1Y6XA

The 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
VKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMISRGLSLDDVYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 30
structure length 87
sequence length 87
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1y6xA00
2Q9LA 2P06A 1YVWA 2Q73A 1YXBA 2A3QA 2OIEA 2A7WA 2Q5ZA 2OIGA 2YXHA 1Y6XA 5IE9A 2GTAA 1VMGA 3CRAA 2Q4PA 3CRCA 4QGPA 3C90A
chains in the Genus database with same CATH superfamily
2YXYA 4ZOLA 1ZUQA 5BZBA 3CCRV 3G80A 1MG1A 4JI2B 4JI6O 1SETA 3ZHQA 1GKFA 4J42A 1GTOA 3ASNB 5EIBD 5KLVH 1EFRG 3ML0A 1XOUA 1I94O 3ZRWB 3LNMB 5LYJB 4CH3A 4X1IB 4I9QA 4YIOA 2F1MA 3KKYA 4IGGA 3EXAA 2A9HA 3ZBHA 3ZRVA 3P32A 4DUYO 2DE0X 3JALA 4CS2A 4TUYA 3OW2U 2DJVA 4LNUB 2DW4A 5GONA 2IBZH 3CCVV 1IBLB 3M8AA 2IJJA 5KHGA 2QA4V 2CDYA 1I7FA 3DGEA 1FD9A 3RYFA 2ZE5A 3OAAG 1AILA 1YCIA 2WLIB 4JAUA 1W2BU 2KG7A 4DR2O 1XI1A 2BTQB 4JTDB 1E79G 3ABKB 1XMOB 4C7UA 1SZTA 4MT8A 2YEVA 1Y74A 2ZDIC 5BMVB 1VF7A 4LWSB 4LF7B 2UUBO 1R3LC 4YIPA 1TVKA 3BABA 2EILC 3QO7A 4PI0A 1K4DC 2OIGA 3T4DA 5B1OA 3CEIA 5KHHA 1XHZA 2Y0PA 3SJBC 3UT5A 4FLWA 3AK3A 4UCSA 5LMUB 2A06H 3QO5A 1XL6A 4WF9V 1HNWB 2HFEC 3OEEG 4X1YA 1MABG 5LP6A 2EILB 4IT5A 2PZSA 3X2QC 2IU3A 3BCCH 2XAGA 1FKAO 4LFBO 2JS5A 1RFYA 2YC0A 4CH4A 4GCZA 2X0LA 2ZM6B 1EBOA 4W4KA 4GT1A 4JYAO 1JOYA 3R66A 5CN0A 4DR1O 1KMIZ 1FXHA 1K5SA 2LGQA 3MHHC 1SQPH 3OD4A 3SJQC 1KKCA 4W4LA 4O2BA 2UU9B 3B2EE 3X2QB 1QVGU 4UCRA 1P7GA 1N36B 3ZMSA 1XDCA 3STLC 1AR5A 4DV6B 4RUEA 1F23A 4JYBA 3C3TA 5KA6A 3N27A 3RYCB 4X1KB 2O57A 2AW9A 4O2AB 4DV3O 2ITCC 3W7TA 3SPJA 2YIBD 2HJFC 4LBEC 1NVPB 1BHAA 2IH3C 1NBMG 5J9PC 1MOFA 5LGNA 1ROPA 3HKEA 3VQVA 4X8AA 3M99B 3G67A 2EJ7A 4NR1A 4RUFA 1J95A 1H8HG 1SA0A 5AG2A 1US6A 2HHHB 1NTZH 4B08A 4OPAA 4P30A 4MVOA 2ZD9A 5CB4B 2JK5C 4JI5B 4LF6B 5IY5B 2OT5A 2JJ2G 2BCCH 4JPRA 1AR1B 1VMGA 1AI7A 2PF4E 3A0HZ 1TA8A 1JPXA 2UUCO 1BE3H 5L3CA 3ETQA 4JF3A 3K59A 1GMGA 4I7ZB 4JYCA 3A8TA 3RFRA 3ZCCA 3CCJV 2E75B 4X64B 4NXMO 4UCVA 2XHBA 4JI0B 1RSOA 3JSLA 2ZNJA 5C93A 1Q7YW 2HLDG 1YTFD 5KA5A 4DV0O 2QWRB 1FJGO 5EC2C 3B8MA 4D7SA 5BR8B 1T5EA 4P9PA 3B40A 1L8DA 4GUNA 4FVMA 2RDCA 2HJDA 3OM3B 4H44B 3OT7A 4MW3A 3TETA 4NVPA 4PDVA 1QVFU 2DQ0A 1SS3A 4GKJB 3WU2Z 5HFLA 2QJ1A 4IIJA 1Q86W 3T4ZA 2L6LA 4YJ3A 3W7XA 1FXKB 4U3JA 4FFKA 2WA3A 2BTOA 1G4YB 2YSUB 4BIUA 5TISZ 2WPDG 4F6RB 5JJNB 1H2KA 1AJPA 5L3EA 3T1HO 4XDLA 3JASB 3Q4HA 4QIWF 2UUAO 4X62B 4J9ZB 2K1EA 2ETNA 2ZXWB 4BAYA 4GLXA 4K35A 1N32O 2Q69A 1XNQO 1KU9A 1ZL8A 1VP7A 2ADPA 1Z2GA 1H2NA 2F23A 4GX0A 4PELA 4DV7B 1WA8A 1V55C 1DF5A 3C3SA 5EZYA 5CA0B 5BXZA 1FAFA 4B3RB 4MTXA 2UXCB 4OGQB 5A9GA 3CMAV 1YIJV 1GN3A 1L1FA 1XREA 1NTKH 1Q8IA 1Z5VA 2LP7A 5DECA 3JD2A 1AVMA 3MAQA 5LMNO 2HVJC 4TSFG 2QWNB 4TV9B 3SGIA 4YXWG 5LXTA 1B06A 1QHTA 1W0KG 1SQFA 5FNVB 3TJTA 1M9NA 5EYPB 2YI8A 2AZ2A 4WBNA 3W7SA 3DSQA 3CCMV 1ENVA 2OCCC 2MW2B 1N4CA 1JFFB 4O4JA 2EIKC 4ICGA 2HG5C 4TWKA 2Y69B 3SPIA 4B3MB 2ZQMA 4MVSA 3CXHF 2YIDA 3JAKB 4RQFA 4JYYA 1VQMV 1FXVA 2FKXA 2DYSB 4GX1A 2NNUA 4ZI7B 2EBOA 4EB6A 2IM9A 4JI2O 1BL8A 3B09A 5JQGA 3TXQA 2WAMA 3FB7C 3NXSA 1N8RW 4BIZA 4FLTA 1AI4A 2EX3A 3HKBB 2P06A 4XBFA 2IJHA 4JV5B 5IYZA 3IGAC 1X59A 1IBLO 1V54B 1EN5A 1BZKA 2CTWA 1GH6A 2LJ2A 2DWDC 2KKWA 3H1IH 5H5NA 3CCLV 4B7EA 3T1YB 2JVDA 1OCZC 2XAQA 1SC5B 4NKGB 3FFQA 4ZOLB 1OCOB 2AXTZ 4IYIA 4JI4B 4FLXA 1QLNA 2FMLA 3HPLC 2GTAA 2QWPB 3F5WC 1XMOO 4O4IA 1H2LA 1A32A 2E74B 5B3SC 1JJ2U 3TGUH 3KCXA 4H13B 5H2FZ 4LF7O 3ASOC 1K8AW 1LUVA 1Q6UA 3D3IA 4NTXA 1P7BA 3LDCA 1AJQA 2Q0OC 3ABMC 5CBGA 3JALB 2ZIOA 1I0HA 3WB2A 5B1BC 4K8ZA 4TUYB 4LF9B 2UXNA 5GONB 1JQ0A 2OTLV 1F4NA 1QCEA 2Z5UA 5LMUO 2QEXV 5B3SB 1YF2A 2QM7A 3JD4A 3K08A 1E1QG 4PDMA 1Q6HA 3BPZA 1BSMA 3RYFB 1HNXB 1HNWO 4UVAA 4KHPB 2IH1C 5C8YA 3K0GA 3JYCA 1Q3EA 1WB8A 2QWQB 