2OCHA

J-domain of dnj-12 from caenorhabditis elegans
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
66
Chain Sequence
KETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPDGAEQFKQISQAYEVLSDEKKRQIYDQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein dnj-12
publication title X-ray crystal structure of J-domain of dnj-12 from Caenorhabditis elegans.
rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 21
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ochA00
2CTPA 1FPOA 2Y4UA 2QWNB 2N04A 4J7ZA 1GH6A 1WJZA 2QWQB 2DN9A 2M6YA 2QSAA 2CTWA 3UO2A 2Y4TA 3APQA 4J80A 1BQ0A 2OCHA 2CTRA 2CTQA 2KQXA 4IT5A 2QWRB 2LGWA 1XBLA 2LO1A 1FAFA 1BQZA 2GUZA 2QWPB 3AG7A 2YUAA 3BVOA 2DMXA 2GUZB 2N05A 1HDJA 2QWOB 2PF4E 3APOA 3UO3A 2YS8A 2EJ7A 1NZ6A 1N4CA 3UCSC 2CUGA 1IURA 4RWUA 2L6LA
chains in the Genus database with same CATH superfamily
4DV6B 3CCSV 2N04A 4UCOA 3RGBA 2R9AA 1BE3H 1Y74A 3THOA 4UCTA 3H9VA 1H2GA 4BIUA 3P3PA 1VQOV 1IXMA 3G6EV 3JARB 3ZJZA 1RM1C 4WFGA 3K9SA 1EN5A 4MVRA 4LF9B 3CXCU 4E2LA 4U3JB 3A0RA 4HYOA 1W59A 1N33B 1FFXA 1I94B 1J5EO 4NKGB 4LNUA 4I9QA 2IJHA 1LUWA 3UQ8A 1SESA 3CRMA 4PI0A 4JPRA 3T4DA 3RVZA 4OX9O 2R9IA 2WLMA 4E4EA 2DYSC 3E8HA 3CSXA 1XMOB 5LHIA 3K0GA 5LMUB 3ZMTA 2DQ0A 5IYDO 4CZZA 3PJSK 1BMFG 1DF4A 1OZ0A 2VQFB 5LXTB 1K4CC 4MW8A 1BT8A 3HKCB 1VIBA 1EN4A 2VQEO 3W7SA 4IHJB 4X62B 4JI5O 1KUQA 1VQLV 1OHHG 1ZAUA 1VQPV 1OCOB 4I55A 4TQDA 3UO2A 2IU0A 1ZUQA 3HKCA 4FM2A 1GN4A 3FB7C 4NXNB 5GTIZ 1PD3A 3AG7A 2JK5C 5E1AC 4WCEV 5H9CA 5L3GA 3TETA 1XOUA 1CXZB 2UXDB 5FLXN 2UXBO 5B1AC 5B1BB 3ASNC 3TGUH 5IJ0B 2K9PA 4FLYA 4F6EA 4EFBA 5LHGA 5EIBD 4FM1A 4DR1O 1OCRB 1XUQA 1K5SA 1F4NA 1E79G 3SR2C 3QO5A 4XDKA 1JFFA 2QGNA 1P7BA 2JJ2G 4P30A 5IJ0A 1IZ3A 5LBQA 4GX5A 1XDCA 1R73A 4JI4B 2QWQB 4JI2O 3Q4HA 1YEWA 3CJHB 1QLEC 3T1YB 4GKKB 4ZBMA 3ZRWA 1YJ9V 4NTXA 1VQNV 1I0HA 2VWKA 2EULA 4X66O 1G8MA 3ZS8C 5C8YB 1BGYH 1TAEA 1RPOA 2ZE5A 1XHZA 3CJHA 1MSWD 1M57C 2DJVA 2R9RB 1QVFU 4WF9V 4LF6B 2ZCEA 3F5TA 1GN3A 4QGPA 1FXVA 3S3WA 3G67A 5C8YA 1XL4A 5KA6A 1D5NA 2QR4A 3ABTA 2BOBC 3ZHUA 3ZN1A 3WG7B 3VQWA 2Y69C 4ZI7B 4EFEA 1THZA 3LDCA 1FFTB 1HP8A 4FM0A 1RFYA 3FYIB 4K8XA 2WWWA 2W6IG 5A9GA 3TJTA 1NVPD 3SYQA 4YY3B 4JI8O 2WLKA 3R66A 4CS4A 4FPPA 4J7ZA 1SQPH 3RBZA 4PHZA 3BABA 4QJFB 2JS3A 3E2EA 1S5JA 5IJ9B 1JOYA 4JTDB 1Z5VA 3B40A 1G1XB 2DMXA 1WA8B 1IXBA 5KA5A 4PD4F 2YSUB 2GSMB 1L1FA 3T4ZA 3K3WA 5KMGA 2QEXV 2YIDA 1R3JC 2ZM6B 2A9HA 3FB6C 1ZWIC 1BL8A 3UT5B 3RW0A 1TUEB 3LDEA 4ZOLB 1HNZO 4DR6O 2P6JA 1XILA 1LR1A 3B09A 3ZX6A 4PDLA 3RFRA 4IIJA 1NBMG 5EZYB 1RPRA 1VF7A 4MTXA 3F5WC 4GT1A 1R3KC 1IDSA 5LA6B 3UT5A 2Q9LA 3OMAB 1SF9A 2AXTZ 1N8RW 3DC6A 4JYAO 4RUFA 1OCZB 2UUBB 1K97A 5A2QN 3G6BA 4ASUG 1NTKH 3C90A 1S3JA 4TV9B 1XL6A 5EK0A 3AK1A 2DQ3A 2B9ZA 1V55C 4JGSA 4DXWA 5IYBO 5ITZA 4WBNB 5KHIA 2UUAB 2P7TC 3ASOB 2QA4V 3OGIB 2B5UA 4FFBB 4H13B 1VQ7V 1QR8A 3K04A 2P67A 5LYJA 5IT9N 4ZKIA 1DLBA 1NR7A 1FS0G 2Q4PA 3HR0A 3CCLV 4TV9A 3KCYA 1XNRO 4P2ZA 1VQ4V 2YUAA 3E22A 4MTGA 1KU9A 2ZR3A 1B6QA 1QNMA 3RYCB 4BW5A 2F1MA 2LW1A 3D3QA 4WBNA 4D6TH 2H94A 2JEUA 4FVMA 3MDSA 1LNQA 2E3CA 4LWSB 1K5QA 1F51A 2GDSA 1Q43A 5JJJB 1KKCA 3P3NA 3HKEA 4FFKA 3ETQA 4PA7A 1VQMV 3ABKB 3F7YC 3RYCA 3IC9A 3H1LH 4I9WA 1Y66A 5BXZA 3RYHB 3WB0A 3T1HB 1S77D 2LQTA 2ZE7A 3FYEB 1IURA 4LWSA 4J9ZB 2OCCC 1NTZH 3JALB 2M7WA 1VQKV 4BAYA 4JV5O 4JI6O 4G2KA 3STLC 3APQA 3HB3B 4DV6O 4PDRA 1K4DC 2FL4A 1P7GA 1JPXA 3WG7C 2Q5ZA 1WB8A 3K5OA 3RYHA 2HEPA 4LFAB 3OR6C 1M5IA 3M99B 2JGUA 4B3TO 1UPGA 3DXRB 2F4VO 3CCRV 4BWAA 1YTFD 2QWNB 1MNGA 3ZHSA 4LF9O 4C7UA 4KFMA 1N33O 1I94O 1NKDA 3SYPA 3CP1A 3SYCA 3O65A 2JVDA 5BR8B 4TT3G 2WLIA 4JI1B 4JASA 3DXRA 1N4CA 2HHHB 2A79B 2UXNA 2XAJA 3E35A 4P9PA 1XMOO 3EXAA 3QO7A 3C3SA 4J41A 1NH2B 1BQ0A 3IC7A 2OCHA 4TQFA 4WFHA 5EYPB 5J2UB 1SRYA 2FKXA 4PA9A 2VQFO 4JI0B 1RM1B 2CGOA 4X1KB 3C3TA 3K58A 3BPZA 1K92A 2KSDA 5J2TB 4TWKA 2XTAA 4UVCA 3ZMUA 4X62O 2HG5C 2QDOA 2BSKB 4DRXB 