4NTWA

Structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
412
structure length
410
Chain Sequence
b'VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
total genus 109
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntwA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntwA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntwA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntwA02
4FZ0A 4NYKA 2FB5A 3S3XA 3S3WA 1WP8A 2QTSA 2L35A 1WP7A 3N27A 4NTYA 4NTWA 3IJ4A 4FZ1A 4NTXA
chains in the Genus database with same CATH superfamily
2QM7A 2YEVA 4YJ2B 3P32A 3L74H 3SJCC 1DGSA 2WLLB 2Q0AA 1TUEB 1V54C 1UJWB 1I5XA 3Q4HB 4GZRB 3JAMN 4FJCC 3D8CA 4EEQA 1Q81W 3G80A 2CUGA 1OV9A 1KU9A 2WLNA 1PNKA 1FS0G 3C90A 3H1IH 1XREA 3CCJV 1H2GA 4UCVA 5CN0A 4QIWF 3ZMUA 1WB7A 2JJ2G 1FXKC 4B3RO 4DV3B 2YXHA 2MK3A 4UVAA 4I9WA 1N0JA 1R3JC 2KB1A 3JSNA 1G6UA 3D36A 1JJ2U 1VQ6V 2QE7G 4B3RB 3SYQA 3CS5A 5KHGA 1NTKH 4I4TB 5H2FZ 2OIEA 5E79Z 3BEHA 3ABLC 3OUSA 3C3SA 3QF7A 3ASNC 1H2KA 1PL0A 2YS8A 1OCRB 5BY1A 3IAYA 2P22C 4DV2O 3VOUA 1SQVH 1WB8A 1BL8A 1Z5VA 1PP9H 4DV5B 5J2TB 2AZ0A 3G6EV 3D3QA 2ZDIC 2NLJC 4MTFA 1DTOA 5LP6B 5B5EZ 3LNNA 4QNHB 5FL7G 3ETQA 4TWKA 1KP3A 5IYCO 3T4ZA 3ETDA 4DYLA 1M9NA 3T1YO 3HKEB 4I5SA 4UUJC 2YDEA 2UXCB 1XMOO 5B1BC 3T1YB 1XBLA 1NTMH 2KG7A 2DYRB 2C2AA 4JYBA 1F4MA 5BZBA 2VRZA 3ZHSA 3K0GA 1IDSA 3JD3A 4PV1B 2X6BA 5GONB 2GHYA 1ENVA 4J7ZA 3UO3A 3H1JH 2P5OA 4J42A 4R8CA 1HP8A 2XASA 2LJ2A 1ZL8B 1I5YA 1QCEA 3THOA 1DF4A 1SKVA 3APQA 3ZBHA 2EBOA 1MSDA 2P06A 4X1KB 2GSMB 3RWRD 1HDJA 2QWQB 3OD4A 1Q82W 1M56C 4I50A 5K1XA 3DC6A 4JYAO 1FFTB 4I55B 4X8AA 2XNDG 2CK3G 1IURA 3AEIA 5LHHA 3KG2A 5EYPA 2QWRB 3LDDA 2YI9A 5KX5A 3JAWA 3G4SV 5DECA 1KD1W 3O9OA 2EZPA 4YJ2A 2EZOA 1LUWA 2VS0A 2ZE8A 1BHBA 2OIGA 1JQ0A 2WLLA 2LW7A 4KHPB 3Q4HA 1PD3A 1JR9A 3T1CA 3JSLA 4DXWA 1WPBA 1QLEC 4J11A 5E1AC 4Q20A 3GB7C 4JI8O 1FPOA 2GTSA 2IJHA 2ZCEA 4EFBA 2L35A 1N33B 2Q4PA 4PI2A 1VQOV 2WSSG 3OW2U 4JI8B 4UCTA 2VQEB 2D3OW 1OHHG 2XOKG 1VQ5V 2LGQA 5GW7A 1CEZA 4X66O 1K7DA 2ZKOA 3OM3B 2VQFO 1NJIW 2AW9A 5CA0B 1TGOA 2Q7GA 5KUMA 3E89A 2OYQA 5EIBD 3K9SA 4I4TA 3S3WA 4ZBMA 1JA8A 4WFHA 3CCEV 2ZE6A 1RPOA 4GX0A 4DV4O 4G27B 1N34O 3ZCCA 1KB9F 2A3QA 2JRIA 4K8XA 3STZC 4RUFA 2OCHA 3MHSC 1GKFA 4DV4B 1Q7YW 5JVDB 5J2TA 1Q86W 4RQEA 5BR8O 1ZUQA 4JASA 5LP6A 2ZE5A 4MSWC 2E76B 2YUAA 1RP3B 2OT5A 2Y48A 1M4UA 5BR8B 2QSAA 1O9HA 3HKEA 3AG1C 4JI7O 4DUYO 1H8EG 4CC6A 4IGGA 3RGBA 1WP8A 1EZJA 4F6EA 4RQFA 3JALB 1US6A 3MD0A 2YIAA 5KHJA 1IBMO 4DR5O 3EFFK 1HWYA 4H0LB 2WLMA 2KKWA 1WAZA 4LFCO 4QPJA 3B77A 5GONA 4PA3A 3RW0A 3RVYA 1ZL8A 1V54B 3ZHQA 4BIOA 4H13B 4P30A 1SQPH 2ZQMA 4DR4B 3CSXA 4X1KA 2DW4A 3E8GA 4UV8A 1BS3A 4B7KA 4BW9A 3X2QC 1PNLA 4LP8A 4I55A 5B66Z 3SYPA 1P49A 3OTOO 3BVOA 1N32B 4O4IB 1I94B 2GUZB 1VF7A 2B5UA 4XBFA 4A5UB 4BIZA 1FXKB 4LF6O 3PN1A 3BHPA 1HNZO 1XL6A 2F66C 2UUAO 3OMAB 4UFZA 1QVGU 4FLYA 4NVPA 4K0KO 1SZXA 1XEQA 3NXSA 1XMQB 2QKCA 2QWPB 5IYDO 3K79A 5B1AC 1XILA 5LMNB 3ZRVA 3LSSA 1WP7A 1JOYA 1VIBA 3OEHG 3H01A 3BAAA 4LH6A 1D5AA 4X65O 1SF9A 1MG1A 3LSUA 5ITZB 4Z2WA 2UUBB 4MVQA 1FKAO 3AG2C 1BCCH 2E5LO 5IYZB 5K1PA 4C7UA 2QTOA 5CA0A 4MVZA 1EFRG 4DR2O 3WU2Z 2ADQB 1EBOA 1LUVA 4LR3A 3G71V 4DR2B 4U3FH 4DV1B 1R73A 2Q8VA 1X4TA 1S5HC 1CXZB 1VQKV 3DSQA 1H2MA 4TUYB 1NZ6A 2CDYA 5IYBO 4YHHO 3ASOB 5LHIA 3RN4A 1JFFB 3VQXA 5JVDA 4B3SO 4LF9B 1G8MA 1OCOB 1R6TA 1OCCB 3VBBA 1K5QA 1NTZH 4B3SB 1GN6A 2F95B 2Y0IA 2JVDA 3CCRV 4LC1A 3K0DA 4DR3O 1FYJA 1GM8A 3A0BZ 2HHHO 3JYCA 4CH4A 1AI6A 4X1YB 1M93A 2YICA 2EINC 3L73H 2HHHB 2QDOA 5LGUA 3JALA 3JD4A 4IYHA 3AK3A 1SA0B 3J7AU 1M57C 1A32A 2HJFC 3RVZA 2DJVA 1X59A 3OR6C 3RBZA 2PI4A 1QU7A 5KHHA 5FNVB 2Q0OC 5JCOC 5LA6B 4NR1A 3FYIB 3JAKB 4GKKO 5CBHA 2CTRA 1GK9A 2QKSA 5BMVB 4WFGA 4GLXA 3HKCB 3SJAC 3ZMVA 