4NTWA

Structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
412
structure length
410
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
total genus 109
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntwA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntwA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntwA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntwA02
4FZ0A 1WP7A 3N27A 2FB5A 4NTXA 4FZ1A 3IJ4A 3S3WA 2L35A 1WP8A 2QTSA 4NTWA 4NYKA 3S3XA 4NTYA
chains in the Genus database with same CATH superfamily
2EIKB 3NXSA 5TISZ 4J41A 4FIPC 2Q0OC 4B3RB 4FFBB 4RUFA 3T1HB 1KKDA 5KX5A 1L8DA 1DGSA 2ZT9B 2PZSA 1AROP 1U96A 4LF8B 2YIBA 2EZPA 1N34O 4JASA 2ZNIA 5KMGA 2CTRA 1OCCB 2HLDG 2EULA 5GTHZ 1H2LA 3TCUA 5KHJA 3SJBC 1K4DC 4O4LA 4O2BA 4DV1O 4MTGA 5ITZA 1BS3A 4X9QA 4QPJA 1S72V 4HZ3A 2B5UA 1FXKA 4P2ZA 5KA5A 2HHHO 2Z5UA 1Z5WA 1GM7A 1FJGB 1JQ0A 2PTMA 4MVRA 1N34B 4B08A 1DTOA 1X59A 5JCOA 4J80A 4BIZA 3AG3C 3AG1B 4MVUA 2UUBB 2E5LO 4O4IB 4X62B 4LFCO 3E89A 3GWKC 1SZXA 4PI0A 3ZX6A 3B09A 4DV1B 1G8MA 1Y66A 2ZR2A 3OW2U 2HHHB 4WFAV 2OTLV 4XDKA 1NI8A 3T1CA 2R9RB 2LQTA 3HKCA 4AHCA 3E8FA 3H9VA 3N27A 4I7ZB 4OPHA 4LP8A 1YHQV 2Q6AA 2BSKB 3ABUA 2E5LB 4LFCB 4DR4B 4RQFA 1XMQO 2LGQA 3P3NA 2IJHA 3B2EE 1QLNA 3BFRA 1H8HG 4ZOLA 1EZVH 1NZ6A 5J2UA 2Y69C 3E8GA 5A9GA 3TK1A 5DN6G 3FAVB 3JAWA 5DECA 4EFBA 4FLWA 4X1KA 3C3TA 3D36A 3RYFB 2HKOA 3SPHA 4UB6Z 5GTIZ 2JEXA 4P9PA 4X1IA 4JI0B 2WLNA 2OIGA 2QA4V 4YJ2B 1M93A 1WA8A 2BTQA 1NTMH 5F2VO 3R66A 4TV9B 2YS8A 3SPJA 2UXNA 4CH6A 3FKSG 4I9WA 4JF3A 1IBKO 3B40A 4UCOA 3STZC 3QVNA 5IYDO 2Y4TA 4MVSA 2CE4A 3K5MA 1EN4A 4DK0A 1MA1A 1R3JC 4D7SA 4WFBV 1VF6A 4RAIA 4LF7O 2CDYA 3QTCA 5FL7G 2ZXWC 2QJ1A 1EBOA 4WFHA 3VQXA 2ITCC 3JCZA 5KLVH 2CTWA 1VQ5V 2Q0AA 1BE3H 3NR7A 1L0LH 4X89A 1KMIZ 2IJJA 1FPOA 4MSWC 4JYAO 2ODMA 3SR2C 5L3DA 2XHBA 3FYEB 2IW5A 1IBKB 1XMOB 1MSWD 1M90W 3ZCCA 2X6BA 3Q4HB 3STLC 4B3MO 4LF7B 3KCYA 4JAUA 5KUKA 4FMTA 1KC8W 1IZ3A 4DK1A 5CN0A 2DMXA 1FXHA 2H94A 1ZX3A 2ZQMA 3PN1A 2OWOA 1QCEA 1W59A 1QVFU 1DLBA 1Y6XA 3LNMB 5LHHA 4JYAB 2UXDO 4Q20A 3AG4C 4LFBO 1NVPB 2HG5C 4LWSB 4Q6GA 1M56C 1HNWB 4O4IA 3HKEB 3E2EA 5CB4B 4KFMA 1S77D 1WAZA 1NTZH 3ML0A 1XDCA 1PP9H 2HP8A 3A8TA 4JPRA 2LO1A 1AB3A 2ZE8A 2OCCB 5CBGA 4J10A 5EBWC 3N2KA 1BZKA 4IL6Z 3EFFK 2XASA 2XTAA 3ABTA 2UXDB 1K97A 1GMGA 3KKYA 3ASNC 4GLXA 3JAMN 3DGEA 2X6CA 2P06A 2WLJA 4GT1A 2BSKA 2OIEA 1K5SA 4DUYB 4FM1A 3P3PA 3K5LA 3K5NA 1RPOA 1AR1B 2EJRA 1VQMV 2QM8A 3CHXA 5GONB 2ZIOA 3W7UA 2ITDC 2QWQB 4CS2A 1X4TA 2YUAA 2WLMA 2PF4E 4IHJB 1XNQO 3LUTB 1QVGU 3ZRXA 3FAVA 1TVKB 4MVOA 1U97A 3C3SA 3RYFA 5KHKA 1Q86W 4PA4A 2CAZC 2DYSC 2XT9A 3SPGA 1RP3B 1OCRC 4BAYA 2X0LA 2P5OA 2EIJC 4YJ2A 3OR6C 1AI6A 3SYCA 2ZM6O 4LF4B 3R65A 4TV9A 3AG2B 1FAFA 3ZMTA 3HKDB 1XNQB 1YI2V 4HYOA 2IJKA 5BMVB 1KU9A 3D3QA 3FYIB 3OGCC 5BR8O 2HR3A 3OTOO 4YXWG 2OTJV 2QTSA 3CC4V 3M8AA 4MVZA 5FPRA 4JI1O 1JA8A 4PA7A 1Z5VA 1RPRA 4EKWA 5LGUA 4FFKA 5LYJB 2PYLA 4DV3O 5A2QN 2ZM6B 2Q5ZA 2FMLA 3UO2A 3AG7A 3LDCA 1RM1C 3AK1A 1JR9A 1SQPH 2WLHA 2GDSA 3KZIZ 5BR8B 4PI2A 4GKJO 3ZMZA 3OTOB 