2FYUH

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2fyuH00
5KLVH 1NTKH 3H1KH 1PP9H 3L70H 3CX5F 4D6TH 3H1JH 3CXHF 1NU1H 2FYUH 1BGYH 3H1HH 1PPJH 1KYOF 1NTZH 2IBZH 1P84F 1BE3H 3H1LH 1SQQH 3L75H 4PD4F 1EZVH 2BCCH 3TGUH 1SQXH 1KB9F 1NTMH 1BCCH 1SQVH 1L0NH 1SQBH 3CWBH 3L71H 4U3FH 2A06H 3L73H 3L74H 1SQPH 3L72H 3BCCH 3H1IH 1L0LH
chains in the Genus database with same CATH superfamily
4J11A 2CK3G 1PM9A 2WPDG 2DN9A 2WA3A 5B3SC 2X7RB 4O4LA 3JAWB 2Y4TA 3VQWA 4E2LA 1JX9A 2JDIG 3HKCB 3CCRV 2VWKA 3MHHC 1RPRA 2M7WA 2YIDA 3AK2A 5DECA 3QO8A 4JI8O 1VF7A 3ZJZA 1NQTA 4H33A 3OTOB 3OMNB 4J42A 2JJ1G 1TGOA 2IJKA 2A9HA 3OEEG 1DF5A 4HBNA 1W0KG 3BEHA 4TV8B 4PA6A 5LA6A 1AJNA 4UB6Z 2UXBB 2A7WA 3K5MA 2A0LA 5LOVB 2ZKOA 5HFLA 4JYYA 4J80A 2ZQMA 4C7UA 4FFKA 2QDOA 1XI1A 1QR8A 2ZIMA 4JGSA 4DV1B 3CC7V 1VARA 3CCLV 2G38A 1GN6A 2P6JA 4LFCO 3CRMA 3ZRWA 2WLLA 1XL4A 1WP8A 1IXBA 4K3AA 2YDEA 1HR0O 3RYCB 4MVSA 4J7ZA 2OIGA 4X9QA 4WFFA 2LGQA 2QJ1A 1JA8A 5CA1B 3SPIA 2D3OW 5FL7G 3JARB 5KHIA 2QM4A 1FXKB 1WPBA 1LUVA 2CDYA 5BMVA 1YEWA 3SYOA 4P2ZA 2EZPA 3VOUA 4X20B 1CXZB 1Y67A 5H6RA 5C8YA 3FB8C 1YJ9V 1Q82W 1JVMA 4DV7O 3G6EV 3G6BA 1FAFA 1EM1A 3B2EE 4RAIA 2AHZA 2JEUA 5AG2A 1HR0B 5IYDO 3G67A 3RBZA 1GK9A 3IC9A 1G8MA 3K0GA 1Y76A 4GUNA 4DV4O 4QPJA 1PP9H 5IYZB 2V7QG 1YJWV 1KP2A 3ABLC 5L3EA 3RFRA 1NBMG 1SA0B 3KCYA 4QIWF 3T1HB 4ZIBA 3ZS8C 4CH6A 1BCCH 2ZCEA 5KUMA 5BZBA 3KZIZ 2Q0OC 3BFRA 3SJQC 1QLEC 1V54B 1VQNV 3BY6A 3M8AA 1CEZA 4IYIA 3OMAB 1GN3A 2W6JG 4OGQB 1BE3H 5JVDB 5KHJA 1JFFB 5J2TB 3P3NA 2HKOA 1BSMA 3OEHG 1VQ6V 3CJHB 4DR1B 1ZLZA 4JASA 4JI6B 1J5EB 1OCOB 1QLNA 4DR5O 1AI5A 4Z1MG 3LDDA 3KCXA 3WB0A 3ZRVA 4FLVA 1Q6IA 1QQCA 2GHYA 2BE3A 4GX1A 1H2NA 2QTOA 4ZHQA 4FM1A 1TVKB 5A9GA 2XNDG 1D5NA 2Q6AA 5B66Z 2JRIA 3A0RA 4MW8A 4GKJB 3CPWU 4DR3O 5CA0A 3AG2C 1H8HG 4BIZA 3QTCA 1FXVA 1YSCA 1ZL8B 3U10A 1AR1B 4RQFA 1AR5A 1GRJA 1K7DA 2YXYA 1E1QG 1SKVA 3L75H 4O4HA 5LMUO 1N36O 5J2UA 1I5YA 4F6RA 4WFBV 5D5QA 5LYJA 2EIJC 2V1DA 4PA3A 3E35A 4DR5B 3CCVV 5FPOA 3DXRB 5KHGA 4YHHB 5KX5A 1EFRG 1FD9A 4JI3B 3G4SV 3S3WA 4YJ2A 2A79B 4X64O 3RWRD 4KP4A 4NR1A 2WLIA 2V4DA 5TISZ 2OIEA 1S72V 4I55B 1GN2A 2OCCB 4MVZA 5CMUA 3ZN1A 3BVOA 2CTRA 4O2AA 4NTYA 2HR3A 4L8JA 3NR7A 1I5XA 3TXQA 1MZFA 4B7KA 4PDMA 4UCSA 5BY1A 2JVDA 1HWYA 1M57C 3K06A 2KQXA 5C8YB 2EULA 4NXMO 2UXXA 4LF8B 4J41A 5EC1C 5LHHA 2UXCO 5K1XA 2Q7GA 4B3RB 1QR9A 1Q6HA 1GM9A 4YXWG 5GTIZ 1S5HC 4LF6B 1YJNV 2JS3A 1QVFU 3N2GB 3R65A 2ILMA 2ZM6O 2UXDO 1SZXA 3CCEV 1K8AW 3N2KA 1XMQO 4I9WA 4X1YA 5EK0A 2Z0AA 3CCQV 4EKWA 2CGNA 1KECA 3RGBA 2KG7B 3FAVA 1QHTA 2KB1A 1P4RA 1Y66A 1TUEB 5IYBO 1WN7A 2IJHA 1PNMA 2Q73A 3TJTA 1GAXA 3AG1C 2ZNIA 1K5QA 4I4TB 3HB3B 1SQPH 3F7VC 1M90W 2LO1A 2IJIA 3T1YB 1E79G 3ETGA 5IY5B 1TAEA 4DV0O 1XMQB 4H13B 2NLJC 3R66A 1NKDA 2UU9O 1ZWIC 1K97A 3ASNB 3GVMA 3OM3B 4X66B 3OUSA 4NVPA 5LHIA 4CH4A 2AXTZ 3AG4C 3RVZA 4K8XA 3EHBB 1XREA 1HP8A 3UO3A 3B4SA 5KLVH 2DWEC 4TWKA 3H1JH 4P9OA 4B7EA 3JASA 1MABG 1FFTB 2FYUH 3UO2A 1P84F 2F66C 3TXSA 2HVJC 3VBBA 3MDSA 1BQ0A 5EC2C 4O4JB 3OTFA 4IHJB 1OCZC 1VQMV 3TCUA 4YY3O 2BTQB 2Q7EA 4O4IA 1W2BU 3LSUA 2HJDA 3CRAA 3SR2C 3CHXA 3L72H 5IJ9B 4JI1O 3ZMVA 3U11A 2ZE8A 2RQ6A 1VQ8V 2K1EA 4CBCA 2UU9B 3JAKA 4PA4A 4IGGA 3D8CA 3BA8A 1KKDA 1EZVH 1M4UA 3OMIB 1N0JA 1KB9F 5CB4A 1GH6A 3D3IA 5KHKA 1BS3A 2B1GA 3LUTB 2BTOA 4UVAA 2X0LA 1GM8A 2MK3A 1S3JA 4LH6A 5H5NA 3CC2V 4LCUC 2ZDIA 5H9CA 5EIBC 5BXZA 1JMKC 4UFZA 4JTAB 4YY3B 2XHBA 2N05A 4TV9A 5BR8O 4JZGA 3C3SA 2GTSA 3OT7A 4B3SB 2JEXA 1I94O 4K0KB 1NT2B 3OR6C 1DF4A 2H8PC 2Y69B 5LXTA 2IH1C 4DUYB 4TUYA 4PI2A 3H9VA 1IBLB 1N33O 1SZTA 2WSSG 3CMEV 2OT5A 4FIPC 1JPXA 3JD3A 3RYFB 2QWRB 5EBWC 2HVKC 1U97A 1DGSA 4DW0A 5JH7B 1R6KA 2X6AA 2VS0A 1Y74B 2Z5UA 4JI0B 2PI5A 2YEVA 1AILA 1KD1W 1IBKB 1US6A 3QNEA 4QGPA 4X62O 4X65B 1GN4A 3LDCA 4LC1A 3A0BZ 5BR8B 4X1YB 3K04A 4XDKA 3MAQA 3ZN0A 1I94B 1SQBH 