2FYUH

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
64
structure length
64
Chain Sequence
DPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
total genus 17
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 2fyuH00
3L74H 1SQVH 1EZVH 1NU1H 1SQQH 4U3FH 2FYUH 3TGUH 3CX5F 2IBZH 1BGYH 4PD4F 3H1IH 1PP9H 2BCCH 4D6TH 3H1JH 3H1KH 1SQPH 3BCCH 3CXHF 3H1HH 3L71H 1BCCH 1BE3H 1NTZH 1NTMH 1NTKH 1SQXH 3CWBH 3H1LH 1KB9F 3L70H 1SQBH 1P84F 3L75H 1PPJH 2A06H 5KLVH 1L0NH 1L0LH 3L72H 3L73H 1KYOF
chains in the Genus database with same CATH superfamily
2WA4A 1KMIZ 1P4RA 2N05A 4GUNA 3CJHB 1VF7A 3ZBHA 2WAMA 3STZC 4J11A 5FLXN 2HJDA 2YEVB 4GYCB 4X65O 4WFGA 2F4VO 4B3MO 4MVOA 1U96A 3CD6V 2EJRA 3FAVB 3NR7A 1PPJH 1KQSU 1KC8W 2YDEA 1AR1B 4K8ZA 4LFCO 1M57C 4KHPO 4NTWA 2Q6AA 5JQGB 4OXSA 2YIBD 4K3AA 1K4DC 4ZIBA 2L6LA 5C8YB 3B09A 3DC5A 3J81N 3BCCH 5B3SB 3OTFA 1NS1A 3Q4HA 3HKDA 5J2TB 2UU9B 2JS3A 2CTQA 3H01A 3S3XA 2DE0X 1K9MW 3RYCA 3OGCC 3ZHTA 3T4DA 5KX5B 1GTOA 2M7WA 1IZ3A 1OCCC 1QR9A 4ICGA 1K97A 4K8XA 1YJNV 1G4YB 2ZDIC 1TAEA 5B5EZ 1M5IA 3VQWA 3CCJV 4JI0B 4DR6B 1SZTA 5LXTB 1OCZB 2IH1C 2NN4A 5K1XA 1FJGO 4ZOLA 2GV9A 1XOUA 3BRCA 1L0NH 2Q5ZA 3T4ZA 2YXYA 5KAIZ 4DR2O 1MG1A 4BIUA 4LF6O 4UXNA 2OTJV 4CC5A 3ZJZA 4UV9A 2YEVA 3AG4B 4Z1MG 4U7NA 4X62B 1Q81W 1SA0A 3RYHA 3BHPA 4CH6A 4FZ1A 2E74B 3FAVA 3FX7A 3OAAG 1ZX3A 2C2AA 4WFAV 2OCHA 5LA6A 4JAUA 2A79B 4PDRA 4BW5A 2BTOA 1D5NA 2UUBO 2YI9A 3SJQC 4LR3A 3QVNA 3RVYA 4E2LA 5JJJB 5DN6G 4DR1O 4GKJO 3ML0A 1WP7A 4JV5O 5LMNO 5EBMC 5CBGA 4LNUA 5LYJB 2FL4A 4DO2A 4F4LA 5FNVB 4LBEC 2EILC 3CSXA 1H2LA 4DV5B 4JGSA 4TQDA 3AK2A 1KYOF 4MTFA 4CH3A 5JCOA 4JYBA 3KKYA 3X2QB 4CBCA 4LF6B 4X64B 2P67A 5IY5B 1MABG 2F43G 1YSCA 3AK3A 2YXHA 4F6RA 5JJNB 1RM1B 4LF8O 4O2BA 2ZD9A 3ZRWA 3SPGA 1FPOA 1VF6A 1YTFB 1JCHA 3CX5F 2BSKB 2UUBB 4QGPA 3H1JH 3RFRA 3OTOO 3CC2V 3ZIAG 1SERA 3LSSA 1SQBH 5LMNB 4DR7O 2JRIA 2RJZA 4OX9O 1KP2A 3AG1B 2UXBO 2LP7A 4FLZA 1VQKV 1VP7A 3JALA 4FJCC 4X9QA 4JI3O 2D2CB 2IJJA 4DR5O 4N21A 2YS8A 1N32O 3ASOC 2KG7A 4LH7A 3IJ4A 1ROPA 4N23A 4DV4O 2IU3A 1HNWO 1BT8A 2X6AA 3ETQA 4DV7B 4PA6A 2OT5A 4LF4B 3CCLV 4NTXA 2XT9A 3E8BA 1F51A 3JAWB 2OTLV 4HZ3A 5L3DA 3L75H 2R9RB 3B4SA 2CUGA 2WLJA 3OTOB 3HKCB 5IDJA 1SQFA 2CE4A 4EFBA 2ZXWC 3ZHSA 3AG2C 1RPRA 3K5NA 3UO2A 3T1HO 1B6QA 3BAAA 5D5PA 1HNZO 1FYJA 1YJWV 1YITV 2HVJC 3LUTB 1S0VA 4R6ZA 3E2EA 3STLC 1B3QA 5L3EA 5CA1A 1GMGA 1Q90D 2R72A 4NXMB 4CS3A 3OM3B 1CP9A 4JTDB 2EIJC 4PD4F 2PYLA 3ABLB 4IIJB 1SQGA 4DV4B 3K06A 4B3TO 5J2UA 1N34O 1BE3H 2VQEO 1K3EA 1SESA 1FFXA 4FLWA 4DK1A 2XAGA 3E8GA 1R3JC 2WLIA 4JYYA 1XI1A 1XHZA 4DV3B 2XOKG 3SYCA 4UCSA 1N33O 3F5WC 3K5LA 3ABKC 3APOA 2HR3A 5KA6A 4FM0A 2P06A 4LF9B 4P9OA 2QDOA 3CCVV 2W0XA 1GM9A 4X1KB 3L72H 2LQTA 2ODMA 1SS3A 1CXZB 4R8CA 3IC9A 1VQ8V 2Q7HA 5LMUO 5JCOC 1VARA 3CCRV 2Q0AA 1I7FA 1BQZA 3FKSG 2Q9LA 5BMVB 4AILC 2E5LO 3ETGA 1BQ0A 3ZCCA 2W0FC 3L73H 4DUZB 1WPXA 5L3GA 1CPYA 2YIBA 3M7MX 3OMIB 3H9VA 5LP6A 4AQYB 1NVPD 1VF6C 5GTIZ 1N4CA 4J7KA 3WU2Z 1N33B 1VMGA 4PV1B 5FPOA 2JGDB 3RVZA 4RUFA 4I0XB 5IYZA 1SQVH 1IBMB 3OUSA 4OPAA 3ZMUA 2JK5C 3LDEA 4NR1A 4QPJA 2ZNJA 2IBZH 4GT1A 2UUCO 4O2AA 4D7SA 5HFMA 2Z5UA 4NYKA 5EBLC 4DV0B 4K0KO 4YHHB 2GBOA 2EBOA 4LP8A 1AB3A 2AGAA 2AHYA 2N74A 2JEXA 1PNMA 2E5LB 2FYUH 3JCUZ 1V54C 3VQVA 1GN6A 4DR3O 4R7CA 1RSOA 3RYIB 1SQPH 2P5OA 3JARB 4ZBMA 2WLKA 3G67A 4X1IA 4UCOA 4MVQA 4KXRA 4NXNB 1GO3F 3W7SA 3ABUA 1IX9A 4X1YB 3WG7B 4JI8O 1BMFG 1NR7A 1M56C 2AZ0A 1Y4MA 2DJVA 2QWOB 1OCRC 4TV8B 1JR9A 3OMAB 5EZYB 5BY1A 3GB7C 1R1BA 5DM6V 4ZI7B 2RNBA 4FFBA 2F66C 4UCTA 2HG5C 5B1AB 3VBBA 1I5XA 4JZGA 4K35A 3JASB 3B77A 1NH2D 1OHHG 2F23A 1YZBA 1THZA 3D8CA 3EFFK 3R66A 3DSQA 4MTGA 2DQ3A 1IDSA 2ATKC 2OWOA 4DV1B 2EJ7A 3PJSK 1GM8A 3CC7V 4I9WA 1W0KG 4BIOA 5BR8O 1EZVH 3BVOA 1XMQO 3RYIA 4LF7O 1NJIW 3SDLA 1Q6HA 4YY3O 4R50A 4PHZA 3HPLC 1F7YA 1G8MA 1S5HC 4G2KA 1QLNA 4IYIA 