1Y6XA

The 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
87
structure length
87
Chain Sequence
VKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMISRGLSLDDVYRKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphoribosyl-ATP pyrophosphatase
publication title The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 30
structure length 87
sequence length 87
ec nomenclature ec 3.6.1.31: Phosphoribosyl-ATP diphosphatase.
pdb deposition date 2004-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 1y6xA00
2Q4PA 3CRAA 2YXHA 4QGPA 3CRCA 1YVWA 2A3QA 2OIEA 5IE9A 2A7WA 1Y6XA 2Q5ZA 2GTAA 1VMGA 1YXBA 3C90A 2P06A 2Q73A 2Q9LA 2OIGA
chains in the Genus database with same CATH superfamily
1OCZB 3OAAG 1BCCH 2QWNB 4DW0A 4DR7B 4WBNA 3ASNB 2EJRA 1GMGA 2X7RB 3CCRV 1MG1A 1S5HC 2GUZA 5LGUA 2UUCB 2EIKB 4ICGA 2JJ2G 1Q82W 3STLC 3ZMVA 3THOA 4TV8B 4YXWG 5D5QA 5JJJB 2K9PA 3CCVV 1TUBA 5JCOA 1YDXA 2Y48A 4O2AB 4DR5B 4J9ZB 4P9PA 2KQXA 3LSQA 4LFAB 2F4VB 3ABTA 2Q69A 2QM8A 4CBCA 1GRJA 1H2KA 4I55A 1PNKA 1FKAO 5GTIZ 4GKJO 1H2NA 4X64O 3SYQA 2V1DA 4DUZO 5JQGA 2X6BA 3STZC 5EBMC 3H01A 3JSLA 3X2QB 2DYRC 1RPOA 1TVKB 4DV2O 5ITZB 2F95B 1SQXH 1OV9A 1WN7A 2EINB 3DXRA 4LF6B 1VQNV 3I55V 3D3QA 3OUFA 2MW2B 2W6JG 2F66C 3GB7C 1QCEA 3ZIAG 3K0GA 3MHHC 3SJAC 2NLJC 3RYHA 4LF8B 1O9HA 3OUSA 1BE3H 3EXAA 4X9QA 4JI7B 4TOIA 5EIBC 3RYFA 2OIEA 3BHPA 1HR0O 1FXKA 1Q8IA 4UCOA 2L35A 3T1HB 4GX5A 1G8MA 4DK1A 2MK3A 3KCXA 4LF4O 3J81N 3K08A 3Q4HB 1IBLB 2P6JA 5B5EZ 3AK2A 1D5NA 4B3SB 1TUEB 1N32B 3E8BA 2UU9O 3RGBA 4FZ0A 1XL6A 4JI2B 4UCSA 4XDLA 1NKDA 2A7WA 1YITV 4JAAA 1VQ7V 2FB5A 2JS5A 3WB0A 5JJEB 3FYIB 3L74H 4IYIA 3B8NA 5IYZA 4HZ3A 1NT2B 2IJKA 4BIUA 2ATKC 4MTFA 4J10A 4DR4O 2AHZA 4F6EA 1L8DA 4JZGA 2NNUA 1BQZA 1I0HA 2YIDA 5CA0B 1DGSA 4X1KA 1K73W 4OXSA 4JI0B 1VQKV 4WF9V 2EULA 1NBMG 2BSKB 4AQYO 1O9GA 1AB3A 3GWOA 2ZD9A 4LF9O 3CP1A 1M56B 2GTSA 4P2ZA 4DV1B 4X1IA 1BGYH 5B1OA 1IXMA 2ZR2A 3CWBH 4RQEA 1HW7A 1M4UA 1XMOO 1WP7A 4O4JB 1QNMA 4OPHA 3K59A 2ZIMA 3CCLV 1XNRB 5EYPA 4G27B 1F7YA 2XAGA 3CEIA 1YVWA 4TV9A 4O2BB 1PPJH 5IYDO 1XHXA 3MHSC 5LYJA 4B3TB 3CD6V 3JARB 4UCRA 4E4EA 4CZZA 3JD4A 3C90A 4UCUA 3IAYA 2GHYA 3ABMC 4PA9A 1N33B 4DYLA 4NTXA 5IWAB 2A06H 5LHIA 3MAQA 3KZIZ 1NJIW 1V9PA 2CH7B 3ZEDA 1XQ8A 4I5SA 5JVDB 1GN6A 1K4DC 1RPRA 2PGGA 5BMVB 2HVKC 3KKYA 1AJPA 2BTQB 2AHYA 2UXCB 1Q81W 3BRCA 3CXHF 4ZHQB 4J7JA 1M90W 1JVMA 5GONA 5KX5B 2R70A 2EILB 1FD9A 4EKWA 4JI1O 3O9OA 1SQGA 5LHGA 1XMQB 4CC5A 2YC0A 3P30A 2EZOA 1US6A 2VS0A 2CTQA 1AILA 1NVPB 3K5NA 4FM2A 2PUSA 1Q6HA 1H8HG 1AR4A 3W7UA 5KUKA 3IJ4A 4DV5B 4HNAB 4X20B 3TJTA 5KA5A 2E3CA 4K0KO 4FLVA 5EC2C 1RP3B 1YI2V 3CCEV 3TK1A 2AXTZ 4JI8B 4EFBA 2Q68A 4H37A 4LF7O 4LH7A 4JZ2A 2DJVA 2LFSA 2QKAA 1QVGU 5KAIZ 4N21A 1SZXA 1K3EA 2Q7GA 3OTFA 3CCMV 4BW9A 1MZFA 4JI5B 4KP4A 4P9OA 5A2QN 3WG7C 4MW8A 2D2CB 1VQMV 2IU0A 3R65A 2E76B 4D7SA 3RW0A 2WWWA 3QO7A 2UUAO 3UQ8A 4BR6A 4FLXA 2YEVB 2OYQA 1ZWIC 4ZI7A 1ORQC 1J5EB 1NH2B 3CJHA 4TQDA 3CYOA 3H1IH 3SGIA 2IBZH 1WPXA 1G4YB 1H8EG 3FAVA 3E8HA 3WB2A 4DK0A 3K9SA 5KAFZ 3ABLC 3N2KB 3F7YC 3BABA 4H13B 4R8CA 1ZL8B 3RYCB 2Y69C 3ZRSA 5KMGB 3ZN1A 4XBFA 3K5OA 4UV9A 2QE7G 4A5UB 1XOUA 2CGNA 2ILMA 3FB7C 4MSWC 2P5OA 4J7KA 1R6TA 1K92A 1EBOA 1SQQH 3K9AA 4NVPA 5DEDA 1Q3EA 1XREA 1G6UA 4J11A 3ZMUA 3CRQA 3F5TA 3ETDA 3TGUH 4IYHA 1YF2A 3U11A 2JS3A 1THZA 2YICA 1R3LC 1K5SA 1SKVA 4B3RB 1FYJA 2GSMB 5D5PA 4KUMA 2PI5A 4FFBB 4IT5A 2JJ1G 2KSDA 4LFBO 5KHIA 2BE3A 3ABLB 3T1YO 4DXWA 2PYJA 1BS3A 4G2KA 4RUFA 4PA4A 4GX1A 2DYSC 2Q4PA 2Y69B 3ZCCA 2CTRA 2KG7A 1HNXO 1GM8A 4FM0A 3AG2C 1KBHA 1CPYA 4U3JA 2FL4A 4FLWA 2QR4A 4LNUA 1N36B 2K1EA 5IT9N 4ZOLA 2LGWA 1VF7A 4DUYO 3ZRVA 3X2QC 4I9QA 3SYOA 3FD9A 3APOA 2OIGA 4DR1B 3CHXA 1SESA 5LP6C 4UV8A 4JYAO 3ABKB 4X62B 3JAWB 1BMFG 3GVMA 1IBKO 2QEXV 2EX3A 4I7ZB 2WLIB 3RBZA 1SZTA 