4LR3A

Crystal structure of e. coli yfbu at 2.5 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
164
structure length
164
Chain Sequence
MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diamonds in the rough: a strong case for the inclusion of weak-intensity X-ray diffraction data.
pubmed doi rcsb
molecule tags Apoptosis
molecule keywords protein YfbU
total genus 58
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03887 YfbU YfbU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.680 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lr3A01
1.10.3190.10 Mainly Alpha Orthogonal Bundle yfbu gene product, domain 2 yfbu gene product, domain 2 4lr3A02
4LR3A 1WPBA
chains in the Genus database with same CATH superfamily
4DV3O 3T1HO 1EFRG 4JI5B 3ZS8C 1R6TA 1BSMA 3JD0A 3CB2A 1U96A 1Q6IA 2CH7B 1SS3A 4WFFA 4G2KA 1Q6UA 3TXQA 5H6QA 2KQXA 5J2TB 1HWYA 1OCOC 1QBZA 3B77A 3DGEA 3G80A 2QTSA 3H01A 2UXBB 3CCJV 2QE7G 2GSMB 2PY5A 2ATKC 1TUEB 4L8JA 1OCOB 3L71H 3RYIB 1YTFB 3OM3B 4MT8A 5EZYA 1SQPH 1N0NA 1WP8A 5LYJB 3CCLV 3K57A 3CMAV 3RFRA 2KSDA 4DR6O 3F7VC 4X66O 4IIJB 1BHAA 3HKEB 5CBHA 1EBOA 4X64B 1BMFG 2CDYA 4X1IA 2E74B 4MTGA 2ZE8A 1VP7A 4BW9A 1GM8A 1HP8A 1VF6A 4KFMA 4EB6A 3K79A 3HKDA 2GUZB 4QNHB 1Y76B 2YEVB 4ZHQB 1YITV 1HNWB 3ZMZA 3MHHC 4DV4O 4R50A 3LDEA 4J42A 4DR3B 3AK1A 4JI5O 2XAFA 1UFIA 1AP6A 3OUFA 2WA3A 5H2FZ 5EC1C 1XNQO 4O4LB 1M57B 2CE4A 5LL6Y 1G6UA 3SYCA 4I0XA 1KYOF 4DR5O 2QKCA 2R9IA 1EZJA 1S5HC 1U97A 2PF4E 1GM7A 2K9PA 5KX5A 2B1IA 5L3GA 5FNVB 1SC5B 1Y4MA 4GCZA 4JAUA 1ENVA 3CXHF 2RCVA 3Q4HB 3BCCH 3ABLC 1SZTA 3T1YO 3RYIA 3D3QA 5BMVB 4UVBA 2JEXA 2DYSC 1KC8W 1JVMA 5C8YA 3UM7A 4H0LB 1H2MA 2F1MA 3FYIB 2PZSA 1VF5B 1RPOA 1WA8B 3ZBHA 2Q7GA 2IM9A 3HPLC 1IBLB 2ETNA 4JI8B 4LF9O 5L3FA 2JS5A 3G4SV 3ZMTA 2Y4UA 3BFRA 4O4HB 2OIGA 4DK1A 3AK3A 3O65A 3DC6A 1BQ0A 5B3SB 5J2TA 3KG2A 5LOVB 3U11A 4J80A 1PL0A 4KUMA 2Y48A 3GB7C 3ZHSA 4WFAV 2UUBB 2E75B 5EBLC 2JK5C 3CC7V 2R70A 4QE9A 2BOCC 4YIOA 3CE2A 4O2AB 1SESA 3OTFA 1NKDA 4A5UB 4CS3A 2P22C 1ZWIC 3CCMV 2YXHA 4LF6O 4RWUA 3HKCA 3ABMC 3OEHG 5DEDA 1MABG 4MS2A 1KB9F 5GONB 1P7BA 1HNXB 3N2GB 4KP4A 2GTAA 3K9AA 4OPHA 5LP6C 4LH7A 4B3SB 3H1HH 4HZ3A 2YXLA 1CEZA 1OCRB 3OAAG 2IU3A 5CA0A 4MVUA 1BE3H 3KKYA 3SPIA 1IXBA 3IGAC 2ZE5A 4CZZA 3ZMSA 1RPRA 1SQVH 1RSOB 1IBKB 4Z1VA 2R9RB 5LP6B 3SPHA 4JYCA 1GTOA 2DWEC 1TVKA 4JI7B 3BA9A 2BSKA 2UXCO 1YCIA 2CAZC 3E22A 1NI8A 4D6TH 4UCRA 2LFSA 1S77D 1Y66A 3E8FA 3H1IH 1J95A 1OCZC 2YICA 4K0KB 2P90A 4X62B 5B1AC 4KL1A 4XBFA 2CTPA 2AW9A 4LFAO 3OEEG 4LBEC 4AILC 2V1DA 3BEHA 3WFVA 4JI0B 3AG4B 1GKFA 3JAKB 1XMQO 3ZRVA 4CC6A 4NXMO 2N04A 3RW0A 3ZMVA 4I55A 1L1FA 3K9SA 2YXYA 3WB1A 1Q8IA 3AK2A 2QWRB 1O9GA 2DW4A 2KKWA 4DV2O 2YI9A 3ZHRA 2F23A 1GO3F 3GWOA 2YEVA 4NTXA 4ZHQA 2PI4A 3ZCCA 4YJ2A 2XAHA 4D7SA 1VQLV 1QHTA 1JOYA 2ZD9A 3ZJZA 3UO3A 1Q82W 1YHQV 5KX5B 4CH3A 1XHXA 1WA8A 3P30A 3KCYA 1M1KW 2WLNA 2Y0PA 4PI2A 1X4TA 3BRCA 3FKSG 4MVRA 1R3KC 3AG1C 4GUNA 4BW5A 1YIJV 1VARA 2XASA 5BY1A 3MDSA 5FNVA 3K0GA 2R9AA 2QTOA 4IHJA 4LFCO 2X6AA 1SA0A 2XAQA 4O4HA 4CH6A 2YSUB 2M7WA 4W4KA 4AQYO 1XHZA 1CPYA 1SRYA 4DR2O 3MD0A 3RYCB 2P06A 2QSAA 5CMUA 3CRRA 1WAZA 2Z0AA 3H1KH 5B1BB 3HKEA 1DLBA 5ITZA 2Q67A 3T4ZA 2BE3A 1XI1A 4JYYA 1Y76A 4XDLA 5AG2A 2EINC 4RQEA 3Q4HA 3CMEV 5EK0A 4FLZA 1MZFA 2ZINA 1K34A 2ZE7A 3AG2B 1Y74B 4O2AA 5JJNB 1F51A 1AROP 2ILMA 2DMXA 1IX9A 3ABMB 4I0XB 5DM6V 1QQCA 1W0JG 4R8CA 3TGUH 1RFYA 3ZEDA 1XDCA 4X64O 4GYCB 3IFXA 2FKXA 4LWSB 1NU1H 1K73W 4F6RB 2HHHO 4DR7B 3SYPA 4XDJA 4UB8Z 2N74A 1NTKH 3C3TA 2UUCB 5B5EZ 1SQXH 3H1JH 1HNWO 2EIKB 3BPZA 3FB8C 3PN1A 3RYFB 1K4DC 3B09A 2ZM6O 3OTOO 4ICGA 4JI4O 3LSSA 4RUEA 3L72H 4X20A 1NH2B 1ROPA 1N32B 3ZHUA 4DV0O 3CJHA 2XAGA 4JAAA 1AB3A 1R6KA 1JR9A 3ZHVA 1E79G 2HR3A 4YHHB 1N8RW 1IBMO 2RJZA 1N33O 3FB6C 1SF9A 4IT5A 4DRXB 4JV5O 1FJGB 1L8DA 1IURA 3D3IA 3P3PA 4E4EA 3ABUA 4QJFB 1AI4A 2ADPA 5LA6B 3U10A 4DV1O 1ZL8B 4OX9B 2HKOA 5LHIA 1AR1B 3T4DA 4JYAO 5KHGA 1M4UA 4FMTA 4JI3O 1B06A 2ARHA 2EJ7A 1HNZO 4IYHA 1DF4A 2ZDIA 1S76D 5LMNB 2EIJC 1WLEA 4YJ3A 5KHKA 1FS0G 3TJTA 3K0DA 3OR6C 1QR8A 3GWKC 3OMNB 4BAYA 3ASNB 1VQ6V 4P9PA 5IY5B 1N4CA 5K1PA 4B7EA 4R7CA 5CA0B 3B8NA 3L75H 5CBGA 4JI6O 4ZI7A 4PA4A 2QWQB 1PD3A 1NR7A 1KP3A 5DECA 3VQVA 4DO2A 4J10A 2WLLA 2RMKB 3OTOB 2IJJA 1PPJH 4PDRA 5E1AC 2R72A 1Q3EA 3AG7A 2CK3G 1QR9A 4O4IB 4DV1B 1R3JC 4YJ2B 1K4CC 1VQ7V 5IJ9B 4ZKIA 4DW1A 1S5LZ 2ZCEA 4WFGA 1YJNV 4DK0A 4B08A 5K1XA 4I55B 2WLHA 2MK3A 3E83A 4Z1MG 2ZT9B 1IXMA 4OPAA 1P84F 1LUVA 1S3JA 1HR0O 3A0RA 4HNAA 2DJVA 4DW0A 1MG1A 3CCRV 3SJAC 2RQ6A 5EYPB 2VQFO 4LF4O 4CS4A 1K9MW 4FJCC 4JYBA 1NVPB 4MTFA 1AR4A 3HKBA 4X1YA 2OTLV 1PNLA 2Q9LA 3N2KA 3UT5B 1QVGU 4D7TA 4O4JB 5KLVH 1NR1A 4LF8B 2AZ0A 1H2SB 4G27B 3GVMA 