2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
2W0XA 2CGOA 1YCIA 5JWPA 1MZFA 2YDEA 2WA3A 3D8CA 1H2KA 4NR1A 1H2MA 4JAAA 2ILMA 3KCYA 4Z1VA 4Z2WA 4BIOA 2CGNA 1IZ3A 1H2LA 1MZEA 4B7EA 3P3PA 2WA4A 2Y0IA 1H2NA 4QU2A 3P3NA 3KCXA 3OD4A 2YC0A 4B7KA 2XUMA 4AI8A
chains in the Genus database with same CATH superfamily
1XYPA 4COVA 2ES3A 1PO23 3E97A 3NL1A 1B04A 3OEHG 2P3IA 4XAAA 2ZACA 2CDYA 2J1RA 2ZGPA 1CN1A 1HRI2 2V09A 4IV1B 1NVPB 2AGAA 4IYHA 2IJJA 2Q8OA 4Q4V3 1YITV 4I5SA 4YW2A 3PTRB 3LOIA 1DQ2A 1MS0A 4HOOA 3UJQA 4H3WA 2BTVC 2QSAA 4A44A 5IYZB 4CCNA 2WAAA 4WVWA 5EHDA 4QM9A 1BCCH 1VBD2 4XJ8A 2A0LA 4B4PA 3JCUZ 2WWSA 4HFSA 1V70A 1FAFA 1STMA 4Y1XA 2ZKLA 1PZ8A 4PDWA 1DLCA 2DBIA 3J7AU 3NMBA 3MV01 4LKSA 2EIJC 4AQYB 4LO4B 5FY1A 4B3RB 2NQYA 4YW5A 1VE0A 5GONA 1D2DA 1H2KA 2WLLB 1IXMA 1W03A 3CCUV 2CU5A 5LHGA 4HKWA 1PX3A 2YC0A 4FM2A 3VZLA 2OWOA 2EF6A 2C6SA 4XVHA 1B09A 1FMD1 3RYPA 2FDGA 1S2EA 3T4ZA 1ZZ9A 1KITA 3DGTA 4CCDA 2V1DA 3GCXA 2A71A 3U4SA 1OLME 1XE7A 4OUSA 2LW7A 3VDCA 2A6XA 1UOFA 1MZ5A 4CCKA 2A9HA 3S57A 3ATGA 1DCSA 3DTUB 4XHXA 4UVAA 2ZE7A 3L73H 4Q4V1 5A3MA 2VCAA 3UESA 3FD9A 1RVF1 4XZUG 4JI1O 3QBQA 3POFA 3K58A 1WLDA 3ZFFB 4XW3A 3B94A 4P5HA 2VMHA 5DUXA 1NY71 3SHRA 1WA6X 4YVSC 1NLQA 5HCHA 1RPOA 2OS2A 5DPNA 3B01A 3E6BA 4QX5A 4OI4A 3LKJA 4BK4A 1RXFA 1OSGA 4CUCA 4PI0A 4URAA 1TVKA 3OPWA 4RGKA 2Q69A 1W2NA 3SR2C 2PYLA 3VKNA 5BMVA 1NVPD 4PCRA 3OPZA 3BGAA 5C9AC 1WAZA 2Y0IA 3NKTA 2DYRB 2X6CA 1C1FA 5L36A 1RUC2 1ZLZA 3LDEA 3ZFGA 4JDNA 1W9TA 3JB4C 5DN2A 5CBHA 4Q8KA 3VKFC 3FLPA 1H8TC 2Y6KA 4CS4A 5KUMA 1NCRC 1CONA 4WM8C 1RL3A 2W87A 1HNZO 1PK6C 4CDQC 2J1AA 4K8XA 1PM7A 2PHFA 3I3DA 5FPRA 1WA4A 2VOXA 2HHHB 3HBKA 3W58A 4CCEA 1U5ZA 4EN7B 1Z2GA 3AG4C 4U36A 2YC2A 3AKSA 2QTSA 2Q4PA 4JGZA 5GLVA 1NA1B 5KXEA 5B1BC 2YXHA 3TEYA 3JD0A 2EZOA 4K35A 4JI4O 3S6PA 3VBFB 3VBRA 2OW4A 4C7UA 4ZI7B 1TMF1 5GKAC 3C90A 1J1LA 3N2KA 1G8WA 1J59A 3V0AA 1UOGA 3SQOA 1MEC3 1MVQA 1X8MA 3P5BA 3QCWA 1V6LA 3MPBA 5BXZA 1GWLA 4IIJA 1YCIA 4X1YA 1PGSA 1LODA 3CWBH 2H6CA 4PA6A 3AG7A 5LA1A 3G6EV 4JAAA 1YJWV 1D4VB 2DTWA 3WOGA 2B9VA 5F2WA 1SF9A 5A1LA 4NN0A 3AX4A 2L9LA 4UW3A 5C5UA 3I2GA 4FI9A 2XVKA 1RUI1 4JZRA 1CD3G 4QDRA 4Q4W3 4ABMA 1BHGA 4TV8B 4UW4A 4G9SB 1ND3C 1PPJH 1MS3A 2LW8A 4FAHA 3KCCA 2JDIG 1D5AA 1TA8A 4W4KA 5EYPA 1Q81W 5FZFA 2RN9A 4QPJA 4X1IA 1ZX5A 5IDJA 5FWJA 3FFZA 2XONA 1JFFB 3QNEA 3MYXA 1N3QA 3MW4A 4LBQA 2JIGA 3VDAA 1W99A 5F5CA 4R8CA 4UAPA 2H0BA 1EBOA 1SC5B 5H9RA 3WU2Z 3N9QA 4JHTA 2G4IA 3OMIB 2VMGA 4FZ1A 3K5MA 1R083 2OIEA 1MEC1 1CPNA 1JOYA 3UKVA 4FT8A 4XJUA 4AEDB 4XQWA 3VBOA 3FMGA 3AK1A 1RUH1 1R64A 3S5QA 1AX1A 3DECA 2LUWA 1BEV1 3JAWA 4XURA 2VAUA 1ENQA 2WLIB 3LA2A 3KVAA 4JVAA 1OH4A 4LF5B 5ABJC 3KZ4C 4AXOA 2WZPP 3CMAV 2H0VA 3PNAA 3LEMA 1S0JA 1V6OA 5FDBA 4Q4Y3 2JKBA 4QPIA 2Z5UA 2YXLA 4KBBA 2O14A 2R063 2IXKA 5C6CA 4UXNA 4JI7B 1DGLA 1WUVA 2WNVA 3VKMA 3WG7C 2GH2A 3OBAA 1PMIA 1YRZA 4LEJA 2LJ2A 2D7FA 1PMJX 3WY6A 5LB6A 1ZZ8A 1XU1A 3AYAA 3L74H 1QGLA 1XHZA 1CZVA 3BODA 3AZXA 2FYUH 2CYFA 1I5ZA 4KI5M 2X53S 4Q0PA 1BT8A 4UV9A 5BNOA 5EQUA 4JX0A 3OBTA 2RDQA 3LCPA 1OHHG 2AH2A 1C4RA 2SBAA 2BNNA 3MLLA 1K5SA 4IQPA 4M0NA 4YVSB 3LPFA 5IK4A 2VQFB 2VBPA 1QOSA 4X65B 1VPHA 2YPDA 5J37A 5CFDC 1GQGA 2VMDA 3HB3B 1JYCA 3MF6A 3P3PA 2A5ZA 2R9IA 2HWE2 1KC8W 1L7LA 4YJ3A 3E89A 1GQPA 3T4HB 2HKXA 3D36A 5C9AB 5LZ6A 4CEWB 2WZR3 5A32B 4CEYA 2UYAA 5D1IA 1K34A 2WQ4A 1BZKA 2B9ZA 1H8TB 3B77A 3JASA 1O5LA 1GZCA 4U3JB 4TZDA 2XJSA 3Q9OA 1PK6B 1S0IA 3AMPA 2LALA 2ZHLA 1T6BX 3GDBA 1RTVA 5EBMC 4GKJB 4P9PA 4YRDA 1YJKA 3VB9A 3ZHQA 4HZFA 3AG4B 4KP4A 4CZZA 2ET7A 5DMYA 3WDWA 1YQ2A 3IIIA 2XVGA 4XMAA 5K9YA 2K9ZA 3RWRD 1SERA 3QO5A 1F4HA 4A45A 2LFSA 4OHYA 1G6UA 1XDCA 1BLZA 5IJRA 1ZBE1 1NT2B 2XJPA 1JZ7A 2YB7A 4UFLA 4QD2A 4I09A 2GMPA 5CA1B 2PHUA 2EJRA 1YTFB 1DIWA 5B1NA 2QDRA 4R9BA 3DXRB 2RVAA 2AXTZ 4YHHO 1UW8A 2WFPA 3PVEA 4O2AA 5KBFA 2DWDC 2BP6A 4L87A 3D3IA 2KD7A 4QHZA 1UIKA 3B7MA 4A7KA 4UCTA 4KBZA 2WSVA 4W50A 3VBHA 3HN3A 4LF7B 1H4HA 2MHFA 1P4RA 3ZDSA 2H8PC 2N05A 5I0RA 1V6NA 3S7IA 4E2LA 1OUXA 4WM7A 1ND3B 4A41A 2VPVA 1W6OA 2E53A 3KS7A 2VZOA 5FY7A 2UU9B 4YVWA 2DCTA 3ZXGA 5A6XA 3WDXA 4OQ9A 2JDNA 1P49A 1VMGA 3RYIB 1QLNA 4QPGA 3BIEA 4ZOLA 1G9FA 3JQWA 3KLSA 2WLMA 3Q8FA 1L0LH 2CNAA 1WW4A 1S72V 5D8AC 3RVZA 1YXBA 3UGGA 3KCYA 2XLAA 1K3EA 1OBNA 4QXCA 2GZWA 1DGWA 1YZBA 3OD4A 3ZMOA 3ZRSA 4CS3A 4HSLA 3LSDA 1JS9A 1GNZA 2ZE8A 2E74B 5FZ6A 1MSWD 3MUY1 5KHKA 4PDVA 3UYJA 4DR4O 1W06A 5LA0A 3P32A 4BQ2A 2Z5WA 5LY1A 2VY0A 2VCMA 4Y22B 4HN1A 3AMNA 1B6QA 3IKWA 4HAMA 5JJEB 3ILRA 2XWBB 1L0NH 2HWD3 2ZA9A 4ZIBA 4GX0A 3K59A 4FFFA 2XL9A 5ABJB 2JGDA 5H9PA 2D98A 3THOA 2FBEA 4R9DA 2BOIA 4TWKA 5KX5A 5E16A 3FFQA 4DNYA 1YTFD 1NOVA 4IEWA 3K5OA 4TQFA 4GULA 4ASKA 3HKBB 1GYKA 3LEIA 3VZMA 1QVFU 3WG7B 2JDAA 4DV4O 3VGIA 3MICA 4JV5O 4YG6A 3KHCA 2ARCA 2P6CA 5LY2A 3OTFA 2ZTNA 3A0HZ 3K5LA 2ARXA 1RUNA 4DR6O 1LHOA 1EZVH 3T0BA 1D4M2 4XUPA 1AXKA 1SMVA 3GJAA 2JDKA 1BK0A 1NZIA 3K06A 1W0JG 3K3WA 4I50B 3MGUA 4EEQA 2A7WA 5E89A 1FOD3 2DVAA 4BH9A 5CFDB 3T1YB 3K0DA 