2OCHA

J-domain of dnj-12 from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
KETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Hypothetical protein dnj-12
publication title X-ray crystal structure of J-domain of dnj-12 from Caenorhabditis elegans.
rcsb
source organism Caenorhabditis elegans
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ochA00
1BQZA 1GH6A 2GUZA 4J80A 2Y4UA 3UO3A 2L6LA 2CTRA 4IT5A 2N05A 2PF4E 4J7ZA 2M6YA 2EJ7A 3UCSC 2KQXA 2Y4TA 1BQ0A 1N4CA 2QWNB 3APQA 2QWRB 2CTPA 2GUZB 2OCHA 2QSAA 2QWPB 1XBLA 3UO2A 1HDJA 2LGWA 2DN9A 3APOA 1IURA 2CTWA 2LO1A 4RWUA 2QWQB 2CTQA 1WJZA 3AG7A 2YUAA 2CUGA 1FAFA 1NZ6A 2YS8A 1FPOA 3BVOA 2QWOB 2DMXA 2N04A
chains in the Genus database with same CATH superfamily
1XHZA 2A06H 5FLXN 2DYSB 2WLNA 2WLJA 4LF4O 5K1PA 1PD3A 4J9ZB 4ZHQB 1AI5A 4LFCB 4F6RA 4FPPA 3I5DA 4LWSB 3HKBB 4GCZA 1QLEB 1KQSU 4NXNB 3ZCCA 3MD0A 3RW0A 2AXTZ 2WSSG 1JQ0A 2CH7A 1YJNV 3JD2A 1M57C 2F4VO 1SA0B 2EIKC 2W6JG 2W0FC 3A0HZ 4UCRA 1K3EA 1DTOA 2YXHA 2XAHA 1VARA 2Y4UA 3WFVA 2F95B 4IYHA 1B6QA 4XDKA 4LF6B 2Z3YA 2PF4E 3CJHB 1URFA 5EC1C 3RYIA 2ZNIA 1K5SA 4CH4A 2ZE5A 2L35A 2AW9A 5JQGA 2EINB 4TV8A 2V7QG 3LSQA 1CXZB 3CRRA 2A3QA 4DV0O 5CB4A 2EIJC 3ZMUA 4DV5O 3G67A 3KKYA 2ZXWB 1U97A 1Y66A 2Y4TA 1NJIW 4NTWA 3EVKA 1W59A 1VQMV 2ZM6B 4E4EA 3K5OA 2Q7GA 5CA3A 4ZHQA 4YY3O 4I50B 2BTQB 4HBNA 2A7WA 3FB5C 2OT5A 3ZMZA 3CE2A 4O4HB 2YXYA 5JWPA 4NTYA 4PA3A 3ZMTA 4PV1B 4LF8B 1SA0A 3IC9A 4JYAB 3WU2Z 1SQXH 3X2QB 3AK2A 1N34B 2UXBO 1WB8A 4MW3A 3CJHA 4GKJO 3NXSA 2VQFB 4TV9B 4PDVA 1D5AA 4JV5O 1OCRB 4B3SO 4MVSA 1KKDA 4I7ZB 4LC1A 2BOBC 4ZKIA 1NTMH 4JI4B 4ASUG 1ROPA 1HDJA 3ZMVA 1WP7A 3K9SA 3BA8A 5C8YB 1VQKV 2IJHA 1FPOA 1GO3F 4DK1A 4HNAA 1OCOC 1SETA 5KX5B 2NNUA 1RSOB 1V54B 3B2EE 3HR0A 3JASB 3JCZA 2HR3A 3QO7A 2IBZH 4I50A 2BTQA 5E79Z 5KA6A 1WNSA 1XMOO 1P7GA 1XQ8A 5KAFZ 3K06A 2QDOA 1IDSA 4O4HA 2ZT9B 2CE4A 2F4VB 1WB7A 2FMLA 4C7UA 3SGIA 4UFZA 3QO5A 2QM4A 3FKSG 4TV9A 5B1NA 2GHYA 4WFHA 4ZIBA 2YI8A 1AVMA 4J7KA 1P4RA 1Y74A 2NLJC 1QNMA 3B40A 4UCTA 2ADPA 3CRMA 2ZD9A 4DRXB 4DO2A 4GYCB 4RUFA 1QVFU 3H1HH 3KZIZ 4W4LA 3RYHB 4DV5B 1H8EG 4O4IB 4OPHA 3E83A 4DR1O 5C8YA 2ZINA 3UQ8A 2KQXA 1Z5VA 3HPLC 4RQEA 2QWRB 5EYPA 3HB3B 5KX5A 3T1HO 1RSOA 3ZHQA 3JASA 5KMGB 4FVMA 3FB6C 4LF9O 4R7CA 4YY3B 2HKOA 2O57A 3L70H 5GTIZ 4WF9V 5CBHA 2OTLV 5AG2A 2YXLA 2HFEC 3E89A 4B7EA 2XASA 4AQYO 5CA0A 5LA6B 4BIZA 2YI9A 2HVKC 2QM8A 5CN0A 2HJFC 2FTKA 4FIPC 4UCVA 3VQWA 3A8TA 4B3RO 1WAZA 3JD0A 1R3LC 1DGSA 2UXBB 1BGYH 4GKJB 3H1KH 2K1EA 5IYBO 4JV5B 4DUZO 3GVMA 1FJGO 3ZN1A 5BZBA 1ZTEA 4MVMA 3H1LH 3OAAG 4B3SB 2HJDA 3W7WA 4JI1O 5CBFA 4LH6A 3QO8A 4DRXA 2YSUB 1IBKO 2WWWA 4DR3O 4UVBA 2DYRC 4ABMA 3RYHA 4O4IA 3ZS8C 4MTOA 3SYOA 1KB9F 1AI4A 1F4NA 3JSLA 2LJ2A 3B09A 1KC8W 1S3JA 5HFMA 4DR4O 2QE7G 5LP6C 4L8JA 1XMOB 2WA3A 2VRZA 2IJJA 2CDYA 1B04A 4BIUA 3RYCB 1RP3B 2P7TC 1RPRA 4RWUA 2WLIB 3E8FA 4GX0A 5LA6A 1I08A 1HR0O 3TK1A 4ZBMA 1Q81W 3AG1B 2Z0AA 5BR8O 4FLXA 1LR1A 1OCZC 4JF3A 3JARB 1NTZH 1QR9A 2CTPA 1Q3EA 2DN9A 1XILA 1UFIA 5FL7G 2LW1A 3ETDA 2DQ0A 3K08A 1KBHA 1V55C 3D36C 3VOUA 2PY5A 2A0LA 2P67A 4DR1B 4OXSA 4JI7O 2XAJA 3A0RA 3T1HB 5EC2C 4TQFA 1SERA 4QE7A 4LF9B 3ICXA 3T2MA 3RBZA 4EKWA 3J81N 1GH6A 1MMMA 1AR5A 2RQ6A 3RYCA 3OMAB 4DW0A 3L75H 1GM7A 3FFQA 4AQYB 4YJ3B 2WLIA 3CCLV 3A0BZ 1Q43A 1EZJA 4YHHO 3CSXA 2IU0A 4DV7O 4B3RB 4H37A 4HYOA 2CTWA 4LNUB 1SQPH 4MVUA 3SPHA 1R73A 1SESA 3JARA 2W6IG 4DUZB 1FJGB 5IYZB 4U3FH 5JH7B 2EJ7A 3JD3A 4JI1B 4IL6Z 2NR5A 2Y0IA 1ZSPA 1IBKB 4Z1MG 4I4TB 1MA1A 4DR3B 1PM9A 3OEEG 1N32O 1LUWA 1GAXA 1GMGA 2E76B 2RDCA 1IBMB 1MZEA 3E86A 5L3FA 5B5EZ 4H13B 4K8XA 4DR4B 1WA8B 1L0NH 1XL6A 4CH3A 3OT7A 1VIBA 4YJ3A 2OWOA 1ZUQA 4EFEA 1W0KG 1NZ6A 4X1KB 1HR0B 2DYSC 3ZRWB 5F2VO 2WAMA 2XHBA 3BRCA 5EIBD 3JD4A 3K3WA 2L6LA 3CD6V 2DW4A 5BR8B 4LNUA 3MDSA 1QLEC 1JFFB 4NXMO 1M90W 2JJ2G 4QIWF 4DXWA 4FLUA 5IJ0B 1I0HA 4IIJB 5IYZA 2W0XA 5EIBC 5JH7A 3K9AA 