4NTWA

Structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
412
structure length
410
Chain Sequence
b'VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
molecule tags Transport protein/toxin
source organism Gallus gallus
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
total genus 109
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntwA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntwA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntwA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntwA02
3IJ4A 4NTXA 3S3WA 4NYKA 2FB5A 2L35A 2QTSA 1WP7A 4FZ1A 4FZ0A 1WP8A 4NTWA 4NTYA 3S3XA 3N27A
chains in the Genus database with same CATH superfamily
1KKCA 4ZHQA 4MTOA 4B3RB 1VF7A 4D6TH 2ZDIA 4PI2A 3JAKB 4O4JB 3K0DA 2HP8A 4J7JA 1AP6A 2GTSA 4LCUC 2YC0A 1DF4A 1D5AA 5LA6A 3CS5A 3T4DA 2EZPA 3STLC 3D3IA 3DSQA 3K03A 3J80N 1LNQA 1OHHG 2GV9A 1E1QG 2Q8VA 3ETEA 1PL4A 5EC2C 2ZT9B 1ZX3A 4FFBA 2IH3C 2XAHA 1V54B 4TV8A 3OM3B 4I50A 3IFXA 3K9SA 4J10A 3CMEV 3DC5A 2XUMA 1F4MA 3CSXA 4XDKA 1VQMV 4GCZA 4Q6GA 4GUNA 2R9IA 4CS3A 4MVQA 3ZRWB 1VF5B 3JASA 3FAVA 2QM8A 1Q6IA 3OR7C 1Q7YW 1XNRO 1N33B 4I9QA 1SQXH 5D5PA 1GM8A 4R7CA 4K3AA 2Q69A 3P3PA 4LNUB 3JD4A 4IGGA 1A32A 4CH5A 2CTWA 2QWNB 1K4CC 4UCVA 1Z5VA 2MK3A 4DYLA 2CUGA 1HNZO 4MTXA 4LFBB 1M4UA 2AW9A 4BIUA 4EFBA 1IVSA 2Q6AA 1L0LH 3OMIB 2NN4A 1XMQB 1N36B 4I55B 1GN4A 2QKAA 4JYAO 1AR5A 1PV0A 5CN0A 1IXBA 1CEZA 1XUQA 1Q5OA 5J2UA 2XHBA 3F7VC 1R6TA 1OCRB 3RYIA 3CCJV 3OFNG 2PUSA 4PELA 1OCZC 1Q82W 3IGAC 2QE7G 1Z2GA 4WFEA 1CPYA 4UV8A 3ABKC 2DWEC 2QJ1A 1S5LZ 1JJ2U 1OCOB 4NXMB 1AP5A 5IYZB 1YXBA 2XOKG 3HKEA 3JD3A 3QF7A 3MHHC 4BW5A 2QGNA 5LXTA 2PYLA 2Q68A 3DC6A 2Q7EA 3B09A 1B04A 4PDRA 3ABMB 1R3JC 2CK3G 3IAYA 3N2GB 4JTAB 3ETDA 1AJQA 2JEXA 3UT5B 4X8AA 2YUAA 2CAZC 2ZIOA 2YXHA 5JWPA 2OCCB 2PI4A 3ZEDA 1THZA 1S76D 1KB9F 5B3SC 4B7KA 1R6NA 5BXZA 1O9HA 2DW4A 4BAYA 3K5LA 3K59A 2Q0OC 4PJ0Z 3K3WA 3AG2B 3ZRVA 1AR4A 1PL0A 1PM9A 4LFAB 5ITZB 1QR8A 3B8MA 3VBBA 1K33A 3E8FA 2PF4E 5CA0B 4OPHA 1FXHA 3ABLB 4DUYB 1MNGA 2P22C 2EILC 1YJWV 1LUVA 2DE0X 4GZRB 5B1BC 2RNBA 2C2AA 1NKDA 1RM1C 1AI4A 1V55B 1XBLA 1JVMA 3UT5A 4DR4O 5LGNA 5L3CA 1NR1A 5JH7B 3Q4HB 3OD4A 1MSDA 4IL6Z 2YXYA 1ZUQA 3A8TA 4JI3B 2R9AA 3QTCA 1BZKA 5KHHA 4TV9A 1EBOA 4X65B 3SJAC 1N32O 3HKCB 2WLJA 3E8BA 2IJHA 3P30A 3NR7A 4X1KB 1QHTA 2DOSA 4JI4O 3W7TA 5B3SB 2Z3YA 2LW1A 2YEVB 4WF9V 2QWRB 4LFCO 4LF5B 2ZQMA 5KMGA 4LF9O 5EBMC 3RYFB 1WB7A 4J7KA 2OWOA 5JVDB 4YJ3A 1QU7A 2HKOA 4GKJO 5CA3A 1SKVA 1IXMA 2HR3A 3LSSA 1FAFA 1M9NA 1N34O 2ADPA 4RUEA 1WPBA 3CRQA 4BIZA 2LGWA 3AK1A 1BCCH 4LH6A 4X62O 1AVMA 1FKAO 2UXDB 5F2VO 4MW3A 2UUCB 2G38A 1OCOC 4IHJA 2X7RB 1G4YB 2YIDA 3L73H 4CC6A 2R72A 1I5YA 1H8HG 3BEHA 4QE9A 3FX7A 1R3KC 2A3QA 2JDIG 5DM6V 2VQEO 2XAJA 2P5OA 1ZWIC 4EB6A 1FJGB 2KSDA 1SQQH 4AQYB 4O4LB 1SA0B 4CH6A 4LWSB 3R65A 3HKBB 4ZI7A 3K9AA 4AI8A 5KHIA 1DLBA 4O4JA 4X64O 1SERA 1JFFA 4EEQA 2LW7A 5EBLC 2XTAA 4GX5A 5IYCO 2UXCO 3TGUH 2WLIA 1MA1A 1GKFA 4FZ0A 4KP4A 3OUFA 4LP8A 1YCIA 1FJGO 4WBNA 3JD1A 3IC7A 4I5SA 1GM9A 1XHZA 2IJKA 4J9ZB 1SESA 2N05A 1X4TA 3KCYA 1JCHA 1VEWA 1XQ8A 3DXRB 2W0FC 1DGSA 2HJFC 1M57B 3ZMZA 2UXCB 4YY3B 2XAGA 5FNVB 2WSSG 4X1IA 2LGQA 4JZGA 2WLMA 1GN2A 5H6QA 1GK9A 3HKDA 3RN4A 3G4SV 4DK1A 5ITZA 1FXKA 4PI0A 5LL6Y 4KHPO 4GKKO 4EB6B 4IIJB 3T1HB 4K8XA 2RN9A 5LMNB 4TOIA 1K3EA 4RQFA 4E4EA 5BMVB 5CB4B 2EIJC 1XMQO 4CBCA 3OTOO 4YY3O 4KXRA 2L6LA 1ORQC 1IBKB 4X89A 4O2BB 1VQ8V 1SQBH 1NS1A 3ASOC 5CA0A 4FLVA 1ZLZA 2FL4A 1EN5A 5H2FZ 2YIBD 4UXNA 1VQ4V 5IJ0A 2EIJB 4JAVA 4UB8Z 3TCUA 4JI5O 4X1YB 4ZI7B 4FPPA 4CH3A 1XNQB 3GVMA 5GW7A 2ZNIA 2KB1A 5EIBD 2OIEA 5H6RA 4JI1O 4JI8B 3AK2A 1XMOO 1HNWB 4I0XB 1R3LC 2HVKC 3N2KB 1JPXA 3TETA 2V1DA 3E35A 4DR1B 1UJWB 4QE7A 2ZIMA 4NR1A 2ILMA 1SZXA 2QR4A 1W2BU 2WPDG 1IBLO 3VQWA 