2OCHA

J-domain of dnj-12 from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
b'KETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein dnj-12
publication title X-ray crystal structure of J-domain of dnj-12 from Caenorhabditis elegans.
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ochA00
2YS8A 4RWUA 2CTWA 1BQZA 2DN9A 2YUAA 1XBLA 1FPOA 2GUZB 1GH6A 1BQ0A 3APOA 2QWNB 1HDJA 4J7ZA 3UO2A 1N4CA 2CTRA 2KQXA 2GUZA 2QWPB 2QWQB 2EJ7A 3AG7A 3APQA 2M6YA 1NZ6A 3UCSC 3UO3A 2CTQA 2QWOB 2CUGA 2QWRB 4J80A 2L6LA 3BVOA 2QSAA 2N04A 2N05A 2DMXA 2PF4E 2Y4TA 2LGWA 1FAFA 2Y4UA 1WJZA 2CTPA 2OCHA 1IURA 2LO1A 4IT5A
chains in the Genus database with same CATH superfamily
2GBOA 5KAFZ 4U3JA 2D2CB 5B3SB 4LF4B 2GUZB 1DF5A 1K9MW 3TCUA 5LXTA 2DQ3A 3BPZA 3ZHRA 1R3IC 4C7UA 5AG2A 3M99B 3QNEA 2UXDO 3OW2U 1Q7YW 4JGSA 2ZDIA 1SS3A 4X1KA 1AI5A 3U10A 2LO1A 5HFMA 3C3SA 4KL1A 2DN9A 3ABLC 2Q67A 1QNMA 2UU9B 1HNXO 3ZN0A 3JARA 3HKBA 4FLTA 1MSWD 2ZNJA 4DV1B 3JAWB 4NXNO 2Y0IA 4PA7A 4LFAO 4K8XA 4GKKB 3UQ8A 3S3WA 1Q86W 4JI7O 4B3RO 3LDDA 4I5SA 2EIKC 1URFA 5H5NA 2XASA 1LR1A 1H2SB 2ZCEA 4NXMO 3ASNB 4J7ZA 4E2LA 5CA1A 4H0LB 4MVRA 2DYSC 4JYAO 2XAFA 4K35A 3SYCA 3L70H 2GSMB 2A3QA 3CXHF 3Q4HA 4EB6B 1HR0O 4I0XB 5LYJB 4B3SB 3CC2V 3SPJA 4EFBA 1JCHA 1K4CC 3A2FA 5LP6C 4J7KA 1WN7A 3ZHQA 1K3EA 1EM1A 4LNUB 4J11A 5C93A 4X65B 2XAQA 2W6JG 2P5OA 1N36O 4HZ3A 3K3WA 5EYPA 1QLEB 1JA8A 2HFEC 4G27B 1ZUQA 4MVZA 3ZRWA 2RMKB 4RUFA 4LFBB 2FYUH 1H2NA 3AG7A 2Q7GA 3ETEA 4XDLA 2EBOA 1V54C 1YTFD 4MTOA 1S5LZ 1KB9F 5KHIA 3L72H 4A5UB 2IH1C 4OX9O 3K5MA 4JV5B 3ETDA 5LOVB 1N8RW 2OWOA 3SGIA 4PJ0Z 3AG3B 4QIWF 1Q8IA 1GO3F 4MVSA 5JH7B 5CA0A 2A06H 2HG5C 2PZSA 3OD4A 4UCTA 1M4UA 4H13B 2Q73A 1NI8A 4O4HA 4TQDA 4CH4A 4X62B 1IXMA 3BEHA 4IT5A 3A0RA 3GWKC 1NTMH 1TUBB 1YJNV 4LF5O 3EVKA 3STZC 2NLJC 2CTRA 1N32B 5FPOA 4YJ2A 3H1LH 3MHSC 2EIJB 2WLNA 1F4NA 3CP1A 3UO3A 4O2BA 1Z5VA 4UB8Z 4DR6O 4MW3A 4O2AA 3A0BZ 2QSAA 1BMFG 4NR1A 2E5LB 3MDSA 4JYYA 2VQFO 2FB5A 1FFXA 4YXWG 3SYAA 5EK0A 1I94O 2AZ2A 1PM9A 3CEIA 2IW5A 4FLYA 3F5TA 2EZOA 2ZR2A 3ML0A 4B3TO 5DECA 4PHZA 4DV3B 2CK3G 2UXCB 1JFFA 4LF8B 5IY5B 4O4JB 2XHBA 4AILC 1GK9A 5JJJB 2QKSA 4RQFA 1HNWB 1MNGA 2R70A 2R9IA 3TJTA 4CS2A 1FXKC 4JAVA 1BCCH 4HNAA 4FZ1A 4LWSA 4WBNA 5DM6V 2LW7A 5ITZB 1RM1B 5JJNB 5KA6A 1MABG 4JAUA 4H44B 4DR1O 2QKCA 4MTFA 1OCZB 2OCCC 4ZOLB 3CCUV 1JMKC 1CPYA 1AVMA 4D7TA 5LMNB 5FLXN 4P9OA 3DXRA 5JQGB 1L8DA 1WAZA 4YJ3A 1Y76B 4FFKA 4U3FH 2IU3A 4I7ZB 1G8MA 3KZIZ 3JATA 4B7EA 5B1BB 3CCVV 1VP7A 2Y0PA 4X20B 3LUTB 4NTXA 3SJCC 2QA4V 3CC7V 1AJNA 2OCHA 1VQ5V 3CX5F 4FLVA 2F66C 2QM7A 4PDMA 2Q0AA 4FZ0A 4JI8O 5KX5B 4NVPA 2ZINA 4DV4B 3TGUH 4PDLA 2R9AA 3UT5B 3R65A 2XNDG 5E1AC 5J2TA 4RUEA 1PPJH 2NN4A 3BHPA 4NYKA 4CC5A 5EIBD 2X6AA 3SYPA 2QR4A 4W4KA 4CH5A 3WB2A 2EIMC 3F7VC 1YVWA 1N34O 4JI4B 2VRZA 2UUAB 3CCQV 3UKMA 2ZIMA 5KLVH 2L35A 1JJOA 1FJGB 3QF7A 1FAFA 3JALB 4X64O 3WG7C 2E75B 5IYBO 5CA3A 1N33O 2C2AA 2IJJA 3RT3C 2AZ0A 2Y69B 2P4VA 3AK2A 3J80N 1H38A 3G6BA 4F4LA 4CBCA 1B04A 3A0HZ 2ZT9B 3HKEB 4H33A 1DGSA 3CWBH 5LHHA 4DV5O 1MG1A 2B9ZA 2EILB 3FB7C 2PY5A 4PA3A 5IYZA 2H3OA 1S76D 3GWOA 1XMQO 4NTYA 1BSMA 3ABKC 2YEVB 3E86A 5BXZA 2UXDB 2PI4A 2YI8A 2UXBO 2JGUA 3HB3B 1YXBA 2WPDG 4NTWA 5CB4A 2JJ1G 5D5QA 4UCVA 3K59A 2HR3A 5JJEB 1VQKV 1HNXB 1NVPB 3O65A 4R6ZA 3K79A 4JPRA 2CGOA 4QE7A 1S72V 1NR1A 4O4LB 4NXNB 2DJVA 4LFAB 5LP6A 4FFBB 4WCEV 1Q3EA 3ABMB 4JI7B 4B3RB 3F5WC 3M8AA 2CH7B 1PNKA 2AW9A 3ZMSA 1TVKB 5FNVB 4NXMB 4DXWA 2QJ1A 3H1IH 1OHHG 4I9WA 4UCSA 3APOA 1BHBA 4FLUA 4JYAB 1JVMA 1TGOA 1CEZA 3BCCH 4IIJB 3CXCU 5FL7G 1HR0B 5KHKA 4U3JB 4YIPA 2Q5ZA 3EHBB 3LNNA 4BIZA 5LXTB 1FKAO 1XNQO 3WFVA 2QWNB 5D5PA 4DO2A 1SQFA 2A0LA 4PI0A 3ZEDA 4BWAA 1WA8A 5B3SC 1R3JC 2HKOA 4FLXA 1VQ7V 1N36B 2P22C 1DTOA 1I5YA 1YCIA 1NTZH 2XAJA 1XI1A 1VF6A 3JARB 3HKBB 5EBMC 4UFZA 3FYEB 2JEUA 1OCRB 1YSCA 4OX9B 2F95B 3K0GA 4JF3A 1S77D 2YI9A 5KHGA 1IBKO 4UXNA 1KC8W 