1QBZA 5A2QN 2CK3G 1X59A 4JYYA 2WLLA 1JA8A 2UUCO 2QTOA 4I4TA 2ZE8A 4X89A 3UKMA 2UUBO 1H2MA 1SQQH 3SPJA 2QWNB 5D5QA 2EINC 4JI7B 3P30A 1J5EO 3JAWB 4DV2O 1NTKH 2CGNA 2Q73A 4JAAA 1WA8A 2NN4A 2Q7HA 1QVGU 2FYUH 2PUSA 1Y6XA 2QEXV 1M56B 2ZXWC 4PD4F 4DV6O 4MVRA 4WFEA 5B1OA 4FLVA 2RCVA 4O2AB 4X1KA 1N33O 4YHHB 3W7XA 1A32A 1PV0A 4JI5O 4P2ZA 4DV7B 1ZL8B 3UT5B 3OMNB 2ZM6O 2LO1A 4HAMA 5KHIA 3IGAC 1JFFA 4JTDB 1KMIZ 4DW1A 1PNLA 2N04A 4OX9O 3IAYA 1GN6A 5IJ0A 1K34A 3HKCB 1Z2GA 1W2BU 5H6RA 4IIJA 2ZKOA 2Q67A 1VQ5V 2P5OA 1B06A 4YJ2A 4X66O 4EB6B 5JJEB 3BHPA 3VQVA 5LXTB 4RQFA 2DWEC 3X2QC 4JYAO 2JK5C 2Q0OC 1FFXB 2XUMA 3ZHRA 1YITV 3OGCC 1N32B 1EBOA 3D36A 1OCRC 2QJ1A 3ZX6A 2DJVA 1AJPA 1COWG 1SQFA 5LYJB 4UVAA 3JAWA 2N05A 3MAQA 1SF9A 1PKXA 3NR7A 1FS0G 4O2BB 4TUYB 4J7JA 1AB3A 3U10A 3LUTB 1JX9A 2XT9A 3P32A 3ZIAG 1VQ7V 5BXZA 4O2AA 2Q8VA 3OR7C 2ZR3A 4CZZA 1V54C 2ADQB 4O4JB 5EBMC 1ZL8A 3UT5A 4NVPA 3P3PA 4JTCB 1X4TA 3ZHUA 3M99B 2UXNA 1SQVH 5H5NA 4NXMB 1GN4A 1GN3A 2GDSA 1WPXA 2ODMA 3HKCA 4OPAA 4P9PA 3B8MA 1K9MW 2XAGA 2A9HA 2KG7A 5FPOA 4X1IB 3H9VA 1MSWD 2OCCB 3AG4B 3QG5A 5FPRA 1M93A 1YZBA 4MVQA 3CRCA 5JJNB 2OTJV 4PI2A 2UUCB 1FFXA 4IT5A 3OE7G 4K3AA 4X9QA 1DF5A 2UUBB 3CX5F 5IE9A 4X64B 4WCEV 1BHBA 2YDEA 1J5EB 5LYJA 4PDMA 4DV2B 1E1QG 1YTFB 1F23A 2X6AA 2HVJC 4B7KA 2C2AA 4YXWG 2R9RB 2Q9LA 4TUYA 4O2BA 3WB1A 4FLWA 1XHXA 2UXCO 2WLMA 4DV6B 2KB1A 2M6YA 2YC0A 4LBEC 4LCUC 1IBLO 1N33B 3CCEV 4O4LB 3D8CA 4BAYA 4JI5B 4O4JA 4YIPA 3U11A 5LL6Y 1XL4A 2VWKA 4JI2O 2GV9A 3ASOB 1JCHA 2EIMB 1J95A 4OX9B 3S3WA 4LWSA 3HKBA 1RFYA 4X1IA 1VQ9V 4PA6A 2P90A 3TXQA 3FB7C 4X66B 5B1BB 4L87A 5KUKA 1VQ4V 1M4UA 3ABTA 3W7UA 4GX5A 4FZ1A 2RN9A 3ABLB 4JI8O 2FL4A 4BW9A 4G27B 1BE3H 1G8MA 3EFFK 4TOIA 3VQXA 5B1AB 2R70A 3FX7A 1TGOA 2IH3C 1OZ0A 2IJKA 3K5MA 2R9AA 3IJ4A 4JAVA 5CA1B 4UCSA 2DE0X 1GRJA 4XDLA 3TJTA 1HWYA 2F66C 4O4LA 4JYCA 3ML0A 1XEQA 1YHQV 1Q82W 2V1DA 3N27A 4Q20A 1GK9A 4CC5A 2AZ0A 2MW2B 3F5WC 2QGNA 4CS3A 4A5UB 3UO2A 1IURA 1FYJA 2BSKB 4RO2A 4DR5O 3ABMB 1MOFA 1SS3A 3CCRV 3AG1C 4DR2O 3RT3C 4JZGA 4ZOLB 3SYQA 3DC5A 4WBNB 2WLKA 5B66Z 3PJSK 3STZC 2R72A 4F4LA 5EK0A 4QPKA 1VQLV 2EILB 1KP2A 3QTCA 3OTOO 2P06A 1TA8A 3LSUA 2PYLA 2XNDG 1SC5B 4I5SA 3RGBA 1R6TA 4J7ZA 2UXCB 3PN1A 3P3NA 1JJ2U 2ZCEA 1IBLB 4LH7A 3F7VC 4X65O 4J41A 5GONB 1XUQA 3AK1A 5K1XA 4JI2B 5EZYB 4UCUA 1BQZA 3Q4HB 4R6ZA 1FXHA 1E79G 5KHHA 4JASA 1FXVA 1XI1A 1LNQA 4WBNA 4CBCA 1PL4A 3BABA 3GB7C 3J80N 4JI8B 2XAQA 2ZR2A 3L9DA 3CXHF 2V4DA 1EZVH 3E8GA 1H2SB 3G80A 1S77D 1NI8A 3OR6C 1YVWA 3ZN0A 4R50A 1S5HC 4GX1A 1BSMA 1BT8A 2E75B 1K73W 4NR1A 1IXBA 5J9PC 4G28B 1K8AW 4W4KA 1EN4A 1YSCA 1IBMO 1JR9A 1WN7A 5GONA 1NVPB 5KMGA 3G4SV 4U7OA 5EZYA 5LGNA 3CB2A 4DV1O 3L74H 4G2KA 1XNRO 3Q4HA 1SRYA 2RJZA 3SJCC 2QR4A 2H3OA 4DR5B 1K4CC 1Q6UA 3CC2V 1GKFA 4Q6GA 4DR2B 4FM2A 3CMAV 1FD9A 2YIAA 1K4DC 2UUAO 4IHJB 4ZI7B 5DECA 1XOUA 2F43G 2VQEO 3AEIA 3L72H 1MABG 1S0VA 3OTOB 1JPXA 2OIGA 1R3IC 4MVZA 2IM9A 3JYCA 5LMNO 1NKDA 4KP4A 3TGUH 4MTGA 3ZRXA 1Q5OA 2X7RB 3B8NA 4X1YB 4FM0A 1N4CA 1F4MA 4X65B 3SJBC 2AHYA 1JJOA 2ZIMA 4EFBA 3I55V 1M56C 4NTXA 3CPWU 1IX9A 3KCXA 3JSNA 1N0JA 2LW7A 3K57A 1YI2V 2MK3A 2JIZG 1KUQA 3OM3B 1H2KA 2KKWA 3AG2B 1YIJV 2UXXA 2EJRA 1K7DA 5J2TB 3AG7A 3S3XA 4MTFA 4FLTA 3K0GA 3CRAA 3CXCU 1XMQO 2B5UA 5IY5B 1PL0A 2F23A 1AJNA 3D3QA 3CHXA 4FZ0A 4JI3O 4AI8A 1DF4A 2BCCH 5BY1A 1XBLA 4CS2A 2ZE6A 4TQDA 2E74B 2CTQA 1YDXA 3H01A 4X1YA 3CCMV 4BR6A 1Q8IA 3OFNG 1NU1H 1G6UA 1MSDA 4B3TO 1KD1W 4D6TH 1QHTA 1QU7A 4GZRB 4WFAV 4DV1B 5KUMA 3H1JH 2XOKG 3BA9A 1L1FA 1XNRB 2PZSA 3ZHTA 4JI6O 1NH2B 1N0NA 2GTAA 1AR1B 3J7AU 3QNEA 4TWKA 2UXDO 2HHHO 1VQ6V 3R65A 2GTSA 3OTFA 5B3SB 2UUAB 3JALB 3N2GB 3HKEB 3VBBA 3APQA 2VQEB 1FKAO 2QSAA 4X88A 4F6EA 2OCCC 4PELA 4CH5A 2LGWA 2Q4PA 3AG4C 4IYIA 2P4KA 3FYEB 2D3OW 1YTFD 4LP8A 4MVOA 3RYFB 4LFAO 4UXNA 2VS0A 1NS1A 4J80A 1N36O 5LMNB 2ITCC 2JRIA 2RNBA 5L3DA 3ZRSA 4DK0A 2JS5A 3F7YC 4X64O 5E1AC 5ITZB 3KG2A 1R1BA 