
chains in the Genus database with same CATH topology
5KAIZ 4UB8Z 4UB6Z 5B66Z 5H2FZ 3JCUZ 5B5EZ 4PJ0Z 3A0HZ 5GTIZ 4IL6Z 5GTHZ 5E79Z 2AXTZ 5KAFZ 3WU2Z 1S5LZ 3A0BZ 5TISZ 3KZIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI Z;  4UB8 Z;  4UB6 Z;  5B66 Z;  5H2F Z;  3JCU Z;  5B5E Z;  4PJ0 Z;  3A0H Z;  5GTI Z;  4IL6 Z;  5GTH Z;  5E79 Z;  2AXT Z;  5KAF Z;  3WU2 Z;  1S5L Z;  3A0B Z;  5TIS Z;  3KZI Z; 
#chains in the Genus database with same CATH topology
 3ML0 A;  1N36 O;  4ZKI A;  2X6B A;  2L6L A;  3ETD A;  4J10 A;  2XAG A;  5B3S C;  1FFX A;  2YDE A;  1PKX A;  2N05 A;  5IT9 N;  4FLX A;  2CTQ A;  1JVM A;  1TUE B;  1ROP A;  3CCU V;  5EYP A;  4FFB B;  1EZV H;  1Q7Y W;  3FB5 C;  3ZCC A;  2A0L A;  4O4I B;  3CWB H;  4JZG A;  4UXN A;  3K3W A;  5KX5 B;  3VQY A;  3SGI A;  4U3F H;  3W7S A;  4FJC C;  4LF9 B;  3UO2 A;  1VQP V;  2W0X A;  2IBZ H;  5GTH Z;  2N74 A;  1EZJ A;  4X1Y B;  3K79 A;  4KL1 A;  2F4V B;  3CRA A;  3FKS G;  3ABM B;  1SA0 A;  2AZ2 A;  2LW7 A;  5HFM A;  1R6K A;  2WWW A;  1N4C A;  3JAR B;  1S5J A;  1E1R G;  1FPO A;  1M4U A;  2YIB A;  3U10 A;  2ZD9 A;  1AI7 A;  3BEH A;  5IY5 B;  2PUS A;  5FNV A;  1S0V A;  2QJ1 A;  4ZHQ A;  3P32 A;  4O2B B;  1R3K C;  3D8C A;  4LFB O;  4U7N A;  3RYH A;  2DYR C;  3OT7 A;  1YHQ V;  2FKX A;  1GKF A;  2HHH O;  2OIG A;  4HNA A;  1HDJ A;  4DW1 A;  4YXW G;  4G28 B;  2QTS A;  4QPJ A;  4ZIB A;  2X0L A;  1K97 A;  3LNM B;  2RJZ A;  1K5S A;  2VQE B;  1HNZ O;  2M7W A;  3AK2 A;  4ZI7 A;  3K59 A;  4B3T O;  2E3C A;  1OCR B;  3OD4 A;  1LR1 A;  1YIT V;  2DN9 A;  3AG1 C;  3K5M A;  3H1I H;  1KP3 A;  4JI1 O;  1H38 A;  1KP2 A;  2YSU B;  1VP7 A;  1OV9 A;  4EFE A;  1PL0 A;  2R70 A;  3CC2 V;  4DR2 B;  2EIJ C;  1MZF A;  3X2Q B;  2H3O A;  3DSQ A;  4O4H A;  2UU9 O;  3CS5 A;  4QIW F;  2DQ0 A;  4PA4 A;  2AGA A;  5KLV H;  4ICG A;  1FXK B;  1H2G A;  1UJW B;  3L9D A;  4PI0 A;  4DR7 B;  4WBN B;  1YEW A;  4JAU A;  4N21 A;  2UXC B;  3TCU A;  4QE7 A;  1M56 B;  2E74 B;  2CUG A;  3IC9 A;  1XUQ A;  2JRI A;  1RSO B;  1ZUQ A;  1CPY A;  3OR7 C;  4X1K B;  1NS1 A;  2DWE C;  1MAB G;  2JDI G;  3KG2 A;  2BE3 A;  5EK0 A;  2ZKO A;  4FZ1 A;  1YTF B;  1HWY A;  4I50 A;  1DF4 A;  3K9S A;  2ZXW B;  3OFN G;  1M90 W;  3HB3 B;  4I9Q A;  1N32 O;  5JCO