4LR3A

Crystal structure of e. coli yfbu at 2.5 a resolution
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
164
structure length
164
Chain Sequence
MEMTNAQRLILSNQYKMMTMLDPANAERYRRLQTIIERGYGLQMRELDREFGELKEETCRTIIDIMEMYHALHVSWSNLQDQQSIDERRVTFLGFDAATEARYLGYVRFMVNVEGRYTHFDAGTHGFNAQTPMWEKYQRMLNVWHACPRQYHLSANEINQIINA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein YfbU
publication title Diamonds in the rough: a strong case for the inclusion of weak-intensity X-ray diffraction data.
pubmed doi rcsb
molecule tags Apoptosis
total genus 58
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03887 YfbU YfbU domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.680 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4lr3A01
1.10.3190.10 Mainly Alpha Orthogonal Bundle yfbu gene product, domain 2 yfbu gene product, domain 2 4lr3A02
1WPBA 4LR3A
chains in the Genus database with same CATH superfamily
3JARB 3E22B 3ZRVA 1NJIW 2QM7A 3THOA 2QR4A 2HJDA 1YJ9V 2XAFA 1FS0G 4IHJA 4MT8A 4OX9O 4GT1A 2EZOA 3OMNB 2NR5A 2IJJA 1MMMA 3K03A 2QDOA 2JRIA 1Q81W 1NTMH 3CJHA 2VQFB 1I0HA 1DLBA 3JD2A 5CB4B 5H6RA 3AG3C 5E1AC 2ZT9B 3TJTA 3K59A 1KU9A 3OAAG 4GCZA 4XDJA 4O2AB 3K0GA 4PJ0Z 1R73A 3AK1A 4JI6O 4O4JA 1VF5B 2BE3A 3J81N 2UXBB 4JI5B 3ABMB 1TUBA 5ITZA 4Q20A 1JFFB 3CCRV 5LP6B 5AG2A 5FNVB 3SJCC 2QTOA 4UVBA 1VQ7V 4QGPA 2JJ2G 1IBMB 4EB6B 2X0LA 3FB5C 1D5AA 1K34A 3OTOB 2N04A 2VRZA 1GN6A 3ZHVA 2P4KA 3BFRA 2ZNIA 1MZEA 4TOIA 4E4EA 5CBFA 4K35A 2E76B 1GM8A 1IDSA 2FTKA 5GONB 1JCHA 1Q5OA 4AQYO 3B8MA 4H0LB 2QE7G 3PJSK 1ZUQA 1K92A 5FPOA 4WFHA 3VOUA 1S5JA 2HVKC 3IC9A 4EEQA 1Y76B 1I5YA 5IYZA 3K08A 1YZBA 1LNQA 2ZIMA 2WPDG 1FAFA 1ZLZA 3ABMC 1QU7A 3CCEV 1L0LH 4DV4O 1YSCA 4X65B 4MVZA 4RUFA 5DECA 4JI4B 3LSQA 1K3EA 4UXNA 5LP6C 3CS5A 1XBLA 3CCQV 1W0JG 1QVFU 3F5TA 4YIPA 4B3TO 5LP6A 1HNXB 3ZEDA 1M93A 3FKSG 4ZI7A 4PA6A 1RM1B 2EZPA 1MABG 4A5UB 4LF8O 2A9HA 2Q9LA 3OR6C 5J2UB 5JCOC 1SA0B 1WN7A 3HKCB 3KCYA 2D2CB 4J7KA 1B04A 1KMIZ 2XTAA 5J9PC 4FJCC 4TV8B 2BCCH 4GKKO 3LSSA 1XMQB 2JEXA 4JI8B 3ZRXA 3F7VC 1YHQV 4NTYA 3UO3A 3MHHC 3ZIAG 4FZ1A 5LGUA 3D3QA 1AJNA 4U7NA 1NI8A 2R70A 3IC7A 1S5HC 2YIBA 2JVDA 2LFSA 3FYIB 4R8CA 2UUBO 4KL1A 2QJ1A 3JCUZ 1XL6A 3HKBB 3K9AA 1RM1C 1SQVH 2ZXWB 3ZMVA 5LHIA 5LMUO 3W7TA 1M1KW 4CS3A 1V54B 1XHXA 3STZC 1NH2D 2XUMA 5EIBC 3OUFA 1B6QA 4QJFB 2PUSA 3SYQA 3JASA 3Q4HA 1SQBH 3F5WC 4RQEA 1AI6A 1PPJH 2JJ1G 5LXTB 4TV8A 3LDEA 3IJ4A 1MA1A 5LMNO 4DUZO 1JJ2U 3ZMSA 2KG7B 1JJOA 4DR1O 4B7EA 1M5IA 5B66Z 4J41A 4PA3A 2IH3C 4RO2A 4U3JB 3S3WA 1KP2A 2WWWA 3QO8A 1WB8A 1R3IC 2LJ2A 3TK1A 1NH2B 3DTUB 2L35A 1OV9A 3UKMA 4LF9O 2F93B 2IJIA 3E35A 1ZL8A 2YC0A 4R7CA 5KA6A 2UUCB 4B3MO 2ZXWC 2IJHA 2ZCEA 4LFAB 2RN9A 4W4KA 1KYOF 2ETNA 2LFRA 4EFBA 4CBCA 5HFMA 1CEZA 4KXRA 4E2LA 1V54C 1NU1H 1US6A 4JI0B 3AK2A 3ZHUA 3CRQA 3HPLC 3K5OA 5J2TA 1HR0B 1BT8A 4X64O 4DXWA 2LQTA 4O4LB 4IL6Z 3M7MX 4JTDB 2H3OA 3ZMZA 1IURA 1KB9F 1GTOA 2N05A 3L70H 4JYAO 4DUYO 1GN4A 1MZFA 1R3LC 2WLIA 5JWPA 2BTQB 2PYLA 1URFA 2YIDA 5LXTA 4MW3A 4I9QA 3N2GB 3QTCA 2KG7A 2EILB 1N36B 2HEPA 1Q90D 4DV5B 4HNAB 4K8ZA 4X66O 1XILA 1TGOA 1DF5A 3BVOA 5C8YB 1L0NH 2N74A 3KKYA 4B3SB 3N27A 3OMAB 4MVRA 3CMEV 1QVGU 2GUZB 2K1EA 4OGQB 3E8GA 2JGDB 4GX1A 1NTKH 1QR8A 3P3NA 2HR3A 1FXHA 2KQXA 3CCVV 4HZ3A 4KUMA 3OW2U 3ZJZA 3O9OA 2HG5C 3ETGA 3BPZA 2ZE5A 2YICA 3JAWB 4JZ2A 4MVUA 5DM6V 4DR3B 3O65A 3HKDA 3D8CA 4MTGA 4N23A 1FXKA 4OPAA 5EZYA 2P90A 4KFMA 2XASA 4HNAA 5LOVA 1VIBA 2RJZA 2P4VA 3L73H 4FIPC 1VP7A 4DW1A 5L3DA 1N4CA 4UV8A 2WAMA 1VQ6V 2EBOA 3BAAA 4D7TA 1GK9A 2DN9A 2JGUA 4K0KB 1S76D 1X59A 4GX2A 1K7DA 1Y66A 3TETA 3ZRSA 2ZE7A 1NVPD 1U96A 1R6NA 3K3WA 5KUKA 2GTAA 1SQFA 1IVSA 5KMGA 3NXSA 1KECA 3CX5F 3ABKC 2QTSA 1MSDA 3LDDA 1NQTA 2Z3YA 3A0HZ 4JV5O 4TV9B 4JI3B 4X62B 2EX3A 4JZGA 3UT5A 4DV7B 4KHPO 1R3JC 5H6QA 1I94B 1HNZB 1K5SA 4CH6A 1VQ8V 4DR4O 3BABA 1JMKC 1TA8A 5EYPA 3SJBC 5CBGA 1NVPB 4JF3A 2Y0PA 4FLZA 4X88A 2Q0AA 4I0XB 2RQ6A 1FPOA 1Y74B 3RT3C 3FX7A 4I55A 4FVMA 4D7SA 2ZM6O 4PDMA 1I7FA 2Z5UA 3DC6A 3FAVB 2LW1A 4GKJO 4JI1B 3E86A 4GZRB 3SYOA 2AHZA 2Y69B 3HKEA 2WLMA 2WSSG 2UUAO 4PA4A 1F4NA 1QQCA 3VQXA 4DR2B 1W2BU 2CTPA 2HHHO 1VARA 4DV3O 2VWKA 1AI5A 4JTAB 2OWOA 4NYKA 2CGOA 4J11A 3RYIA 4PDVA 2UXCO 2C2AA 1COWG 4LWSA 4WBNB 2KB1A 3K9SA 1Q6HA 2O57A 5LHHA 4X1IB 5JJEB 5LA6A 3E83A 4I4TA 1ZWIC 1F23A 2Q6AA 1BMFG 2LGQA 4TT3G 3ZBHA 1IBLO 3B40A 4IHJB 1VQ4V 2PZSA 4DR5O 5BXZA 3M99B 5IWAO 4J42A 2YXLA 3TCUA 3CRCA 2HJFC 1Y74A 3K5NA 2Y69C 3CJHB 4DR6O 1ENVA 4G2KA 3FAVA 3QNEA 2ATKC 3F7YC 4LH7A 2P6JA 1ZAUA 1N32O 3OGCC 2P06A 2QKAA 4YJ3A 3CE2A 4BW5A 5B3SC 4TUYA 1BS3A 4DV2O 4UCVA 3ZS8C 3AG3B 4BIZA 4ZHQA 4JI2O 4RQFA 1GMGA 4DV6O 1P84F 1K4CC 4PDLA 5EBMC 3CSXA 1TUBB 5ITZB 1W0KG 3LSUA 4WBNA 2R72A 3ZCCA 