2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
1MZFA 2XUMA 4QU2A 4JAAA 2CGNA 1H2NA 4BIOA 4B7EA 4NR1A 1H2MA 2Y0IA 1H2LA 2CGOA 3KCXA 4Z1VA 1YCIA 2YC0A 2ILMA 1IZ3A 3OD4A 1H2KA 3D8CA 4B7KA 3P3NA 2WA4A 2WA3A 4Z2WA 5JWPA 3KCYA 1MZEA 2YDEA 4AI8A 3P3PA 2W0XA
chains in the Genus database with same CATH superfamily
2GNTA 1S5HC 1D2DA 2OCHA 3A0KA 3VB9A 2LTNA 5DAPA 3SPIA 1ZBA3 4CYDA 5GONA 4YJ2A 2JDUA 2OWOA 2ZTNA 4RA0A 2UWBA 5L36A 4B8EA 1WN7A 4R8HA 3ELNA 3ABTA 4FJCC 3C3TA 1VQOV 2WL1A 5FZ0A 3WXPA 1KJRA 1F31A 4LC1A 1IXMA 4K6BA 1R6NA 4FVMA 4BE3A 1G9BA 1RMU2 4AI1A 3OBRA 1ORQC 3HQRA 1UMHA 1U96A 5H9QA 4H33A 4Q0SA 2ARBA 4Y1YA 1RJ7A 3LB9A 2KSDA 4BWAA 4BB3A 1UYYA 1H6XA 1IBLB 3A0HZ 4NMIA 1OOPB 1CVNA 3MUY1 4UCRA 4MUVA 3AP5A 4AEMA 1OPMA 5F5QA 3WT3A 5IT9N 1UOBA 3TCUA 5DG1A 4KNCA 1PM7A 5F5AA 4DY3A 3IDBB 1AJOA 5EC2C 3AK0A 2Y6FA 3B8MA 1W2NA 3VZKA 3M70A 1A8DA 5L9RA 4LF7O 5JJJB 4PIXA 3ES4A 2PYLA 3ASOB 2Q8OA 4AFBA 3LOIA 1ENRA 2E63A 2KR2A 2P17A 1HNXO 4GKYA 4Q4X1 2JDMA 1MEC1 2QDOA 5CG8A 1X59A 3K5LA 2JJ6A 4NWWA 5FLJA 5JOYA 1KITA 4QKFA 1TAEA 4WZCA 1EZJA 3D3IA 1LHUA 5F5CA 2DBNA 2I07B 3DECA 2P3JA 5C9AC 3LFIA 1TNFA 5CU1A 1J3QA 4JI0B 4PDWA 2ZKLA 4CP0A 1W8HA 4LKEA 2BOIA 2FB5A 1FFXA 4IE0A 2C9KA 2E9QA 5AFBA 1Y9GA 3LEGA 3AMNA 3BY6A 5J2UB 5EXOA 2C2AA 4DW0A 4FMTA 1NCRC 3IDEA 4J7KA 3CB2A 2MEV2 1LB2A 4QXHA 2Q73A 3E97A 1HRV3 1D5AA 3L2YA 5BXZA 2BNMA 3WEZA 4CDWB 3CZJA 1G9AA 3ZYHA 1K92A 2RDCA 4N9HA 1QOSA 4CRQA 2XJSA 3ZMOA 3J81N 3WZ1A 1COV2 5KR7A 2F4VO 2RMU2 1AI5A 4O4JA 5SV8A 1YFXA 2O0OA 5FZ8A 1DYOA 3KZ4C 2PXJA 1FXKB 3NKTA 3APBA 1VMGA 2DF7A 2WT1A 3JCZA 3J8F3 4YW2A 2E7TA 3MLJA 1R64A 2RM23 2XTAA 2DVDA 1BMV2 1WAZA 5J1XA 2Q5ZA 1N33O 3H1JH 4I55B 5G04L 1BL8A 1BGYH 1AI4A 3T1YO 2Q7HA 2BTQB 3IKWA 4UV9A 3H01A 4JRLA 4Y5Z0 3I2FA 4HPKB 2IXKA 1BMFG 4X20B 4GXLA 5TSWA 1JUHA 2J1AA 1VMJA 3MZHA 5H2FZ 4P9PA 2JXAA 4CS4A 2ORZA 2RVAA 1ZAUA 3FB6C 5JZGB 3PTRB 1QLEC 5L3BA 1ND2A 5FMDA 4UCTA 5KA6A 3O1VA 5LMUB 3RYFA 1W99A 4L2NA 3P1IA 1H2SB 2YEVA 1REFA 4WM8C 3RWNA 4CP9B 2DU0A 1REDA 4BISA 5CFCB 4XQWA 4B3RB 3HQXA 4PD4F 2RR13 4P5HA 4BXSV 3FB7C 5IY5C 5FLHA 2RE9A 2AUYA 1UAIA 3QF7A 1HXS2 3CXHF 2ETEA 2J1EA 1BJQA 1RM1C 5A32A 3DXRA 2QJ1A 2R062 1RITA 1ULOA 3S57A 1N34B 1UX6A 2H6CA 1WPXA 4KMQA 3VZLA 1QJX2 5E1AC 2OIIA 4JZRA 2QTWB 1YYNA 4DV3O 4AEDA 4QQOA 4XHBA 3ZYBA 4WVMA 3ABKB 5IFPA 2PAEA 3ZLIA 4JTAB 2DVBA 1ULFA 1H8TB 4C1WA 4XMAA 2VCCA 5FZ1A 1NVPB 2P6HA 3FUOA 4YRDA 4WFGA 1W6QB 4M01A 1BYHA 4HVQA 5FO7B 1YJWV 4KGGA 3BCCH 3OGRA 2XQRA 2DCYA 5DAWA 2YZ4A 4Y4YA 5T5JA 3H1MA 3B69A 2EIJB 3T4HB 3K0DA 4YFWA 2BNNA 1XNAA 2E51A 4DO2A 1UZWA 4LLFA 3UKVA 4Y20B 1TUEB 1MS1A 1UNBA 1SLAA 1ULGA 1SQGA 3HOBA 3MDPA 4I2OA 5D5QA 4PDMA 3UT5A 1K9MW 2AZ0A 4P9JA 2VNRA 3KHCA 4WFFA 4RGKA 3LSQA 1R3KC 2YBSA 3VZNA 2RJLA 1GV9A 4AYUA 2VZVA 1RUOA 2VAUA 1ZRIA 1C4RA 4XUOA 2QEXV 5ABJC 1VQ4V 5KMGB 2OXBA 4AFMA 4JGYB 2O8QA 3ZN6A 1RHI2 4HFSA 3JD1A 3PMEA 1GMMA 4N43A 4RAIA 4CEWB 1AYM2 3ZSEA 5CFDA 1X7NA 4GCZA 5K8SA 1W9TA 3KT4A 3UNPA 5CKNA 1YFYA 2QFEA 1LTEA 2JDKA 1MEC2 1OLQA 2BEOA 4URTA 2XHBA 1KBHA 4U36A 1OCCB 4E4DX 1YF2A 1RVF1 1LU2A 5H9PA 1U5XA 4YLZA 2RS13 3C7OA 4KG8A 3RYCA 1UY2A 4RFRB 1O5LA 5CBLA 1WLTA 4MVRA 4DV0O 5C8CB 3ZJZA 4JI3O 5FMOL 3K0GA 5D8AA 4F83A 4C0BA 5F2VO 4Z2AA 4U3JA 2Y0PA 4XFGA 3H42B 5H9CA 4YJ2B 5C5TA 1V00A 1W8WA 2NQYA 2KD7A 2XNDG 3ZSLA 2ZM6O 4LBNA 4EFEA 1BCXA 1LECA 3N35A 3PUAA 3MIBA 2YHJA 1NE6A 1VBA1 3GHMA 4CEYC 4Q0VA 3MW4A 1JHJA 4DR7O 4DR2O 3NRUA 3AG1B 1YI9A 3ME2A 5CAZA 1RL3A 5JI9A 3KLSA 1RPRA 4S2GA 2D6KA 2AYHA 3GXUA 4LBMA 4MW8A 3FYIB 5KHKA 1UY1A 3VZMA 3TGUH 1NZCA 1URFA 1OT5A 1TME3 3H7JA 3U10A 4YHHB 3GZEA 4I50B 4KU8A 4LITA 2Z2SB 4OZXA 1VQ8V 2QE7G 1B35A 1G6NA 1HQWA 4WM7B 2ZT9B 1BHBA 3BPSA 1X82A 5E16A 5FY4A 5BXXA 1GQPA 2CTVA 4XOGA 2ZPXA 2EILC 3ZPOA 5A1FA 5KC6A 4F7ZA 4JI5B 1KJLA 4OQ8A 1HB3A 3D8CA 5DAXA 4LKDA 4E4HA 1H38A 1W03A 5KXCA 2HLDG 4H7LA 3FL7A 4HK9A 4QXKA 2XOMA 1QXRA 4B3TO 4LH6A 3W7SA 4LULA 3GNEA 3LDKA 5B1AC 4ZZ8A 3K3WA 3TOJA 1US2A 1KFXL 2CV6A 4CCLA 3WNOA 4Y33A 4AI0A 1HJFA 1K4DC 1VAMA 2QWRB 1W2AX 3N27A 4W4KA 2GH8A 4HOOA 1JMKC 4L9BA 3BYWA 3O12A 5EZWA 4ONUA 3SXWA 2DU1A 4ZZ5A 1JA8A 1QJU3 2RDRA 2Q4PA 2ZGSA 2YG0A 4F6RB 1XSQA 3PUQA 1G9FA 3G6JB 5FZIA 3TBDA 4LF9B 4WZFA 3UO3A 1SBEA 1J3RA 2JDZA 4M0NA 1SQQH 1FMD3 3O1MA 1GSLA 3WNKA 4BQ2A 2LP7A 1OHHG 3ZDVA 4J6GA 2L6LA 1HQLA 3B9IA 4YM3A 4B1LA 1NS1A 4QPGA 2EIMB 1AVBA 1ZNPA 1FPOA 3E83A 1VQKV 2QQUA 3WF3A 2QM8A 3RVYA 2VNGA 1PGW2 1AP5A 2BFUS 3RJRA 1DZQA 4A5UB 2GUZA 4TXWA 4K8FA 1QU7A 3UYJA 3CCMV 3ZMSA 1V6OA 2C5DA 5FKCA 2Y0OA 1CPYA 3GM8A 2WNVA 1TG7A 3VBOA 1IBMB 1W9SA 2VMCA 2BWAA 2R16A 3CJHA 5CMUA 1RUE2 5IWAB 5A6YA 1DGRA 3MIFA 1OQEA 2BQPA 2ARXA 2KM2A 3ZYFA 1GZWA 1NT0A 3JD73 4P2ZA 4CCEA 3A21A 5DEDA 2WLKA 3CPWU 5DUXA 3VBSC 3NV2A 4JAVA 3UGGA 1GFF2 1F8VA 3RYHA 4JZGA 4CDXC 4ZKTB 2ZEYA 1XNQO 1WCQA 1QQP2 3UM7A 1DQ2A 3B5LB 1HRI2 5FY1A 1MQTC 3LNNA 3B8NA 1RVF2 1LNSA 4Q20A 2PYTA 5FJKA 5FLIA 3RJ2X 1IBKB 3D36A 4K3AA 2D7FA 3WB2A 2V5YA 3AKTA 3VBBA 5IK4A 2Q7GA 4RN5A 5FCCA 1FJGO 