A;  1H2K A;  4NXN O;  3HKC A;  3SYC A;  3SYA A;  3ZHT A;  2UUA O;  3ZRV A;  2VRZ A;  3JD4 A;  4GKK O;  1QLE C;  2YXY A;  5IY5 C;  2Y0P A;  3D3Q A;  1KMI Z;  3OUS A;  1HR0 B;  4DV2 O;  4B08 A;  1Y74 A;  2EIN C;  2FTK A;  1VQ6 V;  2R9I A;  1SQX H;  5LA6 A;  1M5I A;  4JZ2 A;  4FLU A;  3G71 V;  1VAR A;  3AG7 A;  4MW8 A;  4UCV A;  1IUR A;  5EZY A;  5EIB D;  4BAY A;  2HJD A;  4JI0 B;  5EC1 C;  4BWA A;  1XL6 A;  1N34 B;  2P22 C;  2OTL V;  3SPG A;  1BQ0 A;  1Z5V A;  2ZT9 B;  2JGD A;  3SPH A;  3T4D A;  3VQV A;  2CAZ C;  3K03 A;  4GCZ A;  1L1F A;  1R6N A;  1I94 O;  4U3J A;  2LGQ A;  4MSW C;  4FM2 A;  5L3G A;  2CTP A;  2BSK A;  1S5H C;  4X62 B;  5IJ9 B;  2UXX A;  4G27 B;  3CX5 F;  5FPR A;  4CH6 A;  4DV3 B;  4E4E A;  4B7E A;  4X65 O;  2PYL A;  2CE4 A;  4JI2 B;  5CA0 A;  1CP9 A;  1QCE A;  1ZL8 A;  2LGW A;  3B09 A;  5IYZ A;  1RFY A;  2OWO A;  4NXM O;  4BIO A;  3CPW U;  3FAV B;  1NJI W;  1X4T A;  5C93 A;  3BY6 A;  5LYJ B;  5LGT A;  1JJ2 U;  5CB4 B;  5KA6 A;  1FXK C;  4KFM A;  1BHA A;  3ZBH A;  1D5A A;  3RYI B;  4LF4 O;  3FYE B;  1H2N A;  3TXQ A;  4BIZ A;  5LP6 C;  1D2D A;  1ZWI C;  3JSL A;  4YJ2 B;  2EIM C;  1M56 C;  1YJW V;  4LCU C;  4YIO A;  1I7F A;  1PNM A;  3QNE A;  4LFA B;  5E1A C;  4CS3 A;  1U96 A;  3QG5 A;  3ZX6 A;  5LHG A;  5IWA B;  3EVK A;  1P84 F;  4RWU A;  4B3R O;  1M57 C;  4H44 B;  3HKD B;  3OGC C;  2UUC B;  2AHZ A;  1TAE A;  1IBL B;  3T1H O;  2QGN A;  1NVP B;  3WB1 A;  4PDM A;  2B1I A;  5C8Y A;  2AXT Z;  4PDV A;  3K5L A;  4JI5 B;  3JAS B;  3JAT A;  1AJP A;  4WFE A;  3CCQ V;  1G1X B;  2VS0 A;  3ZN1 A;  2QDO A;  4Z1M G;  1NR1 A;  4PDL A;  4CH3 A;  4CC6 A;  2DJV A;  2UXD B;  3E8H A;  4KP4 A;  5B5E Z;  4NKG B;  1BS3 A;  1DLB A;  1KU9 A;  4JYB A;  2E76 B;  1R6T A;  4UV9 A;  5E79 Z;  2R9R B;  3WFV A;  1JX9 A;  4YJ3 A;  3U11 A;  4B7K A;  3OMI B;  2HVK C;  4KHP B;  3P3P A;  2ILM A;  1F23 A;  3ZMZ A;  3IGA C;  5LOV B;  5LL6 Y;  5DN6 G;  3OEH G;  4F4L A;  2IU3 A;  2MK3 A;  2CK3 G;  1SZT A;  5BMV A;  2YEV A;  3ZHV A;  4YHH B;  2CGN A;  2PF4 E;  1KQS U;  4RQF A;  1SES A;  4K8X A;  3K08 A;  1YDX A;  4GYC B;  3ZMV A;  1S77 D;  4ABM A;  1VQ8 V;  3R65 A;  4FK5 C;  2IJK A;  2ZE6 A;  3VQX A;  4TT3 G;  4X66 B;  4MS2 A;  1P4R A;  5CBG A;  3J7A