2N04A

Solution structure of the phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
104
Chain Sequence
MRSPGMADQRQRSLTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily C member 5
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n04A00
2CTRA 2QWPB 1FPOA 2CTPA 2M6YA 3UCSC 4RWUA 1IURA 2N05A 2Y4UA 1N4CA 3BVOA 1WJZA 2CUGA 2KQXA 2GUZB 2L6LA 4J80A 3UO2A 1XBLA 2Y4TA 1BQZA 2QWQB 4IT5A 2LO1A 2YS8A 3APOA 3UO3A 2QSAA 2QWNB 4J7ZA 1FAFA 2DMXA 2CTWA 2YUAA 1HDJA 2LGWA 2PF4E 3AG7A 2DN9A 1GH6A 2CTQA 2OCHA 2EJ7A 2QWOB 1BQ0A 2QWRB 2GUZA 2N04A 3APQA 1NZ6A
chains in the Genus database with same CATH superfamily
2PI5A 4QE7A 4X88A 5GTHZ 1YCIA 4O2AA 1N33B 5J9PC 2YEVA 3PN1A 1VQOV 3UO2A 5B1AB 3ZN0A 5IE9A 3ZHTA 1GM9A 4LF6O 2R72A 1PV0A 3RYCA 2A0LA 2GDSA 3JD3A 1D5AA 3E35A 3JCZA 4DV3O 2EILB 3K0GA 4O4HB 2P7TC 3VQVA 3RYIA 2ZR2A 2WLIA 4GX1A 5LMNB 3OW2U 4LF4B 3C3SA 2R70A 1MOFA 4PDRA 1H2KA 2P90A 2QTOA 4Z1MG 1RPRA 4MTGA 2PYLA 5EC2C 5BZBA 1O9HA 3UT5B 1AI7A 2LQTA 4LFAO 4B3SO 4DW0A 5BMVA 4CH4A 1ZWIC 2AW9A 3JSNA 3JALA 1MA1A 4ICGA 1XILA 3K0DA 1JFFB 1VQ5V 1S0VA 2DQ0A 3IFXA 3ZHUA 3D36A 2VQFB 2K1EA 4QIWF 4UCTA 2EIMC 2ODMA 1PD3A 1XHXA 2P06A 5H5NA 1BZKA 2Q69A 3LSSA 2YI8A 2ATKC 1QQCA 4ASUG 2QKAA 5KUKA 1HWYA 3K9AA 4L8JA 3EVKA 4U3FH 1GN6A 1K4DC 3CCVV 1N36B 5LP6A 2EINB 4CS2A 1KC8W 2LP7A 4PA3A 2AGAA 1Q7YW 2JDIG 2XHBA 2M6YA 4O2BA 2VWKA 1BMFG 1H2MA 3RW0A 4UV8A 1QVGU 4LF9B 4TV8B 4HNAB 3SDLA 1VMGA 1B6QA 4K0KB 1TAEA 1H8EG 4PD4F 2EIJC 3D36C 3FYIB 1OJHA 3DXRB 3ZMVA 3T1YO 2WLMA 2Z5UA 3H1LH 1W59A 1B06A 4B3RB 1IBLB 5KMGA 5JWPA 2E3CA 3QO8A 1JR9A 4FFBB 2ZM6B 1AR1B 4WFFA 2CH7A 3N2GB 3JASA 4JI2O 4ZI7A 5LP6C 1OCZC 2KB1A 2QWPB 4BR6A 1TUBA 4EB6B 3LSUA 4HZ3A 2PZSA 3M8AA 2Q4PA 4GX2A 1XEQA 3STZC 5BMVB 4UCVA 2R9IA 2N74A 3L9DA 4UXNA 3ZRWA 1EN5A 4J42A 2JK5C 4DR3O 1LUWA 1X59A 4DR5O 2Q7EA 1SZXA 1JVMA 1Y6XA 2CGOA 1ROPA 2R9RB 4NXMO 3SJQC 3L74H 3SR2C 1EZJA 3HKBB 3FX7A 2Y0PA 2P67A 3J81N 1YDXA 1GAXA 4MT8A 4JF3A 2CAZC 3AG7A 2B5UA 3G67A 3CCLV 3ZHRA 5KX5B 1VQ4V 4J9YB 1OCCC 4U7OA 1P7BA 5LL6Y 1OCZB 1Y74B 3L75H 3NXSA 4RUFA 5CB4B 4BIZA 2JJ2G 5B5EZ 2EJRA 1G4YB 4ZOLA 2AHYA 4BIOA 1SA0B 2VQEB 2QM4A 5FPRA 4G2KA 3RYFB 4CH3A 4ZHQA 1AILA 4X66O 3K5NA 4IL6Z 4DV2O 1R6TA 4FZ1A 2PYJA 4QPKA 4H13B 3B8MA 2YSUB 3ETGA 4KP4A 2RNBA 4JI6B 1P4RA 2GBOA 2UXBB 4GKJB 3QG5A 2GTAA 2A79B 4UB6Z 4WFGA 5KAFZ 1KP3A 5IYBO 1OCOC 1KP2A 2N05A 1XQ8A 3AG1B 1F23A 4TV9B 2KQXA 1XBLA 3E89A 4JI4B 3JD4A 1SZTA 3K57A 1Q43A 3ML0A 2ADQB 5AG2A 4JYCA 3CC7V 2RMKB 3A0BZ 2Q9LA 3MAQA 4O4IA 5IJ0B 2OCCB 3FB8C 1K33A 2EULA 3JAKB 2UUAB 4XDKA 2A06H 1IXMA 4WFHA 3B40A 1BQZA 4LF8O 3I55V 1U96A 4TWKA 3HKCB 3CCEV 3Q4HA 3E22A 1NZ6A 1VP7A 1ZX3A 1IVSA 1FPOA 1YITV 4O4JA 4LF7B 1KKCA 4DRXB 3WU2Z 5JH7A 1Q8IA 4X1IB 1IBKO 2QM8A 3SPGA 3SYCA 2UUBB 1FXKA 3NR7A 4R8CA 1RPOA 4Q20A 3TJTA 3RFRA 3RYHA 2VWJA 4B3TO 5JVDB 3OMAB 3MHSC 3KCYA 1KUQA 4LF6B 4R7CA 4QE9A 1WA8A 4DV3B 3FFQA 3RVYA 4OX9B 4JTDB 4UB8Z 4FVMA 5KA6A 1L0LH 2ZXWB 1GKFA 5J2UB 2UU9O 4MVMA 5H6RA 2ZDIC 3J7AU 5LGUA 1RSOB 2M7WA 1OCRB 5D5QA 5IDJA 4PELA 1VEWA 4PDVA 3ZHQA 5LMUO 2QA4V 1Q6HA 2NNUA 2HKOA 2W0XA 2EIKC 1TVKB 5KHGA 2RDCA 4P2ZA 2WLNA 4B3SB 4X65O 4FMTA 4IHJB 1AB3A 2OT5A 3TK1A 3L73H 1L0NH 1J5EO 1FXKC 1NI8A 3H1HH 3OFNG 3W7SA 1NBMG 2Y4TA 2LO1A 2EZOA 4X1KA 4D7TA 4I0XB 1VQ9V 3UM7A 4B7EA 1B04A 1VQ6V 4DK1A 2UXCO 5IWAO 5FL7G 1H2NA 5JQGB 1H2LA 1S3JA 2OIGA 3ASOC 1I0HA 3BA9A 4PJ0Z 4DR2O 3JATB 1I94B 2F93B 2AZ2A 1VQMV 4UCSA 4QGPA 2ZKOA 1XL4A 4DR7B 3ZBHA 3WB2A 4I5SA 1VQ8V 3QTCA 1MSWD 1X4TA 4FZ0A 3OGCC 3QVNA 1K73W 5K1XA 1T5EA 4IGGA 2UUCB 5ITZB 3K3WA 3ZRXA 1XMOO 1VF7A 2HVJC 3A8TA 3OEEG 3FKSG 2YIAA 4KFMA 5EZYB 5JJJB 2DYSC 1COWG 3SGIA 3ABUA 3CRCA 2YI9A 3ZRVA 3T1YB 1AI4A 3CJHA 3D3QA 3U0ZA 2IM9A 4PI2A 2F23A 3ABMC 3ASOB 1NR7A 5BY1A 4HAMA 1Q6UA 2HVKC 4DV1O 4LWSA 4FLUA 3F5WC 4JI2B 4JI3O 5CBFA 4ZKIA 3AK1A 1SF9A 3F7YC 4CC6A 2LW1A 3N27A 4F6EA 1NQTA 3L72H 3UCSC 