4JI6B 4HYOA 4X1YB 4B3RO 3IGAC 3H9VA 4GLXA 4PDRA 4EFEA 1F51A 5GTHZ 4FM1A 3WG7B 4MVQA 4YHHO 2PYJA 3ABTA 1SQXH 1KBHA 4FFBA 3ETQA 3VQWA 3JYCA 1V55C 3CRRA 4LFBO 3KZIZ 2EIMB 1P7BA 2A7WA 2UU9B 2X6BA 2M7WA 1IXBA 1VQ5V 1BHAA 5IYZB 3T4DA 5LGTA 4H33A 4MVOA 3APQA 1XNQO 1S3JA 3ML0A 1SF9A 2PI5A 3C90A 4TSFG 4NVPA 2M6YA 2CTWA 4GUNA 4JYYA 3W7WA 1A32A 2AHYA 3AG2C 3DC5A 3CCLV 1VQKV 1YITV 4JAUA 5L3CA 1LUVA 4DV4B 3WG7C 2Q0OC 2QSAA 5IJ9A 2E3CA 4X1YA 4DR7O 4ZI7B 2V7QG 2F4VB 1VQ9V 4WFAV 1L8DA 2YIBD 3OEHG 5DEDA 2OCCB 5TISZ 3JAKA 4EKWA 2EIMC 2H8PC 2P22C 1RP3B 4I50A 1XOUA 2OTJV 4LF8B 2V4DA 1GN3A 1EM1A 2F23A 5LHGA 1N33O 2LP7A 1Y67A 4IIJA 1VF6A 5EIBD 4GKKB 2CTQA 1FKAO 4UCTA 2Q7HA 2W6JG 5C93A 1L1FA 2ZE8A 2BTOA 4DV0B 2UXDB 1TVKB 4CH3A 3JATA 2OCCC 3P30A 5KAIZ 3QG5A 1NZ6A 1E1RG 3CXCU 2CH7A 2OIGA 3B09A 5FL7G 1QCEA 3JD0A 3JASB 3Q4HB 5LMUB 4K8XA 3L74H 2GSMB 1YF2A 4FM2A 3A2FA 4Q6GA 1IBKB 2DJVA 1AP6A 5KLVH 3G71V 1XQ8A 1H8HG 3OEEG 2P7TC 1P49A 3RFRA 1G6UA 2CK3G 3E8BA 1QHTA 3VQVA 4FLYA 2YIAA 3JCZA 4NR1A 4U7OA 4UFZA 2AZ0A 1DK1A 3OMIB 1YIJV 4PA9A 2ZDIC 2YS8A 5LYJA 4DUZB 5LMNB 4P30A 5H9CA 4DR1B 2IU3A 2QWQB 1ZL8B 1LUWA 4F6RB 2ZDIA 4FLXA 1Y4MA 1UPGA 4L8JA 3CC4V 4JI4O 1SQPH 3ZHSA 1TVKA 2ZINA 4MS2A 4XDLA 1K4DC 2PTMA 4UVCA 1G1XB 1JA8A 5CA0A 4YY3B 2YI8A 5J2TB 3T1HB 2WLHA 3T4ZA 2OTLV 2GTSA 4DRXA 1WA8A 2YXHA 1HNWB 2Q67A 2WLIB 2DE0X 4X64B 2RDCA 3JAMN 1SKVA 1M9NA 4LF6B 3CCJV 5L3EA 5A2QN 1KD1W 2GBOA 3U10A 1EFRG 1IX9A 3WU2Z 4DUYB 4JYAB 2QA4V 2XHBA 1XMQO 3BEHA 3GB7C 4TWKA 1PD3A 1SQGA 3K06A 2BSKA 3NR7A 2BOCC 4X8AA 3WB0A 5B1BB 3OUSA 2IW5A 1OCZB 5CA1A 4F6RA 3CWBH 1X4TA 2Y4UA 2W6IG 4BAYA 2UXXA 1I5XA 4WFEA 1PP9H 4HAMA 3HB3B 1YVWA 2B1GA 4X66B 1FYJA 4YXWG 4LF4O 3T1CA 2VWJA 1QLNA 3RYHA 2ARHA 3P3PA 1EN5A 4PD4F 1FJGO 1OZ0A 4N21A 1ROPA 2YUAA 5KHHA 3RYFA 1KC8W 4AILC 1I08A 3RVZA 2R9IA 4BR6A 4F6EA 3H1JH 3SJAC 5HFLA 5CBHA 4J80A 1JR9A 3OE7G 1V9PA 3HKDB 4X9QA 1JOYA 4FLVA 1GRJA 1CPYA 1FXKB 2ZD9A 5KX5A 1DF4A 1SQQH 4UCSA 2WLLB 2AGAA 5B1BC 2XAGA 5EZYB 1OCZC 1VEWA 5LOVB 4FLTA 4O4HA 1KKDA 2GV9A 2RMKB 3SYCA 3G4SV 1VF7A 4ZBMA 4FLUA 3G67A 1DTOA 2ILMA 3OD4A 1JX9A 3BY6A 1JQ0A 5K1PA 2HVJC 5LGNA 2UXNA 2LO1A 3FD9A 3RWRD 4O2BA 1SZTA 2YI9A 2FL4A 1IXMA 1XI1A 4JI0O 1AP5A 2JK5C 2NNUA 4JAVA 4LFCO 5KMGB 5BR8B 2DYSC 2YSUB 3DXRA 3C3TA 5KHJA 1WJZA 1YCIA 4H13B 2X6CA 3SPCA 3EXAA 2Q4PA 3SPJA 2Q8VA 3FYEB 3FB8C 3PN1A 5D5PA 1FXKC 2AW9A 3AG1B 2CE4A 3QO7A 3ABKB 4DV1O 3UT5B 4LNUA 3EHBB 4UB6Z 3ZMUA 4J7ZA 3ETDA 2WLLA 4JV5B 4LF7O 4FFKA 5EYPB 1M4UA 3K04A 2EIKB 5EK0A 2XNDG 2HLDG 4I55B 5H2FZ 4DR4B 4PV1B 3VQYA 4UCUA 3L71H 3OGIB 4NXNO 2E5LO 4X20A 4DW0A 3HKEB 2Q7GA 4FZ0A 4BIOA 1PL4A 2PF4E 2EULA 1Q6UA 2QKSA 5B1OA 4LF5B 1ORQC 4GKJB 3LNMB 3K79A 3AG1C 2Q73A 3RYIB 2X6AA 1N34B 2UUAB 4LWSB 3SJQC 3L9DA 2WLNA 1W59A 1J95A 4R6ZA 3SYPA 4YJ2A 1XREA 2IBZH 2EIKC 2RCVA 3JD1A 5LA6B 4PELA 2CUGA 4I4TB 1NTZH 1KUQA 3E89A 1EN4A 1R1BA 2YDEA 3K5MA 1OCRB 3K57A 2BOBC 3ZRWB 1TAEA 2DQ0A 1OCOB 5JQGA 4H37A 2R9RB 3RYCA 2GDSA 2EJ7A 3SPHA 1IBLB 3ZN1A 5KHGA 3ABUA 4TQDA 1JPXA 4DR5B 5IWAB 1R3KC 3BA8A 4YJ3B 2Y4TA 3ICXA 4TUYB 1JVMA 4DR6B 4LCUC 1Q8IA 4CC5A 3MHSC 4ZHQB 1Q6IA 1WB7A 5B3SB 1N32B 3E8FA 4JPRA 2D3OW 1WPBA 2YEVA 1SESA 1FFTB 2W0XA 3UCSC 2FYUH 1S0VA 4DV2B 3ZMTA 1AR4A 3EVKA 1DGSA 1OJHA 4I7ZB 5GW7A 5KHKA 5EC2C 1VQOV 1OCRC 2ADPA 4JI2B 2DW4A 2H94A 4JI3O 4DV6B 4JI7B 3CXHF 3CCSV 4X62O 3G6BA 3I55V 1OCOC 1HNZO 1H8EG 1KKCA 3ZRWA 4NXMB 4JGSA 4L87A 1VQMV 1WNSA 1YTFB 4B3RB 1AB3A 3QF7A 1VMGA 3J80N 4FFBB 1MOFA 4YIOA 1N0NA 3WB1A 2IH1C 3JALA 1XNRO 3D3IA 5H5NA 4YHHB 5IE9A 1AROP 1K73W 1YDXA 4HBNA 4OX9B 5JJJB 4MVSA 4JI1O 1V55B 3AG7A 3OTFA 3C3SA 1AI4A 4GX0A 4DR2O 1S5LZ 1M90W 1R6KA 4I5SA 4WF9V 3N2KA 3CCUV 1BL8A 1GO3F 4BWAA 1XNQB 5K1XA 3ZX6A 3LNNA 5CA3A 2Q69A 4Z2WA 5IJ9B 5GTIZ 1XL4A 3AG2B 4UV9A 1UJWB 4PA7A 4D6TH 5A9GA 3I5DA 1QR9A 3QO5A 3S3XA 3JAKB 1MSWD 2JDIG 4J9ZB 4DR7B 2VQEO 4I50B 3W7XA 1GM9A 3D36A 1EBOA 2ODMA 4ZOLA 2WA3A 4O4IA 1J5EO 1NKDA 4J7JA 5JJNB 2A3QA 2P67A 1SRYA 1XMOO 4AQYB 2AZ2A 1OCCB 4IIJB 3MAQA 2PGGA 4FK5C 4C7UA 1Z5WA 1THZA 4IT5A 3OR7C 1QLEB 4WFGA 1N33B 4H44B 3RW0A 3K5LA 3GWOA 1PL0A 3T1YO 2NN4A 4NKGB 1WPXA 1H2KA 3JD3A 3ZN0A 1IZ3A 3FFQA 2QKCA 1PNMA 3JATB 1KQSU 2KSDA 3B2EE 2DYRB 4ABMA 4X1KA 1XHZA 4WFFA 4UCRA 4UUJC 2CDYA 2ZQMA 2CH7B 4MTOA 5EBWC 5EC1C 1AR5A 3SPGA 2ZE6A 1T5EA 2HP8A 2NLJC 3SYAA 4B3TB 1CP9A 2XT9A 1PKXA 1F7YA 2A0LA 2YXYA 3E8HA 1N0JA 2WLJA 1SS3A 3UM7A 4UCOA 3JARA 1S77D 5E79Z 4QE7A 3E22A 4X89A 1OCCC 3KCXA 1VF6C 3CRMA 1WP7A 2VQFO 3SR2C 2JEUA 1QLEC 2UU9O 2Y0IA 4NTXA 3AK3A 1B3QA 3CP1A 5LYJB 1D5NA 3R66A 1P4RA 1GKFA 3WB2A 2KKWA 3G6EV 5L3BA 2DYRC 1Q82W 5CB4A 2F43G 3A0BZ 4QPJA 1SC5B 2ZR3A 3E2EA 2UXBO 4FLWA 4JI5O 2DOSA 3H01A 1BE3H 3JSNA 4MSWC 3OFNG 3WFVA 1QBZA 5CA0B 3P32A 2R9AA 4O2AA 