5B5EZ

Crystal structure analysis of photosystem ii complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 26
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b5eZ00
3WU2Z 2AXTZ 5TISZ 5KAFZ 5B66Z 5H2FZ 3KZIZ 5B5EZ 3A0HZ 4PJ0Z 3JCUZ 1S5LZ 4IL6Z 5GTHZ 3A0BZ 5KAIZ 5E79Z 4UB8Z 4UB6Z 5GTIZ
chains in the Genus database with same CATH superfamily
2F95B 4JYCA 1DF5A 4JI6O 2Q6AA 1ZSPA 4X1IB 2BOCC 4JYYA 3B09A 3EXAA 1LR1A 2QKCA 4JTCB 2RCVA 4TV9B 4EEQA 1NT2B 4YY3B 4MTFA 5J2UA 3JCUZ 2GV9A 2JRIA 3CCRV 1N34B 1N36B 4PDLA 3OW2U 1D5NA 3JSNA 3F7YC 4LBEC 4RAIA 4O4HA 4FLVA 1JFFB 4F4LA 5K1PA 1NH2B 3CRAA 4QGPA 2N74A 3RBZA 1GMGA 4NTWA 2BE3A 5KAFZ 4IHJA 4A5UB 3BY6A 3D3QA 5GONA 3ZRSA 3U11A 2XAJA 3I5DA 1F23A 3CCQV 2AZ2A 1O9HA 5KHGA 1NTKH 4X64B 4B3RB 1L8DA 3P30A 2Q0OC 1PNMA 3K57A 3TJTA 1BZKA 4MT8A 4G27B 3LUTB 3B40A 5EIBD 3TXQA 4NTXA 4AI8A 3KKYA 1AROP 3L70H 1VQPV 5IJ9A 5LMUB 1M4UA 5KX5B 4JI3B 2B5UA 1NZ6A 2ZT9B 1N32B 2A79B 3HKEB 4JYAB 1JPXA 3QO7A 5KHKA 2KG7A 2P90A 2V7QG 3BAAA 3E22A 2EILC 1OHHG 3HR0A 4YXWG 4ZOLB 3WG7B 1VQOV 3CMAV 4C7UA 3NR7A 1K9MW 1I5XA 1W2BU 4NTYA 3H1KH 5LYJB 2AW9A 1XMOO 3SPIA 2DWDC 4LCUC 5H6QA 2BTQB 4MW8A 3OTOB 2HLDG 2YEVB 1Z5WA 5B3SC 4J7ZA 3UKMA 3CHXA 1FXKC 4KFMA 4TT3G 4BIZA 4J41A 1VIBA 2DMXA 4JI4O 2LW1A 4F6RB 1XL6A 5L3CA 2HKOA 3D3IA 4DR4O 5EBMC 3K3WA 1F4NA 3F5TA 5JH7B 2ZQMA 2QKAA 3DXRA 3CCSV 2JEXA 1H8HG 4HAMA 5FL7G 2ATKC 2ILMA 3OT7A 3UT5A 2ZE6A 1VQKV 2ZE5A 1H2LA 1SQVH 2QGNA 1Q5OA 2ODMA 3EHBB 3EVKA 2JVDA 2EX3A 4B3TB 3CXCU 4O4JA 2F93B 2BOBC 1XILA 4LF6O 3FAVA 5H2FZ 3O9OA 4FIPC 3AG4B 2EIMB 1MA1A 4DR3O 3K06A 5DM6V 4W4LA 3G67A 5J2UB 4UXNA 3CRQA 2FKXA 5E79Z 2GTSA 4LFAO 5FPOA 4LF4B 3H1LH 4O4HB 3OGIB 2Z0AA 3R65A 1GKFA 4PI0A 4E4EA 4O4IA 1HNWO 4I9WA 3RYHB 2V1DA 1KP3A 5GONB 1PNKA 1W0KG 2W0XA 2JJ2G 1I5YA 1I94O 3J81N 3ABMB 1R6TA 2DYSC 1XNQB 4FLXA 2ZINA 4DRXB 1IBMO 1GM8A 1KYOF 3K08A 1COWG 2A3QA 2JDIG 1GN2A 3ZBHA 3BCCH 3D8CA 3D36A 4NXMB 2OIGA 4MTXA 1I08A 3VQWA 5IJ9B 2NR5A 3ZMZA 4AQYO 4JZ2A 1NTZH 2KG7B 4GKJO 4H0LB 2P7TC 2HHHB 2QKSA 4G28B 3ASOB 4DW0A 5BZBA 3ZMVA 4DW1A 2LFRA 4BAYA 4DR7O 1LNQA 2IH1C 3CRRA 5EYPA 1SQXH 4PELA 5BR8O 1XMQO 2QTSA 2QM4A 4UCSA 4FMTA 1XOUA 3B4SA 2ZE7A 3E2EA 3WG7C 1QU7A 4FVMA 1Y6XA 2FMLA 2RDCA 4KHPO 4TUYA 5HFMA 1CXZB 1MSDA 1MABG 1J5EO 3CC2V 3LDEA 1YEWA 3WB0A 2P22C 1ZL8A 1ZAUA 3QG5A 3QTCA 4ZHQB 3CP1A 5IYCO 3WB1A 4DV1B 3MHHC 3ICXA 1NVPB 3ZRXA 1R73A 3CCUV 3FAVB 1L0LH 4QE7A 5H6RA 1J95A 4CS3A 1D5AA 2Q7GA 2QWRB 4O2AA 4MVSA 3DC5A 2UUCB 4YY3O 3ZCCA 4D6TH 4UCVA 2ARHA 3M99B 3SYQA 1N36O 1N34O 1D2DA 4DR5B 2X0LA 4J11A 3FKSG 4O4IB 1MZEA 1QR8A 2Q5ZA 2VRZA 2EIMC 3AG4C 2LGQA 3UQ8A 5DEDA 3SJAC 4OXSA 2QTOA 4X64O 4B3RO 1M1KW 3QF7A 5GW7A 3KZIZ 1EN6A 4JF3A 4X62B 2Q0AA 4KXRA 1AP6A 1VMGA 1XDCA 3L9DA 3N2GB 4AILC 2N04A 2QEXV 4P2ZA 1KC8W 4JI3O 3W7UA 3ABMC 5KHHA 1RPOA 1N32O 4JYAO 4R6ZA 1VQ5V 1ZX3A 3OTFA 5DECA 2L6LA 5C93A 4QPJA 3T1HB 4H33A 4UCTA 2P67A 1QLEB 3AG1B 4U3FH 2XT9A 5LXTA 2QWOB 1F51A 3LNNA 2IJIA 1QR9A 2F43G 4UCUA 2H94A 1OV9A 3OTOO 1R3KC 1TUBA 1WA8A 2YXYA 4PDRA 2HR3A 1O9GA 3E8BA 1UJWB 3OMAB 2PYJA 3QO8A 5B66Z 3SPGA 1PV0A 1YTFD 3JAMN 4HYOA 5IYDO 1YIJV 4EKWA 5JJEB 4JV5B 3OR6C 2Z3YA 3ASOC 3J7AU 2QE7G 2ZM6B 2YIDA 4IGGA 4K35A 2OTJV 5EBLC 1VQ4V 1QVFU 2R9AA 1Y76B 2ZDIA 1YI2V 5B5EZ 2F4VB 1ZL8B 5CMUA 3BA8A 3OGCC 3JD4A 2X6CA 4B3TO 1K5QA 4RO2A 2UXBB 2QM7A 2UUAB 3E8FA 1URFA 4MTOA 2QDOA 2QR4A 3K03A 4DR3B 4PDMA 4DK1A 2JEUA 1R1BA 1X4TA 3K9AA 1XL4A 1PPJH 1Q6IA 4O2AB 2PUSA 1P7BA 4ZI7A 2BCCH 1X59A 2D3OW 3K9SA 4DV2B 3SPCA 1SQGA 2AHYA 2OCHA 4LF4O 2EZPA 3QNEA 3BHPA 3F7VC 4UV9A 3EFFK 3OFNG 2Q73A 4DV6B 1Y74A 1A32A 2RJZA 2FB5A 3P32A 4YHHB 5LGTA 1RFYA 3JSLA 2IJJA 3ZX6A 1SQBH 2PI4A 4PDVA 4FLZA 2YIBA 3VQVA 1M93A 3AEIA 2ITCC 3VQYA 1XNQO 4UCOA 1P49A 3ETDA 4GX5A 4X1YB 