U;  1LUV A;  1YSC A;  3TK1 A;  4DR5 O;  2HEP A;  1KC8 W;  2WLN A;  2JS5 A;  1HNX B;  1NZ6 A;  2ZR2 A;  2UXB O;  1GMG A;  4DRX B;  2Y0I A;  2OCC B;  3OTO O;  5JH7 B;  5KUM A;  3NXS A;  5J2T B;  4R8C A;  4DV4 B;  4DV0 O;  2ZE8 A;  5KHK A;  1YJN V;  4F6R A;  2HLD G;  4MT8 A;  3RGB A;  1FFT B;  1XMQ B;  3WU2 Z;  3M99 B;  3KCY A;  4I55 B;  4WFF A;  1K4C C;  1IX9 A;  1NR7 A;  3K58 A;  2QM8 A;  3RW0 A;  2HFE C;  1Q6H A;  5LP6 A;  5EBL C;  2PY5 A;  3CJH B;  4WFH A;  1N0J A;  3O65 A;  1AI5 A;  5KUK A;  1Q90 D;  1QVG U;  1VMG A;  3AK3 A;  2VQF O;  1VQM V;  2Q9L A;  2QEX V;  1XNR O;  5CBH A;  2WA4 A;  4DW0 A;  3W7X A;  4JTA B;  3G67 A;  2IU0 A;  1N8R W;  2E75 B;  2QTO A;  1Y6X A;  3TGU H;  1FAF A;  3UCS C;  3K04 A;  4B3S B;  1TUB A;  1GN4 A;  1S3J A;  4PDR A;  4J41 A;  1DF5 A;  1VQ7 V;  2QR4 A;  1LUW A;  2CGO A;  3N2G B;  5IE9 A;  4CS2 A;  3JD3 A;  4GKJ B;  4DV6 B;  4LF5 B;  4EKW A;  5LXT B;  4JYA B;  4LNU A;  4PD4 F;  1FXV A;  1N33 O;  3WB2 A;  2GUZ A;  2XAJ A;  3AG2 B;  1V54 C;  1Z2G A;  1GH6 A;  1F4N A;  3E83 A;  3BAA A;  1V55 C;  1VQ9 V;  2EZP A;  3FX7 A;  3PJS K;  1FYJ A;  4IIJ A;  4JI6 B;  3HKB B;  3ZMU A;  3WG7 B;  5JQG B;  1R3L C;  3LDE A;  2QA4 V;  4I4T B;  1Y66 A;  1SQB H;  2XND G;  2FL4 A;  2OCC C;  1NTM H;  1ZLZ A;  2V7Q G;  1XMO B;  5KMG A;  1XL4 A;  1N0N A;  3RFR A;  1OCC B;  2YXH A;  4DO2 A;  4ZOL B;  4J42 A;  1XHZ A;  4FLZ A;  3ZRS A;  5JJE B;  5CA1 A;  1F51 A;  4IHJ B;  3LNN A;  3TJT A;  4GX0 A;  3ZMS A;  5F2V O;  1FJG O;  5IYB O;  1NI8 A;  1K4D C;  4X89 A;  4JTD B;  4X1I B;  5B1O A;  3QF7 A;  1EFR G;  2P4K A;  1W0K G;  2IM9 A;  4LP8 A;  4IT5 A;  1K8A W;  5LGU A;  5JWP A;  3CCJ V;  5JVD B;  3I56 V;  2LQT A;  2F43 G;  4H37 A;  3A8T A;  2LW1 A;  4GX2 A;  4NTW A;  1WA8 A;  3Q4H B;  4X20 B;  2YIB D;  4CH4 A;  3MHS C;  4JV5 O;  3D3I A;  4JYC A;  4O2A B;  1NTK H;  4DR2 O;  4CC5 A;  2QKC A;  4LWS A;  3SDL A;  4UV8 A;  2A79 B;  4HBN A;  1URF A;  4OPA A;  4K0K B;  3B77 A;  2WLL A;  4JF3 A;  1GN6 A;  4FLV A;  2ZDI A;  1K3E A;  4CH5 A;  2IJJ A;  1YXB A;  2X6A A;  4ASU G;  5LGN A;  2ZIM A;  3AG2 C;  2NN4 A;  2Y4U A;  3BHP A;  4YJ3 B;  2ZM6 B;  4JI4 B;  1RPO A;  2OT5 A;  4GLX A;  1R73 A;  3UT5 B;  4LF7 O;  1ZSP A;  1XQ8 A;  1JFF