4J11A 1YEWA 2E3CA 1XL6A 4I7ZB 5BZBA 3JSLA 1Q5OA 4I4TA 5IDJA 3K5OA 1BL8A 1Q7YW 1I94O 1JQ0A 4TSFG 3E22B 3K58A 1MA1A 2JGDB 1OJHA 1SQQH 1VF7A 4RO2A 2EX3A 1BQZA 3X2QB 3JATA 3ZN0A 4QPJA 4X65O 1IVSA 1O9HA 1SQBH 2YIDA 4P2ZA 4P9OA 2QKAA 3W7SA 1NTZH 5B3SC 4I9QA 4TV9B 2HVKC 3STZC 5IYBO 3ZRXA 4PDLA 3CRQA 1N0JA 1SQFA 3OT7A 1KUQA 5J2UA 1I7FA 2QWPB 3E2EA 3T2MA 4JI8O 4LF9B 2AXTZ 2LW7A 5TISZ 4B3TO 2M6YA 4O2BA 3HKDB 5A9GA 5KUKA 4ASUG 4K35A 4DV4B 1R73A 2BTOA 4DV6B 1MNGA 2V4DA 4F6RA 5L3DA 4LF8O 4HYOA 1YI2V 3EVKA 5LMUO 5HFMA 1FKAO 3IAYA 3LNMB 2H8PC 1QVFU 1DGSA 3JALA 2EIMB 4PA9A 2AGAA 1FXKB 2P4VA 1P7GA 3A2FA 3ICXA 2Q73A 4UCUA 3ASNC 1VQMV 1D2DA 2X7RB 2F66C 3F5WC 4DV5O 3FB5C 4B3MO 4ZOLB 2IJKA 3QG5A 1UJWB 2FMLA 4PELA 2WLKA 3MHSC 1PNKA 3VQWA 5EC2C 2P4KA 1NBMG 3HKCB 5L3BA 4YY3B 2A79B 4TUYA 3UCSC 2ZXWC 2PGGA 3ZX6A 2HHHB 4DR1B 4FLVA 4DR7O 3CCQV 4JI1O 1I0HA 3K08A 2IBZH 5BMVA 3CP1A 4ZBMA 3M7MX 2YC0A 1PM9A 3EXAA 2Q4PA 3KZIZ 5CB4B 2P5OA 1LR1A 2H94A 1AJQA 2UXDB 5B66Z 4YIPA 3E86A 3WU2Z 1GN2A 3QTCA 1FPOA 1F4MA 3B4SA 1XUQA 1XNRO 2UUAB 1JFFA 3J7AU 1N32O 4Z2WA 3QO8A 5C93A 4DV7O 2WLMA 4PJ0Z 4TV8A 3E35A 3QVNA 1N36B 1R3LC 5KMGB 1JPXA 2QKSA 5EBWC 4JV5B 3OR7C 1FYJA 4X1KA 3JASB 3OW2U 1PKXA 1YJ9V 2Q8VA 1QCEA 5LHHA 1DF5A 1KECA 3ETEA 1S72V 4J7ZA 1VMGA 2HFEC 4JI3B 4LH6A 4GKKB 1AI6A 3MAQA 5KHHA 2KG7B 5GW7A 1VQPV 4UVCA 3L9DA 4L87A 4YHHO 3CCSV 3D8CA 4PV1B 3QO5A 2DWDC 4X20B 1NTMH 4LC1A 4H37A 3RVYA 2UXBO 1WB7A 4IGGA 1H8HG 4MTOA 4NVPA 3M8AA 4ZIBA 5ITZB 1ZSPA 5CBFA 2DYSB 5LGNA 2UUAO 5KMGA 2ZR2A 5JCOA 3CRCA 4GT1A 4NXNO 1Q43A 2EBOA 2CH7A 2LQTA 1NJIW 4IHJB 2A06H 1XMQB 4BWAA 1B3QA 2QA4V 4JTCB 4F4LA 4U3JA 2RDCA 1TA8A 1G4YB 4DUZB 2PI5A 4FM2A 2P67A 1GRJA 4KHPO 2LW1A 2EINB 3A8TA 1XEQA 1YXBA 3OE7G 3K5NA 1MZEA 1NQTA 4GKJO 1M90W 2Q69A 3EFFK 1FXVA 4LF5B 2N05A 3VBBA 1YDXA 1JX9A 3JAKA 3CCUV 4TWKA 3W7WA 2F95B 4I5SA 5EIBC 3D36A 3SJBC 5BR8B 4JI2B 5B1OA 4U7OA 4WFHA 2UUCO 3LDDA 1LNQA 5CN0A 3JD3A 4QGPA 2JJ1G 1J5EO 5EBMC 3SJCC 2OCCC 5L3EA 2YIBA 2Q5ZA 1BZKA 3H1LH 1CP9A 5IYZA 1G8MA 2UXDO 2XNDG 1H2LA 4JPRA 3WB2A 1VQ5V 4H33A 2RN9A 3W7TA 4N23A 3HR0A 1D5AA 1OCRC 2MW2B 1KKDA 1FXHA 3ZN1A 1P49A 1RM1C 1QLEB 2VWJA 1N33B 3SYOA 1OCZB 2ZE6A 1ZTEA 4P30A 3N2GA 3HKBB 4LF6B 1MSWD 3QNEA 3O9OA 4OXSA 2NLJC 4TV9A 4DR4O 2X6BA 2EJRA 3L74H 1XMOB 3CYOA 3FD9A 2CTRA 1RM1B 2HG5C 1AR5A 1AJNA 3FFQA 4PA6A 5JQGA 4FIPC 1TAEA 5IYZB 2OWOA 4UV8A 4B3RB 2F43G 3CSXA 4EKWA 1MOFA 4GZRB 1B04A 1EN5A 4MVMA 1AILA 1D5NA 3CJHB 3JARA 3K03A 2Q0OC 5FPOA 5IWAB 5IJ0B 4MVSA 2GHYA 3ZHTA 3CC4V 3ABLB 5EIBD 4DYLA 2NN4A 2BTQA 3RWRD 2LO1A 2YIBD 1K7DA 1GAXA 4J7KA 1HNZB 2CTQA 2WPDG 1SETA 4Q6GA 4JI0O 1OHHG 2YIAA 1WPXA 3P3NA 3DC5A 3JCZA 3C90A 2BOBC 4U3FH 1N34B 1I5XA 3I56V 3OMIB 4U3JB 4MTXA 2VS0A 2UUBO 2F93B 4JI4B 4WF9V 3CS5A 2LGWA 3ABKB 4EEQA 2QWNB 2Q68A 2AZ2A 1EN6A 5JWPA 5F2VO 5E79Z 2CUGA 3S3XA 4TQDA 3A0BZ 2ZDIC 4K3AA 3SR2C 3OMAB 1R3IC 5JJJB 3CCVV 3JASA 1MSDA 3BAAA 4LF7O 1M56B 3OGIB 3LUTB 1Z2GA 3N27A 1AI5A 1WJZA 4JI2O 3ZRSA 2A3QA 2XTAA 3UO2A 4R6ZA 4TV8B 3SPJA 2HJFC 5DN6G 4IYIA 2UXNA 2RNBA 5JCOC 1Q6HA 4GX5A 2Y4TA 4G28B 1I94B 3JSNA 5D5PA 4DR6B 4DUYO 2Z3YA 4X9QA 3ASOC 1Z5WA 2PTMA 2YI8A 2P6JA 2ITCC 4OX9O 1XBLA 1PL4A 2EILB 4IL6Z 5LGTA 2Y69C 3CXCU 1UPGA 1YTFD 3ASOB 2GDSA 5B1AB 5LMNO 1GK9A 2EIKC 1SKVA 1YVWA 1H8EG 1Y67A 1ZAUA 4WBNA 2Y69B 1AP5A 1XMOO 5LBQA 4IIJA 2UU9B 4NXMB 3J80N 1IDSA 2AHYA 1Y74A 4I50B 4NKGB 5KAIZ 5LYJA 3ZHQA 3CRMA 4EFBA 2DN9A 2O57A 1F23A 1HW7A 2VQEO 3JAWB 3G6BA 3AG3C 4CH5A 2GV9A 2QWOB 4JASA 3DTUB 3R65A 1LUWA 3JALB 2W0XA 4KXRA 4TOIA 3G67A 4I4TB 1RP3B 2UXXA 2ZIOA 3RYCA 1VQ4V 4B3MB 5CB4A 1GH6A 4TUYB 2EIMC 1G1XB 1SA0B 4BIZA 5LHGA 4LP8A 1AJPA 2C2AA 1XL4A 4LR3A 4JF3A 3EHBB 2EZPA 3W7XA 1V55B 1E1QG 1PV0A 1URFA 1YSCA 3APOA 4F6EA 4LFBB 2B5UA 5IT9N 3CX5F 1FAFA 4PHZA 2QR4A 2Z5UA 2QDOA 2WLIB 2DQ0A 1Q90D 5H6RA 3CCEV 2PYLA 1F7YA 2DOSA 4X8AA 3SGIA 4DXWA 5CA1A 2B1GA 5KHIA 4LNUA 3JARB 3APQA 5KA6A 4WCEV 4I9WA 1YZBA 3OGCC 2AHZA 2HP8A 1ZX3A 4GKJB 2JGDA 3K5LA 2QGNA 1FJGO 5LXTA 1B6QA 5CA3A 3SPCA 1IBMB 4JGSA 3RVZA 4FVMA 4FLXA 4H44B 3RYHB 1XQ8A 3HB3B 4ZOLA 3LSQA 3CRAA 1KKCA 3CEIA 2UU9O 1S5JA 2X6CA 4DR1O 1K33A 1Y6XA 1DK1A 1HNXO 3RGBA 1M56C 3TCUA 1BCCH 3W7UA 2KB1A 3N2KB 3UT5A 5JVDB 1WB8A 1OCCC 4B3TB 1YJWV 3SYQA 1EN4A 4X66B 1JJ2U 4DUYB 1XNQB 2PUSA 4B7KA 2DQ3A 1WP7A 4MVOA 4W4LA 4RQFA 4LCUC 2WLJA 5JQGB 3SJQC 4FLYA 3BABA 3K04A 2W6JG 4UB6Z 3JATB 3S3WA 3OD4A 1H2KA 1OV9A 2QJ1A 4UCOA 4FK5C 4PD4F 5LP6A 1K92A 4O4IA 5IJ0A 4DR5B 3G6EV 4RAIA 3G71V 3FAVB 1W59A 1FFXB 3RBZA 1XILA 1PP9H 3IC9A 4FFBB 3D36C 4O4JA 2WSSG 1VIBA 3OUSA 2P7TC 3FAVA 5L3CA 1GM9A 1S0VA 3A0HZ 3K06A 3B40A 4WFEA 5HFLA 5CA1B 5GTIZ 2VQEB 5GONA 5FLXN 3VOUA 1NZ6A 1VEWA 4HAMA 2ZIMA 2EZOA 3QO7A 3AG4C 4UV9A 2WLIA 