1P84F 4B3SB 4PD4F 4PHZA 3VQVA 2F1MA 5KA6A 3H1JH 5AG2A 1H8EG 2WLHA 3QNEA 3ZJZA 5IJ9B 2K1EA 1OCCB 3D8CA 2JS3A 1H38A 2UUBO 4PDLA 4DR2B 4LFBO 5FPOA 3OTFA 1YZBA 4QIWF 1GAXA 3LNMB 3LSQA 3E86A 4YIOA 4LF6B 4LFCB 1YIJV 4I0XA 1ZAUA 1KBHA 3JAWB 4W4LA 3U11A 4WCEV 1M56B 1VQOV 5IJ0B 2F66C 1FFXB 3S3WA 4O4HA 2WAMA 3ICXA 3LSUA 4X62B 5IJ9A 2Y48A 4UCRA 4UB6Z 4P2ZA 4X65O 4CS2A 2F4VO 4FM1A 3MAQA 3ABTA 3RYCA 3KZIZ 4WFGA 3ZX6A 5KX5B 2UXBB 1NT2B 2F43G 2W0XA 1YTFB 5LHHA 1VQKV 4FVMA 3KKYA 1SQFA 1H2GA 3GWKC 2VQEB 1S77D 2P6JA 3E22B 4LF5O 2Q73A 2ZINA 1NJIW 1GN3A 5B1NA 1E79G 1IURA 5C8YB 5IWAB 2CTRA 2Q67A 3CX5F 1HP8A 2Z0AA 1D5NA 4QGPA 1MZFA 3RYHA 2XAQA 4FLYA 2EULA 3G67A 2ITDC 4DV5O 2HVJC 4U3JB 1X59A 3UCSC 2ZDIC 3G80A 2P67A 5B5EZ 3AG7A 1MSWD 4QJFB 3THOA 1M5IA 4PA7A 3OMAB 3AEIA 2CTQA 4C7UA 4DV2B 1BHBA 4B7EA 2PTMA 1S72V 4JPRA 3CCVV 1R6KA 3CCQV 2BSKA 1AROP 3BFRA 2NLJC 4TWKA 3CCLV 2JJ1G 2YEVA 2B1IA 3VQYA 4L87A 3O65A 4PA3A 1S3JA 3JARB 1XL6A 3M99B 3UO2A 4I50B 4J42A 2QWPB 5B1AB 1RPOA 4J41A 4DUZO 1D2DA 4DK0A 1PNKA 2ZE7A 2WA4A 3N2KA 3B8NA 3ZHRA 1SA0A 2GUZB 4AILC 1NVPB 1FFTB 1QLEC 4LF9B 1HW7A 2AHZA 1RM1B 3BCCH 2EJ7A 2DQ3A 1KECA 3C90A 4DV3B 1JA8A 4MTFA 4WFBV 2WLNA 1Q86W 3QO5A 1Y74A 2IW5A 2Q7HA 3OAAG 1HDJA 2B9ZA 2RQ6A 4UVCA 5JH7A 2FMLA 1BSMA 3CCRV 4IYIA 2LO1A 5JQGA 4OX9O 2AHYA 1MG1A 4K35A 4IYHA 3T4ZA 3N27A 3OMNB 1K4DC 5FLXN 4JTCB 3SJCC 2VQFB 4UFZA 3QO8A 2NNUA 5BMVA 4MVMA 4X9QA 1BMFG 1L8DA 4B08A 1M1KW 3OTOB 3OGCC 3FYIB 4MVRA 1KU9A 4JI7B 3C3TA 4DO2A 2YS8A 3ABMC 1Q6UA 3G6BA 2UUAO 3D36C 1PNMA 4I7ZB 4OX9B 2DQ0A 3ZRXA 5KHJA 4DR6O 3CRMA 3L72H 2BTOA 1AI5A 4DR3B 4FM2A 2GDSA 2IJIA 2P90A 4LF7B 1SQGA 1YHQV 4PA6A 2Q9LA 2OT5A 4DR2O 1KP3A 2EIKB 4GT1A 3J7AU 1ZL8A 2E5LO 5KMGB 1WA8A 2UUAB 2DYSB 4FLTA 5GTHZ 5KLVH 3Q4HA 1YITV 2A79B 5JJNB 2QWQB 4ICGA 1M56C 4KL1A 1H2SB 1YSCA 2N74A 2CE4A 1KQSU 1Q43A 3KCXA 4N23A 1H2MA 3K5MA 3DGEA 1XEQA 3CP1A 3ASNB 2JRIA 3SPHA 1QLNA 3H9VA 1N34B 3RWRD 4KHPB 2WA3A 3OT7A 3QVNA 2UUBB 4G28B 3I5DA 4K0KB 2E5LB 1JR9A 3SYPA 3VQXA 4Z2WA 4ZHQB 1K73W 1BL8A 4J80A 4Q20A 2W6JG 3ML0A 4JAAA 1B3QA 3BHPA 5EIBC 3E8HA 1Q90D 1WB8A 2IJJA 3CE2A 3CCUV 4WBNB 2KG7B 3RT3C 2BOBC 2H3OA 5B66Z 4FLZA 2CH7A 2ZXWB 3A0RA 3JCZA 3CD6V 1ZSPA 3ZN1A 1L0NH 3DXRA 3AK3A 1H2NA 1HNZB 5B1AC 1BS3A 1JX9A 2VS0A 3QG5A 2F93B 2DYRB 5J2TB 2WLIB 1N36O 5CA1B 4X66O 2DYSC 1RP3B 3H1KH 1B6QA 4N21A 3CB2A 3BPZA 3SJQC 3CCEV 5JCOA 4JF3A 3CXHF 1OV9A 4CS4A 4CH4A 3CC7V 2UXXA 1F51A 4TSFG 2UXDO 5GONA 3X2QC 4YHHB 4WFFA 4X88A 3JSNA 4NXMO 1PP9H 3VOUA 2OCHA 4P9OA 1TAEA 1MABG 2ZM6B 1EN4A 1YEWA 3K06A 1TGOA 2ETNA 2JEUA 4F6RB 4Z1MG 4RQEA 3ZMSA 1UFIA 4I9WA 3CMAV 4R8CA 1NH2B 2V4DA 4LF8B 2VRZA 2HHHO 1M93A 3LDEA 4NB5A 4UV9A 1WLEA 3TK1A 1AI7A 3P3NA 3SPGA 1F7YA 1Q3EA 1K5SA 3JCUZ 1J5EB 4F6RA 4LF4B 1MMMA 3ZHQA 5LMNO 4DV3O 3JD2A 2A9HA 4FLUA 1VARA 1ENVA 3DTUB 2ZM6O 3AG2C 4UCOA 1I94O 1K8AW 2DN9A 1ROPA 5HFMA 2ITCC 5C8YA 4MVOA 2Y4UA 1WAZA 4JYBA 3SYCA 2AXTZ 3CCSV 1FXKB 4PA9A 2JGDB 1NU1H 4X1YA 5LHGA 4ZIBA 5E1AC 3UM7A 1SS3A 4DR5B 5FNVA 4F4LA 4LF4O 1QLEB 2Y0PA 4TV8B 4DV6O 4KUMA 5KUMA 1H2KA 1KP2A 5KHGA 1I08A 1I5XA 1DF5A 3E2EA 2X0LA 3HB3B 3IJ4A 1CXZB 3ZMVA 3W7XA 5IWAO 3BA9A 3G6EV 2A06H 1HNWO 5B1OA 1XDCA 1ZTEA 2QKCA 1VP7A 4JYYA 5B1BB 3CXCU 1YVWA 5LMUO 4DR3O 4O2AA 3ZMTA 1RSOA 3M7MX 1OCZB 3H1IH 3ZN0A 2GHYA 5EC1C 4W4KA 1UPGA 1SQVH 2MW2B 4EKWA 1YJ9V 3CC4V 1SZTA 5CBHA 3JALB 4JI6O 2Y4TA 5BZBA 4H37A 1JJOA 4DW1A 3IC9A 3WB1A 1P7BA 4O4IA 1F4NA 1WPXA 3HKCA 4LF6O 3JASB 4DV7B 5EK0A 3BAAA 4TT3G 1XNQO 1YDXA 1QCEA 3JYCA 5CMUA 3BRCA 3F7YC 4O4IB 2E3CA 1P49A 4AQYO 2P7TC 1HR0B 4GX2A 3E8GA 2LJ2A 3ETGA 2CGNA 3L9DA 4R6ZA 1GMGA 1WNSA 2YDEA 1NR7A 1VQ9V 1Q81W 3OR6C 3CPWU 3JATA 2XAFA 5K1XA 1V55C 1GM7A 3FB8C 3W7UA 4UCUA 2LFSA 1AJNA 3KG2A 1F23A 2LP7A 3D3QA 1HR0O 4JI3O 5LP6C 3SYAA 5EZYA 4LH7A 3SPJA 