4CS2A 4K35A 1NS1A 3AG7A 4ASUG 2N74A 2ZM6O 4RWUA 1AVMA 2X7RB 4O4IA 2GUZA 1GH6A 3F7YC 3CEIA 4ZHQB 5IY5B 3E22B 3TK1A 3OGCC 1FXKA 2CTWA 3UT5B 4PDVA 2LO1A 1NR1A 4DR7O 4OX9O 1S72V 1M1KW 2LW1A 4X88A 3A0RA 1SQQH 1VQLV 4DR7B 4ZKIA 4L87A 4JZGA 3RFRA 3WFVA 4J9ZB 3KZIZ 4FK5C 3BRCA 1VQMV 1J95A 3JD1A 4DR1B 3ZRXA 2IU0A 3JATB 1KP2A 1Q6HA 3ML0A 1HNXO 5ITZA 1JJOA 3AK2A 5CB4B 4DUZB 2DYSC 4JI4B 1N0NA 3TJTA 3CMEV 1H2LA 3UM7A 1YI2V 2LFRA 1HR0O 1N36B 5IWAO 1SQBH 3E86A 5IYZA 2X6CA 4MW8A 1WNSA 2Y0PA 4R6ZA 3CC2V 3T2MA 1BE3H 4JI1B 3L9DA 4WFBV 2ZXWC 4FFBB 3E35A 3G67A 3ZHTA 2QKAA 1IBKO 2JK5C 2UXDO 1S5LZ 2NN4A 4TUYA 3SGIA 2BE3A 3QG5A 1P7BA 2EILB 3ZMSA 1IBLO 2ZR3A 1IBKB 1JFFA 3E8HA 4HNAB 5FPOA 1GN3A 2OWOA 1GM7A 3ZRWB 2HJDA 4JTAB 1BMFG 1IBLB 1KKDA 4GYCB 1UPGA 4OGQB 3E83A 4BIUA 3ZHVA 4CC5A 3FB8C 3STLC 4X1YA 3QO5A 2R9IA 2EJ7A 2YC0A 3H9VA 4UVCA 1TVKB 2PTMA 2AXTZ 1NR7A 4DV3O 3CRMA 4YJ3B 3GWKC 1KECA 3CRRA 1SA0A 5LGTA 2QR4A 1KQSU 1EN5A 1RPRA 4K3AA 2B1GA 1F51A 4LF5B 3FKSG 2ILMA 3HKDB 3IC7A 5FNVA 1GN2A 3OTFA 2Q5ZA 5LA6A 1I08A 1MZEA 2H8PC 1K4CC 2UU9B 4PHZA 3OGIB 1PKXA 3JAKA 2VWJA 5B1AB 1V55B 1K8AW 5BMVA 4DV5O 4QGPA 3DXRB 1BGYH 3HKCA 2V1DA 3OMNB 4J7JA 5DN6G 1NVPB 3CC7V 2RQ6A 3BPZA 1E1RG 2RCVA 5IJ9B 4ZHQA 3E22A 5JJNB 2EX3A 2EIMC 3UT5A 2UXCO 3OT7A 2E75B 2GDSA 2CAZC 5JJEB 3RT3C 4NXNB 1NKDA 2P4KA 1K3EA 4WFEA 2D2CB 4X20B 3CC4V 4RUEA 4WF9V 1RSOB 1S3JA 1TA8A 1AP6A 5L3GA 1DF5A 1SQFA 4KL1A 3LSQA 3ABMB 5EK0A 2K1EA 1AJNA 5LBQA 4NKGB 3JD0A 1SS3A 3JATA 3O65A 5H5NA 4IIJB 3N2KB 5CB4A 3AG4C 4PD4F 4X89A 4X9QA 2JGDB 1AI7A 3CJHB 5B1OA 1G4YB 4LFAB 2RDCA 1T5EA 2UXXA 1GMGA 3SYOA 3IFXA 3CCQV 4JGSA 2Q68A 1URFA 1FD9A 3ICXA 2UXNA 3D3IA 4E2LA 4ZOLB 2F4VO 3KCYA 4FFBA 4FLVA 2Q6AA 5L3FA 2BTQB 4NYKA 2F4VB 2FKXA 3TXQA 5JQGB 3K06A 3SPJA 1DLBA 1BQZA 3IGAC 3MAQA 4KHPO 2R9AA 3CCVV 4HNAA 3G6BA 2XHBA 3WG7C 3ZRWA 1Q8IA 2HVJC 2RN9A 3K57A 5J2UB 1NH2B 2VWKA 1N33O 3SJBC 4JPRA 1H8HG 3BY6A 1W0JG 4CH3A 2FYUH 2VQEO 4KFMA 3ZN0A 1OZ0A 2X0LA 4NTXA 2UUCO 4XDLA 5LOVB 3D36C 1TVKA 1XOUA 2CH7B 4HBNA 5CBFA 2UUCB 4YJ3A 5EIBC 3P3PA 3SYAA 3K5NA 3ZMTA 3ABKB 5JJJB 3L75H 1VP7A 1YSCA 3QO7A 4I9QA 1L1FA 2DWDC 2PF4E 2W6JG 3HKDA 4FZ0A 4PA6A 4H37A 1M90W 2OCCB 4FM2A 1NQTA 4IT5A 2QM4A 1QNMA 4P9PA 1JMKC 5GTHZ 5L3DA 1IX9A 4PDRA 2Y69B 3RYFB 2ITDC 1R3KC 1PPJH 3DXRA 1B04A 5KAIZ 3W7UA 2A79B 3JCZA 4G28B 3MHHC 5IJ9A 4JF3A 1K92A 2Q67A 4JI5O 4TT3G 4P2ZA 2PZSA 3K5OA 1PV0A 1VQNV 5L3EA 1QR8A 4JI5B 4O4JB 1QHTA 4NXMB 5EC2C 2IJJA 4X20A 2LFSA 1RSOA 1QVFU 4GUNA 2ZXWB 4DR6B 1L0NH 1R3LC 1LNQA 1K4DC 2WLKA 1AROP 1Q6IA 4NTYA 2F43G 3K08A 5HFLA 2OTJV 4PELA 4IIJA 3AG3C 3N2KA 4D6TH 4JI3B 4DR4O 4ZIBA 1O9GA 2R9RB 2JGDA 4MVOA 1Q6UA 3CJHA 1Q3EA 3E8FA 2UXBB 3ZHRA 4K8ZA 1R1BA 2K9PA 3OAAG 2HR3A 4UCSA 5EBMC 1Q43A 2QA4V 1IVSA 1N32O 1IXBA 1I94O 1LR1A 2PY5A 1K34A 1B06A 4ZOLA 3JARB 4IL6Z 3TXSA 1ZAUA 5H6QA 4JI6B 4MT8A 1XNQO 2PI5A 2CGOA 3OMIB 2BTQA 4GX2A 2L6LA 5JQGA 1XNQB 2CTQA 4J7KA 2XAJA 1XMQO 1KKCA 2P7TC 3K5LA 3DTUB 5J2UA 5JCOA 5LMNO 1KBHA 3ABLB 3ASNB 1J5EB 1SETA 4FIPC 4KUMA 1VMGA 1NU1H 4GKJB 5KAFZ 2P67A 2E74B 1K9MW 5LOVA 2UUBO 2CH7A 2HVKC 4U7NA 1AI5A 2Z0AA 5H9CA 4JAAA 1XI1A 4QPKA 1P84F 5LMUB 2EIMB 2W0XA 3OR7C 1Y76B 4X62B 3VQVA 2ZE7A 3M99B 2ZIMA 3CXHF 4HZ3A 3H1LH 4O4HB 4JZ2A 4QJFB 3I5DA 1Y6XA 2A9HA 4UV9A 4DV1O 3RYHB 5B1BB 1N8RW 1VQ8V 5LP6C 2AZ2A 3J80N 1F7YA 3CXCU 1SERA 1IZ3A 1SQGA 1JCHA 2YI8A 3RYFA 1S5JA 4LF9O 2DWEC 1U96A 1NVPD 5CBGA 4LH7A 4PDMA 2JEUA 2B1IA 4X1IB 4DV6B 4DW0A 4X64B 4OPHA 1K5SA 3TCUA 3CMAV 3TETA 3E8BA 2DYRC 3BA8A 4FLTA 1NT2B 2KSDA 1S76D 4FLZA 5AG2A 4DK1A 2RJZA 5IDJA 1ZSPA 4O4JA 4B3TB 4HYOA 1M56B 3EXAA 1E1QG 1ZLZA 2A06H 3DC5A 1YZBA 5J9PC 5KHIA 3OE7G 4LNUB 1SESA 1N4CA 5F2VO 3T4DA 3T1HB 1THZA 4Q6GA 5CMUA 1YXBA 2WWWA 3H1KH 1NI8A 3K3WA 4JTCB 4TV9B 3LNMB 3WB2A 4E4EA 