2N04A

Solution structure of the phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
104
Chain Sequence
MRSPGMADQRQRSLTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 24
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n04A00
2CTQA 3BVOA 1BQ0A 1IURA 3UO2A 2KQXA 2DN9A 4RWUA 2YS8A 3APOA 3UCSC 2GUZA 2M6YA 2DMXA 4IT5A 2N04A 3APQA 2QWOB 2LO1A 2N05A 2Y4TA 2QWRB 1FAFA 4J80A 1HDJA 2Y4UA 2L6LA 2CTRA 2GUZB 2CTWA 2CUGA 2EJ7A 1GH6A 1BQZA 1FPOA 2QWQB 2OCHA 2YUAA 1NZ6A 2QSAA 3UO3A 2PF4E 2QWPB 1XBLA 1N4CA 2CTPA 4J7ZA 1WJZA 2LGWA 3AG7A 2QWNB
chains in the Genus database with same CATH superfamily
1MSDA 1RM1C 4BAYA 1NS1A 2F43G 1QVFU 4BWAA 2XHBA 1EBOA 2QWRB 4F6RB 3J80N 4DK0A 1Q3EA 3W7TA 3F7YC 3CJHA 4U3JB 3L75H 5ITZA 1VQLV 1NBMG 2QKSA 1DLBA 2YXHA 4C7UA 4DR3B 2ZIOA 2QEXV 3T2MA 2LO1A 3HPLC 4DW1A 3W7UA 1N36B 2HLDG 2GSMB 2AGAA 4CH5A 3ZMTA 1E1QG 4LFAB 3K59A 4TV9B 5D5PA 1YZBA 1YHQV 5LGNA 1VQPV 1N33B 2Y69B 3JALA 1YCIA 3T1YB 1AJNA 4J9ZB 3THOA 4RO2A 3CB2A 2ZR3A 4LF5B 3MD0A 5JJNB 1QR9A 1M4UA 1F7YA 2YUAA 1K5QA 5LYJB 2F66C 2HFEC 3JAKB 1OCZC 3ZS8C 2UXDB 2EIKC 2L35A 3B2EE 3JAWB 1GM8A 4JI3B 5KHHA 2FKXA 4WCEV 1COWG 3RYHB 3E83A 5KA5A 3ZHQA 2R72A 4DV1O 4UUJC 1CP9A 3W7XA 4KHPB 5J2UA 4PA7A 1OCOB 4L8JA 3WFVA 3JASA 3FX7A 3CWBH 1RM1B 1J5EB 3K0GA 4DV6O 3NR7A 3Q4HB 1G1XB 1YEWA 5KMGA 4ZI7A 1U96A 3T1HB 1H2MA 2QWPB 2UXNA 1FXKA 1UFIA 2W0XA 3JYCA 2KKWA 4MTOA 4I55A 1WA8B 1S3JA 1LR1A 3MHSC 3LDCA 1IBKB 4CS4A 2QWOB 4TWKA 2F95B 4QE9A 2CAZC 3CRRA 3L73H 2VQFB 3N2KB 2RJZA 2LP7A 3ABTA 1W2BU 4WFBV 3JD0A 1W0KG 4JI5B 1NR7A 4U7NA 3E8FA 5HFLA 1AROP 2AHYA 4AQYB 3B40A 3MAQA 3G67A 1ZX3A 4FLUA 1LUVA 4PI2A 4I5SA 4UCVA 1OCCB 1SESA 4UCUA 1YSCA 3QVNA 3K58A 3PJSK 3TJTA 1TGOA 1VQKV 5LHGA 4U7OA 1Z5WA 4DXWA 1KB9F 1Q7YW 4WFEA 5IY5C 1LNQA 3VQYA 2Q5ZA 1NI8A 4J9YB 2YIAA 3G4SV 3CJHB 1YJNV 5ITZB 2P22C 4YY3B 1JFFA 2M6YA 2CGNA 2BOCC 1AI6A 1OCZB 3OUSA 3G6EV 2CH7A 4OPAA 2F1MA 2EIKB 3F5TA 1PL0A 1LUWA 5BZBA 3BFRA 1H8EG 3I55V 2ETNA 3ML0A 2HJFC 3WB0A 4IL6Z 2ZKOA 4IHJA 4LF4O 1ZTEA 2WSSG 3QTCA 2DN9A 4J7KA 1NVPB 2CDYA 3AK3A 2OCCC 1AI5A 4FPPA 3U10A 3ZX6A 4PJ0Z 3JALB 1M93A 2MW2B 1YTFB 3UQ8A 4DV2O 5IYCO 3HKBA 2DQ0A 1FPOA 1I5YA 5B1BC 3R65A 2X6AA 2PYLA 3OFNG 3T4DA 4B3SO 4OX9O 3CD6V 3DGEA 1XOUA 4OPHA 5GONA 2CGOA 2R9IA 1M1KW 1MZFA 5JH7A 1SC5B 1H2LA 4FFBB 1S77D 4FLXA 3AK1A 1F4NA 4IGGA 2XNDG 3SYOA 1YDXA 1SQFA 4TUYA 1G4YB 1HWYA 1AR4A 1TVKA 2GTSA 2ZE7A 3B8MA 3E8HA 3FFQA 2D2CB 2Q0AA 3T1CA 3JATA 2ARHA 1PP9H 3RYCA 2JS5A 1Q6IA 5J2UB 3ZCCA 2ZIMA 2E5LO 4HYOA 1GN6A 2IJKA 3JASB 4X62O 2DW4A 3CS5A 5EK0A 4JYYA 1SQBH 2QKAA 3TK1A 5KMGB 5BR8O 1I0HA 4K0KO 4A5UB 4K35A 4JYAO 2V1DA 1R6KA 3TXQA 5IY5B 3APOA 2YI9A 5K1PA 1XMQB 4I55B 5DM6V 4DV5B 4F4LA 1KP2A 2E75B 5HFMA 2A0LA 4GKKO 4Z1MG 3H1HH 2EULA 2JJ1G 3AG3B 3AG2B 1EM1A 3UM7A 4UB8Z 1R3LC 1AP5A 2F23A 5B3SB 2ZNIA 2LFRA 4GUNA 1GTOA 3WG7B 1FKAO 1YITV 2OWOA 4ZOLA 1US6A 3ZMZA 3OTOB 4JI0B 3CCVV 3R66A 3RT3C 5LMUB 4UV9A 4UVBA 2QDOA 4B7EA 2UUAB 2WLLB 1IVSA 2IW5A 3ZRXA 4R7CA 4UCOA 3N2GA 5DEDA 1MSWD 2OIEA 2QR4A 4FIPC 1T5EA 1VQ4V 1L0NH 4ZKIA 3CRCA 1YI2V 4DR1B 4PV1B 3H1JH 1JFFB 4JI7O 5EBMC 4H44B 2CH7B 2E74B 2HHHO 3WU2Z 3RVYA 1B6QA 4LF6B 4YHHB 2KSDA 3LUTB 3CCSV 4DV0O 4K3AA 1KKDA 4N21A 4NKGB 5BMVB 5H6RA 3E35A 4IHJB 4WFFA 2JS3A 2DOSA 4B3RB 4LWSA 4E2LA 3K3WA 4TV8B 2HEPA 2YDEA 3ABLC 3HKCB 3QNEA 1K73W 5L3FA 1XMOO 1CXZB 1BQZA 4MS2A 1W59A 1MABG 4JAAA 3HKBB 3VQXA 3RGBA 3B4SA 3OGIB 1N0NA 2G38A 3OD4A 4GKJB 4IIJA 1K92A 1Y74A 4DR2O 1CEZA 5GONB 3O65A 5JH7B 4P2ZA 4CZZA 5IT9N 3C90A 3OT7A 3ZEDA 4X65B 1QVGU 1B04A 2WAMA 3OE7G 4TUYB 2IJHA 1TVKB 4G2KA 3MDSA 3SDLA 5CA1A 3JATB 1NU1H 1L0LH 3QF7A 1AVMA 1L8DA 3ZMSA 3RYCB 3CRMA 2GTAA 1QLNA 1VQ8V 4DUZB 2B1GA 4YJ2A 3E2EA 3OR6C 1Q5OA 2UXBO 5EYPA 1XHXA 1NR1A 4OGQB 3M8AA 4TSFG 4DV4B 3JD2A 2VWJA 4FMTA 3L70H 3SJAC 3C3SA 1FJGO 1S76D 1DGSA 1SF9A 1VARA 1FXHA 5LXTA 3EHBB 5CN0A 4O2AA 3WB2A 2W6IG 