2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
3D8CA 1YCIA 4B7EA 1MZFA 3OD4A 1H2NA 2WA3A 1IZ3A 2YC0A 3KCXA 2WA4A 4Z1VA 4JAAA 4AI8A 4Z2WA 2W0XA 4NR1A 3P3PA 2CGNA 2YDEA 4BIOA 1H2LA 2ILMA 3KCYA 1H2MA 1H2KA 2Y0IA 4QU2A 2XUMA 5JWPA 1MZEA 3P3NA 4B7KA 2CGOA
chains in the Genus database with same CATH superfamily
4B7EA 2IXKA 2FZ2A 3AXDA 4AZZA 3O1OA 3AVRA 4CH6A 1QJZA 2D5HA 4JASA 2E9QA 2VZUA 3CEIA 4BQ2A 4AQ2A 3W21A 2XNDG 3ZOIA 2ZKNA 3M3OA 3KG2A 2G9GA 2ARCA 3RQ0A 2WINB 2VGDA 4XCAA 4CCOA 1JTZX 4X66O 1TG7A 3DGEA 3OB8A 2CGPA 2XQRA 5K9YA 4LF7O 5KUKA 1SLTA 4AEMA 1UPSA 3U14A 4J7KA 1GZWA 1WW4A 3T3YA 5C3RA 4XFHA 1OCOB 2Q0OC 2DBNA 1K33A 3CF6E 3VBOA 3VL9A 3JD4A 2OCHA 2E6VA 2P90A 1REFA 1S2EA 2CTPA 4DUXA 1Y6XA 1EBOA 2TBVA 4YZ4A 2LROA 1LNSA 2F23A 1GN2A 1NI8A 1Y66A 4UW3A 1AF9A 2VZPA 5FMBA 3WINE 1GOGA 1T2XA 2JG8A 1YC61 1XSRA 2WQ4A 2ZEWA 3G80A 4XAEA 1OZ0A 1DLBA 3SXWA 4IE7A 4KNCA 3VB9A 1HQNA 5A6ZA 4QPKA 5DZEA 3HBZA 2DCJA 5J3UA 1JZ3A 1BVP1 3TXSA 1WCKA 2F66C 5BV6A 3JAKB 1X7NA 1N1VA 4NB5A 3JCUZ 1AJPA 3H1IH 4CUAA 4MVOA 4ISQA 3LFIA 3N7LA 4PIXA 3OUIA 3K04A 2VQEO 2UUAB 5FYMA 5AFBA 1Q56A 2WO1A 2B5UA 1EN6A 1W9SA 4XBLA 2Q4PA 1XHZA 4JX0A 3VQYA 1AR71 4GKYA 1H1MA 2WR9A 1BEV3 4MGSA 4RHV1 4YVWC 1RJ8A 1ULFA 1P84F 5IVCA 2P22C 2VZSA 5IJ0B 4NN0A 1UZVA 3WSOA 2O57A 1XXNA 1TMF3 5HV4A 3POJA 3D3IA 3T08A 1G6NA 2QKAA 1SDWA 1OUSA 1EZJA 1QQCA 5A3UA 2RDCA 2EJ7A 1KFUL 4U7NA 3O9OA 4RR3B 4OI2A 5B1NA 3W59A 4D69A 4R9DA 4HANA 5JVDB 3PHMA 3T2TA 3D36C 3AG2B 2VMCA 3HN3A 3AG3B 2Q68A 3OE7G 3FB8C 2CY6A 1M5IA 2P67A 2BTVC 4RQEA 1KGYA 4MVRA 4LBQD 2XPJA 4CH4A 5EQUA 2QBXA 5DZFA 3CC2V 3K4AA 1GN6A 4Q4X2 5A1FA 5BNNA 3RYIB 1BXHA 1APNA 3THTA 5A3PA 4J7ZA 3ZFEA 4META 4XJWA 3T1HB 3BOPA 2LJ2A 3IDAA 2ATFA 1UU5A 1TZOA 1I94B 5B5EZ 1LULA 1VP6A 5IYYA 5CFDB 1QU7A 2E3CA 3ZMNA 4IYIA 4QQOA 1GP4A 1KITA 1VF6A 4CP9B 2HWC1 2XJTA 2XBO3 5C8CB 2P3IA 1N32O 4XYXA 2D40A 2Z5WA 1M4WA 4H55A 3EBRA 1OV9A 4UFKA 1PZ8A 2K1EA 5LXTA 1JPXA 5F5CA 4F6EA 1BLZA 5KXBA 2JD4A 1ST8A 3ZYIB 2VXRA 3CJXA 4R50A 3UNPA 1OVSA 5K0UC 1IQAA 3POGA 1OHHG 2YXHA 1V9U3 4UFMA 1UMZA 4Y5TA 1MS4A 5JVDA 2WNUC 4J42A 2BCCH 1VLNA 3DYMA 4JHTA 1NH2D 1VBE1 3ACHA 2HWB3 4ZIBA 5CB4A 3SKJE 2WSSG 4OHYA 2VNGA 4AI1A 2RJ2A 3VD9A 3J26N 2KG7A 5FXZA 1QH6A 2F17A 1AJOA 3BU7A 4DY3A 1C8M3 3WFVA 2Q30A 2VNRA 2ZDIA 5L3EA 1TE1B 4WFHA 4MSWC 4QQHA 1PV0A 2XHBA 1D7PM 4D6SA 1HXS1 1RUG3 1FOD2 3I2IA 4DUYB 1XNAA 2VQUA 4WFGA 1QJY3 3CCMV 4H7MA 4YM1A 3L71H 1XBLA 4Z2WA 4YLZA 1Y76B 3L2HA 3C7EA 3FZ3A 3VBRB 4QWNA 2FCTA 4MV2A 1KB9F 3C3VA 2JDMA 1N8RW 4LBMA 4A5UB 1RL3A 4W4ZA 3LCPA 2RM22 3RVYA 2IW5A 3QG5A 1H2MA 2UU8A 2RM21 3J4UH 1QJX2 4ZHQA 1Y74B 1VBC3 4WBNB 1J1TA 3WNMA 5C33A 2HHHO 4YYOA 3ILRA 1COV2 2IFRA 3OBZA 2ZGMA 4TQFA 3RSJA 3USSA 1D5AA 4EB6A 4AE2A 4OGQB 3SLIA 2R061 1YI2V 3ACGA 2W6JG 2QA4V 5EYYA 4WM8A 2WRAA 4OQ9A 4LEJA 4LTAA 2GU9A 3GHMA 1W2UA 3VDAA 4JTNA 5J7MA 2BVBA 3W5MA 4GWJA 4PI2A 2VBBA 4NIGA 3T4HB 4H14A 2XOMA 5JIAA 4QHOA 3BIEA 4J6GA 3ETDA 1E1QG 4IT5A 3JD73 2A70A 5KR7A 2F4VB 2DN9A 1YJLA 2QE7G 5AFEA 4MXWB 2UUBO 3KCYA 1BKZA 1MNGA 2WO3A 3O12A 4A6SA 2X29A 4YM2A 3O1SA 1PO11 4AI3A 2YSUB 2YZ4A 4QQLA 1QBZA 4LBJA 3U10A 3JALB 1RUNA 3RVZA 3AP6A 3MEPA 1ND3C 3T09A 3LGRA 5ERLA 1AYN2 1YZBA 1CZVA 1AR91 1ZBA3 4MGZE 2YIBA 1HDKA 3ZS8C 4FT8A 5IAXA 3FWEA 1SS3A 2NLRA 1SC5B 1M57C 1TQ5A 3N2GA 4JCKA 1TUBA 2V4AA 2JDZA 1QOOA 4FQZA 2SBAA 2WAOA 1XNTA 4LMFA 4YY3O 1WP7A 4F4LA 5KAFZ 2GBOA 3PL0A 1F8VA 2MEV1 3T2MA 4FFBA 3OUHA 3A0BZ 2AENA 1XC6A 4FFKA 2WL1A 3VV1A 2ZS6B 3RJ2X 4O2BA 1HXS2 4P14A 2RDRA 2EXKA 4FPGA 3OGIB 5CYYA 5KXCA 2C5DA 5E16A 2YMZA 3ZXAC 5CA3A 1OH3A 1VQNV 2B1GA 1RUF1 3MD0A 4TZDA 2EZPA 4YXWG 2R041 5IUQA 4Q26A 4ZS3A 1G9CA 1X82A 4IQPA 1WA8B 3FB7C 3WX5A 2FMYA 4E4DX 1JUHA 4HBNA 4IV1C 4P30A 4O4LA 4WFBV 4QX7A 1Y74A 5H2FZ 3L9JT 3AKTA 4CEYB 4CE8A 2O14A 1PNKA 2QUOA 5IT9N 4P9WA 2XAJA 3SYQA 1J3RA 1IPKA 1SLLA 1UY0A 4N7IA 3D0SA 2YUAA 1PX4A 1ODMA 5A1AA 1GBGA 2JDUA 4X66B 4Q4Y1 4I4TB 4QU2A 1OT5A 2E74B 5IYBO 4I0XA 4CDWC 3I2JA 2WO2A 2JWPA 4Y4YA 3WEZA 2R9IA 4MXWA 2VMEA 4YHHB 3MIFA 3TN93 2K9ZA 3JATB 1WCSA 5B1AC 2HYKA 5DAPA 2HVKC 1OD3A 4TSVA 5A3NA 5B1BB 2PHTA 2V5YA 5GLVA 3SISA 4X6RB 4OHWA 3QH6A 4TYSA 1PIV3 1ENVA 1C4RA 3CCLV 1RB8G 2G4IA 3IN9A 1S0DA 4XDQA 4C90A 3GNEA 2ATKC 2V09A 3LSSA 5AVPA 4W6XA 5FIXA 1WMFA 4P5HA 4AAXA 1FV3A 1FJGB 1ENQA 1X59A 3UKTA 1XREA 4DV5O 4GKKO 1D4M2 5JDBA 1SG3A 5IYZA 1OPMA 2BFUL 4DV3O 1RSOA 1YQ2A 2RMU2 3K9SA 1F31A 3LZZA 1FXVA 3WUCA 4X64B 3WG1A 1M1KW 3TGUH 1DGLA 3RJRA 4BMEA 1NT2B 1AILA 5JVVA 4OPAA 3TN92 5K0UA 1Y9QA 3MPPG 2QCSB 4DUZB 4TOIA 3DUIA 3CMGA 2WZPP 4JGYB 2HLEA 3R65A 4YGDA 4CSWA 4MTGA 3M4FA 1LEMA 5CA0B 5B3SC 4COWA 5L3FA 1WZXA 2Q4SA 3ZIAG 3H7JA 1RUF2 2CTRA 1A8DA 2CTQA 2WPDG 2NN8A 3ACFA 4IE4A 2FD8A 1FATA 3TRSB 3OEAA 5FPLA 4HG6B 4KWJA 3JBG2 4DV5B 4GKKB 5L3BA 2C1FA 4DV7B 5GM0A 2LS6A 1LKNA 2ZMNA 5I8YA 2E7TA 5KHHA 4MGTA 1LECA 2QSAA 5D21A 5JOZA 3F7YC 1ZZ6A 1OBNA 4FIPC 4YVSB 3N9QA 1VBD2 4NR1A 3PU3A 5IYCO 1UKRA 4OYUA 2HWB1 4AI9A 2GMEA 5LB6A 1LOAA 3VD4A 2EIMC 2RDNA 