4LR3A

Crystal structure of e. coli yfbu at 2.5 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
164
structure length
164
Chain Sequence
MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords protein YfbU
publication title Diamonds in the rough: a strong case for the inclusion of weak-intensity X-ray diffraction data.
pubmed doi rcsb
total genus 58
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03887 YfbU YfbU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.680 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lr3A01
1.10.3190.10 Mainly Alpha Orthogonal Bundle yfbu gene product, domain 2 yfbu gene product, domain 2 4lr3A02
1WPBA 4LR3A
chains in the Genus database with same CATH superfamily
3CCSV 1RFYA 2XT9A 4U3JA 3STLC 1XBLA 3FYEB 4IL6Z 4NTXA 4OPAA 3OE7G 4WFEA 3DC6A 1XNQO 5LHGA 4X1YB 1Y6XA 4P9OA 3L72H 3VQWA 2YIBD 2ZE5A 3ABMC 2OIEA 3RYIA 3TETA 3ABUA 2L35A 4H33A 2ZXWC 1GN6A 1FS0G 5KHHA 1XHZA 1VQ4V 1T5EA 3WU2Z 1XDCA 3JD4A 1OV9A 2OTLV 1WP8A 4LNUA 5E1AC 4LF5O 2E5LO 1BHBA 1IX9A 4N23A 3FKSG 5CA0B 2DWDC 5FNVA 4Q20A 1J5EO 1W0KG 2RJZA 4TUYA 3W7XA 1H38A 3ZHQA 5JVDB 1LNQA 5JJNB 4HZ3A 5LXTB 1BHAA 3T1CA 4DR3B 1TUEB 3LSUA 4TOIA 3M99B 4D6TH 3K3WA 1VF6C 1NH2D 5LYJA 5KMGB 1YSCA 5D5PA 1SESA 3G6EV 1KUQA 2CDYA 2FTKA 4B3RO 3FAVA 1YTFD 1OCRB 5CB4B 4ZKIA 3ZHTA 5LP6A 5LP6C 1DF5A 3MD0A 4ZBMA 1LUWA 1OCZB 4UFZA 2OTJV 2EBOA 3K04A 4IHJB 1KECA 1HR0O 1ZL8A 4RWUA 4DV3B 1QLNA 3BAAA 3E83A 4YY3O 2N74A 4F6EA 3JCUZ 2W0XA 3OW2U 1V55C 4GCZA 4KHPO 1PL4A 1HW7A 4BAYA 3K57A 2H8PC 1AB3A 1V54C 1Y74A 4D7SA 3ZJZA 1GK9A 3E8GA 4CS2A 4NXNB 3FB5C 1S72V 2BTQB 2XAHA 3LDEA 2XNDG 2CH7A 1BMFG 1EZVH 4JYAO 2W0FC 1XILA 5KHIA 2GSMB 4DRXA 3T1HO 3LSSA 2YSUB 4LFBB 4FPPA 5CBGA 4XDJA 1GN3A 1YTFB 1VQNV 1GTOA 2F23A 3D3IA 3F5WC 1AP5A 1QNMA 1KYOF 4LF6O 4TT3G 3BHPA 1EBOA 2DYSC 3SYAA 1BT8A 4I4TB 4BW5A 1NT2B 2PZSA 1VQ8V 1EN6A 1E1RG 5CN0A 1URFA 1PD3A 5IYZA 3HKDA 4TV8A 2OYQA 3SYCA 4DR6B 4RUFA 2P67A 4MVUA 5CBFA 2EIKC 1KD1W 2UXDO 4LP8A 1YF2A 3GVMA 3UKMA 2CTPA 1ZAUA 3CCVV 5JH7B 3A0BZ 1KU9A 3JALA 1ZSPA 4F6RA 4LF4B 4E2LA 3W7WA 3ZN1A 4PJ0Z 1YIJV 3OR7C 1XNRO 2JK5C 5FPOA 1Z5WA 3E89A 3TGUH 3UO3A 5J9PC 1IBLB 1R1BA 2UXBO 4JI2O 1EM1A 3ZBHA 2R9AA 3UM7A 5IWAO 3FX7A 5IJ0B 2YDEA 5JCOC 4O4JA 4GUNA 2QKCA 2Q0AA 1JJ2U 1M56B 2FL4A 4GYCB 1KQSU 4O2BB 1CP9A 1XQ8A 2WLKA 4ICGA 2W6JG 1HNZO 3CJHA 5JVDA 4JF3A 4EFEA 2IJJA 2WSSG 5LXTA 2JEXA 1HNXB 4KP4A 4H37A 2BCCH 3JARB 2CGNA 4XBFA 1D2DA 1WN7A 2VQEO 1SA0B 1IDSA 2ATKC 2X6CA 4UV8A 4BIUA 3OGCC 4A5UB 4CH4A 1TVKA 5EIBD 5JQGA 2VS0A 4DV0B 4NTYA 1GM7A 1P49A 1FPOA 4X66O 3MHHC 5CB4A 5KAFZ 2JDIG 2YIBA 3OEEG 3T4DA 1OCOC 1QR8A 4WFHA 1XMOO 3WFVA 2UU9O 3K9AA 2ADPA 3D8CA 2ITDC 4IHJA 3CX5F 2F4VB 2P7TC 1A32A 4JTDB 4OGQB 3RYCB 1X4TA 2MW2B 4QIWF 3B4SA 1E79G 1K33A 5B3SC 3FB6C 5TISZ 4HBNA 4FZ0A 4DR2B 2BTQA 2EJ7A 2CGOA 4FM0A 4PDMA 4F4LA 2JEUA 1IZ3A 2PI5A 1JFFB 4NXMO 2XAFA 3CRAA 2ZR3A 2BSKB 1MNGA 2JRIA 2CE4A 1P84F 1W2BU 3JD0A 4X20A 2A79B 4WFGA 4Z1MG 1FJGO 4IT5A 2ZDIA 1O9HA 2ZDIC 5IJ9B 5IYCO 2UXCO 2Q68A 5BMVA 3OMIB 1Q8IA 5GTIZ 1VQLV 4WFBV 5IE9A 2WA3A 4J7KA 4I4TA 2HLDG 5KAIZ 1L1FA 4B3SO 1N33O 1HWYA 4AI8A 4DV6O 1K73W 3A2FA 4ZHQA 4PI0A 4JI7B 3UT5A 1MOFA 4WBNB 4DV0O 4JI8O 2WA4A 1WPXA 4I50B 3AG2C 4JV5B 3FYIB 1VIBA 2P90A 4X1KA 5LL6Y 3E35A 5DN6G 4JPRA 2D3OW 3PJSK 3P32A 3BA8A 1B06A 3RYHB 3ZRSA 5LMUB 4FFKA 1VARA 1G8MA 2AHYA 2R70A 5EBMC 1AROP 1SZXA 3ZMSA 3TJTA 4U3JB 3KG2A 3N27A 2HHHB 1VMGA 2EZPA 3B8MA 1S76D 4DR4O 4I5SA 4QPKA 4LFCO 3B09A 3CPWU 2EIJB 4O2BA 3SYQA 1K5QA 3KKYA 3ABMB 4JI5B 4LF8B 4JI6O 2DWEC 2FMLA 2ADQB 2ZXWB 1YDXA 1SZTA 2IJIA 4LC1A 4MW8A 2IH1C 3JARA 5A9GA 4CBCA 2HR3A 4PV1B 2KKWA 3CB2A 5BR8O 1DK1A 3KZIZ 3TXQA 4TV9B 4FLYA 3CCUV 4JI4O 1SQVH 4J41A 3CSXA 2UXXA 2QA4V 2QSAA 1H2KA 3E22B 1XMQO 1K8AW 3OTFA 5FNVB 2X0LA 2P4VA 4X1IA 5K1XA 1YXBA 3LSQA 4LF9B 3T1YO 2Y69C 5H2FZ 3SJBC 1JCHA 4DO2A 2WLLB 2JIZG 3E8HA 4DR7B 2F95B 3FB7C 5LHIA 1Q6UA 5KLVH 3N2KA 5LYJB 4UV9A 5IYBO 3ML0A 1AJPA 4GKJB 4DW0A 4X65O 1R3KC 1VQ5V 3RYCA 1DTOA 4OXSA 3FAVB 4NR1A 2IH3C 5B5EZ 1YZBA 5LP6B 5B1AC 3APQA 4GX1A 3A0HZ 4DUZO 2RCVA 3NXSA 1H2NA 1N0JA 3STZC 3SJAC 3JAWB 1W0JG 3CRCA 3I55V 4CS4A 3L75H 2LW7A 4G2KA 3SYPA 4JI1O 1QCEA 4GT1A 5EZYB 4RAIA 1TGOA 1JMKC 1QHTA 1FXVA 2R9RB 1GM9A 4XDLA 3F7YC 2N04A 1FYJA 2BSKA 1M57C 5EIBC 2CAZC 5B1BB 3P3NA 3ZN0A 1V55B 4DR1B 1PKXA 2QKAA 4IGGA 5IJ9A 2C2AA 1V54B 5J2UB 3CS5A 1DLBA 1NTMH 1BZKA 1OCCC 4PDRA 4IYIA 3E8FA 2CH7B 4X8AA 1VQOV 2ZKOA 3OTOO 1XOUA 1Q6IA 4R8CA 4DRXB 3LNNA 4LR3A 3QF7A 1CPYA 2AW9A 5L3FA 3ZEDA 3RVZA 2YXYA 2F1MA 4X62B 4WBNA 1NR1A 5IY5C 3PN1A 4X64B 2WLHA 1D5NA 2QKSA 1PNMA 3CC7V 2QWPB 1XL4A 3IJ4A 4K8XA 4DV5O 2DYSB 1KMIZ 2ILMA 4R6ZA 2V7QG 5KA5A 3S3WA 4LF7O 4GLXA 