1PO23 2ZX2A 4WVMB 2GSYA 2ZHMA 4UVAA 2WZR1 4HONA 4YXWG 2WO2A 3ZIWA 3CL1A 4NUBA 4IEUA 1W59A 1LEMA 3MD0A 3BVCA 1KB9F 4PHZA 4XTPA 2ZEWA 3N9MA 1VBA2 5CA0B 3ZOIA 3FHAA 3PJSK 2EIDA 3I3DA 4KP4A 5LZ6A 1AR5A 3K3OA 3ZMTA 1Q56A 3NKGA 1I5PA 4JQTA 3WNNA 3ZYRA 1AR61 4OCTA 2ZHNA 3D4KA 4URAA 1PGL1 5HV4A 1QDCA 2R9RB 5C3SA 3VGIA 1UIKA 1IVSA 4LBQA 3IAPA 3EMRA 4LBKA 2N04A 1RTVA 3T0DA 2VR4A 2ZS6B 2XVKA 3WP4A 2V4VA 1WD3A 4LBEC 3OPWA 5FZLA 1K45A 3TXQA 3SPGA 3F7VC 3C2UA 2HWB1 3ZRVA 4S2HA 3AL6A 1YTFD 3AYCA 1JZ3A 1PMHX 2DBIA 1BQ0A 2Y64A 5LCWL 4I02A 2XHKA 4NHYA 4JDMA 1K12A 5FZ7A 4CH3A 1VB4A 5FXVA 1BCCH 1PK6A 1XILA 1JQ0A 2YV8A 2B9VA 3BGAA 2HVKC 1MS5A 3SKVA 1G8WA 3EVKA 1EBOA 3GCXA 3APOA 2DYCA 5GZEA 3CCSV 3WD5A 5KAIZ 3DYMA 2E74B 4UFLA 5F7UA 1RC6A 2DUPA 2LROA 4LF4O 2VTXJ 1O3TA 3CJIA 5JDBA 4IGPA 1AR93 5EBMC 2A6ZA 1H2KA 2W6IG 1ONAA 4XYXA 4PELA 4FPFA 2PN5A 4MXWB 3LE0A 2CK3G 2GV9A 1W06A 1RUH1 3AYEA 2IVIB 3VBRA 1B6QA 3MIDA 3CCQV 3RWKX 3CRQA 4IW3A 2WC2A 3MBWA 5FZGA 5D21A 3SJCC 2EINC 2O1QA 2H6BA 5BNNC 2Q7EA 3BTZA 3U0ZA 2UXBB 4Q4W2 1Y4WA 3EHKA 2EJRA 1ZBE1 4XDQA 3AK3A 2EALA 5T5OA 1D4VB 5FP7A 2PI5A 4WM8B 4J42A 3J9SA 4O4IA 4OHVA 3VKNA 5FXZA 2FL4A 3SEPA 3OYWB 1PVC1 3B09A 3ST7A 1LOEA 3WQ7A 2JGDB 1B35B 1C28A 2X53S 4WVWA 3ROUA 1OF4A 5A80A 4GJZA 2XBO1 3WW2A 4HYOA 2ZKOA 4QPWA 2QDRA 2QSAA 2B9ZA 1VLNA 2A7AA 3E35A 2AC1A 3CRCA 2XJQA 1AVMA 3QH6A 2RMKB 1NG0A 1JI6A 3HKBA 4X65O 5LMUO 1R093 1LUVA 3MPPG 1JOBA 2HLEA 4PI0A 1AXZA 1KQRA 4IETA 4MGTA 2UUCO 1KECA 5LK5A 1W90A 3Q8EA 2R9IA 1UY4A 3C7EA 3JD0A 1V6KA 2EZOA 1CQ9A 4O2BB 1PM9A 2WWUA 4PA7A 1VP6A 4IEWA 4JCKA 2VUJA 5DDJ2 2O8OA 1XSRA 4QHBA 4LO7A 3F95A 2AW9A 3MGUA 4CUCA 2OA2A 1YQCA 2BOCC 4TT3G 5FXWA 4FLTA 3O1OA 4UW5A 3KT1A 4XDLA 3T1LA 2IW5A 1GN2A 3CEWA 2VZQA 3ILNA 4PA4A 4D3WA 2WNOA 2D3OW 3WDTA 5EJ1B 1NE4A 3WLUA 1L7QA 2NMOA 1VQMV 1BK0A 4BIUA 5IYYA 1O4TA 3E6BA 3T1CA 2ZQMA 1Q86W 2QQLA 4BXFA 1BZKA 1KDMA 1XRUA 3PJQA 4RGGA 5F2WA 2B42B 3JB8A 5CYYA 3WV6A 1YQ2A 5H9RA 3A22A 3BOPA 2WNUA 5G05L 1Z0HA 1GZ9A 4NWVA 3NJXA 3SLIA 4DXWA 3JASA 4QPGB 4IYIA 4IE5A 5FUNA 3KVAA 4CCDA 5IHRA 5HV0A 4UT5A 4XJUA 5LWBA 5FPVA 1RUD2 2IUWA 3OY8A 1SDDB 4XPVA 2HHHO 4IGGA 1F15A 2VQFB 2DYSC 4O61A 3IB3A 1QEXA 1UU6A 3IAYA 1LULA 2LO1A 1BVVA 3G67A 2UUBB 1AILA 4JC1A 5C93A 1JYWA 2V09A 4EN0A 1RMU3 2GC0A 2XAQA 2H3OA 2XLFA 1OLRA 2DE0X 3OE7G 3G6EV 2WNVB 1U12A 3RFRA 1PGL2 2IXLA 3ABMC 3VDAA 4FLYA 1TEIA 3CJHB 2XUMA 5FZ6A 4BK4A 2D93A 1KKDA 1VE0A 5L3GA 5K1PA 4KBZA 4UV8A 1BZWA 1GZWB 2ZX0A 3INAA 1VP7A 1XNTA 2VZ3A 3F5WC 3WF2A 5KXDA 3ZSJA 5LBEA 4OMDA 5A7OA 4LE4A 2VZ1A 2AEZA 3BN6A 2Q1ZB 1H1IA 2HWB2 4XFAA 4CEYB 2W94A 1UYZA 2ZBJA 1QVGU 4AGGA 4RQPC 5JCOA 3KGLA 4RR3C 4P14A 1Y74B 1M4UA 2IU0A 2F6BA 2VC9A 5L3FA 2DFBA 4NIIA 4BDVB 3IC7A 1W2UA 2PGGA 4I3PA 4CCMA 4N7UA 1ST8A 3ZN1A 4XCAA 3M3CA 1LGCA 1UMIA 3UV9A 3VQWA 4FOVA 1MZEA 5IAVA 2EXHA 1UY0A 3J80N 3A7QA 3N2GA 1IGOA 4CDUA 3OGSA 3NV1A 4P9YA 2QGNA 4LR3A 3JATA 1C8M1 3K51A 4B3MB 4W6YA 2JB8A 3LFMA 3B01A 5T3NA 4UCUA 2DWRA 2XJRA 4Y3OA 3A0RA 3N7JA 5ACA1 1RSOA 3QO5A 5D8AC 5F3CA 1PNLA 5DECA 3D5OA 3SCFA 1SF9A 1PVXA 2MEV3 3SYPA 3KWVA 1AF9A 1EM1A 5A7WA 1EN6A 4RWUA 4EZ4A 2Y0IA 2B46X 1VQPV 3RQ0A 3VDDA 4WF9V 3SYOA 4OHYA 2JIGA 2DW4A 4WCEV 4MLOA 2QWOB 4CC6A 4A3XA 4YM1A 4B3SB 5J37A 5B1AB 2WAOA 4X62B 4B4PA 1S5JA 1S0EA 4Y26A 3U07A 2VMFA 3V0BA 4INDA 3FLRA 3BA8A 3ZFGC 2ZE5A 4XC9A 3AK2A 4E27A 1L7LA 3WF0A 2JE8A 2RMU3 4TV9A 3WUCA 3MDSA 5KXEA 1QDOA 1SQ4A 4JI5O 1PVC2 3DC5A 1WCSA 4AGRA 2B39A 4CH5A 2DQ0A 5DUVA 4KHPB 1K3IA 1XNRO 2XBO2 4LBQB 1SERA 5HCAA 4HG6B 3TN92 1O5UA 3VBHC 2DMXA 1W8UA 1MNGA 3KCYA 2R071 1VAKA 5B2GB 5EJ3A 1W6PA 3PL0A 3ILFA 1I7FA 4CH6A 4AAXA 4AHCA 3LGRA 1FPN1 5IUQA 5L19A 3FKSG 1YITV 1IOAA 2R0FA 2KG7B 5IVBA 4YW5A 3QO8A 1WMDA 2ADQB 1PK6B 3SNMA 1W8FA 1CZTA 4NR1A 5FZCA 2AHZA 4IV1C 4LF9O 3CDZB 5FZ9A 1Z7S1 1QH7A 3CIHA 4TUYA 3POJA 5F8PA 3WNPA 2LFSA 3M8AA 2D6NA 4CU6A 2HWD1 4YVSA 1WW5A 4DV4O 1HXS3 5JOZA 4KQ7A 3RG0A 4D7YA 5JH7B 3P5BA 3SCGA 2BCCH 2R063 1R3IC 4JGZC 2YIBA 3MIGA 4DINB 1QJX3 3T1HB 3E22B 4Q2FA 2JDYA 1ZL8A 2R9AA 1MVEA 1F4MA 2QZ2A 5FYMA 2P3IA 3QG5A 4BW5A 2ET7A 5J7MA 3AB0A 4M4RA 3ASNB 3OR6C 4N21A 4KUMA 3VBSB 1IPKA 2A73B 3RGBA 4ISRA 5J09A 2XOKG 5IATA 4X1IA 2YC2A 4FLZA 3K5NA 1LOAA 3N2KB 5KX5A 1IBMO 1GQGA 2ZX3A 5LA1A 1V9U1 4UCSA 4GD4A 3AL5A 5JMOA 5C5UA 1E1RG 3WP3A 3ZXEA 3L71H 1Y76A 3EXUA 2ZZJA 2GU9A 5BV6A 2VW0A 2BGCA 1SETA 2XUEA 2ERFA 2ZA9A 1VRH1 4FXKB 3KGZA 4GKXA 2YUEA 3PUHA 5LGTA 4MGQA 1SQXH 3C3VA 2RG4A 2UXDO 2Y4TA 1GANA 1NVPD 1N1VA 2QKSA 2UU8A 3ZIXA 3H50A 5CADA 4GZRB 1NKGA 4YG0A 4C8DA 4I7ZB 4JI8B 1KRIA 5FYSA 4GX5A 3OW2U 2R49A 1GR3A 3R4UA 3NVCA 3OR7C 1MEC3 2FHRA 1JR9A 5AC91 2R041 3U4XA 2WLJA 3KVBA 5IVFA 5JPMB 2IZWA 2Z5WA 1S0IA 4QDRA 3NR7A 1KS5A 3KD4A 1V55C 3B40A 2I74A 4K40A 4CUGA 4Q27A 1TMF1 1C8M2 1H2MA 4O4LA 2YPDA 4JI2B 4HKLA 2EJ7A 4LK6A 4DUYB 4JYBA 1EY2A 5ACA2 4DXSA 4KH9A 4IEQA 1NR7A 1XQ8A 2JICA 3FFZA 2WO3A 3JBG1 3RZKA 4G3YC 5EYYA 3WG3A 3I97A 4BIOA 1GQHA 2JKXA 3K4ZA 2YICA 2QVSB 1E1QG 5JIAA 4JKKA 4JYYA 2D6PA 5A33A 