4FJCC 1VEWA 4A5UB 3CMAV 1MNGA 4IT5A 1FXKC 1Z2GA 3DC6A 1XNQB 2OWOA 4GZRB 1V55B 5KAIZ 4MTGA 4U3JA 1N0NA 2IU0A 5CBFA 2DE0X 1H38A 3CSXA 1JCHA 4LF5B 3H1LH 2XAJA 1UPGA 3GWKC 2OTJV 4WFAV 3OUFA 4Z2WA 2IU3A 1K9MW 1IBMO 4LF9O 2EIKB 3FB6C 1PKXA 3G71V 2F23A 2ADQB 2WA4A 1FJGB 2Q7HA 1EN4A 5EYPB 4UCRA 4LFAO 3TETA 5F2VO 2XAHA 4QE7A 4QNHB 2RCVA 3T4DA 1F51A 1HNZO 4U7OA 3FYEB 4GX0A 4X89A 1WNSA 3IC7A 1VQLV 2YS8A 1LR1A 1ZX3A 1VMGA 2PYJA 5KHHA 3MHSC 4KXRA 1NTKH 4EB6A 2GSMB 3CYOA 1YF2A 1BGYH 4RWUA 1V54C 2PUSA 1GO3F 1TUBB 4GX5A 4DXWA 1VF6C 1Q5OA 4O4IB 3SJBC 1Q7YW 1WB7A 2CAZC 5DEDA 5IJ0A 4AI8A 4FM2A 4FM0A 2LP7A 2ZR3A 5LMNB 2F4VB 1WA8A 3IAYA 5IT9N 2B9ZA 5B1BC 4KHPB 1OCOC 4FMTA 4D7SA 2HHHO 1PL0A 2YIBA 1D5AA 5KMGA 1PD3A 3P32A 2VQFO 3JALA 1M1KW 3BA9A 5JQGB 2YI8A 4XDLA 2LW1A 1RSOA 3RYHA 1OCCC 3STZC 5LHGA 5H6QA 3ABKC 1NTZH 4WFEA 3BPZA 3T2MA 5LP6A 2L35A 1ZSPA 1K3EA 4JI8B 3ASOC 4PV1B 5LP6C 4DR6O 2Y48A 3D36C 1ENVA 4D6TH 2QE7G 2JJ2G 3K5NA 4IYHA 4LFBO 3O65A 1OV9A 3PJSK 4DV5O 1W0JG 4LWSA 4BIUA 4UVBA 4OX9O 1R3JC 3L71H 2EINB 3TK1A 5JJNB 2Q4PA 1EZJA 4X1KB 3E8BA 4NXNO 3Q4HB 4GYCB 4JPRA 4ZOLA 4LFCB 2CGOA 2BOBC 3W7TA 3AG3B 2PI4A 3ETEA 3FYIB 2F43G 2P90A 1MSDA 1KQSU 3HKBB 3K57A 4DR6B 5EZYA 1TA8A 4JYBA 2RN9A 3ZMUA 3RYIA 4NTWA 3M7MX 1BMFG 2E5LO 4B3TO 1DTOA 4DV5B 1NJIW 4HYOA 3ZHVA 3ZRSA 5CBGA 3LSQA 1H2MA 4OX9B 3OW2U 2W6IG 1FFXB 4BAYA 2GUZB 4DYLA 4MSWC 4HNAA 2UUAO 2LFRA 4ZBMA 4WBNA 1XL6A 4UCUA 3HKDB 4LR3A 4DV7B 4DR2O 2Y0IA 2UXNA 1IXMA 3HKEB 4ZI7B 3K5OA 3EVKA 4FPPA 5IE9A 2IW5A 2XT9A 1IURA 1SQGA 1SRYA 1AJPA 4AHCA 3D3QA 1JR9A 1NS1A 4CC6A 4DV4B 2C2AA 2XAGA 1S5LZ 1GKFA 1YITV 1D2DA 4FZ0A 3ZHQA 2JGDA 3ABMB 3B77A 1H2SB 5GONA 1P7BA 4O4LB 3WB2A 2W0XA 2OCHA 3ZRXA 1EN5A 2DOSA 5IY5C 1BT8A 2NR5A 4JTCB 4I0XA 2ZE5A 2Q9LA 4DR7O 2VQEO 3SPGA 3ASNC 2RNBA 1NH2B 4TOIA 3P30A 3DGEA 1QBZA 2Q8VA 3C3TA 1W59A 2H3OA 2DW4A 2Q68A 1OCRC 3BRCA 3N27A 4KFMA 3ZMZA 1N32O 1BHBA 5LA6B 1UFIA 2A3QA 1I08A 3F7YC 3APOA 3JCUZ 4FLXA 3SYCA 1VQ4V 5B1NA 1RSOB 2EJRA 2PYLA 5E79Z 4BIOA 2LJ2A 4LF4O 1Q6UA 3ZRWB 2WLLB 1O9HA 1AVMA 1HNWO 3ZHTA 2EILB 2ODMA 4DR7B 4I7ZB 4JYCA 4DR3B 5IWAO 1Q43A 4DR4O 4X1IA 4PDVA 1S0VA 3RT3C 1YVWA 4JI2O 2ARHA 1G4YB 2UUBO 2JS5A 3U0ZA 2QM8A 4AQYO 5LMUB 4UUJC 1N36B 1KC8W 5BMVB 3OD4A 1VQ9V 4EEQA 3E22A 1WAZA 2CH7A 4DUZO 4ZOLB 5D5PA 3WG7B 4MTXA 1JJ2U 3JATA 2ETNA 4X64B 4JI7O 3ZEDA 4LNUA 1JQ0A 3JCZA 1KMIZ 5KUKA 5FNVA 2Y69C 4FLZA 3ABLB 4U3FH 1Y76B 2BSKA 3QG5A 3UT5A 1M9NA 2M6YA 4PJ0Z 5DN6G 1GM7A 4X88A 2WWWA 4CH5A 1N4CA 2IH3C 1PV0A 4FFBA 4DV2O 2XAFA 3K3WA 2BCCH 4DUZB 4NXMB 4FLYA 2UXCB 1HDJA 2DQ3A 4I9QA 2W0FC 1F4NA 5B5EZ 3LDEA 2ZM6B 1FKAO 2UXDB 2DYRC 4FLTA 1NU1H 1AP6A 2E75B 1QVGU 1Q3EA 1ORQC 3SJCC 2WLHA 3TGUH 4JV5O 2P22C 1BZKA 4ABMA 3A0HZ 1PNKA 4HAMA 4H0LB 2DYSB 3CXCU 2YSUB 4MW3A 1NVPB 2D2CB 1FXHA 1RPOA 4BW5A 1WB8A 1X59A 1QU7A 2GBOA 2KSDA 4CS4A 1R3IC 4ZHQB 3K59A 1YCIA 3C90A 1AB3A 3J81N 1YI2V 3CCSV 4IIJA 4WF9V 1N34O 1VQKV 3CCJV 1LUWA 3WU2Z 1HNXO 2NNUA 5CA0B 4I50A 1P49A 4DV0B 2AGAA 3OGIB 2XOKG 2AHYA 2P7TC 4Z1VA 3K58A 4JAVA 2JIZG 4O4HB 2IBZH 1Q86W 5J2UB 1K73W 3JAWA 4F6RB 5L3CA 5LYJB 2F93B 3HKCA 4N23A 1SQVH 4JI5O 4G28B 2FB5A 3K08A 1KUQA 4MVQA 5KX5B 2VWJA 2OTLV 1BHAA 4GKKO 3JD2A 5JJEB 2R9AA 4YJ2B 3T1CA 2Q0AA 3ZMSA 4Q6GA 1QCEA 2WLIB 1SQQH 4B3MO 1N34B 4HZ3A 3QF7A 1HNXB 4UXNA 4TV8A 2A06H 5JCOC 1K4DC 4WCEV 4JI1B 2N74A 4O2AB 1AP5A 5LOVA 1PNLA 3L9DA 1SERA 2RMKB 4DV6O 4UCVA 1XNRO 2ZE6A 2B5UA 3J7AU 2QR4A 2FKXA 4OXSA 3I56V 4IL6Z 1H2KA 4GKKB 3ABUA 3FKSG 3RYCA 2BOCC 3RN4A 5LBQA 4B3MB 5CA1A 4WFGA 1XHXA 3F5WC 3H01A 1H2LA 3N2KB 1G6UA 3KKYA 3SPHA 4X8AA 2YXHA 1FXKA 4FK5C 3E8FA 1Y6XA 3A2FA 1SQXH 4JI4O 1XUQA 3B40A 3FAVB 4X20A 1THZA 2P06A 3ZMTA 5B1OA 3UM7A 1N33B 1SF9A 2EINC 3EXAA 3AG1B 2LQTA 3G80A 3W7UA 5EBLC 3MD0A 1YZBA 4PI0A 1K4CC 3UKMA 4MVOA 1Q8IA 3W7XA 5KAFZ 4NB5A 4JZ2A 4X62B 5GTHZ 4NTXA 2QKAA 1EN6A 