2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
1H2NA 1MZFA 2WA3A 4Z1VA 3P3NA 4JAAA 2Y0IA 1H2MA 4B7EA 4NR1A 4BIOA 3KCXA 2XUMA 4AI8A 5JWPA 4QU2A 2YDEA 1IZ3A 4Z2WA 3KCYA 3P3PA 2WA4A 3D8CA 3OD4A 1H2KA 2YC0A 1YCIA 4B7KA 2ILMA 2W0XA 1MZEA 2CGOA 1H2LA 2CGNA
chains in the Genus database with same CATH superfamily
3EVKA 4OZXA 5B1OA 3IAPA 2VXJA 2RS33 2NZ9A 4XFAA 5H9PA 4OXSA 3VZKA 5FZGA 2PHXA 3RVZA 4O4JA 4PBOA 4S2DA 1QQP2 3X2QB 1H8TC 3SPIA 3JATA 5CBGA 3HEIA 2FL4A 5GLZA 1KP3A 4LO4B 4LF5O 4PV1B 2ZKOA 5KXEA 1QJX3 2W39A 3TETA 3G67A 1M4WA 1W0NA 3JZVA 3Q8AA 4QB6A 4MX3A 4ZY9A 1S77D 2VUDA 5JUVA 3B9CA 5GTIZ 1CZTA 2XDVA 1XMQB 1HB1A 5A33B 4FFKA 4AGRA 2YIAA 4QNHB 2Y33A 4FPYA 2WLQA 3JBG1 1HWYA 4JI0O 4P9YA 1FPN3 3HN1A 1TUBB 1OSGA 2R073 3ZYGA 2HEWF 3ABMC 1NVPB 5FY4A 3HNMA 4Q4V2 2Z5WA 5FZKA 3BU0A 3ZBHA 1S0DA 1VQOV 4JRAA 3DCQA 1RXFA 4K8XA 1JCHA 4OUSA 2R9RB 4OCTA 5TISZ 2Q1ZB 2P3IA 1W8OA 3MLLA 4NROA 4FI9A 3THPA 3K5NA 4HK8A 1E5RA 1UF2C 2GBOA 3RWRD 4EZHA 3OAAG 4RGGA 4ZS2A 2BVBA 3BI3A 2OUJA 2RS31 5A6ZA 5IJ0B 5IVFA 4RHV3 1H38A 3CCLV 1CIYA 3FKSG 2W1UA 2EINB 4G27B 1HXS2 3GZEA 3DYPA 3I59A 2D3RA 3JAWA 5EWSA 1W6OB 3WINE 2XL9A 4F7ZA 5FZ4A 2C9AA 2G1MA 3EBRA 2CAVA 2IM9A 3E8BA 4AI1A 3JD71 1XBLA 4LF9B 1X7NA 3RYKA 1D4VB 1UWWA 1DTOA 2B1GA 3PIGA 1PL4A 3ILNA 4CDQC 1V55B 4PA9A 3KT1A 3MEPA 3SMHA 2JJ1G 1W8ZA 2TNFA 4DXWA 3O0WA 4TZDA 4NXMO 4IE5A 2PMWB 5LP6A 1KFUL 5CZKA 3GHMA 1OT5A 5KHJA 4B3RO 4FK5C 4HG6B 5FBJA 3AYAA 3ZFEC 3U75A 3RW0A 3LWCA 1CESA 4PA7A 1RUJ1 2IUWA 3M8LA 1IG0A 1QU0A 3AP5A 1O9GA 3EO6A 5J1XA 4DR1O 3AMPA 4W6XA 3TN91 4QXBA 4BXFA 5ITZB 5IFPA 3MPBA 5HCHA 2JG8C 3BU7A 5E79Z 5LHIA 3I2DA 1R083 5FZ7A 5EV7A 2X29A 3HBZA 5TSWA 2X5IA 1G6NA 2W0XA 3KMHA 3KT4A 5H9QA 3M3IA 5C33A 3DPRC 4R9DA 5GLTA 1NA1A 1QQP3 4Q4X2 1OCCC 4PBPA 1R1A2 2ZACA 3ZHUA 3O9OA 1SFNA 1I5XA 4IEVA 1NCRB 4YIPA 2PYJA 4MLOA 1JA8A 1OKOA 1QJX2 1C3HA 2VVFA 3CPWU 3BEHA 4K8FA 1ZBE3 4E4DX 2EALA 4JGZA 2PA7A 4Y26A 1IBKO 2YFUA 2GDSA 5T3NA 1YQ2A 2E63A 2VZ3A 4MVZA 2W3JA 1LOFA 2XONA 3ZJZA 2WLMA 2HVKC 5APAA 3H9VA 3POIA 4YVSC 2IC1A 3OY8A 4CP0A 2N05A 4MTXA 1IX9A 1RMU1 1HXS3 2ZIOA 3AXDA 3T2MA 3TN93 4CXYA 3I7DA 3SH5A 4H14A 3L75H 5ACA3 4I2OA 4EWDA 3HKDA 2ILMA 4CH5A 4DXRA 1M57C 4Q8KA 5LZ6A 1CX4A 5FIXA 1PO13 1I5YA 1V00A 2QQIA 2PELA 2DWEC 5FL7G 3TJTA 5KHGA 1WN7A 4ISQA 3KCYA 5CU1A 4O4LB 2GUZA 3O0XA 3T1YO 2J1UA 4NE9A 4BISA 3PHMA 1NH2D 2WS91 3LZZA 2P3JA 4PA4A 2BZDA 3OD4A 2ZX0A 2DBIA 5A3OA 3FBYA 2BRTA 3HIFA 5DAWA 4ZBMA 1UY4A 4NHYA 1PM7A 4CEYB 3O1TA 4KG8A 1LB2A 3RZZA 3SCHA 4QPGB 2HWF3 2P22C 3O1MA 4JRLA 4ASMB 2VE1A 3OBZA 2B7YA 4HMZA 4CUCA 5BNPA 2ZR3A 4B7EA 2P5OA 1UAIA 3J8F1 3OJBA 2C0ZA 2UYAA 3KF5A 3MICA 3T4HB 5FQ0A 1NE4A 1UNBA 2KQXA 1IBLB 2YI9A 1RPRA 3ZN6B 3QNEA 4CH6A 2ADDA 4XQDA 1ENQA 2WQ8A 5AFEA 3RFRA 3O1RA 3GJAA 3HN3A 1RUG1 1WWYA 1CAUB 5BNOC 2HKXA 3JD72 1OLME 3ASNC 2YYOA 5JR7B 5ABJA 3CO2A 4UCSA 4UBHA 1WCUA 5IYBO 3FB8C 1THZA 5DN2A 2PI5A 2OA2A 2ZGOA 1RIRA 3LSQA 1RUG3 3D0SA 5F1RA 3LSUA 1RL3A 2GV9A 4Q27A 3ZX7A 4X1IA 1HR0B 4J42A 3RZLA 4IL7A 1AYM2 3FAVB 2JG9A 2NR5A 3C8XA 2P6JA 1NT0A 3KVAA 3VGIA 3CCUV 3BPZA 2ZX3A 1OCOB 4M01A 4N7IA 1ZVFA 1GZCA 3ZDSA 4UV8A 1YQ5A 2FKXA 4P9IA 3SCGA 4OI1A 4E4HA 4FZ1A 2D5FA 1XUQA 3Q8BA 3JQWA 4OMCA 3KB5A 3FL7A 4GXLA 5I0RA 1J84A 2MEV3 4YHHB 4NXNO 1GZ9A 3DECA 3L2YA 1BMFG 3ETGA 1FT9A 2JENA 2E51A 4YFWA 5IJRA 1DGWA 5F3GA 3DF0A 4R9CA 1A3KA 2VZRA 3NJXA 4RWUA 2R063 4XIKA 3ACIA 2QUOA 1MS1A 4C8DA 2DVAA 3OR7C 4A2UA 2LUWA 1ORQC 3MHSC 1W8UA 4XBNA 3JSNA 3MHHC 3G6JB 2OZJA 4BLJA 2WWUA 1UYXA 2R062 2YUEA 3LEKA 5DUXA 1YIFA 4Q4V3 3SYQA 4LFBB 4QPIA 1I9RA 4IERA 5JMOA 2A0LA 1U12A 3OR6C 5JCOA 3ZXGA 3TEZA 5ABJC 4QQPA 3CIHA 2ZIMA 4NIDA 1COV2 1W59A 2WNOA 4WBBA 1RUH3 5EIBC 3ASNB 1PO11 1GMMA 4AAXA 5A3TA 2OWOA 4FOYA 2OIIA 3J7HA 5BNOB 4DY5A 4QE9A 2EXIA 4E8DA 3VBHC 4A3ZA 3J7AU 1H1IA 4YZ3A 3GWOA 2F95B 1JFFB 3K58A 3VDCA 3BOPA 3Q8EA 1IXMA 3AB0A 1W6PB 1N1YA 2QE7G 2O0OA 1AUYA 4KBBA 5FRAA 5J2UA 5FZEA 2UXNA 2C24A 4JYCA 1S0FA 2W46A 2DQ3A 4LIUA 1XB9A 1MEC3 4EB6A 2QWNB 1QBZA 3M99B 3E6BA 3IDAA 4JAVA 3O14A 4FSJA 1KRIA 5EBWC 5JH7A 1R3IC 4YJ2B 1VAVA 2PHRA 1O4TA 2BGOA 3QO5A 2H0VA 4B4PA 4R4XA 4LF6O 1VBE1 5EBMC 4LQRA 5F9TA 2BOCC 4PD4F 4DR4O 1QCEA 5A3WA 2X5IC 2B4KA 4Q0SA 3N35A 4O2BA 4JI6O 5CB4B 4FLWA 2EILC 5ANNA 4LFBO 1OQ1A 2FB5A 1NA1C 1UKGA 2NN8A 4XQ4A 5DAXA 4MVMA 1O5UA 1H8TA 3UKMA 3CCRV 2P4EA 1WJZA 3N9NA 5DDJ2 2Y6FA 4LULA 2X6CA 1YDXA 1HNWB 2W91A 2WFF1 2XLGA 4ZU4A 2ZCEA 3POFA 4UT5A 5FYBA 2VMCA 3WU2Z 1XSQA 5D8AA 3ZN5A 1H2LA 4LBLA 2XHKA 4MHUA 3R65A 2D6LX 1G9FA 2ODMA 3ACFA 4R6ZA 3S7IA 4FVMA 4J80A 5IVYA 1PHMA 4H0LB 5F5AA 4MSWC 4Q4Y2 4K35A 1YUDA 1NKGA 1N3PA 1CZSA 1FV2A 1PZ8A 5D5QA 2LQTA 2OXBA 3HQXA 4WVWA 3FLPA 4DK1A 2ZGSA 5IVCA 2W94A 2A75A 1LOFC 5C8CA 4XBLA 2C6SA 1GQHA 3ZYIB 1WMEA 1WCKA 1JODA 3JD0A 4MGIE 4LLFA 1NZCA 5FQ0B 5CN0A 1M57B 1YTFD 1HJFA 1NZ6A 5EYPB 1W6OA 1YZBA 1NCRC 1BGYH 4AEMA 3R4SA 1WZXA 2YS8A 2R0HA 1IG3A 1COWG 5CADA 4HZFA 4MSVA 4O2AB 2JEXA 4AR2A 2HJIA 2Y0OA 4MVRA 3GHNA 1SPPB 1QR8A 1GN6A 1SC5B 2GNBA 