2N04A

Solution structure of the phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
104
Chain Sequence
MRSPGMADQRQRSLTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily C member 5
total genus 24
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n04A00
3UO3A 2LGWA 2QWOB 3UCSC 3AG7A 2GUZA 1BQZA 2QWPB 2CTWA 1XBLA 1N4CA 4IT5A 2LO1A 1NZ6A 2L6LA 2N05A 2M6YA 4RWUA 1BQ0A 2CUGA 2QWRB 4J80A 3UO2A 1WJZA 2QSAA 2DMXA 2DN9A 1FAFA 2CTPA 2OCHA 2EJ7A 1FPOA 2Y4UA 3APOA 2CTRA 2N04A 2YS8A 1IURA 2GUZB 2KQXA 1GH6A 2QWQB 2Y4TA 2PF4E 3APQA 3BVOA 1HDJA 4J7ZA 2YUAA 2QWNB 2CTQA
chains in the Genus database with same CATH superfamily
5DM6V 4DR2O 5JJNB 3CCQV 3AG1B 4FFKA 4BIUA 4DR7B 3G6BA 4QNHB 1US6A 4OXSA 1ZSPA 1KKDA 4I5SA 1FS0G 1V54B 2GSMB 4B08A 2HJDA 4B3SO 3LSUA 2E5LO 4DR3O 3E22A 4LF9B 1E1RG 4PHZA 1CPYA 3H1KH 1SQQH 4R8CA 4KUMA 5DN6G 5EC2C 4EB6B 3FD9A 1BS3A 1XEQA 4MSWC 4B3RO 1SRYA 4H33A 4FMTA 5KHHA 4WF9V 2UU9B 4PDVA 1AJPA 3C3SA 4RAIA 3D3QA 2QJ1A 4MVOA 1GM7A 4TV9B 1EN4A 1NT2B 3JAKA 4R50A 3B2EE 1WA8B 2ZE7A 1H2SB 3HKBB 5J2UA 2AZ0A 4ZBMA 2PGGA 4H13B 3SGIA 4LF6O 1VMGA 1LNQA 1TAEA 1VQ9V 4J80A 3ABLB 3JASB 5CB4B 2OCHA 5LXTA 1SQGA 3ZMUA 1QR8A 4N21A 4DR4O 1KBHA 2ILMA 1XHZA 4UCVA 3JATB 4MVMA 2EBOA 1AVMA 4KP4A 4MW8A 3K9SA 1Q7YW 3SJBC 3ZMSA 2CGOA 3WFVA 1K4CC 4UV8A 1N32O 3T1YB 2P22C 1R3LC 2N04A 3CRRA 4HNAB 5C8YB 5IYZB 4X65O 3H1JH 1Q43A 3G6EV 4UFZA 5LA6B 5IJ9B 3K79A 4LF7O 4PV1B 4MT8A 4J42A 2KSDA 3FB6C 2BSKA 4GLXA 3CCUV 1HR0O 3EFFK 1JQ0A 1JPXA 1VQ4V 5IYCO 3ZHRA 2KB1A 3W7TA 2EZOA 3ZHUA 3SYCA 1AP5A 2P6JA 5LGNA 2Y69C 3SYAA 1I94O 3ABUA 4RWUA 5FPOA 3N2GB 1Z5WA 2WSSG 5JQGA 2UUAO 1HNXB 3ZHTA 1WB8A 3LSSA 4O4LA 4O2AB 5A2QN 3C3TA 3RYHA 4DR3B 3Q4HA 1IBLO 4EFEA 2P7TC 2DOSA 3GVMA 2R70A 3ZJZA 4LH7A 2DYSC 1RM1B 3ETDA 4CS3A 3HKDA 1F23A 2KKWA 2CE4A 4I55B 3ZEDA 2JRIA 4IHJA 2IJIA 2GHYA 4X20B 5J2UB 3ASNB 3O65A 2EILB 4XDKA 4LFAB 2KG7B 3BVOA 4X8AA 4Z1MG 5JWPA 1QQCA 3E8BA 3SJAC 4FLYA 4P30A 1DTOA 2QWPB 3RYFA 4IHJB 2WLIA 3WB2A 5LHGA 2UU9O 2JK5C 2QR4A 1H8HG 2FMLA 1R3KC 4CC5A 3K5NA 3JARA 3LUTB 1YTFD 4JI7O 2LFRA 4MS2A 1P84F 4PI2A 3G80A 3JARB 4I50A 3J80N 1K33A 1K34A 4ICGA 2FL4A 4B3SB 4CH6A 1BHAA 5LHIA 3JAWA 3MHHC 1AROP 5B1AB 3SDLA 4AHCA 5HFLA 2LJ2A 3IC7A 1FAFA 1K9MW 5H9CA 1Q8IA 4JI5B 3BY6A 3ABMC 5KHGA 3IAYA 1F4NA 4JI8O 3L74H 2A0LA 2RN9A 3VQXA 3CP1A 4K0KO 1I94B 1D5AA 2Z0AA 3SPJA 1GO3F 5EIBD 1MOFA 2ATKC 4LF6B 1QR9A 2H94A 5L3DA 4LF5O 1S77D 3OEHG 4IT5A 4MW3A 3L73H 4BIOA 3B8NA 4D7SA 4E2LA 2DWEC 1XMQB 1Z2GA 2Y4TA 3OMAB 1VQ7V 1MZEA 3FB5C 4CH3A 2IH3C 4B7KA 3AK2A 1N32B 2N05A 1Q81W 3L71H 3K9AA 2XAGA 1P4RA 4NXNO 5EYPA 1AI5A 5F2VO 3AG2C 3D36A 1DK1A 2YICA 4MTOA 4LP8A 4FK5C 2A79B 1U97A 2KQXA 2QWQB 1KC8W 3E86A 4DV0B 3M7MX 1OCOC 2EZPA 2P90A 4JYBA 5EZYB 1YEWA 1EZJA 4LWSB 4LNUB 1AJQA 1NH2D 3OD4A 2X6CA 5B3SC 1WP8A 3U0ZA 3K58A 2ZCEA 2ZXWB 1DLBA 3H1LH 2MW2B 3DXRA 1GK9A 4PA4A 2BTOA 2EIMB 4UVBA 2R9IA 1DGSA 1UJWB 4IYHA 2ZKOA 3HKCB 1L0NH 2BOCC 5H5NA 3CC2V 1YF2A 2GV9A 2P67A 2D3OW 4LFBB 2AGAA 4DV2O 3APQA 1SESA 3ZHVA 2YI8A 4U7OA 2XNDG 1NZ6A 2K9PA 1KYOF 1BMFG 4WFGA 1TGOA 2VQEB 4NKGB 3UO2A 3ABTA 1HNZB 3DXRB 4LCUC 2YS8A 3I5DA 2ZNJA 4ZOLA 5E1AC 2DE0X 1I5YA 1OHHG 1Y6XA 4PDLA 1Y66A 4GKJB 1YSCA 1GRJA 1K8AW 1FD9A 4PDRA 5L3FA 4ZIBA 3ZRWA 1FYJA 3A2FA 2Q6AA 4PA9A 2IJHA 1IURA 1KP3A 4DV4O 4FFBA 4P9PA 5IWAB 2JS3A 5IT9N 4EKWA 3LNMB 4WCEV 1BE3H 1IXMA 3TCUA 4JYAB 2D2CB 2XAQA 4WFEA 2LW7A 3K08A 4O4HB 1K7DA 4K8ZA 5ITZA 4OX9O 2QTOA 3K5OA 3OR6C 4KL1A 2R72A 5KA6A 4PDMA 1YJNV 1N33O 1NKDA 3KCXA 3U11A 3TETA 4NTXA 1WNSA 5CA0A 2IU3A 2YXLA 1PV0A 3A8TA 4JTCB 3BABA 4K8XA 4CS4A 4W4LA 3B09A 1JA8A 1LR1A 4O4HA 5B3SB 4I9QA 3JATA 3OAAG 2M6YA 1BQ0A 3TJTA 5L3EA 4FLUA 1IBKB 3AG3B 3DC5A 5EC1C 3PJSK 3H1HH 1SQVH 1FJGB 1A32A 2ZQMA 4YHHB 1Z5VA 3RYIB 1BL8A 2QTSA 4DV1O 1PNKA 2WWWA 3LSQA 4X9QA 1Q6IA 3BA8A 5DECA 4X66O 5KAIZ 5BR8B 1K73W 2RCVA 4JZ2A 1Y4MA 4NTYA 4EEQA 1XOUA 2WLLA 