4LFBO

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lfbO00
1IBMO 4JI5O 1HNWO 2N74A 4DR7O 1D2DA 4B3RO 3T1YO 1N32O 1G1XB 4OPAA 3R66A 4K0KO 1X59A 1I94O 1N33O 2LW7A 4YHHO 2UXDO 1R1BA 1NS1A 1FJGO 4X62O 1XNQO 4B3SO 5LL6Y 4DR3O 5A2QN 2UUBO 4DV5O 1HNZO 2UU9O 1XEQA 1FYJA 4JI4O 4NXMO 4LF8O 4DV2O 4AQYO 4B3TO 4JI8O 1AILA 2DOSA 3RT3C 4LF9O 3J81N 4LF5O 2AGAA 2E5LO 4LFCO 4DR1O 1XMOO 4NXNO 4LF7O 4YY3O 2FKXA 2UXCO 5BR8O 3F5TA 3OTOO 3J80N 4X64O 1XNRO 4X65O 4GKKO 3JAMN 2VQEO 1J5EO 1AB3A 4JI1O 4JI2O 2UXBO 2ZM6O 1N34O 4JI0O 4JI7O 2ZKOA 4JV5O 4JYAO 5IT9N 1XMQO 4DUZO 5LMUO 4DV1O 4DR2O 4LFAO 4DV0O 4DV3O 4OX9O 4GKJO 4DR4O 4JI6O 1N36O 1DK1A 1KUQA 4LF4O 4DR6O 1R6TA 2F4VO 2DJVA 2JRIA 4KHPO 4DR5O 4X66O 2Z0AA 4LFBO 3O65A 4DV4O 4OPHA 1YZBA 1HNXO 4LF6O 5H5NA 5FLXN 4DV7O 3J7AU 4DV6O 2UUAO 3SDLA 1HR0O 1IBLO 3M8AA 5BY1A 5LMNO 1FKAO 1A32A 1F7YA 5IWAO 1IBKO 4A5UB 2VQFO 4B3MO 3T1HO 2UUCO 4JI3O 2HHHO 5BXZA 4DUYO
chains in the Genus database with same CATH superfamily
5IY5B 2QWOB 1N32O 1OZ0A 1XBLA 2H8PC 2Q7GA 2QGNA 4CC6A 3JCZA 1KYOF 3JD2A 1EFRG 3CMEV 4MVOA 1Y76B 5JCOC 1NBMG 2EIMB 1XNQO 3WB2A 1NTZH 5J2TB 4HAMA 1DTOA 3Q4HA 4O2AB 3OW2U 2AGAA 2W0XA 1Q3EA 4TQFA 1IBKB 4YIPA 3CRRA 5LHGA 3K57A 2LGWA 3OAAG 3OGIB 3P32A 4P2ZA 5EIBC 3ZHTA 2HVJC 1N32B 4H44B 1XMQO 2BOCC 2PY5A 3OFNG 2ADPA 5KMGA 2CK3G 1BQ0A 3VBBA 1YIJV 1VQOV 1QHTA 5KUKA 5KHHA 1N36O 1JA8A 3B40A 2JVDA 4QIWF 1G6UA 2HEPA 4AHCA 5IYZA 1DF5A 4MTOA 3SYPA 1GN6A 2WPDG 3F5WC 3SPGA 2A9HA 1ROPA 2OTJV 3LUTB 3LDCA 2GTAA 2Y0IA 5IYDO 2YS8A 4ZHQB 2KSDA 4TWKA 2EILC 3SDLA 2ZDIC 2A0LA 1F7YA 1YXBA 1VF6A 5F2VO 5IDJA 3H1JH 5DN6G 2WLLB 2ZXWB 1XMQB 3BY6A 4K8ZA 1JX9A 4H33A 3QTCA 2OT5A 1WPXA 2RQ6A 1SZXA 3T1YO 1N36B 2RN9A 5FPOA 1K34A 1RPRA 4HNAB 5EC1C 1K92A 5B66Z 5FL7G 4X62O 1URFA 3QO5A 4N21A 3T4ZA 4X1YA 5A2QN 1LNQA 3SPCA 4Q20A 2UU9O 2H94A 1PM9A 4BIUA 4LF8O 5LBQA 3CXHF 3SJAC 3PN1A 4BIZA 3LDEA 4LF5O 4LFCO 1O9GA 3CCJV 2CUGA 4LF7O 2XAHA 4P9PA 5LP6B 1ZWIC 3K08A 1DLBA 3OTOO 3ZRWA 3X2QB 4CS4A 2GUZA 3B8NA 1WA8B 1KD1W 4JI7O 2BE3A 3RYHB 5KX5B 5HFLA 3ASNC 2WLMA 5EC2C 4DRXB 3K5NA 4JZ2A 3NR7A 1VEWA 2F1MA 3UCSC 4PA7A 2UU9B 3QO8A 2HLDG 2LFSA 4LF8B 1KUQA 2ZR3A 2ZIMA 4DO2A 1R6TA 2M7WA 3AEIA 3W7UA 3ZHQA 2QR4A 1XQ8A 3G80A 5GONB 5JVDB 4LFCB 2OTLV 1U96A 2CH7A 4NYKA 4FK5C 1VF5B 4I0XA 4BW5A 4LF7B 1B06A 2RDCA 3CJHA 5L3EA 3K06A 1P49A 2LGQA 3ZN0A 3OTOB 3B77A 3DGEA 2UUBB 2R9IA 3E22B 2DQ3A 1KP2A 1PNLA 2FL4A 3ZN1A 4JI7B 1SQBH 5BXZA 5EYPB 3G6EV 3ZCCA 2EIJB 3K9SA 1GN4A 3JD1A 2N74A 4CZZA 3A8TA 4X1IA 2JIZG 2CGNA 1BHBA 2R72A 1XDCA 2B1GA 4WFBV 1SC5B 1N33O 1WN7A 2DYSC 1ZX3A 4IYHA 4BIOA 2VS0A 2GTSA 1R3IC 4X65B 1YITV 5LL6Y 3QG5A 4N23A 2XAJA 2UXBB 5IY5C 3CC4V 2RNBA 3ETGA 2XHBA 1B6QA 4J11A 4NR1A 3G67A 3UO2A 3HKEB 5E1AC 4UCSA 3R65A 2EIMC 3EVKA 3W7WA 5B3SB 3L9DA 4ZBMA 1CEZA 5BR8O 4NVPA 1XNRO 4JI1O 1Z5VA 2IU0A 3BHPA 1N33B 1FS0G 5GTIZ 1FFTB 1N0NA 1EZVH 4DV0O 2ZINA 1LUVA 4IIJB 2B5UA 4JAAA 4MVMA 1DK1A 1G4YB 5C8YB 3BA8A 3JAKB 5JJJB 1QR9A 2HVKC 1GKFA 3THOA 4WFEA 3FB5C 4EFBA 1YSCA 5KLVH 3WFVA 3ETDA 5BR8B 3RGBA 3K9AA 1XNRB 3UO3A 5LMNO 2YI8A 3CCQV 5L3DA 4JI1B 2HR3A 4JTDB 2HHHO 5IJ9B 1AI5A 5JJEB 3N2GA 1P7GA 4PV1B 3SYOA 5IJ0A 4DV0B 1OCZC 2Q67A 2QM4A 1NR7A 3I55V 2WLKA 4OPAA 1Y74A 1S0VA 1X59A 2ZD9A 1IX9A 4JYYA 5CMUA 3CXCU 5AG2A 1PV0A 3FFQA 4QJFB 1SERA 4NTXA 4QPJA 4OGQB 4JPRA 3G6BA 3JD4A 5TISZ 3SR2C 2BCCH 2DOSA 3GB7C 3H1IH 1SKVA 2ADQB 1I0HA 1QVGU 5LMNB 4BWAA 1VQ5V 4TUYB 4WCEV 4L8JA 1K9MW 4UXNA 3MAQA 2HHHB 1VMGA 2UXCO 5A9GA 5B1BB 2WLIB 2VQEO 4U3JB 2ZKOA 3CEIA 3F7VC 3WG7B 1WLEA 2R9AA 1H2KA 2BTQB 5LP6C 4LFAO 1M4UA 1S77D 2CE4A 5GW7A 1ZL8A 5KHJA 1YDXA 4I55B 3X2QC 3C3SA 1Z5WA 2LFRA 2LO1A 2YUAA 3K3WA 2QTOA 2KB1A 1SA0B 3S3WA 1IURA 4MVQA 1ORQC 1GM7A 2Q8VA 3JASA 4X89A 4PA3A 1RFYA 3UT5B 5EBWC 3ETEA 2KG7A 3BEHA 5EIBD 4I9WA 2UXCB 3N2KB 5J2UB 1AR1B 2NN4A 3ZRWB 2CGOA 3UKMA 1IBLO 1A32A 3ABUA 2VQEB 5IWAO 2BOBC 2VQFO 1MSWD 1E1RG 3KKYA 1WAZA 3CWBH 4LFAB 2CDYA 4RUFA 4DR7O 1YCIA 3C90A 3IC9A 4WBNA 2IW5A 2LW7A 1MOFA 5H6RA 2EIJC 2Q5ZA 5IYBO 4B3SO 2LJ2A 4K35A 1K97A 1BQZA 1XEQA 2G38A 1FYJA 3CJHB 4ZI7B 4B3TO 4FFBA 3SPJA 3D3QA 3HPLC 4FZ1A 1IBLB 3UM7A 3P3NA 1EBOA 5IWAB 4CC5A 5ITZB 4XDLA 2VQFB 3JALA 4FM2A 2JJ1G 2Q4PA 4FM1A 1RSOA 