3LDEA 3ZMZA 2JS5A 1MNGA 2IBZH 1Y74B 1QLEB 4JI0O 1ROPA 2FMLA 2WLIB 4I0XB 3B40A 5D5PA 4FM0A 2ETNA 4UB8Z 3JARA 1H38A 4JI0B 3BABA 2XT9A 1VQ7V 4DO2A 1SQXH 3CCSV 2CTPA 5BXZA 1SRYA 2E3CA 1EN6A 2F93B 1K33A 1S77D 1GTOA 2HKOA 3OUFA 3IJ4A 4N23A 1NH2D 5B3SC 5CA1B 4HAMA 4WBNB 3WB0A 3I55V 4LFBO 2Y4TA 5IJ0B 3R66A 1YJ9V 1ZX3A 3ZS8C 4DR1O 1I0HA 4FLUA 4DRXB 4WFFA 3CPWU 4LFBB 4BWAA 4I7ZB 4GX1A 4DUZO 1VQPV 4JI4O 4UB6Z 2HLDG 5A2QN 4N21A 2CGNA 4AHCA 1L8DA 1N36O 4GCZA 4RO2A 2ZDIA 4GX5A 3F5WC 1DK1A 1Y76A 3FYEB 1VF6C 1YJWV 4JI1O 4FLXA 3I56V 4O4HA 4CBCA 4LF7B 3AG1B 2M6YA 5LYJB 4PA7A 3RYHA 2QWOB 3W7XA 3CCMV 4JI2B 1HNWO 5GTIZ 1U97A 2EIKC 4JV5O 2LGWA 2W6IG 4LF8O 1SC5B 3UCSC 4X1IA 1HNWB 3M7MX 3SR2C 4AI8A 2DQ0A 4JV5B 4LF8B 1MMMA 2WA4A 2A7WA 4U3JB 3SPHA 3OEEG 1W0KG 1P7GA 1Q90D 2FTKA 1E79G 4AQYB 1VF5B 1YCIA 3FAVB 3X2QB 2QM8A 1QLNA 3R65A 4EB6B 4LNUA 3UKMA 4MTGA 3TGUH 4MS2A 4LF5O 3FB6C 4UXNA 2HFEC 4DV0O 2NNUA 2XAGA 4F4LA 2ITCC 4TQDA 2UU9O 1L0LH 4TV9A 1K97A 3A8TA 3LDCA 4DV0B 1Y4MA 2ZNJA 1Y74A 3QO8A 1FXHA 3B8MA 3CRAA 2WLIA 4I0XA 1JVMA 2YXYA 2IJIA 4CH6A 1MA1A 3CHXA 4D7SA 2RMKB 4NB5A 3KKYA 2BCCH 3JCUZ 4AILC 1UFIA 4JTDB 2F1MA 2ADPA 4UCRA 3ABUA 3JASB 3HKBB 1R6NA 1VQ9V 4RAIA 1WN7A 2XUMA 4NXNO 1COWG 3AG2B 3SDLA 3P3NA 1FFXB 4MVUA 3EHBB 5CA1A 4D7TA 2FL4A 4WBNA 3JD2A 3RYIB 4DV2B 1Z2GA 3HB3B 1G1XB 3MDSA 4KXRA 1R3IC 1W59A 5IJ0A 4BAYA 2Q69A 4DRXA 2B9ZA 3UQ8A 3IC9A 1CP9A 1VARA 2XTAA 4QE9A 5EBLC 4LFAO 2IJKA 1VQ4V 2GV9A 2IH3C 4J9YB 2BTOA 1XMOB 2ZNIA 1XHZA 2KQXA 3BA9A 1PL4A 3A2FA 3FB7C 3FFQA 1AR5A 4J41A 3ASOC 4PDLA 1B6QA 2DOSA 5LYJA 4WFAV 1QBZA 2EINB 1OCOC 1OCCC 2IM9A 2R70A 1MZFA 3FB5C 1WA8B 3APOA 2H94A 1M57B 3CYOA 5KMGB 3QTCA 3SJQC 2A0LA 1I7FA 3SYCA 1YIJV 4B7EA 4BR6A 2XAHA 4Z1MG 4JYCA 1M5IA 3ZX6A 5L3CA 3BFRA 3F7VC 2ZD9A 4U3JA 3W7TA 4JYAB 3B4SA 1XNRO 3E2EA 1V9PA 3CE2A 2P6JA 5C8YB 1AP5A 3ABTA 1YVWA 1XNRB 1PM9A 3FAVA 2NR5A 4EB6A 1Q5OA 3OFNG 5HFMA 5KA5A 3CD6V 1QQCA 5EZYB 1WLEA 4J10A 3K9AA 4UCUA 4IHJB 5LGNA 4J80A 2BSKB 2QTSA 1BZKA 1AJPA 2F23A 1YTFB 4R50A 1ZTEA 1B3QA 5B3SB 3HPLC 1F4NA 1XQ8A 1RM1C 1XDCA 1MABG 3N2GB 4O2BB 1S0VA 5IY5C 4TSFG 4OPAA 4PA4A 5B1NA 5IT9N 3K59A 4YIOA 2ZINA 4X66B 5LXTB 3U11A 4B08A 2VQFB 1GM9A 1H2NA 4R7CA 3ZN1A 2W0FC 3ZJZA 3SPCA 4FPPA 3JASA 2DYSB 3HKBA 1FAFA 5H6RA 4CS4A 4O4LB 2WA3A 4EKWA 4NXMO 4ZI7B 4U7OA 1FFXA 2PUSA 2V4DA 2ATKC 1N34B 4DR6O 2BOBC 3L72H 3CCUV 1FJGO 4MVMA 3RYIA 1AB3A 1OCZC 2QJ1A 2Y4UA 1FJGB 2JEXA 1D2DA 2HG5C 1BQ0A 1XHXA 3CRCA 2EIJC 2EIKB 2JGUA 4JI3O 4MTXA 1OJHA 1TUBB 1KC8W 1MOFA 3QVNA 4H44B 4DK0A 2UXBO 2QWNB 3B2EE 1AJQA 4JI7B 1KUQA 3GVMA 4DUYB 3FX7A 4NTWA 3RYCB 2Z5UA 2ZT9B 2ZIOA 2V7QG 3B8NA 4YY3O 4FZ1A 4TV8B 2EILC 4JI6O 4XDJA 4WCEV 3U10A 1IBMB 2IH1C 4YY3B 2YIBA 1GAXA 4CH5A 3KCXA 4DR5B 3B09A 1EM1A 4OXSA 4LFCB 4LBEC 5A9GA 3WB1A 5FLXN 2O57A 2JJ1G 4L8JA 1WA8A 2LQTA 4DW1A 5CA3A 2AHZA 5KMGA 2PYJA 3PJSK 3K58A 3ETEA 5TISZ 3GWOA 2ODMA 3NR7A 1BHAA 4P9OA 1J5EO 2PYLA 2DN9A 2P4VA 3UO2A 4GKJO 3LUTB 2Q73A 4PA9A 4EFEA 3K5MA 1YEWA 4O2AB 3S3XA 4TOIA 2ARHA 1Z5WA 4F6RB 3OTOB 5C8YA 2CE4A 2ZR2A 4ABMA 1NBMG 1KMIZ 5LMUO 4X62O 3U0ZA 3CWBH 4LF6B 5EZYA 3VQYA 1HNZB 1K73W 2UUAB 3J81N 4FM1A 4W4KA 2JDIG 1OCRC 4IHJA 1V55C 1Y67A 4K0KB 5LHGA 2BSKA 3SPGA 1FXVA 2WLJA 1XL4A 1P4RA 2WLHA 3DGEA 4DV7O 2GBOA 4B3MO 2HP8A 3CP1A 3H1HH 2YSUB 1GO3F 5DM6V 4DV7B 5D5QA 3N2GA 4O2BA 1KYOF 4JAUA 4B3MB 2FB5A 3ZHUA 1JX9A 4X65B 4IYIA 4PI0A 2BOCC 4DV6O 1BSMA 4FMTA 5JH7B 4X64O 5LXTA 1CPYA 4LWSB 3CCLV 1WPXA 2H3OA 1QR9A 2JS3A 2E5LB 2EJRA 2QGNA 3AG4B 2IU3A 4B3TO 4O4LA 2M7WA 1VF6A 3ABMC 1VEWA 4ZI7A 1MSWD 3BCCH 2GTAA 1AILA 2YEVB 3CX5F 4JYYA 1YJNV 5KA6A 2N04A 3T1HO 3AK1A 4YHHB 2R72A 3W7SA 3VQWA 5KHKA 4YXWG 2DMXA 2RNBA 1YF2A 1YHQV 4CS3A 1TUBA 1F23A 4FVMA 1IXMA 3WG7B 4DR3B 3EVKA 4PJ0Z 3QNEA 3SPIA 3RYCA 2Q7EA 3L71H 