1FPOA 5KHKA 4DV3O 3G67A 1M57B 5B5EZ 4DUYO 3KCYA 3C90A 1H38A 4HYOA 1IBLB 4Q6GA 2IW5A 3CRQA 2Q4PA 4Q20A 4HAMA 2VQFO 3IFXA 1N34B 4JI4O 4GKKB 3A0RA 2WLJA 1N8RW 2DJVA 1XNQB 4LFBO 2RDCA 3UT5B 4W4KA 2EIMC 4X64O 3CCRV 4OPAA 2X6AA 2ZINA 4FLZA 3CRMA 3CEIA 4O4LB 3JD1A 1KB9F 1YHQV 4X1IB 4RQEA 4J9YB 4DUZO 3E8GA 2IJJA 3FAVB 2PY5A 1R1BA 2ZR3A 4UCOA 3ZHQA 3HB3B 2Q67A 2R9AA 1ZL8B 4GKJO 2FKXA 3ABLC 2ZDIA 4KXRA 4X1IA 1IZ3A 4CBCA 4D6TH 4GUNA 4FM0A 1TUBB 2HEPA 2VRZA 4GX1A 1FXKB 1IDSA 1SF9A 2PZSA 2OT5A 5GTHZ 2WLKA 3WG7C 1NQTA 4QPJA 4NVPA 1AP6A 4U7NA 3JYCA 1OCCB 2YXYA 3DC6A 3RYCA 2HKOA 4R7CA 1FFTB 2F4VO 1PP9H 5HFMA 1BQZA 1VF5B 3FKSG 2MK3A 4LF8B 1J5EB 3ZRWB 3FB7C 4X64B 5LYJB 2XASA 2E3CA 4JTDB 5JJEB 5LGTA 1R3JC 5CA1B 2ZXWC 3L70H 3FX7A 1GKFA 5IJ0B 1ZUQA 4DR6O 1MABG 4FPPA 4I0XA 3K04A 5TISZ 3ABKB 3P3PA 1R6KA 4DUZB 1N36B 1QVFU 5IY5B 5CBFA 3CXCU 4B3MB 4LF5B 2CGNA 4CZZA 1OCZC 4TSFG 1BCCH 1SQXH 4GYCB 3T1CA 4JI1B 5KHJA 3E2EA 3OW2U 1P49A 2Q69A 4JAVA 5KMGA 5AG2A 4HNAA 3HKEB 1N34O 4LFAO 3JAWB 4MVRA 4DRXB 3QNEA 3CB2A 3H1IH 2Q5ZA 4O2BA 2JDIG 4MTFA 4DUYB 1M90W 5LOVB 2G38A 2AXTZ 2PTMA 3ICXA 1COWG 2M7WA 4TUYA 2GDSA 2GUZB 2YDEA 1TVKA 3JCUZ 4G27B 1YDXA 3CCJV 2ETNA 3K06A 3RYHB 4CH5A 2WA3A 4NR1A 5JVDA 1WPXA 2Q9LA 1DF4A 2AHYA 5E79Z 4X1KA 3TXQA 2ZM6B 3E83A 2CDYA 3VOUA 4BW5A 1QLNA 1I0HA 2V7QG 3ZRVA 2Q7HA 4JI7B 3CCVV 4JYAO 4JI1O 1SETA 2JGDB 4JF3A 1GTOA 1GH6A 2V1DA 4TQFA 1RPRA 5D5QA 1OJHA 3CPWU 3QO8A 2W6IG 1S5JA 2K1EA 2P4VA 1Q6HA 3ZIAG 2ADQB 1TUBA 4RUFA 1XILA 1M56C 5JVDB 4JI8B 4UUJC 1D5NA 3HKEA 5B1BC 4FLVA 2EX3A 5JQGB 4LC1A 5J2TA 2JJ2G 4J7ZA 4WFFA 4FM2A 1YXBA 5BY1A 3GWOA 1ZTEA 3AK1A 1SQPH 4YJ3A 2B1GA 3FYIB 3UM7A 4YJ2A 2UXCB 4I50B 4DR2B 2WLIB 2GTSA 4QE9A 4F6EA 4MVUA 4DK0A 2E75B 2HP8A 1HW7A 4WFHA 2NN4A 1YITV 2UUAB 1GN3A 1F51A 2QE7G 2P4KA 1SQFA 2XHBA 2Z5UA 2YUAA 1MMMA 5LXTB 1TVKB 1BGYH 5LP6C 2HG5C 5BZBA 3ML0A 3LDDA 5JCOC 1Q82W 3RWRD 1WP7A 2UXDO 5J2TB 2DQ3A 1WN7A 3K3WA 5CBGA 2Y69B 2ZE8A 2RNBA 3T1HO 3A0BZ 1QNMA 2ZR2A 5KX5A 1UPGA 2B5UA 2QWOB 5IYZA 4JASA 1M9NA 1JCHA 4UB6Z 5CN0A 1XHXA 2ITCC 2LO1A 2W0FC 3E8FA 4LNUA 4LFCO 1VQOV 1VQ8V 5IJ9A 1OCZB 4BR6A 4X1KB 1M57C 1XNRO 3CCMV 4EB6A 2YXHA 1K92A 3CCSV 3CX5F 3EVKA 1J5EO 4I9WA 4LF8O 3ABKC 4U3JA 3FYEB 1M4UA 4HZ3A 2EIKC 1VQNV 2RMKB 1MNGA 4GZRB 4LF9O 1PNLA 3SPIA 5LL6Y 1HNXO 4YJ3B 4OGQB 2YSUB 1K3EA 4B7EA 4TV8A 2JGUA 4NTWA 1IXBA 3SYPA 2UXCO 4TWKA 3RFRA 1NTMH 2UUCO 2CTQA 2FTKA 5L3BA 1MA1A 4XDLA 5EZYA 3IJ4A 2Q68A 4DV1B 2HFEC 3LNNA 4DV5B 1XUQA 1R73A 1NH2B 1B06A 3CCLV 1AR4A 1AI7A 1T5EA 4BAYA 5K1PA 3JAKB 2UXDB 4UCSA 2VWKA 1OV9A 2Y0IA 4B3TB 3G71V 3FAVA 3SPCA 5LP6A 3KKYA 2A7WA 2RJZA 3F5WC 4C7UA 3HKBA 2ZE6A 4F6RA 2NNUA 1VQ6V 2E5LB 1VP7A 1VF6C 2OTLV 1JMKC 4H0LB 5CB4A 1NJIW 1F4MA 4OX9B 1NI8A 2IJKA 3OTOB 1EN6A 2WLLB 2LGWA 1SA0B 2OWOA 1IBMO 1RM1C 1RFYA 2XAFA 4JI6O 2BCCH 4JV5O 1AJNA 1AI6A 4DV3B 4GT1A 4FLTA 2XAJA 1YTFB 1LUVA 3RVZA 1VARA 4JI0O 2WAMA 3MHSC 1BT8A 4HBNA 4UXNA 1O9HA 4AQYB 2HLDG 1S72V 4I7ZB 1VQMV 2WLMA 5C8YA 1WLEA 4F6RB 3HKDB 3N2GA 1NVPB 1OCRB 3OFNG 2F1MA 2CUGA 4DW0A 3K59A 2Q8VA 1HNZO 1LUWA 1ZL8A 3N2KB 5KHIA 1QU7A 5B1NA 3JSLA 4JI2B 3OR7C 4DR1O 2Y48A 4YY3O 4WBNA 3JD2A 5IYDO 4DR6B 2JIZG 1EM1A 2N74A 1QBZA 3H9VA 1FXVA 2FYUH 4O4JB 4KFMA 4JYYA 3ZCCA 4XBFA 1JVMA 1NTZH 3M8AA 1U96A 2PF4E 2HHHO 1Y76B 1RSOA 1QLEC 2IH1C 1W0JG 3LDCA 1KMIZ 1KP2A 4FZ0A 1AR5A 2UXXA 1V54C 3AEIA 3N27A 1PKXA 1WJZA 3AG2B 2QKSA 1URFA 4X89A 2EIJC 1RSOB 4CS2A 5J9PC 4MVZA 3K5MA 4O2AA 4H44B 5KLVH 2ITDC 3BFRA 3QF7A 5CBHA 5H6QA 3A0HZ 2F66C 1SS3A 3RYFB 3RW0A 1E79G 3RBZA 3VQVA 2LGQA 5GTIZ 2DMXA 4TT3G 3QO5A 3M99B 3E8HA 1YVWA 3BRCA 4DR1B 5GW7A 4JI2O 2DQ0A 3CWBH 4DV2B 4JTAB 3T1YO 1G4YB 1S76D 1Y74B 3JALB 1B04A 5A9GA 1FXHA 1MSDA 1MSWD 3BAAA 1GN6A 5IWAO 1GAXA 4JI4B 1R6TA 2HR3A 3OEEG 2QM7A 2UXNA 1HR0B 2NLJC 4BWAA 5IE9A 1NVPD 2QA4V 4AILC 3D8CA 4PA6A 3NXSA 2PYLA 5FLXN 4LF4B 4PELA 4WFAV 3T4ZA 2Q73A 1AB3A 3F5TA 1NBMG 