3EVKA 2YICA 2RQ6A 1XILA 1UPGA 4G27B 2DWEC 4BR6A 5DN6G 3APQA 4JTAB 4IL6Z 2KG7B 2XTAA 3K0DA 4UUJC 1H2GA 3RWRD 2ODMA 3E35A 3M7MX 4FLYA 3ZHUA 3CYOA 1WN7A 2ZM6O 1NR1A 2YIBA 2JJ1G 4YJ2A 3U11A 2VRZA 1VIBA 2JEXA 2YEVB 1BCCH 2EZPA 4MVRA 1Y74B 2WWWA 4BWAA 2B1GA 5LHHA 3A0RA 2UU9O 1IX9A 2Q7GA 1Q5OA 1TVKB 1N36O 5LP6C 1YDXA 1P49A 2WLMA 2ZT9B 5D5PA 2CAZC 4TQFA 4K8XA 4DV6O 1WPBA 5GW7A 2QGNA 2C2AA 1RM1B 2CTRA 3UT5B 2XASA 4H37A 1GM9A 1VF6A 2F66C 2HVKC 4O4LA 5J2UA 3K9SA 1G6UA 4FFBA 3DTUB 1JJOA 4LF4B 1YJWV 3SPHA 1THZA 3JATA 4J41A 4X1YB 2H94A 4DW0A 3ASNC 5LP6B 1AP5A 1R3KC 3N2GA 3OR6C 4HNAA 1UFIA 1IXMA 1K33A 1SQBH 2HHHO 1W0JG 1GAXA 5EBWC 4JI5O 1PV0A 4FMTA 4TQDA 2R9AA 3CPWU 3HKCA 3VQXA 3K06A 3ZMVA 4O2BB 2VWJA 3AG3B 3CCSV 3CMEV 4JAVA 4LFCB 5GTIZ 3OE7G 3ZIAG 3U10A 2QSAA 3G6EV 3K57A 1K34A 4HBNA 2ZE7A 4X64O 3ABKC 2QDOA 4JI0O 3CJHA 3HKEB 2GDSA 3STZC 1EN6A 5BR8O 3GB7C 3ZS8C 1SZXA 3RVYA 1X4TA 3E8BA 2P7TC 1SA0B 4WFBV 4J10A 3FYEB 3LUTB 1Y76A 1DGSA 3ETEA 2N04A 4I50A 4DUZB 4GKJO 2EJRA 3F7YC 2HR3A 2JIZG 4PV1B 2B1IA 4ZBMA 3AK1A 4J9YB 1GN2A 1FFTB 2CGNA 4KFMA 5FL7G 3F7VC 4KXRA 2Y48A 1YITV 2YS8A 1Q43A 4PI2A 5J2TA 1VEWA 1SQVH 4J7KA 5LA6A 5B5EZ 4X62O 3ETGA 1WB7A 4OX9B 1EM1A 3ZEDA 1RSOB 2W0XA 4QE7A 4MSWC 1SQXH 2LQTA 3JCZA 2A3QA 4DR6B 1JVMA 3JAWA 5IT9N 1NT2B 4JI7B 2ATKC 1S5JA 4DV7O 4DV1B 4RQEA 5B1AC 3AK2A 3JSNA 5IYBO 5KHJA 5H6RA 4B3RO 2ZIMA 4WFHA 2UXCO 4X66B 3AG4C 1KD1W 2QR4A 3E8GA 2GUZA 2Q73A 3H1JH 4IIJB 4EFEA 5JJJB 4YJ3B 4TT3G 1NZ6A 4U3JB 1HW7A 3CB2A 4PD4F 4DV2B 3CP1A 1SRYA 1B3QA 3QNEA 4I4TA 1LR1A 5B1AB 2QWOB 1ZWIC 3B8NA 3CCQV 1PD3A 4P9OA 4JI1B 3Q4HB 1ZTEA 3AG4B 3RGBA 5IY5C 3ZRXA 4CC6A 2LFRA 1SF9A 3CRQA 3UO3A 1YI2V 1ZL8B 3WB0A 3CRAA 4UB6Z 4UV8A 1WA8B 4FLZA 4B3MO 5L3GA 5EZYB 1IZ3A 3SJCC 2VQFB 4MVZA 4QPJA 1S3JA 3OEHG 2LW7A 3QVNA 3OMAB 3E8FA 3L9DA 4PDRA 1S72V 2DQ3A 3B77A 2OYQA 4HZ3A 2RMKB 2YXLA 3WG7C 4UV9A 5EIBC 3SYCA 2RCVA 3CRRA 1BQ0A 3K5LA 4WCEV 1M93A 4UXNA 5JVDA 2VQEB 2PI5A 1TUBA 4R50A 4DR7B 2ZNIA 1Q90D 2M6YA 1H2SB 3JCUZ 4LFAB 2CTPA 4JI6B 4JV5O 2DN9A 5LXTB 5KHKA 2DOSA 4JZGA 3OMIB 4UVCA 3I55V 5IE9A 1I94B 2K9PA 4EKWA 3WG7B 2HP8A 1K5QA 2Q4PA 2GSMB 4IHJA 3CRCA 1JR9A 4FK5C 4WBNB 1FS0G 1K92A 3FKSG 2OCHA 4O4JB 1I5XA 4A5UB 1FXKC 2RN9A 3T1YO 1WAZA 3K3WA 1GN4A 4DO2A 1QNMA 1VQ8V 2ZDIA 4JI4O 2YIAA 4EB6B 1HP8A 2KB1A 3MDSA 5JQGB 3RYIA 4EEQA 2ZXWC 3UO2A 2EINC 1W59A 1VQ6V 1FPOA 4KL1A 1D5NA 1N33O 2M7WA 3B4SA 4KP4A 4BW5A 1E1RG 1AJNA 3CE2A 2CH7A 5KUKA 2JS3A 5L3DA 4H0LB 3SR2C 2F95B 4DV5B 4F6EA 5IYZB 1I5YA 4LF9O 1XL4A 3RT3C 1PL4A 1HNZB 2P6JA 1RPRA 4G2KA 2WLNA 3LNNA 3L75H 2EINB 3OFNG 1UJWB 1YJNV 1HNXO 4AI8A 2CK3G 3U0ZA 5ITZA 1URFA 1VQNV 1ZLZA 2UXBB 3L72H 5K1XA 4XDKA 5B66Z 3QO8A 3I56V 3IAYA 4X88A 3G71V 2IW5A 4MTOA 4X20A 1QU7A 4GYCB 1M56C 2LFSA 1Y67A 2QTOA 2H3OA 4XDJA 4LH6A 1PL0A 4O4IB 3QF7A 2R9IA 3OUFA 1AR4A 1GO3F 4GKKB 1VQ5V 5EBMC 3FAVA 4LC1A 1M57B 1O9HA 1G1XB 2Y69C 3H1KH 5K1PA 1BMFG 3J7AU 4JYAB 4I0XA 1M56B 1K97A 1NU1H 1QQCA 1VQLV 3SJAC 3ZHVA 3OR7C 4RO2A 2DYSC 3E2EA 3CRMA 1Y4MA 5EBLC 1NH2D 2E3CA 5B1NA 2A0LA 1P84F 2X6BA 3L73H 3O9OA 4DR3B 4LF4O 3LSUA 5E1AC 1VQPV 5GTHZ 2Y0IA 5C8YB 5IJ0A 1IBMB 3THOA 1WJZA 4P2ZA 2LO1A 2GBOA 1YEWA 1IBKB 4DV3B 2Q0AA 1HDJA 2VS0A 2R72A 2X6CA 2AHZA 3RYHA 4GX5A 2Q9LA 2N74A 1YSCA 2MK3A 4AQYB 2Q67A 4YJ2B 3K5NA 2QKAA 3UQ8A 1V54C 1AI6A 4UCTA 3K5MA 1KBHA 1TGOA 3VQWA 1NKDA 2QM4A 1CEZA 1MA1A 1IVSA 1NQTA 4NXNB 3ZX6A 4DRXA 3EHBB 1RP3B 4FLVA 1K4CC 2Z0AA 1NI8A 1GRJA 4LFCO 4UVBA 1GN6A 1PM9A 5E79Z 3ZMTA 4BW9A 1OCOC 2B9ZA 4UB8Z 1P4RA 2CUGA 3UKMA 4I9WA 4TV8A 4O4LB 2RJZA 1LNQA 5J2UB 5LL6Y 3W7UA 4AHCA 2F43G 2Z3YA 2ZE6A 1V9PA 4FFBB 2UUCB 4QE9A 1XNRB 3ABLC 3JATB 1OCCB 3CS5A 5CBHA 3SDLA 2Q8VA 3N2GB 5L3BA 1R6TA 1IURA 3E8HA 4HNAB 1GK9A 1R1BA 4NB5A 3P30A 2OIEA 1LUWA 3L74H 4AILC 4WFFA 3JD0A 4L87A 