3Q4HA 4GX5A 4G2KA 4JI1B 1TUEB 4JZGA 2KB1A 1YJ9V 1HW7A 4FLZA 2EINC 1OZ0A 4DV3B 4GYCB 2QTOA 4LFAO 4NB5A 4J7KA 1IBLO 5EIBC 1VQ9V 3KG2A 1IVSA 4DR7O 5LA6B 3RYCB 4LWSA 1EN6A 3E86A 3W7XA 2WPDG 2D2CB 2Y0PA 2UXBO 1OCOB 1SA0B 3HKEA 4TSFG 3BA9A 1KD1W 5CB4A 3C90A 4CBCA 2QEXV 1B6QA 1B06A 3FB5C 4L8JA 5KUMA 1JX9A 1OHHG 1MG1A 2CTQA 1J5EB 4YHHO 1D5NA 3JD0A 2DWEC 4KUMA 1IBLB 4DV2O 2FL4A 2Z3YA 3CCJV 4PDLA 3OEEG 3CD6V 3VQVA 4R6ZA 3CXCU 5JQGB 2QM7A 2YXLA 3G80A 2UXBB 2OCHA 4FZ1A 1QR9A 5LMNO 1ZSPA 1MZFA 3JARB 3ETEA 5GONA 2WA3A 1XEQA 4L87A 3ZHVA 3OTFA 3JASB 4WFFA 4NTYA 4PA6A 3CRRA 4IHJA 3HPLC 2OT5A 4YHHB 1K4CC 3L75H 2W6JG 4DR1O 4J42A 5B5EZ 1SZTA 1TVKA 4FVMA 2CUGA 4IT5A 2WAMA 3OGIB 1XL4A 1P4RA 2P7TC 3CC2V 4GKKO 3LSQA 1H2MA 5CA0B 4FLUA 2YXHA 4UFZA 1VQLV 4DR5B 1SRYA 4MT8A 5IYCO 2WSSG 4CC6A 3HKDA 1AR5A 5H5NA 4JGSA 5BMVA 2EBOA 4DR1B 2K9PA 2ZKOA 4Z1MG 5IY5C 4B3TO 2DW4A 2UUAB 5JVDB 1N33B 4H44B 4JI8O 2R9IA 4PJ0Z 3O9OA 2WLIB 1Q5OA 1M1KW 4GKKB 5D5QA 4DV6O 5LYJA 3ZJZA 4DV5B 4PELA 3RW0A 3FB7C 2YC0A 3BEHA 4NR1A 3W7SA 4MTXA 3K59A 4U7OA 2FB5A 2QKCA 1VP7A 3K0DA 3M7MX 4BWAA 5K1PA 4UCVA 4FK5C 3I55V 3RFRA 4QGPA 5H6QA 4F4LA 1US6A 5CBFA 1SESA 3TGUH 1NJIW 1GN6A 4DV6B 2QDOA 1ZL8B 2EILC 3B8NA 1SQXH 4X1YB 5IYZB 2GTSA 4TOIA 4D7TA 4K8XA 2K1EA 2L6LA 2FTKA 4E2LA 2Y69B 1XUQA 3CX5F 3G6EV 3CCLV 2Z0AA 4K3AA 5LA6A 4WFGA 3RYCA 1V55B 3TJTA 4CS4A 4JZ2A 2VRZA 2DYRC 4DYLA 3CSXA 3ASOC 1NQTA 1SA0A 3SYAA 2QKSA 2F95B 1ENVA 2NNUA 1FKAO 3MAQA 3CWBH 2YXYA 4FJCC 1EZJA 1XHZA 3N2GA 3WB2A 3J81N 3E22B 3ZHSA 4LNUB 3UT5B 3K06A 4JV5O 2E74B 3ETGA 4LBEC 5JH7B 4KHPO 4DV0O 1FFXB 2QWOB 2ZE7A 2HEPA 3FX7A 4YY3O 2YSUB 4MVQA 4CS3A 5JQGA 4UV8A 1Y4MA 3ETQA 3LNNA 2CGNA 1NH2D 5CA1B 4FM2A 2CTPA 1VQNV 1N0JA 3E8BA 3JARA 2GUZB 3CMEV 2ZXWB 3T1YO 3JASA 3L70H 1FFTB 2GHYA 1YJWV 5H6RA 4TWKA 2AHYA 4XDJA 1GM9A 2EJ7A 4IYIA 4BW9A 4DV0B 4KHPB 4R8CA 1R1BA 3UM7A 1VF7A 2VQEO 3APQA 2R9AA 3D36C 2QSAA 2WLLB 5CA0A 3ABLB 3I56V 3T1YB 2D3OW 1PPJH 5EBMC 3ZRSA 4MVMA 1HP8A 5KAFZ 1KB9F 5JJJB 1AJQA 1Y76B 4OPAA 4MTOA 4LR3A 4EFEA 2W0XA 2RMKB 1TGOA 2QR4A 3PJSK 3SJQC 2VQEB 3AG4B 3HB3B 4DW1A 2EIKC 3CCQV 1Y67A 4J9YB 1M56B 1Q81W 2F93B 2Q4PA 2WLIA 1D5AA 2P90A 1G6UA 1YTFD 1QU7A 5L3BA 1AJNA 2KKWA 1YEWA 4GCZA 1XMQB 1I5XA 1V54C 3BVOA 3BY6A 3AK2A 5GW7A 1GTOA 3CRMA 1LNQA 3JD4A 1YZBA 1KQSU 4NYKA 1G1XB 1JPXA 3K08A 3ASNB 1S5JA 1WLEA 2P67A 2FKXA 2RDCA 4UCRA 4IIJA 3QF7A 4NVPA 3IGAC 4MW3A 4O4JB 4UB8Z 1R6TA 4JI2O 5J9PC 1ZL8A 3FD9A 1VQPV 4X1YA 3MHHC 3ETDA 5IYZA 1S3JA 1H2KA 2E3CA 4FFBA 3T4DA 1VF5B 2R70A 3QO7A 4NTWA 2Y0IA 1P84F 2H8PC 4X20B 4Z1VA 4LC1A 1GKFA 4TQFA 5EK0A 3SJCC 3BCCH 1QHTA 2KSDA 1VQ4V 4X65O 3S3XA 5LL6Y 2XAJA 1FS0G 2DYSB 1OCRB 2DN9A 2UXCO 5H2FZ 1WB8A 3X2QC 4JI4O 1P7BA 2EIJB 1HR0O 2QKAA 5LGTA 5L3EA 1TA8A 3E22A 4LNUA 3UT5A 3G67A 4UUJC 2WA4A 3F5WC 5JH7A 5E1AC 2UU9O 1Q6UA 4JAVA 5EC1C 2XOKG 4AILC 2VS0A 3BRCA 3RYHB 4X65B 1I08A 1R3IC 5CA1A 3JAKB 1MZEA 1QLEC 3EXAA 4QJFB 5IJ0B 2GUZA 2LW1A 1R6KA 4B3MB 2ZINA 1SQQH 3H1JH 2UXCB 3HKBB 4JI4B 1HR0B 2PGGA 3D8CA 1VIBA 4W4LA 2EX3A 1ZUQA 2UU9B 1RM1B 3OR7C 1GM8A 1WP8A 4H13B 1K8AW 2ZDIC 