4YJ2B 1L8DA 3KG2A 1NKDA 4WBNA 4GZRB 3N2KB 1NTZH 2BE3A 5D5PA 4DR3B 3L70H 4DR5B 1WP8A 5GW7A 4J7ZA 2EBOA 3CRMA 5KHKA 3T1CA 1LUVA 3AG2C 3ZRSA 2GUZA 4RUEA 3BEHA 4NXMB 5CA3A 3CS5A 5B1BB 1K7DA 3CPWU 1AROP 2C2AA 2ITDC 1M9NA 2XNDG 3C3TA 3KKYA 5LHHA 3CMEV 1N0JA 4X62B 1R1BA 2ZIMA 1W2BU 2Q7HA 4R50A 3SJBC 1XMQB 4JGSA 4LH7A 2HHHO 1QLNA 5JCOA 3KZIZ 1JJOA 1M93A 2ZD9A 4EFBA 1R3IC 1CXZB 2UXNA 2UXXA 5LHIA 1Z5VA 1ZL8A 4J10A 2DWDC 4TUYB 2ZCEA 4LC1A 4X1YA 4IYIA 4X66B 4JI7O 1G1XB 1KKDA 2LGWA 2WSSG 4DV2B 2P22C 2AHZA 2PF4E 3E86A 3BAAA 4K8XA 4LNUB 5LOVB 3OGIB 3ASNB 1AP6A 2UXDB 1YIJV 3GVMA 1MSDA 4FK5C 4OGQB 4BW9A 2XTAA 2P4KA 2JGDB 2QKCA 3BPZA 1IX9A 4YJ3A 2Q73A 4W4KA 5CN0A 2WA4A 3P3PA 4CBCA 2ARHA 5LA6B 1QR8A 1Z5WA 3RBZA 1MABG 4GT1A 1U97A 4LF5O 4UVCA 2PY5A 1NT2B 3LDCA 2IW5A 3JAWB 3ZHSA 5JCOC 1E1QG 2QEXV 1Q5OA 4CH5A 1FXVA 2F4VO 5L3GA 4U3JB 1BE3H 3EFFK 4DR4O 2YIBA 1HNXO 1K92A 2CDYA 1HNWO 4LF8B 4DV5O 4LFCB 3O9OA 1HR0O 1E1RG 1KYOF 2VS0A 1S5LZ 3M99B 2MK3A 1FAFA 1R73A 2YXHA 5IJ9A 1F4MA 2QJ1A 2ZIOA 1FFXB 1JMKC 4PHZA 4FLWA 4LFBO 2X6AA 5J2TB 5B1OA 2IJJA 1ZUQA 2GHYA 4I55A 1UFIA 4H37A 3CCMV 2IJHA 2Q0OC 2Y48A 4IT5A 2KKWA 2HFEC 3CYOA 1DK1A 2WLJA 4X8AA 5LGTA 1F51A 2FKXA 4H33A 2Q8VA 4O2AB 3UKMA 5H9CA 2YEVB 4LH6A 3J80N 2ZNJA 2CTQA 4B3TB 4AILC 1YI2V 3JD1A 3H1KH 5KHJA 1SQBH 4JZGA 2EIMB 3CCUV 3S3XA 2IU0A 3RYCB 3E8FA 4LR3A 4JI1O 3WFVA 1GO3F 3FYEB 4FLZA 1EFRG 4BW5A 4JI5O 3RYIB 2WLIB 3G71V 4FLYA 2UU9B 3CCQV 3H01A 4DV7O 1EBOA 1K4CC 1KMIZ 2BSKA 2FYUH 4J41A 2LW7A 5BR8O 5DN6G 5EIBC 5LMUB 1P84F 5LYJA 5FLXN 4GLXA 4BWAA 2CE4A 1WN7A 3B2EE 3P3NA 1PL0A 1FD9A 4YY3O 1AJQA 2FL4A 1M56C 1J5EB 3C90A 2ADPA 4GCZA 4RQEA 1Q90D 2OIEA 3JALB 2IH1C 3CRRA 3HKDA 2W6IG 2BTOA 4TQFA 4DUZO 2WAMA 5EYPA 3FB6C 1K8AW 4MTXA 2QE7G 5KAIZ 2EIJB 4PV1B 5E79Z 3AG3C 3BY6A 1P49A 5GONA 4KHPO 3ZN1A 5FNVA 2UXCB 4GUNA 3LDEA 1EN4A 1EM1A 1OV9A 3ZS8C 4MW3A 1PNMA 1R6KA 5LXTA 3OT7A 1NR1A 2G38A 5IY5C 1IBMO 4DR2B 5LP6B 4NR1A 4FM0A 1XDCA 1BS3A 5L3DA 1ZTEA 4O2BB 1CPYA 2XAQA 3K9SA 3HKEA 1O9GA 4FM2A 1N34O 3SPJA 1V55C 4FLVA 4RAIA 1XMOB 3CP1A 1OZ0A 3MD0A 5JJNB 1DF4A 1JJ2U 1TGOA 2V4DA 5DM6V 1KU9A 3KCXA 2GSMB 4DR6O 4L87A 2P6JA 4Z2WA 1K9MW 5B66Z 3ZMTA 5KMGB 1BCCH 4DR1O 3G4SV 2ZINA 3L71H 1OCCB 1LR1A 4F6RA 4DV1B 4TOIA 2CH7B 1XNRB 1VIBA 4AQYO 2IU3A 4JI3B 1BHAA 3JASB 2V1DA 4ZI7B 1VQNV 3APOA 4X20A 4AI8A 1TUBB 3CC2V 1WAZA 1QU7A 2H8PC 3U10A 3I5DA 4XDLA 2V7QG 2KG7A 1H8HG 3ZRWB 1V55B 3FAVA 4JPRA 1IURA 3CMAV 1FFTB 5C93A 1SQXH 3QF7A 1ENVA 5H2FZ 1BT8A 2F1MA 4I50A 2YIBD 3X2QC 3MHHC 3CX5F 4DV6B 3LSQA 2QWOB 4MTOA 4IIJA 1NU1H 4AHCA 1SKVA 1AR4A 4C7UA 1KB9F 1WNSA 1Z2GA 5EIBD 1OCOB 1M4UA 4ZBMA 5L3CA 4I4TA 4RQFA 4TT3G 2ILMA 3T4ZA 3O65A 1Q81W 4UUJC 1EN6A 4MS2A 2HHHB 1Y76A 4X64B 2B1IA 4N21A 4EFEA 5CA1A 1S5JA 3H9VA 1WP7A 1XOUA 2QDOA 1JA8A 3QNEA 4ZOLB 2CTPA 1RM1C 2Y69C 4ZHQB 4X89A 4Q6GA 1A32A 4LF9O 1XUQA 1LNQA 1WB7A 5KUMA 2OCHA 5EBMC 1MG1A 1QHTA 3K58A 3ZHVA 1SRYA 2XASA 3K5LA 1VQPV 1I08A 3JARA 4LFAB 3ZMUA 1GTOA 4GX0A 3CXCU 5C8YA 3R66A 3VOUA 4A5UB 4LF5B 2DQ3A 4NTXA 2ZM6O 2NR5A 3K03A 4NB5A 2P4VA 2HP8A 4QPJA 3SPHA 4DUYO 4MVRA 4O4IB 2HJFC 1KD1W 2F4VB 3ZMZA 4WF9V 1YF2A 3AK2A 4KXRA 3K08A 2IH3C 4DR4B 3HPLC 3TCUA 4MSWC 3VQXA 1WLEA 4PA6A 1HNWB 2AXTZ 2IJIA 2WPDG 2PI4A 5CA0A 2WLLA 1QBZA 1AJPA 1Y4MA 3Q4HB 3E22B 1BSMA 4NYKA 1SS3A 2YS8A 2EIKB 3OR7C 1GM7A 4O4JB 1M5IA 3ETEA 2LGQA 4LFBB 3AG4C 1HNZO 5IYZA 4NTYA 1H38A 2IBZH 1S5HC 5JH7B 2N04A 1DF5A 3R65A 1PKXA 1VQ7V 1FXKB 5EK0A 4O4LA 3ZJZA 4ZIBA 3RYHB 1K3EA 2OWOA 4FLTA 3OR6C 4EEQA 2FMLA 1XNQO 2DMXA 1HDJA 3JSLA 1R3LC 3JYCA 4JTCB 2QR4A 4OXSA 4JI1B 1AI5A 2JEXA 1AR5A 3DC6A 1JPXA 1WA8B 3ICXA 2OTJV 2XOKG 2NLJC 4JI5B 3ABLC 5HFLA 4IYHA 4LCUC 3CRQA 4DV7B 3MDSA 3BVOA 3I56V 4FPPA 4DV4O 2YXLA 2JJ1G 4O4HA 3WG7C 2D2CB 3RWRD 5B3SC 4JI6O 3BHPA 3ABTA 4JZ2A 3RGBA 3AEIA 1V9PA 5CBGA 4UCOA 3W7TA 1S72V 4N23A 3UT5A 2OTLV 1L1FA 1MZEA 2YC0A 4DV0O 4DUZB 3CC4V 1NJIW 2XAFA 