5EBMC 4EFBA 1TA8A 3OUFA 2OYQA 3EHBB 4O4IA 4TQDA 3JSNA 3E35A 4I4TB 4JV5B 1NR1A 3THOA 1H2GA 2Q7GA 2DWDC 4J41A 2YC0A 1XDCA 3CHXA 1V55C 5CA1A 1BZKA 3SJQC 4P2ZA 4J9ZB 2PYJA 5JJJB 3ETEA 3P3NA 2QKAA 1IBKO 2ARHA 2XUMA 2W0XA 1HWYA 2HJFC 2O57A 4BW9A 1WA8A 1V55B 3TXSA 1WAZA 3S3WA 3B4SA 4DRXA 1YJWV 4UCRA 1JJOA 4F4LA 4QE7A 2F43G 2ZIMA 1YCIA 4DV6B 1N33B 3VQWA 4Z1VA 4IL6Z 4H37A 1FXKA 3DSQA 5IDJA 1BHBA 3VQYA 2JJ1G 4X62O 2QSAA 3FB8C 1FFXB 2Y4UA 1J95A 3CCEV 5GONA 3E22B 2QWNB 2XT9A 3AG7A 1KD1W 1UFIA 2B1IA 3K0DA 5C93A 1HNWO 1KUQA 4CC6A 3WB1A 4LR3A 1QCEA 1JFFA 2YIDA 3ZS8C 5IY5C 4DV7B 4K35A 1M5IA 2JS5A 5IJ0A 2Y0PA 1I5XA 3SPGA 4FLXA 4FZ1A 1G6UA 2E74B 5ITZB 2P06A 2ZT9B 2L6LA 4TV8B 1JR9A 1L0LH 3JD3A 4JAAA 2VQEO 3OTOO 2GTAA 3AG4B 3CRCA 3F7VC 5JH7B 4E4EA 1L1FA 1H2NA 2RQ6A 3ZMTA 1K5QA 2OIEA 4I4TA 4NYKA 1I08A 2LQTA 4DK1A 3FFQA 2Q0AA 4XDJA 4I0XB 2YEVA 5KA5A 1PL0A 2ZD9A 5B1BB 2PUSA 5B1OA 2QKCA 1TUEB 3MDSA 2W6JG 4DO2A 2LFSA 1D2DA 1RPOA 2X0LA 5CA0B 3DTUB 4QPKA 2GBOA 4UB8Z 1XBLA 4ZKIA 2ZM6O 4O4IB 1YZBA 1S5LZ 5FNVB 3IC9A 5EBWC 1XREA 2F95B 3NR7A 3T4DA 1ZX3A 1X59A 2AW9A 2YIBA 1Q90D 3GWKC 2UUCB 4GCZA 1ROPA 3BPZA 3SYOA 4UVCA 1K97A 2BOBC 2LP7A 3QG5A 2X7RB 1XI1A 1WB7A 1GN4A 3UCSC 4PJ0Z 1SZTA 4NXMB 1W2BU 3ABMB 1EN5A 3QTCA 1N0JA 4X20A 3J81N 4DR4B 2F23A 4ABMA 4JGSA 4YJ2B 5LGUA 5EK0A 1H2LA 1P7GA 1DF5A 1GM8A 1JFFB 1PL4A 1RP3B 1NU1H 4MTGA 1N4CA 5LOVA 3B8MA 3KZIZ 3DGEA 5H2FZ 1QLEB 2XTAA 3SR2C 1XMQO 4LH6A 2JEUA 3TK1A 2UUBB 1JOYA 1P7BA 3CYOA 4K3AA 3CXHF 1QHTA 3OT7A 4CH4A 1K4DC 1ORQC 1H2KA 2UXBO 1SZXA 1CXZB 4DXWA 3BCCH 3STLC 1KKCA 4X65B 2EINC 3ASOB 4J10A 2F93B 4ZI7A 3AG3C 4DW1A 3RN4A 5BMVA 4YXWG 3W7XA 4FFBB 1S3JA 4L8JA 2ZDIC 1HDJA 3ZN0A 3N2KA 3ZBHA 4NXNB 3X2QC 4I55A 2YIBD 2DYSB 4D7TA 1XNRB 4IYIA 4FLWA 2OCCB 4UV9A 2BTQB 2VS0A 3HR0A 4N23A 3ZMZA 1K5SA 3Q4HB 3ASOC 1N36O 4LF4O 2DYRB 3L75H 4WFBV 1KU9A 4GX0A 3UT5A 5K1XA 2HVJC 1FFXA 2OCCC 3CS5A 2YEVB 2Z3YA 2CAZC 5EIBC 3OGIB 1YIJV 1JJ2U 4OPHA 4FVMA 3AG4C 3JCZA 4IIJA 4JZGA 5KX5B 4FJCC 2QEXV 5CA3A 1I7FA 3VBBA 1ZLZA 1H2MA 2B9ZA 2KG7A 3W7SA 1N0NA 2QM8A 1EZVH 3JD0A 4U3FH 1F7YA 2JGDA 1G1XB 2LW1A 4IIJB 2VQFB 1JX9A 3OE7G 5CMUA 3F7YC 5LMNB 5LA6A 4JI5O 5B66Z 1GMGA 1THZA 1KECA 4YIPA 2IBZH 5KMGB 2CTPA 3K03A 3L9DA 2QGNA 4DR7O 1SQBH 1SA0A 2AZ2A 3RYIA 4A5UB 3SPHA 1ENVA 2PI5A 1Y67A 5KUKA 4P9OA 2ADPA 5LMUB 4ZHQB 2H8PC 5LP6B 3R65A 5LYJA 4GX5A 4G28B 2UUBO 5BXZA 3B77A 3RVYA 4FM1A 2DN9A 3CC4V 2NR5A 1Q86W 2EINB 1MZFA 4U3JB 4IGGA 2QM4A 3B40A 5D5PA 3AG1C 5KAFZ 1AILA 1H8EG 3IGAC 2BSKB 1Q5OA 4B3RB 2CH7B 1SC5B 5FPRA 1BSMA 1CEZA 2XAHA 2VWJA 5L3CA 3ZRXA 4LF7B 2Q0OC 2R9RB 3ZN1A 1G8MA 3GB7C 3OMIB 1SERA 2BE3A 5LMUO 4RUEA 3L72H 4YIOA 2IM9A 3D36C 3ZX6A 1EBOA 1S5HC 2JEXA 1PPJH 1XL6A 2P5OA 3X2QB 1X4TA 4JYCA 3OTFA 4AQYO 2OTJV 1NS1A 4X66B 5KUMA 3R66A 2WA4A 4X1YB 1KQSU 2X6BA 3JASA 4YHHO 3QVNA 2CK3G 4J11A 2ZE5A 3WU2Z 3TGUH 1FJGO 1OCOB 3RT3C 5BMVB 3OM3B 4R6ZA 1PD3A 4UVAA 2WLHA 3K0GA 4MTXA 2HHHB 5LBQA 1SKVA 3LDEA 4B3MO 3HPLC 2V4DA 4JI6B 4X62B 1IBMB 3I56V 3BHPA 5H6RA 1VF7A 4JAUA 5LMNO 3K5LA 3W7WA 3H01A 5DEDA 1VQLV 1E1QG 4AI8A 4DV6O 4PI0A 4RQFA 3UKMA 1ZWIC 1EFRG 2XOKG 4QGPA 1Q3EA 3UQ8A 3ZMVA 4QIWF 3STZC 4ZHQA 1AR1B 1O9GA 1M56B 2CTRA 2WPDG 3JAMN 1NR7A 5IYBO 1QVGU 2F4VB 4GKKO 1PM9A 1FKAO 1OZ0A 1IVSA 4X88A 3AK3A 3CRAA 1VIBA 4DV7O 2EIKB 2E76B 2EULA 2A06H 4DV5O 1V9PA 4UCTA 5GONB 1XQ8A 2AHZA 4ZOLB 3ASNC 1B6QA 1VEWA 3CMEV 4JI0B 4MVQA 1CP9A 4L87A 3JD4A 4GX2A 5BR8O 2UXBB 3BA9A 2EILC 1PNMA 1VQPV 3HKCA 4O4JA 3ETQA 4RO2A 3O9OA 4PA3A 1AI4A 4ASUG 3WB0A 4DV0O 3OGCC 3RGBA 2A9HA 3P30A 1XL4A 3ZHSA 3ZRSA 1Y76A 1VQ5V 2ODMA 3MAQA 3K57A 1R3IC 5B1AC 3UO3A 2YIAA 2H3OA 4X1YA 4PD4F 3QO7A 1XNQO 3CMAV 4B3TO 4JI3B 5LHHA 3MD0A 4WBNB 3D3IA 3OMNB 4LFCB 4LBEC 1B3QA 1R6NA 1FXKC 1XMOO 2ZNIA 2EJ7A 4BIZA 4YY3B 2EJRA 3E89A 2OIGA 1HP8A 1VF6A 4UCUA 3PN1A 4ZI7B 2GUZA 3T1HB 4J7JA 4TV9A 2DYRC 4FIPC 2L35A 1MG1A 1YI2V 3P32A 4DV4B 2WLNA 1Q6UA 2YI9A 1WPBA 4KHPB 4K0KB 3CE2A 4DR5O 1W0KG 4DR5B 1ZAUA 3JALA 4NXMO 4KHPO 2FB5A 2QDOA 5EYPB 2IU0A 1S0VA 1M93A 1NTKH 3T2MA 3CJHA 3W7UA 2CH7A 5L3GA 3ETGA 4PA7A 3OUSA 3APOA 4G2KA 2JVDA 5JCOA 4MVSA 1VQKV 3J7AU 3SJCC 3CD6V 4TUYB 2C2AA 2ZIOA 1OCRC 3CC7V 2HVKC 4LWSA 3CJHB 2BTQA 4JPRA 1XMOB 3CSXA 3U10A 2QWRB 1L8DA 4JI3O 1GN2A 3BEHA 4DYLA 4NB5A 3WG7B 3KG2A 3S3XA 4Z2WA 3RYCB 5FNVA 3I55V 4O2BB 2CTWA 1M1KW 1OCCC 4TOIA 3SYQA 5EBLC 2Q7EA 1IX9A 1Y74A 2PI4A 1W59A 4QJFB 4J7KA 2EIJB 2A3QA 1HNWB 2DW4A 3EXAA 5JH7A 1YJ9V 3G4SV 5FL7G 1GM9A