1V54B 1XNQO 4D6TH 4TOIA 3BPZA 4FM2A 1QNMA 4UFZA 3DC6A 2D3OW 3SPCA 3CXCU 1HR0B 3JARA 1XL6A 4EEQA 5K1XA 2IJIA 1GO3F 4ZOLB 2Q67A 3D36C 3E8GA 4X64B 1S5JA 2AZ0A 1MNGA 2CTPA 1Z2GA 3OEHG 5C8YA 3N2GB 4I4TB 1R1BA 3DXRA 3A0RA 3K04A 2H3OA 1JJ2U 1IX9A 2JRIA 5IDJA 2FB5A 4DV7B 2WLNA 1K9MW 4MT8A 2Q6AA 1QU7A 4MW8A 2DJVA 4DR6O 3UO3A 4X9QA 4JI4O 3EVKA 1WJZA 4J10A 4E4EA 4H33A 1SERA 3SYQA 4H0LB 4MVSA 5H6QA 1XUQA 2JGUA 2NR5A 4X66B 3PN1A 1Y76A 2QGNA 1PPJH 2BCCH 2DWDC 2AW9A 2ZXWB 3ABUA 2GUZB 1KP3A 4FJCC 1HNZB 4LWSB 5KX5A 1IBLB 1PM9A 1OV9A 3CRAA 3SJCC 3B77A 5B66Z 4FLWA 5KUKA 3ASOB 2ZE5A 1PNKA 4RUEA 3IC9A 3SPIA 4PA4A 4CS3A 4JI2B 1N36O 3K79A 4IIJB 4LFAO 5EC1C 4NTWA 3W7WA 3OM3B 2QSAA 4GYCB 5J9PC 4DR5B 3RYIA 1N33O 4DR7O 2MK3A 2BTQA 3T1YO 4JZGA 4JTDB 1NVPD 5CA1B 1FXVA 4LF5O 2IU0A 4NXMB 1O9HA 1P84F 5JCOA 4LF8B 1XNRO 3CMEV 1YTFD 2A79B 1HNXO 2FTKA 1HNWB 2QJ1A 5EYPB 5KLVH 1I94B 1OCCC 1D5AA 3ASNC 5KAIZ 1JA8A 2ITDC 2AXTZ 3N27A 5CA0A 2C2AA 4D7TA 1I7FA 1FFXA 2EZOA 1H38A 1X4TA 5IYDO 4JPRA 1GM9A 1R3JC 1B06A 2PI5A 4J42A 2RMKB 3K03A 5LXTB 2RDCA 4O2AB 4GX5A 3ABKB 2JDIG 2HVKC 3IJ4A 3K06A 2IH3C 2XUMA 3SGIA 5IJ0A 3VOUA 1VQ6V 1J5EO 3JARB 3E89A 2P06A 3H01A 4KL1A 4B3TB 2YIBA 3T1HO 3IGAC 3SYPA 3K5MA 2RNBA 1E1RG 4CH3A 2KB1A 4AI8A 4DK1A 2KG7A 4BIZA 3FD9A 1IBMO 3BABA 1QBZA 1IBKO 5DECA 5C8YB 2JK5C 3CX5F 1WB7A 5LP6A 3DXRB 4F6EA 1SQGA 2FMLA 2VQFO 1F51A 3RN4A 3TXSA 1X59A 3ETEA 1WAZA 2EIJC 4O4LA 1Y4MA 4J41A 5IJ9A 4LFCB 2YSUB 4O4IA 4DW0A 2UU9O 5CBGA 4JI8B 4X1IA 5BY1A 3D3IA 3H9VA 3ICXA 2Y4TA 4RUFA 1VF6A 4ZIBA 2JVDA 2CTWA 4JF3A 1Y76B 4HNAA 1OZ0A 2LW7A 1BZKA 4DRXA 3E22A 3VQVA 5KX5B 1YF2A 5GTIZ 4YY3O 5IE9A 1K4CC 1V55B 1AR5A 1H2NA 5B1NA 1BGYH 2P67A 2PZSA 3LSQA 1HP8A 2V4DA 3GWKC 3ASNB 1N8RW 3CYOA 1ZWIC 4I9WA 5L3DA 3ZMUA 2BOBC 2LFSA 1VQNV 1FXKC 2YI8A 4TQDA 4FLYA 2Y0PA 3CCMV 1M90W 1UPGA 2IM9A 1IXBA 2ZE6A 4MVQA 3RYIB 3EFFK 3K57A 3L71H 1VF6C 3AG3C 1H2GA 3AG2C 4LFBO 1H2KA 3OEEG 2ZM6B 5B3SC 4X88A 3WG7C 2FYUH 2X6BA 5FPOA 3UT5A 4B7KA 5LOVA 1XHZA 4LF9B 3HR0A 1R3KC 1RP3B 3K0DA 1H8HG 4FFKA 2YICA 1ZUQA 4DV3B 1EZVH 2X0LA 4N23A 1MA1A 1GRJA 1ZL8A 3CEIA 3ZHSA 2QA4V 1Y6XA 2NNUA 4MVRA 5B5EZ 4J80A 3L72H 1FFXB 3M7MX 1P49A 1AILA 1OHHG 4CC6A 4BR6A 1DK1A 2JGDA 1SRYA 4I7ZB 2UXCO 1XBLA 5TISZ 5LHHA 2PYJA 1RPRA 5JVDA 2EIJB 5H5NA 1K7DA 2Q69A 4GX0A 2Z5UA 2YXLA 3X2QC 5KAFZ 2M7WA 5IJ0B 2HG5C 2Y4UA 5EBWC 5F2VO 4EKWA 1JJOA 3M99B 1ZAUA 1DF5A 5EIBD 1AI7A 3KKYA 1R6TA 1QCEA 4J7ZA 2QWNB 4LF4B 2KG7B 2B5UA 2KQXA 1S0VA 4DV5O 2H8PC 1ORQC 3BA9A 2XAGA 3CCEV 1HDJA 1KBHA 5IWAB 5LP6B 1GH6A 1XL4A 3O9OA 5CB4A 1AB3A 2F4VB 3OR7C 1BCCH 3D8CA 4XDLA 4O4LB 5KHIA 2W0FC 1WPBA 1NZ6A 4B3SB 4OX9B 4ZI7B 1PD3A 3E8BA 3HKDA 4ZBMA 3ETDA 1FXKB 4PDVA 4EFEA 3OTOO 4GZRB 2UUCB 1TAEA 4X1IB 1P4RA 2OT5A 3P3PA 3ZMVA 4K8XA 1VIBA 4P9OA 4MVUA 3A0BZ 2E76B 1JX9A 4JYBA 4FZ1A 2XOKG 4DRXB 4OXSA 3ETGA 5EIBC 1SKVA 2E5LB 2YIDA 1J95A 5H9CA 1KYOF 4HBNA 5FL7G 1RSOA 3W7SA 1QQCA 5JQGA 3RYFA 1SQPH 1KECA 4YHHO 4X20A 4CH4A 2ADQB 3LNNA 3SPHA 4AILC 2PTMA 4Z2WA 2UUBO 1VEWA 3FAVA 4NTYA 3ZRVA 3LSSA 5BR8B 1KUQA 5CBFA 2RCVA 4JYAB 4CBCA 3OTFA 4B3RO 4LR3A 2XT9A 1DTOA 4MTXA 1V54C 4X1KA 4YJ3A 4DO2A 4MVOA 4GKKB 1L1FA 4FK5C 4B3MB 4H13B 2Y0IA 1WLEA 3FYEB 3X2QB 1YJ9V 2A06H 3J7AU 1AJQA 2EJRA 3BVOA 3UT5B 4BW5A 5LOVB 3RBZA 3UKMA 4PD4F 1HW7A 4MW3A 4NR1A 1ZL8B 1OCRB 1TUBA 4X65O 3OMIB 4GCZA 4W4KA 1QHTA 3G71V 2B1IA 2GDSA 3LDEA 4NXNB 3UO2A 2JGDB 1I5XA 4K8ZA 5L3CA 2YS8A 3VBBA 1GN4A 2Q7EA 5JVDB 4NYKA 4JV5B 4JAVA 2ZDIA 1N34O 1GKFA 2HVJC 2LW1A 3CC2V 4DUYO 4DV4O 3JSNA 2WLJA 2P90A 4UVAA 4DV0B 3JSLA 2ZXWC 4JAUA 2WWWA 3A2FA 3RWRD 3BRCA 4DYLA 5EZYA 1Z5VA 2WLHA 3ASOC 2Q4PA 3ZHRA 1N32B 1VQ7V 1P7GA 4GX2A 1XEQA 2DYSC 4DR4O 1D2DA 5CB4B 4B08A 1TA8A 1UJWB 2R9AA 3ETQA 5KHJA 2NLJC 1BHAA 2UXXA 4IYIA 2GV9A 4JI6B 4GX1A 3HKDB 4DR2B 5CBHA 4PDMA 4TV9A 3T4ZA 1S72V 2XAQA 4CH6A 1KQSU 4RAIA 1NT2B 1GK9A 3KG2A 3CCLV 1XI1A 3A8TA 3ZIAG 1K4DC 3AG4C 