5JWPA 2X6AA 2Z3YA 3K03A 5EC1C 4TV8A 5DEDA 2YIBD 2JIZG 1AI4A 3CRQA 3L70H 1YDXA 1Y66A 3ZIAG 2WAMA 1ZWIC 1GN4A 4MVSA 1YITV 4TQFA 1W2BU 4JAVA 1EN4A 2YXLA 2N05A 2P90A 4G2KA 4UCOA 4CZZA 4Z1VA 2XAQA 4GKKB 3ZEDA 4MVRA 2G38A 4MW3A 1PNMA 1RM1B 2MW2B 2HEPA 4KP4A 4O2AA 3ABKC 2XAFA 4F6RA 2ZM6B 2WPDG 3C3TA 5EBWC 4H33A 1SZTA 2AHYA 5LL6Y 1XUQA 2OTLV 1R6KA 1AR1B 2QEXV 3F5TA 1H2SB 2OCCC 4LF4O 1BT8A 5L3BA 3A0HZ 4MTOA 4FFKA 4UVBA 4OX9B 1TAEA 3W7WA 4LF4B 4LCUC 4LF7O 3FD9A 2KG7B 3HR0A 2Y69C 1YTFD 2IW5A 5C93A 3ZRSA 2EULA 2Q7HA 1EZVH 5FPRA 5KLVH 4GT1A 5IE9A 4JI2O 2DQ3A 1OCZB 2Q9LA 1WJZA 4W4LA 4XDKA 2LP7A 4QE7A 1HNXB 5JH7A 4BW5A 3N27A 2EIJB 4LWSA 1RFYA 1JPXA 1ORQC 5KUKA 4YIPA 1HR0B 1HW7A 3ETGA 5IWAB 3P30A 4I50B 2PGGA 3AG3B 3M8AA 2YIDA 4AQYO 2AGAA 3K04A 5EYPB 1D5NA 4ICGA 5KX5B 3JAWB 2DE0X 1GRJA 3CB2A 4FLWA 1AR4A 2UXDB
chains in the Genus database with same CATH topology
4FZ0A 4NYKA 2FB5A 3S3XA 3S3WA 1WP8A 2QTSA 2L35A 1WP7A 3N27A 4NTYA 4NTWA 3IJ4A 4FZ1A 4NTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ0 A;  4NYK A;  2FB5 A;  3S3X A;  3S3W A;  1WP8 A;  2QTS A;  2L35 A;  1WP7 A;  3N27 A;  4NTY A;  4NTW A;  3IJ4 A;  4FZ1 A;  4NTX A; 
#chains in the Genus database with same CATH topology
 2QM7 A;  2YEV A;  4YJ2 B;  3P32 A;  3L74 H;  3SJC C;  1DGS A;  2WLL B;  2Q0A A;  1TUE B;  1V54 C;  1UJW B;  1I5X A;  3Q4H B;  4GZR B;  3JAM N;  4FJC C;  3D8C A;  4EEQ A;  1Q81 W;  3G80 A;  2CUG A;  1OV9 A;  1KU9 A;  2WLN A;  1PNK A;  1FS0 G;  3C90 A;  3H1I H;  1XRE A;  3CCJ V;  1H2G A;  4UCV A;  5CN0 A;  4QIW F;  3ZMU A;  1WB7 A;  2JJ2 G;  1FXK C;  4B3R O;  4DV3 B;  2YXH A;  2MK3 A;  4UVA A;  4I9W A;  1N0J A;  1R3J C;  2KB1 A;  3JSN A;  1G6U A;  3D36 A;  1JJ2 U;  1VQ6 V;  2QE7 G;  4B3R B;  3SYQ A;  3CS5 A;  5KHG A;  1NTK H;  4I4T B;  5H2F Z;  2OIE A;  5E79 Z;  3BEH A;  3ABL C;  3OUS A;  3C3S A;  3QF7 A;  3ASN C;  1H2K A;  1PL0 A;  2YS8 A;  1OCR B;  5BY1 A;  3IAY A;  2P22 C;  4DV2 O;  3VOU A;  1SQV H;  1WB8 A;  1BL8 A;  1Z5V A;  1PP9 H;  4DV5 B;  5J2T B;  2AZ0 A;  3G6E V;  3D3Q A;  2ZDI C;  2NLJ C;  4MTF A;  1DTO A;  5LP6 B;  5B5E Z;  3LNN A;  4QNH B;  5FL7 G;  3ETQ A;  4TWK A;  1KP3 A;  5IYC O;  3T4Z A;  3ETD A;  4DYL A;  1M9N A;  3T1Y O;  3HKE B;  4I5S A;  4UUJ C;  2YDE A;  2UXC B;  1XMO O;  5B1B C;  3T1Y B;  1XBL A;  1NTM H;  2KG7 A;  2DYR B;  2C2A A;  4JYB A;  1F4M A;  5BZB A;  2VRZ A;  3ZHS A;  3K0G A;  1IDS A;  3JD3 A;  4PV1 B;  2X6B A;  5GON B;  2GHY A;  1ENV A;  4J7Z A;  3UO3 A;  3H1J H;  2P5O A;  4J42 A;  4R8C A;  1HP8 A;  2XAS A;  2LJ2 A;  1ZL8 B;  1I5Y A;  1QCE A;  3THO A;  1DF4 A;  1SKV A;  3APQ A;  3ZBH A;  2EBO A;  1MSD A;  2P06 A;  4X1K B;  2GSM B;  3RWR D;  1HDJ A;  2QWQ B;  3OD4 A;  1Q82 W;  1M56 C;  4I50 A;  5K1X A;  3DC6 A;  4JYA O;  1FFT B;  4I55 B;  4X8A A;  2XND G;  2CK3 G;  1IUR A;  3AEI A;  5LHH A;  3KG2 A;  5EYP A;  2QWR B;  3LDD A;  2YI9 A;  5KX5 A;  3JAW A;  3G4S V;  5DEC A;  1KD1 W;  3O9O A;  2EZP A;  4YJ2 A;  2EZO A;  1LUW A;  2VS0 A;  2ZE8 A;  1BHB A;  2OIG A;  1JQ0 A;  2WLL A;  2LW7 A;  4KHP B;  3Q4H A;  1PD3 A;  1JR9 A;  3T1C A;  3JSL A;  4DXW A;  1WPB A;  1QLE C;  4J11 A;  5E1A C;  4Q20 A;  3GB7 C;  4JI8 O;  1FPO A;  2GTS A;  2IJH A;  2ZCE A;  4EFB A;  2L35 A;  1N33 B;  2Q4P A;  4PI2 A;  1VQO V;  2WSS G;  3OW2 U;  4JI8 B;  4UCT A;  2VQE B;  2D3O W;  1OHH G;  2XOK G;  1VQ5 V;  2LGQ A;  5GW7 A;  1CEZ A;  4X66 O;  1K7D A;  2ZKO A;  3OM3 B;  2VQF O;  1NJI W;  2AW9 A;  5CA0 B;  1TGO A;  2Q7G A;  5KUM A;  3E89 A;  2OYQ A;  5EIB D;  3K9S A;  4I4T A;  3S3W A;  4ZBM A;  1JA8 A;  4WFH A;  3CCE V;  2ZE6 A;  1RPO A;  4GX0 A;  4DV4 O;  4G27 B;  1N34 O;  3ZCC A;  1KB9 F;  2A3Q A;  2JRI A;  4K8X A;  3STZ C;  4RUF A;  2OCH A;  3MHS C;  1GKF A;  4DV4 