chains in the Genus database with same CATH topology
3UO3A 2LGWA 2QWOB 3UCSC 3AG7A 2GUZA 1BQZA 2QWPB 2CTWA 1XBLA 1N4CA 4IT5A 2LO1A 1NZ6A 2L6LA 2N05A 2M6YA 4RWUA 1BQ0A 2CUGA 2QWRB 4J80A 3UO2A 1WJZA 2QSAA 2DMXA 2DN9A 1FAFA 2CTPA 2OCHA 2EJ7A 1FPOA 2Y4UA 3APOA 2CTRA 2N04A 2YS8A 1IURA 2GUZB 2KQXA 1GH6A 2QWQB 2Y4TA 2PF4E 3APQA 3BVOA 1HDJA 4J7ZA 2YUAA 2QWNB 2CTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO3 A;  2LGW A;  2QWO B;  3UCS C;  3AG7 A;  2GUZ A;  1BQZ A;  2QWP B;  2CTW A;  1XBL A;  1N4C A;  4IT5 A;  2LO1 A;  1NZ6 A;  2L6L A;  2N05 A;  2M6Y A;  4RWU A;  1BQ0 A;  2CUG A;  2QWR B;  4J80 A;  3UO2 A;  1WJZ A;  2QSA A;  2DMX A;  2DN9 A;  1FAF A;  2CTP A;  2OCH A;  2EJ7 A;  1FPO A;  2Y4U A;  3APO A;  2CTR A;  2N04 A;  2YS8 A;  1IUR A;  2GUZ B;  2KQX A;  1GH6 A;  2QWQ B;  2Y4T A;  2PF4 E;  3APQ A;  3BVO A;  1HDJ A;  4J7Z A;  2YUA A;  2QWN B;  2CTQ A; 
#chains in the Genus database with same CATH topology
 5DM6 V;  4DR2 O;  5JJN B;  3CCQ V;  3AG1 B;  4FFK A;  4BIU A;  4DR7 B;  3G6B A;  4QNH B;  1US6 A;  4OXS A;  1ZSP A;  1KKD A;  4I5S A;  1FS0 G;  1V54 B;  2GSM B;  4B08 A;  2HJD A;  4B3S O;  3LSU A;  2E5L O;  4DR3 O;  3E22 A;  4LF9 B;  1E1R G;  4PHZ A;  1CPY A;  3H1K H;  1SQQ H;  4R8C A;  4KUM A;  5DN6 G;  5EC2 C;  4EB6 B;  3FD9 A;  1BS3 A;  1XEQ A;  4MSW C;  4B3R O;  1SRY A;  4H33 A;  4FMT A;  5KHH A;  4WF9 V;  2UU9 B;  4PDV A;  1AJP A;  3C3S A;  4RAI A;  3D3Q A;  2QJ1 A;  4MVO A;  1GM7 A;  4TV9 B;  1EN4 A;  1NT2 B;  3JAK A;  4R50 A;  3B2E E;  1WA8 B;  2ZE7 A;  1H2S B;  3HKB B;  5J2U A;  2AZ0 A;  4ZBM A;  2PGG A;  4H13 B;  3SGI A;  4LF6 O;  1VMG A;  1LNQ A;  1TAE A;  1VQ9 V;  4J80 A;  3ABL B;  3JAS B;  5CB4 B;  2OCH A;  5LXT A;  1SQG A;  3ZMU A;  1QR8 A;  4N21 A;  4DR4 O;  1KBH A;  2ILM A;  1XHZ A;  4UCV A;  3JAT B;  4MVM A;  2EBO A;  1AVM A;  4KP4 A;  4MW8 A;  3K9S A;  1Q7Y W;  3SJB C;  3ZMS A;  2CGO A;  3WFV A;  1K4C C;  4UV8 A;  1N32 O;  3T1Y B;  2P22 C;  1R3L C;  2N04 A;  3CRR A;  4HNA B;  5C8Y B;  5IYZ B;  4X65 O;  3H1J H;  1Q43 A;  3G6E V;  4UFZ A;  5LA6 B;  5IJ9 B;  3K79 A;  4LF7 O;  4PV1 B;  4MT8 A;  4J42 A;  2KSD A;  3FB6 C;  2BSK A;  4GLX A;  3CCU V;  1HR0 O;  3EFF K;  1JQ0 A;  1JPX A;  1VQ4 V;  5IYC O;  3ZHR A;  2KB1 A;  3W7T A;  2EZO A;  3ZHU A;  3SYC A;  1AP5 A;  2P6J A;  5LGN A;  2Y69 C;  3SYA A;  1I94 O;  3ABU A;  4RWU A;  5FPO A;  3N2G B;  1Z5W A;  2WSS G;  5JQG A;  2UUA O;  1HNX B;  3ZHT A;  1WB8 A;  3LSS A;  4O4L A;  4O2A B;  5A2Q N;  3C3T A;  3RYH A;  4DR3 B;  3Q4H A;  1IBL O;  4EFE A;  2P7T C;  2DOS A;  3GVM A;  2R70 A;  3ZJZ A;  4LH7 A;  2DYS C;  1RM1 B;  3ETD A;  4CS3 A;  3HKD A;  1F23 A;  2KKW A;  2CE4 A;  4I55 B;  3ZED A;  2JRI A;  4IHJ A;  2IJI A;  2GHY A;  4X20 B;  5J2U B;  3ASN B;  3O65 A;  2EIL B;  4XDK A;  4LFA B;  2KG7 B;  3BVO A;  4X8A A;  4Z1M G;  5JWP A;  1QQC A;  3E8B A;  3SJA C;  4FLY A;  4P30 A;  1DTO A;  2QWP B;  3RYF A;  4IHJ B;  2WLI A;  3WB2 A;  5LHG A;  2UU9 O;  2JK5 C;  2QR4 A;  1H8H G;  2FML A;  1R3K C;  4CC5 A;  3K5N A;  3JAR A;  3LUT B;  1YTF D;  4JI7 O;  2LFR A;  4MS2 A;  1P84 F;  4PI2 A;  3G80 A;  3JAR B;  4I50 A;  3J80 N;  1K33 A;  1K34 A;  4ICG A;  2FL4 A;  4B3S B;  4CH6 A;  1BHA A;  5LHI A;  3JAW A;  3MHH C;  1ARO P;  5B1A B;  3SDL A;  4AHC A;  5HFL A;  2LJ2 A;  3IC7 A;  1FAF