3B2EE 3JCUZ 3K06A 4I4TA 4JAUA 2Y4TA 1JFFB 4MS2A 1IBMO 3ZHTA 4NXNO 1AP6A 3B4SA 1A32A 2RMKB 3JALB 2EIJB 1PNLA 4JI3B 4GX0A 4CH3A 1CEZA 3AG2B 5CB4A 1NTKH 2D3OW 3K57A 2QWPB 4TSFG 1YXBA 4DRXA 3UCSC 4GYCB 2AW9A 5KUMA 1YTFD 5H6QA 5LA6B 3UT5A 3W7WA 1NZ6A 2LJ2A 2HR3A 1W0JG 1NR1A 2ZKOA 1QQCA 3E86A 2EZPA 3JATA 2ZINA 1F4NA 2UXDB 1HDJA 3K0DA 1CP9A 4DR6B 4DV4B 2HHHB 1JPXA 1PL0A 3W7SA 3P32A 5DM6V 4UVBA 2P7TC 3UM7A 4DV0O 3EFFK 4NXMB 5LXTB 4X65O 2RJZA 2WLNA 3A8TA 3ASNC 1KD1W 2HG5C 4Z1MG 1BSMA 2GDSA 2R9AA 4LWSB 2ZE5A 2YS8A 4PJ0Z 1AR5A 5CN0A 1VQ5V 1XNQO 3CCUV 4QPJA 4AILC 4PD4F 5L3EA 2JIZG 1V54B 3M8AA 3QNEA 1KB9F 3JAWA 2IM9A 3W7TA 4EB6B 1L0NH 1M1KW 2JGDB 2WLKA 4NB5A 1IX9A 1OJHA 4BW5A 3CCJV 5TISZ 3OTOO 4UB6Z 4RAIA 3UKMA 4F6RB 3ZX6A 3QO8A 4IIJA 5IJ9A 4X64B 1L1FA 4DUZB 3CCQV 2W6IG 3HB3B 3LDDA 2XAFA 3CE2A 2DMXA 5LBQA 2B5UA 2E74B 4PDLA 1X4TA 4U3FH 4DV2B 2EINC 3L70H 1D2DA 3OMAB 1QLEB 5LP6A 1I5YA 3MDSA 4O4HA 2NN4A 3ZBHA 4FMTA 1GTOA 1PM9A 5BY1A 2OCCB 3E22A 2IJIA 1B04A 3H1HH 4J80A 3ZRWB 3VQXA 1Z5WA 4I0XA 2XUMA 2ARHA 2DWEC 4R7CA 1XILA 1OCCB 2XAHA 3SR2C 2PI4A 1HR0B 4UXNA 5KHKA 1ROPA 5C8YA 1NVPD 4B08A 3JD1A 2FKXA 1E1RG 4LF4B 5B1BB 2IJHA 2UU9B 2CDYA 1Z5VA 2WLLB 5C93A 4F4LA 1K97A 4JTCB 1MMMA 1WAZA 2JEXA 3VQYA 4FLZA 3UO3A 5KHJA 4L87A 4DV7O 1RSOB 3HKDA 4X1YB 1ZTEA 2JGDA 2XAJA 1M93A 4DV3O 2ZE7A 2F1MA 4MT8A 1W59A 3AK3A 3LSSA 5E79Z 2QTOA 2VRZA 2WLJA 5CA3A 3A2FA 5EBLC 4DR4B 1SQVH 2P06A 2NR5A 2RN9A 2RDCA 1GO3F 5BZBA 2YIBA 1NU1H 1NH2D 4AQYB 1M56C 1UPGA 2JRIA 4TV8A 4LF9B 1MZEA 1TGOA 4FPPA 4QJFB 3N27A 4TT3G 2XASA 4O2AA 2X6AA 1YTFB 1I5XA 4NKGB 1XMOB 4LFCO 4DV6O 2N04A 5B1NA 1S72V 3ZHQA 1XEQA 1P7BA 1I08A 1DTOA 1K8AW 1T5EA 1N4CA 1VIBA 4LP8A 1RM1B 4JYYA 1SQBH 2ZE6A 2QWQB 2EIMB 2VQEO 4I50B 1YIJV 4KHPO 1LUVA 1KKCA 1EN4A 2JEUA 2Q7EA 1NQTA 3HR0A 2F43G 1TVKA 1VQPV 2QKCA 1GN4A 5ITZA 1S77D 1BHAA 5EZYB 2RQ6A 3E89A 4FLUA 1NR7A 2WLMA 3OEEG 3SPGA 4YIOA 3CRMA 3CCSV 3SJCC 2P22C 5HFMA 3OW2U 3H1LH 4U7OA 2DW4A 3N2GB 2QM4A 4MTOA 3B09A 2EILC 4WCEV 2LFRA 1YCIA 3IFXA 3ZMTA 1FXHA 3E8GA 2F23A 4PV1B 4JI1B 1AI6A 3ABUA 3FB8C 4H44B 3ZHRA 3Q4HA 5CA1B 1N34B 2R72A 2OTJV 3ZHVA 2QM7A 2ZDIC 1LR1A 3RVZA 1Q5OA 1TAEA 2GBOA 4LH6A 1ZX3A 1JJ2U 3OT7A 5BXZA 4JPRA 2P4KA 4PDMA 3K5LA 3K79A 3DC6A 3FB5C 3T2MA 1GK9A 4RO2A 2YXHA 2CE4A 4IHJB 1EN5A 2IJJA 1HNWO 3G6EV 4K0KB 4JTDB 4B3MO 4DO2A 1XI1A 3WB1A 1UFIA 5IDJA 5H2FZ 3ETQA 1VMGA 4LF7B 1Y76B 5H5NA 2DQ3A 3IC9A 4X89A 4KFMA 4JV5O 5LGTA 1N34O 1F51A 2Q0AA 5CA0A 1BL8A 3E2EA 2UXXA 2BSKA 1M57B 3H9VA 1K33A 2UUAB 4YJ3B 1VQLV 1SA0B 5L3GA 1VP7A 1J95A 3OM3B 4J42A 4ASUG 4J41A 2UXBO 3JD3A 1SERA 4H33A 4O4JA 4UFZA 1YJNV 3E35A 2H3OA 2M7WA 3M99B 4EFEA 3OGIB 1OZ0A 3D36C 1BT8A 3CC7V 4O2BA 1Q7YW 5IJ0B 1JX9A 1S0VA 3E83A 3FYEB 3B8MA 5EC1C 2CUGA 3JARA 2ITDC 2ZXWC 1SETA 3CC4V 4UVAA 3RWRD 2LGQA 1Y67A 4FZ1A 4YY3O 2XOKG 4MVMA 2FYUH 2V4DA 1Q90D 2CH7A 4BIZA 4JYBA 3RVYA 5JVDA 2XAQA 5LGNA 4O4IB 2PYLA 5BMVA 1VQOV 1N0JA 2DQ0A 3A0RA 2BTQA 3RYIB 3K58A 2WLHA 1R6NA 2BTOA 5JJNB 4ZHQA 3HKBB 5KX5A 3G4SV 4MVRA 4TUYB 2WA3A 2HFEC 1WB7A 5E1AC 1H2LA 4LFBB 3T1YB 2LQTA 3JCZA 2A0LA 4GZRB 1Q6UA 2ZXWB 3BFRA 2ZDIA 1IURA 1HNXB 4GKKO 3HKEB 3UO2A 5BR8O 1QLNA 4BWAA 1Y6XA 1WPBA 2KB1A 2PY5A 4UCTA 1WP8A 3G71V 1KKDA 4HNAA 4X20A 5LMNO 4DUYB 1XL4A 2AZ2A 4AI8A 1PV0A 2ETNA 3ABKC 4PELA 1OCOC 4YJ2B 4K8ZA 1R3JC 1YHQV 4JYAB 3JASB 2QWRB 3SPHA 1IBKB 4PA6A 2Q8VA 2JDIG 4YHHO 3T4ZA 2ZT9B 2EIJC 1YJ9V 1IBMB 3SPIA 1HNZO 4NXNB 1EFRG 1WB8A 2YEVA 2N05A 3CB2A 1YJWV 4DR3O 5H6RA 4TWKA 1COWG 1FFXB 2BCCH 2ZM6O 3ASOC 3ZHUA 2YI8A 5J2UB 5IYCO 4JI4O 4W4LA 1MABG 3U0ZA 1EM1A 3AEIA 2UUBO 1OCOB 5KA6A 5JH7B 2CK3G 5B1AB 3N2KA 1P49A 4TUYA 4WFEA 3D36A 5LOVB 1ZL8A 2PF4E 3RYCA 1WA8B 4K8XA 4FK5C 5KMGA 3MD0A 2KKWA 1XDCA 3TETA 3LNNA 4LR3A 1KUQA 4WFAV 3ZHSA 4DV0B 1KMIZ 5JCOC 4X65B 2JK5C 3W7XA 3IC7A 1DF5A 