3G71V 1TUBB 1LUVA 2GV9A 1OV9A 2WLLA 3FB8C 1Y6XA 4LF5B 1FJGB 4J10A 5EYPA 5CA3A 5J2UA 4I4TB 3NR7A 4YIPA 4W4KA 1Q6HA 3LSSA 4PDMA 1FAFA 4X1KA 2F95B 1OCZC 1JQ0A 4DK0A 5FPRA 2DYSB 5J2TA 1SZXA 2Y48A 2CH7B 1YIJV 3ABLC 2CGNA 4DRXA 2IJJA 1K73W 1KKDA 1X4TA 4I4TA 4PJ0Z 2QTSA 1WPXA 4B3RB 4U7OA 2QKAA 3K5MA 2HLDG 1PM9A 1TA8A 1QQCA 4ZIBA 2GTAA 1GAXA 1K9MW 3FAVA 1G6UA 3E86A 2JGDA 3GVMA 1K3EA 1X59A 1IBLB 4DV7B 1GO3F 1R6TA 1PL4A 4NXMB 2ZXWC 4ABMA 2WPDG 3T1YO 4GKKO 4OPAA 3K79A 2PF4E 2ZDIA 3STZC 5B1AB 5HFLA 3WB1A 1WLEA 3ABKC 1SQVH 1PNLA 3ASNB 1JJ2U 4O4HA 3B8NA 4J7KA 2K1EA 2IM9A 5CB4B 2XOKG 1QBZA 2EIKC 1ZSPA 2RN9A 3SDLA 2BCCH 3VQXA 2QKCA 4IYIA 1M9NA 1GN6A 4LH7A 1H8EG 3OM3B 3JD0A 4DR4B 3ZHRA 4DR2B 2L35A 3JCUZ 4JI7B 4MW3A 1VF6C 1R3IC 2Q8VA 1ZL8B 4KHPB 1WN7A 3QO8A 5CB4A 2JIZG 3ETDA 2OTJV 2L6LA 2CTPA 3CC4V 3CC7V 1QLEB 3KKYA 1TVKA 2PTMA 4GX2A 2FMLA 1IBMB 5KAFZ 2UU9B 4QPKA 2RJZA 5FPOA 2YIBA 2AGAA 1H8HG 1Y74B 2YC0A 1XQ8A 3OR7C 1ZL8A 2OYQA 5KLVH 1NI8A 1QHTA 2AHZA 1ORQC 1AJPA 1M57B 5D5QA 2DWDC 3H1HH 3BA8A 3H1KH 4PI2A 3K57A 2HKOA 1XNQO 1FFXB 1Q81W 2ADPA 4LNUB 3CWBH 4GLXA 4H44B 1XBLA 5LP6A 2YIAA 4FLZA 4X64B 2Y0IA 3ZHTA 1GM9A 5LMNB 2YXLA 1GM7A 5CBGA 1KMIZ 4YIOA 4DUZO 2ZIOA 2UUCO 5CBFA 4QE7A 3L9DA 3AG3C 2Y69B 4IGGA 2CTRA 5DEDA 2NNUA 4L8JA 1CEZA 4MTFA 3RYIB 4QIWF 3OGCC 2RCVA 5DN6G 1H38A 4O4LA 3CB2A 2B1GA 5JJEB 4IYHA 4J7JA 4DV3B 4GYCB 3CCEV 5LHHA 4H37A 1FXKB 2HP8A 4I55B 5CA0A 3RYIA 3SYOA 2RDCA 4R6ZA 3ZMZA 5CMUA 3B2EE 3LSQA 1W0JG 4HNAA 4YHHB 4FZ1A 3UCSC 1AR4A 2QM4A 3ZRVA 1M56C 1N32O 5BZBA 2Z5UA 2ZDIC 1FXKA 2WLNA 1HNXB 4L87A 2X7RB 2CTQA 3CCUV 4DR5O 3RT3C 4LF8B 3MHSC 4JAVA 3SPJA 1ROPA 1UFIA 2IJKA 3JASA 1O9HA 4AHCA 4DYLA 1JFFB 4JF3A 3RYFB 2LP7A 3VBBA 4LH6A 2CAZC 1MZEA 3OTFA 5CA1A 1HR0B 3Q4HB 3K06A 2QWRB 2LGWA 4K0KB 3ZCCA 3SGIA 2Q6AA 4AQYB 4UB8Z 1V55B 4I7ZB 3GWKC 3RYFA 4X1YA 2WAMA 4PA3A 3ZRWB 5L3BA 1MA1A 2Y0PA 1Z2GA 3T1HO 4JYBA 4DV2O 2Q73A 1Y67A 1K8AW 3I5DA 3QVNA 3KZIZ 2OT5A 4LFCB 1Q6IA 2PYLA 3MD0A 4QPJA 4TV8A 3IAYA 4YJ3A 4X65B 2YICA 4BW9A 4X1IB 4LF4B 3BHPA 5LP6C 3EVKA 3CRRA 1AJNA 3UM7A 4LFAO 1AI7A 3CPWU 4LF7O 4RQFA 2UXXA 3SJQC 2F43G 3FB5C 5IWAB 2RQ6A 4DV1B 4UCSA 2XAHA 4ICGA 4CH3A 1MSDA 1YXBA 1KQSU 4O4IA 4X1IA 4GUNA 4GKJO 1AI5A 5B1OA 3JAWA 2HVJC 1WNSA 2OCCB 2VWJA 4MT8A 5B1NA 4ZHQB 3PN1A 3JD4A 5KX5A 4JI1O 2PYJA 3WU2Z 4GCZA 4LC1A 3A8TA 2HHHO 1P84F 4X8AA 2GTSA 3ZRXA 1R6NA 2MW2B 3D36A 3OE7G 2RNBA 3JSNA 5JH7B 2GUZB 4PELA 4ZHQA 1GRJA 2QJ1A 4JI0O 3QG5A 4RWUA 5BMVA 4F4LA 5F2VO 5K1XA 5KMGB 4LR3A 3OMIB 4DV5B 4K8ZA 2KQXA 4MS2A 1FXKC 5JH7A 2GUZA 5L3FA 1FJGO 4LF5O 5AG2A 5E79Z 2E75B 3NXSA 3CC2V 2CUGA 1JMKC 1RP3B 3I55V 2E5LO 4IIJB 3F7VC 4YJ2A 4UV8A 1BHBA 2Y4TA 4HZ3A 4FZ0A 1WP8A 2D3OW 4CS2A 3OUFA 4RUEA 1GM8A 4JYYA 3J7AU 4B3RO 2EJRA 3QTCA 1M1KW 2LFRA 1NH2D 1J5EB 2ZINA 3LDDA 1N36B 1L8DA 1SC5B 2YDEA 3R65A 1T5EA 1GTOA 5ITZB 3FD9A 3J81N 5KUKA 2WA4A 4FLUA 3D8CA 4B7KA 1IBLO 5LYJB 1Y76B 2ZR2A 4DV7O 1VP7A 3E8FA 5FNVA 2N05A 3ABLB 5DECA 4NXMO 2FYUH 1JX9A 3E22B 1F7YA 4O4JB 4XBFA 4H0LB 1R3LC 3BRCA 2C2AA 2PZSA 4JTCB 1Y76A 4B3MB 4O2AB 1R1BA 3SJCC 4DR4O 4PA4A 4DR2O 3HKEB 5IYZB 4O4JA 3H1IH 1EM1A 4JI7O 1HNWB 4KHPO 4JTAB 3JAKB 4O2AA 4XDLA 1U97A 2AW9A 4FLTA 2ZXWB 2XUMA 1UJWB 4DK1A 1PL0A 2XAGA 1IBMO 5IYZA 4CC6A 2UXBB 3D36C 3H1JH 2LFSA 3P32A 1PV0A 2EIKB 1QVGU 3BFRA 4JAAA 3CCQV 3JAKA 1M90W 2XAQA 1H2LA 2UXCB 1HW7A 2E74B 2ZNIA 1N0NA 3LNMB 4DR7B 5H6QA 1VEWA 2LJ2A 4FIPC 4QNHB 4LCUC 3E83A 2YEVA 4JI2B 5LMNO 2WLIB 1B3QA 3J80N 5GONA 3TCUA 2Q7EA 4K35A 2X6BA 4UUJC 1WJZA 4MTOA 4KUMA 5LGTA 2E76B 4JZ2A 1MOFA 2PUSA 1VF6A 4BIOA 5H5NA 4N21A 1GN2A 1H2NA 2OWOA 4HAMA 1DK1A 1P4RA 3TXSA 3FKSG 4MVQA 3ZN0A 3B77A 5EBLC 5LMUO 4DV3O 4R8CA 4IT5A 2WLLB 2ETNA 2V7QG 4DW1A 2Q7HA 2VRZA 3GB7C 3ZHQA 4NB5A 1VQ6V 1GKFA 4IL6Z 1MABG 5JVDB 1H2SB 4Z1MG 3AG3B 2QE7G 4YHHO 2YXYA 1E1QG 4G27B 2QSAA 3FFQA 3CMAV 5KHHA 2P22C 4JI3B 4LFBB 4DV0B 2BTQB 1BSMA 4JYCA 1K33A 5JWPA 4DR3B 3M8AA 2D2CB 4LF8O 