4AHZA 1S0FA 1DG6A 3T3YA 2CE4A 3NJYA 2QQIA 3B8NA 2QGNA 4DQAA 5I93A 3USUB 2HBTA 1N4CA 2CUGA 1OPOA 4AI2A 3RW0A 1RITA 1OKOA 4MLOA 3ACHA 4XFAA 3CU7A 4B29A 2YIBD 4IV1A 2ZMLA 3I2FA 3H9VA 3LSEA 3VLBB 2ADDA 3M3EA 4Q0QA 4Q0SA 4QKBA 1LUVA 2ZMKA 3CZUA 2VUJA 3J26N 5FY5A 2A3YA 5I0UA 1YWKA 3BABA 2FDKA 2ZGQA 1BL8A 1S0CA 2HJDA 2UY8A 3ST7A 1AR83 3TB0A 4XFGA 2MPFA 5EK0A 5LATA 1NX9A 4MW3A 3R05A 1W0PA 5LP6A 2OX0A 1VAKA 1NAEA 3OE7G 2DDUA 2EIGA 2OTLV 4FMTA 2W0FC 5EIBC 5FNVA 3THPA 4YXWG 3RQ0A 4FVMA 2VMFA 4Q4V2 1W6PB 1S0VA 3CEIA 3ZVXA 1JCHA 3KKYA 3ZXKA 2OPWA 1A8MA 1CZSA 2HFEC 1NY72 3TETA 3AKPA 5LBQA 2P3JA 1PX4A 3CRCA 3SKJE 4BWOA 3LA3A 3NXSA 2A6WA 1CESA 2DQ3A 4M4RA 5F5IA 4NPRA 4LA2A 5A6QA 3O9OA 1VQLV 4JAUA 3N9NA 3OFNG 4BM8A 2R1DA 1JH5A 5FR3A 1NI8A 1N0JA 2X5IB 3WF3A 1HDKA 1JUHA 1QQP3 4YPJA 3WINE 4EWAA 1US3A 3NAPB 5KMGB 4IEPA 3ME2A 3ZFFA 5A33B 2QA4V 1ASJ3 4GA9A 1UMHA 4NYKA 1YUDA 4HONA 4FTSA 1N36O 1J5EB 4E4HA 3CRRA 3QTCA 5BY1A 3D8CA 2KSDA 3S0MA 2K0GA 2L6LA 1RM1B 2P17A 1ZL8A 3TOJA 4G2KA 4DY3A 5FO9B 2DW4A 1ODNA 4YW4A 4D7YA 2DFCA 1FI2A 5FZ0A 3VBSA 1OQEA 1RINA 2BQPA 1JPXA 4XF4A 4YZ3A 2A6VA 2FDIA 3UT5A 2JIZG 5FYTA 1M9NA 3RZLA 3NJXA 1GN4A 2C2AA 1D2QA 2DUPA 3OG2A 3L9JT 3POEA 1V55B 4AQSA 1LECA 1FXHA 3RYFB 1I7FA 4OPAA 1OLMA 4M3CA 4AI8A 1YFUA 5FKCA 3Q8AA 3GBFA 4GMP1 5FZEA 5IAXA 3GZAA 3CCSV 4LA3A 5FBZA 1VBB1 1KDKA 2CL2A 1HB3A 3O1VA 1RUI2 5IK5A 1POV3 3RMYA 4DK1A 4PBPA 1V54C 3D6EA 3ZXLA 1AXZA 1J58A 3WNKA 3CC4V 2CAUA 1T5EA 2VVFA 3WLUA 1FT9A 1TUBA 2BV4A 2VZ3A 4EB6A 3WQ1A 1VF5B 4BOWA 4XDKA 2PYTA 4FM1A 1Y66A 3QH7A 4DO2A 1GMMA 1UX7A 3CB2A 5F9TA 2JVDA 3DF0A 3RNSA 4EZ4A 3CRQA 3J9SA 4RQEA 2B1GA 5LWBA 4CU7A 2GC0A 2RDNA 4JI0B 2PXJA 4QX8A 2ZGNA 1ENVA 2E5LO 1OC1A 4GT1A 4TV8A 2QE7G 3SYQA 1MEC2 3ABUA 4BPZA 1OVSA 1SDDB 1RUJ1 4MGYE 5T5LA 1D0GA 2RJKA 3NV2A 1LGCA 4IESA 5EBLC 4AFDA 1RUH2 2V73A 1GKFA 4HMZA 1XNRB 3CMEV 3BTYA 4CU9A 5BXXA 4GXLA 2AYHA 4K0KB 4HN0A 4LF8O 3FB8C 2VC9A 1RSOA 4YM3A 4XEZA 1K42A 3SJBC 1OXCA 3OGIB 1XOYA 1N47A 4NXNO 4LIUA 3AP7A 4I30A 1GZTA 4MVTA 4WFGA 2RJZA 3VD3A 2ZGOA 4QGMA 1HN1A 3JXSA 4QKNA 1KDMA 4WF9V 2RR11 2XKOA 2NN4A 3TN93 2RHPA 3T2PA 3W9AA 1ALYA 3EFFK 1N1YA 4QXBA 4AEDA 5LXTA 5T5OA 1ACCA 4B3TB 2NNUA 1AR91 4IHJA 5AFEA 3I2KA 1WLCA 3POWA 4ZU5A 3GNEA 4QDSA 1KD7A 1KJLA 3VDDB 2ITDC 1GUIA 5AG2A 3M3QA 5F2SA 2WLIA 1S0GA 1AR4A 1J1TA 1SLTA 3FLTA 3LPGA 3UCSC 2XNDG 1R1A3 2DJVA 4FFIA 4JI6O 4FLXA 2VUDA 1R082 1HXS1 5L3DA 1JYTA 3UK9A 1UZ0A 3KGZA 2P6JA 2ZAAA 4FPPA 3UT0A 3WQ7A 1F35A 4XDLA 1QEXA 1N1SA 1U0AA 4NIHA 1G86A 3KSCA 4ZHQA 2GAUA 3CS5A 1WD3A 1VIWB 4GWJA 3V0BB 4C90A 5FP8A 2C5DA 1QJZA 1IQDC 1JW6A 2IH1C 1BYHA 3JARA 2R16A 3S5AA 1I94O 2GC2A 3LWCA 5JIUA 3B3QE 1LOFA 2VVEA 2VULA 3N9OA 2R062 4RQFA 2ZIMA 3KF3A 1CAUA 1DZQA 1GP4A 4ZKTB 3TN91 4COYA 4I4TB 4PDMA 3W7XA 5FZHA 3CJIA 4OLLA 3CRAA 2OPKA 4KMQA 4CP1A 2P06A 1CAWA 2GC1A 3H01A 1ONAA 5IT6A 3O1SA 4XXAA 1W6QA 1BMV1 2ZGLA 2BE3A 2Y6FA 4V1PA 1EPZA 4OYUA 4RO2A 3BHPA 4Y5TA 4CEWA 1M5IA 1R1A1 1ULCA 3EVKA 2GN3A 1ZBE2 2FZ2A 2YEVB 2IXIA 3LSQA 2DN9A 2OZJA 1XSQA 1GP5A 4MVMA 3T09A 4GZRB 1XNKA 5J2TB 4JPRA 3WX5A 3OUFA 3SPGA 3FAVB 5T5JA 1VRH3 3PUQA 5JCTA 1AR63 1G7YA 4JGYA 1BHBA 1RHI3 1QJFA 1VBA1 5C8CC 5IHRA 1TG7A 4DR5B 3PVNA 4X8NA 3TRSB 5IVYA 3ACFA 4BYYA 5FZ8A 3HN1A 3NW4A 1K5MC 5A3UA 2YZ4A 3U78A 1V54B 2K46A 5GLZA 1RUE3 3U75A 1R6KA 2CDPA 4IETA 3SPJA 4P9JA 5FZAA 4LNVA 4NHXA 4UFMA 4DV0O 4D94A 4JYCA 1KS4A 1FXKB 4D8MA 5ANNA 5DUWA 1F23A 2QKCA 1OFSA 2X05A 4ZKIA 4AFBA 1LU1A 3IFXA 1PZ9A 4BJ0A 3AC0A 5C71A 1HB1A 4XIKA 5T50A 4J41A 2HHHO 4LWSB 4DXTA 1HJFA 3H9AA 2UWBA 1UF2C 1BGYH 4DK0A 3KT7A 4TXWA 1YF2A 2JS5A 5CA0A 2W0XA 4F7ZA 4CCMA 4IEXA 1UY2A 1WBFA 1YIPA 4DV2O 4QPYA 1MZ6A 4ISRA 3DPRB 4X1KA 2OQ7A 3BI3A 4K6BA 4D69A 1HDJA 3J81N 1HN0A 2W52A 3IT8A 2VVDA 1EAH1 1VF7A 2YICA 1HNXB 4XQ4A 4TN7A 1ZAUA 2QQVA 1ULDA 4YGEA 1S1AA 1SQBH 3GJBA 2KKWA 1GR3A 4XJWA 1POQA 4FQZA 4WFFA 3WDTA 1UX6A 4N43C 2DWRA 2EAAA 3UO2A 3URFA 1E57A 4DOUA 1N8RW 4JZGA 5LYJA 1FFTB 2IW5A 5DZGA 5KR7A 2WNUA 2PHLA 1F5JA 3K04A 5F39A 3LDRA 2Q68A 3OGVA 3SXWA 4IT5A 1S3JA 1XC6A 1OOPC 2FDFA 2ZKNA 5JPNB 4MVQA 3ZEDA 2WBKA 4MGQA 1XQ8A 2YV8A 1Q7YW 2V5DA 1WCSA 4FOYA 2M7WA 2EJ7A 4KL1A 4YFZA 3UJOA 2XT9A 3ZBHA 4N53A 3ZPOA 2QQJA 1NYWA 4FLUA 5JSOA 2QTWB 2Z79A 2RDCA 3RT3C 4EZHA 2J1UA 2ZABA 3O12A 4PELA 2E75B 2BOBC 1FV2A 3AYEA 3HKBA 3D4KA 2WYFA 5E1RA 3MEPA 4XBFA 5LRSA 2VR4A 1G9AA 1JZ2A 3WDUA 1SA0A 2A06H 2QQKA 3MIEA 1WCQA 3EYPA 3GXUA 4MHUA 1IBLB 1FYUA 1A78A 4HXCA 3HPLC 1D2SA 2FMDA 5JLVA 4DR1O 2UURA 4XJZA 2C4XA 2EIDA 2D6LX 3AXEA 3WQBA 5CB7A 4HVQA 2WSSG 1N3PA 4JTAB 2YI8A 3JD73 2O57A 4JKKA 1B06A 3QH6A 2IXJA 5T54A 1UOBA 2QWOB 4A5UB 2J42A 4DUYB 4GX2A 2QQOA 3RZHA 2VM9A 3AVSA 3OBRA 2ZCEA 2HWF1 2NLJC 3OD0A 2Q4SA 1PL4A 2GSYA 4XDPA 1XE8A 4LIVA 4MVOA 2UXCB 2Y69C 3K03A 3APOA 4FVVA 1RP3B 4PDWC 4BQXA 2W47A 2G9FA 5LRRA 1QR9A 2W6IG 2UWAA 4MTFA 3T30A 5A6YA 5E6HA 1GOFA 1PVC1 4YGDA 4LF6O 2VQFO 2JDHA 4P9GA 4OX9B 3C7GA 5C8CB 3CXHF 4MTGA 4B3MO 2WDBA 2QZ3A 4C1WA 5FZLA 3VL9A 4LF9O 3WNOA 1W6PA 4SLIA 