2ZQMA 1BZKA 4X8AA 3R66A 4P30A 5L3CA 3QF7A 2QWOB 2BE3A 3JCUZ 1Q7YW 3WB2A 3OUSA 4XBFA 3K5LA 3ZRWA 1R6KA 2GUZB 3ASOC 3JALA 5EBLC 3E35A 3N2GA 1IXMA 3HKEA 1XREA 3JAKB 1YJWV 3ASNB 2EIMC 2ZE7A 2DMXA 2FKXA 4J9YB 3H1IH 1ZWIC 4K8ZA 3CCQV 1JMKC 1US6A 1XMQB 5B1BC 3E22B 1R6NA 3ZJZA 5FNVB 2ETNA 2WLHA 4OGQB 1EN5A 1VF7A 2K9PA 3RVYA 3ABLC 4JI3B 2Q7EA 1G1XB 4PI0A 2QKAA 4F6RB 2IJIA 5ITZA 2ATKC 3ABKB 2CH7B 3TCUA 5B1AC 1R3JC 3ETGA 4I9QA 4B3TB 1VQOV 1VQ8V 4UUJC 1MNGA 1KYOF 3DTUB 4KXRA 3SPGA 3SJQC 1JOYA 4DV3O 4JI6B 2AHZA 4CC6A 1BHAA 2PTMA 2UXDB 2HHHB 1Z5WA 2GUZA 4J42A 1S76D 4LF5O 4YIOA 2KSDA 1PNKA 5JCOA 3JAKA 3LNMB 3EHBB 1OCCB 3BEHA 3K04A 5IWAO 5LHHA 4R8CA 4MT8A 1OHHG 5CMUA 2D2CB 1AROP 5KLVH 1EM1A 1P84F 4CS4A 3E22A 4FMTA 3ABMC 1WP8A 4EB6A 5LXTA 3E2EA 4Z2WA 4LFAB 3F5TA 1N36B 3G71V 2Y69B 1KU9A 2EILC 3ABUA 4DYLA 3TETA 1RPOA 3G6BA 4UVCA 3RWRD 3LDEA 3GWKC 3OW2U 5DEDA 2E5LO 3K58A 4DUYO 1YEWA 2Q5ZA 3CCVV 4J10A 1KKCA 3ZMSA 2DWDC 1W0JG 3FAVB 2GBOA 4DR7O 2CUGA 2QKSA 3AK3A 4TT3G 3OMIB 1PNMA 2DOSA 2ZNJA 5LGTA 1RM1B 2EX3A 2X6BA 4NKGB 4HNAB 4MS2A 1SZXA 2PI5A 4X62O 2QWPB 4MW8A 2JEXA 2CAZC 2P22C 3A2FA 1AILA 2Q0AA 2QKCA 5L3EA 3WB0A 3SYPA 4UV9A 2OYQA 1NVPD 5JJJB 2JEUA 3WG7B 3QVNA 1BQ0A 1YXBA 3ZHVA 4XDJA 5A9GA 3AG3B 4DV3B 1EFRG 3E8HA 1ZAUA 4H33A 4U3JB 1L0LH 3K0DA 1AP6A 5KHGA 2H94A 2YIDA 1V9PA 3ETQA 1Y74B 3LNNA 5LOVB 5IYDO 1BS3A 3B4SA 4LF5B 3RVZA 4WFGA 3FAVA 2EZOA 3T1CA 5KHKA 2ZDIC 3B77A 2Q68A 1ENVA 5IWAB 1FXKB 3BCCH 4GT1A 1Y67A 1GN2A 1DK1A 1FFTB 4RAIA 2JVDA 3U0ZA 2YUAA 5BMVB 2IU3A 1H2GA 1M9NA 5EYPB 1WLEA 1IVSA 4LF4B 1VF5B 3SJAC 4X20B 1M1KW 4BIOA 1K5QA 3OUFA 4PDLA 3CC7V 3I56V 4LFBO 3BFRA 3UCSC 4Z1VA 5GW7A 4WFBV 1YF2A 4LR3A 1WPBA 5TISZ 1TUBB 1VMGA 5IJ9B 5CA0B 2YIBA 2M7WA 5DN6G 3DXRB 3K59A 3T1YO 3C3SA 3CS5A 1M57B 1KP3A 2EIKB 3N2KB 1DLBA 4FM1A 3VQYA 1I94O 1VF6A 2E5LB 4DR6O 3SYAA 4DUYB 5CA1A 4U3JA 4FLZA 5LHIA 2WPDG 2OCHA 2JGUA 5LOVA 2BTOA 3JATB 4DR7B 2R9IA 1S5JA 3THOA 1TAEA 4LF7O 4DV0B 1FXKA 2HG5C 2EIJB 3ZHSA 5KHJA 1ORQC 3MHHC 4BWAA 2BSKA 5BMVA 1I5YA 3AG2C 2FB5A 1QQCA 2Y48A 2B9ZA 1NR7A 4FFBB 2IW5A 4ZOLA 1U96A 4X62B 4X20A 3APOA 5H6QA 1NBMG 1Y4MA 2PGGA 4PDRA 4I0XB 4KL1A 4KUMA 3HKDB 1TUBA 5IY5C 3ZEDA 2B1GA 1VP7A 4HZ3A 4BW5A 5IJ9A 3OD4A 1HNWO 1QR8A 2N74A 3ETEA 3DXRA 3FYIB 3LSSA 3N2KA 5KAIZ 5LMUO 4GLXA 2ITDC 1JVMA 1NH2D 3JAMN 3SPCA 5CBGA 4MSWC 1HNZO 1I7FA 2GSMB 1UPGA 4JGSA 4GKKO 3JATA 1QCEA 2P4VA 1HNXO 2ILMA 4EEQA 3CCSV 4FFKA 5D5PA 3L73H 2LFSA 1VEWA 2DQ3A 2BOCC 3FD9A 3K5NA 1UJWB 1TVKB 5B3SC 3CRQA 1AJQA 4FFBA 3CMEV 4UV8A 2RMKB 3CCJV 1OCOB 1GM9A 2CTRA 4JPRA 3RN4A 1D2DA 4LFBB 2YEVB 3E8BA 3BY6A 2H8PC 3MHSC 4I0XA 3T4DA 1THZA 1B3QA 3HKDA 4D7SA 1Q6IA 2Q69A 4J11A 5LBQA 2Z5UA 2X0LA 5GTHZ 3ZRVA 1FAFA 3C3TA 3T1YB 5H9CA 4TSFG 3W7TA 4GX2A 5DM6V 3G6EV 1MG1A 1GM8A 3CP1A 3UO3A 1SZTA 3CYOA 1K97A 4FK5C 1I94B 4N21A 4DV4O 2YICA 1T5EA 4DR6B 3SR2C 4K0KO 3L71H 2AGAA 2JDIG 1VQPV 5J2UB 1IZ3A 5C93A 3SYCA 1TUEB 2QTSA 4LF7B 2LFRA 2ZDIA 2XAFA 1Q86W 4JAUA 1OJHA 4UB8Z 2B1IA 5IYCO 1H2NA 1L8DA 3CEIA 4KFMA 1SKVA 2E3CA 1AI6A 1TVKA 3D3IA 3K79A 5JCOC 1H8HG 3ASNC 4IHJA 4ZI7A 2EBOA 2LP7A 5HFLA 2YEVA 1Y76B 2G38A 1P7BA 1NR1A 4QNHB 1S72V 1CP9A 3O65A 1HNWB 4AILC 1VQNV 3IFXA 1AP5A 2AZ2A 5L3GA 1ZX3A 3O9OA 3ZBHA 2PI4A 3M7MX 1F51A 2XTAA 5LMUB 3OEHG 1NT2B 1I5XA 3ABKC 2JJ1G 1O9GA 1HNZB 1Q6HA 4KHPO 1XNQO 4H44B 5J2UA 4GKKB 4FLYA 1HNXB 1H38A 3BAAA 2VWJA 4JI0O 3M8AA 4JYBA 2WLLB 2JGDB 3T4ZA 1LUVA 4PA9A 4B3MO 1M5IA 2WA4A 3IC7A 1GTOA 2DYRB 2UU9O 2YS8A 1PP9H 1BCCH 1O9HA 4QGPA 1OCCC 3DGEA 5J2TA 2F93B 4UB6Z 4H0LB 4NYKA 1HP8A 4NB5A 2X6CA 4B08A 1SQGA 5LP6B 1S5LZ 1Y76A 1P49A 5JVDB 4K35A 5IT9N 3UM7A 1Q90D 4PA7A 1XDCA 2LGQA 3SPIA 2Y69C 4DV4B 4LFCO 4QJFB 1AI7A 2EULA 3STLC 4K0KB 2P6JA 4NXNO 1OCZB 2JS3A 4I55B 4N23A 4YJ2B 1HW7A 1AR4A 2HLDG 4I9WA 3EXAA 2ZIOA 1QLNA 3CCUV 3SDLA 2JGDA 4LF6O 3OGIB 1D5NA 4AHCA 2F1MA 1V55B 4JZ2A 5KA5A 4PJ0Z 1KECA 1MZFA 4JTAB 2CGOA 1OV9A 3DC6A 