2FYUH

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
b'DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2fyuH00
4D6TH 1SQBH 3L71H 1BCCH 4U3FH 1PP9H 2BCCH 1NTZH 3L75H 1L0LH 3L74H 3L73H 1KYOF 2FYUH 1SQXH 2A06H 3BCCH 3H1IH 1NU1H 3TGUH 1NTMH 1KB9F 1SQQH 3L72H 4PD4F 1SQPH 3CXHF 3CX5F 1BGYH 3H1JH 3H1LH 1NTKH 1PPJH 1P84F 3CWBH 5KLVH 3H1KH 1BE3H 3H1HH 1EZVH 1SQVH 2IBZH 3L70H 1L0NH
chains in the Genus database with same CATH superfamily
1IDSA 4EB6B 3RYFB 4X1KB 3VQXA 3CCJV 3SYOA 2EX3A 4U3FH 1YITV 1GH6A 4LF7B 2Q6AA 5H6QA 3J81N 1VQPV 3I55V 1ZL8B 3RBZA 1IXMA 1Y76A 1KECA 2WA3A 3CX5F 1NQTA 3HKEB 4DK1A 1N32B 4JYAB 4NB5A 2XNDG 3WG7C 3CC7V 1IBMO 2ARHA 3ZEDA 3RGBA 4U7NA 3ETEA 3FYEB 3CCQV 3E35A 1ZX3A 4FFKA 3K0GA 2Q67A 5C8YB 3A0HZ 3CJHB 1XMQB 1YI2V 5KLVH 1MOFA 1AI5A 3N27A 3P30A 2GUZA 5EBLC 3ZMTA 5IDJA 2UXDO 1L1FA 3OE7G 3B77A 2PZSA 1P7BA 1XMOB 1OJHA 5EZYA 1XUQA 1OCRC 3RN4A 4X62O 4GX2A 1QHTA 4I50A 4JF3A 1NU1H 5KUMA 3BEHA 3RYHB 2OIGA 1N8RW 2KG7A 2B9ZA 2Z0AA 2IU3A 4BIZA 4EFBA 4X1IA 1Q6HA 4IIJA 4DR2O 1VQKV 1R3IC 5LMUB 4J7KA 3F5TA 3ETDA 4GKJO 1OZ0A 1TUBA 4XBFA 3ABLC 2KQXA 2F93B 5BR8B 2LW7A 1FJGO 3K03A 3D36C 2IH3C 4JI8O 1GN2A 2ATKC 3IAYA 4DV4O 1I08A 3K58A 2MW2B 2QGNA 4ZHQB 1QU7A 1OHHG 4DR7O 3VQWA 2UUBB 1H2SB 3K06A 3H1LH 1H2LA 3D36A 3H1HH 1ZWIC 1IZ3A 2LFSA 1J95A 2QJ1A 3AG2B 3OUSA 2CH7A 3QG5A 2UUCO 3K5NA 3CP1A 4DUYO 1N0JA 4LWSA 2KKWA 4J10A 1JFFA 3OMAB 4KFMA 1WP8A 2V7QG 1YJ9V 1SF9A 3W7UA 1K4DC 2YIBD 5KUKA 3LDEA 2UXXA 2EZPA 1NR1A 3H9VA 3L70H 3FFQA 3KKYA 1COWG 1DLBA 4PHZA 2XAJA 3D8CA 4L8JA 4UV8A 5D5PA 2AZ2A 2ADPA 3SPHA 2AZ0A 5IJ9A 3DGEA 1R3JC 2L6LA 2E3CA 2H8PC 1MG1A 2R9IA 2OIEA 3AG7A 3WU2Z 3ZHUA 1WN7A 4U3JA 2Z5UA 4LFAB 2A7WA 2ZINA 4LF7O 5JVDB 2Y69B 5EIBC 4J80A 4FVMA 1FPOA 3Q4HB 1GRJA 4TWKA 2EIJB 1Q3EA 1K4CC 5H2FZ 1N32O 4JV5O 4FZ1A 3G6EV 2E5LB 4JI0O 2D3OW 1P4RA 3HB3B 5CA3A 4K0KB 2WLIB 1QLEC 3X2QB 1NTZH 1H2KA 3BCCH 4MVMA 4QGPA 1LR1A 1THZA 2CE4A 1M56B 2YEVB 5B1AB 3TETA 3EVKA 1M57C 2YSUB 3ZJZA 4Z1MG 2ZXWB 2YI9A 5LXTA 3LSSA 1OV9A 1US6A 3BHPA 3G6BA 1S5JA 5BMVA 2E74B 4HNAB 4X66O 2RN9A 1DK1A 3KG2A 1SZTA 1Z5VA 3ZHTA 3RYCA 3C3SA 1FFXA 3P32A 5CA0A 4CC6A 2QTOA 3BABA 4RUEA 2LP7A 2F23A 1JR9A 3SYAA 1HDJA 2HP8A 5FPRA 4X89A 5IYZA 1YJWV 3O65A 3JATB 4Q6GA 2RDCA 4I7ZB 4GZRB 5EBMC 5LOVB 2AW9A 3F7YC 5LMNB 1TVKA 4RQFA 4R50A 2N74A 1SC5B 1VARA 1FD9A 5LP6B 3K3WA 2VQEB 3FB5C 1EBOA 2RJZA 1EN5A 4WBNA 4X88A 4LF4O 1Y74A 3T1HB 4PA3A 5EC2C 1PL0A 2HVKC 5BR8O 1YDXA 1E79G 2YIDA 4D6TH 1WJZA 2WAMA 4PI2A 1KU9A 4FJCC 4E2LA 4KL1A 4DW1A 2PTMA 3LDCA 1HNZB 1SQPH 4AQYB 1HNWO 2BSKB 5J2TB 2UUBO 4WFGA 1W2BU 1NR7A 2NLJC 4TT3G 2YXHA 1N0NA 1OCCC 2H94A 2ZM6B 1FS0G 5EIBD 4DV0B 5HFMA 2IJKA 2PYLA 4ASUG 1GKFA 4JYBA 1W0JG 1WA8B 3PJSK 1UFIA 2W0FC 3TCUA 4O2AA 1K9MW 2F43G 4DV2B 5KMGB 1M1KW 2OWOA 1R6KA 2M6YA 2P06A 5CB4B 1VQNV 4MS2A 3CCRV 2ZT9B 5B1OA 4ZOLA 4LR3A 3C90A 4NXNB 4GX0A 4X1YA 1HWYA 4RO2A 1SERA 2JIZG 4J11A 3CC2V 4FLZA 4D7SA 1IVSA 3ZMZA 1VF6C 2RNBA 2ADQB 5JJJB 2A06H 4KXRA 3KCYA 4H33A 3TJTA 3IFXA 3JALB 3MDSA 2K1EA 4LFBB 1E1RG 2AHYA 2GHYA 3RFRA 4PDRA 5LGUA 3K9SA 4MVOA 1JMKC 4JI1B 3ZBHA 4JI3O 2UXBO 4GT1A 2HR3A 1L8DA 4QPJA 3H1IH 1XBLA 5H9CA 4CH3A 1V9PA 2HHHB 2PGGA 5LGTA 2E75B 4FLWA 4DR6O 3APQA 3VOUA 2C2AA 3OR7C 1BHBA 3CRQA 4JI7O 1YTFD 4K0KO 1I5XA 1IBKB 1V54B 4FFBA 5J2UA 1VIBA 1V54C 2LGWA 4QJFB 2LO1A 2F4VB 4GX1A 1SQQH 4NXMB 1QLNA 5EYPA 2Q7HA 5FNVA 2WLLB 1SA0A 3ABTA 4JI4B 4WCEV 2IW5A 4GUNA 4PJ0Z 3CXCU 2ITCC 4A5UB 1KQSU 1WB8A 3OR6C 1R1BA 2ZE7A 4P2ZA 3B40A 5D5QA 3IC9A 4FM2A 3E8GA 4I55A 1RPRA 3LSQA 3ABKB 3THOA 5GTHZ 1RSOB 4YHHB 3IC7A 4LBEC 1VQ6V 4J9ZB 5TISZ 4G27B 3AK3A 3AG4B 2QM7A 2DWDC 1VQ9V 1RP3B 4J7ZA 4DRXA 3JAKB 5KX5A 4IL6Z 2CTWA 2EIKC 3CRAA 5LMNO 1WPBA 3JD3A 2X6AA 1AVMA 2HEPA 2OCHA 1U96A 2X7RB 2VQEO 3CCSV 1QR9A 1H2NA 3E22A 4F6RA 3K5MA 3JASA 2DYRB 1AILA 3KZIZ 5JCOA 1O9HA 4KUMA 