2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
5JWPA 2CGNA 4BIOA 2W0XA 3OD4A 1H2MA 2ILMA 2YDEA 1YCIA 3KCXA 1MZFA 4B7KA 2Y0IA 1H2NA 4B7EA 1H2LA 2WA4A 4Z1VA 1MZEA 4QU2A 2WA3A 2XUMA 3KCYA 4AI8A 1H2KA 4Z2WA 2CGOA 3P3NA 3D8CA 2YC0A 4NR1A 3P3PA 1IZ3A 4JAAA
chains in the Genus database with same CATH superfamily
3H3LA 3RZKA 1UPIA 1XYPA 4I0BA 4IEUA 4XF0A 1P7BA 1EN4A 3A0KA 4AFAA 3B8MA 1H2LA 3L70H 1W2NA 2HLDG 3ENRA 2F1MA 4QPWA 1GANA 1XEQA 5B1BB 2UUAO 2F43G 4IE4A 5EWSA 3QD6A 1NA1A 1XNDA 2XJRA 4ES8A 5JZGC 3HD8B 3OB8A 1HR0O 1OQ1A 4JRAA 2EIKC 1OLMA 3U37A 3I54A 5FZ8A 5FRAA 2K46A 1QLNA 1FJGO 4DY5A 2WRAA 3IN9A 4X64B 3OEAA 1JZ6A 4C0BA 4K0KO 4O4JA 2ZOEB 3E97A 2QQWA 2QQKA 5C3RA 1PGL2 1KBHA 1OFNA 3VDBA 3TK1A 4L2NA 5K0UA 2BJSA 4D0QA 3JQWA 3HNMA 1MNGA 5A2QN 5FO7B 2OUHA 2NN4A 3JAWB 2ENRA 2AHYA 2ETEA 1YO8A 4IE5A 3AX4A 2YGMA 2RS32 1HRI2 3M8LA 2HEWF 1Q6IA 2BYVE 4N53A 1QDCA 4ZS3A 1JFFB 2A6XA 3FB7C 2BCCH 1PMHX 1CAVB 4P9OA 1F8VA 5LP6B 1TUBA 3ILNA 4TZDA 2Z79A 3JD73 1FS0G 3ETQA 4LBJA 3THCA 5FZMA 1W9WA 3N4MA 2D6KA 2KB1A 1M4WA 4BOWA 4J25A 4GWJA 2WABA 1RL3A 2VMIA 1HB2A 1RUF3 1VALA 5SV8A 2EIJB 5H5NA 3I56V 5C5UA 2EINC 1W8WA 5LHGA 3LDEA 2DVGA 3BALA 1NYWA 1YJKA 3J7AU 4MGIE 3H0OA 1CD3G 4ES9A 1XL4A 4W4KA 3WW1A 1GYKA 3GCWA 5T5OA 3A0BZ 1UY2A 3H7YA 4TQFA 4F6RA 1JYXA 1FXKC 3HOBA 4PA9A 4J41A 1UYZA 1LCLA 1URFA 2ZKLA 3F7YC 3VZJA 3KV6A 2WSSG 1AVMA 2D3OW 1QKQA 4NXNB 2ZBJA 2JS5A 3JBG2 2BUKA 1WMXA 3IIAA 4DV6B 1CPMA 1FXVA 1ZBA1 1UMIA 2D93A 3AYDA 2ZT9B 1CIWA 1OPMA 3H42B 2L9LA 4U3JB 5L3DA 1PIV1 1UY1A 4K1YA 5EP9A 4CUAA 4FPOB 4FVVA 4I50B 2RS13 4LBMA 2BGCA 1ULOA 2PYLA 4CPBA 2ZXWB 3A0RA 4NXMB 3JD2A 1RHI1 2QCSB 3BCCH 4HKLA 1M57C 1NA1B 2Q30A 3FAVB 4AVTA 3E83A 3OAAG 1KKCA 4J7KA 4A6SA 3F7VC 1NVPB 3NAPC 3ILRA 4AI2A 4MVTA 3U75A 4O2BA 2O0OA 4GKJO 1RPOA 3F95A 4XCBA 2R70A 4XAEA 1C4RA 2FZ1A 4JQRA 1ASJ3 1GZCA 4LJHA 2GHYA 4G28B 3WEZA 5JLVA 4QNHB 5K0UB 1DQ0A 5B1AB 4DW0A 4E27A 4KMQA 1ND3C 4GH4C 3SGIA 2UY9A 3ZSLA 2QM8A 1W2AX 3C3SA 4UB8Z 3WNKA 2UXDO 1I94O 1JZ5A 3TEWA 4FCAA 3RI9A 3T0BA 1X82A 1LGBA 1N34O 2X53S 5D8AC 3ZN1A 1O91A 4DXWA 2IVJA 4FFGA 3SEEA 1DP0A 4RWUA 4UB6Z 1DLBA 1OBNA 1W9TA 5JMCA 1DGWX 3LD8A 1LU2A 5JR7B 3JB8A 4L9BA 4PJYA 4GT1A 4HVOA 3WW3A 3FLPA 1ZX5A 3O0XA 4IEYA 4LF5O 4GYCB 4RHV2 1FI2A 5FPXA 2HEPA 4XUOA 2VBDA 4B3SO 1ND2B 1U5ZA 2HWF2 4TWKA 5LCWL 4XDOA 1S0DA 2ORXA 4AW7A 1BK0A 1W2BU 3WDVA 3A2FA 2IXHA 1RUD3 1RB8G 3POIA 1PGL1 2G4IA 5F5AA 1VP7A 4J1XA 5JQGA 1FX5A 4ZY9A 5JI9A 2TBVA 1YQ2A 3P3PA 2HFEC 2RS31 5JXJA 3BTZA 1HRI1 2QTOA 4NKGB 4OI0A 4ZKTB 4IXLA 3FKSG 3QO8A 1YZBA 3MW4A 1L7RA 2CAZC 2H3OA 2DBNA 1PK6A 4NTXA 2WWJA 3K51A 5JSPA 3AMMA 4CDXA 1UZYA 4LFCO 2VECA 4GX0A 5C5TA 3U11A 2VNGA 1DGLA 3QVNA 5J1XA 4KWLA 4LKEA 4P00B 2CWMA 2Q8OA 5IYDO 1GN6A 2R1BA 1NZIA 1K97A 1W0OA 3HKDB 3CHXA 1KGYA 1JBCA 5CB4B 3X2QC 2E32A 4C8DA 1Y7BA 3THPA 2VZUA 4ZS2A 2BNOA 4O2BB 4M3CE 4TSFG 4GWIA 5GZEA 4NRPA 4L11A 1W04A 2GTSA 2JGDA 4Q1PA 5HFMA 2XWJB 3BOWA 1FD9A 4X1KB 4F3JA 4G27B 2X7RB 5JCTA 1X59A 4FPEA 5A80A 1YFYA 1CAUA 2XMLA 1OHHG 4FFKA 1N33O 2BRTA 3JBG1 2RQ6A 4NIDA 1Q8OA 4CEWC 4GMP1 1SZTA 5CVRA 2WNVB 2EXHA 2YS8A 1I9RA 4AFBA 4WZFA 3ZN0A 1ORQC 1M06G 3TXSA 4UW6A 3ASOB 5HV4A 1GV9A 1CZVA 4X65O 2DVAA 1UMZA 1NS1A 1IBKB 3SYOA 2VAUA 4Y1ZA 1LUWA 1IKQA 5C71A 1V0AA 5LK7B 1O3SA 3KV5A 5IT9N 5FZEA 1LHUA 1I08A 3UESA 4H14A 1XC6A 1MZEA 2E63A 4LUKA 2Y64A 3JD4A 3M3EA 2R30A 3FMGA 1XI1A 2EIGA 4NHXA 3JAMN 4QXHA 3IDAA 1RUC3 4QM8A 3KCCA 4DRRA 3BU7A 1IG0A 3ZDVA 4QX2A 5LGNA 4YW3A 5LB6A 4S2GA 1W06A 5JQGB 4NOTA 5FY5A 3VBUC 1HLCA 2B5UA 3SPGA 1GQHA 4B1LA 4W6XA 1JMKC 5FZOB 4E4ZA 4LE3A 5L36A 3O5SA 5EBLC 4DV2O 4R52A 5ABJC 2PY5A 4NIGA 1DGSA 1PK6B 2JD9A 3P5BA 2XQXA 2YI9A 1JZ4A 2Z42A 5KHIA 2PAEA 3POJA 1FXKA 5FZKA 1RVF2 2NMOA 1VBC2 4Y3OA 4MGTA 1L7LA 2HHHB 3K4AA 2Y6HA 2W68A 3CCJV 1F7YA 5EJZB 4NMIA 2WYFA 4DEQA 4CCOA 1XNCA 5KBFA 3AJYA 5I0TA 1DDLA 3Q8AA 2JJ1G 3CCSV 4RHV1 3SYPA 4HETA 2VBPA 4FK5C 4AEKA 2E5LB 3LFIA 2HWF1 3DGTA 3S7EA 4LF6B 2ZR3A 3JCUZ 1BEV3 3AJZA 3SKVA 1MQTA 4LBQA 4XFHA 2ET7A 5H9PA 3OUIA 2XPJA 1D2SA 4CCLA 4Z8BA 2RR12 5I0SA 3C2UA 5IE9A 1N36B 1Z78A 5DAVA 3M7MX 1ULDA 1WGPA 2CH7B 2RJZA 3QACA 2Z2SB 1CAUB 3IMNA 1V9U2 1SBDA 5JZGB 5FY1A 3LDRA 1GKBA 3CRMA 4UCRA 1SPPB 2XJQA 4WVVA 3CCQV 3MHZA 2EIKB 2P06A 2A3YA 1SQXH 4MW8A 2VD7A 1K7DA 4RS5C 5DAWA 2V73A 4DV7B 4URAA 2WDBA 1D4VB 4Q8KA 4KG8A 4I2OA 2C4XA 2QKSA 4H13B 2EA7A 1QQCA 1K12A 3MHHC 1L3JA 1YIFA 4QX5A 3CE2A 4CVUA 1S5LZ 5JCOA 1QJX3 1NZ6A 1LNQA 2BU9A 2J42A 2QKAA 4Y33A 1QVFU 3USUA 4QHBA 5LA0A 4YHHO 1SC5B 2ZGSA 1SQFA 1XPWA 4FPFA 1W6OB 2VZSA 3QCWA 3B93A 4YVWC 2BGPA 4BWOA 4DR5B 2VQEO 4LTAA 3L75H 1MEC3 4BPZA 2H0BA 3ZMNA 2A3XA 3POEA 1F51A 3LKJA 1VAVA 4DK1A 1IZ3A 3UKNA 1CJDA 2BQPA 2YI8A 1UU5A 2VH9A 4WM8C 4YW6A 4ZXEA 1OQEA 1FNZA 4KWJA 2AGAA 5L3EA 4B3MO 3LSEA 2WR9A 4CDWC 4MYEA 3I5DA 1HB4A 1W28A 2EINB 3DN7A 3WQ7A 2QNKA 4JF3A 3ZHTA 3VBRC 1XNKA 4UBGA 4JI8B 3IJ4A 1RUJ3 2AZ0A 4XFAA 4X62O 4Q0SA 4IV3A 3K5MA 1JU4A 2AC1A 2YXLA 4FPPA 1LJ7A 1FXKB 4BH9A 4R50A 4CH3A 4AFCA 3AP6A 