4RWUA 2UUBB 3A0RA 4DRXB 1WA8B 4JASA 3ZHRA 3GVMA 1IBMO 4JTCB 2F4VO 2OT5A 1R6TA 1VQLV 3OTOO 1JFFA 5B5EZ 1BGYH 3I56V 5FNVA 3JSLA 3MDSA 5LBQA 2QM4A 4EB6A 2V1DA 3FB6C 1YI2V 2AXTZ 2L6LA 5FLXN 3L72H 2ZIOA 2FMLA 3AEIA 2HKOA 4PI2A 2B1IA 4K3AA 2BSKB 5GONA 5L3GA 4RAIA 2CAZC 5JCOA 3ABLB 1FD9A 1M57B 3DGEA 5CA1B 1O9HA 3LDCA 4JYBA 2EJRA 4X65O 4B7KA 1Y76A 1S72V 5BZBA 4LF9B 3RYHB 4DV0O 3K0DA 4B08A 2UXDO 4CH5A 4B3MB 1BQ0A 1ZTEA 1MNGA 1HNXO 1P7GA 1GN2A 4XDKA 5IJ0B 1KP3A 3RYFB 4OXSA 4LF4B 4F4LA 4IGGA 3M8AA 1FJGB 4ICGA 4WCEV 2WLKA 3JD4A 3EFFK 1IBKO 1K97A 3UO2A 1WAZA 2CGNA 4FMTA 5KX5B 4Z1MG 1ZX3A 5J2UA 3ABLC 3RBZA 1M57C 1SA0A 3HKCA 4JI8O 4O4HB 4JAAA 4MVMA 1RSOB 4CH4A 2A79B 3APOA 2WA4A 3ASNB 3ZHTA 1F4MA 2ZKOA 3STLC 4G28B 2PY5A 4ASUG 4FPPA 1K8AW 4O2BB 4P2ZA 2FB5A 1XUQA 1EZVH 2QWNB 3IAYA 5KUMA 3TXSA 2OYQA 1H2MA 3OM3B 4YY3O 3T1HO 3DXRB 1EN6A 5IJ0A 4WFBV 4QNHB 4DO2A 2B5UA 3SDLA 1EZJA 4CZZA 3HKBA 2ITDC 1CXZB 3GWKC 1HNWO 1K33A 1SZXA 1WP8A 4QE9A 2DYSB 4PI0A 4LFCB 1O9GA 2ZR2A 4LNUB 4U3FH 2DMXA 4LF6O 1SETA 2JS3A 2LW7A 1Q43A 1QNMA 1YXBA 3UQ8A 3CMAV 3ASNC 4CS2A 4NTWA 5IY5B 1RSOA 4DV1B 1NR1A 1WLEA 3RVYA 4J10A 1H2NA 5BY1A 1FFXB 2QGNA 4TQFA 1H2SB 4RUEA 1ZSPA 2QWPB 4LF7B 1AI7A 3H1HH 3H1IH 2UUCO 4LFAO 3MD0A 1HDJA 3B4SA 4X20B 1GAXA 4U3JA 3CC7V 4AI8A 3AG4B 5IYDO 2PI4A 3ZHQA 2P5OA 2Q68A 1Q7YW 3SPIA 4NXNB 2E5LB 3IFXA 4PHZA 1HR0O 1NS1A 2OCHA 1HWYA 3CHXA 4ZIBA 2Q7EA 3SGIA 1BSMA 4Z1VA 4YJ2B 4GYCB 1D2DA 3G80A 5JH7B 3U0ZA 2Z0AA 5IY5C 4O4LA 2A06H 1Q3EA 3CD6V 2IJKA 1G8MA 3OT7A 1N36O 5IT9N 4MTXA 3RN4A 2DQ3A 2W0FC 2EILC 1AVMA 2B9ZA 2BTQA 2IU0A 3TGUH 4DV5O 4KHPB 5CMUA 4KP4A 4DYLA 5JQGB 1FFXA 2QWRB 3AG4C 3RYCB 3U11A 3N2GA 3RGBA 1VQPV 3KG2A 1HW7A 3VBBA 1BZKA 3CB2A 5LL6Y 1OHHG 4B3SO 2EINB 3CCMV 2IM9A 3ASOB 4MW8A 5IYCO 3CYOA 1XDCA 1YJWV 2ZM6B 4W4LA 3J7AU 1H2LA 1RFYA 2QWOB 3A8TA 4LR3A 5C8YA 4UVAA 1RPRA 3CC2V 1NT2B 4R50A 2Q5ZA 5DN6G 5BR8O 2YEVB 1UFIA 2XOKG 1E1QG 2XAHA 2GUZA 2RNBA 5B1AB 2HHHB 2ADQB 3BA9A 1YJNV 4P9OA 2JGDA 2Y48A 4DV3B 1N8RW 1M56B 5JH7A 5IDJA 3B8NA 4G27B 1Z5VA 2E75B 4NB5A 2UXCB 1BCCH 4DR3O 1PV0A 2MW2B 4ZKIA 2G38A 3B77A 2X7RB 4BW9A 1GM7A 1B06A 4UB8Z 1Z2GA 2XAQA 3JAWA 1Y6XA 1AJPA 1YEWA 1PM9A 4QIWF 2EINC 1BHBA 2F1MA 3JALB 3ASOC 5FPRA 4JYCA 4CS4A 3FB7C 1RPOA 5JVDB 4GX5A 2ITCC 4K0KO 1NBMG 4LBEC 3X2QB 1K9MW 1XNRB 1HP8A 1YTFD 2LGWA 5BMVB 4AHCA 5B1AC 1AJQA 1Q86W 3T2MA 4J9YB 5D5QA 4LF5O 5F2VO 3N2KB 2ZNJA 3BRCA 1M56C 1BQZA 2HFEC 1N34O 3K58A 5L3FA 4MTFA 3HR0A 4CC6A 4LH6A 2QM8A 5CN0A 3L75H 4BIUA 4DV7O 1I94O 3CPWU 2EIJB 3QVNA 4I9WA 3LUTB 4FM0A 3DSQA 4IYHA 4TV9A 1FXVA 4OPHA 2F95B 1NR7A 1K5QA 5KHIA 4ZOLB 4O4IB 3X2QC 4LC1A 1AILA 5JVDA 2E74B 1PNKA 2K9PA 5KA5A 2VS0A 3CEIA 2VQEB 4QPKA 3H1LH 2OIEA 4I0XA 4P9PA 4LFBB 2QEXV 5IYBO 5BMVA 1J5EB 3CRAA 1XEQA 2FKXA 1G4YB 1VQNV 1AR1B 4DK0A 2XAJA 1XMOB 4LP8A 1PNLA 1SERA 3H1KH 5KAFZ 2EIJC 1U97A 1LR1A 1GH6A 1H2GA 4DK1A 4X1KB 3W7UA 4O4JB 3W7SA 3ETEA 2DWDC 4JI7O 4IYIA 3T1YB 4XBFA 2F66C 3D36C 3R65A 3BCCH 1MG1A 2JIZG 2MK3A 3BHPA 1E79G 5EBLC 5B1NA 1TUEB 2GHYA 4NXMO 3TXQA 2CTRA 1H38A 4X1IA 2JS5A 2DWEC
chains in the Genus database with same CATH topology
3JARB 3E22B 1V9PA 1I94B 3HKDB 1HNZB 4CH6A 4FLVA 3THOA 2QM4A 4EB6A 5KX5A 3BABA 4UCSA 1JMKC 1TA8A 5EYPA 5EZYB 3SJBC 2ZIOA 5LOVB 4FLTA 4IHJA 4O4HA 4PI2A 2GV9A 4FLZA 1VF7A 2Q0AA 5GONA 2RQ6A 4FLUA 2CAZC 5JCOA 4I55A 4FVMA 2VQFB 4D7SA 5CA1B 1O9HA 1I7FA 5K1PA 4JI1B 5CB4B 3HKEA 3K59A 3RWRD 4O2BA 4LF9B 2YI9A 3RYHB 1KU9A 4B08A 1XI1A 1QQCA 3VQXA 4DR2B 4CH5A 4B3MB 4O2AB 4O4JA 5KMGB 5BR8B 2VWKA 5IJ0B 5KHJA 2OWOA 2UXBB 3RYFB 4JI5B 3RYIA 4LF4B 1TUBA 5ITZA 4WBNB 3PN1A 5D5PA 1FJGB 1JFFB 5LP6B 4X1IB 5JJEB 5FNVB 3SJCC 3UT5B 4LNUA 5LA6A 1IBMB 4EB6B 4I4TA 5KX5B 1D5AA 3OTOB 4JV5B 5J2UA 5EYPB 1M4UA 1SA0A 2ZNIA 3HKCA 4IHJB 4TOIA 4O4HB 2PZSA 2YXLA 5GONB 4CH4A 3JSLA 1Q5OA 3K5NA 4I55B 4DR4B 3VQYA 4UCUA 5FPOA 1S5JA 4LH7A 4EEQA 1ZAUA 4X20A 2PY5A 3HKEB 2Q7GA 5IYZA 4YJ3A 4O2BB 2ZIMA 4TUYA 4UCVA 3IAYA 3ZS8C 4LF5B 2OYQA 4GKJB 4X65B 4ZHQA 4JI4B 5IJ0A 5LP6C 3RYIB 1N34B 2UUAB 3HKBA 3CSXA 1TUBB 5ITZB 4WBNA 4PI0A 2R72A 4LFCB 4JI6B 5LP6A 4YJ2A 1O9GA 1HNXB 3ZEDA 1M93A 4X1YB 4LNUB 4ZI7A 5LA6B 4GLXA 1Q43A 4EFEA 4I4TB 3UQ8A 4FM1A 3K5MA 5J2UB 5JCOC 3K57A 1SA0B 1WN7A 3HKCB 4CS2A 1TAEA 1RSOA 4DV1B 2PYJA 1B04A 1KMIZ 5JQGA 4FFBA 3ETQA 3VQWA 4TV8B 1FFXB 4TQFA 3RYCA 1H2SB 1IBLB 4LF7B 5KHGA 4TQDA 1XMQB 4JI8B 2UU9B 4DR5B 5IWAB 4X20B 4U3JA 3BA8A 5IYZB 4YJ3B 3ICXA 4TUYB 2P5OA 4DR6B 1Q8IA 4CC5A 4NXNB 2E5LB 2R70A 4PHZA 4ZHQB 2YIBA 2JVDA 4NVPA 1N32B 4KL1A 1WPBA 2QJ1A 3HKBB 3CHXA 4ZIBA 2Q7EA 3SGIA 4DV2B 1DGSA 4DV4B 5KHKA 4CS3A 4YJ2B 4GYCB 1XHXA 5IJ9A 4JI2B 2E3CA 4X1YA 5JH7B 3U0ZA 4DV6B 4ZI7B 4JI7B 5EIBC 4O4LA 2F4VB 1Q3EA 1L8DA 2PUSA 2YIBD 3JASA 3JAKA 4NXMB 2P22C 2BTQA 