2OCHA

J-domain of dnj-12 from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
KETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of J-domain of dnj-12 from Caenorhabditis elegans.
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
molecule keywords Hypothetical protein dnj-12
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ochA00
1FAFA 2QWRB 1XBLA 2M6YA 2Y4UA 2GUZB 2QWPB 1NZ6A 2CTRA 2EJ7A 2CTQA 2YS8A 1N4CA 3APQA 1HDJA 4J80A 2N05A 2CTPA 3BVOA 1IURA 2KQXA 1BQZA 2CUGA 2QWNB 2LGWA 4IT5A 2OCHA 1WJZA 2Y4TA 2QWOB 1FPOA 2GUZA 2L6LA 4RWUA 1BQ0A 2DN9A 1GH6A 3APOA 2CTWA 3UO3A 2QSAA 2N04A 4J7ZA 3UCSC 2PF4E 2LO1A 3AG7A 3UO2A 2YUAA 2QWQB 2DMXA
chains in the Genus database with same CATH superfamily
1WPBA 4O4LB 4LF4B 2Z3YA 4PDLA 2YC0A 1AR4A 3TGUH 2IJIA 4YIOA 3RYIA 5LBQA 5L3EA 1SRYA 2IH3C 1KC8W 4ABMA 3STLC 1I08A 4WFHA 3CC7V 2E74B 4DR6O 4MTGA 1GH6A 3H1KH 4NXMB 3UKMA 4JAUA 2X7RB 4ZKIA 3RW0A 4TWKA 2BE3A 1Y66A 3ABLC 3VBBA 1R6NA 4UV9A 5J2UB 2E76B 1X59A 2A0LA 4YHHB 1WJZA 4LF8B 2WLKA 1VQNV 3R65A 2NNUA 4CH6A 4FMTA 5IJ9A 2DN9A 1VARA 2Q68A 2CDYA 3WB1A 3HR0A 1I94B 1BMFG 4UCTA 2CGOA 1JFFA 5EK0A 4HBNA 5C8YB 2DJVA 3ABKB 2Y69B 1K4CC 2CTPA 4JI2O 1GMGA 1MZFA 1SA0B 4R8CA 4KL1A 3J81N 2EULA 2QM7A 3SJCC 1KU9A 3O65A 2FTKA 3APOA 4LWSA 2QDOA 4LFBO 4X8AA 2K9PA 3JASA 4J7KA 5L3FA 5IY5C 2NLJC 1SQVH 2DYRC 5HFLA 1XL4A 1JMKC 1RP3B 3RFRA 3OTFA 5J9PC 2JRIA 1MA1A 2JGUA 2Q8VA 3B40A 4R7CA 4D6TH 4ZI7B 3VOUA 1M1KW 1IXMA 2IM9A 4IL6Z 1PP9H 2RN9A 4B3MO 2Q67A 3CB2A 4O4HB 3ZHUA 4RUEA 1AJPA 1JX9A 2Q6AA 4TQDA 2O57A 1ZX3A 3KZIZ 1VQ5V 1WP8A 1HNZO 4PJ0Z 4LFBB 2R9AA 2DQ0A 2KQXA 3ABUA 4LH7A 1AI4A 5IYZB 4JI0O 3L9DA 4LNUA 4P2ZA 2UXDB 1HR0O 1KP2A 1ZLZA 2DWDC 3W7WA 1SQBH 1ZTEA 3B8NA 2P06A 2QM8A 4PI0A 4O4JA 1JJ2U 3CRQA 4QE9A 2G38A 4DV3O 4LFAB 4CH3A 4B3MB 1LR1A 2Q69A 3SPHA 4DR4B 4JI8B 3ZHVA 4I55B 3BPZA 5FNVA 2WLIB 1NU1H 3CC2V 3E89A 4J10A 5EIBD 1JJOA 1YTFB 3AEIA 2KSDA 4D7SA 3ZMVA 3CHXA 4IT5A 3RYCA 3SPJA 4OPAA 1DLBA 3KCYA 4IGGA 5B1BC 2P90A 4EB6B 2R70A 4DUYO 5EZYB 2DMXA 1OCOB 4BAYA 2HG5C 1FKAO 2UXCB 2XT9A 4DR6B 5GW7A 4BIZA 2B1GA 1FXVA 4G28B 3SYQA 1JVMA 3HKCA 4FM2A 1GKFA 1K34A 2ZINA 4X62O 4O4IB 2YXHA 4W4KA 4QGPA 3G4SV 1FFXA 2PTMA 5L3BA 4FLVA 1HNXB 2Q9LA 4NKGB 4MTOA 1UPGA 2Y69C 4G2KA 4DR3B 2L35A 5LMNO 2HJFC 4G27B 1R3KC 1M56C 5LMUB 2FB5A 4NXMO 3G67A 3S3XA 2R72A 5E79Z 1VMGA 1GN3A 1W0JG 3OUFA 3K5OA 4ZOLA 4DV7B 2F1MA 4UUJC 3PJSK 2W0FC 4PELA 4I0XA 5JH7B 4LP8A 2HHHO 4DR2O 3OMAB 4PHZA 1YJWV 2BTQB 1M57C 4I4TB 2KKWA 3B8MA 4UFZA 5C93A 4FZ0A 3KKYA 4KHPO 1QQCA 3T2MA 1XMQB 2ZQMA 4PDRA 1NJIW 5GONB 1IBMB 2E5LO 4J9YB 1ZL8B 4P30A 3E8BA 4CS2A 4IYHA 1N32O 4TV9B 5CA1A 4LF5O 2RQ6A 3D3IA 5CA0B 4DUZO 3LDCA 3JSNA 4JI7B 5LOVB 3TETA 2LP7A 4X1IB 1RPOA 5EIBC 4MVRA 2UUBB 2VRZA 2X6BA 4LCUC 3CSXA 3D8CA 4F4LA 4LF6O 1MABG 5B3SB 4B3SO 5LXTB 2DQ3A 1E1RG 4AQYB 3HKDB 2X6CA 1GN2A 3AG3B 2NN4A 5B3SC 4I4TA 2WWWA 2LQTA 1QLEB 3M7MX 1KKDA 3ABTA 3P3PA 1X4TA 3JAKB 4X1YA 4X20B 2EILB 1QCEA 3TXQA 4H33A 2EIJB 2E5LB 2Q7EA 3E86A 2UU9O 3K9AA 4HAMA 1MOFA 4JPRA 1K9MW 3K79A 1ROPA 4QE7A 5J2TA 3W7SA 1EN6A 4DR7B 1PNKA 4J80A 2E3CA 5JJEB 2QWNB 3K5MA 4JI6O 1PNLA 4U3JB 4X64B 1BGYH 2UXXA 1WA8B 1XQ8A 3CRAA 3K9SA 1MSWD 2ATKC 2W6JG 2N74A 3HKEA 2ZE5A 3ASNC 2QWPB 1HNWO 5JCOC 3GVMA 3L75H 4CC5A 3T1YB 1YI2V 2HEPA 3FB8C 3BA9A 4JASA 1EZVH 3JAMN 1VQ4V 1QNMA 1PV0A 3Q4HB 4DR7O 1P7BA 1SERA 4DV0B 1N36B 1VQKV 1YF2A 3W7TA 4MS2A 1XMOB 2QGNA 5LXTA 1U97A 1FFTB 3H1JH 3SJBC 4BWAA 1QR8A 1H8HG 3HKBB 4TUYA 5LMNB 1CXZB 3ETGA 3HPLC 1Q43A 2LJ2A 3FAVB 3HKEB 4GCZA 3P32A 1D5NA 3ASNB 3B4SA 3CPWU 1SQQH 3CMEV 5CA0A 3BHPA 5EBMC 5EC2C 1IBLO 1L8DA 3MD0A 3QO7A 3JALB 1R73A 2Q73A 4Q20A 4O4JB 4P9OA 4YY3B 2XASA 3BFRA 4XDKA 3CD6V 4MVOA 3MAQA 1Y4MA 1TAEA 1WNSA 4NYKA 2LO1A 1SF9A 5EYPA 1TGOA 4JI0B 1Z5VA 4JI8O 4X1YB 1BT8A 2UUAO 1P49A 4NXNB 2IJJA 4MT8A 3I56V 3JD2A 1H2SB 4DV5O 2P4VA 3CCVV 4AHCA 4R6ZA 5EYPB 1H2MA 1GRJA 