2ILMA

Factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
342
structure length
341
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYAEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1 alpha inhibitor
publication title Evidence that two enzyme-derived histidine ligands are sufficient for iron binding and catalysis by factor inhibiting HIF (FIH).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator, oxidoreductase
total genus 100
structure length 341
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2ilmA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2ilmA01
2XUMA 1IZ3A 2WA4A 3OD4A 4BIOA 1H2LA 4Z2WA 1H2KA 2YDEA 2CGNA 4Z1VA 1MZFA 4QU2A 2CGOA 1H2MA 2Y0IA 4B7KA 4B7EA 2YC0A 3P3PA 3KCXA 3D8CA 2ILMA 4JAAA 1YCIA 3P3NA 5JWPA 4AI8A 3KCYA 2WA3A 1H2NA 2W0XA 4NR1A 1MZEA
chains in the Genus database with same CATH superfamily
2VM9A 5K0UC 5JXJA 2A6YA 2WWJA 1DP0A 2A1XA 4CH5A 2D44A 3ZN4A 1EPWA 1YJLA 1QCEA 4X1YA 3N35A 5T5OA 3FL7A 3C7EA 2FCVA 1M93A 3WD5A 2XAFA 1JZ6A 4QPIA 3J81N 4PLNA 1AR73 1Q8IA 4P30A 5GONA 4MSWC 3E8GA 3ZN6B 3QO5A 4GX1A 1PVXA 3V64A 1Q86W 1BYHA 1HN1A 1LOEA 4B4QA 5BNOC 2HEPA 4FLVA 2Q8EA 1CPNA 2ZGSA 3AJYA 4TLFA 4HVOA 2E31A 5KC5A 1HP8A 3M7MX 5FYCA 5A3OA 1UY3A 4EB6A 2VOVA 3ZFFA 3AZVA 2XJSA 3RMXA 5JIAA 4UFMA 1SG3A 2PQSA 1DU3D 4W65A 1IBLO 1Q8OA 5B1AC 5F5IA 1ZRDA 3GCWA 4AVCA 1LHVA 4OULA 3FN9A 3DKQA 1Q8SA 2E7QA 3VBRA 4LXLA 3A0NA 3BOWA 4YRDA 3ZOIA 2G1MA 1OD3A 4Y20A 1OHHG 3RYCA 4A2UA 1YJKA 4FM0A 1C3HA 4XFBA 1POV1 1WLCA 4YJ3A 1QOSA 4EN0A 1NCRB 5FPBA 5JI7A 4CCMA 1HJGA 3EFFK 1HR0B 4NHMA 4BQXA 4DR2B 3QCWA 3M3OA 2UU9O 5FYIA 2PHLA 4X8NA 2E51A 2AHZA 4RD7A 2WLLB 4B3TB 1POQA 2YI8A 2JD4A 3HQXA 1QXJA 2PN5A 2Q69A 1UY2A 5IVVA 2ZGPA 2R9AA 1RC6A 3S6PA 1M56C 3KT1A 2ARAA 5LBQA 2HWD2 1OJHA 2RS13 5IYYA 1L7LA 1VRBA 2WYFA 2YBKA 1QEXA 2HLEA 3MHSC 4HBNA 4IGGA 1VMGA 2I74A 4MGKE 3BALA 3RVZA 2N74A 2QM4A 1LOFC 3DYPA 1SDWA 1MEC3 1ND2B 1UY0A 5JJJB 1KJRA 3GYDA 3R4SA 4GLXA 1AUYA 5L9BA 1BT8A 1YLLA 2DV9A 3K59A 3GZTB 3IPVB 4I3PA 3V0AA 3ASIA 1F7YA 1WGPA 4JI7B 2V73A 3IC7A 5IW0A 1PO23 3SPJA 2CK3G 5JJNB 2IU0A 3BTAA 1PGW2 4ASLA 3OUFA 1NZIA 2LGQA 5IJ9B 1EP0A 4J25A 4WVWA 3HIFA 4INDA 3FHIB 5FP7A 1AILA 3HBZA 3N27A 4D6RA 1AR83 1VBB1 1NVPB 2XAJA 4QU2A 4F83A 3H1IH 1OCRC 4UXNA 2WZ8A 1W39A 3JARA 1FFXA 4JV4A 1J83A 1WCSA 1NCQC 3ZFGC 2P37A 3H8XA 1UZZA 4FTSA 2VPVA 3SNMA 1XU1A 4R50A 2OT5A 1OQEA 4KUMA 4OHZA 3UT5B 1M1KW 4HFSA 4UFLA 1RXGA 4B3NA 3VN4A 4DXRA 3MHHC 2IJIA 3RDIA 3JZVA 1FXKC 1H9PA 1UU4A 2E7AA 2B46X 1VRH2 1Q43A 4LF6B 3ZVXA 1AR81 4BK5A 2KA3A 1WB8A 2JEMA 4KBZA 2LTNA 2WUHA 5LW9A 4GWMA 4JV5B 3AG1C 5EBLC 2W3JA 2R063 1Q90D 3ZDVA 3ZYGA 2CDPA 2VMGA 3FFQA 2WR9A 4XF4A 5KHIA 1RUE3 2DBIA 4F3JA 2P22C 4ZOLA 4J7KA 4D6QA 3VD9A 2EA7A 3VQYA 2ZT9B 1YQ6A 5LZ6A 2XOMA 3QO8A 3AMQA 1R093 3GJBA 5C6CA 2VCBA 2Q0AA 4IQPA 2YXLA 3CCVV 2LQTA 1SERA 1RTVA 5CFDB 5JZGB 5LRRA 2ZBJA 3TXQA 3VBUA 1H30A 1Y9GA 4K8XA 4JTCB 4LFAO 2Y6JA 2Q73A 3T2TA 2YG0A 4EFBA 4QQOA 1YXWA 3AKRA 4CP9A 3H8OA 3ZMTA 3CCQV 1H4HA 5C8WA 1EAH1 4NHYA 2Q8VA 4DV1B 1MS9A 2R061 1D7PM 2RCVA 4B8EA 4XBFA 3WU2Z 5LHHA 2A3XA 5T50A 1RUE1 1KQSU 3ZRVA 5IT6A 4V1PA 2NPIA 5HI0A 4I50A 2V1DA 5KMGA 5IWFA 1IXBA 1A32A 2WLHA 4FPHA 2RV9A 3TEZA 4HLTA 5IVJA 3BA8A 1SQGA 4Y22B 4MVQA 3A22A 3OGJA 2Y34A 1JI6A 3MIHA 4LBQA 4RSUA 5KX5A 2J1VA 3HJRA 3ABZA 1XNAA 4R8HA 2WT1A 5A33B 4PA4A 3N2GB 1HN0A 4JAUA 1FNYA 4MHUA 1ENRA 4K9SA 1G86A 1V6IA 1GQGA 3C7FA 2E74B 5CIRA 1V6MA 2KB1A 1OXCA 2ZD9A 3K5MA 3RN4A 3MYXA 3UO3A 3B8NA 2Q7HA 2B5HA 5H9RA 4GKJB 3ZYJB 3ZLIA 3NNMA 4O2BB 2WNVB 4AGGA 1I9RA 3U11A 5J2UB 3HQUA 2E7TA 5HFLA 2QZ2A 2E33A 3UT0A 2Q67A 1HLCA 1GN3A 4W6YA 1JHJA 1S0CA 1FJGB 2ADEA 1QR8A 4DYLA 3I2KA 1XU2A 4DRXA 3GGLA 4L87A 3LPGA 2LW1A 3DXRB 4PI2A 2W0FC 4R9BA 1UYYA 1V6OA 2G9ZA 4I7ZB 5H5NA 4AHWA 4CU9A 1B6QA 3O65A 4XQWA 3AG3B 5TISZ 5T3NA 4LHKA 3FAVB 1F23A 1NTKH 3JATB 4ZHQB 4Y1UA 4K0KB 2PAEA 1H2LA 1ULFA 2PI4A 1MPXA 2AZ5A 3AP6A 2IH1C 1HV0A 3PUIA 2QWPB 1E79G 2ZHLA 2A70A 5I8TA 4NJ4A 3IC9A 4FPPA 5BNPC 2WDBA 3AJZA 5J98B 1F4NA 4JAVA 1ENXA 4I0AA 5FYVA 1SBEA 2Y6FA 2NMNA 1XNTA 1BHBA 3FD9A 1HB2A 3I54A 2W1QA 3WDWA 1R1A2 1C1FA 1KGYA 5APAA 1VMJA 4YW6A 5BXZA 3EXUA 1N1YA 2ZX3A 3WW2A 1L1FA 3S7IA 3JB8A 5A3PA 3ABLC 4BIOA 4WFFA 4DR5O 2FZ1A 3LNMB 5A7WA 1LOGA 1XE7A 2HHHB 5JH7B 5FMDA 1QF3A 5FYBA 1P7BA 4FPCA 1TMF2 1FPN1 1JA8A 5IYZA 3JD72 1OI6A 1NAEA 4WM8C 1EPZA 3LSDA 1RVF1 4QPJA 3LA2A 3PDQA 2ZA9A 4LH7A 3EVKA 3ZFEB 4CDQA 2ZGKA 1R1BA 1RUD3 4TSVA 2WLPA 4DRVA 3VZNA 2YIAA 5T5PA 5L73A 4K20A 3ACLA 5JOXA 1K4CC 4WFEA 1SLCA 3PHMA 5CBGA 3HEIA 3LB9A 2WZR1 3D4KA 1FPOA 2PHXA 2YHJA 4FLYA 2QKSA 1IBKB 1ENQA 2EAKA 2ZACA 4Q26A 4MZUA 4LIUA 1R081 3I56V 5CG8A 4I2OA 1EFRG 4IW3A 2ZZJA 5LOVA 3NMBA 4Y5Z0 3N9QA 5J96B 1BQZA 1PO12 1QNYA 3N36A 3HT2A 4XTMA 2B1IA 1BJQA 3SITA 1J58A 3NXSA 4X9QA 2VCMA 3J80N 4MXWB 4GX2A 2VZ3A 4FPFA 2ARXA 3NJXA 1NE6A 4IL7A 2ZQMA 1GNYA 2DYSC 1C8M3 3ON7A 2OIEA 4U3JB 1AR93 2G9FA 1ZVFA 2CTQA 4FOQA 1RMU1 1WCQA 2O0OA 2NZ9A 3G7DA 5A80A 3APOA 4ZZ5A 1HX6A 4NKGB 2IBZH 1NQTA 5FXVA 1WMXA 1NTMH 3DUIA 5BY5A 5AG2A 1LUVA 