5ACA3 2DUOA 4E8DA 1IXBA 1AHSA 2OXBA 3FX7A 2ADQB 4JV5O 2A1XA 4LNVA 4F7ZA 2UYAA 4HXCA 1QJU3 2ZTNA 5DN2A 1OF4A 1AR73 3SNMA 2XHKA 3EHKA 3O0WA 4C90A 4PDVA 1R6NA 2EX3A 5LOVA 3MIFA 3SPHA 5CBGA 1AJOA 2ADPA 1O4ZA 1BHAA 2QJ1A 4PA6A 2UU9O 3BPSA 5A1FA 4M0HA 2K2SA 4AI8A 4JYCA 2NN8A 4TT3G 1DYOA 3K0GA 3UK9A 3MDSA 1P4RA 1E1QG 4EQVA 1R092 1M57B 3I3MA 3C7OA 5FIXA 3PMSA 1IURA 1GM8A 2JE9A 2ARXA 2BDRA 4IUGA 3NAPB 2XJUA 3ECQA 2W46A 5FZFA 2QWOB 4GKKO 2QQJA 5IK8A 3WINE 1J59A 5FLXN 4R8HA 5LWBA 3IZOA 1JHNA 1JMUB 5CFCC 5EIYB 1BBT2 3CC4V 4WF9V 1Y9QA 3MIHA 4R4XA 1RVF1 3MEPA 4XUQA 1I5ZA 3DKWA 1VBC1 3AMNA 4AQ2A 4XURA 5DUVA 2Q9LA 2HWB2 3BODA 5CKQA 5IDJA 3PUQA 1XNAA 1ND3B 4GH4B 1AR1B 4AHYA 2R49A 5KHKA 1WD3A 2D6PA 4MG2A 3OOXA 1YF2A 1HP8A 2Y60A 4NHLA 3USUB 4O9EA 2WO7A 2OYZA 3KF3A 1E1RG 1GRJA 5D8AB 1FAYA 2A70A 1ZZ6A 4JTCB 3ROUA 2G9FA 1Y74A 1I5YA 3SH5A 5FUPA 2IJKA 5L19A 3ZRWA 4YIOA 1SA0B 2RR11 4K3UA 3PLQA 1GP4A 3DYOA 4DR1B 4HBNA 1AJPA 2YIBA 1R3KC 1D4M3 1SQBH 5AVPA 4XTPA 1KJRA 2UXBO 1PX3A 4K21A 3APOA 2EBOA 1V6IA 4FZ1A 4N7IA 1I5XA 3H3ZA 3OBRA 4DR4O 4HSLA 4KGQA 2VW2A 3OTOB 5FYIA 1NOVA 3FL7A 4U36A 5KXDA 2CWSA 4XDKA 2LS6A 1FYJA 3AG7A 4Y20B 4N8MA 3ETGA 3ZYGA 3VBUA 1N34B 3KT7A 2DOSA 4V2VA 2V5YA 4NR1A 1ZREA 2KA3A 3I4IA 3PVBB 1JX9A 5LOVB 3O1SA 1X4TA 3UGFA 4GLXA 1KD1W 1W90A 3ACHA 2QQOA 2JXAA 2EJ7A 4B3RO 4WZCA 5A33B 2TNFA 4BDVB 2PF4E 3VQYA 3FB8C 1AR92 4UYBA 4ZI7B 4L8QA 4QT6A 4I7ZB 2YV8A 4ASMB 5A70A 2VVEA 3RYRA 2A7AA 4AVSA 3SXWA 5CA0B 1J3QA 3UGGA 3IT8A 4DZGA 1CQ9A 4EWAA 3TAYA 5A3MA 3X2QB 3I2DA 3T1CA 5DZFA 2OPWA 5FYCA 5I8TA 2W91A 4IEXA 4KQ7A 4X1YB 3ZMVA 3F2ZA 5JDBA 1L8DA 1HXS2 1NCQC 4A44A 2VO5A 4OPAA 4Q4Y2 5FY8A 2JDPA 3POFA 3DECA 1YQCA 3H1HH 3O1MA 1WUVA 1L7QA 3J7LA 3VDDC 5AC92 4MVOA 4DXTA 4OMCA 3GWKC 3VHOA 3CXHF 2D6NA 3CEWA 2VMCA 2VE1A 2YPJA 3VD9A 2WLMA 2WWUA 4YSFA 2WN3A 3AVRA 4CEWB 4LFCB 1WZXA 1CP9A 4JI4O 1C28A 2IXLA 1KQSU 1G8WA 1J58A 4QB2A 1VAMA 1ZYBA 2AEYA 4EKWA 3FUQA 4MTOA 5GONA 2YHJA 3BAAA 4QU2A 4JRLA 3I2KA 3BOPA 1L0NH 3M1HA 2PI4A 1QR9A 4H7MA 4XFCA 3K3OA 3NJVA 4XE9A 3ABTA 2WSVA 1YRZA 2Y34A 3CRCA 2DBIA 2XAJA 3ICXA 1W0PA 2XWBB 2IJIA 1WLTA 5C8YA 1W2OA 4UBHA 4UFLA 4XF1A 5H9RA 1X9PA 1R091 3O1VA 4QQHA 1IBLO 3CL1A 4YNIA 4MXVA 1UY0A 1EV13 4QXKA 4TWTA 3MLLA 1V6KA 1WP8A 3VKFC 3RVHA 1LODA 2Q0OC 2OWOA 4UXNA 4BYYA 1SESA 5JOXA 4R9BA 4YVWA 3IDBB 2QWNB 2GDFA 2ZGUA 3KQ4B 4J6GA 4FPGA 4L87A 2C1FA 2HWB1 2ZACA 3VBUB 2JX9A 1RUI3 4M00A 1ZL8A 4YVSC 3GBWA 3J9SA 4HL0A 3IC7A 1BZKA 4FQ4A 1OLME 2CGNA 4AI3A 5FBJA 3ME2A 2PLV2 2YROA 1CESA 2PAKA 5ABJB 1O8PA 3WB0A 1YNAA 3ZDSA 1UYYA 1RP3B 3OG2A 5DAPA 4CS4A 2HEYF 1SCSA 1TMF1 4GJZA 3JATA 3B00A 3LOIA 1RXFA 1UFIA 1RMU2 2MEV3 1IVSA 3WNXA 1OCZB 4QE7A 1FXZA 4UVAA 2R043 1QEXA 3DXUA 5FPUA 1ENQA 2FQPA 4LOTA 3TN93 4LK6A 3ZRSA 3KZIZ 5BZBA 3ZHVA 1FV3A 2FCTA 1WMEA 4P30A 2QEXV 1XQ8A 4PLNA 1N4CA 4RQEA 1GZTA 2GNMA 4LO6B 2QWPB 4QPKA 2MK3A 2J1TA 1ZLZA 4Q4X2 3T09A 5EK0A 1GUIA 4RD7A 3CU7A 3AK0A 4WBNA 4DV0B 3OF1A 4AGVA 3HQRA 2WWWA 2VJXA 3SR2C 1JXNA 1RUD1 1S4CA 3HNYM 2W1UA 5LMNO 1AYN3 2QQVA 1H1IA 1IDSA 4RS5B 1BT8A 1UY4A 2Q5TA 1GTOA 5FYVA 4I3GA 1AR4A 5FPLA 5CFCA 2VVFA 4P5YA 1O9HA 3B94A 4ATEA 2ZIMA 1W6MB 5F6LB 1MS0A 1C8M3 3T4DA 2QBXA 1Y76A 1AR91 1TNFA 5LEKA 5KA6A 3QBQA 1N1YA 2B9ZA 3T4VA 5C8YB 1XHXA 2WS93 4XMIA 5FJKA 1JZ2A 4JZRA 5IYBO 1LHNA 1DYKA 4JGSA 2JIGA 3J8F3 2VVDA 3JCZA 1IXMA 3URFA 1KRIA 2Q7EA 5CKNA 2P4EA 5EFUA 4AEDC 2AW9A 3CKHA 4FTEA 1IBMO 4AGGA 5FYHA 2RMU2 4NROA 4YVWB 4GD4A 4WFBV 4XUNA 4EN6B 3BTXA 1HXS1 2A5ZA 5FKBA 1IQAA 1N32B 2G1MA 5BNOA 4Q4Y1 4UCTA 2ZMNA 4XPVA 1UAIA 1SDWA 3FHQA 5AC91 4WM8B 1SHWB 2ADDA 1HQWA 4LULA 3W21A 1ZL8B 1W3VA 4CDWB 3OW2U 3DXRA 2VTXJ 3SCHA 4RUEA 2ERFA 3VBRB 2QZ3A 3OM3B 3NXSA 1HNWB 1AL23 5EIBD 4S2FA 2XJPA 2ZGNA 2YC0A 2PFWA 2FMYA 3I7DA 5DDJ2 3BI3A 2CNAA 3OGRA 4JZ2A 3EQEA 4IESA 1WW7A 4W50A 4HMZA 1BVP1 1OUSA 1DQ6A 5J2UA 2JDMA 2NLRA 4LC1A 1O5UA 5DN6G 1S77D 3MIDA 3AK1A 1V54C 4D6SA 4EFBA 2C24A 5FP3A 5L3FA 3GBFA 4E4DX 2ET1A 2ID4A 1P7GA 1H6YA 5IUQA 1XILA 1Q82W 2XVGA 2P6JA 1K4CC 1JYCA 2LGQA 5C9AC 1VBD2 1G4YB 2GMEA 5L3CA 1W8NA 4EFEA 1MZFA 1ONAA 2R073 2VZPA 2WPDG 1X33A 2BOCC 2WLQA 2Y8KA 4LHSA 4YY3B 4WM7C 1K42A 4DNYA 4HVQA 1M56C 4JASA 1COWG 3HPNA 4EB6A 3ZN5A 2PLV1 2RM23 1EAH2 1FFXB 2HWE3 2GTAA 5EQUA 3ZR5A 4E4HA 3K0DA 5LA1A 1EP0A 2LGWA 3T0AA 5APAA 3NR7A 1SZBA 5FQ0A 2VUDA 5CFCB 5IK4A 1RM1C 2BW8A 2J7MA 4AXOA 5I8SA 1V6LA 3ACIA 3TGUH 4FM2A 1AI4A 4P5HA 1VBA2 2VMDA 1PPJH 1RMU1 1CEZA 1OSGA 2RHPA 2QQUA 2DCZA 2GNBA 4Q27A 3W5MA 1FOD2 2YPDA 1QH6A 3ZKYA 4X89A 1KDMA 3MFAA 2NQYA 1UKRA 3IWZA 4FAHA 5GZGA 1QIQA 2HG5C 5JAXA 5EC2C 2ZA9A 4GB32 2IFWA 4DR7B 3W20A 1H9PA 1AXYA 1OCCC 4DR6O 1CPNA 1N1SA 1G9BA 3ZKUA 4B08A 4Q4X1 4K6BA 2C5DA 1FNYA 1V9PA 4FPLA 3K9AA 1W3XA 3VKMA 2YU2A 4NPMA 3VKLA 5CG8A 5LA6B 4BWAA 1WPBA 1AP5A 4EE2A 4HN0A 4AK3A 1NE6A 4JI5O 4Q0UA 3T1YO 2ZAAA 1PL0A 3PJYA 1VQOV 4CC5A 4LKSA 2QM7A 2BOJA 4X8PA 3DXRB 3E89A 3UT5B 3ZIWA 5FZ6A 5T5PA 1DLCA 2VZVA 4OI2A 2ZGTA 5HXVA 3T1HB 4LF7O 1YC61 5FZAA 1ENVA 3EXAA 2R063 1UOJA 3LEGA 