1WNSA 4B3RB 4KHPB 3QF7A 5JQGB 4I50A 5LXTB 4FFBB 4TV8A 1FFXA 4LF8B 2V4DA 3RYCB 3U11A 3N2GA 3WB1A 3JALA 3RGBA 1JJOA 1HW7A 1M5IA 4YHHB 3CB2A 4HBNA 4OX9B 5JJJB 4U3JB 2IM9A 4IIJA 3OTFA 5EIBD 2ZM6B 4GKKB 2F93B 4LR3A 2UUCB 5C8YA 2ZCEA 2Q7HA 4UCTA 4LFAB 4EFBA 1NT2B 3N2KA 2BTOA 4DV0B 4BWAA 4JI0B 2UXDB 1XNQB 1TVKB 5K1XA 4CH3A 2HHHB 3LNNA 3BA9A 3JATA 4DV3B 3K5OA 5J2TA 1HR0B 5IJ9B 3QG5A 5JH7A 1Z5VA 4O4LB 2UXCB 3M7MX 3JASB 5LMUB 3JAKB 4K8XA 4BW9A 2BTQB 4FM2A 3A2FA 4Q6GA 1IBKB 4DR7B 2PYLA 4I50B 3JAWA 1YEWA 5LXTA 1XQ8A 4I9QA 4ZOLA 1P49A 2F1MA 3RFRA 3N2GB 4O4IA 3JALB 3QTCA 5FPRA 4CS4A 1G6UA 1N36B 2HEPA 5JVDB 1QHTA 3VQVA 4FLYA 5JJNB 4DV5B 2YIAA 4HNAB 4UFZA 4AQYB 3MAQA 4IIJB 4K8ZA 5LYJA 4DUZB 5LMNB 2PGGA 1TGOA 1XNRB 4DR1B 1Z5WA 5BMVB 4AHCA 5C8YB 4F6RB 5D5QA 4FLXA 1N33B 4B3SB 3N2KB 3K5LA 2ZNJA 3BRCA 4L8JA 1TVKA 2ZINA 3FFQA 3K58A 3JATB 3B2EE 2PTMA 5CA0A 4YY3B 2YI8A 5J2TB 4CC6A 4X1KA 3T1HB 4LH6A 1XHZA 4UCRA 4DRXA 1HNWB 1T5EA 4B3TB 4FM0A 3DSQA 4TV9A 4X64B 3BPZA 1SKVA 4LF6B 3JAWB 2F95B 5KHIA 4UCOA 3JARA 4ZOLB 4DR3B 3E22A 3HKDA 4O4IB 3U10A 4JYAB 4DUYB 5JVDA 3SR2C 5EZYA 2XHBA 4HNAA 5LOVA 2RJZA 2VQEB 1SQGA 5LYJB 4LFBB 3WB0A 5BMVA 5CA1A 1J5EB 3WB2A 2KKWA 4F6RA 3BAAA 1X4TA 4D7TA 2JGUA 4DK0A 4K0KB 5CB4A 1XMOB 4X66B 4FLWA 3JSNA 2VWJA 3RYHA 5CA0B 4DK1A 4X1KB 2R9AA 4O2AA 1SQFA 4O4JB 5KMGA 2UUBB 5KHHA 4DRXB 3T1YB 3RYFA 2F66C 4AILC 3BHPA 4TV9B 1JFFA 4JI3B 4X62B 3SJAC 2EX3A 4X1IA 5FNVA 3UT5A 2JS5A 4DV7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WPB A;  4LR3 A; 
#chains in the Genus database with same CATH topology
 3JAR B;  3E22 B;  3ZRV A;  1NJI W;  2QM7 A;  3THO A;  2QR4 A;  2HJD A;  1YJ9 V;  2XAF A;  1FS0 G;  4IHJ A;  4MT8 A;  4OX9 O;  4GT1 A;  2EZO A;  3OMN B;  2NR5 A;  2IJJ A;  1MMM A;  3K03 A;  2QDO A;  2JRI A;  1Q81 W;  1NTM H;  3CJH A;  2VQF B;  1I0H A;  1DLB A;  3JD2 A;  5CB4 B;  5H6R A;  3AG3 C;  5E1A C;  2ZT9 B;  3TJT A;  3K59 A;  1KU9 A;  3OAA G;  4GCZ A;  4XDJ A;  4O2A B;  3K0G A;  4PJ0 Z;  1R73 A;  3AK1 A;  4JI6 O;  4O4J A;  1VF5 B;  2BE3 A;  3J81 N;  2UXB B;  4JI5 B;  3ABM B;  1TUB A;  5ITZ A;  4Q20 A;  1JFF B;  3CCR V;  5LP6 B;  5AG2 A;  5FNV B;  3SJC C;  2QTO A;  4UVB A;  1VQ7 V;  4QGP A;  2JJ2 G;  1IBM B;  4EB6 B;  2X0L A;  3FB5 C;  1D5A A;  1K34 A;  3OTO B;  2N04 A;  2VRZ A;  1GN6 A;  3ZHV A;  2P4K A;  3BFR A;  2ZNI A;  1MZE A;  4TOI A;  4E4E A;  5CBF A;  4K35 A;  2E76 B;  1GM8 A;  1IDS A;  2FTK A;  5GON B;  1JCH A;  1Q5O A;  4AQY O;  3B8M A;  4H0L B;  2QE7 G;  3PJS K;  1ZUQ A;  1K92 A;  5FPO A;  4WFH A;  3VOU A;  1S5J A;  2HVK C;  3IC9 A;  4EEQ A;  1Y76 B;  1I5Y A;  5IYZ A;  3K08 A;  1YZB A;  1LNQ A;  2ZIM A;  2WPD G;  1FAF A;  1ZLZ A;  3ABM C;  1QU7 A;  3CCE V;  1L0L H;  4DV4 O;  1YSC A;  4X65 B;  4MVZ A;  4RUF A;  5DEC A;  4JI4 B;  3LSQ A;  1K3E A;  4UXN A;  5LP6 C;  3CS5 A;  1XBL A;  3CCQ V;  1W0J G;  1QVF U;  3F5T A;  4YIP A;  4B3T O;  5LP6 A;  1HNX B;  3ZED A;  1M93 A;  3FKS G;  4ZI7 A;  4PA6 A;  1RM1 B;  2EZP A;  1MAB G;  4A5U B;  4LF8 O;  2A9H A;  2Q9L A;  3OR6 C;  5J2U B;  5JCO C;  1SA0 B;  1WN7 A;  3HKC B;  3KCY A;  2D2C B;  4J7K A;  1B04 A;  1KMI Z;  2XTA A;  5J9P C;  4FJC C;  4TV8 B;  2BCC H;  4GKK O;  3LSS A;  1XMQ B;  2JEX A;  4JI8 B;  3ZRX A;  3F7V C;  1YHQ V;  4NTY A;  3UO3 A;  3MHH C;  3ZIA G;  4FZ1 A;  5LGU A;  3D3Q A;  1AJN A;  4U7N A;  1NI8 A;  2R70 A;  3IC7 A;  1S5H C;  2YIB A;  2JVD A;  2LFS A;  3FYI B;  4R8C A;  2UUB O;  4KL1 A;  2QJ1 A;  3JCU Z;  1XL6 A;  3HKB B;  3K9A A;  1RM1 C;  1SQV H;  2ZXW B;  3ZMV A;  5LHI A;  5LMU O;  3W7T A;  1M1K W;  4CS3 A;  1V54 B;  1XHX A;  3STZ C;  1NH2 D;  2XUM A;  5EIB C;  3OUF A;  1B6Q A;  4QJF B;  2PUS A;  3SYQ A;  3JAS A;  3Q4H A;  1SQB H;  3F5W C;  4RQE A;  1AI6 A;  1PPJ H;  2JJ1 G;  5LXT B;  4TV8 A;  3LDE A;  3IJ4 A;  1MA1 A;  5LMN O;  4DUZ O;  1JJ2 U;  3ZMS A;  2KG7 B;  1JJO A;  4DR1 O;  4B7E A;  1M5I A;  5B66 Z;  4J41 A;  4PA3 A;  2IH3 C;  4RO2 A;  4U3J B;  3S3W A;  1KP2 A;  2WWW A;  3QO8 A;  1WB8 A;  1R3I C;  2LJ2 A;  3TK1 A;  1NH2 B;  3DTU B;  2L35 A;  1OV9 A;  3UKM A;  4LF9 O;  2F93 B;  2IJI A;  3E35 A;  1ZL8 A;  2YC0 A;  4R7C A;  5KA6 A;  2UUC B;  4B3M O;  2ZXW C;  2IJH A;  2ZCE A;  4LFA B;  2RN9 A;  4W4K A;  1KYO F;  2ETN A;  2LFR A;  4EFB A;  4CBC A;  5HFM A;  1CEZ A;  4KXR A;  4E2L A;  1V54 C;  1NU1 H;  1US6 A;  4JI0 B;  3AK2 A;  3ZHU A;  3CRQ A;  3HPL C;  3K5O A;  5J2T A;  1HR0 B;  1BT8 A;  4X64 O;  4DXW A;  2LQT A;  4O4L B;  4IL6 Z;  3M7M X;  4JTD B;  2H3O A;  3ZMZ A;  1IUR A;  1KB9 F;  1GTO A;  2N05 A;  3L70 H;  4JYA O;  4DUY O;  1GN4 A;  1MZF A;  1R3L C;  2WLI A;  5JWP A;  2BTQ B;  2PYL A;  1URF A;  2YID A;  5LXT A;  4MW3 A;  4I9Q A;  3N2G B;  3QTC A;  2KG7 