2BCCH 2JJ1G 1YSCA 4I50B 4PHZA 4LFBB 2YI9A 2WLLA 2VWJA 3OAAG 2W6IG 4JTDB 2QGNA 1BCCH 3DXRB 5BY1A 3WB0A 2EINB 1BQZA 4OGQB 1CEZA 4E4EA 4O4HB 2ILMA 1SKVA 1Y76A 1K92A 1N0NA 1Q7YW 1IX9A 1AP5A 5DEDA 1MABG 4H37A 3FFQA 3JATB 4FPPA 2QM4A 1K73W 3SYPA 5EIBD 2CGOA 4K35A 2H3OA 1R3LC 1IBMO 1NBMG 4X8AA 2V4DA 3ZBHA 5JJNB 3BA8A 3CP1A 1R3KC 1AVMA 3UO3A 1SS3A 3L74H 1HDJA 1BL8A 3K0GA 1F51A 4O4JA 5LP6B 4DV7O 2EZOA 4A5UB 1K34A 2IJIA 2JDIG 3VBBA 2Q68A 3LDDA 5HFLA 3F5TA 4QNHB 3ZMVA 4DR3O 1IBMB 1JOYA 2ZE5A 1YIJV 3JCUZ 4X20A 4LF6O 1Q3EA 3H1LH 5LMUO 3ZRVA 2A79B 3ICXA 3L72H 3K04A 4I0XB 2QE7G 4YJ3B 1CXZB 4NXNO 4DV7B 1M57C 3ABKC 1V9PA 1IDSA 2DQ0A 2WWWA 2PI5A 5KAIZ 2N74A 4DR3B 3JD1A 2OYQA 4ZI7B 5L3FA 4JI7O 2DJVA 1MSDA 1SQFA 2G38A 2B1GA 2E75B 1XILA 3JSNA 3OMAB 4DUZO 1JJOA 4LF6B 1XBLA 4BIUA 4N21A 3CYOA 5B1BC 5B1AB 1B3QA 3RYHA 4UCUA 5IDJA 1BT8A 2A3QA 5IY5B 4O2AB 4KP4A 4GKJB 3GB7C 5BXZA 3LDEA 5CBHA 4NXNB 5IJ0A 3CMAV 4PD4F 3CCMV 1VQ8V 2HJDA 3HKBA 2AZ0A 1G4YB 3ZHQA 3WB1A 1I7FA 4JTAB 1NR1A 1XI1A 2ARHA 3BAAA 2DQ3A 5DM6V 4FLYA 2RJZA 4LF9O 3OEHG 3TXQA 1VQ6V 2VQFO 4LFAB 2LGWA 2XAGA 2Q7EA 3VQYA 2A7WA 1NT2B 3U0ZA 4DR7B 2YIBD 1H2SB 1AI4A 4I50A 4TQDA 4G27B 3DXRA 3E8HA 2ZIMA 5B1NA 2M6YA 3S3WA 1RSOB 2EILB 4ZHQB 2GV9A 3VOUA 3L9DA 5KHGA 1E1RG 2JIZG 2ZNJA 4O4HA 1VQ7V 3K3WA 4LF9B 2VQFB 4KXRA 3CCSV 1WP7A 4ZKIA 4DV2B 2GTAA 3JATA 4R7CA 1J95A 3A0RA 1MMMA 5IWAO 1WPXA 2LJ2A 3CXHF 3MDSA 3ASOB 2BTOA 2YICA 2IBZH 1S5HC 2EIMC 2AXTZ 2MK3A 3L73H 2JEUA 5LMNB 2IH3C 1THZA 2M7WA 2QWNB 3E83A 3JD3A 5LHIA 4RUEA 3OD4A 4X64O 4JTCB 2PUSA 3RGBA 3CEIA 4U7NA 2V7QG 4KL1A 1BGYH 1JJ2U 4PDVA 1GRJA 2ZE6A 4JI5O 4J11A 4OXSA 5LHGA 1VEWA 1F7YA 4PV1B 5LP6A 3AK3A 3OFNG 3AG3B 5L3GA 2B9ZA 1B04A 1OCZC 4HNAB 1W0JG 1COWG 3FB6C 1KP2A 2IU3A 4X64B 2L35A 1GO3F 1N32O 3K57A 4OX9O 4X88A 1AI5A 2C2AA 1S0VA 3ZMSA 1HNXO 2ADQB 4JI5B 4B3TB 4I0XA 4YJ3A 1UPGA 2JGUA 4JI8B 4TUYB 4HAMA 1IXMA 5J2TB 1DF5A 4B3RO 1Q43A 1Q6IA 3UKMA 4LF5O 4ZI7A 1FXKC 5IE9A 4LF8O 1KBHA 3HR0A 2ADPA 1FD9A 5AG2A 2AGAA 4O2AA 5JCOC 1CP9A 1SETA 3T4ZA 4I55B 1XHXA 5JWPA 4J7ZA 1OV9A 4UXNA 4MTFA 1OJHA 3EVKA 4LF5B 1V54B 1FJGO 1Q6HA 2Q8VA 4JYCA 3ZMUA 2Y48A 4JAAA 1EFRG 4J9ZB 4CH5A 1Q8IA 1VQKV 5FPOA 2R72A 3BPZA 1PV0A 1NH2B 4NXMO 2F66C 2A9HA 4JYYA 4WCEV 1SQBH 2UUBO 2F43G 4X62O 1MNGA 1N4CA 2F4VO 2CH7B 1QNMA 2NR5A 2NN4A 1JMKC 2A0LA 1YDXA 2AZ2A 1RSOA 2LW7A 4ZHQA 1ORQC 2P6JA 3K79A 1FYJA 1H38A 1AJPA 1TUBB 3WG7C 3CRAA 4AI8A 1IXBA 3OM3B 4GUNA 3CB2A 3P30A 4NXMB 4FLXA 4JV5B 3GVMA 3GWOA 2ZCEA 2VWKA 3F7YC 1XQ8A 4YY3B 2RN9A 2JJ2G 4LCUC 4I5SA 4DR4O 3B8MA 2F4VB 1AILA 3LSSA 5B3SC 4UCTA 1BQ0A 1P7GA 4FLTA 1A32A 4DR6O 1GK9A 4I4TB 4FLVA 2JGDB 3X2QB 3MD0A 4BW5A 3UQ8A 3N2KB 1D2DA 5IYBO 1AR4A 3W7TA 3FB8C 5EC2C 1SQVH 3JYCA 1W0KG 3K9SA 1GN4A 1EM1A 5CMUA 2Y4UA 2JRIA 2X6AA 4WBNB 2LFSA 4NTXA 4PDRA 1LUWA 4K8ZA 1YTFB 2PYJA 1SC5B 4QPKA 4QIWF 1QQCA 5JVDA 1Q82W 3ABMC 2FYUH 1QLEB 1VF6C 4JI0O 3IJ4A 3RT3C 3J80N 3JALB 4XBFA 4EB6B 5C93A 5HFMA 4TV8B 4DR6B 1Y74B 4PDMA 4HNAA 4NKGB 1NKDA 1F4MA 1I5YA 3TETA 2WLKA 4DO2A 3ZN0A 2O57A 3P32A 4HBNA 3BHPA 1V55C 1OCCC 3D3IA 4LH7A 