1J3QA 4AK3A 4UW6A 1O3SA 2V4VA 1YQ6A 2QM7A 4CS4A 1W2BU 1ZA4A 3Q8CA 4MGKE 2CTWA 4LUMA 4IHJB 4QPYA 2ZXQA 4CH4A 4G4FA 3D4KA 2J7MA 2R30A 1YIPA 5A1FA 3DV8A 2V5DA 4MVSA 2ORXA 5LGUA 1MSWD 1RSOA 1PNFA 2XWBB 3ZFEB 1OQEA 4Z8BA 3RYIA 4RS5A 4DR3B 1K5MA 3JD2A 5B66Z 4QB2A 2Y48A 1EAH2 5FPLA 4CEWB 4NUBA 1K42A 1MZEA 2VL4A 1EM1A 2XVLA 4F6RA 3OGIB 3KZ4C 3ZRVA 3POJA 3SPHA 4TV8A 5BNOA 4CZSA 5EZYB 3WP6A 4D6QA 3E8FA 4ARYA 4A5UB 3T1HO 4U7OA 1AF9A 3K9AA 3WSOA 1UO9A 4TV9B 1L7RA 4LBNA 1B3QA 2QM4A 3OEBA 3T09A 1U5ZA 1B35A 5KX5B 3ELNA 2WQ4A 1BK1A 3ZYPA 5LBCA 1KS4A 3S57A 1SBFA 2KSDA 3AJYA 5A7QA 3ICXA 5FREA 1FFTB 5FZAA 1BXHA 4MHRA 4GQ7A 2JDIG 1YQCA 2E26A 1GP6A 1W2TA 2DU1A 5HV4A 3DEMA 2JDYA 1ND2B 3JXSA 2IU0A 1JZ5A 2Y6GA 4K8ZA 2QKDA 4NAMA 1OFSA 4AAPA 3ZPYA 2A6ZA 1GP4A 3HQRA 3EHBB 4KP4A 1Q8SA 3RJRA 5FZCA 1W8TA 3SYOA 1W0JG 1JQ0A 4BZ4A 2QTOA 4BDVB 3KV9A 3W5MA 2P90A 1RUC3 4UXNA 4FPEA 4E27A 3EB7A 4GX2A 2OT7A 5L73A 1LGNA 1W3XA 5C8YB 4AI9A 1AR72 4WBNA 2K1EA 2EX3A 2BQPA 4K21A 1LR5A 1QNYA 3BAAA 2BNOA 3ZKYA 4BOWA 2V4AA 2O8QA 1MQTA 3QBQA 1JYXA 2ZGTA 1AXKA 4ZU5A 3M3CA 2QWRB 1SDDB 3N2KB 3B40A 2CWSA 4JI1B 2R72A 5FZ9A 2IJHA 5JR2A 1AR81 4KGQA 5A3MA 1EFRG 1KC8W 4KUMA 5GONB 3VBHB 1JYCA 1HB4A 1Z0HA 4JTCB 2VMEA 1OH3A 4FPPA 1H2NA 5HCAA 5IK4A 1DYOA 4LF7O 2PHLA 5B3SC 3LD8A 4UF0A 1S5JA 1KKDA 2K9PA 1SG3A 1GKBA 4Y1UA 3TRSB 1S3JA 4XDPA 5LRRA 4CCNA 1FYJA 3AL6A 2R043 4J1XA 1RM1B 4NYKA 1JJ2U 4AE2A 5C5TA 3AZVA 1HW5A 2EXKA 1HDKA 1WW5A 3GVMA 4DOUA 1W2OA 4FFFA 2WINB 1APNA 2JXAA 2Z69A 3VZNA 2WABA 5ANQA 4YNIA 4QDSA 1TME2 4O7XA 5GKAC 5CFDC 4JGZC 3ETQA 5LA0A 5CG8A 3H1MA 4LF9O 2ZNIA 1VBA2 2A7WA 1EAH3 4HZ3A 4UYBA 1MPXA 3H1LH 1AYM1 2BOJA 3H8XA 3ZIXA 5CISA 4DV1B 2JJ2G 3NMBA 1K3IA 1HW7A 2D2CB 4YGEA 1WW7A 3SJCC 4DR2O 3J7MA 1Y9GA 1POV0 2KKWA 4IEXA 2W87A 4XUTA 5GM0A 1LTEA 5BNNB 3JAKB 4FVVA 4RN5A 4G2KA 4U7NA 4Q4W2 4X8NA 2M7WA 3RZMA 4X1KB 5K1XA 3GZAA 4YYOA 4D7YA 3I3DA 1Q6IA 3ETPA 3F2ZA 4LPLA 1EBOA 2Q7HA 2OX0A 3OCPA 4XC9A 4XJWA 3L9DA 3V65A 1JI6A 4QAWA 1JHJA 2MEV1 4GWIA 1QLEB 3AYEA 4D6TH 1HB2A 1SDWA 4RA0A 2C26A 1XQNA 3VKMA 2WLLA 1VBD2 2JWPA 1GNYA 1OH4A 2WPDG 2IXHA 4FPJA 1Q8QA 4LXLA 1ZRFA 4EN0A 4AGVA 2PFWA 1NU1H 1CAVA 2AUYA 4M3CF 4LF8B 2VZOA 2EF6A 1YSCA 2RN9A 4J41A 5C6CA 1W03A 1TE1B 2FMDA 4AQSA 3B4SA 4CS3A 1X50A 3CDZB 1AR91 3PIJA 3LNNA 1FAFA 2VZQA 2HJFC 1H30A 3IZOA 1S0CA 1O91A 1VALA 3AZZA 1DZRA 2YXLA 3NJZA 5IYZA 4GD4A 3P6BA 3SISA 1RUD2 4ONUA 2PHTA 1KUQA 1US6A 4DV0O 1SQFA 4EROA 4GJZA 2EIEA 3BVCA 1YWKA 4D6SA 3ZHRA 1WBFA 3P1IA 3A0RA 4LF8O 1OOPA 5FUPA 4KWJA 3JD4A 4CDWA 4NHXA 1GTOA 2Q9LA 3IDEA 3ZIAG 1R73A 1VPHA 2QQWA 5F3EA 4YJ3A 3I97A 5FO8B 4DMIA 4TLFA 1NKDA 2VTFA 4WF9V 3CF6E 1LOGA 1EZJA 4XJUA 1TEIA 1ONAA 3NNJA 4XUPA 1AX1A 3ON7A 5LA2A 4Q29A 3CRQA 1W8FA 5JH7B 1RUH1 3BUCA 3S7EA 4XIOA 2X7RB 3SCFA 4H37A 4X62O 2NN4A 4QXKA 3ZXJA 3MLKA 1G4YB 3MIBA 2BV4A 4LNVA 1QLEC 1GO3F 1GQPA 2EILB 5B2GB 3I2KA 1A6CA 1TMF3 1KU9A 3CWBH 2CHHA 4DEVA 1WUVA 2QBXA 1K4DC 1YHFA 3JU9A 4TOIA 3UM7A 2IJJA 4JZRA 2QQVA 2YHJA 4QX0A 3ACHA 3EQEA 4Y4RA 1DQ0A 2PQQA 3N7MA 3H3ZA 5BR8B 1VBD3 5GONA 4UW4A 4NHKA 2HLEA 2PHFA 4MV2A 3RWKX 1B06A 5LA6B 2QQOA 1OQDA 2QJ1A 2GSMB 1DCSA 3O1PA 3ASOC 1UPSA 5FLIA 4LC1A 1NS1A 4WZFA 4O4IA 3AG1B 5LOVB 1GMGA 1W6QB 3PURA 3ST7A 4L11A 2DURA 1AR4A 5CA1A 4X1YB 4X6RB 3UT5A 3WG4A 1NCQC 4XFFA 5M0TA 2EJRA 2UURA 3RQ0A 4N53C 1ZREA 4JCKA 5IJ0A 2WZR3 4AHZA 4Y5TA 5LY1A 4ES8A 5T50A 1J83A 1R1ZA 2WKKA 3Q4HA 1YTFB 2WLPA 2L6LA 1LUVA 2K46A 1YFWA 1IBLO 1GN2A 4X8AA 4OULA 5J9PC 1N3OA 4NIIA 4N53B 2VMHA 4UOJA 1GOGA 3VBRC 3C7HA 4XTPA 1ZTEA 2A3QA 1GANA 3GYDA 4ZOLB 5LGTA 1ND2C 5AVPA 1XOUA 1M56C 2IFRA 1RMU2 1ZRIA 4I9WA 3VBFC 4CP9B 5GTHZ 3M4FA 1ZYBA 3JYCA 1QOSA 2KG7B 4BU2A 1HRI3 4LFAO 3OF1A 5IJ9A 2XJPA 2UU8A 4LE4A 2E3CA 4JTDB 1CXZB 1UY0A 4B3NA 1MR5A 2GSYA 3VBBA 4JDOA 3ILFA 1ZM1A 2OYZA 2VUCA 1ZBE2 1MQTC 4R52A 2R071 1AI7A 2JDAA 1SF9A 2VCAA 2B45X 1AYN2 3STLC 2QQMA 2Q8DA 1O3QA 3SH4A 4E9KA 2XJQA 4H7LA 2HWF1 3KT7A 1W0KG 4RUEA 4MT8A 4CP2A 2H3OA 4DR4B 4LF6B 3E8GA 2NM1A 2JDHA 1LENA 2VVDA 3OPTA 3PVOA 2EXJA 2VPVA 2VY0A 3F7VC 4JI1O 3BTYA 2CAUA 4OUEA 4IE6A 2WS93 4YVWA 3AM2A 4FTSA 4I50B 5FLXN 4BLIA 3BIWE 4DV5O 4JI8B 5F37A 1WGPA 2VCMA 3U4SA 1T5EA 4FXKB 3NXSA 1COV3 4FM2A 1ZRCA 2CDPA 3WHUA 1MG1A 2GP3A 4UFLA 3HNBM 5CA0B 4JVAA 3GJBA 3GWKC 2H6CA 5K1PA 1EN4A 5IK8A 4HKWA 5JZGB 4QDRA 2P6HA 2HFEC 3H1YA 3J9SA 3T4VA 4QU1A 1SLTA 2DTWA 2QWPB 1V9PA 1O8SA 2F4PA 1ZSPA 1C1LA 5LK7B 1YEWA 4RFT0 3LOIA 1IURA 2HWF2 1Y6XA 1VQ8V 4YM3A 2RQ6A 1XNRO 1MEC2 2XG3A 3FHAA 2WO3A 3OOXA 4ASLA 4Q4W3 3O1VA 1ENXA 2X6AA 4GMP3 4V2WA 4YW5A 3RI9A 5FY5A 3IIIA 5GW7A 3ZOIA 1U5YA 3K48A 4F6EA 4U2AA 3PMSA 2EIMC 3G71V 4XF9A 2JDZA 1AX0A 1W04A 3K06A 3RPQA 2EIDA 1Y67A 4LA2A 1QJEA 3PU8A 2CU5A 4CU9A 1VAKA 2UUCB 3PU3A 5FP3A 1OXCA 1GU3A 4Q4X1 3TCUA 4F4LA 3GM8A 4MGYE 4L9BA 2Q8OA 1HXS1 3LA2A 3FYIB 5FZ6A 1F5JA 1W8HA 1W9WA 4X1IB 1LOBA 2XL7A 2GH8A 2QDNA 4LKDA 3CJXA 2AC1A 2G19A 4FFBB 1IS3A 3VUOA 1PNKA 1NXD1 4R8HA 2XHNA 1ULGA 1FPN2 1JOYA 4W6WA 2XJSA 4P00B 3VBUC 4KHPB 4KWKA 4PT6A 