1FS0G 5BXZA 3CCSV 1B3QA 2DYSB 1FYJA 2IJKA 2Q7GA 3ZX6A 2RCVA 3SJAC 2XT9A 4X1KB 1GRJA 1JFFA 4HYOA 4FIPC 3ABKC 3ABLB 1E79G 3BFRA 2JIZG 4NXNO 2Y4UA 5B1AC 1MNGA 3BCCH 3ABMB 3B8NA 2ZR3A 1XI1A 3EXAA 2ZE8A 4H0LB 5IT9N 3S3WA 2JEUA 1ORQC 2EILC 1IBMB 3CWBH 1ZAUA 4JI0O 1R3JC 3E8HA 2HG5C 3ETDA 1Y66A 4YHHO 3W7XA 1IDSA 1NTKH 3IJ4A 4CS4A 1KBHA 4X9QA 2MW2B 2YICA 4JYAO 4DYLA 1N34B 4G28B 3OTOO 4DK0A 2YUAA 1YVWA 3DGEA 3TGUH 3HB3B 2UUBO 1BGYH 3AG2B 4TV8A 4HNAA 2L35A 2WLKA 4LBEC 2DJVA 4QJFB 4MW8A 3ABKB 1M57C 2B9ZA 1N4CA 4OPHA 2DYRC 5IYDO 4DR6B 1AP5A 3CJHB 4B08A 4W4LA 5DEDA 3DXRA 4DR1B 1J95A 2Q5ZA 1THZA 2EX3A 1KQSU 4OX9O 5TISZ 1SQPH 2H3OA 4UVBA 4AQYB 4LWSB 2WLHA 3OMIB 3WB1A 4QNHB 1SQGA 4WFAV 2Q0AA 4DW1A 1URFA 4FFBA 1WJZA 3OUSA 3N2GA 2JGUA 4GYCB 2JS3A 2EINC 3SYOA 2HR3A 2E5LO 1EZVH 4WBNB 4EB6A 4UFZA 1I7FA 1R6NA 2A3QA 4EKWA 2RJZA 1H2GA 3OAAG 3F5TA 1M57B 1CP9A 1WPXA 1DLBA 3JAMN 4XBFA 2DYRB 2GUZB 1HP8A 1I5YA 3BA8A 1GMGA 4GX5A 2XAGA 5KA5A 1SETA 3T1HO 1FJGO 5EC1C 3HKBA 4UVAA 1PNKA 3CRAA 2XAJA 1IBKB 1YTFB 3SJCC 3SYQA 3ZCCA 5KX5A 4JI8O 1JCHA 1Y74A 2Q6AA 1I94O 3D8CA 1ZL8B 2X7RB 1K5QA 1GH6A 3T2MA 3BRCA 1H2SB 3K06A 1F4NA 3UQ8A 5CB4A 4X1YB 2FB5A 3CEIA 3ZIAG 1JQ0A 3FD9A 3STLC 1JX9A 4DR7O 4H44B 1SA0A 3P30A 2CUGA 2ZQMA 2L6LA 2AZ0A 1NS1A 5L3FA 4K35A 3RYFA 1VQKV 3T4DA 4P9PA 3W7UA 1FKAO 4D7SA 2UUCO 2H94A 4NKGB 3BABA 5E1AC 5H6QA 3OM3B 5A9GA 3G6BA 3DC5A 3OD4A 4WFEA 4P30A 2CTRA 4B3MO 2WWWA 4YJ3B 1N32O 1PPJH 4X65B 1GN3A 1NH2B 1M1KW 4J11A 1NVPB 4MVUA 3K5OA 4R6ZA 3THOA 4JYBA 4TV9A 1WPBA 2LFRA 1IXBA 2LFSA 5KLVH 3W7WA 4DUYB 3VQWA 4LP8A 1BL8A 1XREA 2XAHA 4J7JA 1SQQH 4I7ZB 3H1IH 1Y67A 4PA9A 1MMMA 2QWQB 1XHZA 5CMUA 3F7VC 5IJ0A 5IWAB 4E4EA 2QSAA 4DXWA 3JAKA 1G6UA 4GKKO 2EZPA 4JV5O 3G6EV 4PDMA 1GK9A 3SYAA 1GN4A 2DWEC 2FTKA 3IGAC 1UPGA 3RT3C 5IJ9B 4MVQA 1Q6IA 4MVOA 1VQLV 3HKCA 3A0HZ 4JAUA 1HNZB 4JYYA 5LGNA 1YTFD 3G80A 4I55B 4PA7A 4UCUA 5B1NA 1M56B 1P7GA 1Q3EA 4E2LA 1V54C 2EJ7A 1SC5B 2F66C 4X62O 4DRXA 5L3BA 3QO7A 1XMQO 3U11A 3AG1C 4BIUA 1D5NA 4X1IA 3E8GA 5DECA 1PL4A 2QTSA 3AG3B 1XNQB 2ETNA 1XL6A 2CK3G 1N33O 3ZMSA 1F7YA 1K97A 5JVDA 5F2VO 2DN9A 2KSDA 4FLXA 2OCCC 4ABMA 1UJWB 2PUSA 3ZEDA 3GWOA 3LUTB 4DV4B 1AI6A 1TUEB 4U7NA 4K8ZA 2GTSA 2QKSA 2BSKB 3CE2A 5IY5B 1WB8A 1ZLZA 1DGSA 1YJNV 2UXDO 5LMNO 5J2UA 4LF4O 5LYJB 4I9WA 4BAYA 3QO5A 3K5MA 1RSOA 1NH2D 4PDLA 2A7WA 1NVPD 3B09A 2W6JG 5GTIZ 2JS5A 2ZNIA 1V54B 2E76B 2Z3YA 1ZSPA 1TVKA 1QNMA 2LJ2A 3SPIA 3CD6V 1Q82W 3AK3A 4IHJA 5HFMA 4DV0B 1AVMA 4UCRA 3HKDB 5EYPB 3FB5C 2GV9A 1W0KG 1US6A 4TQDA 4YXWG 4P9OA 3CCJV 5K1PA 1PNLA 4J9ZB 1YSCA 5GONB 3OTFA 5FNVB 3OMNB 2WA3A 4NXNB 2YIDA 3B4SA 2YDEA 3APQA 3GB7C 1MZFA 2VQFO 2HJDA 1G8MA 4I0XA 2DW4A 1YEWA 2O57A 5LXTB 4UV9A 2X0LA 5JQGA 1SESA 4JI0B 4LFCO 3E2EA 2ZDIA 3OUFA 2ZXWC 4YHHB 1YXBA 2Q67A 1OCRC 3JATA 1N36O 5IYCO 1QLEC 2VRZA 2QM7A 4YIPA 4TSFG 4K3AA 1CEZA 1VF5B 4JYAB 3HKEB 3OTOB 4JI7B 1YJ9V 4JAVA 3E8BA 4RO2A 5A2QN 2Z0AA 3X2QB 3K59A 2X6CA 3CB2A 5EBLC 1TA8A 5ITZA 1I5XA 4K0KO 4FJCC 1Q86W 2OYQA 3ETQA 5EZYA 2JRIA 2D3OW 1M90W 2JVDA 2Q68A 5LHGA 3RN4A 4I9QA 2W0FC 4F6RB 3FB7C 4B3RO 1IBLO 3B77A 3CCRV 1W0JG 3WB0A 1N8RW 2QWRB 2XUMA 3IAYA 2RN9A 5KHHA 4X20B 1HW7A 1QLEB 5KHIA 4NTWA 5FPOA 3E83A 4PA4A 1RM1B 2Y69B 3SPCA 2E5LB 2ZE6A 2KG7B 1VF6A 3FAVB 1SERA 3M7MX 3GWKC 1D2DA 1DTOA 3LNNA 4YJ2A 1HNXB 1BHBA 4CC5A 3TXQA 1K5SA 4YIOA 3N2KA 4DV5B 1QR9A 4I50B 1HR0B 2Y0IA 2BOCC 3A0RA 1OHHG 1YZBA 4IIJB 5EBWC 1QVFU 2DOSA 3UO3A 2QWNB 3T1HB 1RFYA 1FJGB 4I4TB 3K79A 1YHQV 1VARA 3EHBB 4RWUA 2P5OA 1Y76B 5CA1B 4JI8B 2BTQA 2K9PA 4KUMA 3D3IA 2BOBC 3JD2A 1YJWV 3PJSK 2HEPA 4HBNA 2HLDG 1VF6C 3IC9A 2VQEO 4TUYA 4F4LA 3HR0A 4PI0A 2E74B 3K04A 4JTAB 4J80A 4KL1A 2ZE7A 4FM1A 4J7KA 4LNUA 5LOVA 4G27B 5BR8B 1NTMH 1FXHA 1PM9A 4B3MB 3AG4B 1GN2A 1AJNA 2A9HA 2UXBO 3JARB 1N32B 3SYPA 2CGNA 1SQVH 2B1GA 2JGDA 2X6BA 5B1BC 4WFBV 4GKJO 5JJEB 4YY3B 1GM8A 3H1JH 1PP9H 4CZZA 5C8YB 3JCUZ 1KECA 2DE0X 2F95B 4MVZA 1XNRO 3CXHF 4MTFA 5LA6A 2CTWA 4JI4O 2QGNA 5L3EA 4CH6A 5LBQA 1BQ0A 4XDJA 4Z1VA 3JAWA 2ITCC 1JOYA 4KHPB 3LNMB 1N0NA 2R9AA 3P32A 4CS3A 3VBBA 4JAAA 3A2FA 3CSXA 1SQFA 2PGGA 4U3JA 1QCEA 4GKKB 2NN4A 2ZT9B 2RQ6A 2UUAO 1RP3B 3IC7A 2WLLB 5CA0B 2PTMA 4D6TH 4JV5B 3WG7B 2YXYA 5B3SB 3OEHG 3LDDA 3ASNC 3TXSA 4DV6O 1K34A 3RVZA 5IYZB 4MVSA 4OPAA 3DSQA 2E75B 3TETA 4B7KA 2ZE5A 3VQYA 1FFXA 1R3KC 3OE7G 4NVPA 4DO2A 4LF7O 4JASA 3JD0A 2BCCH 5J2TA 2BTQB 4O4LB 2F43G 1S77D 4WCEV 1IZ3A 3CHXA 3DTUB 1S76D 4FFKA 5CBHA 4X64O