5GONA 2XAFA 4X20B 1FYJA 2BCCH 1B06A 2Q69A 3L75H 2Y4TA 3JAWB 5C93A 4DV5O 4MVUA 1TGOA 1FXKA 3PN1A 4AQYO 1QR8A 4BW5A 1XL4A 1P84F 5KAFZ 5LHGA 4JZ2A 1MZFA 2ZM6O 2ZQMA 3OMNB 4DV7B 4DV0O 3JAMN 4NTWA 2CK3G 1Q43A 2KB1A 3ZN1A 3HKCB 3FB6C 1GN3A 1DF4A 5B5EZ 1S76D 1DGSA 2VS0A 3HKDB 2GBOA 2BOBC 4FPPA 5KHGA 2DYSB 4B3RO 4JPRA 2CTPA 2DYSC 3N2KA 4CH6A 2CUGA 2LW1A 1IBLB 3BA9A 4K35A 1HR0B 3N2GB 1N34B 4LCUC 5IYDO 2Q7EA 5LYJA 2M7WA 3FB7C 4YY3O 2HJDA 4O4JA 1KBHA 4B7KA 4YJ2B 3JYCA 2YS8A 3CB2A 3LNMB 5IYBO 4NKGB 4DR1B 4FZ0A 4DV6B 4Z1VA 3UQ8A 3EFFK 1AR4A 4I9WA 4JI1O 2DOSA 3HR0A 4MTXA 5IYCO 5LA6A 1XNQB 2XAHA 3QNEA 1YEWA 5KHKA 4OXSA 1BT8A 4IGGA 1PPJH 1ZSPA 4LF8O 2P67A 4XDLA 1XREA 2NR5A 3IGAC 3RYFA 5GW7A 3QO7A 3ZRWA 4QIWF 1CXZB 1QNMA 3SGIA 2NN4A 1ZL8A 1IBKO 4LNUA 2HKOA 3CC4V 4GKKO 4QE7A 3HKEA 2B5UA 4UFZA 3QO8A 1SESA 4NXMO 3H1JH 1XHZA 2A79B 1SRYA 5H5NA 4JI4O 2JDIG 2YIBA 1AP6A 3RVZA 1XEQA 1KC8W 2GUZB 4NR1A 1ZAUA 4WF9V 1LUWA 4K8XA 3AEIA 2JGUA 4MW8A 4X64B 3E8BA 1BZKA 1MNGA 3CPWU 2DMXA 4LH7A 3CJHA 1JA8A 1A32A 5B1BB 1S5HC 3J80N 1IX9A 4YHHO 2K9PA 1JCHA 3JCZA 1BL8A 2IBZH 1RM1B 2QKSA 3CEIA 1AP5A 4LFCO 2DQ3A 4JTAB 4FLVA 4B3MB 4IIJB 1BHAA 1FXHA 2JVDA 3JSNA 4JI2B 3S3XA 1N36O 1R3KC 4MSWC 3ZS8C 1AR1B 1X59A 1WB7A 2PY5A 2ZE8A 4O4HA 2AGAA 5J9PC 3JD0A 2FMLA 1NI8A 1QVFU 2WLJA 4G28B 3CCVV 3UO2A 1ZUQA 1GAXA 5CBFA 4R8CA 3VQVA 2ZD9A 1PD3A 2DN9A 3CXHF 1GK9A 3ZMSA 2YUAA 1P7GA 2O57A 3CSXA 2YC0A 1WP7A 2UU9B 1PNLA 2UUAO 2V4DA 1DF5A 3A8TA 3ZMVA 3AG2C 2HJFC 3ASOB 3ML0A 4L87A 3ZX6A 3ASOC 4FIPC 3OTOB 1SQFA 5IT9N 2QDOA 3HPLC 2QKAA 1IBLO 1L0NH 3F7VC 1HR0O 1K73W 4FMTA 2QM4A 4DV1B 4MTOA 5KHHA 4X8AA 3FKSG 2EILB 1NJIW 5BXZA 3A0BZ 4P9PA 4P30A 3OUFA 4DUZB 2WPDG 4LF9B 2YICA 2WSSG 3FD9A 2IH1C 2G38A 4PA9A 4OPAA 4DR3B 4XDKA 3SJBC 1EN6A 4DR1O 1VQ7V 4X65B 4DV6O 2LQTA 1RPOA 1H2GA 1ROPA 4DR4B 4W4LA 5L3DA 2R70A 2N05A 5IE9A 2YXYA 3E83A 3WB1A 2XTAA 2Y69C 1T5EA 3SPJA 4N21A 3CRCA 2EIJC 1BE3H 3JARA 4X9QA 3CMAV 4WFHA 4JYAO 1VQMV 4DV3B 2W0XA 5FL7G 2BTQB 1PL4A 4GX5A 3X2QC 3I56V 3Q4HA 3G67A 2Q5ZA 1CEZA 4UVCA 1OCZB 3APOA 1S0VA 1M56C 2UXCB 5B1AC 3UT5A 1OCZC 4UVBA 1XMQO 1K5SA 2CGNA 1FKAO 1S72V 1K33A 2ZXWC 3L9DA 1PP9H 1MMMA 1XMOO 4UCRA 3ZHSA 5BMVB 1H2MA 2YEVA 1I94B 1TUEB 4DW0A 4TV8B 1NS1A 5CA0B 2QWNB 3B8MA 1NVPB 5K1XA 3RYIB 3SYCA 5A9GA 3E86A 4LF6B 5IYZB 3UKMA 3ZIAG 1M93A 3QF7A 2EIMB 5CA1B 1KYOF 3OD4A 1PM9A 4JAVA 1Q6IA 5LMUO 1S3JA 2HLDG 2ILMA 4JI2O 4B3TB 5LP6C 5CMUA 1AI6A 3M99B 4NTYA 4F6EA 3T1CA 1I7FA 1KP2A 3BRCA 1KP3A 1K97A 2QEXV 3SPGA 4WFAV 5LOVA 2EJRA 4I0XA 4W4KA 1YIJV 2ZKOA 5B1NA 1Q81W 1SKVA 4DO2A 3CMEV 3VBBA 5B66Z 2ZIOA 3SYPA 2ZR2A 3ZHRA 3RVYA 4BIUA 2JGDA 2KSDA 3BPZA 1WLEA 4PV1B 1F4NA 1K92A 2A0LA 2BSKA 2D2CB 4F4LA 1YJNV 4O4IB 4J42A 1NBMG 3CCUV 4WFBV 2QKCA 4B3SB 5EC1C 4YXWG 4HBNA 3D3IA 4ZOLB 4B08A 2HVJC 3WB0A 5LHIA 1VP7A 2RQ6A 3TXSA 1WA8A 3FYIB 3ZCCA 1FAFA 2GDSA 4DV1O 1DTOA 1YZBA 4GCZA 3SJAC 1SETA 5KMGA 3J7AU 4G2KA 1R6NA 4FK5C 4H13B 4JI6B 3HKBA 3JSLA 1K7DA 3ABUA 1XL6A 4OX9B 3T1YB 2HFEC 4TOIA 3OEHG 2WLHA 4DR3O 5IJ0B 4X65O 3DSQA 3L71H 1VF6A 2ZE5A 1R73A 4R6ZA 3OGIB 4LFAO 3JALA 5GTIZ 1NT2B 4H37A 4PD4F 4CBCA 3RW0A 2CAZC 4JI5B 3SR2C 3OM3B 1ORQC 4BW9A 1K3EA 2QWRB 4TUYA 4CH5A 2B1IA 1H8EG 2JEUA 3VQYA 4PA7A 1EZJA 1GO3F 2DQ0A 2E5LO 1W59A 1LUVA 5ITZB 5J2UB 1YF2A 1HNXB 2XAGA 3CRRA 5FNVB 3K5LA 1BS3A 1CPYA 1SA0B 2OYQA 1IBMB 1BSMA 5JQGA 2WA4A 4AILC 1V55B 4FLYA 1SZXA 2PF4E 2Z3YA 2QM8A 3T4DA 1D2DA 4I55B 2LGQA 3E2EA 2QWPB 4YJ3A 3ABKC 3CRMA 3ABMB 3T4ZA 3DC6A 2WLLA 1I94O 5DECA 4NTXA 2VRZA 4ZI7A 1EM1A 1AROP 1MA1A 1MZEA 2GSMB 4CZZA 2ZDIC 3SYQA 3SPCA 1KUQA 3AG4C 4I4TA 2CTQA 4LF6O 4CH4A 2XASA 5KX5B 3CCMV 1Q90D 2JJ2G 3CD6V 1RSOA 1YSCA 1JJ2U 3U10A 1U97A 1G4YB 5B3SB 2ZDIA 3DXRA 1NTKH 1ZLZA 4B3TO 3E22B 2W6IG 2AXTZ 4F6RB 2B1GA 2ZNIA 2N04A 3GB7C 3JASB 4TV9A 2DYRC 3T1HO 5GONB 1FXVA 4OGQB 1QQCA 1AI4A 4UB6Z 2Q68A 2GV9A 