4X65B 3CC4V 2GV9A 2NR5A 1VQOV 1NTMH 4DUZO 3HKCB 3MD0A 2W6IG 3ABLB 1KYOF 3SPGA 3OUSA 4NYKA 2EZOA 3IC9A 1PNLA 4QPKA 1M1KW 2OTJV 4D7TA 4N21A 3P3PA 3CCEV 5LGTA 3K58A 5H9CA 4NTWA 3DXRA 4DXWA 3AG1B 1WLEA 1AI5A 3HB3B 2A79B 4OX9O 4U7OA 1VF5B 5IWAB 2BSKA 3CJHB 5FPRA 4K0KB 3RBZA 4DR6O 5FLXN 1RPOA 4JI7O 1VQ7V 3K9AA 4DV1O 4I55A 5BY1A 4DK1A 1BHBA 1RM1C 2Q6AA 1Y76B 2XAFA 4QJFB 3ZHTA 2AHYA 2XUMA 4X66O 1XHXA 4I50B 1K7DA 3BA8A 1NS1A 1YJ9V 4RAIA 3SPCA 4Z2WA 4B3SB 1HR0B 1Y6XA 4DV2O 3AEIA 2HKOA 5JCOA 2WSSG 4DV4B 1XEQA 5DM6V 3GWOA 3BY6A 2QTSA 2N05A 4MVQA 5J2TB 1OCRB 1M5IA 2JGDA 5LA6B 5KHIA 3CX5F 2P67A 5KMGA 4ZHQA 4F4LA 2WLLA 2VWKA 1NVPD 3AG2C 1MZFA 1Q6IA 2Q5ZA 4CH5A 1F7YA 1AB3A 4LR3A 4R7CA 2F93B 3JAWB 1U97A 2ZCEA 1MSDA 3AG3C 3G6BA 3C90A 4J80A 2NN4A 1OV9A 2VQFO 4J7JA 5IYDO 4LF5B 4LF6O 2NLJC 1XUQA 4D6TH 3AG2B 3CCUV 2KSDA 2FL4A 2GUZB 4B3TB 3CWBH 1R73A 2CGOA 3E86A 4PDLA 2VQEO 2EIJC 2FTKA 5JWPA 1Y66A 4DR7O 2UXDB 4I4TB 5FPOA 4R6ZA 3LSQA 4ZKIA 4LFAO 1KC8W 1VQKV 4ABMA 2B5UA 4H33A 3ICXA 2V1DA 4FZ0A 2XAHA 4J11A 2Q68A 1MMMA 3E83A 4DR4B 3KG2A 3JARA 2Q7EA 2EIJB 4JI3B 2F4VB 5LOVA 3ZN1A 1KECA 3T1CA 4CZZA 2EULA 3CC2V 1QLEC 5H6QA 4DW1A 3W7WA 5CA1A 3HR0A 4X9QA 1K3EA 1VQ9V 3VQYA 3BA9A 3OTFA 1SERA 3E22A 1MSWD 3PJSK 3D8CA 2P22C 3BFRA 2PYLA 5JVDB 3UCSC 2PUSA 2X7RB 1TUBB 4JASA 4JI8B 1YXBA 3BHPA 2Y4UA 1BGYH 1QLEB 3AG7A 3ZMUA 2XAJA 3S3XA 3H01A 3HKDA 4DV5O 1S0VA 1EZVH 3JD3A 4PA7A 4JGSA 2E5LB 1HNZO 3UM7A 5IYCO 1CPYA 4DK0A 4LP8A 3LDDA 4FPPA 4IHJB 1FFXA 1SQQH 2UXBO 3LSSA 1KB9F 5JH7A 1DTOA 4LF8B 2YXHA 2XOKG 5KX5A 5LGUA 1N34B 2AGAA 4O4HA 2LGWA 1Q81W 3J80N 1WP8A 1BT8A 1PNMA 3J81N 3RYIB 3D36A 4GKKO 2Q7HA 4CS4A 5KUMA 3N2KA 4UFZA 3ABTA 3RW0A 4Q20A 2CH7B 3FYIB 2WLHA 5EK0A 1IDSA 3VOUA 1SQGA 2P5OA 2IU0A 2JRIA 2ADQB 1I08A 3OTOB 3GVMA 1CXZB 2YUAA 2ZINA 4YY3B 4E2LA 1J5EB 3IJ4A 4DR5B 4DR3O 3S3WA 3ZRWA 4KUMA 5LYJA 4X1IA 5ITZB 2P90A 3QG5A 1BS3A 4G28B 1GM8A 1SKVA 4HYOA 5IDJA 1IBMO 3WB1A 3I5DA 3IFXA 1CP9A 1QR8A 4X20B 4LNUA 1IBKO 1EZJA 3L71H 1L0NH 2WA4A 1MNGA 2BE3A 1D2DA 4AQYO 4LH7A 4YHHB 1XMQB 3O65A 2AZ0A 4MVUA 2FB5A 1OZ0A 3L70H 3G4SV 3FB8C 3PN1A 2WLIA 1QBZA 5EC1C 3FAVB 5A2QN 4NXNO 5CA3A 2XT9A 2BTQA 4U3FH 2L35A 2LW1A 3RN4A 4FM2A 2FYUH 4I0XB 4EFBA 2D3OW 2PI4A 5BMVA 1B6QA 1JMKC 4TOIA 5F2VO 4LWSA 1OJHA 2PY5A 3ABUA 1XNRO 4ZIBA 2JGUA 5IJ0B 1R3JC 4DUYB 3H1LH 3RYHB 4X65O 3FB5C 2H8PC 2YDEA 4HAMA 3T2MA 2CTQA 4OXSA 5KAFZ 2PTMA 3JAMN 4FM1A 1WPXA 5CBFA 3KCYA 1S77D 3KZIZ 3CD6V 4DRXB 3BVOA 4DR2B 1QR9A 4MW8A 2D2CB 2P4KA 1ZX3A 3R65A 1XQ8A 2ZR2A 1PPJH 1S5HC 3P3NA 5CMUA 3D3QA 4TV8B 3CC7V 3FB6C 2UUBB 5IWAO 3OMNB 4Z1VA 4PA6A 1DF4A 4KHPO 2QKSA 4K0KO 1M90W 3H9VA 4IYHA 4Q6GA 1M57C 3K04A 1H8EG 1KQSU 3RYCA 4K3AA 4X1KA 4O2AA 4BIOA 5JJEB 1PNKA 1FYJA 3QTCA 3CSXA 2DYRC 4E4EA 1OHHG 3K79A 4J7ZA 2RNBA 4R8CA 3TCUA 1NR7A 4B3SO 3ZHRA 1HR0O 4GZRB 5KAIZ 4LFBB 3GWKC 5CB4A 4DV4O 3DXRB 4WFAV 1N0JA 4DR1B 3SYPA 3ZRSA 2DYRB 3CXCU 4FM0A 3SYOA 1JX9A 2YI9A 3DC6A 4JAAA 2BSKB 4CH6A 1MZEA 1V55B 1KKDA 1VQ4V 3FX7A 1SESA 2UXXA 4OPHA 2V4DA 1GM7A 5JCOC 4I55B 1DK1A 1BQZA 4L8JA 3A0BZ 4MTGA 5HFMA 1KP3A 4LF5O 1VF6C 1PP9H 4NTYA 1ORQC 3OGIB 4B3TO 1COWG 3MHSC 3IC7A 1IXBA 2R70A 1OCCC 4FIPC 2UXDO 2HEPA 5IJ9B 2ZR3A 1N0NA 2KQXA 2IJIA 4N23A 2JGDB 5KMGB 4ZHQB 2WLLB 3TK1A 2OCCB 4MTFA 2WLKA 4I5SA 2P4VA 2EIKB 1FXKA 4DR4O 2W6JG 4RWUA 4JTCB 2QE7G 3OGCC 2ZKOA 4JI3O 2F4VO 1R6NA 2R9RB 1S76D 2W0FC 4F6RA 5LHIA 3K03A 4JZ2A 1YZBA 1JCHA 3JASA 1WP7A 3BRCA 4CC5A 4NXMB 5LBQA 3AG1C 3VBBA 4DYLA 1L0LH 5DEDA 1PKXA 1NJIW 2WLJA 1ZAUA 2QM8A 2BOCC 2X6AA 4DV0B 1FJGB 4FLUA 1YTFB 2BOBC 3FD9A 3K5OA 4WFEA 3ETDA 2ARHA 4JI8O 1KUQA 1B04A 3APOA 5CA0A 2GHYA 3TXSA 3LDEA 3SYQA 5D5QA 4QNHB 4FZ1A 4LCUC 4QGPA 1DLBA 2E5LO 1D5AA 4PA9A 3ZHSA 1AP6A 4B7KA 3A2FA 1N33B 1OCZB 2OWOA 3JARB 2PGGA 1O9GA 3H1HH 