5LP6A 2LQTA 3K03A 2IH1C 3W7SA 5LGUA 4IGGA 1CPYA 3LDDA 4PHZA 3C90A 4MTXA 5JVDA 1RM1C 2EZPA 3CC4V 2YIBD 1E1RG 3BPZA 4P9OA 1NQTA 2A79B 4WFFA 2ARHA 3RYFA 1EN6A 4QE9A 1ZLZA 4ICGA 4UCOA 1WJZA 3FB8C 1R3KC 2QA4V 2PYJA 2KG7B 4PA4A 4KHPB 4I55A 1XNQB 4LF8O 3RFRA 3WG7C 4QPJA 2HP8A 1G4YB 3TXSA 4JI0B 1PPJH 1VF6C 3AG3C 1BMFG 2OIEA 5IDJA 1N34O 3JD1A 1F7YA 2QWQB 4GUNA 1YCIA 4B3MB 3GWOA 3RYIB 2VQFO 2UU9B 3KCYA 1H2LA 3BVOA 5EBWC 2QM7A 1BL8A 5JQGB 3DSQA 4TV8B 3LDCA 5L3BA 2HEPA 1K92A 1FXKC 4U7NA 4E2LA 4JI4O 5CB4B 5LHGA 1YJ9V 1SQBH 4CH6A 1N8RW 2Y0PA 4FJCC 5FNVA 1CEZA 2Q6AA 5H2FZ 1K33A 4D7TA 4RUEA 3CWBH
chains in the Genus database with same CATH topology
1BQZA 1GH6A 2GUZA 4J80A 2Y4UA 3UO3A 2L6LA 2CTRA 4IT5A 2N05A 2PF4E 4J7ZA 2M6YA 2EJ7A 3UCSC 2KQXA 2Y4TA 1BQ0A 1N4CA 2QWNB 3APQA 2QWRB 2CTPA 2GUZB 2OCHA 2QSAA 2QWPB 1XBLA 3UO2A 1HDJA 2LGWA 2DN9A 3APOA 1IURA 2CTWA 2LO1A 4RWUA 2QWQB 2CTQA 1WJZA 3AG7A 2YUAA 2CUGA 1FAFA 1NZ6A 2YS8A 1FPOA 3BVOA 2QWOB 2DMXA 2N04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQZ A;  1GH6 A;  2GUZ A;  4J80 A;  2Y4U A;  3UO3 A;  2L6L A;  2CTR A;  4IT5 A;  2N05 A;  2PF4 E;  4J7Z A;  2M6Y A;  2EJ7 A;  3UCS C;  2KQX A;  2Y4T A;  1BQ0 A;  1N4C A;  2QWN B;  3APQ A;  2QWR B;  2CTP A;  2GUZ B;  2OCH A;  2QSA A;  2QWP B;  1XBL A;  3UO2 A;  1HDJ A;  2LGW A;  2DN9 A;  3APO A;  1IUR A;  2CTW A;  2LO1 A;  4RWU A;  2QWQ B;  2CTQ A;  1WJZ A;  3AG7 A;  2YUA A;  2CUG A;  1FAF A;  1NZ6 A;  2YS8 A;  1FPO A;  3BVO A;  2QWO B;  2DMX A;  2N04 A; 
#chains in the Genus database with same CATH topology
 1XHZ A;  2A06 H;  5FLX N;  2DYS B;  2WLN A;  2WLJ A;  4LF4 O;  5K1P A;  1PD3 A;  4J9Z B;  4ZHQ B;  1AI5 A;  4LFC B;  4F6R A;  4FPP A;  3I5D A;  4LWS B;  3HKB B;  4GCZ A;  1QLE B;  1KQS U;  4NXN B;  3ZCC A;  3MD0 A;  3RW0 A;  2AXT Z;  2WSS G;  1JQ0 A;  2CH7 A;  1YJN V;  3JD2 A;  1M57 C;  2F4V O;  1SA0 B;  2EIK C;  2W6J G;  2W0F C;  3A0H Z;  4UCR A;  1K3E A;  1DTO A;  2YXH A;  2XAH A;  1VAR A;  2Y4U A;  3WFV A;  2F95 B;  4IYH A;  1B6Q A;  4XDK A;  4LF6 B;  2Z3Y A;  2PF4 E;  3CJH B;  1URF A;  5EC1 C;  3RYI A;  2ZNI A;  1K5S A;  4CH4 A;  2ZE5 A;  2L35 A;  2AW9 A;  5JQG A;  2EIN B;  4TV8 A;  2V7Q G;  3LSQ A;  1CXZ B;  3CRR A;  2A3Q A;  4DV0 O;  5CB4 A;  2EIJ C;  3ZMU A;  4DV5 O;  3G67 A;  3KKY A;  2ZXW B;  1U97 A;  1Y66 A;  2Y4T A;  1NJI W;  4NTW A;  3EVK A;  1W59 A;  1VQM V;  2ZM6 B;  4E4E A;  3K5O A;  2Q7G A;  5CA3 A;  4ZHQ A;  4YY3 O;  4I50 B;  2BTQ B;  4HBN A;  2A7W A;  3FB5 C;  2OT5 A;  3ZMZ A;  3CE2 A;  4O4H B;  2YXY A;  5JWP A;  4NTY A;  4PA3 A;  3ZMT A;  4PV1 B;  4LF8 B;  1SA0 A;  3IC9 A;  4JYA B;  3WU2 Z;  1SQX H;  3X2Q B;  3AK2 A;  1N34 B;  2UXB O;  1WB8 A;  4MW3 A;  3CJH A;  4GKJ O;  3NXS A;  2VQF B;  4TV9 B;  4PDV A;  1D5A A;  4JV5 O;  1OCR B;  4B3S O;  4MVS A;  1KKD A;  4I7Z B;  4LC1 A;  2BOB C;  4ZKI A;  1NTM H;  4JI4 B;  4ASU G;  1ROP A;  1HDJ A;  3ZMV A;  1WP7 A;  3K9S A;  3BA8 A;  5C8Y B;  1VQK V;  2IJH A;  1FPO A;  1GO3 F;  4DK1 A;  4HNA A;  1OCO C;  1SET A;  5KX5 B;  2NNU A;  1RSO B;  1V54 B;  3B2E E;  3HR0 A;  3JAS B;  3JCZ A;  2HR3 A;  3QO7 A;  2IBZ H;  4I50 A;  2BTQ A;  5E79 Z;  5KA6 A;  1WNS A;  1XMO O;  1P7G A;  1XQ8 A;  5KAF Z;  3K06 A;  2QDO A;  1IDS A;  4O4H A;  2ZT9 B;  2CE4 A;  2F4V B;  1WB7 A;  2FML A;  4C7U A;  3SGI A;  4UFZ A;  3QO5 A;  2QM4 A;  3FKS G;  4TV9 A;  5B1N A;  2GHY A;  4WFH A;  4ZIB A;  2YI8 A;  1AVM A;  4J7K A;  1P4R A;  1Y74 A;  2NLJ C;  1QNM A;  3B40 A;  4UCT A;  2ADP A;  3CRM A;  2ZD9 A;  4DRX B;  4DO2 A;  4GYC B;  4RUF A;  1QVF U;  3H1H H;  3KZI Z;  4W4L A;  3RYH B;  4DV5 B;  1H8E G;  4O4I B;  4OPH A;  3E83 A;  4DR1 O;  5C8Y A;  2ZIN A;  3UQ8 A;  2KQX A;  1Z5V A;  3HPL C;  4RQE A;  2QWR B;  5EYP A;  3HB3 B;  5KX5 A;  3T1H O;  1RSO A;  3ZHQ A;  3JAS A;  5KMG B;  4FVM A;  3FB6 C;  4LF9 O;  4R7C A;  4YY3 B;  2HKO A;  2O57 A;  3L70 H;  