3W20A 1IS6A 4JGSA 5FZ9A 2ZS6B 2ID4A 5FZBA 1CAVA 2G38A 4Y24A 4O61A 4JGYA 2MW2B 3BTYA 1UY4A 3POSA 4GWJA 3SKVA 2DVDA 4Q0PA 2CYFA 1DG6A 3UO2A 2RR13 5KAFZ 1Y3TA 1GM9A 4LITA 1QLEC 4TXWA 3AKPA 1GFF2 2P6JA 4I02A 4GX5A 4CUBA 4GZRB 1Z7S1 3HKDA 3AZZA 3OEAA 4LO8A 3MIEA 4J9ZB 4DUYB 5FMOL 4LO4B 3Q8FA 4MGSA 5F6KA 4CCCA 4MGYE 3WY6A 4X88A 2JK5C 4Q4V2 1VQ7V 2QQNA 4FT8A 1SA0A 2BTQB 4AI8A 1CD3G 1VBE3 2Z2SB 1FYJA 4UWDA 2WFF1 3K3WA 3K48A 5HXMA 1DDLA 3OCPA 2ZMNA 3ZMOA 5IFPA 3ES1A 2RR11 2GDSA 4CS2A 3FB6C 3K9SA 4W6WA 4NVPA 4HG6B 3UKVA 1WA8B 2PY5A 3CC4V 4O4JA 4MSVA 1H2GA 5EFUA 1N34B 1HJFA 3OGSA 5GTIZ 4XOGA 4ZS3A 3I3BA 4DY5A 5FXWA 1S0GA 1WW5A 2MK3A 1HRV1 3E8BA 2XHKA 5E89A 4LO5B 1WLDA 2EIMB 4LF9O 3CRCA 1C5IA 2VOKA 4CVUA 3VBOA 2FDGA 1EV13 3AK1A 3ZJZA 5EQUA 1VQ8V 5AC92 4Y1VA 3MI8A 5IWAO 2UXDB 1QNMA 1W0KG 2AEZA 2P3IA 3RYIB 1RIRA 2GTAA 4PI0A 5FNVB 1LUWA 4D8MA 2HKOA 1COWG 4LBNA 3JQWA 2WC2A 5LP6A 5HV0A 3D82A 4XDOA 1SQXH 2TBVA 4X62O 1CAUB 5BY1A 3QTCA 2A79B 1YDXA 4TQFA 5FBZA 2C26A 3AP4A 1ZBA3 5BNNA 3PU8A 1RUNA 2GUZA 1JFFA 2QDNA 1F51A 3HKEB 1STMA 1BVP1 3L72H 4OMCA 1YI9A 2YI9A 5L36A 4JI5O 2JIJA 1RUH3 1TUBB 5A6QA 2R073 4I4TA 4Z2WA 4CUCA 2RJZA 4QPGB 3SMHA 1G7YA 2VQFB 2DBNA 3ZSEA 5J2TA 4EWDA 1TG7A 2ZMKA 3B9IA 2X09A 1NOVA 5EC1C 2TUNA 1JHNA 1UZWA 4K8ZA 5DPNA 4NIAA 4RO2A 1G9DA 5A32A 1RHI3 4OXSA 5E6HA 1YYNA 1ZRIA 3D5OA 1HQLA 2OCHA 4C90A 4NOTA 3CC2V 4FFGA 2XVKA 1SDDB 4NIDA 1N1TA 3UL2A 3WW4A 4X1YB 2D6MA 3OGCC 1OCZC 1N0JA 4QPIB 4JKLA 3ETEA 4OX9B 2GC0A 2UYAA 2YFZA 4URTA 5LHGA 5A3TA 4QKNA 4B29A 4XEZA 1US6A 5GONB 5CYYA 3T1MA 2B42B 3VLBB 2WO1A 3Q8BA 4C1WA 5FWJA 1AR72 2Z42A 1LU1A 3C7GA 3WP6A 1YUDA 1PHMA 1R1ZA 4PF1A 3JBG2 2WLIA 1AJOA 2RVAA 3OTOB 4DK0A 4LOSA 4XHXA 3RRDA 4M4RA 2BFUL 1RHI1 1AHSA 3KF5A 4Q0UA 4Z07A 2E5LO 4EB6B 3ZFFB 4IE5A 4LHNA 2YV8A 4ARXA 2ZAHA 3K3NA 3T1YB 2UXCB 1LOCA 2VNGA 4XYXA 2JD9A 1N33O 4CTEA 3MEPA 4DS0A 2LGWA 5C3PA 2H6CA 2YU1A 4JI4O 3CE2A 4LF5O 4UBGA 2LROA 3VBRB 2YIDA 5FPVA 4AVSA 4DK1A 3VBFC 4QIWF 4QE9A 4Y20B 3RYCB 3WB0A 1XNRB 1J59A 1J84A 4EKWA 3T1HO 2O8OA 3ZXJA 3S57A 4YVWA 1X9TA 1ZM1A 3T4ZA 5E1RA 3BEHA 4QQ2A 3AYCA 1VAMA 2DTYA 2D6NA 1MNGA 4UW5A 3OB8A 2J7MA 4PJYA 5JJEB 3A0KA 2ZNIA 1GYKA 4OQ9A 3E2EA 4E4ZA 4DW1A 1ZSPA 1HNZB 1RUJ2 1I94B 1DQ0A 1QJFA 1URFA 4BAYA 2PHUA 1OCCC 2KSDA 1WA6X 4X1KA 3IWZA 1ZZ6A 3CJXA 3SEPA 1R64A 1C4RA 5EIBD 1HNWB 2JKBA 1N47A 4RS5A 5FOBB 2EIKC 3PUQA 2X29A 2QBXA 2Y4TA 2ZKLA 3DYMA 2RS12 4RQEA 3RYPA 1YTFD 3K58A 3D3IA 1JMKC 1E5SA 1XXNA 1YWKA 4KG0A 1BGYH 5LA1A 2GNBA 5I93A 1G8WA 4CPBD 1F9KA 3TETA 1MQTC 3KT4A 4P9XA 4JKKA 2W94A 1BK0A 5GALA 3A21A 1NUKA 3QH7A 5L3BA 4GJYA 5GKAC 4Z82A 2JG8A 3EBRA 1SFYA 4EYUA 3S5QA 1BS3A 3Q4HA 2OUHA 1JJ2U 1UYXA 1I5XA 4M00A 4GH4C 3X2QC 2A3YA 2RMU3 3VZLA 1BHAA 2ETEA 2GP3A 2VZRA 2NQYA 4G27B 2A5ZA 4E4HA 3FLTA 1XYPA 2J1EA 2BYVE 3JARB 3H1WA 1GQPA 1FFXB 1XQ8A 1S0FA 4UCVA 4D7SA 3AKSA 2F95B 1LODA 2VQEB 2BBAA 4JX0A 5D8AC 3CMEV 1BZWA 4ZU5A 2A6ZA 5G04L 3MHZA 3ASOB 4CXWA 1SPPB 1W9SA 3MD0A 3O1TA 4RR3A 1GSLA 4XUNA 1RUC1 3AL5A 3LDBA 4CCJA 4FCAA 5EXOA 1PL4A 4V2WA 2P6CA 2RNBA 5L3EA 5LL6Y 2RS32 3W58A 4HPKA 3ZSJA 1XMOO 4Q4Y2 1S76D 4GAZA 4RGKA 4JI0B 1UCXA 4IV3C 5ISLA 1S2EA 1V9U2 4MW8A 4AVTA 1CZSA 1AP6A 4GUNA 4N90A 1JCHA 5A3NA 4WFHA 1RJ8A 5FY1A 2NLRA 3C3VA 2VCAA 2WNUA 4FFKA 3WB2A 4X66O 4M3CA 3BA9A 2EJ7A 3E6CC 4ZOLB 2QTOA 3UK9A 1H1MA 2ZNJA 4RUFA 1P8JA 2JWPA 1HW7A 1R3IC 4N23A 4JZRA 5B1OA 1OLQA 1DQ2A 1JH5A 4ONUA 1OCOC 1GLHA 3KVBA 1OOPC 2JDHA 1I3HA 4RHV3 2Y48A 4XW3A 3HNYM 4LHSA 2XASA 3P3NA 4UVCA 3VBUB 3TN92 3VDAA 3N9LA 1X82A 1V6NA 3SH5A 1ZWIC 3O1OA 5JOWA 2ZXWC 2ES3A 4EN6B 3ETQA 1PD3A 1QJU2 1RUG2 4DMIA 2ZKOA 1YNAA 2DCZA 5J7MA 2X0LA 3UJOA 5LA2A 4I50B 3K4ZA 1E1QG 1AYN1 3AFGA 3KV4A 3RZHA 4UW3A 3WF2A 2JDIG 5LASA 5DDJ1 1W0OA 1HNXO 1NA1C 2DQ0A 3WDYA 4RHV1 4XF1A 3OOXA 3IIAA 1XI1A 4OGQB 3ZHVA 2ODMA 4FFBA 1FOD3 3VBSC 4H7MA 4WBNA 3VQWA 1B35C 1OSGA 5FPUA 4N7IA 4LBQB 4X64O 2JEUA 5KX5B 3LDCA 3DPRA 5FYYA 3PTRB 1ZZ7A 1I6XA 4H44B 5IJ0A 2J22A 4M3CE 1AR62 1R73A 2Y69C 5C4WA 4I0BA 5FPXA 1I1EA 4YVSA 3DCQA 4WVZA 3MO4A 4AQ6A 1WWYA 3E5XA 1VQ6V 4CE8A 3KWVA 1VBA1 4BA6A 3VBHC 1LKNA 4ASMB 4JVAA 5JWPA 5CBLA 4YG0A 2PLV2 3CRMA 5JCOC 4FZ0A 3TWIA 1W05A 2Y26A 2YXYA 3G6EV 1ROPA 2KD7A 4QAWA 2PELA 3CBNA 4CDUC 2V4DA 2D5FA 3NAPA 3IDAA 1TNFA 4DRXB 5EYPA 5EZWA 2XAGA 2OUJA 5HCBA 4LF4O 4UV8A 5CA6A 4LA2A 3W5MA 4AGVA 4LUKA 3WHUA 3R0RA 1SLTA 2F93B 2DYRB 2XBO3 3ILFA 3ABMB 3SGIA 4HZ3A 2Q1ZB 2W46A 2BCCH 3CWBH 2XH6A 1GANA 4TN7A 4CPBA 3LSSA 5BNQA 3AG4C 1X36A 4XIOA 4RA0A 1D2QA 4DR4B 5LGTA 1H8HG 4C8DA 4PDMA 1RJ7A 2VC9A 5J36A 4XJWA 3VHOA 2XL7A 1S2BA 3CLPA 3T1CA 2UURA 1OVSA 1GM8A 1HQNA 5FYMA 4FOYA 2ZR3A 3UJQA 1LHUA 4N53C 1QJY2 2GALA 3L73H 4R7CA 3IAQA 1ODNA 2I07B 3JB4C 2ZGLA 2XJTA 2P6HA 1UX6A 5HCAA 4H0LB 1N36B 3QOPA 1IBMB 4PT6A 2UUAB 1NVPD 4O4LA 2DURA 1XNBA 2YUAA 2ZIMA 5GZFA 3ZRXA 3NQHA 1S0EA 3IZOA 5CB4B 5FZ6A 3NR7A 4AEDC 5B3SB 1AJKA 4Y1ZA 5LA9A 5JLVA 3K5OA 1VE0A 3I2FA 5DZEA 4N43C 1KJLA 3CO2A 4LF7O 3ROUA 4J9YB 2OXBA 1KKCA 4P02B 1OQDA 3X29B 1NR7A 1REFA 2F4LA 5JOYA 4W6XA 5BR8O 4XZUG 1LJ7A 2OQ7A 4CDQB 2YPDA 4NRQA 4NYKA 