5LOVB 1F51A 3EFFK 4LF8O 1N34O 4TV9A 3T1HB 2Y4TA 2UUAB 4U7NA 5FNVA 3RVZA 5CA1B 3ZN0A 5EYPA 4UCUA 1OCRC 1M4UA 1U96A 1N32B 1ZSPA 2JEUA 3ASOB 2QKCA 5L3FA 2CE4A 3ZMZA 1XNQB 5LHGA 3E22B 1JA8A 2IJKA 1JFFA 4PA4A 2DMXA 3BEHA 4GX2A 3CHXA 3ABMB 3DC5A 4PHZA 3JAKA 2V7QG 5B1BB 4PA3A 1KP2A 4UCOA 1VARA 1H2MA 4WFGA 2GTSA 1YHQV 1F4MA 3BAAA 5IJ9A 1WNSA 2ITDC 4ZI7A 3HKDB 2E76B 3OTOO 4JI1O 4YY3O 1J5EO 2G38A 1YVWA 3E89A 3JD1A 1S5LZ 4DR5O 4X89A 3NR7A 1FFXB 3F5TA 1G8MA 3SYAA 4FJCC 3D36C 1AROP 1R3IC 3HKBA 1Q82W 5LMNB 2ZE8A 5JH7B 2EIMC 1TUEB 5KX5B 4Z1MG 4CBCA 2XNDG 3ZJZA 1TAEA 4O4HB 4ASUG 1Z5WA 1K73W 1K9MW 4PJ0Z 4CS3A 1XBLA 1NH2B 1HWYA 4YHHO 1XMQO 2A7WA 2ILMA 2PYJA 1H38A 4MVMA 2JDIG 1R6KA 3WFVA 3N2KB 1EN4A 2EIMB 4MS2A
chains in the Genus database with same CATH topology
2Q9LA 2P06A 1YVWA 2Q73A 1YXBA 2A3QA 2OIEA 2A7WA 2Q5ZA 2OIGA 2YXHA 1Y6XA 5IE9A 2GTAA 1VMGA 3CRAA 2Q4PA 3CRCA 4QGPA 3C90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9L A;  2P06 A;  1YVW A;  2Q73 A;  1YXB A;  2A3Q A;  2OIE A;  2A7W A;  2Q5Z A;  2OIG A;  2YXH A;  1Y6X A;  5IE9 A;  2GTA A;  1VMG A;  3CRA A;  2Q4P A;  3CRC A;  4QGP A;  3C90 A; 
#chains in the Genus database with same CATH topology
 2YXY A;  4ZOL A;  1ZUQ A;  5BZB A;  3CCR V;  3G80 A;  1MG1 A;  4JI2 B;  4JI6 O;  1SET A;  3ZHQ A;  1GKF A;  4J42 A;  1GTO A;  3ASN B;  5EIB D;  5KLV H;  1EFR G;  3ML0 A;  1XOU A;  1I94 O;  3ZRW B;  3LNM B;  5LYJ B;  4CH3 A;  4X1I B;  4I9Q A;  4YIO A;  2F1M A;  3KKY A;  4IGG A;  3EXA A;  2A9H A;  3ZBH A;  3ZRV A;  3P32 A;  4DUY O;  2DE0 X;  3JAL A;  4CS2 A;  4TUY A;  3OW2 U;  2DJV A;  4LNU B;  2DW4 A;  5GON A;  2IBZ H;  3CCV V;  1IBL B;  3M8A A;  2IJJ A;  5KHG A;  2QA4 V;  2CDY A;  1I7F A;  3DGE A;  1FD9 A;  3RYF A;  2ZE5 A;  3OAA G;  1AIL A;  1YCI A;  2WLI B;  4JAU A;  1W2B U;  2KG7 A;  4DR2 O;  1XI1 A;  2BTQ B;  4JTD B;  1E79 G;  3ABK B;  1XMO B;  4C7U A;  1SZT A;  4MT8 A;  2YEV A;  1Y74 A;  2ZDI C;  5BMV B;  1VF7 A;  4LWS B;  4LF7 B;  2UUB O;  1R3L C;  4YIP A;  1TVK A;  3BAB A;  2EIL C;  3QO7 A;  4PI0 A;  1K4D C;  2OIG A;  3T4D A;  5B1O A;  3CEI A;  5KHH A;  1XHZ A;  2Y0P A;  3SJB C;  3UT5 A;  4FLW A;  3AK3 A;  4UCS A;  5LMU B;  2A06 H;  3QO5 A;  1XL6 A;  4WF9 V;  1HNW B;  2HFE C;  3OEE G;  4X1Y A;  1MAB G;  5LP6 A;  2EIL B;  4IT5 A;  2PZS A;  3X2Q C;  2IU3 A;  3BCC H;  2XAG A;  1FKA O;  4LFB O;  2JS5 A;  1RFY A;  2YC0 A;  4CH4 A;  4GCZ A;  2X0L A;  2ZM6 B;  1EBO A;  4W4K A;  4GT1 A;  4JYA O;  1JOY A;  3R66 A;  5CN0 A;  4DR1 O;  1KMI Z;  1FXH A;  1K5S A;  2LGQ A;  3MHH C;  1SQP H;  3OD4 A;  3SJQ C;  1KKC A;  4W4L A;  4O2B A;  2UU9 B;  3B2E E;  3X2Q B;  1QVG U;  4UCR A;  1P7G A;  1N36 B;  3ZMS A;  1XDC A;  3STL C;  1AR5 A;  4DV6 B;  4RUE A;  1F23 A;  4JYB A;  3C3T A;  5KA6 A;  3N27 A;  3RYC B;  4X1K B;  2O57 A;  2AW9 A;  4O2A B;  4DV3 O;  2ITC C;  3W7T A;  3SPJ A;  2YIB D;  2HJF C;  4LBE C;  1NVP B;  1BHA A;  2IH3 C;  1NBM G;  5J9P C;  1MOF A;  5LGN A;  1ROP A;  3HKE A;  3VQV A;  4X8A A;  3M99 B;  3G67 A;  2EJ7 A;  4NR1 A;  4RUF A;  1J95 A;  1H8H G;  1SA0 A;  5AG2 A;  1US6 A;  2HHH B;  1NTZ H;  4B08 A;  4OPA A;  4P30 A;  4MVO A;  2ZD9 A;  5CB4 B;  2JK5 C;  4JI5 B;  4LF6 B;  5IY5 B;  2OT5 A;  2JJ2 G;  2BCC H;  4JPR A;  1AR1 B;  1VMG A;  1AI7 A;  2PF4 E;  3A0H Z;  1TA8 A;  1JPX A;  2UUC O;  1BE3 H;  5L3C A;  3ETQ A;  4JF3 A;  3K59 A;  1GMG A;  4I7Z B;  4JYC A;  3A8T A;  3RFR A;  3ZCC A;  3CCJ V;  2E75 B;  4X64 B;  4NXM O;  4UCV A;  2XHB A;  4JI0 B;  1RSO A;  3JSL A;  2ZNJ A;  5C93 A;  1Q7Y W;  2HLD G;  1YTF D;  5KA5 A;  4DV0 O;  2QWR B;  1FJG O;  5EC2 C;  3B8M A;  4D7S A;  5BR8 B;  1T5E A;  4P9P A;  3B40 A;  1L8D A;  4GUN A;  4FVM A;  2RDC A;  2HJD A;  3OM3 B;  4H44 B;  3OT7 A;  4MW3 A;  3TET A;  