4IGGA 5C8YB 2QWPB 1SF9A 4B3SO 4TUYA 5J2TA 3CCEV 3K03A 4PA9A 3J7AU 3RBZA 1O9GA 1ZTEA 1S76D 4BR6A 1QR8A 3QNEA 1URFA 1UJWB 1H2GA 1F23A 3JD2A 5KHIA 4B7EA 4YIOA 4UCSA 5LXTB 1UFIA 1H2NA 1BHBA 1XMOO 2XAHA 5BZBA 1YITV 2P22C 2HFEC 3SYOA 1HWYA 3AG1C 3F7VC 4I55A 4B7KA 4B3SB 3G71V 4N23A 1VMGA 2Q7GA 2KG7B 1K5QA 1N36O 3SDLA 1ZLZA 5KA6A 3K58A 4JI2B 4F6RB 3QG5A 1WB7A 4P9OA 3QO5A 1W2BU 3DTUB 1K3EA 3CCVV 1KYOF 1GN3A 4K0KO 1XREA 2BE3A 2Q67A 5LGNA 1BSMA 1R6NA 1QBZA 1PNMA 1FFXA 1HNWO 4ASUG 1KUQA 4CC5A 3A0HZ 3ABLC 3QO8A 2CH7A 4GX0A 4C7UA 3KCXA 4ZBMA 3RVYA 3ZHTA 2P4KA 1XL6A 4ZIBA 3B4SA 1N36B 1PNKA 4BIOA 1E79G 2IU0A 1TUBA 4DV4O 1VQOV 3W7WA 1DK1A 3CJHB 2HVJC 4U3FH 3ZIAG 4X66O 4I9QA 3CRCA 1TAEA 3CE2A 4K0KB 2MW2B 3B77A 1AP6A 4GX1A 5B1OA 4DUYO 1M9NA 2XNDG 2CK3G 4AQYO 1Z2GA 2GSMB 1JCHA 1WJZA 1NVPD 1NTKH 1M57B 3ABKB 4UVCA 2ZR3A 4I4TA 2BOBC 2JGDA 4WFEA 4DXWA 4DV4B 1M4UA 4DRXB 1KKCA 1E1QG 2Q73A 4X66B 1YVWA 5LBQA 4F6EA 1EN5A 3OUFA 4CH4A 4WBNA 3RWRD 5B1BB 2F1MA 3ZHRA 4AQYB 4GZRB 4CZZA 4QE9A 4U3JB 4EEQA 3JALA 3L71H 4EB6A 2PY5A 4TV8A 3SJAC 1Y74A 1K7DA 2ETNA 4CH3A 5IT9N 4J7JA 1WN7A 2DE0X 4LF4O 1VARA 2XUMA 4DR2O 1PNLA 3THOA 3ZRWB 5KHHA 1GN2A 1JFFB 2JS3A 5C8YA 3I5DA 3CRQA 3ZHUA 2B1IA 4RQEA 1F4NA 1H8EG 2ZDIA 4W4KA 1PM9A 5FNVB 2DOSA 3MHSC 3SPIA 3E35A 2F23A 5L3CA 4WF9V 5IJ9B 4JI6O 2UXXA 4R50A 3DC6A 4P30A 3M99B 3RN4A 2V1DA 2GBOA 5LXTA 4DR2B 2N04A 4FZ0A 1DF4A 5LOVB 3H1HH 1P49A 2ZD9A 2HVKC 2RCVA 1MOFA 1WPBA 3WU2Z 2X7RB 4UVBA 1LUVA 2BOCC 2KG7A 3BABA 5EZYB 3SPCA 1ZAUA 1O9HA 2JK5C 4FM0A 2EIMB 1SERA 4QE7A 4TT3G 3UCSC 4F6RA 4JI6B 2OCCC 2YIAA 5FLXN 4MW8A 4UVAA 1LR1A 2P4VA 3K9AA 1L1FA 2KQXA 3WFVA 3G6BA 4H0LB 4ABMA 3H01A 3EHBB 5EYPB 2N05A 5LMUB 3IC9A 4RWUA 3RYIB 1PL4A 2YDEA 2YEVB 2ATKC 3DSQA 3JAKA 1K33A 4Z2WA 2A06H 1SQGA 3RVZA 1OCZB 2XAFA 3CJHA 1YXBA 1ZWIC 1J5EO 5KX5B 4YIPA 1PD3A 4JI7B 1I0HA 5KMGB 4DUZB 2NLJC 3U11A 2IM9A 2YI8A 3K5OA 3ZEDA 1FXVA 1RFYA 1YF2A 4O4LB 4O2BB 2AW9A 5ITZB 3O65A 1PKXA 4DRXA 1M5IA 3N2GB 1FXKB 3AG2C 1L0NH 2RNBA 1NR7A 1NS1A 3CS5A 3VQWA 5D5PA 1YCIA 1HNZO 1CPYA 2XAQA 3LSUA 1AI7A 4G28B 2Q9LA 5LP6C 2JS5A 2DYRB 4U3JA 3OE7G 1KP3A 3JSLA 4DR5O 1GAXA 3U10A 4MS2A 5E79Z 3A2FA 2E76B 4JYBA 3CPWU 1I94O 1XNRO 3ZRWA 3ZS8C 1JVMA 2UUCO 1JFFA 1HNZB 3CC7V 3IAYA 4LH6A 3HKCB 1BMFG 2UUAO 1N33O 3APOA 1ROPA 1S5LZ 2LP7A 2Q69A 3CCRV 5FNVA 4JI3O 1YJNV 5IWAB 2LFRA 2DWDC 4DV5O 3IC7A 5IJ9A 4XDLA 3SYQA 3OMIB 5JJEB 3OMNB 4ICGA 3WG7B 4ZOLB 4D6TH 1I94B 5J2UB 3H1KH 2IH1C 2W0FC 1Q90D 3DC5A 5LOVA 1XNRB 2Q7HA 5B66Z 4RO2A 2UUCB 3OUSA 5B1AC 1KECA 5EBLC 5H9CA 1T5EA 1NU1H 3A0BZ 3T2MA 2HJFC 3JAWB 4IYHA 4H33A 3H1IH 3G4SV 2JVDA 1OCOC 3CCUV 4X1KB 1GH6A 4JI3B 5EZYA 3IFXA 3SGIA 5B3SB 1XOUA 1PL0A 4X1IB 1K9MW 3T1HO 1IURA 1R73A 2RQ6A 1BHAA 4GX2A 1WA8B 2BTQB 4DW0A 1N8RW 2QWRB 4UV9A 3OT7A 1WNSA 3ZN1A 5EYPA 4PA3A 3AEIA 2PI4A 1N32B 5K1XA 2YIDA 3RYIA 4OX9B 2YEVA 2AHZA 4IIJB 5CA3A 1HNXB 3TXSA 3ABMB
chains in the Genus database with same CATH topology
