2N04A

Solution structure of the phosphorylated n-terminal region of human cysteine string protein (csp)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
104
Chain Sequence
MRSPGMADQRQRSLTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Phosphorylation of Cysteine String Protein Triggers a Major Conformational Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 24
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2n04A00
4IT5A 2GUZB 3UO3A 2N04A 2QWRB 2GUZA 2DN9A 2CTWA 4RWUA 2M6YA 1FPOA 3AG7A 2KQXA 2QWPB 2YS8A 3APQA 1NZ6A 2Y4TA 2QWOB 3APOA 3UO2A 2CUGA 2CTQA 3UCSC 2N05A 2QWQB 2Y4UA 2LO1A 1IURA 1GH6A 2CTPA 3BVOA 2L6LA 1XBLA 2OCHA 2YUAA 2PF4E 1N4CA 1HDJA 2QWNB 1FAFA 1BQZA 2EJ7A 1BQ0A 2CTRA 2DMXA 2LGWA 4J7ZA 1WJZA 2QSAA 4J80A
chains in the Genus database with same CATH superfamily
3JAMN 1UPGA 5L3DA 1SF9A 2G38A 1NU1H 3S3WA 1R3IC 3APQA 3JD3A 4W4KA 3W7UA 1PD3A 3OGIB 4DK0A 5CN0A 4YXWG 4FMTA 4TUYB 4J42A 2QE7G 5IWAB 5B3SB 3MHHC 1NTKH 3B2EE 4X1KA 5BMVA 2KG7A 1N36O 3G67A 4J10A 2PTMA 4P9OA 5LYJA 4LF5B 5CA3A 1XMQO 4F6RA 4GYCB 1O9GA 4H33A 4O4JB 2CTQA 1PL4A 3SPGA 3ZCCA 1L0NH 2VRZA 2IU3A 1OCZB 2OTLV 2UXBB 2ZE6A 3E22B 1KKDA 4HNAA 4Z1MG 3TCUA 1CP9A 4AI8A 3DC6A 4UVBA 2DE0X 2EINC 4TOIA 3FB7C 3L73H 2CAZC 1ZX3A 1PNKA 4UCTA 1R6KA 3ZHQA 1S5HC 5L3GA 4ZOLB 5LBQA 1JJOA 3OMAB 2VQEO 4NXMO 1NBMG 2N04A 2YIDA 1H2KA 3SYOA 2P6JA 1PNLA 4H0LB 4X65B 1HNZB 4LF4B 4X20A 3ASOB 1QLNA 4EB6A 4DYLA 3J80N 3BPZA 2RQ6A 3ZMTA 3OTFA 4YY3O 4JI3B 4R7CA 2BTQB 3L9DA 2ZR2A 1J5EB 2XOKG 4FM0A 3CRMA 2Y0PA 2YEVA 1SZTA 5LMNO 3ETQA 1M1KW 4NVPA 2WA4A 1I7FA 2R9RB 3RVZA 2AXTZ 2UUBO 2OTJV 2UXDB 1IBKO 2BOCC 1QVGU 2VWKA 1M4UA 3FX7A 2QKAA 4PDRA 1V55B 3C90A 5JH7A 3RGBA 3CSXA 3FB6C 4WF9V 3ZRWB 1IX9A 1M57C 1FPOA 1SESA 3D3IA 3IJ4A 4AQYB 1IBLB 2JRIA 2DYRB 5LA6B 3T4DA 4PHZA 4BWAA 2CTPA 4LH6A 4RUEA 2FTKA 5J2TA 5IYZA 1NTZH 2WPDG 3FB5C 3CE2A 4LR3A 2HHHO 4R8CA 5EYPA 3FKSG 1XMOB 3N27A 4QNHB 4J11A 3B8MA 2NR5A 1YJWV 1I08A 2LO1A 5DM6V 4J7JA 2XNDG 1DK1A 3FYEB 3UKMA 1B04A 1KMIZ 4JZ2A 5BZBA 2Y48A 5H5NA 4CBCA 3QTCA 4LFBO 4MTXA 1VQ6V 2DQ3A 1YJ9V 3AK2A 3KZIZ 4JI2O 2UXCO 3OM3B 4O2AA 2ILMA 4NYKA 5BXZA 4I9WA 3L72H 1KECA 1IZ3A 3JAWA 3X2QC 1QHTA 4X65O 4LF4O 3AG4C 1Q7YW 2QTOA 2LJ2A 1R3JC 3ZHVA 3HKDB 3LSUA 3WB2A 2BOBC 2LW1A 5B1OA 2QKSA 3K9AA 2QA4V 3RW0A 4PELA 1XNRB 2WLIA 1IDSA 2BE3A 2UUAB 2L6LA 2P06A 4DV4B 2HG5C 5JWPA 1H38A 2RCVA 3ABLC 5EIBC 4AHCA 2WAMA 3B4SA 3OD4A 4LWSA 4MTGA 4OX9B 4OGQB 3P3NA 4JI8B 3T1YB 1KBHA 2UU9B 1SQPH 3WU2Z 4FFKA 1Y6XA 2FKXA 3CJHA 5DN6G 1XBLA 1L8DA 2QKCA 4AQYO 2LGWA 1LR1A 2DWDC 1NI8A 1NS1A 2GBOA 2Q68A 5IJ9B 1AJQA 3D36A 2IJKA 1Q3EA 3ZMZA 4DR1O 1H8EG 1VQPV 4O4LB 1HNXB 2ZD9A 1N34O 2OCHA 3UT5B 1XMOO 2XHBA 5JQGB 2Q0AA 4B3RB 2E5LO 1ROPA 1SQXH 1Y67A 1ZWIC 3PJSK 4H13B 5GW7A 2ADPA 1EZJA 1XEQA 2AZ0A 4YJ3A 3HKCB 1JMKC 1AI7A 4UV8A 1AJNA 2B1GA 2ZE7A 1B6QA 1PM9A 2ITDC 2JS3A 4J7ZA 4EFBA 2HP8A 3H1JH 1VF5B 2R70A 3JARB 2V1DA 4BIZA 5EIBD 3WG7B 4K8ZA 2IM9A 3RT3C 2EBOA 3K79A 1Y76A 4YIOA 2X6CA 4W4LA 4I55B 1DTOA 4MVQA 2A7WA 4EEQA 1WB8A 2EIJC 3MAQA 3VQYA 1XNRO 1XL6A 1YHQV 4DV4O 4MVUA 5EBLC 3FYIB 1YZBA 4MTOA 2YS8A 5B66Z 3OW2U 3BA8A 3P32A 5H6QA 5KHHA 5C8YB 2P90A 4DR3B 1KYOF 4OX9O 4IL6Z 1SQFA 2BSKB 4JI8O 4FM2A 5B5EZ 1K4CC 1YDXA 3UO3A 1KKCA 3UM7A 1JPXA 2QGNA 1S72V 4U3JA 4PD4F 3HKBA 3K9SA 3GWKC 1KP3A 1TUEB 1M57B 4FPPA 2ZT9B 4JPRA 3AG3B 2PF4E 5CB4A 3OR6C 4MVMA 1LUVA 3CP1A 4LF9O 1DLBA 4PV1B 4MT8A 4UCOA 1HNXO 3DXRA 2NNUA 1W2BU 3AG7A 1VEWA 2Q8VA 4B3RO 3CEIA 1K92A 2E76B 1P49A 3E8HA 1IBMB 2DWEC 2IH1C 2YICA 1GM8A 5GTIZ 5LXTB 4UCSA 3BRCA 3GB7C 5F2VO 4B3SO 1OCOB 1DF4A 1I0HA 1MZEA 3CMEV 2W0XA 5KHKA 2QWPB 4UCRA 3ETGA 5HFLA 4FLXA 4GKKO 2A9HA 1FYJA 3K59A 1FFXB 5IT9N 3ZRVA 2YIBD 2ZR3A 4BIOA 3AG1C 5CA1B 1XHZA 3E35A 2PUSA 5EZYA 1K7DA 1PL0A 1RFYA 1AI5A 3JATA 3JSNA 4ASUG 2A3QA 1EN4A 4DV0B 2HR3A 1TA8A 4KXRA 4FFBB 3CMAV 3OUFA 1OV9A 5LGTA 4X1YB 1JR9A 3JALA 3R66A 2Q69A 2RJZA 