A;  2EIL B;  1N36 B;  2HEP A;  1Q90 D;  4DV5 B;  4HNA B;  4K8Z A;  4X66 O;  1XIL A;  1TGO A;  1DF5 A;  3BVO A;  5C8Y B;  1L0N H;  2N74 A;  3KKY A;  4B3S B;  3N27 A;  3OMA B;  4MVR A;  3CME V;  1QVG U;  2GUZ B;  2K1E A;  4OGQ B;  3E8G A;  2JGD B;  4GX1 A;  1NTK H;  1QR8 A;  3P3N A;  2HR3 A;  1FXH A;  2KQX A;  3CCV V;  4HZ3 A;  4KUM A;  3OW2 U;  3ZJZ A;  3O9O A;  2HG5 C;  3ETG A;  3BPZ A;  2ZE5 A;  2YIC A;  3JAW B;  4JZ2 A;  4MVU A;  5DM6 V;  4DR3 B;  3O65 A;  3HKD A;  3D8C A;  4MTG A;  4N23 A;  1FXK A;  4OPA A;  5EZY A;  2P90 A;  4KFM A;  2XAS A;  4HNA A;  5LOV A;  1VIB A;  2RJZ A;  2P4V A;  3L73 H;  4FIP C;  1VP7 A;  4DW1 A;  5L3D A;  1N4C A;  4UV8 A;  2WAM A;  1VQ6 V;  2EBO A;  3BAA A;  4D7T A;  1GK9 A;  2DN9 A;  2JGU A;  4K0K B;  1S76 D;  1X59 A;  4GX2 A;  1K7D A;  1Y66 A;  3TET A;  3ZRS A;  2ZE7 A;  1NVP D;  1U96 A;  1R6N A;  3K3W A;  5KUK A;  2GTA A;  1SQF A;  1IVS A;  5KMG A;  3NXS A;  1KEC A;  3CX5 F;  3ABK C;  2QTS A;  1MSD A;  3LDD A;  1NQT A;  2Z3Y A;  3A0H Z;  4JV5 O;  4TV9 B;  4JI3 B;  4X62 B;  2EX3 A;  4JZG A;  3UT5 A;  4DV7 B;  4KHP O;  1R3J C;  5H6Q A;  1I94 B;  1HNZ B;  1K5S A;  4CH6 A;  1VQ8 V;  4DR4 O;  3BAB A;  1JMK C;  1TA8 A;  5EYP A;  3SJB C;  5CBG A;  1NVP B;  4JF3 A;  2Y0P A;  4FLZ A;  4X88 A;  2Q0A A;  4I0X B;  2RQ6 A;  1FPO A;  1Y74 B;  3RT3 C;  3FX7 A;  4I55 A;  4FVM A;  4D7S A;  2ZM6 O;  4PDM A;  1I7F A;  2Z5U A;  3DC6 A;  3FAV B;  2LW1 A;  4GKJ O;  4JI1 B;  3E86 A;  4GZR B;  3SYO A;  2AHZ A;  2Y69 B;  3HKE A;  2WLM A;  2WSS G;  2UUA O;  4PA4 A;  1F4N A;  1QQC A;  3VQX A;  4DR2 B;  1W2B U;  2CTP A;  2HHH O;  1VAR A;  4DV3 O;  2VWK A;  1AI5 A;  4JTA B;  2OWO A;  4NYK A;  2CGO A;  4J11 A;  3RYI A;  4PDV A;  2UXC O;  2C2A A;  1COW G;  4LWS A;  4WBN B;  2KB1 A;  3K9S A;  1Q6H A;  2O57 A;  5LHH A;  4X1I B;  5JJE B;  5LA6 A;  3E83 A;  4I4T A;  1ZWI C;  1F23 A;  2Q6A A;  1BMF G;  2LGQ A;  4TT3 G;  3ZBH A;  1IBL O;  3B40 A;  4IHJ B;  1VQ4 V;  2PZS A;  4DR5 O;  5BXZ A;  3M99 B;  5IWA O;  4J42 A;  2YXL A;  3TCU A;  3CRC A;  2HJF C;  1Y74 A;  3K5N A;  2Y69 C;  3CJH B;  4DR6 O;  1ENV A;  4G2K A;  3FAV A;  3QNE A;  2ATK C;  3F7Y C;  4LH7 A;  2P6J A;  1ZAU A;  1N32 O;  3OGC C;  2P06 A;  2QKA A;  4YJ3 A;  3CE2 A;  4BW5 A;  5B3S C;  4TUY A;  1BS3 A;  4DV2 O;  4UCV A;  3ZS8 C;  3AG3 B;  4BIZ A;  4ZHQ A;  4JI2 O;  4RQF A;  1GMG A;  4DV6 O;  1P84 F;  1K4C C;  4PDL A;  5EBM C;  3CSX A;  1TUB B;  5ITZ B;  1W0K G;  3LSU A;  4WBN A;  2R72 A;  3ZCC A;  4JI6 B;  4HYO A;  4X1Y B;  4B3R O;  3IGA C;  3H9V A;  4GLX A;  4PDR A;  4EFE A;  1F51 A;  5GTH Z;  4FM1 A;  3WG7 B;  4MVQ A;  4YHH O;  2PYJ A;  3ABT A;  1SQX H;  1KBH A;  4FFB A;  3ETQ A;  3VQW A;  3JYC A;  1V55 C;  3CRR A;  4LFB O;  3KZI Z;  2EIM B;  1P7B A;  2A7W A;  2UU9 B;  2X6B A;  2M7W A;  1IXB A;  1VQ5 V;  1BHA A;  5IYZ B;  3T4D A;  5LGT A;  4H33 A;  4MVO A;  3APQ A;  1XNQ O;  1S3J A;  3ML0 A;  1SF9 A;  2PI5 A;  3C90 A;  4TSF G;  4NVP A;  2M6Y A;  2CTW A;  4GUN A;  4JYY A;  3W7W A;  1A32 A;  2AHY A;  3AG2 C;  3DC5 A;  3CCL V;  1VQK V;  1YIT V;  4JAU A;  5L3C A;  1LUV A;  4DV4 B;  3WG7 C;  2Q0O C;  2QSA A;  5IJ9 A;  2E3C A;  4X1Y A;  4DR7 O;  4ZI7 B;  2V7Q G;  2F4V B;  1VQ9 V;  4WFA V;  1L8D A;  2YIB D;  3OEH G;  5DED A;  2OCC B;  5TIS Z;  3JAK A;  4EKW A;  2EIM C;  2H8P C;  2P22 C;  1RP3 B;  4I50 A;  1XOU A;  2OTJ V;  4LF8 B;  2V4D A;  1GN3 A;  1EM1 A;  2F23 A;  5LHG A;  1N33 O;  2LP7 A;  1Y67 A;  4IIJ A;  1VF6 A;  5EIB D;  4GKK B;  2CTQ A;  1FKA O;  4UCT A;  2Q7H A;  2W6J G;  5C93 A;  1L1F A;  2ZE8 A;  2BTO A;  4DV0 B;  2UXD B;  1TVK B;  4CH3 A;  3JAT A;  2OCC C;  3P30 A;  5KAI Z;  3QG5 A;  1NZ6 A;  1E1R G;  3CXC U;  2CH7 A;  2OIG A;  3B09 A;  5FL7 G;  1QCE A;  3JD0 A;  3JAS B;  3Q4H B;  5LMU B;  4K8X A;  3L74 H;  2GSM B;  1YF2 A;  4FM2 A;  3A2F A;  4Q6G A;  1IBK B;  2DJV A;  1AP6 A;  5KLV H;  3G71 V;  1XQ8 A;  1H8H G;  3OEE G;  2P7T C;  1P49 A;  3RFR A;  1G6U A;  2CK3 G;  3E8B A;  1QHT A;  3VQV A;  4FLY A;  2YIA A;  3JCZ A;  4NR1 A;  4U7O A;  4UFZ A;  2AZ0 A;  1DK1 A;  3OMI B;  1YIJ V;  4PA9 A;  2ZDI C;  2YS8 A;  5LYJ A;  4DUZ B;  5LMN B;  4P30 A;  5H9C A;  4DR1 B;  2IU3 A;  2QWQ B;  1ZL8 B;  1LUW A;  4F6R B;  2ZDI A;  4FLX A;  1Y4M A;  1UPG A;  4L8J A;  3CC4 V;  4JI4 O;  1SQP H;  3ZHS A;  1TVK A;  2ZIN A;  4MS2 A;  4XDL A;  1K4D C;  2PTM A;  4UVC A;  1G1X B;  1JA8 A;  5CA0 A;  4YY3 B;  2YI8 A;  5J2T B;  3T1H B;  2WLH A;  3T4Z A;  2OTL V;  2GTS A;  4DRX A;  1WA8 A;  2YXH A;  1HNW B;  2Q67 A;  2WLI B;  2DE0 X;  4X64 B;  2RDC A;  3JAM N;  1SKV A;  1M9N A;  4LF6 B;  3CCJ V;  5L3E A;  5A2Q N;  1KD1 W;  2GBO A;  3U10 A;  1EFR G;  1IX9 A;  3WU2 Z;  4DUY B;  4JYA B;  2QA4 V;  