5GTI Z;  4WF9 V;  5CBH A;  2OTL V;  5AG2 A;  2YXL A;  2HFE C;  3E89 A;  4B7E A;  2XAS A;  4AQY O;  5CA0 A;  5LA6 B;  4BIZ A;  2YI9 A;  2HVK C;  2QM8 A;  5CN0 A;  2HJF C;  2FTK A;  4FIP C;  4UCV A;  3VQW A;  3A8T A;  4B3R O;  1WAZ A;  3JD0 A;  1R3L C;  1DGS A;  2UXB B;  1BGY H;  4GKJ B;  3H1K H;  2K1E A;  5IYB O;  4JV5 B;  4DUZ O;  3GVM A;  1FJG O;  3ZN1 A;  5BZB A;  1ZTE A;  4MVM A;  3H1L H;  3OAA G;  4B3S B;  2HJD A;  3W7W A;  4JI1 O;  5CBF A;  4LH6 A;  3QO8 A;  4DRX A;  2YSU B;  1IBK O;  2WWW A;  4DR3 O;  4UVB A;  2DYR C;  4ABM A;  3RYH A;  4O4I A;  3ZS8 C;  4MTO A;  3SYO A;  1KB9 F;  1AI4 A;  1F4N A;  3JSL A;  2LJ2 A;  3B09 A;  1KC8 W;  1S3J A;  5HFM A;  4DR4 O;  2QE7 G;  5LP6 C;  4L8J A;  1XMO B;  2WA3 A;  2VRZ A;  2IJJ A;  2CDY A;  1B04 A;  4BIU A;  3RYC B;  1RP3 B;  2P7T C;  1RPR A;  4RWU A;  2WLI B;  3E8F A;  4GX0 A;  5LA6 A;  1I08 A;  1HR0 O;  3TK1 A;  4ZBM A;  1Q81 W;  3AG1 B;  2Z0A A;  5BR8 O;  4FLX A;  1LR1 A;  1OCZ C;  4JF3 A;  3JAR B;  1NTZ H;  1QR9 A;  2CTP A;  1Q3E A;  2DN9 A;  1XIL A;  1UFI A;  5FL7 G;  2LW1 A;  3ETD A;  2DQ0 A;  3K08 A;  1KBH A;  1V55 C;  3D36 C;  3VOU A;  2PY5 A;  2A0L A;  2P67 A;  4DR1 B;  4OXS A;  4JI7 O;  2XAJ A;  3A0R A;  3T1H B;  5EC2 C;  4TQF A;  1SER A;  4QE7 A;  4LF9 B;  3ICX A;  3T2M A;  3RBZ A;  4EKW A;  3J81 N;  1GH6 A;  1MMM A;  1AR5 A;  2RQ6 A;  3RYC A;  3OMA B;  4DW0 A;  3L75 H;  1GM7 A;  3FFQ A;  4AQY B;  4YJ3 B;  2WLI A;  3CCL V;  3A0B Z;  1Q43 A;  1EZJ A;  4YHH O;  3CSX A;  2IU0 A;  4DV7 O;  4B3R B;  4H37 A;  4HYO A;  2CTW A;  4LNU B;  1SQP H;  4MVU A;  3SPH A;  1R73 A;  1SES A;  3JAR A;  2W6I G;  4DUZ B;  1FJG B;  5IYZ B;  4U3F H;  5JH7 B;  2EJ7 A;  3JD3 A;  4JI1 B;  4IL6 Z;  2NR5 A;  2Y0I A;  1ZSP A;  1IBK B;  4Z1M G;  4I4T B;  1MA1 A;  4DR3 B;  1PM9 A;  3OEE G;  1N32 O;  1LUW A;  1GAX A;  1GMG A;  2E76 B;  2RDC A;  1IBM B;  1MZE A;  3E86 A;  5L3F A;  5B5E Z;  4H13 B;  4K8X A;  4DR4 B;  1WA8 B;  1L0N H;  1XL6 A;  4CH3 A;  3OT7 A;  1VIB A;  4YJ3 A;  2OWO A;  1ZUQ A;  4EFE A;  1W0K G;  1NZ6 A;  4X1K B;  1HR0 B;  2DYS C;  3ZRW B;  5F2V O;  2WAM A;  2XHB A;  3BRC A;  5EIB D;  3JD4 A;  3K3W A;  2L6L A;  3CD6 V;  2DW4 A;  5BR8 B;  4LNU A;  3MDS A;  1QLE C;  1JFF B;  4NXM O;  1M90 W;  2JJ2 G;  4QIW F;  4DXW A;  4FLU A;  5IJ0 B;  1I0H A;  4IIJ B;  5IYZ A;  2W0X A;  5EIB C;  5JH7 A;  3K9A A;  1QBZ A;  5A2Q N;  2CK3 G;  1X59 A;  4JYY A;  2WLL A;  1JA8 A;  2UUC O;  2QTO A;  4I4T A;  2ZE8 A;  4X89 A;  3UKM A;  2UUB O;  1H2M A;  1SQQ H;  3SPJ A;  2QWN B;  5D5Q A;  2EIN C;  4JI7 B;  3P30 A;  1J5E O;  3JAW B;  4DV2 O;  1NTK H;  2CGN A;  2Q73 A;  4JAA A;  1WA8 A;  2NN4 A;  2Q7H A;  1QVG U;  2FYU H;  2PUS A;  1Y6X A;  2QEX V;  1M56 B;  2ZXW C;  4PD4 F;  4DV6 O;  4MVR A;  4WFE A;  5B1O A;  4FLV A;  2RCV A;  4O2A B;  4X1K A;  1N33 O;  4YHH B;  3W7X A;  1A32 A;  1PV0 A;  4JI5 O;  4P2Z A;  4DV7 B;  1ZL8 B;  3UT5 B;  3OMN B;  2ZM6 O;  2LO1 A;  4HAM A;  5KHI A;  3IGA C;  1JFF A;  4JTD B;  1KMI Z;  4DW1 A;  1PNL A;  2N04 A;  4OX9 O;  3IAY A;  1GN6 A;  5IJ0 A;  1K34 A;  3HKC B;  1Z2G A;  1W2B U;  5H6R A;  4IIJ A;  2ZKO A;  2Q67 A;  1VQ5 V;  2P5O A;  1B06 A;  4YJ2 A;  4X66 O;  4EB6 B;  5JJE B;  3BHP A;  3VQV A;  5LXT B;  4RQF A;  2DWE C;  3X2Q C;  4JYA O;  2JK5 C;  2Q0O C;  1FFX B;  2XUM A;  3ZHR A;  1YIT V;  3OGC C;  1N32 B;  1EBO A;  3D36 A;  1OCR C;  2QJ1 A;  3ZX6 A;  2DJV A;  1AJP A;  1COW G;  1SQF A;  5LYJ B;  4UVA A;  3JAW A;  2N05 A;  3MAQ A;  1SF9 A;  1PKX A;  3NR7 A;  1FS0 G;  4O2B B;  4TUY B;  4J7J A;  1AB3 A;  3U10 A;  3LUT B;  1JX9 A;  2XT9 A;  3P32 A;  3ZIA G;  1VQ7 V;  5BXZ A;  4O2A A;  2Q8V A;  3OR7 C;  2ZR3 A;  4CZZ A;  1V54 C;  2ADQ B;  4O4J B;  5EBM C;  1ZL8 A;  3UT5 A;  4NVP A;  3P3P A;  4JTC B;  1X4T A;  3ZHU A;  3M99 B;  2UXN A;  1SQV H;  5H5N A;  4NXM B;  1GN4 A;  1GN3 A;  2GDS A;  1WPX A;  2ODM A;  3HKC A;  4OPA A;  4P9P A;  3B8M A;  1K9M W;  2XAG A;  2A9H A;  2KG7 A;  5FPO A;  4X1I B;  3H9V A;  1MSW D;  2OCC B;  3AG4 B;  3QG5 A;  5FPR A;  1M93 A;  1YZB A;  4MVQ A;  3CRC A;  5JJN B;  2OTJ V;  4PI2 A;  2UUC B;  1FFX A;  4IT5 A;  3OE7 G;  4K3A A;  4X9Q A;  1DF5 A;  2UUB B;  3CX5 F;  5IE9 A;  4X64 B;  4WCE V;  1BHB A;  2YDE A;  1J5E B;  5LYJ A;  4PDM A;  4DV2 B;  1E1Q G;  1YTF B;  1F23 A;  2X6A A;  2HVJ C;  4B7K A;  2C2A A;  4YXW G;  2R9R B;  2Q9L A;  4TUY A;  4O2B A;  3WB1 A;  4FLW A;  1XHX A;  2UXC O;  2WLM A;  4DV6 B;  2KB1 A;  2M6Y A;  2YC0 A;  4LBE C;  4LCU C;  1IBL O;  1N33 B;  3CCE V;  4O4L B;  3D8C A;  4BAY A;  4JI5 B;  4O4J A;  4YIP A;  3U11 A;  5LL6 Y;  1XL4 A;  2VWK A;  4JI2 O;  2GV9 A;  3ASO B;  1JCH A;  2EIM B;  1J95 A;  4OX9 B;  3S3W A;  4LWS A;  3HKB A;  1RFY A;  4X1I A;  1VQ9 V;  4PA6 A;  2P90 A;  3TXQ A;  3FB7 C;  4X66 B;  5B1B B;  4L87 A;  5KUK A;  1VQ4 V;  1M4U A;  3ABT A;  3W7U A;  4GX5 A;  4FZ1 A;  2RN9 A;  3ABL B;  4JI8 O;  2FL4 A;  4BW9 A;  4G27 B;  1BE3 H;  1G8M A;  3EFF K;  4TOI A;  3VQX A;  5B1A B;  2R70 A;  3FX7 A;  1TGO A;  2IH3 C;  1OZ0 A;  2IJK A;  3K5M A;  2R9A A;  3IJ4 A;  4JAV A;  5CA1 B;  4UCS A;  2DE0 X;  1GRJ A;  4XDL A;  3TJT A;  1HWY A;  2F66 C;  4O4L A;  4JYC A;  3ML0 A;  1XEQ A;  1YHQ V;  1Q82 W;  2V1D A;  3N27 A;  4Q20 A;  1GK9 A;  4CC5 A;  2AZ0 A;  2MW2 B;  3F5W C;  2QGN A;  4CS3 A;  4A5U B;  3UO2 A;  1IUR A;  1FYJ A;  2BSK B;  4RO2 A;  4DR5 O;  3ABM B;  1MOF A;  1SS3 A;  3CCR V;  3AG1 C;  4DR2 O;  3RT3 C;  4JZG A;  4ZOL B;  3SYQ A;  3DC5 A;  4WBN B;  2WLK A;  5B66 Z;  3PJS K;  3STZ C;  2R72 A;  4F4L A;  5EK0 A;  4QPK A;  1VQL V;  2EIL B;  1KP2 A;  3QTC A;  3OTO O;  2P06 A;  1TA8 A;  3LSU A;  2PYL A;  2XND G;  1SC5 B;  4I5S A;  3RGB A;  1R6T A;  4J7Z A;  2UXC B;  3PN1 A;  3P3N A;  1JJ2 U;  2ZCE A;  1IBL B;  4LH7 A;  3F7V C;  4X65 O;  4J41 A;  5GON B;  1XUQ A;  3AK1 A;  5K1X A;  4JI2 B;  5EZY B;  4UCU A;  1BQZ A;  3Q4H B;  4R6Z A;  1FXH A;  1E79 G;  5KHH A;  4JAS A;  1FXV A;  1XI1 A;  1LNQ A;  4WBN A;  4CBC A;  1PL4 A;  3BAB A;  3GB7 C;  3J80 N;  4JI8 B;  2XAQ A;  2ZR2 A;  3L9D A;  3CXH F;  2V4D A;  1EZV H;  3E8G A;  1H2S B;  3G80 A;  1S77 D;  1NI8 A;  3OR6 C;  1YVW A;  3ZN0 A;  4R50 A;  1S5H C;  4GX1 A;  1BSM A;  1BT8 A;  2E75 B;  1K73 W;  4NR1 A;  1IXB A;  5J9P C;  4G28 B;  1K8A W;  4W4K A;  1EN4 A;  1YSC A;  1IBM O;  1JR9 A;  1WN7 A;  5GON A;  1NVP B;  5KMG A;  3G4S V;  4U7O A;  5EZY A;  5LGN A;  3CB2 A;  4DV1 O;  3L74 H;  4G2K A;  1XNR O;  3Q4H A;  1SRY A;  2RJZ A;  3SJC C;  2QR4 A;  2H3O A;  4DR5 B;  1K4C C;  1Q6U A;  3CC2 V;  1GKF A;  4Q6G A;  4DR2 B;  4FM2 A;  3CMA V;  1FD9 A;  2YIA A;  1K4D C;  2UUA O;  4IHJ B;  4ZI7 B;  5DEC A;  1XOU A;  2F43 G;  2VQE O;  3AEI A;  3L72 H;  1MAB G;  1S0V A;  3OTO B;  1JPX A;  2OIG A;  1R3I C;  4MVZ A;  2IM9 A;  3JYC A;  5LMN O;  1NKD A;  4KP4 A;  3TGU H;  4MTG A;  3ZRX A;  1Q5O A;  2X7R B;  3B8N A;  4X1Y B;  4FM0 A;  1N4C A;  1F4M A;  4X65 B;  3SJB C;  2AHY A;  1JJO A;  2ZIM A;  4EFB A;  3I55 V;  1M56 C;  4NTX A;  3CPW U;  1IX9 A;  3KCX A;  3JSN A;  1N0J A;  2LW7 A;  3K57 A;  1YI2 V;  2MK3 A;  2JIZ G;  1KUQ A;  3OM3 B;  1H2K A;  2KKW A;  3AG2 B;  1YIJ V;  2UXX A;  2EJR A;  1K7D A;  5J2T B;  3AG7 A;  3S3X A;  4MTF A;  4FLT A;  3K0G A;  3CRA A;  3CXC U;  1XMQ O;  2B5U A;  5IY5 B;  1PL0 A;  2F23 A;  1AJN A;  3D3Q A;  3CHX A;  4FZ0 A;  4JI3 O;  4AI8 A;  1DF4 A;  2BCC H;  5BY1 A;  1XBL A;  4CS2 A;  2ZE6 A;  4TQD A;  2E74 B;  2CTQ A;  1YDX A;  3H01 A;  4X1Y A;  3CCM V;  4BR6 A;  1Q8I A;  3OFN G;  1NU1 H;  1G6U A;  1MSD A;  4B3T O;  1KD1 W;  4D6T H;  1QHT A;  1QU7 A;  4GZR B;  4WFA V;  4DV1 B;  5KUM A;  3H1J H;  2XOK G;  3BA9 A;  1L1F A;  1XNR B;  2PZS A;  3ZHT A;  4JI6 O;  1NH2 B;  1N0N A;  2GTA A;  1AR1 B;  3J7A U;  3QNE A;  4TWK A;  2UXD O;  2HHH O;  1VQ6 V;  3R65 A;  2GTS A;  3OTF