B;  1Q7Y W;  5JVD B;  5J2T A;  1Q86 W;  4RQE A;  5BR8 O;  1ZUQ A;  4JAS A;  5LP6 A;  2ZE5 A;  4MSW C;  2E76 B;  2YUA A;  1RP3 B;  2OT5 A;  2Y48 A;  1M4U A;  5BR8 B;  2QSA A;  1O9H A;  3HKE A;  3AG1 C;  4JI7 O;  4DUY O;  1H8E G;  4CC6 A;  4IGG A;  3RGB A;  1WP8 A;  1EZJ A;  4F6E A;  4RQF A;  3JAL B;  1US6 A;  3MD0 A;  2YIA A;  5KHJ A;  1IBM O;  4DR5 O;  3EFF K;  1HWY A;  4H0L B;  2WLM A;  2KKW A;  1WAZ A;  4LFC O;  4QPJ A;  3B77 A;  5GON A;  4PA3 A;  3RW0 A;  3RVY A;  1ZL8 A;  1V54 B;  3ZHQ A;  4BIO A;  4H13 B;  4P30 A;  1SQP H;  2ZQM A;  4DR4 B;  3CSX A;  4X1K A;  2DW4 A;  3E8G A;  4UV8 A;  1BS3 A;  4B7K A;  4BW9 A;  3X2Q C;  1PNL A;  4LP8 A;  4I55 A;  5B66 Z;  3SYP A;  1P49 A;  3OTO O;  3BVO A;  1N32 B;  4O4I B;  1I94 B;  2GUZ B;  1VF7 A;  2B5U A;  4XBF A;  4A5U B;  4BIZ A;  1FXK B;  4LF6 O;  3PN1 A;  3BHP A;  1HNZ O;  1XL6 A;  2F66 C;  2UUA O;  3OMA B;  4UFZ A;  1QVG U;  4FLY A;  4NVP A;  4K0K O;  1SZX A;  1XEQ A;  3NXS A;  1XMQ B;  2QKC A;  2QWP B;  5IYD O;  3K79 A;  5B1A C;  1XIL A;  5LMN B;  3ZRV A;  3LSS A;  1WP7 A;  1JOY A;  1VIB A;  3OEH G;  3H01 A;  3BAA A;  4LH6 A;  1D5A A;  4X65 O;  1SF9 A;  1MG1 A;  3LSU A;  5ITZ B;  4Z2W A;  2UUB B;  4MVQ A;  1FKA O;  3AG2 C;  1BCC H;  2E5L O;  5IYZ B;  5K1P A;  4C7U A;  2QTO A;  5CA0 A;  4MVZ A;  1EFR G;  4DR2 O;  3WU2 Z;  2ADQ B;  1EBO A;  1LUV A;  4LR3 A;  3G71 V;  4DR2 B;  4U3F H;  4DV1 B;  1R73 A;  2Q8V A;  1X4T A;  1S5H C;  1CXZ B;  1VQK V;  3DSQ A;  1H2M A;  4TUY B;  1NZ6 A;  2CDY A;  5IYB O;  4YHH O;  3ASO B;  5LHI A;  3RN4 A;  1JFF B;  3VQX A;  5JVD A;  4B3S O;  4LF9 B;  1G8M A;  1OCO B;  1R6T A;  1OCC B;  3VBB A;  1K5Q A;  1NTZ H;  4B3S B;  1GN6 A;  2F95 B;  2Y0I A;  2JVD A;  3CCR V;  4LC1 A;  3K0D A;  4DR3 O;  1FYJ A;  1GM8 A;  3A0B Z;  2HHH O;  3JYC A;  4CH4 A;  1AI6 A;  4X1Y B;  1M93 A;  2YIC A;  2EIN C;  3L73 H;  2HHH B;  2QDO A;  5LGU A;  3JAL A;  3JD4 A;  4IYH A;  3AK3 A;  1SA0 B;  3J7A U;  1M57 C;  1A32 A;  2HJF C;  3RVZ A;  2DJV A;  1X59 A;  3OR6 C;  3RBZ A;  2PI4 A;  1QU7 A;  5KHH A;  5FNV B;  2Q0O C;  5JCO C;  5LA6 B;  4NR1 A;  3FYI B;  3JAK B;  4GKK O;  5CBH A;  2CTR A;  1GK9 A;  2QKS A;  5BMV B;  4WFG A;  4GLX A;  3HKC B;  3SJA C;  3ZMV A;  4CS2 A;  4K35 A;  1NS1 A;  3AG7 A;  4ASU G;  2N74 A;  2ZM6 O;  4RWU A;  1AVM A;  2X7R B;  4O4I A;  2GUZ A;  1GH6 A;  3F7Y C;  3CEI A;  4ZHQ B;  5IY5 B;  3E22 B;  3TK1 A;  3OGC C;  1FXK A;  2CTW A;  3UT5 B;  4PDV A;  2LO1 A;  1NR1 A;  4DR7 O;  4OX9 O;  1S72 V;  1M1K W;  2LW1 A;  4X88 A;  3A0R A;  1SQQ H;  1VQL V;  4DR7 B;  4ZKI A;  4L87 A;  4JZG A;  3RFR A;  3WFV A;  4J9Z B;  3KZI Z;  4FK5 C;  3BRC A;  1VQM V;  1J95 A;  3JD1 A;  4DR1 B;  3ZRX A;  2IU0 A;  3JAT B;  1KP2 A;  1Q6H A;  3ML0 A;  1HNX O;  5ITZ A;  1JJO A;  3AK2 A;  5CB4 B;  4DUZ B;  2DYS C;  4JI4 B;  1N0N A;  3TJT A;  3CME V;  1H2L A;  3UM7 A;  1YI2 V;  2LFR A;  1HR0 O;  1N36 B;  5IWA O;  1SQB H;  3E86 A;  5IYZ A;  2X6C A;  4MW8 A;  1WNS A;  2Y0P A;  4R6Z A;  3CC2 V;  3T2M A;  1BE3 H;  4JI1 B;  3L9D A;  4WFB V;  2ZXW C;  4FFB B;  3E35 A;  3G67 A;  3ZHT A;  2QKA A;  1IBK O;  2JK5 C;  2UXD O;  1S5L Z;  2NN4 A;  4TUY A;  3SGI A;  2BE3 A;  3QG5 A;  1P7B A;  2EIL B;  3ZMS A;  1IBL O;  2ZR3 A;  1IBK B;  1JFF A;  3E8H A;  4HNA B;  5FPO A;  1GN3 A;  2OWO A;  1GM7 A;  3ZRW B;  2HJD A;  4JTA B;  1BMF G;  1IBL B;  1KKD A;  4GYC B;  1UPG A;  4OGQ B;  3E83 A;  4BIU A;  3ZHV A;  4CC5 A;  3FB8 C;  3STL C;  4X1Y A;  3QO5 A;  2R9I A;  2EJ7 A;  2YC0 A;  3H9V A;  4UVC A;  1TVK B;  2PTM A;  2AXT Z;  1NR7 A;  4DV3 O;  3CRM A;  4YJ3 B;  3GWK C;  1KEC A;  3CRR A;  1SA0 A;  5LGT A;  2QR4 A;  1KQS U;  1EN5 A;  1RPR A;  4K3A A;  2B1G A;  1F51 A;  4LF5 B;  3FKS G;  2ILM A;  3HKD B;  3IC7 A;  