3ZHUA 4IT5A 1AJPA 5IE9A 2X6AA 4X20B 1TUEB 2VWKA 2FTKA 3L70H 1P4RA 3UO3A 1W59A 2HFEC 5IY5C 1CP9A 1HWYA 1SC5B 4GYCB 2F95B 3RYFA 3RYIB 5JQGB 2Q5ZA 3RYCB 4DW0A 4BWAA 5IYDO 4YJ3B 3W7SA 3FB5C 2F23A 3SPIA 5BR8B 1BT8A 5FPRA 2JIZG 2Y0IA 2N04A 4X1KA 4FM0A 4ZBMA 1WA8B 4DV4O 4I55A 5GONB 4PDMA 3OE7G 4O2AB 2CDYA 1VQNV 3STZC 1VF6A 3D36A 3K58A 3RBZA 1IBKO 4NTWA 4H0LB 4LFAO 4YJ2B 1L1FA 1TVKB 4DRXB 3RVYA 1WP7A 2GUZA 2JS5A 1NQTA 5HFLA 4H33A 3ZS8C 3JATB 1ZL8B 1FD9A 1NTZH 3SPCA 2H94A 1S0VA 4BW9A 3T1YB 5BY1A 1W0KG 1KD1W 1I94B 2PI5A 2QM7A 1SETA 1NI8A 2QWOB 1R73A 2QEXV 5IYBO 1JQ0A 2CH7B 4X64B 1FYJA 1GN6A 3FFQA 4QPKA 4JI8O 4JTDB 3PN1A 1AR1B 2ZE5A 2OCCC 4DV2O 2XT9A 3SR2C 2EJRA 3WU2Z 3LDDA 1IBMB 2LFRA 5LHIA 2PY5A 4X1IB 4JI4B 4TQDA 5EBWC 5LGTA 4DV6B 3EFFK 4NVPA 5J2UB 2NR5A 2BTQB 4RUFA 5KAFZ 3H1LH 2ZKOA 1GH6A 4GKJB 1O9GA 3K5NA 1YTFD 2B1GA 3K08A 4NXNB 3AG4C 4HZ3A 4JZ2A 2WLKA 3FYEB 1TUBA 5L3GA 1M57C 3SYOA 4U7OA 2ARHA 3K5OA 4RWUA 1URFA 4I4TB 4AHCA 4TUYB 4DR5O 2JJ2G 2FKXA 4ZKIA 3L71H 2HG5C 5JVDA 5LYJB 1AILA 4NXNO 4FLXA 3OGIB 4LF7O 1EZVH 1YJNV 4FJCC 4JI6B 1LUWA 3M8AA 1N0NA 4NKGB 3AG1C 4G27B 3ZBHA 3JALA 1NBMG 4U3FH 4MTGA 2YSUB 4DR7B 2YI9A 2HLDG 3LDCA 3CCMV 3CJHA 5LMUB 2E76B 4XDJA 4L8JA 2VQFO 4NTYA 3E83A 1COWG 2XASA 3F5TA 3E22A 1KKDA 4JI7O 1EZJA 2FYUH 1K7DA 2KQXA 2YIAA 4P30A 1XREA 4O2BA 3UKMA 4MVUA 4JI2B 3O9OA 2EIMB 3CC2V 2Z5UA 1N32B 4DR7O 4B3MO 3B40A 3W7WA 4FFBB 1PPJH 5EYPB 2WLLB 2HEPA 4UVBA 1IBLB 5C93A 3A0BZ 1I0HA 2QKSA 1JOYA 4U7NA 3FB6C 4K8ZA 1N4CA 1HNXO 1Y6XA 4DXWA 1OZ0A 1NZ6A 2RCVA 1EM1A 5LA6B 4NTXA 2Y69C 2YIBA 2YI8A 4JV5B 1SF9A 1Y76B 1JMKC 3ZRSA 3WB2A 1KYOF 1Y4MA 5TISZ 4F6EA 4MVSA 1H2LA 5D5QA 1Q8IA 2IM9A 4FFKA 1NH2D 2XNDG 2P4KA 1PKXA 5GTIZ 5H9CA 5LOVA 2DWDC 1IDSA 1VIBA 3A0HZ 5H5NA 3CEIA 4GX0A 3FKSG 4JASA 5KX5A 1YF2A 3CRRA 2OTJV 1IX9A 3RVZA 4FZ1A 3U10A 4EFEA 4DUZB 1XL4A 5IYZA 3GB7C 4FK5C 3ZCCA 3TXQA 4FLWA 4JV5O 4MSWC 1DK1A 4CZZA 5EZYB 4YHHO 3K79A 3JSLA 1OCCC 4H13B 5KUKA 3J81N 3EVKA 2E75B 2DMXA 3JD0A 4X20A 1SQPH 4HNAA 1QQCA 4PDVA 2GSMB 1XILA 5L3BA 1TVKA 4H44B 3MHSC 4J11A 3JAMN 2R70A 4G2KA 3WG7B 1S5JA 5LXTB 3U0ZA 2JK5C 4UUJC 1XHXA 3ABUA 3JAWA 5BR8O 3NXSA 1K34A 3UQ8A 2PYJA 1QNMA 4B3RO 4B3TB 3S3XA 2IBZH 1BE3H 2JGDA 4RAIA 1N0JA 4TUYA 1B06A 1PD3A 1OJHA 1Y67A 1VQ5V 2V7QG 3MD0A 2P06A 1KC8W 4YIPA 1V9PA 4E2LA 1VQ7V 1K97A 2ZNJA 3HKEB 3K57A 4MW8A 1G1XB 4FMTA 1VF6C 3ASOB 1DTOA 3SJBC 1VQ6V 4DR6B 2UU9O 1FXVA 5CB4A 4ZOLB 3T1HO 2O57A 1QR9A 2Y69B 4GLXA 2EINC 1QBZA 1T5EA 2IU3A 4PV1B 1FXKC 2BOCC 2GBOA 4U3JA 3L75H 4XDLA 2M6YA 1RFYA 2AZ2A 5A2QN 3ETQA 4OXSA 1OCRC 4UCSA 2UXNA 2PZSA 1N8RW 1R3IC 1XNRB 4KFMA 5DECA 2F4VB 2HHHB 3ZHVA 5JJEB 5LGUA 1G8MA 4DUYO 3T1CA 1IBMO 2UU9B 1BHAA 2OTLV 1J5EO 1SRYA 2A7WA 1WJZA 3R66A 2ZR3A 2BCCH 3E89A 3MDSA 4ZOLA 2HJDA 4HYOA 2BE3A 4JI1B 5L3EA 4DV1B 1KMIZ 2JGUA 2Q0AA 4JAUA 1XMOB 3EXAA 2H8PC 2W6IG 3EHBB 2BSKB 4OGQB 4DR1O 1Y74B 3B4SA 4DV5B 2ATKC 2RDCA 3ZHTA 5J9PC 1GRJA 3LUTB 2ZCEA 2RMKB 3B77A 4JI0O 3T2MA 4B3SO 1S5HC 4RO2A 2WWWA 1FPOA 3JAKA 2Q4PA 4I4TA 5FL7G 2QA4V 1EFRG 4O4HB 1VQLV 4UCTA 4UVAA 4YXWG 4YJ2A 3H01A 4JI2O 3JARA 1JFFB 3HR0A 3TJTA 2EILB 5JCOC 1BGYH 3OEEG 3T1YO 2ODMA 4TV9B 4TQFA 4MVZA 1NTKH 3GWOA 2ADQB 3WB0A 2D2CB 4NYKA 4JI0B 2JVDA 2LQTA 4LC1A 3AG3B 2M7WA 2WLLA 2ZXWC 3WG7C 1N33O 2DJVA 2PGGA 2ZE6A 4J9YB 3FAVB 4XBFA 1M90W 3AG3C 1NVPD 1FS0G 2VWJA 4FIPC 5LP6B 1E1RG 2RJZA 1TA8A 3L74H 3OEHG 3BVOA 1TUBB 4GX1A 3FB7C 1Y76A 3HPLC 2L35A 4D7TA 1K5QA 5CBFA 4DV7O 4DRXA 4B3MB 2X6CA 1FFXA 3HKDB 3HKBA 2B5UA 3BY6A 1MZEA 2EINB 2ZE8A 3ASNC 3CYOA 4WFAV 1Y66A 5L3DA 2Q7GA 1IZ3A 4P9PA 3SDLA 5A9GA 4LNUA 3CWBH 3ABKB 3RGBA 3N2GA 2KKWA 1KUQA 5KAIZ 1VMGA 4JGSA 4QNHB 4LR3A 4K0KO 2X6BA 4J7ZA 1NTMH 1WP8A 3K04A 4JI5B 3ZMUA 2R9RB 2ZR2A 1AI6A 3RW0A 3AG1B 1GTOA 1WN7A 1PNLA 1BQZA 5LBQA 5J2TA 4JYAB 1U97A 3WFVA 1K92A 3BABA 4BIOA 3OW2U 1R1BA 3SGIA 3OUSA 3ABLC 3LNNA 3TXSA 1Z5WA 3CRCA 1MOFA 2K9PA 4PA4A 3APQA 3P32A 4CC5A 1US6A 4ASUG 4B3TO 3QO7A 3ZHSA 1J95A 1EN6A 2EX3A 1K9MW 5IDJA 4LWSA 5E79Z 2UUCO 2OIGA 2E74B 5JJJB 2QM4A 4IIJA 2P4VA 2QTSA 1RSOB 2QTOA 3AG4B 3FD9A 5DEDA 1GO3F 1BQ0A 1G6UA 4R50A 4HAMA 3RYHB 1V54C 5K1PA 3H1HH 1U96A 3CHXA 5KHKA 3PJSK 3B2EE 4IHJB 4DV4B 2IH1C 2QSAA 5CA1A 5EYPA 2GTAA 3C3SA 5LYJA 3APOA 1P7GA 3ZRWA 4QPJA 2CGOA 1HNXB 5LOVB 2AZ0A 4LBEC 2CTPA 3CRAA 2QDOA 5KA5A 1AB3A 3CJHB 2D3OW 4A5UB 1XI1A 1RPRA 4DV0B 2BTQA 2OYQA 4LF8O 3RFRA 2ZD9A 1LR1A 2EZOA 4MS2A 5CBGA 2EIKC 5DN6G 2UXBO 3F5WC 2EBOA 4D7SA 4DR4B 2YXLA 1XOUA 4DV1O 2IU0A 3I55V 4HNAB 4JYCA 1Q6HA 4O4LA 4ABMA 2EIMC 3I56V 4BR6A 1VQPV 5LP6A 4DV0O 4MT8A 3ZIAG 4Z1VA 4X66B 5L3FA 1QVFU 2YICA 4WFHA 1YI2V 3G71V 4HBNA 4GKKB 3SYQA 2FB5A 2DYRC 3BA8A 1W0JG 3X2QB 2KG7A 2A0LA 1QVGU 3K0GA 4OPAA 5IY5B 5IT9N 3A2FA 2AGAA 1I7FA
chains in the Genus database with same CATH topology
3IJ4A 4NTXA 3S3WA 4NYKA 2FB5A 2L35A 2QTSA 1WP7A 4FZ1A 4FZ0A 1WP8A 4NTWA 4NTYA 3S3XA 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IJ4 A;  4NTX A;  3S3W A;  4NYK A;  2FB5 A;  2L35 A;  2QTS A;  1WP7 A;  4FZ1 A;  4FZ0 A;  1WP8 A;  4NTW A;  4NTY A;  3S3X A;  3N27 A; 
#chains in the Genus database with same CATH topology
 1KKC A;  4ZHQ A;  4MTO A;  4B3R B;  1VF7 A;  4D6T H;  2ZDI A;  4PI2 A;  3JAK B;  4O4J B;  3K0D A;  2HP8 A;  4J7J A;  1AP6 A;  2GTS A;  4LCU C;  2YC0 A;  1DF4 A;  1D5A A;  5LA6 A;  3CS5 A;  3T4D A;  2EZP A;  3STL C;  3D3I A;  3DSQ A;  3K03 A;  3J80 N;  1LNQ A;  1OHH G;  2GV9 A;  1E1Q G;  2Q8V A;  3ETE A;  1PL4 A;  5EC2 C;  2ZT9 B;  1ZX3 A;  4FFB A;  2IH3 C;  2XAH A;  1V54 B;  4TV8 A;  3OM3 B;  4I50 A;  3IFX A;  3K9S A;  4J10 A;  3CME V;  3DC5 A;  2XUM A;  1F4M A;  3CSX A;  4XDK A;  1VQM V;  4GCZ A;  4Q6G A;  4GUN A;  2R9I A;  4CS3 A;  4MVQ A;  3ZRW B;  1VF5 B;  3JAS A;  3FAV A;  2QM8 A;  1Q6I A;  3OR7 C;  1Q7Y W;  1XNR O;  1N33 B;  4I9Q A;  1SQX H;  5D5P A;  1GM8 A;  4R7C A;  4K3A A;  2Q69 A;  3P3P A;  4LNU B;  3JD4 A;  4IGG A;  1A32 A;  4CH5 A;  2CTW A;  2QWN B;  1K4C C;  4UCV A;  1Z5V A;  2MK3 A;  4DYL A;  2CUG A;  1HNZ O;  4MTX A;  4LFB B;  1M4U A;  2AW9 A;  4BIU A;  4EFB A;  1IVS A;  2Q6A A;  1L0L H;  3OMI B;  2NN4 A;  1XMQ B;  1N36 B;  4I55 B;  1GN4 A;  2QKA A;  4JYA O;  1AR5 A;  1PV0 A;  5CN0 A;  1IXB A;  1CEZ A;  1XUQ A;  1Q5O A;  5J2U A;  2XHB A;  3F7V C;  1R6T A;  1OCR B;  3RYI A;  3CCJ V;  3OFN G;  2PUS A;  4PEL A;  1OCZ C;  1Q82 W;  3IGA C;  2QE7 G;  1Z2G A;  4WFE A;  1CPY A;  4UV8 A;  3ABK C;  2DWE C;  2QJ1 A;  1S5L Z;  1JJ2 U;  1OCO B;  4NXM B;  1AP5 A;  5IYZ B;  1YXB A;  2XOK G;  3HKE A;  3JD3 A;  3QF7 A;  3MHH C;  4BW5 A;  2QGN A;  5LXT A;  2PYL A;  2Q68 A;  3DC6 A;  2Q7E A;  3B09 A;  1B04 A;  4PDR A;  3ABM B;  1R3J C;  2CK3 G;  3IAY A;  3N2G B;  4JTA B;  3ETD A;  1AJQ A;  2JEX A;  3UT5 B;  4X8A A;  2YUA A;  2CAZ C;  2ZIO A;  2YXH A;  5JWP A;  2OCC B;  2PI4 A;  3ZED A;  1THZ A;  1S76 D;  1KB9 F;  5B3S C;  4B7K A;  1R6N A;  5BXZ A;  1O9H A;  2DW4 A;  4BAY A;  3K5L A;  3K59 A;  2Q0O C;  4PJ0 Z;  3K3W A;  3AG2 B;  3ZRV A;  1AR4 A;  1PL0 A;  1PM9 A;  4LFA B;  5ITZ B;  1QR8 A;  3B8M A;  3VBB A;  1K33 A;  3E8F A;  2PF4 E;  5CA0 B;  4OPH A;  1FXH A;  3ABL B;  4DUY B;  1MNG A;  2P22 C;  2EIL C;  1YJW V;  1LUV A;  2DE0 X;  4GZR B;  5B1B C;  2RNB A;  2C2A A;  1NKD A;  1RM1 C;  1AI4 A;  1V55 B;  1XBL A;  1JVM A;  3UT5 A;  4DR4 O;  5LGN A;  5L3C A;  1NR1 A;  5JH7 B;  3Q4H B;  3OD4 A;  1MSD A;  4IL6 Z;  2YXY A;  1ZUQ A;  3A8T A;  4JI3 B;  2R9A A;  3QTC A;  1BZK A;  5KHH A;  4TV9 A;  1EBO A;  4X65 B;  3SJA C;  1N32 O;  3HKC B;  2WLJ A;  3E8B A;  2IJH A;  3P30 A;  3NR7 A;  4X1K B;  1QHT A;  2DOS A;  4JI4 