1G6UA 3T2MA 2WLJA 2EILB 1S5LZ 3H1HH 1AI4A 1AJQA 1JQ0A 5CA3A 3BPZA 4QE9A 1NBMG 4F6EA 4QNHB 1S5JA 2ETNA 4GT1A 4J9YB 4LWSA 1P4RA 4NXMO 4JAVA 5B3SB 1AI7A 4X88A 2KKWA 1FXKB 4IIJA 3RW0A 1F4MA 2XAGA 5JVDA 4KP4A 2PY5A 2JGDB 2LGWA 1WPBA 4NB5A 2HHHO 3JD2A 4L87A 1N0JA 5CB4A 5LXTB 2WWWA 4J7JA 1YCIA 2QWPB 4LR3A 4FLTA 1WA8B 1JJOA 1AI5A 2P5OA 1YITV 1JCHA 3APOA 2LJ2A 2IJHA 3CMEV 1BQ0A 4JAUA 4JTDB 4TWKA 3U0ZA 1JJ2U 1QLEC 1MNGA 1K97A 3AG1C 3JAKA 3C3TA 2UXXA 1L1FA 3CC4V 3IAYA 4Z1MG 2W6IG 4BW5A 1NJIW 2ZR3A 2FYUH 1N4CA 3ZHRA 5H9CA 3DGEA 4ABMA 3CS5A 1WB7A 4FLUA 1DK1A 2DQ0A 2EBOA 1E1RG 2FL4A 3CJHA 3E35A 4DV1O 3HKBA 3AG7A 3P3PA 2C2AA 4I55A 1S0VA 3HKCB 5LHHA 2ZXWB 1AILA 2ITDC 4OPAA 4LC1A 2DYSB 3FD9A 3IGAC 3MAQA 3LSQA 3B77A 1XNRB 2UUCO 1LUVA 1S77D 4DR5O 5KMGB 1Y74B 1IVSA 4J9ZB 3DC6A 3ZJZA 4TQFA 1Q3EA 2R9IA 2W6JG 1WPXA 4LNUA 1TVKB 2OYQA 3GVMA 4UB6Z 5D5QA 4D7TA 4X62O 4DR6B 2M6YA 5LOVA 1KBHA 4YJ2B 1MZFA 3KCXA 1FFTB 2YUAA 3MD0A 4FFBA 2N05A 1FFXA 1P7GA 4UCRA 5JVDB 1R3JC 1OJHA 1MG1A 1R3LC 5CN0A 5E1AC 4MVOA 3T1HO 2CTQA 5CB4B 1RM1C 2FTKA 1EM1A 4CH3A 3JD0A 2GDSA 3FB8C 1ZTEA 1NKDA 4J42A 4J7KA 5EC2C 2JS3A 3CWBH 1PD3A 2OT5A 1RP3B 1ZUQA 2H8PC 1DLBA 3W7TA 3JD3A 1VF7A 2UXNA 5J2TA 3OR7C 4JV5O 3C3SA 1VQMV 3JAKB 4MS2A 3E89A 4U7OA 3THOA 4LFCB 2ZM6O 1ZWIC 3W7WA 3ZMTA 4Z1VA 5L3DA 4DR2O 2DQ3A 1YZBA 2R9RB 1K7DA 5JWPA 1FKAO 4K8ZA 1GRJA 2RQ6A 5KA5A 3SJCC 2YSUB 3CRCA 3BABA 4WBNA 2A0LA 2Q7HA 4I5SA 4FFKA 4JPRA 1VEWA 5C8YA 3SJQC 1EZJA 4WCEV 2F4VO 1WP8A 5CBHA 1AR5A 4I7ZB 1WP7A 3WB2A 2YICA 2XOKG 1BHBA 4DK0A 2UXBO 2UUAO 2L35A 4X66O 2A06H 4I0XA 1NR1A 1VARA 5A2QN 2E74B 1BMFG 3BVOA 1E1QG 4EFEA 1KP2A 3J80N 4DV2O 2X6AA 4K3AA 3K5MA 1M5IA 4U3JA 4BWAA 1V55B 2MK3A 1I0HA 4DV6O 2CTWA 4IHJB 2E5LO 4YHHO 2ZXWC 3N27A 4W4KA 3JATA 4NXNB 1K4CC 1TUEB 4JAAA 4LNUB 5EBWC 4UVCA 5EZYA 2CUGA 3O65A 3JASA 3FFQA 2DYRB 1K8AW 3UO3A 2M7WA 4QPKA 4MVZA 4R50A 5LOVB 1K34A 3LDCA 3IC9A 4ICGA 4IT5A 2VWJA 1NH2D 4X8AA 3G4SV 2OTLV 4JASA 2DOSA 3U10A 2LW7A 3L72H 2JGUA 5CA0A 5JQGA 4BW9A 1QVGU 2WLLA 3W7XA 3ZEDA 1YJNV 2YIBD 3JD1A 1M57B 3E22B 3BEHA 4B7KA 3FYEB 1BE3H 3RYIA 3W7SA 2JK5C 2XTAA 2P6JA 1HNZB 2ZNJA 3K5LA 3RYFA 1PL0A 3ETEA 3N2KA 1GH6A 4RUEA 1R6NA 1TAEA 3WFVA 4JYBA 2X7RB 1HP8A 4JI8B 3ZRWA 3IJ4A 4O2BA 5J9PC 3DXRB 2XAFA 3VBBA 1SC5B 5IJ0A 1RPRA 2Y4TA 2B1GA 3UT5B 2PI5A 5BXZA 2CTPA 2EZOA 5KLVH 1BS3A 4WBNB 3LNMB 3UO2A 3ZIAG 4EB6A 5C8YB 4DV5B 2QJ1A 4O4JB 4GKKB 2DN9A 4PJ0Z 1THZA 1EFRG 4I0XB 1H2KA 3SDLA 3A0BZ 1OCCB 2GTAA 2AGAA 2JS5A 3BFRA 3VQXA 2HJDA 5KHJA 3K5NA 1SRYA 4XBFA 3Q4HA 4K8XA 1XNRO 1Z5VA 3OAAG 4IYIA 1K73W 3FB5C 1OCOB 2Y4UA 1JX9A 2WPDG 3H01A 2KSDA 4TSFG 5IY5B 1K92A 4UVBA 1BCCH 3P3NA 4OX9B 1WNSA 5LP6A 3GWKC 1T5EA 1ENVA 1GN3A 2GHYA 2WSSG 3LSUA 1U97A 1B04A 5EZYB 1G8MA 3JASB 1B6QA 2UUBB 2WLHA 3K0DA 3T4ZA 1Q8IA 1V55C 4YIOA 1JOYA 4EFBA 4DR6O 1W59A 4JI7B 1MMMA 2BSKA 4NYKA 3H1IH 1EN4A 1FPOA 5CA0B 1QNMA 3AG3B 2WLLB 4DV7B 2DYRC 3RYIB 1RSOA 2OIEA 1SETA 5GTHZ 3JARA 3RYFB 1ROPA 1FAFA 1JMKC 2E76B 1IXBA 5EYPB 4BIUA 3N2KB 2UU9B 3SR2C 3SGIA 2WLKA 2YDEA 3BRCA 2XAQA 2LFSA 5BMVA 3CRMA 1M57C 2UXCB 4ASUG 3QO5A 2EJ7A 3ZRWB 4O2BB 3JYCA 4DR2B 4RWUA 4BIOA 4PA4A 5IJ0B 4DV4B 2Q9LA 4LFCO 4Q6GA 4TUYB 5IWAB 4QIWF 2CDYA 5JCOA 1V54B 3G6EV 1DF4A 4WF9V 1M9NA 4DXWA 2Q4PA 2Y0PA 1BGYH 1SESA 4LF5B 1EN5A 2Y48A 2YS8A 5K1XA 4X66B 1IBLO 5L3EA 2MW2B 1GM9A 3K59A 5FPRA 3STZC 4JI0B 4AHCA 3B8MA 1Q90D 3SYAA 4HBNA 1K33A 3ETGA 3Q4HB 4XDKA 3JCZA 5LMNB 1Q6UA 3SPJA 4DO2A 1VQNV 4X1KA 1FYJA 4FZ0A 4LP8A 1HW7A 2VQFB 4PD4F 4X1IA 3SYOA 1NQTA 1SZTA 1KU9A 2E5LB 4TV9A 5LP6B 1NVPD 4PA7A 1OCCC 1WN7A 2ADPA 1I7FA 4NXNO 1UFIA 3ASNC 3VOUA 3RVYA 5CA1A 4HNAA 4IL6Z 1IXMA 2E75B 2B1IA 3CPWU 1DGSA 1OCOC 2LQTA 1PP9H 1RM1B 2P06A 2HFEC 3E86A 3H1JH 4JGSA 1XUQA 5IY5C 2BSKB 1SS3A 4LF7B 4GX1A 