chains in the Genus database with same CATH topology
2CTRA 2QWPB 1FPOA 2CTPA 2M6YA 3UCSC 4RWUA 1IURA 2N05A 2Y4UA 1N4CA 3BVOA 1WJZA 2CUGA 2KQXA 2GUZB 2L6LA 4J80A 3UO2A 1XBLA 2Y4TA 1BQZA 2QWQB 4IT5A 2LO1A 2YS8A 3APOA 3UO3A 2QSAA 2QWNB 4J7ZA 1FAFA 2DMXA 2CTWA 2YUAA 1HDJA 2LGWA 2PF4E 3AG7A 2DN9A 1GH6A 2CTQA 2OCHA 2EJ7A 2QWOB 1BQ0A 2QWRB 2GUZA 2N04A 3APQA 1NZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTR A;  2QWP B;  1FPO A;  2CTP A;  2M6Y A;  3UCS C;  4RWU A;  1IUR A;  2N05 A;  2Y4U A;  1N4C A;  3BVO A;  1WJZ A;  2CUG A;  2KQX A;  2GUZ B;  2L6L A;  4J80 A;  3UO2 A;  1XBL A;  2Y4T A;  1BQZ A;  2QWQ B;  4IT5 A;  2LO1 A;  2YS8 A;  3APO A;  3UO3 A;  2QSA A;  2QWN B;  4J7Z A;  1FAF A;  2DMX A;  2CTW A;  2YUA A;  1HDJ A;  2LGW A;  2PF4 E;  3AG7 A;  2DN9 A;  1GH6 A;  2CTQ A;  2OCH A;  2EJ7 A;  2QWO B;  1BQ0 A;  2QWR B;  2GUZ A;  2N04 A;  3APQ A;  1NZ6 A; 
#chains in the Genus database with same CATH topology
 2PI5 A;  4QE7 A;  4X88 A;  5GTH Z;  1YCI A;  4O2A A;  1N33 B;  5J9P C;  2YEV A;  3PN1 A;  1VQO V;  3UO2 A;  5B1A B;  3ZN0 A;  5IE9 A;  3ZHT A;  1GM9 A;  4LF6 O;  2R72 A;  1PV0 A;  3RYC A;  2A0L A;  2GDS A;  3JD3 A;  1D5A A;  3E35 A;  3JCZ A;  4DV3 O;  2EIL B;  3K0G A;  4O4H B;  2P7T C;  3VQV A;  3RYI A;  2ZR2 A;  2WLI A;  4GX1 A;  5LMN B;  3OW2 U;  4LF4 B;  3C3S A;  2R70 A;  1MOF A;  4PDR A;  1H2K A;  2P90 A;  2QTO A;  4Z1M G;  1RPR A;  4MTG A;  2PYL A;  5EC2 C;  5BZB A;  1O9H A;  3UT5 B;  1AI7 A;  2LQT A;  4LFA O;  4B3S O;  4DW0 A;  5BMV A;  4CH4 A;  1ZWI C;  2AW9 A;  3JSN A;  3JAL A;  1MA1 A;  4ICG A;  1XIL A;  3K0D A;  1JFF B;  1VQ5 V;  1S0V A;  2DQ0 A;  3IFX A;  3ZHU A;  3D36 A;  2VQF B;  2K1E A;  4QIW F;  4UCT A;  2EIM C;  2ODM A;  1PD3 A;  1XHX A;  2P06 A;  5H5N A;  1BZK A;  2Q69 A;  3LSS A;  2YI8 A;  2ATK C;  1QQC A;  4ASU G;  2QKA A;  5KUK A;  1HWY A;  3K9A A;  4L8J A;  3EVK A;  4U3F H;  1GN6 A;  1K4D C;  3CCV V;  1N36 B;  5LP6 A;  2EIN B;  4CS2 A;  1KC8 W;  2LP7 A;  4PA3 A;  2AGA A;  1Q7Y W;  2JDI G;  2XHB A;  2M6Y A;  4O2B A;  2VWK A;  1BMF G;  1H2M A;  3RW0 A;  4UV8 A;  1QVG U;  4LF9 B;  4TV8 B;  4HNA B;  3SDL A;  1VMG A;  1B6Q A;  4K0K B;  1TAE A;  1H8E G;  4PD4 F;  2EIJ C;  3D36 C;  3FYI B;  1OJH A;  3DXR B;  3ZMV A;  3T1Y O;  2WLM A;  2Z5U A;  3H1L H;  1W59 A;  1B06 A;  4B3R B;  1IBL B;  5KMG A;  5JWP A;  2E3C A;  3QO8 A;  1JR9 A;  4FFB B;  2ZM6 B;  1AR1 B;  4WFF A;  2CH7 A;  3N2G B;  3JAS A;  4JI2 O;  4ZI7 A;  5LP6 C;  1OCZ C;  2KB1 A;  2QWP B;  4BR6 A;  1TUB A;  4EB6 B;  3LSU A;  4HZ3 A;  2PZS A;  3M8A A;  2Q4P A;  4GX2 A;  1XEQ A;  3STZ C;  5BMV B;  4UCV A;  2R9I A;  2N74 A;  3L9D A;  4UXN A;  3ZRW A;  1EN5 A;  4J42 A;  2JK5 C;  4DR3 O;  1LUW A;  1X59 A;  4DR5 O;  2Q7E A;  1SZX A;  1JVM A;  1Y6X A;  2CGO A;  1ROP A;  2R9R B;  4NXM O;  3SJQ C;  3L74 H;  3SR2 C;  1EZJ A;  3HKB B;  3FX7 A;  2Y0P A;  2P67 A;  3J81 N;  1YDX A;  1GAX A;  4MT8 A;  4JF3 A;  2CAZ C;  3AG7 A;  2B5U A;  3G67 A;  3CCL V;  3ZHR A;  5KX5 B;  1VQ4 V;  4J9Y B;  1OCC C;  4U7O A;  1P7B A;  5LL6 Y;  1OCZ B;  1Y74 B;  3L75 H;  3NXS A;  4RUF A;  5CB4 B;  4BIZ A;  2JJ2 G;  5B5E Z;  2EJR A;  1G4Y B;  4ZOL A;  2AHY A;  4BIO A;  1SA0 B;  2VQE B;  2QM4 A;  5FPR A;  4G2K A;  3RYF B;  4CH3 A;  4ZHQ A;  1AIL A;  4X66 O;  3K5N A;  4IL6 Z;  4DV2 O;  1R6T A;  4FZ1 