5B1NA 1BHGA 2B39A 4LBLA 2ZGLA 4EJRA 2ZGRA 2IZWA 4UFJA 2M6YA 4U7OA 5J2UB 3C90A 3VHNA 2B9UA 3EO6A 5FJHA 2GC0A 5E79Z 5ANQA 1XE0A 4UCSA 3KV9A 3SDLA 4OQ9A 2JVDA 1CGPA 1MMMA 3MHSC 1SERA 1DZRA 5BNPC 1G9FA 5K4LA 2FDJA 5A7PA 3IGAC 2CHHA 5FXVA 2RJ2A 2RMU1 1RUH2 4CS2A 1ODMA 5C4WC 1W6QA 4X66O 5FMOL 2N7GA 3WV6A 4OULA 1NY72 3ZPYA 5ANNA 4DV3B 4QHZA 2OPKA 1NLRA 2EIBA 2VMEA 3JU9A 4XFBA 1WPXA 4JI1O 3LQCA 5BY1A 1WB8A 2PHRA 3NNLA 4BIOA 1X8EA 1PVC2 2PXJA 3RYFB 2IH3C 4H37A 3KLSA 3NQHA 3DSQA 2Y6KA 3J80N 1LOAA 1YCIA 3VHRA 4B7KA 3HPLC 4RQPA 5FZHA 4RUFA 4UXAA 1UU4A 3MLJA 1H8VA 2RDNA 3BHPA 3NVCA 1WN7A 1TGOA 1BGYH 2OTJV 1NCQB 5LW9A 2LALA 2PHXA 2XLAA 3VD4A 1HNZO 3HT1A 5DDJ1 3MV11 3LE0A 1XJAA 2NZ9A 2CSGA 1GWMA 4YZ1A 2CTVA 2JJ6A 1CX4A 1YI2V 1H0BA 2OIGA 1LGCA 3VDDB 4LEJA 3VZOA 1ZUQA 3N9OA 3MYXA 2KD7A 2VQFO 1OUXA 1T2XA 2VZQA 4HZFA 1VQ4V 4S2DA 3LDKA 3FLRA 4DV1B 3GXUA 3O65A 2IXCA 1J5EB 3RI8A 2RV9A 3ZCCA 1KP3A 4WVZA 4DV4O 4MZUA 1AXKA 1WP7A 4TYSA 3U0ZA 1OH4A 3BA9A 4CDUC 3I3QA 1QJEA 3FN9A 4TQDA 3ZM8A 1ZX3A 2ZKOA 4PI0A 1W9YA 1VBD1 4LORA 3O0VA 2GH8A 3KVBA 3RFRA 4QB6A 2AACA 3OSDA 5C3SA 2DVFA 3H9VA 5LA2A 3I55V 1XMQO 4DIQA 4XTMA 1UW8A 5FO8B 2FDGA 2ZX2A 1V6JA 4AEDA 5T50A 1W9FA 2FBEA 1ENXA 1AROP 5FY4A 4LPLA 4X1IA 3UM7A 1EAH1 3QNEA 3SISA 2Y33A 2QKCA 3CRQA 1ZBA3 5JH7A 1ULPA 4XDPA 2CYFA 1GP5A 3O12A 5FKCA 1BLZA 4FJCC 1BE3H 5E1RA 1PIV3 1SG3A 1LKNA 1NZCA 1ZZ9A 4IEZA 4RQFA 2PTMA 1W6NB 3MIGA 1FOD1 4YVSB 1RHI3 3VD5A 1RXGA 3AZVA 2YFZA 3MW2A 1ZBE2 2WQ8A 5EJ3A 2CDOA 4QKBA 2X5IC 4BR6A 2UURA 4GB31 3C7EA 4NIHA 1GSLA 2QQNA 3D82A 3BN6A 1C5IA 5IVYA 5F3IA 3AG1C 2FCUA 1N3QA 3RYHB 5JJJB 4OHYA 3AP9A 2E31A 3FZ3A 3GGLA 2DTWA 3JQXA 4FLZA 2Q6AA 2VS0A 1VF5B 2P6HA 3LDDA 1CXZB 1TVGA 2OCCC 3N2KA 2F4LA 2PHDA 3CXCU 2ZGPA 1YIJV 1UWWA 2NYYA 1LOFA 5DZGA 4UV8A 4LF8O 3T30A 3DPRC 2ES3A 1LOGA 4ZKIA 1XB9A 1VE0A 1Q90D 3JALB 2GH2A 4ZIBA 3CMGA 4DMIA 1UNBA 2LJ2A 2WBKA 3RWRD 1JVMA 4XUPA 3RN4A 4K40A 3OD4A 1P84F 2GSYA 4Y1YA 4Y22A 3O9OA 2B9VA 2D44A 3MPPG 4MVQA 5EIBC 4JI2O 5D5QA 2Q7GA 3VGIA 3CO2A 2N05A 5KR7A 5FY9A 4L99A 3AG2C 3P30A 5LXTA 2EXJA 3PTRB 3CIHA 1KMIZ 1RUH1 3MUY1 4XDJA 4LKFA 2Y69C 3SEPA 1YHFA 1EYBA 1VIBA 4WV8A 1XDCA 5FYTA 3WHUA 1NY71 1BJQA 5FLIA 1ODNA 2I74A 1T6GC 1VQPV 3Q4HA 3CCUV 4AR2A 3JASA 2CK3G 1VQ9V 3BEHA 2BOIA 3CDZB 4AFDA 1PVC1 3QH7A 4MADA 4MSWC 1OC1A 4BE3A 1J3RA 2RS33 1THZA 1JJ2U 1OQDA 1N8RW 1HRI3 2JDIG 4FT8A 3HKEB 2F93B 2ZCEA 4CP2A 1EY2A 2ZKNA 3GJAA 4AEDB 3PTYA 3S6PA 2Y0OA 1Q6UA 2UUCB 4M4RA 4Y4YA 2XASA 2BTQA 4BA6A 1AYM2 2PYTA 2WQ4A 3GZAA 1JR9A 3AZYA 1KS4A 1WCSA 4MTGA 3E1F1 4IV1C 2YMZA 4J9YB 2JKBA 4UFMA 4JKKA 4OCTA 3CZJA 3HEIA 3AKSA 4JAAA 2FMDA 1WD4A 4NPLA 4JHZA 4O4IA 3MUZ1 3ZRXA 5DABA 1HV0A 5GLTA 2WA4A 4NUBA 4KWUA 5T54A 3ZX7A 2VOWA 3WUCA 5GALA 3BUCA 4UCVA 2D40A 1BZWA 1ULFA 1Z5WA 1ZRDA 5BXZA 4N43A 2PAMA 3H1JH 3CC2V 1ENSA 1YFXA 3K2OA 2W6JG 2QWRB 1PNMA 1OXCA 3H1IH 1SQQH 4RYDA 2P22C 2ILMA 4LR4A 3HWJA 5IVFA 1V54B 4FPCA 5FPRA 3MIEA 1HW7A 3OR7C 2KSDA 5LBQA 1WBFA 4DUWA 3UL2A 5BNPA 1JZ8A 4XYXA 5JI7A 3JBG3 4W4ZA 4QE9A 3VKOA 2E33A 3N2KB 3LB9A 5E16A 3ACLA 4BQYA 4D94A 2JE7A 4GMP3 1A3KA 1XQNA 1POV1 3D3AA 5IAXA 3OGJA 1GICA 5L7OA 5C4WA 3C7GA 4OUMA 5C9AB 3JD1A 4JTNA 2W3JA 4N90A 4XF9A 4A41A 3OUSA 2B46X 5FOJB 1CVNA 2Q1ZB 5IVCA 3JARA 2AUYA 3HVDA 4WM7B 3NV1A 2W5FA 4G9SB 2G19A 1M56B 1SFYA 4OUSA 5C6CA 2ZE6A 5BPXA 3K57A 1ZBE1 3OUJA 3ZXEA 4BZ4A 4I9WA 3O7OA 2DU1A 2ODMA 1R082 3ZFFA 4NIIA 2BWAA 1RM1B 2CGOA 2YICA 2JDYA 4QX0A 4FOWA 3IFXA 2E75B 2YGLA 5HI0A 4CU9A 2YBSA 1GAXA 4JGZC 4LHKA 4P9PA 4EN7B 3LEKA 3MLKA 3U10A 2Q8DA 1QU7A 1R6TA 3CPWU 3UQ8A 2OA2A 2WNOA 4AVVA 4CDUA 1H30A 4PT6A 4DY3A 3E22A 3ZS8C 1QY4A 3OR6C 2IXJA 1OCCB 4R9AA 5AG2A 3WNLA 1UZZA 5L9RA 2XQRA 2UUBO 4I01A 2DWDC 4XBFA 4CH6A 4CZZA 2WNUA 4QJFB 4URTA 2ITCC 2OQ7A 3WQ1A 5J2TA 1OI6A 2WT0A 4KH9A 3I2JA 3AM2A 3I59A 3P1IA 5FK8A 1U5XA 1TVKB 3N2GA 2Q7HA 2VOVA 2BGOA 2VGDA 3CRRA 1SMVA 2WN2A 2RVAA 4K20A 1H8TA 2WNEA 2HWD2 2ZINA 4CSWA 3S3WA 4MTFA 4RHV3 2ARHA 2XL9A 2J1RA 1CONA 2HWF3 1JHJA 2W1QA 3E5XA 3NJXA 3A0NA 3W5NA 4QX8A 5H6RA 2DMXA 1IG3A 3J7NA 2ZE8A 2HBTA 4DUYO 1YQ5A 2RE9A 5FL7G 1UMHA 3VBHC 2XL7A 4Z07A 2HBUA 5BNPB 1YHQV 3PUAA 1TME2 2ARCA 1XL6A 4AILC 2X5IA 3NKTA 5GKAC 3VBSC 4Q5OA 4MTXA 3NV2A 1AYM1 5C4WB 5LYJA 4NRMA 4YLZA 1F23A 2XONA 4UI9L 4ZHQA 2XAHA 4YJ2B 3AFGA 3I49A 3ZYBA 4DXZA 2VOKA 5JVVA 4CU6A 5D5PA 4DK0A 2QE7G 2JDNA 5LASA 5EBWC 3R6SA 5FPAA 3TEXA 1VRH2 1Q56A 3JARB 4AAXA 4JYAO 1SQ4A 4PDMA 3HT2A 4I09A 4K7JA 1VRBA 3ETEA 2Q8VA 1LB2A 3LNNA 5FYSA 2WFF2 1OVSA 5AFBA 5IVJA 4JCKA 5JVDB 3ES4A 1Q86W 5L9BA 2Y4TA 1JTZX 1XSRA 4O4HA 3EXUA 4FFFA 1PO22 4O7XA 1ZVFA 2A6WA 4DPNA 1O5LA 1DZQA 2E53A 4AEJA 2VZ1A 2R72A 4LNUB 3SH4A 4XBNA 1IOAA 3VBOA 3F5WC 5CFDC 2IU0A 1YQ8A 1LECA 2WWSA 4FPYA 1QXRA 3SMHA 4H55A 4D3WA 4CP0A 3ABMC 4QGNA 4ISQA 4KNCA 4WFFA 2XAFA 4IIJA 4DUVA 1SLTA 3M8AA 3ZFGC 2Y38A 3PVOA 4UF0B 1SQGA 4CDUB 1WW6A 2OX0A 4O4LB 3AG3C 4UFZA 2GN3A 3H50A 3ZFEC 4B3TO 1X7NA 1QR8A 1HKDA 3ABUA 3KMHA 1AX0A 5B4XA 4FMTA 1SBFA 4XBLA 3CJHB 2ITDC 3N35A 4HOOA 