1I0HA 1PKXA 4Z1VA 4DV6O 1RPOA 1XL4A 2JGDA 4AI8A 3HPLC 4XBFA 4FVMA 1AP5A 2YXYA 2XTAA 3RYCA 3AEIA 4MS2A 4J9ZB 1Z5WA 2WLIA 2BSKB 2FMLA 1YITV 2K9PA 3K9SA 5IYDO 1NS1A 3Q4HB 3OUSA 1HP8A 1RFYA 3ASNC 5L3EA 3S3XA 4LF5B 1COWG 3ASOB 4OPAA 1M57B 4I4TA 4DUYO 2ODMA 3X2QB 4FM1A 2WAMA 4P2ZA 2HJDA 4DR6B 3KCXA 3T1YO 4W4LA 2QM8A 2VQFB 1M9NA 3IC9A 3VOUA 4Z1MG 3CMEV 2DE0X 2LFRA 1I94B 3B2EE 3NR7A 2L6LA 3IJ4A 3K5NA 2HVJC 4GX5A 3G67A 5EYPB 3ZRWB 3SPHA 3RYIB 4B3TB 2UUCO 3UM7A 1BQZA 4BIOA 3E89A 4HAMA 5LGUA 1QCEA 1K33A 2NR5A 2QKAA 2ZM6O 1VQ4V 4TUYA 3GB7C 1SQVH 4JI1O 3B09A 1VQOV 1VQ9V 2QWPB 2V1DA 3OMIB 3AG4C 4TV9A 4WF9V 3T1HO 2YIAA 4DR1B 1Z2GA 5H9CA 2MK3A 1O9GA 4I55A 4DK1A 3RVZA 5CA0B 1O9HA 2OIGA 4Z2WA 3SJQC 2JEXA 5KHJA 4GT1A 5GW7A 4O4HB 1X4TA 3AG3C 2P90A 1K7DA 3AG1B 4GYCB 1AILA 2F43G 2GV9A 3O9OA 1FFTB 4O4IB 1S5HC 1VF7A 1WB7A 3RBZA 3DTUB 5H6QA 4YJ2B 3ZMTA 1M93A 3W7WA 4LR3A 2HHHO 2JS5A 4O2BB 2H8PC 3CE2A 1R6TA 1G1XB 5LA6A 1W0JG 1H8HG 5LHIA 3E2EA 1MMMA 1NZ6A 1N0JA 2HLDG 2ZD9A 3FB6C 5IJ0B 4UCRA 3N2KA 4ZI7A 1UJWB 4JI8B 1SKVA 2KSDA 4F6EA 2CTWA 1I5XA 1JFFB 5BY1A 3SPGA 5CMUA 2LJ2A 4IHJA 1RP3B 5LGNA 4JI5O 2X0LA 1YTFB 4FM0A 5J9PC 4WBNB 4LWSB 1VQ8V 1E1RG 5IWAO 3MAQA 4LH6A 4QJFB 4PELA 3CRMA 1N34B 3VQVA 5IJ9A 1D5AA 1JQ0A 2ZKOA 5IT9N 2ZE7A 3WB0A 5LBQA 2W0FC 3HKCA 2UUBO 2ETNA 1P7BA 5JWPA 4K8ZA 4X8AA 3IC7A 4X1YA 3I55V 4QPKA 3DXRB 4X64B 5LHGA 2RCVA 4GX0A 1L1FA 2IH3C 4BW9A 3QO7A 4YJ3B 1JJ2U 1N33B 2N04A 3ZBHA 1OCZC 5KMGA 1Y4MA 3JATB 1W59A 1Y67A 4LCUC 2X6BA 2Q4PA 1VQNV 3ABUA 4TV8A 2ZXWB 1ZL8A 4GZRB 4PDRA 3I56V 1EN4A 2WSSG 1EZVH 4DV5B 4IGGA 2DW4A 3ETGA 4UCUA 1BGYH 2ILMA 1GN6A 1XMQB 1Q43A 2XUMA 5B1BC 1AB3A 5EBWC 4J41A 2UXBB 1BE3H 3D36A 5C8YA 3ZJZA 1Q6HA 2YIBD 4JI0O 5J2TB 3APQA 4TQFA 1J95A 2Q8VA 4J80A 2XT9A 1ZX3A 3B77A 2GTSA 2Q69A 3ABTA 3RYHA 5B5EZ 1K5SA 3CJHA 2WLLA 2KG7A 2UXXA 2GTAA 2V7QG 4NKGB 1K73W 1LNQA 3K5OA 2GUZA 3AK1A 1V55B 4LF7O 2HEPA 4DYLA 2DYRB 1VMGA 4FLWA 3ABLB 3FAVA 4PA6A 4H37A 3L74H 1WPBA 5B1OA 1VQMV 3OAAG 4ABMA 1MZFA 4DUZO 5BR8O 4JYBA 2QE7G 4LF6O 2PYJA 4ICGA 2P7TC 4XDJA 1W0KG 2ZE5A 5H2FZ 4P30A 4K3AA 2Y69C 5IYZB 1YHQV 1H2KA 3JAWA 4FLZA 1XNQB 2RN9A 3CHXA 2EULA 3W7TA 2CTPA 3CMAV 2M7WA 4LF9O 2YXLA 2YDEA 3P30A 1FPOA 4LBEC 4BW5A 5CB4B 1TAEA 2YXHA 5DEDA 3QG5A 2YSUB 2D3OW 3F7YC 2QTOA 4OXSA 2YIBA 1X59A 3STLC 1WP7A 5LP6B 5JCOC 4JI3O 3BRCA 1YI2V 3ZX6A 1S5JA 1GN3A 3K03A 4EB6A 2Q68A 2YICA 3UO2A 1IBKB 1OCOC 3TXSA 1NKDA 4DV6B 4WFEA 4JI6O 4PD4F 3SPCA 3SR2C 1RSOA 3DC6A 1KBHA 3ZHSA 1NH2D 2IBZH 1NTKH 1K4DC 3FKSG 1YZBA 4QNHB 1SESA 1PL0A 4EFEA 2VWJA 2A7WA 5KAIZ 1KMIZ 3CCJV 1VF5B 2QGNA 4DUYB 3IFXA 2YC0A 3WB1A 4DR2O 3T1YB 3OM3B 1XHZA 1WA8B 2DWEC 4HBNA 3P3NA 1UPGA 1B3QA 4JTCB 2A9HA 1HWYA 3ZS8C 1B06A 1EBOA 1QHTA 2IJHA 2EINB 2DQ0A 2UUCB 1RPRA 2PTMA 3H9VA 4MVUA 4CS3A 1SRYA 2ZM6B 2HP8A 3CS5A 4JI1B 1K34A 5KA5A 1HDJA 1I08A 1Q90D 2ADQB 3T1HB 3K9AA 2AGAA 1TUBA 3NXSA 3CB2A 4FMTA 1F51A 4DV0O 3B4SA 3OE7G 2XOKG 1N0NA 1OCRC 3H01A 1S0VA 5LGTA 3KKYA 2DWDC 3H1JH 2ATKC 1YIJV 1QLNA 3G4SV 5F2VO 4LC1A 2BTOA 2P67A 2QM4A 3JCUZ 4CH6A 1HW7A 1JPXA 3LSUA 2Q6AA 3KG2A 1PL4A 1NJIW 5JVDA 5A2QN 4MVOA 4IL6Z 3RW0A 5LMUO 5KUMA 4R8CA 1SETA 1R73A 2CUGA 3OTFA 3FB8C 4I4TB 1VIBA 1VQLV 2N05A 5K1XA 2Y4TA 3BAAA 2Y48A 5IDJA 3VQXA 2ZIOA 3ZIAG 5KUKA 3AG2C 1WPXA 3PJSK 1XQ8A 1M5IA 3ASOC 3IGAC 1LUWA 1SQGA 3X2QC 2CTQA 4X9QA 1D2DA 1I7FA 5H6RA 1DLBA 4UVBA 4DR3O 4TUYB 2F93B 1ZAUA 4JI5B 1FXHA 4UV8A 5B1AB 3ZRSA 3E22A 5BMVA 1AROP 5IWAB 3HKDA 2OT5A 4DW1A 1Y76A 4I50A 1IDSA 2ITCC 4JYCA 5J2UA 3CCMV 4I55B 4FM2A 2UUBB 1XUQA 1QBZA 4DV7O 3CRRA 4RWUA 2VWKA 4YIOA 1J5EO 3E8GA 4WFAV 1L0LH 4MTGA 1ZTEA 2FTKA 3QTCA 1ROPA 1F4MA 4X1IA 4KXRA 4X1KB 1XILA 4UVCA 3IAYA 2PI5A 4R7CA 1SZXA 2KKWA 4CH3A 3H1HH 4FPPA 5LA6B 1Q82W 4DRXA 3AG1C 1HNWO 3GVMA 4OPHA 3B8NA 3N2KB 1YJWV 4X89A 5GTIZ 1GKFA 4KHPO 3JD3A 2LW1A 2X6CA 1G4YB 3FYIB 3AK3A 1IBLO 4DR4O 4JI0B 3CCRV 4IHJB 1GRJA 3K04A 5EC1C 5CA1B 