1IURA 3CE2A 3ZRSA 5B1AC 2RQ6A 2VQEB 5GW7A 2VWKA 5EC2C 5LYJA 4MTFA 4LNUA 2EZPA 1RSOB 4FLZA 3OW2U 1XREA 3JAWA 2WPDG 5JQGB 3RYFB 2A9HA 2P6JA 3AK2A 4JI1O 4RQEA 4X20B 4CS2A 4MVZA 4BIUA 2Q9LA 3RYHA 2BSKA 3FAVB 2V7QG 1AI4A 1MOFA 2FL4A 5JJJB 3VQWA 1I08A 2JIZG 1IBLO 3ABMB 1SZXA 4X1KB 4I0XA 3ABKC 4YJ3B 5LMNO 1S5LZ 1H2SB 4FLVA 1XNQB 3L74H 1EN4A 3ZHUA 4JI2O 4WFGA 1GM7A 2Z3YA 3Q4HA 3IC7A 2N05A 3KCYA 2PI4A 4LH7A 2OYQA 3ZBHA 1MG1A 2OCHA 4QGPA 3S3WA 1TUBB 4J11A 3SJQC 4KFMA 3BAAA 1Y66A 3FB8C 5IYZA 4DR3O 2YC0A 1M5IA 3K08A 2DYSB 3TETA 1URFA 2P5OA 2N04A 2OTJV 2AZ2A 2EIMC 4NXMO 4LF8O 4FM0A 2XAHA 1Y74B 3AG1B 4CC5A 1M56C 1I94O 4DR6B 3K9AA 3D3QA 4ZHQA 1QLEB 4JI4B 1VQMV 4QNHB 2ITCC 4YIOA 3I56V 1JCHA 3FB7C 3G80A 1Y67A 2WLMA 3AG4B 2N74A 3BCCH 4LF7B 1WN7A 2GHYA 5B1AB 5H2FZ 3FB5C 2LJ2A 5EZYB 1V55C 4YJ2B 4UB6Z 2UXDO 2P4VA 2QKCA 2LGWA 4NB5A 4TT3G 4BIOA 4YIPA 3OGCC 1VP7A 4JI3O 2YXYA 1BE3H 1K3EA 3HKEA 2K9PA 1OJHA 4H37A 4WBNA 1KKCA 1NH2D 3J81N 4B3TO 4R8CA 1FS0G 1R3IC 3CCJV 2H94A 1BL8A 1Q6HA 3TGUH 4KHPO 1ROPA 2DWEC 2ILMA 1GN2A 3SPGA 3C3TA 2YIBD 4DR7B 2B9ZA 2P4KA 2PUSA 4I9QA 2OTLV 3F7VC 1R73A 5KUMA 5JCOC 3EXAA 1A32A 2CE4A 3GWOA 3CXHF 1XNRB 1D5NA 1HNXB 2XAFA 4LFCO 4LNUB 4FFBA 4JI8O 5KHGA 1KMIZ 5E79Z 2LQTA 1EFRG 2BSKB 1E79G 2ZT9B 1SQXH 3CCUV 1SS3A 1B3QA 4MSWC 1Q8IA 2EX3A 1WB8A 5FNVA 4LP8A 4KUMA 3QO7A 2DE0X 2EIMB 4JI5O 4I0XB 2ZNJA 2HJDA 2X6CA 1BS3A 4AQYO 1M57B 1M56B 3K5LA 3AEIA 4RQFA 1Q82W 4WFHA 1O9GA 5JJEB 2EILC 3ZN1A 4FZ0A 4DV1B 5B1OA 3A0HZ 2IH1C 4PDRA 4HZ3A 2PF4E 2Q8VA 2QM8A 4IYHA 4Z1VA 1N4CA 4UCRA 3K5NA 3JD4A 1IBMB 5LGTA 3FKSG 2JEXA 5LP6C 1EN6A 1FD9A 5IYZB 1AJPA 3P3NA 1GMGA 4MVMA 2ZM6O 2IBZH 2EJ7A 5LA6A 4DV6B 1JOYA 3CPWU 4LF9O 2IU3A 4FM1A 2QM4A 3H1KH 4P9PA 4O2BA 5J2TA 4DV3O 1IXMA 1GAXA 1VF7A 2Q7HA 2UU9B 1KU9A 2AHZA 4ZHQB 2WLLA 1VF5B 3FYIB 1NTZH 2BTQB 1PV0A 2ZINA 1SZTA 1MMMA 5GTHZ 1YIJV 2GBOA 3OMAB 1KD1W 2QE7G 3KCXA 1WPXA 1K5SA 4D7SA 1JQ0A 2WA3A 3P30A 3JCZA 4LCUC 2Q68A 4QJFB 4RWUA 4QPKA 3G6BA 4O4JA 5CA0B 3HKEB 4UCSA 5D5QA 4WBNB 5EBLC 1RPOA 4Q20A 2QWQB 5KA6A 5BMVA 4G27B 5LBQA 3B8NA 3H1IH 3OAAG 3FB6C 1SQQH 4UCTA 2OIGA 1Q86W 1BQ0A 4TV8A 3HB3B 3HKCA 4PDLA 2DMXA 1NH2B 5IWAO 1KC8W 2NN4A 3IAYA 4LFBB 1BSMA 2F4VO 4J7JA 4PA9A 2EILB 4I50A 3S3XA 3U0ZA 5L3BA 1FYJA 4BW9A 3QO8A 2R70A 3CCQV 1OCRC 2YEVA 1XMQO 2UUCO 1XDCA 5A2QN 4NVPA 1GN3A 1ENVA 1VMGA 2JJ2G 4DV2B 1EN5A 5JWPA 5CMUA 5FNVB 2UXCB 3CHXA 3K5OA 3CMAV 2EBOA 3TCUA 2ZD9A 3BEHA 1PL4A 5IJ9B 2DYRC 5AG2A 4O4IB 3APQA 4JI0O 2WLIA 1K33A 3LNMB 5LMUO 3OUFA 2UUAO 2ZR2A 4XDKA 1YXBA 4HNAB 1BT8A 5FLXN 4DR1O 3E22B 3DC5A 3JCUZ 3RFRA 5LHIA 4LH6A 5KHKA 1NQTA 1NTMH 5LL6Y 1FFTB 2HP8A 3SYAA 4B3MO 1N0JA 4X62B 1K8AW 4LF6O 2EINC 4ICGA 4EB6A 4JTAB 4R50A 1RFYA 5LA6B 1F23A 4X1YA 1PNLA 5C93A 1SA0A 4PHZA 4K0KB 1YJWV 4O4HA 2CK3G 1PKXA 4O2BB 4IT5A 5J2TB 3CCRV 4ASUG 1K97A 3K9SA 2L6LA 2XAJA 4WF9V 2CUGA 2OCCB 4ABMA 4I4TA 3E86A 3ZJZA 1G8MA 5BXZA 3ZRWA 1AR1B 4QE7A 1ZSPA 2Y48A 2X7RB 4NXNO 4P30A 1NKDA 5B1BB 3CRQA 3JD3A 4XBFA 4GKJO 5CA3A 4L87A 4PI0A 2W6JG 4JV5O 3U11A 1FAFA 1VQ5V 1AP6A 1S5HC 4O4JB 2P7TC 2QTSA 2BE3A 5L3GA 1R6NA 4KXRA 2JEUA 4XDJA 1JVMA 2BTOA 2UUBB 3ZHTA 4TQFA 2VRZA 2GUZA 3ABMC 4QPJA 3BA8A 3H1LH 2A3QA 4UXNA 1MZEA 4DUZO 2HKOA 2CTRA 1N32O 4JI7B 1BMFG 2DYRB 2XASA 1M9NA 2Z0AA 3STLC 2HHHB 2Q73A 4U3FH 1BHBA 3SYCA 3QG5A 3RW0A 4I50B 4PA3A 2CTQA 3I5DA 2WA4A 1VQOV 1YVWA 3JD1A 1ZLZA 4NTXA 1U97A 1W0JG 4F6RA 4JI6O 1K34A 2PY5A 3JAMN 4JGSA 4JZ2A 1P7BA 2YEVB 4KP4A 5IYBO 4U3JA 3NXSA 5L3EA 3LSUA 1XMOB 3BY6A 3SR2C 3F5WC 1JMKC 2ZQMA 1HR0O 2A7WA 2EINB 2VQEO 4JASA 1Q6UA 1Q43A 3AG1C 5A9GA 2ZDIC 3QO5A 3WB1A 3ZN0A 2O57A 1N34B 2WLIB 1QLEC 1XILA 2XTAA 4Q6GA 4DUYB 4X64O 3D36A 5LGUA 3CSXA 3SPJA 1XQ8A 2F93B 1EZJA 1WP7A 2DQ3A 3IFXA 2R9RB 1THZA 4DV7O 3BHPA 3CP1A 1DF4A 1G6UA 2PGGA 3JAKA 2UXBB 4LBEC 4PELA 4DR4B 3P32A 5FPRA 4EB6B 2ODMA 3GB7C 4UVCA 3SJBC 4R6ZA 1FJGB 4X1YB 4X8AA 4FLTA 4GLXA 4WFAV 1SA0B 4X66O 1PNMA 1IDSA 2QTOA 3CC7V 1V9PA 2LGQA 4QIWF 4O4HB 1SETA 4G28B 1HNZO 4UV8A 2Y69C 4MTGA 3DSQA 3MHHC 3ABLB 2ADPA 2Q7GA 3LDDA 3KZIZ 2ZE8A 3AG7A 3ZRWB 1TUEB 1F4MA 4PA6A 1QR8A 3UCSC 3DTUB 4EFBA 2ATKC 2QM7A 2RN9A 5E1AC 4YXWG 2K1EA 3OMNB 1VQ9V 1CPYA 4FVMA 1JPXA 1SQVH 4X89A 3L9DA 3ZHVA 4HAMA 1WA8A 2VS0A 4DR5O 1Q81W 4AHCA 4JI1B 1Q90D 2HR3A 4W4LA 3STZC 2WLKA 3GVMA 2IJJA 1JR9A 3N2KA 2Q0OC 1WNSA 4JYCA 1IZ3A 2E3CA 4LF7O 4GT1A 5DN6G 4LC1A 1M57C 1OCOC 3B09A 5LMNB 4JTCB 1HNWO 2ZCEA 3RVZA 3CC4V 1WP8A 1NJIW 1NTKH