4X88A 1P4RA 3I5DA 4FZ1A 3X2QC 3RYFA 4J7JA 4BIOA 1JMKC 2A9HA 3DSQA 1MMMA 4QE7A 3IC7A 4JAVA 2D3OW 4AI8A 3SDLA 5JVDA 1SZXA 2YUAA 2QM4A 2JEUA 2HVJC 1ZUQA 2ZM6B 3ML0A 3J81N 1TVKB 1M93A 2XUMA 5LGUA 2BSKB 2V7QG 3NXSA 4MW8A 1NVPD 3SPGA 4LF7B 2JGUA 2F4VO 2WLLB 2LGQA 4UXNA 2E5LB 3JAWA 3LNNA 3L73H 4FFBA 4PA3A 1FFTB 4JZ2A 4EFEA 2JIZG 4ZI7B 4LFCB 2WA4A 2FL4A 4AQYB 1V55C 5IJ9A 3JD4A 2FYUH 2LFRA 2IW5A 1XOUA 4X65B 4UVAA 4X89A 5EZYB 4DR2B 3E8HA 2KG7A 3BVOA 1JA8A 1SERA 3K3WA 4PDVA 1K5SA 2OYQA 3VQXA 1ZL8A 3QF7A 4NB5A 3F5TA 2Y0IA 3B8MA 3THOA 1KU9A 4K0KO 4E2LA 1ZLZA 4GX0A 3RYHA 1V54C 4NXNB 2W0FC 4X1KB 5KA5A 4DRXA 1COWG 1VQ8V 1IBKO 2IH1C 2GUZA 3JYCA 3NR7A 1VQOV 4O4LA 4UFZA 1OCCB 1VF6C 2ZNIA 2Q0AA 1QLEC 4JTAB 4MSWC 2ZXWB 2IH3C 2JDIG 1BT8A 1WNSA 1ORQC 5GTHZ 3C3SA 4CH4A 1JFFB 3K59A 5LOVA 3ABKC 4FFKA 4X62O 4Q20A 2ZKOA 1THZA 1H38A 4J9ZB 1K5QA 4NYKA 3T1CA 2QM7A 5B1BC 3TETA 5IWAO 5B1NA 4AHCA 3B2EE 3ZRWA 4LF5O 1GN4A 4U7NA 5C8YB 2NR5A 4DV3B 4TT3G 2IJIA 3RT3C 1PNMA 5IE9A 1M5IA 1KMIZ 5D5QA 3R66A 4CBCA 1TUBB 1BGYH 4JYAB 4HBNA 1US6A 4FLWA 4JI1B 1M9NA 5IYDO 1M57C 1AVMA 4FPPA 4DV2B 2OCHA 4FZ0A 2EULA 4QIWF 1NH2D 3E89A 3BY6A 5FL7G 2ZQMA 1X59A 3RN4A 1KBHA 1IZ3A 2D2CB 2JJ2G 2NNUA 4WBNB 1V9PA 1A32A 1EZVH 2DYRB 4C7UA 1QNMA 2Q7EA 1H2NA 5KAFZ 4B3SO 3BHPA 1N36O 3FB7C 4X1IB 4MVZA 4LFAB 1GN6A 3UKMA 4DR3O 1EM1A 2BTQB 2W6IG 4MW3A 1CXZB 4UCVA 2XHBA 3JCUZ 5JJEB 2GBOA 5H5NA 1VQNV 1R6NA 3OFNG 4LWSA 4LFBO 3L70H 2JVDA 4CC5A 4UUJC 1I5YA 2PYJA 2F4VB 1GMGA 4JI6B 2HEPA 1FXKC 3DXRB 2FTKA 3WG7C 4UCTA 2HLDG 1FXKA 3KCXA 2XOKG 4FLUA 2DE0X 1HR0B 4B3RO 1TUBA 4J41A 3E8GA 3ETQA 5FPRA 2A7WA 4J9YB 1L0NH 1E1RG 4YXWG 4PI0A 1OZ0A 1W2BU 5H9CA 4BIUA 1QLNA 2A0LA 2XAJA 2LJ2A 4PA7A 2OTJV 1T5EA 2EIJB 2EILC 2VRZA 4GLXA 2G38A 2E76B 4PDMA 2XT9A 5KHJA 5A2QN 3F7YC 1I08A 3T1YB 3CHXA 4JTDB 4MVQA 3VQYA 3WB0A 1GN3A 4DUZO 5IY5C 1F4NA 1V54B 4KHPB 1BS3A 2FB5A 1L0LH 2L35A 4RUFA 2IJHA 1IBLO 1XNRB 4GX2A 1R1BA 2OCCB 1Q86W 4H13B 3K5MA 4O2BB 2QM8A 4NTYA 4DV7B 1K3EA 4FLTA 3SYAA 4N21A 2LP7A 3AG1B 4YY3O 2YDEA 4ABMA 4K8XA 1HDJA 5J2UB 2VWKA 4NR1A 2B9ZA 1KD1W 1KP2A 3I55V 4WFBV 2H3OA 2OIEA 1WPBA 1N34O 3AG3B 2WWWA 5JH7B 4HNAB 2ADQB 1WN7A 5IYCO 4FM0A 1YF2A 4FM1A 4QPKA 3FX7A 3P32A 3JAMN 4GX1A 4CS2A 2L6LA 1W0KG 3CWBH 1VQ9V 4NTWA 1K8AW 1J5EB 1XREA 4DV6O 5LMUB 1FFXA 3ZMUA 2K1EA 1H2GA 3LDCA 2UXCB 2BCCH 1FD9A 4JI7O 1NT2B 2ZR3A 1Z5VA 1NS1A 1JCHA 1K97A 3AG2C 3TXSA 1VQKV 4BR6A 3CD6V 2HJDA 2DYRC 4UCSA 4TQFA 4EB6B 3BA8A 3ABTA 4DR4B 4X1YB 3CPWU 4XDKA 2X0LA 3UQ8A 5EYPA 2JRIA 3PJSK 3ETDA 3T1HB 3FYEB 3U0ZA 2CTWA 4GKKO 1BHBA 1DTOA 5J9PC 3STLC 1RSOA 2E5LO 2ITDC 2JS3A 4I50A 3ZIAG 3TK1A 4DV5B 3IJ4A 3AEIA 2IU0A 3M99B 3WG7B 3JD2A 5JH7A 4YJ3B 5KUMA 1JJOA 2GTSA 3JD1A 1KQSU 1SQGA 5LA6A 2OT5A 3ETGA 2CGOA 4K8ZA 1QU7A 5LXTB 1TGOA 2Q7HA 3ZRWB 3H9VA 3CC2V 5BR8O 2YS8A 2ODMA 3LSUA 2ZNJA 5BXZA 3E8BA 2Q6AA 1AI7A 3DXRA 2WAMA 4DV0B 1Q81W 4OGQB 2QEXV 4LNUB 2VQFB 2CGNA 4LF4B 4JZGA
chains in the Genus database with same CATH topology
4JI5B 3ZS8C 2F95B 2ZIMA 5EIBC 3SJBC 3CB2A 5BR8B 3RYFA 4X20A 4JI2B 1JMKC 1N32B 3DSQA 5JVDA 5J2TB 3SJCC 2YIBA 2QM4A 4YHHB 2ZM6B 2RJZA 4DRXB 5IYZA 1TVKB 1M93A 1FJGB 1L8DA 2UXBB 3WB2A 4LF7B 2JGUA 3U10A 5LA6B 2PY5A 4OX9B 4L8JA 1D5AA 2E5LB 3JAWA 3LNNA 3RYIB 5KHGA 4FFBA 1M4UA 4EFEA 4ZI7B 4LFCB 5EZYA 1P49A 4AQYB 5LYJB 5IJ9A 3K57A 2VWJA 3RFRA 1N33B 4X65B 3N2GA 5LMNB 3HKBB 4LF6B 5EZYB 4DR2B 4TV9A 4IIJB 4YJ3A 5KHKA 3HKEB 1XMOB 4X64B 2OYQA 3VQXA 3QF7A 4X1IA 3THOA 1KU9A 3FFQA 4BW9A 5JQGA 3RYHA 5K1PA 4NXNB 1TAEA 4X1KB 4DRXA 5IYZB 5CA0B 4EB6A 4ZI7A 2OWOA 3HKDA 4B3RB 3CSXA 4ZHQB 1HNWB 3VQVA 1B04A 4O4LA 4UFZA 2ZNIA 2Q0AA 4DR3B 3OTOB 3JARA 2R72A 1WNSA 5FPOA 1Q3EA 5IWAB 5IJ0B 4O4IB 4DV1B 4YJ2B 4CH4A 1JFFB 3K59A 4O4LB 5EIBD 5IJ9B 5LOVA 1G6UA 2ZCEA 2BTQA 3RWRD 4DK0A 4B08A 2YIBD 5K1XA 4I55B 5KX5A 1HNZB 5FNVB 4Q6GA 4HNAA 2YIAA 4AHCA 3RYIA 3B2EE 5BMVB 3SJAC 5C8YB 5C8YA 1N34B 2RQ6A 4DV3B 5EYPB 2PZSA 2F1MA 4CS4A 4U3JB 3HKBA 2Q7GA 1M5IA 1KMIZ 2IM9A 4X1YA 5D5QA 1TUBB 1IBLB 2F93B 4JI8B 4JYAB 4HBNA 4JI4B 4FLWA 2JS5A 4JI1B 3N2KA 3UT5B 4D7TA 4O4HB 4DK1A 4O4JB 4EEQA 4DV2B 5J2TA 5LOVB 4LF8B 3U11A 1H2SB 4TQDA 1YEWA 2E3CA 3SR2C 3JSLA 1Q5OA 5JJJB 4I4TA 3K5OA 3JASA 2UUBB 3BAAA 3E22B 4WBNB 3K58A 1V9PA 1VF7A 2EX3A 2Q7EA 3JATA 2R70A 4O2AB 4TV8B 3OTFA 3BHPA 4CS3A 2P22C 4X1IB 1O9HA 4LFAB 5JCOC 2BTQB 4UCVA 2XHBA 5JJEB 3HKCA 1I94B 3JSNA 5D5PA 4DR6B 4I9QA 4TV9B 5GONB 1HNXB 1Z5WA 2PTMA 1SQFA 3N2GB 2YI8A 2JVDA 4CC5A 5J2UA 2PYJA 1I7FA 2F4VB 5LP6C 4LH7A 4B3SB 4LF9B 2YXLA 4JI6B 2HEPA 4O2BA 3HKDB 5CA0A 4UCTA 4DV4B 2BTOA 4DV6B 2V4DA 4F6RA 4FLUA 1HR0B 1IBKB 1TUBA 3IAYA 5LP6B 1DGSA 1TVKA 3JALA 1SKVA 3ETQA 4JI7B 3BA9A 5FPRA 3A2FA 1ZAUA 3ICXA 2CAZC 3E22A 4PI0A 4WBNA 4UCUA 