3B7MA 1ZUQA 2OKXA 3NMBA 3N9NA 3AC0A 2XL9A 4PA9A 2QZ2A 3KM5A 1W6MB 3ZXEA 3ZYHA 2YS8A 1KRIA 3NJVA 2TUNA 2KB1A 1AYN1 3LEIA 3JASB 2G19A 4TV8B 2NMOA 1JUIA 3GCWA 2O0OA 3JATA 4HL0A 5L7OC 1X36A 5M0TA 3AZYA 4B08A 4QDSA 2EIKC 4RS5A 1YFUA 3MW2A 1OCRC 1SF9A 2IJIA 2WS91 1IS5A 1CQ9A 1K12A 1OD5A 4YG6A 3GJBA 5ABJB 3WP6A 3CCUV 1QY4A 3LEMA 4D7TA 3DXRA 3KVAA 5GLWA 4FPCA 1JOJA 1QOTA 2NQYA 5IYZB 3N9PA 2DWDC 3N2KA 4A45A 1O6UA 2B1IA 1JZ7A 2ZIOA 4S2HA 1R73A 3NXSA 1VQOV 3RYCA 4RFRB 2R042 5J48A 1V9U1 3OPTA 2N04A 4WM8B 1K7DA 3LKJA 4C0HA 3WLUA 1LU1A 1ZNPA 2E32A 1PO22 1NXMA 2VMGA 4BW9A 4J7JA 4JDNA 1AR63 4YM3A 2ZR3A 4AILC 1POQA 4IV1A 4NPRA 4WV8A 1RUJ2 4QX0A 3N7KA 2N7GA 3ILNA 2WZ8A 1CPYA 2PLV2 1MG1A 3C3SA 1BQZA 4JGSA 1WLEA 3GCXA 5CG8A 1JFFB 4UWDA 1UY2A 2K2SA 3B93A 4IETA 5AC92 1TNFA 2UUCB 3LPFA 5ANNA 3JBG3 3T0BA 3KHBA 3JBG1 3ETQA 4UV9A 5LP6C 1YI7A 2FHRA 3BKZA 1W6MA 4BK5A 3VDBA 2QQOA 1HN1A 1CAWB 4IXLA 2PFWA 3FL7A 4NWWA 2W1WA 4FK5C 2GP5A 3ZFEB 2UUCO 2AXTZ 1ND3B 3U07A 4XFCA 1W8OA 3WNXA 3HPLC 1P49A 1TA8A 3I3BA 4AEDB 3TEXA 5EHDA 1RXGA 2ZE8A 4K3UA 4YG0A 3WW3A 4JGZA 2VCBA 2ZGTA 4QPWA 2VY0A 4MHUA 2OTJV 4TV9A 5T5JA 3RDIA 4JVAA 5LRSA 4I0BA 5C71A 2OT7A 2W1UA 3FUOA 3LDRA 4EN6B 2VBPA 2EVXA 4JTOA 2A0LA 2EALA 4OX9O 2IFWA 1HR0B 2HWF3 4JC1A 3OSDA 3FHIB 4YFWA 1KP2A 4TSFG 4LWSB 1ZRFA 4NPMA 2LP7A 4EN7B 2WKKA 1ZZBA 2WWJA 2ZGLA 3ZN5A 4HZ3A 3B3QE 4QDQA 1H8TB 3UGFA 1DF5A 4ICGA 1NE6A 2ZHNA 4AL9A 2BNNA 3JASA 1UNBA 1H9WA 3ZR6A 1BSMA 3VZOA 2DVBA 3ZX6A 4QT6A 2JD9A 4CU8A 2LO1A 1VARA 3QLQA 1JYVA 1S0CA 1Z5WA 5BUVA 3G67A 2QDNA 2WBKA 1GKBA 4LBQA 5BNQA 5DQ0A 4LFBB 4TWKA 1MS8A 4OHVA 1EP0A 2JEMA 2FDFA 1R091 3NV4A 4HETA 3OTFA 2PAEA 1V6IA 4DIQA 3ACLA 2CE4A 1UXZA 4YW7A 1EFRG 2A9HA 1ZAUA 5CG9A 5EYPB 5FMOS 3VDDB 4J10A 4QX1A 4BPZA 3OPWA 1Q6IA 4ZY9A 1V54B 2JJ2G 1Y76A 2Y33A 5FK7A 1HB3A 1GN3A 4NXNB 2XAHA 4YIPA 3N7JA 1DQ2A 1OQDA 3NRUA 1QOSA 1N0JA 4H44B 3H8UA 4X62O 2R0HA 5F2SA 1RVF1 1Q8IA 2HG5C 4DR6B 4IV1B 4DR1B 4JDOA 4R8HA 5IT6A 4NHKA 3GHNA 4NO4A 4N43A 4IL7A 4JRAA 5FYYA 4BWOA 3VKLA 3CNAA 1JHNA 1N33O 1UFIA 1LOBA 1D4M3 3JZVA 3FJSA 2DMXA 2RDSA 1BBT1 4X9QA 4FCAA 2BU9A 1QEXA 1QHDA 2QQIA 1S5LZ 1R6KA 1WP8A 2DFCA 4UYBA 4U36A 1FMD3 4DZGA 2Y4UA 4XMAA 4IV3B 3HKCB 2UXCO 1EAH2 1YIJV 1YI9A 1QVFU 4GB32 4EWAA 3VHNA 3WDTA 1ENSA 4L87A 4XFAA 4HT1T 2VQAA 2UXDO 1SQFA 3U78A 1BK1A 1Z7S2 1IBMB 1C57A 3VBUC 1GN4A 4TTGA 1MOFA 5GW7A 5T50A 2J1RA 1LGCA 3TEYA 1O5UA 4X88A 4K6BA 1AI4A 3VHPA 5JWPA 1F4NA 1O3SA 4URAA 4L8QA 4TT3G 2DYRB 2Z69A 2QQKA 2H8PC 2GUZA 3LPGA 3M3IA 4CVUA 2X09A 4XOGA 4M01A 3O0VA 3WB0A 4CDWA 4BLIA 1UPIA 1XMQB 4JKKA 3RWNA 2BNMA 3N7MA 1NLSA 2ZD9A 3M2MA 3ELNA 4DV4B 3E35A 1IX9A 4XUOA 2C24A 2PYTA 3HOBA 1G8MA 5CKNA 3BALA 4RR3C 3KT7A 1RUE1 3EO6A 3NL1A 4PBOA 2IJKA 2JVDA 3AMHA 1BK0A 1OUXA 1Z78A 5A33A 2WYFA 2F4VO 4AHZA 2R32A 2JE8A 3M1HA 1L1FA 4PDRA 1WKYA 1Q8VA 2ZNJA 4K8ZA 4XBNA 4XABA 4EE2A 3AG4C 1PIV2 3THCA 5B3SB 2Y0OA 5FZGA 5EP9A 3LNNA 1AL0G 3DXUA 2EXHA 5DG1A 4AFDA 3K75B 4Q2FA 4FPJA 4PDLA 2ZA9A 1OMIA 2DCYA 2YB7A 2J1EA 3LUTB 4FFHA 4DV7O 5C4WA 2QQJA 1NS1A 2XUMA 2VOWA 4NRQA 2P34A 1H1AA 5KX5B 2DTWA 4JI4B 3U75A 5AG2A 3ZXDA 4DR7B 3DPRC 4J25A 1VBE2 2XJQA 1NBMG 3ACIA 3IPVA 3HKDA 4GMP1 2ZOEB 1CAVA 1Q8OA 3JQXA 4COZA 1RUC1 5IFTA 4XURA 3P6BA 3BRCA 3SCFA 5F2VO 2IXJA 1QQP2 5JXJA 1L0NH 1O8SA 2GMMA 1NKDA 2HHHB 2WWSA 3J8F2 3CIHA 4V2WA 2KXLA 2VBDA 4JRLA 4KL1A 5FZEA 4P2ZA 3ZFGB 1G6UA 4XUQA 3I55V 4QPIA 3CWBH 4CCJA 3H50A 3N27A 3DV8A 4A3XA 3HKBB 4MYEA 4EWEA 3J7MA 1WPXA 3O0WA 4TUYB 3C7OA 5DM6V 4XDOA 3M8AA 1BT8A 2WFF3 3NV2A 2W1SA 1N36O 1W28A 2L9LA 5CADA 2Q5ZA 1ZM1A 3E8FA 1VIBA 1CXZB 3K3NA 4MVMA 4WM7B 2CHHA 3MDSA 1XYPA 3QVNA 2CAVA 2RS53 4ZZ8A 4W6WA 1F51A 4FPPA 3DXRB 1XUQA 3T1LA 4I5SA 3P32A 4E9KA 2PQSA 3H42B 2RMU1 3WP3A 2EILB 2DW4A 1PIV1 2TEPA 1QJX1 2KG7B 2PI5A 1PK6A 2IVJA 1MPXA 4XPVA 3OOXA 3AG7A 1Q6HA 3CRMA 5FZKA 1YXBA 5JCOA 2WZR2 3AG3C 3H8OA 3VKMA 3ZXLA 3SYPA 2ERFA 1BJQA 1VQ7V 4ES8A 3VBFC 2YI8A 4ZOLA 4CC5A 3VLBB 3ABMB 2HEWF 1MZ6A 4FAHA 1YFWA 2ZCWA 1YXWA 3OGGA 2BTOA 4LF5B 2VVFA 3NJYA 3I8TA 2ZX3A 4EN0A 1U5IA 1H0BA 2IU3A 4WZCA 4BISA 4QIWF 4A3ZA 4B1LA 1OF4A 4G3YC 2NMNA 1KS4A 1GZTA 5A6QA 2H3OA 4KMQA 2BSKA 2R071 2QQPA 2VH9A 2EINB 3T30A 5EZYB 3TCUA 1G86A 1HV0A 5FP8A 3E8HA 2N05A 1R1ZA 4ONUA 2YC2A 1D2SA 5FOJB 1UOFA 5I91A 3I54A 1R092 1KDMA 3N35A 2D6PA 4WM7A 1OXCA 4LNUA 1OSGA 4GJZA 3DECA 1RUI3 4CPBA 1KYOF 3VQXA 1FT9A 4KU7A 4J41A 2OYQA 4Q4Y2 1PL0A 3I5DA 2QM7A 2ODMA 3OPZA 5HCFA 4X8NA 2QKDA 4LO4B 4HXCA 3A7QA 3H1YA 2OVUA 3FBMA 4XUTA 3HR0A 2GNMA 4SLIA 1PK6B 2P3YA 5LA0A 1N3OA 1UZWA 2C6SA 4HSJA 2W52A 3DKQA 2C4XA 3C2UA 1N3PA 2A06H 3ES1A 3JD2A 5F37A 3ZMSA 2A6WA 5JXGA 1UU4A 2VRZA 2GAUA 5KMGA 1A6CA 2HBTA 1CD3G 1STMA 4TWTA 4CDQC 1YJWV 4LKSA 5IVVA 3ZYRA 4JZRA 1H1IA 3NNGA 3FHQA 4DINB 4CCKA 1UMIA 1W8NA 1C5HA 5JUVA 3D3QA 5JLVA 2WFF2 5FP9A 3V0BB 3SYCA 4HN0A 4DXTA 4AI8A 4BQ4A 3CZUA 3M99B 2E5LB 5F7UA 5EJ3A 1RVF2 3K79A 4CC6A 1S3JA 1MS0A 5T52A 4LUKA 3LNMB 4FVVA 4Y5Z0 4GX0A 2GTSA 3T1YB 2XB6C 3CRQA 4EROA 1JMUB 1E79G 4CP2A 1WW7A 