3B8NA 1SF9A 4NKGB 3SYCA 4B7EA 3T1YB 3RN4A 3TK1A 2Y69B 3ABLB 3ZMUA 1VF6A 5FLXN 1SQFA 4FPPA 1GK9A 3D36C 1HNZO 1Y67A 3JARB 4GX2A 1P84F 1PNLA 1TUBB 3OM3B 2CGNA 3AG3C 2WLNA 4LH6A 5JJJB 3ML0A 4JI2B 3CXHF 3S3XA 5BMVB 1VF5B 2LO1A 2ADQB 2OCCC 4JI8O 1VP7A 4MVUA 4N21A 2BTQA 2IU3A 3SJBC 2AXTZ 1SQQH 5ITZA 2NNUA 2CK3G 1H2GA 3UM7A 4Q20A 3UCSC 1HNXB 1SA0A 5JH7A 4O4LA 2VWKA 1SERA 3G6BA 1JR9A 5BY1A 3OUSA 4DV5O 2WA3A 1HR0B 3S3WA 4GKKO 3WU2Z 3MDSA 2Q68A 3JAWA 1OCRC 4WFEA 5IYBO 4WFGA 4PHZA 1GN4A 3HKDA 4N23A 2BTOA 1V54C 4CS2A 4G2KA 1Y66A 5CBFA 1YF2A 4ZI7B 4J10A 4RUFA 1Q82W 4I50A 3K0GA 4FJCC 2XASA 3FB7C 1IURA 4X1KB 3TGUH 1NS1A 4P9PA 2DWEC 4QJFB 4U7NA 1SZXA 1KD1W 2A9HA 1GAXA 2Y0IA 2QM8A 1QCEA 1EBOA 4OX9O 1K3EA 2JJ1G 3L74H 1NTMH 4DV0B 4H13B 4PA9A 1F7YA 3ETQA 2HVJC 5CA1B 1AVMA 4HNAB 1YHQV 2EIJB 2UUBO 3RYHA 3I55V 1Q43A 4UFZA 3AG2B 4LWSB 4PA6A 3PN1A 2AHZA 4JI7O 4JI5B 1NU1H 1XHZA 5LP6C 5CBGA 3GWOA 4DRXA 3SPHA 4IIJB 5EIBC 2R72A 3K79A 4LF8B 4DV7O 3A8TA 1VQ7V 1M90W 4X89A 3ABTA 1MSWD 4UVAA 1FXVA 3ABKB 2EINB 3MHSC 2VQEB 4TQDA 5L3GA 1FJGB 5B1OA 2IM9A 5D5PA 4BR6A 2UU9O 4LF9B 4PA3A 2CH7A 5GTIZ 2PZSA 2Y69C 3ABLC 5LHGA 2IJKA 2R70A 2UXCO 2F1MA 2GBOA 3ZMSA 2QSAA 1AI6A 1K4DC 3TETA 4DV4O 5ITZB 4CC6A 5JJNB 1H2MA 5IWAO 3ABUA 1PM9A 2EJRA 4TOIA 4X65B 4H44B 1SA0B 4DUZO 4CZZA 4KL1A 4O4LB 2Q7EA 3ZS8C 4LF5O 1IBLB 5KA6A 1QBZA 3CJHB 3K5OA 3HKBB 4CS4A 4I55B 3JAWB 2B9ZA 3CE2A 2ZIMA 3HKDB 4R8CA 4FM1A 5JCOC 4J80A 2F66C 4JI0O 1HWYA 3RYCA 1N33B 4I50B 4ZHQA 5IYZA 2ZDIC 5B1BB 3OMNB 1CP9A 3ZHQA 3OEHG 3APQA 4PI2A 1H2NA 5LMNO 4DV3B 4HZ3A 2PF4E 1W0JG 4WFHA 3CB2A 3F5WC 2VQFO 3OD4A 2DJVA 3NXSA 4K0KO 4OPHA 1US6A 1H2SB 1WLEA 2WA4A 1MOFA 3CEIA 3OUFA 1KMIZ 2WLIA 3M8AA 2W0FC 3LSSA 1AJPA 4CH5A 5AG2A 1LUWA 2QA4V 2NN4A 2ZE8A 1FS0G 4B3SB 3M7MX 1KQSU 3CSXA 3STLC 2UXDB 3ZHTA 1QLNA 5LBQA 2DE0X 3SYPA 4FFBB 1CPYA 4LF7O 2Q69A 5LGNA 3CYOA 1FFXB 4LH7A 2YXHA 1OCZB 3T1YO 1XHXA 2KB1A 2QWNB 2IU0A 3N2GA 3CCMV 1AP5A 2EIJC 3RFRA 2Q67A 1N8RW 5IE9A 1JA8A 3AG2C 1EZVH 4LFBB 4FLYA 2YXLA 1Q86W 1G1XB 1YTFB 1M56B 1IBKB 4DUYO 4JZGA 1OZ0A 2YI9A 5LA6A 2CH7B 4NR1A 1VQ9V 1B06A 4JI2O 5LL6Y 2ZIOA 3KCYA 1GM7A 1VF6C 5J2TB 1KKCA 3E83A 3TCUA 4B08A 1H8EG 5B1NA 1KUQA 4B3MB 3ABKC 2EINC 3OMIB 4UUJC 1BHAA 2E3CA 3AK1A 3DTUB 5A9GA 3G80A 5LGUA 1QHTA 1PKXA 4RQEA 3B2EE 1HNXO 2K9PA 1YJ9V 1GN6A 1R3IC 4JI1O 2CTRA 1HR0O 3A0RA 4R7CA 4MSWC 3DSQA 2CAZC 4D7SA 4YJ3A 1KECA 1BSMA 1Y76A 4DR1B 2IBZH 1VQ6V 2YC0A 3K04A 2O57A 5H5NA 5TISZ 3RYCB 1SQPH 4TV8A 5IYZB 3ASNB 2VS0A 2ZNIA 1BQZA 3CCEV 4JI6B 5B1AB 5IT9N 2KQXA 4U3JB 3A2FA 1S72V 2NLJC 3X2QB 1Y4MA 2HG5C 3ZN0A 2AZ0A 2GSMB 4UV8A 1S5HC 3IFXA 4L8JA 3JATB 1AJNA 3H9VA 2WLIB 5B1BC 4DV0O 2ZKOA 4X20A 5EC1C 1E79G 1GO3F 5KHIA 3RWRD 2XAHA 4DYLA 2K1EA 1AR4A 2JIZG 4KUMA 2RN9A 2PTMA 4JI5O 4X1YA 3FYIB 1HDJA 4OGQB 1AR1B 5JQGB 4I9QA 4LF8O 1G4YB 2PYLA 2V4DA 2RNBA 1TGOA 3RVZA 1R6KA 4CH6A 2EIKB 2RMKB 2OCCB 4MVMA 1IX9A 2CGOA 3L71H 4P30A 5L3FA 3CCVV 5LMUO 1VQ8V 3R66A 3ZRVA 4GX0A 1YSCA 1SKVA 1FXKA 1GTOA 2EULA 1CEZA 2VQEO 2IH3C 1FJGO 1WAZA 1KKDA 2JGDA 5LA6B 4LF9O 1L0NH 4GLXA 1KB9F 1OCZC 2OWOA 1XREA 3C90A 5KUMA 1XMOB 3CD6V 5KUKA 2P4KA 3L75H 5FNVA 4RQFA 2A7WA 1OCRB 5EK0A 4FLWA 4MVRA 1M56C 4JI4B 2Z5UA 2IW5A 4DR4B 4X9QA 5DN6G 4DUZB 3E8GA 1XBLA 4X65O 3ZHVA 4EB6B 1IDSA 3OEEG 4FK5C 1K5SA 2HVKC 2GUZA 2HJFC 4YJ3B 1S3JA 4GZRB 4ZIBA 1ORQC 2QWQB 1ZLZA 4TV8B 1B3QA 1N33O 1IZ3A 4LF6B 3JALA 2G38A 1N0NA 1NI8A 4I4TA 5LHIA 4DV3O 1FXHA 1XQ8A 4CBCA 1V9PA 3HKCA 5KAIZ 4K0KB 5L3BA 2P4VA 3FX7A 5HFLA 3CX5F 2X6BA 1YJWV 3K58A 4ZKIA 4LFAB 3FB6C 2DW4A 3BA9A 2Q8VA 4WFFA 1Q6HA 1DTOA 1JFFA 4CH4A 4Z2WA 4X20B 2CE4A 1NR7A 1HNWB 5KMGA 5B1AC 1QQCA 4B3SO 3IC7A 2XNDG 1I94B 3HPLC 3X2QC 4XDJA 2UXDO 1BL8A 1IBMB 2LP7A 4FZ1A 1BT8A 1TVKA 2ZCEA 2XUMA 4MVQA 3ZHUA 1Q81W 