4FZ0A 1WP7A 3N27A 2FB5A 4NTXA 4FZ1A 3IJ4A 3S3WA 2L35A 1WP8A 2QTSA 4NTWA 4NYKA 3S3XA 4NTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FZ0 A;  1WP7 A;  3N27 A;  2FB5 A;  4NTX A;  4FZ1 A;  3IJ4 A;  3S3W A;  2L35 A;  1WP8 A;  2QTS A;  4NTW A;  4NYK A;  3S3X A;  4NTY A; 
#chains in the Genus database with same CATH topology
 2EIK B;  3NXS A;  5TIS Z;  4J41 A;  4FIP C;  2Q0O C;  4B3R B;  4FFB B;  4RUF A;  3T1H B;  1KKD A;  5KX5 A;  1L8D A;  1DGS A;  2ZT9 B;  2PZS A;  1ARO P;  1U96 A;  4LF8 B;  2YIB A;  2EZP A;  1N34 O;  4JAS A;  2ZNI A;  5KMG A;  2CTR A;  1OCC B;  2HLD G;  2EUL A;  5GTH Z;  1H2L A;  3TCU A;  5KHJ A;  3SJB C;  1K4D C;  4O4L A;  4O2B A;  4DV1 O;  4MTG A;  5ITZ A;  1BS3 A;  4X9Q A;  4QPJ A;  1S72 V;  4HZ3 A;  2B5U A;  1FXK A;  4P2Z A;  5KA5 A;  2HHH O;  2Z5U A;  1Z5W A;  1GM7 A;  1FJG B;  1JQ0 A;  2PTM A;  4MVR A;  1N34 B;  4B08 A;  1DTO A;  1X59 A;  5JCO A;  4J80 A;  4BIZ A;  3AG3 C;  3AG1 B;  4MVU A;  2UUB B;  2E5L O;  4O4I B;  4X62 B;  4LFC O;  3E89 A;  3GWK C;  1SZX A;  4PI0 A;  3ZX6 A;  3B09 A;  4DV1 B;  1G8M A;  1Y66 A;  2ZR2 A;  3OW2 U;  2HHH B;  4WFA V;  2OTL V;  4XDK A;  1NI8 A;  3T1C A;  2R9R B;  2LQT A;  3HKC A;  4AHC A;  3E8F A;  3H9V A;  3N27 A;  4I7Z B;  4OPH A;  4LP8 A;  1YHQ V;  2Q6A A;  2BSK B;  3ABU A;  2E5L B;  4LFC B;  4DR4 B;  4RQF A;  1XMQ O;  2LGQ A;  3P3N A;  2IJH A;  3B2E E;  1QLN A;  3BFR A;  1H8H G;  4ZOL A;  1EZV H;  1NZ6 A;  5J2U A;  2Y69 C;  3E8G A;  5A9G A;  3TK1 A;  5DN6 G;  3FAV B;  3JAW A;  5DEC A;  4EFB A;  4FLW A;  4X1K A;  3C3T A;  3D36 A;  3RYF B;  2HKO A;  3SPH A;  4UB6 Z;  5GTI Z;  2JEX A;  4P9P A;  4X1I A;  4JI0 B;  2WLN A;  2OIG A;  2QA4 V;  4YJ2 B;  1M93 A;  1WA8 A;  2BTQ A;  1NTM H;  5F2V O;  3R66 A;  4TV9 B;  2YS8 A;  3SPJ A;  2UXN A;  4CH6 A;  3FKS G;  4I9W A;  4JF3 A;  1IBK O;  3B40 A;  4UCO A;  3STZ C;  3QVN A;  5IYD O;  2Y4T A;  4MVS A;  2CE4 A;  3K5M A;  1EN4 A;  4DK0 A;  1MA1 A;  1R3J C;  4D7S A;  4WFB V;  1VF6 A;  4RAI A;  4LF7 O;  2CDY A;  3QTC A;  5FL7 G;  2ZXW C;  2QJ1 A;  1EBO A;  4WFH A;  3VQX A;  2ITC C;  3JCZ A;  5KLV H;  2CTW A;  1VQ5 V;  2Q0A A;  1BE3 H;  3NR7 A;  1L0L H;  4X89 A;  1KMI Z;  2IJJ A;  1FPO A;  4MSW C;  4JYA O;  2ODM A;  3SR2 C;  5L3D A;  2XHB A;  3FYE B;  2IW5 A;  1IBK B;  1XMO B;  1MSW D;  1M90 W;  3ZCC A;  2X6B A;  3Q4H B;  3STL C;  4B3M O;  4LF7 B;  3KCY A;  4JAU A;  5KUK A;  4FMT A;  1KC8 W;  1IZ3 A;  4DK1 A;  5CN0 A;  2DMX A;  1FXH A;  2H94 A;  1ZX3 A;  2ZQM A;  3PN1 A;  2OWO A;  1QCE A;  1W59 A;  1QVF U;  1DLB A;  1Y6X A;  3LNM B;  5LHH A;  4JYA B;  2UXD O;  4Q20 A;  3AG4 C;  4LFB O;  1NVP B;  2HG5 C;  4LWS B;  4Q6G A;  1M56 C;  1HNW B;  4O4I A;  3HKE B;  3E2E A;  5CB4 B;  4KFM A;  1S77 D;  1WAZ A;  1NTZ H;  3ML0 A;  1XDC A;  1PP9 H;  2HP8 A;  3A8T A;  4JPR A;  2LO1 A;  1AB3 A;  2ZE8 A;  2OCC B;  5CBG A;  4J10 A;  5EBW C;  3N2K A;  1BZK A;  4IL6 Z;  3EFF K;  2XAS A;  2XTA A;  3ABT A;  2UXD B;  1K97 A;  1GMG A;  3KKY A;  3ASN C;  4GLX A;  3JAM N;  3DGE A;  2X6C A;  2P06 A;  2WLJ A;  4GT1 A;  2BSK A;  2OIE A;  1K5S A;  4DUY B;  4FM1 A;  3P3P A;  3K5L A;  3K5N A;  1RPO A;  1AR1 B;  2EJR A;  1VQM V;  2QM8 A;  3CHX