3POSA 1NLRA 1W2OA 3G7DA 3IZOA 1F4AA 1UOJA 4B3TO 4YW2A 4HSLA 3O1MA 5IK5A 1VBA3 2DU1A 5C7GA 4NROA 1AVMA 2YFZA 1CPNA 3WHTA 4Y33A 4O4LB 5JPMB 4DW1A 3I3DA 1S5HC 5H6RA 1DZTA 2XWBB 1QLEB 1SBEA 5FYIA 1DYKA 5LGNA 1FNYA 1PO21 1WGPA 5FDBA 5CFCC 3LQCA 4IERA 5A80A 3BEHA 3WCRA 1UO9A 3KD4A 1N32B 1B04A 5GJ6A 4L0PA 4HFSA 4IEOA 4XW3A 2Y0PA 4TV9B 4C1XA 4GMP0 4IEWA 3UV9A 4MADA 2CTWA 3AZVA 4KWKA 5HCAA 5C3QA 1RUI2 2Y48A 3DYPA 3KCXA 5IDJA 1QNYA 3BYWA 3MUZ1 4P9LA 5JJEB 1US6A 1YITV 1BEV2 3ASOC 2KA3A 1AHSA 1V9PA 3M3CA 2RS31 3P30A 2GC0A 2XJPA 3ETPA 4RYDA 5EIYB 5J96B 4X1IB 5FZHA 1GP6A 3HBKA 1NA1C 3GALA 5C3OA 2VR4A 2N74A 2ZZJA 4E2GA 2W68A 1UMHA 3MHSC 1YQ5A 2ES3A 1FJGO 2FDHA 4X8AA 5FBJA 3AG2C 2AYHA 3PVEA 4KGQA 4GWIA 5KHJA 5FY9A 3M70A 4XUNA 2EXJA 4WFAV 3VD7A 5I0RA 4Z1VA 1W59A 3NJXA 1NCRB 2ZEYA 3RRDA 4KHPO 1KD1W 4BXFA 2OS2A 4OXSA 4I30A 4YJ3A 2XOKG 1MZFA 2H6CA 1SPPB 4R9CA 5LRRA 5KHKA 3GZTB 1OLQA 3T1HO 3AFGA 1IZ3A 1NKGA 1R3LC 2ZAHA 3FAVB 3U11A 5JIUA 2VOXA 1A8MA 1OLME 5DUWA 1NVPD 2BTQB 2UWBA 3SHRA 3TK1A 2XMLA 5KBFA 1S0VA 4J9YB 1AR82 4NKGB 3JXSA 2F6BA 3BIWE 4DW0A 2HKOA 1VBA2 4NIDA 4YIOA 1LR5A 3LEGA 4OHXA 3MHZA 3S0MA 4DR4B 1Q81W 3UYJA 4LKDA 1RHI2 5FFOC 1HB2A 2QQLA 5FUNA 2WWWA 4YY3B 3BTXA 4FM0A 4UFZA 4DR7O 1GAXA 3NNMA 1V6MA 4Q4X3 1AYN3 5D8AA 3UETA 1VMFA 3HKBA 1Y9GA 4NHXA 3I3QA 2DURA 5FZLA 4E4HA 5JCTA 2XAGA 1H8TC 4I01A 3HIFA 3K77A 2LGQA 3U1XA 4DXRA 1NQTA 3OJBA 2HYXA 2WA4A 2VUCA 2ADPA 1MSWD 5JPNB 3KZIZ 2MW2B 2VZRA 3PUQA 4XC9A 4TQDA 4NE9A 1ZBA2 4R52A 3ASOB 4BCUA 4NMIA 5IJ9B 3EJKA 4GX5A 5ANQA 1G9DA 1HQLA 3CHXA 4K0KO 5HXVA 4TXWA 2EAKA 1OJHA 3N4MA 4XBFA 4CP0A 1XQ8A 3W5NA 1URFA 4YZ1A 4GJYA 5LGTA 5LBBA 3UM7A 5H9QA 1IQDC 3N9MA 1J95A 3DKWA 2RM23 4R6ZA 5FYVA 1JU3A 1CR7A 1N1TA 3OEHG 4NVPA 5LHGA 3BTYA 5I8SA 1HRI3 3NAPB 4EFBA 1WNSA 3I2HA 4O4HA 1MABG 3ES4A 4KG0A 4KGGA 5HXMA 3ZRWB 2I45A 2VMHA 2UUAO 3J7NA 4HKLA 1IPSA 4DK1A 4QE7A 4CCMA 2QM8A 5B66Z 1E5HA 4NAOA 4GX2A 4MZUA 1KU9A 1K5MA 1LOCA 1MVQA 2WSVA 1RUH2 3EB7A 3RZHA 2KKWA 4L9BA 1VIWB 4ZXEA 5IK8A 1IOAA 1D2DA 4HK8A 3EMRA 2WLMA 4I09A 1VBC2 2GTAA 4AFAA 2WC2A 3K48A 4KWLA 4M4PA 1MQTC 3UCSC 1RIRA 4CZZA 3L74H 1FOD3 1Y4WA 4PF1A 1RUG2 1AR72 3BA8A 1M56B 1HNXB 2XG3A 3IMMA 2BOCC 1EPWA 2ZR2A 5GONB 2ENRA 3DTUB 3K3WA 3MF6A 3SPGA 1RITA 2B9VA 4PA3A 3POWA 2A3QA 5LA9A 2BGCA 3ZHVA 5FJKA 5I0SA 3ZRXA 5DN2A 4I4TA 2VCMA 1H38A 3A0RA 2MHFA 4LLFA 1F5FA 1J3PA 2PELA 3H7YA 4Q4V2 3B09A 2P6HA 4O4JB 4CDQB 4LHNA 1WWYA 4FOYA 3TJTA 5LXTB 4DS0A 2EINC 1PX3A 4XHBA 4ZPIA 5T5PA 3GZEA 4I02A 1QJU2 2XVGA 5F3GA 2H0VA 4K3AA 2XBO2 3ZRWA 4PBPA 2Q1MA 5ITZB 3H1LH 2JG9C 3VGIA 5CFDC 3VZKA 4LF9B 3THOA 3JB8A 4DV4O 1JJ2U 1GRJA 2XR4A 3RGBA 1UD1A 2Y4TA 1HB1A 1DQ4A 2CH7B 2Q6AA 4YVWB 4LA3A 1LENA 4YW5A 2AW9A 1Q8PA 4CS3A 1Z0HA 1FPN2 3L2YA 4H3WA 2JB8A 5KMGB 2BGPA 2YY1A 2R072 2PMWB 4HAMA 3OG2A 1AR92 1DU3D 5DDJ3 5EXOA 1SBDA 5CBLA 2EJRA 3CCQV 3O1TA 1POV3 5J1XA 4CUCA 4FM1A 3ZRSA 1H6XA 5E79Z 2YBSA 3RWRD 5CB4B 4LR3A 4ZI7B 4M0NA 1OA2A 4U2AA 1FNZA 1CGPA 1PZ7A 1WD3A 2VZTA 5BXZA 4JI5B 5IVBA 3ABUA 3IB3A 2GDSA 3ROUA 1U5XA 4CU9A 2VQEB 3MI8A 1BVVA 4Q0PA 4Y20B 3LSEA 5TSWA 2IH3C 3BTZA 2VO5A 4G4FA 4CDUA 3OD0A 1WN7A 4UCOA 2IVIB 2KD7A 3W7UA 1K8AW 4BM8A 4QB1A 2EAAA 2PI4A 1ENXA 3C7FA 5G04L 3H8XA 2JDNA 2FDJA 4RGKA 2KR2A 1P7GA 3CSXA 3THPA 2OA2A 3BVCA 3WDWA 4XDPA 4NXNO 2WLPA 4PJ0Z 1YSCA 5DDJ2 1JBCA 1FXHA 2NPIA 4K7JA 1NCQB 2CUGA 4QHBA 3WNPA 3E8GA 1C8NA 1VF5B 2Y6JA 1RHI3 4FOQA 2XUEA 1RUE3 1ZA7A 1VAVA 4QMAA 3ZMOA 1KQSU 4EYUA 4H37A 3NW4A 5CN0A 1J5EO 5FZ6A 5FXXA 4LH6A 1W6QA 4EB6B 1R6TA 4RD7A 2YROA 3CC4V 1K3IA 1L7QA 1QJU3 2WZEA 1NR1A 5FXWA 5DAVA 2Q5TA 4M4RA 3DN7A 1NA1B 1PO13 2OZJA 3MV01 2DVDA 4AHWA 2BRTA 1BCXA 1UPGA 2YGLA 3G6EV 5JOXA 4CDQA 2I07B 5IJRA 4D6QA 5F3IA 3ASNB 1DYOA 4TV8A 3LDBA 2D3SA 4A7ZA 2DU0A 5FZFA 3SH4A 1XNRO 5EIBC 4MXVA 1H8VA 2YEVA 4JHZA 1EAH3 4AVAA 3O65A 2AZ2A 1XE7A 3HN1A 4JI8B 4QU1A 3MAQA 3SCGA 4CEWA 1HRV1 1W3VA 1JYCA 2GN7A 1KQRA 3AYCA 4AEDC 2DOSA 3AP4A 2RDQA 1W6PB 2WNVB 3W7XA 2UU9B 5LA2A 3AX4A 3KV5A 2EIKB 3K46A 4B3RO 3FBYA 4WVWA 4RQPB 3RZMA 1JX9A 4HKWA 5J36A 3AK0A 2J1AA 3H1MA 2PHDA 4HPKA 1WBLA 3ZCCA 5GLZA 4GT1A 3TXQA 4P9JA 1W6OB 4QGLA 3NO8A 4K8XA 1W6QB 3OW2U 1HLCA 4MGYE 2QDRA 1SLCA 2Y6GA 3IWZA 4BQYA 3WQ7A 1VBB1 2RJLA 4NJ4A 3IM0A 2ZXWB 1Q86W 1NVPB 3OMIB 1CP9A 3G71V 1SFYA 3HNMA 3VBHC 1A32A 4Y20A 3DXTA 4QGPA 3CD6V 2ZPXA 1AYM3 2RNBA 1PNFA 4AFCA 3LDKA 3ZHSA 1FS0G 1Q5OA 3OGSA 3UKMA 2NLJC 2UXBB 1SCSA 5FZBA 1LODA 5C6CA 5IAVA 4KG8A 3CYOA 4OVEA 1PGSA 1YJ9V 1YJNV 1ZZ9A 5C8YB 1SQPH 2NZ9A 1EN5A 1IBKB 1DFQA 1PVXA 5F5IA 5C70A 3K9AA 4AOCA 2UYBA 1R081 4JTDB 5A7NA 2VTFA 1OF3A 2G9FA 4ZU5A 3E2EA 4YZ5A 2ZABA 4JQRA 3CBNA 3ASIA 2BJSA 1O4YA 4HKOA 1PL4A 2XKOA 4WCEV 5KC6A 1ZL8B 4CUBA 3MFCA 3CJIB 4YW1A 1DK1A 1V6KA 1NR7A 5A7WA 1GQGA 2F95B 3ZYJB 3E6DA 4XF4A 4HVQA 1HQWA 1RM1B 3AKQA 4MVSA 4OHZA 5FZCA 2VD7A 2BE3A 2WNVC 5A7PA 3HNYM 2DCKA 4D0QA 5FZ3A 3NJZA 3JUUA 1VF7A 2FB5A 1LEDA 4YFZA 3E8BA 3CEWA 2FMLA 4MS2A 2VXJA 5B1OA 1WMDA 1GOFA 3Q8BA 4MX3A 3P1IA 1ND2C 4X1IA 2W08A 3HMYA 2HEPA 