2Q6AA 4UVBA 1SQFA 4GLXA 2EZOA 1I7FA 4DR7B 1VQNV 4MVZA 1Q7YW 2CAZC 4I5SA 5L3FA 5E79Z 3T1CA 3ZS8C 4EB6B 5B3SC 5JH7B 1XILA 1M57B 3BFRA 1HWYA 1TUBA 2HG5C 4B3SB 4BAYA 3SYQA 4JI6O 1AR4A 5CA0A 4B3TB 3AK3A 1QU7A 2VRZA 2JRIA 4PDLA 3D3IA 5EZYA 1JPXA 4DV4O 3DXRA 1Q6UA 4I50B 1X4TA 4RWUA 2NR5A 4DV6O 2UUAO 1SRYA 3CE2A 2JS5A 5KHKA 4GX0A 3OUFA 2XUMA 2MK3A 1T5EA 1OCCB 4CBCA 2UXNA 4BW9A 3SYAA 2IM9A 3RYIA 4GX1A 2QWQB 3P30A 3LSUA 3RVYA 2Q68A 4PHZA 4JI6B 4JAUA 3HKCB 3MHHC 1PP9H 5B1AB 2JK5C 3ZIAG 3WU2Z 3OEHG 1QNMA 2YXLA 1HNZO 4O2BA 1DGSA 2WSSG 4JI4O 2QA4V 5BZBA 2JGDB 2E75B 1LUWA 3PJSK 4DV2O 3SPIA 3A0HZ 4DV6B 2UUAB 4JZGA 4KFMA 5H6QA 3JCUZ 4R6ZA 2UXXA 1KECA 2YICA 4B7KA 2Q0AA 4J9ZB 1AVMA 1MA1A 1XL6A 1QLNA 3EFFK 1PL0A 2EX3A 4GKKO 3ZRSA 4BR6A 4OXSA 5LA6B 1BMFG 5CB4A 5H2FZ 1L0NH 3GWKC 4DV1O 2WLHA 4DR2O 2YEVB 4DV3O 3U0ZA 2X6BA 4X1KB 4TSFG 5B1BC 4G2KA 1FXKC 2PGGA 2OYQA 4B3MB 2XAGA 3OE7G 1W2BU 1HNZB 1ENVA 1E1QG 2ZE5A 3WG7C 1QBZA 4DV2B 1MABG 5LGUA 1SQVH 5H9CA 4LF4O 1JFFA 5LGNA 1TVKB 3KZIZ 2WA3A 3K5MA 3T4DA 3AG4B 3K0DA 4X20A 3VQXA 1XNQB 4MVSA 1YVWA 1HR0O 3NXSA 2IJHA 5LYJB 1I08A 4FLTA 4GKKB 1Q6IA 1GRJA 1SQPH 2Q9LA 4NTYA 5FNVA 4DV1B 4TV9A 3K59A 4DR2B 2JEUA 4WFGA 1I5YA 4DV3B 1NH2B 5LXTB 3A2FA 3JARA 1OHHG 4KP4A 3CMAV 1GN3A 4LF4B 3MHSC 4JTAB 5CA1A 3HKBA 4H0LB 4UV9A 4PD4F 5JJNB 2Z5UA 3CS5A 1V55C 4GUNA 4FLUA 1K4DC 5LOVB 5JCOA 4LF9O 3ZHUA 1JCHA 1HR0B 1QVFU 1PL4A 3ZX6A 3OR6C 1K5SA 2BSKA 5GTHZ 2P4VA 1YHQV 3RBZA 5BMVA 3DC5A 2XAFA 2AHZA 1TUEB 3ML0A 1SQGA 2YIAA 2ZM6O 1N34O 4FPPA 1EN6A 1G8MA 2N04A 4B7EA 4TOIA 4OX9O 4MW3A 4O4IA 2GHYA 3QF7A 1N0JA 2LP7A 3FAVA 5LHIA 5KHGA 2L6LA 4ZOLA 4DR6O 2EINB 1MZFA 2B9ZA 2DJVA 4P30A 1M57C 4D7TA 4NKGB 3T1YB 1BGYH 4MVRA 2ZT9B 2JS3A 1BSMA 1SF9A 4TV8B 1BHAA 4MS2A 1MZEA 1ZUQA 2HKOA 4O4JB 5K1PA 4X62B 1CXZB 1P84F 4PJ0Z 1XREA 1BL8A 1V9PA 1L1FA 3SJBC 4R7CA 4IL6Z 3ZRVA 2PYJA 3D36C 2ZM6B 1N34B 4UUJC 1Y6XA 4X8AA 4X9QA 1AR5A 3RFRA 4K3AA 2ZDIA 4LF5B 2E76B 1D2DA 1OCRB 3HKDA 4UB6Z 3RYCA 1N4CA 4O4HA 4U7OA 1OCCC 1R1BA 4XBFA 1Q8IA 1RPOA 4DR6B 2IJJA 4W4KA 4MTXA 3CCEV 1TA8A 4L87A 5B5EZ 3IJ4A 4NXMO 3DSQA 3JD3A 1GO3F 4KL1A 3IAYA 4MTFA 5B1AC 4GZRB 2EZPA 2LW1A 4DXWA 3JSLA 3RYIB 3F5TA 1WB7A 2DYRB 3JAWB 4KUMA 4ICGA 1FFXA 3CCSV 4I7ZB 1M90W 1H38A 1KP3A 4G28B 4AI8A 5KUMA 3RYFA 1SESA 2ZR2A 1VP7A 1MG1A 4LH6A 3BPZA 1UPGA 1YI2V 3A0BZ 4QE9A 4QNHB 3FX7A 4F6RA 5B1OA 1K4CC 4LWSA 3U10A 2JJ2G 3ABTA 2CTWA 3LNNA 3H1HH 1JJOA 1XHZA 3D8CA 3E8HA 4MVUA 1W59A 3T2MA 2ILMA 3J7AU 1N8RW 1IDSA 4JTCB 1WP7A 1J95A 4UCRA 1XL4A 4PELA 3S3XA 3IC7A 1Q5OA 5CB4B 3AG2B 3AG4C 4I4TA 4JI3O 3Q4HB 3TGUH 1PPJH 1RM1B 2X6AA 4WFHA 1M56B 2IH1C 3IGAC 1BZKA 1K7DA 3SJQC 1JVMA 5DECA 1NZ6A 2GSMB 1GH6A 2ITCC 2QKSA 4PA9A 1GK9A 5KMGB 3H1LH 2FTKA 1S3JA 3I56V 4FLVA 2HP8A 5JQGA 2D3OW 3AK1A 3L75H 1M1KW 4E2LA 2F95B 3JYCA 2P5OA 3M99B 5KHIA 5IYZB 2ZXWC 2ZNIA 3ETQA 1WJZA 1R6KA 1YEWA 4B08A 4X64O 4IYIA 5CN0A 1Y76A 1KKDA 4LC1A 1YF2A 4JI2O 4JI0O 3E2EA 1FD9A 5LMUO 3CCUV 2Y48A 5KAFZ 5EBLC 4MSWC 4O2AA 3OUSA 1S5JA 4GKJO 1NU1H 1SETA 4IHJA 1IXMA 4HYOA 2YI9A 1BT8A 5EBMC 4O4LA 3CCMV 2Q7EA 5KA5A 1R3LC 2Y0PA 3K5OA 2A79B 1ZLZA 2P67A 3E8BA 1YJ9V 1Q82W 2QEXV 1COWG 2PI4A 4UVCA 2PTMA 3B8MA 1JQ0A 4X1YB 4X64B 2EINC 2DQ0A 1AI7A 5D5PA 3TXSA 1YTFB 1MSDA 3ZEDA 4JI2B 3CSXA 1XI1A 5LMUB 2OCCB 4DUYO 1M93A 1U97A 4EKWA 4NTWA 1F51A 3QNEA 1UFIA 1QR8A 4GYCB 4GKJB 4K0KO 3FAVB 1EZJA 4ZOLB 3LSSA 4YHHO 1K33A 2UXDO 1NS1A 4ZHQA 2WA4A 1R73A 1IXBA 2GUZB 2EIKB 2ZCEA 1GMGA 3I5DA 2OIEA 1OCRC 3CRCA 1S5LZ 1EM1A 1AILA 2WLLA 3ZHRA 2GDSA 3J81N 1YJNV 3ABKB 2FYUH 4FMTA 4QE7A 1HDJA 3L72H 4RUEA 2IJIA 1VQKV 2DW4A 1EN5A 1JR9A 3ZJZA 1NQTA 3P3PA 3AG1B 3ASOB 4RQFA 2CH7B 3BRCA 4JV5O 5L3GA 4I0XB 3JATA 4JYAO 4K0KB 4DUZO 2ZQMA 4YHHB 1AJPA 1S76D 2UXDB 4J7ZA 4RAIA 3RN4A 2DYRC 1D5AA 4C7UA 2JEXA 2GV9A 2N05A 3LSQA 1VQ9V 5LP6A 1DF4A 2V4DA 4X1IB 4LP8A 4DR5O 4LFBO 3H1KH 3K5LA 4J42A 4TT3G 1WA8A 3GWOA 3F7YC 2NLJC 3RYHA 5KX5A 3KG2A 3CB2A 3BABA 3FKSG 3M7MX 1FFXB 4DRXA 3ZMSA 4JF3A 2JDIG 4MTGA 1NKDA 4JV5B 2UUCO 2X6CA 2R9RB 1UJWB 3DTUB 3C3TA 4DUZB 2M6YA 1NJIW 4JI5O 1HNWO 2C2AA 3TETA 4LNUA 1NVPD 1WNSA 2P4KA 3H01A 2EJRA 2P7TC 4DYLA 5GONA 4H13B 3R66A 2W0FC 1RP3B 1SQXH 3AG2C 3ASNB 1H2MA 4WFAV 1JMKC 1FAFA 2XT9A 3VQVA 