A;  5B3S B;  2UUA B;  3JAL B;  3N2G B;  3HKE B;  3VBB A;  3APQ A;  2VQE B;  1FKA O;  2QSA A;  4X88 A;  4F6E A;  2OCC C;  4PEL A;  4CH5 A;  2LGW A;  2Q4P A;  3AG4 C;  4IYI A;  2P4K A;  3FYE B;  2D3O W;  1YTF D;  4LP8 A;  4MVO A;  3RYF B;  4LFA O;  4UXN A;  2VS0 A;  1NS1 A;  4J80 A;  1N36 O;  5LMN B;  2ITC C;  2JRI A;  2RNB A;  5L3D A;  3ZRS A;  4DK0 A;  2JS5 A;  3F7Y C;  4X64 O;  5E1A C;  5ITZ B;  3KG2 A;  1R1B A;  2ZQM A;  1BZK A;  4X8A A;  3R66 A;  4P30 A;  5L3C A;  3QF7 A;  2QWO B;  2BE3 A;  3JCU Z;  1Q7Y W;  3WB2 A;  3OUS A;  4XBF A;  3K5L A;  3ZRW A;  1R6K A;  2GUZ B;  3ASO C;  3JAL A;  5EBL C;  3E35 A;  3N2G A;  1IXM A;  3HKE A;  1XRE A;  3JAK B;  1YJW V;  3ASN B;  2EIM C;  2ZE7 A;  2DMX A;  2FKX A;  4J9Y B;  3H1I H;  1ZWI C;  4K8Z A;  3CCQ V;  1JMK C;  1US6 A;  1XMQ B;  5B1B C;  3E22 B;  1R6N A;  3ZJZ A;  5FNV B;  2ETN A;  2WLH A;  4OGQ B;  1EN5 A;  1VF7 A;  2K9P A;  3RVY A;  3ABL C;  4JI3 B;  2Q7E A;  1G1X B;  4PI0 A;  2QKA A;  4F6R B;  2IJI A;  5ITZ A;  2ATK C;  3ABK B;  2CH7 B;  3TCU A;  5B1A C;  1R3J C;  3ETG A;  4I9Q A;  4B3T B;  1VQO V;  1VQ8 V;  4UUJ C;  1MNG A;  1KYO F;  3DTU B;  4KXR A;  3SPG A;  3SJQ C;  1JOY A;  4DV3 O;  4JI6 B;  2AHZ A;  4CC6 A;  1BHA A;  2PTM A;  2UXD B;  2HHH B;  1Z5W A;  2GUZ A;  4J42 A;  1S76 D;  4LF5 O;  4YIO A;  2KSD A;  1PNK A;  5JCO A;  3JAK A;  3LNM B;  3EHB B;  1OCC B;  3BEH A;  3K04 A;  5IWA O;  5LHH A;  4R8C A;  4MT8 A;  1OHH G;  5CMU A;  2D2C B;  1ARO P;  5KLV H;  1EM1 A;  1P84 F;  4CS4 A;  3E22 A;  4FMT A;  3ABM C;  1WP8 A;  4EB6 A;  5LXT A;  3E2E A;  4Z2W A;  4LFA B;  3F5T A;  1N36 B;  3G71 V;  2Y69 B;  1KU9 A;  2EIL C;  3ABU A;  4DYL A;  3TET A;  1RPO A;  3G6B A;  4UVC A;  3RWR D;  3LDE A;  3GWK C;  3OW2 U;  5DED A;  2E5L O;  3K58 A;  4DUY O;  1YEW A;  2Q5Z A;  3CCV V;  4J10 A;  1KKC A;  3ZMS A;  2DWD C;  1W0J G;  3FAV B;  2GBO A;  4DR7 O;  2CUG A;  2QKS A;  3AK3 A;  4TT3 G;  3OMI B;  1PNM A;  2DOS A;  2ZNJ A;  5LGT A;  1RM1 B;  2EX3 A;  2X6B A;  4NKG B;  4HNA B;  4MS2 A;  1SZX A;  2PI5 A;  4X62 O;  2QWP B;  4MW8 A;  2JEX A;  2CAZ C;  2P22 C;  3A2F A;  1AIL A;  2Q0A A;  2QKC A;  5L3E A;  3WB0 A;  3SYP A;  4UV9 A;  2OYQ A;  1NVP D;  5JJJ B;  2JEU A;  3WG7 B;  3QVN A;  1BQ0 A;  1YXB A;  3ZHV A;  4XDJ A;  5A9G A;  3AG3 B;  4DV3 B;  1EFR G;  3E8H A;  1ZAU A;  4H33 A;  4U3J B;  1L0L H;  3K0D A;  1AP6 A;  5KHG A;  2H94 A;  2YID A;  1V9P A;  3ETQ A;  1Y74 B;  3LNN A;  5LOV B;  5IYD O;  1BS3 A;  3B4S A;  4LF5 B;  3RVZ A;  4WFG A;  3FAV A;  2EZO A;  3T1C A;  5KHK A;  2ZDI C;  3B77 A;  2Q68 A;  1ENV A;  5IWA B;  1FXK B;  3BCC H;  4GT1 A;  1Y67 A;  1GN2 A;  1DK1 A;  1FFT B;  4RAI A;  2JVD A;  3U0Z A;  2YUA A;  5BMV B;  2IU3 A;  1H2G A;  1M9N A;  5EYP B;  1WLE A;  1IVS A;  4LF4 B;  1VF5 B;  3SJA C;  4X20 B;  1M1K W;  4BIO A;  1K5Q A;  3OUF A;  4PDL A;  3CC7 V;  3I56 V;  4LFB O;  3BFR A;  3UCS C;  4Z1V A;  5GW7 A;  4WFB V;  1YF2 A;  4LR3 A;  1WPB A;  5TIS Z;  1TUB B;  1VMG A;  5IJ9 B;  5CA0 B;  2YIB A;  2M7W A;  5DN6 G;  3DXR B;  3K59 A;  3T1Y O;  3C3S A;  3CS5 A;  1M57 B;  1KP3 A;  2EIK B;  3N2K B;  1DLB A;  4FM1 A;  3VQY A;  1I94 O;  1VF6 A;  2E5L B;  4DR6 O;  3SYA A;  4DUY B;  5CA1 A;  4U3J A;  4FLZ A;  5LHI A;  2WPD G;  2OCH A;  2JGU A;  5LOV A;  2BTO A;  3JAT B;  4DR7 B;  2R9I A;  1S5J A;  3THO A;  1TAE A;  4LF7 O;  4DV0 B;  1FXK A;  2HG5 C;  2EIJ B;  3ZHS A;  5KHJ A;  1ORQ C;  3MHH C;  4BWA A;  2BSK A;  5BMV A;  1I5Y A;  3AG2 C;  2FB5 A;  1QQC A;  2Y48 A;  2B9Z A;  1NR7 A;  4FFB B;  2IW5 A;  4ZOL A;  1U96 A;  4X62 B;  4X20 A;  3APO A;  5H6Q A;  1NBM G;  1Y4M A;  2PGG A;  4PDR A;  4I0X B;  4KL1 A;  4KUM A;  3HKD B;  1TUB A;  5IY5 C;  3ZED A;  2B1G A;  1VP7 A;  4HZ3 A;  4BW5 A;  5IJ9 A;  3OD4 A;  1HNW O;  1QR8 A;  2N74 A;  3ETE A;  3DXR A;  3FYI B;  3LSS A;  3N2K A;  5KAI Z;  5LMU O;  4GLX A;  2ITD C;  1JVM A;  