1QVFU 5IYDO 3FAVA 4O4HB 4JGSA 1GK9A 1NZ6A 2CGOA 5HFMA 4X66B 4J9ZB 2XT9A 2HFEC 1L1FA 2IJHA 3WFVA 2EILC 1EFRG 4OPAA 2YSUB 3MD0A 3Q4HA 1FXKB 1MSWD 1Q6IA 1R73A 3CC7V 1N33O 3HB3B 2ZXWB 5IYBO 5LHGA 2F4VO 4CS2A 2ZQMA 1U97A 1F4NA 3H1KH 1RPRA 2R9AA 1RM1C 4IGGA 3HKEA 4RO2A 2VQEB 4NXMB 3N2GA 2GSMB 2K1EA 2CE4A 1V9PA 5CMUA 4FIPC 2CTRA 4DRXB 2CH7A 3RYCB 1Q8IA 1XILA 2GUZA 1XHXA 5J9PC 4WFHA 1G1XB 4YY3B 1Z5VA 3ZIAG 4FLUA 4HYOA 3M7MX 4P9PA 1SQBH 4TV9B 1WA8A 5LMNB 2DJVA 2Q0OC 3OMIB 4IIJA 1NR7A 2ZDIA 1PKXA 3CX5F 1TAEA 3DGEA 3RVYA 3H1IH 3ML0A 1IBKB 4FLVA 4DUYO 2CK3G 3ZJZA 4QJFB 4WBNB 4J7KA 5LOVB 1XNQB 1WLEA 2OCCC 1IXMA 1FD9A 4GX1A 1SS3A 1HWYA 4I50A 1R3LC 2QTSA 2GTAA 2ZIMA 3O65A 4X9QA 4X1KB 1YXBA 5BMVB 1SC5B 5KAFZ 4MVZA 1N0JA 4DV0O 5GONA 2EULA 1NH2D 4G28B 4H44B 4TQFA 4QPJA 4DR5B 2GV9A 2DQ0A 5H6RA 4WFAV 1MA1A 3J81N 3RFRA 2AW9A 2IU0A 3IC7A 2HHHB 2W6IG 2JGUA 1M56B 1Q90D 4TUYA 2ARHA 3B77A 4WFEA 2H8PC 4X8AA 4X66O 3OAAG 2RDCA 4P30A 2K9PA 3GVMA 4FLTA 2AHZA 2X0LA 1FKAO 2O57A 5A9GA 5LHIA 1Y4MA 2XAQA 4B7EA 2Z5UA 3SJQC 4A5UB 2EIKC 1M5IA 3G6EV 4DR4O 4O4JA 2Y4UA 3LUTB 5B1AB 2IBZH 3TJTA 4LFBB 5KA6A 1QR8A 2WLHA 2RN9A 4LF7B 4JI2B 2UXCB 2YXYA 3E22A 3RN4A 4X20B 3A8TA 2F66C 4EB6B 2N74A 1D5AA 2Y4TA 3MHSC 1XUQA 1XREA 3AG2C 3OT7A 3CC4V 4XDJA 3SPIA 2Q9LA 1BHBA 1J95A 4ZOLA 1WN7A 4NXNO 2JJ1G 3F5WC 5KUKA 2RMKB 2CTWA 4IYHA 2VQFB 5B1NA 2JK5C 1YEWA 4G2KA 4LNUB 1GTOA 2DYSC 5D5QA 4UCVA 3BA9A 2P67A 1M9NA 2WLLB 5EBMC 3LSQA 2A06H 3QO7A 1W0JG 4OXSA 3N2KA 2L35A 5BY1A 1XNQO 5JH7B 5CA0A 1VQMV 5LGUA 4B3TB 1X59A 3ABKB 3A0BZ 1I5YA 1LUWA 1S5JA 2P22C 1S3JA 2RNBA 1BHAA 3AG1B 3EXAA 3TGUH 1GO3F 2WLMA 4LFCB 4AILC 4DR5O 4P2ZA 4QIWF 3NXSA 3K57A 1NT2B 3CS5A 4CH6A 4E2LA 3D8CA 2ZINA 5EYPB 3ZN0A 4PA6A 2E74B 3ZRWA 4DR1B 2UUCB 1MSDA 1G8MA 4UV9A 1N34B 4QGPA 4GX5A 4I0XB 2E5LB 5EC2C 2IJIA 2KKWA 4CC5A 2OYQA 2QWQB 4B3MO 5LA6A 1R6NA 4KL1A 2H3OA 4O4IA 4FLZA 1B3QA 3CRRA 2ETNA 4N21A 3FB8C 1ZAUA 4YJ2B 4IT5A 1CEZA 4BAYA 3ABMB 3C3TA 4ZI7B 2EILB 2IH3C 4MW3A 1NH2B 5DEDA 3RBZA 4PI0A 3P30A 4LF7O 3CCMV 3CB2A 3QVNA 2PYLA 1BSMA 3JAWB 1AILA 3HR0A 3KKYA 5DECA 1RM1B 3JAKB 4LH7A 2P4VA 2PI4A 4WFFA 1VP7A 4PA9A 5IDJA 3A0RA 4ZKIA 2F43G 5J2UB 4KHPB 2JJ2G 1VF7A 4GX2A 2N05A 5AG2A 4PDLA 1F7YA 1IURA 4HAMA 2VQFO 1QU7A 4LWSB 2ZCEA 4K35A 3K3WA 3BCCH 5KUMA 3HKDA 3SPJA 1G6UA 2D3OW 4RQEA 1V54C 3OE7G 1DF5A 2XAFA 3SYQA 4B3TO 1M93A 1GM7A 1Y74A 3KCXA 5B1BC 5D5PA 3JASB 2LW7A 1K5QA 2OCCB 4UCUA 4ZIBA 2HJDA 5KLVH 2ADQB 4PA7A 1PNMA 2QM4A 5KX5B 5FL7G 4LFCO 3SJCC 2Y69C 1KUQA 3RYIA 1Q43A 1WPXA 1WP8A 5IYCO 1K34A 4D6TH 4LF9B 1NVPD 1GH6A 2UXXA 2UUCO 2EZOA 3ZHRA 1YI2V 1S0VA 1ZSPA 4NTWA 3K08A 2Q5ZA 4IHJA 3W7TA 2PYJA 3WB0A 1MG1A 4G27B 3M8AA 3LDCA 1L0LH 1JFFB 2OWOA 2ZDIC 4MVSA 4YJ3B 3OUSA 4I7ZB 1XDCA 1IXBA 1SQGA 3SR2C 1KC8W 5FNVA 4UVAA 5TISZ 4B3SB 1CPYA 4O4LA 3ZHTA 1GN2A 4JTCB 2EINB 5E1AC 2Q7HA 1QCEA 3ZRXA 2YXLA 1OCRC 4NTYA 4GKKB 4PDVA 2XAHA 4DV7B 4XDKA 1E1QG 5LP6A 3APOA 3E2EA 1AP5A 4WCEV 3L74H 3A2FA 3RYFA 4E4EA 1H8HG 3HKCA 3MDSA 3ABUA 2FB5A 2JGDA 1AI4A 2FL4A 4KHPO 1H2LA 4KP4A 5LGNA 2VWJA 3JD1A 4DV6O 1W59A 2LQTA 4L8JA 3AG2B 4JYAB 3GWOA 4JI4B 5IY5C 3CC2V 4U3FH 1MABG 4FZ0A 2PY5A 3QNEA 4LFAO 1VQKV 1JCHA 2C2AA 3CXCU 4U7OA 2DYSB 1VQLV 3G80A 1XOUA 1ENVA 3FFQA 3CRQA 2V7QG 2JEXA 4ZHQA 3SPHA 1Q82W 4DV2B 1EN5A 1CXZB 1G4YB 1K5SA 1VF6A 3VOUA 2B1IA 2DOSA 1OZ0A 4U3JB 1K9MW 3HKBB 4TWKA 3SJBC 2CUGA 1N33B 4CS3A 1VQ5V 4K8XA 2F4VB 5CB4B 3BVOA 2XTAA 4DW0A 4LF8O 1AJPA 4FLWA 3H1HH 3KG2A 2BSKA 2VS0A 1OHHG 3ZEDA 3EVKA 1HW7A 1VQOV 5H2FZ 4GKJB 2V4DA 4ZBMA 2UXNA 3OFNG 1A32A 4LP8A 2GHYA 3OTOB 4TV8B 3E8GA 4QE7A 3BHPA 2AGAA 2ZKOA 3ASOC 3S3XA 3K5OA 1GN3A 3OMNB 1RSOB 1WNSA 1F4MA 4K0KB 1GM9A 3TXSA 5JJEB 1KU9A 1UJWB 3PN1A 1AP6A 2F23A 2ZM6B 4NKGB 4UB8Z 2M7WA 3JD2A 2F95B 1SETA 4I4TB 5CBFA 2Q6AA 4DR6B 2QM8A 1ZL8B 4DUYB 4DV7O 1X4TA 3F7VC 5LXTA 4ICGA 2XASA 3CRCA 4FLYA 1FXHA 4JI6B 3UQ8A 3CWBH 3SDLA 4DV1O 1WB7A 4D7TA 1W0KG 1TVKA 2F1MA 