1KMIZ 3R6SA 3H1JH 1FX5A 4QHOA 1N4CA 4FO9A 1AJPA 1J1TA 2J42A 3DEMA 3LE0A 3AYDA 3RZLA 2JJ2G 4LR3A 2HJDA 2ZJCA 1G8MA 1RINA 2WZEA 5F3EA 4JI8B 3ETDA 2OCCB 2HWE2 1AF9A 2Z0AA 2AEYA 1CP9A 5EJ3A 5CA1B 2DQ3A 3BU0A 5A6ZA 3RYRA 1Q8PA 3FB8C 3ZM8A 2VUAA 4DR3B 1D0HA 4BLIA 2JGUA 5LOVB 2CY6A 1QQP2 3OGIB 3OGGA 1G6NA 4YGBA 4PHZA 2LFSA 4IGOA 3ZFFC 3BCCH 1I08A 5LXTA 2QA4V 4XJ9A 3BIEA 2RMKB 4YNIA 4P14A 1AL22 1KB9F 2J1UA 4XDJA 3EO6A 4AQTA 1POV0 3GXUA 3VBRC 1O4TA 4MW3A 3WOGA 2XHBA 2XLAA 2Y6GA 4QHBA 3KD4A 4JYAB 1MVQA 1UYPA 1WCKA 3NNLA 1LGCA 4QB2A 3MFAA 4B1LA 4CDXC 1UKGA 2XR4A 4LBLA 2WQZC 1AR92 2HBUA 1RUI2 4DV7O 1MABG 4GYCB 3MW4A 3E5UA 5LY2A 1ZZ9A 1NI8A 1HB4A 2WBKA 2YC0A 2P4KA 4LA3A 3J7NA 1JZ5A 1E5HA 2GC1A 3HOBA 3VB9A 4BQ1A 1RGSA 1VP6A 4IV1A 5E88A 4BQYA 4KL1A 4AVBA 4HANA 1ZBE2 1CAVB 3IAPA 3NV3A 4Y4RA 1Q8QA 2DVAA 1CONA 4UVAA 1CZTA 5DAPA 4KI5M 1XMQO 2DDUA 1QH7A 3ETPA 1K73W 2ZEWA 4MTGA 5FTTC 2NNUA 3ZEDA 1KDKA 4DPNA 4IGQA 1NCRA 5D5QA 3D0SA 4NHXA 2FYUH 3T30A 4YYOA 3HKDB 1O8SA 3AC0A 4CCEA 2DCTA 3T2MA 1X50A 2YFUA 3VHRA 4ZPIA 2A6WA 2OYZA 2W6JG 3GVMA 3DKWA 1RM1B 3RWRD 3HWJA 3DC6A 2W5FA 3UESA 2IW5A 1AZDA 1UIKA 5D21A 1PIV2 2ZIOA 2A75A 3E1F1 3ORJA 3O1RA 4XHBA 1KFUL 2HWD3 1E5RA 5JDBA 1QOOA 3JD0A 2XPJA 2ZM6O 3LFIA 1DQ1A 5FKBA 2JIZG 3WF4A 1OH4A 4X65O 2XWJB 1RP3B 4JI6B 1K5MC 4KWLA 4YW3A 1K97A 3JASA 4O4JB 1GZTA 2ZHMA 1NLSA 1O5LA 2QGNA 3CCUV 2RJKA 2VWKA 1XNQB 1R3LC 4R4ZA 3IDBB 4WM7B 3VBOB 4DO0A 3RT3C 2RDSA 5FUPA 2V4VA 3K75B 2K9ZA 1KQRA 2VW2A 4B7EA 3TEXA 4AK3A 1D4VB 1H1AA 2N04A 2B8MA 2CTRA 3IFXA 2YC4A 5H9QA 3THTA 1DGSA 3ZHTA 5IJ9A 5LP6B 4KG8A 2R9IA 4EN7B 5J09A 1ODMA 1N32B 1D0GA 1ND3A 1N1SA 4WFBV 1XDCA 3IMNA 4Q27A 5F1RA 3SPIA 4IEVA 1JQ0A 4LNVA 5AVAA 5BNNB 2GH2A 2GUZB 1JFFB 1AX1A 5I8SA 2DOSA 1QMJA 4YZ4A 3ML0A 4B3RB 2JEXA 3LDRA 3KCCA 4BYYA 3ASNC 3UT5A 2QJ1A 3LSQA 3THPA 3OD0A 2VMEA 1JVMA 4XJUA 4XURA 4I4TB 2R9RB 1VRH3 4PDVA 4HOOA 1OA4A 2QM8A 4LO6B 5IVCA 3B00A 4I0XA 1SZTA 3PURA 5J2TB 4LBKA 3SR2C 3O1VA 4CP2A 4RGGA 4QHZA 4MX3A 5I0UA 3JCZA 5GJ6A 3SYOA 5FQ0B 1V6KA 1PGL2 4NXNO 1W8UA 5A32B 2H0BA 1K3EA 3M4FA 2VZVA 5I91A 1ALYA 2WT2A 2XQRA 3BODA 4DR7O 5F2VO 3ZRWB 5F37A 4CXYA 1I7FA 4QGPA 1QNWA 3O9OA 2Q0OC 5IY5B 3J26N 3KZ4C 2XDVA 3I59A 1JTZX 3USUB 2FD8A 2SLIA 3KT7A 1WW4A 3CJIA 3FYIB 3HD8B 1W6MB 2WLIB 3K2OA 4MVSA 1HV1A 5J3UA 5LMUB 2E32A 5C8CA 2JDUA 2F4VO 2MPFA 1SMVA 1EBOA 3RZMA 5DQ0A 1KD7A 1W9YA 1J5EO 3CSXA 4A41A 4AFMA 1JUHA 2P06A 2HWB1 3QBQA 1H2KA 4QU1A 1LB2A 4DR1B 5FP4A 2X5IC 2VRZA 3C8XA 2YEVA 4LEJA 1H8TA 3BTZA 5CFCC 4NWVA 3JALB 2HBTA 1IKPA 1NT0A 3M1HA 4FI9A 2BTVC 3SH3A 1WPBA 4ISRA 4DW0A 4YVWB 4Y3OA 5FZKA 1XBLA 2PF4E 2WLQA 1RYYA 5SV5A 2V4AA 1A8DA 3S0MA 4JZ2A 3AK3A 3BPZA 1Q6UA 5K0UA 4TWKA 1W6NB 1MZFA 1KP2A 4OHYA 1V6LA 3ZHRA 1GP5A 4NMIA 3R65A 1HR0O 2ET1A 1EN5A 2HYKA 4GT1A 4HKOA 4N9IA 1F35A 4UCUA 1VQOV 1JBCA 1NYWA 3SJBC 1SLBA 1W8TA 3VD3A 2DYRC 1BBT1 5F6LB 1JX9A 4X1KB 4B3TO 5BNOA 1YCIA 4O2BA 5FZDA 1W03A 1V00A 2AW9A 2IFRA 5J2UA 4RS5B 1Q82W 2VOXA 4GMP1 2C9KA 2ZE5A 1W2NA 2UY9A 2JG9C 2XJUA 4WFGA 2IJJA 5L7OC 3AG2B 2HWF2 1DQ6A 4A7YA 1YRZA 4DY3A 3DXRA 4OHVA 4JASA 1W6OA 3GWKC 4C91A 3NSTA 1VF5B 2LP7A 4CS4A 1HRI1 2VAUA 4JRAA 3QG5A 2GU9A 3Q4HB 2B4KA 4JI7O 2RN9A 1SACA 2W52A 3PIGA 3WG3A 3ZPYA 3BB6A 4ZY9A 3ES4A 3VDCA 1OF4A 2EXKA 3D36C 2VS0A 1SBFA 1XJAA 2Q9LA 2VBPA 3C7HA 4FOWA 1OLMA 3H3ZA 5HFMA 3ZDSA 2VNVA 4UW6A 4DIQA 5A2QN 5G05L 1VBB2 1FNZA 2UY8A 2IVJA 3H42B 4IHJA 1R1A3 1BEV3 4QQLA 2E9QA 1ZX3A 3PUSA 1K7DA 3OM3B 3LFMA 4PIZA 1TE1B 3F5TA 3K08A 1AVMA 2FDKA 3U1XA 2VQUA 3GHMA 4AI3A 4LULA 1REEA 4LBOA 2ZX2A 2IU3A 1NKDA 2ZX1A 1VQNV 1LGBA 4NB5A 4LFBO 3J8F1 4HPKB 2FCTA 1TMF3 2IC1A 3JD73 2VL4A 2D6LX 4URAA 2WLMA 5KXCA 2MEV1 5IVYA 1XYOA 3LF7A 5FAXA 1W3XA 2WNOA 1JYIA 3H8UA 4DUWA 4LORA 4WV8A 5JSPA 4Z1MG 2XAHA 2PTMA 1DBNA 2WNUB 3K51A 2WJSA 4LKFA 5FY9A 1LU2A 4JV5O 2B9UA 1CR7A 3OUHA 4XJAA 1KEXA 3CS5A 2VGDA 4BIZA 1X8MA 4LMFA 4TYSA 2YY1A 1W8WA 4HKLA 4PELA 4FPEA 4LKEA 2MNGA 4JTDB 3MPBA 3JD4A 5LEKA 2OW4A 3INAA 1W9TA 4IEYA 4JPRA 5FP3A 4L99A 5L3CA 1NCQA 2YUEA 3WP3A 1PO13 2C9AA 5EBMC 4PDWC 4S2DA 3AYEA 3NNFA 5DUWA 4HXCA 4FQZA 1EAH2 3GNEA 3AX4A 2HEYF 3OBAA 1WJZA 1X8EA 2VNRA 5LRSA 5ACA1 1DGWA 4OUSA 4Q4W1 1AVBA 3K9AA 4MXWA 3S5AA 3MF6A 4B7KA 1LCLA 1UU6A 1N8RW 5K4LA 3E35A 2ZHKA 4AF9A 4EZ4A 5FO7B 1QJX2 4LFCB 1QJZA 4JGYC 2CH7A 2PGGA 4U3JA 3B9CA 4MVMA 3PTYA 4BU2A 3LEIA 2K9PA 5FLXN 3B02A 3U75A 2VBDA 4FFBB 4WBNB 1Y7BA 2JDMA 1PO11 2C5DA 4ASKA 1G4YB 4FVVA 3DPRB 5E16A 1GO3F 1TME1 3L74H 4RQPC 2CE4A 2R32A 4OI1A 2EZPA 1SQBH 1SZXA 2UU8A 4AOCA 4YVSB 3VDBA 1NT2B 3T4VA 3AMNA 5CB7A 3WG7C 3BAAA 3OD4A 3WX5A 5FCCA 5FIXA 1YHFA 2VW1A 4PBOA 4CS3A 2FB5A 5FZ7A 4NXMB 2F23A 4YGDA 5B1BB 3PVNA 1MMMA 3EB7A 1UN1A 2VE1A 3RPQA 2JECA 4HNAB 4GKJO 4M4PA 1S0DA 4CCNA 3J7HA 5T5JA 4BXFA 4FSJA 4K1ZA 3T3YA 5T52A 4KGQA 4Q4V3 2HEVF 4Q4X1 2BVBA 5D2AA 5FWEA 2OYQA 2P1BA 4UCRA 1O4ZA 5EYPB 4MOAA 1CPMA 1O7FA 1ASJ1 4LK7A 1FJGO 2BOCC 1IXMA 1H2NA 2BTQA 3AP7A 2QQWA 4LR4A 4COWA 5JVDA 5BUVA 5C7GA 4MXVA 1F5FA 4JI2B 4DB5A 2PMWB 2Y0IA 3VBBA 2P3YA 4NPMA 3KGLA 4XC9A 2XBO2 3E97A 4IEZA 3TEWA 3CCSV 5GM0A 