1E79G 2AR6A 1VF6C 1HP8A 3V0BA 5EZYA 2JDKA 3T4ZA 3UT5B 4DB5A 4IV3C 5HPOA 5E8AA 4GX0A 3HAGA 1JN2P 2ZE6A 2EVXA 5T54A 1GWLA 3I4IA 2FMYA 4YPJA 2ZEWA 3VL9A 2A6VA 4S2HA 3HKBB 4XJ8A 2ZDIC 2N04A 3LFMA 1XJAA 2QKCA 1MACA 2DDUA 2JIGA 4TQDA 2RHPA 3J7LA 1JZ8A 3E8HA 3IC9A 5FZOB 4KU8A 3OUIA 4XJZA 4O65A 4URTA 1I94B 1CONA 1YJNV 3AVRA 3ETEA 2GC0A 1V6MA 2GALA 4I09A 1PK6A 3MYXA 5FP8A 4KMQA 2Q0AA 5FPAA 5EC1C 1OLQA 1W39A 2XGXA 3DUIA 3DYOA 1JU3A 4YVSA 3IIAA 4WM8B 3G80A 4XF4A 2DYRB 4LKEA 1E5IA 5L19A 2BSKA 1UIKA 1S0EA 4K6BA 1BVP1 2W95A 3K9SA 2BGPA 1BBT2 4AVAA 3WD5A 3M70A 2ZM6B 2W2IA 3I5DA 4DV6B 4XUQA 1JFFA 4C7UA 3VDDC 4J25A 4FFHA 2J1AA 3JD73 2IJIA 1IPSA 3RYCB 3DXUA 3BOWA 1OFNA 3R6SA 5JSRA 3GB7C 2WNVC 3JBG3 3NKGA 3ZLIA 4DRXB 4AF9A 3JQXA 4CU7A 5JXJA 2RM21 2UXBO 2WN3A 3ASOB 5C3RA 5C7GA 1F31A 1ZA7A 2BERA 1FS0G 1Z7S1 1SQBH 2AGSA 2ZT9B 1AYM3 3CEIA 1W6MB 3J7NA 1AI4A 4XTMA 1ZZBA 3ZFGB 2P7TC 1AVBA 4I50A 4DV3O 3OT7A 4HN0A 5BXZA 1G8WA 4YGBA 3TEXA 1FMD1 2ZE8A 3VZLA 4YJ3B 1EPZA 2RCVA 2ZZJA 4IEQA 4AQYB 1UZVA 3JCUZ 3PMEA 3HNYM 1HKDA 3VQYA 4AFBA 2UXDB 2VZSA 4LO5B 1KFXL 1AXYA 5DABA 2ATFA 1DIWA 5K0UA 5FZ0A 2BNNA 4XJ9A 4Y22A 1TA8A 1K4CC 5JCTA 2OQ7A 1A78A 4CDXA 5BY5A 3GGLA 1S0GA 1O4ZA 3POBA 5FUNA 2HHHO 3AL5A 1VAMA 2A7AA 1XREA 1SMVA 4K3UA 1TGOA 2ZMKA 1R1A3 3VD4A 4AI0A 4LH6A 1NR1A 4MZUA 4H55A 3C7FA 1AR82 1IS6A 1PO12 2VTXA 1FMD3 1P84F 1HJGA 2XJRA 3N2GA 5ERLA 4JC1A 1EN5A 3J4UH 4FPOB 3U10A 2XAQA 3IAYA 2KM2A 1Q86W 1HRV1 3AX4A 2R32A 5EC2C 4DQAA 1YJ9V 5J36A 1UOFA 3T1LA 2WT2A 1QVFU 1AYN3 4BIOA 3Q4HB 4BQ3A 1AL21 5IYYA 2MW2B 2FBEA 2Z5UA 4QX7A 1DBNA 4JZGA 1JTZX 2D3PA 1OCRC 2WAAA 3GZTB 2F23A 1XNCA 4UVCA 3K5MA 1GSLA 3LQCA 4JKLA 1OCOC 1J5EO 1KXGA 2JDPA 2XBO1 2H94A 4P9JA 3MGUA 4YHHO 4NXNB 3ZMOA 4SBVA 2W9XA 3K59A 1DQ2A 1E5HA 1J1TA 2WS92 4N53A 3UT0A 3OM3B 4Q1RA 4ZHQB 1ASJ3 4QXHA 3W59A 2EULA 5FMOL 3MF6A 2RS11 4YZ4A 3ZR6A 2LRPA 1D5NA 3H1KH 4FPKA 4K40A 2Y4UA 3LA7A 1XNTA 3T2PA 2PXJA 3GNEA 1PO23 3K46A 2W5FA 1FATA 3AYDA 1J3PA 2HBTA 3WEZA 1G9CA 3I2GA 1QJY1 2ZGUA 1M5IA 5AG2A 3MV01 4EE2A 3P30A 1BHBA 4FZ0A 5L3EA 3ZXEA 4XDQA 3OTOB 1E57A 1CAWB 2IJKA 4MXVA 2Q7EA 2PQSA 3V64A 4Q4X3 3A23A 5KC6A 3B77A 1JYIA 1VQ7V 4LEJA 2J42A 2EBOA 4UXAA 5CFCC 3IN9A 2VOKA 3LSDA 5JQGB 4BE3A 4L87A 2JG9C 2WAMA 3RYCA 4CBCA 3CCVV 4GA9A 3NSTA 2DVDA 2HH9A 4A3XA 4TWTA 1YI2V 4LHSA 4AFDA 4AI2A 2R9IA 5IE9A 4Q0PA 1HNXO 4DUXA 2J1VA 3HKEB 4QPJA 4QB1A 3DPRB 3AFGA 2BTQB 1O8PA 1ULDA 2I2SA 2YEVB 1MEC1 2RMKB 2E53A 1VMHA 4XHXA 5A3LA 1SQ4A 3TWIA 1RSOB 1GP5A 1V6OA 1UL9A 1ENVA 2DUQA 4COYA 2WNVA 3K57A 1GUIA 2GMPA 1R64A 4PA3A 1RUE1 3H42B 4CPBD 2WRAA 4TWKA 5LB6A 3BABA 4AVVA 4GWNA 2AW9A 3ZXDA 1X9TA 1C57A 1Y3TA 1UYYA 1H2GA 4JI0B 2ZR2A 1GK9A 2B9ZA 1U97A 4PDWA 2FD8A 4XEZA 3BRCA 3WP4A 5C71A 5FYMA 3ZMSA 3KF3A 1KP2A 3PVBB 4Q26A 3OBTA 5K4LA 4YSFA 3CKHA 1RHI2 1ZZ7A 2GH2A 4RR3B 4XW3A 1I0HA 1JPXA 2PLV1 4PI2A 4HANA 4NTYA 4HN1A 3ZHSA 2X53S 5FJKA 1DQ5A 4QQ2A 2DVBA 2PYLA 4AGGA 4N9IA 1RUH2 4BQ2A 3WNXA 3ZYRA 2VBDA 4IL6Z 5T55A 2CGOA 1SZBA 3AMMA 5J7MA 4I55B 1MZ6A 2BU9A 1LHWA 5F3IA 1NQTA 4COZA 5GZCA 2WDBA 4CEWC 4OI0A 3U0ZA 1NJIW 2ARBA 1VBB1 5A3PA 4IE0A 2AACA 1FXKA 3B8NA 3EMRA 3M1HA 1FV3A 5FZHA 4RQEA 4WVZA 3CMGA 2R16A 3KLSA 5LA6A 5T5LA 1Y43B 3ALQA 2HYXA 1VIWB 3WDWA 1LKNA 4P5HA 3WUDA 5LP6C 1HRI1 3OBRA 4MGSA 1OA2A 1Z5WA 1QEXA 1QXJA 5L7OC 3P3PA 4GB31 3SLIA 3H7YA 5C5UA 1VMJA 1GKFA 3AP6A 1XC6A 1JS9A 1PNLA 4LBQB 4IV1A 3M2MA 3C3SA 4KNCA 4MGQA 4DR7B 3U11A 2JDUA 4J11A 2A5ZA 1DG6A 4GALA 3NL1A 3E35A 3H1HH 4BM8A 2IWGB 5FDBA 2PI4A 5CKQA 2BYVE 1NTMH 3OB8A 1YJLA 1QKQA 4AI3A 2VVEA 4N43B 3A0KA 3AZYA 3PL0A 1SPPA 1XNKA 1K45A 1CVNA 3BA8A 2QQUA 3E5UA 2NMNA 3VD3A 5C9AA 2DUOA 4HYOA 1UY1A 4RS5C 2DW4A 1K5MC 4FLVA 1N8RW 5LBEA 2VCCA 4IHJA 1S1AA 4DUVA 1I5ZA 5A7SA 3QG5A 4JHZA 3LIHA 1SA0B 5FPVA 2WZ8A 3HR0A 2FZ1A 5IK7A 3AC0A 2IXKA 4LORA 5F32A 2VZVA 1MZFA 3HVDA 3RYPA 3UESA 1O3RA 4RL7A 1BSMA 4GMP0 3TXSA 4LKFA 5BPXA 4LBOA 2LJ2A 4AXOA 1Q3EA 4GZRB 1RUD1 4FPGA 3T0AA 3SJQC 1QF3A 1AILA 2TEPA 2DFBA 2A71A 2ZDIA 1BHAA 4ASKA 3PLQA 3QF7A 5FKCA 1G9DA 2E9QA 3BODA 2WZR1 1LGBA 1AVMA 2X09A 4AEDA 1AR83 1S55A 4XABA 1GH6A 3KVBA 4X66B 2AZ0A 1RUI1 2Y0PA 2XAHA 3LUTB 2QGNA 3T2OA 2ZM6O 4AVBA 2XJVA 2ZKNA 4K20A 1LJ7A 1A8DA 4GX1A 3ME2A 2ZABA 3VHPA 4XE9A 1N0JA 2LM3A 1H8TB 3SYAA 2I07B 1K5JA 4KFMA 4YW3A 1AZDA 2VZ1A 4D7TA 4UBGA 4QX3A 4I0WB 1ULEA 5BNQA 2OTLV 3S5QA 1K8AW 4N8MA 3DC6A 4LBEC 5K7PA 1W9FA 5GLUA 1LEDA 4WBNB 4UFMA 1T6BX 2WLNA 1F4HA 3CC7V 4XF0A 3WF1A 4HBNA 5FOBB 3RBZA 2F1MA 1N47A 5JDBA 3ES4A 1MS8A 1K33A 4K9SA 1T2XA 3ZSJA 3SQOA 4AYUA 4Q0UA 5DUUA 3IB3A 5T52A 1VBC1 4EN9B 3TK1A 4B29A 1Q43A 3C3VA 1DZTA 4FP3A 3BKZA 5JVDA 4A44A 3MV11 3KKYA 1O59A 1QQP1 1P7GA 4LP8A 1AJKA 4BAYA 2WLIA 4JI8O 1SQVH 3CYOA 3DL3A 4IIJB 1NX9A 5FYCA 3BTXA 1QJX1 5FO9B 1K12A 5FCCA 2Y6JA 2RDRA 3ZMNA 1S2EA 3C90A 1MS4A 4ZZ8A 1DGSA 4J7JA 2VMDA 1YF2A 4YW4A 3ZSKA 5H6QA 4OYUA 1S0VA 1V9U2 2VBPA 4YZ5A 3S0MA 3WCSA 1BQZA 3M3EA 4XXAA 1FXKC 4TSFG 5F8PA 3HKBA 4LOTA 3MW3A 4HPKA 5A7WA 1TNFA 2YC2A 2ARAA 2OIEA 2RS13 2R70A 