O;  3W7T A;  5B3S B;  2Z3Y A;  2LW1 A;  2YEV B;  4WF9 V;  2QWR B;  4LFC O;  4LF5 B;  2ZQM A;  5KMG A;  4LF9 O;  5EBM C;  3RYF B;  1WB7 A;  4J7K A;  2OWO A;  5JVD B;  4YJ3 A;  1QU7 A;  2HKO A;  4GKJ O;  5CA3 A;  1SKV A;  1IXM A;  2HR3 A;  3LSS A;  1FAF A;  1M9N A;  1N34 O;  2ADP A;  4RUE A;  1WPB A;  3CRQ A;  4BIZ A;  2LGW A;  3AK1 A;  1BCC H;  4LH6 A;  4X62 O;  1AVM A;  1FKA O;  2UXD B;  5F2V O;  4MW3 A;  2UUC B;  2G38 A;  1OCO C;  4IHJ A;  2X7R B;  1G4Y B;  2YID A;  3L73 H;  4CC6 A;  2R72 A;  1I5Y A;  1H8H G;  3BEH A;  4QE9 A;  3FX7 A;  1R3K C;  2A3Q A;  2JDI G;  5DM6 V;  2VQE O;  2XAJ A;  2P5O A;  1ZWI C;  4EB6 A;  1FJG B;  2KSD A;  1SQQ H;  4AQY B;  4O4L B;  1SA0 B;  4CH6 A;  4LWS B;  3R65 A;  3HKB B;  4ZI7 A;  3K9A A;  4AI8 A;  5KHI A;  1DLB A;  4O4J A;  4X64 O;  1SER A;  1JFF A;  4EEQ A;  2LW7 A;  5EBL C;  2XTA A;  4GX5 A;  5IYC O;  2UXC O;  3TGU H;  2WLI A;  1MA1 A;  1GKF A;  4FZ0 A;  4KP4 A;  3OUF A;  4LP8 A;  1YCI A;  1FJG O;  4WBN A;  3JD1 A;  3IC7 A;  4I5S A;  1GM9 A;  1XHZ A;  2IJK A;  4J9Z B;  1SES A;  2N05 A;  1X4T A;  3KCY A;  1JCH A;  1VEW A;  1XQ8 A;  3DXR B;  2W0F C;  1DGS A;  2HJF C;  1M57 B;  3ZMZ A;  2UXC B;  4YY3 B;  2XAG A;  5FNV B;  2WSS G;  4X1I A;  2LGQ A;  4JZG A;  2WLM A;  1GN2 A;  5H6Q A;  1GK9 A;  3HKD A;  3RN4 A;  3G4S V;  4DK1 A;  5ITZ A;  1FXK A;  4PI0 A;  5LL6 Y;  4KHP O;  4GKK O;  4EB6 B;  4IIJ B;  3T1H B;  4K8X A;  2RN9 A;  5LMN B;  4TOI A;  1K3E A;  4RQF A;  4E4E A;  5BMV B;  5CB4 B;  2EIJ C;  1XMQ O;  4CBC A;  3OTO O;  4YY3 O;  4KXR A;  2L6L A;  1ORQ C;  1IBK B;  4X89 A;  4O2B B;  1VQ8 V;  1SQB H;  1NS1 A;  3ASO C;  5CA0 A;  4FLV A;  1ZLZ A;  2FL4 A;  1EN5 A;  5H2F Z;  2YIB D;  4UXN A;  1VQ4 V;  5IJ0 A;  2EIJ B;  4JAV A;  4UB8 Z;  3TCU A;  4JI5 O;  4X1Y B;  4ZI7 B;  4FPP A;  4CH3 A;  1XNQ B;  3GVM A;  5GW7 A;  2ZNI A;  2KB1 A;  5EIB D;  2OIE A;  5H6R A;  4JI1 O;  4JI8 B;  3AK2 A;  1XMO O;  1HNW B;  4I0X B;  1R3L C;  2HVK C;  3N2K B;  1JPX A;  3TET A;  2V1D A;  3E35 A;  4DR1 B;  1UJW B;  4QE7 A;  2ZIM A;  4NR1 A;  2ILM A;  1SZX A;  2QR4 A;  1W2B U;  2WPD G;  1IBL O;  3VQW A;  1P84 F;  4B3S B;  4PD4 F;  4PHZ A;  3VQV A;  2F1M A;  5KA6 A;  3H1J H;  5AG2 A;  1H8E G;  2WLH A;  3QNE A;  3ZJZ A;  5IJ9 B;  2K1E A;  1OCC B;  3D8C A;  2JS3 A;  1H38 A;  2UUB O;  4PDL A;  4DR2 B;  4LFB O;  5FPO A;  3OTF A;  1YZB A;  4QIW F;  1GAX A;  3LNM B;  3LSQ A;  3E86 A;  4YIO A;  4LF6 B;  4LFC B;  1YIJ V;  4I0X A;  1ZAU A;  1KBH A;  3JAW B;  4W4L A;  3U11 A;  4WCE V;  1M56 B;  1VQO V;  5IJ0 B;  2F66 C;  1FFX B;  3S3W A;  4O4H A;  2WAM A;  3ICX A;  3LSU A;  4X62 B;  5IJ9 A;  2Y48 A;  4UCR A;  4UB6 Z;  4P2Z A;  4X65 O;  4CS2 A;  2F4V O;  4FM1 A;  3MAQ A;  3ABT A;  3RYC A;  3KZI Z;  4WFG A;  3ZX6 A;  5KX5 B;  2UXB B;  1NT2 B;  2F43 G;  2W0X A;  1YTF B;  5LHH A;  1VQK V;  4FVM A;  3KKY A;  1SQF A;  1H2G A;  3GWK C;  2VQE B;  1S77 D;  2P6J A;  3E22 B;  4LF5 O;  2Q73 A;  2ZIN A;  1NJI W;  1GN3 A;  5B1N A;  1E79 G;  1IUR A;  5C8Y B;  5IWA B;  2CTR A;  2Q67 A;  3CX5 F;  1HP8 A;  2Z0A A;  1D5N A;  4QGP A;  1MZF A;  3RYH A;  2XAQ A;  4FLY A;  2EUL A;  3G67 A;  2ITD C;  4DV5 O;  2HVJ C;  4U3J B;  1X59 A;  3UCS C;  2ZDI C;  3G80 A;  2P67 A;  5B5E Z;  3AG7 A;  1MSW D;  4QJF B;  3THO A;  1M5I A;  4PA7 A;  3OMA B;  3AEI A;  2CTQ A;  4C7U A;  4DV2 B;  1BHB A;  4B7E A;  2PTM A;  1S72 V;  4JPR A;  3CCV V;  1R6K A;  3CCQ V;  2BSK A;  1ARO P;  3BFR A;  2NLJ C;  4TWK A;  3CCL V;  2JJ1 G;  2YEV A;  2B1I A;  3VQY A;  4L87 A;  3O65 A;  4PA3 A;  1S3J A;  3JAR B;  1XL6 A;  3M99 B;  3UO2 A;  4I50 B;  4J42 A;  2QWP B;  5B1A B;  1RPO A;  4J41 A;  4DUZ O;  1D2D A;  4DK0 A;  1PNK A;  2ZE7 A;  2WA4 A;  3N2K A;  3B8N A;  3ZHR A;  1SA0 A;  2GUZ B;  4AIL C;  1NVP