1QKQA 2VR4A 4K0KO 1J95A 2QWRB 2VUCA 5T5LA 3ZIAG 4KU8A 2XMLA 2YDEA 3FZ3A 1WA8A 3F5WC 3PU3A 1A3KA 1GAXA 1UY1A 3AMPA 4Q4V1 1XNDA 3GCXA 1FAYA 4BH9A 4DV5B 1IOAA 3OY8A 1JYVA 1PV0A 5AC93 4BJ0A 5CMUA 1JU3A 1SQPH 2ZDIC 4AEKA 3CCRV 4MTXA 1C57A 4JTAB 2AZ0A 5IFTA 3HN1A 1ULEA 3NL1A 3RYIA 1DGRN 5LHIA 3K4DA 4O4LB 1GKBA 1XB9A 4HK8A 1MG1A 4R6ZA 1Z5WA 4CUAA 3ZO0B 3ZYPA 4DQAA 3K57A 1OQ1A 4LF9B 2AZ2A 1F2NA 4H37A 2ZGQA 1IDSA 2ZTNA 1X4TA 1JMUB 1A8MA 2P17A 2HHHO 5IK4A 3OPZA 5A7SA 1PMJX 2ADDA 1D4M1 1RVF2 5CKNA 1BMV2 5L3GA 4FM1A 3VKOA 4YM3A 4DV3B 1Q56A 3WLUA 2ITDC 4UB8Z 2OPKA 1V0AA 2HJFC 1LNQA 2CWSA 2WS91 4X8AA 3U4XA 5DM6V 1UJWB 5CADA 3MPPG 2BE3A 4H2AA 1AI6A 1COV1 5EZYA 5I8YA 3O0XA 1GN2A 3OEHG 4JHTA 5FMCA 1M4UA 4GZ9A 5KHHA 2WZR2 5BNPA 1QBZA 5C5UA 2R16A 4TTGA 3MIGA 1YHQV 1ZL8B 1FFTB 1GOGA 4GWIA 3T0BA 1R082 3RGBA 1IBKO 4PDLA 4AEJA 4DV2B 3I2JA 2XJPA 5ABJC 2BSKA 3WVJA 2IXIA 2XLGA 1TAEA 2CDYA 3H9VA 4QM9A 5LXTB 1JXNA 4NAMA 3M70A 1ZZCA 1JW6A 5CA3A 3RJ2X 3IN9A 4QGMA 1O4YA 4XDLA 2J1RA 3IDCB 4DXWA 2VCCA 2QKAA 4YGEA 1P84F 4CC6A 3JQXA 3T0AA 3WNLA 3JBG3 3G6BA 1O6UA 2QE3A 3VDDC 1L0LH 3RI8A 1ST8A 2JE7A 4WM8A 2GP5A 1IURA 1RMU2 1CX4A 2W87A 3HNMA 3APBA 1Y76A 4KBBA 3NNGA 4J80A 5IYBO 2HLDG 3KGZA 3SC7X 3ZXEA 1MS8A 1VEWA 1C28A 1TNRA 3I3EA 1G1XB 2R6QA 2UXBB 5IVEA 2LALA 4IV1B 1QDOA 1NLRA 1V9PA 4YIOA 3W21A 2JENA 4BQ3A 3WDVA 2TNFA 1WMDA 1ZRRA 1PX4A 1AR71 4LBQD 1TZOA 4CZSA 4W8JA 1LOAA 5IVBA 3JBG1 2W91A 1W3VA 4DUZB 5J37A 4XUTA 4LC1A 4NN0A 3I4IA 5GLUA 1M90W 5L9RA 2JS3A 1SC5B 2ZKNA 3T08A 3N9OA 4DXTA 2KKWA 1WB7A 2P90A 2Y60A 3VZOA 3WB1A 2W92A 1UPSA 1Z7S2 1RUJ3 4B1MA 2NN8A 4JQTA 2VOWA 4EJRA 1K5SA 4K35A 5BXXA 5FJHA 1HB3A 2B5UA 1S5HC 2IXJA 3BY6A 5H6RA 4DUYO 3ZBHA 4O7XA 1FYUA 2Q30A 3J7MA 2O1QA 2JB8A 5C8YA 3I2OA 2JG8C 5JQGA 3PJYA 1SZBA 4BPZA 2WFF2 1YQCA 3KB5A 4JI1B 2H6BA 4CDWC 5FMOS 2EIJB 5FYSA 1GTOA 2PQQA 3IGAC 3JASB 3LSEA 5FY0A 2DW4A 3HMYA 2OPWA 4Y26A 5T55A 5FO8B 5C9AC 3M7AA 5JUVA 2WPDG 5CEHA 1JYWA 3MLKA 1ZYBA 4GKKB 1HRV2 1JOJA 1OPOA 1XREA 3W7SA 1UXZA 1UO9A 5LYJB 4EROA 3FBYA 1H2SB 2NM1A 3D3AA 3OW2U 2BPA2 1AR5A 4LWSA 4RR3C 2KXLA 3FFZA 1S0BA 5EV7A 2RS11 2UXDO 4GULA 5KWRA 4IETA 2HFEC 5DAWA 3H9AA 4FM2A 3KHBA 4P9WA 1ND3B 3B2EE 3BCWA 4UFKA 1MEC1 3PVEA 4BZ4A 2CHHA 4BDVB 3IAYA 5DEDA 3Q9OA 2ARBA 3IMMA 2GTSA 1W2TA 1XL6A 1RITA 2Y0PA 3CCJV 1UKRA 3POYA 3G71V 4U2AA 5FZHA 5GLTA 1OPMA 2VZUA 3BFRA 2RJLA 1SPPA 1J3QA 3AKQA 3E86A 1PO21 4CH3A 2RS33 2H94A 2FMYA 4LIVA 2R72A 1TUEB 4Q4Y3 2YPJA 5DAVA 4GKXA 4HN0A 4I0XB 2QR4A 4L8QA 4CEWB 3PVOA 2UXNA 3O5SA 1V9U3 4MVOA 2DJVA 4NTXA 2DWRA 4YW7A 3L9DA 1C8NA 2ZE6A 2TEPA 4QX0A 1V55B 2VO5A 4NPRA 3WNOA 4BW9A 3F7VC 3AEIA 3HBKA 3RJRA 3GHNA 3IDEA 1BMFG 2F66C 3NRUA 2Z4FA 1WN7A 3KMHA 3APQA 4NRMA 4KGGA 2GDFA 3MDSA 2FKXA 5CBFA 3CC7V 3OTFA 4GWNA 3QO7A 1XMOB 3HQRA 3H1MA 1UZVA 4DOUA 4FQ4A 3TN93 3IJ4A 2VQAA 3FX3A 2Z69A 3I49A 2WL1A 3I59B 1WA4A 3LCPA 4RQFA 1W9FA 4K8RB 4OX9O 1QXRA 4TOIA 5GZGA 4DXSA 4JCKA 4FFFA 3ZSKA 3CJIB 2RQ6A 2P5BA 3NJYA 4F8AA 4ZU7A 2EINB 4ASUG 2QQUA 1QJU3 1RUG3 4CP0A 3HB3B 5H9CA 2ZEYA 4UOJA 4H7LA 4JGZC 1W06A 5C8CB 1XOYA 2K0GA 2QWOB 4XBLA 1V54C 3EHKA 2YROA 1M57C 5LCWL 3OTOO 1W2BU 3PLQA 2OQ6A 5FYUA 2CGNA 3QVNA 1VQMV 3LD8A 5C4WC 2PYTA 1W9WA 3TOJA 2PHRA 1R091 4MO3M 1MS0A 2RE9A 4I30A 1NQDA 4EWEA 2YEVB 4DEVA 3T1YO 2UXCO 2RS53 1MZ6A 1H8TB 2DVFA 1M9NA 1KDMA 1DLCA 1WD4A 4A3ZA 4NAOA 1NY71 2D93A 4R8CA 3MIBA 3LUTB 2XTAA 2BFUS 3RZZA 5B2GB 4AYUA 1H2MA 5IYCO 1DYPA 4IEPA 1UQXA 4S2GA 1XNRO 2A9HA 3VZJA 1XSRA 4FPGA 2GC2A 3LOBA 4P9OA 5K0UB 3OG2A 1AR63 3L2YA 3FJSA 3POBA 3GBGA 4MHRA 1US2A 3ABKC 1Y4WA 3NAPC 2W9XA 1GUIA 4QPWA 3RYHA 5EIBC 1MSWD 3GB7C 1YFYA 2F17A 3TEYA 5D1IA 5EYYA 1NZCA 3CCEV 1OKQA 3ZN5A 1LEMA 5FZ0A 5I0SA 3ACGA 2CAUA 2VD7A 1HNZO 4Z8BA 1NH2B 1I94O 5BNOB 2PLV3 3GWOA 4QX1A 4I55A 3VV1A 4D3WA 5A3MA 1ZRCA 3KQ4B 4AAPA 3LPFA 2DE0X 2IJHA 5D5PA 1HNWO 3ZXLA 4P9IA 3WNNA 5FK8A 1TA8A 5B1AB 1W8NA 3PNAA 4QQPA 4TV9B 1W6OB 1R6KA 4MGZE 5DUXA 3I3MA 3VBFA 2VECA 5CZKA 4DRRA 5JSOA 3AMMA 5GLVA 2VTXA 3AFKA 3GJAA 1DGWX 4YY3O 1ZA7A 3HN3A 3WQ7A 1W8ZA 5L19A 2VU9A 3ZS8C 3MLLA 1REDA 1MZ5A 5A9GA 1EM1A 4EEQA 4H33A 4AHZA 2C1FA 3I5DA 4J1WA 1VBC2 1QJY3 1GOFA 1QIQA 3QF7A 1ZZ8A 2EICA 4LHLA 2BBVA 1QU7A 5LB6A 2ATKC 1KP3A 1GRJA 2WO2A 4YWAA 3WFVA 4IHJB 2HVKC 3ZSLA 1PK6C 3VL8A 3DSQA 1UZ0A 3LAGA 4OZXA 4ES8A 1PL0A 3JAWB 2Q6AA 5FJKA 4SBVA 3S30A 4MV2A 4CU6A 1P49A 5DUVA 1VP7A 1BEV2 1M56B 4JYBA 5FXZA 4CP1A 4TUYA 4YHHO 4RAIA 4E8DA 3EYPA 2EILC 1XSQA 3ZMZA 4FAHA 4HVRA 5CB4A 3KM5A 1RUC2 5C3OA 3F7YC 3SCGA 2D5HA 1N0NA 3DYOA 4UF0A 5IAXA 3DL3A 1SHWB 1UL9A 1QJY1 1ZRFA 3B69A 1H9WA 4JI0O 1MQTA 4ZBMA 3MW3A 1VIWB 2GMEA 2J1TA 2OS2A 1BZKA 4GXLA 5B5EZ 3SKJE 3WDXA 3M99B 2VZOA 4UXAA 1XL4A 3ZMVA 1VAKA 4MYEA 1Q3EA 2HWE3 4GH4A 2CTVA 4IESA 4GD4A 3H1YA 2NYYA 2MHFA 5FKCA 4OZOA 1AP5A 4LBEC 5CA1A 1OCRB 3K4AA 1ORQC 3QACA 2BGCA 5ITZA 4R9CA 1NCQB 3ZFGB 1QQP3 3HVDA 4O9GA 4GJZA 4QPYA 4LUMA 5D8AA 4EN8B 3VZKA 3CB2A 3OEBA 2JIGA 2UXXA 2J1AA 2VUDA 4FTEA 2L6LA 1AL23 2Q7GA 1XNCA 3WZ1A 5KHJA 1RUD1 3P5BA 3UGFA 3WHTA 2ZAAA 1WLTA 3RS6A 5GZCA 4IL6Z 3ABUA 3ZX6A 4HK9A 1FXKB 1F5JA 