3JATB 1V55C 4H37A 1D2DA 3X2QB 5KMGB 3AG4B 2YIAA 3BABA 4PDMA 4JYAO 4JI4O 2YXHA 3U0ZA 5JVDB 3SGIA 1GKFA 5CA1A 3JALB 1XL4A 3QO8A 3QG5A 1KP2A 2MW2B 1VMGA 1PP9H 4XBFA 3FD9A 5LMUO 2Y0IA 1AB3A 1QBZA 3C3SA 3OEEG 4GCZA 3ABLB 2EIMC 3E89A 3JD0A 1QLEC 4FFBA 4DV2O 2HVKC 5JCOA 3CD6V 4O2BB 3ASNC 3Q4HB 4DXWA 3T2MA 3CCLV 1SA0A 4X1YA 3DTUB 2IJJA 3CCRV 1KB9F 2JDIG 3STZC 4DR4B 3ZHSA 1EZVH 3HKEB 3T4ZA 1VQ7V 3KCYA 2WLJA 2QWOB 4JYYA 3UO2A 4KUMA 2PGGA 3H9VA 1P4RA 4JAAA 4GKJO 2Y69B 3F7YC 1TUBA 3E86A 1FXKA 4XDLA 1Y66A 5ITZB 3CCJV 1RPOA 3OTOO 1R3KC 4MVOA 1EN6A 1RP3B 3CRAA 3B09A 4NTXA 3ZN1A 1YF2A 3T1HB 1WA8B 1DGSA 3B8NA 1I5XA 4NXNB 4K0KO 3RYHB 1SRYA 1S5LZ 4EKWA 3U11A 4R50A 4YIPA 5EBWC 1K73W 5FLXN 2ZM6O 3QO5A 4UB6Z 5IJ0B 4DRXA 3AEIA 4DR6O 3RYCA 4X1IA 3CCUV 1YIJV 4U7NA 3I5DA 4JI6O 3JD4A 4JI0B 1SQQH 3J7AU 1OCRB 3D36C 3CCEV 2WLNA 5LHHA 4JYBA 4FZ1A 2KG7B 1HDJA 5L3CA 4GLXA 3K5LA 4B08A 3G6BA 4YHHO 4FJCC 3ZBHA 4WBNA 4JV5B 5LYJB 5LOVA 3EFFK 5BR8B 4F6RB 1UFIA 4DW1A 2EIJB 3ZMSA 1MOFA 3E8FA 5IY5B 4JI7O 3OEHG 2Q73A 2JIZG 2MK3A 4HNAB 1GMGA 2HKOA 5KHIA 3ZS8C 4B3MB 1EM1A 4PI2A 4X64B 4JI5O 4J9YB 1O9HA 2QM7A 2R9IA 1HR0B 1E1RG 1NR1A 2PZSA 2X7RB 4MW8A 1N32B 5LP6C 5L3FA 2EZPA 2H94A 2KSDA 3K06A 2YIBA 5IE9A 2A79B 3LNNA 1BGYH 1THZA 4RQFA 4DR2O 5FPOA 4FM1A 1VQNV 2QDOA 4JYCA 3SYAA 3LNMB 3R65A 1KQSU 3L70H 4LC1A 2Q67A 4X62B 3JCUZ 4KFMA 1B06A 3K58A 3WG7C 3T1HO 2YEVB 5H9CA 1K8AW 2NN4A 3ZMUA 1AR1B 4QE9A 4TT3G 1SQVH 4I5SA 4RWUA 3EHBB 1AI6A 1VQ4V 4TQDA 5JJNB 3N2KB 1VF6C 3L75H 1JOYA 1K33A 2YUAA 5CA0B 1OCCC 2Q4PA 4Z2WA 4JI0O 1NKDA 2BTQA 2Q7GA 1AVMA 1GAXA 2NLJC 5KA5A 3JCZA 3H01A 4EFEA 2PI5A 2CGNA 2GDSA 3HPLC 4LNUA 1FJGO 1MNGA 4JI1B 5K1XA 2WLLA 1PPJH 1OJHA 2ZNIA 4JV5O 5J2TB 5IYZB 5BR8O 3IGAC 1H2SB 2GTSA 3E8BA 3LDDA 2KB1A 4Q20A 1BMFG 3AG3C 1US6A 2QEXV 5IWAO 4TSFG 4PA3A 3OR7C 5EC1C 1T5EA 1ORQC 2XAJA 3ZHUA 4O4IB 4X64O 3STLC 2HJFC 3CYOA 4LF5O 4L87A 3ZMVA 3THOA 2F93B 1VARA 3NR7A 1HR0O 3WB1A 3CCSV 2R72A 2CDYA 2EIMB 3B40A 1QLEB 1N32O 4DR7B 4ABMA 2UXBO 4BW9A 4HZ3A 2X6AA 2P7TC 3ASNB 1MZFA 1OCOC 4O2AB 2LFSA 4I0XA 4Z1VA 3H1LH 4DO2A 2X6BA 2WA3A 1Z5WA 2JS5A 1WAZA 4DUZB 2ZNJA 4J80A 3P3PA 1YTFD 4J41A 4X62O 3BY6A 4YJ2A 4GUNA 1S76D 4BIUA 1COWG 1YVWA 2WWWA 4ZI7A 1EBOA 2XUMA 1JQ0A 5CBGA 4DV6B 1FXVA 2W0FC 2WLIB 3ETDA 4UVCA 2HLDG 1ZUQA 4NB5A 2OIGA 3CCVV 1HNZO 1NTMH 3K5NA 4DV5B 2D2CB 2EJ7A 2W6JG 1AR5A 3JAKA 5CBHA 4IYIA 4HBNA 1BCCH 1R6TA 4LFAB 2HVJC 5JCOC 2YI9A 3BAAA 1E79G 4JI3O 4CS4A 5J2UA 1J5EO 2B9ZA 1Y74B 3RWRD 3QF7A 1N0NA 3CJHB 1URFA 3DC5A 2BCCH 1NQTA 2UXDO 1LNQA 1F51A 4JI1O 3JYCA 5K1PA 1GRJA 3RYIB 2AHYA 4LF8B 1FXKC 1YCIA 2ZXWC 3AK1A 1SERA 1Q5OA 2DW4A 4CH3A 1BE3H 3IC9A 4IHJB 3JASA 1SZXA 1FAFA 1IBLO 4UFZA 4C7UA 1WJZA 5JJJB 3O9OA 1JVMA 5GTHZ 5IJ9A 3SYCA 5KX5A 5FNVB 3W7SA 1H2NA 3A0HZ 3K0GA 2B5UA 1F23A 2QR4A 4DR7O 3SPCA 1Q6UA 3ZRSA 3UT5A 5JQGA 1WP7A 2ZIOA 2Z0AA 1VIBA 2EIKB 3TK1A 2QWRB 5LL6Y 1JFFA 3L71H 5LP6B 4CC6A 2LFRA 3M99B 3SJAC 1Q6HA 3RYFB 3VQXA 4DUZO 4DV1B 2JGDB 4CH5A 1IVSA 2QJ1A 3K5MA 5KHGA 1Y76B 3D3QA 3U10A 1NJIW 2LP7A 5KAIZ 1QQCA 3OGCC 3BEHA 1Q86W 4JF3A 5B3SC 4JAUA 2EJRA 4DV5O 4BR6A 5A2QN 3JARA 3VBBA 1JA8A 2Z3YA 3UCSC 1HNWB 2ITCC 3IAYA 1QR9A 3CXHF 2IW5A 1K97A 4JTDB 1MMMA 4RAIA 5LMUB 2ATKC 1R1BA 1AR4A 4I55A 2ZE8A 3I56V 3SYPA 4ZHQB 1ZTEA 3ZX6A 4NR1A 3G4SV 1GN4A 2UUAO 1YSCA 2DN9A 1M56C 1OCZC 1YTFB 3JSLA 4UXNA 2WLKA 3T1CA 1OCCB 1JJ2U 2ODMA 1K4DC 4K3AA 5C8YA 3T1YO 2UU9O 4GT1A 2JVDA 5B1AC 1YJNV 2BTOA 3DXRB 4WFGA 1HP8A 2JEUA 3ICXA 3TXQA 5C93A 4OPHA 1XQ8A 4LF6B 3DSQA 1KD1W 1Z2GA 1P7BA 3K03A 4X89A 4PA4A 3G71V 4MS2A 2QWNB 4N23A 4CZZA 4MVRA 1N8RW 1JX9A 1D5NA 2M6YA 2P4KA 2KQXA 2YC0A 4FVMA 4DV3B 5E79Z 3F5TA 2WSSG 4D7SA 1I94B 2LGQA 4DK1A 4TV8A 4GX0A 1NVPB 2FMLA 5FPRA 3IFXA 1RSOA 1TVKB 1BQZA 3ABTA 3VQWA 5EZYB 1H2MA 4PJ0Z 2FYUH 3BFRA 4R6ZA 3LDEA 1P7GA 3ABKC 3LSSA 1U96A 2YI8A 4F6EA 4I4TA 1FS0G 1ZL8A 4YHHB 4JAVA 4RUFA 2YDEA 1FFXA 3I55V 4X88A 2HEPA 2P5OA 2DYRC 