A;  1K9M W;  5H9C A;  1Q8I A;  4JI5 B;  3BY6 A;  3ABM C;  5KHG A;  3IAY A;  1F4N A;  4JI8 O;  3L74 H;  2A0L A;  2RN9 A;  3VQX A;  3CP1 A;  4K0K O;  1I94 B;  1D5A A;  2Z0A A;  3SPJ A;  1GO3 F;  5EIB D;  1MOF A;  2ATK C;  4LF6 B;  1QR9 A;  2H94 A;  5L3D A;  4LF5 O;  1S77 D;  3OEH G;  4IT5 A;  4MW3 A;  3L73 H;  4BIO A;  3B8N A;  4D7S A;  4E2L A;  2DWE C;  1XMQ B;  1Z2G A;  2Y4T A;  3OMA B;  1VQ7 V;  1MZE A;  3FB5 C;  4CH3 A;  2IH3 C;  4B7K A;  3AK2 A;  1N32 B;  2N05 A;  1Q81 W;  3L71 H;  3K9A A;  2XAG A;  1P4R A;  4NXN O;  5EYP A;  1AI5 A;  5F2V O;  3AG2 C;  3D36 A;  1DK1 A;  2YIC A;  4MTO A;  4LP8 A;  4FK5 C;  2A79 B;  1U97 A;  2KQX A;  2QWQ B;  1KC8 W;  3E86 A;  4DV0 B;  3M7M X;  1OCO C;  2EZP A;  2P90 A;  4JYB A;  5EZY B;  1YEW A;  1EZJ A;  4LWS B;  4LNU B;  1AJQ A;  1NH2 D;  3OD4 A;  2X6C A;  5B3S C;  1WP8 A;  3U0Z A;  3K58 A;  2ZCE A;  2ZXW B;  1DLB A;  3H1L H;  2MW2 B;  3DXR A;  1GK9 A;  4PA4 A;  2BTO A;  2EIM B;  4UVB A;  2R9I A;  1DGS A;  1UJW B;  4IYH A;  2ZKO A;  3HKC B;  1L0N H;  2BOC C;  5H5N A;  3CC2 V;  1YF2 A;  2GV9 A;  2P67 A;  2D3O W;  4LFB B;  2AGA A;  4DV2 O;  3APQ A;  1SES A;  3ZHV A;  2YI8 A;  4U7O A;  2XND G;  1NZ6 A;  2K9P A;  1KYO F;  1BMF G;  4WFG A;  1TGO A;  2VQE B;  4NKG B;  3UO2 A;  3ABT A;  1HNZ B;  3DXR B;  4LCU C;  2YS8 A;  3I5D A;  2ZNJ A;  4ZOL A;  5E1A C;  2DE0 X;  1I5Y A;  1OHH G;  1Y6X A;  4PDL A;  1Y66 A;  4GKJ B;  1YSC A;  1GRJ A;  1K8A W;  1FD9 A;  4PDR A;  5L3F A;  4ZIB A;  3ZRW A;  1FYJ A;  3A2F A;  2Q6A A;  4PA9 A;  2IJH A;  1IUR A;  1KP3 A;  4DV4 O;  4FFB A;  4P9P A;  5IWA B;  2JS3 A;  5IT9 N;  4EKW A;  3LNM B;  4WCE V;  1BE3 H;  1IXM A;  3TCU A;  4JYA B;  2D2C B;  2XAQ A;  4WFE A;  2LW7 A;  3K08 A;  4O4H B;  1K7D A;  4K8Z A;  5ITZ A;  4OX9 O;  2QTO A;  3K5O A;  3OR6 C;  4KL1 A;  2R72 A;  5KA6 A;  4PDM A;  1YJN V;  1N33 O;  1NKD A;  3KCX A;  3U11 A;  3TET A;  4NTX A;  1WNS A;  5CA0 A;  2IU3 A;  2YXL A;  1PV0 A;  3A8T A;  4JTC B;  3BAB A;  4K8X A;  4CS4 A;  4W4L A;  3B09 A;  1JA8 A;  1LR1 A;  4O4H A;  5B3S B;  4I9Q A;  3JAT A;  3OAA G;  2M6Y A;  1BQ0 A;  3TJT A;  5L3E A;  4FLU A;  1IBK B;  3AG3 B;  3DC5 A;  5EC1 C;  3PJS K;  3H1H H;  1SQV H;  1FJG B;  1A32 A;  2ZQM A;  4YHH B;  1Z5V A;  3RYI B;  1BL8 A;  2QTS A;  4DV1 O;  1PNK A;  2WWW A;  3LSQ A;  4X9Q A;  1Q6I A;  3BA8 A;  5DEC A;  4X66 O;  5KAI Z;  5BR8 B;  1K73 W;  2RCV A;  4JZ2 A;  1Y4M A;  4NTY A;  4EEQ A;  1XOU A;  2WLL A;  1FPO A;  5KHK A;  4DV3 O;  3G67 A;  1M57 B;  5B5E Z;  4DUY O;  3KCY A;  3C90 A;  1H38 A;  4HYO A;  1IBL B;  4Q6G A;  2IW5 A;  3CRQ A;  2Q4P A;  4Q20 A;  4HAM A;  2VQF O;  3IFX A;  1N34 B;  4JI4 O;  4GKK B;  3A0R A;  2WLJ A;  1N8R W;  2DJV A;  1XNQ B;  4LFB O;  2RDC A;  3UT5 B;  4W4K A;  2EIM C;  4X64 O;  3CCR V;  4OPA A;  2X6A A;  2ZIN A;  4FLZ A;  3CRM A;  3CEI A;  4O4L B;  3JD1 A;  1KB9 F;  1YHQ V;  4X1I B;  4RQE A;  4J9Y B;  4DUZ O;  3E8G A;  2IJJ A;  3FAV B;  2PY5 A;  1R1B A;  2ZR3 A;  4UCO A;  3ZHQ A;  3HB3 B;  2Q67 A;  2R9A A;  1ZL8 B;  4GKJ O;  2FKX A;  3ABL C;  2ZDI A;  4KXR A;  4X1I A;  1IZ3 A;  4CBC A;  4D6T H;  4GUN A;  4FM0 A;  1TUB B;  2HEP A;  2VRZ A;  4GX1 A;  1FXK B;  1IDS A;  1SF9 A;  2PZS A;  2OT5 A;  5GTH Z;  2WLK A;  3WG7 C;  1NQT A;  4QPJ A;  4NVP A;  1AP6 A;  4U7N A;  3JYC A;  1OCC B;  2YXY A;  3DC6 A;  3RYC A;  2HKO A;  4R7C A;  1FFT B;  2F4V O;  1PP9 H;  5HFM A;  1BQZ A;  1VF5 B;  3FKS G;  2MK3 A;  4LF8 B;  1J5E B;  3ZRW B;  3FB7 C;  4X64 B;  5LYJ B;  2XAS A;  2E3C A;  4JTD B;  5JJE B;  5LGT A;  1R3J C;  5CA1 B;  2ZXW C;  3L70 H;  3FX7 A;  1GKF A;  5IJ0 B;  1ZUQ A;  4DR6 O;  1MAB G;  4FPP A;  4I0X A;  3K04 A;  5TIS Z;  3ABK B;  3P3P A;  1R6K A;  4DUZ B;  1N36 B;  1QVF U;  5IY5 B;  5CBF A;  3CXC U;  4B3M B;  4LF5 B;  2CGN A;  4CZZ A;  1OCZ C;  4TSF G;  1BCC H;  1SQX H;  4GYC B;  3T1C A;  4JI1 B;  5KHJ A;  