A;  4FM0 A;  1NTZ H;  2E5L B;  2B1G A;  4X64 O;  3CRM A;  1HNW B;  1D5N A;  1P7G A;  5B1N A;  4LFC O;  3RWR D;  4JAA A;  3JAK B;  2Y48 A;  2Q8V A;  1N36 B;  1VQN V;  2BOB C;  4I5S A;  3L74 H;  1DK1 A;  4JI8 O;  1Q5O A;  2UUB B;  1XNQ O;  2ZE7 A;  3DXR B;  3OTF A;  4DUY O;  4PI2 A;  4FIP C;  4DR4 O;  1MZE A;  3RT3 C;  2FML A;  1Q82 W;  1QHT A;  4MTF A;  3JAW B;  4K3A A;  3G6E V;  2XHB A;  4LC1 A;  5HFL A;  1Q3E A;  4E2L A;  2JEX A;  4HAM A;  5IJ0 B;  1BCC H;  4I9W A;  1HR0 O;  2WLI B;  3R66 A;  5J2U A;  1FKA O;  1EN4 A;  3DC5 A;  2PI5 A;  4H0L B;  1XEQ A;  1Y4M A;  3FB7 C;  3ZED A;  4MVO A;  5JJN B;  3CD6 V;  3CC7 V;  4P30 A;  1XI1 A;  2LJ2 A;  2F93 B;  4EB6 B;  3D36 C;  3GB7 C;  1SKV A;  4MTO A;  5BY1 A;  4QNH B;  1SS3 A;  5B1B B;  2R72 A;  1SQG A;  3PN1 A;  4MVQ A;  4MTG A;  4DV7 O;  5L3F A;  1NQT A;  5EC2 C;  4DK0 A;  1VF6 C;  2ITD C;  2Q0A A;  4TV8 B;  2H8P C;  2G38 A;  3LSU A;  3OM3 B;  2M6Y A;  4O4L B;  5H5N A;  3W7U A;  4X62 O;  3ZHR A;  4LFB B;  4PJ0 Z;  1GK9 A;  3RYF B;  3T2M A;  3SJQ C;  4TUY A;  2HHH B;  2DE0 X;  2OYQ A;  3AG3 B;  5LMU O;  2ITC C;  3T1Y B;  3CP1 A;  5KA5 A;  2F1M A;  4O4J A;  3ABM C;  1IBK B;  5GON A;  1JCH A;  1WN7 A;  5L3B A;  2XAF A;  3E35 A;  1F4M A;  4AI8 A;  4L8J A;  3ABT A;  3WB0 A;  3SR2 C;  4DV1 O;  4PA7 A;  3UQ8 A;  2ADP A;  3BCC H;  1U97 A;  2V4D A;  3LUT B;  1XBL A;  1HNZ B;  1HP8 A;  2P06 A;  5GTI Z;  3ABU A;  2DW4 A;  3B4S A;  2JJ1 G;  4B3T B;  3K0D A;  1H8E G;  2ADQ B;  3BRC A;  4XBF A;  2CH7 B;  4CBC A;  4LBE C;  4OGQ B;  1V9P A;  3OMA B;  4F6E A;  1AP6 A;  4UVC A;  4LFA O;  2W0F C;  4TV9 A;  3UM7 A;  2ZNJ A;  1W59 A;  2EIK B;  4TWK A;  3ZRW B;  1SQP H;  4YY3 O;  5EBW C;  4I0X B;  3S3X A;  2UU9 B;  3DC6 A;  5ITZ B;  1B06 A;  3E22 B;  2UUC O;  1VF7 A;  1E79 G;  2X7R B;  1ZTE A;  1MA1 A;  3BVO A;  3GWO A;  5BR8 O;  1Y76 A;  3P30 A;  1B04 A;  3OGI B;  1OCR C;  3ETE A;  2GBO A;  3F5W C;  2Q7G A;  3JAL B;  4FVM A;  4R7C A;  4LF8 O;  1JR9 A;  1PM9 A;  4JI7 O;  3N2K A;  1YVW A;  4MVR A;  3HKE B;  3X2Q C;  2VWJ A;  1JQ0 A;  4DUZ O;  3AG4 B;  1IBM B;  5EBM C;  4DYL A;  3H1L H;  4LR3 A;  2JIZ G;  2BTQ B;  1KKD A;  5LMN O;  4NYK A;  2KG7 B;  1PPJ H;  4W4K A;  3F7V C;  1N32 B;  4NXN B;  1WJZ A;  3DGE A;  2RMK B;  2UUA B;  3CEI A;  2IW5 A;  4GKK B;  1FD9 A;  3HR0 A;  1GM9 A;  2Q5Z A;  1GN2 A;  4PA3 A;  4DR3 O;  3H9V A;  2P6J A;  3FFQ A;  4H33 A;  4GZR B;  1ENV A;  3D36 A;  2GSM B;  1FFX B;  3ZJZ A;  2ARH A;  2ZXW C;  2QKS A;  4X66 O;  2KQX A;  3AG3 C;  4IL6 Z;  3MAQ A;  5LHI A;  1BSM A;  2ZIN A;  4PV1 B;  1VF6 A;  4FFB A;  5B1A B;  2N04 A;  4MW3 A;  4O4I A;  5EYP B;  1Q43 A;  1IXB A;  3SJA C;  1IVS A;  5KX5 A;  3FB8 C;  2PTM A;  1I94 B;  4DR1 O;  3CCL V;  1NH2 D;  4WFB V;  4RO2 A;  1MOF A;  4DV4 O;  2LO1 A;  1COW G;  4RAI A;  4WF9 V;  3JAR A;  1US6 A;  5KHH A;  4JAS A;  4OXS A;  5KAI Z;  4NXM B;  4R50 A;  1SA0 B;  5A9G A;  3P3N A;  2JK5 C;  2Q68 A;  4O2B A;  1NT2 B;  5FNV B;  3ZHS A;  1OHH G;  1FS0 G;  2V1D A;  4ZHQ B;  1Q81 W;  2Q73 A;  3K5N A;  4Q6G A;  1QNM A;  1AR4 A;  1IXM A;  2ETN A;  3RYH B;  1BGY H;  2W6J G;  2QM4 A;  1TA8 A;  3ETG A;  4HNA B;  4FLW A;  2ATK C;  2A9H A;  2B9Z A;  1J5E O;  1YIJ V;  2F66 C;  4B3R B;  3AG4 C;  4B3S O;  3BPZ A;  4DR6 B;  4ZI7 B;  1S76 D;  4UB8 Z;  3K0G A;  2BCC H;  2XOK G;  4MVM A;  2WLH A;  3L73 H;  2EJR A;  3ZRX A;  3E89 A;  3K06 A;  3L75 H;  2Q6A A;  5H2F Z;  4PA9 A;  3L71 H;  2WPD G;  1XDC A;  2DYS B;  1M9N A;  1W2B U;  4DV5 O;  3CCM V;  1FXK A;  1H2S B;  4O4H B;  3ASN B;  4JI3 B;  4WBN A;  1WP7 A;  2K1E A;  2XAS A;  1AR5 A;  2L35 A;  1WAZ A;  3GWK C;  3APQ A;  1SQF A;  2KKW A;  4EEQ A;  4X88 A;  1YF2 A;  1OCO B;  2W6I G;  3T4Z A;  3JD2 A;  3H1J H;  1RSO A;  1MMM A;  4UUJ C;  4X1K A;  5B1A C;  1O9G A;  4YIP A;  2P7T C;  2JEU A;  1L0L H;  4TQF A;  2D2C B;  5H9C A;  3RN4 A;  2KSD A;  3CYO A;  5B3S B;  5K1X A;  4LF6 B;  4GT1 A;  1HW7 A;  1DTO A;  4FLY A;  4XDK A;  1K7D A;  4UCR A;  4RUE A;  1JPX A;  1WPB A;  4I50 B;  3B2E E;  4BR6 A;  3ZHQ A;  3HKC B;  1O9H A;  4DR5 B;  2QWO B;  3STL C;  3CE2 A;  3EXA A;  5CBF A;  4J7Z A;  2UXB B;  2WLK A;  5FPO A;  4P2Z A;  5J9P C;  2Y69 B;  3OTO B;  3SPI A;  1KEC A;  3RBZ A;  3CC4 V;  1Y74 B;  4HYO A;  4G2K A;  2NNU A;  1YJ9 V;  1YCI A;  3E2E A;  5LA6 B;  2C2A A;  4L87 A;  1AIL A;  3IC7 A;  2PGG A;  1GO3 F;  4N23 A;  4TOI A;  5EZY B;  1THZ A;  3MD0 A;  5H6R A;  1QLN A;  3ZN0 A;  1K9M W;  1VQ5 V;  2YID A;  3G6B A;  1OJH A;  3JYC A;  2HG5 