3LSSA 1NZ6A 5IYZA 3AG4B 3CS5A 3RW0A 1AR4A 1U96A 4R7CA 3WB1A 2AW9A 2FTKA 1SA0A 4TQFA 1VQ5V 5KA5A 1O9GA 2ZE7A 3WFVA 4R8CA 2QTSA 3THOA 3JASB 2EX3A 3SGIA 2VRZA 1YHQV 1SS3A 1OCZB 1V9PA 3W7SA 1VF6A 5E1AC 3OTOO 3OE7G 2P5OA 1YDXA 3JD1A 2CTQA 1SC5B 1IBMB 4MTOA 5JVDA 4LF9B 1JFFA 3IGAC 5J2TA 4FZ1A 1IZ3A 4I50B 3JYCA 3CJHA 2UXBO 4LFAB 2QWOB 3JAKB 3CRQA 4ASUG 1HNZB 3CRCA 3B8MA 3AEIA 4UVCA 1XMOO 4DV1O 3GWOA 5ITZA 4CZZA 2WLNA 5CB4B 3ABMC 3E2EA 2QWQB 1KBHA 2P4KA 1TVKA 4MTFA 1X4TA 1ROPA 1IX9A 3H1KH 3OGCC 2GDSA 4OPHA 2ITCC 3E89A 3P3PA 4TT3G 1NH2D 4NKGB 1ZL8A 4TV9B 4I5SA 3M99B 1NI8A 2YC0A 2ZD9A 4QPKA 2YIBD 1VQOV 3D36A 3B09A 1YIJV 3AG7A 4UCTA 1LNQA 5LXTB 4FLWA 3UCSC 2LW7A 2ADPA 4TUYB 3FFQA 4JTDB 3DXRA 1XMOB 2XUMA 1J95A 3CRRA 5B1AB 5DM6V 3H1HH 4W4KA 2HHHB 4J7KA 5L3DA 3OFNG 3S3XA 2VQFB 2YUAA 1RM1B 1AI4A 2QWPB 4PDLA 3CC4V 2E3CA 3CCMV 2YEVB 2P4VA 2EJ7A 1OJHA 4CC5A 2MW2B 5A2QN 1XOUA 2ZXWB 4I55A 2EILC 2HFEC 1WJZA 1XEQA 1M56B 3KG2A 3QVNA 3ZHUA 2B1IA 3DSQA 4NYKA 1WPXA 4DV3O 1ZUQA 3SYPA 2OCCC 4GX2A 3T1HO 1JOYA 3FX7A 1NTMH 2R9IA 2P67A 4O2BA 2K9PA 1NR7A 4U3JB 4LFBB 4K35A 3ZBHA 3ABTA 1PL4A 4UB8Z 1L8DA 1KYOF 3N2GA 2X6CA 3WG7C 1N8RW 3RVYA 4MS2A 2EIMB 2QKSA 4H44B 3X2QB 4LF7O 4NXNB 4DR1O 5C93A 4DRXA 1P7GA 2GTAA 4JI6O 3QO5A 4DV3B 1J5EO 4P9PA 2Q69A 2KG7A 4PA7A 1VQ7V 1K33A 4KL1A 2CTWA 4GLXA 1L0NH 4UV9A 3E8GA 2DMXA 5B3SB 2E5LB 4B3TB 3BCCH 4EB6B 4I4TA 4GKJO 3L70H 1M5IA 4FVMA 2X6BA 2FL4A 2L6LA 4UV8A 4GCZA 4QE9A 1GTOA 2UUAB 4LF7B 1WLEA 1XHZA 5IJ0B 2IJJA 2CE4A 1YTFD 1H2GA 4DR2B 1Q90D 3PN1A 5B1BB 2YXLA 1R1BA 4MVUA 1Q81W 4G27B 1WA8B 4TQDA 4YHHO 2DYSC 1RFYA 5ITZB 2HEPA 4JI3O 1NVPD 4PELA 2PY5A 4BWAA 1MA1A 4L87A 1IDSA 4QJFB 2HP8A 5KMGB 1URFA 3STLC 1OCCB 3ML0A 1VIBA 3JALB 4GT1A 5GW7A 1E1RG 4O4JA 4IHJA 5FLXN 2YIAA 3ABKB 3CP1A 2QSAA 3UQ8A 2ZT9B 2BTQA 3RYHB 2QKCA 1OHHG 3OAAG 5IJ9A 4J7JA 3DTUB 4RUEA 1MMMA 2E74B 1I7FA 3ASOB 5LP6B 3AK1A 2VQEB 2ATKC 4DO2A 4YJ3A 4DK1A 2O57A 4XBFA 3I55V 4LF8O 2JGUA 3ZX6A 4R6ZA 2PZSA 3AK3A 1AI6A 4B3RO 3IFXA 3LNNA 2R9RB 4LF6O 1N32B 1NR1A 4LWSB 1S77D 1JJOA 4PA9A 3K5LA 1GMGA 3DC5A 1FYJA 1DLBA 3FB7C 3L74H 4EFBA 3CEIA 4LF4B 3B8NA 1MOFA 1K92A 1HNWB 3SDLA 5CBHA 1ZAUA 4AILC 1XILA 4UCOA 3RYFA 4R50A 4O2BB 4E4EA 1BQZA 5IWAB 5EZYB 1COWG 2N04A 5JH7A 4DR4B 3L73H 3RYIB 1Y74A 4DW1A 2LGWA 4JI2B 2FMLA 2F95B 2UUBB 1AI7A 1FPOA 2E76B 4AQYB 4F6EA 3T1YO 1CPYA 5K1PA 2Y0PA 1QLEB 1T5EA 1VQPV 4HNAB 3SJAC 4WBNB 3ZIAG 4X66O 2RDCA 4DRXB 3JD0A 2XTAA 4CS3A 3JAMN 4JI7B 3HPLC 4OPAA 5JWPA 1K5SA 4J9ZB 2KKWA 3APQA 4RQEA 1V55C 2QA4V 1YTFB 1VP7A 3CB2A 1L1FA 1R3KC 3VQYA 3J80N 1DK1A 2JGDB 3GB7C 2QWNB 1F7YA 5GONB 3SPCA 4D7TA 4N21A 4EFEA 5EYPA 4DV2B 2EIKC 5IDJA 3E8HA 3HR0A 4J9YB 1OZ0A 3VQVA 5CN0A 1B04A 1IVSA 4I0XB 3AG2B 1EBOA 4Q20A 2Z3YA 1OCRB 4MVMA 3ZHSA 1SQFA 5IYCO 3ICXA 5JJJB 1Z5WA 3H1IH 3ETDA 4PDRA 1WP7A 4LBEC 5LGTA 1FS0G 2Q67A 2EIJB 2XAQA 4JF3A 1PPJH 1AROP 2QEXV 4MVRA 5L3GA 3CD6V 2R72A 4JV5B 2GV9A 1TUBA 3I5DA 2NN4A 4JAUA 4LP8A 1RP3B 3K9AA 4J10A 1HW7A 5LL6Y 4K8ZA 3VQXA 4CH3A 2PTMA 4U7NA 2ITDC 2R70A 3LNMB 4B3SO 4K0KO 2LFSA 1XBLA 1I0HA 2AZ0A 4XDJA 5CA3A 1M93A 1R6TA 2YICA 3IJ4A 4DUYO 1IBLO 3E86A 4YIPA 2PF4E 2Q5ZA 5JCOA 5EBMC 4YJ3B 4FLUA 1KKCA 2JK5C 4B08A 2PGGA 3QO7A 3JD4A 4G2KA 1R73A 4ZKIA 3K9SA 5L3FA 1UJWB 3JSNA 1A32A 4X1IB 4MT8A 1SETA 4JI0O 4RUFA 5JQGA 3K03A 4BW9A 3CXHF 1IBKO 1M57B 5EIBD 2WLJA 4X65O 2DWDC 3ZHRA 1R3LC 5HFMA 2Y4UA 3E22B 4PD4F 2CH7B 2ZDIC 4JI5B 2CTPA 2UUCO 3EFFK 1Z5VA 3F5TA 5LGNA 2XASA 3SPJA 2ZINA 3CE2A 3O9OA 4LH7A 4JAAA 5LGUA 2WLKA 3CCUV 3OR7C 1XNQO 2DQ0A 3JATB 4ICGA 4LNUB 1KU9A 1KP3A 4CS2A 3SYQA 5FPRA 3T4ZA 5FNVB 2ZIOA 2RJZA 3JARA 1CP9A 4LF5O 1SESA 1S76D 5B1AC 3SYAA 1ZTEA 2HG5C 2BSKB 2DJVA 1XDCA 3K79A 3JSLA 3UT5B 4DV6B 4JYAO 1RM1C 4X1KA 5J9PC 1VF5B 2CUGA 1XNRB 3Q4HA 1Y4MA 1FJGO 4FFBB 2ZXWC 2ZR2A 3FB5C 1M56C 1B3QA 4KUMA 5KA6A 2UUCB 2WAMA 3FD9A 2YI9A 2DYRB 5L3BA 4W4LA 3HKBA 3AG3C 2WLMA 5H2FZ 1MG1A 3BHPA 1F4MA 1L0LH 2HJFC 4F4LA 1BL8A 3K0DA 1S5JA 1AJQA 1B6QA 4WFHA 4JI4B 1K34A 1MSWD 1F23A 4PHZA 1MZEA 1R6NA 1FFXA 2GUZA 3CWBH 4JYAB 3E83A 1B06A 3A8TA 2IM9A 3NXSA 3ETQA 3BAAA 2QGNA 3HKDA 4DK0A 2EIMC 2OYQA 3CX5F 4YIOA 1G1XB 4H37A 3HKEA 3X2QC 4ZI7A 2EZOA 4TSFG 5LMNO 1YXBA 4P30A 1XQ8A 2F4VO 4RO2A 2F1MA 2HLDG 2AZ2A 4IIJB 2QM7A 4BR6A 4KHPO 3BABA 2H94A 1QNMA 2ZNJA 3W7WA 1H8EG 3ZCCA 2EBOA