4IE0A 5J2TB 4Q20A 1J83A 2UYBA 3Q8CA 4DV5B 3I59B 4PDWC 1PNGA 2NR5A 4XBQA 2OZJA 1DK1A 4FLUA 2MNGA 4CP9A 1V70A 1D2DA 3CP1A 2DFCA 1DGRA 1H38A 2PN5A 3JAWA 4MVSA 4FIPC 3VKNA 4LIUA 4Z82A 3HNBM 4FP3A 4DB5A 4ZHNA 4FTBA 4DUZO 1R081 3FWEA 2F4VB 2XB6C 1UPSA 4DO0A 4IV1A 1JYWA 4CXYA 2P3KA 1Z7S2 5LP6A 1BYHA 1JU3A 3K75B 2DJVA 5IAVA 3INAA 2W2IA 1G7YA 1WA6X 4LCUC 2VMFA 1MSDA 4JI3O 4DR3B 2KG7B 1KU9A 1C8NA 4FBFA 2D98A 2Z0AA 2X5IB 3ASIA 1SF9A 3D0JA 2QQPA 4JI6B 4GCZA 5LYJB 3AG1B 1HNXB 2GNDA 3K03A 3ZYJB 2C26A 1EFRG 1GWLA 5J09A 4LBKA 5HPOA 4I0WB 2YU1A 3K46A 2AZ2A 4I55A 1RVF3 1D7PM 1K9MW 1VBC3 4RFT0 5C3OA 2V5DA 4JTAB 3D4KA 4M0NA 2DYCA 4LUMA 1PL4A 2OCCB 3CD6V 3LAGA 3RWNA 3CZUA 3WDWA 2E74B 4NAMA 4B7EA 3VL9A 3DPRB 2HWD1 2VUCA 5EPAA 5FPOA 4O4HB 5A7OA 2ZM6O 4N9IA 4QPGC 2VR4A 1F4MA 5KX5B 2VL4A 4K3AA 3M2MA 4K8RB 4BU2A 3VD3A 4LBOA 4IE7A 3V64A 3UT0A 3RG0A 4RGAA 3R4UA 2V09A 1Q8PA 2RR13 4AI9A 4U3JA 5IWFA 3VLBB 1DIWA 4I50A 1OHFA 1NQJA 3VZKA 5CA6A 2DV9A 4BK5A 2DYRC 1TME1 4IIJB 3B9IA 3E8BA 3H8XA 3AG2B 3SH3A 4AZZA 1X9TA 2Y69B 2BEOA 1UN1A 3FAVA 1LRHA 2YB7A 1EM1A 1W8TA 2A9HA 2NNUA 4HG6B 2FYUH 2HH9A 1SLLA 2DURA 3B02A 3MDPA 1AI7A 3RWKX 2P3YA 3HKCA 4JDOA 1FMD2 2Y6LA 5LK5A 2VZTA 4JGZA 2GNTA 1WB7A 4CCNA 1VRH1 3JUUA 3K4ZA 5IFTA 3TRSB 1N0JA 2XTAA 4RR3C 2BE3A 1L1FA 5FZLA 2XH6A 2ZEYA 5EXOA 4UUJC 3I2GA 3N9QA 5IY5C 4CP9B 2WFF1 1P49A 3WG4A 3LFMA 3PL0A 5A7NA 2KM2A 5KHJA 2B42B 5IT6A 4WFHA 1VMGA 4CDQC 5JUVA 2WLHA 1K5MC 3DV8A 3KV4A 2PHLA 1GOFA 2X09A 1PO21 4PDLA 3B09A 5H9QA 3SC7X 4IV1B 4UFKA 1A32A 2E9QA 4AEMA 3NMBA 1IGOA 5J37A 4TLFA 5J3UA 1JZ3A 1DF5A 4I9QA 2ZNIA 2JG9C 1QNWA 2ZMKA 1NKDA 4AL9A 4PBPA 1S0CA 5BXXA 5GZFA 4AQYB 1KD7A 3K58A 3UGHA 4FFHA 3ZEDA 3N7JA 4LA3A 4DR2B 2VOXA 3JD0A 3K5OA 3VV1A 4ZPIA 1NQTA 3CNAA 4QAWA 2Z69A 4IL7A 3JZVA 3T2TA 3AMQA 4EV0A 5K7PA 3OFNG 3PVEA 1XNRB 4I55B 1ND2A 3W7WA 1OF3A 4J42A 5LATA 2WLLB 2PQSA 4XJUA 4GX1A 1BVVA 5FWJA 1JPXA 3IDEA 3LNMB 1UJWB 2WKKA 1BCXA 4DQAA 4PLMA 2FDFA 5FBZA 4ASUG 1TZOA 3WSOA 3S5AA 1RITA 3VBSA 3G6JB 3WF4A 5CA1B 3OUHA 3R0RA 3PJSK 1FAFA 1DG6A 4XZUG 4XF3A 1Y6XA 2AH2A 5GM0A 4Q26A 4TLGA 1H9WA 4HNAA 2GDSA 4LF4B 1SCRA 5FP7A 1HJFA 3RZZA 3WX5A 1DQ5A 5JOZA 2W9XA 1Z7S1 2IUWA 2HKOA 1VPHA 2UXXA 3ABKC 4B4RA 4AYUA 2DN9A 1LULA 3OMNB 1R093 3PJQA 4XACA 4CCMA 1R1A2 2HR3A 3JCIA 3L72H 3CS5A 1E57A 1V00A 3B9CA 2FDIA 4LLOA 4PLOA 4ZBMA 4QDRA 1XYOA 1X50A 1NBMG 1CN1A 4IEQA 5J36A 4JAVA 2JWPA 4FVMA 4GZRB 5CU1A 3NJYA 3HKDA 3LEIA 5CB4A 4A7YA 4ZU7A 5ERLA 3K48A 5L3BA 3N27A 1BBT3 4P9XA 4LO7A 3FC0A 1LENA 1VMJA 3RYIB 3HKCB 5GTHZ 2WUHA 4ZONA 5F2SA 1EZVH 2NPIA 4JGZB 3OPTA 1DQ1A 3K04A 5T5JA 2HWB3 4LFAB 5IJRA 3VD7A 4B1MA 3VQWA 4X1KA 3ES1A 4CPBD 4OX9O 5LRSA 1GN3A 2EAAA 1AP6A 3IC9A 4FQZA 2FB5A 3ZFEA 1JOJA 4YZ4A 4B4PA 1YXBA 1K8AW 3ZO0B 2YSUB 5F6KA 2XHNA 3VL8A 2WIIB 2NMNA 2WNVA 5B4NA 5LBEA 4GZ9A 1GN2A 1TMF3 5FPVA 3BYWA 5HCHA 4RSUA 4NVPA 4LMFA 3DGEA 4PQQA 1MACA 4PIXA 5A7WB 1EBOA 2BSKA 3T2OA 2JEXA 3POBA 4LQRA 4Y1UA 4OGQB 4DS0A 3OUFA 3OMIB 1OLRA 5FMDA 1YJ9V 2C2AA 1CAXB 2E26A 3S0MA 1POQA 1NT2B 3RYPA 2Q4PA 1UOFA 2QGNA 1OCOC 3PDQA 2R0FA 3X29B 5J98B 4YWAA 5JPMB 1REFA 4CCKA 5F37A 2CTPA 1CAWA 5H9CA 3T08A 1FMD1 3NSTA 4P9JA 4Y5Z0 4DINB 2R9AA 1BCCH 4X64O 1X36A 1Y4WA 4UFIA 2X6BA 4OI4A 4YARA 3VBHB 4K1ZA 4LF9B 3OPZA 4JI7B 4IGQA 2BBAA 4TSVA 2IW5A 3LSUA 3RJRA 1WBLA 4IEOA 4J1WA 5FP8A 3TWIA 1Y3TA 3WOGA 3R66A 1G9DA 2MW2B 5HXMA 3VBSB 2V1DA 1RFYA 1BL8A 4GKYA 4D69A 5I0DA 4PIYA 3QTCA 1N3OA 2DWRA 5CADA 4HNAB 2AGSA 3I3EA 2LM3A 2R7EB 1LOBA 5FZOA 3UJQA 4GAZA 5JXGA 1JOPA 4EN9B 5BR8O 3ZYPA 3H1MA 3WG7C 1AR93 3ZJZA 4ORFA 2VWKA 2XVLA 1W2UA 4Q4W2 1OOPC 4GKXA 4HKWA 1WA8A 2PZSA 1HWYA 4EEQA 1NTMH 3ITQA 2X6CA 2GAUA 4MGYE 4MX3A 4L97A 2EAKA 4QX3A 3LUTB 4BW9A 3TCUA 3KHCA 5C8WA 4LFBB 3FX3A 4D7YA 1MS3A 1H2NA 5E88A 2PMWB 2EILC 4KFMA 3MO4A 5LMUB 3W9AA 1HXS3 4A45A 5FO9B 3CJXA 3HN1A 4Q4Y3 4YG6A 1D2QA 1NJIW 1GN4A 5FYMA 4ZXKA 4Q0QA 5CFDB 1NTKH 1QJFA 1MZ5A 5F2WA 4AHCA 3SJCC 1FV2A 5AC93 3MV01 3PUSA 3IIIA 1PP9H 4BQ2A 1GMGA 4FFIA 2Y0IA 3APBA 2E51A 3ABMB 1ZZ7A 3T4ZA 4R9CA 2UXCB 2JJ2G 2VCCA 4KL1A 3ZFGB 3TNPB 2CH7A 3KZ4C 3ZMOA 1VQ7V 1V6NA 3AG3B 2EJRA 4NHKA 4YW2A 1UF2C 4NXNO 2W0XA 3K5NA 3ZFEB 5JZGA 1RSOB 2R0HA 3ETDA 1SPPA 4COVA 1WAZA 4M3CB 4COUA 2WZEA 3ZLIA 4DV6O 3ZHUA 4XMAA 3UV9A 2DCYA 4A6OA 3EB7A 2E3CA 5LBBA 1JUIA 4JI0B 1QDOA 4OHZA 3ZMTA 4QGPA 4PDWB 2B5HA 2E7AA 4ATFA 2FD8A 2D2CB 2BSKB 5E6HA 1JW6A 5HCAA 3THDA 1SZXA 5FMBA 3QO5A 5HCFA 2VBBA 4AGRA 5LGUA 2ZDIC 1R1A1 3HBKA 3JAKA 3OGGA 1WCQA 5BMVB 2G9GA 1O7FA 2ZAHA 4CDQA 2W52A 3CLPA 1F5JA 2DE0X 4DXRA 5K1XA 1GZWB 2RG4A 3W7UA 4CEYC 1DF0A 4H3WA 3PNAA 3KWVA 1K4DC 4QDQA 1W6OA 1CAWB 1MS8A 2EZPA 3OEEG 1PZ8A 4AHWA 5F5IA 4X9QA 3DUIA 1XOYA 4TV9B 3GJBA 3HR9A 3CCEV 5IJ9B 4HFSA 5DMYA 3ZIAG 1F2NA 2B4KA 1VBE2 4QD2A 4CUGA 4XXPA 4XXAA 1ZTEA 2JKXA 4H0LB 1XYNA 3NJZA 4S2HA 1YQ6A 4PA4A 1VAKA 2PELA 2PLV3 3CX5F 1Y9MA 5EV7A 4XQWA 4YG0A 4NWVA 2FDHA 4LITA 3O14A 2YYOA 4QX7A 1IS5A 2R072 1GFF2 1M4UA 4L0PA 1O4YA 5FZGA 2XG3A 1S0GA 5JPNB 4CS3A 1RMU3 1W6PA 1LOEA 4OVEA 3ZPOA 