1AP6A 2W6IG 1Q6IA 3CPWU 5IJ9B 1M1KW 4GX2A 1VQ6V 3ZMUA 4Q6GA 1KKDA 5CN0A 3HKCB 1FXKA 2G38A 3FD9A 3OEHG 3B8MA 1YEWA 4MVMA 4X1YB 2YUAA 1BL8A 4LF7B 2ZNIA 1KU9A 1GAXA 2LFSA 5L3GA 2Q7HA 3CRCA 4TOIA 2YEVA 5KHHA 2WLJA 5EBLC 2QWOB 3OMAB 3RYFA 1ZWIC 4CZZA 1ZSPA 4TV8B 4DUZB 5BR8B 4DV4O 1BHAA 1ZL8B 1S3JA 3QVNA 1H2LA 3E83A 2OTJV 4LF6B 2YS8A 4TT3G 3K06A 1R6KA 4AQYO 4X66O 4ZHQA 4BR6A 5CBHA 4XDKA 3OR6C 3JASA 3T1CA 2X7RB 1U96A 4FFBA 3KCYA 2Q0OC 4LF9B 1QLEC 2ZXWC 3ZN1A 2VS0A 1E1QG 3DGEA 3OGIB 4RO2A 2JDIG 4ZIBA 1XHXA 4GUNA 1OV9A 3CRQA 1P4RA 1GM8A 4N21A 1V9PA 2ZE8A 1JX9A 4UCOA 4JI3B 1US6A 3RYHB 1SC5B 3CJHB 3BVOA 2WLLB 2N74A 2KG7B 2AHYA 3JD0A 4F6RA 4FJCC 4JI6B 4CS4A 3K57A 3FAVB 4DV2O 4O2AB 5IYCO 3QO8A 3JAKA 2BE3A 3CCEV 4PA9A 3DC5A 1CP9A 1FFXB 1SQPH 4BAYA 1JR9A 3J81N 3E8BA 1V55C 2EIJC 3FB5C 1THZA 1OCCB 1Y74A 1AR1B 2ZR3A 2DYRC 4WFHA 1JOYA 2EZPA 4D6TH 1FXVA 3SPIA 1K97A 4KFMA 2P6JA 2P4KA 1E79G 3ZHVA 4DR2B 1XOUA 4HNAB 5BZBA 4JTAB 3K08A 4N23A 2B1GA 1PD3A 3N2GA 1SA0A 1K92A 4KUMA 5IY5C 3EFFK 1UFIA 3D3IA 5E79Z 4R50A 2JIZG 3K0DA 2FKXA 2JS3A 3U11A 4YHHO 3BY6A 4DR5O 3TK1A 2BSKA 3JD4A 4MSWC 1RM1C 1FYJA 3PN1A 2CDYA 3A8TA 3VQYA 3SYQA 4MVQA 3OFNG 3OR7C 5HFLA 4B3MO 4JI2O 1M56B 2P06A 4UV9A 2BTQA 4DV0B 2IJIA 2XAGA 3WU2Z 1T5EA 5EIBC 3ZMVA 4LFCO 2K1EA 1EN6A 1RSOB 3CCSV 1XREA 2IU0A 1VEWA 2YIDA 3ZRXA 2R9RB 2ARHA 2E76B 4DR7O 1DF4A 3G71V 1KP3A 5EZYA 3E35A 1F7YA 3QO5A 4G28B 1B6QA 3AG4B 4ASUG 5LMUB 1BQ0A 1WLEA 4TSFG 3RYIA 1XMOO 2JRIA 2RJZA 3OT7A 2W0XA 2VQEO 3UCSC 1PP9H 4MW8A 2GHYA 3OEEG 3N27A 2O57A 2LGWA 1GTOA 3FX7A 4GCZA 3M7MX 2F1MA 2KB1A 1XDCA 1IBMO 3C3TA 1R6NA 2R72A 5GONA 3C90A 1HNZO 4OGQB 1Y6XA 1KKCA 1BS3A 2QTSA 1M90W 3OTOO 4DR3B 4EEQA 4RAIA 1ZLZA 3ZHUA 1K5QA 1QVFU 2B5UA 4JZGA 3HR0A 1WJZA 1WB8A 3MD0A 2RNBA 4J42A 2EINC 3EXAA 1NT2B 1VF6C 3FFQA 1SERA 1QU7A 4O4IA 1P7GA 1Y66A 2BCCH 1BT8A 5LL6Y 3LNMB 2EIKB 1XNRO 2OYQA 4U7OA 4DV7B 1IXBA 1D5NA 2JVDA 1J5EB 4HYOA 4GKJO 4B08A 3BABA 1NH2B 2DMXA 3JYCA 5IJ0A 1NBMG 5JVDB 4I9QA 2EX3A 2DYSB 4J10A 3L71H 1MZEA 3T4ZA 2EILC 4K0KO 1FS0G 2F4VO 4NB5A 3LSQA 1ORQC 2UXNA 1MOFA 2MW2B 2PUSA 5FPRA 5L3FA 4YY3O 1AI6A 2LGQA 4KHPB 4JTDB 3E8FA 2AXTZ 4I0XA 5LYJA 1R3KC 3SJAC 1AJPA 2KQXA 2ZQMA 1KQSU 4LF4O 1IBLB 4DR4B 3ABMC 4LNUA 1AI4A 3T2MA 5TISZ 3E22B 5BMVB 4ZKIA 3D3QA 3HKDB 2DOSA 1KYOF 4I50B 1V54B 5J2UB 2OIEA 3W7SA 2E3CA 4D7SA 3RN4A 5IE9A 2F23A 5B1AC 1GM9A 2A79B 1CXZB 5K1PA 2UU9O 5A9GA 4U7NA 4LH7A 1SQBH 1WP8A 3ZRVA 4DV1O 4KP4A 1YF2A 4JZ2A 3OGCC 1R3LC 2HVKC 4GKKO 3BFRA 4X1IB 3SYOA 4EKWA 3DSQA 3G80A 4FIPC 3B40A 5LOVA 4DK0A 2CGNA 3E8HA 1H2GA 4UB6Z 1F23A 4DRXB 5B66Z 4X66B 4AQYB 5JH7A 1XL6A 2ZDIC 2WA3A 4JAAA 1YDXA 2ZE6A 1SQXH 1VARA 3RGBA 3P3PA 4B3SO 2WLKA 3CD6V 2JGDB 1P84F 3JCZA 3RYCB 2Z3YA 1QVGU 3T4DA 3L9DA 2JJ2G 2WLIB 4L8JA 1ENVA 3SJBC 1R1BA 4X65O 1PNMA 1AI7A 4WFBV 1SF9A 1SZTA 1KD1W 5L3BA 4QPJA 1AJQA 4GX1A 4RQEA 2QWQB 1FXKB 1XEQA 4E4EA 3L75H 4LFBO 1KECA 1IZ3A 1VQPV 2HHHB 2HJFC 3ETQA 4O4JA 1IURA 4DV2B 2OCCB 1GN2A 2Q9LA 2Z5UA 1PNLA 4X88A 4J9YB 1N4CA 1U97A 3RYFB 4AHCA 4JV5O 5ITZA 4FK5C 2E74B 1KP2A 1M57C 3ZHTA 1KUQA 1G6UA 1P49A 3TXQA 4G2KA 3W7UA 2OTLV 4ZHQB 1OCOB 2PGGA 1YJ9V 4ZOLA 3JASB 3CRAA 5JQGA 3I5DA 4X62O 1NU1H 3OUFA 1Q5OA 4TV9B 1GM7A 1EFRG 1N32O 5DN6G 3LSSA 5L3CA 1IVSA 2NNUA 3K5LA 4YHHB 4X20A 4DR5B 1FD9A 3D36C 4UVAA 1W2BU 4BIUA 2E5LO 3R66A 4TWKA 2CE4A 5L3DA 3CC4V 2JK5C 4UUJC 2LP7A 1K8AW 2EJ7A 4IYIA 4L87A 4JASA 4B3MB 4JI2B 3RFRA 3JAMN 4F6RB 3RWRD 3SDLA 1A32A 5KX5A 2EIMB 1BZKA 4DV3O 2WWWA 2UXCO 4LF8O 2FL4A 1MA1A 4LFCB 3JD2A 3THOA 1NVPD 3UT5A 3JAKB 1GH6A 1AR5A 3MHHC 4CC6A 1QR8A 3TETA 4B7KA 4GLXA 4DR7B 2WLHA 3CSXA 4ZI7B 1AR4A 3WG7B 1Y74B 5EC2C 1GN4A 4MTXA 3ICXA 3ZMZA 1XMOB 1QR9A 4PDVA 5LMNO 1NQTA 1XBLA 2EJRA 2VQEB 3JALA 1Q6UA 2IM9A 3LDEA 4QE9A 1OCCC 1TA8A 3VBBA 3W7XA 3N2GB 1SA0B 2M6YA 1IBMB 2XAHA 2IJKA 1EZJA 4PV1B 1WNSA 1HNZB 2GDSA 3ABKB 2RDCA 2WLMA 2QEXV 2B1IA 1H8EG 3VQWA 3OTOB 3HKEA 3L73H 3RVYA 1EN5A 4QGPA 1IX9A 5GTHZ 1TUEB 3ZCCA 2LQTA 2AHZA 4PI2A 3BA9A 4IYHA 1MSDA 2V4DA 5KMGB 3LDCA 2QWRB 3AG2B 5CBGA 2BOBC 2BTQB 5JCOA 3CCLV 4MT8A 3G6EV 3P32A 1SQQH 1NR7A 1XNRB 4GKJB 4ZBMA 2ADPA 2Q7EA 4WFGA 4O4LA 1M56C 1LUVA 1PV0A 3J7AU 4PA4A 5EZYB 4JI4O 3D8CA 2UUAO 5C8YB 5CBFA 3H1KH 2PYLA 4P9PA 1H2MA 2PF4E 2CH7A 3CYOA 2Z0AA 1OJHA 4K0KB 3BA8A 1QQCA 1TVKA 1GMGA 2H94A 5FNVA 1OZ0A 2CAZC 2F4VB 4Q20A 3JSNA 3OMNB 1FJGO 5B1NA 1Q81W 2BOCC 1L0NH 4DW0A 3JD1A 4J7JA 2RQ6A 4YY3B 3U0ZA 1DK1A 3K58A 5GONB 2ITDC 4IIJA 3JSLA 2Y4UA 2WA4A 4LP8A 4WFFA 2QDOA