chains in the Genus database with same CATH topology
5KLVH 1NTKH 3H1KH 1PP9H 3L70H 3CX5F 4D6TH 3H1JH 3CXHF 1NU1H 2FYUH 1BGYH 3H1HH 1PPJH 1KYOF 1NTZH 2IBZH 1P84F 1BE3H 3H1LH 1SQQH 3L75H 4PD4F 1EZVH 2BCCH 3TGUH 1SQXH 1KB9F 1NTMH 1BCCH 1SQVH 1L0NH 1SQBH 3CWBH 3L71H 4U3FH 2A06H 3L73H 3L74H 1SQPH 3L72H 3BCCH 3H1IH 1L0LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV H;  1NTK H;  3H1K H;  1PP9 H;  3L70 H;  3CX5 F;  4D6T H;  3H1J H;  3CXH F;  1NU1 H;  2FYU H;  1BGY H;  3H1H H;  1PPJ H;  1KYO F;  1NTZ H;  2IBZ H;  1P84 F;  1BE3 H;  3H1L H;  1SQQ H;  3L75 H;  4PD4 F;  1EZV H;  2BCC H;  3TGU H;  1SQX H;  1KB9 F;  1NTM H;  1BCC H;  1SQV H;  1L0N H;  1SQB H;  3CWB H;  3L71 H;  4U3F H;  2A06 H;  3L73 H;  3L74 H;  1SQP H;  3L72 H;  3BCC H;  3H1I H;  1L0L H; 
#chains in the Genus database with same CATH topology
 4J11 A;  2CK3 G;  1PM9 A;  2WPD G;  2DN9 A;  2WA3 A;  5B3S C;  2X7R B;  4O4L A;  3JAW B;  2Y4T A;  3VQW A;  4E2L A;  1JX9 A;  2JDI G;  3HKC B;  3CCR V;  2VWK A;  3MHH C;  1RPR A;  2M7W A;  2YID A;  3AK2 A;  5DEC A;  3QO8 A;  4JI8 O;  1VF7 A;  3ZJZ A;  1NQT A;  4H33 A;  3OTO B;  3OMN B;  4J42 A;  2JJ1 G;  1TGO A;  2IJK A;  2A9H A;  3OEE G;  1DF5 A;  4HBN A;  1W0K G;  3BEH A;  4TV8 B;  4PA6 A;  5LA6 A;  1AJN A;  4UB6 Z;  2UXB B;  2A7W A;  3K5M A;  2A0L A;  5LOV B;  2ZKO A;  5HFL A;  4JYY A;  4J80 A;  2ZQM A;  4C7U A;  4FFK A;  2QDO A;  1XI1 A;  1QR8 A;  2ZIM A;  4JGS A;  4DV1 B;  3CC7 V;  1VAR A;  3CCL V;  2G38 A;  1GN6 A;  2P6J A;  4LFC O;  3CRM A;  3ZRW A;  2WLL A;  1XL4 A;  1WP8 A;  1IXB A;  4K3A A;  2YDE A;  1HR0 O;  3RYC B;  4MVS A;  4J7Z A;  2OIG A;  4X9Q A;  4WFF A;  2LGQ A;  2QJ1 A;  1JA8 A;  5CA1 B;  3SPI A;  2D3O W;  5FL7 G;  3JAR B;  5KHI A;  2QM4 A;  1FXK B;  1WPB A;  1LUV A;  2CDY A;  5BMV A;  1YEW A;  3SYO A;  4P2Z A;  2EZP A;  3VOU A;  4X20 B;  1CXZ B;  1Y67 A;  5H6R A;  5C8Y A;  3FB8 C;  1YJ9 V;  1Q82 W;  1JVM A;  4DV7 O;  3G6E V;  3G6B A;  1FAF A;  1EM1 A;  3B2E E;  4RAI A;  2AHZ A;  2JEU A;  5AG2 A;  1HR0 B;  5IYD O;  3G67 A;  3RBZ A;  1GK9 A;  3IC9 A;  1G8M A;  3K0G A;  1Y76 A;  4GUN A;  4DV4 O;  4QPJ A;  1PP9 H;  5IYZ B;  2V7Q G;  1YJW V;  1KP2 A;  3ABL C;  5L3E A;  3RFR A;  1NBM G;  1SA0 B;  3KCY A;  4QIW F;  3T1H B;  4ZIB A;  3ZS8 C;  4CH6 A;  1BCC H;  2ZCE A;  5KUM A;  5BZB A;  3KZI Z;  2Q0O C;  3BFR A;  3SJQ C;  1QLE C;  1V54 B;  1VQN V;  3BY6 A;  3M8A A;  1CEZ A;  4IYI A;  3OMA B;  1GN3 A;  2W6J G;  4OGQ B;  1BE3 H;  5JVD B;  5KHJ A;  1JFF B;  5J2T B;  3P3N A;  2HKO A;  1BSM A;  3OEH G;  1VQ6 V;  3CJH B;  4DR1 B;  1ZLZ A;  4JAS A;  4JI6 B;  1J5E B;  1OCO B;  1QLN A;  4DR5 O;  1AI5 A;  4Z1M G;  3LDD A;  3KCX A;  3WB0 A;  3ZRV A;  4FLV A;  1Q6I A;  1QQC A;  2GHY A;  2BE3 A;  4GX1 A;  1H2N A;  2QTO A;  4ZHQ A;  4FM1 A;  1TVK B;  5A9G A;  2XND G;  1D5N A;  2Q6A A;  5B66 Z;  2JRI A;  3A0R A;  4MW8 A;  4GKJ B;  3CPW U;  4DR3 O;  5CA0 A;  3AG2 C;  1H8H G;  4BIZ A;  3QTC A;  1FXV A;  1YSC A;  1ZL8 B;  3U10 A;  1AR1 B;  4RQF A;  1AR5 A;  1GRJ A;  1K7D A;  2YXY A;  1E1Q G;  1SKV A;  3L75 H;  4O4H A;  5LMU O;  1N36 O;  5J2U A;  1I5Y A;  4F6R A;  4WFB V;  5D5Q A;  5LYJ A;  2EIJ C;  2V1D A;  4PA3 A;  3E35 A;  4DR5 B;  3CCV V;  5FPO A;  3DXR B;  5KHG A;  4YHH B;  5KX5 A;  1EFR G;  1FD9 A;  4JI3 B;  3G4S V;  3S3W A;  4YJ2 A;  2A79 B;  4X64 O;  3RWR D;  4KP4 