4GZRB 3AK3A 1HNWO 1BQ0A 1ZLZA 3K0DA 2XAGA 3FAVB 4JI7B 1N36B 1FFTB 2EX3A 5KMGA 4UUJC 4WFBV 4B7KA 2OT5A 4LBEC 4MSWC 4JZGA 4JI5B 5JVDA 1YITV 4MTFA 1N4CA 1SA0B 1V54B 1XMQB 3VQVA 2QSAA 1QNMA 3CCQV 1BZKA 4DR3O 1K3EA 2E3CA 5B1BB 2AZ2A 1SKVA 4JTAB 1VQ8V 4O4HA 5L3EA 3N2GB 3ABMC 4FK5C 3W7XA 3W7WA 1S77D 4F4LA 4DR2B 1M90W 2OIEA 1TUBB 4O2BA 4JASA 2Q7EA 1PV0A 2CH7B 4LF6O 2GUZB 3TETA 1BL8A 1TGOA 4Q6GA 3CPWU 4I9QA 5EK0A 4CH4A 4IIJB 4LCUC 4QPKA 1BT8A 2ZE5A 4DV3O 3E83A 1IBMO 1I94O 4BW5A 4X1IB 5ITZA 1XI1A 1VQ9V 1Q81W 1P84F 4I50B 1AROP 3ETEA 5L3BA 4TV9A 3RYHA 1H2GA 2E75B 3K04A 1BS3A 3CHXA 2UUBB 1WPBA 2A0LA 1FJGB 2DMXA 5GONB 5IJ0A 5KHJA 1GN6A
chains in the Genus database with same CATH topology
4IT5A 2GUZB 3UO3A 2N04A 2QWRB 2GUZA 2DN9A 2CTWA 4RWUA 2M6YA 1FPOA 3AG7A 2KQXA 2QWPB 2YS8A 3APQA 1NZ6A 2Y4TA 2QWOB 3APOA 3UO2A 2CUGA 2CTQA 3UCSC 2N05A 2QWQB 2Y4UA 2LO1A 1IURA 1GH6A 2CTPA 3BVOA 2L6LA 1XBLA 2OCHA 2YUAA 2PF4E 1N4CA 1HDJA 2QWNB 1FAFA 1BQZA 2EJ7A 1BQ0A 2CTRA 2DMXA 2LGWA 4J7ZA 1WJZA 2QSAA 4J80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IT5 A;  2GUZ B;  3UO3 A;  2N04 A;  2QWR B;  2GUZ A;  2DN9 A;  2CTW A;  4RWU A;  2M6Y A;  1FPO A;  3AG7 A;  2KQX A;  2QWP B;  2YS8 A;  3APQ A;  1NZ6 A;  2Y4T A;  2QWO B;  3APO A;  3UO2 A;  2CUG A;  2CTQ A;  3UCS C;  2N05 A;  2QWQ B;  2Y4U A;  2LO1 A;  1IUR A;  1GH6 A;  2CTP A;  3BVO A;  2L6L A;  1XBL A;  2OCH A;  2YUA A;  2PF4 E;  1N4C A;  1HDJ A;  2QWN B;  1FAF A;  1BQZ A;  2EJ7 A;  1BQ0 A;  2CTR A;  2DMX A;  2LGW A;  4J7Z A;  1WJZ A;  2QSA A;  4J80 A; 
#chains in the Genus database with same CATH topology
 3JAM N;  1UPG A;  5L3D A;  1SF9 A;  2G38 A;  1NU1 H;  3S3W A;  1R3I C;  3APQ A;  3JD3 A;  4W4K A;  3W7U A;  1PD3 A;  3OGI B;  4DK0 A;  5CN0 A;  4YXW G;  4FMT A;  4TUY B;  4J42 A;  2QE7 G;  5IWA B;  5B3S B;  3MHH C;  1NTK H;  3B2E E;  4X1K A;  5BMV A;  2KG7 A;  1N36 O;  3G67 A;  4J10 A;  2PTM A;  4P9O A;  5LYJ A;  4LF5 B;  5CA3 A;  1XMQ O;  4F6R A;  4GYC B;  1O9G A;  4H33 A;  4O4J B;  2CTQ A;  1PL4 A;  3SPG A;  3ZCC A;  1L0N H;  2VRZ A;  2IU3 A;  1OCZ B;  2OTL V;  2UXB B;  2ZE6 A;  3E22 B;  1KKD A;  4HNA A;  4Z1M G;  3TCU A;  1CP9 A;  4AI8 A;  3DC6 A;  4UVB A;  2DE0 X;  2EIN C;  4TOI A;  3FB7 C;  3L73 H;  2CAZ C;  1ZX3 A;  1PNK A;  4UCT A;  1R6K A;  3ZHQ A;  1S5H C;  5L3G A;  4ZOL B;  5LBQ A;  1JJO A;  3OMA B;  2VQE O;  4NXM O;  1NBM G;  2N04 A;  2YID A;  1H2K A;  3SYO A;  2P6J A;  1PNL A;  4H0L B;  4X65 B;  1HNZ B;  4LF4 B;  4X20 A;  3ASO B;  1QLN A;  4EB6 A;  4DYL A;  3J80 N;  3BPZ A;  2RQ6 A;  3ZMT A;  3OTF A;  4YY3 O;  4JI3 B;  4R7C A;  2BTQ B;  3L9D A;  2ZR2 A;  1J5E B;  2XOK G;  4FM0 A;  3CRM A;  2Y0P A;  2YEV A;  1SZT A;  5LMN O;  3ETQ A;  1M1K W;  4NVP A;  2WA4 A;  1I7F A;  2R9R B;  3RVZ A;  2AXT Z;  2UUB O;  2OTJ V;  2UXD B;  1IBK O;  2BOC C;  1QVG U;  2VWK A;  1M4U A;  3FX7 A;  2QKA A;  4PDR A;  1V55 B;  3C90 A;  5JH7 A;  3RGB A;  3CSX A;  3FB6 C;  4WF9 V;  3ZRW B;  1IX9 A;  1M57 C;  1FPO A;  1SES A;  3D3I A;  3IJ4 A;  4AQY B;  1IBL B;  2JRI A;  2DYR B;  5LA6 B;  3T4D A;  4PHZ A;  4BWA A;  2CTP A;  4LH6 A;  4RUE A;  2FTK A;  5J2T A;  5IYZ A;  1NTZ H;  2WPD G;  3FB5 C;  3CE2 A;  4LR3 A;  2HHH O;  4R8C A;  5EYP A;  3FKS G;  1XMO B;  3N27 A;  4QNH B;  4J11 A;  3B8M A;  2NR5 A;  1YJW V;  1I08 A;  2LO1 A;  5DM6 V;  4J7J A;  2XND G;  1DK1 A;  3FYE B;  3UKM A;  1B04 A;  1KMI Z;  4JZ2 A;  5BZB A;  2Y48 A;  5H5N A;  4CBC A;  3QTC A;  4LFB O;  4MTX A;  1VQ6 V;  2DQ3 A;  1YJ9 V;  3AK2 A;  3KZI Z;  4JI2 O;  2UXC O;  3OM3 B;  4O2A A;  2ILM A;  4NYK A;  5BXZ A;  4I9W A;  3L72 H;  1KEC A;  1IZ3 A;  3JAW A;  3X2Q C;  1QHT A;  4X65 O;  4LF4 O;  3AG4 C;  1Q7Y W;  2QTO A;  2LJ2 A;  1R3J C;  3ZHV A;  3HKD B;  3LSU A;  3WB2 A;  2BOB C;  2LW1 A;  5B1O A;  2QKS A;  3K9A A;  2QA4 V;  3RW0 A;  4PEL A;  1XNR B;  2WLI A;  1IDS A;  2BE3 A;  2UUA B;  2L6L A;  