1F31A 4LLFA 3V0AB 1WA8B 3IBMA 3QLQA 1M93A 3QF7A 3RJ2X 4QPGB 4I0XA 4WFEA 4LIVA 4Q4X3 5IWAB 1JA8A 1JOYA 5CISA 3MGUA 3CJIC 1RJ8A 1WLDA 4DRVA 2EXIA 1E5IA 1VARA 1HB3A 3ZX6A 5HBAA 4D6RA 1Q6HA 3CQOA 4OPHA 4KHPB 4GMP0 5KXBA 1SFNA 4XJWA 5T3NA 4SLIA 2DYRB 1QXJA 3NO8A 4N53C 1QLEC 2ZMLA 3DTUB 4N9HA 1S55A 3CB2A 4YG3A 1WW4A 3ZOIA 1H4HA 1DQ2A 5TISZ 2DCKA 3NAPA 2D6OX 2W1WA 4OHWA 3UYJA 1O6UA 1KITA 1HRV2 2W39A 4Q0VA 2OS2A 2D97A 5D2AA 4XF4A 2P67A 4LBQD 5EYYA 3J7MA 3UNPA 4WVWA 4XDLA 5FYYA 4Q4W1 1PO12 4RR3B 4BHPA 4ZU4A 5IY5B 3JAKB 1QOOA 2QA4V 5F7UA 1T5EA 3A0HZ 3EVKA 4AOCA 1M1KW 4AI1A 4CDQB 1R73A 2QDRA 3RSJA 4QQLA 1ND3A 4GH4A 1MS1A 1K5MB 2CAUA 2WQZC 5GZCA 5FUNA 4C7UA 5KMGB 2RMU3 4LBEC 3WXPA 1QHDA 4BJ0A 1Q8VA 2I2SA 2YEVB 2NP0A 4KI5M 2RS52 3QOPA 5D8AA 1PM7A 2W6IG 1Y67A 2ZZJA 4A5UB 4Q4V2 2WLIB 1OKQA 2YFUA 2JG9B 3O1OA 2UUAB 5EYPB 1W9SA 1AJQA 3S30A 1HR0B 1UX7A 4INDA 1SA0A 4G4FA 5LHHA 3SCFA 3WW4A 1FJGB 1LHWA 3E5QA 3BA8A 3S3XA 4YYOA 3UKTA 1KC8W 4DFSA 4J80A 4K0KB 2L35A 1ACCA 4I02A 3WF3A 2Y4UA 5F32A 5DDJ3 2B1IA 2Q8CA 2YZ4A 1ALYA 3BCWA 3KKYA 5A7QA 1LUVA 4DOUA 4LH7A 1I6XA 1W6PB 1OH3A 3OEBA 1Q5OA 4BMEA 1IBKO 4EN0A 3CRAA 3M3IA 4Y20A 2CL2A 3SPJA 3WQ0A 1R3IC 3VDCA 5B2GB 4XCAA 2TEPA 2Z4FA 2PA7A 5CEHA 4M01A 3GNEA 3EMRA 5A7SA 1M5IA 2GSMB 1C1LA 5FFOC 4I0XB 2IFRA 3GYDA 1V6MA 1VBD3 3IKWA 1W05A 2JS3A 2H6BA 4W4LA 5A33A 2DCJA 2WO2A 3ABKB 3AVSA 3WQBA 3QO7A 2WZR2 4QQPA 1B6QA 1DGRN 1VQ8V 4ZI7A 1UYXA 1VBE1 1AJKA 3CEIA 2AR6A 3PIJA 3OJBA 3OGIB 3AYCA 1ZWIC 3TNQA 4MOAA 2Q0AA 5D1IA 3SYCA 5CA0A 1EAH3 4XJ8A 1MR5A 4YGBA 5F3GA 5E8AA 2VPVA 4MHUA 1I7FA 5EYXA 2FL4A 1QWRA 1PVXA 1PX4A 1K3IA 1LHOA 3ABLC 3VN4A 4TV8B 3NL1A 4TOIA 5CZKA 3LA7A 3MF6A 4GWMA 4LK7A 4X1YA 3BKZA 1BMV2 4EWEA 4XUTA 1RUG2 1UD1A 1G6NA 1FOD3 2D3PA 2P90A 1GR3A 2XUEA 1PNKA 3CF6E 1FYUA 3T3YA 1LR1A 3I2OA 4D6TH 2VZOA 2HHHO 3F5TA 1VR3A 2WT1A 4XFFA 2JDZA 2EZOA 1ZZCA 4GB33 2YUAA 3MFCA 4NWWA 4CEWA 4LT5A 5DPNA 3H7JA 3AP7A 5I93A 4BQ3A 5JSRA 3DEMA 2WAAA 4L92A 3U78A 4R6ZA 4YRDA 3JSLA 1AR82 2E5LO 1SFPA 1IPKA 4LF6O 3V56A 1SLBA 1K3EA 2WINB 1H1AA 3R05A 2IU3A 2Q68A 3O1UA 2ZDIA 3K08A 1GOHA 1FPN2 1SKVA 1KQRA 1TAEA 3UKVA 1N36O 5F2VO 3WDXA 5A3LA 1QCEA 4GKJB 3ZXDA 4CUBA 1V9U1 3WNPA 5FXWA 1OCOB 4RGGA 1F35A 3GWOA 2P17A 4CDXC 2WO1A 3P6BA 1BK1A 4MGKE 4QIWF 1HRV1 4BQ5A 1GK9A 5JSOA 4AHZA 2A71A 4ZU5A 4DV7O 2D5HA 2W08A 5JIAA 1ZRRA 3Q8BA 4HYOA 3FYIB 1PO11 2UXDB 1I94B 2E7QA 4QGLA 1D5AA 3CMEV 1MS9A 1D5NA 2H0VA 1HX6A 2YIBD 2OW4A 5A3UA 2BPA2 4FP2A 2WJSA 1S76D 3M3QA 5C3QA 4FFBB 3USSA 1RUH3 4IEPA 5B1OA 3GB7C 5ABJA 2GC2A 2RS51 4QHOA 2Y0PA 3WG7B 1UPGA 1S0VA 3H1WA 5GW7A 2WZ8A 4Q4V1 1QJY2 4LXLA 1OOPB 4DR5O 3HKBB 4JV4A 4JGYC 5HV0A 2XJVA 4UW3A 1PVC3 4KU7A 4UAPA 2AXTZ 3OY8B 1R64A 4MXWB 4BMBA 4LF5B 1TEIA 2OIEA 2QR4A 4KU8A 2VQAA 2ZEXA 4G3YC 3NV4A 2HJFC 1SRYA 4B3SB 1QXPA 1F4NA 4BXFA 4YPJA 2RJLA 2EILB 5FAXA 4FLXA 4HK8A 3TXQA 2D3SA 2Y6GA 3ZSEA 3HBZA 2IBZH 2IXKA 3CJIA 1BKZA 4JI8O 1ZSPA 1DYPA 3ZN6A 2W0FC 1AUYA 4FLYA 1QF3A 4M3CF 4YW5A 5DEDA 4LA2A 5FWEA 1DZTA 1DHKB 2XJTA 3KT1A 4XAAA 4ZOLB 1E5HA 2C9KA 4CA9A 4P08A 5BR8B 1PNFA 1UYPA 4LE4A 3TEYA 2OVUA 2FMLA 1QJZA 4IEVA 1WCKA 3SQOA 1FFTB 3DKQA 4RS5A 1O9GA 3ZXKA 4EN8B 1SS3A 1WMFA 3TB0A 5FMOS 3KM5A 5GLUA 2ZE5A 4ARXA 1W6MA 4B8EA 2WZR1 2JDAA 4NHYA 2CTWA 5FZ4A 4JTOA 1K5JA 3ELNA 1GO3F 1POV3 4XJ9A 4LKDA 2JEUA 1MS4A 3CCMV 3SJBC 4H33A 4CEYB 2P37A 4HVRA 4FM1A 3A8TA 4DRXB 4F83A 4I5SA 1UO9A 1GNHA 4O9GA 1S1AA 1ZZ8A 3L73H 4MW3A 1BMV1 3H01A 3JXSA 1N33B 1U97A 5IJ0B 1RUG1 1BBT1 1TE1B 2XT9A 3LWCA 5JMOA 3SCGA 2F66C 1SDDB 4WM8A 1ZBE3 1S5HC 1QH7A 2VNVA 3SYAA 3RZJA 1WA4A 1MOFA 1YVWA 4KXRA 2CY6A 4HKOA 4CDWA 2ZPXA 4X65B 3BVOA 3PN1A 3FBYA 2UWCA 2E76B 2ZX0A 1NU1H 4QPIC 3MD0A 3VBRA 4A7KA 2Y6JA 3M3CA 1MQTC 1VQ6V 4XIKA 3AZXA 2DCTA 1NAEA 3G6EV 4KGGA 3VQXA 1AR81 2GALA 1SQPH 2WC2A 1QOTA 5IK7A 4FOQA 2YC2A 3ZXJA 3OD0A 2F95B 5LEJA 4LR3A 4CCCA 1FPN1 4NHMA 2P5OA 1S5JA 3G71V 1VQ5V 4YGEA 2B1GA 4XABA 5A1AA 3PU8A 3OGSA 4DR1O 1ZRCA 1UIJA 2KXLA 5G04L 4Z2AA 2YXHA 4COZA 1O59A 2ZQMA 5FK7A 1VJ2A 2SBAA 1HV1A 3BGAA 4D7SA 4O4JB 3B01A 3CJIB 2VTFA 2Q8EA 4FM0A 2QZ2A 3OTOO 4QKNA 5B3SC 3ZN6B 5JCOC 5CA3A 3W7XA 2J1SA 4RL7A 2VY0A 1AZDA 4Y24A 4PF5A 5B5EZ 4N53B 4AFMA 1QLEB 2OT5A 4PHZA 4DV2B 1KFXL 3N9LA 4UW5A 1O8SA 3BFRA 4FPJA 5FZDA 1TUBB 2DUPA 2R16A 1FFXA 3RYKA 1COV2 4J11A 1OCRC 3MF9A 2B8MA 3GVMA 4PI2A 3RZLA 2UY8A 1H6XA 4P9GA 4A7ZA 1NUKA 5L3GA 1QJY1 5LY2A 3E8FA 4YM0A 5DZEA 4YFWA 2JDUA 3RVZA 1VBB2 5FP9A 4PF1A 1KKDA 1WKYA 2WLJA 3E6BA 3AKRA 1W8UA 4AWDA 4OZXA 4PELA 1GNYA 4MGSA 2DF7A 2HWC2 4KP4A 1AYM3 3SLIA 4MLOA 4IV3C 2J1VA 3IAPA 4F6RB 3RPQA 2JK5C 1AJNA 3OCPA 5FCCA 3CCRV 2GBOA 1YTFD 2DU0A 3M7AA 1ZA4A 1BMFG 2A6VA 2CAVA 3HAGA 2P4KA 4X20A 3AKQA 3CC7V 5IVBA 1TA8A 5LA6A 2RDSA 1XRUA 5IHRA 1K33A 2HJIA 3WVJA 1R1ZA 4E4EA 2W47A 3WNMA 4XETA 3WG3A 3B69A 1RUE2 3RNSA 2VQ0A 4GJYA 3UT5A 1PGW2 4YW1A 4FI9A 1ENRA 4EWDA 3S57A 4V2WA 3NKGA 3VZLA 1AXZA 1G1XB 4J7JA 2NM1A 2MPFA 1CR7A 1US2A 4AE2A 1GLHA 4OI1A 1IKPA 3I8TA 4IW3A 3KF5A 1ZAUA 1LEMA 4AG4A 4Q6GA 4R7CA 