4TV8B 1VF7A 2LFRA 4NTWA 1KBHA 2ARHA 2KB1A 1DF4A 3ZMVA 4O4IB 3JD1A 4CH3A 3JALB 2ZM6B 1R73A 2XAQA 2HKOA 2IM9A 4F6RB 2LFSA 1F23A 3CE2A 2DN9A 3JAMN 3HKEB 4BW9A 5LMNO 3K5NA 4I55B 4Z2WA 3IFXA 3ZX6A 1R6TA 3W7TA 4MTXA 5KHGA 2Q0OC 2XUMA 4WFFA 3QNEA 4O4JB 4TV9A 1M4UA 1PNLA 3E22A 1K4DC 4OX9O 3BRCA 2H94A 1I7FA 1ZX3A 3LDDA 3CJHB 4MT8A 1NVPB 1M5IA 4JAAA 1K7DA 2OCCC 2WLLA 4LFAO 1SQGA 1UJWB 4UXNA 4DR5O 1Q86W 2AZ0A 3JSNA 5BXZA 1VF6A 2QM7A 2UUBB 2UUCO 3SYOA 3FD9A 1TVKB 3ZHRA 1NTZH 5JQGB 3SPGA 2Y0IA 1GMGA 1U97A 2Y0PA 1KP2A 3HKBB 5B66Z 1X59A 3RBZA 1GRJA 2RDCA 4QPJA 3CMAV 1H2LA 4J7ZA 3K5MA 4YXWG 5HFLA 1FXKC 2DJVA 3JAWA 1WLEA 4B3TB 1RPRA 4YHHB 1P4RA 1PL0A 3G4SV 4GKKO 5EZYA 3H1HH 3W7SA 1BGYH 4X9QA 5L3DA 4DV2B 2PYJA 4AHCA 2IJHA 3AG4C 1PP9H 4CS3A 1MA1A 2ZM6O 3G71V 3OAAG 4AILC 3FFQA 1R6NA 1THZA 3AG1B 5J2UA 1XUQA 1FFXA 4B08A 1XREA 4LWSA 1F4NA 1KB9F 4TQDA 4UCRA 3X2QB 1NH2B 2P6JA 1Q81W 2ZNIA 2HG5C 3ZIAG 4JYYA 3O65A 3CRMA 4X20B 3ZS8C 4FM2A 4K8ZA 3JATA 2QM4A 1F4MA 1SS3A 2OT5A 4JAVA 4PA7A 2X6AA 1IBMB 4PA9A 3CHXA 5BMVB 4CC6A 3ABLC 3F5TA 3L73H 3BABA 1Z5VA 4YJ2B 3K5LA 4GX5A 2Z3YA 4DR3O 1AR5A 4B3MB 4CH6A 1N34B 1I08A 4ZHQB 1JVMA 3J7AU 4AQYB 1MSWD 2XAJA 3JD2A 3L74H 2IU3A 4O4IA 1K97A 4FMTA 3UT5B 2K9PA 3DGEA 5LA6B 2JGDB 1VQPV 4U3FH 3AG2B 3RYFB 1NJIW 4G27B 2UUAB 4X1KB 4FJCC 3HKEA 4DXWA 4H44B 4I55A 4B3TO 1FXHA 1IURA 3U10A 5ITZA 1KKDA 2WLJA 5JCOA 4DV3O 2LGQA 5L3CA 3ZMZA 2RQ6A 4ZIBA 4DW1A 3ZRXA 1NU1H 3APOA 2ZE7A 1GM8A 5JJEB 2QTSA 1IXBA 2QTOA 4NXNO 3IGAC 3G6BA 1H2MA 1MG1A 3K0DA 2A3QA 1WP7A 4CZZA 2QWRB 1SRYA 4BR6A 3OUSA 4LFBO 1G1XB 3IC9A 3DXRA 3ASNC 1SQXH 3HKBA 2Q69A 4X1IB 2A7WA 2VQFB 4BWAA 5BY1A 3RFRA 2Y69B 2YEVB 4OPHA 4FZ1A 3CD6V 1AR4A 3ZHSA 1JA8A 4FVMA 4KXRA 1K5SA 1BQZA 4DK0A 3N2KB 1TA8A 3GWKC 4EFBA 4DV1B 3M8AA 1YHQV 1COWG 4EB6B 4DR6O 5A2QN 4PHZA 3FB8C 3BVOA 3I56V 1I94B 3ABKC 2QJ1A 2Q6AA 1HNWB 3CC2V 1MZFA 2NNUA 2FYUH 5B1AB 4FLTA 4I0XB 2GTSA 4LF4O 2GHYA 5L3EA 2EZOA 1Q7YW 3UQ8A 4HAMA 2HFEC 1NQTA 3CP1A 4DUYB 3D36C 2Z0AA 2PUSA 2X7RB 4JZGA 1IBLO 2Y48A 1BCCH 2CK3G 4DK1A 1M57B 1K9MW 3ZHVA 1E1QG 3OD4A 2LW1A 3BA9A 2ZNJA 4R7CA 2AXTZ 1I5YA 4MTFA 1N36B 3UCSC 2BE3A 1NTKH 1JPXA 1OCCB 1US6A 1L0LH 4BIZA 5FLXN 5GONB 5C93A 1BQ0A 4Z1VA 4YJ2A 1HNXO 2JJ1G 2K1EA 2YIDA 4HYOA 5EC2C 3D3QA 4O4LA 1NS1A 2DQ3A 1OZ0A 2QR4A 3U11A 4MS2A 4JZ2A 1QBZA 4PA3A 4PA4A 4PDLA 3AG3C 3QVNA 5IY5B 5EYPA 5LA6A 2JGDA 1JR9A 3RYFA 4FLZA 1RP3B 3AG7A 2PGGA 4E4EA 3S3XA 2GBOA 4P2ZA 1K34A 2A9HA 1B3QA 3H1JH 2F4VO 3K5OA 1QLEC 3CCRV 3RVYA 3N2GB 1YITV 5L3GA 3CCQV 4JI3B 3VQVA 2JVDA 4JI0B 1K3EA 2RMKB 1JQ0A 4ZI7B 1HNWO 2HJFC 1ZTEA 4HNAA 2EIMC 2OCHA 1N32B 1Q3EA 1AJNA 2XASA 2BTOA 4RQEA 4DR2O 1LR1A 2YIAA 1FD9A 5B1NA 1Q43A 3VQYA 4FFBA 3M7MX 3ZRWA 4L8JA 4P9PA 2GUZB 1GKFA 4D7TA 3K06A 4JTAB 3H1IH 3HPLC 2GDSA 4KL1A 1N36O 3E2EA 2M7WA 1YI2V 2DOSA 3G80A 3OM3B 4MW3A 4YIPA 2YEVA 1H2GA 1VQ9V 1EN5A 2ZT9B 2YXLA 3E8BA 1ROPA 1IBKB 3SPHA 1NBMG 5H6QA 3CXCU 4UCTA 4K0KB 3VBBA 4DV4B 3J80N 2R9IA 1VEWA 1XL6A 4EB6A 5DM6V 4JI7O 2WLMA 4DV7B 1SQFA 2R72A 3RGBA 2HVKC 5F2VO 1SC5B 5LGNA 4I0XA 4JV5O 2KQXA 5CBHA 4JGSA 3BEHA 3VQXA 3K03A 1H8EG 2YUAA 4NVPA 4GX0A 4PELA 5EK0A 5LMUO 1I0HA 5B1OA 1M9NA 3K9SA 1XNQB 1V9PA 1Y4MA 1JX9A 1WB7A 1R3LC 4RQFA 4DYLA 3AG4B 4JI3O 2HHHO 3SPIA 4JI0O 3ABTA 2ZCEA 2Q7EA 2FB5A 5C8YB 4J7JA 1HP8A 3LDCA 3P30A 4B7EA 3SGIA 4JI5O 5IDJA 4R50A 1FFXB 2WAMA 4UUJC 4LF8O 5GONA 1DGSA 4LWSB 5BZBA 4LF5B 2E3CA 2VRZA 2E5LB 3ZMUA 4UCOA 1Y76B 4J42A 2DE0X 4O2AB 2ZE6A 3RWRD 4L87A 4ZOLB 2YICA 1J5EB 2Q7GA 3JATB 4I9WA 5HFMA 4FLWA 2PTMA 3I5DA 3RT3C 3ABLB 1TAEA 3IAYA 1BE3H 4FLUA 4LF9O 2FKXA 3K79A 2Y4UA 3L9DA 2XHBA 2AHZA 1YVWA 1G4YB 4DR7O 1GN4A 2P4KA 4C7UA 2MK3A 5DECA 4B3RB 3N2GA 3HKCB 5LHHA 2EIKB 1YCIA 1UFIA 1AI4A 5LGUA 1J95A 4GKJO 4UCUA 1NR7A 2F66C 2LP7A 1D5AA 3THOA 4ZI7A 2Q67A 2KG7A 3AK3A 3C90A 2V1DA 1HR0B 4H0LB 3L70H 5H9CA 3K59A 3B77A 1MABG 5CA3A 2HP8A 1R3JC 1R6KA 3K0GA 4YY3B 5EBWC 4J80A 3CCEV 5ITZB 2F93B 4J9ZB 4I9QA 4KHPB 4N21A 3OMNB 2IU0A 2GUZA 3NR7A 1ZUQA 5E79Z 2B5UA 2EIJC 1YJ9V 1XI1A 2EX3A 2ZIOA 3OT7A 2V4DA 4DR1O 2ITCC 5DEDA 4I7ZB 3SPCA 2PI4A 4JYAB 1S5JA 1R3IC 4FLXA 1BL8A 3BFRA 3T1HB 4UVCA 2NN4A 4BIOA 3L71H 5K1PA 1Q82W 3JSLA 3OR6C 1PV0A 2B1IA 4CC5A 2DMXA 1FAFA 3OMAB 4O4HB 3QO8A 2D2CB 3A8TA 5CA1B 4LH6A 5KX5A 3CXHF 4TQFA 2HEPA 4MVRA 2QM8A 1I5XA 3DXRB 3QTCA 1Q90D 3ASNB 4LF6B 4X62O 3WG7C 2ZQMA 4X64O 4J9YB 1AI7A 4YJ3B 1OCOB 1N4CA 1PPJH 2GTAA 3CMEV 1FXKA 4UVAA 1NKDA 2X6BA 2NR5A 3OEHG 2QEXV 1YJWV 2UXDB 4QE7A 2B1GA 4QJFB 4K3AA 1LUVA 4EEQA 1WAZA 3ABKB 1RM1C 3CYOA 1H2SB 3U0ZA 2DYRC 2Q73A 3QO5A 1GAXA 2WPDG 1XNRB 5B3SB 1AI5A 2BOCC 3Q4HB 3JAKB 5C8YA 3R66A 2UXBB 4JI2B 5IWAB 3ETEA 1RSOA 5H5NA 3CCMV 3H01A 3H1LH 1QVFU 3F7VC 4PI2A 2JGUA 2EILC 5B1BC 3K58A 