1KBHA 5CA1B 1WLEA 5H5NA 1B6QA 5IWAB 1Q6IA 1KKCA 2YIBA 3Q4HA 2UXBB 1UJWB 4GKKO 3UT5B 3BY6A 1N33O 4GKJO 2OIEA 3VQVA 3ASOC 4ZI7A 1IBKO 1O9GA 1DTOA 4O2AA 4MVUA 5ITZB 3K5NA 3KCXA 4P9PA 4DUYB 2GUZA 1BHBA 5CBHA 1S3JA 2CTWA 4JI5B 2XNDG 4I5SA 1EN4A 3ZMSA 4LF6B 3T4DA 4DR1O 4LWSB 2F4VO 1KUQA 5EBWC 2YSUB 3B09A 4MVZA 5IJ0B 2Z5UA 5LYJA 4PDMA 1AJNA 1OCOC 2HKOA 3HB3B 1EBOA 1A32A 3K03A 3D36A 4LBEC 5JVDA 4R50A 3CCJV 4LF8O 2ZDIC 3A0HZ 2Q7HA 5B1AB 1ORQC 4Z2WA 3CCEV 1V9PA 2E75B 2YIDA 3CYOA 5KUKA 1O9HA 4DR2B 1KYOF 1S5HC 2YXYA 2EX3A 4JI3O 4E4EA 4GX0A 1HW7A 3HKCB 1Q81W 3G71V 1AR5A 1SA0A 3NXSA 4JI1O 5JWPA 1K73W 5GTIZ 3VQWA 3RYIB 4GT1A 3K58A 1AI5A 2ITDC 4ICGA 3P30A 3AG1C 4I7ZB 5EZYA 1MNGA 2N04A 3CJHB 3ZIAG 5CA3A 3LSSA 1N36O 2BSKB 1VQ9V 3WG7C 4TV9A 1FAFA 1Q5OA 1ZL8A 3CC4V 1YCIA 1IBMO 3T1YO 2ZE6A 2ZXWC 2RJZA 3QVNA 2ZM6O 2QTSA 3F5TA 3CRRA 5J2UA 2OCHA 3T4ZA 4W4LA 4PDVA 3K59A 4EB6A 1AROP 3X2QB 4MVMA 2FYUH 2PF4E 3H1IH 5KA5A 3D36C 3FYEB 1RFYA 3DSQA 1H2KA 5L3CA 3OFNG 4UCUA 2PZSA 2W0XA 3JD3A 1VP7A 4GX1A 1GM7A 5IDJA 1RPRA 2QWOB 1K92A 2JGDB 2DYSB 2YXLA 1FJGO 2B1IA 2RCVA 3LDDA 3AK1A 1EN5A 1SKVA 2ZM6B 3KG2A 3K08A 3OMNB 2UUAB 1URFA 4DRXA 3OEEG 5GONA 3ZRWB 2AZ2A 1GM9A 4WCEV 3ABKC 5H6RA 4UB6Z 4WFFA 4FK5C 5B66Z 1VQ6V 1XILA 2HFEC 4PI2A 1Y74A 3A0BZ 3AG4B 3OR7C 3SR2C 3ZCCA 4JYAO 4DW0A 3VQYA 1WN7A 4DV4O 5LP6C 4QPKA 4CZZA 4AI8A 2ZXWB 1COWG 5D5QA 5BMVB 1Y76B 4IHJA 4UCOA 1NZ6A 1T5EA 1PD3A 3BA8A 4YIPA 5LHIA 1M4UA 1BS3A 1FXKA 2ZIOA 3K5LA 5JH7A 3N2KB 3R66A 3E35A 4PA6A 3CP1A 4B08A 4YXWG 1Y67A 3L71H 3QNEA 4U3FH 3W7XA 1AR1B 2HHHB 5KHJA 4GX2A 5IWAO 1XREA 3BCCH 1TUBA 1Y74B 4UB8Z 3IJ4A 2HP8A 3JATB 1UFIA 4FFKA 3H1LH 1F23A 4MW3A 2DE0X 2LGWA 4WF9V 4DV0O 3K0DA 1JFFB 5BZBA 3FD9A 4FFBB 4QNHB 1FFXB 5HFMA 4X1KA 4I55A 3ETDA 1Q7YW 1H38A 4LFAO 2YICA 1ZAUA 5CMUA 3ETQA 1N34O 1P7GA 3DXRA 4ZHQA 2ZE7A 1K33A 3AG2C 2RMKB 3K06A 1Y76A 3RGBA 4JTAB 3CXCU 3OUSA 2ADQB 4J7ZA 3IC7A 2OIGA 4X9QA 4PV1B 2HR3A 2YS8A 3WB0A 1JOYA 1NQTA 3N2GA 1GAXA 2GDSA 1NVPD 1SZTA 4O4LA 3BRCA 3ZHSA 2YDEA 1N8RW 1NH2D 3J80N 2XAFA 2JGDA 4FFBA 4B3RB 4JI1B 4FPPA 2JVDA 1KMIZ 1RM1C 4LF7O 4FZ1A 4RUFA 2H8PC 2HVJC 1BQZA 4YJ2B 1NT2B 4JI2B 4MVQA 2HVKC 3K57A 1IBKB 3DTUB 5B1NA 1D5AA 3E8FA 1AB3A 1V55C 3JAWB 4WFAV 1M57B 2XTAA 2DW4A 1I0HA 2H94A 3SGIA 1TA8A 4DV6B 1RSOB 4K8ZA 3N2KA 2Q5ZA 1FXKB 4NXNO 2XAGA 1S76D 5H9CA 2JDIG 5CBFA 2UXBO 3G6EV 4FVMA 4ZIBA 4GKKB 2WA4A 5IE9A 3E2EA 4TOIA 1R1BA 2EIMC 5BY1A 3E22B 1AJQA 1YXBA 3DGEA 4C7UA 1XOUA 2WLMA 1RSOA 1QBZA 2EILC 2P4KA 3F7VC 3ZRWA 2R9IA 4IIJA 4MW8A 2A9HA 1XL6A 3ABLB 1NVPB 1HR0B 1P84F 4B7EA 1F4NA 3G6BA 4CS4A 2ZCEA 1OHHG 5K1PA 3A2FA 4K3AA 2WLJA 4YJ2A 1W59A 1SC5B 1YZBA 2GSMB 1SS3A 4DRXB 4E2LA 2ZNJA 2QSAA 1M56B 3ZN1A 2JIZG 3E8GA 5KHKA 3LNNA 4DK0A 3ABMC 3ETEA 3X2QC 1WAZA 4PA4A 4LF5B 4IYIA 2PUSA 3BAAA 3N2GB 3P3NA 3FFQA 5KUMA 1IURA 3GWOA 3JCUZ 2OYQA 5JCOA 1H2GA 3RYFB 4D7TA 3T1HO 2L6LA 4YHHO 2OCCC 5DM6V 4AQYO 1JR9A 1YSCA 5IYCO 1BHAA 1ZUQA 4DYLA 3AG1B 3QO5A 3CJHA 4I9QA 3LDEA 2FKXA 3ZRVA 2XAHA 4J41A 2UXCO 1DF5A 4QIWF 4DXWA 4ZHQB 2CUGA 2BTOA 1I5XA 4RQFA 4U7OA 3L74H 4JAAA 2KB1A 2OTJV 4DV1O 2IW5A 2MK3A 4QPJA 5KMGB 4JI5O 4JF3A 1F51A 2P22C 3T1HB 3ICXA 4WBNB 3TK1A 3APQA 2DYSC 1H8EG 3B2EE 2Y0PA 3M99B 2LGQA 2AHYA 2QKSA 3WB2A 3AK3A 5BXZA 1E1QG 1NS1A 4B3TB 1Z5WA 2GHYA 3QF7A 1MMMA 2LW7A 4ASUG 3OT7A 3OAAG 4B3RO 1K8AW 4NVPA 1LNQA 3JD1A 1NR7A 1PPJH 1KP3A 3QG5A 4JYYA 1HP8A 4K0KB 4LF9O 4KHPB 3IGAC 1FD9A 3SPIA 5H2FZ 1HNWB 1N4CA 1XHZA 2F93B 3CX5F 2AZ0A 4OX9B 1XNRO 3G80A 1VF6C 4FLZA 4RWUA 2KG7A 2ZD9A 1VQ7V 1Y6XA 2XAQA 2EINB 2UXDO 3AG7A 1GO3F 4UV8A 1EZJA 4NTWA 4YJ3A 4EEQA 3N27A 3FKSG 4BW5A 4X66O 2A3QA 4Q6GA 1OCZB 1JQ0A 2CK3G 2BOCC 4HZ3A 1NTMH 2WA3A 1XNQO 1IBLB 5LL6Y 1FPOA 3UT5A 4AILC 4JYAB 1BQ0A 2VWKA 5DN6G 2QR4A 1ZWIC 1M5IA 2YEVB 1N32B 2CH7A 5FLXN 4WFBV 2Y48A 5ITZA 3CCQV 4X20A 1YJNV 2ILMA 1F4MA 3ZEDA 3RN4A 4KP4A 4JZGA 4CBCA 4JI4B 3CCLV 5D5PA 3U11A 1YJ9V 2P67A 4X66B 