2XHB A;  1XMQ O;  3BEH A;  3GB7 C;  4TWK A;  1PD3 A;  1SQG A;  3K06 A;  2BSK A;  3NR7 A;  2BOC C;  4X8A A;  3WB0 A;  5B1B B;  3OUS A;  2IW5 A;  1OCZ B;  5CA1 A;  4F6R A;  3CWB H;  1X4T A;  2Y4U A;  2W6I G;  4BAY A;  2UXX A;  1I5X A;  4WFE A;  1PP9 H;  4HAM A;  3HB3 B;  1YVW A;  2B1G A;  4X66 B;  1FYJ A;  4YXW G;  4LF4 O;  3T1C A;  2VWJ A;  1QLN A;  3RYH A;  2ARH A;  3P3P A;  1EN5 A;  4PD4 F;  1FJG O;  1OZ0 A;  4N21 A;  1ROP A;  2YUA A;  5KHH A;  3RYF A;  1KC8 W;  4AIL C;  1I08 A;  3RVZ A;  2R9I A;  4BR6 A;  4F6E A;  3H1J H;  3SJA C;  5HFL A;  5CBH A;  4J80 A;  1JR9 A;  3OE7 G;  1V9P A;  3HKD B;  4X9Q A;  1JOY A;  4FLV A;  1GRJ A;  1CPY A;  1FXK B;  2ZD9 A;  5KX5 A;  1DF4 A;  1SQQ H;  4UCS A;  2WLL B;  2AGA A;  5B1B C;  2XAG A;  5EZY B;  1OCZ C;  1VEW A;  5LOV B;  4FLT A;  4O4H A;  1KKD A;  2GV9 A;  2RMK B;  3SYC A;  3G4S V;  1VF7 A;  4ZBM A;  4FLU A;  3G67 A;  1DTO A;  2ILM A;  3OD4 A;  1JX9 A;  3BY6 A;  1JQ0 A;  5K1P A;  2HVJ C;  5LGN A;  2UXN A;  2LO1 A;  3FD9 A;  3RWR D;  4O2B A;  1SZT A;  2YI9 A;  2FL4 A;  1IXM A;  1XI1 A;  4JI0 O;  1AP5 A;  2JK5 C;  2NNU A;  4JAV A;  4LFC O;  5KMG B;  5BR8 B;  2DYS C;  2YSU B;  3DXR A;  3C3T A;  5KHJ A;  1WJZ A;  1YCI A;  4H13 B;  2X6C A;  3SPC A;  3EXA A;  2Q4P A;  3SPJ A;  2Q8V A;  3FYE B;  3FB8 C;  3PN1 A;  5D5P A;  1FXK C;  2AW9 A;  3AG1 B;  2CE4 A;  3QO7 A;  3ABK B;  4DV1 O;  3UT5 B;  4LNU A;  3EHB B;  4UB6 Z;  3ZMU A;  4J7Z A;  3ETD A;  2WLL A;  4JV5 B;  4LF7 O;  4FFK A;  5EYP B;  1M4U A;  3K04 A;  2EIK B;  5EK0 A;  2XND G;  2HLD G;  4I55 B;  5H2F Z;  4DR4 B;  4PV1 B;  3VQY A;  4UCU A;  3L71 H;  3OGI B;  4NXN O;  2E5L O;  4X20 A;  4DW0 A;  3HKE B;  2Q7G A;  4FZ0 A;  4BIO A;  1PL4 A;  2PF4 E;  2EUL A;  1Q6U A;  2QKS A;  5B1O A;  4LF5 B;  1ORQ C;  4GKJ B;  3LNM B;  3K79 A;  3AG1 C;  2Q73 A;  3RYI B;  2X6A A;  1N34 B;  2UUA B;  4LWS B;  3SJQ C;  3L9D A;  2WLN A;  1W59 A;  1J95 A;  4R6Z A;  3SYP A;  4YJ2 A;  1XRE A;  2IBZ H;  2EIK C;  2RCV A;  3JD1 A;  5LA6 B;  4PEL A;  2CUG A;  4I4T B;  1NTZ H;  1KUQ A;  3E89 A;  1EN4 A;  1R1B A;  2YDE A;  3K5M A;  1OCR B;  3K57 A;  2BOB C;  3ZRW B;  1TAE A;  2DQ0 A;  1OCO B;  5JQG A;  4H37 A;  2R9R B;  3RYC A;  2GDS A;  2EJ7 A;  3SPH A;  1IBL B;  3ZN1 A;  5KHG A;  3ABU A;  4TQD A;  1JPX A;  4DR5 B;  5IWA B;  1R3K C;  3BA8 A;  4YJ3 B;  2Y4T A;  3ICX A;  4TUY B;  1JVM A;  4DR6 B;  4LCU C;  1Q8I A;  4CC5 A;  3MHS C;  4ZHQ B;  1Q6I A;  1WB7 A;  5B3S B;  1N32 B;  3E8F A;  4JPR A;  2D3O W;  1WPB A;  2YEV A;  1SES A;  1FFT B;  2W0X A;  3UCS C;  2FYU H;  1S0V A;  4DV2 B;  3ZMT A;  1AR4 A;  3EVK A;  1DGS A;  1OJH A;  4I7Z B;  5GW7 A;  5KHK A;  5EC2 C;  1VQO V;  1OCR C;  2ADP A;  4JI2 B;  2DW4 A;  2H94 A;  4JI3 O;  4DV6 B;  4JI7 B;  3CXH F;  3CCS V;  4X62 O;  3G6B A;  3I55 V;  1OCO C;  1HNZ O;  1H8E G;  1KKC A;  3ZRW A;  4NXM B;  4JGS A;  4L87 A;  1VQM V;  1WNS A;  1YTF B;  4B3R B;  1AB3 A;  3QF7 A;  1VMG A;  3J80 N;  4FFB B;  1MOF A;  4YIO A;  1N0N A;  3WB1 A;  2IH1 C;  3JAL A;  1XNR O;  3D3I A;  5H5N A;  4YHH B;  5IE9 A;  1ARO P;  1K73 W;  1YDX A;  4HBN A;  4OX9 B;  5JJJ B;  4MVS A;  4JI1 O;  1V55 B;  3AG7 A;  3OTF A;  3C3S A;  1AI4 A;  4GX0 A;  4DR2 O;  1S5L Z;  1M90 W;  1R6K A;  4I5S A;  4WF9 V;  3N2K A;  3CCU V;  1BL8 A;  1GO3 F;  4BWA A;  1XNQ B;  5K1X A;  3ZX6 A;  3LNN A;  5CA3 A;  2Q69 A;  4Z2W A;  5IJ9 B;  5GTI Z;  1XL4 A;  3AG2 B;  4UV9 A;  1UJW B;  4PA7 A;  4D6T H;  5A9G A;  3I5D A;  1QR9 A;  3QO5 A;  3S3X A;  3JAK B;  1MSW D;  2JDI G;  4J9Z B;  4DR7 B;  2VQE O;  4I50 B;  3W7X A;  1GM9 A;  3D36 A;  1EBO A;  2ODM A;  4ZOL A;  2WA3 A;  4O4I A;  1J5E O;  1NKD A;  4J7J A;  5JJN B;  2A3Q A;  2P67 A;  1SRY A;  1XMO O;  4AQY B;  2AZ2 A;  1OCC B;  4IIJ B;  3MAQ A;  2PGG A;  4FK5 C;  4C7U A;  1Z5W A;  1THZ A;  4IT5 A;  3OR7 C;  1QLE B;  4WFG A;  1N33 B;  4H44 B;  3RW0 A;  3K5L A;  3GWO A;  1PL0 A;  3T1Y O;  2NN4 A;  4NKG B;  1WPX A;  1H2K A;  3JD3 A;  3ZN0 A;  1IZ3 A;  3FFQ A;  2QKC A;  1PNM A;  3JAT B;  1KQS U;  2KSD A;  3B2E E;  2DYR B;  4ABM A;  4X1K A;  1XHZ A;  4WFF A;  4UCR A;  4UUJ C;  2CDY A;  2ZQM A;  2CH7 B;  4MTO A;  5EBW C;  5EC1 C;  1AR5 A;  3SPG A;  2ZE6 A;  1T5E A;  2HP8 A;  2NLJ C;  3SYA A;  4B3T B;  1CP9 A;  2XT9 A;  1PKX A;  1F7Y A;  2A0L A;  2YXY A;  3E8H A;  1N0J A;  2WLJ A;  1SS3 A;  3UM7 A;  4UCO A;  3JAR A;  1S77 D;  5E79 Z;  4QE7 A;  3E22 A;  4X89 A;  1OCC C;  3KCX A;  1VF6 C;  3CRM A;  1WP7 A;  2VQF O;  3SR2 C;  2JEU A;  1QLE C;  2UU9 O;  2Y0I A;  4NTX A;  3AK3 A;  1B3Q A;  3CP1 A;  5LYJ B;  1D5N A;  3R66 A;  1P4R A;  1GKF A;  3WB2 A;  2KKW A;  3G6E V;  5L3B A;  2DYR C;  1Q82 W;  5CB4 A;  2F43 G;  3A0B Z;  4QPJ A;  1SC5 B;  2ZR3 A;  