2P06 A;  4DV4 B;  2HG5 C;  5JWP A;  1H38 A;  2RCV A;  3ABL C;  5EIB C;  4AHC A;  2WAM A;  3B4S A;  3OD4 A;  4LWS A;  4MTG A;  4OX9 B;  4OGQ B;  3P3N A;  4JI8 B;  3T1Y B;  1KBH A;  2UU9 B;  1SQP H;  3WU2 Z;  4FFK A;  1Y6X A;  2FKX A;  3CJH A;  5DN6 G;  1XBL A;  1L8D A;  2QKC A;  4AQY O;  2LGW A;  1LR1 A;  2DWD C;  1NI8 A;  1NS1 A;  2GBO A;  2Q68 A;  5IJ9 B;  1AJQ A;  3D36 A;  2IJK A;  1Q3E A;  3ZMZ A;  4DR1 O;  1H8E G;  1VQP V;  4O4L B;  1HNX B;  2ZD9 A;  1N34 O;  2OCH A;  3UT5 B;  1XMO O;  2XHB A;  5JQG B;  2Q0A A;  4B3R B;  2E5L O;  1ROP A;  1SQX H;  1Y67 A;  1ZWI C;  3PJS K;  4H13 B;  5GW7 A;  2ADP A;  1EZJ A;  1XEQ A;  2AZ0 A;  4YJ3 A;  3HKC B;  1JMK C;  1AI7 A;  4UV8 A;  1AJN A;  2B1G A;  2ZE7 A;  1B6Q A;  1PM9 A;  2ITD C;  2JS3 A;  4J7Z A;  4EFB A;  2HP8 A;  3H1J H;  1VF5 B;  2R70 A;  3JAR B;  2V1D A;  4BIZ A;  5EIB D;  3WG7 B;  4K8Z A;  2IM9 A;  3RT3 C;  2EBO A;  3K79 A;  1Y76 A;  4YIO A;  2X6C A;  4W4L A;  4I55 B;  1DTO A;  4MVQ A;  2A7W A;  4EEQ A;  1WB8 A;  2EIJ C;  3MAQ A;  3VQY A;  1XNR O;  1XL6 A;  1YHQ V;  4DV4 O;  4MVU A;  5EBL C;  3FYI B;  1YZB A;  4MTO A;  2YS8 A;  5B66 Z;  3OW2 U;  3BA8 A;  3P32 A;  5H6Q A;  5KHH A;  5C8Y B;  2P90 A;  4DR3 B;  1KYO F;  4OX9 O;  4IL6 Z;  1SQF A;  2BSK B;  4JI8 O;  4FM2 A;  5B5E Z;  1K4C C;  1YDX A;  3UO3 A;  1KKC A;  3UM7 A;  1JPX A;  2QGN A;  1S72 V;  4U3J A;  4PD4 F;  3HKB A;  3K9S A;  3GWK C;  1KP3 A;  1TUE B;  1M57 B;  4FPP A;  2ZT9 B;  4JPR A;  3AG3 B;  2PF4 E;  5CB4 A;  3OR6 C;  4MVM A;  1LUV A;  3CP1 A;  4LF9 O;  1DLB A;  4PV1 B;  4MT8 A;  4UCO A;  1HNX O;  3DXR A;  2NNU A;  1W2B U;  3AG7 A;  1VEW A;  2Q8V A;  4B3R O;  3CEI A;  1K92 A;  2E76 B;  1P49 A;  3E8H A;  1IBM B;  2DWE C;  2IH1 C;  2YIC A;  1GM8 A;  5GTI Z;  5LXT B;  4UCS A;  3BRC A;  3GB7 C;  5F2V O;  4B3S O;  1OCO B;  1DF4 A;  1I0H A;  1MZE A;  3CME V;  2W0X A;  5KHK A;  2QWP B;  4UCR A;  3ETG A;  5HFL A;  4FLX A;  4GKK O;  2A9H A;  1FYJ A;  3K59 A;  1FFX B;  5IT9 N;  3ZRV A;  2YIB D;  2ZR3 A;  4BIO A;  3AG1 C;  5CA1 B;  1XHZ A;  3E35 A;  2PUS A;  5EZY A;  1K7D A;  1PL0 A;  1RFY A;  1AI5 A;  3JAT A;  3JSN A;  4ASU G;  2A3Q A;  1EN4 A;  4DV0 B;  2HR3 A;  1TA8 A;  4KXR A;  4FFB B;  3CMA V;  3OUF A;  1OV9 A;  5LGT A;  4X1Y B;  1JR9 A;  3JAL A;  3R66 A;  2Q69 A;  2RJZ A;  1QVF U;  5IYD O;  3FAV A;  4O4H B;  4JGS A;  1GK9 A;  1NZ6 A;  2CGO A;  5HFM A;  4X66 B;  4J9Z B;  2XT9 A;  2HFE C;  1L1F A;  2IJH A;  3WFV A;  2EIL C;  1EFR G;  4OPA A;  2YSU B;  3MD0 A;  3Q4H A;  1FXK B;  1MSW D;  1Q6I A;  1R73 A;  3CC7 V;  1N33 O;  3HB3 B;  2ZXW B;  5IYB O;  5LHG A;  2F4V O;  4CS2 A;  2ZQM A;  1U97 A;  1F4N A;  3H1K H;  1RPR A;  2R9A A;  1RM1 C;  4IGG A;  3HKE A;  4RO2 A;  2VQE B;  4NXM B;  3N2G A;  2GSM B;  2K1E A;  2CE4 A;  1V9P A;  5CMU A;  4FIP C;  2CTR A;  4DRX B;  2CH7 A;  3RYC B;  1Q8I A;  1XIL A;  2GUZ A;  1XHX A;  5J9P C;  4WFH A;  1G1X B;  4YY3 B;  1Z5V A;  3ZIA G;  4FLU A;  4HYO A;  3M7M X;  4P9P A;  1SQB H;  4TV9 B;  1WA8 A;  5LMN B;  2DJV A;  2Q0O C;  3OMI B;  4IIJ A;  1NR7 A;  2ZDI A;  1PKX A;  3CX5 F;  1TAE A;  3DGE A;  3RVY A;  3H1I H;  3ML0 A;  1IBK B;  4FLV A;  4DUY O;  2CK3 G;  3ZJZ A;  4QJF B;  4WBN B;  4J7K A;  5LOV B;  1XNQ B;  1WLE A;  2OCC C;  1IXM A;  1FD9 A;  4GX1 A;  1SS3 A;  1HWY A;  4I50 A;  1R3L C;  2QTS A;  2GTA A;  2ZIM A;  3O65 A;  4X9Q A;  4X1K B;  1YXB A;  5BMV B;  1SC5 B;  5KAF Z;  4MVZ A;  1N0J A;  4DV0 O;  5GON A;  2EUL A;  1NH2 D;  4G28 B;  4H44 B;  4TQF A;  4QPJ A;  4DR5 B;  2GV9 A;  2DQ0 A;  5H6R A;  4WFA V;  1MA1 A;  3J81 N;  3RFR A;  2AW9 A;  2IU0 A;  3IC7 A;  2HHH B;  2W6I G;  2JGU A;  1M56 B;  1Q90 D;  4TUY A;  2ARH A;  3B77 A;  4WFE A;  2H8P C;  4X8A A;  4X66 O;  3OAA G;  2RDC A;  4P30 A;  2K9P A;  3GVM A;  4FLT A;  2AHZ A;  2X0L A;  1FKA O;  2O57 A;  5A9G A;  5LHI A;  1Y4M A;  2XAQ A;  4B7E A;  2Z5U A;  3SJQ C;  4A5U