1V54C 1QLNA 2Z0AA 4JI3B 1PL4A 4GZRB 5L3DA 3K04A 5FL7G 5L3GA 1AVMA 4UCVA 3VQXA 1V54B 1LUWA 1IZ3A 2WSSG 1BL8A 3L72H 3OEHG 5E1AC 1DF4A 1EM1A 4B7KA 2JEUA 4X89A 3JD0A 1VQPV 2OTLV 2QWQB 4JZ2A 2B5UA 3FAVA 4OXSA 1NH2B 3H1HH 1K5QA 3M8AA 4O2AB 3OR6C 1K7DA 3HKBA 4LH6A 3U10A 4DR3O 1SETA 2EIKC 2R9RB 1K3EA 4UVBA 5CB4B 4UCRA 1AI7A 2YI8A 3SYCA 5EBLC 1DGSA 3CXHF 2AXTZ 1XMOO 3ZHQA 1NTKH 4EFEA 3AG2B 1N0JA 3MDSA 4NR1A 1HNZB 4LFCB 4K8XA 3IC9A 1G1XB 1D2DA 3BVOA 3QTCA 4O2BB 4CS3A 4J11A 1XHXA 4MSWC 3OTOO 1MSDA 4U7NA 4FLTA 1Q82W 2CH7B 2BSKA 1TVKA 4ZOLB 1R3JC 4XBFA 1XEQA 1AI6A 5JVDB 1VQOV 2QA4V 4DK1A 5FPRA 2A06H 2QTOA 2EJ7A 1HDJA 1JCHA 1G4YB 4UCSA 2WPDG 1YVWA 3EHBB 5IJ0A 2V1DA 2RDCA 1OV9A 4JAVA 1N0NA 4BIUA 2WLLA 4PA7A 5K1XA 5BR8O 1AP5A 1B06A 3UO3A 4JYBA 4HNAB 5IYBO 3THOA 3ZRSA 1KB9F 3OGIB 1KD1W 1WA8A 2KG7B 1KQSU 2M6YA 2GUZB 4PA3A 5F2VO 2ZNIA 1BZKA 3ABMB 4UVCA 2F95B 2XOKG 5JQGB 4F6RB 5J2TB 1N34B 4K0KO 4X65O 1PKXA 1XI1A 3SDLA 1XUQA 1FS0G 3AG3C 2QWRB 1XBLA 4DW1A 1W0KG 4J42A 1VEWA 3T1CA 4OX9O 1XNRB 4RQEA 2CAZC 2N05A 1YTFD 4LC1A 4DV2B 3GB7C 3SJAC 2VQEB 4JV5B 4IHJB 4WFGA 5CN0A 4DV7O 1IX9A 2ADPA 3C3TA 4X1IA 2UU9B 1YEWA 1OZ0A 4TV8B 1FJGB 2ZIMA 3HKDA 4J9ZB 2IU0A 3CCUV 4XDJA 4JYCA 2EZPA 4H37A 3AG4C 3JALA 3A8TA 2ZE8A 1E79G 4GKJB 5LP6A 3UM7A 5LOVA 5KAIZ 1NKDA 4DV1B 4GLXA 1QR9A 4TT3G 5KHHA 2EINC 1OCCB 1Q6HA 1S77D 4O2BA 1I5YA 2ODMA 1J5EB 4JI6B 2WLIA 5FNVB 2XHBA 2DOSA 2F23A 1QU7A 2VQFB 2PYJA 2AW9A 5LP6B 1K97A 2Q4PA 3C90A 4I9WA 4DR1B 1G8MA 2UUCB 3CEIA 1L0NH 4I0XB 5LGNA 1R3IC 3ZHTA 1GK9A 3MHSC 1VF6A 5KA6A 3CRMA 1BE3H 3CRCA 3ZMUA 1ZSPA 2XAJA 3FB5C 2DWEC 5LGUA 4CH4A 1GN4A 3ASOB 3SJQC 5KAFZ 3K0GA 4TUYB 1B04A 4DO2A 2BCCH 3E22A 4MTFA 1I94O 1PM9A 2IH1C 2P6JA 1MG1A 4LF9B 2X0LA 2P7TC 1YHQV 1S5JA 3JYCA 2UXNA 3CMAV 5B1OA 4FLYA 4DUZB 3IFXA 1L0LH 1SESA 3OE7G 2Q0AA 2F43G 1B3QA 3OM3B 4FM1A 2UUCO 1VQ8V 2OT5A 3JAKA 3K3WA 1M9NA 1NBMG 1Q90D 1M90W 1R6TA 3ZJZA 5AG2A 4FLWA 1R6KA 4HNAA 2QEXV 4JGSA 1AILA 4PD4F 4F6RA 2IJKA 1FXHA 2ZR2A 3O9OA 4PA9A 4MTXA 4U3JA 1VF5B 1S0VA 1Z2GA 2CTQA 5LYJB 4N23A 4EFBA 4H13B 4CC6A 1LUVA 4RAIA 4FJCC 5B1BB 2VWJA 1WPXA 1QVGU 1WP7A 2WLHA 3RVYA 1QVFU 1NR1A 4LNUB 4LF4O 3SYPA 2WLLB 5IY5B 1G6UA 1THZA 3EXAA 3PN1A 1VQLV 1AP6A 2K1EA 5IYZA 3FB7C 2YIAA 4L8JA 1NTZH 3STZC 2JS5A 2C2AA 4NB5A 1TUEB 1HWYA 3RWRD 5KLVH 3BEHA 3C3SA 2NR5A 5FPOA 3NR7A 2B9ZA 1WB8A 3RYCB 1OCCC 4DV2O 3OGCC 5JJJB 2JK5C 3CCMV 4WBNA 3L70H 1VQMV 3QO8A 3J7AU 1FXKC 2H3OA 2XUMA 4KUMA 4FM0A 5LA6A 2AHZA 2V4DA 4GX5A 4X88A 2YIBD 4A5UB 3JATA 1GTOA 4NTXA 2IU3A 1YDXA 3F7YC 4DR5O 1H2LA 4LR3A 3E8HA 5EC1C 2OWOA 3CWBH 1EFRG 3LUTB 4TV8A 4JI7O 2OCCB 3SPCA 1NI8A 1N33B 3FX7A 3ML0A 3ZHRA 2YUAA 4FLXA 5KHIA 1H2NA 4IIJB 5A2QN 2JJ1G 3I55V 1Q6UA 1GM8A 5TISZ 3ZMTA 2GBOA 1L1FA 2JEXA 1K4DC 2EIJC 3RVZA 4BR6A 4J7JA 4YY3O 3JARA 5BMVA 2EBOA 2VQFO 4O4HA 1US6A 2PYLA 1QLEC 3UO2A 2EIKB 4JI4O 1TVKB 2X6AA 2HJDA 3A0RA 4RO2A 5JQGA 2M7WA 2RNBA 3TCUA 2LFRA 4H0LB 2CE4A 5LMUO 5GTHZ 1DK1A 2VS0A 2Y4TA 3WFVA 4UXNA 5BR8B 1SQFA 2A7WA 4YJ3B 4JTDB 3UCSC 1XDCA 3JASB 2JJ2G 4DV4B 4O4IA 1HNXO 1IVSA 1XNQB 3WG7B 1I7FA 2EJRA 4OGQB 5A9GA 5CBGA 2VQEO 5KX5B 2EZOA 4JV5O 4I50B 3FYIB 3U0ZA 5H6QA 1M93A 1P4RA 2Q7GA 3OW2U 1WB7A 2F66C 1IDSA 3TJTA 2GTSA 2WLNA 2ZDIA 1JA8A 2V7QG 4MVSA 2GTAA 3GWKC 3OD4A 4LFCO 3MHHC 2D2CB 3EFFK 4FIPC 1BSMA 2W6IG 5IYDO 2PI4A 4OPHA 2Q0OC 2UUBO 4TQFA 1S72V 3JCZA 1SQXH 2PGGA 4LF7B 1Q8IA 4FLUA 4L87A 2PY5A 3JAWA 4B3TO 4B3SB 3WU2Z 5CB4A 1CPYA 3H9VA 2ETNA 1JPXA 1OCZC 3IAYA 5JJNB 3JSLA 1XMQO 1MZEA 1KECA 3SYOA 2FMLA 2IJHA 5KX5A 5DECA 1CEZA 2ZKOA 2Y0IA 2LFSA 2YEVA 2DYRB 4KFMA 3OMIB 4X1KB 2BOBC 3OTOB 1FYJA 4KXRA 1R3LC 1J5EO 2CTRA 2ZR3A 3LNMB 2QM4A 2YI9A 3F5WC 3RYFA 3RYHB 2FL4A 1PL0A 4Z1MG 3ZMZA 1V55B 1F7YA 4BW9A 3DC6A 1CP9A 1Q3EA 2QKAA 4H44B 4X64O 2BTQA 5DEDA 2PI5A 2Y4UA 2CGNA 3LSUA 1VF7A 2QKCA 1S5LZ 3DXRB 3DC5A 4N21A 3SPGA 1YITV 4TSFG 5LGTA 3W7UA 3CCSV 2WAMA 3RBZA 4QJFB 4NTYA 1K5SA 