3P3PA 4GKJB 4U7OA 2VWJA 1G6UA 2JS5A 4DXWA 1HNZO 3H01A 4TQFA 2XHBA 4JI8B 1XI1A 3T2MA 3MHHC 3G71V 1GM8A 4X20A 3AG3B 1SQBH 1D5NA 2IJJA 3AG3C 2OTLV 3OTFA 2R9RB 3JAWA 3CE2A 4UCVA 4WFFA 1SS3A 4HZ3A 1KB9F 5H6RA 1D5AA 3NXSA 1WAZA 3RT3C 4DR5B 1EFRG 4KHPB 1XNRB 2QA4V 4DV2O 3TXQA 1AR5A 3FAVB 4B3SO 4IHJA 4NXNO 5IY5B 5LYJB 3QO5A 5IY5C 2E76B 4DUYB 1VQ5V 3E8FA 1VQOV 3SDLA 4O4JB 3SJCC 5JH7A 3HKDA 4ZIBA 2DE0X 1GTOA 4R7CA 4NYKA 4O4LB 4JI6O 4D7TA 3B2EE 4J9YB 4LFBO 1N4CA 1QVGU 3K59A 1Y6XA 4O2BA 3CCLV 2UXNA 3T1YO 1YVWA 2FKXA 3LNNA 1ENVA 3JCUZ 3SJQC 5LA6B 1GM9A 1Q8IA 1SQXH 1SQGA 4HAMA 3K04A 1JVMA 1WPXA 3BAAA 3G80A 4RWUA 1Y76B 2RCVA 1KMIZ 3ZMUA 4JI5O 2HHHO 1YXBA 1Q86W 4EB6A 4QNHB 2L35A 3I5DA 4MVZA 4X1KA 1AI7A 2BE3A 3K0DA 2WLMA 3ZRWB 3GWKC 1EN4A 2IJHA 2PYJA 1Y4MA 1URFA 1JX9A 3IJ4A 4LNUB 3B8NA 3L72H 1RFYA 1HNXO 4PDMA 2F4VO 1G8MA 1VQ4V 2CGOA 4PA6A 4JV5B 3F5WC 3WG7B 2DJVA 3M7MX 4JI0B 4N23A 2Y48A 4YIPA 3CS5A 3UCSC 4UCOA 2P5OA 1B6QA 1MSWD 5EZYB 5JJNB 4I50B 1UPGA 5C8YA 1M5IA 1VF7A 3WFVA 1FFTB 4DYLA 5B1BC 4FM1A 2IJIA 2X0LA 4K3AA 4IYHA 2KG7B 2Y0PA 1OCRB 4J7JA 5CBHA 5L3CA 2ZNJA 4X66B 1RM1C 4LP8A 1TAEA 1L0LH 4X1IB 1Y67A 2NNUA 5LL6Y 3U0ZA 4UCSA 3RYHA 4E4EA 3OFNG 5KA5A 1F51A 3FB8C 1TUBB 1TA8A 4O4HB 3E89A 4BR6A 1XQ8A 2PI5A 2VQFB 3K9AA 1XHXA 2IU0A 2GTAA 1OCOB 2HG5C 2OT5A 1JJOA 1OCOC 2A9HA 4MVQA 1R6TA 3ABLB 4CS3A 4LF4B 4AI8A 3LUTB 1VQ8V 1Y66A 4TSFG 3E8HA 2IM9A 1GM7A 1N33B 1F7YA 1IURA 2W6JG 4ZHQA 3ICXA 4DV7O 2P6JA 2CH7B 3DC5A 1HNWB 1NTMH 2QWQB 2PI4A 1P49A 3STZC 4LWSB 1F4MA 1JFFB 3JD2A 4DR5O 5BZBA 4KHPO 1XNRO 3ETQA 4LF5B 2WLNA 1N34O 3CCEV 4PI0A 3MD0A 2P7TC 3QTCA 5LGNA 2EILC 3G4SV 1PNKA 1K34A 1M9NA 1PKXA 3AK2A 5IJ9B 2CTRA 1GMGA 3EHBB 4PA4A 3WB2A 1H8HG 2GTSA 4AHCA 1SQVH 1J5EB 5DEDA 1BCCH 3W7WA 4Q20A 4U3JB 4FLTA 1XNQO 4MTFA 4UCTA 1MSDA 3U11A 2YIAA 1YHQV 3UM7A 5LBQA 2EBOA 2R72A 3JARB 5CN0A 4JI3B 2UXBB 4JGSA 4CC5A 3OAAG 3ZRSA 4ZKIA 2JS3A 5JVDA 4DK0A 1AB3A 5K1PA 2VWKA 1Z5WA 2Q73A 3TGUH 5DM6V 1KKDA 4EFEA 4UUJC 4DR6B 4UVAA 5KAIZ 1K8AW 4XDJA 3UT5B 2Q0OC 4JI7B 1LNQA 1QLEB 1PV0A 2WLIA 2BTQA 5LXTB 4J41A 4P9OA 2WWWA 5EBWC 5JJEB 5KA6A 1F23A 3GWOA 2QE7G 4X64O 4MW3A 1M57B 5FLXN 2XAQA 3ETGA 1Q7YW 3RYCB 1BGYH 2ZE6A 3MAQA 1FFXB 4MTGA 1W0KG 5L3GA 3ZN0A 1I5YA 4CS4A 2QWOB 5IWAB 1XILA 2ZCEA 1H38A 5HFLA 4HNAA 2P4KA 4QE9A 4B3MO 2EIMC 4JYCA 2CDYA 1Q6UA 1TVKB 4TV8A 1G1XB 3UO3A 2Y0IA 1S77D 5L3FA 2DW4A 2Y4UA 3RYIA 4WBNB 1M90W 1NZ6A 1IXBA 1Y74B 3JATA 4RAIA 2H3OA 2Q4PA 2YDEA 2VQFO 5CA1A 1Z2GA 4I0XB 2F95B 5KHIA 1BMFG 1B3QA 1YTFB 5LP6A 2X6CA 4EEQA 2FTKA 3OMIB 3AG1B 2XUMA 3AG1C 3ZHVA 3GVMA 4JTDB 5DN6G 1B04A 5AG2A 3FX7A 4BIOA 3P3NA 1N33O 2LJ2A 2JGDB 2UU9O 2Q9LA 2YXLA 4DV5B 1QBZA 3D3QA 4CS2A 3W7SA 4O2AB 5J2TA 4WFEA 2JJ1G 2F1MA 4ZBMA 1OCCB 3BY6A 3K57A 3OTOO 3KCXA 4UB8Z 5BY1A 4FM0A 3QVNA 4JAUA 4JASA 1Q5OA 4C7UA 4LF5O 4X1YB 4IYIA 4NVPA 1KKCA 1BQ0A 2AHZA 1X4TA 4HYOA 3JD4A 4O4IA 3OW2U 4B3RB 2Q8VA 4MVSA 3M8AA 3AK1A 5CB4A 3HKBB 4DUZO 4LF9O 3CWBH 1VF5B 2PUSA 4BWAA 3H1KH 1VQLV 2V1DA 4KP4A 3JD1A 4YY3B 5L3EA 4RQEA 1YCIA 1J5EO 1VMGA 4DR4O 2Q0AA 3ZHQA 3K5OA 4PDVA 2ETNA 2EULA 2X6BA 1NVPD 2YI8A 1NH2B 4ICGA 4I5SA 3ASNB 3ZRXA 1I0HA 1S5LZ 3ASNC 5IJ0A 1PNMA 2WLKA 4TUYB 2JK5C 1KD1W 3W7TA 3CYOA 2P90A 2EZOA 4FLXA 3K08A 4DV3O 4YIOA 4FFBB 1O9GA 1K5QA 1MABG 4LF8B 4IT5A 5A2QN 1NKDA 2ODMA 5EYPB 3O9OA 2UXCO 3S3WA 5JQGB 3ZRVA 5ITZA 5KHJA 1V55C 4EKWA 4GLXA 2F66C 2JRIA 4JZGA 4I9QA 1JPXA 4GKKB 1AJQA 1VEWA 3EXAA 2BOCC 4YJ3B 3LSUA 3ABMC 4Z2WA 4ZI7B 5L3BA 4LH6A 2UXDB 1CP9A 3R65A 4JYYA 1JQ0A 2FB5A 1UJWB 4X62B 2XOKG 4UXNA 3LDDA 2JEXA 4I4TB 5IWAO 3TK1A 4H44B 4DRXB 2Q7GA 2LFRA 2FYUH 3BFRA 1R3LC 4LC1A 2ZR3A 2RMKB 1GN6A 3DXRB 3OGCC 4UV9A 5B3SC 3RWRD 3BA8A 4UCUA 4LFCB 1AJPA 3B09A 4FLUA 4PELA 3OEEG 4TV9B 2EIKB 3JAKA 4DR2B 2QSAA 2OCCB 5JCOC 1AJNA 2OCCC 4ABMA 1BQZA 1N36B 1FXKB 4PDLA 2QR4A 3MHSC 2ZIMA 1FXKC 1FJGB 2QTSA 1EZVH 4DV4B 2A3QA 5E1AC 2EINB 3OT7A 1NH2D 3K79A 4DR7B 2EINC 3CHXA 5EK0A 4OPHA 3NR7A 3A2FA 5JWPA 4TQDA 2R9AA 1WNSA 5FPOA 1XOUA 2FL4A 3N2KB 5CBGA 5F2VO 4B7EA 5LHHA 2UUAB 3A0RA 4IHJB 2UUCB 1XDCA 3HKCA 1Q82W 3L74H 5JH7B 4H0LB 2P22C 2DWEC 3C3TA 1QCEA 3BVOA 3FAVA 1HW7A 3N2GA 4GYCB 2BTOA 4O2BB 5E79Z 1HP8A 4OX9O 4JAAA 2OTJV 2XT9A 1JOYA 4MVRA 4JTCB 1M4UA 4YJ2A 3SPIA 3L73H 4MT8A 2MK3A 1ZTEA 4K8ZA 4O4LA 2P4VA 2ITDC 4RUFA 3STLC 4QPKA 3B4SA 3W7XA 4BAYA 3DTUB 3R66A 1E1QG 1GN4A 2EJ7A