3A2FA 3JAKB 5FP9A 1YO8A 4Y33A 2EULA 2VQ0A 4XFCA 2HBUA 4Q8LA 4GJYA 3OBZA 1C1LA 2IWGB 2ATFA 4WVVA 1OQDA 3AMMA 5LK7B 5LA6A 2Q7EA 5CBFA 4LNUB 1N1TA 1O91A 1UPGA 1QNMA 3SCFA 1JZ4A 1VAMA 3G80A 3VQWA 1GP6A 4RYDA 2ZM6B 2WUHA 1L7QA 1WD4A 2PQSA 1QDOA 4LR4A 3IDAA 1H2LA 1CVNA 1QU7A 4LP8A 3NVCA 5CN0A 4WV8A 3RJ2X 2FQPA 3E5QA 4XUTA 2JENA 1XXNA 5IY5C 2X5IA 3ETDA 2WT1A 4D6TH 4CCJA 2ZDIA 5KUKA 1AHSA 4GKJO 1LOCA 4WVMA 1KYOF 3NAPA 2ARBA 1MPXA 5SV8A 5A33A 2QVSB 3OYWB 4K1ZA 1QF3A 2VNOA 1UKGA 2ZXWB 2ZNJA 3RZGA 4TUYA 1W6MB 1LEMA 2O8OA 5FYBA 2XB6C 3MPPG 3DYMA 4K3AA 5FYYA 3ZFGC 3VD5A 4ATFA 3NSTA 1VBB2 4NWVA 3NO8A 3B00A 5GZCA 2WRAA 1ASJ2 1ST8A 1QMJA 5FTTC 3CF6E 3TXQA 1UO9A 3MFCA 4N43B 1X9PA 3H8RA 4AAXA 1JYNA 1NQDA 1F2NA 4JGZC 5EFUA 4K7JA 5FZBA 5A7QA 2EIKC 4L92A 1MG1A 4J7KA 3RYFA 1OOPB 4O4JA 5FOBB 1IOAA 2CHHA 3VOUA 3VBRC 4KG0A 4FOVA 3HPNA 3EBRA 1R091 4P00B 1US6A 3RMXA 4X62B 2WLNA 1WW7A 4LFCO 4NR1A 3ZFEA 3ZMSA 1TGOA 3S7EA 3V56A 2H94A 3GCWA 4C0HA 4NE9A 1BJQA 1D7PM 1NLRA 3HOBA 1IPSA 2EICA 3K2OA 3UQ8A 1Y9MA 4E2SA 4J1WA 2JD4A 3ETEA 1Q8OA 4QGLA 3WFVA 4UVBA 2JWPA 2B5UA 1F5FA 3NV1A 1MABG 5H2FZ 3PURA 2CWMA 3AMQA 2ITCC 2PLV3 4I0BA 3RZJA 4BZ4A 2OT7A 4FPKA 4NUBA 5FZIA 5JI7A 1Z5WA 1K4CC 1UFIA 2NP0A 2W1WA 4CXWA 1CPMA 2F1MA 5EZYB 5CAZA 1VQ8V 2RS31 1R1BA 5CYYA 1PZ7A 1W2OA 4HNAA 2ODMA 1VBD3 2ETEA 4GKXA 4GWIA 1XL6A 4YM0A 4U2AA 2HEPA 2Y48A 5CG8A 5L3FA 1W9SA 2WQZC 2RR12 1JU3A 2QQNA 3POIA 4GB33 1GNHA 5J1XA 2XG3A 2LP7A 4PT6A 3CEWA 4Y26A 5CA6A 3KCXA 3EHBB 5EJ3A 3CJHA 1Y4MA 1FXVA 3GALA 1IS5A 4LKFA 2Z69A 4Q1PA 3WNNA 5F8PA 1XREA 1SRYA 1GK9A 1ZTEA 4MW8A 2Y69B 3J7NA 4GZ9A 1JJOA 2RNBA 3SPCA 1HXS2 2IJKA 1KKCA 3CHXA 4NHKA 3VBOC 4D3WA 2XUMA 4L8QA 5DABA 3SKVA 5JOZA 3LB9A 3WP3A 2ATKC 4WFEA 2Y26A 2KXLA 4NIGA 3WNLA 4ZONA 1FV3A 2WN2A 1LHWA 3HNYM 2PLV1 1SLCA 1JVMA 3WV6A 2G1MA 2JDZA 4E8DA 2R30A 1C28A 1VBE3 1FKAO 5LL6Y 1O4TA 5JXJA 4A42A 3QO7A 2AUYA 4F8AA 1SQVH 5I8TA 3SPIA 3C7EA 3U07A 3VDDA 4QPIC 4F6EA 2VQEB 1N34B 2YIDA 1ZRFA 4HVOA 1AP5A 2QEXV 3W7TA 2WNVC 4ASMB 1G6NA 1Q5OA 4AGGA 3H1LH 1YC61 4L2NA 4GKYA 3JD2A 4GIQA 1W0KG 4MGKE 1OHFA 1ULEA 1MS1A 2LRPA 4GB31 3TN92 2K1EA 3RDIA 3I8TA 4YARA 3B93A 3K77A 5LGNA 3L70H 3RZKA 4PF1A 2JIJA 5J09A 3WG1A 5J2UA 5BNOC 1HP8A 1BMV2 1TAEA 4UW5A 1RUF1 5JAXA 1CZTA 3PVBB 3MI8A 4PQQA 3Q8CA 1BK1A 1WKYA 2JJ6A 1R1A2 3OMNB 1K5JA 4AQ6A 3I59B 4DR3B 2HWB3 3IDEA 2VW0A 4QB2A 3I3BA 1DYPA 3JYCA 3HKEA 4F83A 1TVKB 2DV9A 2VJXA 4DO0A 2F4LA 2QM8A 3AK3A 5BMVB 4I4TA 4RHV3 3D36C 1HR0B 1VBE1 3CBNA 2JICA 2F4VB 3GVMA 4CEYC 2QWNB 3FB5C 4X64B 1UZZA 1F9KA 2OYQA 1OURA 3RYCB 3IMMA 1VBA2 1O9HA 1XNQB 4FLYA 3UKTA 1WP8A 2Q67A 5CKNA 5IJ0B 4QAWA 1IS3A 2BWCA 5HXVA 3OCPA 1N32B 4IE6A 3KF5A 2P3KA 5DECA 2UUAO 4NIIA 3I3MA 1H4GA 4JGZB 1GZWA 1NH2B 3VZOA 2WIIB 2AEYA 4XE9A 2EIKB 1LKNA 3POBA 4OHWA 4C0BA 4XC9A 2HJFC 2NLRA 2JDMA 3VBRB 5IVJA 4AWDA 1J5EO 2XR4A 2IZWA 3N2KB 4QT6A 1QXPA 2O8QA 2HWB1 1AR5A 1IG0A 4IIJB 2CSGA 1JZ8A 4B3SB 1W9YA 3JU9A 5D5PA 4COUA 3ABLC 5CKMA 4QX3A 4QB6A 2WT2A 3CP1A 1GANA 2K2SA 2F93B 2QDOA 1IBMB 2SLIA 4RHV1 1RJ8A 5CFCA 4TLGA 1OCOB 4MTOA 3VBHC 2N74A 1AR1B 3OSDA 4O4IA 4LBNA 1FXKA 4Z8BA 1DQ6A 4GLXA 1F4AA 2PAMA 2AACA 4GKKB 1PGW1 4CUAA 5BY5A 4WM7C 1UMIA 4RQPA 4MXVA 4YVWC 5BR8B 3ASOC 1BQPA 5EYPB 1KUQA 4AQTA 4QPGC 1ZA4A 5H6RA 4BXFA 4M4PA 4F6RA 2WWJA 3CCMV 4IE4A 4ATEA 3GHMA 2X6AA 4LBQB 1L8DA 3IPVA 3FUQA 1X82A 3DPRA 2ILMA 1Q43A 4HETA 5H5NA 3T2TA 1QKQA 3WB0A 1KRIA 3DCQA 5FLIA 3GHNA 1OT5A 3PMEA 1UY0A 4P5YA 2FMYA 5DZFA 2VH9A 4FLVA 1SESA 4FBFA 4BW5A 1MS5A 2AW9A 3LDCA 2R0FA 4IEUA 3VBOB 4CP2A 3BUCA 2WFF1 2AHZA 2P37A 1SEFA 4CH4A 4B08A 1FPOA 1NH2D 2VXJA 2TBVA 4IYIA 1K7DA 3AVRA 4OVEA 5FYMA 2O0OA 3I55V 1AYM1 4AI9A 2WO7A 2D3OW 1R3IC 4LE4A 3HQXA 3NV4A 2F23A 3OGGA 3JUUA 2ZHKA 2WLKA 2DCZA 5TSWA 4ES9A 1R3KC 2OUJA 3OR6C 5EWSA 2LS6A 2WNVB 4ITCA 4K40A 1RIRA 4O4HB 4BDVB 3CRMA 5FMBA 5CIRA 4FP2A 2P5BA 5FPBA 1JYXA 4MADA 1S0BA 1OLRA 3SYOA 4MS2A 3ABZA 4NIDA 3NNMA 1XNTA 3C2UA 4UXAA 4QE7A 4S2HA 1QJU1 3ZYRA 2VZQA 3OW2U 2X10A 3J7HA 4Z1VA 1Q8QA 3AP4A 2AZ2A 5DEDA 2HWF2 3RRDA 4PF5A 4XXPA 1TZOA 1VMHA 4XIOA 3E5XA 1NTKH 2AENA 4B3TO 1E1RG 1ODMA 3W21A 4DR7B 4DYLA 2B46X 4WZCA 3KMHA 4LUMA 1SBDA 1PKXA 3OF1A 2GDFA 4YJ3B 1HRV3 3C8XA 5E79Z 4LBQD 4I7ZB 2Q7GA 4JI8O 2D40A 4IV1C 4LFBO 4CEYB 4NTWA 3WEZA 1O4ZA 1PVC2 3CIHA 1O9GA 4P9LA 1JZ3A 1N3OA 2VZPA 2R041 4AQ2A 3JASB 4OMDA 4XFFA 5FAXA 2UXNA 5FZDA 2Q0OC 4IGPA 1FJGO 4LK7A 3LFMA 2XHNA 2V72A 2BZDA 2IFWA 3C7HA 2FDHA 3KQ4B 3ROUA 3SCHA 3R4SA 3AP6A 4FPOB 1M90W 1HX6A 2Y4TA 5JOXA 5FREA 2Y6LA 1B3QA 5K0UA 5LP6C 3MIDA 1JHJA 4UCUA 4K8FA 5LEKA 4WVZA 4NO4A 2WWWA 1UPSA 2V4AA 4AYUA 3J8F3 3VD7A 2A70A 2BGCA 2YSUB 1H9WA 1CJDA 3N36A 5LW9A 4JYYA 1R6TA 1NE4A 1BSMA 3SEEA 3ZMZA 5KXBA 1L1FA 4CH5A 1P8JA 3WF4A 1VMJA 3VD4A 1AL21 5HPOA 1LENA 3MDPA 1XUQA 3JD3A 4YIPA 3ZS8C 2ZOEB 2UUCB 4BCUA 1DLLA 5C3QA 4NAOA 4GYCB 1IVSA 3ABLB 4XF1A 1HRV1 1WCDJ 2JDUA 1UXXX 2X0LA 2PZSA 3VBHB 4LNUA 1SHWB 1M06G 5IUQA 3DN7A 2JRIA 2C0ZA 2UXBO 5JR7B 3WT3A 4Q4X1 4BIZA 3ELNA 2CWSA 1IX9A 4O9EA 5IFPA 