B;  2EIK C;  1M5I A;  3G6E V;  4DR4 O;  4O4J A;  2Y4U A;  3LUT B;  5B1A B;  2IBZ H;  3TJT A;  4LFB B;  5KA6 A;  1QR8 A;  2WLH A;  2RN9 A;  4LF7 B;  4JI2 B;  2UXC B;  2YXY A;  3E22 A;  3RN4 A;  4X20 B;  3A8T A;  2F66 C;  4EB6 B;  2N74 A;  1D5A A;  2Y4T A;  3MHS C;  1XUQ A;  1XRE A;  3AG2 C;  3OT7 A;  3CC4 V;  4XDJ A;  3SPI A;  2Q9L A;  1BHB A;  1J95 A;  4ZOL A;  1WN7 A;  4NXN O;  2JJ1 G;  3F5W C;  5KUK A;  2RMK B;  2CTW A;  4IYH A;  2VQF B;  5B1N A;  2JK5 C;  1YEW A;  4G2K A;  4LNU B;  1GTO A;  2DYS C;  5D5Q A;  4UCV A;  3BA9 A;  2P67 A;  1M9N A;  2WLL B;  5EBM C;  3LSQ A;  2A06 H;  3QO7 A;  1W0J G;  4OXS A;  3N2K A;  2L35 A;  5BY1 A;  1XNQ O;  5JH7 B;  5CA0 A;  1VQM V;  5LGU A;  4B3T B;  1X59 A;  3ABK B;  3A0B Z;  1I5Y A;  1LUW A;  1S5J A;  2P22 C;  1S3J A;  2RNB A;  1BHA A;  3AG1 B;  3EXA A;  3TGU H;  1GO3 F;  2WLM A;  4LFC B;  4AIL C;  4DR5 O;  4P2Z A;  4QIW F;  3NXS A;  3K57 A;  1NT2 B;  3CS5 A;  4CH6 A;  4E2L A;  3D8C A;  2ZIN A;  5EYP B;  3ZN0 A;  4PA6 A;  2E74 B;  3ZRW A;  4DR1 B;  2UUC B;  1MSD A;  1G8M A;  4UV9 A;  1N34 B;  4QGP A;  4GX5 A;  4I0X B;  2E5L B;  5EC2 C;  2IJI A;  2KKW A;  4CC5 A;  2OYQ A;  2QWQ B;  4B3M O;  5LA6 A;  1R6N A;  4KL1 A;  2H3O A;  4O4I A;  4FLZ A;  1B3Q A;  3CRR A;  2ETN A;  4N21 A;  3FB8 C;  1ZAU A;  4YJ2 B;  4IT5 A;  1CEZ A;  4BAY A;  3ABM B;  3C3T A;  4ZI7 B;  2EIL B;  2IH3 C;  4MW3 A;  1NH2 B;  5DED A;  3RBZ A;  4PI0 A;  3P30 A;  4LF7 O;  3CCM V;  3CB2 A;  3QVN A;  2PYL A;  1BSM A;  3JAW B;  1AIL A;  3HR0 A;  3KKY A;  5DEC A;  1RM1 B;  3JAK B;  4LH7 A;  2P4V A;  2PI4 A;  4WFF A;  1VP7 A;  4PA9 A;  5IDJ A;  3A0R A;  4ZKI A;  2F43 G;  5J2U B;  4KHP B;  2JJ2 G;  1VF7 A;  4GX2 A;  2N05 A;  5AG2 A;  4PDL A;  1F7Y A;  1IUR A;  4HAM A;  2VQF O;  1QU7 A;  4LWS B;  2ZCE A;  4K35 A;  3K3W A;  3BCC H;  5KUM A;  3HKD A;  3SPJ A;  1G6U A;  2D3O W;  4RQE A;  1V54 C;  3OE7 G;  1DF5 A;  2XAF A;  3SYQ A;  4B3T O;  1M93 A;  1GM7 A;  1Y74 A;  3KCX A;  5B1B C;  5D5P A;  3JAS B;  2LW7 A;  1K5Q A;  2OCC B;  4UCU A;  4ZIB A;  2HJD A;  5KLV H;  2ADQ B;  4PA7 A;  1PNM A;  2QM4 A;  5KX5 B;  5FL7 G;  4LFC O;  3SJC C;  2Y69 C;  1KUQ A;  3RYI A;  1Q43 A;  1WPX A;  1WP8 A;  5IYC O;  1K34 A;  4D6T H;  4LF9 B;  1NVP D;  1GH6 A;  2UXX A;  2UUC O;  2EZO A;  3ZHR A;  1YI2 V;  1S0V A;  1ZSP A;  4NTW A;  3K08 A;  2Q5Z A;  4IHJ A;  3W7T A;  2PYJ A;  3WB0 A;  1MG1 A;  4G27 B;  3M8A A;  3LDC A;  1L0L H;  1JFF B;  2OWO A;  2ZDI C;  4MVS A;  4YJ3 B;  3OUS A;  4I7Z B;  1XDC A;  1IXB A;  1SQG A;  3SR2 C;  1KC8 W;  5FNV A;  4UVA A;  5TIS Z;  4B3S B;  1CPY A;  4O4L A;  3ZHT A;  1GN2 A;  4JTC B;  2EIN B;  5E1A C;  2Q7H A;  1QCE A;  3ZRX A;  2YXL A;  1OCR C;  4NTY A;  4GKK B;  4PDV A;  2XAH A;  4DV7 B;  4XDK A;  1E1Q G;  5LP6 A;  3APO A;  3E2E A;  1AP5 A;  4WCE V;  3L74 H;  3A2F A;  3RYF A;  4E4E A;  1H8H G;  3HKC A;  3MDS A;  3ABU A;  2FB5 A;  2JGD A;  1AI4 A;  2FL4 A;  4KHP O;  1H2L A;  4KP4 A;  5LGN A;  2VWJ A;  3JD1 A;  4DV6 O;  1W59 A;  2LQT A;  4L8J A;  3AG2 B;  4JYA B;  3GWO A;  4JI4 B;  5IY5 C;  3CC2 V;  4U3F H;  1MAB G;  4FZ0 A;  2PY5 A;  3QNE A;  4LFA O;  1VQK V;  1JCH A;  2C2A A;  3CXC U;  4U7O A;  2DYS B;  1VQL V;  3G80 A;  1XOU A;  1ENV A;  3FFQ A;  3CRQ A;  2V7Q G;  2JEX A;  4ZHQ A;  3SPH A;  1Q82 W;  4DV2 B;  1EN5 A;  1CXZ B;  1G4Y B;  1K5S A;  1VF6 A;  3VOU A;  2B1I A;  2DOS A;  1OZ0 A;  4U3J B;  1K9M W;  3HKB B;  4TWK A;  3SJB C;  2CUG A;  1N33 B;  4CS3 A;  1VQ5 V;  4K8X A;  2F4V B;  5CB4 B;  3BVO A;  2XTA A;  4DW0 A;  4LF8 O;  1AJP A;  4FLW A;  3H1H H;  3KG2 A;  2BSK A;  2VS0 A;  1OHH G;  3ZED A;  3EVK A;  1HW7 A;  1VQO V;  5H2F Z;  4GKJ B;  2V4D A;  4ZBM A;  2UXN A;  3OFN G;  1A32 A;  4LP8 A;  2GHY A;  3OTO B;  4TV8 B;  3E8G A;  4QE7 A;  3BHP A;  2AGA A;  2ZKO A;  3ASO C;  3S3X A;  3K5O A;  1GN3 A;  3OMN B;  1RSO B;  1WNS A;  1F4M A;  4K0K B;  1GM9 A;  3TXS