4IL6Z 2E5LO 1EZVH 1E79G 2YIAA 4D6TH 4QE7A 3TXSA 4J9YB 2R9RB 4FLTA 1XNQB 4UUJC 1KC8W 1V54C 2UXNA 1BHBA 2Q6AA 3ZMSA 1IDSA 3R66A 3ASOB 3M7MX 1Y74B 3CXCU 3J7AU 5K1PA 4JTAB 1S5LZ 4FFBA 4O4LB 1MNGA 4WBNB 4X66O 5L3FA 4ZBMA 2GUZB 2CGOA 1KQSU 3OTOB 3VBBA 4CC6A 1S76D 3IGAC 2DWDC 4FJCC 2VQFB 1HWYA 2ADQB 1EZJA 1TUBB 3SYAA 5B66Z 1Y66A 4CS3A 1FPOA 5A9GA 1Q86W 3EHBB 4G28B 2EBOA 2HKOA 3DGEA 1EN6A 2AGAA 1I7FA 2X0LA 1JOYA 1FXKC 3E8FA 1QLEC 4JI6O 4OX9O 4NYKA 2IU3A 4KXRA 4I55B 5K1XA 3SPJA 1B6QA 1VQ8V 1MSWD 2WAMA 1XHZA 5JQGB 2OCCC 4GX2A 1YSCA 1SS3A 1ZSPA 4JAVA 5FL7G 2XNDG 5IE9A 1N0NA 1WA8A 2WLIA 4LF5O 1AI7A 2AZ0A 1OCCC 3WFVA 1OCRB 1JFFA 5KHHA 3ZRXA 4RWUA 4WFBV 3DXRB 2VQFO 1K9MW 3JALA 3U10A 1I94O 1AJQA 5B1BC 5LMUO 1H2SB 3OEHG 3RYHB 2H8PC 4W4KA 2ITCC 3BA9A 1KP2A 3RYFB 5LA6A 3HKCB 1IXBA 2HLDG 1FXKB 2QA4V 3GWKC 3SJBC 3AG1C 1JCHA 2LP7A 3OGCC 2Q9LA 4O4LA 3SPCA 4DV7B 1K7DA 2YDEA 1SF9A 3H1JH 3EVKA 3PJSK 4KL1A 4DV3B 3ETGA 5F2VO 2B1IA 3AG4B 5LXTA 1KU9A 4GT1A 4JF3A 3JAKB 1X59A 4FFKA 1FJGO 3FFQA 2ZNJA 1Q43A 1AJNA 4LWSA 1GN2A 1U96A 1QBZA 3JAMN 4QGPA 4UB8Z 5IYZB 3P3PA 1BZKA 1PD3A 3TCUA 1QU7A 3QTCA 3LDEA 4B7KA 4DR7O 5EK0A 3AG1B 4EB6A 1GM9A 3L9DA 4X1KB 3CPWU 1AROP 1PNMA 2UUCO 4LFCB 4DV6B 2PTMA 2IH3C 1RM1C 4FLYA 1XUQA 2EIMC 3VQWA 4F6RA 1F4MA 3OR6C 1H38A 4UVCA 3JSNA 2Z5UA 3H1KH 2VQEB 4MVOA 2DN9A 4XDJA 3JD2A 4X1IB 2V7QG 4KHPB 3APQA 4DR5O 2VWJA 4GCZA 1VQ6V 4FM1A 3S3XA 4LFAO 2F4VO 2QJ1A 3HKCA 5EYPB 3L72H 4Q20A 1QVFU 5J2TB 4TV9B 1H2GA 5CBGA 1KP3A 3BEHA 2P67A 5LYJB 3RN4A 4IGGA 1R3KC 3ZRWA 2DYRB 5KHGA 2A79B 2CTPA 2E75B 3KCYA 1D5AA 1SRYA 3B40A 4LF6O 4H0LB 3JAKA 1JMKC 4E2LA 2FTKA 2IW5A 3CSXA 1WJZA 1YEWA 1QHTA 3K3WA 1AR1B 5L3DA 3CMAV 5J9PC 3DC5A 2ZQMA 4LF8O 1G1XB 5FNVB 5KLVH 4JI7O 1LUWA 2QGNA 4NTYA 2FMLA 2OWOA 3RFRA 1M9NA 4WFFA 5CMUA 2OCHA 2WLLA 3T1HO 1VF6C 2RCVA 1R1BA 5GONB 1AI5A 4LBEC 1RSOA 4X1YA 1SQFA 1TA8A 2LW7A 4I9WA 1M5IA 3SYPA 1HNWB 1IBLO 2RNBA 2Q67A 4B3MB 4L8JA 4B3SO 1N32O 1R73A 4UCVA 1DK1A 1H2MA 3D3IA 4JI2O 3ML0A 5IYBO 2O57A 1AVMA 2IH1C 2LO1A 3QVNA 4JV5B 4TQFA 3K5MA 5LL6Y 3ICXA 4CS4A 3QG5A 1M57C 2GV9A 1URFA 1S5JA 3SYCA 4BIOA 2Z3YA 3AG7A 4QPKA 3L75H 5FPRA 4AHCA 3FKSG 3QF7A 4PA3A 5J2TA 2HP8A 1JR9A 3OD4A 3F7VC 5IY5C 2UXBB 2BOCC 4JI0O 2GTAA 4U7NA 2C2AA 2Q73A 2DE0X 1JA8A 2YXLA 2LW1A 2EJ7A 1AP5A 4QIWF 1K5QA 3F5WC 4ZI7B 4I50A 3BAAA 4DV1O 3K04A 4XDKA 3BCCH 3BPZA 3CJHB 4QE9A 2HVJC 5FNVA 2BOBC 1PP9H 3CX5F 5EZYA 1VQ9V 1XNRO 1R6KA 3FAVB 2R9IA 3NR7A 3D8CA 2M6YA 1K4CC 2F93B 4YY3B 1CXZB 4BAYA 3B77A 4MTXA 4B3TO 5AG2A 3ZS8C 4X8AA 1UJWB 2XHBA 2Q0OC 5IY5B 4JYCA 4MVQA 3N2GA 5CBFA 1MOFA 2PZSA 5CBHA 1N33O 1XBLA 3ABMB 2CTWA 1Y4MA 5IWAO 4NR1A 2ODMA 4MVSA 4CH5A 3SDLA 4WFGA 1VEWA 4MW3A 5CA1A 2N74A 1SQPH 1YZBA 4CH4A 2QWOB 2UXCO 3WU2Z 1B3QA 4GKKB 1P84F 1GH6A 5BR8B 1R3IC 3OE7G 4IHJA 1QR9A 2XTAA 2JGUA 1VF6A 5FLXN 2HJFC 1XMQO 2JVDA 1GAXA 5LMNB 1RFYA 1NI8A 5L3CA 2ZCEA 3AG3C 4K35A 5L3BA 1Y76A 4PDRA 3AK1A 2KG7B 1GKFA 4HBNA 1E1QG 3G67A 1B06A 4GUNA 5DECA 4U3JB 4DV5O 4LNUB 4Z2WA 1P4RA 2WPDG 4R6ZA 4ZOLB 3T4DA 1VARA 4RUEA 3K03A 4YHHB 1N8RW 4JI8O 1LNQA 2WSSG 5LHHA 1VQ4V 5DN6G 3T1CA 1K34A 1HP8A 1ZAUA 2YUAA 4YJ3A 3LDCA 1HNZB 3JYCA 4DW1A 4MTGA 4GLXA 5GW7A 1SA0A 3FB6C 1IVSA 4JI5O 4DR3B 1ZLZA 4PHZA 2B1GA 3SJQC 2P4VA 4X88A 3CC2V 2ZM6B 4OPAA 4I4TB 3WG7B 2YIBD 4JASA 2YI9A 2ZE8A 4JI4B 2OT5A 5B1AC 3AG3B 4B7EA 2YSUB 3BY6A 2A9HA 3HPLC 3OMIB 2UUBB 3LSUA 1J5EO 5CB4B 1KYOF 5IJ0A 3QO5A 4N23A 2G38A 1V55C 4DRXB 3OFNG 3OMNB 1F23A 3ETEA 3C3SA 3UT5B 2DOSA 5EBWC 1ZUQA 2W0FC 1JJOA 4Q6GA 2ZIOA 3JATB 2E5LB 5B3SC 1PKXA 1W0KG 2XT9A 4CH6A 1NTMH 2X6CA 1BQ0A 2OTLV 4O4IA 5H9CA 1QR8A 1DLBA 1FS0G 3RYIA 4FVMA 3BVOA 4PA7A 3CRCA 3PN1A 1ENVA 1AI4A 4YIPA 3HKBA 1W2BU 1Z2GA 4LCUC 1OHHG 2VWKA 4ZKIA 1WNSA 4X66B 4J7ZA 2Y0IA 2WA4A 1SC5B 1V55B 2HEPA 3VQVA 3BA8A 4B3RO 4RQFA 3HKEA 4PI0A 