2DYRC 3OT7A 3RT3C 1V9PA 1XQ8A 1XMOO 1M90W 2Y69C 4U3FH 3CP1A 4IGGA 4J9YB 3AG3B 1JQ0A 4QIWF 4PI0A 4BW9A 2EIKB 1W2BU 3BABA 3JATA 5CB4B 1WA8A 2VWJA 2KQXA 1DGSA 1KKCA 1QLEC 1Q7YW 5LBQA 1OCOB 1ENVA 3OR7C 2ILMA 4MSWC 1ZL8A 5H9CA 2XNDG 2UXDO 1Y76A 4MVSA 1Q43A 1BL8A 1N0NA 4TUYA 5B1BC 1EBOA 4I55B 4BIZA 3K0GA 4TV9B 5KHHA 4MVZA 3UT5A 4IHJA 2UU9O 5LP6C 1Y74B 3H1KH 3QG5A 1H2NA 1XMQB 4JI1B 3B8NA 2PI4A 2WA3A 2ZE8A 3CWBH 2P22C 5JVDB 1JFFB 4CS4A 1S5LZ 3RGBA 5CA0B 2CAZC 1OV9A 1Q6IA 5IJ9A 1JMKC 3A2FA 2QEXV 4ZKIA 2H94A 4LF5B 3RBZA 3FB7C 3GVMA 4F6EA 4JI0O 1XMOB 4DR6O 1K33A 1AI4A 2Q8VA 1Q5OA 2ZM6O 3JAKA 1LUVA 4XBFA 3TK1A 5L3BA 2EIMB 4O4JA 1OZ0A 4NVPA 4X62O 1WB7A 4TOIA 4UUJC 1WAZA 2DYSC 1EN4A 2Y0PA 1PNLA 3E83A 3CRRA 4DR4B 3DGEA 4BAYA 2UXDB 3JD1A 2PZSA 1NVPB 5LOVA 1Y66A 5CB4A 4FM1A 3OMNB 2GUZA 5J9PC 3JD4A 3TJTA 4JI6B 2A06H 3GWKC 2X6CA 1H8HG 4U3JB 1GK9A 2CH7A 5EIBD 2ZQMA 5A9GA 5AG2A 3OEHG 1VQ7V 2A0LA 2RQ6A 3EHBB 2DN9A 4DV5O 3CXHF 4FPPA 4QPKA 4I4TA 1R73A 5TISZ 1AI7A 2F95B 1QCEA 2DWDC 2ZM6B 4FLXA 3CJHA 1A32A 3JD0A 4X64O 1S5JA 4Z1VA 2EZPA 4PDLA 3MHHC 4QE7A 4KFMA 2OIGA 2Q7GA 1XNRO 1HWYA 4DRXB 3E89A 1QR8A 1TUEB 4FLTA 3SJAC 1EFRG 1VQLV 4B08A 1GAXA 4I50B 3RN4A 1R3IC 2OIEA 4DK0A 2EINC 5JQGA 2JS5A 1EN6A 1EN5A 5C8YA 3LDCA 5F2VO 3CMEV 2IJHA 2WWWA 4QE9A 1PV0A 5J2TA 5GW7A 2HP8A 3T1YB 3SGIA 4FVMA 5KX5A 5KLVH 2JVDA 1NH2B 5B1NA 4X20B 4FFKA 2ARHA 5KMGB 4LCUC 4WFHA 2Q67A 3HKBB 2EX3A 3HKEB 2ZCEA 1AJNA 2OCCB 3K3WA 1DLBA 3SYOA 5LXTA 4LWSB 2AXTZ 1Q82W 2YSUB 2LGQA 4GX1A 1WPBA 1XNRB 3QO5A 2X0LA 3CMAV 1JVMA 2YI8A 4DV7O 1E79G 1B06A 1TA8A 2YUAA 4LF4O 1VIBA 2QTOA 2XAFA 1YCIA 1S72V 3W7TA 2XAQA 1HNXB 4HYOA 3ETDA 3OR6C 1PL0A 2UXXA 2FB5A 5EK0A 4I50A 2EULA 3ZEDA 4JAVA 1S77D 4MTXA 4YJ3B 1OCRB 1FXKB 2CTWA 4UB8Z 2KSDA 4QJFB 4UCRA 3FFQA 4NB5A 5ITZB 1V55B 1H2MA 4MVUA 1AI5A 1N0JA 4UFZA 2A7WA 3JSLA 5LYJA 5CMUA 2AHZA 5EYPB 1W59A 5FNVA 3IFXA 1ZTEA 3ZHUA 2KB1A 2UXCB 3ZMTA 4NXMO 1HP8A 4X20A 2RMKB 5CN0A 3K9AA 3QO7A 3M99B 2ZR3A 3WB0A 4FM2A 3HKBA 1AI6A 1ZAUA 3ASNC 2D3OW 3S3WA 4WF9V 2R9AA 1KECA 3OFNG 2WLHA 4DYLA 3VOUA 3CPWU 1UJWB 5IT9N 4B7EA 1DF4A 1SQXH 4DV3O 1P84F 3ETEA 4RQFA 1QVFU 2Q4PA 4J41A 4BR6A 2ZKOA 2QM8A 2HFEC 1O9GA 4Q6GA 2BSKA 1LUWA 4JYAO 1VQMV 1Q8IA 4LF9O 1FS0G 4W4LA 3WB1A 2ZE7A 3UQ8A 3B8MA 1NZ6A 1JPXA 4WBNB 1AJQA 3SR2C 2Z0AA 1I0HA 4WFBV 3H1LH 4RUEA 4EFEA 4JI5O 1N36B 3ZN0A 1N8RW 1I5YA 4O4IB 4E4EA 4G28B 2NNUA 5E1AC 3ABMC 1TVKB 3SJBC 4IL6Z 3HB3B 1R3KC 5EYPA 1MZFA 2O57A 3VQYA 2IH3C 4XDKA 4IYHA 3H1HH 4DUZO 3OE7G 3CCEV 1KB9F 3RWRD 1M93A 4AQYO 2XASA 2QGNA 3JSNA 2MW2B 1TUBB 2ZR2A 2RN9A 5L3FA 4G27B 5IJ0B 1UFIA 5K1PA 3JAWA 3P3PA 5B3SC 1ZLZA 4JYAB 2WSSG 3KZIZ 1IBMO 1MSWD 4TT3G 2WLLB 3R65A 4CH5A 3HKCA 4I5SA 3P3NA 3SPCA 2QR4A 1OJHA 4UV8A 3W7WA 1K5QA 1AROP 1YHQV 4JI5B 4LFBO 3K5MA 3TETA 4DV0O 3A0BZ 4YHHO 2HKOA 2ITCC 2BCCH 4MTOA 4B3RB 2HLDG 1NR1A 2HEPA 4O4IA 3LNMB 3PN1A 4MVMA 1AP5A 1OCZC 2BOCC 1M57B 5D5QA 1HR0B 1QNMA 3CS5A 5HFLA 3W7UA 4P2ZA 1R3LC 1COWG 1FFTB 4IIJA 4YXWG 2K9PA 3E8FA 4NXNO 3AG4C 3K59A 2FKXA 4PELA 1TGOA 3ZN1A 4D6TH 5LGUA 3APQA 3SYQA 4JI7O 2M6YA 4X88A 4B7KA 2OYQA 2Q0OC 4JTCB 2BTQB 2HJFC 1TUBA 1XREA 1OCCB 1K92A 5LGNA 3IGAC 1ZWIC 1JA8A 4P30A 4DUYB 4LFBB 2WPDG 4ASUG 3ABTA 3I55V 4X1KA 3K04A 5GONB 2PUSA 3N2KB 4ZHQB 2V7QG 1SRYA 4HNAB 4B3SB 1GKFA 1Z5VA 1NU1H 3QTCA 4DV1O 5KUMA 4EB6B 3X2QC 3BA9A 3P30A 3WFVA 4JYCA 1X4TA 3KCYA 5BMVA 4AHCA 5IY5C 3CRCA 1S3JA 1RP3B 2MK3A 5KUKA 2GHYA 5LHIA 3O65A 4JI7B 1RM1C 1H2KA 3T2MA 1XNQO 3B40A 2P6JA 3ZHRA 1NQTA 1D2DA 4JPRA 3CB2A 1FXVA 3FD9A 3L71H 1BCCH 2JGDA 1MZEA 3THOA 2A9HA 1AVMA 2EILB 1QBZA 4I0XA 1KU9A 2E75B 1FD9A 2QTSA 1H38A 4YIOA 1MMMA 4UVCA 3AG1C 2X6BA 3BFRA 4JZ2A 1MSDA 5H6QA 2XAHA 2LFSA 4X66B 4PDMA 2CGNA 5JH7B 3F7YC 3G80A 1YF2A 3RYFB 4WFEA 2NLJC 1FAFA 2CK3G 3C3SA 4RO2A 2QKAA 1MNGA 1IBKO 1BS3A 2PY5A 4LFAB 4JI1O 3D3IA 3JARA 3E22B 1XNQB 2G38A 1M4UA 4X1YA 