4W65A 3WNXA 3ZFFC 2YDEA 4UF0A 4WM7B 3B40A 1ND2A 4XBLA 4X8AA 4FLWA 4YVWB 4ICGA 3K3OA 2C26A 3VHOA 3ASOB 3T2MA 4UFJA 1FAYA 4BAYA 3GM8A 4QPGB 1HB2A 1DGRN 1H2SB 3MV11 4ZOLB 1GBGA 4DXRA 5CU1A 2VNVA 4DR5O 4EN0A 4BQ1A 4JYBA 3STLC 3AM2A 3WG4A 4LBEC 1NJIW 3ZXEA 4UCSA 3D0JA 5A2QN 3CCVV 4XHBA 2O1QA 2LROA 3VBSC 2DYRC 4EN6B 1H30A 2KR2A 3RI9A 2K9PA 4NOTA 3H7JA 1WLTA 4W8JA 1Q6UA 3L2HA 3UV9A 4CCOA 2P6HA 3SITA 3T1LA 2AZ5A 4FPLA 4DV3O 4YGBA 5FPLA 3P30A 1Y76A 3SCGA 2YFZA 4Q6GA 3SYAA 2Y0PA 4EFEA 3H1KH 3VBUB 4I0XA 5JOWA 2DCYA 1EN5A 4ISQA 4B3NA 4UFZA 3VKOA 3QLQA 4Q2FA 3IWZA 5FYIA 1AJKA 4Y3OA 2F43G 4DV6O 4J6GA 3HQRA 3EJKA 4LBKA 1SCRA 4BWAA 3VBFC 2KQXA 2JS3A 1PO13 1XNDA 2Q8CA 4EYUA 3CMGA 5FZKA 5LK5A 1WWYA 3TEXA 2RS32 2OUHA 1THZA 2B5HA 3CPWU 3BOPA 4Q27A 4ZXEA 3B8MA 1T6GC 4QQPA 3ZKUA 3LF7A 2BUKA 3ZXDA 3DUIA 5C7GA 2W08A 2HKOA 2ZJCA 4LF4B 4HKLA 1WA8A 2Q5TA 4I2OA 3GZTB 4TT3G 1APNA 3LEGA 1YI7A 1A3KA 1CAVA 2VTFA 5DZEA 3FL7A 3THTA 1OD3A 5C3RA 1NBMG 4MXWB 1SDWA 1Y43B 1CWPA 3UNPA 2YU1A 2CAVA 5EZYA 2XVLA 1ZA7A 4E4ZA 1LOBA 2R071 1FMD3 1H8VA 4UT5A 4GX5A 5DAQA 5LMNO 2BDRA 4X6RB 1QJEA 4JI1B 3ASIA 3BU7A 4BIOA 5JJNB 4IEVA 3S30A 4DUZB 5FJKA 4JDOA 1VF6A 2VG9A 3K3NA 3ETQA 1UPIA 2PLV2 5AC91 4CSWA 1KFXL 5CB4A 1OV9A 4W6XA 1LULA 4AVTA 4AFAA 1UY3A 4D0QA 4NXMO 5E1AC 4JCKA 1PO11 3FZ3A 1RVF3 2N04A 3RSJA 1U97A 3FB6C 5FYSA 4K8RB 2LFRA 3AKQA 2ZGSA 1OA3A 5FPXA 4BR6A 1SLBA 4AHYA 5A9GA 2W95A 2MEV1 4P2ZA 5FL7G 1GN2A 5B4XA 2OXBA 3THDA 2XDVA 2ZGMA 1GO3F 4AEDC 1NKDA 1IBLO 4PA7A 2AR6A 5LP6B 3I2JA 3FLRA 2Q1ZB 4GB32 2VCCA 1F4NA 4HG6B 1P7BA 5FNVB 1LEDA 1MZFA 1YI9A 1TNFA 3PU3A 4YG3A 4X88A 4MGTA 4ZBMA 4JTNA 5LOVA 3PLQA 2JGUA 2R0HA 1HNZB 2ZZJA 3D0SA 1RUF2 2R32A 1Z5VA 1Q8IA 2BBAA 4RS5A 1W6NA 3JD1A 3OPTA 1Y9GA 4DUYO 1I1EA 2VNRA 3I3QA 2XTAA 4N7IA 1K45A 4UBHA 4JI4B 3A8TA 1YIFA 1AILA 5A7WA 1IHMA 2QQPA 4OCTA 4BMBA 3WNMA 5B2GB 4I55B 2D6KA 3EB7A 4J80A 1VBE2 2IXHA 1S5HC 4FPCA 4HK8A 2VWKA 5H6QA 2QR4A 2QWPB 3QOPA 5FPZA 4N9IA 2R6QA 3JCZA 1JQ0A 5F3EA 5GZDA 2Y6JA 2DYSB 2P1BA 4QX7A 1TMF3 2RS11 1XYOA 3I59A 2YU2A 1URXA 3CJIC 1ZL8B 4JF3A 3FBYA 3PUSA 1J83A 1XBLA 4DV5B 3ZSEA 4QX2A 2VE1A 4A6SA 5KHJA 4MTXA 1HW5A 1EN4A 4AGVA 3OUIA 4XPVA 2DTYA 1XMQO 3VBSB 4CEWC 2YC4A 2JJ1G 3IAPA 3OUSA 4QKFA 3JALA 1I9RA 1O6UA 3UT5B 5AVPA 2QWRB 1RUI3 2MK3A 3RYCA 4GWMA 3PIGA 2X09A 1OD5A 1YQ6A 3PHMA 1VIBA 3W20A 2HWB2 2VXRA 2E7AA 2DU1A 5IJ0A 4PIYA 4MH0E 3ZHTA 4QKDA 1QH7A 3M7MX 3G7DA 4ZU4A 2YUEA 2QJ1A 1H8HG 3K4AA 4Q1RA 4M3CB 4PLOA 3E22B 3I2DA 4RHV2 4AVSA 1FATA 3BFRA 3ES4A 2VCBA 3G67A 4YZ1A 2EBOA 1E5IA 2UY9A 1Z7S3 4G4FA 3ZYPA 3BCCH 2XQRA 3T1HB 3O0VA 3MHHC 3N7MA 5FPAA 2A79B 1PGW2 1RFYA 3K9SA 1JA8A 3BPZA 3U37A 5C93A 1OKQA 2YHJA 4NIAA 2P4VA 1W9WA 1TUBB 4EB6B 4AZZA 1US2A 1G1XB 1IS4A 4E27A 2RJ2A 4ARYA 1W3XA 4DY5A 4CRQA 4MZUA 5CISA 3IC9A 4H37A 1RUH3 1M56C 1X36A 3LAGA 3WB1A 1COV3 1BEV3 1NTZH 2BOCC 5IWAB 3AL5A 3LSUA 3SMHA 2EXJA 4E4SA 2YGMA 3AZZA 3MZHA 2BU9A 1H38A 1D5NA 3E6CC 4DXSA 3W5MA 3HAGA 2UXDB 5FY4A 2DVFA 1OCCC 4AI1A 4DR2O 4CA9A 2NPIA 3H8XA 5FK8A 2GV9A 2LQTA 4EJRA 1VQ4V 3SC7X 2WFF2 3KV9A 5DDJ1 3PU8A 4D7SA 2EXHA 5C3PA 1WMEA 1AX2A 4JI5B 1RSOB 1Z7S1 1O3RA 2RM23 1J3QA 1AYM2 2ZGKA 3TXSA 3IAQA 3V64A 5ACA3 5JR2A 3GBGA 2BFUS 5F2VO 1DP0A 2B9UA 3A22A 2ZXQA 4CDUA 3E5UA 5H9SA 1W8HA 1NLSA 2B42B 1KU9A 4FPFA 2WNUC 1LUWA 2VU9A 1COWG 4DV1O 2RJLA 5LXTB 5E88A 2XJUA 4D6QA 3U1XA 4P9WA 4IHJB 1IS6A 1COV1 1GNYA 2DVDA 4QU2A 1IKPA 1UYPA 1QJU2 5FUNA 1O8SA 1UYXA 1SFYA 2GU9A 3KVBA 5IATA 1UQXA 5C8WA 1V9PA 2OCHA 1W8OA 2FCUA 4N53C 3ACIA 4KG8A 1CAXA 1FFXA 5CZKA 5FRAA 2PELA 2VGDA 3WP6A 3ZYBA 5GALA 2HEWF 4O4HA 4FLZA 3OEAA 2IC1A 1KBHA 1S5LZ 1LOAA 3AEIA 1HLCA 4ZHQB 5FZ4A 2WPDG 1DYKA 4EV0A 2V5YA 3LOBA 2Q8DA 2RM21 5L3GA 2JDYA 2JEMA 3WUDA 5ACA1 1AJNA 4PA3A 3A0NA 4KWKA 2YBPA 3JARB 1SFPA 4W4LA 1S2KA 3E8FA 4P9IA 1AB3A 1XBFA 4YHHB 2JE7A 2R042 2IJIA 3O1OA 1AI4A 5FZ1A 1ZZCA 1ZBE3 1X4TA 4JI2O 2XPJA 3N4MA 2A6ZA 3JSNA 3BA8A 3K5NA 1AROP 1CAUB 2BOJA 2PAKA 4XOGA 4CVUA 3CJIB 4XQDA 4E4DX 1CAWB 1XNBA 4DZGA 1IZ3A 3WNPA 1CP9A 3MIGA 1W6QB 1PGL1 1RPRA 2NYYA 3ZIWA 2RG4A 4I3PA 4Y1YA 1C8M1 2YXSA 1IQAA 1J84A 5DUUA 4JKLA 4PV1B 5FQ0A 1UYZA 2VS0A 1SFNA 5DG2A 1SZXA 5BNQA 2OQ6A 1KXGA 1AL22 5KXDA 4QXHA 4JQRA 2XH6A 2WT0A 3O5SA 2TNFA 2WA3A 3KZIZ 2XAGA 1SETA 3OEEG 4HT1T 4OHVA 4R7CA 3HKCA 4ASUG 1SQGA 4UVCA 1DF5A 3PJYA 1PIV1 1HRV2 2ZBJA 2E7TA 3UGFA 4NHMA 4FTEA 4V2VA 4XETA 5LASA 1UCXA 2QQUA 4JGYB 1H2GA 3CCJV 4IE7A 4AILC 2FL4A 1LGNA 4J9ZB 4AI0A 4B4RA 4RR3A 4DR4B 5FBJA 4Q4X2 1FD9A 5CMUA 3X2QC 3A0RA 2RDRA 3ZMTA 3IB3A 3D3AA 1HV1A 4JKMA 2Y64A 2UWCA 1F15A 1LHNA 4K9SA 1JOBA 4KHPO 4FFHA 4XACA 1HW7A 4DXWA 3M99B 3OUJA 1S5JA 1BBT1 1SQFA 2NMNA 3LD8A 1GWMA 4FFBB 4LKDA 3BTXA 4HLTA 4FXGB 4NHYA 4IGOA 2ARHA 4PA4A 1OF4A 4I3GA 3J8F2 1M56B 1GAXA 4YW7A 4WFAV 2VMEA 3H7YA 5T3NA 1GRJA 4LR3A 2D93A 2X5IC 2QKDA 4UUJC 2ZDIC 2OKXA 4QHBA 1PHMA 3QG5A 3SYCA 1Q56A 3NAPC 4GMP0 1QLEC 3WW1A 4CU8A 4JV5B 2QZ2A 1OCCB 1EFRG 5CA0B 1FPN3 3ZSLA 5JWPA 1PVXA 5IAVA 2Y6HA 3LZZA 2ZT9B 5JQGA 4ES8A 4DR6B 1R3JC 4UB6Z 