4NXNO 4D7TA 5JVDA 5L3EA 5LL6Y 2IH3C 3OMNB 4GX1A 5EIBC 5L3DA 4OXSA 3SYAA 2XNDG 2Q0OC 2UXDO 1US6A 3FAVB 2JJ1G 2JGDB 4R50A 2ILMA 2BTQA 1SS3A 2RMKB 3L70H 1VF5B 1AR5A 1R6KA 3KG2A 3N2GA 4K0KO 2NLJC 1M56B 1KP2A 1BCCH 2EILC 1AILA 4AQYO 5KHGA 4R7CA 1G4YB 1Y4MA 1ZLZA 3CS5A 2Y4UA 3OEHG 4O4HB 1AI4A 3ABUA 5IYCO 2ATKC 2ITDC 1IBKB 1SA0A 3P30A 3TK1A 3BEHA 1W0KG 4JI4O 5K1PA 1S5HC 3B4SA 1N34B 1SQFA 5CBHA 3BVOA 4LFCO 3VQYA 2PI4A 4FJCC 1V54C 2EINC 5LOVB 3OAAG 4LF4O 1SQBH 1PNKA 2CDYA 1I7FA 2R70A 3ETEA 2IU3A 3HKBA 1A32A 1TVKB 2OIGA 5IWAO 4LF6O 2FTKA 3VQVA 4LP8A 2EX3A 5LOVA 4YXWG 3MHHC 5KAIZ 3L72H 4TSFG 3JD1A 3MAQA 4UXNA 2WA3A 4J80A 2VS0A 3N27A 1HWYA 3OD4A 5JCOA 1NR1A 3OT7A 2HR3A 4G28B 2W6JG 1E1RG 5LP6B 2A3QA 3CX5F 3ZMSA 1AJQA 1KBHA 4O2BB 2KB1A 3X2QC 4FLXA 4YY3O 2JRIA 4P9OA 2QM8A 5B3SC 4HBNA 1EZJA 1DGSA 4FLVA 2WLJA 1FD9A 1DTOA 4UVBA 2EIMC 4O2BA 4JI6B 1RSOA 1NT2B 1FPOA 1AR1B 5B66Z 3ZBHA 2Q69A 4O4LB 1GH6A 1BHAA 4X20B 2JS5A 3E8BA 1FXHA 2ZIMA 2EIJC 3OFNG 3TXQA 1QLNA 5J9PC 4LBEC 2FB5A 2Q7GA 2LO1A 1GK9A 3LUTB 2ZM6O 4B3TB 5CA0B 3OTOB 1NU1H 1VQ8V 2F4VB 3N2KA 1XEQA 3EHBB 3VOUA 4B3SB 3D3IA 2Q67A 4HNAB 4DUYB 4X20A 4DO2A 1N36O 1SKVA 1D2DA 5H2FZ 3SPCA 4CH4A 1COWG 1XMQB 3JARA 3AG2C 1OCCC 1YZBA 2EBOA 5LGUA 3CCJV 4I5SA 1YITV 2UUBO 2OIEA 2WSSG 4EKWA 4U3JA 1SETA 5CN0A 3U11A 3JASB 4WFFA 4UV9A 4X88A 2IJIA 5D5PA 4FLWA 3AG1B 4PDVA 2UUAO 4Z1VA 4J11A 2P90A 5CA1B 2DYRC 3UKMA 3BA9A 4B3MO 3SJBC 3IGAC 1VARA 2XAFA 3SPIA 5GW7A 4X1YB 4FMTA 3AG4C 2DE0X 2ZNJA 5LXTA 1HNWO 1YDXA 1SQXH 1J95A 3A0BZ 3BAAA 1MG1A 4IHJA 4JAUA 1KYOF 1JVMA 3I56V 4TV8B 3ML0A 4YJ3B 5KUMA 1QR9A 3ZHVA 5JCOC 1SZTA 5KHJA 3KCXA 2P06A 3ABMC 1Q90D 1WB7A 4DV4B 2CE4A 3CHXA 2UXCO 3ZIAG 2W0FC 3QF7A 1EZVH 3APOA 2Z3YA 4DR7O 1URFA 4O4IB 4Q20A 1SQQH 2DW4A 3CE2A 3JAWB 4UB6Z 2YI8A 2KG7B 5GTHZ 1KB9F 5KX5B 4X89A 1AP5A 3K59A 2P4VA 3DSQA 3G4SV 2ITCC 1PNMA 3OW2U 1EN6A 1S5LZ 4BR6A 4NVPA 4PV1B 2AZ2A 3JATB 1MMMA 4AILC 3QNEA 2KG7A 5BR8O 1YSCA 2P5OA 3DGEA 1I5YA 4PA6A 1XI1A 1KC8W 5BMVB 2ZE8A 3SJAC 1BQZA 2EZOA 3JATA 1QU7A 1K7DA 1Q8IA 1NZ6A 1S72V 4NTYA 2XT9A 5JQGB 1O9GA 3JD2A 2X6AA 2G38A 4YJ2B 2R72A 1WAZA 1KECA 3RN4A 2BE3A 1JA8A 4JI3O 4LFBO 2HFEC 3DC5A 4CS3A 4DV0O 4MVSA 1JCHA 1KP3A 3SPGA 4NYKA 4DR3O 3G80A 4KXRA 3JD3A 1XNQB 4WFEA 2V4DA 3LNNA 5JQGA 1U96A 3K0DA 3CRAA 3O9OA 1YJNV 4ZI7A 2M6YA 3JCZA 3WB2A 1W2BU 1AROP 5L3CA 4DUZB 2QWPB 2PGGA 3AG1C 5LGNA 1L0NH 2O57A 1GMGA 1AVMA 2UUCB 1NS1A 1YVWA 5EBMC 3RVYA 5FNVB 2AHYA 5C93A 2WLHA 2H3OA 4NR1A 4BIZA 1ENVA 2IW5A 4KL1A 4EEQA 5IJ9A 3SPHA 1OCOC 2BTOA 5IDJA 1N0JA 1AB3A 2ZD9A 1Q82W 4OX9B 1EFRG 3LSUA 1WA8A 4CC5A 1IBKO 1BZKA 4RO2A 3E89A 1N34O 1Q5OA 4GZRB 3DTUB 2LGQA 4D7SA 4QE9A 2ADQB 3CCMV 4UCUA 5B1BC 3A2FA 2EZPA 4ZOLA 1V9PA 4CH5A 2XHBA 2VQEB 4B7EA 4JI5B 1OCRC 1NJIW 1N32B 1HDJA 2EILB 5EZYA 4WFBV 1F23A 5FL7G 1VQ5V 1MZFA 3K9AA 4W4LA 5LA6A 1I5XA 4MVMA 4DR5B 3W7WA 2IBZH 1YF2A 5IY5B 1Q3EA 2IH1C 3CRCA 1B06A 2A0LA 2YI9A 4JZGA 1V54B 4H33A 2EINB 3CD6V 1D5AA 2UU9O 2QKSA 4J42A 2QM7A 4MVUA 3CCVV 3K03A 2ZE6A 2YXHA 2QWOB 5H6RA 4FFBA 2YEVB 4MVZA 5TISZ 3ETGA 4DR1B 5GONB 2W0XA 2CTWA 1EBOA 4DW0A 4EB6B 2F23A 1PPJH 3T2MA 2GBOA 3AEIA 1Q6UA 3ZRSA 3CEIA 4U3FH 4DV2B 4X64O 3L75H 2A06H 3W7TA 2NR5A 3BCCH 3W7UA 5HFMA 2ZKOA 3ICXA 3IFXA 4AI8A 2HJFC 2X0LA 4EB6A 2DN9A 5DM6V 1NVPB 1CP9A 2A7WA 3T1CA 1CPYA 2YIBD 1YJWV 3WFVA 1JJOA 1FYJA 5BY1A 1ZX3A 3ZMVA 4TUYB 1M4UA 1Z5WA 5EBWC 4X66B 4OPHA 3BY6A 2ZQMA 3CRQA 3JALA 2F66C 3OTOO 4LF7B 3X2QB 3GWOA 1IVSA 4Q6GA 2LW7A 1K34A 4B3SO 3H01A 2ODMA 2ZT9B 4MVOA 5B3SB 5IE9A 2Q68A 4DUYO 1YCIA 2GHYA 1YHQV 4Z2WA 4GKJB 4TUYA 5JJNB 1XMQO 4F6RB 3AK2A 5EC1C 3CYOA 2EIMB 4I50B 4K3AA 1P49A 4MSWC 3B8MA 2ARHA 2X6CA 3HPLC 2EIJB 3L73H 1H2KA 2Q0AA 4WFAV 2JEXA 1S76D 2P4KA 4F6RA 2JDIG 2F93B 4RQEA 1HNXO 2BOCC 2PY5A 4JI8B 4I50A 3S3XA 1VMGA 1M93A 2OTLV 3N2GB 4OGQB 4GX0A 1Q86W 4NTWA 4I0XB 4TOIA 3AG2B 1OCCB 1SA0B 1XREA 1HR0O 1NQTA 2B1IA 2Z0AA 2E5LB 1YI2V 2PI5A 3E8GA 1WPBA 