chains in the Genus database with same CATH topology
4D6TH 1SQBH 3L71H 1BCCH 4U3FH 1PP9H 2BCCH 1NTZH 3L75H 1L0LH 3L74H 3L73H 1KYOF 2FYUH 1SQXH 2A06H 3BCCH 3H1IH 1NU1H 3TGUH 1NTMH 1KB9F 1SQQH 3L72H 4PD4F 1SQPH 3CXHF 3CX5F 1BGYH 3H1JH 3H1LH 1NTKH 1PPJH 1P84F 3CWBH 5KLVH 3H1KH 1BE3H 3H1HH 1EZVH 1SQVH 2IBZH 3L70H 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T H;  1SQB H;  3L71 H;  1BCC H;  4U3F H;  1PP9 H;  2BCC H;  1NTZ H;  3L75 H;  1L0L H;  3L74 H;  3L73 H;  1KYO F;  2FYU H;  1SQX H;  2A06 H;  3BCC H;  3H1I H;  1NU1 H;  3TGU H;  1NTM H;  1KB9 F;  1SQQ H;  3L72 H;  4PD4 F;  1SQP H;  3CXH F;  3CX5 F;  1BGY H;  3H1J H;  3H1L H;  1NTK H;  1PPJ H;  1P84 F;  3CWB H;  5KLV H;  3H1K H;  1BE3 H;  3H1H H;  1EZV H;  1SQV H;  2IBZ H;  3L70 H;  1L0N H; 
#chains in the Genus database with same CATH topology
 1IDS A;  4EB6 B;  3RYF B;  4X1K B;  3VQX A;  3CCJ V;  3SYO A;  2EX3 A;  4U3F H;  1YIT V;  1GH6 A;  4LF7 B;  2Q6A A;  5H6Q A;  3J81 N;  1VQP V;  3I55 V;  1ZL8 B;  3RBZ A;  1IXM A;  1Y76 A;  1KEC A;  2WA3 A;  3CX5 F;  1NQT A;  3HKE B;  4DK1 A;  1N32 B;  4JYA B;  4NB5 A;  2XND G;  3WG7 C;  3CC7 V;  1IBM O;  2ARH A;  3ZED A;  3RGB A;  4U7N A;  3ETE A;  3FYE B;  3CCQ V;  3E35 A;  1ZX3 A;  4FFK A;  3K0G A;  2Q67 A;  5C8Y B;  3A0H Z;  3CJH B;  1XMQ B;  1YI2 V;  5KLV H;  1MOF A;  1AI5 A;  3N27 A;  3P30 A;  2GUZ A;  5EBL C;  3ZMT A;  5IDJ A;  2UXD O;  1L1F A;  3OE7 G;  3B77 A;  2PZS A;  1P7B A;  1XMO B;  1OJH A;  5EZY A;  1XUQ A;  1OCR C;  3RN4 A;  4X62 O;  4GX2 A;  1QHT A;  4I50 A;  4JF3 A;  1NU1 H;  5KUM A;  3BEH A;  3RYH B;  2OIG A;  1N8R W;  2KG7 A;  2B9Z A;  2Z0A A;  2IU3 A;  4BIZ A;  4EFB A;  4X1I A;  1Q6H A;  4IIJ A;  4DR2 O;  1VQK V;  1R3I C;  5LMU B;  4J7K A;  3F5T A;  3ETD A;  4GKJ O;  1OZ0 A;  1TUB A;  4XBF A;  3ABL C;  2KQX A;  2F93 B;  5BR8 B;  2LW7 A;  1FJG O;  3K03 A;  3D36 C;  2IH3 C;  4JI8 O;  1GN2 A;  2ATK C;  3IAY A;  4DV4 O;  1I08 A;  3K58 A;  2MW2 B;  2QGN A;  4ZHQ B;  1QU7 A;  1OHH G;  4DR7 O;  3VQW A;  2UUB B;  1H2S B;  3K06 A;  3H1L H;  1H2L A;  3D36 A;  3H1H H;  1ZWI C;  1IZ3 A;  2LFS A;  1J95 A;  2QJ1 A;  3AG2 B;  3OUS A;  2CH7 A;  3QG5 A;  2UUC O;  3K5N A;  3CP1 A;  4DUY O;  1N0J A;  4LWS A;  2KKW A;  4J10 A;  1JFF A;  3OMA B;  4KFM A;  1WP8 A;  2V7Q G;  1YJ9 V;  1SF9 A;  3W7U A;  1K4D C;  2YIB D;  5KUK A;  3LDE A;  2UXX A;  2EZP A;  1NR1 A;  3H9V A;  3L70 H;  3FFQ A;  3KKY A;  1COW G;  1DLB A;  4PHZ A;  2XAJ A;  3D8C A;  4L8J A;  4UV8 A;  5D5P A;  2AZ2 A;  2ADP A;  3SPH A;  2AZ0 A;  5IJ9 A;  3DGE A;  1R3J C;  2L6L A;  2E3C A;  2H8P C;  1MG1 A;  2R9I A;  2OIE A;  3AG7 A;  3WU2 Z;  3ZHU A;  1WN7 A;  4U3J A;  2Z5U A;  4LFA B;  2A7W A;  2ZIN A;  4LF7 O;  5JVD B;  2Y69 B;  5EIB C;  4J80 A;  4FVM A;  1FPO A;  3Q4H B;  1GRJ A;  4TWK A;  2EIJ B;  1Q3E A;  1K4C C;  5H2F Z;  1N32 O;  4JV5 O;  4FZ1 A;  3G6E V;  2E5L B;  4JI0 O;  2D3O W;  1P4R A;  3HB3 B;  5CA3 A;  4K0K B;  2WLI B;  1QLE C;  3X2Q B;  1NTZ H;  1H2K A;  3BCC H;  4MVM A;  4QGP A;  1LR1 A;  1THZ A;  2CE4 A;  1M56 B;  2YEV B;  5B1A B;  3TET A;  3EVK A;  1M57 C;  2YSU B;  3ZJZ A;  4Z1M G;  2ZXW B;  2YI9 A;  5LXT A;  3LSS A;  1OV9 A;  1US6 A;  3BHP A;  3G6B A;  1S5J A;  5BMV A;  2E74 B;  4HNA B;  4X66 O;  2RN9 A;  1DK1 A;  3KG2 A;  1SZT A;  1Z5V A;  3ZHT A;  3RYC A;  