4UCRA 4IIJA 2UU9B 4NXMB 4K0KB 2VQEB 4I50B 4X62B 2F66C 5LYJA 4KL1A 4EFBA 1T5EA 4ZOLB 3QG5A 4GLXA 1HW7A 4AILC 3JAWB 3VQWA 4CH5A 2GV9A 5KHJA 4JI0B 3HKCB 4YY3B 3JALB 3T1YB 4TUYA 3CHXA 3JAKB 4TOIA 3VQYA 3WB0A 4CC6A 4I4TB 2ZIOA 2PGGA 2HHHB 4DR1B 4FLVA 3RYCA 4KHPB 4B3MB 5CB4A 4TUYB 1XNRB 4I55A 5BMVA 3K5MA 4O2BB 1SA0B 3WB1A 3M7MX 1Q8IA 4DV7B 4FLTA 4LR3A 1O9GA 5CB4B 2P5OA 4K8XA 5J2UB 2VWKA 2UXDB 2KKWA 2YI9A 4LFBB 4PHZA 3QTCA 1WPBA 2UUAB 4ZHQA 1JFFA 5JH7B 2PYLA 4HNAB 4YJ2A 4D7SA 3SGIA 1QHTA 1WN7A 4FM0A 5CA1A 5KHIA 4FM1A 4LNUA 3JARB 4TV8A 1N36B 4CS2A 5KX5B 4CH3A 1XHXA 5KMGB 1J5EB 4GKJB 4JV5B 3K5LA 5LXTA 4PI2A 5LMUB 1X4TA 3BRCA 1FFXA 4X1KA 1IBMB 3JASB 4FVMA 4FLXA 3RYHB 1XQ8A 2UXCB 4ZOLA 1NT2B 5FNVA 1Z5VA 1S5JA 2R9AA 4IHJA 4JI3B 4LH6A 3RGBA 4GKKB 3MAQA 5KHHA 4UCSA 4TQFA 1SA0A 4O4HA 4EB6B 4CH6A 3BA8A 3N2KB 3UT5A 5JVDB 4DR4B 1XHZA 4B3TB 4X1YB 3RYCB 4X20B 3UQ8A 5EYPA 3T1HB 3HKEA 3U0ZA 4X66B 1XNQB 4NVPA 5ITZA 2PUSA 4ZIBA 5ITZB 4DUYB 1XI1A 5KMGA 5JCOA 4FLZA 2ZINA 1RSOA 5JQGB 4FLYA 3BABA 4I50A 4O2AA 5JJNB 1Q43A 3JATB 4DV5B 4IHJB 5JH7A 2QJ1A 4YJ3B 1QQCA 4UCOA 1XMQB 1JJOA 4BWAA 1SQGA 5LA6A 5LP6A 4O4IA 5IJ0A 3ZEDA 4DR5B 4U3JA 4K8ZA 4GYCB 1TA8A 4F6RB 5LXTB 4DR7B 4DUZB 1FFXB 4FM2A 1TGOA 2Q7HA 4FFBB 2ZNJA 4O4JA 3K5NA 2UUCB 4DV0B 4LF5B 3BPZA 3PN1A 4LNUB 3RYFB 2VQFB 3JAKA 4LF4B 5CA1B 5GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LR3 A;  1WPB A; 
#chains in the Genus database with same CATH topology
 4DV3 O;  3T1H O;  1EFR G;  4JI5 B;  3ZS8 C;  1R6T A;  1BSM A;  3JD0 A;  3CB2 A;  1U96 A;  1Q6I A;  2CH7 B;  1SS3 A;  4WFF A;  4G2K A;  1Q6U A;  3TXQ A;  5H6Q A;  2KQX A;  5J2T B;  1HWY A;  1OCO C;  1QBZ A;  3B77 A;  3DGE A;  3G80 A;  2QTS A;  3H01 A;  2UXB B;  3CCJ V;  2QE7 G;  2GSM B;  2PY5 A;  2ATK C;  1TUE B;  4L8J A;  1OCO B;  3L71 H;  3RYI B;  1YTF B;  3OM3 B;  4MT8 A;  5EZY A;  1SQP H;  1N0N A;  1WP8 A;  5LYJ B;  3CCL V;  3K57 A;  3CMA V;  3RFR A;  2KSD A;  4DR6 O;  3F7V C;  4X66 O;  4IIJ B;  1BHA A;  3HKE B;  5CBH A;  1EBO A;  4X64 B;  1BMF G;  2CDY A;  4X1I A;  2E74 B;  4MTG A;  2ZE8 A;  1VP7 A;  4BW9 A;  1GM8 A;  1HP8 A;  1VF6 A;  4KFM A;  4EB6 A;  3K79 A;  3HKD A;  2GUZ B;  4QNH B;  1Y76 B;  2YEV B;  4ZHQ B;  1YIT V;  1HNW B;  3ZMZ A;  3MHH C;  4DV4 O;  4R50 A;  3LDE A;  4J42 A;  4DR3 B;  3AK1 A;  4JI5 O;  2XAF A;  1UFI A;  1AP6 A;  3OUF A;  2WA3 A;  5H2F Z;  5EC1 C;  1XNQ O;  4O4L B;  1M57 B;  2CE4 A;  5LL6 Y;  1G6U A;  3SYC A;  4I0X A;  1KYO F;  4DR5 O;  2QKC A;  2R9I A;  1EZJ A;  1S5H C;  1U97 A;  2PF4 E;  1GM7 A;  2K9P A;  5KX5 A;  2B1I A;  5L3G A;  5FNV B;  1SC5 B;  1Y4M A;  4GCZ A;  4JAU A;  1ENV A;  3CXH F;  2RCV A;  3Q4H B;  3BCC H;  3ABL C;  1SZT A;  3T1Y O;  3RYI A;  3D3Q A;  5BMV B;  4UVB A;  2JEX A;  2DYS C;  1KC8 W;  1JVM A;  5C8Y A;  3UM7 A;  4H0L B;  1H2M A;  2F1M A;  3FYI B;  2PZS A;  1VF5 B;  1RPO A;  1WA8 B;  3ZBH A;  2Q7G A;  2IM9 A;  3HPL C;  1IBL B;  2ETN A;  4JI8 B;  4LF9 O;  5L3F A;  2JS5 A;  3G4S V;  3ZMT A;  2Y4U A;  3BFR A;  4O4H B;  2OIG A;  4DK1 A;  3AK3 A;  3O65 A;  3DC6 A;  1BQ0 A;  5B3S B;  5J2T A;  3KG2 A;  5LOV B;  3U11 A;  4J80 A;  1PL0 A;  4KUM A;  2Y48 A;  3GB7 C;  3ZHS A;  4WFA V;  2UUB B;  2E75 B;  5EBL C;  2JK5 C;  3CC7 V;  2R70 A;  4QE9 A;  2BOC C;  4YIO A;  3CE2 A;  4O2A B;  1SES A;  3OTF A;  1NKD A;  4A5U B;  4CS3 A;  2P22 C;  1ZWI C;  3CCM V;  2YXH A;  4LF6 O;  4RWU A;  3HKC A;  3ABM C;  3OEH G;  5DED A;  1MAB G;  4MS2 A;  1KB9 F;  5GON B;  1P7B A;  1HNX B;  3N2G B;  4KP4 A;  2GTA A;  3K9A A;  4OPH A;  5LP6 C;  4LH7 A;  4B3S B;  3H1H H;  4HZ3 A;  2YXL A;  1CEZ A;  1OCR B;  3OAA G;  2IU3 A;  5CA0 A;  4MVU A;  1BE3 H;  3KKY A;  3SPI A;  1IXB A;  3IGA C;  2ZE5 A;  4CZZ A;  3ZMS A;  1RPR A;  1SQV H;  1RSO B;  1IBK B;  4Z1V A;  2R9R B;  5LP6 B;  3SPH A;  4JYC A;  1GTO A;  2DWE C;  1TVK A;  4JI7 B;  3BA9 A;  2BSK A;  2UXC O;  1YCI A;  2CAZ C;  3E22 A;  1NI8 A;  4D6T H;  4UCR A;  2LFS A;  1S77 D;  1Y66 A;  3E8F A;  3H1I H;  1J95 A;  1OCZ C;  2YIC A;  4K0K B;  2P90 A;  4X62 B;  5B1A C;  4KL1 A;  4XBF A;  2CTP A;  2AW9 A;  4LFA O;  3OEE G;  4LBE C;  4AIL C;  2V1D A;  3BEH A;  3WFV A;  4JI0 B;  3AG4 B;  1GKF A;  3JAK B;  1XMQ O;  3ZRV A;  4CC6 A;  4NXM O;  2N04 A;  3RW0 A;  3ZMV A;  4I55 A;  1L1F A;  3K9S A;  2YXY A;  3WB1 A;  1Q8I A;  3AK2 A;  2QWR B;  1O9G A;  2DW4 A;  2KKW A;  4DV2 O;  2YI9 A;  3ZHR A;  2F23 A;  1GO3 F;  3GWO A;  2YEV A;  4NTX A;  4ZHQ A;  2PI4 A;  3ZCC A;  4YJ2 A;  2XAH A;  4D7S A;  1VQL V;  1QHT A;  1JOY A;  2ZD9 A;  3ZJZ A;  3UO3 A;  1Q82 W;  1YHQ V;  5KX5 B;  4CH3 A;  1XHX A;  1WA8 A;  3P30 A;  3KCY A;  1M1K W;  2WLN A;  2Y0P A;  4PI2 A;  1X4T A;  3BRC A;  3FKS