3ZEDA 5KHKA 2BSKA 1TUBA 4I0XA 4A5UB 3M7MX 1HNZB 4DR6B 3ASOC 2DYRB 2DOSA 1S0VA 1ZTEA 1PP9H 5IY5C 4U7NA 3U10A 2CH7A 3HKBB 2MK3A 4DV4O 1DF5A 3UO3A 1AI6A 4CBCA 3AG4B 4X65O 4JYAB 1JR9A 2CK3G 1BS3A 1OJHA 3CMEV 4XDJA 2XASA 1PKXA 5EC2C 3FX7A 1AP6A 4X9QA 2H8PC 3JAMN 4J9YB 4DV1O 4CH6A 1Q7YW 2EJ7A 4UCRA 3L71H 1IX9A 3HKDB 3ABMB 3A0HZ 3EFFK 1NTMH 2N74A 2HJDA 4UFZA 1XNRB 1KD1W 2AZ0A 1YTFB 3CXHF 4FK5C 1F4MA 3OUSA 3HKDA 3W7XA 1H2MA 3JYCA 3K5NA 1SERA 3RWRD 1L0LH 1SQGA 5B5EZ 4UVAA 1FKAO 1XHXA 1RSOB 4N23A 2HVKC 2DWEC 3K08A 3JSLA 1I08A 1B04A 2NN4A 1TGOA 4UCVA 4RAIA 1VQ9V 3IJ4A 4DV5O 3OEEG 2KKWA 1WP7A 4KP4A 2QTOA 2YS8A 3AK3A 1QCEA 3K5LA 3U0ZA 4B08A 4JV5B 2V1DA 3N2KB 3L74H
chains in the Genus database with same CATH topology
2CTPA 1FPOA 2Y4UA 2QWNB 2N04A 4J7ZA 1GH6A 1WJZA 2QWQB 2DN9A 2M6YA 2QSAA 2CTWA 3UO2A 2Y4TA 3APQA 4J80A 1BQ0A 2OCHA 2CTRA 2CTQA 2KQXA 4IT5A 2QWRB 2LGWA 1XBLA 2LO1A 1FAFA 1BQZA 2GUZA 2QWPB 3AG7A 2YUAA 3BVOA 2DMXA 2GUZB 2N05A 1HDJA 2QWOB 2PF4E 3APOA 3UO3A 2YS8A 2EJ7A 1NZ6A 1N4CA 3UCSC 2CUGA 1IURA 4RWUA 2L6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTP A;  1FPO A;  2Y4U A;  2QWN B;  2N04 A;  4J7Z A;  1GH6 A;  1WJZ A;  2QWQ B;  2DN9 A;  2M6Y A;  2QSA A;  2CTW A;  3UO2 A;  2Y4T A;  3APQ A;  4J80 A;  1BQ0 A;  2OCH A;  2CTR A;  2CTQ A;  2KQX A;  4IT5 A;  2QWR B;  2LGW A;  1XBL A;  2LO1 A;  1FAF A;  1BQZ A;  2GUZ A;  2QWP B;  3AG7 A;  2YUA A;  3BVO A;  2DMX A;  2GUZ B;  2N05 A;  1HDJ A;  2QWO B;  2PF4 E;  3APO A;  3UO3 A;  2YS8 A;  2EJ7 A;  1NZ6 A;  1N4C A;  3UCS C;  2CUG A;  1IUR A;  4RWU A;  2L6L A; 
#chains in the Genus database with same CATH topology
 4DV6 B;  3CCS V;  2N04 A;  4UCO A;  3RGB A;  2R9A A;  1BE3 H;  1Y74 A;  3THO A;  4UCT A;  3H9V A;  1H2G A;  4BIU A;  3P3P A;  1VQO V;  1IXM A;  3G6E V;  3JAR B;  3ZJZ A;  1RM1 C;  4WFG A;  3K9S A;  1EN5 A;  4MVR A;  4LF9 B;  3CXC U;  4E2L A;  4U3J B;  3A0R A;  4HYO A;  1W59 A;  1N33 B;  1FFX A;  1I94 B;  1J5E O;  4NKG B;  4LNU A;  4I9Q A;  2IJH A;  1LUW A;  3UQ8 A;  1SES A;  3CRM A;  4PI0 A;  4JPR A;  3T4D A;  3RVZ A;  4OX9 O;  2R9I A;  2WLM A;  4E4E A;  2DYS C;  3E8H A;  3CSX A;  1XMO B;  5LHI A;  3K0G A;  5LMU B;  3ZMT A;  2DQ0 A;  5IYD O;  4CZZ A;  3PJS K;  1BMF G;  1DF4 A;  1OZ0 A;  2VQF B;  5LXT B;  1K4C C;  4MW8 A;  1BT8 A;  3HKC B;  1VIB A;  1EN4 A;  2VQE O;  3W7S A;  4IHJ B;  4X62 B;  4JI5 O;  1KUQ A;  1VQL V;  1OHH G;  1ZAU A;  1VQP V;  1OCO B;  4I55 A;  4TQD A;  3UO2 A;  2IU0 A;  1ZUQ A;  3HKC A;  4FM2 A;  1GN4 A;  3FB7 C;  4NXN B;  5GTI Z;  1PD3 A;  3AG7 A;  2JK5 C;  5E1A C;  4WCE V;  5H9C A;  5L3G A;  3TET A;  1XOU A;  1CXZ B;  2UXD B;  5FLX N;  2UXB O;  5B1A C;  5B1B B;  3ASN C;  3TGU H;  5IJ0 B;  2K9P A;  4FLY A;  4F6E A;  4EFB A;  5LHG A;  5EIB D;  4FM1 A;  4DR1 O;  1OCR B;  1XUQ A;  1K5S A;  1F4N A;  1E79 G;  3SR2 C;  3QO5 A;  4XDK A;  1JFF A;  2QGN A;  1P7B A;  2JJ2 G;  4P30 A;  5IJ0 A;  1IZ3 A;  5LBQ A;  4GX5 A;  1XDC A;  1R73 A;  4JI4 B;  2QWQ B;  4JI2 O;  3Q4H A;  1YEW A;  3CJH B;  1QLE C;  3T1Y B;  4GKK B;  4ZBM A;  3ZRW A;  1YJ9 V;  4NTX A;  1VQN V;  1I0H A;  2VWK A;  2EUL A;  4X66 O;  1G8M A;  3ZS8 C;  5C8Y B;  1BGY H;  1TAE A;  1RPO A;  2ZE5 A;  1XHZ A;  3CJH A;  1MSW D;  1M57 C;  2DJV A;  2R9R B;  1QVF U;  4WF9 V;  4LF6 B;  2ZCE A;  3F5T A;  1GN3 A;  4QGP A;  1FXV A;  3S3W A;  3G67 A;  5C8Y A;  1XL4 A;  5KA6 A;  1D5N A;  2QR4 A;  3ABT A;  2BOB C;  3ZHU A;  3ZN1 A;  3WG7 B;  3VQW A;  2Y69 C;  4ZI7 B;  4EFE A;  1THZ A;  3LDC A;  1FFT B;  1HP8 A;  4FM0 A;  1RFY A;  3FYI B;  4K8X A;  2WWW A;  2W6I G;  5A9G A;  3TJT A;  1NVP D;  3SYQ A;  4YY3 B;  4JI8 O;  2WLK A;  3R66 A;  4CS4 A;  4FPP A;  4J7Z A;  1SQP H;  3RBZ A;  4PHZ A;  3BAB A;  4QJF B;  2JS3 A;  3E2E A;  1S5J A;  5IJ9 B;  1JOY A;  4JTD B;  1Z5V A;  3B40 A;  1G1X B;  2DMX A;  1WA8 B;  1IXB A;  5KA5 A;  4PD4 F;  2YSU B;  2GSM B;  1L1F A;  3T4Z