3C3S A;  1FFX A;  3P32 A;  5CA0 A;  4CC6 A;  2QTO A;  3BAB A;  4RUE A;  2LP7 A;  2F23 A;  1JR9 A;  3SYA A;  1HDJ A;  2HP8 A;  5FPR A;  4X89 A;  5IYZ A;  1YJW V;  3O65 A;  3JAT B;  4Q6G A;  2RDC A;  4I7Z B;  4GZR B;  5EBM C;  5LOV B;  2AW9 A;  3F7Y C;  5LMN B;  1TVK A;  4RQF A;  4R50 A;  2N74 A;  1SC5 B;  1VAR A;  1FD9 A;  5LP6 B;  3K3W A;  2VQE B;  3FB5 C;  1EBO A;  2RJZ A;  1EN5 A;  4WBN A;  4X88 A;  4LF4 O;  1Y74 A;  3T1H B;  4PA3 A;  5EC2 C;  1PL0 A;  2HVK C;  5BR8 O;  1YDX A;  1E79 G;  2YID A;  4D6T H;  1WJZ A;  2WAM A;  4PI2 A;  1KU9 A;  4FJC C;  4E2L A;  4KL1 A;  4DW1 A;  2PTM A;  3LDC A;  1HNZ B;  1SQP H;  4AQY B;  1HNW O;  2BSK B;  5J2T B;  2UUB O;  4WFG A;  1W2B U;  1NR7 A;  2NLJ C;  4TT3 G;  2YXH A;  1N0N A;  1OCC C;  2H94 A;  2ZM6 B;  1FS0 G;  5EIB D;  4DV0 B;  5HFM A;  2IJK A;  2PYL A;  4ASU G;  1GKF A;  4JYB A;  1W0J G;  1WA8 B;  3PJS K;  1UFI A;  2W0F C;  3TCU A;  4O2A A;  1K9M W;  2F43 G;  4DV2 B;  5KMG B;  1M1K W;  2OWO A;  1R6K A;  2M6Y A;  2P06 A;  5CB4 B;  1VQN V;  4MS2 A;  3CCR V;  2ZT9 B;  5B1O A;  4ZOL A;  4LR3 A;  3C90 A;  4NXN B;  4GX0 A;  4X1Y A;  1HWY A;  4RO2 A;  1SER A;  2JIZ G;  4J11 A;  3CC2 V;  4FLZ A;  4D7S A;  1IVS A;  3ZMZ A;  1VF6 C;  2RNB A;  2ADQ B;  5JJJ B;  2A06 H;  4KXR A;  3KCY A;  4H33 A;  3TJT A;  3IFX A;  3JAL B;  3MDS A;  2K1E A;  4LFB B;  1E1R G;  2AHY A;  2GHY A;  3RFR A;  4PDR A;  5LGU A;  3K9S A;  4MVO A;  1JMK C;  4JI1 B;  3ZBH A;  4JI3 O;  2UXB O;  4GT1 A;  2HR3 A;  1L8D A;  4QPJ A;  3H1I H;  1XBL A;  5H9C A;  4CH3 A;  1V9P A;  2HHH B;  2PGG A;  5LGT A;  2E75 B;  4FLW A;  4DR6 O;  3APQ A;  3VOU A;  2C2A A;  3OR7 C;  1BHB A;  3CRQ A;  4JI7 O;  1YTF D;  4K0K O;  1I5X A;  1IBK B;  1V54 B;  4FFB A;  5J2U A;  1VIB A;  1V54 C;  2LGW A;  4QJF B;  2LO1 A;  2F4V B;  4GX1 A;  1SQQ H;  4NXM B;  1QLN A;  5EYP A;  2Q7H A;  5FNV A;  2WLL B;  1SA0 A;  3ABT A;  4JI4 B;  4WCE V;  2IW5 A;  4GUN A;  4PJ0 Z;  3CXC U;  2ITC C;  4A5U B;  1KQS U;  1WB8 A;  3OR6 C;  1R1B A;  2ZE7 A;  4P2Z A;  3B40 A;  5D5Q A;  3IC9 A;  4FM2 A;  3E8G A;  4I55 A;  1RPR A;  3LSQ A;  3ABK B;  3THO A;  5GTH Z;  1RSO B;  4YHH B;  3IC7 A;  4LBE C;  1VQ6 V;  4J9Z B;  5TIS Z;  4G27 B;  3AK3 A;  3AG4 B;  2QM7 A;  2DWD C;  1VQ9 V;  1RP3 B;  4J7Z A;  4DRX A;  3JAK B;  5KX5 A;  4IL6 Z;  2CTW A;  2EIK C;  3CRA A;  5LMN O;  1WPB A;  3JD3 A;  2X6A A;  1AVM A;  2HEP A;  2OCH A;  1U96 A;  2X7R B;  2VQE O;  3CCS V;  1QR9 A;  1H2N A;  3E22 A;  4F6R A;  3K5M A;  3JAS A;  2DYR B;  1AIL A;  3KZI Z;  5JCO A;  1O9H A;  4KUM A;  5GON A;  2XAF A;  4X20 B;  1FYJ A;  2BCC H;  1B06 A;  2Q69 A;  3L75 H;  2Y4T A;  3JAW B;  5C93 A;  4DV5 O;  4MVU A;  1TGO A;  1FXK A;  3PN1 A;  4AQY O;  1QR8 A;  4BW5 A;  1XL4 A;  1P84 F;  5KAF Z;  5LHG A;  4JZ2 A;  1MZF A;  2ZM6 O;  2ZQM A;  3OMN B;  4DV7 B;  4DV0 O;  3JAM N;  4NTW A;  2CK3 G;  1Q43 A;  2KB1 A;  3ZN1 A;  3HKC B;  3FB6 C;  1GN3 A;  1DF4 A;  5B5E Z;  1S76 D;  1DGS A;  2VS0 A;  3HKD B;  2GBO A;  2BOB C;  4FPP A;  5KHG A;  2DYS B;  4B3R O;  4JPR A;  2CTP A;  2DYS C;  3N2K A;  4CH6 A;  2CUG A;  2LW1 A;  1IBL B;  3BA9 A;  4K35 A;  1HR0 B;  3N2G B;  1N34 B;  4LCU C;  5IYD O;  2Q7E A;  5LYJ A;  2M7W A;  3FB7 C;  4YY3 O;  2HJD A;  4O4J A;  1KBH A;  4B7K A;  4YJ2 B;  3JYC A;  2YS8 A;  3CB2 A;  3LNM B;  5IYB O;  4NKG B;  4DR1 B;  4FZ0 A;  4DV6 B;  4Z1V A;  3UQ8 A;  3EFF K;  1AR4 A;  4I9W A;  4JI1 O;  2DOS A;  3HR0 A;  4MTX A;  5IYC O;  5LA6 A;  1XNQ B;  2XAH A;  3QNE A;  1YEW A;  5KHK A;  4OXS A;  1BT8 A;  4IGG A;  1PPJ H;  1ZSP A;  4LF8 O;  2P67 A;  4XDL A;  1XRE A;  2NR5 A;  3IGA C;  3RYF A;  5GW7 A;  3QO7 A;  3ZRW A;  4QIW F;  1CXZ B;  1QNM A;  3SGI A;  2NN4 A;  1ZL8 A;  1IBK O;  4LNU A;  2HKO A;  3CC4 V;  4GKK O;  4QE7 A;  3HKE A;  2B5U A;  4UFZ A;  3QO8 A;  1SES A;  4NXM O;  