1NH2 D;  3JAM N;  3SPC A;  5CBG A;  4MSW C;  1HNZ O;  1I7F A;  2GSM B;  1UPG A;  4JGS A;  4GKK O;  3JAT A;  1QCE A;  2P4V A;  1HNX O;  2ILM A;  4EEQ A;  3CCS V;  4FFK A;  5D5P A;  3L73 H;  2LFS A;  1VEW A;  2DQ3 A;  2BOC C;  3FD9 A;  3K5N A;  1UJW B;  1TVK B;  5B3S C;  3CRQ A;  1AJQ A;  4FFB A;  3CME V;  4UV8 A;  2RMK B;  3CCJ V;  1OCO B;  1GM9 A;  2CTR A;  4JPR A;  3RN4 A;  1D2D A;  4LFB B;  2YEV B;  3E8B A;  3BY6 A;  2H8P C;  3MHS C;  4I0X A;  3T4D A;  1THZ A;  1B3Q A;  3HKD A;  4D7S A;  1Q6I A;  2Q69 A;  4J11 A;  5LBQ A;  2Z5U A;  2X0L A;  5GTH Z;  3ZRV A;  1FAF A;  3C3T A;  3T1Y B;  5H9C A;  4TSF G;  3W7T A;  4GX2 A;  5DM6 V;  3G6E V;  1MG1 A;  1GM8 A;  3CP1 A;  3UO3 A;  1SZT A;  3CYO A;  1K97 A;  4FK5 C;  1I94 B;  4N21 A;  4DV4 O;  2YIC A;  1T5E A;  4DR6 B;  3SR2 C;  4K0K O;  3L71 H;  2AGA A;  2JDI G;  1VQP V;  5J2U B;  1IZ3 A;  5C93 A;  3SYC A;  1TUE B;  2QTS A;  4LF7 B;  2LFR A;  2ZDI A;  2XAF A;  1Q86 W;  4JAU A;  1OJH A;  4UB8 Z;  2B1I A;  5IYC O;  1H2N A;  1L8D A;  3CEI A;  4KFM A;  1SKV A;  2E3C A;  1AI6 A;  1TVK A;  3D3I A;  3K79 A;  5JCO C;  1H8H G;  3ASN C;  4IHJ A;  4ZI7 A;  2EBO A;  2LP7 A;  5HFL A;  2YEV A;  1Y76 B;  2G38 A;  1P7B A;  1NR1 A;  4QNH B;  1S72 V;  1CP9 A;  3O65 A;  1HNW B;  4AIL C;  1VQN V;  3IFX A;  1AP5 A;  2AZ2 A;  5L3G A;  1ZX3 A;  3O9O A;  3ZBH A;  2PI4 A;  3M7M X;  1F51 A;  2XTA A;  5LMU B;  3OEH G;  1NT2 B;  1I5X A;  3ABK C;  2JJ1 G;  1O9G A;  1HNZ B;  1Q6H A;  4KHP O;  1XNQ O;  4H44 B;  5J2U A;  4GKK B;  4FLY A;  1HNX B;  1H38 A;  3BAA A;  2VWJ A;  4JI0 O;  3M8A A;  4JYB A;  2WLL B;  2JGD B;  3T4Z A;  1LUV A;  4PA9 A;  4B3M O;  1M5I A;  2WA4 A;  3IC7 A;  1GTO A;  2DYR B;  2UU9 O;  2YS8 A;  1PP9 H;  1BCC H;  1O9H A;  4QGP A;  1OCC C;  3DGE A;  5J2T A;  2F93 B;  4UB6 Z;  4H0L B;  4NYK A;  1HP8 A;  4NB5 A;  2X6C A;  4B08 A;  1SQG A;  5LP6 B;  1S5L Z;  1Y76 A;  1P49 A;  5JVD B;  4K35 A;  5IT9 N;  3UM7 A;  1Q90 D;  4PA7 A;  1XDC A;  2LGQ A;  3SPI A;  2Y69 C;  4DV4 B;  4LFC O;  4QJF B;  1AI7 A;  2EUL A;  3STL C;  4K0K B;  2P6J A;  4NXN O;  1OCZ B;  2JS3 A;  4I55 B;  4N23 A;  4YJ2 B;  1HW7 A;  1AR4 A;  2HLD G;  4I9W A;  3EXA A;  2ZIO A;  1QLN A;  3CCU V;  3SDL A;  2JGD A;  4LF6 O;  3OGI B;  1D5N A;  4AHC A;  2F1M A;  1V55 B;  4JZ2 A;  5KA5 A;  4PJ0 Z;  1KEC A;  1MZF A;  4JTA B;  2CGO A;  1OV9 A;  3DC6 A;  5LP6 A;  2LQT A;  3K03 A;  2IH1 C;  3W7S A;  5LGU A;  4IGG A;  1CPY A;  3LDD A;  4PHZ A;  3C90 A;  4MTX A;  5JVD A;  1RM1 C;  2EZP A;  3CC4 V;  2YIB D;  1E1R G;  3BPZ A;  4P9O A;  1NQT A;  2A79 B;  4WFF A;  2ARH A;  3RYF A;  1EN6 A;  4QE9 A;  1ZLZ A;  4ICG A;  4UCO A;  1WJZ A;  3FB8 C;  1R3K C;  2QA4 V;  2PYJ A;  2KG7 B;  4PA4 A;  4KHP B;  4I55 A;  1XNQ B;  4LF8 O;  3RFR A;  3WG7 C;  4QPJ A;  2HP8 A;  1G4Y B;  3TXS A;  4JI0 B;  1PPJ H;  1VF6 C;  3AG3 C;  1BMF G;  2OIE A;  5IDJ A;  1N34 O;  3JD1 A;  1F7Y A;  2QWQ B;  4GUN A;  1YCI A;  4B3M B;  3GWO A;  3RYI B;  2VQF O;  2UU9 B;  3KCY A;  1H2L A;  3BVO A;  5EBW C;  2QM7 A;  1BL8 A;  5JQG B;  3DSQ A;  4TV8 B;  3LDC A;  5L3B A;  2HEP A;  1K92 A;  1FXK C;  4U7N A;  4E2L A;  4JI4 O;  5CB4 B;  5LHG A;  1YJ9 V;  1SQB H;  4CH6 A;  1N8R W;  2Y0P A;  4FJC C;  5FNV A;  1CEZ A;  2Q6A A;  5H2F Z;  1K33 A;  4D7T A;  4RUE A;  3CWB H; 
#chains in the Genus database with same CATH homology
 1BQZ A;  1GH6 A;  2GUZ A;  4J80 A;  2Y4U A;  3UO3 A;  2L6L A;  2CTR A;  4IT5 A;  2N05 A;  2PF4 E;  4J7Z A;  2M6Y A;  2EJ7 A;  3UCS C;  2KQX A;  2Y4T A;  1BQ0 A;  1N4C A;  2QWN B;  3APQ A;  2QWR B;  2CTP A;  2GUZ B;  2OCH A;  2QSA A;  2QWP B;  1XBL A;  3UO2 A;  1HDJ A;  2LGW A;  2DN9 A;  3APO A;  1IUR A;  2CTW A;  2LO1 A;  4RWU A;  2QWQ B;  2CTQ A;  1WJZ A;  3AG7 A;  2YUA A;  2CUG A;  1FAF A;  1NZ6 A;  2YS8 A;  1FPO A;  3BVO A;  2QWO B;  2DMX A;  2N04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...