1YJ9V 4YGCA 3I59A 5CA3A 4XF0A 2K1EA 4GMP1 4KFMA 2JIZG 1R1BA 1VBD2 3NMBA 4GMP0 4QPYA 1QXJA 3CCVV 2ARHA 5K0UB 4YVWA 5IYDO 1YQ5A 3I3EA 5BNPA 4Q6GA 2BDRA 1X8EA 1H1AA 5CA1A 1GOHA 1OI6A 3CNAA 1PIV1 3KF5A 1ASJ1 2YFZA 2ARCA 2I2SA 3NO8A 5L7OC 5BMVB 2ZGOA 5EZYB 3LEMA 2EINB 1SQFA 5BNNB 1H30A 4DV1B 1N32B 3UKNA 4X1KA 4CBCA 4NRPA 1UL9A 2VVEA 4J11A 4XBNA 1RUF1 3OMNB 4OYUA 4ATEA 3D82A 1DF5A 2E76B 2HYXA 4AXOA 2IXHA 4GWMA 3F5TA 5FP9A 4I0WB 1Y66A 1DGSA 3KB5A 5K7PA 3O1RA 1QIQA 1XE8A 3A0BZ 5FY9A 1D2SA 1Z7S2 2XASA 4TN7A 3RYPA 4HVRA 3AG3C 4CDUB 2WLLA 5CN0A 1EFRG 2Q30A 3JB4C 3LEIA 4ASMB 2NP0A 3OGCC 1WCUA 2D3PA 4DR3B 2JG9C 2UXBO 4COUA 4XJ9A 1W8TA 4I30A 2JRIA 4GX0A 3AKQA 2P06A 5EIBC 4LFBB 3AC0A 3U11A 3IIAA 1SZXA 4LF8B 3THPA 3WFVA 3H8UA 4KWUA 4LA2A 1DGRN 3C7HA 4LO4B 2Q0AA 4BH9A 1UFIA 1I0HA 1C8NA 4R7CA 1NU1H 3BA9A 5LXTA 1OFSA 1AJKA 1WJZA 2GHYA 2Y8KA 1OMIA 5FPAA 2Y34A 3ASIA 1EPZA 4XUPA 2XR4A 1FAYA 1OQDA 3BU7A 1GP6A 4AQTA 3FMGA 1Z5VA 5A3PA 4LFAB 2EAAA 4TV9B 2VY0A 3LDRA 4QB1A 4ZHQB 1UZYA 2JGUA 4J9ZB 3K3NA 3RYKA 3RPQA 4D7SA 1OLMA 5HI0A 1O3RA 3ZRWA 4QX0A 5I0SA 2C9AA 3VD9A 2PHWA 5IWFA 1H9PA 2W68A 1WLDA 1O9GA 1N0NA 3TXSA 1FNYA 4YSFA 3OTFA 3RZGA 2CTPA 2ADEA 2QUOA 4UW4A 4BYYA 5ISLA 3TEYA 1YFUA 4IV3A 5KHGA 4DNYA 4A45A 1I08A 1RUE3 4E2SA 4DB5A 3WDYA 2Z69A 2CL2A 2W91A 1H4HA 3LUTB 1E57A 4E9KA 4U7OA 2QKCA 1NTMH 4Q8LA 4N8MA 2XH6A 1GM9A 2C26A 1POV0 3AFKA 5IVEA 1URXA 1JHNA 1N47A 5BY1A 2QQNA 5BNOC 3WG2A 4I0XA 3VKLA 1HR0B 1S76D 1AYN1 3LSEA 3LDDA 2HH9A 3T4ZA 1EZVH 1HV0A 3UGHA 3QH7A 4MVTA 2PUSA 2N7GA 5AC92 2VMHA 2E53A 3K9AA 4UFZA 2R042 4AQSA 4QKBA 3Q4HA 1AR72 1RVF3 5FQ0B 4YVSB 4ZONA 3ABMB 2EIKB 5JVDB 3ZFEC 2FDJA 5GLVA 1JZ5A 2R70A 4PDLA 4SLIA 5LOVB 3M7AA 4JI6B 1HV1A 4J10A 3H3UA 2ZD9A 3WHTA 1K3EA 2B1GA 3CXCU 4QM8A 1W28A 1AL21 4NO4A 1ULPA 4RR3B 2FQPA 2CU5A 1XB9A 3LDBA 2UYAA 3MFCA 1M9NA 3K2OA 3OEHG 3AX4A 1VBA3 2IXIA 5LYJA 1XYOA 2X6AA 3HT1A 2NR5A 2PAKA 4YPJA 3D6EA 2IJHA 4DR4O 3POSA 3USUB 5LBBA 1DF4A 5JI7A 1C1LA 2P4VA 1VQLV 1W8OA 1WCKA 4O4HA 3DYOA 2LW7A 3H1LH 5HFLA 3J7NA 1YXWA 4FPOB 2VMGA 2WKKA 1LEDA 4DV2B 3KQ4B 2E26A 4IIJB 1PIV2 4OI0A 1ASJ2 1RUC1 2PHUA 1XEQA 3X2QC 1LOCA 4Y4RA 3VZOA 4QX3A 3GB7C 5APAA 4LWSA 3TK1A 3ZFFA 2A3XA 1XREA 1AXYA 4N53C 1RFYA 1RUI1 1Y67A 2VD7A 5A6ZA 4B3MO 1FOD1 4DUZB 4GWJA 3N9LA 3OGIB 1MZFA 2PELA 1WMEA 5ITZB 4XFCA 4LQRA 4X8PA 2QTOA 5FZDA 3R6SA 3LIHA 2B9UA 3O1UA 4JYCA 5LB6A 3OBAA 4H0LB 4IE6A 1OSGA 3ACFA 4AL9A 4MGYE 3SDLA 4X62O 1DQ0A 3D0SA 1JFFA 1HIXA 3NSTA 3K75B 4GZ9A 1WLEA 4FP2A 2OUHA 3RZHA 1XL4A 3PVNA 3CQOA 2GNDA 4CH4A 5J98B 2ATKC 4O2AA 2BRTA 1RUG2 2EBOA 3NL1A 2VQAA 2D44A 4BIFA 4NIGA 3THOA 4XTMA 2VZTA 3I59B 1BXHA 2PHTA 3KM5A 1YO8A 2IH1C 1KFUL 4QDQA 2R6QA 1WA8B 2CYFA 3CF6E 1CAVA 1N1TA 4LLOA 5FPOA 4R4XA 4RS5A 3UJQA 4QD2A 2ZGUA 3WQBA 4JPRA 4AE2A 2HWE1 4PA3A 3Q8BA 4Q1PA 4EZHA 5KA5A 2D6OX 1SLLA 2IJKA 5FBZA 4RUEA 4JGZB 2XJVA 4UUJC 3LIGA 3HIFA 1VQNV 3WW3A 5FY7A 3PNAA 1XJAA 2ZGPA 4Q0UA 2W47A 5LRRA 1AJQA 1VQ7V 3T1YB 1OPOA 1TNRA 4XIOA 3SGIA 3FAVA 3GJBA 4GH4A 4NIAA 4QPIB 4X1KB 1K5JA 4W6WA 5FO8B 1ND3A 2YC0A 1JMUB 4LNUB 1BVP1 2ODMA 1GK9A 5LEKA 1ZZBA 4B08A 3KHBA 3RZJA 2HEPA 2XG3A 4QQ2A 5DDJ3 1MSDA 1WB7A 2EICA 3IC9A 2C4XA 2MPFA 2P5BA 4AQ6A 3T1HO 1Q3EA 3DGTA 1M90W 1CN1A 4XUQA 2AACA 3LSDA 2DVAA 4GIQA 2CTQA 1UOJA 5C4WA 1NH2B 1WWYA 3RNSA 4FCAA 1CIYA 3IFXA 1JZ7A 3NQHA 1H4GA 1NTKH 4AFDA 1BBT1 2GNMA 1R081 4OMCA 1J3PA 4AEKA 4QPKA 4QQPA 5B66Z 5I8TA 3E5UA 4O7XA 2A6YA 1XC6A 3GWKC 1ZRDA 1FAFA 3QD6A 4K8RB 5C71A 4X64O 2W1WA 4NE9A 2ZR3A 3O0WA 4LFCB 2P2KA 3SCHA 4LOTA 3USSA 3AG2C 5FYCA 2X7RB 3UKTA 2VNVA 4LXLA 1RUD3 4U3FH 3KCCA 1JZ6A 4AVCA 2ZDIC 4RYDA 3PTYA 5HFMA 1MSWD 4J7ZA 1V55B 4IE7A 2QA4V 1PM4A 1UN1A 1YJKA 3E1F1 1YI2V 1AR63 2KB1A 3PVEA 2BU9A 2DOSA 2WAAA 4CCCA 3WG4A 1IKQA 5DMYA 4YIPA 4CS2A 4XXPA 1H8EG 1FXVA 3ZXDA 4DQAA 4TQFA 5CKMA 1M56C 4D6QA 1H8VA 2Y38A 2ZX1A 3SHRA 3HEIA 2C24A 4F4LA 3I3BA 3ML0A 1W6MB 2A7WA 1LKNA 1ZRFA 1SPPB 4QHOA 3WF1A 2YC4A 2HWB3 4XVHA 4I0XB 1C5IA 3ZO0B 1D7PM 3SPJA 3ACLA 3RBZA 1QVFU 1GWLA 2K9PA 4IEPA 1F9KA 3GHNA 4NXNB 1RUI2 4D0QA 3ORJA 4JI2O 2WJSA 3VBFA 3MIEA 4DUYO 2FMLA 2QM4A 1JODA 3THTA 3C7FA 5J2UA 2GNBA 5IYBO 3MW3A 4QB6A 5FY0A 1X9TA 3O0XA 3I3QA 2CUGA 4UB6Z 1I6XA 4PF1A 5F3GA 4DV0B 4CDWA 4FM0A 3ZM8A 2V72A 3ZHRA 1ODNA 2IH3C 4Q5OA 4N23A 4QAWA 2VWKA 1I94B 3NAPC 4JF3A 5L7OB 1V0AA 3KSCA 4CP2A 1B06A 1J95A 1RUH3 1G7YA 3AVSA 4ZIBA 4R9AA 1ZVFA 1EPWA 1EUUA 4PA9A 5FYTA 1QR9A 3WDUA 3JSNA 4ORFA 2VVFA 3WB0A 1FXKA 2PHFA 3O65A 3U75A 3CCRV 1SA0B 4GB32 1VBE2 4NRMA 4DR2B 1JW6A 3NJYA 4EWEA 4D6RA 4CDQC 4HN0A 1C1FA 1S0VA 4I55A 2V73A 3AXEA 5LA2A 1VR3A 5CG9A 2K0GA 4JYAO 3MLKA 4P9XA 1PVC3 4MTOA 2BTQA 3AMMA 2Y48A 2HR3A 5BYNA 1QOOA 3LCPA 1UJWB 2JG9B 4NTXA 1QQCA 1U97A 1GP5A 4HPKA 2XBO3 1LCLA 4X20A 3TN93 2GTAA 2E7QA 4IEZA 4IE4A 1NA1C 3BB6A 3JU9A 4DOUA 3K57A 2CGPA 2ZGKA 5H6QA 1VQ6V 3AMHA 3AZXA 2CNAA 3LZZA 4YGBA 1JS9A 3W7TA 1OVSA 5KHJA 2R7EB 4LHKA 5EC1C 4MVSA 4EWAA 2WFF2 1TGOA 1G9CA 3FHQA 4CP9A 3OUHA 4YIOA 4XQDA 4OPAA 5CFCA 3K04A 3WDVA 1V9PA 