5FNV A;  1GN2 A;  3OTF A;  2Q5Z A;  5LA6 A;  1I08 A;  1MZE A;  2H8P C;  1K4C C;  2UU9 B;  4PHZ A;  3OGI B;  1PKX A;  3JAK A;  2VWJ A;  5B1A B;  1V55 B;  1K8A W;  5BMV A;  4DV5 O;  4QGP A;  3DXR B;  1BGY H;  3HKC A;  2V1D A;  3OMN B;  4J7J A;  5DN6 G;  1NVP B;  3CC7 V;  2RQ6 A;  3BPZ A;  1E1R G;  2RCV A;  5IJ9 B;  4ZHQ A;  3E22 A;  5JJN B;  2EX3 A;  2EIM C;  3UT5 A;  2UXC O;  3OT7 A;  2E75 B;  2GDS A;  2CAZ C;  5JJE B;  3RT3 C;  4NXN B;  1NKD A;  2P4K A;  1K3E A;  4WFE A;  2D2C B;  4X20 B;  3CC4 V;  4RUE A;  4WF9 V;  1RSO B;  1S3J A;  1TA8 A;  1AP6 A;  5L3G A;  1DF5 A;  1SQF A;  4KL1 A;  3LSQ A;  3ABM B;  5EK0 A;  2K1E A;  1AJN A;  5LBQ A;  4NKG B;  3JD0 A;  1SS3 A;  3JAT A;  3O65 A;  5H5N A;  4IIJ B;  3N2K B;  5CB4 A;  3AG4 C;  4PD4 F;  4X89 A;  4X9Q A;  2JGD B;  1AI7 A;  3CJH B;  5B1O A;  1G4Y B;  4LFA B;  2RDC A;  1T5E A;  2UXX A;  1GMG A;  3SYO A;  3IFX A;  3CCQ V;  4JGS A;  2Q68 A;  1URF A;  1FD9 A;  3ICX A;  2UXN A;  3D3I A;  4E2L A;  4ZOL B;  2F4V O;  3KCY A;  4FFB A;  4FLV A;  2Q6A A;  5L3F A;  2BTQ B;  4NYK A;  2F4V B;  2FKX A;  3TXQ A;  5JQG B;  3K06 A;  3SPJ A;  1DLB A;  1BQZ A;  3IGA C;  3MAQ A;  4KHP O;  2R9A A;  3CCV V;  4HNA A;  3G6B A;  2XHB A;  3WG7 C;  3ZRW A;  1Q8I A;  2HVJ C;  2RN9 A;  3K57 A;  5J2U B;  1NH2 B;  2VWK A;  1N33 O;  3SJB C;  4JPR A;  1H8H G;  3BY6 A;  1W0J G;  4CH3 A;  2FYU H;  2VQE O;  4KFM A;  3ZN0 A;  1OZ0 A;  2X0L A;  4NTX A;  2UUC O;  4XDL A;  5LOV B;  3D36 C;  1TVK A;  1XOU A;  2CH7 B;  4HBN A;  5CBF A;  2UUC B;  4YJ3 A;  5EIB C;  3P3P A;  3SYA A;  3K5N A;  3ZMT A;  3ABK B;  5JJJ B;  3L75 H;  1VP7 A;  1YSC A;  3QO7 A;  4I9Q A;  1L1F A;  2DWD C;  2PF4 E;  2W6J G;  3HKD A;  4FZ0 A;  4PA6 A;  4H37 A;  1M90 W;  2OCC B;  4FM2 A;  1NQT A;  4IT5 A;  2QM4 A;  1QNM A;  4P9P A;  1JMK C;  5GTH Z;  5L3D A;  1IX9 A;  4PDR A;  2Y69 B;  3RYF B;  2ITD C;  1R3K C;  1PPJ H;  3DXR A;  1B04 A;  5KAI Z;  3W7U A;  2A79 B;  3JCZ A;  4G28 B;  3MHH C;  5IJ9 A;  4JF3 A;  1K92 A;  2Q67 A;  4JI5 O;  4TT3 G;  4P2Z A;  2PZS A;  3K5O A;  1PV0 A;  1VQN V;  5L3E A;  1QR8 A;  4JI5 B;  4O4J B;  1QHT A;  4NXM B;  5EC2 C;  2IJJ A;  4X20 A;  2LFS A;  1RSO A;  1QVF U;  4GUN A;  2ZXW B;  4DR6 B;  1L0N H;  1R3L C;  1LNQ A;  1K4D C;  2WLK A;  1ARO P;  1Q6I A;  4NTY A;  2F43 G;  3K08 A;  5HFL A;  2OTJ V;  4PEL A;  4IIJ A;  3AG3 C;  3N2K A;  4D6T H;  4JI3 B;  4DR4 O;  4ZIB A;  1O9G A;  2R9R B;  2JGD A;  4MVO A;  1Q6U A;  3CJH A;  1Q3E A;  3E8F A;  2UXB B;  3ZHR A;  4K8Z A;  1R1B A;  2K9P A;  3OAA G;  2HR3 A;  4UCS A;  5EBM C;  1Q43 A;  2QA4 V;  1IVS A;  1N32 O;  1IXB A;  1I94 O;  1LR1 A;  2PY5 A;  1K34 A;  1B06 A;  4ZOL A;  3JAR B;  4IL6 Z;  3TXS A;  1ZAU A;  5H6Q A;  4JI6 B;  4MT8 A;  1XNQ O;  2PI5 A;  2CGO A;  3OMI B;  2BTQ A;  4GX2 A;  2L6L A;  5JQG A;  1XNQ B;  2CTQ A;  4J7K A;  2XAJ A;  1XMQ O;  1KKC A;  2P7T C;  3K5L A;  3DTU B;  5J2U A;  5JCO A;  5LMN O;  1KBH A;  3ABL B;  3ASN B;  1J5E B;  1SET A;  4FIP C;  4KUM A;  1VMG A;  1NU1 H;  4GKJ B;  5KAF Z;  2P67 A;  2E74 B;  1K9M W;  5LOV A;  2UUB O;  2CH7 A;  2HVK C;  4U7N A;  1AI5 A;  2Z0A A;  5H9C A;  4JAA A;  1XI1 A;  4QPK A;  1P84 F;  5LMU B;  2EIM B;  2W0X A;  3OR7 C;  1Y76 B;  4X62 B;  3VQV A;  2ZE7 A;  3M99 B;  2ZIM A;  3CXH F;  4HZ3 A;  3H1L H;  4O4H B;  4JZ2 A;  4QJF B;  3I5D A;  1Y6X A;  2A9H A;  4UV9 A;  4DV1 O;  3RYH B;  5B1B B;  1N8R W;  1VQ8 V;  5LP6 C;  2AZ2 A;  3J80 N;  1F7Y A;  3CXC U;  1SER A;  1IZ3 A;  1SQG A;  1JCH A;  2YI8 A;  3RYF A;  1S5J A;  4LF9 O;  2DWE C;  1U96 A;  1NVP D;  5CBG A;  4LH7 A;  4PDM A;  2JEU A;  2B1I A;  4X1I B;  4DV6 B;  4DW0 A;  4X64 B;  4OPH A;  1K5S A;  3TCU A;  3CMA V;  3TET A;  3E8B A;  2DYR C;  3BA8 A;  4FLT A;  1NT2 B;  2KSD A;  