5FL7G 1Y76A 3B2EE 2YXHA 4O2AA 1WB8A 3ASOC 4ZOLA 3ZMTA 4NKGB 1HNZB 2B9ZA 2Z5UA 3C3SA 4GX2A 3LNMB 4PDVA 3A0RA 2JJ2G 1AI6A 5IT9N 3WB2A 5D5QA 2WLIB 3H1KH 1SETA 2VQEB 3W7UA 3EFFK 2XOKG 3SDLA 2IW5A 2G38A 1JOYA 1AVMA 2EINC 2A0LA 3ETQA 2PYLA 2HVJC 3SR2C 4J11A 4O4LB 4UCVA 1M93A 3EVKA 4X66B 3HKCA 1QU7A 2UUBO 5KA6A 4WCEV 1F7YA 1S0VA 4WFAV 3AG3B 1Q6HA 3EHBB 1XMOB 3WB0A 5EYPB 2UU9B 5JWPA 2DQ0A 4X89A 4IIJB 1Y67A 1PM9A 4J10A 3SPJA 2F43G 2CTQA 3OGIB 3E86A 3P3PA 5KHJA 2Q8VA 1HDJA 4YHHO 1ORQC 3CEIA 3EXAA 1QLEB 4FM1A 4Q6GA 3ETDA 2JS5A 3HB3B 2ETNA 2Q7HA 2E76B 4DV2O 4X1YA 2CUGA 4UB8Z 1CEZA 2YI8A 2W6IG 1EFRG 1L0NH 4HNAB 4U7NA 3JCZA 2EIMB 4JTCB 3QO7A 2AGAA 1YEWA 4NXMB 1GN2A 2YC0A 1FFTB 4MVZA 5AG2A 2E75B 2PF4E 1WJZA 4H13B 1G6UA 4JASA 1SQPH 4FFBB 5EC1C 3MAQA 1GH6A 4YIOA 1SF9A 2NLJC 3ZRWB 1FJGB 4W4KA 1EZJA 4O4HA 1K4CC 4MSWC 5CA0A 3K08A 5CA1A 2UXCB 2LQTA 3TCUA 4ABMA 2Q9LA 2BOBC 4LCUC 2RN9A 1IBMO 2ZE8A 1WA8B 2A06H 4NYKA 4B3SB 1N33B 4YJ3A 4DV6B 3TK1A 1WPBA 1JJOA 2KSDA 2EJRA 4UB6Z 5KMGA 2EULA 1B6QA 4MTGA 2L6LA 4B3MO 3JASB 2ZINA 4JI8B 4UCSA 5KHKA 1N34O 1FKAO 1KP3A 1OCRC 4AQYO 1S3JA 4JAUA 3SJQC 1Q5OA 1XEQA 2CTRA 3G67A 1OCZC 3Q4HA 2P06A 3RN4A 2UUAO 3JAKA 4PD4F 1VP7A 1UPGA 1CXZB 1MSDA 4PA6A 3MHSC 3D36A 3CC4V 1L8DA 4DR4B 4LFCB 4B7KA 4RO2A 1H8HG 2OIGA 2Y4TA 3AG1C 4GZRB 2DW4A 4JI6B 1AJQA 4MTOA 3UO2A 3OUFA 3GWOA 3X2QC 2WLIA 4UVBA 5BR8B 5GW7A 4RUEA 3ZCCA 1VQ7V 4IYHA 4JI4B 1MZEA 1AILA 4KFMA 4KUMA 4FLVA 1XMQB 1ZLZA 2IBZH 3DTUB 5LOVB 3C3TA 2Q4PA 4WF9V 2QWQB 3IC7A 3T1YB 3T2MA 3CCLV 1O9GA 4W4LA 4CH5A 3H9VA 4X88A 4IIJA 2VQFO 1WNSA 1VQ6V 2IJKA 1AP6A 1NZ6A 1Y66A 4XDKA 4X65B 5J2TB 5JH7A 1TUBB 3GB7C 1AR1B 4DV1O 1BS3A 3QG5A 5FPRA 4DUZB 1I94O 2H3OA 1N8RW 3MDSA 3JYCA 2KG7B 4U7OA 2PY5A 4JI1B 2WWWA 1Z2GA 3B8NA 1SQBH 2HJDA 2O57A 5IJ0A 4DUYO 4K35A 1RPOA 1KKCA 2N05A 1M56C 2RNBA 2QGNA 1S77D 3O9OA 1K92A 4MVMA 2XTAA 3RYIB 3LUTB 1ZWIC 1VQMV 2LJ2A 1WA8A 3CWBH 3OTOB 1S5LZ 3CRRA 1SA0A 2OCCB 4LNUB 1P7BA 3VOUA 5H6RA 1MMMA 1N0NA 4TWKA 2ZIMA 4FK5C 1SKVA 3JASA 3CCJV 3ETGA 1PNKA 4MVOA 5EBLC 3T4ZA 3ICXA 1VQKV 5KX5B 4P30A 4TUYB 3J81N 4DV5B 3WG7B 1XHXA 4LH7A 2OWOA 3CRQA 1IVSA 4QGPA 4LF7B 2VWKA 3BCCH 2P5OA 1FXKB 4MVQA 5KUMA 1OHHG 1QVGU 1SERA 1EN4A 1GO3F 4NB5A 1M1KW 2Q5ZA 1RM1B 5L3BA 2XAGA 2DYRB 3SJCC 2YI9A 2UXNA 5LMNB 2ZD9A 1VF5B 1KC8W 3AEIA 1ENVA 1S5HC 3RW0A 4LBEC 5IYDO 1N32O 2ZR2A 1JFFA 2GV9A 1ZL8B 2E74B 1RSOB 5LBQA 5LGTA 4MVSA 2ODMA 3JD3A 3ZRVA 2EILB 2LO1A 1SQQH 5JJJB 3DC5A 4QNHB 3ASOB 4OX9B 5KUKA 2WLNA 2LGWA 1Y74B 4G28B 3ZHUA 5GTHZ 2JS3A 5LOVA 3BY6A 3B40A 1IXMA 1U96A 1QR9A 4JYBA 2QWOB 1M90W 4LFAB 1P7GA 3BPZA 4DR5B 1QQCA 4TSFG 2AZ2A 2UUCB 3AK2A 1OJHA 3KCYA 1YJNV 3HR0A 1B04A 2EINB 1IBKO 3WB1A 1F51A 3AK1A 5J2TA 3R65A 2QDOA 4K0KO 4DV4O 1TUBA 2YS8A 3DSQA 1NI8A 4ASUG 4I50A 3TXSA 1BSMA 3KCXA 4QE9A 2QE7G 4DV7O 3OFNG 4JYCA 5CMUA 2P22C 4EKWA 3RYHA 1NVPD 4FIPC 2VWJA 4GKKB 2QWNB 5IYZB 1W59A 3HKDB 2CTWA 2M6YA
chains in the Genus database with same CATH topology
4FLYA 3WB2A 5D5QA 2VQEB 4U3JA 4FLTA 3CSXA 3E22B 3UQ8A 3OTFA 5FNVB 4X1IA 5K1XA 4DUYB 4X1YB 3ETQA 2PYLA 3SR2C 4LF9B 2PUSA 4O4LB 4UCVA 1M93A 3SJBC 3VQWA 4X66B 2YIBD 3HKCA 4DR7B 2F95B 3RYIA 4DK1A 1XMOB 3N2KA 3WB0A 5EYPB 5LYJB 2UU9B 1XHZA 5KHHA 3BA9A 2ZNJA 4IIJB 1T5EA 4GKJB 1N36B 3RYCA 4LNUA 5KHJA 5LP6B 5GONB 4FM1A 4Q6GA 4YJ2A 5CA0B 5FNVA 2JS5A 3SJAC 2Q7HA 3JAWB 4CS4A 2RJZA 4TUYA 4X1YA 5JVDB 5EZYB 5JJNB 4O4LA 1TGOA 2YI8A 1JMKC 5LXTB 1QHTA 4DR3B 4TOIA 4HNAB 3U11A 5EIBC 1YEWA 4NXMB 5LYJA 5EYPA 5LA6A 2CAZC 3RYFA 5KMGB 4DR1B 4FLZA 1G6UA 5D5PA 2PGGA 4FFBB 3MAQA 5IJ9A 5J2UB 5CB4B 1FJGB 5LP6A 5LP6C 3K5OA 4O4HA 3N2GB 5CA0A 5CA1A 4UFZA 2UXCB 4DRXB 4JI3B 3LNNA 3VQVA 4IHJB 4LR3A 3QF7A 2JVDA 4JI0B 4ZI7B 4B3SB 1N33B 4YJ3A 4DV3B 4HNAA 3ZEDA 3BAAA 4DV6B 2F1MA 4X62B 1N32B 4WBNA 1Q3EA 1WPBA 1JJOA 3PN1A 4X64B 2BTOA 5KMGA 2YIAA 1Q43A 3VQYA 1HW7A 3JASB 2ZINA 4FFBA 3K57A 3M7MX 4JI8B 4K8XA 4UCSA 5KHKA 1KMIZ 4D7SA 4CS2A 4NXNB 2BTQB 4L8JA 4D7TA 1Q5OA 4GLXA 4TV8B 1VF7A 5KHIA 4DRXA 3JAKA 4O4IB 4KL1A 4LFBB 4CH3A 3JALB 2ZM6B 2IM9A 4F6RB 1L8DA 4DR4B 3HKEB 4BW9A 2YXLA 4LFCB 1IBKB 3K5NA 4I55B 4UCTA 4K0KB 4DV4B 3BHPA 4I4TB 4EB6A 5KHGA 1NT2B 2PZSA 4JI6B 4DV7B 1SQFA 5IYZA 2R72A 3HKDA 3RGBA 4O4JB 4TV8A 2OYQA 4TV9A 4DR6B 1M4UA 5BR8B 1ZAUA 3E22A 3BRCA 3VQXA 5JH7B 1KU9A 3JALA 1I7FA 4NVPA 4JI4B 4F6RA 4LF4B 1M5IA 4FLVA 1XMQB 1XNQB 1V9PA 5LOVB 1SQGA 5FPOA 1Z5WA 3JSNA 3T1YB 1O9GA 1IBLB 4CH5A 2UUBB 2R9AA 4IIJA 1TVKB 2ZCEA 5JQGB 5IJ0B 5JCOC 2Q7EA 5C8YB 1WNSA 4O4JA 3HKBB 3SGIA 2Q0AA 1FFXB 4X65B 4GYCB 1DGSA 5GONA 5J2TB 4O2BB 3K5MA 5JH7A 1XQ8A 4LF5B 2E3CA 1TUBB 3JAWA 2E5LB 4B3TB 4UCOA 4YHHB 3QG5A 5FPRA 4DUZB 4O2AB 5JVDA 3RWRD 4EFEA 5EZYA 5LXTA 1HNXB 4ZOLB 3JARB 1J5EB 4DV2B 2Q7GA 