1RM1C 4LFBB 3E22A 1GAXA 1M56C 5EK0A 3CC7V 1PD3A 4JI8O 5EYPA 4DW1A 4DK1A 3E83A 2XAQA 1NR1A 4QPKA 3W7XA 2UUCB 4EFEA 5HFMA 1WP8A 4I9QA 2F23A 3SPHA 4JI5B 1HNWB 2NNUA 3JAMN 4DV4B 1AI4A 3W7SA 3IFXA 4PA4A 1TGOA 4Z1MG 3HKEA 4EEQA 2R70A 1K8AW 2JGUA 1FXHA 4DR4O 4FVMA 2Y4TA 1P4RA 3A0RA 2ATKC 3OGCC 2PI5A 3N2GB 3STZC 4JI8B 1QQCA 5IJ0B 2EJ7A 2F66C 5CBGA 3APQA 4FM0A 1B04A 3WB0A 1Y74B 4X88A 1VF6C 3CX5F 3JD0A 4ZIBA 3BA9A 1Q6HA 3VQWA 2Q0OC 1W0JG 2CTRA 3WB1A 1FKAO 1AI6A 3T1HO 4JI4B 3DC6A 2KQXA 4IIJA 2RMKB 1ZSPA 2Q69A 3SYCA 5L3BA 1IBMO 4J9YB 5C8YA 2ZE7A 3JAKA 4DR4B 4IHJB 2DN9A 4IGGA 4O4LB 2Y4UA 3OM3B 1HP8A 1VIBA 3KCXA 2OCCC 2DWDC 1KKCA 2QSAA 4J7KA 4YXWG 1MMMA 1PNKA 1XHXA 1EN4A 5IYCO 4IT5A 5IJ9A 4K8XA 3RT3C 1E79G 1ZL8B 2EIKC 1QLEB 2XNDG 3B2EE 3T1HB 1XMOO 4NXNO 2FKXA 2YIBD 4YJ2A 3JASB 1IBMB 1KC8W 1AB3A 3CCRV 1H8EG 3ABKC 1AP5A 2KG7B 5IT9N 2F93B 1KU9A 1NH2D 4LR3A 1IVSA 2QKAA 3CHXA 1VARA 2Y69B 1OCZB 3AG1C 4KXRA 2IU3A 2Z3YA 3ASOC 2ZNJA 4TUYA 1Q81W 2A7WA 4CH4A 4U3FH 5DEDA 3ZBHA 1FXKA 3E8FA 2WLIA 4U3JA 1YZBA 4JAVA 4LF6O 4J10A 4WBNB 1VF7A 1AP6A 2AHYA 1XMOB 4NXNB 3LDDA 3FB7C 3HR0A 1VQ6V 2BTQA 4FJCC 3G71V 5B1NA 1F23A 3N27A 1CPYA 4G27B 2LQTA 2P22C 4UFZA 3FYEB 2P90A 1L8DA 2HJDA 4GT1A 3JATB 1WB8A 4I55A 1YJWV 4FFBB 4CH6A 4PA6A 1SA0A 1IZ3A 2GBOA 4LF9B 2DE0X 1Q90D 3APOA 2VWKA 4PI0A 3ABMB 3JALB 2A3QA 1RSOB 3UT5A 2KKWA 4U7NA 3FB8C 3L71H 1FJGO 3TCUA 4UVAA 4JYBA 3ZMTA 3N2KA 5J2UA 4DR3O 2UUBO 4DV5O 3O9OA 4JYCA 4LF6B 2ZE8A 1K5QA 2WLNA 1TUBB 4OX9B 2QWRB 1SZTA 4UCOA 5CA0B 4AILC 1R3JC 4XDKA 3CP1A 4YY3O 3JSNA 3J80N 2X0LA 4WFFA 1H2GA 4LNUB 4F6EA 4W4LA 5EZYB 4X65O 3DXRB 2UXBO 4FLXA 2QM7A 2YSUB 1GN2A 3ABLB 1FJGB 2CTPA 2QE7G 4ZI7A 4NB5A 4MW8A 1Y4MA 3B09A 4UB8Z 4DR3B 4DV5B 1AJNA 4UCTA 4FFKA 1VQ8V 5ITZA 3ZHVA 2OCHA 1XUQA 3HB3B 2YXHA 1VQMV 3ZRXA 4KHPO 3O65A 2ZIOA 1H2SB 4GCZA 4R50A 5L3CA 1GM9A 5K1XA 4YY3B 2BTOA 2DMXA 1M5IA 4EB6A 5JH7A 1US6A 4Z2WA 4CH5A 4O2BB 2HJFC 4A5UB 4UV8A 4NXMB 4R8CA 2RJZA 2ETNA 2CTQA 3L70H 3KCYA 2XASA 4JGSA 1G1XB 3D36A 2EULA 1OCOB 3BVOA 4I50A 4YJ3A 4GX5A 2QWNB 1P7BA 4ASUG 1K3EA 2F43G 5IE9A 1WPBA 4KHPB 3H9VA 2XOKG 1VQLV 2WAMA 4QGPA 1OV9A 2ODMA 2AW9A 2V7QG 1LR1A 1GM8A 3K58A 2E5LO 1NI8A 2RCVA 4D7SA 2IJKA 3TXQA 1S5HC 3MD0A 3CPWU 2E3CA 3G4SV 3CRMA 3HKCA 3K04A 2FB5A 1JFFB 2QJ1A 2WLJA 3U11A 4PI2A 3B4SA 1QLEC 4X20B 4WF9V 1Q43A 2JGDA 3ICXA 4DK0A 4HZ3A 2XTAA 4RQEA 5J9PC 2QTSA 3CRQA 3L73H 1JOYA 1ZAUA 4J41A 4JI3B 3AG3B 5FNVB 1W0KG 4TV9B 4ABMA 2ITDC 1VQPV 2YIDA 5CBHA 4FIPC 1AJQA 1F4MA 3CRAA 4X66O 2Z0AA 1BCCH 4FLZA 3OMAB 3JARB 1KB9F 1B3QA 2Y69C 3QVNA 2E5LB 3CCVV 1HNXO 5J2TA 3E35A 5LA6A 1AROP 2E74B 1H8HG 1MNGA 2YDEA 1V54B 2YXYA 4YJ2B 1QCEA 5CA1B 5CA3A 2K1EA 3HKBB 3M8AA 2YEVA 5BY1A 2B1IA 4X1KA 2YC0A 3W7TA 3QO7A 1XOUA 2K9PA 4PDMA 2PYLA 1H2NA 2QDOA 5DM6V 2BSKB 1TVKA 1NT2B 1ZTEA 3LNMB 3CYOA 3VOUA 5BMVB 3BCCH 1I94O 3ZMVA 3AG7A 3SGIA 2X7RB 4Q6GA 4J80A 4CH3A 2P06A 2PZSA 2D2CB 4F4LA 2YIBA 1FXKB 5LYJA 1OJHA 4X66B 4JI0B 3ABMC 2P6JA 1HNXB 4J7JA 3CC2V 4UCVA 4AQYO 3RVZA 2OIGA 3OMIB 5D5QA 1SQQH 4O4IB 2V1DA 3CCLV 2AZ2A 3OD4A 5LXTA 3SJCC 1NTMH 3EXAA 4DW0A 4FLWA 1O9HA 3ZMZA 1YTFD 1L0LH 1J5EO 1F4NA 5KA6A 1KMIZ 2ZE6A 3E86A 1I94B 4TQDA 1R3KC 5LOVA 2O57A 3OTFA 2PF4E 2IBZH 2HFEC 2MW2B 3FYIB 3L74H 3CD6V 5JWPA 4HNAA 4DUYB 3FD9A 2EILB 4CS3A 4AQYB 4FLYA 1PNMA 2F4VO 3ABLC 3HKDB 3K03A 1Z2GA 2Q7HA 2WWWA 4O4HB 3RYCB 1KBHA 4H37A 4HBNA 1V55B 3UQ8A 4DV7O 3EHBB 3ZMUA 1FXVA 4P9OA 3AK2A 1J5EB 4PDVA 2W6IG 5LGTA 4FZ0A 4YIOA 5LHHA 4ZKIA 2A06H 3K0GA 5CBFA 2AXTZ 4LBEC 3VQYA 4B3RO 1K73W 1H2LA 4TV8A 5KAIZ 3OEEG 1Y66A 4O4JA 2F4VB 3ZHSA 1CP9A 3E8GA 4RO2A 3FB6C 3K79A 4JYAB 1PKXA 1R6NA 1NVPB 2IH3C 3RYFB 4DV7B 3OT7A 1OCOC 1I5XA 5JVDA 3E89A 1VQ7V 1BE3H 2H3OA 4DR1O 1THZA 4F6RB 2VWJA 3RW0A 1FPOA 3OR7C 4LWSB 3OMNB 1GTOA 4DR5B 2L35A 4D6TH 1Q86W 4B3RB 5C93A 2Q73A 4YJ3B 2QM8A 2AZ0A 2EBOA 3BAAA 1KQSU 3TJTA 4PDRA 1BS3A 4CS2A 1NTKH 4I4TB 1Y67A 4XDJA 2QKCA 3GVMA 5FPRA 1JJ2U 2W6JG 3STLC 4JASA 4LH7A 4GX2A 1TAEA 4LCUC 3JAWA 4UCUA 1SS3A 4OPHA 1M9NA 5H5NA 4Z1VA 5FLXN 4DR1B 1D5NA 2DWEC 2QWPB 3MDSA 3RWRD 3AG3C 1HW7A 4MT8A 1S72V 2OWOA 2ARHA 1IBKO 1VQ4V 4B3MO 2DYSB 3TK1A 2PUSA 4E4EA 5JQGB 2FMLA 1V54C
chains in the Genus database with same CATH topology