A;  2PYJ A;  4QPK A;  4H13 B;  3B8M A;  2YSU B;  3ETG A;  4KP4 A;  2RNB A;  4JI6 B;  1P4R A;  2GBO A;  2UXB B;  4GKJ B;  3QG5 A;  2GTA A;  2A79 B;  4UB6 Z;  4WFG A;  5KAF Z;  1KP3 A;  5IYB O;  1OCO C;  1KP2 A;  2N05 A;  1XQ8 A;  3AG1 B;  1F23 A;  4TV9 B;  2KQX A;  1XBL A;  3E89 A;  4JI4 B;  3JD4 A;  1SZT A;  3K57 A;  1Q43 A;  3ML0 A;  2ADQ B;  5AG2 A;  4JYC A;  3CC7 V;  2RMK B;  3A0B Z;  2Q9L A;  3MAQ A;  4O4I A;  5IJ0 B;  2OCC B;  3FB8 C;  1K33 A;  2EUL A;  3JAK B;  2UUA B;  4XDK A;  2A06 H;  1IXM A;  4WFH A;  3B40 A;  1BQZ A;  4LF8 O;  3I55 V;  1U96 A;  4TWK A;  3HKC B;  3CCE V;  3Q4H A;  3E22 A;  1NZ6 A;  1VP7 A;  1ZX3 A;  1IVS A;  1FPO A;  1YIT V;  4O4J A;  4LF7 B;  1KKC A;  4DRX B;  3WU2 Z;  5JH7 A;  1Q8I A;  4X1I B;  1IBK O;  2QM8 A;  3SPG A;  3SYC A;  2UUB B;  1FXK A;  3NR7 A;  4R8C A;  1RPO A;  4Q20 A;  3TJT A;  3RFR A;  3RYH A;  2VWJ A;  4B3T O;  5JVD B;  3OMA B;  3MHS C;  3KCY A;  1KUQ A;  4LF6 B;  4R7C A;  4QE9 A;  1WA8 A;  4DV3 B;  3FFQ A;  3RVY A;  4OX9 B;  4JTD B;  4UB8 Z;  4FVM A;  5KA6 A;  1L0L H;  2ZXW B;  1GKF A;  5J2U B;  2UU9 O;  4MVM A;  5H6R A;  2ZDI C;  3J7A U;  5LGU A;  1RSO B;  2M7W A;  1OCR B;  5D5Q A;  5IDJ A;  4PEL A;  1VEW A;  4PDV A;  3ZHQ A;  5LMU O;  2QA4 V;  1Q6H A;  2NNU A;  2HKO A;  2W0X A;  2EIK C;  1TVK B;  5KHG A;  2RDC A;  4P2Z A;  2WLN A;  4B3S B;  4X65 O;  4FMT A;  4IHJ B;  1AB3 A;  2OT5 A;  3TK1 A;  3L73 H;  1L0N H;  1J5E O;  1FXK C;  1NI8 A;  3H1H H;  3OFN G;  3W7S A;  1NBM G;  2Y4T A;  2LO1 A;  2EZO A;  4X1K A;  4D7T A;  4I0X B;  1VQ9 V;  3UM7 A;  4B7E A;  1B04 A;  1VQ6 V;  4DK1 A;  2UXC O;  5IWA O;  5FL7 G;  1H2N A;  5JQG B;  1H2L A;  1S3J A;  2OIG A;  3ASO C;  1I0H A;  3BA9 A;  4PJ0 Z;  4DR2 O;  3JAT B;  1I94 B;  2F93 B;  2AZ2 A;  1VQM V;  4UCS A;  4QGP A;  2ZKO A;  1XL4 A;  4DR7 B;  3ZBH A;  3WB2 A;  4I5S A;  1VQ8 V;  3QTC A;  1MSW D;  1X4T A;  4FZ0 A;  3OGC C;  3QVN A;  1K73 W;  5K1X A;  1T5E A;  4IGG A;  2UUC B;  5ITZ B;  3K3W A;  3ZRX A;  1XMO O;  1VF7 A;  2HVJ C;  3A8T A;  3OEE G;  3FKS G;  2YIA A;  4KFM A;  5EZY B;  5JJJ B;  2DYS C;  1COW G;  3SGI A;  3ABU A;  3CRC A;  2YI9 A;  3ZRV A;  3T1Y B;  1AI4 A;  3CJH A;  3D3Q A;  3U0Z A;  2IM9 A;  4PI2 A;  2F23 A;  3ABM C;  3ASO B;  1NR7 A;  5BY1 A;  4HAM A;  1Q6U A;  2HVK C;  4DV1 O;  4LWS A;  4FLU A;  3F5W C;  4JI2 B;  4JI3 O;  5CBF A;  4ZKI A;  3AK1 A;  1SF9 A;  3F7Y C;  4CC6 A;  2LW1 A;  3N27 A;  4F6E A;  1NQT A;  3L72 H;  3UCS C;  4YJ2 B;  1L8D A;  3KG2 A;  1NKD A;  4WBN A;  4GZR B;  3N2K B;  1NTZ H;  2BE3 A;  5D5P A;  4DR3 B;  3L70 H;  4DR5 B;  1WP8 A;  5GW7 A;  4J7Z A;  2EBO A;  3CRM A;  5KHK A;  3T1C A;  1LUV A;  3AG2 C;  3ZRS A;  2GUZ A;  4RUE A;  3BEH A;  4NXM B;  5CA3 A;  3CS5 A;  5B1B B;  1K7D A;  3CPW U;  1ARO P;  2C2A A;  2ITD C;  1M9N A;  2XND G;  3C3T A;  3KKY A;  5LHH A;  3CME V;  1N0J A;  4X62 B;  1R1B A;  2ZIM A;  1W2B U;  2Q7H A;  4R50 A;  3SJB C;  1XMQ B;  4JGS A;  4LH7 A;  2HHH O;  1QLN A;  5JCO A;  3KZI Z;  1JJO A;  1M93 A;  2ZD9 A;  4EFB A;  1R3I C;  1CXZ B;  2UXN A;  2UXX A;  5LHI A;  1Z5V A;  1ZL8 A;  4J10 A;  2DWD C;  4TUY B;  2ZCE A;  4LC1 A;  4X1Y A;  4IYI A;  4X66 B;  4JI7 O;  1G1X B;  1KKD A;  2LGW A;  2WSS G;  4DV2 B;  2P22 C;  2AHZ A;  2PF4 E;  3E86 A;  3BAA A;  4K8X A;  4LNU B;  5LOV B;  3OGI B;  3ASN B;  1AP6 A;  2UXD B;  1YIJ V;  3GVM A;  1MSD A;  4FK5 C;  4OGQ B;  4BW9 A;  2XTA A;  2P4K A;  2JGD B;  2QKC A;  3BPZ A;  1IX9 A;  4YJ3 A;  2Q73 A;  4W4K A;  5CN0 A;  2WA4 A;  3P3P A;  4CBC A;  2ARH A;  5LA6 B;  1QR8 A;  1Z5W A;  3RBZ A;  1MAB G;  4GT1 A;  1U97 A;  4LF5 O;  4UVC A;  2PY5 A;  1NT2 B;  3LDC A;  2IW5 A;  3JAW B;  3ZHS A;  5JCO C;  1E1Q G;  2QEX V;  1Q5O A;  4CH5 A;  1FXV A;  2F4V O;  5L3G A;  4U3J B;  1BE3 H;  3EFF K;  4DR4 O;  2YIB A;  1HNX O;  1K92 A;  2CDY A;  1HNW O;  4LF8 B;  4DV5 O;  4LFC B;  3O9O