5IK7A 1AP6A 2ZX1A 4JDMA 1RM1C 4Q0UA 1VBC3 3RFRA 4AVBA 4X1KB 1QJY1 4LFAO 3ZO0B 1CIYA 2VZRA 2XKPA 5ANQA 1PM4A 2CAZC 4MT8A 3FX7A 2ID4A 5DAWA 3H1YA 3E2EA 1CEZA 1Q6IA 3IDCB 2FHRA 2OIGA 1H9PA 5GTHZ 3HBZA 4B4QA 3IAYA 1JXNA 3VD9A 5IYYA 3PMSA 1AR71 2B7YA 2IVJA 2D6MA 4TOIA 2VZSA 3FWEA 1VQ7V 5LYJB 5D5QA 4YW6A 2W39A 2IBZH 2WNUB 4FPEA 3AG2C 3WHTA 1V55C 1K33A 4UOJA 4MV2A 5FP7A 3CDZB 4CH3A 4KWJA 2JK5C 3M3OA 1NKGA 2D97A 3VBUA 5BR8O 5FXWA 1E79G 2F95B 3JAMN 2ZGRA 3WSOA 5EV7A 1GZ9A 4A6OA 1YXWA 1YFYA 3VQYA 3ZFEC 1FPN1 4LHNA 3POYA 4N53B 2DE0X 3AP5A 2GDSA 2RDSA 2BRTA 1LNSA 3RPQA 4CUGA 5KLVH 3O14A 1NQTA 1POV0 4NRPA 5L73A 1B35A 2R072 4UWDA 1VBC1 1O3TA 3I49A 1SA0B 1EV13 4Y20A 4YY3O 2RS51 2P90A 3ABKC 5J9PC 3WD5A 4PHZA 3ZRXA 3BKZA 3WF2A 3EXAA 4DV7O 1E1QG 1O8PA 2XJRA 3WHUA 1PO12 4QIWF 4X66O 4MXWA 1OH3A 3MIHA 4D6RA 3SGIA 5IFTA 1AI7A 1YNAA 4XBNA 2BVBA 2HJIA 2P22C 2ZX3A 1UN1A 3UETA 2JG8A 3K51A 4JQTA 1BZWA 5J48A 3TWIA 2RMU1 2WZEA 3SDLA 3W59A 4PQ9A 3OY8A 3U10A 1NR1A 2IU0A 4Z2WA 1XILA 2JG9A 4RSUA 5KC6A 3FUOA 4E4EA 1C8NA 1N36B 1VR3A 4XFHA 3AG3C 4JYAB 1SBFA 4P9YA 5CADA 4XF9A 1Y3TA 4PIZA 2A3XA 4FOQA 1S76D 2QQMA 1G4YB 4COZA 2EILC 3U14A 1FMD2 4FP3A 4EROA 2PFWA 1JTZX 4LOTA 1EV11 5IYCO 1VQPV 2BJSA 1NZCA 2QJVA 5FKBA 3G4SV 1X50A 4IEQA 1AX0A 1HQNA 3BVCA 3VDDC 2QCSB 3X2QB 3IJ4A 1RVF2 1WW6A 2DWEC 1ZM1A 1ENXA 4UCRA 4YYOA 1RXGA 4HPKB 3POGA 1BQZA 5CKQA 3DC5A 3UGHA 4EKWA 1W0NA 3RWNA 1VQ6V 1XL4A 2ZPXA 3F95A 1W8TA 2RS12 5LA6B 4G28B 3ZN0A 2ZMNA 2ZZQA 1GOHA 1YIJV 3E83A 1W0OA 4I02A 4B1MA 2NR5A 5L3EA 4RGGA 3BVOA 1UNBA 1XYNA 3O1PA 4Q29A 3H1MA 4CXXA 5EC2C 4YM1A 2ZX0A 1CXZB 2E76B 5DN6G 4I55A 2FD8A 5FXZA 4FPGA 3TNQA 4GMP3 1Y9QA 4JASA 3O0WA 4WVMB 3ILFA 3RS6A 1VBB3 1IPJA 1QLEB 4R9AA 5J96B 3B69A 3HVDA 4FLTA 3JBG1 4HYOA 4OZOA 5FZ3A 4J9YB 5EBWC 3M1HA 2PHDA 1HWYA 2YMZA 4TYSA 1C5IA 2XBO3 4TUYB 4LT5A 2EVXA 5LMUO 4YZ2A 2EZPA 4OGQB 5K7PA 1PNMA 2CDOA 4OI1A 4UFHA 2P4KA 2E5LB 5IVBA 4JRLA 2DUQA 2Y33A 4S2DA 4FJCC 4WFBV 2VUCA 3WG2A 5B1AC 3W7WA 5GW7A 1W28A 1S0EA 1ENRA 4DEVA 1RUD1 2BNOA 2BTOA 4WFHA 4WZFA 1I0HA 4XABA 3AZWA 5A1AA 1CR7A 1TMF2 1OQ1A 1AJOA 1ZZ7A 5L9BA 4Q0VA 2BTQB 4Q20A 3WG3A 5EJZB 1CJPA 5BUVA 4IV3A 3CZJA 4LF8B 4ZU7A 3HD8B 2XUEA 4IW3A 1GFF2 3AG2B 2VMCA 3K79A 3VDBA 1RUJ3 1H6YA 1V0AA 5IWFA 5FYVA 3TGUH 4MSVA 4NXNB 1EN6A 1VQNV 1QIQA 4O4JB 4H2AA 2LW1A 1HB4A 3E22A 1LESA 2YUAA 4CE8A 3S3XA 2DBNA 3ZFEB 2GNBA 2R72A 2B1IA 4CDXA 1OUSA 4YZ5A 4MVSA 5FJHA 1MSDA 2QKSA 3ZLIA 5ISLA 2XBO1 1ULGA 4IE5A 4R4ZA 5BNPB 4DUXA 4JGSA 4O61A 4OFGA 5APAA 2IUWA 5CFCC 1JBCA 5K1PA 1W2AX 2DFBA 3S3WA 1N33O 2RR13 4XTMA 1F8VA 2VL4A 4UI9L 3SPHA 2BSKA 5DDJ2 4JI6B 4QQLA 1FXKC 3ABKB 4M3CF 4TSFG 1AR93 1PP9H 1GH6A 1Z7S2 2HLDG 1D4M1 4IEOA 4RQPC 2ZX4A 3KQRA 2XAFA 4RUEA 4XJAA 3HEIA 5JZGA 1WLEA 3O7OA 4A2UA 4MVUA 4XZPA 3DSQA 3CD6V 4HNAB 1WBLA 2ZHMA 1V6JA 2C9AA 4UBGA 4BE3A 5JUVA 1HXS3 3A21A 5J3UA 5L7OB 3M4FA 3APBA 4YGCA 3ZPYA 4HKOA 4L0PA 4AOCA 4P9XA 1I94B 4LO8A 2AGSA 2E7QA 4LH7A 3DPRC 4XUQA 3CJHB 3OEBA 4DS0A 1COV2 1BEV2 2IH3C 1J3PA 4U7NA 3AG3B 2XGXA 2WAOA 5JMCA 2D2CB 1DZTA 1RUOA 1WMDA 4LF4O 2CTRA 4GCZA 5EXOA 4CP9A 3OGSA 2EILB 1W05A 2EIMC 2ZR2A 1PO21 4Y1VA 2GMMA 1XI1A 2NZ9A 2TUNA 3F5TA 3RYHA 2W3JA 5G05L 2W92A 3IDBB 4M3CE 4XF0A 3WUCA 1S4CA 3PUHA 4D7TA 4XFIA 4U3FH 4AVAA 1SPPA 5FFOC 3I5DA 4P08A 1GM7A 2RM22 5DQ0A 5L9RA 2PTMA 1CQ9A 3NRUA 1BQ0A 4FQ4A 4N7UA 5ACA2 3B2EE 4DUZO 2DQ0A 2C9KA 2OIIA 2GTSA 3IGAC 2Y38A 4MHRA 1AYN3 3KT1A 2XLGA 1G9BA 2I74A 4DINB 4AFMA 1LNQA 3U0ZA 1GWKA 4URTA 3GZUC 2RMKB 3CCQV 5J2UB 3KWVA 2A73B 1K3IA 1DF0A 1GICA 4PDLA 1PGL2 1QVGU 5A6ZA 2D43A 1XPWA 2ZQMA 1Q6HA 1JODA 1V6KA 3CNAA 2YBSA 4KU7A 1C8M2 4PJYA 4Z82A 5C4WA 4YNIA 2DOSA 1AUYA 3TEWA 1VBA3 2VZTA 3WW3A 1VMFA 1S0DA 4RA0A 3EQEA 5GTIZ 4DV0B 2JJ2G 5IE9A 1KKDA 2GUZB 4AQYO 3ZYHA 4G3YC 3HKEB 3WZ1A 4H14A 5HBAA 3IBMA 4B3RO 3MO4A 3VZNA 3PJQA 2HWC3 2PHTA 4JTDB 2GSMB 2ZGTA 4HVRA 3LA7A 1H8EG 2DVGA 2OZ6A 1ZX3A 3R4UA 2R9RB 1PIV2 3FYIB 4COWA 1WZXA 1IURA 4C8DA 1Q86W 3TAYA 1ROPA 1BVP1 1VJ2A 1K4DC 3AZYA 5B1AB 4M00A 1LTEA 4EE2A 4MGSA 1G8MA 5F3CA 4CZSA 3OT7A 2ZNIA 1BE3H 4DV2B 1DFQA 1QHTA 4GH4A 1AYN1 4O4LB 4H33A 1UOJA 2EIBA 5LHHA 3QD6A 2Z3YA 4QXKA 2QQLA 4LITA 5K0UC 2G19A 2B4KA 3BCWA 1D0HA 1GZWB 2PQQA 2PA7A 1BBT2 3DC6A 1KP3A 1ZZBA 3ZRWA 5FY9A 5KHGA 3SJAC 2P3YA 1YQ5A 5JCOA 4XUOA 3QO8A 4DV5O 1EAH3 4MVZA 3ECQA 3ZYJB 2OVUA 5F5QA 5L19A 2FDJA 1TME3 1ZYBA 3AMHA 3DL3A 4N23A 2W94A 4MVRA 2HWC1 1QH6A 1NCQA 3FJSA 5CFCB 3OR7C 1V6IA 4FCAA 3RVYA 4B1LA 2A1XA 1IBKB 4DW0A 1U5IA 1Y7BA 4O4IB 4FFBA 5IVCA 2V4DA 1QJY2 1ZRRA 2XMLA 3BOWA 1JMKC 5HCAA 4IL6Z 1ND2C 4RQPB 4WBNA 4CPBA 5GJ6A 1I5YA 1IXBA 5BYNA 2PHXA 1RYYA 4U7OA 2XLFA 1H1AA 4BQ5A 1YJ9V 1AR72 2ZEYA 5LHIA 4TV9A 3HR9A 2AEZA 4FTBA 1OF3A 4OI0A 4F6RB 3T4DA 1VQKV 3IMNA 4HSJA 2ZXWC 2WL1A 4UV8A 3T1HO 1YFWA 3CL1A 1TVGA 3H1JH 4DR1B 2KA3A 2J1VA 3IPVB 2GN7A 3SH3A 4O2BA 4IGGA 3GZEA 2EIJB 2RCVA 4PLNA 2PN5A 3PN1A 3MW2A 3CCRV 4X20A 1FS0G 1MQTA 3DGEA 4QJFB 4Q4W1 1TME1 4I9QA 2J1SA 2XAJA 5KA6A 1FPN2 2EIMB 3NWKA 3IN9A 3CC2V 5IWAO 