4YZ5A 2NLJC 2ZHLA 1GKFA 4YGCA 4YHHB 4CZSA 2XUMA 5H6QA 1HDKA 1K34A 3KQRA 2IJJA 1UKGA 5FZCA 4O65A 5IFPA 2VQEB 4FLWA 5GZDA 1UX6A 5FREA 5CBLA 4GALA 5DG2A 4UV9A 3RS6A 1S0FA 3UCSC 4SBVA 3RYCA 4JGYA 3I2IA 1ST8A 4B3MB 5DM6V 1VB2A 2DYSC 3POGA 1YWKA 5BNNC 1A78A 3C8XA 5JXHA 1EPZA 3AK3A 5EZYA 3RYFA 1D0HA 3U4SA 5LGTA 4X62B 3M3OA 4XHXA 4LBNA 1STMA 1WLEA 1R083 1JYNA 1AB3A 3S7IA 2HLEA 1PKXA 3ABLB 3AL6A 3H8RA 4Q1RA 2R9IA 3IMMA 1H8EG 2EIMC 1B09A 1GWKA 4BIZA 1NCQA 1AR62 4JV5B 5A3TA 3ETPA 2DQ3A 3IAQA 2ZEZA 2E6VA 3GBGA 3VDDA 3BVCA 4H2AA 5FTTC 3AYAA 4OHVA 1KS5A 1YUDA 5CNAA 5H9SA 2QM4A 1XREA 2UU9B 1W8ZA 2QDNA 4NB5A 2V7QG 2R9RB 1S0JA 1SLCA 5FZIA 4ISRA 5KHGA 5DXDA 4U3FH 4LH6A 1GH6A 3EBRA 4FOVA 2ZGQA 1Q3EA 2H8PC 3B3QE 4BCUA 3VBFC 3B77A 4Q29A 5A1LA 1HJGA 2WLPA 1K92A 4X20B 3OPWA 4DV0O 2D6LX 3PUHA 3ABZA 4GKKB 2XBO2 1RPRA 2A06H 4RO2A 5FLJA 2CV6A 5IYCO 1NI8A 2HWD3 5I8YA 4HSJA 2HVKC 1SEFA 1AL0G 1HN0A 4CDXB 2I07B 2EVXA 2QTWB 2VW0A 3AYEA 1COV1 5LRRA 3ASNC 4CBCA 1OCZC 1NX9A 3EHBB 1VBB1 5GLVA 1GM9A 3NNFA 2QJVA 1IQDC 1W6NA 2BVBA 4NAOA 1TME3 4YVSA 1R1BA 4XEZA 2F6BA 2KR2A 1QHTA 1OD3A 1QMJA 3G80A 3L2HA 1AX2A 2HWC1 4QPIA 4XILA 3H3UA 1QQP2 2JGDB 5FYBA 1KP2A 1VIWB 1VF7A 1OLQA 1Q8IA 5CMUA 3FBMA 1A8MA 2OIIA 4K8XA 4LOSA 4LHLA 5KXCA 4BQ1A 3RYCB 4YW7A 4UWDA 4JGYB 2XVKA 1VRH3 2UXBB 1N32O 4BM8A 1US3A 3RYHA 3FB5C 5ISLA 4ITCA 4YZ3A 2EALA 3SKJE 3WG1A 3K3WA 5IYYA 3SJAC 1W2TA 3B7MA 2D3RA 4DR4B 2WFF3 5EZYB 1RGSA 1PM9A 4N23A 2A79B 4X6RB 2JIJA 3RDIA 1B3QA 4JZGA 3IB3A 4P9LA 2H6CA 1RUE1 2XNDG 1PGW1 1Y66A 1PO23 1JQ0A 1HNWO 3LA3A 2X8KA 3JALA 2FTKA 3FFQA 4MO3M 1S0BA 1LAJA 3N9MA 1IX9A 1B06A 3POYA 3QH6A 2N04A 3LIHA 3AZWA 3AXDA 4CXXA 2QQIA 1GMMA 2ZHMA 3TJTA 3LOBA 2DTYA 3G67A 4B3RB 3SPIA 3DC5A 3T0DA 5FLHA 1QNMA 3D0SA 5KA5A 1BXHA 2A3QA 4PIZA 2OTLV 5LY1A 2LP7A 3STLC 5FXXA 3DCQA 4HK9A 3GHMA 4GX2A 3JD72 4AF9A 2A7WA 3CCVV 4NE9A 3HMYA 2X10A 4H7LA 2I45A 2ZJCA 3AXEA 3U07A 3K4DA 1BQ0A 4A42A 3ZR6A 2FCVA 2MHFA 2QQMA 1UU6A 1RUF2 4IHJA 3OBTA 5AFEA 2JDKA 4YY3O 3BU0A 3E6DA 3HKEA 4CH5A 1WMDA 5I0RA 1MABG 4XJZA 2ADEA 2DDUA 3RT3C 2AZ5A 2O8OA 4GXLA 4ASLA 1RUOA 2ZGOA 1BSMA 4YZ2A 3PU3A 3ZBHA 3E5UA 3APQA 1LU1A 3PHMA 2OKXA 3K77A 1U0AA 4UVBA 3ZRVA 1AR61 1O3RA 2LTNA 1Z7S3 3WF2A 1V55C 4CCDA 3J7HA 1MG1A 5FDBA 5J9PC 2O57A 1VBA1 3H1YA 3I3BA 4CP1A 4H44B 4JI4B 2QUOA 3A23A 4NO4A 4YW4A 4QPIB 5A6YA 2YBPA 1MQTB 4LBQB 1VF6C 1JUHA 4KWKA 3BTAA 2PYJA 4LO5B 4DR7O 3FLTA 3R4DB 4AQTA 4BIFA 3WB1A 2WZPP 3FUOA 1JCHA 1IBLB 2LO1A 2RS12 3MIBA 4MSVA 4GIQA 1W59A 1XMOO 2XBO1 4JQTA 1JS9A 3DXTA 2YY1A 3WZ1A 1I5PA 2ZGKA 3POSA 3HQXA 2LW1A 4WFAV 3FE5A 3ORJA 1BQZA 2Q67A 3HR0A 4XVHA 3T1HO 3C7FA 2F4PA 4FLTA 4ZZ5A 1ASJ2 1VQNV 5C9AA 5B3SB 3AFKA 2P6CA 4XZPA 3GALA 3G6BA 3SPCA 1D0GA 4AVCA 3B40A 1N1VA 2Q4SA 5BNNA 2BWCA 3ZXGA 2IC1A 1G9AA 1C57A 2PHFA 4ZZ8A 2VNRA 5EHDA 2WL1A 5EJ1B 2IXIA 4WM7A 4N7UA 4HZ3A 4J10A 4JHTA 1A34A 3Q9OA 1B04A 3ZN4A 3N9PA 2OUJA 1TMF2 1QQP1 4C0HA 1S0IA 1OCRB 1OZ0A 5BNOC 3AKTA 2FHRA 1XNBA 1ZRFA 2GP5A 3U14A 3H9AA 1VQKV 1FMD3 1DQ4A 4QB1A 4O61A 3ZSMA 2WAMA 1GU3A 2R32A 4ET7A 5A6QA 4MV2A 4DV3O 2XKOA 3T4HB 5BY5A 4Y1XA 5EBMC 1MS5A 4IHJB 1ZRIA 1JZ7A 1XU1A 1PGSA 4QWNA 4IV3B 2IVIB 2JICA 3JB4C 2LFSA 5IATA 2R1DA 3HN3A 5FPBA 1BQPA 2Z5WA 1DFQA 4ASKA 4P02B 1I1EA 2P5BA 3VBFA 4GUNA 4K35A 1RUD2 3BTYA 2Y6FA 2W1SA 4M4PA 1GQPA 3MZHA 1Q43A 4PA3A 5LMNB 1HQNA 1PV0A 4IGGA 4YM2A 3UO3A 4FXKB 1UZVA 5E89A 1VMFA 1FXHA 1TVKA 4DV1O 1S2BA 4JDNA 4BIUA 1J5EO 3D3QA 1W03A 4PV1B 2A73B 2O1QA 4FTSA 3K06A 4W65A 1XNTA 1DCSA 5DAQA 2JGUA 2ZHNA 2Q5ZA 1YEWA 5F3CA 1X8MA 1NQDA 3JD71 1Q7YW 3ZIXA 4DYLA 1OT5A 2DVBA 5HCBA 1HQLA 5C8CC 3I2HA 2JG8C 2UWBA 2GN7A 1IBMB 3E8HA 1JJOA 3L9JT 4NRQA 1RUF1 4EYUA 1YSCA 3ZYHA 5IW0A 4Z2WA 3A22A 4XFGA 2XOMA 4FO9A 2VW1A 2BBVA 2GC3A 4CYDA 1E5SA 2LUWA 2AREA 2LROA 4XHBA 3WP5A 1EZJA 5C7GA 2ZX3A 3N9NA 4UVCA 3CSXA 5L73A 2DYSB 4YJ2A 5BNNB 2JENA 1DGWA 1OV9A 5FZ7A 3OTFA 1R1A3 3LA2A 4W6YA 4IEWA 4HPKA 2JDHA 3OGCC 5K9YA 2KKWA 5DG1A 3KGZA 1H8HG 1V6OA 2QVSB 1Y74B 5JVDA 3NW4A 5DUUA 3LPGA 4MGZE 2EIMB 5BYNA 2XOKG 2EIEA 3ZRWB 1W8OA 3DYMA 1Z2GA 3DYPA 1O4TA 4Z1VA 2VC9A 3LSSA 4COYA 5A3PA 1E5RA 3VQVA 2XKPA 1PNLA 2RS11 5BNQA 1MSWD 1YIPA 4PD4F 3N36A 3KD4A 4I3PA 5FNVA 4LNUA 4PA7A 4I30A 4BISA 2RMKB 1YJWV 4LP8A 3TOJA 3ZVXA 3K79A 5L9VA 3RMXA 1AI6A 3MBWA 2JD4A 3WT3A 4UW4A 3DL3A 1RUC2 1J95A 4UF0A 5T52A 4XQDA 4MVZA 4O4LA 1N1TA 3G4SV 2X6AA 1JH5A 3WCSA 1ASJ1 2BNMA 3VBFB 4IDZA 4E8CA 5T5LA 4ARYA 1NR7A 1VEWA 3CJHA 1OFSA 3AKPA 2ZE7A 3RZGA 1K5QA 4J7ZA 2XJSA 3LCPA 4J9ZB 1WW5A 1T6BX 3N7MA 2RJKA 2UU8A 2QSAA 2X0LA 4AVAA 1Z5VA 3U4XA 3P32A 3EYPA 1Y9GA 1C1FA 1JN2P 1BHBA 4BB3A 1PZ9A 4DEVA 2ZABA 2BTOA 4OYUA 2VU9A 2Q69A 1NCRC 2O14A 5J96B 4MVUA 2HYKA 2EXKA 2Q1MA 4CUCA 3ASNB 2A6ZA 4FPKA 1ZNPA 2JE8A 4XC9A 3SHRA 3CYOA 1RIRA 1POV0 1XU2A 1H2MA 2SLIA 2P3IA 4RQPC 5A3WA 4TN7A 2R6QA 2VNOA 4DR6B 3L71H 2JEMA 1G9CA 3WP3A 1LGNA 4AQ6A 2ATFA 1N0NA 2KG7A 5GLWA 4QKFA 4IYIA 4CE8A 4CH4A 1NKGA 4QQ2A 1VF6A 3HB3B 3MI8A 2D43A 5C3PA 2UUCO 4GX5A 4WCEV 3RGBA 2PQQA 5J48A 3MW3A 