1WN7A 2PYJA 3JATB 2PY5A 4JI1B 4AHCA 1SA0B 4FLWA 2PTMA 4CS3A 4CH4A 1TVKA 5EIBD 5JQGA 5IJ0A 1TAEA 4AILC 4DV0B 3FFQA 3IAYA 4FLUA 5J2UA 1P49A 5CB4A 2XHBA 2YIBA 1FFXA 4B08A 4B3RB 3N2GA 4TQDA 4UCRA 3HKCB 3RYIB 2ZNIA 4IHJA 2F4VB 4UCUA 2F66C 3OTOB 1D5AA 4X20B 3THOA 4ZI7A 3ZS8C 4FM2A 4K8ZA 3JATA 2QM4A 1IBMB 1SA0A 1HR0B 3RYCB 1X4TA 4LNUB 3CHXA 5BMVB 2ZIMA 4CC6A 1SKVA 3K59A 4YY3B 3JASA 3BABA 5ITZB 2F93B 4HBNA 1Z5VA 3ICXA 4YJ2B 3K5LA 4I9QA 5KX5B 4DR2B 2BTQA 4KHPB 4TUYB 4B3MB 4FM0A 4CH6A 4DV5B 1JFFB 1XHXA 4LH7A 2EX3A 1XI1A 1N34B 2OWOA 2ZIOA 4ZHQB 2V4DA 4AQYB 4O4IA 3UT5B 4LF7B 2VWKA 2P5OA 4JYAB 1S5JA 4FLXA 5LA6B 4X20A 3RYFB 3T1HB 2UUAB 1O9HA 4X1KB 5K1PA 5IJ9B 3JSLA 3HKEA 4I55A 5BMVA 4CC5A 1Q8IA 3U10A 3SJCC 5ITZA 2YI9A 4O4HB 4I4TA 5CA1B 4LH6A 5LMNB 5KX5A 4TQFA 2HEPA 5JCOA 3QTCA 4LF6B 1JFFA 2GV9A 3A2FA 4ZHQA 4PI0A 4JI7B 2RQ6A 4YJ3B 4ZIBA 3UT5A 4WBNB 5JJEB 4I50B 4JV5B 2UXDB 5JJJB 4X1KA 4OX9B 5LOVA 4EEQA 3BA8A 3RYHB 5LMUB 1H2SB 2R70A 3U0ZA 4LFAB 3BPZA 1XNRB 4DR5B 1QQCA 4U3JB 3JAKB 5C8YA 2UXBB 2HHHB 4JI2B 3HKBA 2UUCB 5IWAB 1B04A 1RSOA 4X1IB 3WB1A 2VQFB 4BWAA 3RFRA 4O2BA 5J2TA 1TUBA 3DSQA 4PI2A 4JI5B 2JGUA 4I50A 3K58A 4LF8B 3B2EE 4FVMA 4O2AA 4DK0A 3N2KB 1TA8A 4ZOLA 4EFBA 4DV1B 3JARA 2P22C 4EB6B 4PHZA 3RYHA 1HNZB 2VWJA 1I94B 2KKWA 3CB2A 4GKKB 5IYZB 3HKDB 2QJ1A 4TV9B 1HNWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPB A;  4LR3 A; 
#chains in the Genus database with same CATH topology
 3CCS V;  1RFY A;  2XT9 A;  4U3J A;  3STL C;  1XBL A;  3FYE B;  4IL6 Z;  4NTX A;  4OPA A;  3OE7 G;  4WFE A;  3DC6 A;  1XNQ O;  5LHG A;  4X1Y B;  1Y6X A;  4P9O A;  3L72 H;  3VQW A;  2YIB D;  2ZE5 A;  3ABM C;  2OIE A;  3RYI A;  3TET A;  3ABU A;  2L35 A;  4H33 A;  2ZXW C;  1GN6 A;  1FS0 G;  5KHH A;  1XHZ A;  1VQ4 V;  1T5E A;  3WU2 Z;  1XDC A;  3JD4 A;  1OV9 A;  2OTL V;  1WP8 A;  4LNU A;  5E1A C;  4LF5 O;  2E5L O;  1BHB A;  1IX9 A;  4N23 A;  3FKS G;  5CA0 B;  2DWD C;  5FNV A;  4Q20 A;  1J5E O;  1W0K G;  2RJZ A;  4TUY A;  3W7X A;  1H38 A;  3ZHQ A;  5JVD B;  1LNQ A;  5JJN B;  4HZ3 A;  5LXT B;  1BHA A;  3T1C A;  4DR3 B;  1TUE B;  3LSU A;  4TOI A;  3M99 B;  4D6T H;  3K3W A;  1VF6 C;  1NH2 D;  5LYJ A;  5KMG B;  1YSC A;  5D5P A;  1SES A;  3G6E V;  1KUQ A;  2CDY A;  2FTK A;  4B3R O;  3FAV A;  1YTF D;  1OCR B;  5CB4 B;  4ZKI A;  3ZHT A;  5LP6 A;  5LP6 C;  1DF5 A;  3MD0 A;  4ZBM A;  1LUW A;  1OCZ B;  4UFZ A;  2OTJ V;  2EBO A;  3K04 A;  4IHJ B;  1KEC A;  1HR0 O;  1ZL8 A;  4RWU A;  4DV3 B;  1QLN A;  3BAA A;  3E83 A;  4YY3 O;  2N74 A;  4F6E A;  3JCU Z;  2W0X A;  3OW2 U;  1V55 C;  4GCZ A;  4KHP O;  1PL4 A;  1HW7 A;  4BAY A;  3K57 A;  2H8P C;  1AB3 A;  1V54 C;  1Y74 A;  4D7S A;  3ZJZ A;  1GK9 A;  3E8G A;  4CS2 A;  4NXN B;  3FB5 C;  1S72 V;  2BTQ B;  2XAH A;  3LDE A;  2XND G;  2CH7 A;  1BMF G;  1EZV H;  4JYA O;  2W0F C;  1XIL A;  5KHI A;  2GSM B;  4DRX A;  3T1H O;  3LSS A;  2YSU B;  4LFB B;  4FPP A;  5CBG A;  4XDJ A;  1GN3 A;  1YTF B;  1VQN V;  1GTO A;  2F23 A;  3D3I A;  3F5W C;  1AP5 A;  1QNM A;  1KYO F;  4LF6 O;  4TT3 G;  3BHP A;  1EBO A;  2DYS C;  3SYA A;  1BT8 A;  4I4T B;  4BW5 A;  1NT2 B;  2PZS A;  1VQ8 V;  1EN6 A;  1E1R G;  5CN0 A;  1URF A;  1PD3 A;  5IYZ A;  3HKD A;  4TV8 A;  2OYQ A;  3SYC A;  4DR6 B;  4RUF A;  2P67 A;  4MVU A;  5CBF A;  2EIK C;  1KD1 W;  2UXD O;  4LP8 A;  1YF2 A;  3GVM A;  3UKM A;  2CTP A;  1ZAU A;  3CCV V;  5JH7 B;  3A0B Z;  1KU9 A;  3JAL A;  1ZSP A;  4F6R A;  4LF4 B;  4E2L A;  3W7W A;  3ZN1 A;  4PJ0 Z;  1YIJ V;  3OR7 C;  1XNR O;  2JK5 C;  5FPO A;  1Z5W A;  3E89 A;  3TGU H;  3UO3 A;  5J9P C;  1IBL B;  1R1B A;  2UXB O;  4JI2 O;  1EM1 A;  3ZBH A;  2R9A A;  3UM7 A;  5IWA O;  3FX7 A;  5IJ0 B;  2YDE A;  5JCO C;  4O4J A;  4GUN A;  2QKC A;  2Q0A A;  1JJ2 U;  1M56 B;  2FL4 A;  4GYC B;  1KQS U;  4O2B B;  1CP9 A;  1XQ8 A;  2WLK A;  4ICG A;  2W6J G;  1HNZ O;  3CJH A;  5JVD A;  4JF3 A;  4EFE A;  2IJJ A;  2WSS G;  5LXT A;  2JEX A;  1HNX B;  4KP4 A;  4H37 A;  2BCC H;  3JAR B;  2CGN A;  4XBF A;  1D2D A;  1WN7 A;  2VQE O;  1SA0 B;  1IDS A;  2ATK C;  2X6C A;  4UV8 A;  4BIU A;  3OGC C;  4A5U B;  4CH4 A;  1TVK A;  5EIB D;  5JQG A;  2VS0 A;  4DV0 B;  4NTY A;  1GM7 A;  1P49 A;  1FPO A;  4X66 O;  3MHH C;  5CB4 A;  5KAF Z;  2JDI G;  2YIB A;  3OEE G;  3T4D A;  1OCO C;  1QR8 A;  4WFH A;  1XMO O;  3WFV A;  2UU9 O;  3K9A A;  2ADP A;  3D8C A;  2ITD C;  4IHJ A;  3CX5 F;  2F4V B;  2P7T C;  1A32 A;  4JTD B;  4OGQ B;  3RYC B;  1X4T A;  2MW2 B;  4QIW F;  3B4S A;  1E79 G;  1K33 A;  5B3S C;  3FB6 C;  5TIS Z;  4HBN A;  4FZ0 A;  4DR2 B;  2BTQ A;  2EJ7 A;  2CGO A;  4FM0 A;  4PDM A;  4F4L A;  2JEU A;  1IZ3 A;  2PI5 A;  1JFF B;  4NXM O;  2XAF A;  3CRA A;  2ZR3 A;  2BSK