4NVP A;  4PDV A;  1QVF U;  2DQ0 A;  1SS3 A;  4GKJ B;  3WU2 Z;  5HFL A;  2QJ1 A;  4IIJ A;  1Q86 W;  3T4Z A;  2L6L A;  4YJ3 A;  3W7X A;  1FXK B;  4U3J A;  4FFK A;  2WA3 A;  2BTO A;  1G4Y B;  2YSU B;  4BIU A;  5TIS Z;  2WPD G;  4F6R B;  5JJN B;  1H2K A;  1AJP A;  5L3E A;  3T1H O;  4XDL A;  3JAS B;  3Q4H A;  4QIW F;  2UUA O;  4X62 B;  4J9Z B;  2K1E A;  2ETN A;  2ZXW B;  4BAY A;  4GLX A;  4K35 A;  1N32 O;  2Q69 A;  1XNQ O;  1KU9 A;  1ZL8 A;  1VP7 A;  2ADP A;  1Z2G A;  1H2N A;  2F23 A;  4GX0 A;  4PEL A;  4DV7 B;  1WA8 A;  1V55 C;  1DF5 A;  3C3S A;  5EZY A;  5CA0 B;  5BXZ A;  1FAF A;  4B3R B;  4MTX A;  2UXC B;  4OGQ B;  5A9G A;  3CMA V;  1YIJ V;  1GN3 A;  1L1F A;  1XRE A;  1NTK H;  1Q8I A;  1Z5V A;  2LP7 A;  5DEC A;  3JD2 A;  1AVM A;  3MAQ A;  5LMN O;  2HVJ C;  4TSF G;  2QWN B;  4TV9 B;  3SGI A;  4YXW G;  5LXT A;  1B06 A;  1QHT A;  1W0K G;  1SQF A;  5FNV B;  3TJT A;  1M9N A;  5EYP B;  2YI8 A;  2AZ2 A;  4WBN A;  3W7S A;  3DSQ A;  3CCM V;  1ENV A;  2OCC C;  2MW2 B;  1N4C A;  1JFF B;  4O4J A;  2EIK C;  4ICG A;  2HG5 C;  4TWK A;  2Y69 B;  3SPI A;  4B3M B;  2ZQM A;  4MVS A;  3CXH F;  2YID A;  3JAK B;  4RQF A;  4JYY A;  1VQM V;  1FXV A;  2FKX A;  2DYS B;  4GX1 A;  2NNU A;  4ZI7 B;  2EBO A;  4EB6 A;  2IM9 A;  4JI2 O;  1BL8 A;  3B09 A;  5JQG A;  3TXQ A;  2WAM A;  3FB7 C;  3NXS A;  1N8R W;  4BIZ A;  4FLT A;  1AI4 A;  2EX3 A;  3HKB B;  2P06 A;  4XBF A;  2IJH A;  4JV5 B;  5IYZ A;  3IGA C;  1X59 A;  1IBL O;  1V54 B;  1EN5 A;  1BZK A;  2CTW A;  1GH6 A;  2LJ2 A;  2DWD C;  2KKW A;  3H1I H;  5H5N A;  3CCL V;  4B7E A;  3T1Y B;  2JVD A;  1OCZ C;  2XAQ A;  1SC5 B;  4NKG B;  3FFQ A;  4ZOL B;  1OCO B;  2AXT Z;  4IYI A;  4JI4 B;  4FLX A;  1QLN A;  2FML A;  3HPL C;  2GTA A;  2QWP B;  3F5W C;  1XMO O;  4O4I A;  1H2L A;  1A32 A;  2E74 B;  5B3S C;  1JJ2 U;  3TGU H;  3KCX A;  4H13 B;  5H2F Z;  4LF7 O;  3ASO C;  1K8A W;  1LUV A;  1Q6U A;  3D3I A;  4NTX A;  1P7B A;  3LDC A;  1AJQ A;  2Q0O C;  3ABM C;  5CBG A;  3JAL B;  2ZIO A;  1I0H A;  3WB2 A;  5B1B C;  4K8Z A;  4TUY B;  4LF9 B;  2UXN A;  5GON B;  1JQ0 A;  2OTL V;  1F4N A;  1QCE A;  2Z5U A;  5LMU O;  2QEX V;  5B3S B;  1YF2 A;  2QM7 A;  3JD4 A;  3K08 A;  1E1Q G;  4PDM A;  1Q6H A;  3BPZ A;  1BSM A;  3RYF B;  1HNX B;  1HNW O;  4UVA A;  4KHP B;  2IH1 C;  5C8Y A;  3K0G A;  3JYC A;  1Q3E A;  1WB8 A;  2QWQ B;  3EVK A;  2YIC A;  2RQ6 A;  1XIL A;  1UPG A;  4G27 B;  2DWE C;  4BR6 A;  5DN6 G;  3APQ A;  4JTA B;  4IL6 Z;  2KG7 B;  2XTA A;  3K0D A;  4UUJ C;  1H2G A;  3RWR D;  2ODM A;  3E35 A;  3M7M X;  4FLY A;  3ZHU A;  3CYO A;  1WN7 A;  2ZM6 O;  1NR1 A;  2YIB A;  2JJ1 G;  4YJ2 A;  3U11 A;  2VRZ A;  1VIB A;  2JEX A;  2YEV B;  1BCC H;  2EZP A;  4MVR A;  1Y74 B;  2WWW A;  4BWA A;  2B1G A;  5LHH A;  3A0R A;  2UU9 O;  1IX9 A;  2Q7G A;  1Q5O A;  1TVK B;  1N36 O;  5LP6 C;  1YDX A;  1P49 A;  2WLM A;  2ZT9 B;  5D5P A;  2CAZ C;  4TQF A;  4K8X A;  4DV6 O;  1WPB A;  5GW7 A;  2QGN A;  2C2A A;  1RM1 B;  2CTR A;  3UT5 B;  2XAS A;  4H37 A;  1GM9 A;  1VF6 A;  2F66 C;  2HVK C;  4O4L A;  5J2U A;  3K9S A;  1G6U A;  4FFB A;  3DTU B;  1JJO A;  4LF4 B;  1YJW V;  3SPH A;  1THZ A;  3JAT A;  4J41 A;  4X1Y B;  2H94 A;  4DW0 A;  3ASN C;  5LP6 B;  1AP5 A;  1R3K C;  3N2G A;  3OR6 C;  4HNA A;  1UFI A;  1IXM A;  1K33 A;  1SQB H;  2HHH O;  1W0J G;  1GAX A;  5EBW C;  4JI5 O;  1PV0 A;  4FMT A;  4TQD A;  2R9A A;  3CPW U;  3HKC A;  3VQX A;  3K06 A;  3ZMV A;  4O2B B;  2VWJ A;  3AG3 B;  3CCS V;  3CME V;  4JAV A;  4LFC B;  5GTI Z;  3OE7 G;  3ZIA G;  3U10 A;  2QSA A;  3G6E V;  3K57 A;  1K34 A;  4HBN A;  2ZE7 A;  4X64 O;  3ABK C;  2QDO A;  4JI0 O;  3CJH A;  3HKE B;  2GDS A;  3STZ C;  1EN6 A;  5BR8 O;  3GB7 C;  3ZS8 C;  1SZX A;  3RVY A;  1X4T A;  3E8B A;  2P7T C;  1SA0 