4JTDB 4JI5B 1BEV2 4NPRA 3AK2A 3T1YB 2IWGB 2D5FA 2RDCA 3BB6A 3V0BA 4Q4W3 3VHPA 1RC6A 1W0JG 4KUMA 2XLGA 3RRDA 3GZUC 5FY0A 4LF7B 1C5HA 4HPKB 1YI9A 3N3HA 4XIOA 2GC1A 5GONB 1ZM1A 4OXSA 1FATA 5JJEB 1PD3A 1HDJA 1PM4A 4LO8A 2A3WA 4Y1VA 5IK5A 4JX0A 3LDBA 3BY6A 3DPRA 2A0LA 3VUOA 2CTQA 2TUNA 2XR4A 4XQ4A 4RGKA 1US6A 5KX5A 5DUXA 4YXWG 4RAIA 1IHMA 3ZMUA 1AILA 2YXYA 1R6KA 1HN1A 1W0KG 5FNVB 3A4UA 1SLAA 4CTEA 1QJX2 2VMGA 1G6UA 2J22A 5LBCA 3LF7A 3HQUA 1MVQA 3MICA 1JYIA 2WA3A 3WY6A 4IGPA 2YC4A 3BRCA 3VB9A 2BFUS 4X66B 1I3HA 2C9AA 2QFEA 5FP4A 1NH2D 4YFZA 5FZ3A 5FZBA 3PURA 2D6MA 4JI1B 2YIAA 5C33A 3VZMA 5A6XA 5SV5A 1RUNA 1MEC2 5FZ1A 2WLNA 2V4AA 3AG4C 1OA4A 5K8SA 1XSQA 3R65A 3JD3A 3RW0A 3C3TA 1M90W 2DQ0A 5A32A 1F4AA 3W58A 1Z0HA 5LZ6A 2N74A 3WHTA 1YFWA 3PVNA 4CU7A 3BIWE 1YXWA 1R3JC 1OMIA 1IS4A 5HFLA 4P14A 2WLKA 2VCMA 1HNZB 1VP6A 4IE6A 2W95A 4NJ4A 5DUWA 3JATB 5AVAA 4EZHA 1RUJ2 2Q1FA 1NXD1 3IPVA 2VQFB 2OQ6A 4BAYA 5J7MA 1V55B 4JVAA 1SQVH 2F17A 2GU9A 1MVEA 4BK4A 5ACA2 4DV4B 1Q8QA 2HP8A 2YDEA 4KG0A 4Y5TA 1VBE3 4YIPA 3M99B 1QJU2 1AR72 3M70A 4NN0A 1LOFC 3BPZA 4GWNA 4Z1MG 4X8AA 4IT5A 1LTEA 3WCRA 2PI5A 2VCBA 5B66Z 3ZXLA 4BLJA 1RUC1 2AYHA 3FYEB 1K45A 4WBNB 3DC6A 5F3EA 5JOWA 3FHIB 5EZWA 2J1AA 2FDKA 2Y26A 4BW5A 1OA2A 1NTZH 1E79G 1MA1A 1XMQB 3IM0A 3V0BB 1G86A 3E86A 5CAZA 4UOJA 5C8CA 1XOUA 2JG8A 4QKDA 5DQ0A 1JYTA 2F23A 3TETA 1DU3D 3TYJA 2WLLA 4P9YA 3ZSJA 1AX1A 1NLSA 3WD5A 2CU5A 3E6CC 3WR0A 5CBHA 5JJNB 1XE8A 2ARBA 1YTFB 5CA1A 2LW7A 1WCUA 1YDXA 1Y76B 3WDTA 5FR3A 1S72V 4GQ7A 5FYZA 1CZTA 1QVGU 4Q8LA 1YJLA 3CMAV 1QBZA 2CGPA 3POWA 1AI5A 1W8HA 1H2KA 1JOBA 3QG5A 4C91A 5KXEA 4QXCA 3H1LH 4BQWA 4FOYA 1VLNA 2EULA 1V9U3 1LR5A 3KVAA 5BNOB 1KXGA 3VBBA 4JDMA 4MS2A 2IM9A 1GM7A 1XMOB 1ZA7A 1HRV3 4TXWA 1BEV1 3ON7A 4QPYA 1TUEB 3O1TA 5A32B 5F9TA 3RYIA 1PO13 1WCDJ 1EN5A 1JI6A 4LF8B 3IDCB 2RDRA 3T1MA 3P3NA 1D4M2 1UZ0A 1NT0A 4I0AA 4DW1A 3LDCA 3NV3A 4N43C 4Y5SA 2VCAA 1FT9A 1CJPA 3AZZA 2RS53 3W59A 2VZRA 2YUEA 2HEVF 3IPVB 5GJ6A 3RQ0A 1S3JA 1NVPD 3I97A 3ML0A 4MUVA 1NLQA 4K8FA 4Q4V3 1P8JA 4LHNA 1CX1A 4BQXA 1UOGA 2IH1C 2PGGA 1YJNV 1SLIA 4JI2B 1FKAO 2YG0A 1QJX1 1EUUA 5A7WA 5M0TA 3K9SA 1RINA 3GHNA 1W0NA 3N7LA 5L7OC 1WWYA 2JECA 2ZEWA 4FAGA 2L6LA 1ROPA 4D7TA 5KAIZ 1AF9A 5TSWA 1FPOA 1NCRA 2VTXA 1CAXA 5IYZA 3T2QA 2EICA 3S5QA 1MEC1 1AVBA 5JWPA 2Z3YA 4QM9A 2OZ6A 1KUQA 2VG9A 5A9GA 1O3QA 5C8CB 3D36C 3ST7A 2JG8B 1J84A 2V72A 4EB6B 2VUJA 3ZXFA 3D5OA 2C6SA 3E35A 2OCHA 3VBHA 4DV5O 2RN9A 5K1PA 4D6QA 2XGXA 1RJ7A 4NTYA 3ZFFC 2HJDA 5FQ0B 3UETA 2WO3A 2GMPA 1RUJ1 5IVVA 5DAXA 4PQ9A 2QE3A 5FOBB 4RA0A 1GNZA 1EUTA 5FYUA 3ZYFA 2VOTA 1XUQA 3J81N 2F4VO 2J1EA 1U12A 2CDYA 1XE7A 5ACA1 1PHMA 3C3VA 1CPYA 3HJRA 4QXBA 2WZR3 3KT4A 3FB6C 4PCRA 3AB0A 3KG2A 1QJU1 2A6YA 1AR71 5GLZA 1U96A 4HT1T 3RBZA 2XLFA 1REEA 2ZS6B 1ZZBA 4MVRA 1YITV 1R3LC 3E2EA 1GP6A 1N47A 2PHWA 2ZCWA 3LIGA 4BQ4A 4BXSV 4DR3O 4X6QB 3H8UA 1ULCA 2WNUC 2HVJC 4LWSA 3SJQC 4RN5A 3ATGA 1H4GA 4JI6O 4Q0PA 4PDRA 2EF6A 1HNXO 1OPOA 1RUG3 1TNRA 4HN1A 5KWRA 2ZD9A 1Q81W 5KUMA 5CFDA 3WW2A 4C1XA 3RMYA 4Z92B 1H8TC 3JSNA 1I0HA 1DBNA 1IS3A 1EV12 3GZEA 1AR5A 1UCXA 3WDYA 2IJHA 4E4SA 3V65A 3ZFGA 4AHXA 1QNYA 4ONUA 1APNA 3D8CA 1XXNA 4XOGA 2RCVA 3FHAA 1RSOA 3WUDA 2JB8A 5FUIA 4QU1A 1AR83 4M3CA 4AQSA 3OGVA 3LPFA 3C7HA 2YIDA 3I3DA 2ZX1A 4GA9A 2D7FA 1XNQO 1U5IA 3BIEA 5FY7A 1FPN3 1RUI2 3ZHSA 2BZDA 2UWAA 4OLLA 4PDWA 5CYYA 5KC6A 2GMMA 4YM3A 2K9ZA 4FXGB 1KB9F 4RFRB 3GCXA 5CIRA 4MT8A 1W6QB 3GF6A 2DW4A 3T2MA 4CCJA 5BMVA 3K3NA 1J1TA 2WT2A 1S2KA 4A4AA 1B35C 4R9DA 4QMAA 4HAMA 1NCRB 2Y48A 3ZYIB 5IYZB 1YLLA 1GZWA 1W39A 2W87A 2CUGA 4QX1A 3WLUA 4R8CA 4GULA 1OA3A 2MEV2 2ZX4A 3FJSA 3FFZA 4RQPB 3AEIA 1LHVA 1D4M1 4TV9A 4CCEA 1OJHA 5IJ9A 2R042 3N7KA 3OBAA 3G7DA 1HIXA 3TN92 5T55A 3B8NA 5A3NA 4XJAA 3KGLA 3OMAB 2BVVA 2UUBB 2BFUL 3GM8A 5LBFA 1LNSA 1NR1A 2QTSA 3K5LA 2P2KA 1WNSA 3ACGA 2H94A 2VWJA 4W8JA 3VBOC 2VXRA 1S2EA 1QJY3 1GQGA 4WVMA 4UCUA 3RVYA 2GV9A 1YI7A 4TTGA 2ZNJA 1JODA 2FZ2A 4OZOA 3V0AA 5B1BC 1BS3A 3WFVA 1PMJX 1AYN2 3PMEA 4AQYO 4JC1A 4U7NA 1CIYA 4DR2O 3EJKA 3W7SA 4LWSB 4FZ0A 4DUYB 4QPGA 5IVEA 4E2GA 2KQXA 2K0GA 5JR2A 1C8M2 3O1RA 4Y26A 3B4SA 3ZHRA 2QQLA 2WS92 5BUVA 1XNRO 1NE4A 4N21A 1GOGA 3W7TA 4OQ8A 1UY3A 4XW3A 4X1IB 3WNNA 1IPJA 2VMHA 2Z5UA 3J8F2 1H2GA 3NWKA 1K5SA 4UT5A 5JH7B 3GDBA 4KBBA 4LO4B 4WFGA 2K1EA 1K73W 4CC6A 3KCYA 2M7WA 4DUXA 4FSJA 3MAQA 5F8PA 3KS7A 1W8FA 3T2PA 4OHXA 3PIGA 5LP6C 4IQPA 3AG4B 4JYAB 1QOSA 4TUYA 3NRUA 4LF4O 3O1PA 2VRZA 1MZ6A 1PMIA 3M4FA 2VQTA 2O8QA 4AAPA 5KC5A 4KBZA 1HB1A 1NG0A 4D8MA 4E2SA 2X05A 3WB2A 2E7TA 4RR3A 2LRPA 4XFIA 2EIJC 2W94A 3ZHQA 1AL22 1UZWA 3WF1A 3NNMA 3LZZA 3AC0A 4L8JA 1K5MA 4B4QA 2XAGA 2BOBC 4NXMO 5KMGA 4E2LA 5H2FZ 3H8OA 1KEXA 2VQUA 2YEVA 2QDOA 4O2AA 3Q8EA 4NTWA 1KECA 3WNOA 3J4UH 4DXSA 2WLIA 2JG9A 4OMDA 5FZ9A 3LEMA 1JYVA 3RZHA 4F8AA 5EYPA 4A3ZA 5C70A 4JYYA 1EV11 4B3TB 4LFAO 3OYWA 3ZYRA 4META 5F1RA 5I91A 5ITZA 2V4VA 2WSUA 1DTOA 3D3IA 1OVPA 3THTA 2OYQA 4PBOA 2AENA 4HONA 1W99A 4NYKA 1LESA 4Y22B 2GUZA 4WVMB 3D36A 2YBKA 3SITA 