3E2E A;  3OW2 U;  1P49 A;  2Q69 A;  4JAV A;  5KMG A;  5AG2 A;  4HNA A;  3HKE B;  1N34 O;  4LFA O;  3JAW B;  4MVR A;  4DRX B;  3QNE A;  3CB2 A;  3H1I H;  2Q5Z A;  4O2B A;  2JDI G;  4MTF A;  4DUY B;  1M90 W;  5LOV B;  2G38 A;  2AXT Z;  2PTM A;  3ICX A;  1COW G;  2M7W A;  4TUY A;  2GDS A;  2GUZ B;  2YDE A;  1TVK A;  3JCU Z;  4G27 B;  1YDX A;  3CCJ V;  2ETN A;  3K06 A;  3RYH B;  4CH5 A;  2WA3 A;  4NR1 A;  5JVD A;  1WPX A;  2Q9L A;  1DF4 A;  2AHY A;  5E79 Z;  4X1K A;  3TXQ A;  2ZM6 B;  3E83 A;  2CDY A;  3VOU A;  4BW5 A;  1QLN A;  1I0H A;  2V7Q G;  3ZRV A;  2Q7H A;  4JI7 B;  3CCV V;  4JYA O;  4JI1 O;  1SET A;  2JGD B;  4JF3 A;  1GTO A;  1GH6 A;  2V1D A;  4TQF A;  1RPR A;  5D5Q A;  1OJH A;  3CPW U;  3QO8 A;  2W6I G;  1S5J A;  2K1E A;  2P4V A;  1Q6H A;  3ZIA G;  2ADQ B;  1TUB A;  4RUF A;  1XIL A;  1M56 C;  5JVD B;  4JI8 B;  4UUJ C;  1D5N A;  3HKE A;  5B1B C;  4FLV A;  2EX3 A;  5JQG B;  4LC1 A;  5J2T A;  2JJ2 G;  4J7Z A;  4WFF A;  4FM2 A;  1YXB A;  5BY1 A;  3GWO A;  1ZTE A;  3AK1 A;  1SQP H;  4YJ3 A;  2B1G A;  3FYI B;  3UM7 A;  4YJ2 A;  2UXC B;  4I50 B;  4DR2 B;  2WLI B;  2GTS A;  4QE9 A;  4F6E A;  4MVU A;  4DK0 A;  2E75 B;  2HP8 A;  1HW7 A;  4WFH A;  2NN4 A;  1YIT V;  2UUA B;  1GN3 A;  1F51 A;  2QE7 G;  2P4K A;  1SQF A;  2XHB A;  2Z5U A;  2YUA A;  1MMM A;  5LXT B;  1TVK B;  1BGY H;  5LP6 C;  2HG5 C;  5BZB A;  3ML0 A;  3LDD A;  5JCO C;  1Q82 W;  3RWR D;  1WP7 A;  2UXD O;  5J2T B;  2DQ3 A;  1WN7 A;  3K3W A;  5CBG A;  2Y69 B;  2ZE8 A;  2RNB A;  3T1H O;  3A0B Z;  1QNM A;  2ZR2 A;  5KX5 A;  1UPG A;  2B5U A;  2QWO B;  5IYZ A;  4JAS A;  1M9N A;  1JCH A;  4UB6 Z;  5CN0 A;  1XHX A;  2ITC C;  2LO1 A;  2W0F C;  3E8F A;  4LNU A;  4LFC O;  1VQO V;  1VQ8 V;  5IJ9 A;  1OCZ B;  4BR6 A;  4X1K B;  1M57 C;  1XNR O;  3CCM V;  4EB6 A;  2YXH A;  1K92 A;  3CCS V;  3CX5 F;  3EVK A;  1J5E O;  4I9W A;  4LF8 O;  3ABK C;  4U3J A;  3FYE B;  1M4U A;  4HZ3 A;  2EIK C;  1VQN V;  2RMK B;  1MNG A;  4GZR B;  4LF9 O;  1PNL A;  3SPI A;  5LL6 Y;  1HNX O;  4YJ3 B;  4OGQ B;  2YSU B;  1K3E A;  4B7E A;  4TV8 A;  2JGU A;  4NTW A;  1IXB A;  3SYP A;  2UXC O;  4TWK A;  3RFR A;  1NTM H;  2UUC O;  2CTQ A;  2FTK A;  5L3B A;  1MA1 A;  4XDL A;  5EZY A;  3IJ4 A;  2Q68 A;  4DV1 B;  2HFE C;  3LNN A;  4DV5 B;  1XUQ A;  1R73 A;  1NH2 B;  1B06 A;  3CCL V;  1AR4 A;  1AI7 A;  1T5E A;  4BAY A;  5K1P A;  3JAK B;  2UXD B;  4UCS A;  2VWK A;  1OV9 A;  2Y0I A;  4B3T B;  3G71 V;  3FAV A;  3SPC A;  5LP6 A;  3KKY A;  2A7W A;  2RJZ A;  3F5W C;  4C7U A;  3HKB A;  2ZE6 A;  4F6R A;  2NNU A;  1VQ6 V;  2E5L B;  1VP7 A;  1VF6 C;  2OTL V;  1JMK C;  4H0L B;  5CB4 A;  1NJI W;  1F4M A;  4OX9 B;  1NI8 A;  2IJK A;  3OTO B;  1EN6 A;  2WLL B;  2LGW A;  1SA0 B;  2OWO A;  1IBM O;  1RM1 C;  1RFY A;  2XAF A;  4JI6 O;  2BCC H;  4JV5 O;  1AJN A;  1AI6 A;  4DV3 B;  4GT1 A;  4FLT A;  2XAJ A;  1YTF B;  1LUV A;  3RVZ A;  1VAR A;  4JI0 O;  2WAM A;  3MHS C;  1BT8 A;  4HBN A;  4UXN A;  1O9H A;  4AQY B;  2HLD G;  1S72 V;  4I7Z B;  1VQM V;  2WLM A;  5C8Y A;  1WLE A;  4F6R B;  3HKD B;  3N2G A;  1NVP B;  1OCR B;  3OFN G;  2F1M A;  2CUG A;  4DW0 A;  3K59 A;  2Q8V A;  1HNZ O;  1LUW A;  1ZL8 A;  3N2K B;  5KHI A;  1QU7 A;  5B1N A;  3JSL A;  4JI2 B;  3OR7 C;  4DR1 O;  2Y48 A;  4YY3 O;  4WBN A;  3JD2 A;  5IYD O;  4DR6 B;  2JIZ G;  1EM1 A;  2N74 A;  1QBZ A;  3H9V A;  1FXV A;  2FYU H;  4O4J B;  4KFM A;  4JYY A;  3ZCC A;  4XBF A;  1JVM A;  1NTZ H;  3M8A A;  1U96 A;  2PF4 E;  2HHH O;  1Y76 B;  1RSO A;  1QLE C;  2IH1 C;  1W0J G;  3LDC A;  1KMI Z;  1KP2 A;  4FZ0 A;  1AR5 A;  2UXX A;  1V54 C;  3AEI A;  3N27 A;  1PKX A;  1WJZ A;  3AG2 B;  2QKS A;  1URF A;  4X89 A;  2EIJ C;  1RSO B;  4CS2 A;  5J9P C;  4MVZ A;  3K5M A;  4O2A A;  4H44 B;  5KLV H;  2ITD C;  3BFR A;  3QF7 A;  5CBH A;  5H6Q A;  3A0H Z;  2F66 C;  1SS3 A;  3RYF B;  3RW0 A;  1E79 G;  3RBZ A;  3VQV A;  