1U97A 3P3NA 3ZJZA 2B9ZA 1MA1A 2ZNIA 5B3SB 4PDVA 3RT3C 4JI6B 4OX9B 2Q7HA 3I5DA 5JWPA 3LUTB 4DR2B 1L0LH 4YJ2A 2Z0AA 4PI2A 1GM7A 2DYSB 2Y4UA 3JASA 4JGSA 4IIJB 5IJ9B 1N36O 4K3AA 3OR7C 2QDOA 2HJDA 1OCRC 2CAZC 1IZ3A 2Q5ZA 4LF5B 3CS5A 3FX7A 4DR1O 3J80N 3O65A 5LP6B 4X62O 3CRAA 1MSDA 2W0XA 1I94B 2A3QA 4O4HB 4C7UA 4LC1A 5EIBD 4P30A 5LMUB 3L73H 3E22B 1FFXA 3L71H 3G6BA 4ABMA 1VF5B 2L6LA 1P7GA 4I0XB 1NTZH 4D7TA 3LNMB 1FXVA 4MVUA 4DR2O 5J2UA 4NTWA 1OCZC 3S3WA 4Z1VA 3CMEV 2P90A 4JI3O 3I56V 5C8YB 3G80A 5JH7A 1JQ0A 4FIPC 5LOVA 2ADPA 2YXYA 4QNHB 2EIKC 4HAMA 1S3JA 3AG4C 2H94A 2QSAA 1PL4A 4CS2A 5HFLA 1GN3A 3ZN0A 5GTHZ 3NXSA 4HYOA 5FPOA 4EEQA 3DTUB 3DSQA 1FJGB 3HKDB 3TXQA 1Q6IA 2UXDO 2QTSA 2ZR3A 3JD0A 3KG2A 1WLEA 4DR6O 4DV4O 2HHHO 3VOUA 3A0HZ 4OGQB 4WFHA 1DF4A 1FAFA 1FFTB 4R50A 3A0BZ 4NXMO 3CRRA 2Y0PA 1KECA 3C3TA 3ZMZA 4ZIBA 1Y74A 4MVZA 1NS1A 4GKJB 2QKSA
chains in the Genus database with same CATH topology
2Q4PA 3CRAA 2YXHA 4QGPA 3CRCA 1YVWA 2A3QA 2OIEA 5IE9A 2A7WA 1Y6XA 2Q5ZA 2GTAA 1VMGA 1YXBA 3C90A 2P06A 2Q73A 2Q9LA 2OIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4P A;  3CRA A;  2YXH A;  4QGP A;  3CRC A;  1YVW A;  2A3Q A;  2OIE A;  5IE9 A;  2A7W A;  1Y6X A;  2Q5Z A;  2GTA A;  1VMG A;  1YXB A;  3C90 A;  2P06 A;  2Q73 A;  2Q9L A;  2OIG A; 
#chains in the Genus database with same CATH topology
 1OCZ B;  3OAA G;  1BCC H;  2QWN B;  4DW0 A;  4DR7 B;  4WBN A;  3ASN B;  2EJR A;  1GMG A;  2X7R B;  3CCR V;  1MG1 A;  1S5H C;  2GUZ A;  5LGU A;  2UUC B;  2EIK B;  4ICG A;  2JJ2 G;  1Q82 W;  3STL C;  3ZMV A;  3THO A;  4TV8 B;  4YXW G;  5D5Q A;  5JJJ B;  2K9P A;  3CCV V;  1TUB A;  5JCO A;  1YDX A;  2Y48 A;  4O2A B;  4DR5 B;  4J9Z B;  4P9P A;  2KQX A;  3LSQ A;  4LFA B;  2F4V B;  3ABT A;  2Q69 A;  2QM8 A;  4CBC A;  1GRJ A;  1H2K A;  4I55 A;  1PNK A;  1FKA O;  5GTI Z;  4GKJ O;  1H2N A;  4X64 O;  3SYQ A;  2V1D A;  4DUZ O;  5JQG A;  2X6B A;  3STZ C;  5EBM C;  3H01 A;  3JSL A;  3X2Q B;  2DYR C;  1RPO A;  1TVK B;  4DV2 O;  5ITZ B;  2F95 B;  1SQX H;  1OV9 A;  1WN7 A;  2EIN B;  3DXR A;  4LF6 B;  1VQN V;  3I55 V;  3D3Q A;  3OUF A;  2MW2 B;  2W6J G;  2F66 C;  3GB7 C;  1QCE A;  3ZIA G;  3K0G A;  3MHH C;  3SJA C;  2NLJ C;  3RYH A;  4LF8 B;  1O9H A;  3OUS A;  1BE3 H;  3EXA A;  4X9Q A;  4JI7 B;  4TOI A;  5EIB C;  3RYF A;  2OIE A;  3BHP A;  1HR0 O;  1FXK A;  1Q8I A;  4UCO A;  2L35 A;  3T1H B;  4GX5 A;  1G8M A;  4DK1 A;  2MK3 A;  3KCX A;  4LF4 O;  3J81 N;  3K08 A;  3Q4H B;  1IBL B;  2P6J A;  5B5E Z;  3AK2 A;  1D5N A;  4B3S B;  1TUE B;  1N32 B;  3E8B A;  2UU9 O;  3RGB A;  4FZ0 A;  1XL6 A;  4JI2 B;  4UCS A;  4XDL A;  1NKD A;  2A7W A;  1YIT V;  4JAA A;  1VQ7 V;  2FB5 A;  2JS5 A;  3WB0 A;  5JJE B;  3FYI B;  3L74 H;  4IYI A;  3B8N A;  5IYZ A;  4HZ3 A;  1NT2 B;  2IJK A;  4BIU A;  2ATK C;  4MTF A;  4J10 A;  4DR4 O;  2AHZ A;  4F6E A;  1L8D A;  4JZG A;  2NNU A;  1BQZ A;  1I0H A;  2YID A;  5CA0 B;  1DGS A;  4X1K A;  1K73 W;  4OXS A;  4JI0 B;  1VQK V;  4WF9 V;  2EUL A;  1NBM G;  2BSK B;  4AQY O;  1O9G A;  1AB3 A;  3GWO A;  2ZD9 A;  4LF9 O;  3CP1 A;  1M56 B;  2GTS A;  4P2Z A;  4DV1 B;  4X1I A;  1BGY H;  5B1O A;  1IXM A;  2ZR2 A;  3CWB H;  4RQE A;  1HW7 A;  1M4U A;  1XMO O;  1WP7 A;  4O4J B;  1QNM A;  4OPH A;  3K59 A;  2ZIM A;  3CCL V;  1XNR B;  5EYP A;  4G27 B;  1F7Y A;  2XAG A;  3CEI A;  1YVW A;  4TV9 A;  4O2B B;  1PPJ H;  5IYD O;  1XHX A;  3MHS C;  5LYJ A;  4B3T B;  3CD6 V;  3JAR B;  4UCR A;  4E4E A;  4CZZ A;  3JD4 A;  3C90 A;  4UCU A;  3IAY A;  2GHY A;  3ABM C;  4PA9 A;  1N33 B;  4DYL A;  4NTX A;  5IWA B;  2A06 H;  5LHI A;  3MAQ A;  3KZI Z;  1NJI W;  1V9P A;  2CH7 B;  3ZED A;  1XQ8 A;  4I5S A;  5JVD B;  1GN6 A;  1K4D C;  1RPR A;  2PGG A;  5BMV B;  2HVK C;  3KKY A;  1AJP A;  2BTQ B;  2AHY A;  2UXC B;  1Q81 W;  