A;  1HR0 O;  1E1R G;  1KYO F;  2VS0 A;  1S5L Z;  3M99 B;  2MK3 A;  1FAF A;  1R73 A;  2YXH A;  5IJ9 A;  1F4M A;  2QJ1 A;  2ZIO A;  1FFX B;  1JMK C;  4PHZ A;  4FLW A;  4LFB O;  2X6A A;  5J2T B;  5B1O A;  2IJJ A;  1ZUQ A;  2GHY A;  4I55 A;  1UFI A;  4H37 A;  3CCM V;  2IJH A;  2Q0O C;  2Y48 A;  4IT5 A;  2KKW A;  2HFE C;  3CYO A;  1DK1 A;  2WLJ A;  4X8A A;  5LGT A;  1F51 A;  2FKX A;  4H33 A;  2Q8V A;  4O2A B;  3UKM A;  5H9C A;  2YEV B;  4LH6 A;  3J80 N;  2ZNJ A;  2CTQ A;  4B3T B;  4AIL C;  1YI2 V;  3JD1 A;  3H1K H;  5KHJ A;  1SQB H;  4JZG A;  2EIM B;  3CCU V;  3S3X A;  2IU0 A;  3RYC B;  3E8F A;  4LR3 A;  4JI1 O;  3WFV A;  1GO3 F;  3FYE B;  4FLZ A;  1EFR G;  4BW5 A;  4JI5 O;  3RYI B;  2WLI B;  3G71 V;  4FLY A;  2UU9 B;  3CCQ V;  3H01 A;  4DV7 O;  1EBO A;  1K4C C;  1KMI Z;  2BSK A;  2FYU H;  4J41 A;  2LW7 A;  5BR8 O;  5DN6 G;  5EIB C;  5LMU B;  1P84 F;  5LYJ A;  5FLX N;  4GLX A;  4BWA A;  2CE4 A;  1WN7 A;  3B2E E;  3P3N A;  1PL0 A;  1FD9 A;  4YY3 O;  1AJQ A;  2FL4 A;  1M56 C;  1J5E B;  3C90 A;  2ADP A;  4GCZ A;  4RQE A;  1Q90 D;  2OIE A;  3JAL B;  2IH1 C;  3CRR A;  3HKD A;  2W6I G;  2BTO A;  4TQF A;  4DUZ O;  2WAM A;  5EYP A;  3FB6 C;  1K8A W;  4MTX A;  2QE7 G;  5KAI Z;  2EIJ B;  4PV1 B;  5E79 Z;  3AG3 C;  3BY6 A;  1P49 A;  5GON A;  4KHP O;  3ZN1 A;  5FNV A;  2UXC B;  4GUN A;  3LDE A;  1EN4 A;  1EM1 A;  1OV9 A;  3ZS8 C;  4MW3 A;  1PNM A;  1R6K A;  5LXT A;  3OT7 A;  1NR1 A;  2G38 A;  5IY5 C;  1IBM O;  4DR2 B;  5LP6 B;  4NR1 A;  4FM0 A;  1XDC A;  1BS3 A;  5L3D A;  1ZTE A;  4O2B B;  1CPY A;  2XAQ A;  3K9S A;  3HKE A;  1O9G A;  4FM2 A;  1N34 O;  3SPJ A;  1V55 C;  4FLV A;  4RAI A;  1XMO B;  3CP1 A;  1OZ0 A;  3MD0 A;  5JJN B;  1DF4 A;  1JJ2 U;  1TGO A;  2V4D A;  5DM6 V;  1KU9 A;  3KCX A;  2GSM B;  4DR6 O;  4L87 A;  2P6J A;  4Z2W A;  1K9M W;  5B66 Z;  3ZMT A;  5KMG B;  1BCC H;  4DR1 O;  3G4S V;  2ZIN A;  3L71 H;  1OCC B;  1LR1 A;  4F6R A;  4DV1 B;  4TOI A;  2CH7 B;  1XNR B;  1VIB A;  4AQY O;  2IU3 A;  4JI3 B;  1BHA A;  3JAS B;  2V1D A;  4ZI7 B;  1VQN V;  3APO A;  4X20 A;  4AI8 A;  1TUB B;  3CC2 V;  1WAZ A;  1QU7 A;  2H8P C;  3U10 A;  3I5D A;  4XDL A;  2V7Q G;  2KG7 A;  1H8H G;  3ZRW B;  1V55 B;  3FAV A;  4JPR A;  1IUR A;  3CMA V;  1FFT B;  5C93 A;  1SQX H;  3QF7 A;  1ENV A;  5H2F Z;  1BT8 A;  2F1M A;  4I50 A;  2YIB D;  3X2Q C;  3MHH C;  3CX5 F;  4DV6 B;  3LSQ A;  2QWO B;  4MTO A;  4IIJ A;  1NU1 H;  4AHC A;  1SKV A;  1AR4 A;  4C7U A;  1KB9 F;  1WNS A;  1Z2G A;  5EIB D;  1OCO B;  1M4U A;  4ZBM A;  5L3C A;  4I4T A;  4RQF A;  4TT3 G;  2ILM A;  3T4Z A;  3O65 A;  1Q81 W;  4UUJ C;  1EN6 A;  4MS2 A;  2HHH B;  1Y76 A;  4X64 B;  2B1I A;  4N21 A;  4EFE A;  5CA1 A;  1S5J A;  3H9V A;  1WP7 A;  1XOU A;  2QDO A;  1JA8 A;  3QNE A;  4ZOL B;  2CTP A;  1RM1 C;  2Y69 C;  4ZHQ B;  4X89 A;  4Q6G A;  1A32 A;  4LF9 O;  1XUQ A;  1LNQ A;  1WB7 A;  5KUM A;  2OCH A;  5EBM C;  1MG1 A;  1QHT A;  3K58 A;  3ZHV A;  1SRY A;  2XAS A;  3K5L A;  1VQP V;  1I08 A;  3JAR A;  4LFA B;  3ZMU A;  1GTO A;  4GX0 A;  3CXC U;  5C8Y A;  3R66 A;  3VOU A;  4A5U B;  4LF5 B;  2DQ3 A;  4NTX A;  2ZM6 O;  2NR5 A;  3K03 A;  4NB5 A;  2P4V A;  2HP8 A;  4QPJ A;  3SPH A;  4DUY O;  4MVR A;  4O4I B;  2HJF C;  1KD1 W;  2F4V B;  3ZMZ A;  4WF9 V;  1YF2 A;  3AK2 A;  4KXR A;  3K08 A;  2IH3 C;  4DR4 B;  3HPL C;  3TCU A;  4MSW C;  3VQX A;  1WLE A;  4PA6 A;  1HNW B;  2AXT Z;  2IJI A;  2WPD G;  2PI4 A;  5CA0 A;  2WLL A;  1QBZ A;  1AJP A;  1Y4M A;  3Q4H B;  3E22 B;  1BSM A;  4NYK A;  1SS3 A;  2YS8 A;  2EIK B;  3OR7 C;  1GM7 A;  4O4J B;  1M5I A;  3ETE A;  2LGQ A;  4LFB B;  3AG4 C;  1HNZ O;  5IYZ A;  4NTY A;  1H38 A;  2IBZ H;  1S5H C;  5JH7 B;  2N04 A;  1DF5 A;  3R65 A;  1PKX A;  1VQ7 V;  1FXK B;  5EK0 A;  4O4L A;  3ZJZ A;  4ZIB A;  3RYH B;  1K3E A;  2OWO A;  4FLT A;  3OR6 C;  4EEQ A;  2FML A;  1XNQ O;  2DMX A;  1HDJ A;  3JSL