A;  5GON B;  2ZIO A;  3W7U A;  2ITD C;  2QWQ B;  4CS2 A;  1X4T A;  2YUA A;  2WLM A;  2PF4 E;  4IHJ B;  1XNQ O;  3LUT B;  1QVG U;  3ZRX A;  3FAV A;  1TVK B;  4MVO A;  1U97 A;  3C3S A;  3RYF A;  5KHK A;  1Q86 W;  4PA4 A;  2CAZ C;  2DYS C;  2XT9 A;  3SPG A;  1RP3 B;  1OCR C;  4BAY A;  2X0L A;  2P5O A;  2EIJ C;  4YJ2 A;  3OR6 C;  1AI6 A;  3SYC A;  2ZM6 O;  4LF4 B;  3R65 A;  4TV9 A;  3AG2 B;  1FAF A;  3ZMT A;  3HKD B;  1XNQ B;  1YI2 V;  4HYO A;  2IJK A;  5BMV B;  1KU9 A;  3D3Q A;  3FYI B;  3OGC C;  5BR8 O;  2HR3 A;  3OTO O;  4YXW G;  2OTJ V;  2QTS A;  3CC4 V;  3M8A A;  4MVZ A;  5FPR A;  4JI1 O;  1JA8 A;  4PA7 A;  1Z5V A;  1RPR A;  4EKW A;  5LGU A;  4FFK A;  5LYJ B;  2PYL A;  4DV3 O;  5A2Q N;  2ZM6 B;  2Q5Z A;  2FML A;  3UO2 A;  3AG7 A;  3LDC A;  1RM1 C;  3AK1 A;  1JR9 A;  1SQP H;  2WLH A;  2GDS A;  3KZI Z;  5BR8 B;  4PI2 A;  4GKJ O;  3ZMZ A;  3OTO B;  3Q4H A;  4GX5 A;  4G2K A;  4JI1 B;  1TUE B;  4JZG A;  2KB1 A;  1YJ9 V;  1HW7 A;  4FLZ A;  2EIN C;  1OZ0 A;  4DV3 B;  4GYC B;  2QTO A;  4LFA O;  4NB5 A;  4J7K A;  1IBL O;  5EIB C;  1VQ9 V;  3KG2 A;  1IVS A;  4DR7 O;  5LA6 B;  3RYC B;  4LWS A;  1EN6 A;  3E86 A;  3W7X A;  2WPD G;  2D2C B;  2Y0P A;  2UXB O;  1OCO B;  1SA0 B;  3HKE A;  4TSF G;  3BA9 A;  1KD1 W;  5CB4 A;  3C90 A;  4CBC A;  2QEX V;  1B6Q A;  1B06 A;  3FB5 C;  4L8J A;  5KUM A;  1JX9 A;  1OHH G;  1MG1 A;  2CTQ A;  1J5E B;  4YHH O;  1D5N A;  3JD0 A;  2DWE C;  4KUM A;  1IBL B;  4DV2 O;  2FL4 A;  2Z3Y A;  3CCJ V;  4PDL A;  3OEE G;  3CD6 V;  3VQV A;  4R6Z A;  3CXC U;  5JQG B;  2QM7 A;  2YXL A;  3G80 A;  2UXB B;  2OCH A;  4FZ1 A;  1QR9 A;  5LMN O;  1ZSP A;  1MZF A;  3JAR B;  3ETE A;  5GON A;  2WA3 A;  1XEQ A;  4L87 A;  3ZHV A;  3OTF A;  3JAS B;  4WFF A;  4NTY A;  4PA6 A;  3CRR A;  4IHJ A;  3HPL C;  2OT5 A;  4YHH B;  1K4C C;  3L75 H;  2W6J G;  4DR1 O;  4J42 A;  5B5E Z;  1SZT A;  1TVK A;  4FVM A;  2CUG A;  4IT5 A;  2WAM A;  3OGI B;  1XL4 A;  1P4R A;  2P7T C;  3CC2 V;  4GKK O;  3LSQ A;  1H2M A;  5CA0 B;  4FLU A;  2YXH A;  4UFZ A;  1VQL V;  4DR5 B;  1SRY A;  4MT8 A;  5IYC O;  2WSS G;  4CC6 A;  3HKD A;  1AR5 A;  5H5N A;  4JGS A;  5BMV A;  2EBO A;  4DR1 B;  2K9P A;  2ZKO A;  4Z1M G;  5IY5 C;  4B3T O;  2DW4 A;  2UUA B;  5JVD B;  1N33 B;  4H44 B;  4JI8 O;  2R9I A;  4PJ0 Z;  3O9O A;  2WLI B;  1Q5O A;  1M1K W;  4GKK B;  5D5Q A;  4DV6 O;  5LYJ A;  3ZJZ A;  4DV5 B;  4PEL A;  3RW0 A;  3FB7 C;  2YC0 A;  3BEH A;  4NR1 A;  3W7S A;  4MTX A;  3K59 A;  4U7O A;  2FB5 A;  2QKC A;  1VP7 A;  3K0D A;  3M7M X;  4BWA A;  5K1P A;  4UCV A;  4FK5 C;  3I55 V;  3RFR A;  4QGP A;  5H6Q A;  4F4L A;  1US6 A;  5CBF A;  1SES A;  3TGU H;  1NJI W;  1GN6 A;  4DV6 B;  2QDO A;  1ZL8 B;  2EIL C;  3B8N A;  1SQX H;  4X1Y B;  5IYZ B;  2GTS A;  4TOI A;  4D7T A;  4K8X A;  2K1E A;  2L6L A;  2FTK A;  4E2L A;  2Y69 B;  1XUQ A;  3CX5 F;  3G6E V;  3CCL V;  2Z0A A;  4K3A A;  5LA6 A;  4WFG A;  3RYC A;  1V55 B;  3TJT A;  4CS4 A;  4JZ2 A;  2VRZ A;  2DYR C;  4DYL A;  3CSX A;  3ASO C;  1NQT A;  1SA0 A;  3SYA A;  2QKS A;  2F95 B;  1ENV A;  2NNU A;  1FKA O;  3MAQ A;  3CWB H;  2YXY A;  4FJC C;  1EZJ A;  1XHZ A;  3N2G A;  3WB2 A;  3J81 N;  3E22 B;  3ZHS A;  4LNU B;  3UT5 B;  3K06 A;  4JV5 O;  2E74 B;  3ETG A;  4LBE C;  5JH7 B;  4KHP O;  4DV0 O;  1FFX B;  2QWO B;  2ZE7 A;  2HEP A;  3FX7 A;  4YY3 O;  2YSU B;  4MVQ A;  4CS3 A;  5JQG A;  4UV8 A;  1Y4M A;  3ETQ A;  3LNN A;  2CGN A;  1NH2 D;  5CA1 B;  4FM2 A;  2CTP A;  1VQN V;  1N0J A;  3E8B A;  3JAR A;  2GUZ B;  3CME V;  2ZXW B;  3T1Y O;  3JAS A;  3L70 H;  1FFT B;  2GHY A;  1YJW V;  5H6R A;  4TWK A;  2AHY A;  4XDJ A;  1GM9 A;  2EJ7 A;  4IYI A;  4BW9 A;  4DV0 B;  4KHP B;  4R8C A;  1R1B A;  3UM7 A;  1VF7 A;  2VQE O;  3APQ A;  2R9A A;  3D36 C;  2QSA A;  2WLL B;  5CA0 A;  3ABL B;  3I56 V;  3T1Y B;  2D3O W;  1PPJ H;  5EBM C;  3ZRS A;  4MVM A;  1HP8 A;  5KAF Z;  1KB9 F;  5JJJ B;  1AJQ A;  1Y76 B;  4OPA A;  4MTO A;  4LR3 A;  4EFE A;  2W0X A;  2RMK B;  1TGO A;  2QR4 A;  3PJS K;  3SJQ C;  2VQE B;  3AG4 B;  3HB3 B;  4DW1 A;  2EIK C;  3CCQ V;  1Y67 A;  4J9Y B;  1M56 B;  1Q81 W;  2F93 B;  2Q4P A;  2WLI A;  1D5A A;  2P90 A;  1G6U A;  1YTF D;  1QU7 A;  5L3B A;  1AJN A;  2KKW A;  1YEW A;  4GCZ A;  1XMQ B;  1I5X A;  1V54 C;  3BVO A;  3BY6 A;  3AK2 A;  5GW7 A;  1GTO A;  3CRM A;  1LNQ A;  3JD4 A;  1YZB A;  1KQS U;  4NYK A;  1G1X B;  1JPX A;  3K08 A;  3ASN B;  1S5J A;  1WLE A;  2P67 A;  2FKX A;  2RDC A;  4UCR A;  4IIJ A;  3QF7 A;  4NVP A;  3IGA C;  4MW3 A;  4O4J B;  4UB8 Z;  1R6T A;  4JI2 O;  5J9P C;  1ZL8 A;  3FD9 A;  1VQP V;  4X1Y A;  3MHH C;  3ETD A;  5IYZ A;  1S3J A;  1H2K A;  2E3C A;  4FFB A;  3T4D A;  1VF5 B;  2R70 A;  3QO7 A;  4NTW A;  2Y0I A;  1P84 F;  2H8P C;  4X20 B;  4Z1V A;  4LC1 A;  1GKF A;  4TQF A;  5EK0 A;  3SJC C;  3BCC H;  1QHT A;  2KSD A;  1VQ4 V;  4X65 O;  3S3X A;  5LL6 Y;  2XAJ A;  1FS0 G;  2DYS B;  1OCR B;  2DN9 A;  2UXC O;  5H2F Z;  1WB8 A;  3X2Q C;  4JI4 O;  1P7B A;  2EIJ B;  1HR0 O;  2QKA A;  5LGT A;  5L3E A;  1TA8 A;  3E22 A;  4LNU A;  3UT5 A;  3G67 A;  4UUJ C;  2WA4 A;  3F5W C;  5JH7 A;  5E1A C;  2UU9 O;  1Q6U A;  4JAV A;  5EC1 C;  2XOK G;  4AIL C;  2VS0 A;  3BRC A;  3RYH B;  4X65 B;  1I08 A;  1R3I C;  5CA1 A;  3JAK B;  1MZE A;  1QLE C;  3EXA A;  4QJF B;  5IJ0 B;  2GUZ A;  2LW1 A;  1R6K A;  4B3M B;  2ZIN A;  1SQQ H;  3H1J H;  2UXC B;  3HKB B;  4JI4 B;  1HR0 B;  2PGG A;  3D8C A;  1VIB A;  4W4L A;  2EX3 A;  1ZUQ A;  2UU9 B;  1RM1 B;  3OR7 C;  1GM8 A;  1WP8 A;  4H13 B;  1K8A W;  2ZDI C;  2BCC H;  2JJ1 G;  1YSC A;  4I50 B;  4PHZ A;  4LFB B;  2YI9 A;  2WLL A;  2VWJ A;  3OAA G;  2W6I G;  4JTD B;  2QGN A;  1BCC H;  3DXR B;  5BY1 A;  3WB0 A;  2EIN B;  1BQZ A;  4OGQ B;  1CEZ A;  4E4E A;  4O4H B;  2ILM A;  1SKV A;  1Y76 A;  1K92 A;  1N0N A;  1Q7Y W;  1IX9 A;  1AP5 A;  5DED A;  1MAB G;  4H37 A;  3FFQ A;  3JAT B;  4FPP A;  2QM4 A;  1K73 W;  3SYP A;  5EIB D;  2CGO A;  4K35 A;  2H3O A;  1R3L C;  1IBM O;  1NBM G;  4X8A A;  2V4D A;  3ZBH A;  5JJN B;  3BA8 A;  3CP1 A;  1R3K C;  1AVM A;  3UO3 A;  1SS3 A;  3L74 H;  1HDJ A;  1BL8 A;  3K0G A;  1F51 A;  4O4J A;  5LP6 B;  4DV7 O;  2EZO A;  4A5U B;  