5JXHA 1AR1B 4B3TB 3SEEA 3T1MA 4N9IA 1XMQB 5CIRA 3LNMB 1UOFA 2XDVA 5JAXA 2G4IA 5FPUA 2IC1A 1J84A 4A2UA 4LBQD 2ZIMA 3OMIB 1A34A 5T5PA 3CMEV 3TRSB 1UYPA 5GZFA 1DCSA 1E79G 1W9WA 5GJ6A 4YW7A 5JXJA 4LBLA 2W6JG 4WFEA 2HBUA 1BBT2 4LR4A 2Y6LA 1ZA7A 4A7ZA 4OZOA 1H8TA 3RZZA 2BOBC 1XHXA 3WP6A 4ICGA 1W6QA 1YXBA 4D6TH 3K06A 1YNAA 2XLAA 1MS4A 3B3QE 4JTDB 1YIJV 5EBLC 2YY1A 1GWKA 3O0VA 5CEHA 3IMNA 2PLV1 4Y20A 1UD1A 5E1RA 2DYRC 2HEYF 2QQIA 3E5QA 1BQPA 3ETEA 4QX1A 5F5IA 2OW4A 3ZN4A 4ZU4A 2YB7A 3I2KA 2W3JA 3M3QA 4R9BA 1RUJ1 4XDPA 3CZUA 2QWPB 2OUJA 3Q8AA 1PKXA 1DLLA 1DQ4A 2RDNA 1HDKA 3ABZA 3D3QA 5L9VA 1QHDA 1CAUB 3T08A 3ZFEB 1I5ZA 1SFYA 3FC0A 3RN4A 1W05A 1WW4A 5FZ4A 1FT9A 4F8AA 4LCUC 4JGYA 4BM8A 3RYIB 1W04A 4K0KO 4FI9A 2ZAHA 5F37A 3POEA 1GRJA 4AI8A 3D3AA 3M7MX 3ZN0A 2WN2A 2Q1FA 5IE9A 4QX8A 1DF0A 2JD9A 1ND3B 3DF0A 4LO5B 4NRQA 3S3WA 5AG2A 4K1YA 3FFQA 4M3CE 2KXLA 5EP9A 4FZ0A 2PYJA 3NWKA 3FLTA 2JG8A 4FZ1A 2XONA 3LSSA 3ZHUA 4JI6O 4CTEA 3WG1A 2HJIA 5L3EA 1PP9H 3C3SA 5C8CA 3TJTA 4FFBB 3ZXGA 1EN4A 1NT2B 2ADPA 1F51A 2D5HA 3BIEA 3AJYA 5I8YA 1BHAA 4Q0PA 1KXGA 1ZLZA 3SMHA 4G4FA 1WA6X 3H7YA 4MSVA 3ETDA 5FJHA 1BS3A 2ZGTA 3ZXLA 1JCHA 1C8M3 5IJ9B 1FJGB 2E3CA 4QKDA 2XLGA 3X2QB 3RDIA 3APQA 5DG2A 2ILMA 5ACA3 1WGPA 5LMNB 3PUIA 3AP9A 1GOFA 3PN1A 4NKGB 3JSLA 4COVA 4N53B 5L73A 2GP3A 4FOYA 4IEYA 1SLIA 1TQ5A 3CHXA 4I50A 4DV2O 3SKJE 2WYSA 1B09A 1JX9A 1W0KG 4QE9A 4WM7A 1BEV1 5EWSA 3NV4A 4BU2A 3SITA 1SC5B 1CAWB 5KBFA 1MR5A 3B9CA 3JUUA 3AK1A 1VBD3 4QX2A 2VMIA 1QBZA 2Q6AA 3VL9A 5LP6A 1IXBA 3RT3C 2IFRA 4B4QA 1O3QA 3FUQA 4XEZA 3SH3A 2Y6JA 1YHFA 3PIJA 4DUZO 1CONA 4LBOA 1OA2A 4QGNA 1VF6C 4HNAB 2CGNA 1OC1A 3TWIA 5LGUA 1HKDA 2R073 2E31A 4FPCA 4M3CB 3KCXA 4JHZA 2J1VA 2UXCB 3OUJA 3LQCA 1P4RA 4B3NA 4CXYA 3ZMZA 4LORA 1Z2GA 2JK5C 1WBFA 1CEZA 2JEUA 3FX7A 3OD0A 4XUNA 1W0NA 2WO1A 5JSPA 4TWKA 4DV7O 3A8TA 2JS5A 1VARA 1QJY1 4BMBA 4BQWA 1JYIA 1UKGA 3OUIA 5T5LA 2J7MA 2ZGMA 3VBFB 1NQDA 4DIQA 5JWPA 1KKCA 1V54C 4X1YB 5EQUA 3URFA 2QQJA 3HBZA 4AFAA 1N1YA 1DLCA 3HQUA 4P9GA 3VBUA 4F6RA 3ZMUA 1Z7S3 3MEPA 3AEIA 1NBMG 3ABUA 5C3PA 3FB8C 3R65A 4X9QA 4CCKA 2GH2A 3ZR6A 2RS31 2ZE7A 2XL9A 4LF4B 4WV8A 2ZNIA 3GZUC 3R4DB 1TA8A 2VGDA 4AVVA 2HJFC 4H14A 3T2OA 1DQ5A 1NCQC 2WSVA 4O9EA 5FPRA 1SEFA 3MPBA 4XHXA 1SFNA 1UX7A 5FZMA 5FRAA 4JX0A 3AKRA 3GBGA 1ZWIC 5FMOS 1MS8A 1KYOF 2QCSB 4HSJA 3I7DA 2JE7A 4F3JA 1GN3A 2WWJA 5FWJA 1C57A 3IDCB 5KHHA 3CD6V 3PIGA 5A1AA 5J36A 1OA3A 4AVBA 2D5FA 1VRBA 5A3LA 1DGWX 1RUJ2 2OTLV 1V9U3 1D2QA 1S0DA 1GTOA 4Y22B 3JCUZ 3WNXA 5IAXA 1UOGA 3UK9A 5KHIA 4FPLA 3H9VA 4MG2A 4NHXA 1LNQA 4Z82A 4UFMA 2HYKA 3AG7A 3CC7V 4MXVA 4IL6Z 1VBC1 3CMAV 3NNJA 1NLSA 2VL4A 4GT1A 2J1TA 2LS6A 4PLMA 4X65B 1OHFA 3L75H 4XCBA 2W92A 2VZOA 4A4AA 3MV11 3JAWA 2WT0A 2QQKA 4UXAA 2UUCB 5DAQA 4R6ZA 4RD7A 3JAKB 2V7QG 4X8NA 3O5SA 4FFIA 4E4ZA 3AG2B 1S72V 4AG4A 2UY9A 4GH4C 2VQEO 1HWYA 2E6VA 2F4PA 4AHXA 2V4AA 1SQPH 4L87A 2M6YA 3MF6A 3HNBM 5FYHA 1WP8A 4PDRA 2XKPA 5GLWA 4M4PA 3N4MA 5C3RA 1OCRC 4DUXA 5AC93 2ATFA 2R043 5B1BC 1M57C 5CNAA 1AR73 1LODA 1W0JG 4LFCO 4NB5A 3M3IA 4XF4A 2HKOA 2IWGB 1MG1A 4JAAA 1FS0G 1GBGA 5FP4A 3WU2Z 4LF5O 2WAMA 3JD71 4B7KA 3HNYM 2RS51 2FDHA 4LO6B 4MTGA 5CA0A 3KV6A 4PDVA 3FHIB 4X89A 1EAH1 2EXKA 5CISA 5FL7G 2GC1A 3KF3A 4HZ3A 5C9AA 4NOTA 3E6DA 4QKNA 4I9WA 2AEYA 2NYYA 4XFFA 1QKQA 2A3YA 2WN3A 4ATFA 1W3VA 1S1AA 4H55A 1DYPA 4XBQA 4E4SA 1ENSA 4Z8BA 2DCZA 1XNKA 2X6CA 5IJ0B 1H8HG 2HHHB 2X5IC 1XI1A 2EIGA 1BEV2 4WVVA 4UWDA 1GNHA 1K5MC 2XHNA 4DXTA 4BOWA 3N9QA 2WLNA 2YIBD 1PO21 1OOPC 3RS6A 5CBGA 4COZA 2MW2B 4MVUA 2WIIB 4NXNO 2XGXA 4MW3A 2CTWA 2WRAA 4Q4X2 1PIV3 2AREA 3UJOA 5FPBA 1ASJ3 3L9JT 3IPVB 4G27B 3C8XA 3C90A 5AVPA 4NPRA 1HX6A 2PFWA 4RQFA 3G6BA 4XDJA 1Q8PA 1PNMA 2W1UA 1US6A 2WWSA 4A6OA 3LEKA 5EK0A 2JG8B 4PIYA 4CP1A 1QJY2 2X0LA 2JECA 4XJWA 4TV8B 1UPSA 4DR6O 4QWNA 2IFWA 5FMCA 4D94A 1K7DA 4OHZA 2ARAA 1I94O 3E6CC 4QMAA 2WZ8A 3OGJA 3RI9A 2Q8DA 1DQ1A 4MXWA 3ZPYA 4GALA 4NVPA 3V65A 1NAEA 2AZ5A 3ZKUA 4JI7O 1SZBA 2UY8A 1Q81W 5F32A 4MGIE 2A9HA 1YVWA 2ZGQA 4LH7A 3SJBC 4BQ1A 4JI4B 2RS32 1NA1B 3KT7A 3MLLA 2JDHA 4ZPIA 2WLPA 2BVBA 3WINE 3LWCA 1Q5OA 4HN1A 3WHUA 5HCBA 3K4AA 4XJZA 3EJKA 1W6OB 5CVRA 3T2TA 4WM8A 1AI7A 3JALA 1J58A 3CMGA 2PZSA 3JQWA 4XETA 3OYWA 5DZEA 1RUG3 5BNQA 4IHJB 2JGDA 4ZS3A 3FE5A 4YZ2A 1WZXA 1DGLA 1F35A 4IEOA 3STZC 2E5LB 3DTUB 1FXKC 5J2TA 1AR81 3OAAG 4JI1O 3MUZ1 3B94A 3AM2A 5LGNA 1O4YA 5LP6B 2VTXA 3WCRA 4FSJA 1LR5A 2YXLA 5A6QA 1R1A1 1F23A 1JU4A 2J1SA 3PVBB 4JZ2A 3K59A 1EV11 2OVUA 1CZSA 1XNRB 1OCOC 1VBC2 4HZFA 4O2BA 3VDBA 4LBJA 1XMQO 4GKJO 2RN9A 3LD8A 1BSMA 4DPNA 2TBVA 4MYEA 2D6LX 3E89A 1JYNA 2W52A 5I0RA 3B2EE 4JASA 1O3SA 3AG4C 5JZGC 2DYRB 3BAAA 1MS9A 5DM6V 1Q6HA 1U5YA 4IQPA 3QACA 4I4TB 4CUBA 4LF6O 3I2DA 2ZABA 1F4HA 5FK8A 1FYUA 1AYN3 3VBUB 1L0NH 5CFCC 5FMBA 2DVFA 2PAMA 4NTYA 4XIKA 4P9IA 4LUMA 2YIAA 1VIBA 3MFAA 3OBZA 5ABJA 3JD4A 1R091 2SBAA 1GKBA 2FBEA 1QJFA 3ZR5A 4LT5A 3IN9A 4D69A 4GKKO 4YM0A 2BSKB 4FIPC 5FZHA 3FLPA 4DV4B 1DFQA 3NNGA 1K5SA 3OBTA 3ZEDA 5FIXA 2RS52 3ABKC 2H0BA 