3D3QA 4CH5A 3B77A 4EKWA 2ZT9B 1J95A 3ZBHA 3ZX6A 3EVKA 1OCRB 1QHTA 2QE7G 1RM1B 3JD4A 1GN6A 4ZBMA 3SYAA 2GV9A 4DR5B 1OJHA 1TUBB 4X65B 1Q86W 5C8YA 3RYHA 5B5EZ 2F4VB 4DV3B 2HLDG 5LA6B 3ZS8C 2D3OW 2AGAA 4GUNA 1YIJV 1VIBA 3H01A 5IT9N 5IJ9B 4XDLA 5KMGA 2QJ1A 3JARB 3BABA 4WFEA 5LHGA 5B1AC 4Z1VA 2EIMB 1IXBA 3CCRV 4BIOA 1U96A 2P5OA 3E83A 4JTCB 4GYCB 3RT3C 3I5DA 1SQPH 2A79B 2JS3A 2MW2B 5KHGA 1OCRC 3TXSA 4DR4O 4F6EA 1BCCH 1SZXA 3ZN0A 3CS5A 4UVAA 4DV5B 2IBZH 4DV6O 2LW1A 1PNMA 2ITCC 3FB6C 3L73H 3S3WA 3LSQA 1ENVA 2ARHA 1W2BU 3AK2A 4I50A 4X62B 3CE2A 5LHHA 4HYOA 1SQGA 4K35A 3ZRXA 3UQ8A
chains in the Genus database with same CATH topology
1FAFA 2QWRB 1XBLA 2M6YA 2Y4UA 2GUZB 2QWPB 1NZ6A 2CTRA 2EJ7A 2CTQA 2YS8A 1N4CA 3APQA 1HDJA 4J80A 2N05A 2CTPA 3BVOA 1IURA 2KQXA 1BQZA 2CUGA 2QWNB 2LGWA 4IT5A 2OCHA 1WJZA 2Y4TA 2QWOB 1FPOA 2GUZA 2L6LA 4RWUA 1BQ0A 2DN9A 1GH6A 3APOA 2CTWA 3UO3A 2QSAA 2N04A 4J7ZA 3UCSC 2PF4E 2LO1A 3AG7A 3UO2A 2YUAA 2QWQB 2DMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FAF A;  2QWR B;  1XBL A;  2M6Y A;  2Y4U A;  2GUZ B;  2QWP B;  1NZ6 A;  2CTR A;  2EJ7 A;  2CTQ A;  2YS8 A;  1N4C A;  3APQ A;  1HDJ A;  4J80 A;  2N05 A;  2CTP A;  3BVO A;  1IUR A;  2KQX A;  1BQZ A;  2CUG A;  2QWN B;  2LGW A;  4IT5 A;  2OCH A;  1WJZ A;  2Y4T A;  2QWO B;  1FPO A;  2GUZ A;  2L6L A;  4RWU A;  1BQ0 A;  2DN9 A;  1GH6 A;  3APO A;  2CTW A;  3UO3 A;  2QSA A;  2N04 A;  4J7Z A;  3UCS C;  2PF4 E;  2LO1 A;  3AG7 A;  3UO2 A;  2YUA A;  2QWQ B;  2DMX A; 
#chains in the Genus database with same CATH topology
 1WPB A;  4O4L B;  4LF4 B;  2Z3Y A;  4PDL A;  2YC0 A;  1AR4 A;  3TGU H;  2IJI A;  4YIO A;  3RYI A;  5LBQ A;  5L3E A;  1SRY A;  2IH3 C;  1KC8 W;  4ABM A;  3STL C;  1I08 A;  4WFH A;  3CC7 V;  2E74 B;  4DR6 O;  4MTG A;  1GH6 A;  3H1K H;  4NXM B;  3UKM A;  4JAU A;  2X7R B;  4ZKI A;  3RW0 A;  4TWK A;  2BE3 A;  1Y66 A;  3ABL C;  3VBB A;  1R6N A;  4UV9 A;  5J2U B;  2E76 B;  1X59 A;  2A0L A;  4YHH B;  1WJZ A;  4LF8 B;  2WLK A;  1VQN V;  3R65 A;  2NNU A;  4CH6 A;  4FMT A;  5IJ9 A;  2DN9 A;  1VAR A;  2Q68 A;  2CDY A;  3WB1 A;  3HR0 A;  1I94 B;  1BMF G;  4UCT A;  2CGO A;  1JFF A;  5EK0 A;  4HBN A;  5C8Y B;  2DJV A;  3ABK B;  2Y69 B;  1K4C C;  2CTP A;  4JI2 O;  1GMG A;  1MZF A;  1SA0 B;  4R8C A;  4KL1 A;  3J81 N;  2EUL A;  2QM7 A;  3SJC C;  1KU9 A;  3O65 A;  2FTK A;  3APO A;  4LWS A;  2QDO A;  4LFB O;  4X8A A;  2K9P A;  3JAS A;  4J7K A;  5L3F A;  5IY5 C;  2NLJ C;  1SQV H;  2DYR C;  5HFL A;  1XL4 A;  1JMK C;  1RP3 B;  3RFR A;  3OTF A;  5J9P C;  2JRI A;  1MA1 A;  2JGU A;  2Q8V A;  3B40 A;  4R7C A;  4D6T H;  4ZI7 B;  3VOU A;  1M1K W;  1IXM A;  2IM9 A;  4IL6 Z;  1PP9 H;  2RN9 A;  4B3M O;  2Q67 A;  3CB2 A;  4O4H B;  3ZHU A;  4RUE A;  1AJP A;  1JX9 A;  2Q6A A;  4TQD A;  2O57 A;  1ZX3 A;  3KZI Z;  1VQ5 V;  1WP8 A;  1HNZ O;  4PJ0 Z;  4LFB B;  2R9A A;  2DQ0 A;  2KQX A;  3ABU A;  4LH7 A;  1AI4 A;  5IYZ B;  4JI0 O;  3L9D A;  4LNU A;  4P2Z A;  2UXD B;  1HR0 O;  1KP2 A;  1ZLZ A;  2DWD C;  3W7W A;  1SQB H;  1ZTE A;  3B8N A;  2P06 A;  2QM8 A;  4PI0 A;  4O4J A;  1JJ2 U;  3CRQ A;  4QE9 A;  2G38 A;  4DV3 O;  4LFA B;  4CH3 A;  4B3M B;  1LR1 A;  2Q69 A;  3SPH A;  4DR4 B;  4JI8 B;  3ZHV A;  4I55 B;  3BPZ A;  5FNV A;  2WLI B;  1NU1 H;  3CC2 V;  3E89 A;  4J10 A;  5EIB D;  1JJO A;  1YTF B;  3AEI A;  2KSD A;  4D7S A;  3ZMV A;  3CHX A;  4IT5 A;  3RYC A;  3SPJ A;  4OPA A;  1DLB A;  3KCY A;  4IGG A;  5B1B C;  2P90 A;  4EB6 B;  2R70 A;  4DUY O;  5EZY B;  2DMX A;  1OCO B;  4BAY A;  2HG5 C;  1FKA O;  2UXC B;  2XT9 A;  4DR6 B;  5GW7 A;  4BIZ A;  2B1G A;  1FXV A;  4G28 B;  3SYQ A;  1JVM A;  3HKC A;  4FM2 A;  1GKF A;  1K34 A;  2ZIN A;  4X62 O;  4O4I B;  2YXH A;  4W4K A;  4QGP A;  3G4S V;  1FFX A;  2PTM A;  5L3B A;  4FLV A;  1HNX B;  2Q9L A;  4NKG B;  4MTO A;  1UPG A;  2Y69 C;  4G2K A;  4DR3 B;  2L35 A;  5LMN O;  2HJF C;  4G27 B;  