A;  5JJE B;  1KU9 A;  1UJW B;  3PN1 A;  1AP6 A;  2F23 A;  2ZM6 B;  4NKG B;  4UB8 Z;  2M7W A;  3JD2 A;  2F95 B;  1SET A;  4I4T B;  5CBF A;  2Q6A A;  4DR6 B;  2QM8 A;  1ZL8 B;  4DUY B;  4DV7 O;  1X4T A;  3F7V C;  5LXT A;  4ICG A;  2XAS A;  3CRC A;  4FLY A;  1FXH A;  4JI6 B;  3UQ8 A;  3CWB H;  3SDL A;  4DV1 O;  1WB7 A;  4D7T A;  1W0K G;  1TVK A;  2F1M A;  3JAT B;  1V55 C;  4H37 A;  1D2D A;  3X2Q B;  5KMG B;  3AG4 B;  2YIA A;  3BAB A;  4PDM A;  4JYA O;  4JI4 O;  2YXH A;  3U0Z A;  5JVD B;  3SGI A;  1GKF A;  5CA1 A;  3JAL B;  1XL4 A;  3QO8 A;  3QG5 A;  1KP2 A;  2MW2 B;  1VMG A;  1PP9 H;  4XBF A;  3FD9 A;  5LMU O;  2Y0I A;  1AB3 A;  1QBZ A;  3C3S A;  3OEE G;  4GCZ A;  3ABL B;  2EIM C;  3E89 A;  3JD0 A;  1QLE C;  4FFB A;  4DV2 O;  2HVK C;  5JCO A;  3CD6 V;  4O2B B;  3ASN C;  3Q4H B;  4DXW A;  3T2M A;  3CCL V;  1SA0 A;  4X1Y A;  3DTU B;  2IJJ A;  3CCR V;  1KB9 F;  2JDI G;  3STZ C;  4DR4 B;  3ZHS A;  1EZV H;  3HKE B;  3T4Z A;  1VQ7 V;  3KCY A;  2WLJ A;  2QWO B;  4JYY A;  3UO2 A;  4KUM A;  2PGG A;  3H9V A;  1P4R A;  4JAA A;  4GKJ O;  2Y69 B;  3F7Y C;  1TUB A;  3E86 A;  1FXK A;  4XDL A;  1Y66 A;  5ITZ B;  3CCJ V;  1RPO A;  3OTO O;  1R3K C;  4MVO A;  1EN6 A;  1RP3 B;  3CRA A;  3B09 A;  4NTX A;  3ZN1 A;  1YF2 A;  3T1H B;  1WA8 B;  1DGS A;  3B8N A;  1I5X A;  4NXN B;  4K0K O;  3RYH B;  1SRY A;  1S5L Z;  4EKW A;  3U11 A;  4R50 A;  4YIP A;  5EBW C;  1K73 W;  5FLX N;  2ZM6 O;  3QO5 A;  4UB6 Z;  5IJ0 B;  4DRX A;  3AEI A;  4DR6 O;  3RYC A;  4X1I A;  3CCU V;  1YIJ V;  4U7N A;  3I5D A;  4JI6 O;  3JD4 A;  4JI0 B;  1SQQ H;  3J7A U;  1OCR B;  3D36 C;  3CCE V;  2WLN A;  5LHH A;  4JYB A;  4FZ1 A;  2KG7 B;  1HDJ A;  5L3C A;  4GLX A;  3K5L A;  4B08 A;  3G6B A;  4YHH O;  4FJC C;  3ZBH A;  4WBN A;  4JV5 B;  5LYJ B;  5LOV A;  3EFF K;  5BR8 B;  4F6R B;  1UFI A;  4DW1 A;  2EIJ B;  3ZMS A;  1MOF A;  3E8F A;  5IY5 B;  4JI7 O;  3OEH G;  2Q73 A;  2JIZ G;  2MK3 A;  4HNA B;  1GMG A;  2HKO A;  5KHI A;  3ZS8 C;  4B3M B;  1EM1 A;  4PI2 A;  4X64 B;  4JI5 O;  4J9Y B;  1O9H A;  2QM7 A;  2R9I A;  1HR0 B;  1E1R G;  1NR1 A;  2PZS A;  2X7R B;  4MW8 A;  1N32 B;  5LP6 C;  5L3F A;  2EZP A;  2H94 A;  2KSD A;  3K06 A;  2YIB A;  5IE9 A;  2A79 B;  3LNN A;  1BGY H;  1THZ A;  4RQF A;  4DR2 O;  5FPO A;  4FM1 A;  1VQN V;  2QDO A;  4JYC A;  3SYA A;  3LNM B;  3R65 A;  1KQS U;  3L70 H;  4LC1 A;  2Q67 A;  4X62 B;  3JCU Z;  4KFM A;  1B06 A;  3K58 A;  3WG7 C;  3T1H O;  2YEV B;  5H9C A;  1K8A W;  2NN4 A;  3ZMU A;  1AR1 B;  4QE9 A;  4TT3 G;  1SQV H;  4I5S A;  4RWU A;  3EHB B;  1AI6 A;  1VQ4 V;  4TQD A;  5JJN B;  3N2K B;  1VF6 C;  3L75 H;  1JOY A;  1K33 A;  2YUA A;  5CA0 B;  1OCC C;  2Q4P A;  4Z2W A;  4JI0 O;  1NKD A;  2BTQ A;  2Q7G A;  1AVM A;  1GAX A;  2NLJ C;  5KA5 A;  3JCZ A;  3H01 A;  4EFE A;  2PI5 A;  2CGN A;  2GDS A;  3HPL C;  4LNU A;  1FJG O;  1MNG A;  4JI1 B;  5K1X A;  2WLL A;  1PPJ H;  1OJH A;  2ZNI A;  4JV5 O;  5J2T B;  5IYZ B;  5BR8 O;  3IGA C;  1H2S B;  2GTS A;  3E8B A;  3LDD A;  2KB1 A;  4Q20 A;  1BMF G;  3AG3 C;  1US6 A;  2QEX V;  5IWA O;  4TSF G;  4PA3 A;  3OR7 C;  5EC1 C;  1T5E A;  1ORQ C;  2XAJ A;  3ZHU A;  4O4I B;  4X64 O;  3STL C;  2HJF C;  3CYO A;  4LF5 O;  4L87 A;  3ZMV A;  3THO A;  2F93 B;  1VAR A;  3NR7 A;  1HR0 O;  3WB1 A;  3CCS V;  2R72 A;  2CDY A;  2EIM B;  3B40 A;  1QLE B;  1N32 O;  4DR7 B;  4ABM A;  2UXB O;  4BW9 A;  4HZ3 A;  2X6A A;  2P7T C;  3ASN B;  1MZF A;  1OCO C;  4O2A B;  2LFS A;  4I0X A;  4Z1V A;  3H1L H;  4DO2 A;  2X6B A;  2WA3 A;  1Z5W A;  2JS5 A;  1WAZ A;  4DUZ B;  2ZNJ A;  4J80 A;  3P3P A;  1YTF D;  4J41 A;  4X62 O;  3BY6 A;  4YJ2 A;  4GUN A;  1S76 D;  4BIU A;  1COW G;  1YVW A;  2WWW A;  4ZI7 A;  1EBO A;  2XUM A;  1JQ0 A;  5CBG A;  4DV6 B;  1FXV A;  2W0F C;  2WLI B;  3ETD A;  4UVC A;  2HLD G;  1ZUQ A;  4NB5 A;  2OIG A;  3CCV V;  1HNZ O;  1NTM H;  3K5N A;  4DV5 B;  2D2C B;  2EJ7 A;  2W6J G;  