chains in the Genus database with same CATH topology
2CTQA 3BVOA 1BQ0A 1IURA 3UO2A 2KQXA 2DN9A 4RWUA 2YS8A 3APOA 3UCSC 2GUZA 2M6YA 2DMXA 4IT5A 2N04A 3APQA 2QWOB 2LO1A 2N05A 2Y4TA 2QWRB 1FAFA 4J80A 1HDJA 2Y4UA 2L6LA 2CTRA 2GUZB 2CTWA 2CUGA 2EJ7A 1GH6A 1BQZA 1FPOA 2QWQB 2OCHA 2YUAA 1NZ6A 2QSAA 3UO3A 2PF4E 2QWPB 1XBLA 1N4CA 2CTPA 4J7ZA 1WJZA 2LGWA 3AG7A 2QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  3BVO A;  1BQ0 A;  1IUR A;  3UO2 A;  2KQX A;  2DN9 A;  4RWU A;  2YS8 A;  3APO A;  3UCS C;  2GUZ A;  2M6Y A;  2DMX A;  4IT5 A;  2N04 A;  3APQ A;  2QWO B;  2LO1 A;  2N05 A;  2Y4T A;  2QWR B;  1FAF A;  4J80 A;  1HDJ A;  2Y4U A;  2L6L A;  2CTR A;  2GUZ B;  2CTW A;  2CUG A;  2EJ7 A;  1GH6 A;  1BQZ A;  1FPO A;  2QWQ B;  2OCH A;  2YUA A;  1NZ6 A;  2QSA A;  3UO3 A;  2PF4 E;  2QWP B;  1XBL A;  1N4C A;  2CTP A;  4J7Z A;  1WJZ A;  2LGW A;  3AG7 A;  2QWN B; 
#chains in the Genus database with same CATH topology
 1MSD A;  1RM1 C;  4BAY A;  1NS1 A;  2F43 G;  1QVF U;  4BWA A;  2XHB A;  1EBO A;  2QWR B;  4F6R B;  3J80 N;  4DK0 A;  1Q3E A;  3W7T A;  3F7Y C;  3CJH A;  4U3J B;  3L75 H;  5ITZ A;  1VQL V;  1NBM G;  2QKS A;  1DLB A;  2YXH A;  4C7U A;  4DR3 B;  2ZIO A;  2QEX V;  3T2M A;  2LO1 A;  3HPL C;  4DW1 A;  3W7U A;  1N36 B;  2HLD G;  2GSM B;  2AGA A;  4CH5 A;  3ZMT A;  1E1Q G;  4LFA B;  3K59 A;  4TV9 B;  5D5P A;  1YZB A;  1YHQ V;  5LGN A;  1VQP V;  1N33 B;  2Y69 B;  3JAL A;  1YCI A;  3T1Y B;  1AJN A;  4J9Z B;  3THO A;  4RO2 A;  3CB2 A;  2ZR3 A;  4LF5 B;  3MD0 A;  5JJN B;  1QR9 A;  1M4U A;  1F7Y A;  2YUA A;  1K5Q A;  5LYJ B;  2F66 C;  2HFE C;  3JAK B;  1OCZ C;  3ZS8 C;  2UXD B;  2EIK C;  2L35 A;  3B2E E;  3JAW B;  1GM8 A;  4JI3 B;  5KHH A;  2FKX A;  4WCE V;  1COW G;  3RYH B;  3E83 A;  5KA5 A;  3ZHQ A;  2R72 A;  4DV1 O;  4UUJ C;  1CP9 A;  3W7X A;  4KHP B;  5J2U A;  4PA7 A;  1OCO B;  4L8J A;  3WFV A;  3JAS A;  3FX7 A;  3CWB H;  1RM1 B;  1J5E B;  3K0G A;  4DV6 O;  3NR7 A;  3Q4H B;  1G1X B;  1YEW A;  5KMG A;  4ZI7 A;  1U96 A;  3T1H B;  1H2M A;  2QWP B;  2UXN A;  1FXK A;  1UFI A;  2W0X A;  3JYC A;  2KKW A;  4MTO A;  4I55 A;  1WA8 B;  1S3J A;  1LR1 A;  3MHS C;  3LDC A;  1IBK B;  4CS4 A;  2QWO B;  4TWK A;  2F95 B;  4QE9 A;  2CAZ C;  3CRR A;  3L73 H;  2VQF B;  3N2K B;  2RJZ A;  2LP7 A;  3ABT A;  1W2B U;  4WFB V;  3JD0 A;  1W0K G;  4JI5 B;  1NR7 A;  4U7N A;  3E8F A;  5HFL A;  1ARO P;  2AHY A;  4AQY B;  3B40 A;  3MAQ A;  3G67 A;  1ZX3 A;  4FLU A;  1LUV A;  4PI2 A;  4I5S A;  4UCV A;  1OCC B;  1SES A;  4UCU A;  1YSC A;  3QVN A;  3K58 A;  3PJS K;  3TJT A;  1TGO A;  1VQK V;  5LHG A;  4U7O A;  1Z5W A;  4DXW A;  1KB9 F;  1Q7Y W;  4WFE A;  5IY5 C;  1LNQ A;  3VQY A;  2Q5Z A;  1NI8 A;  4J9Y B;  2YIA A;  3G4S V;  3CJH B;  1YJN V;  5ITZ B;  2P22 C;  4YY3 B;  1JFF A;  2M6Y A;  2CGN A;  2BOC C;  1AI6 A;  1OCZ B;  3OUS A;  3G6E V;  2CH7 A;  4OPA A;  2F1M A;  2EIK B;  3F5T A;  1PL0 A;  1LUW A;  5BZB A;  3BFR A;  1H8E G;  3I55 V;  2ETN A;  3ML0 A;  2HJF C;  3WB0 A;  4IL6 Z;  2ZKO A;  4IHJ A;  4LF4 O;  1ZTE A;  2WSS G;  3QTC A;  2DN9 A;  4J7K A;  1NVP B;  2CDY A;  3AK3 A;  2OCC C;  1AI5 A;  4FPP A;  3U10 A;  3ZX6 A;  4PJ0 Z;  3JAL B;  1M93 A;  2MW2 B;  1YTF B;  3UQ8 A;  4DV2 O;  5IYC O;  3HKB A;  2DQ0 A;  1FPO A;  1I5Y A;  5B1B C;  3R65 A;  2X6A A;  2PYL A;  3OFN G;  3T4D A;  4B3S