1AR83 4HZFA 1YHQV 3RZJA 3BOWA 4WZFA 5C8CC 3EHBB 2QZ3A 1FFXA 2VQ0A 1GICA 3VZMA 4IL6Z 2FTKA 2QWPB 3KF5A 2ZE5A 3K4DA 4A7KA 4MVZA 2JXAA 4QPGB 2H94A 2GC1A 2Y64A 1F15A 3KF3A 4LOTA 1ALYA 2QDOA 1GWMA 4QM8A 2WQZC 4NUBA 2A3WA 1B3QA 3X2QB 4FVMA 1WD4A 1N47A 4CPBD 1NG0A 4PLNA 3SR2C 1C28A 2GSYA 4UCVA 1AR4A 5DXDA 3GB7C 5DEDA 2GSMB 4QPIC 2NR5A 5SV8A 5C4WC 5C8YA 4FM2A 4N43B 5EFUA 1XNQB 2WN2A 4BHPA 5CA0A 4X89A 2CAZC 3ABTA 2UXXA 1XHXA 1Q43A 2Z42A 3RZGA 3IC7A 4MGKE 4RFT0 1K4CC 5IWAO 4LBOA 4NIAA 4LITA 4XETA 2RS11 5FO7B 4O4IB 3ZKUA 4N8MA 2D93A 1COV3 1RPRA 2D98A 3WY6A 3UJOA 5FPVA 1VPHA 1C5IA 2W0XA 1PD3A 1ACCA 3I56V 2D6NA 2R72A 3OMNB 3AG1B 4AYUA 4QKDA 1VE0A 2ETEA 3ENRA 4QX8A 4CS4A 1D4M1 4B3MB 2R1BA 3GBFA 4COVA 3KGZA 1YDXA 2E31A 3WQ1A 2OPWA 3TBDA 4G28B 5LHHA 1POV1 4AFMA 4LNUB 1J5EB 5J37A 2QR4A 2BWAA 2GUZB 2QTWB 2DFBA 2WJSA 2ZE7A 3CCRV 4UCRA 2UXDB 2R7EB 2PF4E 3ABKC 2CL2A 3VBSC 3CXCU 4LCUC 4CYDA 3VBUB 2DYSB 3KQ4B 3ZIXA 2B7YA 3LEKA 1ZLZA 4ATEA 1UIKA 2PTMA 4LF9O 1C8M2 5LYJB 2ARHA 1RVF3 1X8EA 2Z4FA 1EYBA 4UW6A 1NTKH 3RYHB 4DRXA 4DRVA 1M90W 4EQVA 4UOJA 5HI0A 1DF0A 1DGRN 2EIEA 1AX2A 1SBFA 3MYXA 2J1VA 2EZOA 2IXCA 2ARBA 1G4YB 1PP9H 1KJLA 3QH7A 3ZXJA 3ZHUA 1XYOA 5JZGB 4ARYA 2WUHA 1ORQC 4GUNA 1QJFA 4W50A 1LHWA 4OMDA 2VOKA 1W0OA 4UF0B 2YXYA 2VUAA 3TNQA 1NYWA 2B42B 4N43C 4FFBB 1OOPC 1HNZB 1JQ0A 3USUA 1TVGA 1J58A 2F4PA 2UXNA 4KP4A 4QPGA 4YZ3A 1QH7A 4QB6A 3RT3C 1XNDA 1E57A 4R4ZA 1MA1A 3I2DA 1I94O 2YICA 1KDKA 2VZ1A 3AMMA 5J2UB 4Q1RA 1NA1A 2EIDA 3A4UA 1SETA 1KC8W 1L0LH 2PZSA 2EIMB 5DAXA 4BE3A 5C93A 2JG8C 3MPBA 1XL6A 3IDEA 3K3OA 2JDIG 3RYRA 5AC93 2DCTA 2HWE1 1NCQA 1VQMV 1R1A3 2GHYA 1GOHA 4BIOA 3VBOB 2XASA 1HNWO 1YTFB 4E8CA 3ZMVA 3R66A 1IBMO 1YLLA 1TMF2 4D3WA 1LAJA 4XIKA 1TVKB 1FMD2 1Z7S3 3DL3A 4PJYA 3ZFGA 5JSPA 1YNAA 5FNVA 1W6OA 3VDDA 4IE6A 2E33A 3B9IA 4JPRA 5FMCA 4ZZ5A 2BOJA 3AZZA 1M9NA 5JJNB 1NJIW 2Y38A 4L11A 3O0XA 3RZZA 4DEVA 4ASMB 2XQXA 4YNIA 4LF5O 3HQRA 5C8WA 2WIIB 3BABA 2GV9A 1BHAA 1XSQA 4UVBA 1TME1 2W6IG 1MACA 3J9SA 4AK3A 1F23A 3D8CA 4JYAO 1R1A1 4QPYA 3STZC 3WW1A 2HH9A 5C5TA 4L2NA 2IU0A 5L9VA 1RMU2 1K5JA 2BYVE 5IVYA 4I3GA 4COUA 2H0BA 2C9AA 3SJQC 4WBBA 3H1JH 1X33A 3CB2A 4EZ4A 3PN1A 3FFQA 2CGNA 2DYRC 4DV1O 2UWCA 4C91A 4GB31 2QTSA 3NSTA 2WNVA 2GALA 3FE5A 2HKXA 3M8LA 5B1AB 2ZM6O 5B2GB 2BW8A 1QLNA 2QQNA 4QXBA 1YIFA 3STLC 5LBEA 2Q8EA 3LDDA 2JE7A 4LFBO 5FZMA 2VQTA 1W05A 3ETGA 5A3MA 4L8JA 5LOVB 2I2SA 3OUSA 2Z0AA 3JYCA 5FZ9A 1U97A 5EK0A 4UT5A 2BVVA 2HVJC 3I2OA 3VQWA 3ASNC 3SYOA 5IHRA 5BNOC 4KU8A 2WLIA 2YC0A 2DUQA 4YGCA 2R70A 3C90A 2B9UA 5FTTC 2V1DA 3B77A 4G27B 5BZBA 2PAKA 3PIJA 2LQTA 1VQ4V 1P4RA 4Z8BA 1ZRIA 4UV8A 3KT1A 1U96A 1IS3A 1W0PA 3A0NA 4RGGA 4UBGA 4YZ2A 4LF8O 3D4KA 3ZYPA 3T2PA 3CPWU 1BQPA 4UW5A 3WW2A 3CCJV 4LOSA 1SZBA 2HJDA 4IV3A 3K57A 2WSUA 4Q4V3 2C0ZA 1LRHA 1RMU3 4WM8C 1OVPA 4OCTA 1O4ZA 3Q4HA 3TETA 1ZREA 1O91A 3CJIC 2ADQB 2WLNA 2EICA 4DQAA 1I1EA 2YG0A 1KUQA 1RUJ1 2PHFA 2HWE2 4PIYA 4DXSA 2VULA 1UZZA 1H8HG 3A0HZ 4JF3A 1FI2A 5A2QN 5LASA 2QVSB 2GC3A 3H9VA 4XXAA 2YXLA 5FNVB 5HFLA 3S5AA 5IJ9A 3APBA 1TVKA 2VG9A 3NV3A 4XCBA 2M6YA 2JDHA 3TYJA 5FWJA 1D2QA 5EWSA 3LA7A 3AVSA 4CH5A 5EYXA 4QGNA 5LWBA 5IVFA 4WFFA 3WD5A 4OX9B 1GQPA 5JAXA 1G9BA 3WCSA 1I5XA 3A8TA 1OH4A 2QFEA 2JK5C 2ZDIC 4XXPA 3DCQA 4EJRA 3FKSG 4IEQA 5IW0A 2RCVA 5FZ7A 5ABJA 4LE4A 5F6LB 2PN5A 1BYHA 3INAA 2LGWA 2Y6HA 1QU0A 2R30A 1ZYBA 1DGWX 1RMU1 2JJ1G 2ZGKA 4CDWB 2BZDA 1GZWB 2RMKB 1SLBA 1M93A 1DYPA 3MBWA 3CE2A 1B35B 5LBFA 1KD7A 5L73A 4CCCA 3F5WC 2Z2SB 3B40A 5CFCA 4PA6A 3ABLB 3PLQA 2D7FA 2XAFA 4Y26A 2VTXA 4HYOA 3J8F1 5AC91 5BXXA 2IXLA 1KXGA 1HNXO 3KV9A 3JD0A 1MZ5A 2OIEA 1LHVA 1QJU1 4LFCB 4YG3A 2WZR3 4A44A 2XWJB 1XRUA 2B39A 4LO5B 1RUC2 2B46X 3CP1A 5FLHA 1J3QA 4BA6A 3JCZA 1GZ9A 1HWYA 5FZ0A 2FCVA 3I3EA 4GKXA 2K0GA 2W95A 3O5SA 5GZCA 4QQPA 3IIAA 4X8PA 4K8FA 4R9AA 3OR6C 5EZWA 3KMHA 4GYCB 5A7OA 2YI9A 1ULEA 4AVBA 3OY8B 1BGYH 3ZIWA 4WBNA 1SQGA 1IPJA 1US2A 2WLLA 2W0FC 4HNAB 5I0UA 4PHZA 1CAVB 3ZO0B 5J9PC 1A34A 3NNFA 4QGMA 5APAA 3LIHA 1VBC1 3ZN6B 2IH1C 5GZEA 3N9OA 4LK6A 4JAUA 1T6GC 2YBPA 1QXPA 2ZGPA 4IGGA 3UL2A 2P37A 1IHMA 1HNWB 1RINA 4EV0A 2K46A 3MIGA 2VW1A 4LWSA 1Y43B 4ZKIA 2OIGA 1NUKA 3ZFEC 2DDUA 1ENRA 1P8JA 4ASUG 2ZZQA 4BZ4A 5ITZA 3HD8B 2BBAA 1GNHA 5IK4A 2JG9B 4JYYA 3NAPC 1CWPA 3N3HA 4AQYO 4LXLA 1JODA 4FFGA 4XQWA 4P9OA 4YVWA 5EPAA 1QJX3 1PGL1 4QDRA 1FAYA 3GZUC 3GM8A 3FN9A 2BOBC 1CX1A 3PUHA 4INDA 4KHPB 4GWMA 1OURA 1ONAA 1V00A 1EV12 3OMAB 4Q6GA 1FPN1 3ABMC 4P9PA 3EXAA 1BHBA 1W99A 2MK3A 4LPLA 5CFDA 4UUJC 1QHTA 1U12A 4PT6A 5K7PA 1JZ5A 5FCCA 3UT5B 3F7VC 4OMCA 4ZU7A 2Q1ZB 3ZYFA 1H2KA 3PJYA 4RN5A 5DDJ1 2JDAA 1WA8A 1DP0A 3D0JA 4QM9A 4DEQA 2ZINA 1CIWA 3W7TA 2VW2A 5FZIA 5CVRA 5FBZA 4K21A 5FZOB 5ABJC 5ACA3 4P9IA 3VBFA 2WAAA 1IS4A 5EC2C 3X29B 3PIGA 2XLFA 1REDA 1XMQO 2ZGSA 5FWEA 4IEPA 1CONA 4QPJA 5JI9A 3MZHA 4UCUA 2VQFO 2IXHA 4BOWA 4XHXA 1UU6A 1K5QA 4N9IA 3OGRA 3OGJA 2D3RA 2Y6FA 1W39A 5CKMA 4D8MA 4XJZA 4LO6B 1LUWA 3S7EA 2A6ZA 2PY5A 3CC7V 1CAXB 3T4DA 4LFAB 3WU2Z 1RUG1 2QQVA 4LO7A 1XPWA 