chains in the Genus database with same CATH topology
2YS8A 4RWUA 2CTWA 1BQZA 2DN9A 2YUAA 1XBLA 1FPOA 2GUZB 1GH6A 1BQ0A 3APOA 2QWNB 1HDJA 4J7ZA 3UO2A 1N4CA 2CTRA 2KQXA 2GUZA 2QWPB 2QWQB 2EJ7A 3AG7A 3APQA 2M6YA 1NZ6A 3UCSC 3UO3A 2CTQA 2QWOB 2CUGA 2QWRB 4J80A 2L6LA 3BVOA 2QSAA 2N04A 2N05A 2DMXA 2PF4E 2Y4TA 2LGWA 1FAFA 2Y4UA 1WJZA 2CTPA 2OCHA 1IURA 2LO1A 4IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YS8 A;  4RWU A;  2CTW A;  1BQZ A;  2DN9 A;  2YUA A;  1XBL A;  1FPO A;  2GUZ B;  1GH6 A;  1BQ0 A;  3APO A;  2QWN B;  1HDJ A;  4J7Z A;  3UO2 A;  1N4C A;  2CTR A;  2KQX A;  2GUZ A;  2QWP B;  2QWQ B;  2EJ7 A;  3AG7 A;  3APQ A;  2M6Y A;  1NZ6 A;  3UCS C;  3UO3 A;  2CTQ A;  2QWO B;  2CUG A;  2QWR B;  4J80 A;  2L6L A;  3BVO A;  2QSA A;  2N04 A;  2N05 A;  2DMX A;  2PF4 E;  2Y4T A;  2LGW A;  1FAF A;  2Y4U A;  1WJZ A;  2CTP A;  2OCH A;  1IUR A;  2LO1 A;  4IT5 A; 
#chains in the Genus database with same CATH topology
 2GBO A;  5KAF Z;  4U3J A;  2D2C B;  5B3S B;  4LF4 B;  2GUZ B;  1DF5 A;  1K9M W;  3TCU A;  5LXT A;  2DQ3 A;  3BPZ A;  3ZHR A;  1R3I C;  4C7U A;  5AG2 A;  3M99 B;  3QNE A;  2UXD O;  3OW2 U;  1Q7Y W;  4JGS A;  2ZDI A;  1SS3 A;  4X1K A;  1AI5 A;  3U10 A;  2LO1 A;  5HFM A;  3C3S A;  4KL1 A;  2DN9 A;  3ABL C;  2Q67 A;  1QNM A;  2UU9 B;  1HNX O;  3ZN0 A;  3JAR A;  3HKB A;  4FLT A;  1MSW D;  2ZNJ A;  4DV1 B;  3JAW B;  4NXN O;  2Y0I A;  4PA7 A;  4LFA O;  4K8X A;  4GKK B;  3UQ8 A;  3S3W A;  1Q86 W;  4JI7 O;  4B3R O;  3LDD A;  4I5S A;  2EIK C;  1URF A;  5H5N A;  2XAS A;  1LR1 A;  1H2S B;  2ZCE A;  4NXM O;  3ASN B;  4J7Z A;  4E2L A;  5CA1 A;  4H0L B;  4MVR A;  2DYS C;  4JYA O;  2XAF A;  4K35 A;  3SYC A;  3L70 H;  2GSM B;  2A3Q A;  3CXH F;  3Q4H A;  4EB6 B;  1HR0 O;  4I0X B;  5LYJ B;  4B3S B;  3CC2 V;  3SPJ A;  4EFB A;  1JCH A;  1K4C C;  3A2F A;  5LP6 C;  4J7K A;  1WN7 A;  3ZHQ A;  1K3E A;  1EM1 A;  4LNU B;  4J11 A;  5C93 A;  4X65 B;  2XAQ A;  2W6J G;  2P5O A;  1N36 O;  4HZ3 A;  3K3W A;  5EYP A;  1QLE B;  1JA8 A;  2HFE C;  4G27 B;  1ZUQ A;  4MVZ A;  3ZRW A;  2RMK B;  4RUF A;  4LFB B;  2FYU H;  1H2N A;  3AG7 A;  2Q7G A;  3ETE A;  4XDL A;  2EBO A;  1V54 C;  1YTF D;  4MTO A;  1S5L Z;  1KB9 F;  5KHI A;  3L72 H;  4A5U B;  2IH1 C;  4OX9 O;  3K5M A;  4JV5 B;  3ETD A;  5LOV B;  1N8R W;  2OWO A;  3SGI A;  4PJ0 Z;  3AG3 B;  4QIW F;  1Q8I A;  1GO3 F;  4MVS A;  5JH7 B;  5CA0 A;  2A06 H;  2HG5 C;  2PZS A;  3OD4 A;  4UCT A;  1M4U A;  4H13 B;  2Q73 A;  1NI8 A;  4O4H A;  4TQD A;  4CH4 A;  4X62 B;  1IXM A;  3BEH A;  4IT5 A;  3A0R A;  3GWK C;  1NTM H;  1TUB B;  1YJN V;  4LF5 O;  3EVK A;  3STZ C;  2NLJ C;  2CTR A;  1N32 B;  5FPO A;  4YJ2 A;  3H1L H;  3MHS C;  2EIJ B;  2WLN A;  1F4N A;  3CP1 A;  3UO3 A;  4O2B A;  1Z5V A;  4UB8 Z;  4DR6 O;  4MW3 A;  4O2A A;  3A0B Z;  2QSA A;  1BMF G;  4NR1 A;  2E5L B;  3MDS A;  4JYY A;  2VQF O;  2FB5 A;  1FFX A;  4YXW G;  3SYA A;  5EK0 A;  1I94 O;  2AZ2 A;  1PM9 A;  3CEI A;  2IW5 A;  4FLY A;  3F5T A;  2EZO A;  2ZR2 A;  3ML0 A;  4B3T O;  5DEC A;  4PHZ A;  4DV3 B;  2CK3 G;  2UXC B;  1JFF A;  4LF8 B;  5IY5 B;  4O4J B;  2XHB A;  4AIL C;  1GK9 A;  5JJJ B;  2QKS A;  4RQF A;  1HNW B;  1MNG A;  2R70 A;  2R9I A;  3TJT A;  4CS2 A;  1FXK C;  4JAV A;  1BCC H;  4HNA A;  4FZ1 A;  4LWS A;  4WBN A;  5DM6 V;  2LW7 A;  5ITZ B;  1RM1 B;  5JJN B;  5KA6 A;  1MAB G;  4JAU A;  4H44 B;  4DR1 O;  2QKC A;  4MTF A;  1OCZ B;  2OCC C;  4ZOL B;  3CCU V;  1JMK C;  1CPY A;  1AVM A;  4D7T A;  5LMN B;  5FLX N;  4P9O A;  3DXR A;  5JQG B;  1L8D A;  1WAZ A;  4YJ3 A;  1Y76 B;  4FFK A;  4U3F H;  2IU3 A;  4I7Z B;  1G8M A;  3KZI Z;  3JAT A;  4B7E A;  5B1B B;  3CCV V;  1VP7 A;  2Y0P A;  4X20 B;  3LUT B;  4NTX A;  3SJC C;  2QA4 V;  3CC7 V;  1AJN A;  2OCH A;  1VQ5 V;  3CX5 F;  4FLV A;  2F66 C;  2QM7 A;  4PDM A;  2Q0A A;  4FZ0 A;  4JI8 O;  5KX5 B;  4NVP A;  2ZIN A;  4DV4 B;  3TGU H;  4PDL A;  2R9A A;  3UT5 B;  3R65 A;  2XND G;  5E1A C;  5J2T A;  4RUE A;  1PPJ H;  2NN4 A;  3BHP A;  4NYK A;  4CC5 A;  5EIB D;  2X6A A;  3SYP A;  2QR4 A;  4W4K A;  4CH5 A;  3WB2 A;  2EIM C;  3F7V C;  1YVW A;  1N34 O;  4JI4 B;  2VRZ A;  2UUA B;  3CCQ V;  3UKM A;  2ZIM A;  5KLV H;  2L35 A;  1JJO A;  1FJG B;  3QF7 A;  1FAF A;  3JAL B;  4X64 O;  3WG7 C;  2E75 B;  5IYB O;  5CA3 A;  1N33 O;  2C2A A;  2IJJ A;  3RT3 C;  2AZ0 A;  2Y69 B;  2P4V A;  3AK2 A;  3J80 N;  1H38 A;  3G6B A;  4F4L A;  4CBC A;  1B04 A;  3A0H Z;  2ZT9 B;  3HKE B;  4H33 A;  1DGS A;  3CWB H;  5LHH A;  4DV5 O;  1MG1 A;  2B9Z A;  2EIL B;  3FB7 C;  2PY5 A;  4PA3 A;  5IYZ A;  2H3O A;  1S76 D;  3GWO A;  1XMQ O;  4NTY A;  1BSM A;  3ABK C;  2YEV B;  3E86 A;  5BXZ A;  2UXD B;  2PI4 A;  2YI8 A;  2UXB O;  2JGU A;  3HB3 B;  1YXB A;  2WPD G;  4NTW A;  5CB4 A;  2JJ1 G;  5D5Q A;  4UCV A;  3K59 A;  2HR3 A;  5JJE B;  1VQK V;  1HNX B;  1NVP B;  3O65 A;  4R6Z A;  3K79 A;  4JPR A;  2CGO A;  4QE7 A;  1S72 V;  1NR1 A;  4O4L B;  4NXN B;  2DJV A;  4LFA B;  5LP6 A;  4FFB B;  4WCE V;  1Q3E A;  3ABM B;  4JI7 B;  4B3R B;  3F5W C;  3M8A A;  2CH7 B;  1PNK A;  2AW9 A;  3ZMS A;  1TVK B;  5FNV B;  4NXM B;  4DXW A;  2QJ1 A;  3H1I H;  1OHH G;  4I9W A;  4UCS A;  3APO A;  1BHB A;  4FLU A;  4JYA B;  1JVM A;  1TGO A;  1CEZ A;  3BCC H;  4IIJ B;  3CXC U;  5FL7 G;  1HR0 B;  5KHK A;  4U3J B;  4YIP A;  2Q5Z A;  3EHB B;  3LNN A;  4BIZ A;  5LXT B;  1FKA O;  1XNQ O;  3WFV A;  2QWN B;  5D5P A;  4DO2 A;  1SQF A;  2A0L A;  4PI0 A;  3ZED A;  4BWA A;  1WA8 A;  5B3S C;  1R3J C;  2HKO A;  4FLX A;  1VQ7 V;  1N36 B;  2P22 C;  1DTO A;  1I5Y A;  1YCI A;  1NTZ H;  2XAJ A;  1XI1 A;  1VF6 A;  3JAR B;  3HKB B;  5EBM C;  4UFZ A;  3FYE B;  2JEU A;  1OCR B;  1YSC A;  4OX9 B;  2F95 B;  3K0G A;  4JF3 A;  1S77 D;  2YI9 A;  5KHG A;  1IBK O;  4UXN A;  1KC8 W;  1I0H A;  1PKX A;  4Z1V A;  4DV6 O;  1RPO A;  1XL4 A;  2JGD A;  4AI8 A;  3HPL C;  4XBF A;  4FVM A;  1AP5 A;  2YXY A;  2XTA A;  3RYC A;  3AEI A;  4MS2 A;  4J9Z B;  1Z5W A;  2WLI A;  2BSK B;  2FML A;  1YIT V;  2K9P A;  3K9S A;  5IYD O;  1NS1 A;  3Q4H B;  3OUS A;  1HP8 A;  1RFY A;  3ASN C;  5L3E A;  3S3X A;  4LF5 B;  1COW G;  3ASO B;  4OPA A;  1M57 B;  4I4T A;  4DUY O;  2ODM A;  3X2Q B;  4FM1 A;  2WAM A;  4P2Z A;  2HJD A;  4DR6 B;  3KCX A;  3T1Y O;  4W4L A;  2QM8 A;  2VQF B;  1M9N A;  3IC9 A;  3VOU A;  4Z1M G;  3CME V;  2DE0 X;  2LFR A;  1I94 B;  3B2E E;  3NR7 A;  2L6L A;  3IJ4 A;  3K5N A;  2HVJ C;  4GX5 A;  3G67 A;  5EYP B;  3ZRW B;  3SPH A;  3RYI B;  4B3T B;  2UUC O;  3UM7 A;  1BQZ A;  4BIO A;  3E89 A;  4HAM A;  5LGU A;  1QCE A;  1K33 A;  2NR5 A;  2QKA A;  2ZM6 O;  1VQ4 V;  4TUY A;  3GB7 C;  1SQV H;  4JI1 O;  3B09 A;  1VQO V;  1VQ9 V;  2QWP B;  2V1D A;  3OMI B;  3AG4 C;  4TV9 A;  4WF9 V;  3T1H O;  2YIA A;  4DR1 B;  1Z2G A;  5H9C A;  2MK3 A;  1O9G A;  4I55 A;  4DK1 A;  3RVZ A;  5CA0 B;  1O9H A;  2OIG A;  4Z2W A;  3SJQ C;  2JEX A;  5KHJ A;  4GT1 A;  5GW7 A;  4O4H B;  1X4T A;  3AG3 C;  2P90 A;  1K7D A;  3AG1 B;  4GYC B;  1AIL A;  2F43 G;  2GV9 A;  3O9O A;  1FFT B;  4O4I B;  1S5H C;  1VF7 A;  1WB7 A;  3RBZ A;  3DTU B;  5H6Q A;  4YJ2 B;  3ZMT A;  1M93 A;  3W7W A;  4LR3 A;  2HHH O;  2JS5 A;  4O2B B;  2H8P C;  3CE2 A;  1R6T A;  1G1X B;  5LA6 A;  1W0J G;  1H8H G;  5LHI A;  