O;  4OX9 O;  3CD6 V;  3DGE A;  1XOU A;  4OPH A;  5GON A;  2CGO A;  2R9I A;  1M1K W;  1MZF A;  5JH7 A;  1SC5 B;  1H2L A;  4FFB B;  1S77 D;  4FLX A;  3AK1 A;  1F4N A;  4IGG A;  2XND G;  3SYO A;  1YDX A;  1SQF A;  4TUY A;  1G4Y B;  1HWY A;  1AR4 A;  1TVK A;  2GTS A;  2ZE7 A;  3B8M A;  3E8H A;  3FFQ A;  2D2C B;  2Q0A A;  3T1C A;  3JAT A;  2ARH A;  1PP9 H;  3RYC A;  2JS5 A;  1Q6I A;  5J2U B;  3ZCC A;  2ZIM A;  2E5L O;  4HYO A;  1GN6 A;  2IJK A;  3JAS B;  4X62 O;  2DW4 A;  3CS5 A;  5EK0 A;  4JYY A;  1SQB H;  2QKA A;  3TK1 A;  5KMG B;  5BR8 O;  1I0H A;  4K0K O;  4A5U B;  4K35 A;  4JYA O;  2V1D A;  1R6K A;  3TXQ A;  5IY5 B;  3APO A;  2YI9 A;  5K1P A;  1XMQ B;  4I55 B;  5DM6 V;  4DV5 B;  4F4L A;  1KP2 A;  2E75 B;  5HFM A;  2A0L A;  4GKK O;  4Z1M G;  3H1H H;  2EUL A;  2JJ1 G;  3AG3 B;  3AG2 B;  1EM1 A;  3UM7 A;  4UB8 Z;  1R3L C;  1AP5 A;  2F23 A;  5B3S B;  2ZNI A;  2LFR A;  4GUN A;  1GTO A;  3WG7 B;  1FKA O;  1YIT V;  2OWO A;  4ZOL A;  1US6 A;  3ZMZ A;  3OTO B;  4JI0 B;  3CCV V;  3R66 A;  3RT3 C;  5LMU B;  4UV9 A;  4UVB A;  2QDO A;  4B7E A;  2UUA B;  2WLL B;  1IVS A;  2IW5 A;  3ZRX A;  4R7C A;  4UCO A;  3N2G A;  5DED A;  1MSW D;  2OIE A;  2QR4 A;  4FIP C;  1T5E A;  1VQ4 V;  1L0N H;  4ZKI A;  3CRC A;  1YI2 V;  4DR1 B;  4PV1 B;  3H1J H;  1JFF B;  4JI7 O;  5EBM C;  4H44 B;  2CH7 B;  2E74 B;  2HHH O;  3WU2 Z;  3RVY A;  1B6Q A;  4LF6 B;  4YHH B;  2KSD A;  3LUT B;  3CCS V;  4DV0 O;  4K3A A;  1KKD A;  4N21 A;  4NKG B;  5BMV B;  5H6R A;  3E35 A;  4IHJ B;  4WFF A;  2JS3 A;  2DOS A;  4B3R B;  4LWS A;  4E2L A;  3K3W A;  4TV8 B;  2HEP A;  2YDE A;  3ABL C;  3HKC B;  3QNE A;  1K73 W;  5L3F A;  1XMO O;  1CXZ B;  1BQZ A;  4MS2 A;  1W59 A;  1MAB G;  4JAA A;  3HKB B;  3VQX A;  3RGB A;  3B4S A;  3OGI B;  1N0N A;  2G38 A;  3OD4 A;  4GKJ B;  4IIJ A;  1K92 A;  1Y74 A;  4DR2 O;  1CEZ A;  5GON B;  3O65 A;  5JH7 B;  4P2Z A;  4CZZ A;  5IT9 N;  3C90 A;  3OT7 A;  3ZED A;  4X65 B;  1QVG U;  1B04 A;  2WAM A;  3OE7 G;  4TUY B;  2IJH A;  1TVK B;  4G2K A;  3MDS A;  3SDL A;  5CA1 A;  3JAT B;  1NU1 H;  1L0L H;  3QF7 A;  1AVM A;  1L8D A;  3ZMS A;  3RYC B;  3CRM A;  2GTA A;  1QLN A;  1VQ8 V;  4DUZ B;  2B1G A;  4YJ2 A;  3E2E A;  3OR6 C;  1Q5O A;  2UXB O;  5EYP A;  1XHX A;  1NR1 A;  4OGQ B;  3M8A A;  4TSF G;  4DV4 B;  3JD2 A;  2VWJ A;  4FMT A;  3L70 H;  3SJA C;  3C3S A;  1FJG O;  1S76 D;  1DGS A;  1SF9 A;  1VAR A;  1FXH A;  5LXT A;  3EHB B;  5CN0 A;  4O2A A;  3WB2 A;  2W6I G;  1V54 B;  1XNQ O;  4D6T H;  4TOI A;  3BPZ A;  4FM2 A;  1QNM A;  4UFZ A;  3DC6 A;  2D3O W;  3SPC A;  3CXC U;  1HR0 B;  3JAR A;  1XL6 A;  4EEQ A;  5K1X A;  2IJI A;  1GO3 F;  4ZOL B;  2Q67 A;  3D36 C;  3E8G A;  4X64 B;  1S5J A;  2AZ0 A;  1MNG A;  2CTP A;  1Z2G A;  3OEH G;  5C8Y A;  3N2G B;  4I4T B;  1R1B A;  3DXR A;  3A0R A;  3K04 A;  2H3O A;  1JJ2 U;  1IX9 A;  2JRI A;  5IDJ A;  2FB5 A;  4DV7 B;  2WLN A;  1K9M W;  4MT8 A;  2Q6A A;  1QU7 A;  4MW8 A;  2DJV A;  4DR6 O;  3UO3 A;  4X9Q A;  4JI4 O;  3EVK A;  1WJZ A;  4J10 A;  4E4E A;  4H33 A;  1SER A;  3SYQ A;  4H0L B;  4MVS A;  5H6Q A;  1XUQ A;  2JGU A;  2NR5 A;  4X66 B;  3PN1 A;  1Y76 A;  2QGN A;  1PPJ H;  2BCC H;  2DWD C;  2AW9 A;  2ZXW B;  3ABU A;  2GUZ B;  1KP3 A;  4FJC C;  1HNZ B;  4LWS B;  5KX5 A;  1IBL B;  1PM9 A;  1OV9 A;  3CRA A;  3SJC C;  3B77 A;  5B66 Z;  4FLW A;  5KUK A;  3ASO B;  2ZE5 A;  1PNK A;  4RUE A;  3IC9 A;  3SPI A;  4PA4 A;  4CS3 A;  4JI2 B;  1N36 O;  3K79 A;  4IIJ B;  4LFA O;  5EC1 C;  4NTW A;  3W7W A;  3OM3 B;  2QSA A;  4GYC B;  5J9P C;  4DR5 B;  3RYI A;  1N33 O;  4DR7 O;  2MK3 A;  2BTQ A;  3T1Y O;  4JZG A;  4JTD B;  1NVP D;  5CA1 B;  1FXV A;  4LF5 O;  2IU0 A;  4NXM B;  1O9H A;  1P84 F;  5JCO A;  4LF8 B;  1XNR O;  3CME V;  1YTF D;  2A79 B;  1HNX O;  2FTK A;  1HNW B;  2QJ1 A;  5EYP B;  5KLV H;  1I94 B;  1OCC C;  1D5A A;  3ASN C;  5KAI Z;  1JA8 A;  