G;  4MVR A;  1R3K C;  3AG1 C;  4GUN A;  4BW5 A;  1YIJ V;  1VAR A;  2XAS A;  5BY1 A;  3MDS A;  5FNV A;  3K0G A;  2R9A A;  2QTO A;  4IHJ A;  4LFC O;  2X6A A;  1SA0 A;  2XAQ A;  4O4H A;  4CH6 A;  2YSU B;  2M7W A;  4W4K A;  4AQY O;  1XHZ A;  1CPY A;  1SRY A;  4DR2 O;  3MD0 A;  3RYC B;  2P06 A;  2QSA A;  5CMU A;  3CRR A;  1WAZ A;  2Z0A A;  3H1K H;  5B1B B;  3HKE A;  1DLB A;  5ITZ A;  2Q67 A;  3T4Z A;  2BE3 A;  1XI1 A;  4JYY A;  1Y76 A;  4XDL A;  5AG2 A;  2EIN C;  4RQE A;  3Q4H A;  3CME V;  5EK0 A;  4FLZ A;  1MZF A;  2ZIN A;  1K34 A;  2ZE7 A;  3AG2 B;  1Y74 B;  4O2A A;  5JJN B;  1F51 A;  1ARO P;  2ILM A;  2DMX A;  1IX9 A;  3ABM B;  4I0X B;  5DM6 V;  1QQC A;  1W0J G;  4R8C A;  3TGU H;  1RFY A;  3ZED A;  1XDC A;  4X64 O;  4GYC B;  3IFX A;  2FKX A;  4LWS B;  1NU1 H;  1K73 W;  4F6R B;  2HHH O;  4DR7 B;  3SYP A;  4XDJ A;  4UB8 Z;  2N74 A;  1NTK H;  3C3T A;  2UUC B;  5B5E Z;  1SQX H;  3H1J H;  1HNW O;  2EIK B;  3BPZ A;  3FB8 C;  3PN1 A;  3RYF B;  1K4D C;  3B09 A;  2ZM6 O;  3OTO O;  4ICG A;  4JI4 O;  3LSS A;  4RUE A;  3L72 H;  4X20 A;  1NH2 B;  1ROP A;  1N32 B;  3ZHU A;  4DV0 O;  3CJH A;  2XAG A;  4JAA A;  1AB3 A;  1R6K A;  1JR9 A;  3ZHV A;  1E79 G;  2HR3 A;  4YHH B;  1N8R W;  1IBM O;  2RJZ A;  1N33 O;  3FB6 C;  1SF9 A;  4IT5 A;  4DRX B;  4JV5 O;  1FJG B;  1L8D A;  1IUR A;  3D3I A;  3P3P A;  4E4E A;  3ABU A;  4QJF B;  1AI4 A;  2ADP A;  5LA6 B;  3U10 A;  4DV1 O;  1ZL8 B;  4OX9 B;  2HKO A;  5LHI A;  1AR1 B;  3T4D A;  4JYA O;  5KHG A;  1M4U A;  4FMT A;  4JI3 O;  1B06 A;  2ARH A;  2EJ7 A;  1HNZ O;  4IYH A;  1DF4 A;  2ZDI A;  1S76 D;  5LMN B;  2EIJ C;  1WLE A;  4YJ3 A;  5KHK A;  1FS0 G;  3TJT A;  3K0D A;  3OR6 C;  1QR8 A;  3GWK C;  3OMN B;  4BAY A;  3ASN B;  1VQ6 V;  4P9P A;  5IY5 B;  1N4C A;  5K1P A;  4B7E A;  4R7C A;  5CA0 B;  3B8N A;  3L75 H;  5CBG A;  4JI6 O;  4ZI7 A;  4PA4 A;  2QWQ B;  1PD3 A;  1NR7 A;  1KP3 A;  5DEC A;  3VQV A;  4DO2 A;  4J10 A;  2WLL A;  2RMK B;  3OTO B;  2IJJ A;  1PPJ H;  4PDR A;  5E1A C;  2R72 A;  1Q3E A;  3AG7 A;  2CK3 G;  1QR9 A;  4O4I B;  4DV1 B;  1R3J C;  4YJ2 B;  1K4C C;  1VQ7 V;  5IJ9 B;  4ZKI A;  4DW1 A;  1S5L Z;  2ZCE A;  4WFG A;  1YJN V;  4DK0 A;  4B08 A;  5K1X A;  4I55 B;  2WLH A;  2MK3 A;  3E83 A;  4Z1M G;  2ZT9 B;  1IXM A;  4OPA A;  1P84 F;  1LUV A;  1S3J A;  1HR0 O;  3A0R A;  4HNA A;  2DJV A;  4DW0 A;  1MG1 A;  3CCR V;  3SJA C;  2RQ6 A;  5EYP B;  2VQF O;  4LF4 O;  4CS4 A;  1K9M W;  4FJC C;  4JYB A;  1NVP B;  4MTF A;  1AR4 A;  3HKB A;  4X1Y A;  2OTL V;  1PNL A;  2Q9L A;  3N2K A;  3UT5 B;  1QVG U;  4D7T A;  4O4J B;  5KLV H;  1NR1 A;  4LF8 B;  2AZ0 A;  1H2S B;  4G27 B;  3GVM A;  4J11 A;  1YEW A;  2E3C A;  1XL6 A;  4I7Z B;  5BZB A;  3JSL A;  1Q5O A;  4I4T A;  5IDJ A;  3K5O A;  1BL8 A;  1Q7Y W;  1I94 O;  1JQ0 A;  4TSF G;  3E22 B;  3K58 A;  1MA1 A;  2JGD B;  1OJH A;  1SQQ H;  1VF7 A;  4RO2 A;  2EX3 A;  1BQZ A;  3X2Q B;  3JAT A;  3ZN0 A;  4QPJ A;  4X65 O;  1IVS A;  1O9H A;  1SQB H;  2YID A;  4P2Z A;  4P9O A;  2QKA A;  3W7S A;  1NTZ H;  5B3S C;  4I9Q A;  4TV9 B;  2HVK C;  3STZ C;  5IYB O;  3ZRX A;  4PDL A;  3CRQ A;  1N0J A;  1SQF A;  3OT7 A;  1KUQ A;  5J2U A;  1I7F A;  2QWP B;  3E2E A;  3T2M A;  4JI8 O;  4LF9 B;  2AXT Z;  2LW7 A;  5TIS Z;  4B3T O;  2M6Y A;  4O2B A;  3HKD B;  5A9G A;  5KUK A;  4ASU G;  4K35 A;  4DV4 B;  1R73 A;  2BTO A;  4DV6 B;  1MNG A;  2V4D A;  4F6R A;  5L3D A;  4LF8 O;  4HYO A;  1YI2 V;  3EVK A;  5LMU O;  5HFM A;  1FKA O;  3IAY A;  3LNM B;  2H8P C;  1QVF U;  1DGS A;  3JAL A;  2EIM B;  4PA9 A;  2AGA A;  1FXK B;  2P4V A;  1P7G A;  3A2F A;  3ICX A;  2Q73 A;  4UCU A;  3ASN C;  1VQM V;  1D2D A;  2X7R B;  2F66 C;  3F5W C;  4DV5 O;  3FB5 C;  4B3M O;  4ZOL B;  2IJK A;  3QG5 A;  1UJW B;  2FML A;  4PEL A;  2WLK A;  3MHS C;  1PNK A;  3VQW A;  5EC2 C;  2P4K A;  1NBM G;  3HKC B;  5L3B A;  4YY3 B;  2A79 B;  4TUY A;  3UCS C;  2ZXW C;  2PGG A;  3ZX6 A;  2HHH B;  4DR1 B;  4FLV A;  4DR7 O;  3CCQ V;  4JI1 O;  1I0H A;  3K08 A;  2IBZ H;  5BMV A;  3CP1 A;  4ZBM A;  3M7M X;  2YC0 A;  1PM9 A;  3EXA A;  2Q4P A;  3KZI Z;  5CB4 B;  2P5O A;  1LR1 A;  2H94 A;  1AJQ A;  2UXD B;  5B66 Z;  4YIP A;  3E86 A;  3WU2 Z;  1GN2 A;  3QTC A;  1FPO A;  1F4M A;  3B4S A;  1XUQ A;  1XNR O;  2UUA B;  1JFF A;  3J7A U;  1N32 O;  4Z2W A;  3QO8 A;  5C93 A;  4DV7 O;  2WLM A;  4PJ0 Z;  4TV8 A;  3E35 A;  3QVN A;  1N36 B;  1R3L C;  5KMG B;  1JPX A;  2QKS A;  5EBW C;  4JV5 B;  3OR7 C;  1FYJ A;  4X1K A;  3JAS B;  3OW2 U;  1PKX A;  1YJ9 V;  2Q8V A;  1QCE A;  5LHH A;  1DF5 A;  1KEC A;  3ETE A;  1S72 V;  4J7Z A;  1VMG A;  2HFE C;  4JI3 B;  4LH6 A;  4GKK B;  1AI6 A;  3MAQ A;  5KHH A;  2KG7 B;  5GW7 A;  1VQP V;  4UVC A;  3L9D A;  4L87 