A;  3K3W A;  5KMG A;  2QEX V;  2YID A;  1R3J C;  2ZM6 B;  2A9H A;  3FB6 C;  1ZWI C;  1BL8 A;  3UT5 B;  3RW0 A;  1TUE B;  3LDE A;  4ZOL B;  1HNZ O;  4DR6 O;  2P6J A;  1XIL A;  1LR1 A;  3B09 A;  3ZX6 A;  4PDL A;  3RFR A;  4IIJ A;  1NBM G;  5EZY B;  1RPR A;  1VF7 A;  4MTX A;  3F5W C;  4GT1 A;  1R3K C;  1IDS A;  5LA6 B;  3UT5 A;  2Q9L A;  3OMA B;  1SF9 A;  2AXT Z;  1N8R W;  3DC6 A;  4JYA O;  4RUF A;  1OCZ B;  2UUB B;  1K97 A;  5A2Q N;  3G6B A;  4ASU G;  1NTK H;  3C90 A;  1S3J A;  4TV9 B;  1XL6 A;  5EK0 A;  3AK1 A;  2DQ3 A;  2B9Z A;  1V55 C;  4JGS A;  4DXW A;  5IYB O;  5ITZ A;  4WBN B;  5KHI A;  2UUA B;  2P7T C;  3ASO B;  2QA4 V;  3OGI B;  2B5U A;  4FFB B;  4H13 B;  1VQ7 V;  1QR8 A;  3K04 A;  2P67 A;  5LYJ A;  5IT9 N;  4ZKI A;  1DLB A;  1NR7 A;  1FS0 G;  2Q4P A;  3HR0 A;  3CCL V;  4TV9 A;  3KCY A;  1XNR O;  4P2Z A;  1VQ4 V;  2YUA A;  3E22 A;  4MTG A;  1KU9 A;  2ZR3 A;  1B6Q A;  1QNM A;  3RYC B;  4BW5 A;  2F1M A;  2LW1 A;  3D3Q A;  4WBN A;  4D6T H;  2H94 A;  2JEU A;  4FVM A;  3MDS A;  1LNQ A;  2E3C A;  4LWS B;  1K5Q A;  1F51 A;  2GDS A;  1Q43 A;  5JJJ B;  1KKC A;  3P3N A;  3HKE A;  4FFK A;  3ETQ A;  4PA7 A;  1VQM V;  3ABK B;  3F7Y C;  3RYC A;  3IC9 A;  3H1L H;  4I9W A;  1Y66 A;  5BXZ A;  3RYH B;  3WB0 A;  3T1H B;  1S77 D;  2LQT A;  2ZE7 A;  3FYE B;  1IUR A;  4LWS A;  4J9Z B;  2OCC C;  1NTZ H;  3JAL B;  2M7W A;  1VQK V;  4BAY A;  4JV5 O;  4JI6 O;  4G2K A;  3STL C;  3APQ A;  3HB3 B;  4DV6 O;  4PDR A;  1K4D C;  2FL4 A;  1P7G A;  1JPX A;  3WG7 C;  2Q5Z A;  1WB8 A;  3K5O A;  3RYH A;  2HEP A;  4LFA B;  3OR6 C;  1M5I A;  3M99 B;  2JGU A;  4B3T O;  1UPG A;  3DXR B;  2F4V O;  3CCR V;  4BWA A;  1YTF D;  2QWN B;  1MNG A;  3ZHS A;  4LF9 O;  4C7U A;  4KFM A;  1N33 O;  1I94 O;  1NKD A;  3SYP A;  3CP1 A;  3SYC A;  3O65 A;  2JVD A;  5BR8 B;  4TT3 G;  2WLI A;  4JI1 B;  4JAS A;  3DXR A;  1N4C A;  2HHH B;  2A79 B;  2UXN A;  2XAJ A;  3E35 A;  4P9P A;  1XMO O;  3EXA A;  3QO7 A;  3C3S A;  4J41 A;  1NH2 B;  1BQ0 A;  3IC7 A;  2OCH A;  4TQF A;  4WFH A;  5EYP B;  5J2U B;  1SRY A;  2FKX A;  4PA9 A;  2VQF O;  4JI0 B;  1RM1 B;  2CGO A;  4X1K B;  3C3T A;  3K58 A;  3BPZ A;  1K92 A;  2KSD A;  5J2T B;  4TWK A;  2XTA A;  4UVC A;  3ZMU A;  4X62 O;  2HG5 C;  2QDO A;  2BSK B;  4DRX B;  3G71 V;  1TUB B;  1LUV A;  2GV9 A;  1OV9 A;  2WLL A;  3FB8 C;  1Y6X A;  4LF5 B;  1FJG B;  4J10 A;  5EYP A;  5CA3 A;  5J2U A;  4I4T B;  3NR7 A;  4YIP A;  4W4K A;  1Q6H A;  3LSS A;  4PDM A;  1FAF A;  4X1K A;  2F95 B;  1OCZ C;  1JQ0 A;  4DK0 A;  5FPR A;  2DYS B;  5J2T A;  1SZX A;  2Y48 A;  2CH7 B;  1YIJ V;  3ABL C;  2CGN A;  4DRX A;  2IJJ A;  1K73 W;  1KKD A;  1X4T A;  4I4T A;  4PJ0 Z;  2QTS A;  1WPX A;  4B3R B;  4U7O A;  2QKA A;  3K5M A;  2HLD G;  1PM9 A;  1TA8 A;  1QQC A;  4ZIB A;  2GTA A;  1GAX A;  1K9M W;  3FAV A;  1G6U A;  3E86 A;  2JGD A;  3GVM A;  1K3E A;  1X59 A;  1IBL B;  4DV7 B;  1GO3 F;  1R6T A;  1PL4 A;  4NXM B;  2ZXW C;  4ABM A;  2WPD G;  3T1Y O;  4GKK O;  4OPA A;  3K79 A;  2PF4 E;  2ZDI A;  3STZ C;  5B1A B;  5HFL A;  3WB1 A;  1WLE A;  3ABK C;  1SQV H;  1PNL A;  3ASN B;  1JJ2 U;  4O4H A;  3B8N A;  4J7K A;  2K1E A;  2IM9 A;  5CB4 B;  2XOK G;  1QBZ A;  2EIK C;  1ZSP A;  2RN9 A;  3SDL A;  2BCC H;  3VQX A;  2QKC A;  4IYI A;  1M9N A;  1GN6 A;  4LH7 A;  1H8E G;  3OM3 B;  3JD0 A;  4DR4 B;  3ZHR A;  4DR2 B;  2L35 A;  3JCU Z;  4JI7 B;  4MW3 A;  1VF6 C;  1R3I C;  2Q8V A;  1ZL8 B;  4KHP B;  1WN7 A;  3QO8 A;  5CB4 A;  2JIZ G;  3ETD A;  2OTJ V;  2L6L A;  2CTP A;  3CC4 V;  3CC7 V;  1QLE B;  3KKY A;  1TVK A;  2PTM A;  4GX2 A;  2FML A;  1IBM B;  5KAF Z;  2UU9 B;  4QPK A;  2RJZ A;  5FPO A;  2YIB A;  2AGA A;  1H8H G;  1Y74 B;  2YC0 A;  1XQ8 A;  3OR7 C;  1ZL8 A;  2OYQ A;  5KLV H;  1NI8 A;  1QHT A;  2AHZ A;  1ORQ C;  1AJP A;  1M57 B;  5D5Q A;  2DWD C;  3H1H H;  3BA8 A;  3H1K H;  4PI2 A;  3K57 A;  2HKO A;  1XNQ O;  1FFX B;  1Q81 W;  2ADP