2LGQ A;  5GTI Z;  2DMX A;  4TT3 G;  3QO5 A;  3M99 B;  3E8H A;  1YVW A;  3BRC A;  4DR1 B;  5GW7 A;  4JI2 O;  2DQ0 A;  3CWB H;  4DV2 B;  4JTA B;  3T1Y O;  1G4Y B;  1S76 D;  1Y74 B;  3JAL B;  1B04 A;  5A9G A;  1FXH A;  1MSD A;  1MSW D;  3BAA A;  1GN6 A;  5IWA O;  1GAX A;  4JI4 B;  1R6T A;  2HR3 A;  3OEE G;  2QM7 A;  2UXN A;  1HR0 B;  2NLJ C;  4BWA A;  5IE9 A;  1NVP D;  2QA4 V;  4AIL C;  3D8C A;  4PA6 A;  3NXS A;  2PYL A;  5FLX N;  4LF4 B;  4PEL A;  4WFA V;  3T4Z A;  2Q73 A;  1AB3 A;  3F5T A;  1NBM G;  5EBM C;  4EFB A;  1TA8 A;  3OUF A;  2OYQ A;  3EHB B;  4O4I A;  4TQD A;  3JSN A;  3E35 A;  4I4T B;  4JV5 B;  1NR1 A;  3THO A;  1H2G A;  2Q7G A;  2DWD C;  4J41 A;  2YC0 A;  1XDC A;  3CHX A;  1V55 C;  5CA1 A;  1BZK A;  3SJQ C;  4P2Z A;  4J9Z B;  2PYJ A;  5JJJ B;  3ETE A;  3P3N A;  2QKA A;  1IBK O;  2ARH A;  2XUM A;  2W0X A;  1HWY A;  2HJF C;  2O57 A;  4BW9 A;  1WA8 A;  1V55 B;  3TXS A;  1WAZ A;  3S3W A;  3B4S A;  4DRX A;  1YJW V;  4UCR A;  1JJO A;  4F4L A;  4QE7 A;  2F43 G;  2ZIM A;  1YCI A;  4DV6 B;  1N33 B;  3VQW A;  4Z1V A;  4IL6 Z;  4H37 A;  1FXK A;  3DSQ A;  5IDJ A;  1BHB A;  3VQY A;  2JJ1 G;  4X62 O;  2QSA A;  3FB8 C;  1FFX B;  2Y4U A;  1J95 A;  3CCE V;  5GON A;  3E22 B;  2QWN B;  2XT9 A;  3AG7 A;  1KD1 W;  1UFI A;  2B1I A;  3K0D A;  5C93 A;  1HNW O;  1KUQ A;  4CC6 A;  3WB1 A;  4LR3 A;  1QCE A;  1JFF A;  2YID A;  3ZS8 C;  5IY5 C;  4DV7 B;  4K35 A;  1M5I A;  2JS5 A;  5IJ0 A;  2Y0P A;  1I5X A;  3SPG A;  4FLX A;  4FZ1 A;  1G6U A;  2E74 B;  5ITZ B;  2P06 A;  2ZT9 B;  2L6L A;  4TV8 B;  1JR9 A;  1L0L H;  3JD3 A;  4JAA A;  2VQE O;  3OTO O;  2GTA A;  3AG4 B;  3CRC A;  3F7V C;  5JH7 B;  4E4E A;  1L1F A;  1H2N A;  2RQ6 A;  3ZMT A;  1K5Q A;  2OIE A;  4I4T A;  4NYK A;  1I08 A;  2LQT A;  4DK1 A;  3FFQ A;  2Q0A A;  4XDJ A;  4I0X B;  2YEV A;  5KA5 A;  1PL0 A;  2ZD9 A;  5B1B B;  2PUS A;  5B1O A;  2QKC A;  1TUE B;  3MDS A;  2W6J G;  4DO2 A;  2LFS A;  1D2D A;  1RPO A;  2X0L A;  5CA0 B;  3DTU B;  4QPK A;  2GBO A;  4UB8 Z;  1XBL A;  4ZKI A;  2ZM6 O;  4O4I B;  1YZB A;  1S5L Z;  5FNV B;  3IC9 A;  5EBW C;  1XRE A;  2F95 B;  3NR7 A;  3T4D A;  1ZX3 A;  1X59 A;  2AW9 A;  2YIB A;  1Q90 D;  3GWK C;  2UUC B;  4GCZ A;  1ROP A;  3BPZ A;  3SYO A;  4UVC A;  1K97 A;  2BOB C;  2LP7 A;  3QG5 A;  2X7R B;  1XI1 A;  1WB7 A;  1GN4 A;  3UCS C;  4PJ0 Z;  1SZT A;  4NXM B;  1W2B U;  3ABM B;  1EN5 A;  3QTC A;  1N0J A;  4X20 A;  3J81 N;  4DR4 B;  2F23 A;  4ABM A;  4JGS A;  4YJ2 B;  5LGU A;  5EK0 A;  1H2L A;  1P7G A;  1DF5 A;  1GM8 A;  1JFF B;  1PL4 A;  1RP3 B;  1NU1 H;  4MTG A;  1N4C A;  5LOV A;  3B8M A;  3KZI Z;  3DGE A;  5H2F Z;  1QLE B;  2XTA A;  3SR2 C;  1XMQ O;  4LH6 A;  2JEU A;  3TK1 A;  2UUB B;  1JOY A;  1P7B A;  3CYO A;  4K3A A;  3CXH F;  1QHT A;  3OT7 A;  4CH4 A;  1K4D C;  1ORQ C;  1H2K A;  2UXB O;  1SZX A;  1CXZ B;  4DXW A;  3BCC H;  3STL C;  1KKC A;  4X65 B;  2EIN C;  3ASO B;  4J10 A;  2F93 B;  4ZI7 A;  3AG3 C;  4DW1 A;  3RN4 A;  5BMV A;  4YXW G;  3W7X A;  4FFB B;  1S3J A;  4L8J A;  2ZDI C;  1HDJ A;  3ZN0 A;  3N2K A;  3ZBH A;  4NXN B;  3X2Q C;  4I55 A;  2YIB D;  2DYS B;  4D7T A;  1XNR B;  4IYI A;  4FLW A;  2OCC B;  4UV9 A;  2BTQ B;  2VS0 A;  3HR0 A;  4N23 A;  3ZMZ A;  1K5S A;  3Q4H B;  3ASO C;  1N36 O;  4LF4 O;  2DYR B;  3L75 H;  4WFB V;  1KU9 A;  4GX0 A;  3UT5 A;  5K1X A;  2HVJ C;  1FFX A;  2OCC C;  3CS5 A;  2YEV B;  2Z3Y A;  2CAZ C;  5EIB C;  3OGI B;  1YIJ V;  1JJ2 U;  4OPH A;  4FVM A;  3AG4 C;  3JCZ A;  4IIJ A;  4JZG A;  5KX5 B;  4FJC C;  2QEX V;  5CA3 A;  1I7F A;  3VBB A;  1ZLZ A;  1H2M A;  2B9Z A;  2KG7 A;  3W7S A;  1N0N A;  2QM8 A;  1EZV H;  3JD0 A;  4U3F H;  1F7Y A;  2JGD A;  1G1X B;  2LW1 A;  4IIJ B;  2VQF B;  1JX9 A;  3OE7 G;  5CMU A;  3F7Y C;  5LMN B;  5LA6 A;  4JI5 O;  5B66 Z;  1GMG A;  1THZ A;  1KEC A;  4YIP A;  2IBZ H;  5KMG B;  2CTP A;  3K03 A;  3L9D A;  2QGN A;  4DR7 