1R3K C;  1M56 C;  5LMU B;  2FB5 A;  4NXM O;  3G67 A;  3S3X A;  2R72 A;  5E79 Z;  1VMG A;  1GN3 A;  1W0J G;  3OUF A;  3K5O A;  4ZOL A;  4DV7 B;  2F1M A;  4UUJ C;  3PJS K;  2W0F C;  4PEL A;  4I0X A;  5JH7 B;  4LP8 A;  2HHH O;  4DR2 O;  3OMA B;  4PHZ A;  1YJW V;  2BTQ B;  1M57 C;  4I4T B;  2KKW A;  3B8M A;  4UFZ A;  5C93 A;  4FZ0 A;  3KKY A;  4KHP O;  1QQC A;  3T2M A;  1XMQ B;  2ZQM A;  4PDR A;  1NJI W;  5GON B;  1IBM B;  2E5L O;  4J9Y B;  1ZL8 B;  4P30 A;  3E8B A;  4CS2 A;  4IYH A;  1N32 O;  4TV9 B;  5CA1 A;  4LF5 O;  2RQ6 A;  3D3I A;  5CA0 B;  4DUZ O;  3LDC A;  3JSN A;  4JI7 B;  5LOV B;  3TET A;  2LP7 A;  4X1I B;  1RPO A;  5EIB C;  4MVR A;  2UUB B;  2VRZ A;  2X6B A;  4LCU C;  3CSX A;  3D8C A;  4F4L A;  4LF6 O;  1MAB G;  5B3S B;  4B3S O;  5LXT B;  2DQ3 A;  1E1R G;  4AQY B;  3HKD B;  2X6C A;  1GN2 A;  3AG3 B;  2NN4 A;  5B3S C;  4I4T A;  2WWW A;  2LQT A;  1QLE B;  3M7M X;  1KKD A;  3ABT A;  3P3P A;  1X4T A;  3JAK B;  4X1Y A;  4X20 B;  2EIL B;  1QCE A;  3TXQ A;  4H33 A;  2EIJ B;  2E5L B;  2Q7E A;  3E86 A;  2UU9 O;  3K9A A;  4HAM A;  1MOF A;  4JPR A;  1K9M W;  3K79 A;  1ROP A;  4QE7 A;  5J2T A;  3W7S A;  1EN6 A;  4DR7 B;  1PNK A;  4J80 A;  2E3C A;  5JJE B;  2QWN B;  3K5M A;  4JI6 O;  1PNL A;  4U3J B;  4X64 B;  1BGY H;  2UXX A;  1WA8 B;  1XQ8 A;  3CRA A;  3K9S A;  1MSW D;  2ATK C;  2W6J G;  2N74 A;  3HKE A;  2ZE5 A;  3ASN C;  2QWP B;  1HNW O;  5JCO C;  3GVM A;  3L75 H;  4CC5 A;  3T1Y B;  1YI2 V;  2HEP A;  3FB8 C;  3BA9 A;  4JAS A;  1EZV H;  3JAM N;  1VQ4 V;  1QNM A;  1PV0 A;  3Q4H B;  4DR7 O;  1P7B A;  1SER A;  4DV0 B;  1N36 B;  1VQK V;  1YF2 A;  3W7T A;  4MS2 A;  1XMO B;  2QGN A;  5LXT A;  1U97 A;  1FFT B;  3H1J H;  3SJB C;  4BWA A;  1QR8 A;  1H8H G;  3HKB B;  4TUY A;  5LMN B;  1CXZ B;  3ETG A;  3HPL C;  1Q43 A;  2LJ2 A;  3FAV B;  3HKE B;  4GCZ A;  3P32 A;  1D5N A;  3ASN B;  3B4S A;  3CPW U;  1SQQ H;  3CME V;  5CA0 A;  3BHP A;  5EBM C;  5EC2 C;  1IBL O;  1L8D A;  3MD0 A;  3QO7 A;  3JAL B;  1R73 A;  2Q73 A;  4Q20 A;  4O4J B;  4P9O A;  4YY3 B;  2XAS A;  3BFR A;  4XDK A;  3CD6 V;  4MVO A;  3MAQ A;  1Y4M A;  1TAE A;  1WNS A;  4NYK A;  2LO1 A;  1SF9 A;  5EYP A;  1TGO A;  4JI0 B;  1Z5V A;  4JI8 O;  4X1Y B;  1BT8 A;  2UUA O;  1P49 A;  4NXN B;  2IJJ A;  4MT8 A;  3I56 V;  3JD2 A;  1H2S B;  4DV5 O;  2P4V A;  3CCV V;  4AHC A;  4R6Z A;  5EYP B;  1H2M A;  1GRJ A;  1KBH A;  5CA1 B;  1WLE A;  5H5N A;  1B6Q A;  5IWA B;  1Q6I A;  1KKC A;  2YIB A;  3Q4H A;  2UXB B;  1UJW B;  4GKK O;  3UT5 B;  3BY6 A;  1N33 O;  4GKJ O;  2OIE A;  3VQV A;  3ASO C;  4ZI7 A;  1IBK O;  1O9G A;  1DTO A;  4O2A A;  4MVU A;  5ITZ B;  3K5N A;  3KCX A;  4P9P A;  4DUY B;  2GUZ A;  1BHB A;  5CBH A;  1S3J A;  2CTW A;  4JI5 B;  2XND G;  4I5S A;  1EN4 A;  3ZMS A;  4LF6 B;  3T4D A;  4DR1 O;  4LWS B;  2F4V O;  1KUQ A;  5EBW C;  2YSU B;  3B09 A;  4MVZ A;  5IJ0 B;  2Z5U A;  5LYJ A;  4PDM A;  1AJN A;  1OCO C;  2HKO A;  3HB3 B;  1EBO A;  1A32 A;  3K03 A;  3D36 A;  4LBE C;  5JVD A;  4R50 A;  3CCJ V;  4LF8 O;  2ZDI C;  3A0H Z;  2Q7H A;  5B1A B;  1ORQ C;  4Z2W A;  3CCE V;  1V9P A;  2E75 B;  2YID A;  3CYO A;  5KUK A;  1O9H A;  4DR2 B;  1KYO F;  1S5H C;  2YXY A;  2EX3 A;  4JI3 O;  4E4E A;  4GX0 A;  1HW7 A;  3HKC B;  1Q81 W;  3G71 V;  1AR5 A;  1SA0 A;  3NXS A;  4JI1 O;  5JWP A;  1K73 W;  5GTI Z;  3VQW A;  3RYI B;  4GT1 A;  3K58 A;  1AI5 A;  2ITD C;  4ICG A;  3P30 A;  3AG1 C;  4I7Z B;  5EZY A;  1MNG A;  2N04 A;  3CJH B;  3ZIA G;  5CA3 A;  3LSS A;  1N36 O;  2BSK B;  1VQ9 V;  3WG7 C;  4TV9 A;  1FAF A;  1Q5O A;  1ZL8 A;  3CC4 V;  1YCI A;  1IBM O;  3T1Y O;  2ZE6 A;  2ZXW C;  2RJZ A;  3QVN A;  2ZM6 O;  2QTS A;  3F5T A;  3CRR A;  5J2U A;  2OCH A;  3T4Z A;  4W4L A;  4PDV A;  3K59 A;  4EB6 A;  1ARO P;  3X2Q B;  4MVM A;  2FYU H;  2PF4 E;  3H1I H;  5KA5 A;  3D36 C;  3FYE B;  1RFY A;  3DSQ A;  1H2K A;  5L3C A;  3OFN G;  4UCU A;  2PZS