C;  5FL7 G;  1SQV H;  2JGD B;  3ETQ A;  2IJH A;  5IJ9 A;  4LF9 O;  4PHZ A;  2DYR B;  2Z3Y A;  4U3J B;  2UXN A;  1QU7 A;  1AR1 B;  2BSK B;  1Q6U A;  2PYJ A;  4NR1 A;  2F4V O;  2CDY A;  2NR5 A;  3OUF A;  1XNR B;  4MVU A;  5BXZ A;  5CA0 B;  3FAV A;  1ZL8 B;  5IYZ B;  3A0H Z;  4X9Q A;  4B3M B;  4MVS A;  1WLE A;  5LYJ A;  4HZ3 A;  3IAY A;  3RYC A;  5CB4 A;  4K0K O;  3H1K H;  1PP9 H;  1L8D A;  4GX1 A;  3GVM A;  3KZI Z;  5CA3 A;  3RYI A;  2QWN B;  3MHH C;  1QR9 A;  4TQD A;  1GTO A;  4UCU A;  3AG1 B;  4YJ2 A;  4NB5 A;  1AJQ A;  1Q86 W;  3C90 A;  1OCO C;  2Q7E A;  4R6Z A;  3OE7 G;  5D5Q A;  2EIJ B;  1JOY A;  1NVP D;  1OCZ B;  1MSW D;  1M93 A;  3HKD A;  5L3D A;  2HVJ C;  4D6T H;  2JS3 A;  2VQE O;  3E8G A;  1N33 B;  2UUB O;  1G4Y B;  2XTA A;  2VWK A;  1I5X A;  1GM8 A;  5DEC A;  1VQK V;  3FD9 A;  3E86 A;  4IYH A;  3SYP A;  1XOU A;  1ORQ C;  2RDC A;  1R1B A;  2CTW A;  1WP8 A;  3W7W A;  5JCO C;  3UO3 A;  2F95 B;  3JAS A;  5C8Y B;  5AG2 A;  1JA8 A;  3LDC A;  2HJF C;  1ZAU A;  2EBO A;  3JAT B;  2WLM A;  4WFA V;  4LH6 A;  3A2F A;  1H8H G;  2YS8 A;  4U7O A;  1T5E A;  2Y69 C;  2FB5 A;  1SZX A;  3CXH F;  2A7W A;  4AQY B;  5KHI A;  4OX9 B;  4DR7 O;  1VEW A;  4P9O A;  1JJO A;  2HKO A;  2Z5U A;  2ZE5 A;  1IDS A;  1EN5 A;  3JCZ A;  2UXC O;  1J95 A;  2P67 A;  4GUN A;  1PD3 A;  1DGS A;  5LOV A;  3FYI B;  4J80 A;  1NH2 B;  5L3C A;  4RUF A;  3WG7 C;  4DXW A;  1QLE B;  1KD1 W;  1BL8 A;  2LP7 A;  5FLX N;  2O57 A;  1RM1 B;  5IDJ A;  4MVZ A;  2A3Q A;  1FJG B;  5A2Q N;  2EIN B;  5KAF Z;  5BMV B;  5EIB C;  2YEV B;  4GX5 A;  1XRE A;  3FB6 C;  1AP5 A;  3T1Y O;  2BOC C;  1IBK O;  4BW5 A;  1OCC C;  2DWD C;  1BE3 H;  1YZB A;  4NVP A;  3RVY A;  2QWR B;  2P5O A;  2PI4 A;  4JAV A;  1Q8I A;  3CCR V;  4DRX A;  3JSN A;  3L72 H;  5JH7 A;  2PZS A;  3AEI A;  5J2T A;  2Q0O C;  3QVN A;  3APO A;  3B8N A;  1AI4 A;  1SF9 A;  4FMT A;  5D5P A;  2XAQ A;  4JV5 B;  1BT8 A;  3ASO B;  4F6R B;  1NBM G;  4JI0 O;  4I55 A;  1N34 O;  1QBZ A;  1OCZ C;  1K5Q A;  3JD1 A;  4RQE A;  3VBB A;  2P4V A;  3CJH A;  3HPL C;  4XDL A;  2DOS A;  3S3W A;  2IH3 C;  5LP6 B;  5GW7 A;  1WB7 A;  4J7K A;  2EIM B;  4DV3 O;  2YXL A;  3BA8 A;  1RP3 B;  3UKM A;  4JI2 O;  3CSX A;  3E8F A;  4LF7 B;  4FPP A;  1Z5W