A;  4LNU B;  3CWB H;  4GLX A;  4H44 B;  1XBL A;  5LP6 A;  2YIA A;  4FLZ A;  4X64 B;  2Y0I A;  3ZHT A;  1GM9 A;  5LMN B;  2YXL A;  1GM7 A;  5CBG A;  1KMI Z;  4YIO A;  4DUZ O;  2ZIO A;  2UUC O;  5CBF A;  4QE7 A;  3L9D A;  3AG3 C;  2Y69 B;  4IGG A;  2CTR A;  5DED A;  2NNU A;  4L8J A;  1CEZ A;  4MTF A;  3RYI B;  4QIW F;  3OGC C;  2RCV A;  5DN6 G;  1H38 A;  4O4L A;  3CB2 A;  2B1G A;  5JJE B;  4IYH A;  4J7J A;  4DV3 B;  4GYC B;  3CCE V;  5LHH A;  4H37 A;  1FXK B;  2HP8 A;  4I55 B;  5CA0 A;  3RYI A;  3SYO A;  2RDC A;  4R6Z A;  3ZMZ A;  5CMU A;  3B2E E;  3LSQ A;  1W0J G;  4HNA A;  4YHH B;  4FZ1 A;  3UCS C;  1AR4 A;  2QM4 A;  3ZRV A;  1M56 C;  1N32 O;  5BZB A;  2Z5U A;  2ZDI C;  1FXK A;  2WLN A;  1HNX B;  4L87 A;  2X7R B;  2CTQ A;  3CCU V;  4DR5 O;  3RT3 C;  4LF8 B;  3MHS C;  4JAV A;  3SPJ A;  1ROP A;  1UFI A;  2IJK A;  3JAS A;  1O9H A;  4AHC A;  4DYL A;  1JFF B;  4JF3 A;  3RYF B;  2LP7 A;  3VBB A;  4LH6 A;  2CAZ C;  1MZE A;  3OTF A;  5CA1 A;  1HR0 B;  3Q4H B;  3K06 A;  2QWR B;  2LGW A;  4K0K B;  3ZCC A;  3SGI A;  2Q6A A;  4AQY B;  4UB8 Z;  1V55 B;  4I7Z B;  3GWK C;  3RYF A;  4X1Y A;  2WAM A;  4PA3 A;  3ZRW B;  5L3B A;  1MA1 A;  2Y0P A;  1Z2G A;  3T1H O;  4JYB A;  4DV2 O;  2Q73 A;  1Y67 A;  1K8A W;  3I5D A;  3QVN A;  3KZI Z;  2OT5 A;  4LFC B;  1Q6I A;  2PYL A;  3MD0 A;  4QPJ A;  4TV8 A;  3IAY A;  4YJ3 A;  4X65 B;  2YIC A;  4BW9 A;  4X1I B;  4LF4 B;  3BHP A;  5LP6 C;  3EVK A;  3CRR A;  1AJN A;  3UM7 A;  4LFA O;  1AI7 A;  3CPW U;  4LF7 O;  4RQF A;  2UXX A;  3SJQ C;  2F43 G;  3FB5 C;  5IWA B;  2RQ6 A;  4DV1 B;  4UCS A;  2XAH A;  4ICG A;  4CH3 A;  1MSD A;  1YXB A;  1KQS U;  4O4I A;  4X1I A;  4GUN A;  4GKJ O;  1AI5 A;  5B1O A;  3JAW A;  2HVJ C;  1WNS A;  2OCC B;  2VWJ A;  4MT8 A;  5B1N A;  4ZHQ B;  3PN1 A;  3JD4 A;  5KX5 A;  4JI1 O;  2PYJ A;  3WU2 Z;  4GCZ A;  4LC1 A;  3A8T A;  2HHH O;  1P84 F;  4X8A A;  2GTS A;  3ZRX A;  1R6N A;  2MW2 B;  3D36 A;  3OE7 G;  2RNB A;  3JSN A;  5JH7 B;  2GUZ B;  4PEL A;  4ZHQ A;  1GRJ A;  2QJ1 A;  4JI0 O;  3QG5 A;  4RWU A;  5BMV A;  4F4L A;  5F2V O;  5K1X A;  5KMG B;  4LR3 A;  3OMI B;  4DV5 B;  4K8Z A;  2KQX A;  4MS2 A;  1FXK C;  5JH7 A;  2GUZ A;  5L3F A;  1FJG O;  4LF5 O;  5AG2 A;  5E79 Z;  2E75 B;  3NXS A;  3CC2 V;  2CUG A;  1JMK C;  1RP3 B;  3I55 V;  2E5L O;  4IIJ B;  3F7V C;  4YJ2 A;  4UV8 A;  1BHB A;  2Y4T A;  4HZ3 A;  4FZ0 A;  1WP8 A;  2D3O W;  4CS2 A;  3OUF A;  4RUE A;  1GM8 A;  4JYY A;  3J7A U;  4B3R O;  2EJR A;  3QTC A;  1M1K W;  2LFR A;  1NH2 D;  1J5E B;  2ZIN A;  3LDD A;  1N36 B;  1L8D A;  1SC5 B;  2YDE A;  3R65 A;  1T5E A;  1GTO A;  5ITZ B;  3FD9 A;  3J81 N;  5KUK A;  2WA4 A;  4FLU A;  3D8C A;  4B7K A;  1IBL O;  5LYJ B;  1Y76 B;  2ZR2 A;  4DV7 O;  1VP7 A;  3E8F A;  5FNV A;  2N05 A;  3ABL B;  5DEC A;  4NXM O;  2FYU H;  1JX9 A;  3E22 B;  1F7Y A;  4O4J B;  4XBF A;  4H0L B;  1R3L C;  3BRC A;  2C2A A;  2PZS A;  4JTC B;  1Y76 A;  4B3M B;  4O2A B;  1R1B A;  3SJC C;  4DR4 O;  4PA4 A;  4DR2 O;  3HKE B;  5IYZ B;  4O4J A;  3H1I H;  1EM1 A;  4JI7 O;  1HNW B;  4KHP O;  4JTA B;  3JAK B;  4O2A A;  4XDL A;  1U97 A;  2AW9 A;  4FLT A;  2ZXW B;  2XUM A;  1UJW B;  4DK1 A;  1PL0 A;  2XAG A;  1IBM O;  5IYZ A;  4CC6 A;  2UXB B;  3D36 C;  3H1J H;  2LFS A;  3P32 A;  1PV0 A;  2EIK B;  1QVG U;  3BFR A;  4JAA A;  3CCQ V;  3JAK A;  1M90 W;  2XAQ A;  1H2L A;  2UXC B;  1HW7 A;  2E74 B;  2ZNI A;  1N0N A;  3LNM B;  4DR7 B;  5H6Q A;  1VEW A;  2LJ2 A;  4FIP C;  4QNH B;  4LCU C;  3E83 A;  2YEV A;  4JI2 B;  5LMN O;  2WLI B;  1B3Q A;  3J80 N;  5GON A;  3TCU A;  2Q7E A;  4K35 A;  2X6B A;  4UUJ C;  1WJZ A;  4MTO A;  4KUM A;  5LGT A;  2E76 B;  4JZ2 A;  1MOF A;  2PUS A;  1VF6 A;  4BIO A;  5H5N A;  4N21 A;  1GN2 A;  1H2N A;  2OWO A;  4HAM A;  1DK1 A;  1P4R A;  3TXS A;  3FKS G;  4MVQ A;  3ZN0 A;  3B77 A;  5EBL C;  5LMU O;  4DV3 O;  4R8C A;  4IT5 A;  2WLL B;  2ETN A;  2V7Q G;  4DW1 A;  