3WF0A 4LH6A 4COZA 1JZ7A 3STZC 3LDDA 3OYWA 1AYN2 2VULA 5FY7A 3GDBA 2CH7B 5DDJ2 4IV3A 5FO9B 5ANQA 2JDYA 1PNKA 4CRQA 1RUI3 1GMMA 2ZE7A 1HQWA 3FUQA 2JVDA 3CPWU 1FKAO 5CG9A 4NIHA 2WINB 3AG1B 1QQP1 5FPLA 5DZGA 1NCRC 3WG2A 3UKNA 2WLNA 5A3LA 3N2KA 4LF8B 5KR7A 4AFAA 4M0NA 1Y4MA 1WD3A 1F4HA 1EY2A 1NR1A 1ZBE3 1BE3H 1S0IA 3OUSA 3EHBB 4MTFA 1FD9A 1U5XA 3V0BA 1D2DA 4LE3A 4UVBA 3MF9A 4XVHA 2BV4A 2V09A 5DN2A 5IK5A 4CU8A 1C8M1 1SLAA 2A7WA 1AR91 4UT5A 1RUI1 3I2GA 1O9GA 4BLJA 4QDQA 3LWCA 1MA1A 2DVGA 1VBA2 3OMAB 4EV0A 1AB3A 4FAGA 4HSLA 1URXA 3TJTA 4NIIA 2GZWA 4XTPA 3O12A 1AR4A 3FE5A 2P2KA 2UWCA 3A4UA 1ND2C 5JXHA 2QKDA 1PIV3 4E8CA 2PZSA 1YJWV 1AL0G 1FXZA 2ZABA 3KCXA 1VB4A 3O1PA 4FOVA 2D6KA 3N3HA 5JVDB 4QNHB 3POFA 1NA1A 4O4IB 2UUBO 1UOFA 4OI4A 1AI5A 1WPXA 4RGAA 1FV3A 3H8RA 3OMIB 1CESA 2YYOA 2FDFA 1JN2P 3VBSA 3CP1A 1B35A 3WQ1A 2W1SA 2IJKA 4DR6B 1QXPA 3SYPA 3NO8A 1JZ4A 1NKGA 3FB7C 4EFEA 1BQ0A 4DR4O 2K1EA 1UMHA 1XPWA 5KXEA 2W1WA 3CMGA 3BU7A 4YG6A 2R1BA 3OY8B 5L3FA 4LP8A 4NTWA 2ADQB 1TVKB 2AXTZ 1LR1A 2HH9A 2RM22 4XABA 3HPNA 1THZA 2ERFA 2ZM6B 4WM7A 4IT5A 4H3WA 1K92A 1VBE1 1PNLA 3W7UA 3HKCB 3RFRA 3VBHA 2OZJA 3KS7A 3WF3A 3DF0A 3R05A 2A0LA 2VVDA 1N36O 4IDZA 5JCOA 1UF2C 3ZXAC 3FHQA 2Z79A 1XEQA 1KS5A 5F9TA 5HCFA 4CDUA 2QDRA 3KHCA 3S7EA 4AHCA 1XHXA 3AXEA 5DMYA 1GNZA 5LBCA 4LBMA 1OUSA 1EN4A 1UPGA 1O3TA 5KUKA 1OUXA 1PZ7A 1VAVA 4TT3G 2UWAA 1SEFA 4GCZA 4QKDA 2PHWA 1EV11 3OR6C 1HB1A 3ACIA 2YICA 1I5YA 5HV4A 3K5LA 2X53S 2F6BA 4I09A 2R30A 5FL7G 3RVHA 1VALA 5GLZA 1NX9A 2Q5ZA 2A73B 2VVFA 1PPJH 2E76B 2QJVA 2GMMA 1MS1A 5EZYB 2LM3A 5F39A 5CFDC 5JZGC 1DF5A 3UGGA 3KLSA 3V56A 3GZEA 4JI8O 4HYOA 2JDZA 1JOPA 4IEQA 5BNPB 3CL1A 5K8SA 3E89A 5FQ0A 1LNSA 1KC8W 3R66A 4Q8KA 2BP6A 2R042 1ZBA1 5EIYB 3BPSA 2Q8OA 2BSKB 1GR3A 2JDKA 1QVFU 5J48A 3N7LA 4D6SA 3E8HA 5FZFA 4FXKB 3ZRWA 5F3CA 4YZ1A 1OF3A 1RUH1 1LOBA 2R071 4BQWA 2P5OA 3J4UH 3DXTA 3ABLB 2JXAA 1ENVA 5J9PC 4NXNB 4N43A 2Q7EA 3USUA 4N7UA 5LK5A 4N8MA 5H2FZ 4IE7A 1W6MA 4WM8B 4AG4A 3CZUA 4JYAO 3L2HA 4FLWA 4DV4B 2Y0OA 4CZZA 1F31A 4DR7B 2L35A 2BZDA 2F43G 1Y76B 4FLXA 4PIXA 5A1FA 1DGLA 4CA9A 4LO7A 4ES9A 1GZCA 3WG4A 1W2OA 2X7RB 4PA3A 1WMEA 5FY5A 1UU5A 1JYCA 1VBD2 1WKYA 1RB8G 5FK7A 3PUHA 2PHFA 3I3DA 1SESA 3JALA 4OQ8A 3WT3A 5KXDA 1JYNA 1POV3 4GMP0 4EWAA 2F4VB 3D8CA 1R3KC 5JIUA 2WNVC 2QKCA 4OI2A 1KD1W 1J5EB 2UUCB 3E22B 2EX3A 5E79Z 1S55A 4RUEA 3C7OA 2XT9A 4AI9A 3LZZA 4ATFA 5T54A 2DUOA 4QE7A 1SBDA 1W6NA 1ONAA 5A7PA 2GN7A 4CXXA 1AYM2 1YITV 5KLVH 3J9SA 3AB0A 1NU1H 2QSAA 4GKYA 1SCRA 5JR7B 1VPHA 4J7JA 3CF6E 4BCUA 4O4HA 2BTOA 2DYSB 4FLTA 3W5NA 2XAQA 3AG3C 1WZXA 5C8YB 1DTOA 3R4DB 4FZ1A 3K46A 5LMNB 3N7JA 3DGEA 5JQGB 4Y1XA 1LGNA 4CDXA 2PYLA 4WVMA 1K12A 5A6YA 2GMPA 4R52A 5KAIZ 2HWF3 1PKXA 4J10A 3ENRA 4FP2A 4NR1A 4JI6O 4LOTA 4XDQA 5FZ8A 4AWDA 5A1LA 1QU0A 1BCCH 1SRYA 4XFAA 4FJCC 1W6QA 1W0PA 4ITCA 1U96A 3MUY1 4KWJA 4B3MO 1LEDA 4L8JA 4K40A 1CXZB 3SCFA 1XNQO 4YZ5A 5EWSA 1RUOA 3H1HH 5IDJA 4LLOA 5K7PA 2YXSA 2XONA 2FL4A 4XJZA 2ZGOA 3ZYFA 4LWSB 1QLEB 2W39A 4JI3O 5C71A 4IE0A 2HWF1 1VBB3 4G9SB 1KS4A 5EHDA 3AKTA 4DINB 4CCOA 4PF5A 4PCRA 1Y66A 5FY4A 4OMDA 4FFIA 1LHWA 4OUEA 2EZOA 4JYYA 1N32O 4QB6A 3ACFA 1HXS2 5C3SA 3HR0A 1BKZA 4QX2A 2QQKA 3ZFEC 4CH4A 4KHPB 3EXAA 2QTWB 3RI9A 3ZYHA 4NE9A 4TLGA 4AI0A 4FXGB 3MV01 2BGPA 4B3RO 3BUCA 5CKMA 3OMNB 5FZMA 2Q8DA 3RVYA 1K5MA 5JPNB 2RMU1 3FUOA 3NKTA 4YXWG 4N9HA 5A6XA 2WAMA 4XZPA 3SXWA 1J3PA 4A6SA 4Q29A 2XJVA 1Z0HA 4CCDA 4JZGA 3HAGA 4DEQA 2JJ6A 1L3JA 1CX1A 4UCOA 3K03A 4B3SB 3W7TA 3THCA 2EVXA 3PMSA 2BWCA 4LFBB 1W59A 1PM7A 3F2ZA 3QD6A 2ZGMA 1VMHA 2WAOA 3TAYA 3B7MA 1D5AA 1DZTA 4YIPA 2PHTA 3VD5A 3RZKA 3TYJA 2GNDA 3BKZA 2GSMB 4L92A 2DU0A 4JDOA 1O91A 4YLZA 4X89A 5LGUA 1HW5A 3ZKUA 5LY1A 2VG9A 4ZONA 2B1GA 1VF6A 4XFGA 3WW3A 4AILC 4XCAA 1M06G 2D43A 1EAH3 4X20A 1JODA 4UCSA 4A6OA 2D2CB 2C2AA 2XOKG 1E5IA 1UZYA 4ZXEA 1ACCA 3RG0A 2EIGA 2IWGB 4F7ZA 1W90A 2BDRA 3ZMSA 5LMUO 1J1LA 3AK2A 2BRTA 3SPCA 3ZIWA 2HWB2 3WP5A 3POEA 1QJX3 1CQ9A 3ZRSA 2A71A 2W08A 1RL3A 3FB5C 4C0HA 1ZA4A 3LEGA 4DR1O 3RWKX 1Z5VA 2RS52 1GU3A 3TNQA 3I97A 1AX0A 5IAVA 3A0HZ 2QWNB 4SLIA 4O2AB 2YB7A 2VMCA 3H7YA 5FZ3A 1R3JC 4KQ7A 4AQYB 3JAKB 1S5JA 1BXHA 2Q1MA 2KR2A 2AGSA 3ZXDA 1XNKA 5F32A 5EC2C 2P4EA 5GW7A 3RYHB 1APNA 2BVVA 1ULGA 2XJRA 5F5CA 2BERA 3D3QA 4BB3A 1OCZB 2CWMA 5C33A 4XQ4A 1AI4A 3OAAG 1QJX1 4JYCA 1PGSA 3TRSB 4D94A 3OBTA 4UW4A 1XC6A 4XFHA 3WCRA 1NQJA 2VH9A 3WDTA 1BBT2 4MVTA 2VWJA 2WQ4A 3CJHA 2I45A 3BGAA 4HNAA 1FOD1 3U4SA 4I55B 1OFSA 1S1AA 3ZKYA 5FZEA 5KHGA 1JYXA 1YF2A 2ZCWA 3B93A 4DV6O 4ET7A 1K5QA 5E8AA 1YZBA 1ZTEA 3B4SA 2WN3A 2X5IA 5EP9A 3H0OA 2EIMC 4P9PA 4NROA 3CCLV 4W4KA 3VBFB 4IIJA 5CFCA 4CU7A 3UM7A 4BW5A 1CZVA 2VOTA 2ZXQA 2Y8KA 4L11A 4MH0E 2OT7A 5JR2A 1HRI2 2JGDA 4S2FA 1IG0A 1E1RG 3UNPA 3L70H 2ZOEB 4HONA 1YJ9V 3B40A 2OKXA 5F3GA 4Y4YA 2PXJA 3O1MA 2ZGUA 5JCTA 1V70A 3JD3A 4CUGA 1RPOA 3LIGA 1O59A 4FTBA 2CGPA 2QQJA 1LRHA 4LJHA 4P9JA 4A5UB 2Q68A 2QM7A 5M0TA 1QOTA 3KKYA 5I0RA 2QCSB 1FMD2 2Q1FA 5FZ1A 4MVZA 1A78A 2OZ6A 4AL9A 1WP8A 3VHPA 2AC1A 1OCCB 3OGRA 1OURA 4IEWA 5TSWA 1W6PA 2WFPA 3RZGA 3ECQA 