3WF0A 3T1LA 2GP3A 3OBZA 4AI0A 1RUI1 2ZHKA 2ZXWC 3KB5A 2JB4A 4DUZB 3I2FA 5LXTB 2G38A 4OFGA 1NA1C 4IYHA 5CN0A 2RM22 3ACFA 2HWE2 2BNNA 2B45X 1F4HA 3Q4HB 4UCOA 3JASB 5DECA 2PHUA 5KHHA 5KAFZ 2W92A 1CZSA 1MPXA 3IAYA 3LGRA 3KHBA 5FZ0A 2MEV1 2ZIOA 4JI3B 2LQTA 1G8MA 4K8ZA 3ZMSA 1URXA 2OT7A 2ZXQA 3CWBH 5CB7A 5K0UC 4CXWA 2HYXA 2R041 5B1AC 2P3JA 2BTQB 3TN91 4LF9O 5D21A 4JI7O 2A75A 4X8NA 1UXZA 1F5FA 2HKXA 1GBGA 3RZMA 1NXMA 4Q2FA 1L0LH 3STZC 4WBBA 4JPRA 3L74H 1COV3 4QQOA 4W6WA 5LL6Y 4JYBA 5A3OA 1Q8SA 2QWQB 4O4IB 1EPWA 2XXZA 2ETNA 1QU0A 4TUYB 5FXZA 1ULGA 4TV8A 4UFHA 4K9SA 3UO2A 4JKLA 1WLCA 1VBB3 1H2SB 4QPJA 1F9KA 3KCXA 2DUQA 1PZ7A 1CWPA 4R4ZA 1KFUL 4B29A 2ZM6B 2PHTA 1AYN1 3AMPA 2P34A 2P7TC 3KSCA 2HWC3 5JXIA 4N43B 3OEHG 4I4TA 2AEZA 2R062 1ND2C 2RDQA 4LFBO 4G2KA 2ZGMA 5F39A 1C8M1 1A6CA 4O2AB 5LMUO 4OUEA 2C0ZA 2WS91 3CBNA 2PUSA 1ULEA 1KJLA 3R4SA 2DWEC 3H1KH 5CBFA 1N3PA 4EROA 3J8F1 2ZZQA 4MHRA 3DF0A 3OYWB 5L7OB 1RTVA 3PUIA 3UKMA 5ITZB 1B35A 1RUE3 2UXCO 3L2YA 3WP6A 1XBLA 2AHZA 1UQXA 4IERA 1LOCA 1Y4MA 3ZXAC 4MGQA 5KLVH 1GZ9A 4ICGA 4BLIA 2RNBA 4YJ3A 3THOA 1WLWA 1EN6A 2GUZB 1VQMV 3HIFA 2XAQA 3BABA 1HW5A 3J26N 2VUAA 3MPBA 5CKMA 5A6ZA 2XDVA 5FPZA 4JI0O 3U1XA 4IGOA 4A3XA 1VB4A 3CCLV 3VDAA 3ZFFB 3TEZA 1RYYA 5I0UA 2WAOA 2DVDA 1O3TA 3AL5A 1AL21 1SBEA 1S0EA 5F5CA 2FKXA 4P9IA 4QDSA 1IS6A 2P1BA 4FFBA 3K59A 1H1MA 5JIUA 4F6EA 1LEDA 5G05L 5F5QA 2ZR2A 2ORZA 1SETA 1SACA 3FD9A 2CDPA 1KDKA 3LSQA 4DO2A 4CRQA 1OOPA 3HKBA 5GTIZ 1OURA 2WYSA 3E22B 1DF4A 3OY8A 3WP4A 2BERA 5LA9A 4MXWA 2G9ZA 2JIZG 2YXSA 2WNVC 3AP4A 2WNUB 3WG2A 1F15A 3WDUA 3ASOC 2VXJA 4IL6Z 1C3HA 3A7QA 2BV4A 4U2AA 2ATKC 4YGDA 1AR63 4AVBA 2J1UA 2R071 3N2GB 5EC1C 2VM9A 3B5LB 1WJZA 2WFPA 4HANA 3TBDA 3ZMZA 1TG7A 5CG9A 5KUKA 2CE4A 2GZWA 1OKOA 3LSDA 1VBA3 3JYCA 1H8TB 1YFUA 2K9PA 1Y43B 4F4LA 3AP5A 2VZ3A 4JAUA 5FMCA 5E1AC 1UL9A 2Q73A 1J3PA 4X88A 1UIKA 4ZOLA 3D6EA 1QGLA 4PJ0Z 2RM21 1JFFA 4B3NA 2HWE1 4FLVA 1U5YA 2CTRA 3L9DA 1ZBA2 1VMHA 1CAVA 3ZSKA 4I4TB 4C1WA 3ILFA 4CU8A 4IETA 1YYNA 2VULA 1PIV2 1M9NA 5BV6A 5IWAO 4E2QA 3VOUA 1TQ5A 3OT7A 3UJOA 3GZTB 4XDQA 1RHI2 3OE7G 1XBFA 2XBO3 3A21A 2UXNA 3Q8FA 1UOBA 4KHPO 1KYOF 4MVMA 4EZ4A 3NNGA 4ZHQB 1B35B 4YM1A 3SYQA 1A8DA 2ARAA 2X29A 1IPSA 4MH0E 3ALQA 4P9WA 4HLTA 5FV3A 5JOYA 1PK6C 2B7YA 2V4DA 4ABMA 4A2UA 4CEYA 1J1LA 1OD5A 4YJ3B 2BTVC 3EFFK 4DRXA 2QKDA 2JRIA 3E8GA 1DLLA 4OX9B 2P4VA 3B2EE 3AMHA 2DFBA 5IJ0A 2LFRA 1NH2B 4JKMA 4COWA 1XHZA 2BP6A 1REDA 2XHBA 4QGMA 3NNJA 4FPHA 1XNQB 1QQP3 5LHIA 1VQLV 2LW8A 2EIDA 1UXXX 3VZNA 4Y4RA 4E9KA 2R061 3VBOB 4NIAA 5C93A 4P2ZA 4V1PA 3WU2Z
chains in the Genus database with same CATH topology
1UPIA 2ZHNA 1XYPA 4I0BA 1KDMA 4IEUA 3MFAA 2NQYA 1UKRA 4XF0A 3IWZA 1X8MA 4FAHA 3A0KA 5GZGA 1NQDA 1GZWB 3JD71 4AFAA 3ZIXA 5JAXA 1H2LA 3ENRA 4CEYC 1DF0A 4H3WA 1GANA 3PNAA 2DVBA 2ZA9A 4GB32 2IFWA 1W6OA 5HCBA 1H9PA 5EWSA 1CAWB 1HQLA 1NA1A 1XNDA 2XJRA 3QD6A 4ES8A 1AXYA 1MS8A 5C8CC 5JZGC 1CPNA 1N1SA 1G9BA 2JG8C 3HD8B 1PZ8A 2UWBA 2GN7A 4AHWA 4Q4X1 4K6BA 1OQ1A 2C5DA 3DUIA 3L9JT 4JRAA 1FNYA 3HR9A 4FPLA 3VKMA 3I54A 5FRAA 3VKLA 4HFSA 1GY9A 5CG8A 1RUF1 1F2NA 1VBE2 4QD2A 4DY5A 4Z2WA 3IN9A 4XXPA 4HN0A 4XFGA 4AK3A 4C0BA 4XXAA 1NE6A 4FO9A 2VW1A 4Q0UA 1XYNA 3NJZA 2BBVA 4S2HA 2GC3A 2ZAAA 4CYDA 1VAKA 2PELA 2PLV3 3PJYA 5EV7A 2ZOEB 3E97A 4XQWA 1PGL2 2LUWA 2AREA 1OFNA 4YG0A 4X8PA 4XHBA 4L2NA 3WP5A 4NWVA 5K0UA 3O14A 3JQWA 2ZX3A 2YYOA 3ZIWA 1IS5A 5FO7B 5T5PA 2OUHA 1OS7A 2R072 1GFF2 2ENRA 2ETEA 4OI2A 1YO8A 3AX4A 2YGMA 2RS32 1O4YA 1HRI2 2ZGTA 3M8LA 5HXVA 5L73A 2HEWF 2XG3A 5BNNB 2BYVE 1S0GA 2JENA 4N53A 1QDCA 5JPNB 1RMU3 1DGWA 5J92A 1W6PA 1LOEA 2R063 1R1A3 3OTFA 2A6XA 3LA2A 4OVEA 4W6YA 4IEWA 4HPKA 1F31A 4LLFA 3V0AB 2B39A 4LBLA 1CAVB 2ZGLA 1F8VA 4EJRA 3IBMA 2ZGRA 5K9YA 2IZWA 5DG1A 3KGZA 3ILNA 1V6OA 4TZDA 3VHNA 2Z79A 2B9UA 3EO6A 3JD73 3QLQA 2QVSB 3ETQA 3NW4A 5DUUA 2GC0A 4LBJA 4MGZE 5BYNA 3N4MA 2D6KA 1CGPA 3RJ2X 4QPGB 1DZRA 5BNPC 1G9FA 1M4WA 1O4TA 4BOWA 4Z1VA 4COYA 4Q4X3 2XKPA 1RL3A 2RS11 2VMIA 5BNQA 2RMU1 1YIPA 3N36A 3KD4A 4I3PA 1RUH2 3MGUA 3CJIC 1RJ8A 1RUF3 1VALA 4I30A 5SV8A 1WLDA 4DRVA 2EXIA 5C4WC 1W6QA 5HBAA 5FMOL 2N7GA 3WV6A 2DVGA 4OULA 1NY72 3TOJA 3BALA 3ZVXA 1NYWA 4GMP0 3ZPYA 1YJKA 5KXBA 3RMXA 1SFNA 4XJWA 2OPKA 1NLRA 2JD4A 5T3NA 4MGIE 3H0OA 3WT3A 4XFBA 1CD3G 3JU9A 4ES9A 4SLIA 4UW4A 1QXJA 3NO8A 4N53C 3WW1A 2PHRA 1GYKA 3DL3A 2ZMLA 4BIOA 1X8EA 1PVC2 1S55A 4N9HA 5T5OA 1RUC2 3KLSA 3H7YA 5T52A 4XQDA 1N1TA 1LOAA 1YCIA 4YG3A 3VHRA 4B7KA 1WW4A 1H4HA 1JH5A 1DQ2A 1LCLA 2ZKLA 3WCSA 1ASJ1 2BNMA 3VZJA 4RQPA 2DCKA 3NAPA 3VBFB 2D6OX 4OHWA 4UXAA 1QKQA 1UU4A 3MLJA 5T5LA 2ZBJA 1H8VA 1KITA 1HRV2 3PVJA 2W39A 4Q0VA 3JBG2 3NVCA 2D97A 1OFSA 2BUKA 3AKPA 3IIAA 1NCQB 4XF4A 2LALA 2PHXA 2XLAA 3HT1A 2XJSA 5DDJ1 4LBQD 5EYYA 3LCPA 1CPMA 1WW5A 2NZ9A 4WVWA 3N7MA 4YZ1A 4Q4W1 2CTVA 1ZBA1 2D93A 1PO12 2RJKA 2UU8A 4RR3B 2JJ6A 3AYDA 1CX4A 4BHPA 4AVAA 1H0BA 1LGCA 4ZU4A 3U4XA 3VDDB 4LEJA 3VZOA 1CIWA 1OPMA 1QOOA 3MYXA 4HZFA 1C1FA 1JN2P 4S2DA 1PIV1 3FLRA 4AI1A 4CDQB 1PZ9A <