2EIEA 2GC2A 1YUDA 4PJ0Z 1U5IA 3B7MA 1T6GC 4DEQA 5A3UA 1EAH2 2GZWA 1LHNA 1RXGA 4R9DA 2Q8CA 1Y3TA 3NNFA 2HJDA 4WBBA 4QX7A 5H6RA 1PZ9A 1AR4A 5A7QA 3I2OA 2JKBA 1R6KA 4I01A 2JB4A 1OVPA 4ZU7A 1RJ8A 3E86A 5GZDA 2DUQA 4CPBD 5IK8A 2X6BA 2CH7B 3DPRC 2TNFA 3T30A 2EULA 2CDYA 5FYYA 3BI3A 4PI2A 3LDCA 5GALA 1L1FA 1G4YB 3AJZA 1UZVA 3WNLA 2VOTA 3ILRA 3OTOO 3VLBB 1R6TA 3ZDSA 2G1MA 4UCVA 3CCEV 4CEYA 3NXSA 3T2PA 5A6XA 1VAVA 5GZGA 3JAWB 1Y74A 3SPCA 4O65A 5LHHA 4YZ3A 2BW8A 3WUDA 1SCRA 2UXDB 1PGSA 4CEWC 2WQZC 3DC6A 2WWWA 2A75A 3HB3B 3D0JA 4CU9A 4C7UA 1YJLA 1NQJA 1YTFB 3K48A 2E7AA 3I2JA 1CX4A 4AHZA 4CA9A 4DO0A 4EROA 1RMU1 1GH6A 1RUI3 2JEMA 3ATGA 1FOD3 3H1WA 1G6UA 4L99A 3K5OA 2VOWA 3U14A 5LMNO 1JOJA 5JMCA 5C8CC 3WW4A 5DZGA 4DY5A 1LHWA 3ZHQA 4CUAA 3M8LA 3FB5C 3V0AB 2PHLA 4XQ4A 1S5LZ 3CP1A 4ZOLB 1W39A 3BUCA 3SJQC 4DYLA 2W2IA 3THCA 5C9AB 2ZNJA 4NPLA 1NYWA 1NOVA 1Q8QA 2BGPA 4RSUA 3SYCA 3UETA 1VMHA 1XUQA 3IMMA 1UPGA 5C3QA 2HEWF 1UXZA 2ZAAA 4FO9A 2Z79A 1V54B 2P67A 5JR2A 4GB33 5BR8B 1VBE3 1NCRB 1JJ2U 4EEQA 1YC61 4FLWA 2AR6A 4H2AA 2RCVA 5DN2A 2UXCO 2JDAA 1AR82 3TETA 4R52A 4A7YA 1JUIA 4LUKA 2G9ZA 2F4LA 4HETA 3CJXA 1R1A2 3DXTA 1EV12 1KGYA 2WA4A 3KZIZ 4QXBA 1NCQB 1ZZ9A 2GDFA 3BIWE 2LQTA 2LM3A 2KG7A 1JOYA 1UY3A 2ENRA 1PD3A 5FY5A 4L11A 4CCJA 2RJKA 3W5MA 2Q9LA 1Y9QA 2ZCEA 3HWJA 3VKOA 4Z2WA 3CWBH 3W7UA 2WFF3 1NI8A 4XURA 2VOXA 2Z0AA 1COV1 3OEEG 3JXSA 2RMU1 2BTOA 1UW8A 3HMYA 3K9SA 2Y60A 4XAEA 2CAVA 3S5AA 2XAJA 4NXMO 2EF6A 1WKYA 4NHKA 1QCEA 3ALQA 4HT1T 4PDWC 5A3MA 2CE4A 4LO8A 3VN4A 5JH7A 3R05A 4ZY9A 3OB8A 1WLWA 1EN5A 3E22A 2WSSG 1PO11 2ITDC 4QJFB 1BBT3 1QLEB 1R083 1QNMA 3VBSA 4DS0A 4AW7A 1VQ9V 5T54A 2A70A 1NLRA 2XJPA 2K9ZA 4L8JA 3N2KA 3AZYA 1JZ8A 2VUAA 3JALB 2QJVA 3FWEA 3MHZA 3GWOA 2VCMA 2ET1A 1LGNA 5GTIZ 5IY5B 2VUCA 1PMJX 4HLTA 1C3HA 1G86A 3WR0A 4AGVA 3WSOA 1RM1B 4RUFA 4ES9A 4ARYA 2X8KA 3MW2A 2IU3A 1S0JA 2WA3A 3BTAA 4Z92B 3VKMA 5J2TB 1V6NA 4QU1A 1OCRB 1HXS1 1SS3A 2QWNB 3PURA 4BHPA 3BTXA 1FKAO 1US3A 1M57B 4J25A 1O9HA 3CCUV 1YIFA 4OFGA 5E88A 4FPYA 1W2BU 2QKAA 4QNHB 4DXZA 1J5EO 2C6SA 4XBLA 1GOGA 3MV01 1A32A 1FATA 1ZM1A 1AROP 3EBRA 2BYVE 1UXXX 4EN8B 4AK3A 3VKFC 1R3LC 3OFNG 4H7MA 1GM7A 3AZWA 2X09A 2VJXA 2CAZC 3IZOA 1AL0G 1COWG 3BABA 2VQUA 1PX4A 2E32A 3U78A 4UYBA 5JIUA 2D98A 4UFHA 1ND2C 1DIWA 1IQDC 3BCWA 1SQVH 5FPLA 1WCDJ 1BQZA 4FTBA 5FZFA 4DV6O 2QQVA 5FYZA 4Q26A 4K21A 5EIYB 1LOGA 2X5IB 3QLQA 3OEAA 2PHXA 4EQVA 2JEXA 3B77A 1K5MB 1GN6A 4KWKA 4OUSA 2NN8A 1ZRRA 2Q0OC 1OBNA 5ABJB 2DJVA 2WZR2 2AENA 1SBDA 1VB2A 5KLVH 2FDIA 4JTNA 3MF9A 3DL3A 1UZZA 4QB2A 4AEDC 5AFEA 1K34A 1K8AW 1J83A 4OPHA 2W39A 1P7GA 1E5SA 1W0OA 5IT6A 1RHI1 3CC2V 3P3NA 2I45A 1CX1A 1E5RA 4OLLA 3ZRSA 1ULDA 1NQTA 1AYM1 1UYXA 2G38A 4OX9O 4W4LA 5I91A 4LMFA 4CVUA 5D5PA 1M5IA 4IDZA 3AMPA 3JQXA 4FPPA 1AXKA 4IYHA 4J1WA 2UYBA 1KC8W 1AR62 4UFIA 4TLGA 1O7FA 3DEMA 3IT8A 4I3GA 1OCZC 1TVKA 4NHLA 2VMDA 5K0UA 1LHOA 4UI9L 5JPNB 4DR4B 2YU1A 2DURA 1XE7A 5GLTA 1G8MA 1FD9A 1RP3B 2W0XA 1JYVA 4C1XA 5EYPA 3QO7A 5BMVA 2WO7A 5EZYA 2QZ3A 4UBHA 3STLC 5BNNA 4EYUA 1POQA 1LU1A 2HBTA 1OUXA 3BU0A 4L92A 4XZPA 3ENRA 4ZI7B 5DABA 4FXGB 2CTRA 5JSRA 2YDEA 2VCAA 4N43C 1L8DA 5CFDC 1HNWB 1H2GA 1DG6A 2VPVA 5ANNA 4PA6A 1Y7BA 1LOFA 5LK7B 5JXIA 4TLFA 4PLOA 3H3ZA 3B02A 1SKVA 3POFA 4A41A 4E4EA 1OKOA 2VBPA 4JI4O 2W46A 4HKOA 3N7MA 1AX2A 5JUVA 3O1TA 1XU1A 5JOXA 3ZYPA 3B93A 2EILB 3MIHA 2B4KA 1RUH2 2UU9O 2Y33A 1R3JC 1S2EA 4W65A 1OCOB 3Q9OA 1PO12 4BQ4A 2A0LA 4X66B 4DXRA 4ZBMA 3NJZA 4DZGA 1ZBE2 4DR1O 2PTMA 3K79A 2E5LO 1P84F 4L8QA 4XABA 4AHYA 5ERLA 3JCIA 4BQ5A 2ZGRA 3R66A 1S0GA 3W7WA 5E6HA 3AG4B 5GTHZ 4XZUG 4ZHQA 3M3OA 4AI3A 1JYCA 2Y6KA 4IEVA 3HT2A 3KG2A 2PLV3 3DV8A 3M4FA 5C8YB 3V56A 4EB6B 4E2LA 2WLIA 4YGDA 2LGQA 3ZKYA 1V6LA 4UW3A 2Q4SA 2QM7A 3KS7A 3OPZA 2WLMA 2NN4A 5HBAA 1RUJ3 2E75B 4HL0A 3I8TA 1B35C 3ZCCA 1CPMA 4CZSA 2OQ6A 3ZRXA 2GTSA 4MS2A 2F23A 4BWOA 2FCUA 3GCWA 4E2QA 3VQVA 4RO2A 5FK7A 5CB4A 3LPGA 2WFPA 1VALA 2BNOA 2Y26A 3M2MA 1IDSA 3CKHA 1MACA 4J80A 4KXRA 4YJ3A 1A6CA 3E8BA 2XL7A 3K4DA 3ZXKA 1XYPA 4FLVA 1IS5A 4IESA 1QNYA 4MX3A 4XF1A 1TUBB 2DWDC 3E8GA 2IJIA 1AI6A 2LRPA 2N74A 4KU7A 1PGW1 2GAUA 4LOSA 1CD3G 4YG6A 4RL7A 3OJBA 2YGLA 3KV4A 5FZBA 2NMNA 5FQ0A 1CZVA 5JVDA 3I5DA 1WP7A 4DK1A 3DPRB 3N3HA 3OGGA 3WNMA 2D43A 4FTEA 1Q43A 1WNSA 4YM2A 3EB7A 1CESA 3LOBA 4AQYB 1OD3A 5LOVA 4CU7A 4YY3B 1IURA 1AHSA 1J1TA 4UCOA 3CO2A 3HKEB 2VWJA 5FOBB 1JPXA 2TUNA 5E8AA 4XDKA 4COWA 3GJAA 1RUE1 1PZ8A 2WR9A 3RZMA 1EYBA 2G9FA 4GULA 2OPKA 2PI4A 4RQPA 1NJIW 2VW2A 4RR3A 4YW3A 3RVHA 3S7IA 3N7LA 5D1IA 4YW6A 2Z5UA 3CRMA 4CDXB 4YYOA 1S0FA 2YBPA 4ASKA 1YRZA 1MMMA 4FQZA 1O8PA 1MQTB 1W6NB 4X64B 4QPGC 1T6BX 2ZXWC 2JENA 3HD8B 5IYZA 3USUA 2XAFA 1N3QA 1QQP1 1UQXA 1HRI1 1BK1A 4HMZA 1I5XA 3BKZA 2UUAB 1Y4MA 1HDJA 4AFCA 1M4WA 2WNVC 5KXBA 3ZMVA 5GZCA 4JV5O 2DCKA 1BEV3 2BWCA 4IIJA 3VBOC 1K5QA 1D4M1 2IXCA 3SPHA 3W58A 2LFRA 4HXCA 4IXLA 1UIJA 5FZAA 4CCNA 5LY1A 2OYQA 3OGVA 1ZREA 5GONB 2WS91 3H0OA 3AYDA 3HPNA 4K8ZA 5IFTA 4BMEA 5LASA 1IS4A 3SH4A 1XNCA 1V70A 4Q4X3 