3A0BZ 2X10A 2XBO1 1JZ8A 1D5NA 1UMZA 4I9QA 4FMTA 2Z5WA 3H1LH 4X6QB 4TUYB 1BK1A 4UCTA 1IPKA 1DLBA 2LJ2A 5JPMB 1PP9H 4Q0QA 2EIKB 3H50A 4QPGC 4QX5A 3O7OA 3WINE 3S3XA 2JG9A 5C93A 1VF7A 4UF0B 3J8F2 5L7OA 1S2KA 5LBEA 1FPN3 2R49A 3PIJA 3RYKA 1K45A 2MEV2 2V72A 1MQTB 1RVF3 4UAPA 1AXYA 4MVRA 3CRQA 2YS8A 3GBFA 1X59A 4G3YC 2V7QG 4KWKA 1ZNPA 3SYAA 4IYIA 5LA6A 5EBWC 3WSOA 4MT8A 2CSGA 1W8HA 4EN9B 5CN0A 3OT7A 1U12A 4GH4B 3X2QB 5HBAA 4DUXA 3JD1A 3D36A 1DQ5A 1F15A 4QPIC 4WCEV 4HVQA 4RWUA 2B45X 2XKPA 2WZR3 4Q2FA 5LATA 5FPOA 1MS4A 1L8DA 3M2MA 3I2DA 3RMYA 4W50A 1CGPA 5DZFA 5ITZB 5CA0A 5A7OA 3WEZA 4DV0B 1R083 3T09A 1ZL8A 1S5LZ 4QD2A 5D8AB 2R70A 3BOPA 1MACA 1MR5A 3K79A 4OFGA 1CIWA 3AM2A 1BMV1 2CUGA 4NPLA 3I8TA 3IKWA 1GMGA 3MBWA 3HNBM 4BQ4A 1XYNA 3U0ZA 2A6VA 1EZVH 3LOIA 5ACA2 2WLJA 1CAXA 4S2HA 4Q4W2 1MZEA 3WXPA 3OYWB 2LO1A 2IXLA 1ULDA 2CDOA 1L0NH 3CRAA 3RYFB 4Q6GA 3CNAA 1PMIA 2J1SA 4IV3B 3Q8CA 2A3QA 4YGCA 2ITCC 3ZHUA 1X9PA 1RMU3 2Y64A 1QY4A 4HL0A 4LFCO 3CEWA 3FLRA 1WBLA 2CV6A 3OUJA 2HEWF 3CQOA 1P4RA 1GN6A 3GALA 1EZJA 3N2KB 4CEYA 1IHMA 4E27A 2AHYA 2ZX0A 3U14A 4BE3A 1LR5A 3U10A 2IH3C 1QR9A 4WFAV 1ENSA 1TME2 4ZI7A 2G4IA 3V0BB 5GZDA 1OCOB 1JOYA 2XQXA 1AJNA 1GWLA 1OOPB 3POGA 3H7JA 3RNSA 2OA2A 1QHDA 1LENA 4GB32 2E6VA 1UD1A 2DFCA 2AGAA 3NWKA 4IERA 1GH6A 2DYCA 4QT6A 5IHRA 2ZXWB 2DVBA 3N7KA 1MVEA 3QH6A 2WRAA 3HKBA 4PDWA 5FZ4A 1Z7S3 1IBLB 4NXMO 1SCSA 3CZJA 2IXHA 2HWC2 4E2SA 1GBGA 4YZ3A 1BVVA 4LCUC 4LKSA 4QXKA 4C1XA 1NH2D 1OVPA 2D3PA 4BMBA 4Q4X2 4ICGA 3AZYA 3RZJA 3JSLA 1S77D 1ASJ2 1KFXL 4F6RA 1NA1B 1IQAA 2QVSB 2WO7A 2WFF3 3KQRA 4UFIA 5B4NA 3VBSB 1B35B 4JI2O 1CAWA 5CU1A 2UU9B 3M3CA 2RG4A 2QQLA 1XILA 3CX5F 3ZCCA 3ZXGA 4UYBA 2WWUA 4AFCA 5AVPA 2VZTA 2P4VA 2BUKA 4UBHA 4YZ2A 4RFRB 1RSOB 1SQFA 1IPSA 1HRV3 3ITQA 4FPLA 5FLJA 4RQPA 2Y69B 3K3OA 3MIDA 1FV2A 1DZQA 3SCHA 1CPYA 3G6JB 4NWWA 1SETA 2W47A 4PJ0Z 4DV5O 1Q5OA 3K77A 3ASOC 2IXCA 4E4EA 5LYJA 3WCSA 3W7WA 2HWD1 4RN5A 3TXSA 4ABMA 4P9LA 1NG0A 3ZXFA 3G80A 4QDSA 3VBHB 2DU1A 2WZPP 1ZAUA 4CCLA 3KCYA 2JB4A 3JAMN 5FZOA 5I0TA 1VJ2A 1K8AW 1YO8A 1PX3A 4CDUB 1QVGU 4Q1RA 1DK1A 1DZRA 2X6AA 2K2SA 1JZ2A 1O3SA 3OPTA 1RUF2 3CD6V 3D6EA 1NS1A 2HR3A 1QQCA 3M8LA 1CN1A 1EN6A 4YW2A 1CIYA 1JPXA 3RW0A 1D4M2 1FAFA 1PGW1 4I9WA 3CMAV 3D0JA 3AG4B 1MOFA 2XUMA 3MFCA 4NTYA 1K3IA 2KG7B 3ETGA 2XHNA 4EE2A 4CEWA 4DV3O 2ZCEA 3N9PA 1YEWA 2WS92 2C4XA 2XVGA 3THDA 1QH6A 4PDRA 1PVC2 2AH2A 3POJA 1H8EG 3VBUC 1COV2 2P3JA 1F8VA 2DF7A 4LNUA 4RL7A 4N53B 4X8PA 1LTEA 2ZDIA 4IEUA 1MS3A 4P9YA 1TQ5A 1Q6HA 4Q0VA 2GBOA 4AGRA 2WSVA 4XUOA 4CSWA 2XJQA 3VGIA 4ISQA 4YW4A 4YJ2B 1IS4A 4DV2O 1VQPV 2P34A 3P6BA 3VKMA 3SPHA 5LA0A 2WN2A 2ZGTA 1YI2V 1VRH1 2QUOA 4AEDB 1WBFA 1HDKA 2B9VA 2FBEA 4G4FA 2BJSA 4QX8A 4N43B 1UAIA 1UXXX 2IVIB 2EIDA 3VQXA 3MW2A 1VR3A 4BQ2A 5IJRA 1KKDA 3T2OA 2E3CA 1ULPA 1SLLA 2QQIA 2OTJV 4XUPA 3SHRA 5JI9A 1K5JA 5IK8A 2ZR2A 3WNKA 2YGLA 3JCUZ 4Q0SA 4HT1T 2X6CA 1G9FA 2JDPA 2GC3A 2QE7G 3WNMA 1ZREA 2UXBO 4LFAB 4OHWA 1V6JA 2OWOA 4AQSA 2CAVA 3OBZA 2LW8A 4HKWA 4DNYA 1GZWA 2IM9A 2WAAA 3GF6A 3THOA 1VLNA 3OE7G 3ACHA 4R4XA 1KYOF 1KXGA 4DUZO 1OFNA 4G2KA 2EALA 5ABJA 4D6TH 1NLQA 3WF1A 5CVRA 4AI2A 1IS5A 1R6NA 2BU9A 2BOBC 4MADA 4Y33A 4KH9A 4DXZA 1P7GA 4E2GA 4DR2O 1H38A 2BWAA 2GH8A 3WQ0A 3P1IA 1HWYA 4O4HB 3SEEA 4OYUA 1EUTA 3AL6A 4BR6A 4A44A 3L71H 3ABMC 3VDDA 2Y33A 3POWA 2UWBA 1UYZA 1ZLZA 3N4MA 2RJ2A 2WKKA 4XUQA 2OTLV 4CDXB 5IT9N 4JDMA 2QNKA 4WVMB 1UOBA 3NJVA 3E8FA 4P9GA 4YJ3B 2E63A 2W2IA 5CKQA 1SQ4A 4L2NA 3USSA 3UV9A 1AXKA 1A34A 2A7AA 5AFEA 4A7KA 1K9MW 4JI1O 5DAXA 3ELNA 4IEOA 2YIBD 1F4MA 4NUBA 5IVFA 1B09A 4K21A 3G67A 2RDNA 1DQ4A 4TV9A 3AVRA 2X8KA 4FLUA 3CEIA 1W6QB 4R9DA 4KWUA 1J3RA 1FXVA 2DUQA 3VHNA 1S0JA 1Q6IA 1T2XA 4QKFA 4WVVA 2JE8A 3VL9A 3ZX7A 4GKKO 2GHYA 1QHTA 4ZIBA 4QB1A 5FPZA 4AFBA 1XRUA 4K3AA 1VBC3 5DG1A 3N9MA 3FC0A 3U07A 2DTWA 4CCKA 2WNEA 5B3SC 1O9HA 3GZAA 4X1IA 4A42A 4DO2A 4W4LA 1IPJA 1W04A 3OF1A 2HKXA 3R4UA 1MEC2 4XCBA 2ORZA 2Y4UA 4YY3B 3OBRA 4WZCA 3V0AB 2XVLA 2D7FA 5F5AA 1U0AA 3JAWA 4J6GA 4CDQC 1YXBA 1GQHA 4YM0A 1KRIA 3AMHA 4AW7A 2Q4PA 4E4SA 3ZYBA 1RUC3 4Y5TA 1AI7A 2BQPA 2ZZQA 4KNCA 4CDWA 1PO22 3FWEA 3VZMA 4C7UA 1VBC1 3IB3A 1K5MB 4XILA 3KZIZ 1DHKB 1DLLA 2OCCC 3KF3A 2LFRA 1LOFA 4LPLA 2M7WA 1G9BA 2CL2A 2XL9A 5C9AA 2ILMA 1AR82 4YPJA 3OR7C 4LF6O 5KXBA 2HYXA 1R1A1 4AXOA 4YHHB 5FFOC 1BEV1 3LA3A 2GV9A 3K06A 3GBWA 4K6BA 5FUNA 3CDZB 1NXD1 2O57A 4DR5B 1DCSA 4P2ZA 5DECA 5CISA 1Q8VA 2VQ0A 3VKLA 2PA7A 1DYKA 1O3QA 1PZ9A 4H14A 5DXDA 1TMF1 3JD71 3ZN0A 1FS0G 2XGXA 4PBPA 5EJ1B 3B77A 4YFZA 1BCXA 1OLME 3ZFGA 4H13B 1N3OA 1Z2GA 2JE9A 4X20B 4LQRA 1OT5A 2VMFA 5BPXA 2VMIA 4A4AA 5FZLA 1OKOA 3URFA 3ZR6A 4YSFA 3E6DA 5FLHA 2P67A 2ZHNA 3ASNB 1CEZA 2R062 3MGUA 4A7ZA 1LHOA 4DV1O 4QM8A 1AYN3 4YG3A 4FPOB 1X7NA 1RUE2 5FUIA 1NZ6A 1W2UA 5F8PA 1JZ3A 1FXKA 1JYTA 5DDJ3 3FHAA 1M5IA 5FLIA 1YIPA 4EQVA 4XPVA 1R092 4QMAA 3VKFC 2W95A 1WCDJ 3PN1A 3J7AU 2WWSA 1NY72 1H8VA 2C24A 2P7TC 3CIHA 4CP9B 2EXHA 2LUWA 2ENRA 2LRPA 3NW4A 3JSNA 3EQEA 1YQ5A 2QWQB 2R7EB 3UKMA 4I01A 4HAMA 2DUPA 4JF3A 1JUIA 1H4GA 1RM1C 3M8AA 5KMGB 3B8MA 4AFDA 3CRRA 3EMRA 