A;  4NR1 A;  2WLI A;  2V4D A;  5TIS Z;  2OIE A;  1S72 V;  4I55 B;  1GN2 A;  2OCC B;  4MVZ A;  5CMU A;  3ZN1 A;  3BVO A;  2CTR A;  4O2A A;  4NTY A;  2HR3 A;  4L8J A;  3NR7 A;  1I5X A;  3TXQ A;  1MZF A;  4B7K A;  4PDM A;  4UCS A;  5BY1 A;  2JVD A;  1HWY A;  1M57 C;  3K06 A;  2KQX A;  5C8Y B;  2EUL A;  4NXM O;  2UXX A;  4LF8 B;  4J41 A;  5EC1 C;  5LHH A;  2UXC O;  5K1X A;  2Q7G A;  4B3R B;  1QR9 A;  1Q6H A;  1GM9 A;  4YXW G;  5GTI Z;  1S5H C;  4LF6 B;  1YJN V;  2JS3 A;  1QVF U;  3N2G B;  3R65 A;  2ILM A;  2ZM6 O;  2UXD O;  1SZX A;  3CCE V;  1K8A W;  3N2K A;  1XMQ O;  4I9W A;  4X1Y A;  5EK0 A;  2Z0A A;  3CCQ V;  4EKW A;  2CGN A;  1KEC A;  3RGB A;  2KG7 B;  3FAV A;  1QHT A;  2KB1 A;  1P4R A;  1Y66 A;  1TUE B;  5IYB O;  1WN7 A;  2IJH A;  1PNM A;  2Q73 A;  3TJT A;  1GAX A;  3AG1 C;  2ZNI A;  1K5Q A;  4I4T B;  3HB3 B;  1SQP H;  3F7V C;  1M90 W;  2LO1 A;  2IJI A;  3T1Y B;  1E79 G;  3ETG A;  5IY5 B;  1TAE A;  4DV0 O;  1XMQ B;  4H13 B;  2NLJ C;  3R66 A;  1NKD A;  2UU9 O;  1ZWI C;  1K97 A;  3ASN B;  3GVM A;  3OM3 B;  4X66 B;  3OUS A;  4NVP A;  5LHI A;  4CH4 A;  2AXT Z;  3AG4 C;  3RVZ A;  4K8X A;  3EHB B;  1XRE A;  1HP8 A;  3UO3 A;  3B4S A;  5KLV H;  2DWE C;  4TWK A;  3H1J H;  4P9O A;  4B7E A;  3JAS A;  1MAB G;  1FFT B;  2FYU H;  3UO2 A;  1P84 F;  2F66 C;  3TXS A;  2HVJ C;  3VBB A;  3MDS A;  1BQ0 A;  5EC2 C;  4O4J B;  3OTF A;  4IHJ B;  1OCZ C;  1VQM V;  3TCU A;  4YY3 O;  2BTQ B;  2Q7E A;  4O4I A;  1W2B U;  3LSU A;  2HJD A;  3CRA A;  3SR2 C;  3CHX A;  3L72 H;  5IJ9 B;  4JI1 O;  3ZMV A;  3U11 A;  2ZE8 A;  2RQ6 A;  1VQ8 V;  2K1E A;  4CBC A;  2UU9 B;  3JAK A;  4PA4 A;  4IGG A;  3D8C A;  3BA8 A;  1KKD A;  1EZV H;  1M4U A;  3OMI B;  1N0J A;  1KB9 F;  5CB4 A;  1GH6 A;  3D3I A;  5KHK A;  1BS3 A;  2B1G A;  3LUT B;  2BTO A;  4UVA A;  2X0L A;  1GM8 A;  2MK3 A;  1S3J A;  4LH6 A;  5H5N A;  3CC2 V;  4LCU C;  2ZDI A;  5H9C A;  5EIB C;  5BXZ A;  1JMK C;  4UFZ A;  4JTA B;  4YY3 B;  2XHB A;  2N05 A;  4TV9 A;  5BR8 O;  4JZG A;  3C3S A;  2GTS A;  3OT7 A;  4B3S B;  2JEX A;  1I94 O;  4K0K B;  1NT2 B;  3OR6 C;  1DF4 A;  2H8P C;  2Y69 B;  5LXT A;  2IH1 C;  4DUY B;  4TUY A;  4PI2 A;  3H9V A;  1IBL B;  1N33 O;  1SZT A;  2WSS G;  3CME V;  2OT5 A;  4FIP C;  1JPX A;  3JD3 A;  3RYF B;  2QWR B;  5EBW C;  2HVK C;  1U97 A;  1DGS A;  4DW0 A;  5JH7 B;  1R6K A;  2X6A A;  2VS0 A;  1Y74 B;  2Z5U A;  4JI0 B;  2PI5 A;  2YEV A;  1AIL A;  1KD1 W;  1IBK B;  1US6 A;  3QNE A;  4QGP A;  4X62 O;  4X65 B;  1GN4 A;  3LDC A;  4LC1 A;  3A0B Z;  5BR8 B;  4X1Y B;  3K04 A;  4XDK A;  3MAQ A;  3ZN0 A;  1I94 B;  1SQB H;  4FJC C;  1VEW A;  4A5U B;  3CMA V;  1MNG A;  4IT5 A;  1FXK C;  1Z2G A;  3DC6 A;  1XNQ B;  2OWO A;  4GZR B;  1V55 B;  5KAI Z;  4MTG A;  4U3J A;  1N0N A;  2IU0 A;  5CBF A;  2DE0 X;  1H38 A;  3CSX A;  1JCH A;  4LF5 B;  3H1L H;  2XAJ A;  1UPG A;  3GWK C;  2OTJ V;  4WFA V;  3OUF A;  4Z2W A;  2IU3 A;  1K9M W;  1IBM O;  4LF9 O;  2EIK B;  3FB6 C;  1PKX A;  3G71 V;  2F23 A;  2ADQ B;  2WA4 A;  1FJG B;  2Q7H A;  1EN4 A;  5EYP B;  4UCR A;  4LFA O;  3TET A;  5F2V O;  2XAH A;  4QE7 A;  4QNH B;  2RCV A;  3T4D A;  1F51 A;  1HNZ O;  4U7O A;  3FYE B;  4GX0 A;  4X89 A;  1WNS A;  3IC7 A;  1VQL V;  2YS8 A;  1LR1 A;  1ZX3 A;  1VMG A;  2PYJ A;  5KHH A;  3MHS C;  4KXR A;  1NTK H;  4EB6 A;  2GSM B;  3CYO A;  1YF2 A;  1BGY H;  4RWU A;  1V54 C;  2PUS A;  1GO3 F;  1TUB B;  4GX5 A;  4DXW A;  1VF6 C;  1Q5O A;  4O4I B;  3SJB C;  1Q7Y W;  1WB7 A;  2CAZ C;  5DED A;  5IJ0 A;  4AI8 A;  4FM2 A;  4FM0 A;  2LP7 A;  2ZR3 A;  5LMN B;  2F4V B;  1WA8 A;  3IAY A;  5IT9 N;  2B9Z A;  5B1B C;  4KHP B;  1OCO C;  4FMT A;  4D7S A;  2HHH O;  1PL0 A;  2YIB A;  1D5A A;  5KMG A;  1PD3 A;  3P32 A;  2VQF O;  3JAL A;  1M1K W;  3BA9 A;  5JQG B;  2YI8 A;  4XDL A;  2LW1 A;  1RSO A;  3RYH A;  1OCC C;  3STZ C;  5LHG A;  5H6Q A;  3ABK C;  1NTZ H;  4WFE A;  3BPZ A;  3T2M A;  5LP6 A;  2L35 A;  1ZSP A;  1K3E A;  4JI8 B;  3ASO C;  4PV1 B;  5LP6 C;  4DR6 O;  2Y48 A;  3D36 C;  1ENV A;  4D6T H;  2QE7 G;  2JJ2 G;  3K5N A;  4IYH A;  4LFB O;  3O65 A;  1OV9 A;  3PJS K;  4DV5 O;  1W0J G;  4LWS A;  4BIU A;  4UVB A;  4OX9 O;  1R3J C;  3L71 H;  2EIN B;  3TK1 A;  5JJN B;  2Q4P A;  1EZJ A;  4X1K B;  3E8B A;  4NXN O;  3Q4H B;  4GYC B;  4JPR A;  4ZOL A;  4LFC B;  2CGO A;  2BOB C;  3W7T A;  3AG3 B;  2PI4 A;  3ETE A;  3FYI B;  2F43 G;  2P90 A;  1MSD A;  1KQS U;  3HKB B;  3K57 A;  4DR6 B;  5EZY A;  1TA8 A;  4JYB A;  2RN9 A;  3ZMU A;  3RYI A;  4NTW A;  3M7M X;  1BMF G;  2E5L O;  4B3T O;  1DTO A;  4DV5 B;  1NJI W;  4HYO A;  3ZHV A;  3ZRS A;  5CBG A;  3LSQ A;  1H2M A;  4OX9 B;  3OW2 U;  2W6I G;  1FFX B;  4BAY A;  2GUZ B;  4DYL A;  4MSW C;  4HNA A;  2UUA O;  2LFR A;  4ZBM A;  4WBN A;  1XL6 A;  4UCU A;  3HKD B;  4LR3 A;  4DV7 B;  4DR2 O;  2Y0I A;  2UXN A;  1IXM A;  3HKE B;  4ZI7 B;  3K5O A;  3EVK A;  4FPP A;  5IE9 A;  2IW5 A;  2XT9 A;  1IUR A;  1SQG A;  1SRY A;  1AJP A;  4AHC A;  3D3Q A;  1JR9 A;  1NS1 A;  4CC6 A;  4DV4 B;  2C2A A;  2XAG A;  1S5L Z;  1GKF A;  1YIT V;  1D2D A;  4FZ0 A;  3ZHQ A;  2JGD A;  3ABM B;  3B77 A;  1H2S B;  5GON A;  1P7B A;  4O4L B;  3WB2 A;  2W0X A;  2OCH A;  3ZRX A;  1EN5 A;  2DOS A;  5IY5 C;  1BT8 A;  2NR5 A;  4JTC B;  4I0X A;  2ZE5 A;  2Q9L A;  4DR7 O;  2VQE O;  3SPG A;  3ASN C;  2RNB A;  1NH2 B;  4TOI A;  3P30 A;  3DGE A;  1QBZ A;  2Q8V A;  3C3T A;  1W59 A;  2H3O A;  2DW4 A;  2Q68 A;  1OCR C;  3BRC A;  3N27 A;  4KFM A;  3ZMZ A;  1N32 O;  1BHB A;  5LA6 B;  1UFI A;  2A3Q A;  1I08 A;  3F7Y C;  3APO A;  3JCU Z;  4FLX A;  3SYC A;  1VQ4 V;  5B1N A;  1RSO B;  2EJR A;  2PYL A;  5E79 Z;  4BIO A;  2LJ2 A;  4LF4 O;  1Q6U A;  3ZRW B;  2WLL B;  1O9H A;  1AVM A;  1HNW O;  3ZHT A;  2EIL B;  2ODM A;  4DR7 B;  4I7Z B;  4JYC A;  4DR3 B;  5IWA O;  1Q43 A;  4DR4 O;  4X1I A;  4PDV A;  1S0V A;  3RT3 C;  1YVW A;  4JI2 O;  2ARH A;  1G4Y B;  2UUB O;  2JS5 A;  3U0Z A;  2QM8 A;  4AQY O;  5LMU B;  4UUJ C;  1N36 B;  1KC8 W;  5BMV B;  3OD4 A;  1VQ9 V;  4EEQ A;  3E22 A;  1WAZ A;  2CH7 A;  4DUZ O;  4ZOL B;  5D5P A;  3WG7 B;  4MTX A;  1JJ2 U;  3JAT A;  2ETN A;  4X64 B;  4JI7 O;  3ZED A;  4LNU A;  1JQ0 A;  3JCZ A;  1KMI Z;  5KUK A;  5FNV A;  2Y69 C;  4FLZ A;  3ABL B;  4U3F H;  1Y76 B;  2BSK A;  3QG5 A;  3UT5 A;  1M9N A;  2M6Y A;  4PJ0 Z;  5DN6 G;  1GM7 A;  4X88 A;  2WWW A;  4CH5 A;  1N4C A;  2IH3 C;  1PV0 A;  4FFB A;  4DV2 O;  2XAF A;  3K3W A;  2BCC H;  4DUZ B;  4NXM B;  4FLY A;  2UXC B;  1HDJ A;  2DQ3 A;  4I9Q A;  2W0F C;  1F4N A;  5B5E Z;  3LDE A;  2ZM6 B;  1FKA O;  2UXD B;  2DYR C;  4FLT A;  1NU1 H;  1AP6 A;  2E75 B;  1QVG U;  1Q3E A;  1ORQ C;  3SJC C;  2WLH A;  3TGU H;  4JV5 O;  2P22 C;  1BZK A;  4ABM A;  3A0H Z;  1PNK A;  4HAM A;  4H0L B;  2DYS B;  3CXC U;  2YSU B;  4MW3 A;  1NVP B;  2D2C B;  1FXH A;  1RPO A;  4BW5 A;  1WB8 A;  1X59 A;  1QU7 A;  2GBO A;  2KSD A;  4CS4 A;  1R3I C;  4ZHQ B;  3K59 A;  1YCI A;  3C90 A;  1AB3 A;  3J81 N;  1YI2 V;  3CCS V;  4IIJ A;  4WF9 V;  1N34 O;  1VQK V;  3CCJ V;  1LUW A;  3WU2 Z;  1HNX O;  2NNU A;  5CA0 B;  4I50 A;  1P49 A;  4DV0 B;  2AGA A;  3OGI B;  2XOK G;  2AHY A;  2P7T C;  4Z1V A;  3K58 A;  4JAV A;  2JIZ G;  4O4H B;  2IBZ H;  1Q86 W;  5J2U B;  1K73 W;  3JAW A;  4F6R B;  5L3C A;  5LYJ B;  2F93 B;  3HKC A;  4N23 A;  1SQV H;  4JI5 O;  4G28 B;  2FB5 A;  3K08 A;  1KUQ A;  4MVQ A;  5KX5 B;  2VWJ A;  2OTL V;  1BHA A;  4GKK O;  3JD2 A;  5JJE B;  2R9A A;  4YJ2 B;  3T1C A;  2Q0A A;  3ZMS A;  4Q6G A;  1QCE A;  2WLI B;  1SQQ H;  4B3M O;  1N34 B;  4HZ3 A;  3QF7 A;  1HNX B;  4UXN A;  4TV8 A;  2A06 H;  5JCO C;  1K4D C;  4WCE V;  4JI1 B;  2N74 A;  4O2A B;  1AP5 A;  5LOV A;  1PNL A;  3L9D A;  1SER