3DSQA 1DZRA 3KKYA 3ZFGA 4CC5A 3IDAA 2FZ1A 4BR6A 3V64A 2UXNA 3MICA 5ITZA 4Q4V1 4W6XA 2LJ2A 4Q1RA 1JU3A 1AJNA 2H94A 1GNYA 2WQ4A 1K33A 1XNDA 1QJY3 4BQ3A 3ZXFA 3RYRA 4QGMA 5C33A 1IG0A 2Y69C 4PF5A 3VBHA 3ZBHA 3D36C 5C3OA 3RVZA 1W8NA 3LDEA 5M0TA 4MADA 1GNZA 2JIJA 3C7GA 4AVSA 4FPEA 4PBOA 3T3YA 3IAQA 3F7YC 2JDNA 4QQLA 4MT8A 5KAFZ 2RS33 2UWCA 4Q0QA 1GP4A 5BR8O 2BJSA 4K8XA 2XT9A 2JDPA 4I0BA 2EAKA 2L9LA 4IV1A 3VD4A 4KWJA 2ZEXA 2X05A 3IWZA 4CXXA 1IG3A 1DHKB 1DTOA 4A7KA 4LHLA 3L73H 5A70A 1WA8A 4DW1A 4LEJA 1S77D 1TVKB 1F4NA 2JJ2G 4NJ4A 2A6VA 1SLBA 1HNZB 4N7IA 2F1MA 5EYXA 4F6EA 3NV3A 4MGSA 4PDWB 1I1EA 3HN3A 1D5NA 3MHSC 4P30A 3KV9A 2CDPA 2R072 2ZMNA 5IVVA 1FFXB 4JGZA 5EYPB 4GYCB 2DVGA 5FLXN 4JYAB 4AEJA 3PU8A 1R1ZA 3J7MA 4UFKA 4HANA 5FNVA 1S55A 4JDNA 1F5FA 1HN1A 4QPIA 1I9RA 4B1MA 1FPN2 2YPJA 1DDLA 3FBMA 3DCQA 1VF7A 4CZZA 3ECQA 4ASLA 3K77A 5LW9A 4ZXKA 1VBC3 1O8SA 4K35A 4LNUA 4AZZA 5BUVA 3ZXAC 3K58A 1Z78A 4MGKE 2ZEZA 3JARA 2HWF1 4Q4W1 3FD9A 1SFPA 4ZKIA 5JJNB 4JTCB 2ZMLA 2YROA 3ZHVA 2HWC1 5EBWC 1NX9A 4O4JB 2LW1A 1PK6C 2VQ0A 4CPBA 3H8OA 4P02B 2YBKA 3EFFK 1KD1W 2HWD2 2OYZA 5TISZ 2ETNA 2AGSA 2OS2A 1ZUQA 3O1SA 2M7WA 4MV2A 2W87A 3OUFA 4FOQA 2VH9A 3A23A 5B4NA 3CJIC 1N4CA 4R50A 3K46A 3SC7X 4Y1UA 1SBFA 1X36A 3CLPA 1VBB1 2B7YA 2R0HA 1PNFA 3CX5F 1MOFA 2P6CA 1UU4A 4BQYA 5A3WA 3VBRC 1ZZ6A 2BE3A 3ZX7A 1K97A 2CAUA 4XFIA 1ACCA 3LPFA 4MTXA 3H9AA 1NXMA 2RS53 1RUNA 2FCVA 5FR3A 5F39A 3VUOA 1W9YA 1V9U2 3WDWA 3ASNC 3JAMN 2B5HA 5DDJ1 2YIDA 1XMOB 3ZS8C 1PL0A 1ND2B 3W59A 1EAH3 1FNZA 3RYFB 4BIZA 2PHRA 2VECA 2YEVB 5DXDA 4META 4K7JA 1YLLA 2WLIB 2VULA 1VJ2A 4CU8A 2PF4E 1WBLA 4M00A 1OH3A 1TVGA 4JQRA 4FFGA 2J1RA 1VRH2 4HK8A 1O59A 1IPJA 2F95B 3OMAB 4QXCA 1STMA 1ULCA 3P3PA 5A32B 3DXRB 3H1YA 2XAGA 2E33A 5CB4B 3OG2A 5C8WA 1D4M2 3R0RA 2WDBA 3CU7A 4AEDB 1H1MA 1POV1 2NLRA 1W6MA 4YJ3B 5FREA 2WS92 3VD3A 1SPPA 4QM9A 4XE9A 4K0KB 4FM1A 4I0AA 5LL6Y 1FV2A 2DYSB 5IVCA 4PCRA 2VMEA 2O57A 3UESA 4HSLA 3HKCA 1CWPA 1RUD1 1IBLO 4LK7A 2W08A 4P00B 2YFUA 1P8JA 3POWA 3QCWA 4XJ8A 3AP7A 2WT2A 5FV3A 2AXTZ 4Q4V2 3WW1A 3I3MA 1OCZB 4ZU5A 5FYVA 5L3CA 5DUWA 2YGMA 2BBVA 2XJUA 3UT5B 1TMF2 4UW6A 5FP3A 2DTWA 1MPXA 1DQ6A 1UPIA 2D6MA 3WY6A 5IJRA 2V1DA 2PQSA 4JAUA 4UAPA 5L7OA 4R8CA 1KP3A 3T4DA 5BZBA 2DWEC 5I8SA 3CS5A 4RQPB 2YYOA 3JBG2 1YWKA 3ZN6B 2OKXA 1UO9A 3I49A 2WNUC 4N43B 4X6QB 5IVYA 5CFDB 4WFAV 2HEVF 1HQNA 3O14A 4JI0O 3BTYA 4GLXA 1SA0A 5IYZB 2RDSA 3TNQA 5LY2A 2VOKA 4LIUA 3P6BA 2VE1A 2BV4A 1RB8G 2IM9A 5A3OA 3ZSMA 4UVBA 3UQ8A 1IS6A 3RYCB 3K03A 3GGLA 2HG5C 1M06G 2P3KA 2JG9A 4FPKA 4Q4Y1 1UCXA 2ZX4A 1ZZ7A 2BPA2 2W9XA 2WUHA 2BFUL 1HNWO 3POGA 5D8AB 5K0UC 2J22A 1AR83 1JZ4A 4FPHA 1RIRA 2QWQB 4U3JB 3AP4A 3G71V 4KWLA 3AXDA 3A2FA 4S2FA 4JRAA 4GWIA 2ZIOA 2GP5A 1R1A3 4QU2A 1EV13 3PUSA 1RUF2 2CHHA 3W7XA 2H8PC 3W21A 1BHGA 4RHV1 1ZX3A 5DN6G 5K1XA 4DMIA 3ZFGB 2P34A 2JX9A 5JCOC 1OKQA 4FPJA 3L70H 4GWNA 4AHWA 2HWF2 4BW9A 2GC3A 1P7BA 1MS0A 5FXXA 4OVEA 2IBZH 3U4SA 1AX1A 2HWC2 2KKWA 5J3UA 2DQ3A 2NZ9A 1LOFC 4X66O 4DV7B 2HVJC 3VBHB 4DRXA 3T2QA 4YARA 5K9YA 4LKFA 3FX3A 3JD3A 3AZVA 4CDUC 3DYPA 5LHGA 4FM2A 4BJ0A 3RW0A 2IVJA 5F1RA 1HN0A 3TYJA 3TN91 2OX0A 4BA6A 2RNBA 5FFOC 1KP2A 1VBB2 2PQQA 5JR7B 4MH0E 1ZA4A 4LHSA 3DN7A 3Q8CA 3G80A 5HCHA 1OA4A 3LKJA 2A3WA 4B3RO 5BNOA 3VDDC 4NIHA 2P1BA 3POIA 4IV1B 3S7EA 1DZTA 4UB8Z 1S2KA 1KQSU 2A6XA 3K08A 1CAXA 1WW6A 3M1HA 1S4CA 1YDXA 3AFGA 2PY5A 4EJRA 3ACHA 4FFKA 1N34O 1IPSA 3U1XA 2MK3A 1JBCA 4U2AA 1CAUA 4XAAA 3ZFEA 4E2GA 2OCCC 1L7RA 1W0PA 3AZZA 1GMGA 4HVOA 4J1XA 3PU3A 4IEXA 3RYIA 2G19A 2AZ2A 4JKMA 5FNVB 1ALYA 4OHWA 3RMYA 2BUKA 3FYEB 5FAXA 1ZSPA 4YFZA 4FAHA 5F6LB 3CCJV 5JOWA 4FVVA 5HXMA 2IXJA 4DEVA 3PDQA 2W1SA 1AX0A 3JARB 2ZACA 2ZGLA 4MHUA 1QMJA 3VD7A 5CBFA 5A9GA 1AYN2 1J1LA 2YS8A 4AQYO 2ZXWB 4YY3O 1K4CC 2F17A 3HR0A 3FJSA 1BT8A 3BVOA 4FFBA 2GUZB 5FY8A 2VZUA 3WQ1A 2VQEB 3OM3B 3PVOA 1FX5A 1OURA 2UURA 4R9CA 3ETQA 1Q6UA 4YVSC 1IX9A 1I3HA 2VM9A 3QBQA 3VBOB 2EIKC 2NNUA 4NN0A 3WG7C 5IJ9A 2WZR3 3SYAA 1AL22 5DPNA 3KV5A 4QHZA 4NIDA 1H6YA 2D40A 4UF0A 3J7LA 3CYOA 4ZS2A 2UUAO 5J48A 4LF5B 5HXVA 5C7GA 1DGWA 1MZ5A 4N53A 5JQGA 5FP8A 3SR2C 1V6MA 1OD5A 2FD8A 3RYHB 2XJTA 1QGLA 2EA7A 3AYAA 2BOJA 5IW0A 1GKFA 5IDJA 3VDCA 5JCTA 4G2KA 3M99B 2WYFA 3ZYIB 1CAWA 2Y69B 1FV3A 4B29A 1ZBA1 2QR4A 4FK5C 1YFWA 2W1QA 4MSWC 2QTSA 4Q4Y2 2YI9A 2VXRA 3Q8FA 4IUGA 4XJAA 2RJ2A 1FFTB 3CCLV 1RUC2 5HCFA 2B5UA 2MHFA 1H2LA 4HNAA 3H8RA 3ZSKA 3WF4A 4DFSA 3UT0A 4M3CA 4OI1A 2WZEA 1SZTA 2WABA 2KA3A 2YXYA 2UXXA 2JE9A 5LHIA 1XE0A 2ORXA 4TSFG 4J41A 1KDKA 2VTFA 3I56V 4RHV2 4YHHO 3HKCB 5E89A 1FOD2 3VQXA 2GMEA 2YUAA 4FFFA 4XILA 4X1YA 2F66C 4H13B 1ROPA 3KMHA 3LA7A 5LA9A 1N3OA 1YIPA 2X29A 1BKZA 2VZRA 1COV3 2FTKA 4H44B 5E79Z 1Q7YW 4JDOA 1K42A 1VBD1 3FN9A 1MA1A 4DR6B 4DV5B 4C90A 4B7EA 1JN2P 1S0CA 3GDBA 4HAMA 4LTAA 2VZPA 1SMVA 1TZOA 4LE3A 4C91A 4P08A 1MS3A 5KWRA 5HPOA 2QDNA 1CIWA 4EV0A 3RZLA 4JI7B 1Q8OA 1PO13 3QVNA 5C6CA 1HNZO 2XPJA 4QX5A 1GAXA 5GLZA 1RXFA 1PPJH 4IGOA 2J42A 1N3PA 5T50A 5AVAA 1ZBE3 4AI2A 2Y6GA 1Q8IA 