5JZGC 2CTRA 1WMXA 3WG7B 3SH3A 3J8F2 5GALA 1A32A 3KGZA 3DGTA 1L1FA 1BZKA 1XNBA 4DV5B 2Y34A 1M4UA 2I45A 4PI0A 4WFAV 4FQ4A 5BZBA 4J7ZA 4CUAA 2YIBA 2RG4A 3WB1A 5FZFA 4MVTA 4DR5O 1SQXH 4LH7A 4UVAA 4Q8LA 3ZO0B 3GBWA 3KV6A 4XHBA 3WQBA 3ZMUA 2ZPXA 2C5DA 4HKOA 4I0XB 5CFCB 1H6XA 2WLJA 2LW7A 1REDA 5FZIA 2BCCH 5CA3A 5IAVA 3R66A 3WF0A 5BNPC 3CCEV 2P3YA 4QMAA 3KGLA 2VD7A 2MPFA 2DYCA 2ZINA 3KHBA 1Q82W 1RUNA 1X9PA 2DE0X 2YIDA 3B8MA 4Q0QA 4NRQA 4JAAA 1W9SA 5F7UA 4WVVA 2W68A 2EXHA 4KGGA 1FAYA 4XZUG 3L74H 2HLDG 2WA4A 5CA6A 1U0AA 1YVWA 2CH7B 5JPNB 4M4RA 3MO4A 2WO7A 3L9JT 4ZKTB 2VMFA 3GCWA 1W0PA 1XI1A 1GZTA 1K97A 3GBFA 2E74B 1HDJA 2JECA 4FAHA 3F5WC 4FLXA 1SZXA 4NIGA 1RUD3 4CS2A 1MABG 3WW1A 2YPDA 1I6XA 4DO2A 2EINC 3ZMTA 2JE8A 4B3TO 3AG2C 4P9OA 4CC5A 3ZFGA 4AQTA 2WBKA 3K51A 1J95A 2FZ2A 2VWJA 1VBA3 1IPKA 2Y6KA 3B9IA 2Y38A 2Q1FA 1W99A 3FX7A 1F2NA 2QDOA 1YIJV 3JASA 3LKJA 4BQ1A 3L70H 1JUHA 2DYSB 5K0UB 2Q7GA 2OKXA 1VP7A 3VQXA 4JHTA 4J9YB 1LHOA 1F15A 3USUB 5A80A 1H8HG 5H5NA 4BK4A 3SXWA 5LYJA 4AILC 3VL8A 1RVF2 1REFA 1MZ5A 2HR3A 4LE3A 2JEMA 5A2QN 3WVJA 4WFHA 4MVOA 4NHMA 1N34O 1G8MA 4XXPA 4GWMA 1ASJ1 2ZS6B 3N9PA 3W21A 4N9HA 4LTAA 5DDJ3 5LK5A 4DRXA 4YLZA 1JYWA 4LWSB 2A3XA 4CDQB 1UKRA 1VBB2 4OQ9A 1WPXA 1ODNA 4LF4O 4NPLA 1XU2A 3A7QA 3TNPB 3U1XA 3T2QA 3OG2A 3UKTA 4M3CE 4K1YA 3DXTA 5FYHA 4IV1C 3MW4A 2YU2A 2WFF2 1LEMA 1S0BA 2YV8A 3A0NA 2GNDA 1W9TA 3ABZA 3IPVA 1V6NA 2RS32 4IDZA 3N9MA 2XAGA 4NTXA 2VBBA 2QSAA 1Q6HA 3P32A 4GKJB 2P67A 4AEDC 1OCCB 4A45A 2MHFA 2D43A 3D0JA 1Y9QA 3WV6A 1C5HA 2UUAB 3UYJA 4CPBA 1FFXB 2R7EB 3VKOA 4OHZA 3PUHA 4DRRA 5IYCO 3CXHF 3HB3B 4LBQA 1IS4A 3ZHTA 4ZOLA 3M8AA 3VZOA 2XWJB 4MTGA 4BWAA 4QHZA 1JZ4A 2UUAO 1D2SA 1Q6UA 2XQRA 2G9ZA 5FYTA 2EZOA 1AI5A 3B3QE 4URAA 1K9MW 4ZI7B 4DY3A 3G6EV 4QHBA 4H44B 2W92A 1G7YA 4IV1B 4M0NA 3IDBB 1HRI2 3QD6A 5FYSA 4BHPA 5IAXA 5LMNB 1SCRA 5FPUA 4EEQA 4LFAB 5FZ1A 1ZUQA 1H6YA 3WG1A 3B00A 4LF7B 3THCA 4CCKA 5DM6V 2VULA 3F95A 2EJ7A 4ZS3A 4F3JA 5F6LB 2ZKLA 5FMOS 3AKSA 4CYDA 1IOAA 2CK3G 3RYFA 3FAVA 5T5OA 3JAWB 2ZOEB 3UKVA 4UFIA 2OCCC 1BMV1 3ZXKA 4CDUB 2QEXV 3PJYA 2WLLB 2XJTA 1L0LH 2PUSA 3AK0A 3QLQA 3RYFB 4YW6A 5IJ9B 2ZE7A 4PDLA 4KL1A 3UKNA 3FFZA 5EXOA 1UMHA 3VQVA 1CAVB 4YM0A 1KB9F 3ZFFB 5FY7A 5E16A 3CLPA 4JZ2A 5FK8A 5C93A 5CFDA 1V54B 2P1BA 1QXRA 5JXIA 4FLTA 4GB32 5I8TA 5EIBD 4LBJA 1O4YA 4Q4Y1 4UCUA 2WWJA 5E1RA 2GAUA 1SLAA 3P5BA 5JOWA 4E4ZA 3BCWA 4QKBA 2W47A 3D6EA 4BMEA 2VCBA 1PK6B 3R0RA 2A73B 4LHNA 5JZGA 2E33A 2QFEA 1PX3A 1TMF2 1TVKA 1VRH2 3KZIZ 3OW2U 5HI0A 1RP3B 1N1SA 4Z1VA 5EYYA 3LDKA 5IDJA 2WFF3 4Y4YA 3UCSC 3VDDA 3AVSA 3A4UA 4XQWA 3K4AA 2OPWA 2BBVA 1AHSA 4TV8B 5JJNB 1XMOB 2X8KA 4AVCA 2PLV2 1VMFA 5FPRA 4I5SA 2RS12 4AG4A 2ITCC 1N3QA 2VQFB 1QWRA 2XLAA 1OCZC 1QDCA 1KDKA 4EWAA 2VNRA 4YVWB 2DBNA 3GALA 3IDCB 2BUKA 1PM9A 2GDFA 5A3UA 5JSPA 4GLXA 2FDGA 2CDOA 2AREA 4LJHA 3ZXLA 1GN4A 4CP1A 5LHGA 3WP5A 3V56A 3K79A 4MXWB 3JALA 4CTEA 2Y26A 2RV9A 3C7GA 2R1DA 4A7YA 5EQUA 1I5PA 5IATA 2F4VB 2GU9A 2ZHNA 3B2EE 1AX2A 3I49A 1K92A 1TUBA 3I3MA 4A6OA 4BA6A 2B42B 1XNAA 2XUEA 3N7JA 1VB4A 2OW4A 1VB2A 4PDWB 2EIKB 3NQHA 1NY71 2W0FC 2AENA 3ABMB 1VF6A 3NRUA 4DR5B 3RVHA 2O57A 2CSGA 3WQ1A 5AC91 5L9RA 5EFUA 5KAIZ 5D21A 1XYNA 4GKKB 3N7LA 5T5JA 4FAGA 3WT3A 1XNQO 4U3FH 2WSSG 5FPOA 4LLOA 1MS5A 2P17A 3GDBA 1HX6A 4HAMA 5JMCA 5B5EZ 2W1SA 2JDNA 2ZGNA 4AQYO 1RHI3 5IUQA 3ZMZA 1YQ8A 2P06A 4B7KA 1EYBA 1OOPC 5GJ6A 5CB4A 2D6OX 4I30A 3WB0A 3ZVXA 5B4XA 2YMZA 2V5YA 4FLYA 3G6BA 4GULA 3H9AA 3E22B 4D7SA 3UV9A 1K5QA 3CJIC 4LUKA 3N9OA 3LAGA 2MNGA 5KAFZ 5KC5A 1X8MA 3OPZA 3FZ3A 2O14A 1N33B 1XE8A 4H7MA 3LDEA 4MVQA 3ZRXA 4NRMA 3DKQA 3CJIB 1CWPA 5GZFA 1NUKA 2VRZA 3CZJA 4O4HA 5E1AC 5IK5A 2BW8A 2YDEA 3I2FA 2WJSA 3N4MA 1NH2B 2OCHA 2XNDG 4AHCA 4C1XA 3UNPA 3HJRA 1VRH3 4WM7C 5LBQA 4ZXKA 5FY0A 1W0OA 4PA6A 2B39A 5DQ0A 2XOMA 4JKMA 4TQFA 4IGOA 4L8JA 4RAIA 2NMOA 4FIPC 1POV3 4QXCA 1W6QA 2PTMA 4AVTA 1QQCA 2DVGA 1JJOA 3CBNA 5IFTA 1UZYA 3HOBA 4JI5B 5CKMA 1ZBA1 3ZRWA 4FBFA 2QVSB 4Y5Z0 5CEHA 1OPOA 3MIFA 3OGSA 3VBOB 2PLV3 1DF0A 3KCXA 4NXMB 5DPNA 1F51A 1RUOA 4YXWG 1OLMA 2RDCA 1R092 4J7KA 4YRDA 5IVEA 2VW0A 2EIJC 2N7GA 4WM8A 5A7OA 5A3NA 3ZRWB 2VXRA 1LHNA 3WDYA 1DHKB 3VHNA 5KWRA 3USUA 1ST8A 3I54A 1OCRB 4NIAA 3AEIA 5KA6A 1X8EA 5EP9A 4TV9A 1VF7A 1G9AA 2WLHA 2VAUA 1MS9A 5KR7A 1SBEA 2XMLA 5J98B 4CC6A 3VKNA 1SHWB 3HKDB 2QWQB 5FFOC 3SR2C 3UETA 1K5MB 1GBGA 1NQDA 2QZ3A 1EP0A 1HN1A 5JI9A 1HNWO 1HNZO 2LROA 3FUOA 2CV6A 2H6BA 1G6UA 1L7QA 5J09A 5FXWA 4DZGA 5AFBA 1FNZA 4OHXA 1EUUA 2B46X 4P9GA 1BBT1 1NBMG 3N2GB 3HT2A 1POV1 2VJXA 1JYVA 5CG9A 3OUFA 1XU1A 4FXGB 3VBFB 4F83A 4OPAA 2VOWA 1VRH1 2J22A 3N3HA 4B08A 3W7TA 1LU2A 3LEMA 3K77A 5B1AC 4NIHA 3R4UA 4O61A 1U5IA 4LK6A 1CPMA 5F2WA 5HXMA 3CRMA 4JV5O 1VBB3 4HL0A 3INAA 4QD2A 1VF5B 4IW3A 5BV6A 2K9ZA 3D82A 2E75B 3SPJA 3NNGA 3LE0A 3TN92 2NNUA 5DMYA 4IEUA 1HLCA 1OUXA 1IKPA 1Z7S2 4QQOA 3AG7A 5FMBA 2RJLA 1LESA 2JDMA 4PCRA 4FFBA 4X8PA 3V0AB 4EB6B 4G9SB 4LKSA 4DRVA 3FWEA 2RDNA 1TNRA 3FB7C 2UWAA 1CAXA 4M3CA 4ZI7A 1GZWA 5FLJA 4FTBA 2GUZB 