A;  2RMK B;  4DV6 O;  4UCV A;  1XNR O;  2ZE6 A;  2B5U A;  3J7A U;  2QR4 A;  2FKX A;  4OXS A;  3I56 V;  4IL6 Z;  1H2K A;  4GKK B;  3ABU A;  3FKS G;  3RYC A;  2BOC C;  3RN4 A;  5LBQ A;  4B3M B;  5CA1 A;  4WFG A;  1XHX A;  3F5W C;  3H01 A;  1H2L A;  3N2K B;  1G6U A;  3KKY A;  3SPH A;  4X8A A;  2YXH A;  1FXK A;  4FK5 C;  3E8F A;  1Y6X A;  3A2F A;  1SQX H;  4JI4 O;  1XUQ A;  3B40 A;  3FAV B;  4X20 A;  1THZ A;  2P06 A;  3ZMT A;  5B1O A;  3UM7 A;  1N33 B;  1SF9 A;  2EIN C;  3EXA A;  3AG1 B;  2LQT A;  3G80 A;  3W7U A;  5EBL C;  3MD0 A;  1YZB A;  4PI0 A;  1K4C C;  3UKM A;  4MVO A;  1Q8I A;  3W7X A;  5KAF Z;  4NB5 A;  4JZ2 A;  4X62 B;  5GTH Z;  4NTX A;  2QKA A;  1EN6 A;  3LSS A;  1NZ6 A;  5IYZ A;  3AG4 B;  3CS5 A;  3RW0 A;  1AR4 A;  1U96 A;  4R7C A;  3WB1 A;  2AW9 A;  2FTK A;  1SA0 A;  4TQF A;  1VQ5 V;  5KA5 A;  1O9G A;  2ZE7 A;  3WFV A;  4R8C A;  2QTS A;  3THO A;  3JAS B;  2EX3 A;  3SGI A;  2VRZ A;  1YHQ V;  1SS3 A;  1OCZ B;  1V9P A;  3W7S A;  1VF6 A;  5E1A C;  3OTO O;  3OE7 G;  2P5O A;  1YDX A;  3JD1 A;  2CTQ A;  1SC5 B;  1IBM B;  4MTO A;  5JVD A;  4LF9 B;  1JFF A;  3IGA C;  5J2T A;  4FZ1 A;  1IZ3 A;  4I50 B;  3JYC A;  3CJH A;  2UXB O;  4LFA B;  2QWO B;  3JAK B;  3CRQ A;  4ASU G;  1HNZ B;  3CRC A;  3B8M A;  3AEI A;  4UVC A;  1XMO O;  4DV1 O;  3GWO A;  5ITZ A;  4CZZ A;  2WLN A;  5CB4 B;  3ABM C;  3E2E A;  2QWQ B;  1KBH A;  2P4K A;  1TVK A;  4MTF A;  1X4T A;  1ROP A;  1IX9 A;  3H1K H;  3OGC C;  2GDS A;  4OPH A;  2ITC C;  3E89 A;  3P3P A;  4TT3 G;  1NH2 D;  4NKG B;  1ZL8 A;  4TV9 B;  4I5S A;  3M99 B;  1NI8 A;  2YC0 A;  2ZD9 A;  4QPK A;  2YIB D;  1VQO V;  3D36 A;  3B09 A;  1YIJ V;  3AG7 A;  4UCT A;  1LNQ A;  5LXT B;  4FLW A;  3UCS C;  2LW7 A;  2ADP A;  4TUY B;  3FFQ A;  4JTD B;  3DXR A;  1XMO B;  2XUM A;  1J95 A;  3CRR A;  5B1A B;  5DM6 V;  3H1H H;  4W4K A;  2HHH B;  4J7K A;  5L3D A;  3OFN G;  3S3X A;  2VQF B;  2YUA A;  1RM1 B;  1AI4 A;  2QWP B;  4PDL A;  3CC4 V;  2E3C A;  3CCM V;  2YEV B;  2P4V A;  2EJ7 A;  1OJH A;  4CC5 A;  2MW2 B;  5A2Q N;  1XOU A;  2ZXW B;  4I55 A;  2EIL C;  2HFE C;  1WJZ A;  1XEQ A;  1M56 B;  3KG2 A;  3QVN A;  3ZHU A;  2B1I A;  3DSQ A;  4NYK A;  1WPX A;  4DV3 O;  1ZUQ A;  3SYP A;  2OCC C;  4GX2 A;  3T1H O;  1JOY A;  3FX7 A;  1NTM H;  2R9I A;  2P67 A;  4O2B A;  2K9P A;  1NR7 A;  4U3J B;  4LFB B;  4K35 A;  3ZBH A;  3ABT A;  1PL4 A;  4UB8 Z;  1L8D A;  1KYO F;  3N2G A;  2X6C A;  3WG7 C;  1N8R W;  3RVY A;  4MS2 A;  2EIM B;  2QKS A;  4H44 B;  3X2Q B;  4LF7 O;  4NXN B;  4DR1 O;  5C93 A;  4DRX A;  1P7G A;  2GTA A;  4JI6 O;  3QO5 A;  4DV3 B;  1J5E O;  4P9P A;  2Q69 A;  2KG7 A;  4PA7 A;  1VQ7 V;  1K33 A;  4KL1 A;  2CTW A;  4GLX A;  1L0N H;  4UV9 A;  3E8G A;  2DMX A;  5B3S B;  2E5L B;  4B3T B;  3BCC H;  4EB6 B;  4I4T A;  4GKJ O;  3L70 H;  1M5I A;  4FVM A;  2X6B A;  2FL4 A;  2L6L A;  4UV8 A;  4GCZ A;  4QE9 A;  1GTO A;  2UUA B;  4LF7 B;  1WLE A;  1XHZ A;  5IJ0 B;  2IJJ A;  2CE4 A;  1YTF D;  1H2G A;  4DR2 B;  1Q90 D;  3PN1 A;  5B1B B;  2YXL A;  1R1B A;  4MVU A;  1Q81 W;  4G27 B;  1WA8 B;  4TQD A;  4YHH O;  2DYS C;  1RFY A;  5ITZ B;  2HEP A;  4JI3 O;  1NVP D;  4PEL A;  2PY5 A;  4BWA A;  1MA1 A;  4L87 A;  1IDS A;  4QJF B;  2HP8 A;  5KMG B;  1URF A;  3STL C;  1OCC B;  3ML0 A;  1VIB A;  3JAL B;  4GT1 A;  5GW7 A;  1E1R G;  4O4J A;  4IHJ A;  5FLX N;  2YIA A;  3ABK B;  3CP1 A;  2QSA A;  3UQ8 A;  2ZT9 B;  2BTQ A;  3RYH B;  2QKC A;  1OHH G;  3OAA G;  5IJ9 A;  4J7J A;  3DTU B;  4RUE A;  1MMM A;  2E74 B;  1I7F A;  3ASO B;  5LP6 B;  3AK1 A;  2VQE B;  2ATK C;  4DO2 A;  4YJ3 A;  4DK1 A;  2O57 A;  4XBF A;  3I55 V;  4LF8 O;  2JGU A;  3ZX6 A;  4R6Z A;  2PZS A;  3AK3 A;  1AI6 A;  4B3R O;  3IFX A;  3LNN A;  2R9R B;  4LF6 O;  1N32 B;  1NR1 A;  4LWS B;  1S77 D;  1JJO A;  4PA9 A;  3K5L A;  1GMG A;  3DC5 A;  1FYJ A;  