1GM7A 3JCZA 3VQXA 2PTMA 4DW0A 4TV8A 3N2GB 4LF5O 4CS2A 3CC4V 1SZXA 5EZYA 3NXSA 1KKDA 1VQOV 4GX2A 4ZI7A 4TSFG 3G6EV 1XDCA 5E79Z 1DF5A 3ZRSA 1QHTA 3CCMV 4JI2B 2IM9A 1IBLO 1SETA 3ASOB 1NKDA 4DV6B 3JASA 1AJPA 2GTSA 1WLEA 2HVKC 3DXRB 3ZRXA 1O9HA 4TQFA 4DR4O 2XUMA 2Y4UA 2PF4E 1VF5B 3B2EE 3HR0A 1LR1A 4P9PA 1BGYH 1PL4A 3K08A 1NT2B 1NI8A 4JI6O 1ZSPA 3FB6C 3ABLC 5LHHA 3CHXA 3ZRVA 1IBKB 5IYDO 5CBFA 2F1MA 2JIZG 4UCUA 3Q4HB 5CA3A 3HKDB 3RYCB 2F93B 2ZXWB 3AG2B 2QM7A 2Y0IA 3A0RA 1VQ9V 3U10A 5FL7G 2ZINA 1GRJA 1HDJA 3UM7A 4QNHB 2YIAA 1F4NA 5FPRA 3LSQA 5IWAB 1IBLB 2QWNB 3CRQA 4ZOLB 2RCVA 4OGQB 2Y48A 2EIJB 1VQNV 5KA5A 3U11A 1SA0B 3DXRA 3RYHB 5CBHA 3KG2A 3L70H 3M8AA 1YVWA 2BE3A 1P7BA 1P49A 5EC2C 1M9NA 2Q68A 5LA6B 4I55A 2V1DA 4TV9A 1AR4A 1KUQA 1X59A 4UCVA 5LL6Y 3ABKB 3G6BA 3OD4A 5KAFZ 1Y74A 4CH4A 3T1YO 4H13B 4PDVA 1BHBA 1Z5WA 2ZIOA 2Q69A 1SKVA 2H8PC 5LGTA 2UUAO 5JVDA 2W6IG 1JFFA 3QNEA 4LNUB 2WLMA 1F23A 5CA0A 3OEEG 2YIDA 2QWPB 4H33A 3CCSV 2Q73A 1VQPV 2QWQB 4FZ0A 2JGUA 2P7TC 2QWRB 2VWKA 2L35A 2IJKA 4PI2A 4DXWA 3SPJA 2AZ2A 1YIJV 1QVGU 1H2GA 1YEWA 2QKCA 3FYEB 3MAQA 1ORQC 1AP6A 2VS0A 3CE2A 4JF3A 1D5AA 4X65B 3CXCU 4FIPC 3LDDA 2F4VB 4B3MB 4JASA 4F6RB 3P32A 3MHSC 1HNXO 3ICXA 4PA3A 4LFCB 4PA9A 4O2BB 3ZRWB 2VQFO 4KHPB 1T5EA 2E76B 2KKWA 1J5EO 1I08A 2ETNA 1XL4A 1AILA 1RPOA 2DW4A 3CEIA 4U3JA 3K0DA 2JEUA 3WG7C 2UUAB 2K1EA 2GSMB 1FXHA 4C7UA 2ZIMA 2UXCO 1WJZA 1PD3A 3K03A 2P4VA 3JALB 5B1AC 3E35A 2ADPA 2V4DA 1BHAA 2XHBA 2KG7B 3I56V 1VQ5V 2GDSA 2ADQB 1V54B 1FJGB 1E1RG 4GZRB 1UPGA 4PA7A 4PJ0Z 4DR2B 3ZHQA 4DRXA 2RDCA 5KHKA 4RWUA 1SF9A 4H37A 2VQFB 3D36A 1M56B 4GCZA 4Z2WA 2Z3YA 4FLUA 2ZT9B 1J5EB 2CDYA 1K34A 2XTAA 3BPZA 4O4HB 4WFFA 1J95A 2QA4V 1XILA 4OPHA 2X7RB 1L1FA 1PP9H 3SYAA 1XHXA 2JJ1G 1N36O 4PA4A 4UB6Z 4DR1B 4GKJB 5H6RA 3J7AU 4JV5B 4FMTA 4CC6A 1XEQA 5DEDA 3ZS8C 2NR5A 5KMGA 5CA1B 1GH6A 2AW9A 3HKEA 1NBMG 2R9IA 3C90A 4J7ZA 3D3QA 3AG3C 1PM9A 1M1KW 4L87A 4LWSA 1U97A 4I9QA 1VEWA 2HHHO 2EIKC 1URFA 2IJIA 1IXMA 3TXSA 1L8DA 5JWPA 3ZX6A 3FB5C 1RFYA 2IW5A 5H2FZ 5J2UB 1XL6A 1OCOC 1GN2A 1FFXB 2QE7G 4X8AA 4UVBA 2WLIB 3QF7A 3AK1A 4LF8B 1H2SB 3BA8A 3MD0A 1IVSA 2ZE5A 2DOSA 2DYRB 4YJ3A 1FXKA 3SPHA 4O4HA 3ZMSA 2P90A 5ITZA 4D7TA 4GX5A 4UVAA 1JJOA 2ZE6A 2Y69B 4MS2A 4J42A 3CRMA 1K4CC 4B3RO 4DR7B 4O4LB 5JJEB 4YJ2B 4DW1A 5GTHZ 4OX9B 1R6KA 5KHIA 2UXBB 5DECA 1HR0O 4NTYA 1ZUQA 1QLEB 1S76D 1BZKA 4JI3B 4DR5B 2HHHB 1G1XB 3MDSA 3E8HA 1N32B 4GX0A 2DQ0A 2EIMC 2P4KA 5B1BB 1US6A 1VQ4V 3GWOA 1YJ9V 1JJ2U 1WN7A 2B9ZA 2PGGA 5LP6B 1GN4A 4WCEV 3C3TA 3O9OA 1HNWB 3ZMZA 2LGWA 1PNKA 1K8AW 2B1GA 3QO8A 3TCUA 2QJ1A 1L0LH 2QSAA 2CTRA 1MOFA 1SQQH 1WNSA 5KHGA 4DUYO 4EEQA 5IYZB 3W7XA 2ITDC 4GLXA 4WBNA 1IXBA 3CYOA 1YXBA 4O2AB 3F7VC 3T1HB 4B3SO 2FTKA 1NTZH 4BWAA 4H44B 4LC1A 3F5TA 1HNZB 1PKXA 1TVKA 3TXQA 4O4LA 3BY6A 3SYPA 3L74H 2DYSB 5B66Z 3LSUA 4YJ2A 1K5SA 2GTAA 3AEIA 1Q6UA 4LH6A 5BXZA 3A8TA 2LJ2A 4U7OA 4KL1A 4JAAA 2VRZA 1XUQA 1WP8A 1Y6XA 3L9DA 4TWKA 1Q86W 1VQ6V 2Y4TA 1RSOB 2CGOA 3LNNA 3G4SV 4X1IB 4B3TB 4FLYA 4Q20A 1N34B 3D36C 2VQEB 4YIPA 1I94O 3DC6A 5B1OA 3OW2U 3TGUH 3J80N 4H0LB 5IJ0A 3RW0A 2PI5A 3G71V 2EZOA 4I7ZB 1R6TA 3DTUB 1LNQA 3K9SA 4FFBB 2W6JG 2WLLA 5EC1C 1NTMH 2H3OA 3IC7A 5A2QN 3JD2A 4IT5A 2R70A 3JD3A 4X89A 4X66O 1KP3A 1EM1A 3I5DA 1R6NA 4XDLA 3JAMN 2OCCC 3UO3A 5LMUB 1EZJA 3OUFA 4J10A 4NKGB 1JOYA 4I4TB 4J7JA 4LFAO 3E86A 4L8JA 2EINB 3T1CA 1Z2GA 3KCXA 1W0JG 2LW7A 1YI2V 2Q7EA 5LHGA 1IURA 5EBWC 3K79A 1E1QG 2DMXA 1I94B 1Y67A 4A5UB 1SC5B 2BTQA 1YDXA 4KUMA 2B1IA 1FXKC 1K7DA 3EVKA 4MVRA 2QM4A 4J9ZB 1V55C 3CCQV 1QQCA 2YICA 1B04A 2ZDIA 4JI2O 4JTAB 1QU7A 4DV2O 4KP4A 4DV6O 3H1IH 3BEHA 5GONA 1KBHA 3N2KA 4ZHQA 2UUCB 1AR5A 4AI8A 3JATB 4HNAA 3N27A 1WA8B 3UCSC 2YXLA 4K0KB 4XDJA 1DK1A 1ZL8B 1KD1W 1GN3A 4EB6A 2A3QA 1Y76B 4JI4O 5BZBA 4TUYB 2XAJA 3AG7A 3UT5B 5IYBO 4IHJB 1P7GA 3ZHVA 2LO1A 4MW8A 5H5NA 2FMLA 4DR3B 2ZNIA 1BSMA 5L3CA 4RQEA 4EKWA 3K57A 1YTFD 4JI8B 3A0HZ 3CRAA 4RAIA 5IJ9B 2LFRA 1Q3EA 2UXNA 1MA1A 2E3CA 3UKMA 1CEZA 3CCUV 3K58A 5KHJA 2N04A 4GKKO 5IWAO 2QKSA 1FKAO 2B5UA 4DV2B 1NTKH 4FLVA 2JDIG 3JYCA 3JAKB 3ASNB 4O4JB 2WLNA 4MW3A 1WB8A 3OGIB 3SPIA 4ABMA 2CTPA 3IAYA 2BOBC 5LOVB 2YC0A 4CZZA 5JH7A 4JI4B 2GUZB 1G6UA 3FYIB 3RYFA 4FK5C 3U0ZA 4HAMA 4MT8A 1K73W 4W4KA 5C93A 1HW7A 5EIBC 2IU0A 2CH7B 5IYCO 3E22A 5BR8B 3ZMVA 2LW1A 1DTOA 1F4MA 5IE9A 4LF7B 3EXAA 1JX9A 1XBLA 4YY3B 3N2GA 3WB2A 1H8EG 2JJ2G 2PYJA 4HBNA 3K5OA 2DWEC 3SJCC 3FB8C 3ABMB 4J80A 4GKKB