B;  4WFB V;  4J10 A;  3FYE B;  3LUT B;  1Y76 A;  1DGS A;  3ETE A;  2N04 A;  4I50 A;  4DUZ B;  4GKJ O;  2EJR A;  3F7Y C;  2HR3 A;  2JIZ G;  4PV1 B;  2B1I A;  4ZBM A;  3AK1 A;  4J9Y B;  1GN2 A;  1FFT B;  2CGN A;  4KFM A;  5FL7 G;  3F7V C;  4KXR A;  2Y48 A;  1YIT V;  2YS8 A;  1Q43 A;  4PI2 A;  5J2T A;  1VEW A;  1SQV H;  4J7K A;  5LA6 A;  5B5E Z;  4X62 O;  3ETG A;  1WB7 A;  4OX9 B;  1EM1 A;  3ZED A;  1RSO B;  2W0X A;  4QE7 A;  4MSW C;  1SQX H;  2LQT A;  3JCZ A;  2A3Q A;  4DR6 B;  1JVM A;  3JAW A;  5IT9 N;  1NT2 B;  4JI7 B;  2ATK C;  1S5J A;  4DV7 O;  4DV1 B;  4RQE A;  5B1A C;  3AK2 A;  3JSN A;  5IYB O;  5KHJ A;  5H6R A;  4B3R O;  2ZIM A;  4WFH A;  2UXC O;  4X66 B;  3AG4 C;  1KD1 W;  2QR4 A;  3E8G A;  2GUZ A;  2Q73 A;  3H1J H;  4IIJ B;  4EFE A;  5JJJ B;  4YJ3 B;  4TT3 G;  1NZ6 A;  4U3J B;  1HW7 A;  3CB2 A;  4PD4 F;  4DV2 B;  3CP1 A;  1SRY A;  1B3Q A;  3QNE A;  4I4T A;  1LR1 A;  5B1A B;  2QWO B;  1ZWI C;  3B8N A;  3CCQ V;  1PD3 A;  4P9O A;  4JI1 B;  3Q4H B;  1ZTE A;  3AG4 B;  3RGB A;  5IY5 C;  3ZRX A;  4CC6 A;  2LFR A;  1SF9 A;  3CRQ A;  3UO3 A;  1YI2 V;  1ZL8 B;  3WB0 A;  3CRA A;  4UB6 Z;  4UV8 A;  1WA8 B;  4FLZ A;  4B3M O;  5L3G A;  5EZY B;  1IZ3 A;  3SJC C;  2VQF B;  4MVZ A;  4QPJ A;  1S3J A;  3OEH G;  2LW7 A;  3QVN A;  3OMA B;  3E8F A;  3L9D A;  4PDR A;  1S72 V;  2DQ3 A;  3B77 A;  2OYQ A;  4HZ3 A;  2RMK B;  2YXL A;  3WG7 C;  4UV9 A;  5EIB C;  3SYC A;  2RCV A;  3CRR A;  1BQ0 A;  3K5L A;  4WCE V;  1M93 A;  4UXN A;  5JVD A;  2VQE B;  2PI5 A;  1TUB A;  4R50 A;  4DR7 B;  2ZNI A;  1Q90 D;  2M6Y A;  1H2S B;  3JCU Z;  4LFA B;  2CTP A;  4JI6 B;  4JV5 O;  2DN9 A;  5LXT B;  5KHK A;  2DOS A;  4JZG A;  3OMI B;  4UVC A;  3I55 V;  5IE9 A;  1I94 B;  2K9P A;  4EKW A;  3WG7 B;  2HP8 A;  1K5Q A;  2Q4P A;  2GSM B;  4IHJ A;  3CRC A;  1JR9 A;  4FK5 C;  4WBN B;  1FS0 G;  1K92 A;  3FKS G;  2OCH A;  4O4J B;  1I5X A;  4A5U B;  1FXK C;  2RN9 A;  3T1Y O;  1WAZ A;  3K3W A;  1GN4 A;  4DO2 A;  1QNM A;  1VQ8 V;  2ZDI A;  4JI4 O;  2YIA A;  4EB6 B;  1HP8 A;  2KB1 A;  3MDS A;  5JQG B;  3RYI A;  4EEQ A;  2ZXW C;  3UO2 A;  2EIN C;  1W59 A;  1VQ6 V;  1FPO A;  4KL1 A;  1D5N A;  1N33 O;  2M7W A;  3B4S A;  4KP4 A;  4BW5 A;  1E1R G;  1AJN A;  3CE2 A;  2CH7 A;  5KUK A;  2JS3 A;  5L3D A;  4H0L B;  3SR2 C;  2F95 B;  4DV5 B;  4F6E A;  5IYZ B;  1I5Y A;  4LF9 O;  1XL4 A;  3RT3 C;  1PL4 A;  1HNZ B;  2P6J A;  1RPR A;  4G2K A;  2WLN A;  3LNN A;  3L75 H;  2EIN B;  3OFN G;  1UJW B;  1YJN V;  1HNX O;  4AI8 A;  2CK3 G;  3U0Z A;  5ITZ A;  1URF A;  1VQN V;  1ZLZ A;  2UXB B;  3L72 H;  5K1X A;  4XDK A;  5B66 Z;  3QO8 A;  3I56 V;  3IAY A;  4X88 A;  3G71 V;  2IW5 A;  4MTO A;  4X20 A;  1QU7 A;  4GYC B;  1M56 C;  2LFS A;  1Y67 A;  2QTO A;  2H3O A;  4XDJ A;  4LH6 A;  1PL0 A;  4O4I B;  3QF7 A;  2R9I A;  3OUF A;  1AR4 A;  1GO3 F;  4GKK B;  1VQ5 V;  5EBM C;  3FAV A;  4LC1 A;  1M57 B;  1O9H A;  1G1X B;  2Y69 C;  3H1K H;  5K1P A;  1BMF G;  3J7A U;  4JYA B;  4I0X A;  1M56 B;  1K97 A;  1NU1 H;  1QQC A;  1VQL V;  3SJA C;  3ZHV A;  3OR7 C;  4RO2 A;  2DYS C;  3E2E A;  3CRM A;  1Y4M A;  5EBL C;  1NH2 D;  2E3C A;  5B1N A;  2A0L A;  1P84 F;  2X6B A;  3L73 H;  3O9O A;  4DR3 B;  4LF4 O;  3LSU A;  5E1A C;  1VQP V;  5GTH Z;  2Y0I A;  5C8Y B;  5IJ0 A;  1IBM B;  3THO A;  1WJZ A;  4P2Z A;  2LO1 A;  2GBO A;  1YEW A;  1IBK B;  4DV3 B;  2Q0A A;  1HDJ A;  2VS0 A;  2R72 A;  2X6C A;  2AHZ A;  3RYH A;  4GX5 A;  2Q9L A;  2N74 A;  1YSC A;  2MK3 A;  4AQY B;  2Q67 A;  4YJ2 B;  3K5N A;  2QKA A;  3UQ8 A;  1V54 C;  1AI6 A;  4UCT A;  3K5M A;  1KBH A;  1TGO A;  3VQW A;  1NKD A;  2QM4 A;  1CEZ A;  1MA1 A;  1IVS A;  1NQT A;  4NXN B;  3ZX6 A;  4DRX A;  3EHB B;  1RP3 B;  4FLV A;  1K4C C;  2Z0A A;  1NI8 A;  1GRJ A;  4LFC O;  4UVB A;  1GN6 