2D2CB 4MTGA 4IYHA 3QVNA 1FD9A 1XI1A 2F23A 3AK2A 1RSOB 4AQYB 4YJ2A 4XDLA 3HB3B 5KX5A 3LDDA 4LFBO 2XHBA 3PJSK 3OE7G 4YIPA 2H3OA 3L73H 2HEPA 3GB7C 3HKEA 3T1CA 4DUYB 4GKJB 1IBKO 2ZR2A 1WJZA 5F2VO 4ZOLA 4JTAB 2ZD9A 4MW3A 3RGBA 4GYCB 4DR7B 5LYJA 2EIKC 4WFBV 3RT3C 4CC5A 4PV1B 5FNVB 4FM0A 1JVMA 5BR8B 2YEVA 1XMQB 4NVPA 4B3MO 2YIAA 3ZN1A 3A0HZ 4F6RA 1Q7YW 3ZHSA 4E2LA 4FM2A 1H38A 1PL4A 4P9OA 3G71V 2WLMA 1VQLV 1UPGA 1YDXA 2PGGA 5IDJA 4JI1B 1S76D 2YI8A 1TA8A 3CC7V 3TXSA 4UB8Z 3CCJV 4ZBMA 2WAMA 4KHPB 4WFAV 1WB8A 1XEQA 1YXBA 1U96A 3E8HA 1J5EB 2GUZB 4GUNA 4H37A 1Z2GA 3I56V 4DR1O 3AK3A 1YVWA 1AB3A 2HP8A 3CCLV 3T4DA 3JALB 3KG2A 4I4TB 4GCZA
chains in the Genus database with same CATH topology
3WU2Z 2AXTZ 5TISZ 5KAFZ 5B66Z 5H2FZ 3KZIZ 5B5EZ 3A0HZ 4PJ0Z 3JCUZ 1S5LZ 4IL6Z 5GTHZ 3A0BZ 5KAIZ 5E79Z 4UB8Z 4UB6Z 5GTIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 Z;  2AXT Z;  5TIS Z;  5KAF Z;  5B66 Z;  5H2F Z;  3KZI Z;  5B5E Z;  3A0H Z;  4PJ0 Z;  3JCU Z;  1S5L Z;  4IL6 Z;  5GTH Z;  3A0B Z;  5KAI Z;  5E79 Z;  4UB8 Z;  4UB6 Z;  5GTI Z; 
#chains in the Genus database with same CATH topology
 2F95 B;  4JYC A;  1DF5 A;  4JI6 O;  2Q6A A;  1ZSP A;  4X1I B;  2BOC C;  4JYY A;  3B09 A;  3EXA A;  1LR1 A;  2QKC A;  4JTC B;  2RCV A;  4TV9 B;  4EEQ A;  1NT2 B;  4YY3 B;  4MTF A;  5J2U A;  3JCU Z;  2GV9 A;  2JRI A;  3CCR V;  1N34 B;  1N36 B;  4PDL A;  3OW2 U;  1D5N A;  3JSN A;  3F7Y C;  4LBE C;  4RAI A;  4O4H A;  4FLV A;  1JFF B;  4F4L A;  5K1P A;  1NH2 B;  3CRA A;  4QGP A;  2N74 A;  3RBZ A;  1GMG A;  4NTW A;  2BE3 A;  5KAF Z;  4IHJ A;  4A5U B;  3BY6 A;  3D3Q A;  5GON A;  3ZRS A;  3U11 A;  2XAJ A;  3I5D A;  1F23 A;  3CCQ V;  2AZ2 A;  1O9H A;  5KHG A;  1NTK H;  4X64 B;  4B3R B;  1L8D A;  3P30 A;  2Q0O C;  1PNM A;  3K57 A;  3TJT A;  1BZK A;  4MT8 A;  4G27 B;  3LUT B;  3B40 A;  5EIB D;  3TXQ A;  4NTX A;  4AI8 A;  3KKY A;  1ARO P;  3L70 H;  1VQP V;  5IJ9 A;  5LMU B;  1M4U A;  5KX5 B;  4JI3 B;  2B5U A;  1NZ6 A;  2ZT9 B;  1N32 B;  2A79 B;  3HKE B;  4JYA B;  1JPX A;  3QO7 A;  5KHK A;  2KG7 A;  2P90 A;  2V7Q G;  3BAA A;  3E22 A;  2EIL C;  1OHH G;  3HR0 A;  4YXW G;  4ZOL B;  3WG7 B;  1VQO V;  3CMA V;  4C7U A;  3NR7 A;  1K9M W;  1I5X A;  1W2B U;  4NTY A;  3H1K H;  5LYJ B;  2AW9 A;  1XMO O;  3SPI A;  2DWD C;  4LCU C;  5H6Q A;  2BTQ B;  4MW8 A;  3OTO B;  2HLD G;  2YEV B;  1Z5W A;  5B3S C;  4J7Z A;  3UKM A;  3CHX A;  1FXK C;  4KFM A;  4TT3 G;  4BIZ A;  4J41 A;  1VIB A;  2DMX A;  4JI4 O;  2LW1 A;  4F6R B;  1XL6 A;  5L3C A;  2HKO A;  3D3I A;  4DR4 O;  5EBM C;  3K3W A;  1F4N A;  3F5T A;  5JH7 B;  2ZQM A;  2QKA A;  3DXR A;  3CCS V;  2JEX A;  1H8H G;  4HAM A;  5FL7 G;  2ATK C;  2ILM A;  3OT7 A;  3UT5 A;  2ZE6 A;  1VQK V;  2ZE5 A;  1H2L A;  1SQV H;  2QGN A;  1Q5O A;  2ODM A;  3EHB B;  3EVK A;  2JVD A;  2EX3 A;  4B3T B;  3CXC U;  4O4J A;  2F93 B;  2BOB C;  1XIL A;  4LF6 O;  3FAV A;  5H2F Z;  3O9O A;  4FIP C;  3AG4 B;  2EIM B;  1MA1 A;  4DR3 O;  3K06 A;  5DM6 V;  4W4L A;  3G67 A;  5J2U B;  4UXN A;  3CRQ A;  2FKX A;  5E79 Z;  2GTS A;  4LFA O;  5FPO A;  4LF4 B;  3H1L H;  4O4H B;  3OGI B;  2Z0A A;  3R65 A;  1GKF A;  4PI0 A;  4E4E A;  4O4I A;  1HNW O;  4I9W A;  3RYH B;  2V1D A;  1KP3 A;  5GON B;  1PNK A;  1W0K G;  2W0X A;  2JJ2 G;  1I5Y A;  1I94 O;  3J81 N;  3ABM B;  1R6T A;  2DYS C;  1XNQ B;  4FLX A;  2ZIN A;  4DRX B;  1IBM O;  1GM8 A;  1KYO F;  3K08 A;  1COW G;  2A3Q A;  2JDI G;  1GN2 A;  3ZBH A;  3BCC H;  3D8C A;  3D36 A;  4NXM B;  2OIG A;  4MTX A;  1I08 A;  3VQW A;  5IJ9 B;  2NR5 A;  3ZMZ A;  4AQY O;  4JZ2 A;  1NTZ H;  2KG7 B;  4GKJ O;  4H0L B;  2P7T C;  2HHH B;  2QKS A;  4G28 B;  3ASO B;  4DW0 A;  5BZB A;  3ZMV A;  4DW1 A;  2LFR A;  4BAY A;  4DR7 O;  1LNQ A;  2IH1 C;  3CRR