A;  1R3L C;  3JYC A;  4JTC B;  2QR4 A;  4OXS A;  4JI1 B;  1AI5 A;  2JEX A;  1AR5 A;  3DC6 A;  1JPX A;  1WA8 B;  3ICX A;  2OTJ V;  2XOK G;  2NLJ C;  4JI5 B;  3ABL C;  5HFL A;  4IYH A;  4LCU C;  3CRQ A;  4DV7 B;  3MDS A;  3BVO A;  3I56 V;  4FPP A;  4DV4 O;  2YXL A;  2JJ1 G;  4O4H A;  3WG7 C;  2D2C B;  3RWR D;  5B3S C;  4JI6 O;  3BHP A;  3ABT A;  4JZ2 A;  3RGB A;  3AEI A;  1V9P A;  5CBG A;  4UCO A;  3W7T A;  1S72 V;  4N23 A;  3UT5 A;  2OTL V;  1L1F A;  1MZE A;  2YC0 A;  4DV0 O;  4DUZ B;  3CC4 V;  1NJI W;  2XAF A;  1FS0 G;  5BXZ A;  3CCS V;  1B3Q A;  2DYS B;  1FYJ A;  2IJK A;  2Q7G A;  3ZX6 A;  2RCV A;  3SJA C;  2XT9 A;  4X1K B;  1GRJ A;  1JFF A;  4HYO A;  4FIP C;  3ABK C;  3ABL B;  1E79 G;  3BFR A;  2JIZ G;  4NXN O;  2Y4U A;  5B1A C;  1MNG A;  3BCC H;  3ABM B;  3B8N A;  2ZR3 A;  1XI1 A;  3EXA A;  2ZE8 A;  4H0L B;  5IT9 N;  3S3W A;  2JEU A;  1ORQ C;  2EIL C;  1IBM B;  3CWB H;  1ZAU A;  4JI0 O;  1R3J C;  3E8H A;  2HG5 C;  3ETD A;  1Y66 A;  4YHH O;  3W7X A;  1IDS A;  1NTK H;  3IJ4 A;  4CS4 A;  1KBH A;  4X9Q A;  2MW2 B;  2YIC A;  4JYA O;  4DYL A;  1N34 B;  4G28 B;  3OTO O;  4DK0 A;  2YUA A;  1YVW A;  3DGE A;  3TGU H;  3HB3 B;  2UUB O;  1BGY H;  3AG2 B;  4TV8 A;  4HNA A;  2L35 A;  2WLK A;  4LBE C;  2DJV A;  4QJF B;  4MW8 A;  3ABK B;  1M57 C;  2B9Z A;  1N4C A;  4OPH A;  2DYR C;  5IYD O;  4DR6 B;  1AP5 A;  3CJH B;  4B08 A;  4W4L A;  5DED A;  3DXR A;  4DR1 B;  1J95 A;  2Q5Z A;  1THZ A;  2EX3 A;  1KQS U;  4OX9 O;  5TIS Z;  1SQP H;  2H3O A;  4UVB A;  4AQY B;  4LWS B;  2WLH A;  3OMI B;  3WB1 A;  4QNH B;  1SQG A;  4WFA V;  2Q0A A;  4DW1 A;  1URF A;  4FFB A;  1WJZ A;  3OUS A;  3N2G A;  2JGU A;  4GYC B;  2JS3 A;  2EIN C;  3SYO A;  2HR3 A;  2E5L O;  1EZV H;  4WBN B;  4EB6 A;  4UFZ A;  1I7F A;  1R6N A;  2A3Q A;  4EKW A;  2RJZ A;  1H2G A;  3OAA G;  3F5T A;  1M57 B;  1CP9 A;  1WPX A;  1DLB A;  3JAM N;  4XBF A;  2DYR B;  2GUZ B;  1HP8 A;  1I5Y A;  3BA8 A;  1GMG A;  4GX5 A;  2XAG A;  5KA5 A;  1SET A;  3T1H O;  1FJG O;  5EC1 C;  3HKB A;  4UVA A;  1PNK A;  3CRA A;  2XAJ A;  1IBK B;  1YTF B;  3SJC C;  3SYQ A;  3ZCC A;  5KX5 A;  4JI8 O;  1JCH A;  1Y74 A;  2Q6A A;  1I94 O;  3D8C A;  1ZL8 B;  2X7R B;  1K5Q A;  1GH6 A;  3T2M A;  3BRC A;  1H2S B;  3K06 A;  1F4N A;  3UQ8 A;  5CB4 A;  4X1Y B;  2FB5 A;  3CEI A;  3ZIA G;  1JQ0 A;  3FD9 A;  3STL C;  1JX9 A;  4DR7 O;  4H44 B;  1SA0 A;  3P30 A;  2CUG A;  2ZQM A;  2L6L A;  2AZ0 A;  1NS1 A;  5L3F A;  4K35 A;  3RYF A;  1VQK V;  3T4D A;  4P9P A;  3W7U A;  1FKA O;  4D7S A;  2UUC O;  2H94 A;  4NKG B;  3BAB A;  5E1A C;  5H6Q A;  3OM3 B;  5A9G A;  3G6B A;  3DC5 A;  3OD4 A;  4WFE A;  4P30 A;  2CTR A;  4B3M O;  2WWW A;  4YJ3 B;  1N32 O;  1PPJ H;  4X65 B;  1GN3 A;  1NH2 B;  1M1K W;  4J11 A;  1NVP B;  4MVU A;  3K5O A;  4R6Z A;  3THO A;  4JYB A;  4TV9 A;  1WPB A;  2LFR A;  1IXB A;  2LFS A;  5KLV H;  3W7W A;  4DUY B;  3VQW A;  4LP8 A;  1BL8 A;  1XRE A;  2XAH A;  4J7J A;  1SQQ H;  4I7Z B;  3H1I H;  1Y67 A;  4PA9 A;  1MMM A;  2QWQ B;  1XHZ A;  5CMU A;  3F7V C;  5IJ0 A;  5IWA B;  4E4E A;  2QSA A;  4DXW A;  3JAK A;  1G6U A;  4GKK O;  2EZP A;  4JV5 O;  3G6E V;  4PDM A;  1GK9 A;  3SYA A;  1GN4 A;  2DWE C;  2FTK A;  3IGA C;  1UPG A;  3RT3 C;  5IJ9 B;  4MVQ A;  1Q6I A;  4MVO A;  1VQL V;  3HKC A;  3A0H Z;  4JAU A;  1HNZ B;  4JYY A;  5LGN A;  1YTF D;  3G80 A;  4I55 B;  4PA7 A;  4UCU A;  5B1N A;  1M56 B;  1P7G A;  1Q3E A;  4E2L A;  1V54 C;  2EJ7 A;  1SC5 B;  2F66 C;  4X62 O;  4DRX A;  5L3B A;  3QO7 A;  1XMQ O;  3U11 A;  3AG1 C;  4BIU A;  1D5N A;  4X1I A;  3E8G A;  5DEC A;  1PL4 A;  2QTS A;  3AG3 B;  1XNQ B;  2ETN A;  1XL6 A;  2CK3 G;  1N33 O;  3ZMS A;  1F7Y A;  1K97 A;  5JVD A;  5F2V O;  2DN9 A;  2KSD A;  4FLX A;  2OCC C;  4ABM A;  1UJW B;  2PUS A;  3ZED A;  3GWO A;  3LUT B;  4DV4 B;  1AI6 A;  1TUE B;  4U7N A;  4K8Z A;  2GTS A;  2QKS A;  2BSK B;  3CE2 