3BRC A;  3CXH F;  4ZHQ B;  4J7J A;  1M90 W;  1JVM A;  5GON A;  5KX5 B;  2R70 A;  2EIL B;  1FD9 A;  4EKW A;  4JI1 O;  3O9O A;  1SQG A;  5LHG A;  1XMQ B;  4CC5 A;  2YC0 A;  3P30 A;  2EZO A;  1US6 A;  2VS0 A;  2CTQ A;  1AIL A;  1NVP B;  3K5N A;  4FM2 A;  2PUS A;  1Q6H A;  1H8H G;  1AR4 A;  3W7U A;  5KUK A;  3IJ4 A;  4DV5 B;  4HNA B;  4X20 B;  3TJT A;  5KA5 A;  2E3C A;  4K0K O;  4FLV A;  5EC2 C;  1RP3 B;  1YI2 V;  3CCE V;  3TK1 A;  2AXT Z;  4JI8 B;  4EFB A;  2Q68 A;  4H37 A;  4LF7 O;  4LH7 A;  4JZ2 A;  2DJV A;  2LFS A;  2QKA A;  1QVG U;  5KAI Z;  4N21 A;  1SZX A;  1K3E A;  2Q7G A;  3OTF A;  3CCM V;  4BW9 A;  1MZF A;  4JI5 B;  4KP4 A;  4P9O A;  5A2Q N;  3WG7 C;  4MW8 A;  2D2C B;  1VQM V;  2IU0 A;  3R65 A;  2E76 B;  4D7S A;  3RW0 A;  2WWW A;  3QO7 A;  2UUA O;  3UQ8 A;  4BR6 A;  4FLX A;  2YEV B;  2OYQ A;  1ZWI C;  4ZI7 A;  1ORQ C;  1J5E B;  1NH2 B;  3CJH A;  4TQD A;  3CYO A;  3H1I H;  3SGI A;  2IBZ H;  1WPX A;  1G4Y B;  1H8E G;  3FAV A;  3E8H A;  3WB2 A;  4DK0 A;  3K9S A;  5KAF Z;  3ABL C;  3N2K B;  3F7Y C;  3BAB A;  4H13 B;  4R8C A;  1ZL8 B;  3RYC B;  2Y69 C;  3ZRS A;  5KMG B;  3ZN1 A;  4XBF A;  3K5O A;  4UV9 A;  2QE7 G;  4A5U B;  1XOU A;  2CGN A;  2ILM A;  3FB7 C;  4MSW C;  2P5O A;  4J7K A;  1R6T A;  1K92 A;  1EBO A;  1SQQ H;  3K9A A;  4NVP A;  5DED A;  1Q3E A;  1XRE A;  1G6U A;  4J11 A;  3ZMU A;  3CRQ A;  3F5T A;  3ETD A;  3TGU H;  4IYH A;  1YF2 A;  3U11 A;  2JS3 A;  1THZ A;  2YIC A;  1R3L C;  1K5S A;  1SKV A;  4B3R B;  1FYJ A;  2GSM B;  5D5P A;  4KUM A;  2PI5 A;  4FFB B;  4IT5 A;  2JJ1 G;  2KSD A;  4LFB O;  5KHI A;  2BE3 A;  3ABL B;  3T1Y O;  4DXW A;  2PYJ A;  1BS3 A;  4G2K A;  4RUF A;  4PA4 A;  4GX1 A;  2DYS C;  2Q4P A;  2Y69 B;  3ZCC A;  2CTR A;  2KG7 A;  1HNX O;  1GM8 A;  4FM0 A;  3AG2 C;  1KBH A;  1CPY A;  4U3J A;  2FL4 A;  4FLW A;  2QR4 A;  4LNU A;  1N36 B;  2K1E A;  5IT9 N;  4ZOL A;  2LGW A;  1VF7 A;  4DUY O;  3ZRV A;  3X2Q C;  4I9Q A;  3SYO A;  3FD9 A;  3APO A;  2OIG A;  4DR1 B;  3CHX A;  1SES A;  5LP6 C;  4UV8 A;  4JYA O;  3ABK B;  4X62 B;  3JAW B;  1BMF G;  3GVM A;  1IBK O;  2QEX V;  2EX3 A;  4I7Z B;  2WLI B;  3RBZ A;  1SZT A;  3B2E E;  3JCU Z;  3K06 A;  4I4T A;  4JAU A;  2Y4T A;  1JFF B;  4MS2 A;  1IBM O;  3ZHT A;  4NXN O;  1AP6 A;  3B4S A;  1A32 A;  2RMK B;  3JAL B;  2EIJ B;  1PNL A;  4JI3 B;  4GX0 A;  4CH3 A;  1CEZ A;  3AG2 B;  5CB4 A;  1NTK H;  2D3O W;  3K57 A;  2QWP B;  4TSF G;  1YXB A;  4DRX A;  3UCS C;  4GYC B;  2AW9 A;  5KUM A;  1YTF D;  5H6Q A;  5LA6 B;  3UT5 A;  3W7W A;  1NZ6 A;  2LJ2 A;  2HR3 A;  1W0J G;  1NR1 A;  2ZKO A;  1QQC A;  3E86 A;  2EZP A;  3JAT A;  2ZIN A;  1F4N A;  2UXD B;  1HDJ A;  3K0D A;  1CP9 A;  4DR6 B;  4DV4 B;  2HHH B;  1JPX A;  1PL0 A;  3W7S A;  3P32 A;  5DM6 V;  4UVB A;  2P7T C;  3UM7 A;  4DV0 O;  3EFF K;  4NXM B;  5LXT B;  4X65 O;  2RJZ A;  2WLN A;  3A8T A;  3ASN C;  1KD1 W;  2HG5 C;  4Z1M G;  1BSM A;  2GDS A;  2R9A A;  4LWS B;  2ZE5 A;  2YS8 A;  4PJ0 Z;  1AR5 A;  5CN0 A;  1VQ5 V;  1XNQ O;  3CCU V;  4QPJ A;  4AIL C;  4PD4 F;  5L3E A;  2JIZ G;  1V54 B;  3M8A A;  3QNE A;  1KB9 F;  3JAW A;  2IM9 A;  3W7T A;  4EB6 B;  1L0N H;  1M1K W;  2JGD B;  2WLK A;  4NB5 A;  1IX9 A;  1OJH A;  4BW5 A;  3CCJ V;  5TIS Z;  3OTO O;  4UB6 Z;  4RAI A;  3UKM A;  4F6R B;  3ZX6 A;  3QO8 A;  4IIJ A;  5IJ9 A;  4X64 B;  1L1F A;  4DUZ B;  3CCQ V;  2W6I G;  3HB3 B;  3LDD A;  2XAF A;  3CE2 A;  2DMX A;  5LBQ A;  2B5U A;  2E74 B;  4PDL A;  1X4T A;  4U3F H;  4DV2 B;  2EIN C;  3L70 H;  1D2D A;  3OMA B;  1QLE B;  5LP6 A;  1I5Y A;  3MDS A;  4O4H A;  2NN4 A;  3ZBH A;  4FMT A;  1GTO A;  1PM9 A;  5BY1 A;  2OCC B;  3E22 A;  2IJI A;  1B04 A;  3H1H H;  4J80 A;  3ZRW B;  3VQX A;  1Z5W A;  4I0X A;  2XUM A;  2ARH A;  2DWE C;  4R7C A;  1XIL A;  1OCC B;  2XAH A;  3SR2 C;  