chains in the Genus database with same CATH topology
3L74H 1SQVH 1EZVH 1NU1H 1SQQH 4U3FH 2FYUH 3TGUH 3CX5F 2IBZH 1BGYH 4PD4F 3H1IH 1PP9H 2BCCH 4D6TH 3H1JH 3H1KH 1SQPH 3BCCH 3CXHF 3H1HH 3L71H 1BCCH 1BE3H 1NTZH 1NTMH 1NTKH 1SQXH 3CWBH 3H1LH 1KB9F 3L70H 1SQBH 1P84F 3L75H 1PPJH 2A06H 5KLVH 1L0NH 1L0LH 3L72H 3L73H 1KYOF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 H;  1SQV H;  1EZV H;  1NU1 H;  1SQQ H;  4U3F H;  2FYU H;  3TGU H;  3CX5 F;  2IBZ H;  1BGY H;  4PD4 F;  3H1I H;  1PP9 H;  2BCC H;  4D6T H;  3H1J H;  3H1K H;  1SQP H;  3BCC H;  3CXH F;  3H1H H;  3L71 H;  1BCC H;  1BE3 H;  1NTZ H;  1NTM H;  1NTK H;  1SQX H;  3CWB H;  3H1L H;  1KB9 F;  3L70 H;  1SQB H;  1P84 F;  3L75 H;  1PPJ H;  2A06 H;  5KLV H;  1L0N H;  1L0L H;  3L72 H;  3L73 H;  1KYO F; 
#chains in the Genus database with same CATH topology
 2WA4 A;  1KMI Z;  1P4R A;  2N05 A;  4GUN A;  3CJH B;  1VF7 A;  3ZBH A;  2WAM A;  3STZ C;  4J11 A;  5FLX N;  2HJD A;  2YEV B;  4GYC B;  4X65 O;  4WFG A;  2F4V O;  4B3M O;  4MVO A;  1U96 A;  3CD6 V;  2EJR A;  3FAV B;  3NR7 A;  1PPJ H;  1KQS U;  1KC8 W;  2YDE A;  1AR1 B;  4K8Z A;  4LFC O;  1M57 C;  4KHP O;  4NTW A;  2Q6A A;  5JQG B;  4OXS A;  2YIB D;  4K3A A;  1K4D C;  4ZIB A;  2L6L A;  5C8Y B;  3B09 A;  3DC5 A;  3J81 N;  3BCC H;  5B3S B;  3OTF A;  1NS1 A;  3Q4H A;  3HKD A;  5J2T B;  2UU9 B;  2JS3 A;  2CTQ A;  3H01 A;  3S3X A;  2DE0 X;  1K9M W;  3RYC A;  3OGC C;  3ZHT A;  3T4D A;  5KX5 B;  1GTO A;  2M7W A;  1IZ3 A;  1OCC C;  1QR9 A;  4ICG A;  1K97 A;  4K8X A;  1YJN V;  1G4Y B;  2ZDI C;  1TAE A;  5B5E Z;  1M5I A;  3VQW A;  3CCJ V;  4JI0 B;  4DR6 B;  1SZT A;  5LXT B;  1OCZ B;  2IH1 C;  2NN4 A;  5K1X A;  1FJG O;  4ZOL A;  2GV9 A;  1XOU A;  3BRC A;  1L0N H;  2Q5Z A;  3T4Z A;  2YXY A;  5KAI Z;  4DR2 O;  1MG1 A;  4BIU A;  4LF6 O;  4UXN A;  2OTJ V;  4CC5 A;  3ZJZ A;  4UV9 A;  2YEV A;  3AG4 B;  4Z1M G;  4U7N A;  4X62 B;  1Q81 W;  1SA0 A;  3RYH A;  3BHP A;  4CH6 A;  4FZ1 A;  2E74 B;  3FAV A;  3FX7 A;  3OAA G;  1ZX3 A;  2C2A A;  4WFA V;  2OCH A;  5LA6 A;  4JAU A;  2A79 B;  4PDR A;  4BW5 A;  2BTO A;  1D5N A;  2UUB O;  2YI9 A;  3SJQ C;  4LR3 A;  3QVN A;  3RVY A;  4E2L A;  5JJJ B;  5DN6 G;  4DR1 O;  4GKJ O;  3ML0 A;  1WP7 A;  4JV5 O;  5LMN O;  5EBM C;  5CBG A;  4LNU A;  5LYJ B;  2FL4 A;  4DO2 A;  4F4L A;  5FNV B;  4LBE C;  2EIL C;  3CSX A;  1H2L A;  4DV5 B;  4JGS A;  4TQD A;  3AK2 A;  1KYO F;  4MTF A;  4CH3 A;  5JCO A;  4JYB A;  3KKY A;  3X2Q B;  4CBC A;  4LF6 B;  4X64 B;  2P67 A;  5IY5 B;  1MAB G;  2F43 G;  1YSC A;  3AK3 A;  2YXH A;  4F6R A;  5JJN B;  1RM1 B;  4LF8 O;  4O2B A;  2ZD9 A;  3ZRW A;  3SPG A;  1FPO A;  1VF6 A;  1YTF B;  1JCH A;  3CX5 F;  2BSK B;  2UUB B;  4QGP A;  3H1J H;  3RFR A;  3OTO O;  3CC2 V;  3ZIA G;  1SER A;  3LSS A;  1SQB H;  5LMN B;  4DR7 O;  2JRI A;  2RJZ A;  4OX9 O;  1KP2 A;  3AG1 B;  2UXB O;  2LP7 A;  4FLZ A;  1VQK V;  1VP7 A;  3JAL A;  4FJC C;  4X9Q A;  4JI3 O;  2D2C B;  2IJJ A;  4DR5 O;  4N21 A;  2YS8 A;  1N32 O;  3ASO C;  2KG7 A;  4LH7 A;  3IJ4 A;  1ROP A;  4N23 A;  4DV4 O;  2IU3 A;  1HNW O;  1BT8 A;  2X6A A;  3ETQ A;  4DV7 B;  4PA6 A;  2OT5 A;  4LF4 B;  3CCL V;  4NTX A;  2XT9 A;  3E8B A;  1F51 A;  3JAW B;  2OTL V;  4HZ3 A;  5L3D A;  3L75 H;  2R9R B;  3B4S A;  2CUG A;  2WLJ A;  3OTO B;  3HKC B;  5IDJ A;  1SQF A;  2CE4 A;  4EFB A;  2ZXW C;  3ZHS A;  3AG2 C;  1RPR A;  3K5N A;  3UO2 A;  3T1H O;  1B6Q A;  3BAA A;  5D5P A;  1HNZ O;  1FYJ A;  1YJW V;  1YIT V;  2HVJ C;  3LUT B;  1S0V A;  4R6Z A;  3E2E A;  3STL C;  1B3Q A;  5L3E A;  5CA1 A;  1GMG A;  1Q90 D;  2R72 A;  4NXM B;  4CS3 A;  3OM3 B;  1CP9 A;  4JTD B;  2EIJ C;  4PD4 F;  2PYL A;  3ABL B;  4IIJ B;  1SQG A;  4DV4 B;  3K06 A;  4B3T O;  5J2U A;  1N34 O;  1BE3 H;  2VQE O;  1K3E A;  1SES A;  1FFX A;  4FLW A;  4DK1 A;  2XAG A;  3E8G A;  1R3J C;  2WLI A;  4JYY A;  1XI1 A;  1XHZ A;  4DV3 B;  2XOK G;  3SYC A;  4UCS A;  1N33 O;  3F5W C;  3K5L A;  3ABK C;  3APO A;  2HR3 A;  5KA6 A;  4FM0 A;  2P06 A;  4LF9 B;  4P9O A;  2QDO A;  3CCV V;  2W0X A;  1GM9 A;  4X1K B;  3L72 H;  2LQT A;  2ODM A;  1SS3 A;  1CXZ B;  4R8C A;  3IC9 A;  1VQ8 V;  2Q7H A;  5LMU O;  5JCO C;  1VAR A;  3CCR V;  2Q0A A;  1I7F A;  1BQZ A;  3FKS G;  2Q9L A;  5BMV B;  4AIL C;  2E5L O;  3ETG A;  1BQ0 A;  3ZCC A;  2W0F C;  3L73 H;  4DUZ B;  1WPX A;  5L3G A;  1CPY A;  2YIB A;  3M7M X;  3OMI B;  3H9V A;  5LP6 A;  4AQY B;  1NVP D;  1VF6 C;  5GTI Z;  1N4C A;  4J7K A;  3WU2 Z;  1N33 B;  1VMG A;  4PV1 B;  5FPO A;  2JGD B;  3RVZ A;  4RUF A;  4I0X B;  5IYZ A;  1SQV H;  1IBM B;  3OUS A;  4OPA A;  3ZMU A;  2JK5 C;  3LDE A;  4NR1 A;  4QPJ A;  2ZNJ A;  2IBZ H;  4GT1 A;  2UUC O;  4O2A A;  4D7S A;  5HFM A;  2Z5U A;  4NYK A;  5EBL C;  4DV0 B;  4K0K O;  4YHH B;  2GBO A;  2EBO A;  4LP8 A;  1AB3 A;  2AGA A;  2AHY A;  2N74 A;  2JEX A;  1PNM A;  2E5L B;  2FYU H;  3JCU Z;  1V54 C;  3VQV A;  1GN6 A;  4DR3 O;  4R7C A;  1RSO A;  3RYI B;  1SQP H;  2P5O A;  3JAR B;  4ZBM A;  2WLK A;  3G67 A;  4X1I A;  4UCO A;  4MVQ A;  4KXR A;  4NXN B;  1GO3 F;  3W7S A;  3ABU A;  1IX9 A;  4X1Y B;  3WG7 B;  4JI8 O;  1BMF G;  1NR7 A;  1M56 C;  2AZ0 A;  1Y4M A;  2DJV A;  2QWO B;  1OCR C;  4TV8 B;  1JR9 A;  3OMA B;  5EZY B;  5BY1 A;  3GB7 C;  1R1B A;  5DM6 V;  4ZI7 B;  2RNB A;  4FFB A;  2F66 C;  4UCT A;  2HG5 C;  5B1A B;  3VBB A;  1I5X A;  4JZG A;  4K35 A;  3JAS B;  3B77 A;  1NH2 D;  1OHH G;  2F23 A;  1YZB A;  1THZ A;  3D8C A;  3EFF K;  3R66 A;  3DSQ A;  4MTG A;  2DQ3 A;  1IDS A;  2ATK C;  2OWO A;  4DV1 B;  2EJ7 A;  3PJS K;  1GM8 A;  3CC7 V;  4I9W A;  1W0K G;  4BIO A;  5BR8 O;  1EZV H;  3BVO A;  1XMQ O;  3RYI A;  4LF7 O;  1NJI W;  3SDL A;  1Q6H A;  4YY3 O;  4R50 A;  4PHZ A;  3HPL C;  1F7Y A;  1G8M A;  1S5H C;  4G2K A;  1QLN A;  4IYI A;  2DYR C;  3OT7 A;  3RT3 C;  1V9P A;  1XQ8 A;  1XMO O;  1M90 W;  2Y69 C;  4U3F H;  3CP1 A;  4IGG A;  4J9Y B;  3AG3 B;  1JQ0 A;  4QIW F;  4PI0 A;  4BW9 A;  2EIK B;  1W2B U;  3BAB A;  3JAT A;  5CB4 B;  1WA8 A;  2VWJ A;  2KQX A;  1DGS A;  1KKC A;  1QLE C;  1Q7Y W;  5LBQ A;  1OCO B;  1ENV A;  3OR7 C;  2ILM A;  4MSW C;  1ZL8 A;  5H9C A;  2XND G;  2UXD O;  1Y76 A;  4MVS A;  1Q43 A;  1BL8 A;  1N0N A;  4TUY A;  5B1B C;  1EBO A;  4I55 B;  4BIZ A;  3K0G A;  4TV9 B;  5KHH A;  4MVZ A;  3UT5 A;  4IHJ A;  2UU9 O;  5LP6 C;  1Y74 B;  3H1K H;  3QG5 A;  1H2N A;  1XMQ B;  4JI1 B;  3B8N A;  2PI4 A;  2WA3 A;  2ZE8 A;  3CWB H;  2P22 C;  5JVD B;  1JFF B;  4CS4 A;  1S5L Z;  3RGB A;  5CA0 B;  2CAZ C;  1OV9 A;  1Q6I A;  5IJ9 A;  1JMK C;  3A2F A;  2QEX V;  4ZKI A;  2H94 A;  4LF5 B;  3RBZ A;  3FB7 C;  3GVM A;  4F6E A;  4JI0 O;  1XMO B;  4DR6 O;  1K33 A;  1AI4 A;  2Q8V A;  1Q5O A;  2ZM6 O;  3JAK A;  1LUV A;  4XBF A;  3TK1 A;  5L3B A;  2EIM B;  4O4J A;  1OZ0 A;  4NVP A;  4X62 O;  1WB7 A;  4TOI A;  4UUJ C;  1WAZ A;  2DYS C;  1EN4 A;  2Y0P A;  1PNL A;  3E83 A;  3CRR A;  4DR4 B;  3DGE A;  4BAY A;  2UXD B;  3JD1 A;  2PZS A;  1NVP B;  5LOV A;  1Y66 A;  5CB4 A;  4FM1 A;  3OMN B;  2GUZ A;  5J9P C;  3JD4 A;  3TJT A;  4JI6 B;  2A06 H;  3GWK C;  2X6C A;  1H8H G;  4U3J B;  1GK9 A;  2CH7 A;  5EIB D;  2ZQM A;  5A9G A;  5AG2 A;  3OEH G;  