A;  2W0X A;  3JD3 A;  1VP7 A;  4GX1 A;  1GM7 A;  5IDJ A;  1RPR A;  2QWO B;  1K92 A;  2JGD B;  2DYS B;  2YXL A;  1FJG O;  2B1I A;  2RCV A;  3LDD A;  3AK1 A;  1EN5 A;  1SKV A;  2ZM6 B;  3KG2 A;  3K08 A;  3OMN B;  2UUA B;  1URF A;  4DRX A;  3OEE G;  5GON A;  3ZRW B;  2AZ2 A;  1GM9 A;  4WCE V;  3ABK C;  5H6R A;  4UB6 Z;  4WFF A;  4FK5 C;  5B66 Z;  1VQ6 V;  1XIL A;  2HFE C;  4PI2 A;  1Y74 A;  3A0B Z;  3AG4 B;  3OR7 C;  3SR2 C;  3ZCC A;  4JYA O;  4DW0 A;  3VQY A;  1WN7 A;  4DV4 O;  5LP6 C;  4QPK A;  4CZZ A;  4AI8 A;  2ZXW B;  1COW G;  5D5Q A;  5BMV B;  1Y76 B;  4IHJ A;  4UCO A;  1NZ6 A;  1T5E A;  1PD3 A;  3BA8 A;  4YIP A;  5LHI A;  1M4U A;  1BS3 A;  1FXK A;  2ZIO A;  3K5L A;  5JH7 A;  3N2K B;  3R66 A;  3E35 A;  4PA6 A;  3CP1 A;  4B08 A;  4YXW G;  1Y67 A;  3L71 H;  3QNE A;  4U3F H;  3W7X A;  1AR1 B;  2HHH B;  5KHJ A;  4GX2 A;  5IWA O;  1XRE A;  3BCC H;  1TUB A;  1Y74 B;  4UB8 Z;  3IJ4 A;  2HP8 A;  3JAT B;  1UFI A;  4FFK A;  3H1L H;  1F23 A;  4MW3 A;  2DE0 X;  2LGW A;  4WF9 V;  4DV0 O;  3K0D A;  1JFF B;  5BZB A;  3FD9 A;  4FFB B;  4QNH B;  1FFX B;  5HFM A;  4X1K A;  4I55 A;  3ETD A;  1Q7Y W;  1H38 A;  4LFA O;  2YIC A;  1ZAU A;  5CMU A;  3ETQ A;  1N34 O;  1P7G A;  3DXR A;  4ZHQ A;  2ZE7 A;  1K33 A;  3AG2 C;  2RMK B;  3K06 A;  1Y76 A;  3RGB A;  4JTA B;  3CXC U;  3OUS A;  2ADQ B;  4J7Z A;  3IC7 A;  2OIG A;  4X9Q A;  4PV1 B;  2HR3 A;  2YS8 A;  3WB0 A;  1JOY A;  1NQT A;  3N2G A;  1GAX A;  2GDS A;  1NVP D;  1SZT A;  4O4L A;  3BRC A;  3ZHS A;  2YDE A;  1N8R W;  1NH2 D;  3J80 N;  2XAF A;  2JGD A;  4FFB A;  4B3R B;  4JI1 B;  4FPP A;  2JVD A;  1KMI Z;  1RM1 C;  4LF7 O;  4FZ1 A;  4RUF A;  2H8P C;  2HVJ C;  1BQZ A;  4YJ2 B;  1NT2 B;  4JI2 B;  4MVQ A;  2HVK C;  3K57 A;  1IBK B;  3DTU B;  5B1N A;  1D5A A;  3E8F A;  1AB3 A;  1V55 C;  3JAW B;  4WFA V;  1M57 B;  2XTA A;  2DW4 A;  1I0H A;  2H94 A;  3SGI A;  1TA8 A;  4DV6 B;  1RSO B;  4K8Z A;  3N2K A;  2Q5Z A;  1FXK B;  4NXN O;  2XAG A;  1S76 D;  5H9C A;  2JDI G;  5CBF A;  2UXB O;  3G6E V;  4FVM A;  4ZIB A;  4GKK B;  2WA4 A;  5IE9 A;  3E2E A;  4TOI A;  1R1B A;  2EIM C;  5BY1 A;  3E22 B;  1AJQ A;  1YXB A;  3DGE A;  4C7U A;  1XOU A;  2WLM A;  1RSO A;  1QBZ A;  2EIL C;  2P4K A;  3F7V C;  3ZRW A;  2R9I A;  4IIJ A;  4MW8 A;  2A9H A;  1XL6 A;  3ABL B;  1NVP B;  1HR0 B;  1P84 F;  4B7E A;  1F4N A;  3G6B A;  4CS4 A;  2ZCE A;  1OHH G;  5K1P A;  3A2F A;  4K3A A;  2WLJ A;  4YJ2 A;  1W59 A;  1SC5 B;  1YZB A;  2GSM B;  1SS3 A;  4DRX B;  4E2L A;  2ZNJ A;  2QSA A;  1M56 B;  3ZN1 A;  2JIZ G;  3E8G A;  5KHK A;  3LNN A;  4DK0 A;  3ABM C;  3ETE A;  3X2Q C;  1WAZ A;  4PA4 A;  4LF5 B;  4IYI A;  2PUS A;  3BAA A;  3N2G B;  3P3N A;  3FFQ A;  5KUM A;  1IUR A;  3GWO A;  3JCU Z;  2OYQ A;  5JCO A;  1H2G A;  3RYF B;  4D7T A;  3T1H O;  2L6L A;  4YHH O;  2OCC C;  5DM6 V;  4AQY O;  1JR9 A;  1YSC A;  5IYC O;  1BHA A;  1ZUQ A;  4DYL A;  3AG1 B;  3QO5 A;  3CJH A;  4I9Q A;  3LDE A;  2FKX A;  3ZRV A;  2XAH A;  4J41 A;  2UXC O;  1DF5 A;  4QIW F;  4DXW A;  4ZHQ B;  2CUG A;  2BTO A;  1I5X A;  4RQF A;  4U7O A;  3L74 H;  4JAA A;  2KB1 A;  2OTJ V;  4DV1 O;  2IW5 A;  2MK3 A;  4QPJ A;  5KMG B;  4JI5 O;  4JF3 A;  1F51 A;  2P22 C;  3T1H B;  3ICX A;  4WBN B;  3TK1 A;  3APQ A;  2DYS C;  1H8E G;  3B2E E;  2Y0P A;  3M99 B;  2LGQ A;  2AHY A;  2QKS A;  3WB2 A;  3AK3 A;  5BXZ A;  1E1Q G;  1NS1 A;  4B3T B;  1Z5W A;  2GHY A;  3QF7 A;  1MMM A;  2LW7 A;  4ASU G;  3OT7 A;  3OAA G;  4B3R O;  1K8A W;  4NVP A;  1LNQ A;  3JD1 A;  1NR7 A;  1PPJ H;  1KP3 A;  3QG5 A;  4JYY A;  1HP8 A;  4K0K B;  4LF9 O;  4KHP B;  3IGA C;  1FD9 A;  3SPI A;  5H2F Z;  1HNW B;  1N4C A;  1XHZ A;  2F93 B;  3CX5 F;  2AZ0 A;  4OX9 B;  1XNR O;  3G80 A;  1VF6 C;  4FLZ A;  4RWU A;  2KG7 A;  2ZD9 A;  1VQ7 V;  1Y6X A;  2XAQ A;  2EIN B;  2UXD O;  3AG7 A;  1GO3 F;  4UV8 A;  1EZJ A;  4NTW A;  4YJ3 A;  4EEQ A;  3N27 A;  3FKS