A;  5IY5 B;  1WB8 A;  1ZLZ A;  1DGS A;  1YJN V;  2UXD O;  5LMN O;  5J2U A;  4LF4 O;  5LYJ B;  4I9W A;  4BAY A;  3QO5 A;  3K5M A;  1RSO A;  1NH2 D;  4PDL A;  2A7W A;  1NVP D;  3B09 A;  2W6J G;  5GTI Z;  2JS5 A;  2ZNI A;  1V54 B;  2E76 B;  2Z3Y A;  1ZSP A;  1TVK A;  1QNM A;  2LJ2 A;  3SPI A;  3CD6 V;  1Q82 W;  3AK3 A;  4IHJ A;  5HFM A;  4DV0 B;  1AVM A;  4UCR A;  3HKD B;  5EYP B;  3FB5 C;  2GV9 A;  1W0K G;  1US6 A;  4TQD A;  4YXW G;  4P9O A;  3CCJ V;  5K1P A;  1PNL A;  4J9Z B;  1YSC A;  5GON B;  3OTF A;  5FNV B;  3OMN B;  2WA3 A;  4NXN B;  2YID A;  3B4S A;  2YDE A;  3APQ A;  3GB7 C;  1MZF A;  2VQF O;  2HJD A;  1G8M A;  4I0X A;  2DW4 A;  1YEW A;  2O57 A;  5LXT B;  4UV9 A;  2X0L A;  5JQG A;  1SES A;  4JI0 B;  4LFC O;  3E2E A;  2ZDI A;  3OUF A;  2ZXW C;  4YHH B;  1YXB A;  2Q67 A;  1OCR C;  3JAT A;  1N36 O;  5IYC O;  1QLE C;  2VRZ A;  2QM7 A;  4YIP A;  4TSF G;  4K3A A;  1CEZ A;  1VF5 B;  4JYA B;  3HKE B;  3OTO B;  4JI7 B;  1YJ9 V;  4JAV A;  3E8B A;  4RO2 A;  5A2Q N;  2Z0A A;  3X2Q B;  3K59 A;  2X6C A;  3CB2 A;  5EBL C;  1TA8 A;  5ITZ A;  1I5X A;  4K0K O;  4FJC C;  1Q86 W;  2OYQ A;  3ETQ A;  5EZY A;  2JRI A;  2D3O W;  1M90 W;  2JVD A;  2Q68 A;  5LHG A;  3RN4 A;  4I9Q A;  2W0F C;  4F6R B;  3FB7 C;  4B3R O;  1IBL O;  3B77 A;  3CCR V;  1W0J G;  3WB0 A;  1N8R W;  2QWR B;  2XUM A;  3IAY A;  2RN9 A;  5KHH A;  4X20 B;  1HW7 A;  1QLE B;  5KHI A;  4NTW A;  5FPO A;  3E83 A;  4PA4 A;  1RM1 B;  2Y69 B;  3SPC A;  2E5L B;  2ZE6 A;  2KG7 B;  1VF6 A;  3FAV B;  1SER A;  3M7M X;  3GWK C;  1D2D A;  1DTO A;  3LNN A;  4YJ2 A;  1HNX B;  1BHB A;  4CC5 A;  3TXQ A;  1K5S A;  4YIO A;  3N2K A;  4DV5 B;  1QR9 A;  4I50 B;  1HR0 B;  2Y0I A;  2BOC C;  3A0R A;  1OHH G;  1YZB A;  4IIJ B;  5EBW C;  1QVF U;  2DOS A;  3UO3 A;  2QWN B;  3T1H B;  1RFY A;  1FJG B;  4I4T B;  3K79 A;  1YHQ V;  1VAR A;  3EHB B;  4RWU A;  2P5O A;  1Y76 B;  5CA1 B;  4JI8 B;  2BTQ A;  2K9P A;  4KUM A;  3D3I A;  2BOB C;  3JD2 A;  1YJW V;  3PJS K;  2HEP A;  4HBN A;  2HLD G;  1VF6 C;  3IC9 A;  2VQE O;  4TUY A;  4F4L A;  3HR0 A;  4PI0 A;  2E74 B;  3K04 A;  4JTA B;  4J80 A;  4KL1 A;  2ZE7 A;  4FM1 A;  4J7K A;  4LNU A;  5LOV A;  4G27 B;  5BR8 B;  1NTM H;  1FXH A;  1PM9 A;  4B3M B;  3AG4 B;  1GN2 A;  1AJN A;  2A9H A;  2UXB O;  3JAR B;  1N32 B;  3SYP A;  2CGN A;  1SQV H;  2B1G A;  2JGD A;  2X6B A;  5B1B C;  4WFB V;  4GKJ O;  5JJE B;  4YY3 B;  1GM8 A;  3H1J H;  1PP9 H;  4CZZ A;  5C8Y B;  3JCU Z;  1KEC A;  2DE0 X;  2F95 B;  4MVZ A;  1XNR O;  3CXH F;  4MTF A;  5LA6 A;  2CTW A;  4JI4 O;  2QGN A;  5L3E A;  4CH6 A;  5LBQ A;  1BQ0 A;  4XDJ A;  4Z1V A;  3JAW A;  2ITC C;  1JOY A;  4KHP B;  3LNM B;  1N0N A;  2R9A A;  3P32 A;  4CS3 A;  3VBB A;  4JAA A;  3A2F A;  3CSX A;  1SQF A;  2PGG A;  4U3J A;  1QCE A;  4GKK B;  2NN4 A;  2ZT9 B;  2RQ6 A;  2UUA O;  1RP3 B;  3IC7 A;  2WLL B;  5CA0 B;  2PTM A;  4D6T H;  4JV5 B;  3WG7 B;  2YXY A;  5B3S B;  3OEH G;  3LDD A;  3ASN C;  3TXS A;  4DV6 O;  1K34 A;  3RVZ A;  5IYZ B;  4MVS A;  4OPA A;  3DSQ A;  2E75 B;  3TET A;  4B7K A;  2ZE5 A;  3VQY A;  1FFX A;  1R3K C;  3OE7 G;  4NVP A;  4DO2 A;  4LF7 O;  4JAS A;  3JD0 A;  2BCC H;  5J2T A;  2BTQ B;  4O4L B;  2F43 G;  1S77 D;  4WCE V;  1IZ3 A;  3CHX A;  3DTU B;  1S76 D;  4FFK A;  5CBH A;  4X64 O; 
#chains in the Genus database with same CATH homology
 2CTR A;  2QWP B;  1FPO A;  2CTP A;  2M6Y A;  3UCS C;  4RWU A;  1IUR A;  2N05 A;  2Y4U A;  1N4C A;  3BVO A;  1WJZ A;  2CUG A;  2KQX A;  2GUZ B;  2L6L A;  4J80 A;  3UO2 A;  1XBL A;  2Y4T A;  1BQZ A;  2QWQ B;  4IT5 A;  2LO1 A;  2YS8 A;  3APO A;  3UO3 A;  2QSA A;  2QWN B;  4J7Z A;  1FAF A;  2DMX A;  2CTW A;  2YUA A;  1HDJ A;  2LGW A;  2PF4 E;  3AG7 A;  2DN9 A;  1GH6 A;  2CTQ A;  2OCH A;  2EJ7 A;  2QWO B;  1BQ0 A;  2QWR B;  2GUZ A;  2N04 A;  3APQ A;  1NZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...