5FZEA 2BTVC 1W3XA 2RDQA 2R1BA 3PLQA 5F6KA 5KUKA 5FUIA 3AG3B 4QE7A 3BFRA 1OH4A 2AHYA 4WVZA 2P5OA 4Y22A 3EO6A 5ANQA 3I2GA 4QGPA 3ETPA 5EFUA 1JTZX 2HWE2 3LSUA 4GAZA 2VUDA 2GMMA 1QY4A 2QE3A 4MO3M 1HRV1 1XXNA 3E8FA 3CJIB 2P90A 1Q82W 4YVWC 5BNPC 4UOJA 1D0HA 2P4KA 2FYUH 3DGEA 1LGBA 1GLHA 4YW1A 1O91A 3N9NA 4JI1B 5A1LA 2OTJV 3TB0A 3VHPA 1SESA 1KU9A 4EN7B 1ENQA 3VBRB 5EPAA 1F4AA 2JVDA 1ZTEA 4CSWA 2R72A 1XOUA 3JAKA 1G1XB 4AWDA 3VZJA 3ZMNA 2QQPA 1QR8A 5EJZB 4XACA 3RRDA 4QPIC 5DZFA 4GKJB 5J9PC 3GBWA 4NAMA 2EVXA 1FXHA 3J8F1 4DR5B 2Z42A 5IVJA 3QNEA 1S2BA 1CXZB 4Y24A 2RM21 2ZDIA 5GM0A 4Y5SA 1L3JA 4O4IB 4XW3A 2CDOA 3ES1A 3F2ZA 1OQ1A 4DRXB 3S5QA 5CA6A 5B1NA 5FWEA 1GYKA 3H1IH 1OJHA 2ZE6A 2HP8A 5IWAO 3T0AA 4DUWA 1BE3H 3HKDA 1R082 4LF6B 2DFCA 3J4UH 3A4UA 3BODA 3O7OA 1WW7A 4H37A 4S2DA 4FLUA 2OT7A 2L35A 2VNOA 2H0VA 3E2EA 1XMOO 3UCSC 3HJRA 2DCJA 3WQ0A 3HKBB 1YQ8A 3OUSA 3CEIA 3ZYJB 1SLTA 4FPGA 4MVMA 2ZE8A 5BY5A 3GVMA 4Z1MG 2RV9A 4EWDA 3QTCA 4OHXA 5H5NA 5BNOB 3WVJA 4GKKB 3ZXJA 1HW7A 4TQDA 2EXJA 3T4VA 5I93A 1PZ7A 4Z07A 3AKSA 3NNMA 1HB4A 4Q29A 1RHI3 2OZJA 2RR11 5F2SA 1IBKO 1CAXB 1YZBA 1AYM3 1QHTA 1CR7A 1PX3A 3TAYA 1E5HA 4J9YB 4MVOA 5IJ0A 4TYSA 4NTWA 4G28B 4O9GA 1SG3A 4YWAA 1QJEA 2P3YA 4U7NA 5L9BA 2B8MA 4AI9A 1AR71 3H1KH 2A79B 1ZBA2 1I5YA 2GBOA 2NLJC 3OF1A 1W2OA 2WQ8A 4KBBA 3W9AA 5FDBA 4WFHA 3PMSA 2P6JA 4UXNA 4LJHA 1WD4A 3NAPA 1HP8A 3WP5A 4Q8KA 4MZUA 3I4IA 2PA7A 3IPVA 1W8ZA 2VRZA 4IV3C 3EHBB 4MGZE 3OTOB 2WNUB 4L97A 1D0GA 5B3SC 2BP6A 3E8HA 4KGQA 1GUIA 3BPZA 3JASB 4BLIA 2ZKNA 4YNIA 5K4LA 2HKXA 2XWJB 1ZX5A 4KI5M 4TV8A 4H3WA 3OY8B 2VQTA 4I9QA 4CDQA 1LOBA 2VO5A 1MZ6A 4GQ7A 2DN9A 2DDUA 1DU3D 2JJ1G 5LBQA 1DLBA 1N36B 1S0BA 3T09A 5KUMA 1PNGA 2BGOA 1AJPA 1LR1A 4G9SB 4MHRA 1NA1A 3CE2A 1H9WA 1KMIZ 3MAQA 4YW4A 2P22C 5JLVA 1EUTA 1JYTA 4EKWA 4XXAA 5B1OA 1NTZH 1YI7A 2ZCWA 4UF0B 3VL8A 2ZHKA 5A3NA 1FXZA 1WUVA 1W6OA 3UO2A 2FMDA 3ITQA 1GWMA 5JQGB 1O6UA 1WB8A 1GN4A 2RS11 1SRYA 3L2HA 3G4SV 3HBKA 5IYCO 4IHJA 2G9GA 1OZ0A 1Q90D 2XVLA 1Z5WA 1DBNA 2DCTA 3HNMA 4Y1VA 3J26N 4AAPA 1U0AA 2V5DA 5FBJA 4AVTA 5T52A 3N2GB 2VVDA 1N8RW 1HRV2 3JATB 4MOAA 5GW7A 2KQXA 4TOIA 1YQ6A 3NW4A 4M3CF 3ABLC 5A7PA 1SCSA 4GX2A 1S3JA 2OZ6A 1REEA 4IERA 1RSOB 1WA4A 4BQXA 4YZ5A 1HJGA 5LEJA 3BRCA 3THDA 5A7WB 1FPN3 3CRRA 1KUQA 3VDDB 5J96B 4FAGA 4AQ2A 1HB2A 2C0ZA 1XOYA 1TME1 4Y1XA 2ZR2A 4I4TA 1X9PA 1RPOA 1RUG1 2ZOEB 3J8F2 3ZFFC 4XBFA 3V0BB 4UBGA 2RM22 1KS4A 4QQHA 2W0FC 2RJZA 1QF3A 5FZOA 4JHTA 2Y4UA 1DYKA 3OD4A 2OCCB 4KL1A 4HBNA 1IKPA 4X88A 2HWD3 4K3UA 2OT5A 4ABMA 5A7NA 1DP0A 1W2TA 4NXMB 1ODMA 1SLCA 2BSKA 2GN3A 1JH5A 1LRHA 1VIWB 1A78A 4AR2A 2JS3A 3LA3A 3N9OA 4PLNA 1W6PB 5SV5A 2FDGA 1YEWA 3U37A 4LIVA 1L0LH 3BHPA 2PLV2 2VG9A 1GM8A 1ZZ8A 2P4EA 4NAOA 2EX3A 3GF6A 2RR12 2QKDA 4RQEA 4X8AA 4XFHA 3R4SA 4W50A 4EN9B 2CH7A 4COYA 1QJU1 3X29B 3ZVXA 2RHPA 4OQ9A 4AF9A 3QOPA 5A2QN 2XVGA 2CWSA 4TUYB 1RINA 4N90A 2VOVA 4KG0A 1QQP3 4ITCA 4RS5C 3S30A 1HRI3 1MABG 2Q8VA 1FMD1 4GUNA 3GBFA 1VRH3 1QNWA 1NZIA 5I0TA 2BBAA 3WG7B 1SACA 2D97A 4A44A 3H1HH 4J7JA 1Q8SA 1F2NA 3OPTA 4MVQA 3W20A 5FTTC 1D4M3 4IL7A 2VU9A 4FLXA 1H0BA 3T0BA 1ZL8B 2VQFO 4P9WA 4X6RB 1QLNA 1J5EB 3ACGA 1APNA 2XMLA 4JV4A 4PV1B 2UUBO 4BPZA 2WS93 3VHRA 4D8MA 1NXD1 1ND3C 4P9OA 2YI8A 1AP6A 1B04A 4X1IB 1WMFA 2PMWB 5KX5B 5FO9B 1QJZA 1NLQA 1T5EA 5DQ0A 2VZSA 3VQYA 1AUYA 1PNKA 4BK5A 3O9OA 3DKQA 3HKDB 4Q4V3 1Y76B 4DV6B 1JYXA 4MTFA 5C4WC 3UGFA 2NM1A 3NNLA 1IZ3A 4IGQA 4I09A 1M56B 3DKWA 1TMF3 1X50A 3V0AA 1A8MA 3KQRA 1VF6A 2ZMKA 5IK7A 2P7TC 4UFJA 1FYJA 4ZOLA 3GZAA 3IIIA 3POBA 2FDKA 2Z3YA 5FZKA 3T2MA 1UMZA 2K2SA 2A3QA 2WLQA 2CSGA 4XF3A 5GLUA 3JBG3 4I5SA 2TEPA 2YU2A 3SH5A 3BALA 4V1PA 4GJYA 2ID4A 5I0UA 3E5XA 2RS12 2WBKA 2JD4A 4TTGA 2QQMA 5LA6A 5F3IA 5L3DA 2WSUA 4ES8A 1B3QA 3AVRA 4OXSA 4LF7B 3FBYA 4OX9B 5FPXA 1NCRA 1FI2A 1HNXB 1UF2C 4GMP3 2AH2A 4GX1A 4UVCA 4XDOA 2ZHLA 3AP6A 2Q8EA 1IS3A 1V6JA 1JVMA 5FPZA 3NAPB 4C0HA 5KC5A 4K1ZA 1NCQA 4B3SO 1CP9A 1ENVA 3SYQA 3B4SA 4EFBA 4O4LB 5I0DA 1UU5A 1Y6XA 1YJNV 4HKWA 3N7KA 3ASOC 1JJOA 2ZZQA 3UKMA 1QU0A 1CPNA 5F3EA 4FTSA 3IM0A 4XMIA 1RUF3 1ZRCA 4RGAA 2W5FA 1LHVA 4CDQB 1TME2 4DV5O 4KHPO 1JZ2A 3AKPA 3S6PA 2LALA 1R73A 3WB1A 1UWWA 5A33B 2HWF3 4GB31 1VBE1 4Q4W3 3I54A 1NY71 2QQWA 4OI2A 2F43G 2HWC3 3VBFC 3RMXA 1PL4A 2OIGA 2R32A 1LENA 3P30A 3TEXA 2F4VB 3POYA 1Y43B 4CS3A 4YVWB 3SJAC 1GU3A 2A6WA 3EXAA 5BNPB 1OLME 4PIZA 4JVAA 2WNEA 5CA1B 4FP3A 3LAGA 4JGSA 1SDWA 2VW1A 1Q6IA 4CDWC 2UWAA 3UL2A 2UU9B 4ZHNA 1A3KA 5LA0A 1NR1A 1N33B 1CJPA 5LBCA 3HN1A 1VBB3 5CBHA 1LUWA 1NKDA 1HB1A 1Q8VA 3RWRD 1ENXA 3W5NA 3TNPB 4ZXEA 4CE8A 1G9DA 1N1SA 2W95A 4FOWA 2WFF1 2PHDA 3MO4A 4TSVA 4DR1B 4XF9A 3BEHA 2YXHA 5FZ3A 1U5ZA 3BOWA 1VMFA 2K46A 3MHHC 1AR91 4WBNA 1XL6A 3JYCA 4PQ9A 2FDFA 1QJU2 3MI8A 4M0HA 5LBFA 3ICXA 1UZ0A 2A1XA 4MVZA 3WDXA 1SQBH 4R4ZA 2ZXQA 2WLLB 4WFBV 4A6SA 3HPLC 2XAHA 2VBDA 2LUWA 2GDSA 1X8MA 1FMD2 2R1DA 2GALA 5FOJB 4QDSA 1TE1B 4CXWA 2CGOA 4DR5O 1YHQV 2WLHA 2XWBB 3S0MA 1XDCA 1K73W 1GZCA 4D6SA 3ZN5A 4IT5A 4BCUA 1XBFA 1POV3 2VS0A 