G;  4BW5 A;  4X66 O;  2A3Q A;  4Q6G A;  1OCZ B;  1JQ0 A;  2CK3 G;  2BOC C;  4HZ3 A;  1NTM H;  2WA3 A;  1XNQ O;  1IBL B;  5LL6 Y;  1FPO A;  3UT5 A;  4AIL C;  4JYA B;  1BQ0 A;  2VWK A;  5DN6 G;  2QR4 A;  1ZWI C;  1M5I A;  2YEV B;  1N32 B;  2CH7 A;  5FLX N;  4WFB V;  2Y48 A;  5ITZ A;  3CCQ V;  4X20 A;  1YJN V;  2ILM A;  1F4M A;  3ZED A;  3RN4 A;  4KP4 A;  4JZG A;  4CBC A;  4JI4 B;  3CCL V;  5D5P A;  3U11 A;  1YJ9 V;  2P67 A;  4X66 B;  1V54 C;  1QLN A;  2Z0A A;  4JI3 B;  1PL4 A;  4GZR B;  5L3D A;  3K04 A;  5FL7 G;  5L3G A;  1AVM A;  4UCV A;  3VQX A;  1V54 B;  1LUW A;  1IZ3 A;  2WSS G;  1BL8 A;  3L72 H;  3OEH G;  5E1A C;  1DF4 A;  1EM1 A;  4B7K A;  2JEU A;  4X89 A;  3JD0 A;  1VQP V;  2OTL V;  2QWQ B;  4JZ2 A;  2B5U A;  3FAV A;  4OXS A;  1NH2 B;  3H1H H;  1K5Q A;  3M8A A;  4O2A B;  3OR6 C;  1K7D A;  3HKB A;  4LH6 A;  3U10 A;  4DR3 O;  1SET A;  2EIK C;  2R9R B;  1K3E A;  4UVB A;  5CB4 B;  4UCR A;  1AI7 A;  2YI8 A;  3SYC A;  5EBL C;  1DGS A;  3CXH F;  2AXT Z;  1XMO O;  3ZHQ A;  1NTK H;  4EFE A;  3AG2 B;  1N0J A;  3MDS A;  4NR1 A;  1HNZ B;  4LFC B;  4K8X A;  3IC9 A;  1G1X B;  1D2D A;  3BVO A;  3QTC A;  4O2B B;  4CS3 A;  4J11 A;  1XHX A;  4MSW C;  3OTO O;  1MSD A;  4U7N A;  4FLT A;  1Q82 W;  2CH7 B;  2BSK A;  1TVK A;  4ZOL B;  1R3J C;  4XBF A;  1XEQ A;  1AI6 A;  5JVD B;  1VQO V;  2QA4 V;  4DK1 A;  5FPR A;  2A06 H;  2QTO A;  2EJ7 A;  1HDJ A;  1JCH A;  1G4Y B;  4UCS A;  2WPD G;  1YVW A;  3EHB B;  5IJ0 A;  2V1D A;  2RDC A;  1OV9 A;  4JAV A;  1N0N A;  4BIU A;  2WLL A;  4PA7 A;  5K1X A;  5BR8 O;  1AP5 A;  1B06 A;  3UO3 A;  4JYB A;  4HNA B;  5IYB O;  3THO A;  3ZRS A;  1KB9 F;  3OGI B;  1KD1 W;  1WA8 A;  2KG7 B;  1KQS U;  2M6Y A;  2GUZ B;  4PA3 A;  5F2V O;  2ZNI A;  1BZK A;  3ABM B;  4UVC A;  2F95 B;  2XOK G;  5JQG B;  4F6R B;  5J2T B;  1N34 B;  4K0K O;  4X65 O;  1PKX A;  1XI1 A;  3SDL A;  1XUQ A;  1FS0 G;  3AG3 C;  2QWR B;  1XBL A;  4DW1 A;  1W0K G;  4J42 A;  1VEW A;  3T1C A;  4OX9 O;  1XNR B;  4RQE A;  2CAZ C;  2N05 A;  1YTF D;  4LC1 A;  4DV2 B;  3GB7 C;  3SJA C;  2VQE B;  4JV5 B;  4IHJ B;  4WFG A;  5CN0 A;  4DV7 O;  1IX9 A;  2ADP A;  3C3T A;  4X1I A;  2UU9 B;  1YEW A;  1OZ0 A;  4TV8 B;  1FJG B;  2ZIM A;  3HKD A;  4J9Z B;  2IU0 A;  3CCU V;  4XDJ A;  4JYC A;  2EZP A;  4H37 A;  3AG4 C;  3JAL A;  3A8T A;  2ZE8 A;  1E79 G;  4GKJ B;  5LP6 A;  3UM7 A;  5LOV A;  5KAI Z;  1NKD A;  4DV1 B;  4GLX A;  1QR9 A;  4TT3 G;  5KHH A;  2EIN C;  1OCC B;  1Q6H A;  1S77 D;  4O2B A;  1I5Y A;  2ODM A;  1J5E B;  4JI6 B;  2WLI A;  5FNV B;  2XHB A;  2DOS A;  2F23 A;  1QU7 A;  2VQF B;  2PYJ A;  2AW9 A;  5LP6 B;  1K97 A;  2Q4P A;  3C90 A;  4I9W A;  4DR1 B;  1G8M A;  2UUC B;  3CEI A;  1L0N H;  4I0X B;  5LGN A;  1R3I C;  3ZHT A;  1GK9 A;  3MHS C;  1VF6 A;  5KA6 A;  3CRM A;  1BE3 H;  3CRC A;  3ZMU A;  1ZSP A;  2XAJ A;  3FB5 C;  2DWE C;  5LGU A;  4CH4 A;  1GN4 A;  3ASO B;  3SJQ C;  5KAF Z;  3K0G A;  4TUY B;  1B04 A;  4DO2 A;  2BCC H;  3E22 A;  4MTF A;  1I94 O;  1PM9 A;  2IH1 C;  2P6J A;  1MG1 A;  4LF9 B;  2X0L A;  2P7T C;  1YHQ V;  1S5J A;  3JYC A;  2UXN A;  3CMA V;  5B1O A;  4FLY A;  4DUZ B;  3IFX A;  1L0L H;  1SES A;  3OE7 G;  2Q0A A;  2F43 G;  1B3Q A;  3OM3 B;  4FM1 A;  2UUC O;  1VQ8 V;  2OT5 A;  3JAK A;  3K3W A;  1M9N A;  1NBM G;  1Q90 D;  1M90 W;  1R6T A;  3ZJZ A;  5AG2 A;  4FLW A;  1R6K A;  4HNA A;  2QEX V;  4JGS A;  1AIL A;  4PD4 F;  4F6R A;  2IJK A;  1FXH A;  2ZR2 A;  3O9O A;  4PA9 A;  4MTX A;  4U3J A;  1VF5 B;  1S0V A;  1Z2G A;  2CTQ A;  5LYJ B;  4N23 A;  4EFB A;  4H13 B;  4CC6 A;  1LUV A;  4RAI A;  4FJC C;  5B1B B;  2VWJ A;  1WPX A;  1QVG U;  1WP7 A;  2WLH A;  3RVY A;  1QVF U;  1NR1 A;  4LNU B;  4LF4 O;  3SYP A;  2WLL B;  5IY5 B;  1G6U A;  1THZ A;  3EXA A;  3PN1 A;  1VQL V;  1AP6 A;  2K1E A;  5IYZ A;  3FB7 C;  2YIA A;  4L8J A;  1NTZ H;  3STZ C;  2JS5 A;  2C2A A;  4NB5 A;  1TUE B;  1HWY A;  