B;  1FFT B;  1QLE C;  4LF9 B;  1HW7 A;  2AHZ A;  1RM1 B;  3BCC H;  2EJ7 A;  2DQ3 A;  1KEC A;  3C90 A;  4DV3 B;  1JA8 A;  4MTF A;  4WFB V;  2WLN A;  1Q86 W;  3QO5 A;  1Y74 A;  2IW5 A;  2Q7H A;  3OAA G;  1HDJ A;  2B9Z A;  2RQ6 A;  4UVC A;  5JH7 A;  2FML A;  1BSM A;  3CCR V;  4IYI A;  2LO1 A;  5JQG A;  4OX9 O;  2AHY A;  1MG1 A;  4K35 A;  4IYH A;  3T4Z A;  3N27 A;  3OMN B;  1K4D C;  5FLX N;  4JTC B;  3SJC C;  2VQF B;  4UFZ A;  3QO8 A;  2NNU A;  5BMV A;  4MVM A;  4X9Q A;  1BMF G;  1L8D A;  4B08 A;  1M1K W;  3OTO B;  3OGC C;  3FYI B;  4MVR A;  1KU9 A;  4JI7 B;  3C3T A;  4DO2 A;  2YS8 A;  3ABM C;  1Q6U A;  3G6B A;  2UUA O;  3D36 C;  1PNM A;  4I7Z B;  4OX9 B;  2DQ0 A;  3ZRX A;  5KHJ A;  4DR6 O;  3CRM A;  3L72 H;  2BTO A;  1AI5 A;  4DR3 B;  4FM2 A;  2GDS A;  2IJI A;  2P90 A;  4LF7 B;  1SQG A;  1YHQ V;  4PA6 A;  2Q9L A;  2OT5 A;  4DR2 O;  1KP3 A;  2EIK B;  4GT1 A;  3J7A U;  1ZL8 A;  2E5L O;  5KMG B;  1WA8 A;  2UUA B;  2DYS B;  4FLT A;  5GTH Z;  5KLV H;  3Q4H A;  1YIT V;  2A79 B;  5JJN B;  2QWQ B;  4ICG A;  1M56 C;  4KL1 A;  1H2S B;  1YSC A;  2N74 A;  2CE4 A;  1KQS U;  1Q43 A;  3KCX A;  4N23 A;  1H2M A;  3K5M A;  3DGE A;  1XEQ A;  3CP1 A;  3ASN B;  2JRI A;  3SPH A;  1QLN A;  3H9V A;  1N34 B;  3RWR D;  4KHP B;  2WA3 A;  3OT7 A;  3QVN A;  2UUB B;  4G28 B;  3I5D A;  4K0K B;  2E5L B;  1JR9 A;  3SYP A;  3VQX A;  4Z2W A;  4ZHQ B;  1K73 W;  1BL8 A;  4J80 A;  4Q20 A;  2W6J G;  3ML0 A;  4JAA A;  1B3Q A;  3BHP A;  5EIB C;  3E8H A;  1Q90 D;  1WB8 A;  2IJJ A;  3CE2 A;  3CCU V;  4WBN B;  2KG7 B;  3RT3 C;  2BOB C;  2H3O A;  5B66 Z;  4FLZ A;  2CH7 A;  2ZXW B;  3A0R A;  3JCZ A;  3CD6 V;  1ZSP A;  3ZN1 A;  1L0N H;  3DXR A;  3AK3 A;  1H2N A;  1HNZ B;  5B1A C;  1BS3 A;  1JX9 A;  2VS0 A;  3QG5 A;  2F93 B;  2DYR B;  5J2T B;  2WLI B;  1N36 O;  5CA1 B;  4X66 O;  2DYS C;  1RP3 B;  3H1K H;  1B6Q A;  4N21 A;  3CB2 A;  3BPZ A;  3SJQ C;  3CCE V;  5JCO A;  4JF3 A;  3CXH F;  1OV9 A;  4CS4 A;  4CH4 A;  3CC7 V;  2UXX A;  1F51 A;  4TSF G;  2UXD O;  5GON A;  3X2Q C;  4YHH B;  4WFF A;  4X88 A;  3JSN A;  4NXM O;  1PP9 H;  3VOU A;  2OCH A;  4P9O A;  1TAE A;  1MAB G;  2ZM6 B;  1EN4 A;  1YEW A;  3K06 A;  1TGO A;  2ETN A;  2JEU A;  4F6R B;  4Z1M G;  4RQE A;  3ZMS A;  1UFI A;  4I9W A;  3CMA V;  4R8C A;  1NH2 B;  2V4D A;  4LF8 B;  2VRZ A;  2HHH O;  1M93 A;  3LDE A;  4NB5 A;  4UV9 A;  1WLE A;  3TK1 A;  1AI7 A;  3P3N A;  3SPG A;  1F7Y A;  1Q3E A;  1K5S A;  3JCU Z;  1J5E B;  4F6R A;  4LF4 B;  1MMM A;  3ZHQ A;  5LMN O;  4DV3 O;  3JD2 A;  2A9H A;  4FLU A;  1VAR A;  1ENV A;  3DTU B;  2ZM6 O;  3AG2 C;  4UCO A;  1I94 O;  1K8A W;  2DN9 A;  1ROP A;  5HFM A;  2ITC C;  5C8Y A;  4MVO A;  2Y4U A;  1WAZ A;  4JYB A;  3SYC A;  2AXT Z;  3CCS V;  1FXK B;  4PA9 A;  2JGD B;  1NU1 H;  4X1Y A;  5LHG A;  4ZIB A;  5E1A C;  3UM7 A;  1SS3 A;  4DR5 B;  5FNV A;  4F4L A;  4LF4 O;  1QLE B;  2Y0P A;  4TV8 B;  4DV6 O;  4KUM A;  5KUM A;  1H2K A;  1KP2 A;  5KHG A;  1I08 A;  1I5X A;  1DF5 A;  3E2E A;  2X0L A;  3HB3 B;  3IJ4 A;  1CXZ B;  3ZMV A;  3W7X A;  5IWA O;  3BA9 A;  3G6E V;  2A06 H;  1HNW O;  5B1O A;  1XDC A;  1ZTE A;  2QKC A;  1VP7 A;  4JYY A;  5B1B B;  3CXC U;  1YVW A;  5LMU O;  4DR3 O;  4O2A A;  3ZMT A;  1RSO A;  3M7M X;  1OCZ B;  3H1I H;  3ZN0 A;  2GHY A;  5EC1 C;  4W4K A;  1UPG A;  1SQV H;  2MW2 B;  4EKW A;  1YJ9 V;  3CC4 V;  1SZT A;  5CBH A;  3JAL B;  4JI6 O;  2Y4T A;  5BZB A;  4H37 A;  1JJO A;  4DW1 A;  3IC9 A;  3WB1 A;  1P7B A;  4O4I A;  1F4N A;  1WPX A;  3HKC A;  4LF6 O;  3JAS B;  4DV7 B;  5EK0 A;  3BAA A;  4TT3 G;  1XNQ O;  1YDX A;  1QCE A;  3JYC A;  5CMU A;  3BRC A;  3F7Y C;  4O4I B;  2E3C A;  1P49 A;  4AQY O;  2P7T C;  1HR0 B;  4GX2 A;  3E8G A;  2LJ2 A;  3ETG A;  2CGN A;  3L9D A;  4R6Z A;  1GMG A;  1WNS A;  