A;  4YHH O;  3CCS V;  3D8C A;  4PV1 B;  3QO5 A;  2DWD C;  4X20 B;  1NTM H;  4LC1 A;  4H37 A;  3RVY A;  2UXB O;  1WB7 A;  4IGG A;  1H8H G;  4MTO A;  4NVP A;  3M8A A;  4ZIB A;  5ITZ B;  1ZSP A;  5CBF A;  2DYS B;  5LGN A;  2UUA O;  5KMG A;  2ZR2 A;  5JCO A;  3CRC A;  4GT1 A;  4NXN O;  1Q43 A;  2EBO A;  2CH7 A;  2LQT A;  1NJI W;  4IHJ B;  2A06 H;  1XMQ B;  4BWA A;  1B3Q A;  2QA4 V;  4JTC B;  4F4L A;  4U3J A;  2RDC A;  1TA8 A;  1G4Y B;  4DUZ B;  2PI5 A;  4FM2 A;  2P67 A;  1GRJ A;  4KHP O;  2LW1 A;  2EIN B;  3A8T A;  1XEQ A;  1YXB A;  3OE7 G;  3K5N A;  1MZE A;  1NQT A;  4GKJ O;  1M90 W;  2Q69 A;  3EFF K;  1FXV A;  4LF5 B;  2N05 A;  3VBB A;  1YDX A;  1JX9 A;  3JAK A;  3CCU V;  4TWK A;  3W7W A;  2F95 B;  4I5S A;  5EIB C;  3D36 A;  3SJB C;  5BR8 B;  4JI2 B;  5B1O A;  4U7O A;  4WFH A;  2UUC O;  3LDD A;  1LNQ A;  5CN0 A;  3JD3 A;  4QGP A;  2JJ1 G;  1J5E O;  5EBM C;  3SJC C;  2OCC C;  5L3E A;  2YIB A;  2Q5Z A;  1BZK A;  3H1L H;  1CP9 A;  5IYZ A;  1G8M A;  2UXD O;  2XND G;  1H2L A;  4JPR A;  3WB2 A;  1VQ5 V;  4H33 A;  2RN9 A;  3W7T A;  4N23 A;  3HR0 A;  1D5A A;  1OCR C;  2MW2 B;  1KKD A;  1FXH A;  3ZN1 A;  1P49 A;  1RM1 C;  1QLE B;  2VWJ A;  1N33 B;  3SYO A;  1OCZ B;  2ZE6 A;  1ZTE A;  4P30 A;  3N2G A;  3HKB B;  4LF6 B;  1MSW D;  3QNE A;  3O9O A;  4OXS A;  2NLJ C;  4TV9 A;  4DR4 O;  2X6B A;  2EJR A;  3L74 H;  1XMO B;  3CYO A;  3FD9 A;  2CTR A;  1RM1 B;  2HG5 C;  1AR5 A;  1AJN A;  3FFQ A;  4PA6 A;  5JQG A;  4FIP C;  1TAE A;  5IYZ B;  2OWO A;  4UV8 A;  4B3R B;  2F43 G;  3CSX A;  4EKW A;  1MOF A;  4GZR B;  1B04 A;  1EN5 A;  4MVM A;  1AIL A;  1D5N A;  3CJH B;  3JAR A;  3K03 A;  2Q0O C;  5FPO A;  5IWA B;  5IJ0 B;  4MVS A;  2GHY A;  3ZHT A;  3CC4 V;  3ABL B;  5EIB D;  4DYL A;  2NN4 A;  2BTQ A;  3RWR D;  2LO1 A;  2YIB D;  1K7D A;  1GAX A;  4J7K A;  1HNZ B;  2CTQ A;  2WPD G;  1SET A;  4Q6G A;  4JI0 O;  1OHH G;  2YIA A;  1WPX A;  3P3N A;  3DC5 A;  3JCZ A;  3C90 A;  2BOB C;  4U3F H;  1N34 B;  1I5X A;  3I56 V;  3OMI B;  4U3J B;  4MTX A;  2VS0 A;  2UUB O;  2F93 B;  4JI4 B;  4WF9 V;  3CS5 A;  2LGW A;  3ABK B;  4EEQ A;  2QWN B;  2Q68 A;  2AZ2 A;  1EN6 A;  5JWP A;  5F2V O;  5E79 Z;  2CUG A;  3S3X A;  4TQD A;  3A0B Z;  2ZDI C;  4K3A A;  3SR2 C;  3OMA B;  1R3I C;  5JJJ B;  3CCV V;  3JAS A;  1MSD A;  3BAA A;  4LF7 O;  1M56 B;  3OGI B;  3LUT B;  1Z2G A;  3N27 A;  1AI5 A;  1WJZ A;  4JI2 O;  3ZRS A;  2A3Q A;  2XTA A;  3UO2 A;  4R6Z A;  4TV8 B;  3SPJ A;  2HJF C;  5DN6 G;  4IYI A;  2UXN A;  2RNB A;  5JCO C;  1Q6H A;  4GX5 A;  2Y4T A;  4G28 B;  1I94 B;  3JSN A;  5D5P A;  4DR6 B;  4DUY O;  2Z3Y A;  4X9Q A;  3ASO C;  1Z5W A;  2PTM A;  2YI8 A;  2P6J A;  2ITC C;  4OX9 O;  1XBL A;  1PL4 A;  2EIL B;  4IL6 Z;  5LGT A;  2Y69 C;  3CXC U;  1UPG A;  1YTF D;  3ASO B;  2GDS A;  5B1A B;  5LMN O;  1GK9 A;  2EIK C;  1SKV A;  1YVW A;  1H8E G;  1Y67 A;  1ZAU A;  4WBN A;  2Y69 B;  1AP5 A;  1XMO O;  5LBQ A;  4IIJ A;  2UU9 B;  4NXM B;  3J80 N;  1IDS A;  2AHY A;  1Y74 A;  4I50 B;  4NKG B;  5KAI Z;  5LYJ A;  3ZHQ A;  3CRM A;  4EFB A;  2DN9 A;  2O57 A;  1F23 A;  1HW7 A;  2VQE O;  3JAW B;  3G6B A;  3AG3 C;  4CH5 A;  2GV9 A;  2QWO B;  4JAS A;  3DTU B;  3R65 A;  1LUW A;  3JAL B;  2W0X A;  4KXR A;  4TOI A;  3G67 A;  4I4T B;  1RP3 B;  2UXX A;  2ZIO A;  3RYC A;  1VQ4 V;  4B3M B;  5CB4 A;  1GH6 A;  4TUY B;  2EIM C;  1G1X B;  1SA0 B;  4BIZ A;  5LHG A;  4LP8 A;  1AJP A;  2C2A A;  1XL4 A;  4LR3 A;  4JF3 A;  3EHB B;  2EZP A;  3W7X A;  1V55 B;  1E1Q G;  1PV0 A;  1URF A;  1YSC A;  3APO A;  4F6E A;  4LFB B;  2B5U A;  5IT9 N;  3CX5 F;  1FAF A;  4PHZ A;  2QR4 A;  2Z5U A;  2QDO A;  2WLI B;  2DQ0 A;  1Q90 D;  5H6R A;  3CCE V;  2PYL A;  1F7Y A;  2DOS A;  4X8A A;  3SGI A;  4DXW A;  5CA1 A;  2B1G A;  5KHI A;  4LNU A;  3JAR B;  3APQ A;  5KA6 A;  4WCE V;  4I9W A;  1YZB A;  3OGC C;  2AHZ A;  2HP8 A;  1ZX3 A;  4GKJ B;  2JGD A;  3K5L A;  2QGN A;  1FJG O;  5LXT A;  1B6Q A;  5CA3 A;  3SPC A;  1IBM B;  4JGS A;  3RVZ A;  4FVM A;  4FLX A;  4H44 B;  3RYH B;  1XQ8 A;  3HB3 B;  4ZOL A;  3LSQ A;  3CRA A;  1KKC A;  3CEI A;  2UU9 O;  1S5J A;  2X6C A;  4DR1 O;  1K33 A;  1Y6X A;  1DK1 A;  1HNX O;  3RGB A;  1M56 C;  3TCU A;  1BCC H;  3W7U A;  2KB1 A;  3N2K B;  3UT5 A;  5JVD B;  1WB8 A;  1OCC C;  4B3T B;  1YJW V;  3SYQ A;  1EN4 A;  4X66 B;  1JJ2 U;  4DUY B;  1XNQ B;  2PUS A;  4B7K A;  2DQ3 A;  1WP7 A;  4MVO A;  4W4L A;  4RQF A;  4LCU C;  2WLJ A;  5JQG B;  3SJQ C;  4FLY A;  3BAB A;  3K04 A;  2W6J G;  4UB6 Z;  3JAT B;  3S3W A;  3OD4 A;  1H2K A;  1OV9 A;  2QJ1 A;  4UCO A;  4FK5 C;  4PD4 F;  5LP6 A;  1K92 A;  4O4I A;  5IJ0 A;  4DR5 B;  3G6E V;  4RAI A;  3G71 V;  3FAV B;  1W59 A;  1FFX B;  3RBZ A;  1XIL A;  