2PI4 A;  1HR0 B;  4UXN A;  5KHK A;  1ROP A;  5C8Y A;  1NVP D;  4B08 A;  3JD1 A;  2FKX A;  1E1R G;  4LF4 B;  5B1B B;  2IJH A;  2UU9 B;  2CDY A;  1Z5V A;  2WLL B;  5C93 A;  4F4L A;  1K97 A;  4JTC B;  1MMM A;  1WAZ A;  2JEX A;  3VQY A;  4FLZ A;  3UO3 A;  5KHJ A;  4L87 A;  4DV7 O;  1RSO B;  3HKD A;  4X1Y B;  1ZTE A;  2JGD A;  2XAJ A;  1M93 A;  4DV3 O;  2ZE7 A;  2F1M A;  4MT8 A;  1W59 A;  3AK3 A;  3LSS A;  5E79 Z;  2QTO A;  2VRZ A;  2WLJ A;  5CA3 A;  3A2F A;  5EBL C;  4DR4 B;  1SQV H;  2P06 A;  2NR5 A;  2RN9 A;  2RDC A;  1GO3 F;  5BZB A;  2YIB A;  1NU1 H;  1NH2 D;  4AQY B;  1M56 C;  1UPG A;  2JRI A;  4TV8 A;  4LF9 B;  1MZE A;  1TGO A;  4FPP A;  4QJF B;  3N27 A;  4TT3 G;  2XAS A;  4O2A A;  2X6A A;  1YTF B;  1I5X A;  4NKG B;  1XMO B;  4LFC O;  4DV6 O;  2N04 A;  5B1N A;  1S72 V;  3ZHQ A;  1XEQ A;  1P7B A;  1I08 A;  1DTO A;  1K8A W;  1T5E A;  1N4C A;  1VIB A;  4LP8 A;  1RM1 B;  4JYY A;  1SQB H;  2ZE6 A;  2QWQ B;  2EIM B;  2VQE O;  4I50 B;  1YIJ V;  4KHP O;  1LUV A;  1KKC A;  1EN4 A;  2JEU A;  2Q7E A;  1NQT A;  3HR0 A;  2F43 G;  1TVK A;  1VQP V;  2QKC A;  1GN4 A;  5ITZ A;  1S77 D;  1BHA A;  5EZY B;  2RQ6 A;  3E89 A;  4FLU A;  1NR7 A;  2WLM A;  3OEE G;  3SPG A;  4YIO A;  3CRM A;  3CCS V;  3SJC C;  2P22 C;  5HFM A;  3OW2 U;  3H1L H;  4U7O A;  2DW4 A;  3N2G B;  2QM4 A;  4MTO A;  3B09 A;  2EIL C;  4WCE V;  2LFR A;  1YCI A;  3IFX A;  3ZMT A;  1FXH A;  3E8G A;  2F23 A;  4PV1 B;  4JI1 B;  1AI6 A;  3ABU A;  3FB8 C;  4H44 B;  3ZHR A;  3Q4H A;  5CA1 B;  1N34 B;  2R72 A;  2OTJ V;  3ZHV A;  2QM7 A;  2ZDI C;  1LR1 A;  3RVZ A;  1Q5O A;  1TAE A;  2GBO A;  4LH6 A;  1ZX3 A;  1JJ2 U;  3OT7 A;  5BXZ A;  4JPR A;  2P4K A;  4PDM A;  3K5L A;  3K79 A;  3DC6 A;  3FB5 C;  3T2M A;  1GK9 A;  4RO2 A;  2YXH A;  2CE4 A;  4IHJ B;  1EN5 A;  2IJJ A;  1HNW O;  3G6E V;  4K0K B;  4JTD B;  4B3M O;  4DO2 A;  1XI1 A;  3WB1 A;  1UFI A;  5IDJ A;  5H2F Z;  3ETQ A;  1VMG A;  4LF7 B;  1Y76 B;  5H5N A;  2DQ3 A;  3IC9 A;  4X89 A;  4KFM A;  4JV5 O;  5LGT A;  1N34 O;  1F51 A;  2Q0A A;  5CA0 A;  1BL8 A;  3E2E A;  2UXX A;  2BSK A;  1M57 B;  3H9V A;  1K33 A;  2UUA B;  4YJ3 B;  1VQL V;  1SA0 B;  5L3G A;  1VP7 A;  1J95 A;  3OM3 B;  4J42 A;  4ASU G;  4J41 A;  2UXB O;  3JD3 A;  1SER A;  4H33 A;  4O4J A;  4UFZ A;  1YJN V;  3E35 A;  2H3O A;  2M7W A;  3M99 B;  4EFE A;  3OGI B;  1OZ0 A;  3D36 C;  1BT8 A;  3CC7 V;  4O2B A;  1Q7Y W;  5IJ0 B;  1JX9 A;  1S0V A;  3E83 A;  3FYE B;  3B8M A;  5EC1 C;  2CUG A;  3JAR A;  2ITD C;  2ZXW C;  1SET A;  3CC4 V;  4UVA A;  3RWR D;  2LGQ A;  1Y67 A;  4FZ1 A;  4YY3 O;  2XOK G;  4MVM A;  2FYU H;  2V4D A;  1Q90 D;  2CH7 A;  4BIZ A;  4JYB A;  3RVY A;  5JVD A;  2XAQ A;  5LGN A;  4O4I B;  2PYL A;  5BMV A;  1VQO V;  1N0J A;  2DQ0 A;  3A0R A;  2BTQ A;  3RYI B;  3K58 A;  2WLH A;  1R6N A;  2BTO A;  5JJN B;  4ZHQ A;  3HKB B;  5KX5 A;  3G4S V;  4MVR A;  4TUY B;  2WA3 A;  2HFE C;  1WB7 A;  5E1A C;  1H2L A;  4LFB B;  3T1Y B;  2LQT A;  3JCZ A;  2A0L A;  4GZR B;  1Q6U A;  2ZXW B;  3BFR A;  2ZDI A;  1IUR A;  1HNX B;  4GKK O;  3HKE B;  3UO2 A;  5BR8 O;  1QLN A;  4BWA A;  1Y6X A;  1WPB A;  2KB1 A;  2PY5 A;  4UCT A;  1WP8 A;  3G71 V;  1KKD A;  4HNA A;  4X20 A;  5LMN O;  4DUY B;  1XL4 A;  2AZ2 A;  4AI8 A;  1PV0 A;  2ETN A;  3ABK C;  4PEL A;  1OCO C;  4YJ2 B;  4K8Z A;  1R3J C;  1YHQ V;  4JYA B;  3JAS B;  2QWR B;  3SPH A;  1IBK B;  4PA6 A;  2Q8V A;  2JDI G;  4YHH O;  3T4Z A;  2ZT9 B;  2EIJ C;  1YJ9 V;  1IBM B;  3SPI A;  1HNZ O;  4NXN B;  1EFR G;  1WB8 A;  2YEV A;  2N05 A;  3CB2 A;  1YJW V;  4DR3 O;  5H6R A;  4TWK A;  1COW G;  1FFX B;  2BCC H;  2ZM6 O;  3ASO C;  3ZHU A;  2YI8 A;  5J2U B;  5IYC O;  4JI4 O;  4W4L A;  1MAB G;  3U0Z A;  1EM1 A;  3AEI A;  2UUB O;  1OCO B;  5KA6 A;  5JH7 B;  2CK3 G;  5B1A B;  3N2K A;  1P49 A;  