2YDE A;  1NR7 A;  1VQ9 V;  1Q81 W;  3OR6 C;  3CPW U;  3JAT A;  2XAF A;  5K1X A;  1V55 C;  1GM7 A;  3FB8 C;  3W7U A;  4UCU A;  2LFS A;  1AJN A;  3KG2 A;  1F23 A;  2LP7 A;  3D3Q A;  1HR0 O;  4JI3 O;  5LP6 C;  3SYA A;  5EZY A;  4LH7 A;  3SPJ A;  3ZHU A;  4IT5 A;  1AJP A;  5IE9 A;  2X6A A;  4X20 B;  1TUE B;  2VWK A;  2FTK A;  3L70 H;  1P4R A;  3UO3 A;  1W59 A;  2HFE C;  5IY5 C;  1CP9 A;  1HWY A;  1SC5 B;  4GYC B;  2F95 B;  3RYF A;  3RYI B;  5JQG B;  2Q5Z A;  3RYC B;  4DW0 A;  4BWA A;  5IYD O;  4YJ3 B;  3W7S A;  3FB5 C;  2F23 A;  3SPI A;  5BR8 B;  1BT8 A;  5FPR A;  2JIZ G;  2Y0I A;  2N04 A;  4X1K A;  4FM0 A;  4ZBM A;  1WA8 B;  4DV4 O;  4I55 A;  5GON B;  4PDM A;  3OE7 G;  4O2A B;  2CDY A;  1VQN V;  3STZ C;  1VF6 A;  3D36 A;  3K58 A;  3RBZ A;  1IBK O;  4NTW A;  4H0L B;  4LFA O;  4YJ2 B;  1L1F A;  1TVK B;  4DRX B;  3RVY A;  1WP7 A;  2GUZ A;  2JS5 A;  1NQT A;  5HFL A;  4H33 A;  3ZS8 C;  3JAT B;  1ZL8 B;  1FD9 A;  1NTZ H;  3SPC A;  2H94 A;  1S0V A;  4BW9 A;  3T1Y B;  5BY1 A;  1W0K G;  1KD1 W;  1I94 B;  2PI5 A;  2QM7 A;  1SET A;  1NI8 A;  2QWO B;  1R73 A;  2QEX V;  5IYB O;  1JQ0 A;  2CH7 B;  4X64 B;  1FYJ A;  1GN6 A;  3FFQ A;  4QPK A;  4JI8 O;  4JTD B;  3PN1 A;  1AR1 B;  2ZE5 A;  2OCC C;  4DV2 O;  2XT9 A;  3SR2 C;  2EJR A;  3WU2 Z;  3LDD A;  1IBM B;  2LFR A;  5LHI A;  2PY5 A;  4X1I B;  4JI4 B;  4TQD A;  5EBW C;  5LGT A;  4DV6 B;  3EFF K;  4NVP A;  5J2U B;  2NR5 A;  2BTQ B;  4RUF A;  5KAF Z;  3H1L H;  2ZKO A;  1GH6 A;  4GKJ B;  1O9G A;  3K5N A;  1YTF D;  2B1G A;  3K08 A;  4NXN B;  3AG4 C;  4HZ3 A;  4JZ2 A;  2WLK A;  3FYE B;  1TUB A;  5L3G A;  1M57 C;  3SYO A;  4U7O A;  2ARH A;  3K5O A;  4RWU A;  1URF A;  4I4T B;  4AHC A;  4TUY B;  4DR5 O;  2JJ2 G;  2FKX A;  4ZKI A;  3L71 H;  2HG5 C;  5JVD A;  5LYJ B;  1AIL A;  4NXN O;  4FLX A;  3OGI B;  4LF7 O;  1EZV H;  1YJN V;  4FJC C;  4JI6 B;  1LUW A;  3M8A A;  1N0N A;  4NKG B;  3AG1 C;  4G27 B;  3ZBH A;  3JAL A;  1NBM G;  4U3F H;  4MTG A;  2YSU B;  4DR7 B;  2YI9 A;  2HLD G;  3LDC A;  3CCM V;  3CJH A;  5LMU B;  2E76 B;  4XDJ A;  4L8J A;  2VQF O;  4NTY A;  3E83 A;  1COW G;  2XAS A;  3F5T A;  3E22 A;  1KKD A;  4JI7 O;  1EZJ A;  2FYU H;  1K7D A;  2KQX A;  2YIA A;  4P30 A;  1XRE A;  4O2B A;  3UKM A;  4MVU A;  4JI2 B;  3O9O A;  2EIM B;  3CC2 V;  2Z5U A;  1N32 B;  4DR7 O;  4B3M O;  3B40 A;  3W7W A;  4FFB B;  1PPJ H;  5EYP B;  2WLL B;  2HEP A;  4UVB A;  1IBL B;  5C93 A;  3A0B Z;  1I0H A;  2QKS A;  1JOY A;  4U7N A;  3FB6 C;  4K8Z A;  1N4C A;  1HNX O;  1Y6X A;  4DXW A;  1OZ0 A;  1NZ6 A;  2RCV A;  1EM1 A;  5LA6 B;  4NTX A;  2Y69 C;  2YIB A;  2YI8 A;  4JV5 B;  1SF9 A;  1Y76 B;  1JMK C;  3ZRS A;  3WB2 A;  1KYO F;  1Y4M A;  5TIS Z;  4F6E A;  4MVS A;  1H2L A;  5D5Q A;  1Q8I A;  2IM9 A;  4FFK A;  1NH2 D;  2XND G;  2P4K A;  1PKX A;  5GTI Z;  5H9C A;  5LOV A;  2DWD C;  1IDS A;  1VIB A;  3A0H Z;  5H5N A;  3CEI A;  4GX0 A;  3FKS G;  4JAS A;  5KX5 A;  1YF2 A;  3CRR A;  2OTJ V;  1IX9 A;  3RVZ A;  4FZ1 A;  3U10 A;  4EFE A;  4DUZ B;  1XL4 A;  5IYZ A;  3GB7 C;  4FK5 C;  3ZCC A;  3TXQ A;  4FLW A;  4JV5 O;  4MSW C;  1DK1 A;  4CZZ A;  5EZY B;  4YHH O;  3K79 A;  3JSL A;  1OCC C;  4H13 B;  5KUK A;  3J81 N;  3EVK A;  2E75 B;  2DMX A;  3JD0 A;  4X20 A;  1SQP H;  4HNA A;  1QQC A;  4PDV A;  2GSM B;  1XIL A;  5L3B A;  1TVK A;  4H44 B;  3MHS C;  4J11 A;  3JAM N;  2R70 A;  4G2K A;  3WG7 B;  1S5J A;  5LXT B;  3U0Z A;  2JK5 C;  4UUJ C;  1XHX A;  3ABU A;  3JAW A;  5BR8 O;  3NXS A;  1K34 A;  3UQ8 A;  2PYJ A;  1QNM A;  4B3R O;  4B3T B;  3S3X A;  2IBZ H;  1BE3 H;  2JGD A;  4RAI A;  1N0J A;  4TUY A;  1B06 A;  1PD3 A;  1OJH A;  1Y67 A;  1VQ5 V;  2V7Q G;  3MD0 A;  2P06 A;  1KC8 W;  4YIP A;  1V9P A;  4E2L A;  1VQ7 V;  1K97 A;  2ZNJ A;  3HKE B;  3K57 A;  4MW8 A;  