1PP9 H;  3IC9 A;  4FFB B;  3D36 C;  4O4J A;  2WSS G;  1VIB A;  3OUS A;  2P7T C;  3FAV A;  5L3C A;  1GM9 A;  1S0V A;  3A0H Z;  3K06 A;  3B40 A;  4WFE A;  5HFL A;  5CA1 B;  5GTI Z;  2VQE B;  5GON A;  5FLX N;  3VOU A;  1NZ6 A;  1VEW A;  4HAM A;  2ZIM A;  2EZO A;  3QO7 A;  3AG4 C;  4UV9 A;  2WLI A;  4X88 A;  1P4R A;  3I5D A;  4FZ1 A;  3X2Q C;  3RYF A;  4J7J A;  4BIO A;  1JMK C;  2A9H A;  3DSQ A;  1MMM A;  4QE7 A;  3IC7 A;  4JAV A;  2D3O W;  4AI8 A;  3SDL A;  5JVD A;  1SZX A;  2YUA A;  2QM4 A;  2JEU A;  2HVJ C;  1ZUQ A;  2ZM6 B;  3ML0 A;  3J81 N;  1TVK B;  1M93 A;  2XUM A;  5LGU A;  2BSK B;  2V7Q G;  3NXS A;  4MW8 A;  1NVP D;  3SPG A;  4LF7 B;  2JGU A;  2F4V O;  2WLL B;  2LGQ A;  4UXN A;  2E5L B;  3JAW A;  3LNN A;  3L73 H;  4FFB A;  4PA3 A;  1FFT B;  4JZ2 A;  4EFE A;  2JIZ G;  4ZI7 B;  4LFC B;  2WA4 A;  2FL4 A;  4AQY B;  1V55 C;  5IJ9 A;  3JD4 A;  2FYU H;  2LFR A;  2IW5 A;  1XOU A;  4X65 B;  4UVA A;  4X89 A;  5EZY B;  4DR2 B;  3E8H A;  2KG7 A;  3BVO A;  1JA8 A;  1SER A;  3K3W A;  4PDV A;  1K5S A;  2OYQ A;  3VQX A;  1ZL8 A;  3QF7 A;  4NB5 A;  3F5T A;  2Y0I A;  3B8M A;  3THO A;  1KU9 A;  4K0K O;  4E2L A;  1ZLZ A;  4GX0 A;  3RYH A;  1V54 C;  4NXN B;  2W0F C;  4X1K B;  5KA5 A;  4DRX A;  1COW G;  1VQ8 V;  1IBK O;  2IH1 C;  2GUZ A;  3JYC A;  3NR7 A;  1VQO V;  4O4L A;  4UFZ A;  1OCC B;  1VF6 C;  2ZNI A;  2Q0A A;  1QLE C;  4JTA B;  4MSW C;  2ZXW B;  2IH3 C;  2JDI G;  1BT8 A;  1WNS A;  1ORQ C;  5GTH Z;  3C3S A;  4CH4 A;  1JFF B;  3K59 A;  5LOV A;  3ABK C;  4FFK A;  4X62 O;  4Q20 A;  2ZKO A;  1THZ A;  1H38 A;  4J9Z B;  1K5Q A;  4NYK A;  3T1C A;  2QM7 A;  5B1B C;  3TET A;  5IWA O;  5B1N A;  4AHC A;  3B2E E;  3ZRW A;  4LF5 O;  1GN4 A;  4U7N A;  5C8Y B;  2NR5 A;  4DV3 B;  4TT3 G;  2IJI A;  3RT3 C;  1PNM A;  5IE9 A;  1M5I A;  1KMI Z;  5D5Q A;  3R66 A;  4CBC A;  1TUB B;  1BGY H;  4JYA B;  4HBN A;  1US6 A;  4FLW A;  4JI1 B;  1M9N A;  5IYD O;  1M57 C;  1AVM A;  4FPP A;  4DV2 B;  2OCH A;  4FZ0 A;  2EUL A;  4QIW F;  1NH2 D;  3E89 A;  3BY6 A;  5FL7 G;  2ZQM A;  1X59 A;  3RN4 A;  1KBH A;  1IZ3 A;  2D2C B;  2JJ2 G;  2NNU A;  4WBN B;  1V9P A;  1A32 A;  1EZV H;  2DYR B;  4C7U A;  1QNM A;  2Q7E A;  1H2N A;  5KAF Z;  4B3S O;  3BHP A;  1N36 O;  3FB7 C;  4X1I B;  4MVZ A;  4LFA B;  1GN6 A;  3UKM A;  4DR3 O;  1EM1 A;  2BTQ B;  2W6I G;  4MW3 A;  1CXZ B;  4UCV A;  2XHB A;  3JCU Z;  5JJE B;  2GBO A;  5H5N A;  1VQN V;  1R6N A;  3OFN G;  4LWS A;  4LFB O;  3L70 H;  2JVD A;  4CC5 A;  4UUJ C;  1I5Y A;  2PYJ A;  2F4V B;  1GMG A;  4JI6 B;  2HEP A;  1FXK C;  3DXR B;  2FTK A;  3WG7 C;  4UCT A;  2HLD G;  1FXK A;  3KCX A;  2XOK G;  4FLU A;  2DE0 X;  1HR0 B;  4B3R O;  1TUB A;  4J41 A;  3E8G A;  3ETQ A;  5FPR A;  2A7W A;  4J9Y B;  1L0N H;  1E1R G;  4YXW G;  4PI0 A;  1OZ0 A;  1W2B U;  5H9C A;  4BIU A;  1QLN A;  2A0L A;  2XAJ A;  2LJ2 A;  4PA7 A;  2OTJ V;  1T5E A;  2EIJ B;  2EIL C;  2VRZ A;  4GLX A;  2G38 A;  2E76 B;  4PDM A;  2XT9 A;  5KHJ A;  5A2Q N;  3F7Y C;  1I08 A;  3T1Y B;  3CHX A;  4JTD B;  4MVQ A;  3VQY A;  3WB0 A;  1GN3 A;  4DUZ O;  5IY5 C;  1F4N A;  1V54 B;  4KHP B;  1BS3 A;  2FB5 A;  1L0L H;  2L35 A;  4RUF A;  2IJH A;  1IBL O;  1XNR B;  4GX2 A;  1R1B A;  2OCC B;  1Q86 W;  4H13 B;  3K5M A;  4O2B B;  2QM8 A;  4NTY A;  4DV7 B;  1K3E A;  4FLT A;  3SYA A;  4N21 A;  2LP7 A;  3AG1 B;  4YY3 O;  2YDE A;  4ABM A;  4K8X A;  1HDJ A;  5J2U B;  2VWK A;  4NR1 A;  2B9Z A;  1KD1 W;  1KP2 A;  3I55 V;  4WFB V;  2H3O A;  2OIE A;  1WPB A;  1N34 O;  3AG3 B;  2WWW A;  5JH7 B;  4HNA B;  2ADQ B;  1WN7 A;  5IYC O;  4FM0 A;  1YF2 A;  4FM1 A;  4QPK A;  3FX7 A;  3P32 A;  3JAM N;  4GX1 A;  4CS2 A;  2L6L A;  1W0K G;  3CWB H;  1VQ9 V;  4NTW A;  1K8A W;  1J5E B;  1XRE A;  4DV6 O;  5LMU B;  1FFX A;  3ZMU A;  2K1E A;  1H2G A;  3LDC A;  2UXC B;  2BCC H;  1FD9 A;  4JI7 O;  1NT2 B;  2ZR3 A;  1Z5V A;  1NS1 A;  1JCH A;  1K97 A;  3AG2 C;  3TXS A;  1VQK V;  4BR6 A;  3CD6 V;  2HJD A;  2DYR C;  4UCS A;  4TQF A;  4EB6 B;  3BA8 A;  3ABT A;  4DR4 B;  4X1Y B;  3CPW U;  4XDK A;  2X0L A;  3UQ8 A;  5EYP A;  2JRI A;  3PJS K;  3ETD A;  3T1H B;  3FYE B;  3U0Z A;  2CTW A;  4GKK O;  1BHB A;  1DTO A;  5J9P C;  3STL C;  1RSO A;  2E5L O;  2ITD C;  2JS3 A;  4I50 A;  3ZIA G;  3TK1 A;  4DV5 B;  3IJ4 A;  3AEI A;  2IU0 A;  3M99 B;  3WG7 B;  3JD2 A;  5JH7 A;  4YJ3 B;  5KUM A;  1JJO A;  2GTS A;  3JD1 A;  1KQS U;  1SQG A;  5LA6 A;  2OT5 A;  3ETG A;  2CGO A;  4K8Z A;  1QU7 A;  5LXT B;  1TGO A;  2Q7H A;  3ZRW B;  3H9V A;  3CC2 V;  5BR8 O;  2YS8 A;  2ODM A;  3LSU A;  2ZNJ A;  5BXZ A;  3E8B A;  2Q6A A;  1AI7 A;  3DXR A;  2WAM A;  4DV0 B;  1Q81 W;  4OGQ B;  2QEX V;  4LNU B;  2VQF B;  2CGN A;  4LF4 B;  4JZG A; 