O;  1SQB H;  1SA0 A;  2AZ2 A;  3RYI A;  4A5U B;  3SPH A;  1ENV A;  2PI5 A;  1Y67 A;  5KUK A;  4P9O A;  2ADP A;  5LMU B;  4ZHQ B;  2H8P C;  5LP6 B;  3R65 A;  5LYJ A;  4GX5 A;  4G28 B;  2UUB O;  5BXZ A;  3B77 A;  3RVY A;  4FM1 A;  2DN9 A;  3CC4 V;  2NR5 A;  1Q86 W;  2EIN B;  1MZF A;  4U3J B;  4IGG A;  2QM4 A;  3B40 A;  5D5P A;  3AG1 C;  5KAF Z;  1AIL A;  1H8E G;  3IGA C;  2BSK B;  1Q5O A;  4B3R B;  2CH7 B;  1SC5 B;  5FPR A;  1BSM A;  1CEZ A;  2XAH A;  2VWJ A;  5L3C A;  3ZRX A;  4LF7 B;  2Q0O C;  2R9R B;  3ZN1 A;  1G8M A;  3GB7 C;  3OMI B;  1SER A;  2BE3 A;  5LMU O;  4RUE A;  3L72 H;  4YIO A;  2IM9 A;  3D36 C;  3ZX6 A;  1EBO A;  1S5H C;  2JEX A;  1PPJ H;  1XL6 A;  2P5O A;  3X2Q B;  1X4T A;  4JYC A;  3OTF A;  4AQY O;  2OTJ V;  1NS1 A;  4X66 B;  5KUM A;  3R66 A;  2WA4 A;  4X1Y B;  1KQS U;  2X6B A;  3JAS A;  4YHH O;  3QVN A;  2CK3 G;  4J11 A;  2ZE5 A;  3WU2 Z;  3TGU H;  1FJG O;  1OCO B;  3RT3 C;  5BMV B;  3OM3 B;  4R6Z A;  1PD3 A;  4UVA A;  2WLH A;  3K0G A;  4MTX A;  2HHH B;  5LBQ A;  1SKV A;  3LDE A;  4B3M O;  3HPL C;  2V4D A;  4JI6 B;  4X62 B;  1IBM B;  3I56 V;  3BHP A;  5H6R A;  1VF7 A;  4JAU A;  5LMN O;  3K5L A;  3W7W A;  3H01 A;  5DED A;  1VQL V;  1E1Q G;  4AI8 A;  4DV6 O;  4PI0 A;  4RQF A;  3UKM A;  1ZWI C;  1EFR G;  2XOK G;  4QGP A;  1Q3E A;  3UQ8 A;  3ZMV A;  4QIW F;  3STZ C;  4ZHQ A;  1AR1 B;  1O9G A;  1M56 B;  2CTR A;  2WPD G;  3JAM N;  1NR7 A;  5IYB O;  1QVG U;  2F4V B;  4GKK O;  1PM9 A;  1FKA O;  1OZ0 A;  1IVS A;  4X88 A;  3AK3 A;  3CRA A;  1VIB A;  4DV7 O;  2EIK B;  2E76 B;  2EUL A;  2A06 H;  4DV5 O;  1V9P A;  4UCT A;  5GON B;  1XQ8 A;  2AHZ A;  4ZOL B;  3ASN C;  1B6Q A;  1VEW A;  3CME V;  4JI0 B;  4MVQ A;  1CP9 A;  4L87 A;  3JD4 A;  4GX2 A;  5BR8 O;  2UXB B;  3BA9 A;  2EIL C;  1PNM A;  1VQP V;  3HKC A;  4O4J A;  3ETQ A;  4RO2 A;  3O9O A;  4PA3 A;  1AI4 A;  4ASU G;  3WB0 A;  4DV0 O;  3OGC C;  3RGB A;  2A9H A;  3P30 A;  1XL4 A;  3ZHS A;  3ZRS A;  1Y76 A;  1VQ5 V;  2ODM A;  3MAQ A;  3K57 A;  1R3I C;  5B1A C;  3UO3 A;  2YIA A;  2H3O A;  4X1Y A;  4PD4 F;  3QO7 A;  1XNQ O;  3CMA V;  4B3T O;  4JI3 B;  5LHH A;  3MD0 A;  4WBN B;  3D3I A;  3OMN B;  4LFC B;  4LBE C;  1B3Q A;  1R6N A;  1FXK C;  1XMO O;  2ZNI A;  2EJ7 A;  4BIZ A;  4YY3 B;  2EJR A;  3E89 A;  2OIG A;  1HP8 A;  1VF6 A;  4UCU A;  3PN1 A;  4ZI7 B;  2GUZ A;  3T1H B;  4J7J A;  4TV9 A;  2DYR C;  4FIP C;  2L35 A;  1MG1 A;  1YI2 V;  3P32 A;  4DV4 B;  2WLN A;  1Q6U A;  2YI9 A;  1WPB A;  4KHP B;  4K0K B;  3CE2 A;  4DR5 O;  1W0K G;  4DR5 B;  1ZAU A;  3JAL A;  4NXM O;  4KHP O;  2FB5 A;  2QDO A;  5EYP B;  2IU0 A;  1S0V A;  1M93 A;  1NTK H;  3T2M A;  3CJH A;  3W7U A;  2CH7 A;  5L3G A;  3ETG A;  4PA7 A;  3OUS A;  3APO A;  4G2K A;  2JVD A;  5JCO A;  4MVS A;  1VQK V;  3J7A U;  3SJC C;  3CD6 V;  4TUY B;  2C2A A;  2ZIO A;  1OCR C;  3CC7 V;  2HVK C;  4LWS A;  3CJH B;  2BTQ A;  4JPR A;  1XMO B;  3CSX A;  3U10 A;  2QWR B;  1L8D A;  4JI3 O;  1GN2 A;  3BEH A;  4DYL A;  4NB5 A;  3WG7 B;  3KG2 A;  3S3X A;  4Z2W A;  3RYC B;  5FNV A;  3I55 V;  4O2B B;  2CTW A;  1M1K W;  1OCC C;  4TOI A;  3SYQ A;  5EBL C;  2Q7E A;  1IX9 A;  1Y74 A;  2PI4 A;  1W59 A;  4QJF B;  4J7K A;  2EIJ B;  2A3Q A;  1HNW B;  2DW4 A;  3EXA A;  5JH7 A;  1YJ9 V;  3G4S V;  5FL7 G;  1GM9 A; 
#chains in the Genus database with same CATH homology
 3UO3 A;  2LGW A;  2QWO B;  3UCS C;  3AG7 A;  2GUZ A;  1BQZ A;  2QWP B;  2CTW A;  1XBL A;  1N4C A;  4IT5 A;  2LO1 A;  1NZ6 A;  2L6L A;  2N05 A;  2M6Y A;  4RWU A;  1BQ0 A;  2CUG A;  2QWR B;  4J80 A;  3UO2 A;  1WJZ A;  2QSA A;  2DMX A;  2DN9 A;  1FAF A;  2CTP A;  2OCH A;  2EJ7 A;  1FPO A;  2Y4U A;  3APO A;  2CTR A;  2N04 A;  2YS8 A;  1IUR A;  2GUZ B;  2KQX A;  1GH6 A;  2QWQ B;  2Y4T A;  2PF4 E;  3APQ A;  3BVO A;  1HDJ A;  4J7Z A;  2YUA A;  2QWN B;  2CTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...