5A32A 2G1MA 4CU7A 4N9HA 1S1AA 4JYAB 1THZA 1BMV2 3CL1A 1W2NA 3BB6A 3CZJA 1YTFD 2NNUA 2E63A 4B8EA 4NXMO 4UFHA 2X0LA 1OFSA 2OWOA 2KQXA 5LEKA 1LGNA 3QOPA 4Y1UA 3C3TA 4AEKA 3ZFFB 4Q4Y3 2QWQB 1R1BA 1OCZB 4XF1A 1GANA 1DQ1A 5CISA 4LO8A 1EAH1 3V65A 1UYYA 2CK3G 5IY5C 1ZZCA 4JGYA 2JDPA 4M3CE 5FYZA 3SDLA 4L92A 5JH7A 1JFFA 5LP6A 3G6JB 3VBFB 3S57A 3VBRA 3GXUA 3V0BA 1HP8A 4UCTA 2X8KA 2DE0X 1GP5A 2X5IA 4NHYA 3IPVB 4PCRA 2X6CA 2WO7A 1CX4A 3BTAA 3ZDVA 3PU8A 4OI1A 3PUSA 1YWKA 2ZBJA 2RR13 4HMZA 3URFA 5HV0A 2VZOA 5DMYA 3ZHRA 1B09A 5F3EA 2YU2A 1QJY1 2W1QA 1WBFA 1CVNA 2KM2A 3AK3A 4O4JA 1MQTA 3L72H 4CXWA 2EIBA 2QJVA 2G9ZA 4IEXA 1JOPA 4EKWA 1AYM2 1W90A 3WDVA 5A1LA 2AACA 1WLTA 4ISRA 2R0FA 3WF3A 5FMOL 1BMFG 1DF4A 4FPYA 5DUUA 4BYYA 5FLJA 1ASJ2 4LIVA 5L3CA 1KFXL 4AI0A 2CDPA 1W8WA 3K0GA 4Z2AA 1FXKC 2HLDG 2WA3A 4JI3O 1JA8A 5JJJB 4N7UA 1W3XA 4B4QA 5D5QA 5E8AA 2RJKA 1UYZA 4O65A 1ULPA 4QPIB 1QDCA 3K08A 2JGUA 2JIZG 3CJHB 3H8RA 4EEQA 4AWDA 3CCEV 2O8OA 1TMF1 2P06A 2AGSA 2CTVA 2V5DA 3VZNA 2HWC3 5LA6B 3AK2A 2ZIMA 4IIJB 5FAXA 1B06A 5KXEA 1OHFA 3H1HH 2EIJC 1I5PA 3RI8A 4LH7A 2HFEC 4LBQB 1O3RA 5JZGC 2Y6KA 2X5IC 1O3QA 5JR2A 2Y8KA 2JKXA 2JDYA 4FQ4A 2P5BA 3OT7A 2CAUA 1ZZ8A 4DR6O 3RBZA 2XHNA 1NY71 3K0DA 3GDBA 5C9AA 1ZRDA 5KLVH 1XI1A 1WCDJ 4MSVA 2OTLV 4DXZA 1CESA 1NU1H 5IJ0A 1IKQA 2JIGA 3RS6A 3IT8A 3KWVA 1W8UA 1K4DC 5LY2A 2GN3A 3KVBA 2ZCEA 3SJBC 4J11A 3KV6A 4G9SB 2HWD3 4ZKTB 4ORFA 1NXD1 4LBEC 2WS92 3S6PA 4JTAB 5CU1A 5LHIA 5KA6A 4XMIA 3IAPA 4ZONA 3OY8A 3ZN0A 5BNPA 1AZDA 3J7LA 1GSLA 3N2KB 3SEEA 4DV2B 4DV6O 5FZ4A 3VKFC 4QKNA 3SGIA 2VUDA 1DZRA 1AX0A 2ZTNA 2ORXA 2R062 1HRI2 1K42A 3JB4C 5FY5A 3CDZB 3JCIA 4XTPA 1Q8SA 1OOPA 2ZHMA 4DV6B 1Q82W 3B01A 1XMOO 3AYDA 3WOGA 3PMEA 2FDIA 4XFFA 1MZEA 3DGTA 2BNOA 4CS2A 4QE9A 3E1F1 4BWAA 4U3JB 3IFXA 4DB5A 3WG7C 4QX2A 1SQQH 1MEC1 2IZWA 4K20A 4OUMA 1IKPA 4CEWB 4LR4A 4QXHA 1AL22 4QXCA 2RN9A 4GIQA 3OGVA 1O9HA 4DV1B 2UXBO 1JW6A 2PAMA 1LOGA 1QR9A 5FKCA 3BHPA 3UO2A 2ZGQA 1UX7A 3FB5C 4YM0A 2ZX4A 3BY6A 1AX1A 4P5YA 4O2AB 5FZ8A 4Y1ZA 2DQ0A 1OA4A 5FY4A 4DPNA 1PHMA 5BR8O 4RQPA 1VAKA 3POBA 2M7WA 2Y69B 4BIUA 3OFNG 2JIJA 5FPRA 3UT5A 3V0AB 4R4XA 2YUEA 5H9RA 1AYM1 5DECA 4FTBA 4DYLA 5L9RA 3SH3A 2VOTA 2YHJA 4FXKB 3QO8A 4ZS2A 2WLJA 1AR93 2VMDA 1M57B 4M0HA 4J9ZB 3ZMUA 2MEV3 1EPZA 3VOUA 2A75A 1XNRB 5FYUA 5LCWL 3ZPYA 2RR12 4O9EA 3IDCB 4AF9A 4LF6B 2W91A 2GNTA 2OUHA 1VJ2A 1GNYA 2SLIA 3WV6A 3SPCA 5LYJA 4FTSA 5F5AA 3MDPA 4O9GA 4QXKA 2VC9A 2V73A 2AUYA 1XQNA 4ES9A 5DAQA 4YGEA 1XMOB 2ZXWC 3NV1A 4DK0A 3K2OA 4CDUC 1W9FA 3IC9A 1FMD1 2PQQA 1ZL8A 2PGGA 3J80N 1AR61 3HT2A 3A0KA 4PIZA 5FL7G 3FLRA 2JE9A 3ZR5A 1JZ8A 2R063 3TB0A 1P7BA 4Q4X1 5F39A 3HQXA 4JI3B 4Y1XA 1ZRRA 2XBO1 5KHGA 2WN3A 3WVJA 3SCHA 1XYNA 2YFUA 4B4RA 5FQ0B 3DF0A 4IEZA 4BQ5A 4JDMA 3POEA 1D5NA 2BFUS 4YWAA 1JHJA 3E89A 4CDXB 3D5OA 3K06A 2HWE3 1JCHA 1SQVH 4ITCA 4NTWA 2VVEA 1WPBA 2LW7A 5JOYA 1SERA 3B5LB 5CBGA 2CYFA 1W2TA 1NE4A 4Q8KA 4LHKA 5CZKA 4JI7B 1RUH1 2XVKA 4FOWA 3C8XA 4E2LA 4WVZA 3AJYA 5E6HA 3FAVA 1ZRCA 4UCSA 4ZBMA 2DYCA 3ZHQA 4B3RB 5T5LA 2EULA 2J42A 3PTRB 1AI7A 1FFTB 4CTEA 4RQFA 3ITQA 2XONA 4LE3A 5H6QA 4M3CB 1Y9MA 2FDKA 1DHKB 3SMHA 1N34B 4FSJA 1UX6A 5T5OA 4FLTA 3I2FA 4XF9A 2HWF2 4NPLA 1JMKC 5A32B 3RNSA 1MEC3 4F6RA 4ZI7A 3VBBA 2HBUA 3ATGA 4WVMB 3RYIA 4PF5A 1PK6C 5CFCB 4NTXA 2YU1A 2Q67A 2OX0A 4DV0B 4GKJO 4KBZA 2ILMA 4XFIA 5A6XA 2DF7A 2QTOA 3ZDSA 3TOJA 2IC1A 2Q69A 1YEWA 3KB5A 1NQJA 1LOFA 1HW5A 2WNUB 3LE0A 1GM7A 1ZTEA 2CU5A 4FLUA 4FPFA 1PNMA 3A22A 4XE9A 4IE0A 1K9MW 3JARA 1WA4A 2PYLA 4DR2B 1FYUA 4ARXA 1SPPA 5GTIZ 2F4LA 4K1ZA 2P1BA 3M3EA 2JS3A 4R7CA 1H6YA 1QQP3 3NWKA 4AAPA 4WVVA 3RI9A 4AXOA 2FMDA 2Y60A 5CA1B 3ALQA 2ZGRA 4CUGA 2ET1A 3UGGA 3W9AA 4KFMA 2YPDA 2Q7HA 3IJ4A 4CEYA 2L35A 3KGLA 3VBHA 1BZKA 5JSOA 2D3PA 3MIBA 5JR7B 3APQA 2AZ0A 3I49A 5JXHA 1V70A 5C4WB 1NCQC 4RAIA 3SPIA 4DOUA 2ADEA 5FPZA 5C5UA 4CP9A 1JZ2A 5CKQA 1GQHA 1JJOA 1K45A 4F8AA 2WLHA 1D0GA 3QD6A 2ZGUA 1JYWA 4X62B 1US3A 2D6KA 2WLIB 2HR3A 3WG4A 3JAWA 4YJ2B 5H5NA 1WLDA 4XILA 4CCNA 5F5QA 2VU9A 2OCCC 3RYHA 3T2OA 1CEZA 1LTEA 1CAXA 4O4HB 2QWNB 4PLOA 1HJGA 2BDRA 3Q8AA 1QKQA 2GH8A 3ZSLA 3OEEG 1C1FA 3WR0A 1PVC2 4BB3A 1CAUB 5LATA 4MVQA 3I97A 4QHZA 4S2GA 2K9PA 2ZEXA 1G9AA 1SACA 3AZWA 1I5YA 3WQ0A 3B69A 4TUYA 4XFBA 1RP3B 3A21A 4QKBA 4UFJA 2AEYA 4ZOLB 4GXLA 3GBWA 4NHLA 3OEBA 2WNOA 4YHHO 3TEWA 5FPXA 5CAZA 3BN6A 1RXFA 5LY1A 2E76B 5LW9A 4K8RB 4MTOA 3MF9A 4Q5OA 1EN4A 2ZEZA 1N1SA 5G05L 4YW6A 4N23A 5A7QA 4R9BA 3EXUA 1I3HA 5EZYA 3UJQA 1ZWIC 1MR5A 4CCDA 1KJRA 3L75H 2XXZA 1WUVA 3ZX7A 4M3CF 3DYOA 2AR6A 3O1RA 1YIPA 1JXNA 4Y4RA 4OZXA 4XBQA 5IVEA 1CN1A 4RUFA 3CS5A 1DTOA 4JI2O 1VQLV 4JV5B 2GNDA 2HWD2 1AR81 4D7YA 5BNNC 1G1XB 3O1PA 3ZSKA 2QE3A 3NNJA 2A73B 1SZXA 3RYFB 4JZ2A 2DVGA 2ADDA 1WJZA 1RUF3 2FYUH 2RMU3 3RVHA 1V6LA 2VMFA 4C7UA 2RQ6A 5DUVA 3RYKA 3JD71 5DG2A 3SJCC 4YVSA 4BR6A 2VUJA 5FY8A 4CXXA 4UBHA 3IDBB 4CCEA 4W65A 5BNOB 4XFGA 1H2SB 4X6QB 3JAWB 3S7IA 2AH2A 1MS5A 1W9YA 2A3XA 1VQPV 2WFF1 3C7HA 1AP5A 3BODA 3J7AU 3BA9A 2UU9O 4ZXKA 4I55A 