#chains in the Genus database with same CATH homology
 4JI5 B;  3ZS8 C;  2F95 B;  2ZIM A;  5EIB C;  3SJB C;  3CB2 A;  5BR8 B;  3RYF A;  4X20 A;  4JI2 B;  1JMK C;  1N32 B;  3DSQ A;  5JVD A;  5J2T B;  3SJC C;  2YIB A;  2QM4 A;  4YHH B;  2ZM6 B;  2RJZ A;  4DRX B;  5IYZ A;  1TVK B;  1M93 A;  1FJG B;  1L8D A;  2UXB B;  3WB2 A;  4LF7 B;  2JGU A;  3U10 A;  5LA6 B;  2PY5 A;  4OX9 B;  4L8J A;  1D5A A;  2E5L B;  3JAW A;  3LNN A;  3RYI B;  5KHG A;  4FFB A;  1M4U A;  4EFE A;  4ZI7 B;  4LFC B;  5EZY A;  1P49 A;  4AQY B;  5LYJ B;  5IJ9 A;  3K57 A;  2VWJ A;  3RFR A;  1N33 B;  4X65 B;  3N2G A;  5LMN B;  3HKB B;  4LF6 B;  5EZY B;  4DR2 B;  4TV9 A;  4IIJ B;  4YJ3 A;  5KHK A;  3HKE B;  1XMO B;  4X64 B;  2OYQ A;  3VQX A;  3QF7 A;  4X1I A;  3THO A;  1KU9 A;  3FFQ A;  4BW9 A;  5JQG A;  3RYH A;  5K1P A;  4NXN B;  1TAE A;  4X1K B;  4DRX A;  5IYZ B;  5CA0 B;  4EB6 A;  4ZI7 A;  2OWO A;  3HKD A;  4B3R B;  3CSX A;  4ZHQ B;  1HNW B;  3VQV A;  1B04 A;  4O4L A;  4UFZ A;  2ZNI A;  2Q0A A;  4DR3 B;  3OTO B;  3JAR A;  2R72 A;  1WNS A;  5FPO A;  1Q3E A;  5IWA B;  5IJ0 B;  4O4I B;  4DV1 B;  4YJ2 B;  4CH4 A;  1JFF B;  3K59 A;  4O4L B;  5EIB D;  5IJ9 B;  5LOV A;  1G6U A;  2ZCE A;  2BTQ A;  3RWR D;  4DK0 A;  4B08 A;  2YIB D;  5K1X A;  4I55 B;  5KX5 A;  1HNZ B;  5FNV B;  4Q6G A;  4HNA A;  2YIA A;  4AHC A;  3RYI A;  3B2E E;  5BMV B;  3SJA C;  5C8Y B;  5C8Y A;  1N34 B;  2RQ6 A;  4DV3 B;  5EYP B;  2PZS A;  2F1M A;  4CS4 A;  4U3J B;  3HKB A;  2Q7G A;  1M5I A;  1KMI Z;  2IM9 A;  4X1Y A;  5D5Q A;  1TUB B;  1IBL B;  2F93 B;  4JI8 B;  4JYA B;  4HBN A;  4JI4 B;  4FLW A;  2JS5 A;  4JI1 B;  3N2K A;  3UT5 B;  4D7T A;  4O4H B;  4DK1 A;  4O4J B;  4EEQ A;  4DV2 B;  5J2T A;  5LOV B;  4LF8 B;  3U11 A;  1H2S B;  4TQD A;  1YEW A;  2E3C A;  3SR2 C;  3JSL A;  1Q5O A;  5JJJ B;  4I4T A;  3K5O A;  3JAS A;  2UUB B;  3BAA A;  3E22 B;  4WBN B;  3K58 A;  1V9P A;  1VF7 A;  2EX3 A;  2Q7E A;  3JAT A;  2R70 A;  4O2A B;  4TV8 B;  3OTF A;  3BHP A;  4CS3 A;  2P22 C;  4X1I B;  1O9H A;  4LFA B;  5JCO C;  2BTQ B;  4UCV A;  2XHB A;  5JJE B;  3HKC A;  1I94 B;  3JSN A;  5D5P A;  4DR6 B;  4I9Q A;  4TV9 B;  5GON B;  1HNX B;  1Z5W A;  2PTM A;  1SQF A;  3N2G B;  2YI8 A;  2JVD A;  4CC5 A;  5J2U A;  2PYJ A;  1I7F A;  2F4V B;  5LP6 C;  4LH7 A;  4B3S B;  4LF9 B;  2YXL A;  4JI6 B;  2HEP A;  4O2B A;  3HKD B;  5CA0 A;  4UCT A;  4DV4 B;  2BTO A;  4DV6 B;  2V4D A;  4F6R A;  4FLU A;  1HR0 B;  1IBK B;  1TUB A;  3IAY A;  5LP6 B;  1DGS A;  1TVK A;  3JAL A;  1SKV A;  3ETQ A;  4JI7 B;  3BA9 A;  5FPR A;  3A2F A;  1ZAU A;  3ICX A;  2CAZ C;  3E22 A;  4PI0 A;  4WBN A;  4UCU A;  4UCR A;  4IIJ A;  2UU9 B;  4NXM B;  4K0K B;  2VQE B;  4I50 B;  4X62 B;  2F66 C;  5LYJ A;  4KL1 A;  4EFB A;  1T5E A;  4ZOL B;  3QG5 A;  4GLX A;  1HW7 A;  4AIL C;  3JAW B;  3VQW A;  4CH5 A;  2GV9 A;  5KHJ A;  4JI0 B;  3HKC B;  4YY3 B;  3JAL B;  3T1Y B;  4TUY A;  3CHX A;  3JAK B;  4TOI A;  3VQY A;  3WB0 A;  4CC6 A;  4I4T B;  2ZIO A;  2PGG A;  2HHH B;  4DR1 B;  4FLV A;  3RYC A;  4KHP B;  4B3M B;  5CB4 A;  4TUY B;  1XNR B;  4I55 A;  5BMV A;  3K5M A;  4O2B B;  1SA0 B;  3WB1 A;  3M7M X;  1Q8I A;  4DV7 B;  4FLT A;  4LR3 A;  1O9G A;  5CB4 B;  2P5O A;  4K8X A;  5J2U B;  2VWK A;  2UXD B;  2KKW A;  2YI9 A;  4LFB B;  4PHZ A;  3QTC A;  1WPB A;  2UUA B;  4ZHQ A;  1JFF A;  5JH7 B;  2PYL A;  4HNA B;  4YJ2 A;  4D7S A;  3SGI A;  1QHT A;  1WN7 A;  4FM0 A;  5CA1 A;  5KHI A;  4FM1 A;  4LNU A;  3JAR B;  4TV8 A;  1N36 B;  4CS2 A;  5KX5 B;  4CH3 A;  1XHX A;  5KMG B;  1J5E B;  4GKJ B;  4JV5 B;  3K5L A;  5LXT A;  4PI2 A;  5LMU B;  1X4T A;  3BRC A;  1FFX A;  4X1K A;  1IBM B;  3JAS B;  4FVM A;  4FLX A;  3RYH B;  1XQ8 A;  2UXC B;  4ZOL A;  1NT2 B;  5FNV A;  1Z5V A;  1S5J A;  2R9A A;  4IHJ A;  4JI3 B;  4LH6 A;  3RGB A;  4GKK B;  3MAQ A;  5KHH A;  4UCS A;  4TQF A;  1SA0 A;  4O4H A;  4EB6 B;  4CH6 A;  3BA8 A;  3N2K B;  3UT5 A;  5JVD B;  4DR4 B;  1XHZ A;  4B3T B;  4X1Y B;  3RYC B;  4X20 B;  3UQ8 A;  5EYP A;  3T1H B;  3HKE A;  3U0Z A;  4X66 B;  1XNQ B;  4NVP A;  5ITZ A;  2PUS A;  4ZIB A;  5ITZ B;  4DUY B;  1XI1 A;  5KMG A;  5JCO A;  4FLZ A;  2ZIN A;  1RSO A;  5JQG B;  4FLY A;  3BAB A;  4I50 A;  4O2A A;  5JJN B;  1Q43 A;  3JAT B;  4DV5 B;  4IHJ B;  5JH7 A;  2QJ1 A;  4YJ3 B;  1QQC A;  4UCO A;  1XMQ B;  1JJO A;  4BWA A;  1SQG A;  5LA6 A;  5LP6 A;  4O4I A;  5IJ0 A;  3ZED A;  4DR5 B;  4U3J A;  4K8Z A;  4GYC B;  1TA8 A;  4F6R B;  5LXT B;  4DR7 B;  4DUZ B;  1FFX B;  4FM2 A;  1TGO A;  2Q7H A;  4FFB B;  2ZNJ A;  4O4J A;  3K5N A;  2UUC B;  4DV0 B;  4LF5 B;  3BPZ A;  3PN1 A;  4LNU B;  3RYF B;  2VQF B;  3JAK A;  4LF4 B;  5CA1 B;  5GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...