A;  1AB3 A;  1GM7 A;  4X64 B;  1SET A;  2A06 H;  1PL4 A;  3C3S A;  4LFC B;  3CCE V;  1M57 B;  3STZ C;  3F5T A;  1ZX3 A;  4UCT A;  1S72 V;  3W7T A;  1IBM O;  5B66 Z;  2NLJ C;  3DTU B;  3K5O A;  1UFI A;  1XHX A;  4MTX A;  4JI8 B;  5LHH A;  4QGP A;  1TUB B;  1XNQ B;  4DUY B;  2R9A A;  4CZZ A;  3N2G A;  4DR4 B;  1QQC A;  4JI1 B;  3SJC C;  2BTO A;  4D7S A;  1BQZ A;  1VIB A;  4JYY A;  2K9P A;  1MNG A;  3O9O A;  5IWA O;  2OIE A;  4OPH A;  4X8A A;  5LXT A;  1XIL A;  1RM1 C;  1I08 A;  1WPX A;  4DK1 A;  2D3O W;  1ARO P;  1IBL O;  4LNU B;  2H94 A;  4J9Z B;  2X6C A;  4J9Y B;  3SPC A;  2IJI A;  4Q20 A;  3IFX A;  2GUZ B;  3HKB A;  5KHJ A;  3KCX A;  4JI5 O;  3A0R A;  5JQG A;  4FM1 A;  2YC0 A;  4IGG A;  1E1Q G;  4IIJ B;  3ABK B;  2WSS G;  4I4T A;  4DV7 B;  2WAM A;  4PEL A;  2ZNI A;  3I55 V;  2QWP B;  2OCH A;  3G80 A;  3OAA G;  1UPG A;  5DED A;  3CXC U;  2UXD O;  3F7Y C;  2XAH A;  2QKA A;  1KYO F;  1R3I C;  3CRQ A;  1SRY A;  1B6Q A;  3K9A A;  2EZO A;  5KMG B;  4BW9 A;  2JGU A;  1RPR A;  3LDD A;  4ZOL A;  5LMU B;  4KHP O;  1F7Y A;  1TVK A;  3ASO C;  2GTA A;  5JJJ B;  5B1B C;  4QPK A;  2GV9 A;  3QTC A;  4KUM A;  3CCV V;  4AIL C;  3RYC B;  4DV1 B;  4IHJ A;  4EFB A;  4NTY A;  3CME V;  4PA6 A;  3VQW A;  5CA1 B;  1I5Y A;  1P7B A;  4YHH O;  1NKD A;  4DV2 B;  4H13 B;  4KXR A;  3JAM N;  3M8A A;  4X1I A;  1WB8 A;  3K57 A;  1GRJ A;  3L70 H;  1AJN A;  2EIL B;  1EBO A;  2ZQM A;  5L3E A;  5JVD A;  1FXH A;  2RNB A;  3KKY A;  4NTX A;  4YY3 B;  2Z0A A;  3LSS A;  1M1K W;  4XDJ A;  2QE7 G;  1HNX O;  4JPR A;  4DR6 O;  1NU1 H;  2Y4T A;  1CXZ B;  2HR3 A;  4FLT A;  4J11 A;  5BR8 B;  3CHX A;  1K92 A;  3Q4H A;  2QM7 A;  3B8M A;  3G4S V;  4X20 A;  4X1Y A;  2EJ7 A;  1WA8 B;  4O2A A;  3CRC A;  4LF8 B;  3CB2 A;  1H2M A;  4X65 B;  1AVM A;  4JI7 B;  1SQQ H;  1YI2 V;  4ZBM A;  1LNQ A;  1XMQ O;  1EN6 A;  2EIK C;  3ZS8 C;  4BIU A;  1IZ3 A;  3ABL B;  4LWS B;  2QSA A;  4DUZ B;  4JI3 O;  3H1H H;  3I5D A;  2WLL B;  2HP8 A;  5LMN B;  4CS4 A;  1EM1 A;  3J81 N;  3A0B Z;  4LF4 B;  5TIS Z;  3UT5 A;  1H2L A;  5IYD O;  3MDS A;  3IJ4 A;  3ABK C;  3THO A;  1JFF B;  1W0J G;  2EUL A;  3JAK A;  4DR3 B;  1OZ0 A;  4LF6 O;  4I7Z B;  2RCV A;  4A5U B;  4Z2W A;  4J7J A;  1QVF U;  2CTR A;  3DXR