A;  5EYP A;  1SQX H;  4PEL A;  5BR8 O;  1XMQ O;  2QTS A;  2QM4 A;  4UCS A;  4FMT A;  1XOU A;  3B4S A;  2ZE7 A;  3E2E A;  3WG7 C;  1QU7 A;  4FVM A;  1Y6X A;  2FML A;  2RDC A;  4KHP O;  4TUY A;  5HFM A;  1CXZ B;  1MSD A;  1MAB G;  1J5E O;  3CC2 V;  3LDE A;  1YEW A;  3WB0 A;  2P22 C;  1ZL8 A;  1ZAU A;  3QG5 A;  3QTC A;  4ZHQ B;  3CP1 A;  5IYC O;  3WB1 A;  4DV1 B;  3MHH C;  3ICX A;  1NVP B;  3ZRX A;  1R73 A;  3CCU V;  3FAV B;  1L0L H;  4QE7 A;  5H6R A;  1J95 A;  4CS3 A;  1D5A A;  2Q7G A;  2QWR B;  4O2A A;  4MVS A;  3DC5 A;  2UUC B;  4YY3 O;  3ZCC A;  4D6T H;  4UCV A;  2ARH A;  3M99 B;  3SYQ A;  1N36 O;  1N34 O;  1D2D A;  4DR5 B;  2X0L A;  4J11 A;  3FKS G;  4O4I B;  1MZE A;  1QR8 A;  2Q5Z A;  2VRZ A;  2EIM C;  3AG4 C;  2LGQ A;  3UQ8 A;  5DED A;  3SJA C;  4OXS A;  2QTO A;  4X64 O;  4B3R O;  1M1K W;  3QF7 A;  5GW7 A;  3KZI Z;  1EN6 A;  4JF3 A;  4X62 B;  2Q0A A;  4KXR A;  1AP6 A;  1VMG A;  1XDC A;  3L9D A;  3N2G B;  4AIL C;  2N04 A;  2QEX V;  4P2Z A;  1KC8 W;  4JI3 O;  3W7U A;  3ABM C;  5KHH A;  1RPO A;  1N32 O;  4JYA O;  4R6Z A;  1VQ5 V;  1ZX3 A;  3OTF A;  5DEC A;  2L6L A;  5C93 A;  4QPJ A;  3T1H B;  4H33 A;  4UCT A;  2P67 A;  1QLE B;  3AG1 B;  4U3F H;  2XT9 A;  5LXT A;  2QWO B;  1F51 A;  3LNN A;  2IJI A;  1QR9 A;  2F43 G;  4UCU A;  2H94 A;  1OV9 A;  3OTO O;  1R3K C;  1TUB A;  1WA8 A;  2YXY A;  4PDR A;  2HR3 A;  1O9G A;  3E8B A;  1UJW B;  3OMA B;  2PYJ A;  3QO8 A;  5B66 Z;  3SPG A;  1PV0 A;  1YTF D;  3JAM N;  4HYO A;  5IYD O;  1YIJ V;  4EKW A;  5JJE B;  4JV5 B;  3OR6 C;  2Z3Y A;  3ASO C;  3J7A U;  2QE7 G;  2ZM6 B;  2YID A;  4IGG A;  4K35 A;  2OTJ V;  5EBL C;  1VQ4 V;  1QVF U;  2R9A A;  1Y76 B;  2ZDI A;  1YI2 V;  5B5E Z;  2F4V B;  1ZL8 B;  5CMU A;  3BA8 A;  3OGC C;  3JD4 A;  2X6C A;  4B3T O;  1K5Q A;  4RO2 A;  2UXB B;  2QM7 A;  2UUA B;  3E8F A;  1URF A;  4MTO A;  2QDO A;  2QR4 A;  3K03 A;  4DR3 B;  4PDM A;  4DK1 A;  2JEU A;  1R1B A;  1X4T A;  3K9A A;  1XL4 A;  1PPJ H;  1Q6I A;  4O2A B;  2PUS A;  1P7B A;  4ZI7 A;  2BCC H;  1X59 A;  2D3O W;  3K9S A;  4DV2 B;  3SPC A;  1SQG A;  2AHY A;  2OCH A;  4LF4 O;  2EZP A;  3QNE A;  3BHP A;  3F7V C;  4UV9 A;  3EFF K;  3OFN G;  2Q73 A;  4DV6 B;  1Y74 A;  1A32 A;  2RJZ A;  2FB5 A;  3P32 A;  4YHH B;  5LGT A;  1RFY A;  3JSL A;  2IJJ A;  3ZX6 A;  1SQB H;  2PI4 A;  4PDV A;  4FLZ A;  2YIB A;  3VQV A;  1M93 A;  3AEI A;  2ITC C;  3VQY A;  1XNQ O;  4UCO A;  1P49 A;  3ETD A;  4GX5 A;  4X1Y B;  1G6U A;  3T2M A;  2WLJ A;  2EIL B;  1S5L Z;  3H1H H;  1AI4 A;  1AJQ A;  1JQ0 A;  5CA3 A;  3BPZ A;  4QE9 A;  1NBM G;  4F6E A;  4QNH B;  1S5J A;  2ETN A;  4GT1 A;  4J9Y B;  4LWS A;  1P4R A;  4NXM O;  4JAV A;  5B3S B;  1AI7 A;  4X88 A;  2KKW A;  1FXK B;  4IIJ A;  3RW0 A;  1F4M A;  2XAG A;  5JVD A;  4KP4 A;  2PY5 A;  2JGD B;  2LGW A;  1WPB A;  4NB5 A;  2HHH O;  3JD2 A;  4L87 A;  1N0J A;  5CB4 A;  5LXT B;  2WWW A;  4J7J A;  1YCI A;  2QWP B;  4LR3 A;  4FLT A;  1WA8 B;  1JJO A;  1AI5 A;  2P5O A;  1YIT V;  1JCH A;  3APO A;  2LJ2 A;  2IJH A;  3CME V;  1BQ0 A;  4JAU A;  4JTD B;  4TWK A;  3U0Z A;  1JJ2 U;  1QLE C;  1MNG A;  1K97 A;  3AG1 C;  3JAK A;  3C3T A;  2UXX A;  1L1F A;  3CC4 V;  3IAY A;  4Z1M G;  2W6I G;  4BW5 A;  1NJI W;  2ZR3 A;  2FYU H;  1N4C A;  3ZHR A;  5H9C A;  3DGE A;  4ABM A;  3CS5 A;  1WB7 A;  4FLU A;  1DK1 A;  2DQ0 A;  2EBO A;  1E1R G;  2FL4 A;  3CJH A;  3E35 A;  4DV1 O;  3HKB A;  3AG7 A;  3P3P A;  2C2A A;  4I55 A;  1S0V A;  3HKC B;  5LHH A;  2ZXW B;  1AIL A;  2ITD C;  4OPA A;  4LC1 A;  2DYS B;  3FD9 A;  3IGA C;  3MAQ A;  3LSQ A;  3B77 A;  1XNR B;  2UUC O;  1LUV A;  1S77 D;  4DR5 O;  5KMG B;  1Y74 B;  1IVS A;  4J9Z B;  3DC6 A;  3ZJZ A;  4TQF A;  1Q3E A;  2R9I A;  2W6J G;  1WPX A;  4LNU A;  1TVK B;  2OYQ A;  3GVM A;  4UB6 Z;  5D5Q A;  4D7T A;  4X62 O;  4DR6 B;  2M6Y A;  5LOV A;  1KBH A;  4YJ2 B;  1MZF A;  3KCX A;  1FFT B;  2YUA A;  3MD0 A;  4FFB A;  2N05 A;  1FFX A;  1P7G A;  4UCR A;  5JVD B;  1R3J C;  1OJH A;  1MG1 A;  1R3L C;  5CN0 A;  5E1A C;  4MVO A;  3T1H O;  2CTQ A;  5CB4 B;  1RM1 C;  2FTK A;  1EM1 A;  4CH3 A;  3JD0 A;  2GDS A;  3FB8 C;  1ZTE A;  1NKD A;  4J42 A;  4J7K A;  5EC2 C;  2JS3 A;  3CWB H;  1PD3 A;  2OT5 A;  1RP3 B;  1ZUQ A;  2H8P C;  1DLB A;  3W7T A;  3JD3 A;  1VF7 A;  2UXN A;  5J2T A;  3OR7 C;  4JV5 O;  3C3S A;  1VQM V;  3JAK B;  4MS2 A;  3E89 A;  4U7O A;  3THO A;  4LFC B;  2ZM6 O;  1ZWI C;  3W7W A;  3ZMT A;  4Z1V A;  5L3D A;  4DR2 O;  2DQ3 A;  1YZB A;  2R9R B;  1K7D A;  5JWP A;  1FKA O;  4K8Z A;  1GRJ A;  2RQ6 A;  5KA5 A;  3SJC C;  2YSU B;  3CRC A;  3BAB A;  4WBN A;  2A0L A;  2Q7H A;  4I5S A;  4FFK A;  4JPR A;  1VEW A;  5C8Y A;  3SJQ C;  1EZJ A;  4WCE V;  2F4V O;  1WP8 A;  5CBH A;  1AR5 A;  4I7Z B;  1WP7 A;  3WB2 A;  2YIC A;  2XOK G;  1BHB A;  4DK0 A;  2UXB O;  2UUA O;  2L35 A;  4X66 O;  2A06 H;  4I0X A;  1NR1 A;  1VAR A;  5A2Q N;  2E74 B;  1BMF G;  3BVO A;  1E1Q G;  4EFE A;  1KP2 A;  3J80 N;  4DV2 O;  2X6A A;  4K3A A;  3K5M A;  1M5I A;  4U3J A;  4BWA A;  1V55 B;  2MK3 A;  1I0H A;  4DV6 O;  2CTW A;  4IHJ B;  2E5L O;  4YHH O;  2ZXW C;  3N27 A;  4W4K A;  3JAT A;  4NXN B;  1K4C C;  1TUE B;  4JAA A;  4LNU B;  5EBW C;  4UVC A;  5EZY A;  2CUG A;  3O65 A;  3JAS A;  3FFQ A;  2DYR B;  1K8A W;  3UO3 A;  2M7W A;  4QPK A;  4MVZ A;  4R50 A;  5LOV B;  1K34 A;  3LDC A;  3IC9 A;  4ICG A;  4IT5 A;  2VWJ A;  1NH2 D;  4X8A A;  3G4S V;  2OTL V;  4JAS A;  2DOS A;  3U10 A;  2LW7 A;  3L72 H;  2JGU A;  5CA0 A;  5JQG A;  4BW9 A;  1QVG U;  2WLL A;  3W7X A;  3ZED A;  1YJN V;  2YIB D;  3JD1 A;  1M57 B;  3E22 B;  3BEH A;  4B7K A;  3FYE B;  1BE3 H;  3RYI A;  3W7S A;  2JK5 C;  2XTA A;  2P6J A;  1HNZ B;  2ZNJ A;  3K5L A;  3RYF A;  1PL0 A;  3ETE A;  3N2K A;  1GH6 A;  4RUE A;  1R6N A;  1TAE A;  3WFV A;  4JYB A;  2X7R B;  1HP8 A;  4JI8 B;  3ZRW A;  3IJ4 A;  4O2B A;  5J9P C;  3DXR B;  2XAF A;  3VBB A;  1SC5 B;  5IJ0 A;  1RPR A;  2Y4T A;  2B1G A;  3UT5 B;  2PI5 A;  5BXZ A;  2CTP A;  2EZO A;  5KLV H;  1BS3 A;  4WBN B;  3LNM B;  3UO2 A;  3ZIA G;  4EB6 A;  5C8Y B;  4DV5 B;  2QJ1 A;  4O4J B;  4GKK B;  2DN9 A;  4PJ0 Z;  1THZ A;  1EFR G;  4I0X B;  1H2K A;  3SDL A;  3A0B Z;  1OCC B;  2GTA A;  2AGA A;  2JS5 A;  3BFR A;  3VQX A;  2HJD A;  5KHJ A;  3K5N A;  1SRY A;  4XBF A;  3Q4H A;  4K8X A;  1XNR O;  1Z5V A;  3OAA G;  4IYI A;  1K73 W;  3FB5 C;  1OCO B;  2Y4U A;  1JX9 A;  2WPD G;  3H01 A;  2KSD A;  4TSF G;  5IY5 B;  1K92 A;  4UVB A;  1BCC H;  3P3N A;  4OX9 B;  1WNS A;  5LP6 A;  3GWK C;  1T5E A;  1ENV A;  1GN3 A;  2GHY A;  2WSS G;  3LSU A;  1U97 A;  1B04 A;  5EZY B;  1G8M A;  3JAS B;  1B6Q A;  2UUB B;  2WLH A;  3K0D A;  3T4Z A;  1Q8I A;  1V55 C;  4YIO A;  1JOY A;  4EFB A;  4DR6 O;  1W59 A;  4JI7 B;  1MMM A;  2BSK A;  4NYK A;  3H1I H;  1EN4 A;  1FPO A;  5CA0 B;  1QNM A;  3AG3 B;  2WLL B;  4DV7 B;  2DYR C;  3RYI B;  1RSO A;  2OIE A;  1SET A;  5GTH Z;  3JAR A;  3RYF B;  1ROP A;  1FAF A;  1JMK C;  2E76 B;  1IXB A;  5EYP B;  4BIU A;  3N2K B;  2UU9 B;  3SR2 C;  3SGI A;  2WLK A;  2YDE A;  3BRC A;  2XAQ A;  2LFS A;  5BMV A;  3CRM A;  1M57 C;  2UXC B;  4ASU G;  3QO5 A;  2EJ7 A;  3ZRW B;  4O2B B;  3JYC A;  4DR2 B;  4RWU A;  4BIO A;  4PA4 A;  5IJ0 B;  4DV4 B;  2Q9L A;  4LFC O;  4Q6G A;  4TUY B;  5IWA B;  4QIW F;  2CDY A;  5JCO A;  1V54 B;  3G6E V;  1DF4 A;  4WF9 V;  1M9N A;  4DXW A;  2Q4P A;  2Y0P A;  1BGY H;  1SES A;  4LF5 B;  1EN5 A;  2Y48 A;  2YS8 A;  5K1X A;  4X66 B;  1IBL O;  5L3E A;  2MW2 B;  1GM9 A;  3K59 A;  5FPR A;  3STZ C;  4JI0 B;  4AHC A;  3B8M