2Q7EA 1B6QA 2Q0AA 4B7KA 5L3GA 1GV9A 3HPNA 5CBHA 4A2UA 3MW4A 3WNOA 3R4SA 2OQ7A 2GZWA 5K4LA 4I0WB 3PDQA 4PELA 3B94A 2E75B 3OBTA 1SHWB 3F2ZA 2J7MA 5DN6G 3FYIB 2A3YA 4Y22B 5SV5A 1NLQA 4EN8B 4DNYA 3SEPA 2Y26A 5FY7A 4GQ7A 1UY4A 2EILC 1OLRA 1G7YA 1QXRA 4DR5B 3X2QC 1BBT2 3R4UA 5JXIA 1TNRA 1H30A 1JYNA 3U4XA 4IHJB 2JDKA 2OIIA 2XL7A 3PVBB 5FLXN 3GF6A 2A79B 3WB1A 3LWCA 5HCBA 1UKGA 1UOGA 3OGCC 4DR5O 4NIIA 3AM2A 4JTCB 3PMSA 2JG8B 5C3SA 3QO7A 5BYNA 3LAGA 2VL4A 5BPXA 2OUJA 4LHSA 4TN7A 2ZGOA 4LP8A 4BQXA 1IBLB 1WMEA 1X9PA 5FZAA 4X1YA 3CCVV 4JI1O 4MVUA 1I5ZA 4AGGA 4RA0A 4V2VA 4UAPA 4XJAA 4IGQA 2X53S 1NT0A 1UCXA 3GWOA 1Q90D 2VWKA 1I7FA 1AI5A 5L7OA 1S0JA 4LKEA 2D5FA 4UB8Z 2VQFB 1M4UA 2IM9A 1BMV1 1GWKA 4LF4B 3K5LA 3W20A 5KAIZ 2W39A 4YSFA 4PDVA 3ZXFA 4X1KA 2W5FA 2YIDA 2NM1A 1DGWA 1OCCB 2XAQA 1HRI1 1TEIA 2WQ8A 5LMUB 1SLAA 3MLLA 2ETNA 2MPFA 2JJ6A 4BXSV 2UYAA 2I74A 3N9LA 4GULA 1AR62 5GZFA 3HKDB 3OUJA 3BGAA 4FTEA 1IGOA 4XDJA 1H8TA 1K5MB 5DAWA 1UZ0A 1V0AA 2RJZA 3IKWA 3NR7A 1K5SA 4OFGA 5A3TA 4UFIA 3LFMA 1AL21 3FB6C 3ZN1A 3ST7A 4GLXA 2W46A 3ZSMA 4AHCA 2QEXV 3AP7A 1WAZA 3J8F3 4JAVA 1GK9A 1CJDA 3ETEA 2FKXA 1W8ZA 1PMIA 1SQXH 2OW4A 1L3JA 2JKBA 1AJKA 4C0BA 2YGMA 4FBFA 2IJJA 1KKCA 1UY3A 1NTZH 5JH7B 2WAMA 2IXIA 1OI6A 3UT0A 5EBWC 1WW6A 3AP9A 1I08A 5EYPA 1IURA 5BY1A 3OAAG 4N90A 5FPAA 5FYBA 1VQ8V 1OKQA 1KKDA 1QMJA 2A6YA 3TAYA 1MSDA 4W4KA 2J1SA 1VQKV 3BPZA 2JB4A 1YQ8A 4OZOA 1AR73 1PGL2 3DPRA 3GZAA 5K0UB 1SQBH 4RR3A 1FV2A 2XKPA 1NTMH 3O1UA 3CLPA 4TLGA 2ZX1A 3OYWB 4Q29A 4LBNA 2PLV1 4PI0A 5A3LA 3E97A 1UF2C 5C3PA 3QACA 1W9WA 2E5LO 4DR1O 4UXAA 3IGAC 2P2KA 4J80A 4BIFA 1AJQA 1I0HA 3WT3A 1GFF2 3QNEA 1JOYA 5FV3A 1PPJH 2VAUA 2VCAA 2ARAA 1V9U2 3D36A 3VKOA 4Z07A 5FPOA 2XJVA 5IWAB 4YRDA 4BIZA 1ULCA 1YQ6A 2RVAA 3ZBHA 4FZ1A 3ZLIA 4Q0QA 1ROPA 4IGOA 3AMQA 3H1WA 3I3MA 2R6QA 3Q8EA 2VOVA 1UIJA 4XQDA 2Z79A 4E27A 1EZVH 3RN4A 4BQWA 4A41A 3GBGA 4PA4A 4BLJA 2ORZA 2MEV2 2OXBA 1JN2P 1GUIA 4PA7A 1Q3EA 5GZDA 4UVCA 1LNQA 3CKHA 1QJY2 1VEWA 3LA2A 4Q4W3 4Q20A 4S2FA 5A3OA 5EIBD 4XJUA 1G8WA 1SMVA 3TEZA 4LIUA 2PHWA 1RYYA 1IVSA 3QO5A 5K8SA 2ZKOA 3WB2A 1H9PA 1TAEA 3K5NA 2HWF1 2R1DA 2O8QA 2VWJA 1L8DA 4AI2A 4JV4A 2LRPA 2RS32 3B02A 3VN4A 4ZHNA 1X4TA 1UJWB 2EIJB 3JSLA 2VECA 2JS5A 1BZWA 3LDEA 3BFRA 4LA2A 4RWUA 1CPMA 3BCWA 3E86A 4HONA 5AVAA 1PO23 4YW4A 4DY5A 4BW5A 2VW0A 2XJSA 2QWRB 3FHAA 2A1XA 1XNKA 1B35C 4U7OA 2PYJA 4P08A 3BAAA 4FLWA 1FPOA 1N1YA 3SITA 2YBKA 5HPOA 5FYTA 2F93B 3PVOA 1WCUA 1YVWA 1SKVA 1FD9A 2W9XA 3HVDA 1VF6C 3OTOB 1QDOA 2VZQA 2Q8DA 1SFNA 2ZMLA 1GU3A 4X20B 1W0JG 3V64A 2OPKA 5KXDA 5KX5A 4Q4W1 5LL6Y 3PUAA 4CP1A 3B4SA 2V4DA 4UI9L 3KKYA 3HB3B 4HOOA 2EF6A 2MNGA 1UN1A 3VQVA 1FXKB 3IAQA 4ASLA 3PVNA 4FPEA 3MICA 1RUE2 2X6BA 5BR8B 2D2CB 5F32A 1E5RA 2GMPA 5L9BA 3KCCA 1CZTA 2ZACA 2ZXQA 3K58A 1VR3A 5I0TA 2QM4A 4DO0A 5A7WB 4LBKA 1PVC3 1TGOA 3ABZA 1OOPB 2Y0IA 4GH4C 1S76D 1QGLA 1C1LA 1Y67A 1MS3A 1ASJ1 1HN0A 1SA0A 1W6NA 2R9AA 3J81N 4AHXA 1R64A 5FYHA 1VMGA 4HPKB 1N33B 4UB6Z 1UXXX 4W4LA 3LDCA 1JR9A 2ZKLA 2X5IB 1HX6A 5EJ1B 3MLJA 4A6OA 1YHFA 3E22B 3UKVA 1CAUA 4G2KA 1V6OA 1A78A 1DCSA 3W7SA 4FZ0A 5JQGA 1JZ4A 2JGDA 4W6YA 2DUPA 2WZR1 2B4KA 3H01A 4IUGA 2DUOA 3T0DA 5CEHA 2B9ZA 2A6XA 2VS0A 5ACA1 1UYXA 1RUD2 2ITCC 1BHGA 4QNHB 5IY5B 1WLCA 4JAAA 2YDEA 2R9RB 3S5QA 1WW5A 1X50A 1J83A 4XQ4A 3IIIA 4E2QA 4MH0E 4GD4A 4H0LB 1ND2B 3EFFK 3MLKA 4LF6O 5IK7A 5F2WA 3DEMA 4XTMA 1D4VB 1ZBE3 4OQ8A 3PUIA 2BUKA 5JZGA 1HKDA 1ZBE1 3LIGA 3WUDA 2UUBB 1W03A 5FQ0A 2FCUA 1KEXA 4MG2A 4Y24A 3BVOA 3E83A 4LF8B 3PJQA 3FD9A 1GKFA 1VP7A 4CDUB 1REEA 5L7OB 4HVOA 3THDA 5JCOC 2JEUA 5HBAA 4IE5A 4LBLA 2AHYA 1PKXA 1OCRB 5CMUA 4NRPA 1N4CA 4QAWA 1AP6A 1EV11 1HRV2 4AQ6A 4BQ3A 1GNZA 4X65B 3D3AA 1DQ0A 3KLSA 2HWB2 2YPJA 4LLOA 4HN1A 2JGDB 1NH2B 3D6EA 3RZLA 4EWDA 3ZN6A 4JI6O 1H2GA 3M3QA 1GZCA 1XE8A 1J59A 1RUJ3 4EZHA 2W92A 4S2DA 1LUVA 3B8MA 5GZGA 2QGNA 5FZ1A 4XZPA 1QVGU 2XHKA 5ISLA 4I0XB 4AG4A 1IG0A 1XU1A 3GWKC 2YEVB 5BNOA 5LOVA 1UYPA 1O3TA 1S77D 2JECA 1ZVFA 3CU7A 3ZVXA 1HV1A 4GWNA 1AR5A 2ZJCA 3AZXA 1EM1A 2TNFA 4BK4A 3AL6A 4IEUA 1RFYA 3JAMN 3B8NA 3OUFA 1FOD1 3T0AA 1VRH1 4JKMA 4JI4O 2YYOA 3DPRB 3POFA 1AXKA 3WP4A 5F9TA 3AXEA 5FZOA 2CV6A 1ULGA 3QCWA 3VUOA 4X65O 4XEZA 4MTXA 1U5YA 2QNKA 2A6VA 1LU2A 3QF7A 4SBVA 4GH4A 2RS33 4H2AA 1Q6UA 1SCRA 2A7AA 2KSDA 1NY72 2A5ZA 4NTYA 4GKJB 1HJFA 3AG1C 1AI6A 1YJKA 4Z82A 3OR7C 1OCOC 2J1UA 3PURA 3P3NA 1R1A2 2XLAA 3HNBM 2DVFA 1AXZA 3JAKA 4O7XA 1XNCA 4PV1B 3EQEA 5GLUA 5BNPB 4YVSC 3DC5A 2Z5UA 2X05A 1IG3A 5EJZB 1JVMA 1C8M1 5IFPA 3H3UA 4AEDA 3SPJA 4DR2O 1PMJX 1R083 3WDUA 2L6LA 5LBQA 1F35A 5T55A 2PHLA 2A71A 3WF0A 4FFIA 1DIWA 4JI5O 1IDSA 4AVVA 3AMNA 2W87A 4YW3A 5LBCA 3I59A 1LHNA 1HIXA 1JS9A 4LC1A 1IXMA 4FLZA 3RYFA 1XOYA 5LK5A 2LTNA 5J2UA 3H1KH 2ZNIA 2J22A 3NVCA 3H3LA 4AEJA 1QXJA 3FMGA 1UL9A 4B3NA 2ITDC 2FBEA 2BOIA 5I8TA 2WNUA 1XEQA 1VMHA 4FO9A 4Y3OA 3ZM8A 3VBHB 1OFNA 3R05A 3MV11 4F83A 1VQ6V 1G9FA 2HEVF 1V55C 4GB33 4MTFA 5LA1A 1AUYA 2E7QA 1C3HA 3WQBA 4DV3B 3H3ZA 3DSQA 2LALA 5CNAA 1SESA 1YUDA 2OZ6A 