B;  1MNG A;  2JRI A;  2CE4 A;  1P84 F;  1W2B U;  3JD0 A;  4X20 A;  2A79 B;  4WFG A;  4Z1M G;  1FJG O;  4IT5 A;  2ZDI A;  1O9H A;  2ZDI C;  5IJ9 B;  5IYC O;  2UXC O;  2Q68 A;  5BMV A;  3OMI B;  1Q8I A;  5GTI Z;  1VQL V;  4WFB V;  5IE9 A;  2WA3 A;  4J7K A;  4I4T A;  2HLD G;  5KAI Z;  1L1F A;  4B3S O;  1N33 O;  1HWY A;  4AI8 A;  4DV6 O;  1K73 W;  3A2F A;  4ZHQ A;  4PI0 A;  4JI7 B;  3UT5 A;  1MOF A;  4WBN B;  4DV0 O;  4JI8 O;  2WA4 A;  1WPX A;  4I50 B;  3AG2 C;  4JV5 B;  3FYI B;  1VIB A;  2P90 A;  4X1K A;  5LL6 Y;  3E35 A;  5DN6 G;  4JPR A;  2D3O W;  3PJS K;  3P32 A;  3BA8 A;  1B06 A;  3RYH B;  3ZRS A;  5LMU B;  4FFK A;  1VAR A;  1G8M A;  2AHY A;  2R70 A;  5EBM C;  1ARO P;  1SZX A;  3ZMS A;  3TJT A;  4U3J B;  3KG2 A;  3N27 A;  2HHH B;  1VMG A;  2EZP A;  3B8M A;  1S76 D;  4DR4 O;  4I5S A;  4QPK A;  4LFC O;  3B09 A;  3CPW U;  2EIJ B;  4O2B A;  3SYQ A;  1K5Q A;  3KKY A;  3ABM B;  4JI5 B;  4LF8 B;  4JI6 O;  2DWE C;  2FML A;  2ADQ B;  2ZXW B;  1YDX A;  1SZT A;  2IJI A;  4LC1 A;  4MW8 A;  2IH1 C;  3JAR A;  5A9G A;  4CBC A;  2HR3 A;  4PV1 B;  2KKW A;  3CB2 A;  5BR8 O;  1DK1 A;  3KZI Z;  3TXQ A;  4TV9 B;  4FLY A;  3CCU V;  4JI4 O;  1SQV H;  4J41 A;  3CSX A;  2UXX A;  2QA4 V;  2QSA A;  1H2K A;  3E22 B;  1XMQ O;  1K8A W;  3OTF A;  5FNV B;  2X0L A;  2P4V A;  4X1I A;  5K1X A;  1YXB A;  3LSQ A;  4LF9 B;  3T1Y O;  2Y69 C;  5H2F Z;  3SJB C;  1JCH A;  4DO2 A;  2WLL B;  2JIZ G;  3E8H A;  4DR7 B;  2F95 B;  3FB7 C;  5LHI A;  1Q6U A;  5KLV H;  3N2K A;  5LYJ B;  4UV9 A;  5IYB O;  3ML0 A;  1AJP A;  4GKJ B;  4DW0 A;  4X65 O;  1R3K C;  1VQ5 V;  3RYC A;  1DTO A;  4OXS A;  3FAV B;  4NR1 A;  2IH3 C;  5B5E Z;  1YZB A;  5LP6 B;  5B1A C;  3APQ A;  4GX1 A;  3A0H Z;  4DUZ O;  2RCV A;  3NXS A;  1H2N A;  1N0J A;  3STZ C;  3SJA C;  3JAW B;  1W0J G;  3CRC A;  3I55 V;  4CS4 A;  3L75 H;  2LW7 A;  4G2K A;  3SYP A;  4JI1 O;  1QCE A;  4GT1 A;  5EZY B;  4RAI A;  1TGO A;  1JMK C;  1QHT A;  1FXV A;  2R9R B;  1GM9 A;  4XDL A;  3F7Y C;  2N04 A;  1FYJ A;  2BSK A;  1M57 C;  5EIB C;  2CAZ C;  5B1B B;  3P3N A;  3ZN0 A;  1V55 B;  4DR1 B;  1PKX A;  2QKA A;  4IGG A;  5IJ9 A;  2C2A A;  1V54 B;  5J2U B;  3CS5 A;  1DLB A;  1NTM H;  1BZK A;  1OCC C;  4PDR A;  4IYI A;  3E8F A;  2CH7 B;  4X8A A;  1VQO V;  2ZKO A;  3OTO O;  1XOU A;  1Q6I A;  4R8C A;  4DRX B;  3LNN A;  4LR3 A;  3QF7 A;  1CPY A;  2AW9 A;  5L3F A;  3ZED A;  3RVZ A;  2YXY A;  2F1M A;  4X62 B;  4WBN A;  1NR1 A;  5IY5 C;  3PN1 A;  4X64 B;  2WLH A;  1D5N A;  2QKS A;  1PNM A;  3CC7 V;  2QWP B;  1XL4 A;  3IJ4 A;  4K8X A;  4DV5 O;  2DYS B;  1KMI Z;  2ILM A;  4R6Z A;  2V7Q G;  5KA5 A;  3S3W A;  4LF7 O;  4GLX A;  4TV8 B;  1VF7 A;  2LFR A;  4NTW A;  1KBH A;  2ARH A;  2KB1 A;  1DF4 A;  3ZMV A;  4O4I B;  3JD1 A;  4CH3 A;  3JAL B;  2ZM6 B;  1R73 A;  2XAQ A;  2HKO A;  2IM9 A;  4F6R B;  2LFS A;  1F23 A;  3CE2 A;  2DN9 A;  3JAM N;  3HKE B;  4BW9 A;  5LMN O;  3K5N A;  4I55 B;  4Z2W A;  3IFX A;  3ZX6 A;  1R6T A;  3W7T A;  4MTX A;  5KHG A;  2Q0O C;  2XUM A;  4WFF A;  3QNE A;  4O4J B;  4TV9 A;  1M4U A;  1PNL A;  3E22 A;  1K4D C;  4OX9 O;  3BRC A;  2H94 A;  1I7F A;  1ZX3 A;  3LDD A;  3CJH B;  4MT8 A;  1NVP B;  1M5I A;  4JAA A;  1K7D A;  2OCC C;  2WLL A;  4LFA O;  1SQG A;  1UJW B;  4UXN A;  4DR5 O;  1Q86 W;  2AZ0 A;  3JSN A;  5BXZ A;  1VF6 A;  2QM7 A;  2UUB B;  2UUC O;  3SYO A;  3FD9 A;  1TVK B;  3ZHR A;  1NTZ H;  5JQG B;  3SPG A;  2Y0I A;  1GMG A;  1U97 A;  2Y0P A;  1KP2 A;  3HKB B;  5B66 Z;  1X59 A;  3RBZ A;  1GRJ A;  2RDC A;  4QPJ A;  3CMA V;  1H2L A;  4J7Z A;  3K5M A;  4YXW G;  5HFL A;  1FXK C;  2DJV A;  3JAW A;  1WLE A;  4B3T B;  1RPR A;  4YHH B;  1P4R A;  1PL0 A;  3G4S V;  4GKK O;  5EZY A;  3H1H H;  3W7S A;  1BGY H;  4X9Q A;  5L3D A;  4DV2 B;  2PYJ A;  4AHC A;  2IJH A;  3AG4 C;  1PP9 H;  4CS3 A;  1MA1 A;  2ZM6 O;  3G71 V;  3OAA G;  4AIL C;  3FFQ A;  1R6N A;  1THZ A;  3AG1 B;  5J2U A;  1XUQ A;  1FFX A;  4B08 A;  1XRE A;  4LWS A;  1F4N A;  1KB9 F;  4TQD A;  4UCR A;  3X2Q B;  1NH2 B;  2P6J A;  1Q81 W;  2ZNI A;  2HG5 C;  3ZIA G;  4JYY A;  3O65 A;  3CRM A;  4X20 B;  3ZS8 C;  4FM2 A;  4K8Z A;  3JAT A;  2QM4 A;  1F4M A;  1SS3 A;  2OT5 A;  4JAV A;  4PA7 A;  2X6A A;  1IBM B;  4PA9 A;  3CHX A;  5BMV B;  4CC6 A;  3ABL C;  3F5T A;  3L73 H;  3BAB A;  1Z5V A;  4YJ2 B;  3K5L A;  4GX5 A;  2Z3Y A;  4DR3 O;  1AR5 A;  4B3M B;  4CH6 A;  1N34 B;  1I08 A;  4ZHQ B;  1JVM A;  3J7A U;  4AQY B;  1MSW D;  2XAJ A;  3JD2 A;  3L74 H;  2IU3 A;  4O4I A;  1K97 A;  4FMT A;  3UT5 B;  2K9P A;  3DGE A;  5LA6 B;  2JGD B;  1VQP V;  4U3F H;  3AG2 B;  3RYF B;  1NJI W;  4G27 B;  2UUA B;  4X1K B;  4FJC C;  3HKE A;  4DXW A;  4H44 B;  4I55 A;  4B3T O;  1FXH A;  