3E2E A;  1MMM A;  1NZ6 A;  1N0J A;  2HLD G;  2ZD9 A;  3FB6 C;  5IJ0 B;  4UCR A;  3N2K A;  4ZI7 A;  1UJW B;  4JI8 B;  1SKV A;  2KSD A;  4F6E A;  2CTW A;  1I5X A;  1JFF B;  5BY1 A;  3SPG A;  5CMU A;  2LJ2 A;  4IHJ A;  1RP3 B;  5LGN A;  4JI5 O;  2X0L A;  1YTF B;  4FM0 A;  5J9P C;  4WBN B;  4LWS B;  1VQ8 V;  1E1R G;  5IWA O;  3MAQ A;  4LH6 A;  4QJF B;  4PEL A;  3CRM A;  1N34 B;  3VQV A;  5IJ9 A;  1D5A A;  1JQ0 A;  2ZKO A;  5IT9 N;  2ZE7 A;  3WB0 A;  5LBQ A;  2W0F C;  3HKC A;  2UUB O;  2ETN A;  1P7B A;  5JWP A;  4K8Z A;  4X8A A;  3IC7 A;  4X1Y A;  3I55 V;  4QPK A;  3DXR B;  4X64 B;  5LHG A;  2RCV A;  4GX0 A;  1L1F A;  2IH3 C;  4BW9 A;  3QO7 A;  4YJ3 B;  1JJ2 U;  1N33 B;  2N04 A;  3ZBH A;  1OCZ C;  5KMG A;  1Y4M A;  3JAT B;  1W59 A;  1Y67 A;  4LCU C;  2X6B A;  2Q4P A;  1VQN V;  3ABU A;  4TV8 A;  2ZXW B;  1ZL8 A;  4GZR B;  4PDR A;  3I56 V;  1EN4 A;  2WSS G;  1EZV H;  4DV5 B;  4IGG A;  2DW4 A;  3ETG A;  4UCU A;  1BGY H;  2ILM A;  1GN6 A;  1XMQ B;  1Q43 A;  2XUM A;  5B1B C;  1AB3 A;  5EBW C;  4J41 A;  2UXB B;  1BE3 H;  3D36 A;  5C8Y A;  3ZJZ A;  1Q6H A;  2YIB D;  4JI0 O;  5J2T B;  3APQ A;  4TQF A;  1J95 A;  2Q8V A;  4J80 A;  2XT9 A;  1ZX3 A;  3B77 A;  2GTS A;  2Q69 A;  3ABT A;  3RYH A;  5B5E Z;  1K5S A;  3CJH A;  2WLL A;  2KG7 A;  2UXX A;  2GTA A;  2V7Q G;  4NKG B;  1K73 W;  1LNQ A;  3K5O A;  2GUZ A;  3AK1 A;  1V55 B;  4LF7 O;  2HEP A;  4DYL A;  2DYR B;  1VMG A;  4FLW A;  3ABL B;  3FAV A;  4PA6 A;  4H37 A;  3L74 H;  1WPB A;  5B1O A;  1VQM V;  3OAA G;  4ABM A;  1MZF A;  4DUZ O;  5BR8 O;  4JYB A;  2QE7 G;  4LF6 O;  2PYJ A;  4ICG A;  2P7T C;  4XDJ A;  1W0K G;  2ZE5 A;  5H2F Z;  4P30 A;  4K3A A;  2Y69 C;  5IYZ B;  1YHQ V;  1H2K A;  3JAW A;  4FLZ A;  1XNQ B;  2RN9 A;  3CHX A;  2EUL A;  3W7T A;  2CTP A;  3CMA V;  2M7W A;  4LF9 O;  2YXL A;  2YDE A;  3P30 A;  1FPO A;  4LBE C;  4BW5 A;  5CB4 B;  1TAE A;  2YXH A;  5DED A;  3QG5 A;  2YSU B;  2D3O W;  3F7Y C;  2QTO A;  4OXS A;  2YIB A;  1X59 A;  3STL C;  1WP7 A;  5LP6 B;  5JCO C;  4JI3 O;  3BRC A;  1YI2 V;  3ZX6 A;  1S5J A;  1GN3 A;  3K03 A;  4EB6 A;  2Q68 A;  2YIC A;  3UO2 A;  1IBK B;  1OCO C;  3TXS A;  1NKD A;  4DV6 B;  4WFE A;  4JI6 O;  4PD4 F;  3SPC A;  3SR2 C;  1RSO A;  3DC6 A;  1KBH A;  3ZHS A;  1NH2 D;  2IBZ H;  1NTK H;  1K4D C;  3FKS G;  1YZB A;  4QNH B;  1SES A;  1PL0 A;  4EFE A;  2VWJ A;  2A7W A;  5KAI Z;  1KMI Z;  3CCJ V;  1VF5 B;  2QGN A;  4DUY B;  3IFX A;  2YC0 A;  3WB1 A;  4DR2 O;  3T1Y B;  3OM3 B;  1XHZ A;  1WA8 B;  2DWE C;  4HBN A;  3P3N A;  1UPG A;  1B3Q A;  4JTC B;  2A9H A;  1HWY A;  3ZS8 C;  1B06 A;  1EBO A;  1QHT A;  2IJH A;  2EIN B;  2DQ0 A;  2UUC B;  1RPR A;  2PTM A;  3H9V A;  4MVU A;  4CS3 A;  1SRY A;  2ZM6 B;  2HP8 A;  3CS5 A;  4JI1 B;  1K34 A;  5KA5 A;  1HDJ A;  1I08 A;  1Q90 D;  2ADQ B;  3T1H B;  3K9A A;  2AGA A;  1TUB A;  3NXS A;  3CB2 A;  4FMT A;  1F51 A;  4DV0 O;  3B4S A;  3OE7 G;  2XOK G;  1N0N A;  1OCR C;  3H01 A;  1S0V A;  5LGT A;  3KKY A;  2DWD C;  3H1J H;  2ATK C;  1YIJ V;  1QLN A;  3G4S V;  5F2V O;  4LC1 A;  2BTO A;  2P67 A;  2QM4 A;  3JCU Z;  4CH6 A;  1HW7 A;  1JPX A;  3LSU A;  2Q6A A;  3KG2 A;  1PL4 A;  1NJI W;  5JVD A;  5A2Q N;  4MVO A;  4IL6 Z;  3RW0 A;  5LMU O;  5KUM A;  4R8C A;  1SET A;  1R73 A;  2CUG A;  3OTF A;  3FB8 C;  4I4T B;  1VIB A;  1VQL V;  2N05 A;  5K1X A;  2Y4T A;  3BAA A;  2Y48 A;  5IDJ A;  3VQX A;  2ZIO A;  3ZIA G;  5KUK A;  3AG2 C;  1WPX A;  3PJS K;  1XQ8 A;  1M5I A;  3ASO C;  3IGA C;  1LUW A;  1SQG A;  3X2Q C;  2CTQ A;  4X9Q A;  1D2D A;  1I7F A;  5H6R A;  1DLB A;  4UVB A;  4DR3 O;  4TUY B;  2F93 B;  1ZAU A;  4JI5 B;  1FXH A;  4UV8 A;  5B1A B;  3ZRS A;  3E22 A;  5BMV A;  1ARO P;  5IWA B;  3HKD A;  2OT5 A;  4DW1 A;  1Y76 A;  4I50 A;  1IDS A;  2ITC C;  4JYC A;  5J2U A;  3CCM V;  4I55 B;  4FM2 A;  2UUB B;  1XUQ A;  1QBZ A;  4DV7 O;  3CRR A;  4RWU A;  2VWK A;  4YIO A;  