4GH4B 2CDYA 3T4ZA 5D8AC 3F5TA 1PMHX 3Q8CA 2V72A 1YFYA 2BGOA 4AVTA 2E51A 4NHMA 2QKSA 1B35A 3AEIA 4UVAA 5BNNB 4PLMA 1VBD3 1EY2A 1N36B 2WS93 3V0AA 4MW3A 5CIRA 3UQ8A 3B00A 4B3SB 1YRZA 3JSNA 5FY1A 3AKPA 1KBHA 4FPLA 5LMNB 5FXVA 3RYPA 2DCZA 1GLHA 1L7RA 5LP6B 3T2QA 1GMGA 3KQRA 4B29A 3A2FA 1NAEA 4NOTA 3WNKA 5FREA 1SEFA 1XL4A 1CAWA 1RUD1 3KV4A 1XILA 1UWWA 4RS5B 4XJ8A 2PHXA 2EIGA 5BNPC 5L3DA 3VD3A 2GH2A 3NKTA 4N53B 3AKSA 2D44A 2NP0A 4YJ3B 1POV0 1GR3A 1VBD1 2IWGB 4JV5O 2JRIA 3GYDA 5BY5A 4M00A 1NZCA 4IW3A 1S0GA 3VZJA 1RUC3 5H9PA 4I9WA 4DUZO 4AQYB 2RV9A 4CCLA 5FP7A 3HR9A 4DMIA 2P7TC 3OBAA 3LF7A 3ME2A 2V4VA 4I50B 1WB8A 3K5OA 3JD1A 3Q9OA 3HKEB 4ATFA 1ZBE2 3ZYBA 1S2KA 1ODNA 4RSUA 1FXZA 1MQTB 2PLV3 3E5QA 1QLEC 3C7GA 2IUWA 4QX5A 4V1PA 3KZ4C 3M7MX 3T4VA 5KC5A 2ZQMA 3WNNA 3CQOA 3U4SA 3SKVA 1M06G 1KS5A 4XUPA 5K1XA 4EN9B 2RHPA 3CMAV 1BCCH 1BQ0A 3POYA 2R043 1GO3F 2WDBA 1U0AA 2XH6A 1Z2GA 3GVMA 4DR3B 3VHOA 3AL5A 2VZ3A 1OA3A 2YXSA 4Q0SA 1VALA 2J1TA 3SNMA 1OLMA 3MFAA 3LSUA 2P3JA 4M3CA 3I2GA 1W6PA 3ZYGA 3D82A 4LHLA 1IXBA 1ZSPA 4LNVA 1AVBA 2WLQA 2WLLB 4BMBA 4Q8LA 2YC4A 4B3SO 1UZYA 4ZHQB 5BMVB 2CNAA 4QJFB 4DUYO 4K40A 2B5HA 2XJUA 1V54C 1ND2A 3ZXGA 2FDGA 2OYZA 5D2AA 3MUY1 1O8PA 2G38A 3VBRC 3W7WA 2ZMKA 1JI6A 3IBMA 4BH9A 4BU2A 5E1AC 2Q8OA 4H13B 3I7DA 2C2AA 2ZE6A 4JGYC 5TISZ 1FKAO 1R082 1XDCA 4F3JA 3HWJA 1FAFA 4N53C 4QX3A 4MUVA 1DGSA 2DTYA 4E8DA 4B3MO 5H9CA 1VBA1 1N34O 3MIDA 1QCEA 1F4HA 3TWIA 1RTVA 3LSDA 2JICA 1R093 1HW7A 1UY1A 5DUXA 1MS1A 1H2NA 4N53A 4ET7A 5FYSA 1BBT3 1AXYA 3AMPA 3VD5A 3L9DA 1E1RG 4P9GA 3S30A 2VTXJ 1ASJ3 4AGVA 2BWCA 4GZRB 2AHZA 4WFEA 3K5MA 1S72V 2RR11 3WF4A 4HLTA 4JI7O 3NKGA 1QF3A 4FPOB 2AC1A 3CRRA 4MO3M 5FK8A 5J2TA 1NOVA 4DRXB 1MMMA 1HXS3 3OM3B 1R3JC 3AB0A 4Z92B 3SH5A 1Z7S1 1XNBA 4AQTA 1KMIZ 1V6JA 1GM9A 4KBBA 1J84A 4FXGB 2X6AA 1AROP 4O2AA 2WT1A 4GZ9A 5J98B 5BMVA 1OKOA 4CEYC 1VRH2 1TUBB 2Z3YA 3UGHA 3K59A 1H4HA 2P3KA 3K51A 4JYBA 1XB9A 4MVTA 4AHYA 3CJIA 1K34A 3KHCA 2ZHLA 4DV0O 1X9TA 1W0KG 1YO8A 2W2IA 5T3NA 4NAMA 4ABMA 3BUCA 1NCRC 1S0FA 2VNVA 4K35A 5A9GA 2PHRA 2PXJA 2XDVA 4WM7C 3RPQA 1RHI1 1K92A 1Q8QA 1LHUA 4IESA 3JARB 5JSRA 3ZEDA 3AG4B 1NCRA 3A23A 4F7ZA 4U3JA 4LF4O 2QQMA 3E5XA 4QQ2A 4RHV3 1ZZ7A 1MEC2 5GALA 4E4SA 1YQCA 3FUQA 3WXPA 1ULOA 5GLTA 3APOA 3PJSK 3LD8A 1XNQO 2O1QA 1DZQA 5CA1A 4I7ZB 4WF9V 1W2AX 4D6TH 3ZHTA 4P00B 3JD72 4LT5A 3CRCA 4A7YA 2P4EA 5LMUO 5J2TB 1O4TA 4AQSA 1ZX3A 2PA7A 3KS7A 2HJFC 1CZSA 5A6YA 5LZ6A 1W8TA 2EA7A 4O61A 4Q1PA 1VBB2 1DGRA 5FJHA 3CX5F 2UXCB 4KH9A 3MIEA 1ZX5A 1HR0O 1T6BX 4DUWA 3M7AA 1N3QA 1QNWA 1LJ7A 1ULDA 3HT1A 4FOVA 3CMEV 2W94A 5I0DA 4IYHA 2D97A 3F95A 4JQTA 4BJ0A 2D43A 2BEOA 4YJ2A 1CJPA 4Q27A 5JMOA 2C26A 4O2BB 3DC6A 3CCSV 2NN4A 4XDLA 5IWFA 4XVHA 1LB2A 2HJIA 4GMP3 3ZJZA 3IMNA 4MGIE 1COWG 5L19A 1OCZC 5FP3A 1M56C 1W9TA 4AVSA 3U37A 3B2EE 1S0EA 1V6NA 5LEJA 1JYXA 1EUUA 1U5ZA 2IBZH 1T5EA 3POIA 4KUMA 2P4VA 2P5OA 2B8MA 2XJRA 3L73H 5LA6A 1LGBA 3LOBA 4OULA 2BTQA 2YV8A 3T1CA 3H9AA 1PM7A 2Q8VA 5JI7A 5B1BC 4YPJA 1PZ9A 1PM9A 1QJEA 5EBMC 3PNAA 1YFXA 2DQ3A 1OQ1A 3ZFGC 4GALA 2VZVA 3ON7A 4U3FH 3LSQA 3CJHA 4DV2O 4CDXC 1RSOB 1S5JA 1H8EG 1TME2 2WT2A 1YF2A 3NAPA 2ZM6B 3VBSA 3BPSA 1PVC1 1F4MA 3EVKA 1DQ6A 2Y34A 4FMTA 4DO2A 1XBFA 3CRAA 4MW8A 2HP8A 1VQ9V 4P02B 3ZMZA 4CU6A 1K97A 3R4DB 1K73W 2ID4A 4BDVB 1MS9A 1DDLA 3LA3A 3TN91 4D94A 5H9SA 1S4CA 4FAGA 2VM9A 3O14A 2BPA2 5GTHZ 3PTYA 4IEYA 4OUEA 5LMNO 4KI5M 5IATA 3VBUA 1QR8A 1JH5A 3HQUA 2BBVA 4XJ9A 1N0NA 3S3XA 1PNGA 1Y4MA 1NZIA 5FP4A 5FZDA 1GWLA 4I50A 2LFRA 1LOEA 4UF0A 1GYKA 4Q4V1 2VPVA 4XF3A 1HRV3 1OQEA 1D0HA 3FLPA 4J1WA 3AYAA 3ILFA 5A70A 1HDJA 4P9XA 3ORJA 4H7LA 2Q9LA 3IAYA 1NZ6A 1UOBA 4NWVA 2VNOA 3WW4A 2EBOA 5KWRA 2QKCA 4Q4W2 3S3WA 4H33A 2HEYF 4RHV2 5FLIA 1S2BA 3ZMTA 4WVMA 4X1YB 4PD4F 1X8MA 2C9KA 3WF2A 5JOWA 4LJHA 4GCZA 4C8DA 4E2SA 4CH3A 5FPBA 1R3IC 3VHRA 2JX9A 2RS13 3BI3A 5FYCA 3G4SV 2WWUA 5F6KA 4FFFA 4Q0UA 2P6CA 3BU0A 4K1YA 1O7FA 3JU9A 4FP3A 4YARA 1LR1A 2ZT9B 3ZSEA 1LHOA 4LUMA 4OPHA 4PQ9A 4PDMA 3E5UA 1RUOA 2VJXA 4RUEA 1LOFC 1DQ5A 2E26A 3ABKB 4B1MA 1ZBA1 4X64O 3HKEA 1RGSA 2OT5A 5CBFA 1Z5VA 2VE1A 1SA0B 1W6NB 3NQHA 5F3CA 1S55A 2DV9A 4XZUG 1PNLA 3MW3A 4MGQA 1W8FA 4IGPA 3VBOC 3N2GB 1PO12 3RW0A 4LQRA 2QQUA 1URXA 4AW7A 2WT0A 1K3EA 2LUWA 1OPOA 4JGZC 2JG9A 5F1RA 1JZ6A 2RE9A 1WCQA 2WABA 2ZAAA 1BS3A 4J1XA 3E6CC 2D6OX 5FO8B 4OUSA 5B4XA 4E4ZA 1BE3H 3HAGA 3WDYA 2LFSA 3WF1A 3AYEA 4FPKA 3N36A 3WZ1A 3JD3A 3KT4A 1SRYA 2RS51 5D1IA 2E7AA 3ICXA 1GH6A 1JYTA 3HKCA 1ND3A 3K4ZA 3ZPOA 4C1WA 2D6LX 4JI0O 3HEIA 3T1MA 2OQ6A 5HFMA 3WNLA 2WFPA 1QIQA 4PDWA 4LORA 2IJHA 4XACA 4DXWA 4LFCO 1RUD3 4Y5SA 1NX9A 3FFZA 4FLVA 4IEVA 2XGXA 5DZGA 1K5MC 1F9KA 3U0ZA 4I3PA 2LW1A 3OF1A 1EUTA 1W8HA 3AK1A 2HWD1 2CSGA 4TLFA 1WLWA 3W58A 1R3KC 2Q7GA 1WA6X 4LF7B 3B9CA 3UK9A 4HVRA 4L97A 2CGOA 2Q8CA 3SJAC 3ML0A 1VRBA 3I59B 1JU4A 4HK9A 5C8CA 2Q73A 5FY0A 1WB7A 4D7SA 4RGAA 2XTAA 4PDWC 3ECQA 3CO2A 1QQP1 3SPHA 4O4IA 1F2NA 3GJAA 4FP2A 5FO9B 3Q4HB 4KQ7A 2P6JA 2LM3A 1KECA 2DVAA 3OYWA 1SDDB 4CA9A 4Y1VA 3FX3A 