3H1J H;  1XHZ A;  2A79 B;  1SRY A;  5H5N A;  4JI4 O;  2JDI G;  2YIB A;  1AP6 A;  3RVZ A;  1XEQ A;  1KC8 W;  2GUZ B;  4NR1 A;  1ZAU A;  4WF9 V;  1LUW A;  4K8X A;  3AEI A;  2JGU A;  4MW8 A;  4X64 B;  3E8B A;  1BZK A;  1MNG A;  3CPW U;  2DMX A;  4LH7 A;  3CJH A;  1JA8 A;  1A32 A;  5B1B B;  1S5H C;  3J80 N;  1IX9 A;  4YHH O;  2K9P A;  1JCH A;  3JCZ A;  1BL8 A;  2IBZ H;  1RM1 B;  2QKS A;  3CEI A;  1AP5 A;  4LFC O;  2DQ3 A;  4JTA B;  4FLV A;  4B3M B;  4IIJ B;  1BHA A;  1FXH A;  2JVD A;  3JSN A;  4JI2 B;  3S3X A;  1N36 O;  1R3K C;  4MSW C;  3ZS8 C;  1AR1 B;  1X59 A;  1WB7 A;  2PY5 A;  2ZE8 A;  4O4H A;  2AGA A;  5J9P C;  3JD0 A;  2FML A;  1NI8 A;  1QVF U;  2WLJ A;  4G28 B;  3CCV V;  3UO2 A;  1ZUQ A;  1GAX A;  5CBF A;  4R8C A;  3VQV A;  2ZD9 A;  1PD3 A;  2DN9 A;  3CXH F;  1GK9 A;  3ZMS A;  2YUA A;  1P7G A;  2O57 A;  3CSX A;  2YC0 A;  1WP7 A;  2UU9 B;  1PNL A;  2UUA O;  2V4D A;  1DF5 A;  3A8T A;  3ZMV A;  3AG2 C;  2HJF C;  3ASO B;  3ML0 A;  4L87 A;  3ZX6 A;  3ASO C;  4FIP C;  3OTO B;  1SQF A;  5IT9 N;  2QDO A;  3HPL C;  2QKA A;  1IBL O;  1L0N H;  3F7V C;  1HR0 O;  1K73 W;  4FMT A;  2QM4 A;  4DV1 B;  4MTO A;  5KHH A;  4X8A A;  3FKS G;  2EIL B;  1NJI W;  5BXZ A;  3A0B Z;  4P9P A;  4P30 A;  3OUF A;  4DUZ B;  2WPD G;  4LF9 B;  2YIC A;  2WSS G;  3FD9 A;  2IH1 C;  2G38 A;  4PA9 A;  4OPA A;  4DR3 B;  4XDK A;  3SJB C;  1EN6 A;  4DR1 O;  1VQ7 V;  4X65 B;  4DV6 O;  2LQT A;  1RPO A;  1H2G A;  1ROP A;  4DR4 B;  4W4L A;  5L3D A;  2R70 A;  2N05 A;  5IE9 A;  2YXY A;  3E83 A;  3WB1 A;  2XTA A;  2Y69 C;  1T5E A;  3SPJ A;  4N21 A;  3CRC A;  2EIJ C;  1BE3 H;  3JAR A;  4X9Q A;  3CMA V;  4WFH A;  4JYA O;  1VQM V;  4DV3 B;  2W0X A;  5FL7 G;  2BTQ B;  1PL4 A;  4GX5 A;  3X2Q C;  3I56 V;  3Q4H A;  3G67 A;  2Q5Z A;  1CEZ A;  4UVC A;  1OCZ B;  3APO A;  1S0V A;  1M56 C;  2UXC B;  5B1A C;  3UT5 A;  1OCZ C;  4UVB A;  1XMQ O;  1K5S A;  2CGN A;  1FKA O;  1S72 V;  1K33 A;  2ZXW C;  3L9D A;  1PP9 H;  1MMM A;  1XMO O;  4UCR A;  3ZHS A;  5BMV B;  1H2M A;  2YEV A;  1I94 B;  1TUE B;  4DW0 A;  4TV8 B;  1NS1 A;  5CA0 B;  2QWN B;  3B8M A;  1NVP B;  5K1X A;  3RYI B;  3SYC A;  5A9G A;  3E86 A;  4LF6 B;  5IYZ B;  3UKM A;  3ZIA G;  1M93 A;  3QF7 A;  2EIM B;  5CA1 B;  1KYO F;  3OD4 A;  1PM9 A;  4JAV A;  1Q6I A;  5LMU O;  1S3J A;  2HLD G;  2ILM A;  4JI2 O;  4B3T B;  5LP6 C;  5CMU A;  1AI6 A;  3M99 B;  4NTY A;  4F6E A;  3T1C A;  1I7F A;  1KP2 A;  3BRC A;  1KP3 A;  1K97 A;  2QEX V;  3SPG A;  4WFA V;  5LOV A;  2EJR A;  4I0X A;  4W4K A;  1YIJ V;  2ZKO A;  5B1N A;  1Q81 W;  1SKV A;  4DO2 A;  3CME V;  3VBB A;  5B66 Z;  2ZIO A;  3SYP A;  2ZR2 A;  3ZHR A;  3RVY A;  4BIU A;  2JGD A;  2KSD A;  3BPZ A;  1WLE A;  4PV1 B;  1F4N A;  1K92 A;  2A0L A;  2BSK A;  2D2C B;  4F4L A;  1YJN V;  4O4I B;  4J42 A;  1NBM G;  3CCU V;  4WFB V;  2QKC A;  4B3S B;  5EC1 C;  4YXW G;  4HBN A;  3D3I A;  4ZOL B;  4B08 A;  2HVJ C;  3WB0 A;  5LHI A;  1VP7 A;  2RQ6 A;  3TXS A;  1WA8 A;  3FYI B;  3ZCC A;  1FAF A;  2GDS A;  4DV1 O;  1DTO A;  1YZB A;  4GCZ A;  3SJA C;  1SET A;  5KMG A;  3J7A U;  4G2K A;  1R6N A;  4FK5 C;  4H13 B;  4JI6 B;  3HKB A;  3JSL A;  1K7D A;  3ABU A;  1XL6 A;  4OX9 B;  3T1Y B;  2HFE C;  4TOI A;  3OEH G;  2WLH A;  4DR3 O;  5IJ0 B;  4X65 O;  3DSQ A;  3L71 H;  1VF6 A;  2ZE5 A;  1R73 A;  4R6Z A;  3OGI B;  4LFA O;  3JAL A;  5GTI Z;  1NT2 B;  4H37 A;  4PD4 F;  4CBC A;  3RW0 A;  2CAZ C;  4JI5 B;  3SR2 C;  3OM3 B;  1ORQ C;  4BW9 A;  1K3E A;  2QWR B;  4TUY A;  4CH5 A;  2B1I A;  1H8E G;  2JEU A;  3VQY A;  4PA7 A;  1EZJ A;  1GO3 F;  2DQ0 A;  2E5L O;  1W59 A;  1LUV A;  5ITZ B;  5J2U B;  1YF2 A;  1HNX B;  2XAG A;  3CRR A;  5FNV B;  3K5L A;  1BS3 A;  1CPY A;  1SA0 B;  2OYQ A;  1IBM B;  1BSM A;  5JQG A;  2WA4 A;  4AIL C;  1V55 B;  4FLY A;  1SZX A;  2PF4 E;  2Z3Y A;  2QM8 A;  3T4D A;  1D2D