1IBMO 4JI5O 1HNWO 2N74A 4DR7O 1D2DA 4B3RO 3T1YO 1N32O 1G1XB 4OPAA 3R66A 4K0KO 1X59A 1I94O 1N33O 2LW7A 4YHHO 2UXDO 1R1BA 1NS1A 1FJGO 4X62O 1XNQO 4B3SO 5LL6Y 4DR3O 5A2QN 2UUBO 4DV5O 1HNZO 2UU9O 1XEQA 1FYJA 4JI4O 4NXMO 4LF8O 4DV2O 4AQYO 4B3TO 4JI8O 1AILA 2DOSA 3RT3C 4LF9O 3J81N 4LF5O 2AGAA 2E5LO 4LFCO 4DR1O 1XMOO 4NXNO 4LF7O 4YY3O 2FKXA 2UXCO 5BR8O 3F5TA 3OTOO 3J80N 4X64O 1XNRO 4X65O 4GKKO 3JAMN 2VQEO 1J5EO 1AB3A 4JI1O 4JI2O 2UXBO 2ZM6O 1N34O 4JI0O 4JI7O 2ZKOA 4JV5O 4JYAO 5IT9N 1XMQO 4DUZO 5LMUO 4DV1O 4DR2O 4LFAO 4DV0O 4DV3O 4OX9O 4GKJO 4DR4O 4JI6O 1N36O 1DK1A 1KUQA 4LF4O 4DR6O 1R6TA 2F4VO 2DJVA 2JRIA 4KHPO 4DR5O 4X66O 2Z0AA 4LFBO 3O65A 4DV4O 4OPHA 1YZBA 1HNXO 4LF6O 5H5NA 5FLXN 4DV7O 3J7AU 4DV6O 2UUAO 3SDLA 1HR0O 1IBLO 3M8AA 5BY1A 5LMNO 1FKAO 1A32A 1F7YA 5IWAO 1IBKO 4A5UB 2VQFO 4B3MO 3T1HO 2UUCO 4JI3O 2HHHO 5BXZA 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  4JI5 O;  1HNW O;  2N74 A;  4DR7 O;  1D2D A;  4B3R O;  3T1Y O;  1N32 O;  1G1X B;  4OPA A;  3R66 A;  4K0K O;  1X59 A;  1I94 O;  1N33 O;  2LW7 A;  4YHH O;  2UXD O;  1R1B A;  1NS1 A;  1FJG O;  4X62 O;  1XNQ O;  4B3S O;  5LL6 Y;  4DR3 O;  5A2Q N;  2UUB O;  4DV5 O;  1HNZ O;  2UU9 O;  1XEQ A;  1FYJ A;  4JI4 O;  4NXM O;  4LF8 O;  4DV2 O;  4AQY O;  4B3T O;  4JI8 O;  1AIL A;  2DOS A;  3RT3 C;  4LF9 O;  3J81 N;  4LF5 O;  2AGA A;  2E5L O;  4LFC O;  4DR1 O;  1XMO O;  4NXN O;  4LF7 O;  4YY3 O;  2FKX A;  2UXC O;  5BR8 O;  3F5T A;  3OTO O;  3J80 N;  4X64 O;  1XNR O;  4X65 O;  4GKK O;  3JAM N;  2VQE O;  1J5E O;  1AB3 A;  4JI1 O;  4JI2 O;  2UXB O;  2ZM6 O;  1N34 O;  4JI0 O;  4JI7 O;  2ZKO A;  4JV5 O;  4JYA O;  5IT9 N;  1XMQ O;  4DUZ O;  5LMU O;  4DV1 O;  4DR2 O;  4LFA O;  4DV0 O;  4DV3 O;  4OX9 O;  4GKJ O;  4DR4 O;  4JI6 O;  1N36 O;  1DK1 A;  1KUQ A;  4LF4 O;  4DR6 O;  1R6T A;  2F4V O;  2DJV A;  2JRI A;  4KHP O;  4DR5 O;  4X66 O;  2Z0A A;  4LFB O;  3O65 A;  4DV4 O;  4OPH A;  1YZB A;  1HNX O;  4LF6 O;  5H5N A;  5FLX N;  4DV7 O;  3J7A U;  4DV6 O;  2UUA O;  3SDL A;  1HR0 O;  1IBL O;  3M8A A;  5BY1 A;  5LMN O;  1FKA O;  1A32 A;  1F7Y A;  5IWA O;  1IBK O;  4A5U B;  2VQF O;  4B3M O;  3T1H O;  2UUC O;  4JI3 O;  2HHH O;  5BXZ A;  4DUY O; 
#chains in the Genus database with same CATH topology
 5IY5 B;  2QWO B;  1N32 O;  1OZ0 A;  1XBL A;  2H8P C;  2Q7G A;  2QGN A;  4CC6 A;  3JCZ A;  1KYO F;  3JD2 A;  1EFR G;  3CME V;  4MVO A;  1Y76 B;  5JCO C;  1NBM G;  2EIM B;  1XNQ O;  3WB2 A;  1NTZ H;  5J2T B;  4HAM A;  1DTO A;  3Q4H A;  4O2A B;  3OW2 U;  2AGA A;  2W0X A;  1Q3E A;  4TQF A;  1IBK B;  4YIP A;  3CRR A;  5LHG A;  3K57 A;  2LGW A;  3OAA G;  3OGI B;  3P32 A;  4P2Z A;  5EIB C;  3ZHT A;  2HVJ C;  1N32 B;  4H44 B;  1XMQ O;  2BOC C;  2PY5 A;  3OFN G;  2ADP A;  5KMG A;  2CK3 G;  1BQ0 A;  3VBB A;  1YIJ V;  1VQO V;  1QHT A;  5KUK A;  5KHH A;  1N36 O;  1JA8 A;  3B40 A;  2JVD A;  4QIW F;  1G6U A;  2HEP A;  4AHC A;  5IYZ A;  1DF5 A;  4MTO A;  3SYP A;  1GN6 A;  2WPD G;  3F5W C;  3SPG A;  2A9H A;  1ROP A;  2OTJ V;  3LUT B;  3LDC A;  2GTA A;  2Y0I A;  5IYD O;  2YS8 A;  4ZHQ B;  2KSD A;  4TWK A;  2EIL C;  3SDL A;  2ZDI C;  2A0L A;  1F7Y A;  1YXB A;  1VF6 A;  5F2V O;  5IDJ A;  3H1J H;  5DN6 G;  2WLL B;  2ZXW B;  1XMQ B;  3BY6 A;  4K8Z A;  1JX9 A;  4H33 A;  3QTC A;  2OT5 A;  1WPX A;  2RQ6 A;  1SZX A;  3T1Y O;  1N36 B;  2RN9 A;  5FPO A;  1K34 A;  1RPR A;  4HNA B;  5EC1 C;  1K92 A;  5B66 Z;  5FL7 G;  4X62 O;  1URF A;  3QO5 A;  4N21 A;  3T4Z A;  4X1Y A;  5A2Q N;  1LNQ A;  3SPC A;  4Q20 A;  2UU9 O;  2H94 A;  1PM9 A;  4BIU A;  4LF8 O;  5LBQ A;  3CXH F;  3SJA C;  3PN1 A;  4BIZ A;  3LDE A;  4LF5 O;  4LFC O;  1O9G A;  3CCJ V;  2CUG A;  4LF7 O;  2XAH A;  4P9P A;  5LP6 B;  1ZWI C;  3K08 A;  1DLB A;  3OTO O;  3ZRW A;  3X2Q B;  4CS4 A;  2GUZ A;  3B8N A;  1WA8 B;  1KD1 W;  4JI7 O;  2BE3 A;  3RYH B;  5KX5 B;  5HFL A;  3ASN C;  2WLM A;  5EC2 C;  4DRX B;  3K5N A;  4JZ2 A;  3NR7 A;  1VEW A;  2F1M A;  3UCS C;  4PA7 A;  2UU9 B;  3QO8 A;  2HLD G;  2LFS A;  4LF8 B;  1KUQ A;  2ZR3 A;  2ZIM A;  4DO2 A;  1R6T A;  2M7W A;  3AEI A;  3W7U A;  3ZHQ A;  2QR4 A;  1XQ8 A;  3G80 A;  5GON B;  5JVD B;  4LFC B;  2OTL V;  1U96 A;  2CH7 A;  4NYK A;  4FK5 C;  