1RUI1 3RMXA 1FYJA 4RL7A 1UW8A 4CZSA 3RG0A 5FR3A 1I6XA 2WYSA 2ZGNA 4LK7A 4MLOA 3L70H 2RS12 1SFPA 4JGZB 2F1MA 1O5LA 3AP5A 4B4PA 4IIJA 1S0BA 1RM1C 4Y22A 1COV1 4AR2A 4ASKA 2D3OW 3NNLA 2W47A 4NRMA 2E53A 1F7YA 4JI6B 1TME3 2ZX0A 2F43G 2UY8A 3QBQA 4QB2A 5GKAC 5KHIA 4N21A 5FOBB 2VVDA 2VCCA 5DABA 2XVLA 2Y6LA 4RO2A 5A3WA 4UW4A 3VDDC 4JKLA 4IDZA 3T1YO 4I55B 5IYDO 1AL23 1ZA4A 2ZHKA 1GM8A 5FUPA 3AFKA 1GMMA 4XDKA 3WG3A 3EYPA 4B3TB 3VL8A 2P4KA 1EV13 2EX3A 2DWRA 1JOBA 1LCLA 3UESA 3ZFFA 4CXYA 4QPGC 3Q8FA 2BERA 5I93A 3AKRA 4FJCC 1I9RA 2W3JA 3FLTA 1R6NA 2EXIA 2YIBD 5KUMA 5LK7B 4PQQA 5T54A 1VB4A 4QKFA 3R0RA 1VMJA 4KWUA 1YYNA 4XIOA 2Y69C 3MO4A 4PDWB 2UY9A 2RG4A 4UFLA 3FX7A 4MHRA 4DUVA 4CEWC 3TNPB 2YIAA 4X20A 1VB2A 1UAIA 4FPHA 4X1KB 1H4GA 2XT9A 2FQPA 2AZ5A 4COYA 2BSKB 1XU2A 3FC0A 1VBE3 5FUIA 1XE0A 3RMYA 2JENA 1PGW2 3ZFFC 2X10A 4FLXA 3GGLA 3USUB 5DPNA 4YGBA 2ARXA 4RS5C 5A7SA 3I2KA 2H6BA 4HNAA 1PGW1 5CA6A 5ACA2 4GA9A 4LFAO 4FLYA 1KP3A 1W04A 3WHUA 2R073 2BP6A 2HWC2 4GX1A 5FKBA 4DFSA 4FI9A 3OTOO 2CH7A 5D5PA 1AJNA 3QTCA 4RQPC 2R49A 4Y1YA 4I0AA 2XLGA 3I4IA 3WG2A 5KA5A 4ZU4A 1VAMA 2CWMA 2UURA 4BAYA 1FFXB 2CWSA 3HJRA 1VBB3 1V55B 4A4AA 5FRAA 2BV4A 1OC1A 3RFRA 3MHHC 4CDXA 1YCIA 5C9AB 2GNBA 4AVCA 1IS6A 2CDOA 5K1PA 1MVEA 4NIHA 2GC2A 3VBSB 5D8AB 4P9YA 5JMCA 3JQWA 3ZRVA 3VDCA 3OBRA 4URTA 3SC7X 4XAAA 1Y3TA 2UWAA 3OD4A 5IVJA 2JEXA 2B45X 2QQWA 3ZN4A 4JI0B 2VMIA 5CB7A 1O59A 3WG7B 4EFEA 3ZXKA 2AEZA 3ABLC 1W06A 2WLKA 1AR1B 2GDFA 1W0NA 2OCCB 1FXKA 3O1VA 1RPOA 4JI2B 3UO3A 5FMDA 1IBKO 3KSCA 3H0OA 3EHKA 1HB4A 3K03A 2PHUA 1Q7YW 2R16A 3MGUA 5GONA 1DG6A 4F6RB 1LESA 4Q0VA 4JI8O 5J09A 1F5JA 4GAZA 3RYCB 3V56A 1QWRA 5FPUA 1DLCA 4R8CA 1E5SA 3ZKYA 1VRH3 3LOIA 1RUH3 3CXHF 1XOUA 2RS52 2P17A 5A33B 3OCPA 5LGUA 5HCHA 4AFBA 4JYCA 1OCCC 3FYEB 1W2BU 2AREA 4NXMB 2D6MA 4K9SA 4I2OA 3O7OA 1SZTA 5EC1C 4D6RA 4QD2A 4Z1MG 3WP5A 3RZKA 2FL4A 1RC6A 2BQPA 4E4EA 5EV7A 2LW8A 4LKFA 1Y7BA 3E22A 5EBLC 4DR3O 4JZGA 2DYSC 4DR4O 1FX5A 3J7HA 2DJVA 3ZSJA 2DWEC 5IE9A 5JQGB 1O9GA 4IV3C 3BCCH 1VQ5V 4MOAA 1SQ4A 1AB3A 2FZ1A 3JALA 1HNZO 1H2LA 4I9QA 2QWOB 2X7RB 4CBCA 5E1RA 5B4NA 2NYYA 3R6SA 5F8PA 4OLLA 3SYAA 4DRRA 2WNEA 3E6BA 4A42A 3SQOA 1CIYA 5C9AC 1QNMA 1NQDA 1BL8A 4BQ1A 1JYIA 1WMXA 4OI4A 4CRQA 1J1LA 4AGRA 1SLIA 3UKNA 4JI1B 2V7QG 4MT8A 1A3KA 3VZLA 2ET7A 2A7WA 1PM4A 1RJ7A 4OI0A 4K0KB 2QJ1A 1E5IA 4KXRA 3AJZA 1DLLA 1DBNA 4W8JA 4L99A 3VKNA 1UQXA 4UXNA 2AGAA 2Q1FA 3RWKX 4LULA 2PUSA 5L36A 4IHJA 3MIHA 2ZX2A 2DBIA 1FPN3 1XJAA 3P3PA 4NYKA 1S0IA 1L7LA 3LB9A 1BEV1 1TUEB 3P5BA 3WDXA 2GP3A 4XF0A 1IBLO 3G6BA 5E89A 5E88A 1GTOA
chains in the Genus database with same CATH topology
1HX6A 4DINB 5IK4A 3MLJA 2JG9B 4B7EA 3NAPC 1YHFA 2IXKA 2FZ2A 3AXDA 1C5HA 3UKVA 4YLMX 1CAUA 5JLVA 2WFF2 3N3HA 1V6OA 3V0BB 1A78A 4HN0A 4AI8A 1QJZA 2D5HA 4XQWA 4W6YA 4YVWA 2DUPA 2E9QA 1QJX3 4AQ2A 2WZR1 1PGL1 2DUOA 1FAYA 3GZUC 2ZKNA 2A6XA 5EJ3A 5ACA1 3M3OA 1RVF2 1RUD2 4C5WA 2G9GA 1WLCA 3RQ0A 2WINB 1MS0A 2VGDA 5T52A 4LUKA 1JTZX 4FVVA 4INDA 4Y5Z0 4GWMA 4JAAA 2CGPA 2YDEA 1ONAA 1V00A 1EV12 1WW5A 2XB6C 5K9YA 1FPN1 1X50A 4EROA 4XQ4A 1JR7A 4E2QA 4MH0E 1ND2B 4CP2A 1SLTA 1WW7A 3MLKA 4AEMA 5IK7A 1UPSA 4XTMA 1D4VB 1ZBE3 5CFDA 3POSA 1NLRA 3G7DA 1GZWA 1U12A 1WW4A 1VZ4A 5K7PA 2BUKA 4YW2A 5FCCA 4HSLA 5JZGA 1HKDA 1ZBE1 4XFHA 3WUDA 5IK5A 1VBA3 5FQ0A 4ZU7A 2Q1ZB 2DU1A 4Y24A 1H2KA 3PJYA 3CF6E 5DDJ1 1VZ5A 3VBOA 3VL9A 1CPNA 2E6VA 3D0JA 4QM9A 2OG6A 3WHTA 3PJQA 1REFA 1CIWA 2VW2A 4CDUB 1REEA 5CVRA 5FBZA 2TBVA 4K21A 5JPMB 4HVOA 4YZ4A 5L7OB 5ABJC 5HBAA 5ACA3 4P9IA 4LBLA 1DZTA 2XWBB 3VBFA 1IS4A 1SBEA 1DYKA 4UW3A 1FNYA 1AF9A 1EV11 1PO21 2XLFA 1WGPA 3X29B 1HRV2 3WINE 4AQ6A 1REDA 1GNZA 5FDBA 2JG8A 5CFCC 2ZGSA 2WQ4A 4IEPA 1CONA 4IERA 5JI9A 3MZHA 3SXWA 4KNCA 1HQNA 2IXHA 3WCRA 4BOWA 4XHXA 3KD4A 1DQ0A 1UU6A 5GJ6A 5DZEA 3HBZA 4HFSA 3KLSA 2DCJA 5J3UA 1BVP1 2HWB2 4IEOA 4XW3A 2YPJA 4LLOA 4N9IA 3OGJA 1WCKA 2D3RA 4HN1A 1W39A 5BV6A 4C1XA 4GMP0 4IEWA 4XJZA 3UV9A 1X7NA 3D6EA 4LO6B 3S7EA 1N1VA 2A6ZA 4EWDA 3AZVA 3ZN6A 4KWKA 5HCAA 1CAXB 1RUI2 4ISQA 3M3QA 3N7LA 3KCXA 1GZCA 1RUG1 1QNYA 4PIXA 1XE8A 1J59A 1OS7A 1RUJ3 4P9LA 1BEV2 4S2DA 5GZGA 5AFBA 2KA3A 1Q56A 4LO7A 1AHSA 5A32A 4XZPA 4N9HA 1S1AA 3M3CA 2XHKA 2RS31 2GC0A 4XBLA 2XJPA 3CL1A 1BMV2 4AG4A 5J96B 1XU1A 3BB6A 1AR71 4GKYA 1H1MA 2E63A 4B8EA 1BEV3 5BNOA 4RHV1 1NA1C 4YVWC 1RJ8A 4M2GA 1ULFA 1OFSA 3GALA 1O3TA 5LEKA 2JECA 1LGNA 3QOPA 1ZVFA 2ZZJA 4Y1UA 2W68A 3CU7A 4E2GA 4NN0A 4AEKA 3ZVXA 2ES3A 1HV1A 4GWNA 3ZFFB 4Q4Y3 4M2FA 2ZJCA 2AYHA 3AZXA 1XXNA 2TNFA 3PVEA 4KGQA 1TMF3 4XF1A 4IEUA 1GANA 5KHJA 1DQ1A 3M70A 1G6NA 1SDWA 2EXJA 4BGMA 4LO8A 1FOD1 1EAH1 3V65A 1VRH1 5I0RA 4Z1VA 2YYOA 3DPRB 1ZZCA 1KFUL 4JGYA 1AXKA 3PVJA 3WP4A 4RR3B 4M3CE 4OI2A 1NX4A 1NCRB 3AXEA 5F9TA 3RRDA 2CV6A 1ULGA 3QCWA 3W59A 4L92A 3VUOA 4BHGA 4D69A 4R9DA 3G6JB 4HANA 4XEZA 1GQWA 1U5YA 3PHMA 3VBFB 2QNKA 3VBRA 3T2TA 2A6VA 4I30A 1LU2A 3V0BA 1MZFA 2H6CA 4R9CA 5LRRA 2CY6A 4SBVA 2X8KA 4GH4A 3GZTB 5KHKA 1OLQA 2BTVC 2RS33 4LBQD 2XPJA 2X5IA 3IPVB 4CVYA 1SCRA