A;  4I55 B;  2LGQ A;  3E2E A;  2QWP B;  4YJ3 A;  3ABK C;  3CRM A;  3ABM B;  3T4Z A;  3DC6 A;  2WLL A;  1I94 O;  5DEC A;  4NTX A;  2VRZ A;  4ZI7 A;  1EM1 A;  1ARO P;  1MA1 A;  1MZE A;  2GSM B;  4CZZ A;  2ZDI C;  3SYQ A;  3SPC A;  1KUQ A;  3AG4 C;  4I4T A;  2CTQ A;  4LF6 O;  4CH4 A;  2XAS A;  5KX5 B;  3CCM V;  1Q90 D;  2JJ2 G;  3CD6 V;  1RSO A;  1YSC A;  1JJ2 U;  3U10 A;  1U97 A;  1G4Y B;  5B3S B;  2ZDI A;  3DXR A;  1NTK H;  1ZLZ A;  4B3T O;  3E22 B;  2W6I G;  2AXT Z;  4F6R B;  2B1G A;  2ZNI A;  2N04 A;  3GB7 C;  3JAS B;  4TV9 A;  2DYR C;  3T1H O;  5GON B;  1FXV A;  4OGQ B;  1QQC A;  1AI4 A;  4UB6 Z;  2Q68 A;  2GV9 A;  3P3P A;  4GKJ B;  4U7O A;  2VWJ A;  1G6U A;  2JS5 A;  4DXW A;  1HNZ O;  3H01 A;  4TQF A;  2XHB A;  4JI8 B;  1XI1 A;  3T2M A;  3MHH C;  3G71 V;  1GM8 A;  4X20 A;  3AG3 B;  1SQB H;  1D5N A;  2IJJ A;  3AG3 C;  2OTL V;  3OTF A;  2R9R B;  3JAW A;  3CE2 A;  4UCV A;  4WFF A;  1SS3 A;  4HZ3 A;  1KB9 F;  5H6R A;  1D5A A;  3NXS A;  1WAZ A;  3RT3 C;  4DR5 B;  1EFR G;  4KHP B;  1XNR B;  2QA4 V;  4DV2 O;  3TXQ A;  1AR5 A;  3FAV B;  4B3S O;  4IHJ A;  4NXN O;  5IY5 B;  5LYJ B;  3QO5 A;  5IY5 C;  2E76 B;  4DUY B;  1VQ5 V;  3E8F A;  1VQO V;  3SDL A;  4O4J B;  3SJC C;  5JH7 A;  3HKD A;  4ZIB A;  2DE0 X;  1GTO A;  4R7C A;  4NYK A;  4O4L B;  4JI6 O;  4D7T A;  3B2E E;  4J9Y B;  4LFB O;  1N4C A;  1QVG U;  3K59 A;  1Y6X A;  4O2B A;  3CCL V;  2UXN A;  3T1Y O;  1YVW A;  2FKX A;  3LNN A;  1ENV A;  3JCU Z;  3SJQ C;  5LA6 B;  1GM9 A;  1Q8I A;  1SQX H;  1SQG A;  4HAM A;  3K04 A;  1JVM A;  1WPX A;  3BAA A;  3G80 A;  4RWU A;  1Y76 B;  2RCV A;  1KMI Z;  3ZMU A;  4JI5 O;  2HHH O;  1YXB A;  1Q86 W;  4EB6 A;  4QNH B;  2L35 A;  3I5D A;  4MVZ A;  4X1K A;  1AI7 A;  2BE3 A;  3K0D A;  2WLM A;  3ZRW B;  3GWK C;  1EN4 A;  2IJH A;  2PYJ A;  1Y4M A;  1URF A;  1JX9 A;  3IJ4 A;  4LNU B;  3B8N A;  3L72 H;  1RFY A;  1HNX O;  4PDM A;  2F4V O;  1G8M A;  1VQ4 V;  2CGO A;  4PA6 A;  4JV5 B;  3F5W C;  3WG7 B;  2DJV A;  3M7M X;  4JI0 B;  4N23 A;  2Y48 A;  4YIP A;  3CS5 A;  3UCS C;  4UCO A;  2P5O A;  1B6Q A;  1MSW D;  5EZY B;  5JJN B;  4I50 B;  1UPG A;  5C8Y A;  1M5I A;  1VF7 A;  3WFV A;  1FFT B;  4DYL A;  5B1B C;  4FM1 A;  2IJI A;  2X0L A;  4K3A A;  4IYH A;  2KG7 B;  2Y0P A;  1OCR B;  4J7J A;  5CBH A;  5L3C A;  2ZNJ A;  4X66 B;  1RM1 C;  4LP8 A;  1TAE A;  1L0L H;  4X1I B;  1Y67 A;  2NNU A;  5LL6 Y;  3U0Z A;  4UCS A;  3RYH A;  4E4E A;  3OFN G;  5KA5 A;  1F51 A;  3FB8 C;  1TUB B;  1TA8 A;  4O4H B;  3E89 A;  4BR6 A;  1XQ8 A;  2PI5 A;  2VQF B;  3K9A A;  1XHX A;  2IU0 A;  2GTA A;  1OCO B;  2HG5 C;  2OT5 A;  1JJO A;  1OCO C;  2A9H A;  4MVQ A;  1R6T A;  3ABL B;  4CS3 A;  4LF4 B;  4AI8 A;  3LUT B;  1VQ8 V;  1Y66 A;  4TSF G;  3E8H A;  2IM9 A;  1GM7 A;  1N33 B;  1F7Y A;  1IUR A;  2W6J G;  4ZHQ A;  3ICX A;  4DV7 O;  2P6J A;  2CH7 B;  3DC5 A;  1HNW B;  1NTM H;  2QWQ B;  2PI4 A;  1P49 A;  3STZ C;  4LWS B;  1F4M A;  1JFF B;  3JD2 A;  4DR5 O;  5BZB A;  4KHP O;  1XNR O;  3ETQ A;  4LF5 B;  2WLN A;  1N34 O;  3CCE V;  4PI0 A;  3MD0 A;  2P7T C;  3QTC A;  5LGN A;  2EIL C;  3G4S V;  1PNK A;  1K34 A;  1M9N A;  1PKX A;  3AK2 A;  5IJ9 B;  2CTR A;  1GMG A;  3EHB B;  4PA4 A;  3WB2 A;  1H8H G;  2GTS A;  4AHC A;  1SQV H;  1J5E B;  5DED A;  1BCC H;  3W7W A;  4Q20 A;  4U3J B;  4FLT A;  1XNQ O;  4MTF A;  4UCT A;  1MSD A;  3U11 A;  2YIA A;  1YHQ V;  3UM7 A;  5LBQ A;  2EBO A;  2R72 A;  3JAR B;  5CN0 A;  4JI3 B;  2UXB B;  4JGS A;  4CC5 A;  3OAA G;  3ZRS A;  4ZKI A;  2JS3 A;  5JVD A;  4DK0 A;  1AB3 A;  5K1P A;  2VWK A;  1Z5W A;  2Q73 A;  3TGU H;  5DM6 V;  1KKD A;  4EFE A;  4UUJ C;  4DR6 B;  4UVA A;  5KAI Z;  1K8A W;  4XDJ A;  3UT5 B;  2Q0O C;  4JI7 B;  1LNQ A;  1QLE B;  1PV0 A;  2WLI A;  2BTQ A;  5LXT B;  4J41 A;  4P9O A;  2WWW A;  5EBW C;  5JJE B;  5KA6 A;  1F23 A;  3GWO