5FRAA 1GNHA 2EULA 4ZHNA 5JOZA 2FQPA 4Q1PA 2WA4A 4UFZA 1WMFA 3KV5A 1VBA3 4B4PA 4ZKTB 1KU9A 1GWMA 4OLLA 5DAQA 2XNDG 3M3EA 2NMOA 2N7GA 3CJHB 1BL8A 2WIIB 5I0DA 4JGZA 3B3QE 5FPRA 2E26A 5F5QA 3I2HA 3KV6A 3DGTA 3LIHA 1SQVH 3TB0A 2H0VA 2D6OX 3TK1A 2Y6LA 1T6GC 4BK4A 3SJCC 4XXPA 2ZX4A 2EIEA 4QWNA 5EPAA 2E75B 2X5IB 1C5HA 4MLOA 1D2SA 2ZEZA 2VXJA 1LAJA 5J1XA 4WM7C 2AYHA 3VBOC 4ARYA 4U3FH 4LT5A 3CXHF 4IIJB 4JC1A 5CFCB 4O4IA 2VZSA 1JR9A 2L9LA 4B08A 3K5NA 2YIBA 4KP4A 2EJRA 1S4CA 3HR9A 2JGDB 1I0HA 1Y74A 4LK6A 1TGOA 4XF3A 4PA6A 4P5YA 1CJDA 2DCKA 5LP6C 4UFHA 1S72V 4GQ7A 2DN9A 2F1MA 2RM23 3Q8EA 4JKMA 3IBMA 4TV8A 3WUDA 2UUBB 3BABA 1TVKA 1UNBA 1U97A 4XBNA 5BNNC 3DXUA 1US3A 3A0RA 2DFBA 4PV1B 2YMZA 1U5ZA 5FP8A 3NV1A 1S3JA 4Z92B 2Y38A 2K46A 1W6PB 1XQNA 2V5DA 3LGRA 1PNMA 1GZ9A 1OBNA 1UOJA 3HKCA 4HSJA 3SH4A 3I3QA 1XOUA 1SF9A 5LGNA 3H1KH 2EIBA 2DWDC 2JG9B 1O3RA 1L7QA 4META 3ZMNA 1GKFA 5LBFA 5L7OB 1Y43B 2RM21 3FMGA 3AP5A 2AUYA 5JXGA 3WDUA 3TCUA 2EXJA 5IWAB 4IE4A 5AC91 1FPN2 3A2FA 2NLJC 3ILRA 5LA6B 4JTNA 4E2QA 3RQ0A 5FREA 4X62B 4QJFB 1SFNA 2D3OW 3ZHSA 3ZR5A 1SKVA 5KC6A 1C1LA 2D98A 5BYNA 1LESA 5FPAA 4AI1A 1U5IA 2VZQA 5IY5C 3A23A 3AZXA 5H9SA 3U78A 2VMHA 1K4DC 4UUJC 5A7WB 5BMVA 3ALQA 3ZYRA 1B06A 4AVVA 2EAAA 5CA0B 2R043 4M01A 5B66Z 1YQ2A 4BOWA 3TNPB 2ET7A 5IYZB 4Z1VA 3CHXA 3JUUA 4NHKA 4FPYA 4Y1YA 4XE9A 4OPHA 1K33A 1PK6A 2Q4SA 4QPKA 1LHNA 5FDBA 4JI5B 4QX7A 1Q7YW 1NBMG 5H9PA 2Q5TA 4HETA 1GV9A 2ZGRA 2JDAA 3WP4A 2QQOA 4YM1A 1RUD2 1IGOA 1W8FA 2AENA 1CAXB 4QXBA 4HN1A 2GSYA 4U36A 4YW5A 4U7OA 4ZXKA 2R0HA 4FFHA 3L75H 3WUCA 4DZGA 4XDKA 5BV6A 4LBJA 3WNXA 5F2WA 2R041 4YVWC 4CBCA 4OI0A 4XFFA 3A7QA 3B01A 3B5LB 3NKGA 1AX2A 3IT8A 4O65A 3AXDA 5A1AA 4CEYB 2ARCA 3W7XA 1VBD3 1LECA 4B4RA 1N1VA 4LF8O 1VIBA 4RYDA 1K42A 4ZI7B 2WQ8A 3A8TA 1DYOA 3B94A 1I5PA 3ZN6A 5LK7B 4QDRA 1C8M2 2E5LB 4QGNA 1B04A 3CYOA 3E22A 3HKBB 4PDWB 3BRCA 1AYM3 3V65A 2VY0A 5IATA 4RS5C 1QJEA 3C3TA 1SLIA 1N33B 4ZS2A 3SQOA 3I2IA 1OV9A 3VD7A 4JI4B 4LF5B 4HZFA 4IE6A 3FBMA 2ZMLA 4K7JA 1VBD1 3AG2C 2NP0A 3CCMV 4AHXA 2VW0A 4Q5OA 5FZGA 5HXVA 3C3SA 4IYHA 3T1HB 2F4PA 1MS5A 4H55A 5BZBA 1OD5A 3ICXA 3PJSK 4F6RB 3STLC 4JGYB 2FDHA 4MUVA 4OHXA 5LEJA 3M3QA 3BYWA 3WG1A 2VNOA 4XIKA 3AYAA 5FOJB 4AEMA 1YFXA 4K3UA 3SPGA 4O9EA 3P32A 1GICA 5B1NA 3GM8A 4W4ZA 1CAWB 2I2SA 2P3KA 3DN7A 2WABA 3VUOA 1VQ9V 4PA9A 3IIIA 1AYM1 3G4SV 5IE9A 2RR12 4UI9L 4XBQA 4P00B 2XUEA 1IG3A 4DR6O 2VTXJ 5EJZB 2IUWA 2R1DA 4RQPB 1AR1B 1RUJ1 2JRIA 1UW8A 1DIWA 5A7QA 2V5YA 3CXCU 5JSRA 2WLLA 2O14A 1OZ0A 1N34O 1SA0B 3K0GA 3WG7B 4Q8LA 3H01A 3GZUC 3OFNG 4GX0A 3DECA 1DF4A 1TVGA 4KU7A 2XG3A 1ZUQA 1OC1A 1VBE2 2FDIA 3KVAA 4COVA 4JHZA 5F2SA 1GP6A 2AR6A 5FZOB 4J1XA 5LBBA 4I5SA 4BWAA 3MV11 3UYJA 3FYEB 4QXCA 4E9KA 3T2QA 3U37A 1OLRA 3FLPA 2BNMA 3SISA 1ND2A 3J7LA 1HXS3 5ERLA 4IGPA 4B3MB 2EBOA 5A70A 2EF6A 5FYZA 2RHPA 3LA7A 3BN6A 1A6CA 3IPVA 3POIA 1Q81W 1NE4A 1UOGA 3BIWE 2WNUC 2ORXA 4XF9A 1WW6A 4BXSV 2B9ZA 1L7RA 3LSUA 2JX9A 4IXLA 3O0VA 5AFBA 1EV12 4JQRA 4JI3B 1YI7A 4ORFA 4XETA 1YFUA 5HPOA 4BQ5A 2BNNA 3SLIA 3T4HB 2XB6C 2HJIA 1H6YA 3O1SA 5C3QA 2VQTA 5DUUA 2VQFO 3ST7A 1U5YA 2YSUB 2ATFA 1HXS1 5FV3A 1VF6C 3QLQA 4LNUB 3HPLC 1NJIW 5GTHZ 4FPJA 2A06H 4J42A 5L3DA 2AREA 3VQVA 4G28B 3T1LA 4BHPA 1ZBA2 1ULOA 1T6BX 3ZIXA 1E57A 3MIFA 2VJXA 1VQ5V 2RS31 2Y6KA 3BTXA 3DV8A 2W68A 3SYCA 4Q4Y1 2WSSG 1RUH2 5FY8A 2R072 2FTKA 4PD4F 1UMIA 1V9U1 4AHYA 1H0BA 2WYSA 5A3WA 5ANNA 1JOBA 4X66B 4M3CF 2OIIA 4P08A 4MG2A 3OGVA 4WF9V 5GLWA 2ZGNA 4LKDA 4MGQA 3MLJA 2FZ2A 3DPRC 2HWB3 2G19A 5KHKA 4A45A 2W0XA 5H6QA 1RHI2 4XAEA 4BIFA 4DV4O 3MICA 3H3LA 1PNGA 3H3UA 3SJQC 3E83A 3E5QA 2E53A 2GNMA 3JCIA 5C70A 4KMQA 4YVSC 2Q8CA 5K9YA 3TN91 1QWRA 5CFDA 5JZGA 2SBAA 2FMDA 3MDPA 3SYQA 3L9JT 1GZWB 4E2LA 1PM9A 4OVEA 3ATGA 5B1BC 4O2AA 2FMLA 1T5EA 4BISA 4NIGA 1QJU1 1RUG1 5KBFA 2IFWA 3JAKA 3TBDA 4L9BA 5ABJB 4TZDA 2FCUA 4QGLA 1AJQA 2UUCO 3T2PA 1YQ8A 2D6PA 5C3RA 1XUQA 2IXKA 3LDEA 5KA5A 4I3GA 3AVSA 4AVAA 1F4AA 4MTOA 2D40A 3ZYIB 2XLFA 1G6UA 2QQMA 1JS9A 2QFEA 1HNXB 4MVUA 3WW1A 2HG5C 2W6IG 1JU4A 1XE8A 1QGLA 4BIUA 1SS3A 1YJNV 1BBT3 2RS51 3JXSA 4A3XA 2M6YA 3EJKA 3VDDB 1VARA 5FBJA 1IX9A 1JJOA 4X64B 1OA2A 4Y22A 4YW1A 3LKJA 2GAUA 5DABA 4BM8A 3N9NA 1YIJV 1GOHA 4M0HA 1PZ8A 4GMP3 3WR0A 5LMNO 2CTPA 1W0JG 3RWNA 1DGRA 5FP9A 2PAKA 2VZ1A 3JD2A 1AR61 5A33A 2YZ4A 3N2GA 3P3PA 4FLZA 2X6BA 1GN4A 1Y9MA 4AZZA 1GM7A 4XACA 2AACA 1N3PA 1R6TA 3KG2A 3P30A 1N3QA 2ZE8A 1HRI3 2UYBA 1PNFA 2JICA 4XFIA 2GN3A 1UWWA 4OUMA 1SQQH 1W2AX 3FX7A 3M3IA 4ZU4A 2YXHA 2ARHA 3HT1A 2WNVA 1CJPA 2PLV1 2HP8A 1IS3A 2WWWA 5IYDO 4DV6B 4XMIA 2YU2A 1ZX5A 5FZIA 3K0DA 1H6XA 2CTWA 4EZHA 4MGIE 4V2VA 4X1IB 4LF4B 5C5TA 1FMD3 4NRPA 4J11A 2BW8A 1KITA 2YBSA 2CU5A 4L0PA 1Y67A 4MS2A 4TWTA 2KQXA 1WP7A 4J7ZA 2DWEC 4YFWA 4Q20A 2VQEO 2JG8B 1EYBA 2VXRA 4COYA 3FAVA 4ZHQA 3JATA 3OPWA 2PHDA 4KHPO 5LWBA 3UGHA 4CDWB 5FR3A 3J8F3 2QQVA 4XQDA 3ZHQA 4F4LA 3AK0A 1UPIA 1IVSA 2MEV3 4OPAA 3K04A 2RMU2 2RDQA 4FK5C 1X33A 4L97A 2FDJA 5EYXA 2BEOA 1FMD1 4MGTA 2GNTA 4WZFA 5C9AB 4XAAA 3BVCA 3PUAA 4XMAA 5CBHA 1G9AA 4KFMA 1ULCA 5FXXA 1CVNA 2VBBA 3NNJA 