1VRBA 1ZUQA 2Q0AA 2ZS6B 2X29A 1VBC2 5L3CA 2Y34A 3LFIA 4FOWA 2UXDO 3SH5A 1HQWA 4CBCA 2OCCC 3L72H 2B8MA 2RS52 1WB7A 3RWKX 5K8SA 4K21A 4O9GA 3FHQA 3D82A 2HWF3 1ZRCA 3ZSJA 3G6BA 3J4UH 4LXLA 3K57A 1R081 5A3PA 1RB8G 5ITZA 4GWNA 4JI5O 3NJVA 4LF6B 1JN2P 3J7MA 3K4DA 1DQ5A 5EPAA 1M4WA 4PI2A 4B3MB 5KXCA 3ZSMA 4LF9B 3V65A 2D6PA 4S2FA 4YFWA 3M8AA 2Y60A 2RMU2 3RN4A 4CYDA 1LHUA 4C91A 1Q8VA 2XQXA 4HBNA 4ASLA 2VO5A 1M4UA 1LOGA 3ZX7A 1ZRDA 4F4LA 1PVC3 1W2TA 1Q8PA 4BMEA 3M3CA 1KECA 2WZ8A 1JX9A 1MOFA 4DEQA 3MHZA 4Q4Y1 5EZWA 3MW3A 1NT0A 2Z42A 1RMU3 2R061 1KEXA 3BRCA 3ZN4A 4RFT0 1NCRB 3UL2A 5CBGA 4K3UA 4WM8B 2E26A 1VF6C 3LUTB 5L9VA 4CDQB 4NRMA 1GOGA 4LF5O 1YVWA 1EV12 4OXSA 4LLFA 5FZOB 1JU4A 2Y8KA 3AKTA 3ZR6A 1KD1W 3WB2A 4ZZ5A 4H7MA 1E5HA 1X33A 5B1BB 4JI7O 2WO3A 3N9MA 2A75A 1QNWA 5BNNA 3B9CA 3ZIXA 2VZUA 1YLLA 5FPVA 2E33A 2VW2A 2J1TA 2J22A 3R4DB 4R8HA 3HR0A 1JZ5A 1BXHA 1AVMA 2M6YA 2ENRA 1K5QA 4V2WA 3ZXJA 5K0UB 1J3RA 2QQWA 3N2GA 4W6YA 5DG1A 2Y6GA 3STZC 5A7PA 3NNFA 1XRUA 3TEZA 3IZOA 2QFEA 5C8YA 1IGOA 2E9QA 3WCSA 4DUVA 4JI3B 4X65O 2WZR1 3ZXAC 4FPJA 2BPA2 3Q4HA 4RS5C 1Y4WA 2GH8A 1K9MW 5KAFZ 3A7QA 1VP6A 4CXYA 1RMU1 3FX3A 4HPKA 3JQXA 3JBG2 4CDWA 3I54A 1ZREA 3WDVA 4IGQA 2TEPA 3LDKA 4GUNA 3JZVA 3FC0A 1UU6A 2BWAA 4LFCB 5ERLA 1H6XA 1NTMH 1WCUA 5LA2A 2GTAA 4Z1MG 4I01A 4XFBA 2VMIA 3ML0A 1UXZA 4UF0B 4ZS2A 3H1IH 1ND2B 2HEYF 1H2NA 4DW1A 2A3QA 1XMOB 1R093 1GM9A 4ZZ8A 1RUD2 2JDPA 4QX1A 4LTAA 4TSVA 3H50A 1WJZA 2JXAA 3VL8A 2ZHNA 1SS3A 1M57C 2XHKA 1U5YA 5EC1C 2HVJC 2ZAHA 1SCSA 1R3LC 1Z78A 1I08A 5KAIZ 2QDNA 3T4VA 1WNSA 1WMFA 2GNMA 2XJVA 5FPOA 3O1UA 3INAA 2E3CA 1FYJA 5GLWA 2OT5A 4XDQA 3ZYGA 1KJRA 4LMFA 2JB4A 2X7RB 4X8PA 2D5HA 4WBBA 2E32A 3X29B 1Y76B 2ADQB 2RS33 2OTJV 1SLAA 3RVHA 3H3LA 2P7TC 4LH6A 4BU2A 3UKMA 4LHKA 2XBO2 4LO6B 3AJZA 2BTQA 3ZKYA 4I0XB 1NR7A 4LF7O 2WLPA 3IC7A 3WXPA 3E35A 1K12A 2WNOA 1KB9F 2LGWA 2GC3A 1DU3D 2OCCB 1UZVA 4EWDA 5EIYB 3ETPA 2UU9O 1MACA 4A7YA 4IEYA 4UYBA 4TTGA 5T52A 3OB8A 4AEMA 1P7GA 4H7LA 4X9QA 4L97A 1MR5A 3AXDA 1W90A 3SJQC 4A3ZA 1ENSA 2QWQB 3ZN6A 2IFRA 5IJ9B 4E9KA 3B9IA 2JKXA 4XCBA 1ULFA 1WA8B 4D6SA 4N9HA 5BNPA 1EP0A 1RUJ2 1SQ4A 2ZE6A 3PVOA 3GB7C 2BERA 3POSA 1OCOC 5IYBO 2KB1A 1SLLA 3B4SA 1FXZA 4NTYA 1EPWA 1HV0A 1CAVB 1S55A 3ZMUA 2B45X 2BVVA 4HZ3A 2FCVA 2HWD1 4DRRA 4NRQA 1GKBA 3ABTA 5FY8A 1VALA 3EHKA 1PMHX 3WW4A 1C3HA 2B39A 1K8AW 3FKSG 1JOPA 3AG1C 5D2AA 3OTOB 1ORQC 3LIGA 1PO22 5IYZA 1HKDA 3VKLA 5L7OA 5HV0A 2VZVA 4E8CA 5I8YA 4ZXKA 4BW9A 2YBKA 3QVNA 3RYRA 5CB4B 1AI6A 2YFUA 3C3VA 1WCKA 1AR92 1XNAA 3OJBA 1K73W 5C5TA 2JX9A 5FOJB 5GLTA 1EYBA 2WQ8A 2XJQA 5A3LA 1RUF3 3CO2A 2WLLA 2R7EB 4CDUC 3BTZA 2BGPA 5B1OA 3N9PA 5I0DA 4B7EA 3O1TA 1I5PA 3FN9A 2R70A 2EINC 1W8FA 1JYVA 2IXCA 2Z0AA 1FOD1 1IDSA 3RZMA 4Z2AA 3MLKA 2XAQA 2X6BA 2W2IA 3JD4A 5T5PA 5LOVB 4NTXA 2WINB 3PUAA 5FUIA 3HKDB 4ZHNA 1SZTA 1SBEA 5LCWL 3APQA 1NU1H 5CNAA 3AK0A 2UUAB 3SEPA 3BALA 4YJ2B 4RS5B 3T1YO 4CCLA 1JYIA 2PI5A 1W6NB 1KGYA 5FMOS 2GP5A 1OPMA 1VQMV 1GQHA 5K4LA 4PBOA 2C24A 1K97A 1H1IA 4INDA 1TEIA 4O7XA 3AB0A 1OCZC 1AR81 4EN9B 1BKZA 2LM3A 5A7WB 3T0DA 4JYAO 2A6YA 1W8WA 1E5RA 1W8NA 2W1QA 3GF6A 4BA6A 2ZR3A 5FYCA 4J10A 1PV0A 5D8AB 5FZCA 5JPMB 1F31A 1NG0A 4LBOA 5CBLA 3P1IA 1OVPA 4N90A 4FO9A 4LK6A 3KG2A 1LR5A 2WJSA 5CG9A 3H3UA 2FCTA 1AYN2 1NE6A 1M57B 2GUZA 2QM7A 4XAEA 4NAMA 4RN5A 2JEXA 2W9XA 3SISA 4LHLA 3DXTA 4UB8Z 4F3JA 4FPYA 2VBDA 3L2YA 2YY1A 3LQCA 5B66Z 3I7DA 3JALB 2IJHA 1VARA 5KA5A 1QQP1 1XE0A 2HLEA 2Q73A 1NA1A 1JI6A 1REFA 5JMOA 5FXVA 4Z92B 2ZCWA 4QU1A 3ILNA 1OLQA 2CH7B 4Y4RA 5A7OA 1ASJ1 3VBFA 4ZI7A 4O4LA 5JIAA 2ZKOA 2HWC2 5GZGA 4XBQA 4QMAA 3AZVA 1JHNA 4DPNA 5HXMA 2W1SA 3F7VC 5F7UA 4LO5B 5E8AA 4Y1UA 1F7YA 1VLNA 4RR3C 3DEMA 4KWLA 3KB5A 2ZEWA 3M3IA 3DV8A 1TNRA 4BQWA 3JATB 1GV9A 1DQ4A 1SLIA 4BK5A 4CH6A 4LUKA 3AFGA 2ORZA 2ZINA 1DK1A 5FMOL 1KMIZ 4OHXA 3O1RA 5C33A 3D5OA 4I9WA 4AR2A 2Q7HA 4AK3A 3AFKA 3LIHA 5F3IA 4RUFA 3FE5A 3OAAG 4DUWA 2WFF3 4ZY9A 2YI9A 4XUNA 4PA9A 4DXZA 1DYOA 5LBFA 4X6QB 4DRVA 3ZR5A 1NQJA 1AYM3 3ZYIB 4MYEA 3I2OA 1JFFA 3K48A 4OQ8A 1EAH2 4LOSA 2JECA 1DHKB 1AXYA 3NNJA 2XASA 4Q4W2 4R6ZA 1POV1 1TME2 3O0XA 1YDXA 3AG1B 3DKQA 2PYJA 1LOEA 3ABMC 3BN6A 1XEQA 1UZWA 4L8JA 3DYOA 3ASNC 1EY2A 4AAPA 3HNMA 1H1MA 3CYOA 4K8ZA 1W2BU 4QM8A 3T2QA 2ZEXA 1QJU3 4LULA 3VZJA 5F3GA 4MOAA 2EX3A 4IUGA 1V9U3 3T0AA 4P9OA 2HR3A 3R65A 3T1CA 4CDUB 1A8DA 1JJ2U 1YI2V 2KM2A 5A70A 4CCCA 2LGQA 1Y67A 2F66C 4JI8B 2BEOA 1YJLA 4LFBB 2MNGA 4EQVA 4K1YA 2EINB 1X59A 4C1XA 2YXYA 3P3NA 2WN3A 2P2KA 3CXCU 5TISZ 5DAVA 3VBUC 4Y24A 3PIJA 1TQ5A 1FJGB 1LHVA 3M8LA 5FYZA 1Q8SA 1AJQA 4JI0O 1HQLA 4QQ2A 5IVEA 1W3VA 1KQSU 1DQ1A 1Q3EA 4H13B 3E8BA 2VZ1A 3ORJA 4LORA 1CAXB 1T2XA 1FFXB 2R043 4DFSA 5F37A 1B35C 1KP2A 1XNRO 4Q4Y2 2WLHA 1ZRIA 4K0KO 2Q1FA 2CV6A 1OCZB 3VV1A 2VOVA 4YVSA 1IG3A 1DGWX 5A3TA 2GALA 2R49A 4KGQA 5H9CA 4KU8A 1YQ8A 1TE1B 5KHIA 1CGPA 1V9U1 3HT2A 3KT4A 1SQQH 5F32A 5C9AA 1QBZA 2VQUA 3VN4A 3AJYA 5A32A 1I5XA 2W46A 1AL23 5BPXA 2UXBB 2JG8C 1PD3A 1HNWB 2Z4FA 1ZSPA 4LE3A 3PTYA 4WCEV 1H8TA 