3RWR D;  5KLV H;  3BEH A;  3C3S A;  2NR5 A;  5FPO A;  3NR7 A;  2B9Z A;  1WB8 A;  3RYC B;  1OCC C;  4DV2 O;  3OGC C;  5JJJ B;  2JK5 C;  3CCM V;  4WBN A;  3L70 H;  1VQM V;  3QO8 A;  3J7A U;  1FXK C;  2H3O A;  2XUM A;  4KUM A;  4FM0 A;  5LA6 A;  2AHZ A;  2V4D A;  4GX5 A;  4X88 A;  2YIB D;  4A5U B;  3JAT A;  1GTO A;  4NTX A;  2IU3 A;  1YDX A;  3F7Y C;  4DR5 O;  1H2L A;  4LR3 A;  3E8H A;  5EC1 C;  2OWO A;  3CWB H;  1EFR G;  3LUT B;  4TV8 A;  4JI7 O;  2OCC B;  3SPC A;  1NI8 A;  1N33 B;  3FX7 A;  3ML0 A;  3ZHR A;  2YUA A;  4FLX A;  5KHI A;  1H2N A;  4IIJ B;  5A2Q N;  2JJ1 G;  3I55 V;  1Q6U A;  1GM8 A;  5TIS Z;  3ZMT A;  2GBO A;  1L1F A;  2JEX A;  1K4D C;  2EIJ C;  3RVZ A;  4BR6 A;  4J7J A;  4YY3 O;  3JAR A;  5BMV A;  2EBO A;  2VQF O;  4O4H A;  1US6 A;  2PYL A;  1QLE C;  3UO2 A;  2EIK B;  4JI4 O;  1TVK B;  2X6A A;  2HJD A;  3A0R A;  4RO2 A;  5JQG A;  2M7W A;  2RNB A;  3TCU A;  2LFR A;  4H0L B;  2CE4 A;  5LMU O;  5GTH Z;  1DK1 A;  2VS0 A;  2Y4T A;  3WFV A;  4UXN A;  5BR8 B;  1SQF A;  2A7W A;  4YJ3 B;  4JTD B;  3UCS C;  1XDC A;  3JAS B;  2JJ2 G;  4DV4 B;  4O4I A;  1HNX O;  1IVS A;  1XNQ B;  3WG7 B;  1I7F A;  2EJR A;  4OGQ B;  5A9G A;  5CBG A;  2VQE O;  5KX5 B;  2EZO A;  4JV5 O;  4I50 B;  3FYI B;  3U0Z A;  5H6Q A;  1M93 A;  1P4R A;  2Q7G A;  3OW2 U;  1WB7 A;  2F66 C;  1IDS A;  3TJT A;  2GTS A;  2WLN A;  2ZDI A;  1JA8 A;  2V7Q G;  4MVS A;  2GTA A;  3GWK C;  3OD4 A;  4LFC O;  3MHH C;  2D2C B;  3EFF K;  4FIP C;  1BSM A;  2W6I G;  5IYD O;  2PI4 A;  4OPH A;  2Q0O C;  2UUB O;  4TQF A;  1S72 V;  3JCZ A;  1SQX H;  2PGG A;  4LF7 B;  1Q8I A;  4FLU A;  4L87 A;  2PY5 A;  3JAW A;  4B3T O;  4B3S B;  3WU2 Z;  5CB4 A;  1CPY A;  3H9V A;  2ETN A;  1JPX A;  1OCZ C;  3IAY A;  5JJN B;  3JSL A;  1XMQ O;  1MZE A;  1KEC A;  3SYO A;  2FML A;  2IJH A;  5KX5 A;  5DEC A;  1CEZ A;  2ZKO A;  2Y0I A;  2LFS A;  2YEV A;  2DYR B;  4KFM A;  3OMI B;  4X1K B;  2BOB C;  3OTO B;  1FYJ A;  4KXR A;  1R3L C;  1J5E O;  2CTR A;  2ZR3 A;  3LNM B;  2QM4 A;  2YI9 A;  3F5W C;  3RYF A;  3RYH B;  2FL4 A;  1PL0 A;  4Z1M G;  3ZMZ A;  1V55 B;  1F7Y A;  4BW9 A;  3DC6 A;  1CP9 A;  1Q3E A;  2QKA A;  4H44 B;  4X64 O;  2BTQ A;  5DED A;  2PI5 A;  2Y4U A;  2CGN A;  3LSU A;  1VF7 A;  2QKC A;  1S5L Z;  3DXR B;  3DC5 A;  4N21 A;  3SPG A;  1YIT V;  4TSF G;  5LGT A;  3W7U A;  3CCS V;  2WAM A;  3RBZ A;  4QJF B;  4NTY A;  1K5S A;  3D3Q A;  4CH5 A;  3B77 A;  4EKW A;  2ZT9 B;  1J95 A;  3ZBH A;  3ZX6 A;  3EVK A;  1OCR B;  1QHT A;  2QE7 G;  1RM1 B;  3JD4 A;  1GN6 A;  4ZBM A;  3SYA A;  2GV9 A;  4DR5 B;  1OJH A;  1TUB B;  4X65 B;  1Q86 W;  5C8Y A;  3RYH A;  5B5E Z;  2F4V B;  4DV3 B;  2HLD G;  5LA6 B;  3ZS8 C;  2D3O W;  2AGA A;  4GUN A;  1YIJ V;  1VIB A;  3H01 A;  5IT9 N;  5IJ9 B;  4XDL A;  5KMG A;  2QJ1 A;  3JAR B;  3BAB A;  4WFE A;  5LHG A;  5B1A C;  4Z1V A;  2EIM B;  1IXB A;  3CCR V;  4BIO A;  1U96 A;  2P5O A;  3E83 A;  4JTC B;  4GYC B;  3RT3 C;  3I5D A;  1SQP H;  2A79 B;  2JS3 A;  2MW2 B;  5KHG A;  1OCR C;  3TXS A;  4DR4 O;  4F6E A;  1BCC H;  1SZX A;  3ZN0 A;  3CS5 A;  4UVA A;  4DV5 B;  2IBZ H;  4DV6 O;  2LW1 A;  1PNM A;  2ITC C;  3FB6 C;  3L73 H;  3S3W A;  3LSQ A;  1ENV A;  2ARH A;  1W2B U;  3AK2 A;  4I50 A;  4X62 B;  3CE2 A;  5LHH A;  4HYO A;  1SQG A;  4K35 A;  3ZRX A;  3UQ8 A; 
#chains in the Genus database with same CATH homology
 1FAF A;  2QWR B;  1XBL A;  2M6Y A;  2Y4U A;  2GUZ B;  2QWP B;  1NZ6 A;  2CTR A;  2EJ7 A;  2CTQ A;  2YS8 A;  1N4C A;  3APQ A;  1HDJ A;  4J80 A;  2N05 A;  2CTP A;  3BVO A;  1IUR A;  2KQX A;  1BQZ A;  2CUG A;  2QWN B;  2LGW A;  4IT5 A;  2OCH A;  1WJZ A;  2Y4T A;  2QWO B;  1FPO A;  2GUZ A;  2L6L A;  4RWU A;  1BQ0 A;  2DN9 A;  1GH6 A;  3APO A;  2CTW A;  3UO3 A;  2QSA A;  2N04 A;  4J7Z A;  3UCS C;  2PF4 E;  2LO1 A;  3AG7 A;  3UO2 A;  2YUA A;  2QWQ B;  2DMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...