A;  3OEE G;  3SJB C;  4D7T A;  3CRR A;  1V54 B;  3T1H B;  1PV0 A;  1BZK A;  3N27 A;  3ICX A;  4TSF G;  1QR8 A;  5LBQ A;  1V55 B;  3BA9 A;  4UVB A;  5DM6 V;  3JAW A;  4JGS A;  3OMN B;  4QJF B;  2Q67 A;  2DMX A;  2B5U A;  5H6Q A;  5IJ0 A;  2WLI A;  4GKJ O;  1GN3 A;  3RVZ A;  4DV6 O;  4LF5 O;  2Q4P A;  4JYA O;  2JVD A;  5J2U B;  4DR1 B;  2WA3 A;  2AHY A;  2KB1 A;  3EFF K;  1PNK A;  1KUQ A;  2IH1 C;  4UB6 Z;  3EHB B;  4EB6 A;  1P49 A;  1VQ4 V;  3B40 A;  2ODM A;  2EIL C;  2RN9 A;  4JI6 O;  2WLJ A;  3SYO A;  2OTJ V;  4JTC B;  1YTF D;  4Z1V A;  2LFS A;  1CEZ A;  4TV8 A;  4UFZ A;  3AK1 A;  3J80 N;  1KKC A;  2ZCE A;  2Q69 A;  4O4L A;  4K8Z A;  4WFG A;  1XMO O;  4AHC A;  4FZ0 A;  1R3J C;  5IYC O;  3RYF A;  4LH7 A;  2AZ0 A;  2GTS A;  2P90 A;  4QE9 A;  4K35 A;  4UVA A;  4TUY B;  3LSQ A;  2XUM A;  4B3M O;  1J5E B;  5CN0 A;  1SER A;  4O4J B;  5GON B;  1G8M A;  3ZHU A;  5CMU A;  3ABL C;  2YUA A;  1K33 A;  1MSD A;  1VQL V;  3H01 A;  3U0Z A;  3OW2 U;  1BHB A;  2LFR A;  2ZDI C;  2CH7 A;  3TET A;  1L0N H;  2Q7H A;  1S5L Z;  3ZIA G;  2GHY A;  2YI9 A;  5KHG A;  5BZB A;  1KBH A;  2ZIO A;  4DV0 B;  1KB9 F;  3BAB A;  3JD0 A;  1BMF G;  1G6U A;  3ZRW A;  4TV9 B;  1SC5 B;  3T1C A;  4WCE V;  3NR7 A;  4I0X A;  3OR6 C;  5ITZ A;  3QO5 A;  2QWQ B;  4DV5 B;  1K34 A;  3E22 A;  3BFR A;  1Q6I A;  1I0H A;  1TGO A;  1AI6 A;  2EX3 A;  1VF5 B;  3VOU A;  1MG1 A;  1Y76 B;  3JAL A;  2YIA A;  3QO7 A;  3ZMT A;  1JMK C;  2AW9 A;  3QO8 A;  2YI8 A;  2VQF B;  1A32 A;  3SPJ A;  3SYQ A;  3JCU Z;  3HKE A;  2F23 A;  2ZR3 A;  3N2K B;  2DYS C;  4FFK A;  1WNS A;  2MW2 B;  2GDS A;  2RQ6 A;  4P9P A;  3CMA V;  4AQY O;  2BTQ A;  4OX9 O;  3M7M X;  3ASN C;  2XT9 A;  1B3Q A;  2KG7 A;  1PNL A;  4W4L A;  3E8B A;  1K73 W;  1GAX A;  1VQO V;  3CCS V;  4UCO A;  4UCS A;  2ZM6 O;  4JI4 O;  2FYU H;  1TVK B;  1Y67 A;  2E5L O;  2JJ2 G;  2YIC A;  3C3T A;  1HNW O;  4C7U A;  2DQ3 A;  1X59 A;  5K1P A;  3TXS A;  4IYI A; 
#chains in the Genus database with same CATH homology
 5KAI Z;  4UB8 Z;  4UB6 Z;  5B66 Z;  5H2F Z;  3JCU Z;  5B5E Z;  4PJ0 Z;  3A0H Z;  5GTI Z;  4IL6 Z;  5GTH Z;  5E79 Z;  2AXT Z;  5KAF Z;  3WU2 Z;  1S5L Z;  3A0B Z;  5TIS Z;  3KZI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...