1S76 D;  4FLZ A;  5AG2 A;  4DK1 A;  2RJZ A;  5IDJ A;  1ZSP A;  4O4J A;  4B3T B;  4HYO A;  1M56 B;  3EXA A;  1E1Q G;  1ZLZ A;  2A06 H;  3DC5 A;  1YZB A;  5J9P C;  5KHI A;  3OE7 G;  4LNU B;  1SES A;  1N4C A;  5F2V O;  3T4D A;  3T1H B;  1THZ A;  4Q6G A;  5CMU A;  1YXB A;  2WWW A;  3H1K H;  1NI8 A;  3K3W A;  4JTC B;  4TV9 B;  3LNM B;  3WB2 A;  4E4E A;  3LDE A;  3ZMZ A;  2JS5 A;  1MNG A;  2IBZ H;  1Y74 B;  1QLE B;  4JI0 O;  1ROP A;  2FML A;  2WLI B;  4I0X B;  3B40 A;  5D5P A;  4FM0 A;  2ETN A;  4UB8 Z;  3JAR A;  1H38 A;  4JI0 B;  3BAB A;  2XT9 A;  1VQ7 V;  4DO2 A;  1SQX H;  3CCS V;  2CTP A;  5BXZ A;  1SRY A;  2E3C A;  1EN6 A;  2F93 B;  1K33 A;  1S77 D;  1GTO A;  2HKO A;  3OUF A;  3IJ4 A;  4N23 A;  1NH2 D;  5B3S C;  5CA1 B;  4HAM A;  4WBN B;  3WB0 A;  3I55 V;  4LFB O;  2Y4T A;  5IJ0 B;  3R66 A;  1YJ9 V;  1ZX3 A;  3ZS8 C;  4DR1 O;  1I0H A;  4FLU A;  4DRX B;  4WFF A;  3CPW U;  4LFB B;  4BWA A;  4I7Z B;  4GX1 A;  4DUZ O;  1VQP V;  4JI4 O;  4UB6 Z;  2HLD G;  5A2Q N;  4N21 A;  2CGN A;  4AHC A;  1L8D A;  1N36 O;  4GCZ A;  4RO2 A;  2ZDI A;  4GX5 A;  3F5W C;  1DK1 A;  1Y76 A;  3FYE B;  1VF6 C;  1YJW V;  4JI1 O;  4FLX A;  3I56 V;  4O4H A;  4CBC A;  4LF7 B;  3AG1 B;  2M6Y A;  5LYJ B;  4PA7 A;  3RYH A;  2QWO B;  3W7X A;  3CCM V;  4JI2 B;  1HNW O;  5GTI Z;  1U97 A;  2EIK C;  4JV5 O;  2LGW A;  2W6I G;  4LF8 O;  1SC5 B;  3UCS C;  4X1I A;  1HNW B;  3M7M X;  3SR2 C;  4AI8 A;  2DQ0 A;  4JV5 B;  4LF8 B;  1MMM A;  2WA4 A;  2A7W A;  4U3J B;  3SPH A;  3OEE G;  1W0K G;  1P7G A;  1Q90 D;  2FTK A;  1E79 G;  4AQY B;  1VF5 B;  1YCI A;  3FAV B;  3X2Q B;  2QM8 A;  1QLN A;  3R65 A;  4EB6 B;  4LNU A;  3UKM A;  4MTG A;  3TGU H;  4MS2 A;  4LF5 O;  3FB6 C;  4UXN A;  2HFE C;  4DV0 O;  2NNU A;  2XAG A;  4F4L A;  2ITC C;  4TQD A;  2UU9 O;  1L0L H;  4TV9 A;  1K97 A;  3A8T A;  3LDC A;  4DV0 B;  1Y4M A;  2ZNJ A;  1Y74 A;  3QO8 A;  1FXH A;  3B8M A;  3CRA A;  2WLI A;  4I0X A;  1JVM A;  2YXY A;  2IJI A;  4CH6 A;  1MA1 A;  3CHX A;  4D7S A;  2RMK B;  4NB5 A;  3KKY A;  2BCC H;  3JCU Z;  4AIL C;  1UFI A;  4JTD B;  2F1M A;  2ADP A;  4UCR A;  3ABU A;  3JAS B;  3HKB B;  1R6N A;  1VQ9 V;  4RAI A;  1WN7 A;  2XUM A;  4NXN O;  1COW G;  3AG2 B;  3SDL A;  3P3N A;  1FFX B;  4MVU A;  3EHB B;  5CA1 A;  4D7T A;  2FL4 A;  4WBN A;  3JD2 A;  3RYI B;  4DV2 B;  1Z2G A;  3HB3 B;  1G1X B;  3MDS A;  4KXR A;  1R3I C;  1W59 A;  5IJ0 A;  4BAY A;  2Q69 A;  4DRX A;  2B9Z A;  3UQ8 A;  3IC9 A;  1CP9 A;  1VAR A;  2XTA A;  4QE9 A;  5EBL C;  4LFA O;  2IJK A;  1VQ4 V;  2GV9 A;  2IH3 C;  4J9Y B;  2BTO A;  1XMO B;  2ZNI A;  1XHZ A;  2KQX A;  3BA9 A;  1PL4 A;  3A2F A;  3FB7 C;  3FFQ A;  1AR5 A;  4J41 A;  3ASO C;  4PDL A;  1B6Q A;  2DOS A;  5LYJ A;  4WFA V;  1QBZ A;  2EIN B;  1OCO C;  1OCC C;  2IM9 A;  2R70 A;  1MZF A;  3FB5 C;  1WA8 B;  3APO A;  2H94 A;  1M57 B;  3CYO A;  5KMG B;  3QTC A;  3SJQ C;  2A0L A;  1I7F A;  3SYC A;  1YIJ V;  4B7E A;  4BR6 A;  2XAH A;  4Z1M G;  4JYC A;  1M5I A;  3ZX6 A;  5L3C A;  3BFR A;  3F7V C;  2ZD9 A;  4U3J A;  3W7T A;  4JYA B;  3B4S A;  1XNR O;  3E2E A;  1V9P A;  3CE2 A;  2P6J A;  5C8Y B;  1AP5 A;  3ABT A;  1YVW A;  1XNR B;  1PM9 A;  3FAV A;  2NR5 A;  4EB6 A;  1Q5O A;  3OFN G;  5HFM A;  5KA5 A;  3CD6 V;  1QQC A;  5EZY B;  1WLE A;  4J10 A;  3K9A A;  4UCU A;  4IHJ B;  5LGN A;  4J80 A;  2BSK B;  2QTS A;  1BZK A;  1AJP A;  2F23 A;  1YTF B;  4R50 A;  1ZTE A;  1B3Q A;  5B3S B;  3HPL C;  1F4N A;  1XQ8 A;  1RM1 C;  1XDC A;  1MAB G;  3N2G B;  4O2B B;  1S0V A;  5IY5 C;  4TSF G;  4OPA A;  4PA4 A;  5B1N A;  5IT9 N;  3K59 A;  4YIO A;  2ZIN A;  4X66 B;  5LXT B;  3U11 A;  4B08 A;  2VQF B;  1GM9 A;  1H2N A;  4R7C A;  3ZN1 A;  2W0F C;  3ZJZ A;  3SPC A;  4FPP A;  3JAS A;  2DYS B;  3HKB A;  1FAF A;  5H6R