3S6PA 1R093 1B09A 1TQ5A 1XQ8A 4ISRA 5JOYA 2N74A 2D5HA 3O0VA 1KQRA 1IBMO 1ZZCA 4I7ZB 2UUBO 4E4EA 1DLBA 3AP9A 4Y22B 3HBKA 4HLTA 1DZQA 3NV3A 1KYOF 3O65A 1CZVA 3I56V 3WNNA 5B4NA 3KV4A 5HFMA 3VKLA 4WVMB 3CL1A 3ORJA 1YC61 1RITA 1XBFA 3LEGA 4X1KA 4CEYA 2LGWA 3BY6A 4WCEV 4XFGA 1UX7A 2BOBC 1VQLV 1QIQA 4QPGA 3J80N 2PAMA 1U96A 2Q5ZA 4LNUA 2V73A 4XILA 4UCTA 3DXRB 2G9FA 1BMV2 5EJ3A 1PZ9A 2XVGA 3K08A 1B6QA 4YY3O 3POWA 2LTNA 3WX5A 4QT6A 1VMGA 1JOJA 1OC1A 1SRYA 2YY1A 1TME1 1LCLA 3POEA 3CE2A 3DGEA 1YFYA 5FP4A 5I93A 4BXSV 4H13B 5CA1B 3RYRA 1XXNA 4GMP1 3ZFFA 2EIMB 2HWD2 2ZEYA 2DQ0A 5I0DA 2RR12 3S30A 3ZEDA 2HVJC 3OEHG 4PHZA 4YW7A 2V7QG 3G4SV 1WLWA 2WZPP 2Q73A 3IBMA 5DG2A 3W5NA 2E7QA 5C3QA 4N43A 1WLEA 2JGDA 3G7DA 5L3DA 5EJZB 3UGGA 2JG9B 4YWAA 2PYTA 4JI6B 1S5HC 4ICGA 4JI5O 1QOOA 4K1ZA 4W50A 1XE0A 4HFSA 4ZKIA 1MVEA 3H1IH 5HXVA 3Q8FA 5CFDB 4ZHNA 2RDSA 1NZIA 1JR9A 1YITV 4DIQA 5F5IA 1LR1A 5IW0A 2ARHA 4TT3G 2X05A 4J10A 4JI7O 5L9BA 3QACA 4MUVA 3LPGA 4YGCA 1WA6X 2D7FA 3RSJA 5BMVB 4AFCA 4EWEA 4I55A 5DZGA 5FAXA 2IXIA 4ORFA 5G05L 2D3OW 1RM1C 5A32A 1SFPA 4PF5A 2XKOA 4ZZ5A 2LALA 1KJLA 1RJ8A 1NG0A 2WA3A 5DZFA 2DYSC 1N32B 2ZZQA 3JUUA 4FTEA 4XFBA 3AK3A 1Q8IA 4Z82A 3VBOC 2UXCO 1K7DA 4DR6O 4X65B 2HG5C 2G38A 1NQJA 2WWWA 1JZ2A 4HK9A 1F35A 3VD5A 4DUYO 1MVQA 2NQYA 4JQRA 5C3OA 3SJBC 1GOFA 1PIV3 2F4LA 4CCEA 1US3A 1ENRA 4C90A 5IVJA 3HQUA 4AWDA 4IV3B 2CTQA 2IXCA 2AHYA 1HQLA 4J1WA 3IMMA 3BTAA 3D8CA 1XMQO 1QNWA 4DS0A 2VZTA 4XUOA 2G4IA 3VBSB 1EV12 1KS5A 4UFKA 2WAOA 3I8TA 4DW1A 2SLIA 1GICA 2VW2A 4N43C 4BIUA 1OHFA 4DFSA 1PGSA 3ZXAC 2QR4A 3A0BZ 3E1F1 2J1TA 1FPN1 5DAQA 1FYUA 2ZCWA 2H8PC 2YU1A 2SBAA 3WLUA 3MFAA 4GKKO 3BALA 2XQXA 1RUG2 3OMIB 4X65O 1O9HA 3VBSC 2K0GA 3SKVA 4MS2A 3TXQA 3ACLA 2HBUA 5A1AA 3LF7A 4UCVA 1VQKV 4OI4A 1ULCA 2E7TA 1JYNA 4H3WA 4D3WA 1X36A 4Q2FA 1AXZA 3THTA 4QPWA 5CKNA 1FOD2 2K2SA 4WM8C 1ND3B 2VU9A 3T1MA 3BYWA 5GZGA 5FXZA 5LA9A 2YC4A 4TXWA 2BP6A 2RE9A 4QKFA 2JIZG 2R9AA 3H7JA 3VHOA 1RJ7A 2HWD3 1RXGA 3J8F3 4D69A 3H1JH 1Y4WA 2RR13 4QJFB 2OT5A 2JK5C 3AYCA 3QO7A 5IWAO 3WFVA 3AZWA 2B9VA 2H0BA 1AR63 4Q5OA 4XMAA 2GTAA 3IAQA 2HHHB 4OHWA 5EZWA 1FXVA 1CN1A 3FLTA 3VBRA 1ZL8A 3NAPB 3SPCA 1OD5A 1UU4A 4MO3M 3VN4A 5KUKA 3AG4B 4JYAB 3OTFA 3S3WA 3HT1A 4NVPA 1C8M3 1H0BA 4FPCA 1AL22 3PUQA 3MZHA 4MW8A 3TEWA 4YZ1A 5JIAA 3VBOA 2EAAA 3SKJE 3ZDVA 4DV2B 4D94A 2D93A 3WY6A 4GJYA 4WZCA 1XYOA 3ZHQA 2QKAA 4DO0A 3W7XA 4UW5A 2B8MA 2GNMA 2ZXWB 2VZPA 2ZAAA 1QU7A 1PX4A 4E2SA 1PIV2 3I55V 5B1BB 3SYPA 3PJSK 4RGAA 4JGZB 1RUE2 2YGLA 3WDTA 3HKCA 1YRZA 4LF4B 2GN3A 2WT0A 3T0BA 4DV4B 4YW1A 1CP9A 1OMIA 1CD3G 1D7PM 2VNVA 1RFYA 4UW3A 1LNSA 3NJVA 4BH9A 1H1AA 2RS51 1JYTA 2UXBB 2BFUL 3VDAA 2VZUA 1BEV3 3A0HZ 4JI3B 2JS5A 2JICA 2Q8EA 1UYPA 1MNGA 4TYSA 1TG7A 2EIGA 2CY6A 4RSUA 1JX9A 5LXTB 4V1PA 2NLJC 1QR9A 1N0NA 5I0TA 1KD7A 5LGNA 5FUIA 1U5XA 1FKAO 1GN3A 3W7UA 4R9AA 4M0HA 4RGKA 4UFZA 4QGLA 5BNNA 1FD9A 2RVAA 3PUIA 1LAJA 1X82A 1VBE3 2CH7A 3WNKA 1AR5A 3EJKA 1OCZB 4DV3B 3UO3A 3T0DA 4DXZA 1BQ0A 4FLUA 1O5LA 3OGVA 4E4SA 4ZPIA 2BVVA 4XDLA 4COVA 3K75B 1NI8A 1CEZA 4X88A 5FYUA 3LDBA 1N1VA 4S2GA 1NYWA 2KD7A 4GKXA 1CGPA 4CEYC 4P9PA 1TVGA 1H9WA 4PDVA 3JALB 5IVBA 2XPJA 3JAMN 3BHPA 4FLZA 2D6KA 3NNLA 2FMLA 5FYYA 1QJZA 5C4WC 4UFHA 1QJU2 2UXDO 2ZGMA 4W8JA 4X20A 1CR7A 2DF7A 3A8TA 3AJZA 5A6XA 2VGDA 2WLIB 3TGUH 3ZS8C 4CDUC 2P37A 4C0BA 2ZGLA 3NJYA 4EZ4A 1KDMA 4JAUA 1H8VA 4LHLA 5BXXA 5F2SA 3CJHB 1FMD2 2Q1MA 1DGWX 1M1KW 5C8WA 4KXRA 2Y69B 2UUCO 1EV11 2XR4A 1W6MA 1NCQB 2CGPA 2NYYA 3E97A 2IW5A 3WNPA 4XYXA 1J3RA 3ITQA 4HETA 2PY5A 1LODA 1QDOA 2ZX1A 2QE3A 2P3KA 3ZFFC 1XNQB 3JSLA 4JI4O 4I9QA 1IPJA 5J3UA 4NPMA 4XDJA 2GMEA 4C91A 3QO8A 5JJEB 1GZWB 3KCCA 4IYIA 4EQVA 3SEEA 2HWB1 4JGYC 5CA0A 3WNMA 3SGIA 3CMEV 5I0SA 1WNSA 1XNRB 3R4DB 1F4NA 1AL23 4RQPB 4WFBV 1W2UA 2RS53 3TEYA 4LT5A 4I3PA 4MADA 1L8DA 3ENRA 3K5OA 4O2AA 3QH6A 1LULA 1V9U1 1VQNV 2UYBA 4COWA 5HCBA 2ZE5A 3CHXA 3SPGA 2WSUA 3I2OA 3NV4A 1H4HA 3ABKB 2VG9A 1RUJ2 3PUAA 3WW2A 2P34A 3U14A 1G9BA 1KQSU 5I0UA 1OVPA 4HONA 1F7YA 3L72H 3PNAA 4CDWC 3U37A 1O7FA 3B94A 4QHOA 4YY3B 2D6MA 5F3CA 1NTKH 4SLIA 1XE7A 3FHQA 2JJ6A 1OVSA 1XDCA 3D3QA 4GH4B 2D44A 3F5TA 5B1NA 1RB8G 5H9CA 4CCMA 3ZFEA 5KXDA 2IZWA 3VBHA 1OF3A 5K0UC 2VC9A 1XMOO 5HV0A 4NAOA 2VH9A 4COUA 1QLNA 1T6GC 1D2DA 1QHDA 3CZUA 1BVVA 2X5IB 4RUFA 1UX6A 4JYBA 1HV0A 4ZIBA 1GNHA 5EYPA 2E5LB 4AQ2A 1CJDA 2WIIB 2P2KA 1QJU3 2Q0OC 1SLIA 1NCRA 5KA5A 1LNQA 2QQJA 4Y1VA 3APOA 3MUZ1 1NR7A 1GR3A 3KD4A 2QZ2A 4QGNA 1B35B 3QOPA 5ABJB 2OYQA 4KWLA 5AC93 1Y74A 1VQ9V 4GT1A 5LYJB 3CB2A 4NTWA 2VECA 4BR6A 3OD0A 4QKDA 3ROUA 4AVSA 1J1LA 3J26N 2PGGA 4LBKA 5KX5A 1V6IA 1HNZB 3MI8A 4LK7A 5F6KA 1PD3A 4K8RB 3RI8A 2WR9A 2GC2A 1W2NA 1SESA 2Q6AA 4BB3A 1W05A 5FV3A 1S5LZ 3A22A 3AK2A 1W3VA 3OYWB 1STMA 1M56B 3BFRA 4DUZO 3T1CA 1LOEA 5BUVA 3AKTA 3T2TA 2ARCA 1FXHA 3ZX6A 3CXCU 1SETA 4XCAA 1REEA 1WCDJ 3MHZA 2JGUA 2YUAA 2FYUH 1VQ5V 4KWUA 2VUJA 2R061 3B5LB 1VJ2A 5FWJA 1UOBA 3WHTA 2F6BA 2AZ2A 4KQ7A 5SV8A 3PTRB 3AG2B 3L2HA 1JW6A 1HV1A 3AZXA 2PHUA 2F66C 