A;  1PM9 A;  5E79 Z;  3ZMT A;  4BW9 A;  1OCO C;  2B9Z A;  4UB8 Z;  1P4R A;  2CUG A;  3UKM A;  4I9W A;  4TV8 A;  4O4L B;  2RJZ A;  1LNQ A;  5J2U B;  5LL6 Y;  3W7U A;  4AHC A;  2F43 G;  2Z3Y A;  2ZE6 A;  1V9P A;  4FFB B;  2UUC B;  4QE9 A;  1XNR B;  3ABL C;  3JAT B;  1OCC B;  3CS5 A;  5CBH A;  3SDL A;  2Q8V A;  3N2G B;  5L3B A;  1R6T A;  1IUR A;  3E8H A;  4HNA B;  1GK9 A;  1R1B A;  4NB5 A;  3P30 A;  2OIE A;  1LUW A;  3L74 H;  4AIL C;  4WFF A;  3JD0 A;  4L87 A;  4X65 B;  3CC4 V;  2GV9 A;  2NR5 A;  1VQO V;  1NTM H;  4DUZ O;  3HKC B;  3MD0 A;  2W6I G;  3ABL B;  1KYO F;  3SPG A;  3OUS A;  4NYK A;  2EZO A;  3IC9 A;  1PNL A;  4QPK A;  1M1K W;  2OTJ V;  4D7T A;  4N21 A;  3P3P A;  3CCE V;  5LGT A;  3K58 A;  5H9C A;  4NTW A;  3DXR A;  4DXW A;  3AG1 B;  1WLE A;  1AI5 A;  3HB3 B;  2A79 B;  4OX9 O;  4U7O A;  1VF5 B;  5IWA B;  2BSK A;  3CJH B;  5FPR A;  4K0K B;  3RBZ A;  4DR6 O;  5FLX N;  1RPO A;  4JI7 O;  1VQ7 V;  3K9A A;  4DV1 O;  4I55 A;  5BY1 A;  4DK1 A;  1BHB A;  1RM1 C;  2Q6A A;  1Y76 B;  2XAF A;  4QJF B;  3ZHT A;  2AHY A;  2XUM A;  4X66 O;  1XHX A;  4I50 B;  1K7D A;  3BA8 A;  1NS1 A;  1YJ9 V;  4RAI A;  3SPC A;  4Z2W A;  4B3S B;  1HR0 B;  1Y6X A;  4DV2 O;  3AEI A;  2HKO A;  5JCO A;  2WSS G;  4DV4 B;  1XEQ A;  5DM6 V;  3GWO A;  3BY6 A;  2QTS A;  2N05 A;  4MVQ A;  5J2T B;  1OCR B;  1M5I A;  2JGD A;  5LA6 B;  5KHI A;  3CX5 F;  2P67 A;  5KMG A;  4ZHQ A;  4F4L A;  2WLL A;  2VWK A;  1NVP D;  3AG2 C;  1MZF A;  1Q6I A;  2Q5Z A;  4CH5 A;  1F7Y A;  1AB3 A;  4LR3 A;  4R7C A;  2F93 B;  3JAW B;  1U97 A;  2ZCE A;  1MSD A;  3AG3 C;  3G6B A;  3C90 A;  4J80 A;  2NN4 A;  1OV9 A;  2VQF O;  4J7J A;  5IYD O;  4LF5 B;  4LF6 O;  2NLJ C;  1XUQ A;  4D6T H;  3AG2 B;  3CCU V;  2KSD A;  2FL4 A;  2GUZ B;  4B3T B;  3CWB H;  1R73 A;  2CGO A;  3E86 A;  4PDL A;  2VQE O;  2EIJ C;  2FTK A;  5JWP A;  1Y66 A;  4DR7 O;  2UXD B;  4I4T B;  5FPO A;  4R6Z A;  3LSQ A;  4ZKI A;  4LFA O;  1KC8 W;  1VQK V;  4ABM A;  2B5U A;  4H33 A;  3ICX A;  2V1D A;  4FZ0 A;  2XAH A;  4J11 A;  2Q68 A;  1MMM A;  3E83 A;  4DR4 B;  3KG2 A;  3JAR A;  2Q7E A;  2EIJ B;  4JI3 B;  2F4V B;  5LOV A;  3ZN1 A;  1KEC A;  3T1C A;  4CZZ A;  2EUL A;  3CC2 V;  1QLE C;  5H6Q A;  4DW1 A;  3W7W A;  5CA1 A;  3HR0 A;  4X9Q A;  1K3E A;  1VQ9 V;  3VQY A;  3BA9 A;  3OTF A;  1SER A;  3E22 A;  1MSW D;  3PJS K;  3D8C A;  2P22 C;  3BFR A;  2PYL A;  5JVD B;  3UCS C;  2PUS A;  2X7R B;  1TUB B;  4JAS A;  4JI8 B;  1YXB A;  3BHP A;  2Y4U A;  1BGY H;  1QLE B;  3AG7 A;  3ZMU A;  2XAJ A;  3S3X A;  3H01 A;  3HKD A;  4DV5 O;  1S0V A;  1EZV H;  3JD3 A;  4PA7 A;  4JGS A;  2E5L B;  1HNZ O;  3UM7 A;  5IYC O;  1CPY A;  4DK0 A;  4LP8 A;  3LDD A;  4FPP A;  4IHJ B;  1FFX A;  1SQQ H;  2UXB O;  3LSS A;  1KB9 F;  5JH7 A;  1DTO A;  4LF8 B;  2YXH A;  2XOK G;  5KX5 A;  5LGU A;  1N34 B;  2AGA A;  4O4H A;  2LGW A;  1Q81 W;  3J80 N;  1WP8 A;  1BT8 A;  1PNM A;  3J81 N;  3RYI B;  3D36 A;  4GKK O;  2Q7H A;  4CS4 A;  5KUM A;  3N2K A;  4UFZ A;  3ABT A;  3RW0 A;  4Q20 A;  2CH7 B;  3FYI B;  2WLH A;  5EK0 A;  1IDS A;  3VOU A;  1SQG A;  2P5O A;  2IU0 A;  2JRI A;  2ADQ B;  1I08 A;  3OTO B;  3GVM A;  1CXZ B;  2YUA A;  2ZIN A;  4YY3 B;  4E2L A;  1J5E B;  3IJ4 A;  4DR5 B;  4DR3 O;  3S3W A;  3ZRW A;  4KUM A;  5LYJ A;  4X1I A;  5ITZ B;  2P90 A;  3QG5 A;  1BS3 A;  4G28 B;  1GM8 A;  1SKV A;  4HYO A;  5IDJ A;  1IBM O;  3WB1 A;  3I5D A;  3IFX A;  1CP9 A;  1QR8 A;  4X20 B;  4LNU A;  1IBK O;  1EZJ A;  3L71 H;  1L0N H;  2WA4 A;  1MNG A;  2BE3 A;  1D2D A;  4AQY O;  4LH7 A;  4YHH B;  1XMQ B;  3O65 A;  2AZ0 A;  4MVU A;  2FB5 A;  1OZ0 A;  3L70 H;  3G4S V;  3FB8 C;  3PN1 A;  2WLI A;  1QBZ A;  5EC1 C;  3FAV B;  5A2Q N;  4NXN O;  5CA3 A;  2XT9 A;  2BTQ A;  4U3F H;  2L35 A;  2LW1 A;  