A;  1Q90 D;  3SYA A;  4HBN A;  1K33 A;  3ETG A;  3Q4H B;  4XDK A;  3JCZ A;  5LMN B;  1Q6U A;  3SPJ A;  4DO2 A;  1VQN V;  4X1K A;  1FYJ A;  4FZ0 A;  4LP8 A;  1HW7 A;  2VQF B;  4PD4 F;  4X1I A;  3SYO A;  1NQT A;  1SZT A;  1KU9 A;  2E5L B;  4TV9 A;  5LP6 B;  1NVP D;  4PA7 A;  1OCC C;  1WN7 A;  2ADP A;  1I7F A;  4NXN O;  1UFI A;  3ASN C;  3VOU A;  3RVY A;  5CA1 A;  4HNA A;  4IL6 Z;  1IXM A;  2E75 B;  2B1I A;  3CPW U;  1DGS A;  1OCO C;  2LQT A;  1PP9 H;  1RM1 B;  2P06 A;  2HFE C;  3E86 A;  3H1J H;  4JGS A;  1XUQ A;  5IY5 C;  2BSK B;  1SS3 A;  4LF7 B;  4GX1 A;  3B8N A;  1SF9 A;  4NKG B;  3SYC A;  4B7E A;  3T1Y B;  3RN4 A;  3TK1 A;  2Y69 B;  3ABL B;  3ZMU A;  1VF6 A;  5FLX N;  1SQF A;  4FPP A;  1GK9 A;  3D36 C;  1HNZ O;  1Y67 A;  3JAR B;  4GX2 A;  1P84 F;  1PNL A;  1TUB B;  3OM3 B;  2CGN A;  3AG3 C;  2WLN A;  4LH6 A;  5JJJ B;  3ML0 A;  4JI2 B;  3CXH F;  3S3X A;  5BMV B;  1VF5 B;  2LO1 A;  2ADQ B;  2OCC C;  4JI8 O;  1VP7 A;  4MVU A;  4N21 A;  2BTQ A;  2IU3 A;  3SJB C;  2AXT Z;  1SQQ H;  5ITZ A;  2NNU A;  2CK3 G;  1H2G A;  3UM7 A;  4Q20 A;  3UCS C;  1HNX B;  1SA0 A;  5JH7 A;  4O4L A;  2VWK A;  1SER A;  3G6B A;  1JR9 A;  5BY1 A;  3OUS A;  4DV5 O;  2WA3 A;  1HR0 B;  3S3W A;  4GKK O;  3WU2 Z;  3MDS A;  2Q68 A;  3JAW A;  1OCR C;  4WFE A;  5IYB O;  4WFG A;  4PHZ A;  1GN4 A;  3HKD A;  4N23 A;  2BTO A;  1V54 C;  4CS2 A;  4G2K A;  1Y66 A;  5CBF A;  1YF2 A;  4ZI7 B;  4J10 A;  4RUF A;  1Q82 W;  4I50 A;  3K0G A;  4FJC C;  2XAS A;  3FB7 C;  1IUR A;  4X1K B;  3TGU H;  1NS1 A;  4P9P A;  2DWE C;  4QJF B;  4U7N A;  1SZX A;  1KD1 W;  2A9H A;  1GAX A;  2Y0I A;  2QM8 A;  1QCE A;  1EBO A;  4OX9 O;  1K3E A;  2JJ1 G;  3L74 H;  1NTM H;  4DV0 B;  4H13 B;  4PA9 A;  1F7Y A;  3ETQ A;  2HVJ C;  5CA1 B;  1AVM A;  4HNA B;  1YHQ V;  2EIJ B;  2UUB O;  3RYH A;  3I55 V;  1Q43 A;  4UFZ A;  3AG2 B;  4LWS B;  4PA6 A;  3PN1 A;  2AHZ A;  4JI7 O;  4JI5 B;  1NU1 H;  1XHZ A;  5LP6 C;  5CBG A;  3GWO A;  4DRX A;  3SPH A;  4IIJ B;  5EIB C;  2R72 A;  3K79 A;  4LF8 B;  4DV7 O;  3A8T A;  1VQ7 V;  1M90 W;  4X89 A;  3ABT A;  1MSW D;  4UVA A;  1FXV A;  3ABK B;  2EIN B;  3MHS C;  2VQE B;  4TQD A;  5L3G A;  1FJG B;  5B1O A;  2IM9 A;  5D5P A;  4BR6 A;  2UU9 O;  4LF9 B;  4PA3 A;  2CH7 A;  5GTI Z;  2PZS A;  2Y69 C;  3ABL C;  5LHG A;  2IJK A;  2R70 A;  2UXC O;  2F1M A;  2GBO A;  3ZMS A;  2QSA A;  1AI6 A;  1K4D C;  3TET A;  4DV4 O;  5ITZ B;  4CC6 A;  5JJN B;  1H2M A;  5IWA O;  3ABU A;  1PM9 A;  2EJR A;  4TOI A;  4X65 B;  4H44 B;  1SA0 B;  4DUZ O;  4CZZ A;  4KL1 A;  4O4L B;  2Q7E A;  3ZS8 C;  4LF5 O;  1IBL B;  5KA6 A;  1QBZ A;  3CJH B;  3K5O A;  3HKB B;  4CS4 A;  4I55 B;  3JAW B;  2B9Z A;  3CE2 A;  2ZIM A;  3HKD B;  4R8C A;  4FM1 A;  5JCO C;  4J80 A;  2F66 C;  4JI0 O;  1HWY A;  3RYC A;  1N33 B;  4I50 B;  4ZHQ A;  5IYZ A;  2ZDI C;  5B1B B;  3OMN B;  1CP9 A;  3ZHQ A;  3OEH G;  3APQ A;  4PI2 A;  1H2N A;  5LMN O;  4DV3 B;  4HZ3 A;  2PF4 E;  1W0J G;  4WFH A;  3CB2 A;  3F5W C;  2VQF O;  3OD4 A;  2DJV A;  3NXS A;  4K0K O;  4OPH A;  1US6 A;  1H2S B;  1WLE A;  2WA4 A;  1MOF A;  3CEI A;  3OUF A;  1KMI Z;  2WLI A;  3M8A A;  2W0F C;  3LSS A;  1AJP A;  4CH5 A;  5AG2 A;  1LUW A;  2QA4 V;  2NN4 A;  2ZE8 A;  1FS0 G;  4B3S B;  3M7M X;  1KQS U;  3CSX A;  3STL C;  2UXD B;  3ZHT A;  1QLN A;  5LBQ A;  2DE0 X;  3SYP A;  4FFB B;  1CPY A;  4LF7 O;  2Q69 A;  5LGN A;  3CYO A;  1FFX B;  4LH7 A;  2YXH A;  1OCZ B;  3T1Y O;  1XHX A;  2KB1 A;  2QWN B;  2IU0 A;  3N2G A;  3CCM V;  1AP5 A;  2EIJ C;  3RFR A;  2Q67 A;  1N8R W;  5IE9 A;  1JA8 A;  3AG2 C;  1EZV H;  4LFB B;  4FLY A;  2YXL A;  1Q86 W;  1G1X B;  1YTF B;  1M56 B;  1IBK B;  4DUY O;  4JZG A;  1OZ0 A;  2YI9 A;  5LA6 A;  2CH7 B;  4NR1 A;  1VQ9 V;  1B06 A;  4JI2 