2ITD C;  2AXT Z;  3N27 A;  5CA0 A;  2C2A A;  4D7T A;  1I7F A;  1FFX A;  2EZO A;  1H38 A;  1X4T A;  5IYD O;  4JPR A;  1GM9 A;  1R3J C;  1B06 A;  2PI5 A;  4J42 A;  2RMK B;  3K03 A;  5LXT B;  2RDC A;  4O2A B;  4GX5 A;  3ABK B;  2JDI G;  2HVK C;  3IJ4 A;  3K06 A;  2IH3 C;  2XUM A;  3SGI A;  5IJ0 A;  3VOU A;  1VQ6 V;  1J5E O;  3JAR B;  3E89 A;  2P06 A;  3H01 A;  4KL1 A;  4B3T B;  2YIB A;  3T1H O;  3IGA C;  3SYP A;  3K5M A;  2RNB A;  1E1R G;  4CH3 A;  2KB1 A;  4AI8 A;  4DK1 A;  2KG7 A;  4BIZ A;  3FD9 A;  1IBM O;  3BAB A;  1QBZ A;  1IBK O;  5DEC A;  5C8Y B;  2JK5 C;  3CX5 F;  1WB7 A;  5LP6 A;  3DXR B;  4F6E A;  1SQG A;  2FML A;  2VQF O;  1F51 A;  3RN4 A;  3TXS A;  1X59 A;  3ETE A;  1WAZ A;  2EIJ C;  4O4L A;  1Y4M A;  4J41 A;  5IJ9 A;  4LFC B;  2YSU B;  4O4I A;  4DW0 A;  2UU9 O;  5CBG A;  4JI8 B;  4X1I A;  5BY1 A;  3D3I A;  3H9V A;  3ICX A;  2Y4T A;  4RUF A;  1VF6 A;  4ZIB A;  2JVD A;  2CTW A;  4JF3 A;  1Y76 B;  4HNA A;  1OZ0 A;  2LW7 A;  1BZK A;  4DRX A;  3E22 A;  3VQV A;  5KX5 B;  1YF2 A;  5GTI Z;  4YY3 O;  5IE9 A;  1K4C C;  1V55 B;  1AR5 A;  1H2N A;  5B1N A;  1BGY H;  2P67 A;  2PZS A;  3LSQ A;  1HP8 A;  2V4D A;  3GWK C;  3ASN B;  1N8R W;  3CYO A;  1ZWI C;  4I9W A;  5L3D A;  3ZMU A;  2BOB C;  2LFS A;  1VQN V;  1FXK C;  2YI8 A;  4TQD A;  4FLY A;  2Y0P A;  3CCM V;  1M90 W;  1UPG A;  2IM9 A;  1IXB A;  2ZE6 A;  4MVQ A;  3RYI B;  3EFF K;  3K57 A;  3L71 H;  1VF6 C;  3AG3 C;  1H2G A;  3AG2 C;  4LFB O;  1H2K A;  3OEE G;  2ZM6 B;  5B3S C;  4X88 A;  3WG7 C;  2FYU H;  2X6B A;  5FPO A;  3UT5 A;  4B7K A;  5LOV A;  1XHZ A;  4LF9 B;  3HR0 A;  1R3K C;  1RP3 B;  3K0D A;  1H8H G;  4FFK A;  2YIC A;  1ZUQ A;  4DV3 B;  1EZV H;  2X0L A;  4N23 A;  1MA1 A;  1GRJ A;  1ZL8 A;  3CEI A;  3ZHS A;  2QA4 V;  1Y6X A;  2NNU A;  4MVR A;  5B5E Z;  4J80 A;  3L72 H;  1FFX B;  3M7M X;  1P49 A;  1AIL A;  1OHH G;  4CC6 A;  4BR6 A;  1DK1 A;  2JGD A;  1SRY A;  4I7Z B;  2UXC O;  1XBL A;  5TIS Z;  5LHH A;  2PYJ A;  1RPR A;  5JVD A;  2EIJ B;  5H5N A;  1K7D A;  2Q69 A;  4GX0 A;  2Z5U A;  2YXL A;  3X2Q C;  5KAF Z;  2M7W A;  5IJ0 B;  2HG5 C;  2Y4U A;  5EBW C;  5F2V O;  4EKW A;  1JJO A;  3M99 B;  1ZAU A;  1DF5 A;  5EIB D;  1AI7 A;  3KKY A;  1R6T A;  1QCE A;  4J7Z A;  2QWN B;  4LF4 B;  2KG7 B;  2B5U A;  2KQX A;  1S0V A;  4DV5 O;  2H8P C;  1ORQ C;  3BA9 A;  2XAG A;  3CCE V;  1HDJ A;  1KBH A;  5IWA B;  5LP6 B;  1GH6 A;  1XL4 A;  3O9O A;  5CB4 A;  1AB3 A;  2F4V B;  3OR7 C;  1BCC H;  3D8C A;  4XDL A;  4O4L B;  5KHI A;  2W0F C;  1WPB A;  1NZ6 A;  4B3S B;  4OX9 B;  4ZI7 B;  1PD3 A;  3E8B A;  3HKD A;  4ZBM A;  3ETD A;  1FXK B;  4PDV A;  4EFE A;  3OTO O;  4GZR B;  2UUC B;  1TAE A;  4X1I B;  1P4R A;  2OT5 A;  3P3P A;  3ZMV A;  4K8X A;  1VIB A;  4P9O A;  4MVU A;  3A0B Z;  2E76 B;  1JX9 A;  4JYB A;  4FZ1 A;  2XOK G;  4DRX B;  4OXS A;  3ETG A;  5EIB C;  1SKV A;  2E5L B;  2YID A;  1J95 A;  5H9C A;  1KYO F;  4HBN A;  5FL7 G;  1RSO A;  3W7S A;  1QQC A;  5JQG A;  3RYF A;  1SQP H;  1KEC A;  4YHH O;  4X20 A;  4CH4 A;  2ADQ B;  3LNN A;  3SPH A;  4AIL C;  2PTM A;  4Z2W A;  2UUB O;  1VEW A;  3FAV A;  4NTY A;  3ZRV A;  3LSS A;  5BR8 B;  1KUQ A;  5CBF A;  2RCV A;  4JYA B;  4CBC A;  3OTF A;  4B3R O;  4LR3 A;  2XT9 A;  1DTO A;  4MTX A;  1V54 C;  4X1K A;  4YJ3 A;  4DO2 A;  4MVO A;  4GKK B;  1L1F A;  4FK5 C;  4B3M B;  4H13 B;  2Y0I A;  1WLE A;  3FYE B;  3X2Q B;  1YJ9 V;  2A06 H;  3J7A U;  1AJQ A;  2EJR A;  3BVO A;  3UT5 B;  4BW5 A;  5LOV B;  3RBZ A;  3UKM A;  4PD4 F;  1HW7 A;  4MW3 A;  4NR1 A;  1ZL8 B;  1OCR B;  1TUB A;  4X65 O;  3OMI B;  4GCZ A;  4W4K A;  1QHT A;  3G71 V;  2B1I A;  2GDS A;  3LDE A;  4NXN B;  3UO2 A;  2JGD B;  1I5X A;  4K8Z A;  5L3C A;  2YS8 A;  3VBB A;  1GN4 A;  2Q7E A;  5JVD B;  4NYK A;  4JV5 B;  4JAV A;  2ZDI A;  1N34 O;  1GKF A;  2HVJ C;  2LW1 A;  3CC2 V;  4DUY O;  4DV4 O;  3JSN A;  2WLJ A;  2P90 A;  4UVA A;  4DV0 B;  3JSL A;  2ZXW C;  4JAU A;  2WWW A;  3A2F A;  3RWR D;  3BRC A;  4DYL A;  5EZY A;  1Z5V A;  2WLH A;  3ASO C;  2Q4P A;  3ZHR A;  1N32 B;  1VQ7 V;  1P7G A;  4GX2 A;  1XEQ A;  2DYS C;  4DR4 O;  1D2D A;  5CB4 B;  4B08 A;  1TA8 A;  1UJW B;  2R9A A;  3ETQ A;  5KHJ A;  2NLJ C;  1BHA A;  2UXX A;  4IYI A;  2GV9 A;  4JI6 B;  4GX1 A;  3HKD B;  4DR2 B;  5CBH A;  4PDM A;  4TV9 A;  3T4Z A;  1S72 V;  2XAQ A;  4CH6 A;  1KQS U;  4RAI A;  1NT2 B;  1GK9 A;  3KG2 A;  3CCL V;  1XI1 A;  3A8T A;  3ZIA G;  1K4D C;  3AG4 C;  1IUR A;  3CE2 A;  3ZRS A;  5B1A C;  2RQ6 A;  2VQE B;  5GW7 A;  2VWK A;  5EC2 C;  5LYJ A;  4MTF A;  4LNU A;  2EZP A;  1RSO B;  4FLZ A;  3OW2 U;  1XRE A;  3JAW A;  2WPD G;  5JQG B;  3RYF B;  2A9H A;  2P6J A;  3AK2 A;  4JI1 O;  4RQE A;  4X20 B;  4CS2 A;  4MVZ A;  4BIU A;  2Q9L A;  3RYH A;  2BSK A;  3FAV B;  2V7Q G;  1AI4 A;  1MOF A;  2FL4 A;  5JJJ B;  3VQW A;  1I08 A;  2JIZ G;  1IBL O;  3ABM B;  1SZX A;  4X1K B;  4I0X A;  3ABK C;  4YJ3 B;  5LMN O;  1S5L Z;  1H2S B;  4FLV A;  1XNQ B;  3L74 H;  1EN4 A;  3ZHU A;  4JI2 O;  4WFG A;  1GM7 A;  2Z3Y A;  3Q4H A;  3IC7 A;  2N05 A;  3KCY A;  2PI4 A;  4LH7 A;  2OYQ A;  3ZBH A;  1MG1 A;  2OCH A;  4QGP A;  3S3W A;  1TUB B;  4J11 A;  3SJQ C;  4KFM A;  3BAA A;  1Y66 A;  3FB8 C;  5IYZ A;  4DR3 O;  2YC0 A;  1M5I A;  3K08 A;  2DYS B;  3TET A;  1URF A;  2P5O A;  2N04 A;  2OTJ V;  2AZ2 A;  2EIM C;  4NXM O;  4LF8 O;  4FM0 A;  2XAH A;  1Y74 B;  3AG1 B;  4CC5 A;  1M56 C;  1I94 O;  4DR6 B;  3K9A A;  3D3Q A;  4ZHQ A;  1QLE B;  4JI4 B;  1VQM V;  4QNH B;  2ITC C;  4YIO A;  3I56 V;  1JCH A;  3FB7 C;  3G80 A;  1Y67 A;  2WLM A;  3AG4 B;  2N74 A;  3BCC H;  4LF7 B;  1WN7 A;  2GHY A;  5B1A B;  5H2F Z;  3FB5 C;  2LJ2 A;  5EZY B;  1V55 C;  4YJ2 B;  4UB6 Z;  2UXD O;  2P4V A;  2QKC A;  2LGW A;  4NB5 A;  4TT3 G;  4BIO A;  4YIP A;  3OGC C;  1VP7 A;  4JI3 O;  2YXY A;  1BE3 H;  1K3E A;  3HKE A;  2K9P A;  1OJH A;  4H37 A;  4WBN A;  1KKC A;  1NH2 D;  3J81 N;  4B3T O;  4R8C A;  1FS0 G;  1R3I C;  3CCJ V;  2H94 A;  1BL8 A;  1Q6H A;  3TGU H;  4KHP O;  1ROP A;  2DWE C;  2ILM A;  1GN2 A;  3SPG A;  3C3T A;  2YIB D;  4DR7 B;  2B9Z A;  2P4K A;  2PUS A;  4I9Q A;  2OTL V;  3F7V C;  1R73 A;  5KUM A;  5JCO C;  3EXA A;  1A32 A;  2CE4 A;  3GWO A;  3CXH F;  1XNR B;  1D5N A;  1HNX B;  2XAF A;  4LFC O;  4LNU B;  4FFB A;  4JI8 O;  5KHG A;  1KMI Z;  5E79 Z;  2LQT A;  1EFR G;  2BSK B;  1E79 G;  2ZT9 B;  1SQX H;  3CCU V;  1SS3 A;  1B3Q A;  4MSW C;  1Q8I A;  2EX3 A;  1WB8 A;  5FNV A;  4LP8 A;  4KUM A;  3QO7 A;  2DE0 X;  2EIM B;  4JI5 O;  4I0X B;  2ZNJ A;  2HJD A;  2X6C A;  1BS3 A;  4AQY O;  1M57 B;  1M56 B;  3K5L A;  3AEI A;  4RQF A;  1Q82 W;  4WFH A;  1O9G A;  5JJE B;  2EIL C;  3ZN1 A;  4FZ0 A;  4DV1 B;  5B1O A;  3A0H Z;  2IH1 C;  4PDR A;  4HZ3 A;  2PF4 E;  2Q8V A;  2QM8 A;  4IYH A;  4Z1V A;  1N4C A;  4UCR A;  3K5N A;  3JD4 A;  1IBM B;  5LGT A;  3FKS G;  2JEX A;  5LP6 C;  1EN6 A;  1FD9 A;  5IYZ B;  1AJP A;  3P3N A;  1GMG A;  4MVM A;  2ZM6 O;  2IBZ H;  2EJ7 A;  5LA6 A;  4DV6 B;  1JOY A;  3CPW U;  4LF9 O;  2IU3 A;  4FM1 A;  2QM4 A;  3H1K H;  4P9P A;  4O2B A;  5J2T A;  4DV3 O;  1IXM A;  1GAX A;  1VF7 A;  2Q7H A;  2UU9 B;  1KU9 A;  2AHZ A;  4ZHQ B;  2WLL A;  1VF5 B;  3FYI B;  1NTZ H;  2BTQ B;  1PV0 A;  2ZIN A;  1SZT A;  1MMM A;  5GTH Z;  1YIJ V;  2GBO A;  3OMA B;  1KD1 W;  2QE7 G;  3KCX A;  1WPX A;  1K5S A;  4D7S A;  1JQ0 A;  2WA3 A;  3P30 A;  3JCZ A;  4LCU C;  2Q68 A;  4QJF B;  4RWU A;  4QPK A;  3G6B A;  4O4J A;  5CA0 B;  3HKE B;  4UCS A;  5D5Q A;  4WBN B;  5EBL C;  1RPO A;  4Q20 A;  2QWQ B;  5KA6 A;  5BMV A;  4G27 B;  5LBQ A;  3B8N A;  3H1I H;  3OAA G;  3FB6 C;  1SQQ H;  4UCT A;  2OIG A;  1Q86 W;  1BQ0 A;  4TV8 A;  3HB3 B;  3HKC A;  4PDL A;  2DMX A;  1NH2 B;  5IWA O;  1KC8 W;  2NN4 A;  3IAY A;  4LFB B;  1BSM A;  2F4V O;  4J7J A;  4PA9 A;  2EIL