2Q7H A;  2VRZ A;  3GB7 C;  3ZHQ A;  4NB5 A;  1VQ6 V;  1GKF A;  4IL6 Z;  1MAB G;  5JVD B;  1H2S B;  4Z1M G;  3AG3 B;  2QE7 G;  4YHH O;  2YXY A;  1E1Q G;  4G27 B;  2QSA A;  3FFQ A;  3CMA V;  5KHH A;  2P22 C;  4JI3 B;  4LFB B;  4DV0 B;  2BTQ B;  1BSM A;  4JYC A;  1K33 A;  5JWP A;  4DR3 B;  3M8A A;  2D2C B;  4LF8 O;  4NXN O;  4D7T A;  5JVD A;  5L3E A;  5LL6 Y;  2IH3 C;  3OMN B;  4GX1 A;  5EIB C;  5L3D A;  4OXS A;  3SYA A;  2XND G;  2Q0O C;  2UXD O;  1US6 A;  3FAV B;  2JJ1 G;  2JGD B;  4R50 A;  2ILM A;  2BTQ A;  1SS3 A;  2RMK B;  3L70 H;  1VF5 B;  1AR5 A;  1R6K A;  3KG2 A;  3N2G A;  4K0K O;  2NLJ C;  1M56 B;  1KP2 A;  1BCC H;  2EIL C;  1AIL A;  4AQY O;  5KHG A;  4R7C A;  1G4Y B;  1Y4M A;  1ZLZ A;  3CS5 A;  2Y4U A;  3OEH G;  4O4H B;  1AI4 A;  3ABU A;  5IYC O;  2ATK C;  2ITD C;  1IBK B;  1SA0 A;  3P30 A;  3TK1 A;  3BEH A;  1W0K G;  4JI4 O;  5K1P A;  1S5H C;  3B4S A;  1N34 B;  1SQF A;  5CBH A;  3BVO A;  4LFC O;  3VQY A;  2PI4 A;  4FJC C;  1V54 C;  2EIN C;  5LOV B;  3OAA G;  4LF4 O;  1SQB H;  1PNK A;  2CDY A;  1I7F A;  2R70 A;  3ETE A;  2IU3 A;  3HKB A;  1A32 A;  1TVK B;  2OIG A;  5IWA O;  4LF6 O;  2FTK A;  3VQV A;  4LP8 A;  2EX3 A;  5LOV A;  4YXW G;  3MHH C;  5KAI Z;  3L72 H;  4TSF G;  3JD1 A;  3MAQ A;  4UXN A;  2WA3 A;  4J80 A;  2VS0 A;  3N27 A;  1HWY A;  3OD4 A;  5JCO A;  1NR1 A;  3OT7 A;  2HR3 A;  4G28 B;  2W6J G;  1E1R G;  5LP6 B;  2A3Q A;  3CX5 F;  3ZMS A;  1AJQ A;  1KBH A;  4O2B B;  2KB1 A;  3X2Q C;  4FLX A;  4YY3 O;  2JRI A;  4P9O A;  2QM8 A;  5B3S C;  4HBN A;  1EZJ A;  1DGS A;  4FLV A;  2WLJ A;  1FD9 A;  1DTO A;  4UVB A;  2EIM C;  4O2B A;  4JI6 B;  1RSO A;  1NT2 B;  1FPO A;  1AR1 B;  5B66 Z;  3ZBH A;  2Q69 A;  4O4L B;  1GH6 A;  1BHA A;  4X20 B;  2JS5 A;  3E8B A;  1FXH A;  2ZIM A;  2EIJ C;  3OFN G;  3TXQ A;  1QLN A;  5J9P C;  4LBE C;  2FB5 A;  2Q7G A;  2LO1 A;  1GK9 A;  3LUT B;  2ZM6 O;  4B3T B;  5CA0 B;  3OTO B;  1NU1 H;  1VQ8 V;  2F4V B;  3N2K A;  1XEQ A;  3EHB B;  3VOU A;  4B3S B;  3D3I A;  2Q67 A;  4HNA B;  4DUY B;  4X20 A;  4DO2 A;  1N36 O;  1SKV A;  1D2D A;  5H2F Z;  3SPC A;  4CH4 A;  1COW G;  1XMQ B;  3JAR A;  3AG2 C;  1OCC C;  1YZB A;  2EBO A;  5LGU A;  3CCJ V;  4I5S A;  1YIT V;  2UUB O;  2OIE A;  2WSS G;  4EKW A;  4U3J A;  1SET A;  5CN0 A;  3U11 A;  3JAS B;  4WFF A;  4UV9 A;  4X88 A;  2IJI A;  5D5P A;  4FLW A;  3AG1 B;  4PDV A;  2UUA O;  4Z1V A;  4J11 A;  2P90 A;  5CA1 B;  2DYR C;  3UKM A;  3BA9 A;  4B3M O;  3SJB C;  3IGA C;  1VAR A;  2XAF A;  3SPI A;  5GW7 A;  4X1Y B;  4FMT A;  3AG4 C;  2DE0 X;  2ZNJ A;  5LXT A;  1HNW O;  1YDX A;  1SQX H;  1J95 A;  3A0B Z;  3BAA A;  1MG1 A;  4IHJ A;  4JAU A;  1KYO F;  1JVM A;  3I56 V;  4TV8 B;  3ML0 A;  4YJ3 B;  5KUM A;  1QR9 A;  3ZHV A;  5JCO C;  1SZT A;  5KHJ A;  3KCX A;  2P06 A;  3ABM C;  1Q90 D;  1WB7 A;  4DV4 B;  2CE4 A;  3CHX A;  2UXC O;  3ZIA G;  2W0F C;  3QF7 A;  1EZV H;  3APO A;  2Z3Y A;  4DR7 O;  1URF A;  4O4I B;  4Q20 A;  1SQQ H;  2DW4 A;  3CE2 A;  3JAW B;  4UB6 Z;  2YI8 A;  2KG7 B;  5GTH Z;  1KB9 F;  5KX5 B;  4X89 A;  1AP5 A;  3K59 A;  2P4V A;  3DSQ A;  3G4S V;  2ITC C;  1PNM A;  3OW2 U;  1EN6 A;  1S5L Z;  4BR6 A;  4NVP A;  4PV1 B;  2AZ2 A;  3JAT B;  1MMM A;  4AIL C;  3QNE A;  2KG7 A;  5BR8 O;  1YSC A;  2P5O A;  3DGE A;  1I5Y A;  4PA6 A;  1XI1 A;  1KC8 W;  5BMV B;  2ZE8 A;  3SJA C;  1BQZ A;  2EZO A;  3JAT A;  1QU7 A;  1K7D A;  1Q8I A;  1NZ6 A;  1S72 V;  4NTY A;  2XT9 A;  5JQG B;  1O9G A;  3JD2 A;  2X6A A;  2G38 A;  4YJ2 B;  2R72 A;  1WAZ A;  1KEC A;  3RN4 A;  2BE3 A;  1JA8 A;  4JI3 O;  4LFB O;  2HFE C;  3DC5 A;  4CS3 A;  4DV0 O;  4MVS A;  1JCH A;  1KP3 A;  3SPG A;  4NYK A;  4DR3 O;  3G80 A;  4KXR A;  3JD3 A;  1XNQ B;  4WFE A;  2V4D A;  3LNN A;  5JQG A;  1U96 A;  3K0D A;  3CRA A;  3O9O A;  1YJN V;  4ZI7 A;  2M6Y A;  3JCZ A;  3WB2 A;  1W2B U;  1ARO P;  5L3C A;  4DUZ B;  2QWP B;  2PGG A;  3AG1 C;  5LGN A;  1L0N H;  2O57 