1G1X B;  4FMT A;  1VF6 C;  3ASO B;  1DTO A;  3SJB C;  1VQ6 V;  4DR6 B;  2UU9 O;  1FXV A;  5CB4 A;  4ZOL B;  3T1H O;  2O57 A;  1QR9 A;  2Y69 B;  4GLX A;  2EIN C;  1QBZ A;  1T5E A;  2IU3 A;  4PV1 B;  1FXK C;  2BOC C;  2GBO A;  4U3J A;  3L75 H;  4XDL A;  2M6Y A;  1RFY A;  2AZ2 A;  5A2Q N;  3ETQ A;  4OXS A;  1OCR C;  4UCS A;  2UXN A;  2PZS A;  1N8R W;  1R3I C;  1XNR B;  4KFM A;  5DEC A;  2F4V B;  2HHH B;  3ZHV A;  5JJE B;  5LGU A;  1G8M A;  4DUY O;  3T1C A;  1IBM O;  2UU9 B;  1BHA A;  2OTL V;  1J5E O;  1SRY A;  2A7W A;  1WJZ A;  3R66 A;  2ZR3 A;  2BCC H;  3E89 A;  3MDS A;  4ZOL A;  2HJD A;  4HYO A;  2BE3 A;  4JI1 B;  5L3E A;  4DV1 B;  1KMI Z;  2JGU A;  2Q0A A;  4JAU A;  1XMO B;  3EXA A;  2H8P C;  2W6I G;  3EHB B;  2BSK B;  4OGQ B;  4DR1 O;  1Y74 B;  3B4S A;  4DV5 B;  2ATK C;  2RDC A;  3ZHT A;  5J9P C;  1GRJ A;  3LUT B;  2ZCE A;  2RMK B;  3B77 A;  4JI0 O;  3T2M A;  4B3S O;  1S5H C;  4RO2 A;  2WWW A;  1FPO A;  3JAK A;  2Q4P A;  4I4T A;  5FL7 G;  2QA4 V;  1EFR G;  4O4H B;  1VQL V;  4UCT A;  4UVA A;  4YXW G;  4YJ2 A;  3H01 A;  4JI2 O;  3JAR A;  1JFF B;  3HR0 A;  3TJT A;  2EIL B;  5JCO C;  1BGY H;  3OEE G;  3T1Y O;  2ODM A;  4TV9 B;  4TQF A;  4MVZ A;  1NTK H;  3GWO A;  2ADQ B;  3WB0 A;  2D2C B;  4NYK A;  4JI0 B;  2JVD A;  2LQT A;  4LC1 A;  3AG3 B;  2M7W A;  2WLL A;  2ZXW C;  3WG7 C;  1N33 O;  2DJV A;  2PGG A;  2ZE6 A;  4J9Y B;  3FAV B;  4XBF A;  1M90 W;  3AG3 C;  1NVP D;  1FS0 G;  2VWJ A;  4FIP C;  5LP6 B;  1E1R G;  2RJZ A;  1TA8 A;  3L74 H;  3OEH G;  3BVO A;  1TUB B;  4GX1 A;  3FB7 C;  1Y76 A;  3HPL C;  2L35 A;  4D7T A;  1K5Q A;  5CBF A;  4DV7 O;  4DRX A;  4B3M B;  2X6C A;  1FFX A;  3HKD B;  3HKB A;  2B5U A;  3BY6 A;  1MZE A;  2EIN B;  2ZE8 A;  3ASN C;  3CYO A;  4WFA V;  1Y66 A;  5L3D A;  2Q7G A;  1IZ3 A;  4P9P A;  3SDL A;  5A9G A;  4LNU A;  3CWB H;  3ABK B;  3RGB A;  3N2G A;  2KKW A;  1KUQ A;  5KAI Z;  1VMG A;  4JGS A;  4QNH B;  4LR3 A;  4K0K O;  2X6B A;  4J7Z A;  1NTM H;  1WP8 A;  3K04 A;  4JI5 B;  3ZMU A;  2R9R B;  2ZR2 A;  1AI6 A;  3RW0 A;  3AG1 B;  1GTO A;  1WN7 A;  1PNL A;  1BQZ A;  5LBQ A;  5J2T A;  4JYA B;  1U97 A;  3WFV A;  1K92 A;  3BAB A;  4BIO A;  3OW2 U;  1R1B A;  3SGI A;  3OUS A;  3ABL C;  3LNN A;  3TXS A;  1Z5W A;  3CRC A;  1MOF A;  2K9P A;  4PA4 A;  3APQ A;  3P32 A;  4CC5 A;  1US6 A;  4ASU G;  4B3T O;  3QO7 A;  3ZHS A;  1J95 A;  1EN6 A;  2EX3 A;  1K9M W;  5IDJ A;  4LWS A;  5E79 Z;  2UUC O;  2OIG A;  2E74 B;  5JJJ B;  2QM4 A;  4IIJ A;  2P4V A;  2QTS A;  1RSO B;  2QTO A;  3AG4 B;  3FD9 A;  5DED A;  1GO3 F;  1BQ0 A;  1G6U A;  4R50 A;  4HAM A;  3RYH B;  1V54 C;  5K1P A;  3H1H H;  1U96 A;  3CHX A;  5KHK A;  3PJS K;  3B2E E;  4IHJ B;  4DV4 B;  2IH1 C;  2QSA A;  5CA1 A;  5EYP A;  2GTA A;  3C3S A;  5LYJ A;  3APO A;  1P7G A;  3ZRW A;  4QPJ A;  2CGO A;  1HNX B;  5LOV B;  2AZ0 A;  4LBE C;  2CTP A;  3CRA A;  2QDO A;  5KA5 A;  1AB3 A;  3CJH B;  2D3O W;  4A5U B;  1XI1 A;  1RPR A;  4DV0 B;  2BTQ A;  2OYQ A;  4LF8 O;  3RFR A;  2ZD9 A;  1LR1 A;  2EZO A;  4MS2 A;  5CBG A;  2EIK C;  5DN6 G;  2UXB O;  3F5W C;  2EBO A;  4D7S A;  4DR4 B;  2YXL A;  1XOU A;  4DV1 O;  2IU0 A;  3I55 V;  4HNA B;  4JYC A;  1Q6H A;  4O4L A;  4ABM A;  2EIM C;  3I56 V;  4BR6 A;  1VQP V;  5LP6 A;  4DV0 O;  4MT8 A;  3ZIA G;  4Z1V A;  4X66 B;  5L3F A;  1QVF U;  2YIC A;  4WFH A;  1YI2 V;  3G71 V;  4HBN A;  4GKK B;  3SYQ A;  2FB5 A;  2DYR C;  3BA8 A;  1W0J G;  3X2Q B;  2KG7 A;  2A0L A;  1QVG U;  3K0G A;  4OPA A;  5IY5 B;  5IT9 N;  3A2F A;  2AGA A;  1I7F A; 
#chains in the Genus database with same CATH homology
 3IJ4 A;  4NTX A;  3S3W A;  4NYK A;  2FB5 A;  2L35 A;  2QTS A;  1WP7 A;  4FZ1 A;  4FZ0 A;  1WP8 A;  4NTW A;  4NTY A;  3S3X A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...