1VQ7 V;  2A0L A;  2RQ6 A;  3EHB B;  2DN9 A;  4DV5 O;  3CXH F;  4FPP A;  4QPK A;  4I4T A;  1R73 A;  5TIS Z;  1AI7 A;  2F95 B;  1QCE A;  2DWD C;  2ZM6 B;  4FLX A;  3CJH A;  1A32 A;  3JD0 A;  4X64 O;  1S5J A;  4Z1V A;  2EZP A;  4PDL A;  3MHH C;  4QE7 A;  4KFM A;  2OIG A;  2Q7G A;  1XNR O;  1HWY A;  4DRX B;  3E89 A;  1QR8 A;  1TUE B;  4FLT A;  3SJA C;  1EFR G;  1VQL V;  4B08 A;  1GAX A;  4I50 B;  3RN4 A;  1R3I C;  2OIE A;  4DK0 A;  2EIN C;  5JQG A;  2JS5 A;  1EN6 A;  1EN5 A;  5C8Y A;  3LDC A;  5F2V O;  3CME V;  2IJH A;  2WWW A;  4QE9 A;  1PV0 A;  5J2T A;  5GW7 A;  2HP8 A;  3T1Y B;  3SGI A;  4FVM A;  5KX5 A;  5KLV H;  2JVD A;  1NH2 B;  5B1N A;  4X20 B;  4FFK A;  2ARH A;  5KMG B;  4LCU C;  4WFH A;  2Q67 A;  3HKB B;  2EX3 A;  3HKE B;  2ZCE A;  1AJN A;  2OCC B;  3K3W A;  1DLB A;  3SYO A;  5LXT A;  4LWS B;  2AXT Z;  1Q82 W;  2YSU B;  2LGQ A;  4GX1 A;  1WPB A;  1XNR B;  3QO5 A;  2X0L A;  3CMA V;  1JVM A;  2YI8 A;  4DV7 O;  1E79 G;  1B06 A;  1TA8 A;  2YUA A;  4LF4 O;  1VIB A;  2QTO A;  2XAF A;  1YCI A;  1S72 V;  3W7T A;  2XAQ A;  1HNX B;  4HYO A;  3ETD A;  3OR6 C;  1PL0 A;  2UXX A;  2FB5 A;  5EK0 A;  4I50 A;  2EUL A;  3ZED A;  4JAV A;  1S77 D;  4MTX A;  4YJ3 B;  1OCR B;  1FXK B;  2CTW A;  4UB8 Z;  2KSD A;  4QJF B;  4UCR A;  3FFQ A;  4NB5 A;  5ITZ B;  1V55 B;  1H2M A;  4MVU A;  1AI5 A;  1N0J A;  4UFZ A;  2A7W A;  3JSL A;  5LYJ A;  5CMU A;  2AHZ A;  5EYP B;  1W59 A;  5FNV A;  3IFX A;  1ZTE A;  3ZHU A;  2KB1 A;  2UXC B;  3ZMT A;  4NXM O;  1HP8 A;  4X20 A;  2RMK B;  5CN0 A;  3K9A A;  3QO7 A;  3M99 B;  2ZR3 A;  3WB0 A;  4FM2 A;  3HKB A;  1AI6 A;  1ZAU A;  3ASN C;  2D3O W;  3S3W A;  4WF9 V;  2R9A A;  1KEC A;  3OFN G;  2WLH A;  4DYL A;  3VOU A;  3CPW U;  1UJW B;  5IT9 N;  4B7E A;  1DF4 A;  1SQX H;  4DV3 O;  1P84 F;  3ETE A;  4RQF A;  1QVF U;  2Q4P A;  4J41 A;  4BR6 A;  2ZKO A;  2QM8 A;  2HFE C;  1O9G A;  4Q6G A;  2BSK A;  1LUW A;  4JYA O;  1VQM V;  1Q8I A;  4LF9 O;  1FS0 G;  4W4L A;  3WB1 A;  2ZE7 A;  3UQ8 A;  3B8M A;  1NZ6 A;  1JPX A;  4WBN B;  1AJQ A;  3SR2 C;  2Z0A A;  1I0H A;  4WFB V;  3H1L H;  4RUE A;  4EFE A;  4JI5 O;  1N36 B;  3ZN0 A;  1N8R W;  1I5Y A;  4O4I B;  4E4E A;  4G28 B;  2NNU A;  5E1A C;  3ABM C;  1TVK B;  3SJB C;  4IL6 Z;  3HB3 B;  1R3K C;  5EYP A;  1MZF A;  2O57 A;  3VQY A;  2IH3 C;  4XDK A;  4IYH A;  3H1H H;  4DUZ O;  3OE7 G;  3CCE V;  1KB9 F;  3RWR D;  1M93 A;  4AQY O;  2XAS A;  2QGN A;  3JSN A;  2MW2 B;  1TUB B;  2ZR2 A;  2RN9 A;  5L3F A;  4G27 B;  5IJ0 B;  1UFI A;  5K1P A;  3JAW A;  3P3P A;  5B3S C;  1ZLZ A;  4JYA B;  2WSS G;  3KZI Z;  1IBM O;  1MSW D;  4TT3 G;  2WLL B;  3R65 A;  4CH5 A;  3HKC A;  4I5S A;  3P3N A;  3SPC A;  2QR4 A;  1OJH A;  4UV8 A;  3W7W A;  1K5Q A;  1ARO P;  1YHQ V;  4JI5 B;  4LFB O;  3K5M A;  3TET A;  4DV0 O;  3A0B Z;  4YHH O;  2HKO A;  2ITC C;  2BCC H;  4MTO A;  4B3R B;  2HLD G;  1NR1 A;  2HEP A;  4O4I A;  3LNM B;  3PN1 A;  4MVM A;  1AP5 A;  1OCZ C;  2BOC C;  1M57 B;  5D5Q A;  1HR0 B;  1QNM A;  3CS5 A;  5HFL A;  3W7U A;  4P2Z A;  1R3L C;  1COW G;  1FFT B;  4IIJ A;  4YXW G;  2K9P A;  3E8F A;  4NXN O;  3AG4 C;  3K59 A;  2FKX A;  4PEL A;  1TGO A;  3ZN1 A;  4D6T H;  5LGU A;  3APQ A;  3SYQ A;  4JI7 O;  2M6Y A;  4X88 A;  4B7K A;  2OYQ A;  2Q0O C;  4JTC B;  2BTQ B;  2HJF C;  1TUB A;  1XRE A;  1OCC B;  1K92 A;  5LGN A;  3IGA C;  1ZWI C;  1JA8 A;  4P30 A;  4DUY B;  4LFB B;  2WPD G;  4ASU G;  3ABT A;  3I55 V;  4X1K A;  3K04 A;  5GON B;  2PUS A;  3N2K B;  4ZHQ B;  2V7Q G;  1SRY A;  4HNA B;  4B3S B;  1GKF A;  1Z5V A;  1NU1 H;  3QTC A;  4DV1 O;  5KUM A;  4EB6 B;  3X2Q C;  3BA9 A;  3P30 A;  3WFV A;  4JYC A;  1X4T A;  3KCY A;  5BMV A;  4AHC A;  5IY5 C;  3CRC A;  1S3J A;  1RP3 B;  2MK3 A;  5KUK A;  2GHY A;  5LHI A;  3O65 A;  4JI7 B;  1RM1 C;  1H2K A;  3T2M A;  1XNQ O;  3B40 A;  2P6J A;  3ZHR A;  1NQT A;  