1RUG3 4CU6A 4U3JA 1NCRA 2D3RA 3A4UA 4NPLA 1O59A 4WM8A 1JOJA 3WW2A 1PK6A 2JG9C 4L99A 3A0KA 4CDQA 1U5XA 1SZBA 1GM8A 1LU2A 5GLUA 5FZOA 4JAVA 2J1EA 2CGNA 4AI3A 5KHHA 2UUBB 3GYDA 4XMIA 4DMIA 5EIBD 2IXLA 5FQ0B 4Q4X3 2CTQA 1WP7A 1UYYA 2WZR2 1N0NA 3CSXA 2DURA 3ENRA 3OM3B 5J7MA 4CP0A 4BISA 2XHBA 3SJCC 3KGLA 5FYHA 4R9CA 1RMU2 1GLHA 3HKCB 5CA1A 4QNHB 3ZMVA 4QPKA 3I2HA 3DXRA 4RR3B 3WCRA 1VB4A 1S2BA 4DV3B 3WQ0A 3RI8A 3WDYA 5I91A 4TWTA 3ZIAG 3T1MA 4QGPA 2VBBA 4YLZA 4E2QA 3ZCCA 3N7KA 4BQYA 5JXIA 2XAHA 3POJA 1LB2A 5A7NA 1S77D 3K08A 1JZ6A 1R1ZA 4DV6B 1RUG1 1ZWIC 4JHZA 1FNYA 1VQ5V 1ND3A 5C3SA 1VAVA 3ETGA 2D3PA 1W04A 1W2UA 1YHFA 1HIXA 2GMEA 3RYIA 5KC5A 4XTPA 1VRH1 1AR61 4NMIA 2XWJB 1RHI1 3MBWA 4AFCA 3W5NA 4YWAA 3H0OA 2VW1A 1MS8A 1O5UA 2RE9A 2DYSC 3VQVA 1R6NA 4AW7A 3MFAA 5JQGB 3I97A 2YIBA 4TLFA 2OA2A 3KV5A 2FZ1A 1XHXA 3ZJZA 1FNZA 1QXRA 3ABMB 1RUE1 3QACA 4ARXA 1UL9A 5F1RA 5HFLA 3ASNB 2EXIA 4LPLA 1BHAA 2VWJA 1IKQA 2EALA 2XOMA 1CX4A 4Y22A 5IW0A 5FWEA 3UM7A 3VUOA 5LMNB 5JVDB 3ES1A 5FMDA 1R092 3ON7A 1IBKO 4HANA 3N27A 2I45A 2MW2B 4IV3C 5ABJA 1O4YA 2JE8A 3EXUA 4KWUA 2P4EA 2R073 2GP3A 4NXMB 1UKRA 3PUIA 2P67A 3OUHA 1AZDA 1Q82W 5HCFA 5A3WA 1CX1A 4XF3A 1LR1A 5FYUA 1I6XA 5FXXA 3OGCC 4K20A 4QDQA 5AC93 1ZVFA 1BMFG 5KWRA 4LBLA 4NROA 4CDXC 1CIWA 2HWD2 5IYDO 1U12A 1YYNA 2PF4E 3KD4A 2P5OA 4FK5C 1DGRA 4I0WB 1K92A 4BIUA 1B35B 2CK3G 2MEV3 2WYSA 3JSLA 2VQTA 4I50A 2BGOA 4Y20B 1UD1A 5IJ9A 1UU5A 4A4AA 1ZBA3 1HNXO 3IIAA 2F17A 1OFNA 5CFDA 4QQHA 4FSJA 1V6MA 4QX0A 4BLIA 3USUA 1WB8A 4OZXA 2G9GA 5JZGC 2PY5A 1WN7A 2CY6A 2YGLA 1OCRC 2PGGA 4BB3A 1LJ7A 3NQHA 1PL0A 4YM2A 3RZZA 2JG8B 4S2GA 3E8GA 4YW1A 4JC1A 1O3QA 3AL6A 3CQOA 3H3ZA 1FOD2 3OY8B 3OGJA 5A7SA 2JG9B 3AYCA 1EUUA 3P6BA 3BY6A 2ZIOA 4YSFA 1H2MA 4IE0A 4AHXA 1OA2A 1UWWA 3LGRA 4P14A 1AI5A 5IVFA 3JB8A 3E86A 2G9ZA 2HYXA 2ORXA 5JH7B 4Y5Z0 2ZEZA 1RGSA 4META 2UXXA 1XMQB 2RS13 4L9BA 1K5MB 2ADEA 1QY4A 2ZGUA 5EYXA 3AKRA 2VOKA 3F5WC 1AR82 1QHDA 1ZBA1 3JD71 4OI2A 1QWRA 2QTOA 4OUMA 1UZYA 2L35A 1MA1A 3EO6A 3KV4A 3H8UA 3HKDA 2Q30A 3SNMA 4LLOA 5BZBA 3Q8EA 2Q5ZA 2PI4A 4BHPA 4YJ2A 3J80N 3HT1A 3CE2A 1XSRA 5FLXN 5KMGA 2CTPA 5AFBA 3CC7V 4P30A 4FPHA 1LAJA 4QHOA 1MMMA 2AHYA 1UMZA 1A6CA 4LKEA 1DDLA 4JRAA 2W1UA 4UW6A 1Y74B 3M7AA 2WO2A 2X8KA 3I4IA 4AL9A 3L71H 4RFRB 5FZMA 2RQ6A 2UXCO 5C4WC 4H0LB 3C7FA 4IDZA 3K0GA 1QXJA 4NPMA 4FFGA 5D8AA 3MLJA 5FZGA 5H9QA 1WLWA 1X8EA 1XOUA 2V4VA 1QQP2 4EWEA 3RG0A 3LE0A 4YZ4A 3U4XA 1LOFC 2NM1A 1XJAA 2W91A 2CGPA 5L3BA 5LA9A 4AVCA 5HCBA 4JI3O 2IU3A 4OX9O 3BAAA 2D6OX 4M01A 2DCJA 2PMWB 1QJX3 1XU2A 1CPYA 4DR2B 3OGRA 3H1HH 3G71V 1R73A 3LDDA 1XQNA 1REEA 2WO1A 4DRXB 2Q6AA 1MZEA 4ORFA 2PHWA 1NUKA 5DAPA 3C7OA 3NNGA 3L75H 3ZOIA 4GH4C 1FX5A 1A34A 3MIBA 4NB5A 4O65A 3H1WA 2FMLA 1VB2A 2F6BA 1ZNPA 3HIFA 4IV3B 2WS93 2CH7A 2ZM6O 5JXHA 1YSCA 1EM1A 1JR9A 3SYPA 2N7GA 2HP8A 5JSRA 4RAIA 2BCCH 1XMOO 4JGYC 5DDJ3 2KG7B 3VHRA 3MDSA 5JCOC 3ZXFA 1HRI3 3ITQA 4A7ZA 4I0AA 1UY1A 3HNBM 4PD4F 4CDXB 3N9LA 4FAGA 3VHPA 5A3NA 2WKKA 1G9DA 4DV1B 3KHBA 3JATA 2Q8EA 4HK9A 4PIXA 3TK1A 4ZPIA 4LJHA 5A80A 1NCQC 2VOWA 3E8HA 3E1F1 1F51A 2WR9A 2VTXJ 3MF9A 1MS4A 1QOOA 4X89A 2R1BA 4KXRA 2BSKB 1PM9A 3MAQA 2XJTA 1QJX1 1IPKA 1SG3A 2IVIB 4BQ4A 4LQRA 2WLQA 1N1VA 1BCXA 5JZGB 2I2SA 5LBCA 3NNLA 2G38A 3NKGA 1O3SA 1GSLA 3I56V 1GU3A 2R9AA 3GWOA 5JJJB 4MO3M 1OCRB 5LGUA 1REDA 2JD9A 2WS91 1VQOV 4AF9A 5JOYA 2XXZA 4PDRA 2WWUA 4PDWB 5FZ9A 4Q26A 4B8EA 5B3SC 1QNYA 2D6NA 2VNGA 4J42A 4JI2B 5GONB 4X62O 1HRI1 2ZD9A 1MQTC 2Q8VA 1NS1A 2HG5C 4NHLA 1PNLA 3CKHA 1DQ0A 4NJ4A 1GN3A 4CP9B 2ARAA 4JZ2A 5F6LB 2YROA 4EFBA 3RYHB 3R6SA 1VBD1 4BQ3A 4CC6A 4J7ZA 5CEHA 1W39A 3AYDA 4P02B 2CTVA 3BA9A 4AEKA 3H42B 4OMCA 2D44A 3H8OA 2VOTA 3BIWE 5J98B 2HH9A 1SPPB 2BNMA 1OZ0A 1E5SA 3QF7A 2P34A 2QM4A 2Z2SB 3KM5A 3OTOO 3CCLV 3ZRVA 2AC1A 1HJGA 1LCLA 2YYOA 1C8M3 4Y1ZA 4AE2A 1V9U2 3N7LA 3V0BA 1RUC3 5IY5B 4BXSV 4NVPA 4LCUC 2XL7A 5T55A 3LSSA 2RV9A 3ZN5A 5K1XA 3ZSKA 4AGRA 2GNDA 1M93A 4UCVA 5B5EZ 2HVKC 1AF9A 3RGBA 3UO3A 2FB5A 1PIV3 3K46A 1TUEB 3L9DA 5I8SA 5DAXA 4YIOA 3DYPA 2FTKA 5C4WB 4KHPB 3FYEB 4MSWC 2AREA 1SKVA 1NZ6A 3ZFGB 3A23A 2XOKG 4FZ0A 2BW8A 2C1FA 4AG4A 2PUSA 4XDOA 5IT9N 2QKAA 3UKNA 5I0SA 2VRZA 1GMGA 5FLJA 4SBVA 2PAEA 4LC1A 3BU0A 5F6KA 1C5HA 2YEVA 4LBMA 3C3SA 2WAMA 1BBT3 4R4XA 5I0TA 1F4MA 4H44B 1Q90D 1WPBA 3K9AA 1OI6A 2W68A 1P84F 2VQEO 1N34O 4M0HA 5DM6V 5C3OA 3W7UA 5J2TA 3ACLA 3C3TA 2CGOA 3FAVA 3HMYA 4R52A 4AHWA 5BNNC 2ERFA 1BS3A 1C57A 4Q5OA 3WVJA 3TCUA 1RUC1 4XYXA 3USSA 3CJXA 4MGZE 4FM0A 4GH4B 3DKWA 2BFUL 4LFAB 3V0AB 1W8ZA 4N8MA 3MUZ1 2AZ0A 4QE9A 4QGNA 4DIQA 2H6BA 1SQPH 4X1YB 5LBBA 1RUG2 4PJ0Z 4KFMA 2GNTA 4JTCB 3ZRWB 1MS9A 3CX5F 1YJNV 4QPWA 4DR3O 1QJY3 1UU4A 4LO7A 1QQCA 1VRH2 2ZX2A 1AR62 1RHI2 4TQDA 2ADPA 5LBEA 1QU0A 3LEKA 2DF7A 4CDWC 1HR0O 5FP3A 1NCQB 3ZN1A 1AR73 2F4VO 4FXKB 4LWSA 5HV4A 5FO8B 5CVRA 3SH4A 4KQ7A 4PLMA 4X64O 1RUE2 1VEWA 5D21A 4X1IB 2HEVF 4UFIA 3MHSC 1XNQO 4IEZA 1W8UA 1KQRA 3ZHRA 4WBNB 1V00A 2A3WA 4IL7A 1N32O 2A7AA 3RYKA 3ZDVA 1AVBA 2GHYA 2LO1A 2EXKA 