1IUR A;  3U10 A;  5ITZ A;  1KKD A;  2WLJ A;  5JCO A;  4DV3 O;  2LGQ A;  5L3C A;  3ZMZ A;  2RQ6 A;  4ZIB A;  4DW1 A;  3ZRX A;  1NU1 H;  3APO A;  2ZE7 A;  1GM8 A;  5JJE B;  2QTS A;  1IXB A;  2QTO A;  4NXN O;  3IGA C;  3G6B A;  1H2M A;  1MG1 A;  3K0D A;  2A3Q A;  1WP7 A;  4CZZ A;  2QWR B;  1SRY A;  4BR6 A;  3OUS A;  4LFB O;  1G1X B;  3IC9 A;  3DXR A;  3ASN C;  1SQX H;  3HKB A;  2Q69 A;  4X1I B;  2A7W A;  2VQF B;  4BWA A;  5BY1 A;  3RFR A;  2Y69 B;  2YEV B;  4OPH A;  4FZ1 A;  3CD6 V;  1AR4 A;  3ZHS A;  1JA8 A;  4FVM A;  4KXR A;  1K5S A;  1BQZ A;  4DK0 A;  3N2K B;  1TA8 A;  3GWK C;  4EFB A;  4DV1 B;  3M8A A;  1YHQ V;  1COW G;  4EB6 B;  4DR6 O;  5A2Q N;  4PHZ A;  3FB8 C;  3BVO A;  3I56 V;  1I94 B;  3ABK C;  2QJ1 A;  2Q6A A;  1HNW B;  3CC2 V;  1MZF A;  2NNU A;  2FYU H;  5B1A B;  4FLT A;  4I0X B;  2GTS A;  4LF4 O;  2GHY A;  5L3E A;  2EZO A;  1Q7Y W;  3UQ8 A;  4HAM A;  2HFE C;  1NQT A;  3CP1 A;  4DUY B;  3D36 C;  2Z0A A;  2PUS A;  2X7R B;  4JZG A;  1IBL O;  2Y48 A;  1BCC H;  2CK3 G;  4DK1 A;  1M57 B;  1K9M W;  3ZHV A;  1E1Q G;  3OD4 A;  2LW1 A;  3BA9 A;  2ZNJ A;  4R7C A;  2AXT Z;  1I5Y A;  4MTF A;  1N36 B;  3UCS C;  2BE3 A;  1NTK H;  1JPX A;  1OCC B;  1US6 A;  1L0L H;  4BIZ A;  5FLX N;  5GON B;  5C93 A;  1BQ0 A;  4Z1V A;  4YJ2 A;  1HNX O;  2JJ1 G;  2K1E A;  2YID A;  4HYO A;  5EC2 C;  3D3Q A;  4O4L A;  1NS1 A;  2DQ3 A;  1OZ0 A;  2QR4 A;  3U11 A;  4MS2 A;  4JZ2 A;  1QBZ A;  4PA3 A;  4PA4 A;  4PDL A;  3AG3 C;  3QVN A;  5IY5 B;  5EYP A;  5LA6 A;  2JGD A;  1JR9 A;  3RYF A;  4FLZ A;  1RP3 B;  3AG7 A;  2PGG A;  4E4E A;  3S3X A;  2GBO A;  4P2Z A;  1K34 A;  2A9H A;  1B3Q A;  3H1J H;  2F4V O;  3K5O A;  1QLE C;  3CCR V;  3RVY A;  3N2G B;  1YIT V;  5L3G A;  3CCQ V;  4JI3 B;  3VQV A;  2JVD A;  4JI0 B;  1K3E A;  2RMK B;  1JQ0 A;  4ZI7 B;  1HNW O;  2HJF C;  1ZTE A;  4HNA A;  2EIM C;  2OCH A;  1N32 B;  1Q3E A;  1AJN A;  2XAS A;  2BTO A;  4RQE A;  4DR2 O;  1LR1 A;  2YIA A;  1FD9 A;  5B1N A;  1Q43 A;  3VQY A;  4FFB A;  3M7M X;  3ZRW A;  4L8J A;  4P9P A;  2GUZ B;  1GKF A;  4D7T A;  3K06 A;  4JTA B;  3H1I H;  3HPL C;  2GDS A;  4KL1 A;  1N36 O;  3E2E A;  2M7W A;  1YI2 V;  2DOS A;  3G80 A;  3OM3 B;  4MW3 A;  4YIP A;  2YEV A;  1H2G A;  1VQ9 V;  1EN5 A;  2ZT9 B;  2YXL A;  3E8B A;  1ROP A;  1IBK B;  3SPH A;  1NBM G;  5H6Q A;  3CXC U;  4UCT A;  4K0K B;  3VBB A;  4DV4 B;  3J80 N;  2R9I A;  1VEW A;  1XL6 A;  4EB6 A;  5DM6 V;  4JI7 O;  2WLM A;  4DV7 B;  1SQF A;  2R72 A;  3RGB A;  2HVK C;  5F2V O;  1SC5 B;  5LGN A;  4I0X A;  4JV5 O;  2KQX A;  5CBH A;  4JGS A;  3BEH A;  3VQX A;  3K03 A;  1H8E G;  2YUA A;  4NVP A;  4GX0 A;  4PEL A;  5EK0 A;  5LMU O;  1I0H A;  5B1O A;  1M9N A;  3K9S A;  1XNQ B;  1V9P A;  1Y4M A;  1JX9 A;  1WB7 A;  1R3L C;  4RQF A;  4DYL A;  3AG4 B;  4JI3 O;  2HHH O;  3SPI A;  4JI0 O;  3ABT A;  2ZCE A;  2Q7E A;  2FB5 A;  5C8Y B;  4J7J A;  1HP8 A;  3LDC A;  3P30 A;  4B7E A;  3SGI A;  4JI5 O;  5IDJ A;  4R50 A;  1FFX B;  2WAM A;  4UUJ C;  4LF8 O;  5GON A;  1DGS A;  4LWS B;  5BZB A;  4LF5 B;  2E3C A;  2VRZ A;  2E5L B;  3ZMU A;  4UCO A;  1Y76 B;  4J42 A;  2DE0 X;  4O2A B;  2ZE6 A;  3RWR D;  4L87 A;  4ZOL B;  2YIC A;  1J5E B;  2Q7G A;  3JAT B;  4I9W A;  5HFM A;  4FLW A;  2PTM A;  3I5D A;  3RT3 C;  3ABL B;  1TAE A;  3IAY A;  1BE3 H;  4FLU A;  4LF9 O;  2FKX A;  3K79 A;  2Y4U A;  3L9D A;  2XHB A;  2AHZ A;  1YVW A;  1G4Y B;  4DR7 O;  1GN4 A;  2P4K A;  4C7U A;  2MK3 A;  5DEC A;  4B3R B;  3N2G A;  3HKC B;  5LHH A;  2EIK B;  1YCI A;  1UFI A;  1AI4 A;  5LGU A;  1J95 A;  4GKJ O;  4UCU A;  1NR7 A;  2F66 C;  2LP7 A;  1D5A A;  3THO A;  4ZI7 A;  2Q67 A;  2KG7 A;  3AK3 A;  3C90 A;  2V1D A;  1HR0 B;  4H0L B;  3L70 H;  5H9C A;  3K59 A;  3B77 A;  1MAB G;  5CA3 A;  2HP8 A;  1R3J C;  1R6K A;  3K0G A;  4YY3 B;  5EBW C;  4J80 A;  3CCE V;  5ITZ B;  2F93 B;  4J9Z B;  4I9Q A;  4KHP B;  4N21 A;  3OMN B;  2IU0 A;  2GUZ A;  3NR7 A;  1ZUQ A;  5E79 Z;  2B5U A;  2EIJ C;  1YJ9 V;  1XI1 A;  2EX3 A;  2ZIO A;  3OT7 A;  2V4D A;  4DR1 O;  2ITC C;  5DED A;  4I7Z B;  3SPC A;  2PI4 A;  4JYA B;  1S5J A;  1R3I C;  4FLX A;  1BL8 A;  3BFR A;  3T1H B;  4UVC A;  2NN4 A;  4BIO A;  3L71 H;  5K1P A;  1Q82 W;  3JSL A;  3OR6 C;  1PV0 A;  2B1I A;  4CC5 A;  2DMX A;  1FAF A;  3OMA B;  4O4H B;  3QO8 A;  2D2C B;  3A8T A;  5CA1 B;  4LH6 A;  5KX5 A;  3CXH F;  4TQF A;  2HEP A;  4MVR A;  2QM8 A;  1I5X A;  3DXR B;  3QTC A;  1Q90 D;  3ASN B;  4LF6 B;  4X62 O;  3WG7 C;  2ZQM A;  4X64 O;  4J9Y B;  1AI7 A;  4YJ3 B;  1OCO B;  1N4C A;  1PPJ H;  2GTA A;  3CME V;  1FXK A;  4UVA A;  1NKD A;  2X6B A;  2NR5 A;  3OEH G;  2QEX V;  1YJW V;  2UXD B;  4QE7 A;  2B1G A;  4QJF B;  4K3A A;  1LUV A;  4EEQ A;  1WAZ A;  3ABK B;  1RM1 C;  3CYO A;  1H2S B;  3U0Z A;  2DYR C;  2Q73 A;  3QO5 A;  1GAX A;  2WPD G;  1XNR B;  5B3S B;  1AI5 A;  2BOC C;  3Q4H B;  3JAK B;  5C8Y A;  3R66 A;  2UXB B;  4JI2 B;  5IWA B;  3ETE A;  1RSO A;  5H5N A;  3CCM V;  3H01 A;  3H1L H;  1QVF U;  3F7V C;  4PI2 A;  2JGU A;  2EIL C;  5B1B C;  3K58 A;  5FL7 G;  1Y76 A;  3B2E E;  2YXH A;  4O2A A;  1WB8 A;  3ASO C;  4ZOL A;  3ZMT A;  4NKG B;  1HNZ B;  2B9Z A;  2Z5U A;  3C3S A;  4GX2 A;  3LNM B;  4PDV A;  3A0R A;  2JJ2 G;  1AI6 A;  5IT9 N;  3WB2 A;  5D5Q A;  2WLI B;  3H1K H;  1SET A;  2VQE B;  3W7U A;  3EFF K;  2XOK G;  3SDL A;  2IW5 A;  2G38 A;  1JOY A;  1AVM A;  2EIN C;  2A0L A;  3ETQ A;  2PYL A;  2HVJ C;  3SR2 C;  4J11 A;  4O4L B;  4UCV A;  1M93 A;  3EVK A;  4X66 B;  3HKC A;  1QU7 A;  2UUB O;  5KA6 A;  4WCE V;  1F7Y A;  1S0V A;  4WFA V;  3AG3 B;  1Q6H A;  3EHB B;  1XMO B;  3WB0 A;  5EYP B;  2UU9 B;  5JWP A;  2DQ0 A;  4X89 A;  4IIJ B;  1Y67 A;  1PM9 A;  4J10 A;  3SPJ A;  2F43 G;  2CTQ A;  3OGI B;  3E86 A;  3P3P A;  5KHJ A;  2Q8V A;  1HDJ A;  4YHH O;  1ORQ C;  3CEI A;  3EXA A;  1QLE B;  4FM1 A;  4Q6G A;  3ETD A;  2JS5 A;  3HB3 B;  2ETN A;  2Q7H A;  2E76 B;  4DV2 O;  4X1Y A;  2CUG A;  4UB8 Z;  1CEZ A;  2YI8 A;  2W6I G;  1EFR G;  1L0N H;  4HNA B;  4U7N A;  3JCZ A;  2EIM B;  4JTC B;  3QO7 A;  2AGA A;  1YEW A;  4NXM B;  1GN2 A;  2YC0 A;  1FFT B;  4MVZ A;  5AG2 A;  2E75 B;  2PF4 E;  1WJZ A;  4H13 B;  1G6U A;  4JAS A;  1SQP H;  4FFB B;  5EC1 C;  3MAQ A;  1GH6 A;  4YIO A;  1SF9 A;  2NLJ C;  3ZRW B;  1FJG B;  4W4K A;  1EZJ A;  4O4H A;  1K4C C;  4MSW C;  5CA0 A;  3K08 A;  5CA1 A;  2UXC B;  2LQT A;  3TCU A;  4ABM A;  2Q9L A;  2BOB C;  4LCU C;  2RN9 A;  1IBM O;  2ZE8 A;  1WA8 B;  2A06 H;  4NYK A;  4B3S B;  1N33 B;  4YJ3 A;  4DV6 B;  3TK1 A;  1WPB A;  1JJO A;  2KSD A;  2EJR A;  4UB6 Z;  5KMG A;  2EUL A;  1B6Q A;  4MTG A;  2L6L A;  4B3M O;  3JAS B;  2ZIN A;  4JI8 B;  4UCS A;  5KHK A;  1N34 O;  1FKA O;  1KP3 A;  1OCR C;  4AQY O;  1S3J A;  4JAU A;  3SJQ C;  1Q5O A;  1XEQ A;  2CTR A;  3G67 A;  1OCZ C;  3Q4H A;  2P06 A;  3RN4 A;  2UUA O;  3JAK A;  4PD4 F;  1VP7 A;  1UPG A;  1CXZ B;  1MSD A;  4PA6 A;  3MHS C;  3D36 A;  3CC4 V;  1L8D A;  4DR4 B;  4LFC B;  4B7K A;  4RO2 A;  1H8H G;  2OIG A;  2Y4T A;  3AG1 C;  4GZR B;  2DW4 A;  4JI6 B;  1AJQ A;  4MTO A;  3UO2 A;  3OUF A;  3GWO A;  3X2Q C;  2WLI A;  4UVB A;  5BR8 B;  5GW7 A;  4RUE A;  3ZCC A;  1VQ7 V;  4IYH A;  4JI4 B;  1MZE A;  1AIL A;  4KFM A;  4KUM A;  4FLV A;  1XMQ B;  1ZLZ A;  2IBZ H;  3DTU B;  5LOV B;  3C3T A;  2Q4P A;  4WF9 V;  2QWQ B;  3IC7 A;  3T1Y B;  3T2M A;  3CCL V;  1O9G A;  4W4L A;  4CH5 A;  3H9V A;  4X88 A;  4IIJ A;  2VQF O;  1WNS A;  1VQ6 V;  2IJK A;  1AP6 A;  1NZ6 A;  1Y66 A;  4XDK A;  4X65 B;  5J2T B;  5JH7 A;  1TUB B;  3GB7 C;  1AR1 B;  4DV1 O;  1BS3 A;  3QG5 A;  5FPR A;  4DUZ B;  1I94 O;  2H3O A;  1N8R W;  3MDS A;  3JYC A;  2KG7 B;  4U7O A;  2PY5 A;  4JI1 B;  2WWW A;  1Z2G A;  3B8N A;  1SQB H;  2HJD A;  2O57 A;  5IJ0 A;  4DUY O;  4K35 A;  1RPO A;  1KKC A;  2N05 A;  1M56 C;  2RNB A;  2QGN A;  1S77 D;  3O9O A;  1K92 A;  4MVM A;  2XTA A;  3RYI B;  3LUT B;  1ZWI C;  1VQM V;  2LJ2 A;  1WA8 A;  3CWB H;  3OTO B;  1S5L Z;  3CRR A;  1SA0 A;  2OCC B;  4LNU B;  1P7B A;  3VOU A;  5H6R A;  1MMM A;  1N0N A;  4TWK A;  2ZIM A;  4FK5 C;  1SKV A;  3JAS A;  3CCJ V;  3ETG A;  1PNK A;  4MVO A;  5EBL C;  3T4Z A;  3ICX A;  1VQK V;  5KX5 B;  4P30 A;  4TUY B;  3J81 N;  4DV5 B;  3WG7 B;  1XHX A;  4LH7 A;  2OWO A;  3CRQ A;  1IVS A;  4QGP A;  4LF7 B;  2VWK A;  3BCC H;  2P5O A;  1FXK B;  4MVQ A;  5KUM A;  1OHH G;  1QVG U;  1SER A;  1EN4 A;  1GO3 F;  4NB5 A;  1M1K W;  2Q5Z A;  1RM1 B;  5L3B A;  2XAG A;  2DYR B;  3SJC C;  2YI9 A;  2UXN A;  5LMN B;  2ZD9 A;  1VF5 B;  1KC8 W;  3AEI A;  1ENV A;  1S5H C;  3RW0 A;  4LBE C;  5IYD O;  1N32 O;  2ZR2 A;  1JFF A;  2GV9 A;  1ZL8 B;  2E74 B;  1RSO B;  5LBQ A;  5LGT A;  4MVS A;  2ODM A;  3JD3 A;  3ZRV A;  2EIL B;  2LO1 A;  1SQQ H;  5JJJ B;  3DC5 A;  4QNH B;  3ASO B;  4OX9 B;  5KUK A;  2WLN A;  2LGW A;  1Y74 B;  4G28 B;  3ZHU A;  5GTH Z;  2JS3 A;  5LOV A;  3BY6 A;  3B40 A;  1IXM A;  1U96 A;  1QR9 A;  4JYB A;  2QWO B;  1M90 W;  4LFA B;  1P7G A;  3BPZ A;  4DR5 B;  1QQC A;  4TSF G;  2AZ2 A;  2UUC B;  3AK2 A;  1OJH A;  3KCY A;  1YJN V;  3HR0 A;  1B04 A;  2EIN B;  1IBK O;  3WB1 A;  1F51 A;  3AK1 A;  5J2T A;  3R65 A;  2QDO A;  4K0K O;  4DV4 O;  1TUB A;  2YS8 A;  3DSQ A;  1NI8 A;  4ASU G;  4I50 A;  3TXS A;  1BSM A;  3KCX A;  4QE9 A;  2QE7 G;  4DV7 O;  3OFN G;  4JYC A;  5CMU A;  2P22 C;  4EKW A;  3RYH A;  1NVP D;  4FIP C;  2VWJ A;  4GKK B;  2QWN B;  5IYZ B;  1W59 A;  3HKD B;  2CTW A;  2M6Y A; 