3E2E A;  2UXB O;  4FLW A;  4JI5 O;  2DOS A;  3H01 A;  1BE3 H;  3JSN A;  4MSW C;  3OFN G;  3WFV A;  1QBZ A;  5CA0 B;  3P32 A;  2R9A A;  4O2A A;  4RWU A;  2UUB B;  3A0R A;  4DRX B;  1WA8 B;  4JAS A;  3ZHR A;  3GVM A;  1IBM O;  4JTC B;  2F4V O;  2OT5 A;  1R6T A;  1VQL V;  3OTO O;  1JFF A;  5B5E Z;  1BGY H;  3I56 V;  5FNV A;  3JSL A;  3MDS A;  5LBQ A;  2QM4 A;  4EB6 A;  2V1D A;  3FB6 C;  1YI2 V;  2AXT Z;  2L6L A;  5FLX N;  3L72 H;  2ZIO A;  2FML A;  3AEI A;  2HKO A;  4PI2 A;  2B1I A;  4K3A A;  2BSK B;  5GON A;  5L3G A;  4RAI A;  2CAZ C;  5JCO A;  3ABL B;  1FD9 A;  1M57 B;  3DGE A;  5CA1 B;  1O9H A;  3LDC A;  4JYB A;  2EJR A;  4X65 O;  4B7K A;  1Y76 A;  1S72 V;  5BZB A;  4LF9 B;  3RYH B;  4DV0 O;  3K0D A;  4B08 A;  2UXD O;  4CH5 A;  4B3M B;  1BQ0 A;  1ZTE A;  1MNG A;  1HNX O;  1P7G A;  1GN2 A;  4XDK A;  5IJ0 B;  1KP3 A;  3RYF B;  4OXS A;  4LF4 B;  4F4L A;  4IGG A;  3M8A A;  1FJG B;  4ICG A;  4WCE V;  2WLK A;  3JD4 A;  3EFF K;  1IBK O;  1K97 A;  3UO2 A;  1WAZ A;  2CGN A;  4FMT A;  5KX5 B;  4Z1M G;  1ZX3 A;  5J2U A;  3ABL C;  3RBZ A;  1M57 C;  1SA0 A;  3HKC A;  4JI8 O;  4O4H B;  4JAA A;  4MVM A;  1RSO B;  4CH4 A;  2A79 B;  3APO A;  2WA4 A;  3ASN B;  3ZHT A;  1F4M A;  2ZKO A;  3STL C;  4G28 B;  2PY5 A;  4ASU G;  4FPP A;  1K8A W;  4O2B B;  4P2Z A;  2FB5 A;  1XUQ A;  1EZV H;  2QWN B;  3IAY A;  5KUM A;  3TXS A;  2OYQ A;  1H2M A;  3OM3 B;  4YY3 O;  3T1H O;  3DXR B;  1EN6 A;  5IJ0 A;  4WFB V;  4QNH B;  4DO2 A;  2B5U A;  3SDL A;  1EZJ A;  4CZZ A;  3HKB A;  2ITD C;  1CXZ B;  3GWK C;  1HNW O;  1K33 A;  1SZX A;  1WP8 A;  4QE9 A;  2DYS B;  4PI0 A;  4LFC B;  1O9G A;  2ZR2 A;  4LNU B;  4U3F H;  2DMX A;  4LF6 O;  1SET A;  2JS3 A;  2LW7 A;  1Q43 A;  1QNM A;  1YXB A;  3UQ8 A;  3CMA V;  3ASN C;  4CS2 A;  4NTW A;  5IY5 B;  1RSO A;  4DV1 B;  1NR1 A;  1WLE A;  3RVY A;  4J10 A;  1H2N A;  5BY1 A;  1FFX B;  2QGN A;  4TQF A;  1H2S B;  4RUE A;  1ZSP A;  2QWP B;  4LF7 B;  1AI7 A;  3H1H H;  3H1I H;  2UUC O;  4LFA O;  3MD0 A;  1HDJ A;  3B4S A;  4X20 B;  1GAX A;  4U3J A;  3CC7 V;  4AI8 A;  3AG4 B;  5IYD O;  2PI4 A;  3ZHQ A;  2P5O A;  2Q68 A;  1Q7Y W;  3SPI A;  4NXN B;  2E5L B;  3IFX A;  4PHZ A;  1HR0 O;  1NS1 A;  2OCH A;  1HWY A;  3CHX A;  4ZIB A;  2Q7E A;  3SGI A;  1BSM A;  4Z1V A;  4YJ2 B;  4GYC B;  1D2D A;  3G80 A;  5JH7 B;  3U0Z A;  2Z0A A;  5IY5 C;  4O4L A;  2A06 H;  1Q3E A;  3CD6 V;  2IJK A;  1G8M A;  3OT7 A;  1N36 O;  5IT9 N;  4MTX A;  3RN4 A;  2DQ3 A;  2W0F C;  2EIL C;  1AVM A;  2B9Z A;  2BTQ A;  2IU0 A;  3TGU H;  4DV5 O;  4KHP B;  5CMU A;  4KP4 A;  4DYL A;  5JQG B;  1FFX A;  2QWR B;  3AG4 C;  3RYC B;  3U11 A;  3N2G A;  3RGB A;  1VQP V;  3KG2 A;  1HW7 A;  3VBB A;  1BZK A;  3CB2 A;  5LL6 Y;  1OHH G;  4B3S O;  2EIN B;  3CCM V;  2IM9 A;  3ASO B;  4MW8 A;  5IYC O;  3CYO A;  1XDC A;  1YJW V;  2ZM6 B;  4W4L A;  3J7A U;  1H2L A;  1RFY A;  2QWO B;  3A8T A;  4LR3 A;  5C8Y A;  4UVA A;  1RPR A;  3CC2 V;  1NT2 B;  4R50 A;  2Q5Z A;  5DN6 G;  5BR8 O;  2YEV B;  1UFI A;  2XOK G;  1E1Q G;  2XAH A;  2GUZ A;  2RNB A;  5B1A B;  2HHH B;  2ADQ B;  3BA9 A;  1YJN V;  4P9O A;  2JGD A;  2Y48 A;  4DV3 B;  1N8R W;  1M56 B;  5JH7 A;  5IDJ A;  3B8N A;  4G27 B;  1Z5V A;  2E75 B;  4NB5 A;  2UXC B;  1BCC H;  4DR3 O;  1PV0 A;  2MW2 B;  4ZKI A;  2G38 A;  3B77 A;  2X7R B;  4BW9 A;  1GM7 A;  1B06 A;  4UB8 Z;  1Z2G A;  2XAQ A;  3JAW A;  1Y6X A;  1AJP A;  1YEW A;  1PM9 A;  4QIW F;  2EIN C;  1BHB A;  2F1M A;  3JAL B;  3ASO C;  5FPR A;  4JYC A;  4CS4 A;  3FB7 C;  1RPO A;  5JVD B;  4GX5 A;  2ITC C;  4K0K O;  1NBM G;  4LBE C;  3X2Q B;  1K9M W;  1XNR B;  1HP8 A;  1YTF D;  2LGW A;  5BMV B;  4AHC A;  5B1A C;  1AJQ A;  1Q86 W;  3T2M A;  4J9Y B;  5D5Q A;  4LF5 O;  5F2V O;  3N2K B;  2ZNJ A;  3BRC A;  1M56 C;  1BQZ A;  2HFE C;  1N34 O;  3K58 A;  5L3F A;  4MTF A;  3HR0 A;  4CC6 A;  4LH6 A;  2QM8 A;  5CN0 A;  3L75 H;  4BIU A;  4DV7 O;  1I94 O;  3CPW U;  2EIJ B;  3QVN A;  4I9W A;  3LUT B;  4FM0 A;  3DSQ A;  4IYH A;  4TV9 A;  1FXV A;  4OPH A;  2F95 B;  1NR7 A;  1K5Q A;  5KHI A;  4ZOL B;  4O4I B;  3X2Q C;  4LC1 A;  1AIL A;  5JVD A;  2E74 B;  1PNK A;  2K9P A;  5KA5 A;  2VS0 A;  3CEI A;  2VQE B;  4QPK A;  3H1L H;  2OIE A;  4I0X A;  4P9P A;  4LFB B;  2QEX V;  5IYB O;  5BMV A;  1J5E B;  3CRA A;  1XEQ A;  2FKX A;  1G4Y B;  1VQN V;  1AR1 B;  4DK0 A;  2XAJ A;  1XMO B;  4LP8 A;  1PNL A;  1SER A;  3H1K H;  5KAF Z;  2EIJ C;  1U97 A;  1LR1 A;  1GH6 A;  1H2G A;  4DK1 A;  4X1K B;  3W7U A;  4O4J B;  3W7S A;  3ETE A;  2DWD C;  4JI7 O;  4IYI A;  3T1Y B;  4XBF A;  2F66 C;  3D36 C;  3R65 A;  3BCC H;  1MG1 A;  2JIZ G;  2MK3 A;  3BHP A;  1E79 G;  5EBL C;  5B1N A;  1TUE B;  2GHY A;  4NXM O;  3TXQ A;  2CTR A;  1H38 A;  4X1I A;  2JS5 A;  2DWE C; 