1J5E O;  3E8G A;  4WFA V;  1L0L H;  4MTG A;  1ZTE A;  2FTK A;  3QTC A;  1ROP A;  1F4M A;  4X1I A;  4KXR A;  4X1K B;  1XIL A;  4UVC A;  3IAY A;  2PI5 A;  4R7C A;  1SZX A;  2KKW A;  4CH3 A;  3H1H H;  4FPP A;  5LA6 B;  1Q82 W;  4DRX A;  3AG1 C;  1HNW O;  3GVM A;  4OPH A;  3B8N A;  3N2K B;  1YJW V;  4X89 A;  5GTI Z;  1GKF A;  4KHP O;  3JD3 A;  2LW1 A;  2X6C A;  1G4Y B;  3FYI B;  3AK3 A;  1IBL O;  4DR4 O;  4JI0 B;  3CCR V;  4IHJ B;  1GRJ A;  3K04 A;  5EC1 C;  5CA1 B;  1AP6 A;  2W6I G;  1Q6I A;  3CPW U;  5IJ9 B;  1M1K W;  4GX2 A;  1VQ6 V;  3ZMU A;  4Q6G A;  1KKD A;  5CN0 A;  3HKC B;  1FXK A;  2G38 A;  3FD9 A;  3OEH G;  3B8M A;  1YEW A;  4MVM A;  4X1Y B;  2YUA A;  1BL8 A;  4LF7 B;  2ZNI A;  1KU9 A;  1GAX A;  2LFS A;  5L3G A;  2Q7H A;  3CRC A;  4TOI A;  2YEV A;  5KHH A;  2WLJ A;  5EBL C;  2QWO B;  3OMA B;  3RYF A;  1ZWI C;  4CZZ A;  1ZSP A;  4TV8 B;  4DUZ B;  5BR8 B;  4DV4 O;  1BHA A;  1ZL8 B;  1S3J A;  3QVN A;  1H2L A;  3E83 A;  2OTJ V;  4LF6 B;  2YS8 A;  4TT3 G;  3K06 A;  1R6K A;  4AQY O;  4X66 O;  4ZHQ A;  4BR6 A;  5CBH A;  4XDK A;  3OR6 C;  3JAS A;  3T1C A;  2X7R B;  1U96 A;  4FFB A;  3KCY A;  2Q0O C;  4LF9 B;  1QLE C;  2ZXW C;  3ZN1 A;  2VS0 A;  1E1Q G;  3DGE A;  3OGI B;  4RO2 A;  2JDI G;  4ZIB A;  1XHX A;  4GUN A;  1OV9 A;  3CRQ A;  1P4R A;  1GM8 A;  4N21 A;  1V9P A;  2ZE8 A;  1JX9 A;  4UCO A;  4JI3 B;  1US6 A;  3RYH B;  1SC5 B;  3CJH B;  3BVO A;  2WLL B;  2N74 A;  2KG7 B;  2AHY A;  3JD0 A;  4F6R A;  4FJC C;  4JI6 B;  4CS4 A;  3K57 A;  3FAV B;  4DV2 O;  4O2A B;  5IYC O;  3QO8 A;  3JAK A;  2BE3 A;  3CCE V;  4PA9 A;  3DC5 A;  1CP9 A;  1FFX B;  1SQP H;  4BAY A;  1JR9 A;  3J81 N;  3E8B A;  1V55 C;  2EIJ C;  3FB5 C;  1THZ A;  1OCC B;  1Y74 A;  1AR1 B;  2ZR3 A;  2DYR C;  4WFH A;  1JOY A;  2EZP A;  4D6T H;  1FXV A;  3SPI A;  1K97 A;  4KFM A;  2P6J A;  2P4K A;  1E79 G;  3ZHV A;  4DR2 B;  1XOU A;  4HNA B;  5BZB A;  4JTA B;  3K08 A;  4N23 A;  2B1G A;  1PD3 A;  3N2G A;  1SA0 A;  1K92 A;  4KUM A;  5IY5 C;  3EFF K;  1UFI A;  3D3I A;  5E79 Z;  4R50 A;  2JIZ G;  3K0D A;  2FKX A;  2JS3 A;  3U11 A;  4YHH O;  3BY6 A;  4DR5 O;  3TK1 A;  2BSK A;  3JD4 A;  4MSW C;  1RM1 C;  1FYJ A;  3PN1 A;  2CDY A;  3A8T A;  3VQY A;  3SYQ A;  4MVQ A;  3OFN G;  3OR7 C;  5HFL A;  4B3M O;  4JI2 O;  1M56 B;  2P06 A;  4UV9 A;  2BTQ A;  4DV0 B;  2IJI A;  2XAG A;  3WU2 Z;  1T5E A;  5EIB C;  3ZMV A;  4LFC O;  2K1E A;  1EN6 A;  1RSO B;  3CCS V;  1XRE A;  2IU0 A;  1VEW A;  2YID A;  3ZRX A;  2R9R B;  2ARH A;  2E76 B;  4DR7 O;  1DF4 A;  3G71 V;  1KP3 A;  5EZY A;  3E35 A;  1F7Y A;  3QO5 A;  4G28 B;  1B6Q A;  3AG4 B;  4ASU G;  5LMU B;  1BQ0 A;  1WLE A;  4TSF G;  3RYI A;  1XMO O;  2JRI A;  2RJZ A;  3OT7 A;  2W0X A;  2VQE O;  3UCS C;  1PP9 H;  4MW8 A;  2GHY A;  3OEE G;  3N27 A;  2O57 A;  2LGW A;  1GTO A;  3FX7 A;  4GCZ A;  3M7M X;  2F1M A;  2KB1 A;  1XDC A;  1IBM O;  3C3T A;  1R6N A;  2R72 A;  5GON A;  3C90 A;  1HNZ O;  4OGQ B;  1Y6X A;  1KKC A;  1BS3 A;  2QTS A;  1M90 W;  3OTO O;  4DR3 B;  4EEQ A;  4RAI A;  1ZLZ A;  3ZHU A;  1K5Q A;  1QVF U;  2B5U A;  4JZG A;  3HR0 A;  1WJZ A;  1WB8 A;  3MD0 A;  2RNB A;  4J42 A;  2EIN C;  3EXA A;  1NT2 B;  1VF6 C;  3FFQ A;  1SER A;  1QU7 A;  4O4I A;  1P7G A;  1Y66 A;  2BCC H;  1BT8 A;  5LL6 Y;  3LNM B;  2EIK B;  1XNR O;  2OYQ A;  4U7O A;  4DV7 B;  1IXB A;  1D5N A;  2JVD A;  1J5E B;  4HYO A;  4GKJ O;  4B08 A;  3BAB A;  1NH2 B;  2DMX A;  3JYC A;  5IJ0 A;  1NBM G;  5JVD B;  4I9Q A;  2EX3 A;  2DYS B;  4J10 A;  3L71 H;  1MZE A;  3T4Z A;  2EIL C;  4K0K O;  1FS0 G;  2F4V O;  4NB5 A;  3LSQ A;  1ORQ C;  2UXN A;  1MOF A;  2MW2 B;  2PUS A;  5FPR A;  5L3F A;  4YY3 O;  1AI6 A;  2LGQ A;  4KHP B;  4JTD B;  3E8F A;  2AXT Z;  4I0X A;  5LYJ A;  1R3K C;  3SJA C;  1AJP A;  2KQX A;  2ZQM A;  1KQS U;  4LF4 O;  1IBL B;  4DR4 B;  3ABM C;  4LNU A;  1AI4 A;  3T2M A;  5TIS Z;  3E22 B;  5BMV