1L7LA 3NNFA 4X20B 1R3KC 1GWMA 4N7UA 4BIFA 4WFFA 1XRUA 4QIWF 4HT1T 4QX5A 3KS7A 4GKJO 1SS3A 4MXWA 3LOBA 2VNOA 4LO6B 2VM9A 3OUHA 5FPBA 2HJDA 1RYYA 4Q0VA 2KXLA 3H01A 1J59A 3FX3A 5FNVB 1OOPB 1D4M1 2VQAA 4WV8A 2Z79A 4MW3A 4NRPA 4JKKA 1UY2A 1IBKB 4WM7B 5HCFA 2WL1A 1Z78A 2A70A 3ASIA 3RZGA 1OF4A 3KV5A 1AI6A 2JKXA 1YFXA 1GFF2 2VQ0A 5DG1A 3WB2A 1IGOA 5LEJA 3K2OA 1URFA 3EFFK 1BT8A 1EY2A 5DDJ1 2XVKA 3A21A 1K34A 4NPRA 1XSRA 1WB7A 3CD6V 4HSLA 1YHQV 2LFSA 2QQPA 2HWC2 2RJ2A 1SCSA 2XAJA 4CUGA 4B1LA 1I1EA 4YIOA 3VB9A 4P02B 4YW2A 2ZHKA 1PGW1 4C0HA 1H2MA 1ZZ8A 2FCVA 4JF3A 1SQQH 4Q20A 3HPNA 4UVBA 1TME3 4BCUA 4GB33 3BCCH 3N2KA 4OLLA 3W20A 4LBMA 3HPLC 1RPOA 3LIGA 5L7OA 2QCSB 5BR8O 3JB4C 2YXHA 4RYDA 4BJ0A 1JH5A 4L99A 1W06A 3WW4A 3ZYBA 2VQEB 1GV9A 2JG8A 4RR3A 2BDRA 2DCTA 3OGRA 1H2SB 4Z1MG 5K8SA 4BYYA 2V4DA 2YXYA 4FM1A 2JB8A 4Y1YA 1DLLA 2ERFA 3POYA 2Z0AA 2Z2SB 4DV1O 5KBFA 4OPHA 3CJIA 2ZGRA 5C3SA 3DN7A 1PPJH 3E89A 2XHBA 4CZZA 3E6DA 3RZHA 3O12A 3TNQA 4QPGC 1WW4A 2A3YA 4N90A 3LSEA 2QM8A 2BEOA 4BQ4A 3AKRA 1KBHA 2R1BA 5IY5B 3B93A 4RD7A 2JRIA 2DWDC 3HKCB 1YXBA 3JARB 1W8NA 3N36A 1D2QA 1XPWA 5IWFA 1OHHG 4IETA 3FB6C 1QGLA 4CEWA 4RFRB 4OMDA 4CA9A 3RZKA 5KXCA 1S0IA 4JV4A 2YI8A 4DXTA 3E6CC 2UXXA 1DGRN 3GCXA 3LGRA 1V6KA 4L92A 3RMYA 4MGZE 5BMVA 1HRV3 3VV1A 3NR7A 5DXDA 2BWCA 1YI9A 1QXPA 3JAKA 5LBBA 1H4GA 3AP7A 1COV1 4FOWA 3T1HB 2VQEO 3FC0A 3ZYHA 3WUCA 2ID4A 3H8UA 5DECA 5L3GA 3GXUA 1BK0A 1I7FA 2HWC3 5IYDO 5J2TA 3THDA 1XNDA 4GCZA 2OUHA 5C4WB 3ZN0A 4JI3O 5JLVA 3AP4A 2RMU2 2YBPA 1W6PA 3BA9A 1GYKA 3SJAC 3POGA 3GBGA 2GN7A 5D8AC 2G9GA 1KGYA 1PZ7A 1BZWA 4W6YA 1PVC1 2P4VA 1GRJA 1BJQA 2F4VO 3C7OA 1K5SA 2JEUA 1Q5OA 3WZ1A 3P3NA 3VD7A 4R50A 3T3YA 5FBZA 4JTOA 3N9QA 4B3RB 4FT8A 3TB0A 3TBDA 5LW9A 4UWDA 4Z2WA 4P08A 2PF4E 2OCCB 3RRDA 1Q8VA 2Q69A 3PN1A 2UXCB 1EAH1 5LXTA 1F8VA 4YG3A 3T1YB 4XDOA 2DCZA 1NOVA 1YJKA 2E32A 3ES1A 1SERA 1CX1A 1QJY3 3B69A 4YG0A 3OGGA 3PUSA 1UZ0A 4ATEA 4JI7B 4LFCB 2A79B 1POQA 2RJKA 4XAAA 4GZ9A 4LA3A 1EN6A 3PTYA 1ND3A 3CMAV 1L3JA 3E5QA 3T30A 4IEYA 2R041 3FE5A 4QX2A 2RM23 4L0PA 1QHTA 4M4PA 4JTNA 1BHGA 4O9EA 4Q4V1 2CYFA 2ADQB 2XT9A 4NR1A 3IC7A 4UF0B 2XBO3 5FR3A 3JD3A 1ZZ6A 4GUNA 3THOA 4Y1XA 5CBLA 2IFWA 1QOTA 3WNOA 2KB1A 1WCQA 3K4DA 1UY3A 1QY4A 2OTJV 2CAZC 1P8JA 1AP5A 4CXXA 4BW9A 4NJ4A 1S4CA 5KMGB 4FFIA 3VBFA 5K9YA 5LRSA 4UB8Z 1AJNA 3VZJA 1DYKA 2ZGQA 5CYYA 4Y33A 5JOZA 1PKXA 3UGFA 2WZR2 2ZD9A 4G28B 2RMU3 3IFXA 2OS2A 4U3JB 4R4ZA 1NE6A 4LR3A 3NVCA 5E6HA 2NLRA 4B3MO 3ZIWA 4XUNA 2XXZA 5JCOC 2D6PA 5F5QA 1IQAA 3ABTA 4BQ5A 1W8WA 2HWB3 4ZXEA 1WA4A 4JYYA 1C4RA 3ZN6A 1EUTA 1GAXA 2BFUS 2JE7A 1DYPA 3U4XA 2OQ6A 1N1TA 4IEWA 1OA4A 3ZHVA 4YFZA 1FXZA 5HBAA 2C9KA 1LU1A 1FFXA 3D3AA 3RT3C 3LEIA 2JG8B 1UPIA 5LMNO 1I94O 1GM7A 1Z5VA 2DUPA 3RJ2X 5KLVH 5FY8A 2CL2A 1RGSA 3ATGA 4X1YA 3UO2A 1UCXA 5L36A 2WO1A 2ES3A 1Y76A 2BBAA 4CCJA 3MFCA 2CE4A 4UB6Z 3E2EA 1WD4A 1VARA 1IQDC 5FYVA 1NXMA 4P5YA 3IWZA 2BTVC 1H1MA 2WUHA 4OZOA 3ABUA 4AOCA 4OHVA 4AEKA 1OUSA 1V0AA 2AEZA 1JHNA 1A8MA 1IBMB 1BCCH 1URXA 2QTSA 4IUGA 1N4CA 3AG4C 3N9LA 1DGLA 2GMMA 1WLTA 3QVNA 2ADPA 4Y20A 1VE0A 2YPJA 2LS6A 3ML0A 1Z7S3 4S2FA 4A4AA 1GWKA 3RWNA 4IE7A 5KHIA 1WP8A 4B4QA 2ETEA 3MIDA 1AP6A 1C5IA 1JOPA 3QTCA 2P4KA 4I0AA 3IKWA 1PV0A 1X33A 4UCRA 5DEDA 4RR3C 1S0JA 1QJFA 2Y0IA 1N33O 3CP1A 4AHXA 4P2ZA 4PF1A 1B35C 2VUAA 1WA8A 3ZN1A 2Q4SA 2HEYF 4DV4O 1ASJ2 4AL9A 3OUJA 2HWC1 4DNYA 3K04A 3U78A 5IYZB 1MSDA 3FD9A 1SBDA 1R081 2RM22 2ZMNA 3CEWA 4Z2AA 4O4LA 1LGCA 4HNAA 3SDLA 2Z3YA 2RJZA 4D8MA 3STZC 4IQPA 1XHXA 2XAFA 5CMUA 4XETA 5A7PA 4E2GA 2FDJA 2HWB2 2ARXA 3APBA 3ZXFA 5C3PA 1OURA 4B3TB 1QVGU 5ACA2 3SNMA 3TYJA 2B1IA 1YI7A 2WT1A 3T4DA 4HNAB 4IGPA 5I8SA 2ITDC 1NLSA 3JASB 1HQWA 3VQWA 3ZFGC 4PJYA 4NB5A 4RO2A 1AR1B 4DINB 5LMUB 4IV3A 4DR6B 4XACA 5C70A 2AHZA 4QQLA 4XCBA 5A70A 2PN5A 2WZEA 1R091 2FDFA 1S72V 5I8YA 4N21A 1C8NA 2Q4PA 4W4LA 3AKQA 1WLDA 5KHKA 1V6JA 3OEAA 3FUQA 2UU9O 5FMCA 3X29B 2EIKC 2TUNA 1ZBA2 1R3LC 2VTXJ 2WNVB 4GAZA 5L3CA 4KU7A 5A32B 3PVNA 4M3CB 1J58A 4TSVA 5A6YA 4JGYB 5FXXA 1PK6C 2GTSA 4XPVA 1WCSA 5C8CC 2ZX2A 4GH4A 4KBZA 2XASA 1UMIA 2JS3A 1R1BA 1UZWA 5L3FA 4W4ZA 1X4TA 1SLBA 2CWMA 1UIJA 4META 3ACGA 3R05A 5FZ8A 5LMUO 1IXBA 2VQFO 3C7EA 1PNMA 4NHLA 4JI4B 2Y60A 2VR4A 5T5PA 1V54C 1PMHX 5JJJB 3JCZA 1CPNA 4WVMA 2IVIB 1WP7A 3PDQA 4V2VA 1R1A1 2VS0A 4R9BA 3UJOA 4A6SA 5BYNA 5FJHA 5LL6Y 3OFNG 3RYHA 2J1RA 5HFLA 3KG2A 4DYLA 2WNEA 2WC2A 3KWVA 4YGDA 3OUSA 1MMMA 1I3HA 4X62B 3ECQA 5H9SA 5FKBA 2HWE3 5FO7B 4WFEA 1SQPH 2E5LO 3K3OA 3B01A 2UY8A 4EKWA 2XUMA 2F43G 1TAEA 2CDYA 1JZ6A 1D4M2 1KEXA 1PVXA 2HWE2 3E86A 1PGW2 2GP5A 3WQ7A 2ZGKA 2D97A 3DXRA 1VQMV 4H33A 4UI9L 1C8M2 4EN6B 3OYWA 2Q68A 3I2IA 3I3EA 3N27A 2KG7A 3CC2V 3WW3A 1RUJ3 4WFGA 3OEEG 1R3JC 2Q67A 5FMDA 4OX9O 4CCOA 2QA4V 5IWAB 3CCMV 4D6RA 4DW0A 2IVJA 3CU7A 2BNMA 1LRHA 1QH6A 1AROP 2Y69C 1VBD1 1XL6A 4Q1PA 3VOUA 4CXWA 1XL4A 1UD1A 1ODMA 5JI7A 1PGL2 4KHPO 4Y24A 1P49A 1ZBA3 4I01A 1RC6A 3JBG2 4TN7A 3RS6A 5FZOA 4B8EA 2JD4A 4QWNA 3LSSA 3ZPOA 3JCIA 4CDUA 1UXXX 1P7BA 