1VF5 B;  4I0X A;  4BW5 A;  4LF7 B;  1B06 A;  2RDC A;  3CJH A;  5L3E A;  3K06 A;  1P49 A;  2LGQ A;  3ZN0 A;  3OTO B;  3B77 A;  3DGE A;  2UUB B;  2R9I A;  3E22 B;  2DQ3 A;  1KP2 A;  1PNL A;  2FL4 A;  3ZN1 A;  4JI7 B;  1SQB H;  5BXZ A;  5EYP B;  3G6E V;  3ZCC A;  2EIJ B;  3K9S A;  1GN4 A;  3JD1 A;  2N74 A;  4CZZ A;  3A8T A;  4X1I A;  2JIZ G;  2CGN A;  1BHB A;  2R72 A;  1XDC A;  2B1G A;  4WFB V;  1SC5 B;  1N33 O;  1WN7 A;  2DYS C;  1ZX3 A;  4IYH A;  4BIO A;  2VS0 A;  2GTS A;  1R3I C;  4X65 B;  1YIT V;  5LL6 Y;  3QG5 A;  4N23 A;  2XAJ A;  2UXB B;  5IY5 C;  3CC4 V;  2RNB A;  3ETG A;  2XHB A;  1B6Q A;  4J11 A;  4NR1 A;  3G67 A;  3UO2 A;  3HKE B;  5E1A C;  4UCS A;  3R65 A;  2EIM C;  3EVK A;  3W7W A;  5B3S B;  3L9D A;  4ZBM A;  1CEZ A;  5BR8 O;  4NVP A;  1XNR O;  4JI1 O;  1Z5V A;  2IU0 A;  3BHP A;  1N33 B;  1FS0 G;  5GTI Z;  1FFT B;  1N0N A;  1EZV H;  4DV0 O;  2ZIN A;  1LUV A;  4IIJ B;  2B5U A;  4JAA A;  4MVM A;  1DK1 A;  1G4Y B;  5C8Y B;  3BA8 A;  3JAK B;  5JJJ B;  1QR9 A;  2HVK C;  1GKF A;  3THO A;  4WFE A;  3FB5 C;  4EFB A;  1YSC A;  5KLV H;  3WFV A;  3ETD A;  5BR8 B;  3RGB A;  3K9A A;  1XNR B;  3UO3 A;  5LMN O;  2YI8 A;  3CCQ V;  5L3D A;  4JI1 B;  2HR3 A;  4JTD B;  2HHH O;  5IJ9 B;  1AI5 A;  5JJE B;  3N2G A;  1P7G A;  4PV1 B;  3SYO A;  5IJ0 A;  4DV0 B;  1OCZ C;  2Q67 A;  2QM4 A;  1NR7 A;  3I55 V;  2WLK A;  4OPA A;  1Y74 A;  1S0V A;  1X59 A;  2ZD9 A;  1IX9 A;  4JYY A;  5CMU A;  3CXC U;  5AG2 A;  1PV0 A;  3FFQ A;  4QJF B;  1SER A;  4NTX A;  4QPJ A;  4OGQ B;  4JPR A;  3G6B A;  3JD4 A;  5TIS Z;  3SR2 C;  2BCC H;  2DOS A;  3GB7 C;  3H1I H;  1SKV A;  2ADQ B;  1I0H A;  1QVG U;  5LMN B;  4BWA A;  1VQ5 V;  4TUY B;  4WCE V;  4L8J A;  1K9M W;  4UXN A;  3MAQ A;  2HHH B;  1VMG A;  2UXC O;  5A9G A;  5B1B B;  2WLI B;  2VQE O;  4U3J B;  2ZKO A;  3CEI A;  3F7V C;  3WG7 B;  1WLE A;  2R9A A;  1H2K A;  2BTQ B;  5LP6 C;  4LFA O;  1M4U A;  1S77 D;  2CE4 A;  5GW7 A;  1ZL8 A;  5KHJ A;  1YDX A;  4I55 B;  3X2Q C;  3C3S A;  1Z5W A;  2LFR A;  2LO1 A;  2YUA A;  3K3W A;  2QTO A;  2KB1 A;  1SA0 B;  3S3W A;  1IUR A;  4MVQ A;  1ORQ C;  1GM7 A;  2Q8V A;  3JAS A;  4X89 A;  4PA3 A;  1RFY A;  3UT5 B;  5EBW C;  3ETE A;  2KG7 A;  3BEH A;  5EIB D;  4I9W A;  2UXC B;  3N2K B;  5J2U B;  1AR1 B;  2NN4 A;  3ZRW B;  2CGO A;  3UKM A;  1IBL O;  1A32 A;  3ABU A;  2VQE B;  5IWA O;  2BOB C;  2VQF O;  1MSW D;  1E1R G;  3KKY A;  1WAZ A;  3CWB H;  4LFA B;  2CDY A;  4RUF A;  4DR7 O;  1YCI A;  3C90 A;  3IC9 A;  4WBN A;  2IW5 A;  2LW7 A;  1MOF A;  5H6R A;  2EIJ C;  2Q5Z A;  5IYB O;  4B3S O;  2LJ2 A;  4K35 A;  1K97 A;  1BQZ A;  1XEQ A;  2G38 A;  1FYJ A;  3CJH B;  4ZI7 B;  4B3T O;  4FFB A;  3SPJ A;  3D3Q A;  3HPL C;  4FZ1 A;  1IBL B;  3UM7 A;  3P3N A;  1EBO A;  5IWA B;  4CC5 A;  5ITZ B;  4XDL A;  2VQF B;  3JAL A;  4FM2 A;  2JJ1 G;  2Q4P A;  4FM1 A;  1RSO A;  2Q6A A;  4UVB A;  1SQF A;  4GLX A;  2EZO A;  1I7F A;  4DR7 B;  1VQN V;  4MVZ A;  1Q7Y W;  2CAZ C;  4I5S A;  5L3F A;  5E79 Z;  3T1C A;  3ZS8 C;  4EB6 B;  5B3S C;  5JH7 B;  1XIL A;  1M57 B;  3BFR A;  1HWY A;  1TUB A;  2HG5 C;  4B3S B;  4BAY A;  3SYQ A;  4JI6 O;  1AR4 A;  5CA0 A;  4B3T B;  3AK3 A;  1QU7 A;  2VRZ A;  2JRI A;  4PDL A;  3D3I A;  5EZY A;  1JPX A;  4DV4 O;  3DXR A;  1Q6U A;  4I50 B;  1X4T A;  4RWU A;  2NR5 A;  4DV6 O;  2UUA O;  1SRY A;  3CE2 A;  2JS5 A;  5KHK A;  4GX0 A;  3OUF A;  2XUM A;  2MK3 A;  1T5E A;  1OCC B;  4CBC A;  2UXN A;  4BW9 A;  3SYA A;  2IM9 A;  3RYI A;  4GX1 A;  2QWQ B;  3P30 A;  3LSU A;  3RVY A;  2Q68 A;  4PHZ A;  4JI6 B;  4JAU A;  3HKC B;  3MHH C;  1PP9 H;  5B1A B;  2JK5 C;  3ZIA G;  3WU2 Z;  3OEH G;  1QNM A;  2YXL A;  1HNZ O;  4O2B A;  1DGS A;  2WSS G;  4JI4 O;  2QA4 V;  5BZB A;  2JGD B;  2E75 B;  1LUW A;  3PJS K;  4DV2 O;  3SPI A;  3A0H Z;  4DV6 B;  2UUA B;  4JZG A;  4KFM A;  5H6Q A;  3JCU Z;  4R6Z A;  2UXX A;  1KEC A;  2YIC A;  4B7K A;  2Q0A A;  4J9Z B;  1AVM A;  1MA1 A;  1XL6 A;  1QLN A;  3EFF K;  1PL0 A;  2EX3 A;  4GKK O;  3ZRS A;  4BR6 A;  4OXS A;  5LA6 B;  1BMF G;  5CB4 A;  5H2F Z;  1L0N H;  3GWK C;  4DV1 O;  2WLH A;  4DR2 O;  2YEV B;  4DV3 O;  3U0Z A;  2X6B A;  4X1K B;  4TSF G;  5B1B C;  4G2K A;  1FXK C;  2PGG