A;  1GMG A;  1AVM A;  2UUC B;  1NS1 A;  1YVW A;  5EBM C;  3RVY A;  5FNV B;  2AHY A;  5C93 A;  2WLH A;  2H3O A;  4NR1 A;  4BIZ A;  1ENV A;  2IW5 A;  4KL1 A;  4EEQ A;  5IJ9 A;  3SPH A;  1OCO C;  2BTO A;  5IDJ A;  1N0J A;  1AB3 A;  2ZD9 A;  1Q82 W;  4OX9 B;  1EFR G;  3LSU A;  1WA8 A;  4CC5 A;  1IBK O;  1BZK A;  4RO2 A;  3E89 A;  1N34 O;  1Q5O A;  4GZR B;  3DTU B;  2LGQ A;  4D7S A;  4QE9 A;  2ADQ B;  3CCM V;  4UCU A;  5B1B C;  3A2F A;  2EZP A;  4ZOL A;  1V9P A;  4CH5 A;  2XHB A;  2VQE B;  4B7E A;  4JI5 B;  1OCR C;  1NJI W;  1N32 B;  1HDJ A;  2EIL B;  5EZY A;  4WFB V;  1F23 A;  5FL7 G;  1VQ5 V;  1MZF A;  3K9A A;  4W4L A;  5LA6 A;  1I5X A;  4MVM A;  4DR5 B;  3W7W A;  2IBZ H;  1YF2 A;  5IY5 B;  1Q3E A;  2IH1 C;  3CRC A;  1B06 A;  2A0L A;  2YI9 A;  4JZG A;  1V54 B;  4H33 A;  2EIN B;  3CD6 V;  1D5A A;  2UU9 O;  2QKS A;  4J42 A;  2QM7 A;  4MVU A;  3CCV V;  3K03 A;  2ZE6 A;  2YXH A;  2QWO B;  5H6R A;  4FFB A;  2YEV B;  4MVZ A;  5TIS Z;  3ETG A;  4DR1 B;  5GON B;  2W0X A;  2CTW A;  1EBO A;  4DW0 A;  4EB6 B;  2F23 A;  1PPJ H;  3T2M A;  2GBO A;  3AEI A;  1Q6U A;  3ZRS A;  3CEI A;  4U3F H;  4DV2 B;  4X64 O;  3L75 H;  2A06 H;  3W7T A;  2NR5 A;  3BCC H;  3W7U A;  5HFM A;  2ZKO A;  3ICX A;  3IFX A;  4AI8 A;  2HJF C;  2X0L A;  4EB6 A;  2DN9 A;  5DM6 V;  1NVP B;  1CP9 A;  2A7W A;  3T1C A;  1CPY A;  2YIB D;  1YJW V;  3WFV A;  1JJO A;  1FYJ A;  5BY1 A;  1ZX3 A;  3ZMV A;  4TUY B;  1M4U A;  1Z5W A;  5EBW C;  4X66 B;  4OPH A;  3BY6 A;  2ZQM A;  3CRQ A;  3JAL A;  2F66 C;  3OTO O;  4LF7 B;  3X2Q B;  3GWO A;  1IVS A;  4Q6G A;  2LW7 A;  1K34 A;  4B3S O;  3H01 A;  2ODM A;  2ZT9 B;  4MVO A;  5B3S B;  5IE9 A;  2Q68 A;  4DUY O;  1YCI A;  2GHY A;  1YHQ V;  4Z2W A;  4GKJ B;  4TUY A;  5JJN B;  1XMQ O;  4F6R B;  3AK2 A;  5EC1 C;  3CYO A;  2EIM B;  4I50 B;  4K3A A;  1P49 A;  4MSW C;  3B8M A;  2ARH A;  2X6C A;  3HPL C;  2EIJ B;  3L73 H;  1H2K A;  2Q0A A;  4WFA V;  2JEX A;  1S76 D;  2P4K A;  4F6R A;  2JDI G;  2F93 B;  4RQE A;  1HNX O;  2BOC C;  2PY5 A;  4JI8 B;  4I50 A;  3S3X A;  1VMG A;  1M93 A;  2OTL V;  3N2G B;  4OGQ B;  4GX0 A;  1Q86 W;  4NTW A;  4I0X B;  4TOI A;  3AG2 B;  1OCC B;  1SA0 B;  1XRE A;  1HR0 O;  1NQT A;  2B1I A;  2Z0A A;  2E5L B;  1YI2 V;  2PI5 A;  3E8G A;  1WPB A;  3ZED A;  5KHK A;  2BSK A;  1TUB A;  4I0X A;  4A5U B;  3M7M X;  1HNZ B;  4DR6 B;  3ASO C;  2DYR B;  2DOS A;  1S0V A;  1ZTE A;  1PP9 H;  5IY5 C;  4U7N A;  3U10 A;  2CH7 A;  3HKB B;  2MK3 A;  4DV4 O;  1DF5 A;  3UO3 A;  1AI6 A;  4CBC A;  3AG4 B;  4X65 O;  4JYA B;  1JR9 A;  2CK3 G;  1BS3 A;  1OJH A;  3CME V;  4XDJ A;  2XAS A;  1PKX A;  5EC2 C;  3FX7 A;  1AP6 A;  4X9Q A;  2H8P C;  3JAM N;  4J9Y B;  4DV1 O;  4CH6 A;  1Q7Y W;  2EJ7 A;  4UCR A;  3L71 H;  1IX9 A;  3HKD B;  3ABM B;  3A0H Z;  3EFF K;  1NTM H;  2N74 A;  2HJD A;  4UFZ A;  1XNR B;  1KD1 W;  2AZ0 A;  1YTF B;  3CXH F;  4FK5 C;  1F4M A;  3OUS A;  3HKD A;  3W7X A;  1H2M A;  3JYC A;  3K5N A;  1SER A;  3RWR D;  1L0L H;  1SQG A;  5B5E Z;  4UVA A;  1FKA O;  1XHX A;  1RSO B;  4N23 A;  2HVK C;  2DWE C;  3K08 A;  3JSL A;  1I08 A;  1B04 A;  2NN4 A;  1TGO A;  4UCV A;  4RAI A;  1VQ9 V;  3IJ4 A;  4DV5 O;  3OEE G;  2KKW A;  1WP7 A;  4KP4 A;  2QTO A;  2YS8 A;  3AK3 A;  1QCE A;  3K5L A;  3U0Z A;  4B08 A;  4JV5 B;  2V1D A;  3N2K B;  3L74 H; 
#chains in the Genus database with same CATH homology
 2CTP A;  1FPO A;  2Y4U A;  2QWN B;  2N04 A;  4J7Z A;  1GH6 A;  1WJZ A;  2QWQ B;  2DN9 A;  2M6Y A;  2QSA A;  2CTW A;  3UO2 A;  2Y4T A;  3APQ A;  4J80 A;  1BQ0 A;  2OCH A;  2CTR A;  2CTQ A;  2KQX A;  4IT5 A;  2QWR B;  2LGW A;  1XBL A;  2LO1 A;  1FAF A;  1BQZ A;  2GUZ A;  2QWP B;  3AG7 A;  2YUA A;  3BVO A;  2DMX A;  2GUZ B;  2N05 A;  1HDJ A;  2QWO B;  2PF4 E;  3APO A;  3UO3 A;  2YS8 A;  2EJ7 A;  1NZ6 A;  1N4C A;  3UCS C;  2CUG A;  1IUR A;  4RWU A;  2L6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...