3BB6A 3LB9A 3NKTA 1JZ3A 4GH4C 3OE7G 5CBHA 1H9PA 1F4AA 3CX5F 1NA1B 1RVF1 1ULOA 3MIHA 4OUMA 3ABLB 4AQ6A 5DUWA 2ZA9A 2ZMLA 2ETNA 3HWJA 2B9UA 4KI5M 3D36C 3MAQA 3NV2A 1HQNA 5BY1A 4AZZA 2HKOA 1TUEB 5CB7A 4AHWA 2CTPA 4CH3A 2RR11 3ABKC 1NAEA 4RHV2 2ZEXA 4UV9A 2ZBJA 3W7WA 1Q90D 3FB5C 5LATA 2JE9A 4BK5A 5CBFA 2QKSA 2LW1A 4O4JB 3H8RA 4JPRA 5D2AA 4FP2A 1VLNA 4FM0A 4J6GA 3DKWA 4CP9A 4FCAA 2PAKA 1BE3H 1KKCA 2QWOB 2VWKA 3QH7A 1TMF1 3PVEA 1WA8B 2A6XA 1UQXA 4B3SO 2YXSA 1ZWIC 1Y9MA 1GOHA 1RUI2 1VBA1 2HEPA 2OZ6A 4PELA 1NT2B 4O2BB 2B5HA 3NNMA 4PJ0Z 2FDKA 4IGGA 2E31A 2XOKG 4BPZA 3WDXA 5DZEA 2F93B 3L71H 3KQ4B 4KG0A 2X10A 3FYEB 1FI2A 3BTZA 2ZHLA 5I91A 1DFQA 3N7KA 4NWWA 3EYPA 2R49A 4OI2A 2YROA 2WNUA 2ZAHA 4B1MA 3CCSV 2DCJA 4TUYB 1WKYA 1XILA 3RVYA 1ALYA 5EHDA 3LA3A 4OVEA 2NP0A 4PIZA 3DPRA 4PDRA 1Z2GA 2JKBA 4MTOA 1Y66A 2QQKA 3VBSA 2C2AA 2ET1A 3MPPG 1R6TA 4L97A 5EK0A 1V55C 1DDLA 1BS3A 1ENSA 3WF4A 2EIBA 2P5BA 3VBUB 5FLHA 1XHZA 1OZ0A 4M00A 3MW2A 3GF6A 2HP8A 2ZX4A 1PMJX 5A33A 3BVOA 1DGRA 4DR7O 1M93A 4CU8A 1VQ6V 4RQPA 1A34A 4YARA 4LNUB 2ZNJA 1AL0G 3I3QA 1KD1W 3UQ8A 1JMKC 1RUC1 1PNGA 1QNMA 1I08A 1SLLA 4D0QA 2GHYA 2CUGA 4QDQA 1N36B 3ZMVA 2NPIA 5FY9A 1BKZA 3VD9A 1WBLA 2MEV2 4QX8A 1WAZA 4P14A 1ROPA 4J9ZB 2IBZH 4OX9B 4EN7B 4EN8B 2KR2A 5SV5A 5KXBA 2DCYA 4MOAA 1KJRA 1YLLA 3ZR5A 4DUWA 1PO22 1Y7BA 3C3TA 2UY9A 2FDHA 3LDDA 4XBQA 2O1QA 5J96B 2XH6A 2AH2A 1J5EB 2LO1A 3JARA 1O3TA 4EV0A 2OVUA 2EIJB 1WB8A 5EYXA 2YICA 2FQPA 4IT5A 2VMIA 4B3SB 5F2VO 3FLRA 5FPZA 4LO8A 2R0FA 2B5UA 4XOGA 3IT8A 2J1EA 1PM4A 3K3WA 5GLVA 2W1WA 2VQUA 4JQTA 1NLQA 5AVAA 1LOCA 2C1FA 1WW6A 4CUBA 4DR2B 2J1SA 5IT6A 3HMYA 2CNAA 4E8CA 2DVFA 4UCOA 2XB6C 4PLNA 5FZLA 1SLCA 3K5LA 3M3QA 2ET7A 4ZHQA 1IHMA 2ZJCA 1FOD3 5J37A 2ZGPA 2YEVA 5FPXA 3AKPA 5AC92 3ZN4A 3W58A 5C9AC 4IXLA 3DYMA 3ILRA 4Y3OA 1FOD1 1M90W 3B02A 4AHYA 4QGMA 4Z92B 3OTOO 3MDSA 1NVPD 2IXLA 3AMHA 4X89A 2HYKA 3O1OA 4BMBA 4NO4A 2XLFA 3WG2A 5LCWL 1JXNA 1VR3A 5DAPA 1E1QG 3OBAA 4XF1A 3POSA 4GIQA 2V72A 3UGHA 4HVOA 2RS52 2UWBA 1ND2A 4MYEA 5JQGA 3MIEA 3O1SA 2X0LA 4FPLA 4QM9A 4MG2A 2VOXA 4Q6GA 1M06G 4LMFA 1DQ6A 2RMU1 2ATKC 2UU9B 1PO21 1HRV2 5H9RA 3B7MA 1OBNA 4MGTA 4K0KB 5KHHA 5H2FZ 1UOGA 2VNGA 1ZAUA 1DF4A 2QDRA 2JGDB 5JXHA 5GZDA 2X6BA 4IEOA 3A2FA 3TOJA 4W65A 3K0GA 4Q4W1 1F5FA 3WCRA 5FTTC 4OGQB 1W2AX 4FFGA 3OMAB 2QNKA 4XBFA 1HB3A 3E5XA 3IPVB 2A6YA 4PQQA 2R072 3HR9A 4I02A 1D4M3 1M9NA 1NCQA 2FHRA 3ABLC 4JV5B 4LCUC 4IE4A 4MH0E 3NW4A 3BGAA 3J81N 4AEJA 3ETDA 3OGCC 1JBCA 2BJSA 4RHV1 4DV0B 1HNXB 4GWJA 5D5PA 4E2QA 2W6JG 4UUJC 1AR73 3BN6A 4JGYA 2FDIA 3WDVA 4TUYA 2WO2A 3U07A 2IXJA 2BPA2 5JIUA 2FTKA 4XAEA 2KA3A 5FOJB 1QJY2 4AI8A 2LP7A 3LDRA 5DAVA 5LASA 2QJVA 1ZRDA 1F23A 2JIJA 4DEQA 3IM0A 3VHRA 1Q56A 2EAKA 1OPMA 2WNUB 4RQFA 4FPFA 2V1DA 3OPWA 3UJQA 2DTYA 1BYHA 4H2AA 2W52A 2YC0A 4C1WA 2YZ4A 2YGMA 2C4XA 1BCXA 4HKLA 1PVC2 1K3EA 4PIYA 3RYHB 4ABMA 3L73H 4EFBA 3CNAA 1RHI1 4Y1ZA 1Y4MA 3CQOA 3LFIA 3ZYFA 4P9LA 5FP9A 4CVUA 4EYUA 3ZSEA 1RTVA 1VBE2 5JSOA 3USSA 3OMNB 2ORZA 1D0HA 4A7ZA 4ITCA 4Y5SA 3RDIA 1VQPV 3SITA 3WXPA 3W9AA 1ACCA 1AR62 4U3JA 4PDMA 4IYHA 4KH9A 5H6RA 3NAPC 3M7AA 3QCWA 1CAUA 3HD8B 2BE3A 2JD9A 5LOVA 3I2JA 2A06H 5ITZA 5C8CB 2AYHA 5ISLA 1LECA 3V0BB 2HEVF 1RUI3 2VOTA 1W28A 1RUF1 1OKQA 1AR92 2Z42A 2XTAA 4GYCB 1F9KA 5JOXA 3JD1A 2Y6HA 2YFZA 1JVMA 2FCTA 1N36O 4B3MB 1W6NA 1E5SA 5JAXA 1UXZA 1AR93 2WWSA 3H50A 2DWRA 4MTFA 1GNZA 4BWOA 2EICA 3LDCA 2L9LA 4I4TA 1PP9H 4XURA 4DUYB 4GX5A 2RNBA 2WYSA 1IDSA 1PL0A 2W6IG 4INDA 4XFIA 1IKQA 3T08A 1JOBA 1MA1A 4E2LA 2R6QA 3AXEA 1ND3C 3AG3C 3CRAA 1SA0A 3IGAC 2A1XA 2OIGA 4I0BA 5E89A 5BNNC 1OV9A 4QU2A 5B3SB 4CRQA 1NLRA 1UPGA 2YSUB 5A7NA 5B1BC 3FMGA 1HN0A 4R7CA 3AMQA 1CQ9A 4W4KA 1FNYA 1YYNA 1DQ1A 1KITA 4YM2A 5IVVA 4FMTA 2QTWB 4JX0A 5JPMB 1L0NH 3I3BA 3K03A 1DP0A 2Y6LA 5J2UB 3WNLA 1OJHA 1UN1A 1LOAA 3C2UA 3EXUA 4PIXA 3RN4A 3CCJV 2DJVA 4MVUA 3M7MX 2I74A 2O8OA 1XOYA 2Z4FA 4CSWA 3WF3A 4Q4Y3 2CGNA 3S3XA 3O7OA 3CRRA 4BQYA 3CJHA 1FJGO 5LWBA 4FO9A 4HVRA 1R6KA 5A9GA 4LFCO 5F39A 1DLCA 2L35A 1ZLZA 5KUMA 1DQ4A 2Q5TA 5C4WA 1V6LA 4JDMA 4ATFA 1VEWA 5D1IA 1EV13 1OLRA 3NWKA 3ZSLA 2LGQA 4G3YC 3OGJA 1UZZA 1N32O 4L8QA 4AFAA 4X9QA 1NTZH 3WOGA 3LNMB 1R6NA 1VP6A 4ZU7A 4LWSA 2WYFA 3SEPA 2MK3A 1OI6A 3VBUA 1AJQA 4LBQD 4X66O 3AMNA 4WM7A 2PHDA 1YJWV 1YXWA 2BSKB 2QQNA 1H2KA 2ZTNA 3LPFA 5EJ1B 1F4MA 2JX9A 5A1LA 1MOFA 4CDXC 1FXKB 4K7JA 3EXAA 5C8YA 5IT9N 2F17A 4XJAA 2DCKA 2VQTA 3JATB 5JWPA 5G04L 2ZHMA 4ES9A 3E22A 4K3AA 4L2NA 4UAPA 1TZOA 1BL8A 5KMGA 4LF5B 1SKVA 2UWCA 3FFQA 4O9GA 4ARXA 1G1XB 1GLHA 4XMIA 3WG3A 4PQ9A 4X64B 4IIJA 1RVF3 1SEFA 3NV1A 1VBC3 1E1RG 1AJOA 3B09A 3X2QC 1XEQA 2JVDA 1CAXB 2ZQMA 1UYZA 2D40A 4UFJA 3DTUB 2ZEZA 2YB7A 4CCCA 2PZSA 4EFEA 1DK1A 4I0XA 5CFCA 4O4HB 3VZMA 5IHRA 1UU5A 4OQ8A 2Y4TA 4Z07A 3LCPA 4A41A 4IGQA 4GKYA 1KMIZ 4P9XA 2YBSA 4IESA 4XDKA 4BIZA 1CJPA 1AYN1 4XFCA 4NWVA 3WG7C 2QQLA 4YG6A 5GLWA 3VDBA 2VOVA 4HVQA 1YNAA 1AR61 5FXVA 3MF9A 2PHWA 1AJPA 2AXTZ 4FQZA 2HWD1 5FZBA 1EPWA 5B1AB 1RUE3 3BPSA 1MQTB 1LHVA 4XZPA 