4TUY A;  4WFE A;  3D36 A;  5LOV B;  1ZL8 A;  2PF4 E;  3RYC A;  1WA8 B;  4K8X A;  4FK5 C;  5KMG A;  3MD0 A;  2KKW A;  1XDC A;  3TET A;  3LNN A;  4LR3 A;  1KUQ A;  4WFA V;  3ZHS A;  4DV0 B;  1KMI Z;  5JCO C;  4X65 B;  2JK5 C;  3W7X A;  3IC7 A;  1DF5 A;  4IL6 Z;  2E5L O;  1EZV H;  1E79 G;  2YIA A;  4D6T H;  4QE7 A;  3TXS A;  4J9Y B;  2R9R B;  4FLT A;  1XNQ B;  4UUJ C;  1KC8 W;  1V54 C;  2UXN A;  1BHB A;  2Q6A A;  3ZMS A;  1IDS A;  3R66 A;  3ASO B;  3M7M X;  1Y74 B;  3CXC U;  3J7A U;  5K1P A;  4JTA B;  1S5L Z;  4FFB A;  4O4L B;  1MNG A;  4WBN B;  4X66 O;  5L3F A;  4ZBM A;  2GUZ B;  2CGO A;  1KQS U;  3OTO B;  3VBB A;  4CC6 A;  1S76 D;  3IGA C;  2DWD C;  4FJC C;  2VQF B;  1HWY A;  2ADQ B;  1EZJ A;  1TUB B;  3SYA A;  5B66 Z;  1Y66 A;  4CS3 A;  1FPO A;  5A9G A;  1Q86 W;  3EHB B;  4G28 B;  2EBO A;  2HKO A;  3DGE A;  1EN6 A;  2AGA A;  1I7F A;  2X0L A;  1JOY A;  1FXK C;  3E8F A;  1QLE C;  4JI6 O;  4OX9 O;  4NYK A;  2IU3 A;  4KXR A;  4I55 B;  5K1X A;  3SPJ A;  1B6Q A;  1VQ8 V;  1MSW D;  2WAM A;  1XHZ A;  5JQG B;  2OCC C;  4GX2 A;  1YSC A;  1SS3 A;  1ZSP A;  4JAV A;  5FL7 G;  2XND G;  5IE9 A;  1N0N A;  1WA8 A;  2WLI A;  4LF5 O;  1AI7 A;  2AZ0 A;  1OCC C;  3WFV A;  1OCR B;  1JFF A;  5KHH A;  3ZRX A;  4RWU A;  4WFB V;  3DXR B;  2VQF O;  1K9M W;  3JAL A;  3U10 A;  1I94 O;  1AJQ A;  5B1B C;  5LMU O;  1H2S B;  3OEH G;  3RYH B;  2H8P C;  4W4K A;  2ITC C;  3BA9 A;  1KP2 A;  3RYF B;  5LA6 A;  3HKC B;  1IXB A;  2HLD G;  1FXK B;  2QA4 V;  3GWK C;  3SJB C;  3AG1 C;  1JCH A;  2LP7 A;  3OGC C;  2Q9L A;  4O4L A;  3SPC A;  4DV7 B;  1K7D A;  2YDE A;  1SF9 A;  3H1J H;  3EVK A;  3PJS K;  4KL1 A;  4DV3 B;  3ETG A;  5F2V O;  2B1I A;  3AG4 B;  5LXT A;  1KU9 A;  4GT1 A;  4JF3 A;  3JAK B;  1X59 A;  4FFK A;  1FJG O;  3FFQ A;  2ZNJ A;  1Q43 A;  1AJN A;  4LWS A;  1GN2 A;  1U96 A;  1QBZ A;  3JAM N;  4QGP A;  4UB8 Z;  5IYZ B;  3P3P A;  1BZK A;  1PD3 A;  3TCU A;  1QU7 A;  3QTC A;  3LDE A;  4B7K A;  4DR7 O;  5EK0 A;  3AG1 B;  4EB6 A;  1GM9 A;  3L9D A;  4X1K B;  3CPW U;  1ARO P;  1PNM A;  2UUC O;  4LFC B;  4DV6 B;  2PTM A;  2IH3 C;  1RM1 C;  4FLY A;  1XUQ A;  2EIM C;  3VQW A;  4F6R A;  1F4M A;  3OR6 C;  1H38 A;  4UVC A;  3JSN A;  2Z5U A;  3H1K H;  2VQE B;  4MVO A;  2DN9 A;  4XDJ A;  3JD2 A;  4X1I B;  2V7Q G;  4KHP B;  3APQ A;  4DR5 O;  2VWJ A;  4GCZ A;  1VQ6 V;  4FM1 A;  3S3X A;  4LFA O;  2F4V O;  2QJ1 A;  3HKC A;  5EYP B;  3L72 H;  4Q20 A;  1QVF U;  5J2T B;  4TV9 B;  1H2G A;  5CBG A;  1KP3 A;  3BEH A;  2P67 A;  5LYJ B;  3RN4 A;  4IGG A;  1R3K C;  3ZRW A;  2DYR B;  5KHG A;  2A79 B;  2CTP A;  2E75 B;  3KCY A;  1D5A A;  1SRY A;  3B40 A;  4LF6 O;  4H0L B;  3JAK A;  1JMK C;  4E2L A;  2FTK A;  2IW5 A;  3CSX A;  1WJZ A;  1YEW A;  1QHT A;  3K3W A;  1AR1 B;  5L3D A;  3CMA V;  5J9P C;  3DC5 A;  2ZQM A;  4LF8 O;  1G1X B;  5FNV B;  5KLV H;  4JI7 O;  1LUW A;  2QGN A;  4NTY A;  2FML A;  2OWO A;  3RFR A;  1M9N A;  4WFF A;  5CMU A;  2OCH A;  2WLL A;  3T1H O;  1VF6 C;  2RCV A;  1R1B A;  5GON B;  1AI5 A;  4LBE C;  1RSO A;  4X1Y A;  1SQF A;  1TA8 A;  2LW7 A;  4I9W A;  1M5I A;  3SYP A;  1HNW B;  1IBL O;  2RNB A;  2Q67 A;  4B3M B;  4L8J A;  4B3S O;  1N32 O;  1R73 A;  4UCV A;  1DK1 A;  1H2M A;  3D3I A;  4JI2 O;  3ML0 A;  5IYB O;  2O57 A;  1AVM A;  2IH1 C;  2LO1 A;  3QVN A;  4JV5 B;  4TQF A;  3K5M A;  5LL6 Y;  3ICX A;  4CS4 A;  3QG5 A;  1M57 C;  2GV9 A;  1URF A;  1S5J A;  3SYC A;  4BIO A;  2Z3Y A;  3AG7 A;  4QPK A;  3L75 H;  5FPR A;  4AHC A;  3FKS G;  3QF7 A;  4PA3 A;  5J2T A;  2HP8 A;  1JR9 A;  3OD4 A;  3F7V C;  5IY5 C;  2UXB B;  2BOC C;  4JI0 O;  2GTA A;  4U7N A;  2C2A A;  2Q73 A;  2DE0 X;  1JA8 A;  2YXL A;  2LW1 A;  2EJ7 A;  1AP5 A;  4QIW F;  1K5Q A;  3F5W C;  4ZI7 B;  4I50 A;  3BAA A;  4DV1 O;  3K04 A;  4XDK A;  3BCC