2UYBA 3W7SA 5JVVA 1URFA 4DV4B 4ZS3A 4YY3B 5AVAA 3I2IA 4FIPC 1NXD1 4TV9B 5HFMA 3J7LA 3RBZA 5DUVA 1G9CA 1YHQV 4W6WA 1MNGA 2FKXA 4DV7B 4GX1A 3B5LB 3ALQA 3O65A 5B3SB 4EN8B 2ETNA 5C70A 4O2BB 3U11A 4W4ZA 1ULOA 1SACA 3FHIB 2Y0OA 4BIFA 4J11A 3JAWB 3FB7C 4LHSA 4X66B 3K4ZA 5BV6A 2DU0A 1EUTA 4RGAA 4X20B 3ICXA 1J95A 2RS53 1MQTB 3N7JA 3G6JB 4B3SO 2YPJA 2YG0A 4HL0A 3WR0A 1OA4A 1VQ9V 1KS5A 1IBMO 5JVDA 1JMUB 1UAIA 4QPIB 4QWNA 2DMXA 2Y4UA 2W5FA 5GZFA 3BB6A 2D5FA 2UU8A 5FIXA 3WF1A 3FHAA 3TJTA 4GKKO 3GWKC 3BTAA 5LGTA 3CCEV 5FP4A 2RMU3 5FPUA 2HWE3 5J36A 4QQOA 3ZM8A 2WSUA 4KUMA 4CUBA 2VQAA 5BNOB 4KGGA 5GM0A 2J7MA 3TNPB 2H3OA 4MGIE 5ITZB 5EYYA 4J25A 5CA3A 1NXMA 4YG0A 4XJ9A 3R0RA 5BNPC 1OMIA 1O7FA 4R50A 1DBNA 2HYKA 1I3HA 3HQUA 3LNNA 1PNFA 3T2OA 4RWUA 2V7QG 4OPHA 1DLBA 3VZKA 3RJRA 2OYZA 1YFXA 4CPBD 3ZHSA 2JB8A 3JCIA 1MVEA 1DGSA 5AC92 4NWWA 4KH9A 2VD7A 4GAZA 4JTOA 3ACGA 2QE3A 3DXUA 3NV3A 5EJ1B 3PJSK 1DF4A 1A32A 3SLIA 2Q9LA 4ONUA 3LDBA 3ZYFA 4OHZA 4YW3A 5LEJA 5L7OC 1JUIA 2MEV2 2QUOA 4N21A 4AHCA 1UY4A 3TBDA 3CLPA 2EAKA 2WABA 1W9FA 2DYCA 1ULPA 1ZBA2 3JD72 1PNGA 3D3QA 5FLHA 4J7JA 2HWE1 1UJWB 3ZHUA 1XNCA 1Z0HA 3AP9A 2E63A 1Y6XA 4XDJA 1WW5A 5BNNB 2E31A 2E51A 3BEHA 4CC5A 4OULA 3M2MA 5LMUB 3GGLA 3M70A 1JYWA 4CS2A 4GJZA 1WPXA 4E2GA 1AL0G 5C8CA 2YS8A 5FMCA 3N35A 4OUEA 2VECA 3N2GB 4JV4A 2WA4A 3JBG3 5JH7A 4CTEA 2IM9A 3JAKA 3VHNA 5FK7A 1RC6A 4Y4YA 4UFKA 1K5MA 4O2AB 5FZ7A 3MD0A 1VP7A 3A0BZ 5C8YB 2EIEA 3HJRA 4XCAA 2PHRA 2W6JG 4NKGB 4IXLA 2NMOA 3WP4A 2ZE5A 3Q4HB 1X7NA 5HI0A 1HNWO 4AEJA 1ZZ6A 4QB1A 5JSPA 5JDBA 4DR7O 5FV3A 5DXDA 3BYWA 2Q1MA 3VQXA 3VBBA 2DCKA 1RUD3 2QNKA 3BPSA 3ZHVA 4CDWB 1W6OB 5A3OA 2I07B 3ZMNA 3WP5A 1PNKA 1L7RA 4Y5SA 2UUBO 4UCOA 1L3JA 2E6VA 3T08A 3LNMB 1WMXA 4MG2A 3R66A 3Q8BA 3MIFA 3OYWA 3KV6A 3OMAB 3J8F1 5IK8A 1GTOA 4GALA 1Y74A 4XILA 1QCEA 1W6MA 2D3SA 2JEUA 1W59A 1UIJA 5EP9A 2NN8A 4RD7A 5B4NA 4L11A 2JE9A 1N33B 1RJ7A 4IERA 2WNEA 3GBWA 2BBVA 3HWJA 3EMRA 4H55A 5FO7B 3N3HA 5FY0A 3THCA 5JXGA 1DZRA 3WF0A 5M0TA 1YEWA 3B02A 1AJPA 2DVBA 4BLJA 4J1XA 4ET7A 4N43A 3NJZA 5F5AA 4A3XA 1QR8A 4AVVA 2WLJA 3PDQA 1QDCA 2F4PA 3AK2A 3TYJA 4MX3A 4KNCA 5GZEA 2UUCO 1NA1C 3F2ZA 2GBOA 3IM0A 5A1FA 4RL7A 1OOPA 4GD4A 2JGDB 4DRXA 1X9TA 1D4M3 4GQ7A 2YIAA 1DTOA 2DUOA 5KX5B 1EZJA 1M1KW 4Z07A 2BYVE 4FFKA 1YQCA 1OJHA 5G04L 3F7YC 2ET1A 3I3EA 3NR7A 3K75B 1GN6A 4DB5A 1SQXH 2CTWA 1LRHA 5FUPA 1WGPA 3PL0A 1QJX2 4MUVA 4G27B 1LGBA 5SV5A 3OOXA 3FBMA 1BVVA 1KFUL 2KG7A 1H0BA 3B09A 1XB9A 2LTNA 2QBXA 3E6DA 3O1MA 2EA7A 1U96A 5IVVA 2VUAA 1QOTA 3ZN6B 5FCCA 4LBJA 5JI9A 4B7KA 2WS92 2WC2A 2VTXA 3ZX6A
chains in the Genus database with same CATH topology
5KXDA 3KB5A 4JQRA 2XH6A 2WT0A 1XYPA 4COVA 3M3IA 3DV8A 3OBRA 1TNRA 2HWF1 2ES3A 1PO23 3O5SA 1GV9A 2TNFA 2WA3A 3OD0A 1DQ4A 1SLIA 4HT1T 3E97A 4OHVA 3NL1A 2Q4SA 4LUKA 2P3IA 3AFGA 2ZACA 3PJYA 1PIV1 1HRV2 2ZBJA 2E7TA 3V17A 4FTEA 4NHMA 5FMOL 2GSYA 1XE8A 4XETA 4OHXA 2ZGPA 1DS1A 1UCXA 4JGYB 5C33A 3D5OA 1CN1A 1HRI2 2V09A 1LGNA 4IV1B 4AI0A 4FVVA 4B4RA 4RR3A 4AK3A 3AFKA 4PDWC 4Q4X2 2Q8OA 2G9FA 4Q4V3 5LRRA 3FE5A 2WFF3 4YW2A 2UWAA 3LOIA 1DQ2A 1HV1A 1MS0A 3UJQA 4H3WA 2BTVC 2UWCA 4DXZA 1LHNA 4K9SA 4WVWA 4X6QB 4DRVA 4QM9A 1PVC1 4YGDA 1NQJA 1AYM3 1VBD2 3ZYIB 4XJ8A 4B4PA 2WWSA 4HFSA 1V70A 4MYEA 4P9GA 1BBT1 5C8CB 2NMNA 4Y1XA 2QZ3A 3K48A 2ZKLA 4C1WA 3VL9A 1PZ8A 1EAH2 4PDWA 4HLTA 1W6PA 1DHKB 1AXYA 2JECA 4FXGB 4SLIA 4Q4W2 4I3GA 1YO8A 1POV1 1TME2 3J8F2 4LO4B 3O0XA 2VQ0A 2NQYA 4XFCA 4YW5A 4Q8LA 3H7YA 5T3NA 1LOEA 1H2KA 1C1LA 2IWGB 2D93A 2X5IC 2QKDA 2ATFA 4WVVA 1OQDA 3AMMA 4QHBA 1PHMA 1EY2A 5LK7B 4HKWA 1H1MA 1Q56A 1N1TA 1O91A 3NAPC 4GMP0 2YC0A 3SCFA 3WW1A 3VZLA 1VAMA 1NX4A 2QZ2A 2EF6A 1FPN3 4QM8A 3ZSLA 5JWPA 1B09A 1PVXA 1FMD1 1QJU3 1WD4A 3LZZA 4LULA 3RYPA 4ES8A 1QDOA 3VZJA 1ZZ9A 1KITA 4LR4A 5IK7A 1H2LA 1CVNA 3DGTA 2ZX1A 4JDMA 1V9U3 3NVCA 4WV8A 3RJ2X 2FQPA 4Q0UA 3E5QA 1VBC3 2A71A 2JENA 1XXNA 1XE7A 4OUSA 2X5IA 4AVBA 2A6XA 4CDUB 2WT1A 1A8DA 2KM2A 1QJY1 1AHSA 1MZ5A 3ZO0B 4WVMA 1LOCA 3NAPA 2ARBA 2BEOA 3ATGA 2XKPA 5SV8A 1YJLA 2MNGA 4K1YA 4XHXA 4C1XA 5A33A 4Q4V1 5A3MA 2QVSB 3OYWB 1RVF1 4K1ZA 3H1YA 1QF3A 3P3NA 2VNOA 3QBQA 1UKGA 2P2KA 3IDCB 2FHRA 1WLDA 3VBUC 4Y24A 3ZFFB 1H9PA 3HBZA 4B4QA 1W6MB 1JXNA 4XW3A 1TQ5A 3B94A 4P5HA 2VMHA 5DUXA 1LEMA 1LHVA 2O8OA 3M8LA 3PMSA 1AR71 1NY71 1Q8SA 1HQLA 2B7YA 3SHRA 2XB6C 4QQ2A 4YVSC 2D6MA 3MPPG 3FWEA 3B01A 1DQ1A 1Q3EA 3E6BA 4QX5A 3ZFGC 2W39A 4OI4A 2WNUB 4FPEA 3LKJA 3WHTA 4ATFA 1CAXB 1OSGA 3NSTA 4MV2A 2R043 1VBB2 4NWVA 4DFSA 3NO8A 4BGMA 3B00A 4KWJA 1B35C 5GZCA 3M3OA 3VKNA 2D97A 3VBUA 4Q4Y2 1ASJ2 5FTTC 1QMJA 3V15A 4PCRA 3OPZA 3CF6E 5C9AC 2CV6A 2ZGRA 3VV1A 5EV7A 2VOVA 1GZ9A 3MFCA 2Y0IA 3NKTA 4N43B 1YXWA 4YVSA 1YFYA 1C1FA 3ZFEC 1DGWX 5L36A 1NQDA 1RUC2 2GALA 1F2NA 3ZFGA 4JDNA 1FPN1 2R49A 4JGZC 3JB4C 3POYA 4KGQA 4LHNA 4BHGA 4KU8A 4N53B 3AP5A 5EFUA 4Q8KA 4K7JA 3VKFC 3FLPA 4L92A 1H8TC 1OOPB 1TE1B 5KHIA 3RPQA 3O14A 5FOBB 1POV0 1IOAA 1NCRC 5L73A 1CGPA 1B35A 1V9U1 1CONA 3VBRC 4WM8C 1RL3A 1DRYA 2R072 4KG0A 1VBC1 3HT2A