A;  2QE7 G;  4X64 O;  4MW3 A;  1M57 B;  5FLX N;  2XAQ A;  3ETG A;  1Q7Y W;  3RYC B;  1BGY H;  2ZE6 A;  3MAQ A;  1FFX B;  4MTG A;  1W0K G;  5L3G A;  3ZN0 A;  1I5Y A;  4CS4 A;  2QWO B;  5IWA B;  1XIL A;  2ZCE A;  1H38 A;  5HFL A;  4HNA A;  2P4K A;  4QE9 A;  4B3M O;  2EIM C;  4JYC A;  2CDY A;  1Q6U A;  1TVK B;  4TV8 A;  1G1X B;  3UO3 A;  2Y0I A;  1S77 D;  5L3F A;  2DW4 A;  2Y4U A;  3RYI A;  4WBN B;  1M90 W;  1NZ6 A;  1IXB A;  1Y74 B;  3JAT A;  4RAI A;  2H3O A;  2Q4P A;  2YDE A;  2VQF O;  5CA1 A;  1Z2G A;  4I0X B;  2F95 B;  5KHI A;  1BMF G;  1B3Q A;  1YTF B;  5LP6 A;  2X6C A;  4EEQ A;  2FTK A;  3OMI B;  3AG1 B;  2XUM A;  3AG1 C;  3ZHV A;  3GVM A;  4JTD B;  5DN6 G;  1B04 A;  5AG2 A;  3FX7 A;  4BIO A;  3P3N A;  1N33 O;  2LJ2 A;  2JGD B;  2UU9 O;  2Q9L A;  2YXL A;  4DV5 B;  1QBZ A;  3D3Q A;  4CS2 A;  3W7S A;  4O2A B;  5J2T A;  4WFE A;  2JJ1 G;  2F1M A;  4ZBM A;  1OCC B;  3BY6 A;  3K57 A;  3OTO O;  3KCX A;  4UB8 Z;  5BY1 A;  4FM0 A;  3QVN A;  4JAU A;  4JAS A;  1Q5O A;  4C7U A;  4LF5 O;  4X1Y B;  4IYI A;  4NVP A;  1KKC A;  1BQ0 A;  2AHZ A;  1X4T A;  4HYO A;  3JD4 A;  4O4I A;  3OW2 U;  4B3R B;  2Q8V A;  4MVS A;  3M8A A;  3AK1 A;  5CB4 A;  3HKB B;  4DUZ O;  4LF9 O;  3CWB H;  1VF5 B;  2PUS A;  4BWA A;  3H1K H;  1VQL V;  2V1D A;  4KP4 A;  3JD1 A;  4YY3 B;  5L3E A;  4RQE A;  1YCI A;  1J5E O;  1VMG A;  4DR4 O;  2Q0A A;  3ZHQ A;  3K5O A;  4PDV A;  2ETN A;  2EUL A;  2X6B A;  1NVP D;  2YI8 A;  1NH2 B;  4ICG A;  4I5S A;  3ASN B;  3ZRX A;  1I0H A;  1S5L Z;  3ASN C;  5IJ0 A;  1PNM A;  2WLK A;  4TUY B;  2JK5 C;  1KD1 W;  3W7T A;  3CYO A;  2P90 A;  2EZO A;  4FLX A;  3K08 A;  4DV3 O;  4YIO A;  4FFB B;  1O9G A;  1K5Q A;  1MAB G;  4LF8 B;  4IT5 A;  5A2Q N;  1NKD A;  2ODM A;  5EYP B;  3O9O A;  2UXC O;  3S3W A;  5JQG B;  3ZRV A;  5ITZ A;  5KHJ A;  1V55 C;  4EKW A;  4GLX A;  2F66 C;  2JRI A;  4JZG A;  4I9Q A;  1JPX A;  4GKK B;  1AJQ A;  1VEW A;  3EXA A;  2BOC C;  4YJ3 B;  3LSU A;  3ABM C;  4Z2W A;  4ZI7 B;  5L3B A;  4LH6 A;  2UXD B;  1CP9 A;  3R65 A;  4JYY A;  1JQ0 A;  2FB5 A;  1UJW B;  4X62 B;  2XOK G;  4UXN A;  3LDD A;  2JEX A;  4I4T B;  5IWA O;  3TK1 A;  4H44 B;  4DRX B;  2Q7G A;  2LFR A;  2FYU H;  3BFR A;  1R3L C;  4LC1 A;  2ZR3 A;  2RMK B;  1GN6 A;  3DXR B;  3OGC C;  4UV9 A;  5B3S C;  3RWR D;  3BA8 A;  4UCU A;  4LFC B;  1AJP A;  3B09 A;  4FLU A;  4PEL A;  3OEE G;  4TV9 B;  2EIK B;  3JAK A;  4DR2 B;  2QSA A;  2OCC B;  5JCO C;  1AJN A;  2OCC C;  4ABM A;  1BQZ A;  1N36 B;  1FXK B;  4PDL A;  2QR4 A;  3MHS C;  2ZIM A;  1FXK C;  1FJG B;  2QTS A;  1EZV H;  4DV4 B;  2A3Q A;  5E1A C;  2EIN B;  3OT7 A;  1NH2 D;  3K79 A;  4DR7 B;  2EIN C;  3CHX A;  5EK0 A;  4OPH A;  3NR7 A;  3A2F A;  5JWP A;  4TQD A;  2R9A A;  1WNS A;  5FPO A;  1XOU A;  2FL4 A;  3N2K B;  5CBG A;  5F2V O;  4B7E A;  5LHH A;  2UUA B;  3A0R A;  4IHJ B;  2UUC B;  1XDC A;  3HKC A;  1Q82 W;  3L74 H;  5JH7 B;  4H0L B;  2P22 C;  2DWE C;  3C3T A;  1QCE A;  3BVO A;  3FAV A;  1HW7 A;  3N2G A;  4GYC B;  2BTO A;  4O2B B;  5E79 Z;  1HP8 A;  4OX9 O;  4JAA A;  2OTJ V;  2XT9 A;  1JOY A;  4MVR A;  4JTC B;  1M4U A;  4YJ2 A;  3SPI A;  3L73 H;  4MT8 A;  2MK3 A;  1ZTE A;  4K8Z A;  4O4L A;  2P4V A;  2ITD C;  4RUF A;  3STL C;  4QPK A;  3B4S A;  3W7X A;  4BAY A;  3DTU B;  3R66 A;  1E1Q G;  1GN4 A;  2EJ7 A; 
#chains in the Genus database with same CATH homology
 4D6T H;  1SQB H;  3L71 H;  1BCC H;  4U3F H;  1PP9 H;  2BCC H;  1NTZ H;  3L75 H;  1L0L H;  3L74 H;  3L73 H;  1KYO F;  2FYU H;  1SQX H;  2A06 H;  3BCC H;  3H1I H;  1NU1 H;  3TGU H;  1NTM H;  1KB9 F;  1SQQ H;  3L72 H;  4PD4 F;  1SQP H;  3CXH F;  3CX5 F;  1BGY H;  3H1J H;  3H1L H;  1NTK H;  1PPJ H;  1P84 F;  3CWB H;  5KLV H;  3H1K H;  1BE3 H;  3H1H H;  1EZV H;  1SQV H;  2IBZ H;  3L70 H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...