#chains in the Genus database with same CATH homology
 4FLY A;  3WB2 A;  5D5Q A;  2VQE B;  4U3J A;  4FLT A;  3CSX A;  3E22 B;  3UQ8 A;  3OTF A;  5FNV B;  4X1I A;  5K1X A;  4DUY B;  4X1Y B;  3ETQ A;  2PYL A;  3SR2 C;  4LF9 B;  2PUS A;  4O4L B;  4UCV A;  1M93 A;  3SJB C;  3VQW A;  4X66 B;  2YIB D;  3HKC A;  4DR7 B;  2F95 B;  3RYI A;  4DK1 A;  1XMO B;  3N2K A;  3WB0 A;  5EYP B;  5LYJ B;  2UU9 B;  1XHZ A;  5KHH A;  3BA9 A;  2ZNJ A;  4IIJ B;  1T5E A;  4GKJ B;  1N36 B;  3RYC A;  4LNU A;  5KHJ A;  5LP6 B;  5GON B;  4FM1 A;  4Q6G A;  4YJ2 A;  5CA0 B;  5FNV A;  2JS5 A;  3SJA C;  2Q7H A;  3JAW B;  4CS4 A;  2RJZ A;  4TUY A;  4X1Y A;  5JVD B;  5EZY B;  5JJN B;  4O4L A;  1TGO A;  2YI8 A;  1JMK C;  5LXT B;  1QHT A;  4DR3 B;  4TOI A;  4HNA B;  3U11 A;  5EIB C;  1YEW A;  4NXM B;  5LYJ A;  5EYP A;  5LA6 A;  2CAZ C;  3RYF A;  5KMG B;  4DR1 B;  4FLZ A;  1G6U A;  5D5P A;  2PGG A;  4FFB B;  3MAQ A;  5IJ9 A;  5J2U B;  5CB4 B;  1FJG B;  5LP6 A;  5LP6 C;  3K5O A;  4O4H A;  3N2G B;  5CA0 A;  5CA1 A;  4UFZ A;  2UXC B;  4DRX B;  4JI3 B;  3LNN A;  3VQV A;  4IHJ B;  4LR3 A;  3QF7 A;  2JVD A;  4JI0 B;  4ZI7 B;  4B3S B;  1N33 B;  4YJ3 A;  4DV3 B;  4HNA A;  3ZED A;  3BAA A;  4DV6 B;  2F1M A;  4X62 B;  1N32 B;  4WBN A;  1Q3E A;  1WPB A;  1JJO A;  3PN1 A;  4X64 B;  2BTO A;  5KMG A;  2YIA A;  1Q43 A;  3VQY A;  1HW7 A;  3JAS B;  2ZIN A;  4FFB A;  3K57 A;  3M7M X;  4JI8 B;  4K8X A;  4UCS A;  5KHK A;  1KMI Z;  4D7S A;  4CS2 A;  4NXN B;  2BTQ B;  4L8J A;  4D7T A;  1Q5O A;  4GLX A;  4TV8 B;  1VF7 A;  5KHI A;  4DRX A;  3JAK A;  4O4I B;  4KL1 A;  4LFB B;  4CH3 A;  3JAL B;  2ZM6 B;  2IM9 A;  4F6R B;  1L8D A;  4DR4 B;  3HKE B;  4BW9 A;  2YXL A;  4LFC B;  1IBK B;  3K5N A;  4I55 B;  4UCT A;  4K0K B;  4DV4 B;  3BHP A;  4I4T B;  4EB6 A;  5KHG A;  1NT2 B;  2PZS A;  4JI6 B;  4DV7 B;  1SQF A;  5IYZ A;  2R72 A;  3HKD A;  3RGB A;  4O4J B;  4TV8 A;  2OYQ A;  4TV9 A;  4DR6 B;  1M4U A;  5BR8 B;  1ZAU A;  3E22 A;  3BRC A;  3VQX A;  5JH7 B;  1KU9 A;  3JAL A;  1I7F A;  4NVP A;  4JI4 B;  4F6R A;  4LF4 B;  1M5I A;  4FLV A;  1XMQ B;  1XNQ B;  1V9P A;  5LOV B;  1SQG A;  5FPO A;  1Z5W A;  3JSN A;  3T1Y B;  1O9G A;  1IBL B;  4CH5 A;  2UUB B;  2R9A A;  4IIJ A;  1TVK B;  2ZCE A;  5JQG B;  5IJ0 B;  5JCO C;  2Q7E A;  5C8Y B;  1WNS A;  4O4J A;  3HKB B;  3SGI A;  2Q0A A;  1FFX B;  4X65 B;  4GYC B;  1DGS A;  5GON A;  5J2T B;  4O2B B;  3K5M A;  5JH7 A;  1XQ8 A;  4LF5 B;  2E3C A;  1TUB B;  3JAW A;  2E5L B;  4B3T B;  4UCO A;  4YHH B;  3QG5 A;  5FPR A;  4DUZ B;  4O2A B;  5JVD A;  3RWR D;  4EFE A;  5EZY A;  5LXT A;  1HNX B;  4ZOL B;  3JAR B;  1J5E B;  4DV2 B;  2Q7G A;  1WN7 A;  2PYJ A;  3JAT B;  2PY5 A;  4JI1 B;  4AHC A;  1SA0 B;  4FLW A;  2PTM A;  4CS3 A;  4CH4 A;  1TVK A;  5EIB D;  5JQG A;  5IJ0 A;  1TAE A;  4AIL C;  4DV0 B;  3FFQ A;  3IAY A;  4FLU A;  5J2U A;  1P49 A;  5CB4 A;  2XHB A;  2YIB A;  1FFX A;  4B08 A;  4B3R B;  3N2G A;  4TQD A;  4UCR A;  3HKC B;  3RYI B;  2ZNI A;  4IHJ A;  2F4V B;  4UCU A;  2F66 C;  3OTO B;  1D5A A;  4X20 B;  3THO A;  4ZI7 A;  3ZS8 C;  4FM2 A;  4K8Z A;  3JAT A;  2QM4 A;  1IBM B;  1SA0 A;  1HR0 B;  3RYC B;  1X4T A;  4LNU B;  3CHX A;  5BMV B;  2ZIM A;  4CC6 A;  1SKV A;  3K59 A;  4YY3 B;  3JAS A;  3BAB A;  5ITZ B;  2F93 B;  4HBN A;  1Z5V A;  3ICX A;  4YJ2 B;  3K5L A;  4I9Q A;  5KX5 B;  4DR2 B;  2BTQ A;  4KHP B;  4TUY B;  4B3M B;  4FM0 A;  4CH6 A;  4DV5 B;  1JFF B;  1XHX A;  4LH7 A;  2EX3 A;  1XI1 A;  1N34 B;  2OWO A;  2ZIO A;  4ZHQ B;  2V4D A;  4AQY B;  4O4I A;  3UT5 B;  4LF7 B;  2VWK A;  2P5O A;  4JYA B;  1S5J A;  4FLX A;  5LA6 B;  4X20 A;  3RYF B;  3T1H B;  2UUA B;  1O9H A;  4X1K B;  5K1P A;  5IJ9 B;  3JSL A;  3HKE A;  4I55 A;  5BMV A;  4CC5 A;  1Q8I A;  3U10 A;  3SJC C;  5ITZ A;  2YI9 A;  4O4H B;  4I4T A;  5CA1 B;  4LH6 A;  5LMN B;  5KX5 A;  4TQF A;  2HEP A;  5JCO A;  3QTC A;  4LF6 B;  1JFF A;  2GV9 A;  3A2F A;  4ZHQ A;  4PI0 A;  4JI7 B;  2RQ6 A;  4YJ3 B;  4ZIB A;  3UT5 A;  4WBN B;  5JJE B;  4I50 B;  4JV5 B;  2UXD B;  5JJJ B;  4X1K A;  4OX9 B;  5LOV A;  4EEQ A;  3BA8 A;  3RYH B;  5LMU B;  1H2S B;  2R70 A;  3U0Z A;  4LFA B;  3BPZ A;  1XNR B;  4DR5 B;  1QQC A;  4U3J B;  3JAK B;  5C8Y A;  2UXB B;  2HHH B;  4JI2 B;  3HKB A;  2UUC B;  5IWA B;  1B04 A;  1RSO A;  4X1I B;  3WB1 A;  2VQF B;  4BWA A;  3RFR A;  4O2B A;  5J2T A;  1TUB A;  3DSQ A;  4PI2 A;  4JI5 B;  2JGU A;  4I50 A;  3K58 A;  4LF8 B;  3B2E E;  4FVM A;  4O2A A;  4DK0 A;  3N2K B;  1TA8 A;  4ZOL A;  4EFB A;  4DV1 B;  3JAR A;  2P22 C;  4EB6 B;  4PHZ A;  3RYH A;  1HNZ B;  2VWJ A;  1I94 B;  2KKW A;  3CB2 A;  4GKK B;  5IYZ B;  3HKD B;  2QJ1 A;  4TV9 B;  1HNW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...