4DPNA 2CTVA 2YIBD 4FJCC 1C28A 2DMXA 5CVRA 2A3WA 1QH7A 2WSVA 1UU6A 1RINA 4CE8A 1OD3A 1RUF2 1S2KA 4IEZA 1WD3A 4QPKA 1Q8OA 1Q8PA 3DSQA 4OFGA 3CCQV 1EZVH 1QJU1 4YVSB 1IS5A 2IH1C 3MUY1 4B4RA 4K0KO 4TLGA 1BEV2 3VLBB 2IH3C 4LITA 3RNSA 2EZPA 3IMNA 3K0DA 2XJUA 2VMGA 1PMIA 4Y20B 1VRBA 1ZX3A 2TBVA 2DOSA 5FYZA 3RYIB 3CS5A 1UW8A 2E7AA 2Q30A 1QMJA 1BLZA 3TAYA 1DF5A 4I3GA 4LR4A 3VBRB 3AFKA 3K4ZA 3SC7X 2WNUC 5FZDA 1Y76B 1SACA 4NMIA 1S2BA 3H3LA 1D0GA 3IJ4A 2AGAA 4FOVA 3WP3A 4IEPA 1GM8A 3ZRSA 4YVWC 1PIV1 4NKGB 4I4TB 5FNVA 2V09A 1Y74B 1JZ7A 2GC1A 3H1WA 4CDQA 2XBO2 2BTQA 3K3NA 2Q8CA 4A7KA 4F6RB 1H8EG 1PVC3 3HKEA 2FCUA 1O6UA 2AZ5A 4X6QB 4QPIB 4TTGA 4DK0A 5LBFA 2R042 3RG0A 3NO8A 3PJQA 1WLCA 4RQPC 5LHHA 3RGBA 3AG1C 2EA7A 3I2HA 3VKFC 5JXGA 2WN2A 4JASA 3OY8B 5E88A 4JI2O 1K73W 4PDWC 2WLKA 4AFMA 4ZONA 1CPYA 4ET7A 4CDWB 1FPOA 2DFCA 3SYCA 5EBLC 3RZJA 1OA3A 1VBC2 4CDXB 1N34B 4QE7A 3H3UA 5LEKA 5L3BA 2M6YA 4CCLA 1BEV1 1AR71 3V0AA 2P6CA 1PGL1 5L9VA 2VO5A 5L7OB 1SZTA 1KECA 1LUWA 4P9WA 5FK7A 2JB4A 4F8AA 1V9U3 1ULFA 2IU3A 2YG0A 5DUVA 3SHRA 4PLMA 4DV6O 5ACA1 3D5OA 4N23A 4LHKA 4YZ2A 1G86A 3H8OA 3D3IA 2BOIA 2A6WA 3ZYJB 3MBWA 2ENRA 1FX5A 4HSJA 1Q81W 3MLJA 1JU4A 1W9YA 4QX1A 4YJ2A 1UFIA 1S76D 4U36A 1ULPA 3KM5A 2AEYA 2WQZC 5A7WB 3FN9A 4PLOA 3BIEA 5CAZA 2HWE1 4YM1A 4FOQA 5CIRA 3UK9A 4A42A 3WDUA 2YBKA 3OSDA 1Q7YW 1HIXA 2LW8A 1C8M1 3RMXA 4CU6A 4FPHA 1MS3A 3H0OA 3WF2A 1RUF3 2E6VA 2A9HA 2VW1A 3DC5A 1JUIA 1SQGA 1SFYA 3MD0A 4LO7A 4DV7B 4O4IB 3W7SA 2GZWA 3KQRA 3WR0A 1BQPA 1NY72 4DV7O 2ADEA 4OHYA 1UOJA 2DU0A 5D8AB 2UUBB 1P4RA 5JVDB 1RMU3 4HOOA 3KHCA 2DYRC 5BNPB 5LP6B 3ZSMA 3MDPA 2E76B 2GC3A 3AG3B 1US2A 3URFA 3JB8A 1GM9A 3ZKUA 1V70A 4LIVA 4JYAO 5FZ3A 2W08A 1ZBE1 1ZRRA 1B04A 3I59B 3MIGA 3AK1A 5IY5C 1WMFA 4X64O 3CRCA 1MS0A 3S5AA 5J2TB 3KSCA 1YFUA 2D98A 1ZL8B 3NAPA 5CNAA 1CAWA 3CC4V 1W90A 4LOSA 3CSXA 4XFHA 2Y8KA 5A6QA 3FBMA 4AW7A 4DR1B 4QQHA 5JVVA 3WQ0A 1YCIA 5GZEA 2D3SA 1CIWA 4HPKB 4JDNA 4QKNA 1WPBA 5FP7A 1ZNPA 3UL2A 2ZXWC 5F5CA 2BTOA 2RDQA 5EIYB 1GQGA 2DV9A 4RS5B 5C9AB 1ZZ9A 4P30A 3F7YC 3FJSA 1FJGB 2XKPA 2GNTA 1YO8A 1HR0O 4DUZB 2Y64A 4CCDA 4DV2O 5FYIA 4XF3A 1DU3D 4DR3O 1TVKB 2W1QA 4JTAB 3Q9OA 2WFPA 3O1UA 1D5AA 4XVHA 1W6NB 3FHIB 4NOTA 4JI2B 1C1FA 4BW5A 3EHKA 4QPIC 3VDDB 2D6NA 2OPKA 3E83A 3O5SA 1AB3A 5LA1A 2BGCA 3GZUC 5FY1A 2LFRA 5J48A 3D36A 5EPAA 4HXCA 4QM8A 1IVSA 1WMDA 3APQA 4NN0A 1BBT3 3ZM8A 1VQ4V 1X59A 4AEDB 1JMUB 2Q8VA 4DXSA 5FZMA 1XYPA 4R8CA 4QGPA 1ZX5A 3M3OA 1UJWB 2PAEA 5DN6G 4BQXA 1UMZA 1IZ3A 5LY2A 1VIBA 4EJRA 2BWAA 4ASUG 1RUC2 4JGSA 1LHUA 1R082 5FWEA 3ZCCA 2DN9A 4BQWA
chains in the Genus database with same CATH topology
2F4PA 4M2FA 1Z7S3 2MNGA 4S2FA 5KC5A 1X8MA 3OPZA 3RWNA 1C1LA 5KHIA 5LK7B 4OZXA 4RFT0 3FZ3A 1XE8A 2ETEA 2RS33 4H7MA 3MIDA 4B4QA 2NZ9A 1C5IA 3LOIA 4XFAA 2HWF2 5H9PA 4I0AA 3VZKA 4YM3A 3IKWA 1MEC2 2PHXA 2XG3A 1X33A 3CJIB 5GZFA 4ASLA 4PBOA 4Q4W3 4S2DA 4RR3C 1QQP2 1S0JA 1ENXA 1H8TC 2Y0IA 5IK5A 5GLZA 4GMP3 4AHXA 4YW5A 4LO4B 1B35C 2BW8A 2YDEA 5KXEA 3RI9A 1QJX3 2VUAA 2WJSA 2Q4SA 3N4MA 2W39A 2HEYF 1U5YA 3K48A 1ASJ2 4U2AA 1M4WA 4C1XA 3PMSA 2HWC1 3JZVA 4DNYA 4XF9A 2JDZA 4MX3A 1VRH3 4WM7C 1AX0A 4ZXKA 1W0OA 2B39A 1SBDA 1R081 3B9CA 2RM22 2ZMNA 3RPQA 3CEWA 4LA2A 2NMOA 1POV3 1VAKA 1W6QA 2PTMA 4AVTA 1LGCA 2DVGA 5A33B 4Q4X1 4IQPA 1UZYA 4AGRA 4FPYA 4MGYE 4XETA 4E2GA 4L9BA 2Q8OA 1HXS1 1ZBA1 2WLQA 2QVSB 3LA2A 4FBFA 3JBG1 2HWB2 4Y5Z0 2ARXA 1F5JA 3APBA 4P9YA 3ZXFA 1FPN3 3HN1A 1LOBA 1OPOA 1OSGA 3MIFA 3VBOB 2PLV3 1DF0A 3KCXA 2R073 2XL7A 2GH8A 3ZYGA 2QDNA 2HEWF 3CJXA 5ACA2 3SNMA 3TYJA 4Q4V2 1IS3A 2Z5WA 1RUOA 3VUOA 1S0DA 1YI7A 4JRAA 2WT1A 1NXD1 4R8HA 1ULGA 1FPN2 4W6WA 1R092 5I8SA 1NLSA 4OUSA 1HQWA 4YRDA 2Q1ZB 2P3IA 2VW0A 3ZFGC 3MLLA 4PJYA 2XJSA 4DINB 4WM8A 2N7GA 3VBUC 4IV3A 4QQLA 4KWKA 3THPA 2VXRA 4HK8A 1LHNA 2PN5A 1UF2C 2AR6A 1R091 5I8YA 3WDYA 1DHKB 3V0BA 1C8NA 3VHNA 5KWRA 4M2EA 4DB5A 4C8RA 4RGGA 3USUA 4IV3C 2BVBA 3I54A 2OUJA 3AKQA 2RS31 1WLDA 5E8AA 5KHKA 3HAGA 1JN2P 1X8EA 1V6JA 1G9AA 3FUQA 2EVXA 4RHV3 5T54A 1MS9A 3X29B 3I4IA 1SBEA 2FMYA 2TUNA 1HXS2 1ZBA2 3VL9A 2A6VA 4S2HA 3I59A 5J98B 2WNVB 4XJ8A 2D3RA 4KU7A 3VKNA 5EWSA 5A32B 1MACA 3PVNA 1W6OB 3WINE 4M3CB 2RHPA 1J58A 2XL9A 4F7ZA 2C9AA 4TSVA 1OIHA 4JGYB 3EBRA 2WBQA 5FFOC 2CAVA 1PK6C 4KU8A 4XPVA 4XJZA 4URTA 1WCSA 1CONA 1K5MB 4AI1A 1GBGA 3JD71 5C8CC 1NQDA 2ZX2A 2QZ3A 1EP0A 1X7NA 4GH4A 2GC0A 3RYKA 1V6MA 2GALA 1SLBA 1D4VB 4I09A 2CWMA 5JI9A 1UIJA 1PK6A 4META 3MYXA 3R05A 3FUOA 2CV6A 2H6BA 2Q0AA 1OLQA 1W39A 3ILNA 4CDQC 1VZ4A 2XGXA 3DUIA 5J09A 3KT1A 3MEPA 3SMHA 4DZGA 4YVSA 4NHLA 5AFBA 5T5PA 1FNZA 3IIAA 4OHXA 2B46X 4P9GA 2TNFA 1BBT1 4WM8B 3O0WA 4TZDA 3HT2A 1POV1 4XF4A 5CG9A 1CPNA 4WVMA 1XU1A 1KFUL 5L19A 3GHMA 4FXGB 1S0EA 1UIKA 4K6BA 1BVP1 1R1A1 5KHJA 3VBFB 4F83A 2VOWA 4R9BA 1BBT2 1VRH1 3UJOA 3AYAA 3ZFEC 4AVAA 3LWCA 3V15A 5BYNA 1CESA 1RUJ1 3WD5A 3M70A 3N3HA 3M8LA 1LU2A 2WNEA 1QU0A 2WC2A 4YGDA 3AP5A 3EO6A 3R4UA 3VDDC 1U5IA 1CPMA 1I3HA 3AMPA 4W6XA 3TN91 1VBB3 3JD73 3INAA 3MPBA 3ECQA 4HL0A 2JG8C