B;  4I50 A;  3S3X A;  3U0Z A;  5L3B A;  1FYJ A;  4BW9 A;  3QO8 A;  2R70 A;  3CCQ V;  1OCR C;  2YEV A;  1XMQ O;  2UUC O;  1XDC A;  5A2Q N;  4NVP A;  1GN3 A;  1ENV A;  1VMG A;  2JJ2 G;  4DV2 B;  1EN5 A;  5JWP A;  5CMU A;  5FNV B;  2UXC B;  3CHX A;  3K5O A;  3CMA V;  2EBO A;  3TCU A;  2ZD9 A;  3BEH A;  1PL4 A;  5IJ9 B;  2DYR C;  5AG2 A;  4O4I B;  3APQ A;  4JI0 O;  2WLI A;  1K33 A;  3LNM B;  5LMU O;  3OUF A;  2UUA O;  2ZR2 A;  4XDK A;  1YXB A;  4HNA B;  1BT8 A;  5FLX N;  4DR1 O;  3E22 B;  3DC5 A;  3JCU Z;  3RFR A;  5LHI A;  4LH6 A;  5KHK A;  1NQT A;  1NTM H;  5LL6 Y;  1FFT B;  2HP8 A;  3SYA A;  4B3M O;  1N0J A;  4X62 B;  1K8A W;  4LF6 O;  2EIN C;  4ICG A;  4EB6 A;  4JTA B;  4R50 A;  1RFY A;  5LA6 B;  1F23 A;  4X1Y A;  1PNL A;  5C93 A;  1SA0 A;  4PHZ A;  4K0K B;  1YJW V;  4O4H A;  2CK3 G;  1PKX A;  4O2B B;  4IT5 A;  5J2T B;  3CCR V;  4ASU G;  1K97 A;  3K9S A;  2L6L A;  2XAJ A;  4WF9 V;  2CUG A;  2OCC B;  4ABM A;  4I4T A;  3E86 A;  3ZJZ A;  1G8M A;  5BXZ A;  3ZRW A;  1AR1 B;  4QE7 A;  1ZSP A;  2Y48 A;  2X7R B;  4NXN O;  4P30 A;  1NKD A;  5B1B B;  3CRQ A;  3JD3 A;  4XBF A;  4GKJ O;  5CA3 A;  4L87 A;  4PI0 A;  2W6J G;  4JV5 O;  3U11 A;  1FAF A;  1VQ5 V;  1AP6 A;  1S5H C;  4O4J B;  2P7T C;  2QTS A;  2BE3 A;  5L3G A;  1R6N A;  4KXR A;  2JEU A;  4XDJ A;  1JVM A;  2BTO A;  2UUB B;  3ZHT A;  4TQF A;  2VRZ A;  2GUZ A;  3ABM C;  4QPJ A;  3BA8 A;  3H1L H;  2A3Q A;  4UXN A;  1MZE A;  4DUZ O;  2HKO A;  2CTR A;  1N32 O;  4JI7 B;  1BMF G;  2DYR B;  2XAS A;  1M9N A;  2Z0A A;  3STL C;  2HHH B;  2Q73 A;  4U3F H;  1BHB A;  3SYC A;  3QG5 A;  3RW0 A;  4I50 B;  4PA3 A;  2CTQ A;  3I5D A;  2WA4 A;  1VQO V;  1YVW A;  3JD1 A;  1ZLZ A;  4NTX A;  1U97 A;  1W0J G;  4F6R A;  4JI6 O;  1K34 A;  2PY5 A;  3JAM N;  4JGS A;  4JZ2 A;  1P7B A;  2YEV B;  4KP4 A;  5IYB O;  4U3J A;  3NXS A;  5L3E A;  3LSU A;  1XMO B;  3BY6 A;  3SR2 C;  3F5W C;  1JMK C;  2ZQM A;  1HR0 O;  2A7W A;  2EIN B;  2VQE O;  4JAS A;  1Q6U A;  1Q43 A;  3AG1 C;  5A9G A;  2ZDI C;  3QO5 A;  3WB1 A;  3ZN0 A;  2O57 A;  1N34 B;  2WLI B;  1QLE C;  1XIL A;  2XTA A;  4Q6G A;  4DUY B;  4X64 O;  3D36 A;  5LGU A;  3CSX A;  3SPJ A;  1XQ8 A;  2F93 B;  1EZJ A;  1WP7 A;  2DQ3 A;  3IFX A;  2R9R B;  1THZ A;  4DV7 O;  3BHP A;  3CP1 A;  1DF4 A;  1G6U A;  2PGG A;  3JAK A;  2UXB B;  4LBE C;  4PEL A;  4DR4 B;  3P32 A;  5FPR A;  4EB6 B;  2ODM A;  3GB7 C;  4UVC A;  3SJB C;  4R6Z A;  1FJG B;  4X1Y B;  4X8A A;  4FLT A;  4GLX A;  4WFA V;  1SA0 B;  4X66 O;  1PNM A;  1IDS A;  2QTO A;  3CC7 V;  1V9P A;  2LGQ A;  4QIW F;  4O4H B;  1SET A;  4G28 B;  1HNZ O;  4UV8 A;  2Y69 C;  4MTG A;  3DSQ A;  3MHH C;  3ABL B;  2ADP A;  2Q7G A;  3LDD A;  3KZI Z;  2ZE8 A;  3AG7 A;  3ZRW B;  1TUE B;  1F4M A;  4PA6 A;  1QR8 A;  3UCS C;  3DTU B;  4EFB A;  2ATK C;  2QM7 A;  2RN9 A;  5E1A C;  4YXW G;  2K1E A;  3OMN B;  1VQ9 V;  1CPY A;  4FVM A;  1JPX A;  1SQV H;  4X89 A;  3L9D A;  3ZHV A;  4HAM A;  1WA8 A;  2VS0 A;  4DR5 O;  1Q81 W;  4AHC A;  4JI1 B;  1Q90 D;  2HR3 A;  4W4L A;  3STZ C;  2WLK A;  3GVM A;  2IJJ A;  1JR9 A;  3N2K A;  2Q0O C;  1WNS A;  4JYC A;  1IZ3 A;  2E3C A;  4LF7 O;  4GT1 A;  5DN6 G;  4LC1 A;  1M57 C;  1OCO C;  3B09 A;  5LMN B;  4JTC B;  1HNW O;  2ZCE A;  3RVZ A;  3CC4 V;  1WP8 A;  1NJI W;  1NTK H; 
#chains in the Genus database with same CATH homology
 2CTQ A;  3BVO A;  1BQ0 A;  1IUR A;  3UO2 A;  2KQX A;  2DN9 A;  4RWU A;  2YS8 A;  3APO A;  3UCS C;  2GUZ A;  2M6Y A;  2DMX A;  4IT5 A;  2N04 A;  3APQ A;  2QWO B;  2LO1 A;  2N05 A;  2Y4T A;  2QWR B;  1FAF A;  4J80 A;  1HDJ A;  2Y4U A;  2L6L A;  2CTR A;  2GUZ B;  2CTW A;  2CUG A;  2EJ7 A;  1GH6 A;  1BQZ A;  1FPO A;  2QWQ B;  2OCH A;  2YUA A;  1NZ6 A;  2QSA A;  3UO3 A;  2PF4 E;  2QWP B;  1XBL A;  1N4C A;  2CTP A;  4J7Z A;  1WJZ A;  2LGW A;  3AG7 A;  2QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...