O;  5LL6 Y;  2ZIO A;  3KCY A;  1GM7 A;  1VF6 C;  5J2T B;  1KKC A;  3E83 A;  3TCU A;  4B08 A;  1H8E G;  5B1N A;  1KUQ A;  4B3M B;  3ABK C;  2EIN C;  3OMI B;  4UUJ C;  1BHA A;  2E3C A;  3AK1 A;  3DTU B;  5A9G A;  3G80 A;  5LGU A;  1QHT A;  1PKX A;  4RQE A;  3B2E E;  1HNX O;  2K9P A;  1YJ9 V;  1GN6 A;  1R3I C;  4JI1 O;  2CTR A;  1HR0 O;  3A0R A;  4R7C A;  4MSW C;  3DSQ A;  2CAZ C;  4D7S A;  4YJ3 A;  1KEC A;  1BSM A;  1Y76 A;  4DR1 B;  2IBZ H;  1VQ6 V;  2YC0 A;  3K04 A;  2O57 A;  5H5N A;  5TIS Z;  3RYC B;  1SQP H;  4TV8 A;  5IYZ B;  3ASN B;  2VS0 A;  2ZNI A;  1BQZ A;  3CCE V;  4JI6 B;  5B1A B;  5IT9 N;  2KQX A;  4U3J B;  3A2F A;  1S72 V;  2NLJ C;  3X2Q B;  1Y4M A;  2HG5 C;  3ZN0 A;  2AZ0 A;  2GSM B;  4UV8 A;  1S5H C;  3IFX A;  4L8J A;  3JAT B;  1AJN A;  3H9V A;  2WLI B;  5B1B C;  4DV0 O;  2ZKO A;  4X20 A;  5EC1 C;  1E79 G;  1GO3 F;  5KHI A;  3RWR D;  2XAH A;  4DYL A;  2K1E A;  1AR4 A;  2JIZ G;  4KUM A;  2RN9 A;  2PTM A;  4JI5 O;  4X1Y A;  3FYI B;  1HDJ A;  4OGQ B;  1AR1 B;  5JQG B;  4I9Q A;  4LF8 O;  1G4Y B;  2PYL A;  2V4D A;  2RNB A;  1TGO A;  3RVZ A;  1R6K A;  4CH6 A;  2EIK B;  2RMK B;  2OCC B;  4MVM A;  1IX9 A;  2CGO A;  3L71 H;  4P30 A;  5L3F A;  3CCV V;  5LMU O;  1VQ8 V;  3R66 A;  3ZRV A;  4GX0 A;  1YSC A;  1SKV A;  1FXK A;  1GTO A;  2EUL A;  1CEZ A;  2VQE O;  2IH3 C;  1FJG O;  1WAZ A;  1KKD A;  2JGD A;  5LA6 B;  4LF9 O;  1L0N H;  4GLX A;  1KB9 F;  1OCZ C;  2OWO A;  1XRE A;  3C90 A;  5KUM A;  1XMO B;  3CD6 V;  5KUK A;  2P4K A;  3L75 H;  5FNV A;  4RQF A;  2A7W A;  1OCR B;  5EK0 A;  4FLW A;  4MVR A;  1M56 C;  4JI4 B;  2Z5U A;  2IW5 A;  4DR4 B;  4X9Q A;  5DN6 G;  4DUZ B;  3E8G A;  1XBL A;  4X65 O;  3ZHV A;  4EB6 B;  1IDS A;  3OEE G;  4FK5 C;  1K5S A;  2HVK C;  2GUZ A;  2HJF C;  4YJ3 B;  1S3J A;  4GZR B;  4ZIB A;  1ORQ C;  2QWQ B;  1ZLZ A;  4TV8 B;  1B3Q A;  1N33 O;  1IZ3 A;  4LF6 B;  3JAL A;  2G38 A;  1N0N A;  1NI8 A;  4I4T A;  5LHI A;  4DV3 O;  1FXH A;  1XQ8 A;  4CBC A;  1V9P A;  3HKC A;  5KAI Z;  4K0K B;  5L3B A;  2P4V A;  3FX7 A;  5HFL A;  3CX5 F;  2X6B A;  1YJW V;  3K58 A;  4ZKI A;  4LFA B;  3FB6 C;  2DW4 A;  3BA9 A;  2Q8V A;  4WFF A;  1Q6H A;  1DTO A;  1JFF A;  4CH4 A;  4Z2W A;  4X20 B;  2CE4 A;  1NR7 A;  1HNW B;  5KMG A;  5B1A C;  1QQC A;  4B3S O;  3IC7 A;  2XND G;  1I94 B;  3HPL C;  3X2Q C;  4XDJ A;  2UXD O;  1BL8 A;  1IBM B;  2LP7 A;  4FZ1 A;  1BT8 A;  1TVK A;  2ZCE A;  2XUM A;  4MVQ A;  3ZHU A;  1Q81 W;  2D2C B;  4MTG A;  4IYH A;  3QVN A;  1FD9 A;  1XI1 A;  2F23 A;  3AK2 A;  1RSO B;  4AQY B;  4YJ2 A;  4XDL A;  3HB3 B;  5KX5 A;  3LDD A;  4LFB O;  2XHB A;  3PJS K;  3OE7 G;  4YIP A;  2H3O A;  3L73 H;  2HEP A;  3GB7 C;  3HKE A;  3T1C A;  4DUY B;  4GKJ B;  1IBK O;  2ZR2 A;  1WJZ A;  5F2V O;  4ZOL A;  4JTA B;  2ZD9 A;  4MW3 A;  3RGB A;  4GYC B;  4DR7 B;  5LYJ A;  2EIK C;  4WFB V;  3RT3 C;  4CC5 A;  4PV1 B;  5FNV B;  4FM0 A;  1JVM A;  5BR8 B;  2YEV A;  1XMQ B;  4NVP A;  4B3M O;  2YIA A;  3ZN1 A;  3A0H Z;  4F6R A;  1Q7Y W;  3ZHS A;  4E2L A;  4FM2 A;  1H38 A;  1PL4 A;  4P9O A;  3G71 V;  2WLM A;  1VQL V;  1UPG A;  1YDX A;  2PGG A;  5IDJ A;  4JI1 B;  1S76 D;  2YI8 A;  1TA8 A;  3CC7 V;  3TXS A;  4UB8 Z;  3CCJ V;  4ZBM A;  2WAM A;  4KHP B;  4WFA V;  1WB8 A;  1XEQ A;  1YXB A;  1U96 A;  3E8H A;  1J5E B;  2GUZ B;  4GUN A;  4H37 A;  1Z2G A;  3I56 V;  4DR1 O;  3AK3 A;  1YVW A;  1AB3 A;  2HP8 A;  3CCL V;  3T4D A;  3JAL B;  3KG2 A;  4I4T B;  4GCZ A; 
#chains in the Genus database with same CATH homology
 3WU2 Z;  2AXT Z;  5TIS Z;  5KAF Z;  5B66 Z;  5H2F Z;  3KZI Z;  5B5E Z;  3A0H Z;  4PJ0 Z;  3JCU Z;  1S5L Z;  4IL6 Z;  5GTH Z;  3A0B Z;  5KAI Z;  5E79 Z;  4UB8 Z;  4UB6 Z;  5GTI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...