A;  2OYQ A;  4B3M B;  2XAG A;  3OE7 G;  1W2B U;  1HNZ B;  1ENV A;  1E1Q G;  2ZE5 A;  3WG7 C;  1QBZ A;  4DV2 B;  1MAB G;  5LGU A;  1SQV H;  5H9C A;  4LF4 O;  1JFF A;  5LGN A;  1TVK B;  3KZI Z;  2WA3 A;  3K5M A;  3T4D A;  3AG4 B;  3K0D A;  4X20 A;  3VQX A;  1XNQ B;  4MVS A;  1YVW A;  1HR0 O;  3NXS A;  2IJH A;  5LYJ B;  1I08 A;  4FLT A;  4GKK B;  1Q6I A;  1GRJ A;  1SQP H;  2Q9L A;  4NTY A;  5FNV A;  4DV1 B;  4TV9 A;  3K59 A;  4DR2 B;  2JEU A;  4WFG A;  1I5Y A;  4DV3 B;  1NH2 B;  5LXT B;  3A2F A;  3JAR A;  1OHH G;  4KP4 A;  3CMA V;  1GN3 A;  4LF4 B;  3MHS C;  4JTA B;  5CA1 A;  3HKB A;  4H0L B;  4UV9 A;  4PD4 F;  5JJN B;  2Z5U A;  3CS5 A;  1V55 C;  4GUN A;  4FLU A;  1K4D C;  5LOV B;  5JCO A;  4LF9 O;  3ZHU A;  1JCH A;  1HR0 B;  1QVF U;  1PL4 A;  3ZX6 A;  3OR6 C;  1K5S A;  2BSK A;  5GTH Z;  2P4V A;  1YHQ V;  3RBZ A;  5BMV A;  3DC5 A;  2XAF A;  2AHZ A;  1TUE B;  3ML0 A;  1SQG A;  2YIA A;  2ZM6 O;  1N34 O;  4FPP A;  1EN6 A;  1G8M A;  2N04 A;  4B7E A;  4TOI A;  4OX9 O;  4MW3 A;  4O4I A;  2GHY A;  3QF7 A;  1N0J A;  2LP7 A;  3FAV A;  5LHI A;  5KHG A;  2L6L A;  4ZOL A;  4DR6 O;  2EIN B;  1MZF A;  2B9Z A;  2DJV A;  4P30 A;  1M57 C;  4D7T A;  4NKG B;  3T1Y B;  1BGY H;  4MVR A;  2ZT9 B;  2JS3 A;  1BSM A;  1SF9 A;  4TV8 B;  1BHA A;  4MS2 A;  1MZE A;  1ZUQ A;  2HKO A;  4O4J B;  5K1P A;  4X62 B;  1CXZ B;  1P84 F;  4PJ0 Z;  1XRE A;  1BL8 A;  1V9P A;  1L1F A;  3SJB C;  4R7C A;  4IL6 Z;  3ZRV A;  2PYJ A;  3D36 C;  2ZM6 B;  1N34 B;  4UUJ C;  1Y6X A;  4X8A A;  4X9Q A;  1AR5 A;  3RFR A;  4K3A A;  2ZDI A;  4LF5 B;  2E76 B;  1D2D A;  1OCR B;  3HKD A;  4UB6 Z;  3RYC A;  1N4C A;  4O4H A;  4U7O A;  1OCC C;  1R1B A;  4XBF A;  1Q8I A;  1RPO A;  4DR6 B;  2IJJ A;  4W4K A;  4MTX A;  3CCE V;  1TA8 A;  4L87 A;  5B5E Z;  3IJ4 A;  4NXM O;  3DSQ A;  3JD3 A;  1GO3 F;  4KL1 A;  3IAY A;  4MTF A;  5B1A C;  4GZR B;  2EZP A;  2LW1 A;  4DXW A;  3JSL A;  3RYI B;  3F5T A;  1WB7 A;  2DYR B;  3JAW B;  4KUM A;  4ICG A;  1FFX A;  3CCS V;  4I7Z B;  1M90 W;  1H38 A;  1KP3 A;  4G28 B;  4AI8 A;  5KUM A;  3RYF A;  1SES A;  2ZR2 A;  1VP7 A;  1MG1 A;  4LH6 A;  3BPZ A;  1UPG A;  1YI2 V;  3A0B Z;  4QE9 A;  4QNH B;  3FX7 A;  4F6R A;  5B1O A;  1K4C C;  4LWS A;  3U10 A;  2JJ2 G;  3ABT A;  2CTW A;  3LNN A;  3H1H H;  1JJO A;  1XHZ A;  3D8C A;  3E8H A;  4MVU A;  1W59 A;  3T2M A;  2ILM A;  3J7A U;  1N8R W;  1IDS A;  4JTC B;  1WP7 A;  1J95 A;  4UCR A;  1XL4 A;  4PEL A;  3S3X A;  3IC7 A;  1Q5O A;  5CB4 B;  3AG2 B;  3AG4 C;  4I4T A;  4JI3 O;  3Q4H B;  3TGU H;  1PPJ H;  1RM1 B;  2X6A A;  4WFH A;  1M56 B;  2IH1 C;  3IGA C;  1BZK A;  1K7D A;  3SJQ C;  1JVM A;  5DEC A;  1NZ6 A;  2GSM B;  1GH6 A;  2ITC C;  2QKS A;  4PA9 A;  1GK9 A;  5KMG B;  3H1L H;  2FTK A;  1S3J A;  3I56 V;  4FLV A;  2HP8 A;  5JQG A;  2D3O W;  3AK1 A;  3L75 H;  1M1K W;  4E2L A;  2F95 B;  3JYC A;  2P5O A;  3M99 B;  5KHI A;  5IYZ B;  2ZXW C;  2ZNI A;  3ETQ A;  1WJZ A;  1R6K A;  1YEW A;  4B08 A;  4X64 O;  4IYI A;  5CN0 A;  1Y76 A;  1KKD A;  4LC1 A;  1YF2 A;  4JI2 O;  4JI0 O;  3E2E A;  1FD9 A;  5LMU O;  3CCU V;  2Y48 A;  5KAF Z;  5EBL C;  4MSW C;  4O2A A;  3OUS A;  1S5J A;  4GKJ O;  1NU1 H;  1SET A;  4IHJ A;  1IXM A;  4HYO A;  2YI9 A;  1BT8 A;  5EBM C;  4O4L A;  3CCM V;  2Q7E A;  5KA5 A;  1R3L C;  2Y0P A;  3K5O A;  2A79 B;  1ZLZ A;  2P67 A;  3E8B A;  1YJ9 V;  1Q82 W;  2QEX V;  1COW G;  2PI4 A;  4UVC A;  2PTM A;  3B8M A;  1JQ0 A;  4X1Y B;  4X64 B;  2EIN C;  2DQ0 A;  1AI7 A;  5D5P A;  3TXS A;  1YTF B;  1MSD A;  3ZED A;  4JI2 B;  3CSX A;  1XI1 A;  5LMU B;  2OCC B;  4DUY O;  1M93 A;  1U97 A;  4EKW A;  4NTW A;  1F51 A;  3QNE A;  1UFI A;  1QR8 A;  4GYC B;  4GKJ B;  4K0K O;  3FAV B;  1EZJ A;  4ZOL B;  3LSS A;  4YHH O;  1K33 A;  2UXD O;  1NS1 A;  4ZHQ A;  2WA4 A;  1R73 A;  1IXB A;  2GUZ B;  2EIK B;  2ZCE A;  1GMG A;  3I5D A;  2OIE A;  1OCR C;  3CRC A;  1S5L Z;  1EM1 A;  1AIL A;  2WLL A;  3ZHR A;  2GDS A;  3J81 N;  1YJN V;  3ABK B;  2FYU H;  4FMT A;  4QE7 A;  1HDJ A;  3L72 H;  4RUE A;  2IJI A;  1VQK V;  2DW4 A;  1EN5 A;  1JR9 A;  3ZJZ A;  1NQT A;  3P3P A;  3AG1 B;  3ASO B;  4RQF A;  2CH7 B;  3BRC A;  4JV5 O;  5L3G A;  4I0X B;  3JAT A;  4JYA O;  4K0K B;  