H;  3BPZ A;  3CJH B;  4QE9 A;  2HVJ C;  5FNV A;  2BOB C;  1PP9 H;  3CX5 F;  5EZY A;  1VQ9 V;  1XNR O;  1R6K A;  3FAV B;  2R9I A;  3NR7 A;  3D8C A;  2M6Y A;  1K4C C;  2F93 B;  4YY3 B;  1CXZ B;  4BAY A;  3B77 A;  4MTX A;  4B3T O;  5AG2 A;  3ZS8 C;  4X8A A;  1UJW B;  2XHB A;  2Q0O C;  5IY5 B;  4JYC A;  4MVQ A;  3N2G A;  5CBF A;  1MOF A;  2PZS A;  5CBH A;  1N33 O;  1XBL A;  3ABM B;  2CTW A;  1Y4M A;  5IWA O;  4NR1 A;  2ODM A;  4MVS A;  4CH5 A;  3SDL A;  4WFG A;  1VEW A;  4MW3 A;  5CA1 A;  2N74 A;  1SQP H;  1YZB A;  4CH4 A;  2QWO B;  2UXC O;  3WU2 Z;  1B3Q A;  4GKK B;  1P84 F;  1GH6 A;  5BR8 B;  1R3I C;  3OE7 G;  4IHJ A;  1QR9 A;  2XTA A;  2JGU A;  1VF6 A;  5FLX N;  2HJF C;  1XMQ O;  2JVD A;  1GAX A;  5LMN B;  1RFY A;  1NI8 A;  5L3C A;  2ZCE A;  3AG3 C;  4K35 A;  5L3B A;  1Y76 A;  4PDR A;  3AK1 A;  2KG7 B;  1GKF A;  4HBN A;  1E1Q G;  3G67 A;  1B06 A;  4GUN A;  5DEC A;  4U3J B;  4DV5 O;  4LNU B;  4Z2W A;  1P4R A;  2WPD G;  4R6Z A;  4ZOL B;  3T4D A;  1VAR A;  4RUE A;  3K03 A;  4YHH B;  1N8R W;  4JI8 O;  1LNQ A;  2WSS G;  5LHH A;  1VQ4 V;  5DN6 G;  3T1C A;  1K34 A;  1HP8 A;  1ZAU A;  2YUA A;  4YJ3 A;  3LDC A;  1HNZ B;  3JYC A;  4DW1 A;  4MTG A;  4GLX A;  5GW7 A;  1SA0 A;  3FB6 C;  1IVS A;  4JI5 O;  4DR3 B;  1ZLZ A;  4PHZ A;  2B1G A;  3SJQ C;  2P4V A;  4X88 A;  3CC2 V;  2ZM6 B;  4OPA A;  4I4T B;  3WG7 B;  2YIB D;  4JAS A;  2YI9 A;  2ZE8 A;  4JI4 B;  2OT5 A;  5B1A C;  3AG3 B;  4B7E A;  2YSU B;  3BY6 A;  2A9H A;  3HPL C;  3OMI B;  2UUB B;  3LSU A;  1J5E O;  5CB4 B;  1KYO F;  5IJ0 A;  3QO5 A;  4N23 A;  2G38 A;  1V55 C;  4DRX B;  3OFN G;  3OMN B;  1F23 A;  3ETE A;  3C3S A;  3UT5 B;  2DOS A;  5EBW C;  1ZUQ A;  2W0F C;  1JJO A;  4Q6G A;  2ZIO A;  3JAT B;  2E5L B;  5B3S C;  1PKX A;  1W0K G;  2XT9 A;  4CH6 A;  1NTM H;  2X6C A;  1BQ0 A;  2OTL V;  4O4I A;  5H9C A;  1QR8 A;  1DLB A;  1FS0 G;  3RYI A;  4FVM A;  3BVO A;  4PA7 A;  3CRC A;  3PN1 A;  1ENV A;  1AI4 A;  4YIP A;  3HKB A;  1W2B U;  1Z2G A;  4LCU C;  1OHH G;  2VWK A;  4ZKI A;  1WNS A;  4X66 B;  4J7Z A;  2Y0I A;  2WA4 A;  1SC5 B;  1V55 B;  2HEP A;  3VQV A;  3BA8 A;  4B3R O;  4RQF A;  3HKE A;  4PI0 A;  1U97 A;  3P3N A;  3ZJZ A;  2B9Z A;  1MA1 A;  2ZNI A;  5B3S B;  4PDV A;  3RT3 C;  4JI6 B;  4OX9 B;  2Q7H A;  3I5D A;  5JWP A;  3LUT B;  4DR2 B;  1L0L H;  4YJ2 A;  2Z0A A;  4PI2 A;  1GM7 A;  2DYS B;  2Y4U A;  3JAS A;  4JGS A;  4IIJ B;  5IJ9 B;  1N36 O;  4K3A A;  3OR7 C;  2QDO A;  2HJD A;  1OCR C;  2CAZ C;  1IZ3 A;  2Q5Z A;  4LF5 B;  3CS5 A;  3FX7 A;  4DR1 O;  3J80 N;  3O65 A;  5LP6 B;  4X62 O;  3CRA A;  1MSD A;  2W0X A;  1I94 B;  2A3Q A;  4O4H B;  4C7U A;  4LC1 A;  5EIB D;  4P30 A;  5LMU B;  3L73 H;  3E22 B;  1FFX A;  3L71 H;  3G6B A;  4ABM A;  1VF5 B;  2L6L A;  1P7G A;  4I0X B;  1NTZ H;  4D7T A;  3LNM B;  1FXV A;  4MVU A;  4DR2 O;  5J2U A;  4NTW A;  1OCZ C;  3S3W A;  4Z1V A;  3CME V;  2P90 A;  4JI3 O;  3I56 V;  5C8Y B;  3G80 A;  5JH7 A;  1JQ0 A;  4FIP C;  5LOV A;  2ADP A;  2YXY A;  4QNH B;  2EIK C;  4HAM A;  1S3J A;  3AG4 C;  2H94 A;  2QSA A;  1PL4 A;  4CS2 A;  5HFL A;  1GN3 A;  3ZN0 A;  5GTH Z;  3NXS A;  4HYO A;  5FPO A;  4EEQ A;  3DTU B;  3DSQ A;  1FJG B;  3HKD B;  3TXQ A;  1Q6I A;  2UXD O;  2QTS A;  2ZR3 A;  3JD0 A;  3KG2 A;  1WLE A;  4DR6 O;  4DV4 O;  2HHH O;  3VOU A;  3A0H Z;  4OGQ B;  4WFH A;  1DF4 A;  1FAF A;  1FFT B;  4R50 A;  3A0B Z;  4NXM O;  3CRR A;  2Y0P A;  1KEC A;  3C3T A;  3ZMZ A;  4ZIB A;  1Y74 A;  4MVZ A;  1NS1 A;  4GKJ B;  2QKS A; 
#chains in the Genus database with same CATH homology
 2Q4P A;  3CRA A;  2YXH A;  4QGP A;  3CRC A;  1YVW A;  2A3Q A;  2OIE A;  5IE9 A;  2A7W A;  1Y6X A;  2Q5Z A;  2GTA A;  1VMG A;  1YXB A;  3C90 A;  2P06 A;  2Q73 A;  2Q9L A;  2OIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...