1DLB A;  3FB7 C;  3L74 H;  4EFB A;  3CEI A;  4LF4 B;  3B8N A;  1MOF A;  1K92 A;  1HNW B;  3SDL A;  5CBH A;  1ZAU A;  4AIL C;  1XIL A;  4UCO A;  3RYF A;  4R50 A;  4O2B B;  4E4E A;  1BQZ A;  5IWA B;  5EZY B;  1COW G;  2N04 A;  5JH7 A;  4DR4 B;  3L73 H;  3RYI B;  1Y74 A;  4DW1 A;  2LGW A;  4JI2 B;  2FML A;  2F95 B;  2UUB B;  1AI7 A;  1FPO A;  2E76 B;  4AQY B;  4F6E A;  3T1Y O;  1CPY A;  5K1P A;  2Y0P A;  1QLE B;  1T5E A;  1VQP V;  4HNA B;  3SJA C;  4WBN B;  3ZIA G;  4X66 O;  2RDC A;  4DRX B;  3JD0 A;  2XTA A;  4CS3 A;  3JAM N;  4JI7 B;  3HPL C;  4OPA A;  5JWP A;  1K5S A;  4J9Z B;  2KKW A;  3APQ A;  4RQE A;  1V55 C;  2QA4 V;  1YTF B;  1VP7 A;  3CB2 A;  1L1F A;  1R3K C;  3VQY A;  3J80 N;  1DK1 A;  2JGD B;  3GB7 C;  2QWN B;  1F7Y A;  5GON B;  3SPC A;  4D7T A;  4N21 A;  4EFE A;  5EYP A;  4DV2 B;  2EIK C;  5IDJ A;  3E8H A;  3HR0 A;  4J9Y B;  1OZ0 A;  3VQV A;  5CN0 A;  1B04 A;  1IVS A;  4I0X B;  3AG2 B;  1EBO A;  4Q20 A;  2Z3Y A;  1OCR B;  4MVM A;  3ZHS A;  1SQF A;  5IYC O;  3ICX A;  5JJJ B;  1Z5W A;  3H1I H;  3ETD A;  4PDR A;  1WP7 A;  4LBE C;  5LGT A;  1FS0 G;  2Q67 A;  2EIJ B;  2XAQ A;  4JF3 A;  1PPJ H;  1ARO P;  2QEX V;  4MVR A;  5L3G A;  3CD6 V;  2R72 A;  4JV5 B;  2GV9 A;  1TUB A;  3I5D A;  2NN4 A;  4JAU A;  4LP8 A;  1RP3 B;  3K9A A;  4J10 A;  1HW7 A;  5LL6 Y;  4K8Z A;  3VQX A;  4CH3 A;  2PTM A;  4U7N A;  2ITD C;  2R70 A;  3LNM B;  4B3S O;  4K0K O;  2LFS A;  1XBL A;  1I0H A;  2AZ0 A;  4XDJ A;  5CA3 A;  1M93 A;  1R6T A;  2YIC A;  3IJ4 A;  4DUY O;  1IBL O;  3E86 A;  4YIP A;  2PF4 E;  2Q5Z A;  5JCO A;  5EBM C;  4YJ3 B;  4FLU A;  1KKC A;  2JK5 C;  4B08 A;  2PGG A;  3QO7 A;  3JD4 A;  4G2K A;  1R73 A;  4ZKI A;  3K9S A;  5L3F A;  1UJW B;  3JSN A;  1A32 A;  4X1I B;  4MT8 A;  1SET A;  4JI0 O;  4RUF A;  5JQG A;  3K03 A;  4BW9 A;  3CXH F;  1IBK O;  1M57 B;  5EIB D;  2WLJ A;  4X65 O;  2DWD C;  3ZHR A;  1R3L C;  5HFM A;  2Y4U A;  3E22 B;  4PD4 F;  2CH7 B;  2ZDI C;  4JI5 B;  2CTP A;  2UUC O;  3EFF K;  1Z5V A;  3F5T A;  5LGN A;  2XAS A;  3SPJ A;  2ZIN A;  3CE2 A;  3O9O A;  4LH7 A;  4JAA A;  5LGU A;  2WLK A;  3CCU V;  3OR7 C;  1XNQ O;  2DQ0 A;  3JAT B;  4ICG A;  4LNU B;  1KU9 A;  1KP3 A;  4CS2 A;  3SYQ A;  5FPR A;  3T4Z A;  5FNV B;  2ZIO A;  2RJZ A;  3JAR A;  1CP9 A;  4LF5 O;  1SES A;  1S76 D;  5B1A C;  3SYA A;  1ZTE A;  2HG5 C;  2BSK B;  2DJV A;  1XDC A;  3K79 A;  3JSL A;  3UT5 B;  4DV6 B;  4JYA O;  1RM1 C;  4X1K A;  5J9P C;  1VF5 B;  2CUG A;  1XNR B;  3Q4H A;  1Y4M A;  1FJG O;  4FFB B;  2ZXW C;  2ZR2 A;  3FB5 C;  1M56 C;  1B3Q A;  4KUM A;  5KA6 A;  2UUC B;  2WAM A;  3FD9 A;  2YI9 A;  2DYR B;  5L3B A;  4W4L A;  3HKB A;  3AG3 C;  2WLM A;  5H2F Z;  1MG1 A;  3BHP A;  1F4M A;  1L0L H;  2HJF C;  4F4L A;  1BL8 A;  3K0D A;  1S5J A;  1AJQ A;  1B6Q A;  4WFH A;  4JI4 B;  1K34 A;  1MSW D;  1F23 A;  4PHZ A;  1MZE A;  1R6N A;  1FFX A;  2GUZ A;  3CWB H;  4JYA B;  3E83 A;  1B06 A;  3A8T A;  2IM9 A;  3NXS A;  3ETQ A;  3BAA A;  2QGN A;  3HKD A;  4DK0 A;  2EIM C;  2OYQ A;  3CX5 F;  4YIO A;  1G1X B;  4H37 A;  3HKE A;  3X2Q C;  4ZI7 A;  2EZO A;  4TSF G;  5LMN O;  1YXB A;  4P30 A;  1XQ8 A;  2F4V O;  4RO2 A;  2F1M A;  2HLD G;  2AZ2 A;  4IIJ B;  2QM7 A;  4BR6 A;  4KHP O;  3BAB A;  2H94 A;  1QNM A;  2ZNJ A;  3W7W A;  1H8E G;  3ZCC A;  2EBO A; 
#chains in the Genus database with same CATH homology
 5KLV H;  1NTK H;  3H1K H;  1PP9 H;  3L70 H;  3CX5 F;  4D6T H;  3H1J H;  3CXH F;  1NU1 H;  2FYU H;  1BGY H;  3H1H H;  1PPJ H;  1KYO F;  1NTZ H;  2IBZ H;  1P84 F;  1BE3 H;  3H1L H;  1SQQ H;  3L75 H;  4PD4 F;  1EZV H;  2BCC H;  3TGU H;  1SQX H;  1KB9 F;  1NTM H;  1BCC H;  1SQV H;  1L0N H;  1SQB H;  3CWB H;  3L71 H;  4U3F H;  2A06 H;  3L73 H;  3L74 H;  1SQP H;  3L72 H;  3BCC H;  3H1I H;  1L0L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...