4DUZ O;  2ZQM A;  4YHH B;  1AJP A;  1S76 D;  2UXD B;  4J7Z A;  4RAI A;  3RN4 A;  2DYR C;  1D5A A;  4C7U A;  2JEX A;  2GV9 A;  2N05 A;  3LSQ A;  1VQ9 V;  5LP6 A;  1DF4 A;  2V4D A;  4X1I B;  4LP8 A;  4DR5 O;  4LFB O;  3H1K H;  3K5L A;  4J42 A;  4TT3 G;  1WA8 A;  3GWO A;  3F7Y C;  2NLJ C;  3RYH A;  5KX5 A;  3KG2 A;  3CB2 A;  3BAB A;  3FKS G;  3M7M X;  1FFX B;  4DRX A;  3ZMS A;  4JF3 A;  2JDI G;  4MTG A;  1NKD A;  4JV5 B;  2UUC O;  2X6C A;  2R9R B;  1UJW B;  3DTU B;  3C3T A;  4DUZ B;  2M6Y A;  1NJI W;  4JI5 O;  1HNW O;  2C2A A;  3TET A;  4LNU A;  1NVP D;  1WNS A;  2P4K A;  3H01 A;  2EJR A;  2P7T C;  4DYL A;  5GON A;  4H13 B;  3R66 A;  2W0F C;  1RP3 B;  1SQX H;  3AG2 C;  3ASN B;  1H2M A;  4WFA V;  1JMK C;  1FAF A;  2XT9 A;  3VQV A;  1RM1 C;  4LFB B;  3E22 A;  1GAX A;  1M56 C;  5EK0 A;  3CC7 V;  1PD3 A;  4JI8 O;  5EYP A;  4DW1 A;  4DK1 A;  3E83 A;  2XAQ A;  1NR1 A;  4QPK A;  3W7X A;  2UUC B;  4EFE A;  5HFM A;  1WP8 A;  4I9Q A;  2F23 A;  3SPH A;  4JI5 B;  1HNW B;  2NNU A;  3JAM N;  4DV4 B;  1AI4 A;  3W7S A;  3IFX A;  4PA4 A;  1TGO A;  4Z1M G;  3HKE A;  4EEQ A;  2R70 A;  1K8A W;  2JGU A;  1FXH A;  4DR4 O;  4FVM A;  2Y4T A;  1P4R A;  3A0R A;  2ATK C;  3OGC C;  2PI5 A;  3N2G B;  3STZ C;  4JI8 B;  1QQC A;  5IJ0 B;  2EJ7 A;  2F66 C;  5CBG A;  3APQ A;  4FM0 A;  1B04 A;  3WB0 A;  1Y74 B;  4X88 A;  1VF6 C;  3CX5 F;  3JD0 A;  4ZIB A;  3BA9 A;  1Q6H A;  3VQW A;  2Q0O C;  1W0J G;  2CTR A;  3WB1 A;  1FKA O;  1AI6 A;  3T1H O;  4JI4 B;  3DC6 A;  2KQX A;  4IIJ A;  2RMK B;  1ZSP A;  2Q69 A;  3SYC A;  5L3B A;  1IBM O;  4J9Y B;  5C8Y A;  2ZE7 A;  3JAK A;  4DR4 B;  4IHJ B;  2DN9 A;  4IGG A;  4O4L B;  2Y4U A;  3OM3 B;  1HP8 A;  1VIB A;  3KCX A;  2OCC C;  2DWD C;  1KKC A;  2QSA A;  4J7K A;  4YXW G;  1MMM A;  1PNK A;  1XHX A;  1EN4 A;  5IYC O;  4IT5 A;  5IJ9 A;  4K8X A;  3RT3 C;  1E79 G;  1ZL8 B;  2EIK C;  1QLE B;  2XND G;  3B2E E;  3T1H B;  1XMO O;  4NXN O;  2FKX A;  2YIB D;  4YJ2 A;  3JAS B;  1IBM B;  1KC8 W;  1AB3 A;  3CCR V;  1H8E G;  3ABK C;  1AP5 A;  2KG7 B;  5IT9 N;  2F93 B;  1KU9 A;  1NH2 D;  4LR3 A;  1IVS A;  2QKA A;  3CHX A;  1VAR A;  2Y69 B;  1OCZ B;  3AG1 C;  4KXR A;  2IU3 A;  2Z3Y A;  3ASO C;  2ZNJ A;  4TUY A;  1Q81 W;  2A7W A;  4CH4 A;  4U3F H;  5DED A;  3ZBH A;  1FXK A;  3E8F A;  2WLI A;  4U3J A;  1YZB A;  4JAV A;  4LF6 O;  4J10 A;  4WBN B;  1VF7 A;  1AP6 A;  2AHY A;  1XMO B;  4NXN B;  3LDD A;  3FB7 C;  3HR0 A;  1VQ6 V;  2BTQ A;  4FJC C;  3G71 V;  5B1N A;  1F23 A;  3N27 A;  1CPY A;  4G27 B;  2LQT A;  2P22 C;  4UFZ A;  3FYE B;  2P90 A;  1L8D A;  2HJD A;  4GT1 A;  3JAT B;  1WB8 A;  4I55 A;  1YJW V;  4FFB B;  4CH6 A;  4PA6 A;  1SA0 A;  1IZ3 A;  2GBO A;  4LF9 B;  2DE0 X;  1Q90 D;  3APO A;  2VWK A;  4PI0 A;  3ABM B;  3JAL B;  2A3Q A;  1RSO B;  3UT5 A;  2KKW A;  4U7N A;  3FB8 C;  3L71 H;  1FJG O;  3TCU A;  4UVA A;  4JYB A;  3ZMT A;  3N2K A;  5J2U A;  4DR3 O;  2UUB O;  4DV5 O;  3O9O A;  4JYC A;  4LF6 B;  2ZE8 A;  1K5Q A;  2WLN A;  1TUB B;  4OX9 B;  2QWR B;  1SZT A;  4UCO A;  5CA0 B;  4AIL C;  1R3J C;  4XDK A;  3CP1 A;  4YY3 O;  3JSN A;  3J80 N;  2X0L A;  4WFF A;  1H2G A;  4LNU B;  4F6E A;  4W4L A;  5EZY B;  4X65 O;  3DXR B;  2UXB O;  4FLX A;  2QM7 A;  2YSU B;  1GN2 A;  3ABL B;  1FJG B;  2CTP A;  2QE7 G;  4ZI7 A;  4NB5 A;  4MW8 A;  1Y4M A;  3B09 A;  4UB8 Z;  4DR3 B;  4DV5 B;  1AJN A;  4UCT A;  4FFK A;  1VQ8 V;  5ITZ A;  3ZHV A;  2OCH A;  1XUQ A;  3HB3 B;  2YXH A;  1VQM V;  3ZRX A;  4KHP O;  3O65 A;  2ZIO A;  1H2S B;  4GCZ A;  4R50 A;  5L3C A;  1GM9 A;  5K1X A;  4YY3 B;  2BTO A;  2DMX A;  1M5I A;  4EB6 A;  5JH7 A;  1US6 A;  4Z2W A;  4CH5 A;  4O2B B;  2HJF C;  4A5U B;  4UV8 A;  4NXM B;  4R8C A;  2RJZ A;  2ETN A;  2CTQ A;  3L70 H;  3KCY A;  2XAS A;  4JGS A;  1G1X B;  3D36 A;  2EUL A;  1OCO B;  3BVO A;  4I50 A;  4YJ3 A;  4GX5 A;  2QWN B;  1P7B A;  4ASU G;  1K3E A;  2F43 G;  5IE9 A;  1WPB A;  4KHP B;  3H9V A;  2XOK G;  1VQL V;  2WAM A;  4QGP A;  1OV9 A;  2ODM A;  2AW9 A;  2V7Q G;  1LR1 A;  1GM8 A;  3K58 A;  2E5L O;  1NI8 A;  2RCV A;  4D7S A;  2IJK A;  3TXQ A;  1S5H C;  3MD0 A;  3CPW U;  2E3C A;  3G4S V;  3CRM A;  3HKC A;  3K04 A;  2FB5 A;  1JFF B;  2QJ1 A;  2WLJ A;  3U11 A;  4PI2 A;  3B4S A;  1QLE C;  4X20 B;  4WF9 V;  1Q43 A;  2JGD A;  3ICX A;  4DK0 A;  4HZ3 A;  2XTA A;  4RQE A;  5J9P C;  2QTS A;  3CRQ A;  3L73 H;  1JOY A;  1ZAU A;  4J41 A;  4JI3 B;  3AG3 B;  5FNV B;  1W0K G;  4TV9 B;  4ABM A;  2ITD C;  1VQP V;  2YID A;  5CBH A;  4FIP C;  1AJQ A;  1F4M A;  3CRA A;  4X66 O;  2Z0A A;  1BCC H;  4FLZ A;  3OMA B;  3JAR B;  1KB9 F;  1B3Q A;  2Y69 C;  3QVN A;  2E5L B;  3CCV V;  1HNX O;  5J2T A;  3E35 A;  5LA6 A;  1ARO P;  2E74 B;  1H8H G;  1MNG A;  2YDE A;  1V54 B;  2YXY A;  4YJ2 B;  1QCE A;  5CA1 B;  5CA3 A;  2K1E A;  3HKB B;  3M8A A;  2YEV A;  5BY1 A;  2B1I A;  4X1K A;  2YC0 A;  3W7T A;  3QO7 A;  1XOU A;  2K9P A;  4PDM A;  2PYL A;  1H2N A;  2QDO A;  5DM6 V;  2BSK B;  1TVK A;  1NT2 B;  1ZTE A;  3LNM B;  3CYO A;  3VOU A;  5BMV B;  3BCC H;  1I94 O;  3ZMV A;  3AG7 A;  3SGI A;  2X7R B;  4Q6G A;  4J80 A;  4CH3 A;  2P06 A;  2PZS A;  2D2C B;  4F4L A;  2YIB A;  1FXK B;  5LYJ A;  1OJH A;  4X66 B;  4JI0 B;  3ABM C;  2P6J A;  1HNX B;  4J7J A;  3CC2 V;  4UCV A;  4AQY O;  3RVZ A;  2OIG A;  3OMI B;  5D5Q A;  1SQQ H;  4O4I B;  2V1D A;  3CCL V;  2AZ2 A;  3OD4 A;  5LXT A;  3SJC C;  1NTM H;  3EXA A;  4DW0 A;  4FLW A;  1O9H A;  3ZMZ A;  1YTF D;  1L0L H;  1J5E O;  1F4N A;  5KA6 A;  1KMI Z;  2ZE6 A;  3E86 A;  1I94 B;  4TQD A;  1R3K C;  5LOV A;  2O57 A;  3OTF A;  2PF4 E;  2IBZ H;  2HFE C;  2MW2 B;  3FYI B;  3L74 H;  3CD6 V;  5JWP A;  4HNA A;  4DUY B;  3FD9 A;  2EIL B;  4CS3 A;  4AQY B;  4FLY A;  1PNM A;  2F4V O;  3ABL C;  3HKD B;  3K03 A;  1Z2G A;  2Q7H A;  2WWW A;  4O4H B;  3RYC B;  1KBH A;  4H37 A;  4HBN A;  1V55 B;  3UQ8 A;  4DV7 O;  3EHB B;  3ZMU A;  1FXV A;  4P9O A;  3AK2 A;  1J5E B;  4PDV A;  2W6I G;  5LGT A;  4FZ0 A;  4YIO A;  5LHH A;  4ZKI A;  2A06 H;  3K0G A;  5CBF A;  2AXT Z;  4LBE C;  3VQY A;  4B3R O;  1K73 W;  1H2L A;  4TV8 A;  5KAI Z;  3OEE G;  1Y66 A;  4O4J A;  2F4V B;  3ZHS A;  1CP9 A;  3E8G A;  4RO2 A;  3FB6 C;  3K79 A;  4JYA B;  1PKX A;  1R6N A;  1NVP B;  2IH3 C;  3RYF B;  4DV7 B;  3OT7 A;  1OCO C;  1I5X A;  5JVD A;  3E89 A;  1VQ7 V;  1BE3 H;  2H3O A;  4DR1 O;  1THZ A;  4F6R B;  2VWJ A;  3RW0 A;  1FPO A;  3OR7 C;  4LWS B;  3OMN B;  1GTO A;  4DR5 B;  2L35 A;  4D6T H;  1Q86 W;  4B3R B;  5C93 A;  2Q73 A;  4YJ3 B;  2QM8 A;  2AZ0 A;  2EBO A;  3BAA A;  1KQS U;  3TJT A;  4PDR A;  1BS3 A;  4CS2 A;  1NTK H;  4I4T B;  1Y67 A;  4XDJ A;  2QKC A;  3GVM A;  5FPR A;  1JJ2 U;  2W6J G;  3STL C;  4JAS A;  4LH7 A;  4GX2 A;  1TAE A;  4LCU C;  3JAW A;  4UCU A;  1SS3 A;  4OPH A;  1M9N A;  5H5N A;  4Z1V A;  5FLX N;  4DR1 B;  1D5N A;  2DWE C;  2QWP B;  3MDS A;  3RWR D;  3AG3 C;  1HW7 A;  4MT8 A;  1S72 V;  2OWO A;  2ARH A;  1IBK O;  1VQ4 V;  4B3M O;  2DYS B;  3TK1 A;  2PUS A;  4E4E A;  5JQG B;  2FML A;  1V54 C; 
#chains in the Genus database with same CATH homology
 1IBM O;  4JI5 O;  1HNW O;  2N74 A;  4DR7 O;  1D2D A;  4B3R O;  3T1Y O;  1N32 O;  1G1X B;  4OPA A;  3R66 A;  4K0K O;  1X59 A;  1I94 O;  1N33 O;  2LW7 A;  4YHH O;  2UXD O;  1R1B A;  1NS1 A;  1FJG O;  4X62 O;  1XNQ O;  4B3S O;  5LL6 Y;  4DR3 O;  5A2Q N;  2UUB O;  4DV5 O;  1HNZ O;  2UU9 O;  1XEQ A;  1FYJ A;  4JI4 O;  4NXM O;  4LF8 O;  4DV2 O;  4AQY O;  4B3T O;  4JI8 O;  1AIL A;  2DOS A;  3RT3 C;  4LF9 O;  3J81 N;  4LF5 O;  2AGA A;  2E5L O;  4LFC O;  4DR1 O;  1XMO O;  4NXN O;  4LF7 O;  4YY3 O;  2FKX A;  2UXC O;  5BR8 O;  3F5T A;  3OTO O;  3J80 N;  4X64 O;  1XNR O;  4X65 O;  4GKK O;  3JAM N;  2VQE O;  1J5E O;  1AB3 A;  4JI1 O;  4JI2 O;  2UXB O;  2ZM6 O;  1N34 O;  4JI0 O;  4JI7 O;  2ZKO A;  4JV5 O;  4JYA O;  5IT9 N;  1XMQ O;  4DUZ O;  5LMU O;  4DV1 O;  4DR2 O;  4LFA O;  4DV0 O;  4DV3 O;  4OX9 O;  4GKJ O;  4DR4 O;  4JI6 O;  1N36 O;  1DK1 A;  1KUQ A;  4LF4 O;  4DR6 O;  1R6T A;  2F4V O;  2DJV A;  2JRI A;  4KHP O;  4DR5 O;  4X66 O;  2Z0A A;  4LFB O;  3O65 A;  4DV4 O;  4OPH A;  1YZB A;  1HNX O;  4LF6 O;  5H5N A;  5FLX N;  4DV7 O;  3J7A U;  4DV6 O;  2UUA O;  3SDL A;  1HR0 O;  1IBL O;  3M8A A;  5BY1 A;  5LMN O;  1FKA O;  1A32 A;  1F7Y A;  5IWA O;  1IBK O;  4A5U B;  2VQF O;  4B3M O;  3T1H O;  2UUC O;  4JI3 O;  2HHH O;  5BXZ A;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...