1D2D A;  4JPR A;  3CB2 A;  1FXV A;  3FD9 A;  3L71 H;  1BCC H;  2JGD A;  1MZE A;  3THO A;  2A9H A;  1AVM A;  2EIL B;  1QBZ A;  4I0X A;  1KU9 A;  2E75 B;  1FD9 A;  2QTS A;  1H38 A;  4YIO A;  1MMM A;  4UVC A;  3AG1 C;  2X6B A;  3BFR A;  4JZ2 A;  1MSD A;  5H6Q A;  2XAH A;  2LFS A;  4X66 B;  4PDM A;  2CGN A;  5JH7 B;  3F7Y C;  3G80 A;  1YF2 A;  3RYF B;  4WFE A;  2NLJ C;  1FAF A;  2CK3 G;  3C3S A;  4RO2 A;  2QKA A;  1MNG A;  1IBK O;  1BS3 A;  2PY5 A;  4LFA B;  4JI1 O;  3D3I A;  3JAR A;  3E22 B;  1XNQ B;  2G38 A;  1M4U A;  4X1Y A;  1GM7 A;  3JCZ A;  3VQX A;  2PTM A;  4DW0 A;  4TV8 A;  3N2G B;  4LF5 O;  4CS2 A;  3CC4 V;  1SZX A;  5EZY A;  3NXS A;  1KKD A;  1VQO V;  4GX2 A;  4ZI7 A;  4TSF G;  3G6E V;  1XDC A;  5E79 Z;  1DF5 A;  3ZRS A;  1QHT A;  3CCM V;  4JI2 B;  2IM9 A;  1IBL O;  1SET A;  3ASO B;  1NKD A;  4DV6 B;  3JAS A;  1AJP A;  2GTS A;  1WLE A;  2HVK C;  3DXR B;  3ZRX A;  1O9H A;  4TQF A;  4DR4 O;  2XUM A;  2Y4U A;  2PF4 E;  1VF5 B;  3B2E E;  3HR0 A;  1LR1 A;  4P9P A;  1BGY H;  1PL4 A;  3K08 A;  1NT2 B;  1NI8 A;  4JI6 O;  1ZSP A;  3FB6 C;  3ABL C;  5LHH A;  3CHX A;  3ZRV A;  1IBK B;  5IYD O;  5CBF A;  2F1M A;  2JIZ G;  4UCU A;  3Q4H B;  5CA3 A;  3HKD B;  3RYC B;  2F93 B;  2ZXW B;  3AG2 B;  2QM7 A;  2Y0I A;  3A0R A;  1VQ9 V;  3U10 A;  5FL7 G;  2ZIN A;  1GRJ A;  1HDJ A;  3UM7 A;  4QNH B;  2YIA A;  1F4N A;  5FPR A;  3LSQ A;  5IWA B;  1IBL B;  2QWN B;  3CRQ A;  4ZOL B;  2RCV A;  4OGQ B;  2Y48 A;  2EIJ B;  1VQN V;  5KA5 A;  3U11 A;  1SA0 B;  3DXR A;  3RYH B;  5CBH A;  3KG2 A;  3L70 H;  3M8A A;  1YVW A;  2BE3 A;  1P7B A;  1P49 A;  5EC2 C;  1M9N A;  2Q68 A;  5LA6 B;  4I55 A;  2V1D A;  4TV9 A;  1AR4 A;  1KUQ A;  1X59 A;  4UCV A;  5LL6 Y;  3ABK B;  3G6B A;  3OD4 A;  5KAF Z;  1Y74 A;  4CH4 A;  3T1Y O;  4H13 B;  4PDV A;  1BHB A;  1Z5W A;  2ZIO A;  2Q69 A;  1SKV A;  2H8P C;  5LGT A;  2UUA O;  5JVD A;  2W6I G;  1JFF A;  3QNE A;  4LNU B;  2WLM A;  1F23 A;  5CA0 A;  3OEE G;  2YID A;  2QWP B;  4H33 A;  3CCS V;  2Q73 A;  1VQP V;  2QWQ B;  4FZ0 A;  2JGU A;  2P7T C;  2QWR B;  2VWK A;  2L35 A;  2IJK A;  4PI2 A;  4DXW A;  3SPJ A;  2AZ2 A;  1YIJ V;  1QVG U;  1H2G A;  1YEW A;  2QKC A;  3FYE B;  3MAQ A;  1ORQ C;  1AP6 A;  2VS0 A;  3CE2 A;  4JF3 A;  1D5A A;  4X65 B;  3CXC U;  4FIP C;  3LDD A;  2F4V B;  4B3M B;  4JAS A;  4F6R B;  3P32 A;  3MHS C;  1HNX O;  3ICX A;  4PA3 A;  4LFC B;  4PA9 A;  4O2B B;  3ZRW B;  2VQF O;  4KHP B;  1T5E A;  2E76 B;  2KKW A;  1J5E O;  1I08 A;  2ETN A;  1XL4 A;  1AIL A;  1RPO A;  2DW4 A;  3CEI A;  4U3J A;  3K0D A;  2JEU A;  3WG7 C;  2UUA B;  2K1E A;  2GSM B;  1FXH A;  4C7U A;  2ZIM A;  2UXC O;  1WJZ A;  1PD3 A;  3K03 A;  2P4V A;  3JAL B;  5B1A C;  3E35 A;  2ADP A;  2V4D A;  1BHA A;  2XHB A;  2KG7 B;  3I56 V;  1VQ5 V;  2GDS A;  2ADQ B;  1V54 B;  1FJG B;  1E1R G;  4GZR B;  1UPG A;  4PA7 A;  4PJ0 Z;  4DR2 B;  3ZHQ A;  4DRX A;  2RDC A;  5KHK A;  4RWU A;  1SF9 A;  4H37 A;  2VQF B;  3D36 A;  1M56 B;  4GCZ A;  4Z2W A;  2Z3Y A;  4FLU A;  2ZT9 B;  1J5E B;  2CDY A;  1K34 A;  2XTA A;  3BPZ A;  4O4H B;  4WFF A;  1J95 A;  2QA4 V;  1XIL A;  4OPH A;  2X7R B;  1L1F A;  1PP9 H;  3SYA A;  1XHX A;  2JJ1 G;  1N36 O;  4PA4 A;  4UB6 Z;  4DR1 B;  4GKJ B;  5H6R A;  3J7A U;  4JV5 B;  4FMT A;  4CC6 A;  1XEQ A;  5DED A;  3ZS8 C;  2NR5 A;  5KMG A;  5CA1 B;  1GH6 A;  2AW9 A;  3HKE A;  1NBM G;  2R9I A;  3C90 A;  4J7Z A;  3D3Q A;  3AG3 C;  1PM9 A;  1M1K W;  4L87 A;  4LWS A;  1U97 A;  4I9Q A;  1VEW A;  2HHH O;  2EIK C;  1URF A;  2IJI A;  1IXM A;  3TXS A;  1L8D A;  5JWP A;  3ZX6 A;  3FB5 C;  1RFY A;  2IW5 A;  5H2F Z;  5J2U B;  1XL6 A;  1OCO C;  1GN2 A;  1FFX B;  2QE7 G;  4X8A A;  4UVB A;  2WLI B;  3QF7 A;  3AK1 A;  4LF8 B;  1H2S B;  3BA8 A;  3MD0 A;  1IVS A;  2ZE5 A;  2DOS A;  2DYR B;  4YJ3 A;  1FXK A;  3SPH A;  4O4H A;  3ZMS A;  2P90 A;  5ITZ A;  