2R30A 3SISA 2D2CB 2YMZA 3I2HA 5LXTB 4DV3B 2QQOA 3EQEA 1M93A 3OOXA 3L9DA 2LGWA 3ZX6A 2JDIG 4OI4A 1JXNA 5H9SA 2X5IA 3OT7A 5FZOB 5T55A 3ACIA 3ZHTA 1K5MA 3ZHSA 5D2AA 3VD5A 4LKSA 1XYNA 2N05A 3WOGA 3ZRWB 1OOPA 3VOUA 4W8JA 2AGAA 4OULA 4K9SA 1PHMA 5IK5A 2FZ2A 3JD72 5JJEB 5DAVA 4OUMA 4NPMA 1PMIA 2VBBA 5LATA 3RSJA 4QT6A 1H8TC 4CCOA 5CB7A 1VEWA 3NJVA 4L0PA 4NROA 4JI8O 4IV3B 2A06H 4PBPA 3VV1A 1XU2A 1AL23 3CBNA 1GZTA 5B3SB 2ADDA 2YXSA 4P5YA 1T2XA 4NYKA 5EV7A 1XPWA 1WPBA 4E8CA 2EIJC 1HW5A 1VQ5V 2F93B 2Q68A 2ZINA 3LF7A 2WZPP 1HLCA 3N9PA 2IJJA 4XUTA 2A5ZA 1NH2D 4DK0A 2D3RA 2QBXA 1OFNA 3L72H 1LESA 1XQNA 3M3EA 2NPIA 4D7TA 2YSUB 3RI8A 2Y6HA 4AOCA 4QGLA 1OV9A 4AILC 1PO22 3Q4HB 1N0JA 4Y5TA 1ZYBA 3IJ4A 3MYXA 3OSDA 3ZIAG 4LP8A 2FKXA 2WINB 5CKQA 1THZA 3HVDA 4QIWF 4Q4Y3 3DUIA 4JGYC 4W4ZA 4JKLA 5JVVA 4ZI7A 4FFHA 4B4RA 2Q69A 1UKRA 1RUC3 4LA3A 3I55V 1LAJA 4JV5B 3B00A 3IGAC 4JI3B 1WLCA 3ZYGA 4NHMA 3K5MA 4AVAA 4Z1VA 4LPLA 1O4ZA 3H8XA 5EHDA 3SQOA 3CSXA 4LHNA 4GA9A 1N36O 2ES3A 2CY6A 5DUUA 1OCCC 4RHV3 4FBFA 2ZM6B 2FMYA 2B1IA 2JWPA 5LYJB 1NZ6A 4EE2A 1YCIA 5LRSA 4XFBA 2JG8C 1AB3A 4DR7B 2MNGA 2XQXA 3G7DA 1NY72 2Q1MA 1QH6A 1M1KW 1GICA 3TEZA 3GALA 4O4HB 3JD2A 1YSCA 2V4DA 4DV1O 1N32O 4FT8A 3ON7A 4P9LA 5A3TA 2DV9A 2GMPA 3ABLB 2ZJCA 2D3SA 1P49A 1RYYA 2X10A 5FYUA 4EN6B 1H2NA 1XNBA 4JTOA 2OPWA 5JZGA 3AG1C 3AMQA 1IQAA 2BERA 1KD7A 5LA6B 1X33A 4LWSB 4OGQB 4BZ4A 3PHMA 2Z4FA 1PV0A 5C8YA 4EB6A 2GN7A 3FZ3A 2RQ6A 5B5EZ 3ZFFB 1E5IA 5BPXA 5JSOA 3JZVA 4ARXA 4DR3O 3N36A 1VF5B 2XXZA 1AR92 3L74H 4DRVA 1ZZCA 4LFBO 1GO3F 1RGSA 4QPJA 5FYBA 4V2VA 4TZDA 4LF8O 4WM7C 3P32A 5JXGA 1LJ7A 2QNKA 4DUVA 4V2WA 2EIBA 2Q5TA 2HWE3 4PT6A 2XB6C 3LA2A 2MEV1 1XHZA 1CGPA 4OUEA 3DXUA 3TEWA 2HFEC 2ITCC 1EP0A 1KEXA 5LP6C 1ULEA 5C70A 4Y1ZA 4BAYA 1JFFB 1J59A 1MVQA 2EZPA 4YZ1A 2O14A 4ASUG 4FQ4A 1TUBA 4LFAO 4PJYA 2DUOA 1F5JA 4BLJA 2CWMA 5FUPA 2P37A 4LNVA 4YGEA 4O2AB 2C1FA 4DRRA 2WPDG 5F9TA 3PJYA 2B45X 1IHMA 1OF3A 1WMXA 3HAGA 3OEBA 2LW8A 3DPRA 1VPHA 2BZDA 1BMV1 3IBMA 1JOPA 2FCTA 5EIBD 1NUKA 2Q67A 1AZDA 3H3LA 1CAVB 5FKBA 3A0NA 5FYIA 1C5HA 3WCSA 1R092 3HKEA 2VXJA 4RS5B 1CJDA 3VBUC 2EXIA 1Y9MA 2VCBA 3CC4V 5B4XA 3S3XA 4SBVA 2OIEA 4RFT0 3J7HA 5KMGA 3VHOA 3CRAA 4K20A 2XKOA 2DTYA 1XBLA 2BVVA 4CDXA 1QXPA 3O1PA 4E8DA 1HR0O 2J1UA 5GKAC 4CEWA 4YZ4A 1OXCA 5A7SA 1MQTA 1W6NA 3GZTB 1QWRA 2EIMC 4GH4B 3FAVB 3EYPA 1F7YA 4ET7A 4A42A 4TWTA 1W9FA 2GSMB 1SHWB 1DK1A 1OUSA 2SLIA 2OQ7A 3WX5A 3I2IA 1QOTA 1V6IA 4ISQA 4A3ZA 5CZKA 3ETGA 4WBNB 3GYDA 3J7AU 1X4TA 3HR9A 5B1BB 4YG3A 2ZGNA 2A71A 2R061 4PQQA 1BLZA 3VHNA 1QJX1 1XNQB 5C4WB 3OCPA
chains in the Genus database with same CATH topology
1CAUA 2GNTA 3ZFEA 4E2GA 3JQWA 4XETA 3A0KA 3OYWA 3FFZA 2LTNA 3JBG1 1W0PA 4G3YC 1ZBA3 5DZEA 5EYYA 3AZZA 1RUG3 3WG3A 4CYDA 4BIOA 4HVOA 4J1XA 5BNQA 1GQHA 4IEXA 2ZTNA 3FE5A 2UWBA 4RA0A 5L36A 4B8EA 4YZ2A 1DGLA 4BG1A 2QVSB 4R8HA 4IEOA 3ELNA 5JIAA 2D6PA 5A33A 1AR81 1ALYA 2WL1A 4YGCA 3WXPA 4OHWA 1KJRA 1F31A 3B94A 3I59A 3AM2A 3RMYA 4K6BA 2BUKA 5FAXA 4XF0A 1O4YA 3WCRA 4YFZA 4FAHA 4FSJA 1LR5A 4GMP1 4BE3A 1R1A1 5F6LB 5JOWA 3PVBB 1VBD2 4GMP0 4FVVA 1G9BA 1EV11 2OVUA 4QPYA 1RMU2 1QXJA 2IXJA 3OBRA 4AI1A 5K0UB 1AX0A 1VBC2 2ZACA 2ZGLA 4YVWA 5H9QA 4HZFA 1QMJA 5BNPA 4Q0SA 2ARBA 4Y1YA 4LBJA 1AYN2 1J1LA 1RJ7A 3LB9A 1X8EA 1H1AA 4DPNA 2TBVA 4MYEA 2D6LX 1OI6A 3CNAA 1PIV1 1ASJ1 2W52A 1OOPB 5I0RA 1CVNA 3FJSA 4MUVA 2I2SA 3AP5A 4AEMA 1OPMA 5F5QA 3NO8A 1O3SA 3WT3A 5JZGC 5L7OC 2ZGOA 5DG1A 2OG7A 4KNCA 3WQ1A 1MS9A 1PM7A 4DY3A 5BNNB 1H30A 1U5YA 3IDBB 1AJOA 3UKNA 3AK0A 3PVOA 1FX5A 4IQPA 3QACA 3VZKA 1UL9A 2VVEA 2UURA 4R9CA 1RUF1 4XBNA 3M70A 1A8DA 3I2DA 2ZABA 4ATEA 3ETQA 4PIXA 3D82A 1FYUA 4YVSC 3ES4A 1I3HA 3QBQA 3VBOB 4AXOA 2Q8OA 2IXHA 1AYN3 3VBUB 4AFBA 4GWMA 5CFCC 3LOIA 1ENRA 2E63A 4I0WB 2P17A 4NN0A 4GKYA 4Q4X1 3KB5A 2WZR3 2DVFA 2PAMA 5K7PA 4XIKA 1MEC1 1XE8A 4P9IA 4LUMA 5CG8A 1AL22 2JJ6A 4NWWA 1D2SA 1Z7S2 5FLJA 3MFAA 5JOYA 5ABJA 3RYPA 1R091 2D40A 2SBAA 1KITA 4HVRA 4CDUB 4WZCA 1GKBA 1LHUA 2FBEA 2I07B 4LT5A 2Q30A 3IN9A 3JB4C 2P3JA 5C9AC 4D69A 4YM0A 5J48A 5HXVA 4ASMB 1TNFA 2NP0A 5CU1A 2D3PA 1DGWA 3FLPA 1MZ5A 4N53A 1J3QA 1DFQA 4PDWA 2JG9C 3OBTA 4COUA 4XJ9A 4I30A 2RS52 2H0BA 3AKQA 1V6MA 2GC2A 1OD5A 2ZKLA 1YUDA 1U5IA 2XJTA 4CP0A 1QGLA 4M25A 2EA7A 3B7MA 3U11A 3IIAA 1T6GC 3AYAA 3MS5A 5AFBA 2E9QA 3THPA 1EAH2 3H8UA 2GZWA 3AMNA 5EXOA 1LHNA 4LA2A 1DGRN 5JCTA 1NCRC 4LO4B 4R9DA 2Q0AA 1Y3TA 4BH9A 3IDEA 4WBBA 3ZYIB 1C8NA 1CAWA 1PZ9A 1FV3A 2JKBA 2MEV2 1OFSA 1LB2A 1AJKA 4I01A 4B29A 4ZU7A 1ZBA1 3E97A 1RJ8A 1HRV3 1OMIA 1YFWA 3L2YA 3ASIA 1EPZA 2BNMA 4Q4Y2 4CDWB 2VXRA 1FAYA 5GZDA 2DUQA 4XJAA 1OQDA 1G9AA 5IK8A 3BU7A 4AQTA 3FMGA 1RUC2 5HCFA 3DPRC 2MHFA 2TNFA 4N9HA 2EAAA 1H2LA 2VY0A 3ZSKA 4DFSA 1UZYA 4M3CA 4OI1A 1QOSA 4CRQA 2XJSA 3ZMOA 2KA3A 3WZ1A 5GALA 1COV2 3RYKA 3RPQA 2RMU2 3AJZA 4D7SA 5HI0A 1O3RA 2JE9A 3ILRA 5SV8A 1YFXA 2O0OA 2C9AA 3VLBB 5I0SA 2PHWA 1H9PA 3KZ4C 1KDKA 3ZDSA 2W68A 1WLDA 3NKTA 3APBA 4RHV2 4CEYA 5E89A 1FOD2 2DF7A 1FNYA 2WT1A 4YSFA 3J8F3 3OTFA 2GMEA