#chains in the Genus database with same CATH homology
 3JAR B;  3E22 B;  1V9P A;  1I94 B;  3HKD B;  1HNZ B;  4CH6 A;  4FLV A;  3THO A;  2QM4 A;  4EB6 A;  5KX5 A;  3BAB A;  4UCS A;  1JMK C;  1TA8 A;  5EYP A;  5EZY B;  3SJB C;  2ZIO A;  5LOV B;  4FLT A;  4IHJ A;  4O4H A;  4PI2 A;  2GV9 A;  4FLZ A;  1VF7 A;  2Q0A A;  5GON A;  2RQ6 A;  4FLU A;  2CAZ C;  5JCO A;  4I55 A;  4FVM A;  2VQF B;  4D7S A;  5CA1 B;  1O9H A;  1I7F A;  5K1P A;  4JI1 B;  5CB4 B;  3HKE A;  3K59 A;  3RWR D;  4O2B A;  4LF9 B;  2YI9 A;  3RYH B;  1KU9 A;  4B08 A;  1XI1 A;  1QQC A;  3VQX A;  4DR2 B;  4CH5 A;  4B3M B;  4O2A B;  4O4J A;  5KMG B;  5BR8 B;  2VWK A;  5IJ0 B;  5KHJ A;  2OWO A;  2UXB B;  3RYF B;  4JI5 B;  3RYI A;  4LF4 B;  1TUB A;  5ITZ A;  4WBN B;  3PN1 A;  5D5P A;  1FJG B;  1JFF B;  5LP6 B;  4X1I B;  5JJE B;  5FNV B;  3SJC C;  3UT5 B;  4LNU A;  5LA6 A;  1IBM B;  4EB6 B;  4I4T A;  5KX5 B;  1D5A A;  3OTO B;  4JV5 B;  5J2U A;  5EYP B;  1M4U A;  1SA0 A;  2ZNI A;  3HKC A;  4IHJ B;  4TOI A;  4O4H B;  2PZS A;  2YXL A;  5GON B;  4CH4 A;  3JSL A;  1Q5O A;  3K5N A;  4I55 B;  4DR4 B;  3VQY A;  4UCU A;  5FPO A;  1S5J A;  4LH7 A;  4EEQ A;  1ZAU A;  4X20 A;  2PY5 A;  3HKE B;  2Q7G A;  5IYZ A;  4YJ3 A;  4O2B B;  2ZIM A;  4TUY A;  4UCV A;  3IAY A;  3ZS8 C;  4LF5 B;  2OYQ A;  4GKJ B;  4X65 B;  4ZHQ A;  4JI4 B;  5IJ0 A;  5LP6 C;  3RYI B;  1N34 B;  2UUA B;  3HKB A;  3CSX A;  1TUB B;  5ITZ B;  4WBN A;  4PI0 A;  2R72 A;  4LFC B;  4JI6 B;  5LP6 A;  4YJ2 A;  1O9G A;  1HNX B;  3ZED A;  1M93 A;  4X1Y B;  4LNU B;  4ZI7 A;  5LA6 B;  4GLX A;  1Q43 A;  4EFE A;  4I4T B;  3UQ8 A;  4FM1 A;  3K5M A;  5J2U B;  5JCO C;  3K57 A;  1SA0 B;  1WN7 A;  3HKC B;  4CS2 A;  1TAE A;  1RSO A;  4DV1 B;  2PYJ A;  1B04 A;  1KMI Z;  5JQG A;  4FFB A;  3ETQ A;  3VQW A;  4TV8 B;  1FFX B;  4TQF A;  3RYC A;  1H2S B;  1IBL B;  4LF7 B;  5KHG A;  4TQD A;  1XMQ B;  4JI8 B;  2UU9 B;  4DR5 B;  5IWA B;  4X20 B;  4U3J A;  3BA8 A;  5IYZ B;  4YJ3 B;  3ICX A;  4TUY B;  2P5O A;  4DR6 B;  1Q8I A;  4CC5 A;  4NXN B;  2E5L B;  2R70 A;  4PHZ A;  4ZHQ B;  2YIB A;  2JVD A;  4NVP A;  1N32 B;  4KL1 A;  1WPB A;  2QJ1 A;  3HKB B;  3CHX A;  4ZIB A;  2Q7E A;  3SGI A;  4DV2 B;  1DGS A;  4DV4 B;  5KHK A;  4CS3 A;  4YJ2 B;  4GYC B;  1XHX A;  5IJ9 A;  4JI2 B;  2E3C A;  4X1Y A;  5JH7 B;  3U0Z A;  4DV6 B;  4ZI7 B;  4JI7 B;  5EIB C;  4O4L A;  2F4V B;  1Q3E A;  1L8D A;  2PUS A;  2YIB D;  3JAS A;  3JAK A;  4NXM B;  2P22 C;  2BTQ A;  1WNS A;  4B3R B;  4KHP B;  3QF7 A;  5JQG B;  4I50 A;  5LXT B;  4FFB B;  4TV8 A;  1FFX A;  4LF8 B;  2V4D A;  3RYC B;  3U11 A;  3N2G A;  3WB1 A;  3JAL A;  3RGB A;  1JJO A;  1HW7 A;  1M5I A;  4YHH B;  3CB2 A;  4HBN A;  4OX9 B;  5JJJ B;  4U3J B;  2IM9 A;  4IIJ A;  3OTF A;  5EIB D;  2ZM6 B;  4GKK B;  2F93 B;  4LR3 A;  2UUC B;  5C8Y A;  2ZCE A;  2Q7H A;  4UCT A;  4LFA B;  4EFB A;  1NT2 B;  3N2K A;  2BTO A;  4DV0 B;  4BWA A;  4JI0 B;  2UXD B;  1XNQ B;  1TVK B;  5K1X A;  4CH3 A;  2HHH B;  3LNN A;  3BA9 A;  3JAT A;  4DV3 B;  3K5O A;  5J2T A;  1HR0 B;  5IJ9 B;  3QG5 A;  5JH7 A;  1Z5V A;  4O4L B;  2UXC B;  3M7M X;  3JAS B;  5LMU B;  3JAK B;  4K8X A;  4BW9 A;  2BTQ B;  4FM2 A;  3A2F A;  4Q6G A;  1IBK B;  4DR7 B;  2PYL A;  4I50 B;  3JAW A;  1YEW A;  5LXT A;  1XQ8 A;  4I9Q A;  4ZOL A;  1P49 A;  2F1M A;  3RFR A;  3N2G B;  4O4I A;  3JAL B;  3QTC A;  5FPR A;  4CS4 A;  1G6U A;  1N36 B;  2HEP A;  5JVD B;  1QHT A;  3VQV A;  4FLY A;  5JJN B;  4DV5 B;  2YIA A;  4HNA B;  4UFZ A;  4AQY B;  3MAQ A;  4IIJ B;  4K8Z A;  5LYJ A;  4DUZ B;  5LMN B;  2PGG A;  1TGO A;  1XNR B;  4DR1 B;  1Z5W A;  5BMV B;  4AHC A;  5C8Y B;  4F6R B;  5D5Q A;  4FLX A;  1N33 B;  4B3S B;  3N2K B;  3K5L A;  2ZNJ A;  3BRC A;  4L8J A;  1TVK A;  2ZIN A;  3FFQ A;  3K58 A;  3JAT B;  3B2E E;  2PTM A;  5CA0 A;  4YY3 B;  2YI8 A;  5J2T B;  4CC6 A;  4X1K A;  3T1H B;  4LH6 A;  1XHZ A;  4UCR A;  4DRX A;  1HNW B;  1T5E A;  4B3T B;  4FM0 A;  3DSQ A;  4TV9 A;  4X64 B;  3BPZ A;  1SKV A;  4LF6 B;  3JAW B;  2F95 B;  5KHI A;  4UCO A;  3JAR A;  4ZOL B;  4DR3 B;  3E22 A;  3HKD A;  4O4I B;  3U10 A;  4JYA B;  4DUY B;  5JVD A;  3SR2 C;  5EZY A;  2XHB A;  4HNA A;  5LOV A;  2RJZ A;  2VQE B;  1SQG A;  5LYJ B;  4LFB B;  3WB0 A;  5BMV A;  5CA1 A;  1J5E B;  3WB2 A;  2KKW A;  4F6R A;  3BAA A;  1X4T A;  4D7T A;  2JGU A;  4DK0 A;  4K0K B;  5CB4 A;  1XMO B;  4X66 B;  4FLW A;  3JSN A;  2VWJ A;  3RYH A;  5CA0 B;  4DK1 A;  4X1K B;  2R9A A;  4O2A A;  1SQF A;  4O4J B;  5KMG A;  2UUB B;  5KHH A;  4DRX B;  3T1Y B;  3RYF A;  2F66 C;  4AIL C;  3BHP A;  4TV9 B;  1JFF A;  4JI3 B;  4X62 B;  3SJA C;  2EX3 A;  4X1I A;  5FNV A;  3UT5 A;  2JS5 A;  4DV7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...