4D7T A;  4GX5 A;  4UVA A;  1JJO A;  2ZE6 A;  2Y69 B;  4MS2 A;  4J42 A;  3CRM A;  1K4C C;  4B3R O;  4DR7 B;  4O4L B;  5JJE B;  4YJ2 B;  4DW1 A;  5GTH Z;  4OX9 B;  1R6K A;  5KHI A;  2UXB B;  5DEC A;  1HR0 O;  4NTY A;  1ZUQ A;  1QLE B;  1S76 D;  1BZK A;  4JI3 B;  4DR5 B;  2HHH B;  1G1X B;  3MDS A;  3E8H A;  1N32 B;  4GX0 A;  2DQ0 A;  2EIM C;  2P4K A;  5B1B B;  1US6 A;  1VQ4 V;  3GWO A;  1YJ9 V;  1JJ2 U;  1WN7 A;  2B9Z A;  2PGG A;  5LP6 B;  1GN4 A;  4WCE V;  3C3T A;  3O9O A;  1HNW B;  3ZMZ A;  2LGW A;  1PNK A;  1K8A W;  2B1G A;  3QO8 A;  3TCU A;  2QJ1 A;  1L0L H;  2QSA A;  2CTR A;  1MOF A;  1SQQ H;  1WNS A;  5KHG A;  4DUY O;  4EEQ A;  5IYZ B;  3W7X A;  2ITD C;  4GLX A;  4WBN A;  1IXB A;  3CYO A;  1YXB A;  4O2A B;  3F7V C;  3T1H B;  4B3S O;  2FTK A;  1NTZ H;  4BWA A;  4H44 B;  4LC1 A;  3F5T A;  1HNZ B;  1PKX A;  1TVK A;  3TXQ A;  4O4L A;  3BY6 A;  3SYP A;  3L74 H;  2DYS B;  5B66 Z;  3LSU A;  4YJ2 A;  1K5S A;  2GTA A;  3AEI A;  1Q6U A;  4LH6 A;  5BXZ A;  3A8T A;  2LJ2 A;  4U7O A;  4KL1 A;  4JAA A;  2VRZ A;  1XUQ A;  1WP8 A;  1Y6X A;  3L9D A;  4TWK A;  1Q86 W;  1VQ6 V;  2Y4T A;  1RSO B;  2CGO A;  3LNN A;  3G4S V;  4X1I B;  4B3T B;  4FLY A;  4Q20 A;  1N34 B;  3D36 C;  2VQE B;  4YIP A;  1I94 O;  3DC6 A;  5B1O A;  3OW2 U;  3TGU H;  3J80 N;  4H0L B;  5IJ0 A;  3RW0 A;  2PI5 A;  3G71 V;  2EZO A;  4I7Z B;  1R6T A;  3DTU B;  1LNQ A;  3K9S A;  4FFB B;  2W6J G;  2WLL A;  5EC1 C;  1NTM H;  2H3O A;  3IC7 A;  5A2Q N;  3JD2 A;  4IT5 A;  2R70 A;  3JD3 A;  4X89 A;  4X66 O;  1KP3 A;  1EM1 A;  3I5D A;  1R6N A;  4XDL A;  3JAM N;  2OCC C;  3UO3 A;  5LMU B;  1EZJ A;  3OUF A;  4J10 A;  4NKG B;  1JOY A;  4I4T B;  4J7J A;  4LFA O;  3E86 A;  4L8J A;  2EIN B;  3T1C A;  1Z2G A;  3KCX A;  1W0J G;  2LW7 A;  1YI2 V;  2Q7E A;  5LHG A;  1IUR A;  5EBW C;  3K79 A;  1E1Q G;  2DMX A;  1I94 B;  1Y67 A;  4A5U B;  1SC5 B;  2BTQ A;  1YDX A;  4KUM A;  2B1I A;  1FXK C;  1K7D A;  3EVK A;  4MVR A;  2QM4 A;  4J9Z B;  1V55 C;  3CCQ V;  1QQC A;  2YIC A;  1B04 A;  2ZDI A;  4JI2 O;  4JTA B;  1QU7 A;  4DV2 O;  4KP4 A;  4DV6 O;  3H1I H;  3BEH A;  5GON A;  1KBH A;  3N2K A;  4ZHQ A;  2UUC B;  1AR5 A;  4AI8 A;  3JAT B;  4HNA A;  3N27 A;  1WA8 B;  3UCS C;  2YXL A;  4K0K B;  4XDJ A;  1DK1 A;  1ZL8 B;  1KD1 W;  1GN3 A;  4EB6 A;  2A3Q A;  1Y76 B;  4JI4 O;  5BZB A;  4TUY B;  2XAJ A;  3AG7 A;  3UT5 B;  5IYB O;  4IHJ B;  1P7G A;  3ZHV A;  2LO1 A;  4MW8 A;  5H5N A;  2FML A;  4DR3 B;  2ZNI A;  1BSM A;  5L3C A;  4RQE A;  4EKW A;  3K57 A;  1YTF D;  4JI8 B;  3A0H Z;  3CRA A;  4RAI A;  5IJ9 B;  2LFR A;  1Q3E A;  2UXN A;  1MA1 A;  2E3C A;  3UKM A;  1CEZ A;  3CCU V;  3K58 A;  5KHJ A;  2N04 A;  4GKK O;  5IWA O;  2QKS A;  1FKA O;  2B5U A;  4DV2 B;  1NTK H;  4FLV A;  2JDI G;  3JYC A;  3JAK B;  3ASN B;  4O4J B;  2WLN A;  4MW3 A;  1WB8 A;  3OGI B;  3SPI A;  4ABM A;  2CTP A;  3IAY A;  2BOB C;  5LOV B;  2YC0 A;  4CZZ A;  5JH7 A;  4JI4 B;  2GUZ B;  1G6U A;  3FYI B;  3RYF A;  4FK5 C;  3U0Z A;  4HAM A;  4MT8 A;  1K73 W;  4W4K A;  5C93 A;  1HW7 A;  5EIB C;  2IU0 A;  2CH7 B;  5IYC O;  3E22 A;  5BR8 B;  3ZMV A;  2LW1 A;  1DTO A;  1F4M A;  5IE9 A;  4LF7 B;  3EXA A;  1JX9 A;  1XBL A;  4YY3 B;  3N2G A;  3WB2 A;  1H8E G;  2JJ2 G;  2PYJ A;  4HBN A;  3K5O A;  2DWE C;  3SJC C;  3FB8 C;  3ABM B;  4J80 A;  4GKK B; 
#chains in the Genus database with same CATH homology
 3L74 H;  1SQV H;  1EZV H;  1NU1 H;  1SQQ H;  4U3F H;  2FYU H;  3TGU H;  3CX5 F;  2IBZ H;  1BGY H;  4PD4 F;  3H1I H;  1PP9 H;  2BCC H;  4D6T H;  3H1J H;  3H1K H;  1SQP H;  3BCC H;  3CXH F;  3H1H H;  3L71 H;  1BCC H;  1BE3 H;  1NTZ H;  1NTM H;  1NTK H;  1SQX H;  3CWB H;  3H1L H;  1KB9 F;  3L70 H;  1SQB H;  1P84 F;  3L75 H;  1PPJ H;  2A06 H;  5KLV H;  1L0N H;  1L0L H;  3L72 H;  3L73 H;  1KYO F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...