A;  4CS4 A;  4O4L B;  2WA3 A;  4EKW A;  4NXM O;  4ZI7 B;  4U7O A;  1FFX A;  2PUS A;  2V4D A;  2ATK C;  1N34 B;  4DR6 O;  2BOB C;  3L72 H;  3CCU V;  1FJG O;  4MVM A;  3RYI A;  1AB3 A;  1OCZ C;  2QJ1 A;  2Y4U A;  1FJG B;  2JEX A;  1D2D A;  2HG5 C;  1BQ0 A;  1XHX A;  3CRC A;  2EIJ C;  2EIK B;  2JGU A;  4JI3 O;  4MTX A;  1OJH A;  1TUB B;  1KC8 W;  1MOF A;  3QVN A;  4H44 B;  4DK0 A;  2UXB O;  2QWN B;  3B2E E;  1AJQ A;  4JI7 B;  1KUQ A;  3GVM A;  4DUY B;  3FX7 A;  4NTW A;  3RYC B;  2Z5U A;  2ZT9 B;  2ZIO A;  2V7Q G;  3B8N A;  4YY3 O;  4FZ1 A;  4TV8 B;  2EIL C;  4JI6 O;  4XDJ A;  4WCE V;  3U10 A;  1IBM B;  2IH1 C;  4YY3 B;  2YIB A;  1GAX A;  4CH5 A;  3KCX A;  4DR5 B;  3B09 A;  1EM1 A;  4OXS A;  4LFC B;  4LBE C;  5A9G A;  3WB1 A;  5FLX N;  2O57 A;  2JJ1 G;  4L8J A;  1WA8 A;  2LQT A;  4DW1 A;  5CA3 A;  2AHZ A;  5KMG A;  2PYJ A;  3PJS K;  3K58 A;  3ETE A;  5TIS Z;  3GWO A;  2ODM A;  3NR7 A;  1BHA A;  4P9O A;  1J5E O;  2PYL A;  2DN9 A;  2P4V A;  3UO2 A;  4GKJ O;  3LUT B;  2Q73 A;  4PA9 A;  4EFE A;  3K5M A;  1YEW A;  4O2A B;  3S3X A;  4TOI A;  2ARH A;  1Z5W A;  4F6R B;  3OTO B;  5C8Y A;  2CE4 A;  2ZR2 A;  4ABM A;  1NBM G;  1KMI Z;  5LMU O;  4X62 O;  3U0Z A;  3CWB H;  4LF6 B;  5EZY A;  3VQY A;  1HNZ B;  1K73 W;  2UUA B;  3J81 N;  4FM1 A;  4W4K A;  2JDI G;  1OCR C;  4IHJ A;  1V55 C;  1Y67 A;  4K0K B;  5LHG A;  2BSK A;  3SPG A;  1FXV A;  2WLJ A;  1XL4 A;  1P4R A;  2WLH A;  3DGE A;  4DV7 O;  2GBO A;  4B3M O;  2HP8 A;  3CP1 A;  3H1H H;  2YSU B;  1GO3 F;  5DM6 V;  4DV7 B;  5D5Q A;  3N2G A;  4O2B A;  1KYO F;  4JAU A;  4B3M B;  2FB5 A;  3ZHU A;  1JX9 A;  4X65 B;  4IYI A;  4PI0 A;  2BOC C;  4DV6 O;  1BSM A;  4FMT A;  5JH7 B;  4X64 O;  5LXT A;  1CPY A;  4LWS B;  3CCL V;  1WPX A;  2H3O A;  1QR9 A;  2JS3 A;  2E5L B;  2EJR A;  2QGN A;  3AG4 B;  2IU3 A;  4B3T O;  4O4L A;  2M7W A;  1VF6 A;  3ABM C;  1VEW A;  4ZI7 A;  1MSW D;  3BCC H;  2GTA A;  1AIL A;  2YEV B;  3CX5 F;  4JYY A;  1YJN V;  5KA6 A;  2N04 A;  3T1H O;  3AK1 A;  4YHH B;  2R72 A;  3W7S A;  3VQW A;  5KHK A;  4YXW G;  2DMX A;  2RNB A;  1YF2 A;  1YHQ V;  4CS3 A;  1TUB A;  1F23 A;  4FVM A;  1IXM A;  3WG7 B;  4DR3 B;  3EVK A;  4PJ0 Z;  3QNE A;  3SPI A;  3RYC A;  2Q7E A;  3L71 H;  5JWP A;  2X6A A;  2Z3Y A;  3K03 A;  5EC1 C;  4TV8 A;  5DED A;  2YIB D;  2JIZ G;  1AI4 A;  3CRQ A;  3L70 H;  1YDX A;  1Y66 A;  3ZIA G;  2WAM A;  1ZWI C;  1GN4 A;  4MVS A;  1YIT V;  4TQF A;  1W2B U;  4JAV A;  1EN4 A;  2YXL A;  2N05 A;  2P90 A;  4G2K A;  4UCO A;  4CZZ A;  4Z1V A;  2XAQ A;  4GKK B;  3ZED A;  4MVR A;  2G38 A;  4MW3 A;  1PNM A;  1RM1 B;  2MW2 B;  2HEP A;  4KP4 A;  4O2A A;  3ABK C;  2XAF A;  4F6R A;  2ZM6 B;  2WPD G;  3C3T A;  5EBW C;  4H33 A;  1SZT A;  2AHY A;  5LL6 Y;  1XUQ A;  2OTL V;  1R6K A;  1AR1 B;  2QEX V;  3F5T A;  1H2S B;  2OCC C;  4LF4 O;  1BT8 A;  5L3B A;  3A0H Z;  4MTO A;  4FFK A;  4UVB A;  4OX9 B;  1TAE A;  3W7W A;  4LF4 B;  4LCU C;  4LF7 O;  3FD9 A;  2KG7 B;  3HR0 A;  2Y69 C;  1YTF D;  2IW5 A;  5C93 A;  3ZRS A;  2EUL A;  2Q7H A;  1EZV H;  5FPR A;  5KLV H;  4GT1 A;  5IE9 A;  4JI2 O;  2DQ3 A;  1OCZ B;  2Q9L A;  1WJZ A;  4W4L A;  4XDK A;  2LP7 A;  4QE7 A;  1HNX B;  5JH7 A;  4BW5 A;  3N27 A;  2EIJ B;  4LWS A;  1RFY A;  1JPX A;  1ORQ C;  5KUK A;  4YIP A;  1HR0 B;  1HW7 A;  3ETG A;  5IWA B;  3P30 A;  4I50 B;  2PGG A;  3AG3 B;  3M8A A;  2YID A;  4AQY O;  2AGA A;  3K04 A;  5EYP B;  1D5N A;  4ICG A;  5KX5 B;  3JAW B;  2DE0 X;  1GRJ A;  3CB2 A;  4FLW A;  1AR4 A;  2UXD B; 
#chains in the Genus database with same CATH homology
 4FZ0 A;  4NYK A;  2FB5 A;  3S3X A;  3S3W A;  1WP8 A;  2QTS A;  2L35 A;  1WP7 A;  3N27 A;  4NTY A;  4NTW A;  3IJ4 A;  4FZ1 A;  4NTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...