1AR5 A;  3JAK A;  5CBH A;  4IYI A;  4HBN A;  1BCC H;  1R6T A;  4LFA B;  2HVJ C;  5JCO C;  2YI9 A;  3BAA A;  1E79 G;  4JI3 O;  4CS4 A;  5J2U A;  1J5E O;  2B9Z A;  1Y74 B;  3RWR D;  3QF7 A;  1N0N A;  3CJH B;  1URF A;  3DC5 A;  2BCC H;  1NQT A;  2UXD O;  1LNQ A;  1F51 A;  4JI1 O;  3JYC A;  5K1P A;  1GRJ A;  3RYI B;  2AHY A;  4LF8 B;  1FXK C;  1YCI A;  2ZXW C;  3AK1 A;  1SER A;  1Q5O A;  2DW4 A;  4CH3 A;  1BE3 H;  3IC9 A;  4IHJ B;  3JAS A;  1SZX A;  1FAF A;  1IBL O;  4UFZ A;  4C7U A;  1WJZ A;  5JJJ B;  3O9O A;  1JVM A;  5GTH Z;  5IJ9 A;  3SYC A;  5KX5 A;  5FNV B;  3W7S A;  1H2N A;  3A0H Z;  3K0G A;  2B5U A;  1F23 A;  2QR4 A;  4DR7 O;  3SPC A;  1Q6U A;  3ZRS A;  3UT5 A;  5JQG A;  1WP7 A;  2ZIO A;  2Z0A A;  1VIB A;  2EIK B;  3TK1 A;  2QWR B;  5LL6 Y;  1JFF A;  3L71 H;  5LP6 B;  4CC6 A;  2LFR A;  3M99 B;  3SJA C;  1Q6H A;  3RYF B;  3VQX A;  4DUZ O;  4DV1 B;  2JGD B;  4CH5 A;  1IVS A;  2QJ1 A;  3K5M A;  5KHG A;  1Y76 B;  3D3Q A;  3U10 A;  1NJI W;  2LP7 A;  5KAI Z;  1QQC A;  3OGC C;  3BEH A;  1Q86 W;  4JF3 A;  5B3S C;  4JAU A;  2EJR A;  4DV5 O;  4BR6 A;  5A2Q N;  3JAR A;  3VBB A;  1JA8 A;  2Z3Y A;  3UCS C;  1HNW B;  2ITC C;  3IAY A;  1QR9 A;  3CXH F;  2IW5 A;  1K97 A;  4JTD B;  1MMM A;  4RAI A;  5LMU B;  2ATK C;  1R1B A;  1AR4 A;  4I55 A;  2ZE8 A;  3I56 V;  3SYP A;  4ZHQ B;  1ZTE A;  3ZX6 A;  4NR1 A;  3G4S V;  1GN4 A;  2UUA O;  1YSC A;  2DN9 A;  1M56 C;  1OCZ C;  1YTF B;  3JSL A;  4UXN A;  2WLK A;  3T1C A;  1OCC B;  1JJ2 U;  2ODM A;  1K4D C;  4K3A A;  5C8Y A;  3T1Y O;  2UU9 O;  4GT1 A;  2JVD A;  5B1A C;  1YJN V;  2BTO A;  3DXR B;  4WFG A;  1HP8 A;  2JEU A;  3ICX A;  3TXQ A;  5C93 A;  4OPH A;  1XQ8 A;  4LF6 B;  3DSQ A;  1KD1 W;  1Z2G A;  1P7B A;  3K03 A;  4X89 A;  4PA4 A;  3G71 V;  4MS2 A;  2QWN B;  4N23 A;  4CZZ A;  4MVR A;  1N8R W;  1JX9 A;  1D5N A;  2M6Y A;  2P4K A;  2KQX A;  2YC0 A;  4FVM A;  4DV3 B;  5E79 Z;  3F5T A;  2WSS G;  4D7S A;  1I94 B;  2LGQ A;  4DK1 A;  4TV8 A;  4GX0 A;  1NVP B;  2FML A;  5FPR A;  3IFX A;  1RSO A;  1TVK B;  1BQZ A;  3ABT A;  3VQW A;  5EZY B;  1H2M A;  4PJ0 Z;  2FYU H;  3BFR A;  4R6Z A;  3LDE A;  1P7G A;  3ABK C;  3LSS A;  1U96 A;  2YI8 A;  4F6E A;  4I4T A;  1FS0 G;  1ZL8 A;  4YHH B;  4JAV A;  4RUF A;  2YDE A;  1FFX A;  3I55 V;  4X88 A;  2HEP A;  2P5O A;  2DYR C;  4GZR B;  3AK3 A;  1HNW O;  1BQ0 A;  1ZLZ A;  3K0D A;  2XAG A;  3FAV B;  4JI7 B;  1N36 B;  1FFT B;  2EX3 A;  5KMG A;  4UUJ C;  4WFB V;  4B7K A;  2OT5 A;  4LBE C;  4MSW C;  4JZG A;  4JI5 B;  5JVD A;  1YIT V;  4MTF A;  1N4C A;  1SA0 B;  1V54 B;  1XMQ B;  3VQV A;  2QSA A;  1QNM A;  3CCQ V;  1BZK A;  4DR3 O;  1K3E A;  2E3C A;  5B1B B;  2AZ2 A;  1SKV A;  4JTA B;  1VQ8 V;  4O4H A;  5L3E A;  3N2G B;  3ABM C;  4FK5 C;  3W7X A;  3W7W A;  1S77 D;  4F4L A;  4DR2 B;  1M90 W;  2OIE A;  1TUB B;  4O2B A;  4JAS A;  2Q7E A;  1PV0 A;  2CH7 B;  4LF6 O;  2GUZ B;  3TET A;  1BL8 A;  1TGO A;  4Q6G A;  3CPW U;  4I9Q A;  5EK0 A;  4CH4 A;  4IIJ B;  4LCU C;  4QPK A;  1BT8 A;  2ZE5 A;  4DV3 O;  3E83 A;  1IBM O;  1I94 O;  4BW5 A;  4X1I B;  5ITZ A;  1XI1 A;  1VQ9 V;  1Q81 W;  1P84 F;  4I50 B;  1ARO P;  3ETE A;  5L3B A;  4TV9 A;  3RYH A;  1H2G A;  2E75 B;  3K04 A;  1BS3 A;  3CHX A;  2UUB B;  1WPB A;  2A0L A;  1FJG B;  2DMX A;  5GON B;  5IJ0 A;  5KHJ A;  1GN6 A; 
#chains in the Genus database with same CATH homology
 4IT5 A;  2GUZ B;  3UO3 A;  2N04 A;  2QWR B;  2GUZ A;  2DN9 A;  2CTW A;  4RWU A;  2M6Y A;  1FPO A;  3AG7 A;  2KQX A;  2QWP B;  2YS8 A;  3APQ A;  1NZ6 A;  2Y4T A;  2QWO B;  3APO A;  3UO2 A;  2CUG A;  2CTQ A;  3UCS C;  2N05 A;  2QWQ B;  2Y4U A;  2LO1 A;  1IUR A;  1GH6 A;  2CTP A;  3BVO A;  2L6L A;  1XBL A;  2OCH A;  2YUA A;  2PF4 E;  1N4C A;  1HDJ A;  2QWN B;  1FAF A;  1BQZ A;  2EJ7 A;  1BQ0 A;  2CTR A;  2DMX A;  2LGW A;  4J7Z A;  1WJZ A;  2QSA A;  4J80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...