2QDOA 3ZN1A 4IEXA 3C2UA 1RXFA 4CC5A 3CKHA 4RR3B 3VD4A 2QTSA 4OCTA 4B3SO 3IM0A 1UIJA 2QQPA 2C6SA 1K34A 4LF7B 3ME2A 2FHRA 4GA9A 1RPRA 3JYCA 3I55V 4CYDA 4E4DX 2NR5A 3UQ8A 1CWPA 4IUGA 5JH7A 4QQHA 4J41A 3VOUA 5BR8B 4QXHA 3QNEA 2N05A 4FVMA 1VB2A 4K8FA 4WBBA 3ZXKA 2Y6HA 3NV4A 1KBHA 2JJ1G 1XBFA 4YM2A 5IUQA 4GIQA 3ZFEA 4M3CB 2A3WA 3Q8AA 4PLOA 4CEYC 5K1PA 3SJAC 5IK7A 5ACA3 3ILNA 4Q4W3 3W59A 4ATEA 3PVBB 1I5ZA 2C0ZA 2HWE1 4AE2A 4BMEA 1FI2A 4IV1C 1B3QA 5A3UA 2BOIA 5GZEA 3NJZA 2G9GA 3RYFA 5E1AC 1GWKA 2RDCA 4XXAA 3WNPA 5JAXA 1IKQA 2ZINA 5DN6G 1YVWA 4RHV2 5FZCA 3LEKA 4COUA 4R9AA 3O14A 1Z78A 4U7NA 5JVVA 2BNOA 1EUUA 2WO3A 2W1UA 2KM2A 1KECA 2O8QA 3VKNA 4JAAA 1AL21 1LULA 1TME3 4AQYO 3OJBA 2BOJA 3PMEA 3WV6A 4GB33 5EK0A 4D0QA 3C90A 2D3SA 1OOPA 4AR2A 1VQ4V 4NO4A 5KA6A 5F7UA 2LS6A 4UFJA 2BGOA 4D69A 2A6XA 3UETA 1FXHA 1GK9A 1RFYA 2ZPXA 4FP3A 4DV7B 2B7YA 1W28A 3UCSC 2WLKA 1VQKV 2PI5A 3UKTA 2HWC3 5A7NA 2NN4A 1DFQA 5CNAA 2CGOA 1OH3A 4JGZB 1WLEA 2EIJC 1V54B 1FOD2 2WA3A 1M57B 4Q4X3 3RSJA 2D97A 1HDJA 5SV8A 5IJ0B 2D3RA 1ASJ3 1OA3A 1ZBE1 1BHGA 5C4WB 4BWOA 4UB6Z 1YIFA 5JMCA 3LDKA 1QLNA 1XMQB 4GB31 3AP9A 3ZPOA 3CU7A 3LNNA 4QX3A 5JXIA 2QZ3A 1G9CA 1FATA 4LTAA 3PJQA 1QDCA 3N7MA 3T4DA 1FT9A 1Y74B 4PLMA 4N21A 1WUVA 4P5HA 1WLWA 1O5UA 4UV9A 3F95A 2HWC1 3O0WA 3DC5A 4X6RB 5FYHA 1PMHX 4JTOA 1DF0A 3SDLA 4CH6A 3ABKB 4TQDA 2OX0A 3NAPB 2JDNA 4DFSA 1RSOA 2ZEXA 1SFPA 4RFT0 1ND3C 1YC61 4TV8B 2DMXA 1PIV1 4F6EA 2YC2A 2HVJC 2XXZA 1WW7A 1PM4A 2DCYA 1YTFB 2Z5UA 1ZZBA 1YFWA 2YGMA 4XJ8A 1OHFA 2XKOA 1HIXA 2H8PC 3T0DA 3LEMA 1W0NA 3S3WA 4X65B 2ETNA 2OVUA 2EXIA 3MUZ1 3PL0A 2ADPA 1XHZA 2R0FA 3W9AA 2PFWA 4NHLA 1WCUA 3KV9A 1IBMO 4ZZ8A 4LE4A 2UUAO 4PIYA 4CEWC 1RUF3 3AG7A 4AAXA 2RDRA 2CNAA 1MSDA 1BSMA 4KXRA 3JU9A 5CAZA 4FBFA 4FPKA 1V55C 3BI3A 1KUQA 2WSUA 4XF0A 5B4XA 3WQBA 2PYJA 5FYTA 4ZKIA 2B39A 3MZHA 1D4M3 4GALA 1IQDC 5L9VA 1TEIA 4PA7A 4FIPC 3ZSMA 1AXZA 2JKXA 3E6BA 1UX7A 1S0VA 1GP4A 5K1XA 1VMFA 2IZWA 4YARA 3B09A 5FNVA 1Y9QA 3NV2A 2CAZC 5F3IA 2WS93 1BQPA 2VTFA 2PAMA 1PVC3 2KG7A 4JRLA 5KUMA 2VVEA 1NXMA 1H1IA 2VZPA 2X05A 3O1UA 1COV3 5FZAA 4Y5SA 2LW7A 2DCJA 1WNSA 4LLFA 1CAUA 4QKBA 1RUF1 1NTZH 3OEEG 5BMVB 3NVCA 2H3OA 1IZ3A 4Z2AA 3TGUH 2YBPA 4XFCA 4DUVA 1YSCA 3CJIC 1W8OA 4N53A 1Y6XA 1O8PA 2EINC 2VUJA 1PK6B 3HKEA 5HCHA 5C8CC 1M4WA 4DV0O 2QEXV 4C0BA 4XDPA 1AROP 3AZWA 2XWBB 5FMBA 4PQ9A 2PUSA 4DR3O 1W99A 3ABTA 3FKSG 5JMOA 4YJ2A 1HKDA 3OSDA 4D7YA 2EILB 1TUBA 1XE0A 3KSCA 4TSFG 1OMIA 1VQLV 3OUIA 1UFIA 3I7DA 4QPGA 2OIGA 1BLZA 1PVC1 4AEDA 4D7TA 4JDNA 3ZMUA 1H8TC 3LQCA 4K1YA 3RBZA 1WAZA 5DG2A 3BVOA 1PGL1 4I0WB 2JS5A 3BHPA 2Z3YA 2WT0A 4HMZA 3MAQA 2VMDA 4AQ2A 4PQQA 3DTUB
chains in the Genus database with same CATH topology
5L19A 2VU9A 1KJLA 5K0UC 3CO2A 3ROUA 3MLLA 2GH8A 3WQ0A 2A6YA 1REDA 1OQDA 3X29B 1MZ5A 2D44A 1REFA 3ZN4A 1EPWA 1YJLA 4AHZA 5JOYA 3VDDA 5T5OA 3N35A 3POWA 2UWBA 4W6XA 2C1FA 3N4MA 4J1WA 1VBC2 3WD5A 2WKKA 4QPIA 4BG1A 4CDXB 1QJY3 4JDMA 2QNKA 4WVMB 1LJ7A 4CDQB 4PLNA 4P9GA 2E63A 1AR73 1ZZ8A 3R6SA 1SQ4A 4LHLA 1FX5A 2BBVA 4L2NA 3USSA 3UV9A 3ZN6B 4FO9A 1AXKA 1J1TA 1PVXA 3AYDA 2A7AA 5AFEA 3ZSLA 3V64A 1BYHA 1LOEA 1PK6C 4B4QA 5BNOC 4A7KA 3VL8A 2ZJCA 1RINA 3LAGA 4OZXA 4ES8A 3ELNA 1CPNA 2ZGSA 2HWE2 3AJYA 4IEOA 4SBVA 3S30A 1AF9A 4MV2A 1B09A 4K21A 4TLFA 5DUVA 4HVOA 1BEV2 1DQ4A 5KC5A 2X8KA 4CP1A 5EJ3A 1W6QB 4R9DA 1J3RA 2VOVA 3ZFFA 2DUQA 2XJSA 3AZVA 3RMXA 3VHNA 1S0JA 5JIAA 4FAHA 1DU3D 3RYRA 1Q8PA 4W65A 4HVRA 3KM5A 1RUC2 1Q8OA 4WVVA 3VL9A 2VUAA 3ZX7A 1ZRDA 1D0HA 4BLIA 4AVCA 1LHVA 4OULA 3SCGA 2D5HA 2OG6A 2CY6A 1Q8SA 1QQP2 3OGGA 2E7QA 3DL3A 5FPZA 4AFBA 1G6NA 4YGBA 1XRUA 3VBRA 1UL9A 3A0NA 1QJY1 1ZRFA 3BOWA 4YRDA 3B69A 1VBC3 3ZFFC 5DG1A 1H9WA 2Q4AA 3FC0A 4XJ9A 4Y20A 1MQTA 3U07A 2DTWA 4A2UA 2WNEA 4YNIA 3MW3A 4P14A 1AL22 1YJKA 1C3HA 1VIWB 3GZAA 2GMEA 4XFBA 1POV1 4GXLA 1WLCA 3EO6A 1QOSA 4AQTA 1POV0 3VBRC 3WDXA 4EN0A 1IPJA 1O4TA 1NCRB 4UXAA 3OF1A 1VAKA 3WOGA 5JI7A 2HKXA 2XLAA 4QHBA 3R4UA 3KD4A 4MYEA 1MEC2 1Q3EA 2HWE3 3OBRA 4WZCA 1MVQA 4NHMA 1WCKA 4GH4A 3QCWA 3V0AB 2XVLA 2CTVA 3M3OA 1LGCA 4IESA 2PHLA 3MFAA 4CDXC 2D7FA 1UKGA 1U0AA 3H1YA 4J6GA 4LBLA 2NYYA 4CDQC 1KRIA 1GQHA 4YM0A 2WQZC 2MHFA 4X8NA 1AR92 1RUI2 3AMHA 2E51A 4AW7A 3MW4A 3E5UA 4RD7A 4E4SA 1ZZ9A 1RUC3 2BQPA 3QACA 2ZZQA 2BGCA 2YC0A 4KNCA 2JD4A 4LA3A 3HQXA 4CDWA 1PO22 1QXJA 3FWEA 4R9CA 3VZMA 2PN5A 1NCQB 3ZFGB 1QQP3 1VBC1 2GC1A 1K5MB 2ZGPA 4XILA 4O9GA 1DHKB 1RC6A 4BQ1A 4QPYA 1DLLA 4LUMA 5D8AA 1RGSA 4EN8B 1VP6A 3VZKA 4IV1A 5E88A 4KL1A 4AVBA 1LOFA 3S6PA 3KT1A 4HANA 1ZBE2 2HWD2 4FTEA 2RS13 1AL23 4M2CA 1XNCA 3WZ1A 1G9BA 1CAVB 3NV3A 2CL2A 2XL9A 5C9AA 1RUD1 3WHTA 5KHJA 4HBNA 1NX8A 1Q8QA 2ILMA 1AR82 2DVAA 2ZAAA 1CONA 1WLTA 3RS6A 2I74A 4MGKE 5GZCA 3BALA 5KXBA 4HK9A 1QH7A 1F5JA 1R1A1 1LOFC 1SDWA 1MEC3 5FFOC 4AXOA 4COZA 1ND2B 5FTTC 1BEV1 3LA3A 3OYWA 3GBWA 1AYN2 4K6BA 1KDKA 2VULA 4DPNA 3R4SA 1KJRA 3GYDA 1NCRA 3D0SA 1NXD1 1AUYA 4BGKA 5J92A 5DDJ2 1YLLA 4IV3A 5FO9B 4YYOA 4CRQA 1RUI3 2DV9A 3MS5A 2DCTA 3GZTB 1X50A 3IPVB 1HQWA 4I3PA 3FUQA 2A6WA 3VHRA 3ASIA 3V0AA 2OYZA 5CG9A 1WGPA 3DKWA 2WINB 2V73A <