B;  4ZKI A;  3D3Q A;  3HKD B;  2DOS A;  1KYO F;  4I50 B;  1V54 B;  5J2U B;  2OIE A;  3W7S A;  2E3C A;  4D7S A;  3RN4 A;  5IE9 A;  2F23 A;  5B1A C;  1GM9 A;  2A79 B;  1CXZ B;  5K1P A;  2UU9 O;  5A9G A;  4U7N A;  4LH7 A;  1SQB H;  1WP8 A;  3ZRV A;  4DV1 O;  4KP4 A;  1YF2 A;  4JZ2 A;  3OGC C;  1R3L C;  2HVK C;  4GKK O;  3BFR A;  4X1I B;  3SYO A;  4EKW A;  3DSQ A;  3G80 A;  4FIP C;  3B40 A;  5LOV A;  4DK0 A;  2CGN A;  3E8H A;  1H2G A;  4UB6 Z;  1F23 A;  4DRX B;  5B66 Z;  4X66 B;  4AQY B;  5JH7 A;  1XL6 A;  2ZDI C;  2WA3 A;  4JAA A;  1YDX A;  2ZE6 A;  1SQX H;  1VAR A;  3RGB A;  3P3P A;  4B3S O;  2WLK A;  3CD6 V;  2JGD B;  1P84 F;  3JCZ A;  3RYC B;  2Z3Y A;  1QVG U;  3T4D A;  3L9D A;  2JJ2 G;  2WLI B;  4L8J A;  1ENV A;  3SJB C;  1R1B A;  4X65 O;  1PNM A;  1AI7 A;  4WFB V;  1SF9 A;  1SZT A;  1KD1 W;  5L3B A;  4QPJ A;  1AJQ A;  4GX1 A;  4RQE A;  2QWQ B;  1FXK B;  1XEQ A;  4E4E A;  3L75 H;  4LFB O;  1KEC A;  1IZ3 A;  1VQP V;  2HHH B;  2HJF C;  3ETQ A;  4O4J A;  1IUR A;  4DV2 B;  2OCC B;  1GN2 A;  2Q9L A;  2Z5U A;  1PNL A;  4X88 A;  4J9Y B;  1N4C A;  1U97 A;  3RYF B;  4AHC A;  4JV5 O;  5ITZ A;  4FK5 C;  2E74 B;  1KP2 A;  1M57 C;  3ZHT A;  1KUQ A;  1G6U A;  1P49 A;  3TXQ A;  4G2K A;  3W7U A;  2OTL V;  4ZHQ B;  1OCO B;  2PGG A;  1YJ9 V;  4ZOL A;  3JAS B;  3CRA A;  5JQG A;  3I5D A;  4X62 O;  1NU1 H;  3OUF A;  1Q5O A;  4TV9 B;  1GM7 A;  1EFR G;  1N32 O;  5DN6 G;  3LSS A;  5L3C A;  1IVS A;  2NNU A;  3K5L A;  4YHH B;  4X20 A;  4DR5 B;  1FD9 A;  3D36 C;  4UVA A;  1W2B U;  4BIU A;  2E5L O;  3R66 A;  4TWK A;  2CE4 A;  5L3D A;  3CC4 V;  2JK5 C;  4UUJ C;  2LP7 A;  1K8A W;  2EJ7 A;  4IYI A;  4L87 A;  4JAS A;  4B3M B;  4JI2 B;  3RFR A;  3JAM N;  4F6R B;  3RWR D;  3SDL A;  1A32 A;  5KX5 A;  2EIM B;  1BZK A;  4DV3 O;  2WWW A;  2UXC O;  4LF8 O;  2FL4 A;  1MA1 A;  4LFC B;  3JD2 A;  3THO A;  1NVP D;  3UT5 A;  3JAK B;  1GH6 A;  1AR5 A;  3MHH C;  4CC6 A;  1QR8 A;  3TET A;  4B7K A;  4GLX A;  4DR7 B;  2WLH A;  3CSX A;  4ZI7 B;  1AR4 A;  3WG7 B;  1Y74 B;  5EC2 C;  1GN4 A;  4MTX A;  3ICX A;  3ZMZ A;  1XMO B;  1QR9 A;  4PDV A;  5LMN O;  1NQT A;  1XBL A;  2EJR A;  2VQE B;  3JAL A;  1Q6U A;  2IM9 A;  3LDE A;  4QE9 A;  1OCC C;  1TA8 A;  3VBB A;  3W7X A;  3N2G B;  1SA0 B;  2M6Y A;  1IBM B;  2XAH A;  2IJK A;  1EZJ A;  4PV1 B;  1WNS A;  1HNZ B;  2GDS A;  3ABK B;  2RDC A;  2WLM A;  2QEX V;  2B1I A;  1H8E G;  3VQW A;  3OTO B;  3HKE A;  3L73 H;  3RVY A;  1EN5 A;  4QGP A;  1IX9 A;  5GTH Z;  1TUE B;  3ZCC A;  2LQT A;  2AHZ A;  4PI2 A;  3BA9 A;  4IYH A;  1MSD A;  2V4D A;  5KMG B;  3LDC A;  2QWR B;  3AG2 B;  5CBG A;  2BOB C;  2BTQ B;  5JCO A;  3CCL V;  4MT8 A;  3G6E V;  3P32 A;  1SQQ H;  1NR7 A;  1XNR B;  4GKJ B;  4ZBM A;  2ADP A;  2Q7E A;  4WFG A;  4O4L A;  1M56 C;  1LUV A;  1PV0 A;  3J7A U;  4PA4 A;  5EZY B;  4JI4 O;  3D8C A;  2UUA O;  5C8Y B;  5CBF A;  3H1K H;  2PYL A;  4P9P A;  1H2M A;  2PF4 E;  2CH7 A;  3CYO A;  2Z0A A;  1OJH A;  4K0K B;  3BA8 A;  1QQC A;  1TVK A;  1GMG A;  2H94 A;  5FNV A;  1OZ0 A;  2CAZ C;  2F4V B;  4Q20 A;  3JSN A;  3OMN B;  1FJG O;  5B1N A;  1Q81 W;  2BOC C;  1L0N H;  4DW0 A;  3JD1 A;  4J7J A;  2RQ6 A;  4YY3 B;  3U0Z A;  1DK1 A;  3K58 A;  5GON B;  2ITD C;  4IIJ A;  3JSL A;  2Y4U A;  2WA4 A;  4LP8 A;  4WFF A;  2QDO A; 
#chains in the Genus database with same CATH homology
 2YS8 A;  4RWU A;  2CTW A;  1BQZ A;  2DN9 A;  2YUA A;  1XBL A;  1FPO A;  2GUZ B;  1GH6 A;  1BQ0 A;  3APO A;  2QWN B;  1HDJ A;  4J7Z A;  3UO2 A;  1N4C A;  2CTR A;  2KQX A;  2GUZ A;  2QWP B;  2QWQ B;  2EJ7 A;  3AG7 A;  3APQ A;  2M6Y A;  1NZ6 A;  3UCS C;  3UO3 A;  2CTQ A;  2QWO B;  2CUG A;  2QWR B;  4J80 A;  2L6L A;  3BVO A;  2QSA A;  2N04 A;  2N05 A;  2DMX A;  2PF4 E;  2Y4T A;  2LGW A;  1FAF A;  2Y4U A;  1WJZ A;  2CTP A;  2OCH A;  1IUR A;  2LO1 A;  4IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...