3RN4 A;  4FM2 A;  2FYU H;  4I0X B;  4EFB A;  2D3O W;  2PI4 A;  5BMV A;  1B6Q A;  1JMK C;  4TOI A;  5F2V O;  4LWS A;  1OJH A;  2PY5 A;  3ABU A;  1XNR O;  4ZIB A;  2JGU A;  5IJ0 B;  1R3J C;  4DUY B;  3H1L H;  3RYH B;  4X65 O;  3FB5 C;  2H8P C;  2YDE A;  4HAM A;  3T2M A;  2CTQ A;  4OXS A;  5KAF Z;  2PTM A;  3JAM N;  4FM1 A;  1WPX A;  5CBF A;  3KCY A;  1S77 D;  3KZI Z;  3CD6 V;  4DRX B;  3BVO A;  4DR2 B;  1QR9 A;  4MW8 A;  2D2C B;  2P4K A;  1ZX3 A;  3R65 A;  1XQ8 A;  2ZR2 A;  1PPJ H;  1S5H C;  3P3N A;  5CMU A;  3D3Q A;  4TV8 B;  3CC7 V;  3FB6 C;  2UUB B;  5IWA O;  3OMN B;  4Z1V A;  4PA6 A;  1DF4 A;  4KHP O;  2QKS A;  4K0K O;  1M90 W;  3H9V A;  4IYH A;  4Q6G A;  1M57 C;  3K04 A;  1H8E G;  1KQS U;  3RYC A;  4K3A A;  4X1K A;  4O2A A;  4BIO A;  5JJE B;  1PNK A;  1FYJ A;  3QTC A;  3CSX A;  2DYR C;  4E4E A;  1OHH G;  3K79 A;  4J7Z A;  2RNB A;  4R8C A;  3TCU A;  1NR7 A;  4B3S O;  3ZHR A;  1HR0 O;  4GZR B;  5KAI Z;  4LFB B;  3GWK C;  5CB4 A;  4DV4 O;  3DXR B;  4WFA V;  1N0J A;  4DR1 B;  3SYP A;  3ZRS A;  2DYR B;  3CXC U;  4FM0 A;  3SYO A;  1JX9 A;  2YI9 A;  3DC6 A;  4JAA A;  2BSK B;  4CH6 A;  1MZE A;  1V55 B;  1KKD A;  1VQ4 V;  3FX7 A;  1SES A;  2UXX A;  4OPH A;  2V4D A;  1GM7 A;  5JCO C;  4I55 B;  1DK1 A;  1BQZ A;  4L8J A;  3A0B Z;  4MTG A;  5HFM A;  1KP3 A;  4LF5 O;  1VF6 C;  1PP9 H;  4NTY A;  1ORQ C;  3OGI B;  4B3T O;  1COW G;  3MHS C;  3IC7 A;  1IXB A;  2R70 A;  1OCC C;  4FIP C;  2UXD O;  2HEP A;  5IJ9 B;  2ZR3 A;  1N0N A;  2KQX A;  2IJI A;  4N23 A;  2JGD B;  5KMG B;  4ZHQ B;  2WLL B;  3TK1 A;  2OCC B;  4MTF A;  2WLK A;  4I5S A;  2P4V A;  2EIK B;  1FXK A;  4DR4 O;  2W6J G;  4RWU A;  4JTC B;  2QE7 G;  3OGC C;  2ZKO A;  4JI3 O;  2F4V O;  1R6N A;  2R9R B;  1S76 D;  2W0F C;  4F6R A;  5LHI A;  3K03 A;  4JZ2 A;  1YZB A;  1JCH A;  3JAS A;  1WP7 A;  3BRC A;  4CC5 A;  4NXM B;  5LBQ A;  3AG1 C;  3VBB A;  4DYL A;  1L0L H;  5DED A;  1PKX A;  1NJI W;  2WLJ A;  1ZAU A;  2QM8 A;  2BOC C;  2X6A A;  4DV0 B;  1FJG B;  4FLU A;  1YTF B;  2BOB C;  3FD9 A;  3K5O A;  4WFE A;  3ETD A;  2ARH A;  4JI8 O;  1KUQ A;  1B04 A;  3APO A;  5CA0 A;  2GHY A;  3TXS A;  3LDE A;  3SYQ A;  5D5Q A;  4QNH B;  4FZ1 A;  4LCU C;  4QGP A;  1DLB A;  2E5L O;  1D5A A;  4PA9 A;  3ZHS A;  1AP6 A;  4B7K A;  3A2F A;  1N33 B;  1OCZ B;  2OWO A;  3JAR B;  2PGG A;  1O9G A;  3H1H H;  5LOV B;  1F51 A;  3EFF K;  4LF8 O;  1N34 O;  4TV9 A;  3T1H B;  2Y4T A;  2UUA B;  4U7N A;  5FNV A;  3RVZ A;  5CA1 B;  3ZN0 A;  5EYP A;  4UCU A;  1OCR C;  1M4U A;  1U96 A;  1N32 B;  1ZSP A;  2JEU A;  3ASO B;  2QKC A;  5L3F A;  2CE4 A;  3ZMZ A;  1XNQ B;  5LHG A;  3E22 B;  1JA8 A;  2IJK A;  1JFF A;  4PA4 A;  2DMX A;  3BEH A;  4GX2 A;  3CHX A;  3ABM B;  3DC5 A;  4PHZ A;  3JAK A;  2V7Q G;  5B1B B;  4PA3 A;  1KP2 A;  4UCO A;  1VAR A;  1H2M A;  4WFG A;  2GTS A;  1YHQ V;  1F4M A;  3BAA A;  5IJ9 A;  1WNS A;  2ITD C;  4ZI7 A;  3HKD B;  2E76 B;  3OTO O;  4JI1 O;  4YY3 O;  1J5E O;  2G38 A;  1YVW A;  3E89 A;  3JD1 A;  1S5L Z;  4DR5 O;  4X89 A;  3NR7 A;  1FFX B;  3F5T A;  1G8M A;  3SYA A;  4FJC C;  3D36 C;  1ARO P;  1R3I C;  3HKB A;  1Q82 W;  5LMN B;  2ZE8 A;  5JH7 B;  2EIM C;  1TUE B;  5KX5 B;  4Z1M G;  4CBC A;  2XND G;  3ZJZ A;  1TAE A;  4O4H B;  4ASU G;  1Z5W A;  1K73 W;  1K9M W;  4PJ0 Z;  4CS3 A;  1XBL A;  1NH2 B;  1HWY A;  4YHH O;  1XMQ O;  2A7W A;  2ILM A;  2PYJ A;  1H38 A;  4MVM A;  2JDI G;  1R6K A;  3WFV A;  3N2K B;  1EN4 A;  2EIM B;  4MS2 A; 
#chains in the Genus database with same CATH homology
 2Q9L A;  2P06 A;  1YVW A;  2Q73 A;  1YXB A;  2A3Q A;  2OIE A;  2A7W A;  2Q5Z A;  2OIG A;  2YXH A;  1Y6X A;  5IE9 A;  2GTA A;  1VMG A;  3CRA A;  2Q4P A;  3CRC A;  4QGP A;  3C90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...