1K34 A;  2IJI A;  2JDI G;  3VBB A;  2Q68 A;  3LDD A;  5HFL A;  3F5T A;  4QNH B;  3ZMV A;  4DR3 O;  1IBM B;  1JOY A;  2ZE5 A;  1YIJ V;  3JCU Z;  4X20 A;  4LF6 O;  1Q3E A;  3H1L H;  5LMU O;  3ZRV A;  2A79 B;  3ICX A;  3L72 H;  3K04 A;  4I0X B;  2QE7 G;  4YJ3 B;  1CXZ B;  4NXN O;  4DV7 B;  1M57 C;  3ABK C;  1V9P A;  1IDS A;  2DQ0 A;  2WWW A;  2PI5 A;  5KAI Z;  2N74 A;  4DR3 B;  3JD1 A;  2OYQ A;  4ZI7 B;  5L3F A;  4JI7 O;  2DJV A;  1MSD A;  1SQF A;  2G38 A;  2B1G A;  2E75 B;  1XIL A;  3JSN A;  3OMA B;  4DUZ O;  1JJO A;  4LF6 B;  1XBL A;  4BIU A;  4N21 A;  3CYO A;  5B1B C;  5B1A B;  1B3Q A;  3RYH A;  4UCU A;  5IDJ A;  1BT8 A;  2A3Q A;  5IY5 B;  4O2A B;  4KP4 A;  4GKJ B;  3GB7 C;  5BXZ A;  3LDE A;  5CBH A;  4NXN B;  5IJ0 A;  3CMA V;  4PD4 F;  3CCM V;  1VQ8 V;  2HJD A;  3HKB A;  2AZ0 A;  1G4Y B;  3ZHQ A;  3WB1 A;  1I7F A;  4JTA B;  1NR1 A;  1XI1 A;  2ARH A;  3BAA A;  2DQ3 A;  5DM6 V;  4FLY A;  2RJZ A;  4LF9 O;  3OEH G;  3TXQ A;  1VQ6 V;  2VQF O;  4LFA B;  2LGW A;  2XAG A;  2Q7E A;  3VQY A;  2A7W A;  1NT2 B;  3U0Z A;  4DR7 B;  2YIB D;  1H2S B;  1AI4 A;  4I50 A;  4TQD A;  4G27 B;  3DXR A;  3E8H A;  2ZIM A;  5B1N A;  2M6Y A;  3S3W A;  1RSO B;  2EIL B;  4ZHQ B;  2GV9 A;  3VOU A;  3L9D A;  5KHG A;  1E1R G;  2JIZ G;  2ZNJ A;  4O4H A;  1VQ7 V;  3K3W A;  4LF9 B;  2VQF B;  4KXR A;  3CCS V;  1WP7 A;  4ZKI A;  4DV2 B;  2GTA A;  3JAT A;  4R7C A;  1J95 A;  3A0R A;  1MMM A;  5IWA O;  1WPX A;  2LJ2 A;  3CXH F;  3MDS A;  3ASO B;  2BTO A;  2YIC A;  2IBZ H;  1S5H C;  2EIM C;  2AXT Z;  2MK3 A;  3L73 H;  2JEU A;  5LMN B;  2IH3 C;  1THZ A;  2M7W A;  2QWN B;  3E83 A;  3JD3 A;  5LHI A;  4RUE A;  3OD4 A;  4X64 O;  4JTC B;  2PUS A;  3RGB A;  3CEI A;  4U7N A;  2V7Q G;  4KL1 A;  1BGY H;  1JJ2 U;  4PDV A;  1GRJ A;  2ZE6 A;  4JI5 O;  4J11 A;  4OXS A;  5LHG A;  1VEW A;  1F7Y A;  4PV1 B;  5LP6 A;  3AK3 A;  3OFN G;  3AG3 B;  5L3G A;  2B9Z A;  1B04 A;  1OCZ C;  4HNA B;  1W0J G;  1COW G;  3FB6 C;  1KP2 A;  2IU3 A;  4X64 B;  2L35 A;  1GO3 F;  1N32 O;  3K57 A;  4OX9 O;  4X88 A;  1AI5 A;  2C2A A;  1S0V A;  3ZMS A;  1HNX O;  2ADQ B;  4JI5 B;  4B3T B;  4I0X A;  4YJ3 A;  1UPG A;  2JGU A;  4JI8 B;  4TUY B;  4HAM A;  1IXM A;  5J2T B;  1DF5 A;  4B3R O;  1Q43 A;  1Q6I A;  3UKM A;  4LF5 O;  4ZI7 A;  1FXK C;  5IE9 A;  4LF8 O;  1KBH A;  3HR0 A;  2ADP A;  1FD9 A;  5AG2 A;  2AGA A;  4O2A A;  5JCO C;  1CP9 A;  1SET A;  3T4Z A;  4I55 B;  1XHX A;  5JWP A;  4J7Z A;  1OV9 A;  4UXN A;  4MTF A;  1OJH A;  3EVK A;  4LF5 B;  1V54 B;  1FJG O;  1Q6H A;  2Q8V A;  4JYC A;  3ZMU A;  2Y48 A;  4JAA A;  1EFR G;  4J9Z B;  4CH5 A;  1Q8I A;  1VQK V;  5FPO A;  2R72 A;  3BPZ A;  1PV0 A;  1NH2 B;  4NXM O;  2F66 C;  2A9H A;  4JYY A;  4WCE V;  1SQB H;  2UUB O;  2F43 G;  4X62 O;  1MNG A;  1N4C A;  2F4V O;  2CH7 B;  1QNM A;  2NR5 A;  2NN4 A;  1JMK C;  2A0L A;  1YDX A;  2AZ2 A;  1RSO A;  2LW7 A;  4ZHQ A;  1ORQ C;  2P6J A;  3K79 A;  1FYJ A;  1H38 A;  1AJP A;  1TUB B;  3WG7 C;  3CRA A;  4AI8 A;  1IXB A;  3OM3 B;  4GUN A;  3CB2 A;  3P30 A;  4NXM B;  4FLX A;  4JV5 B;  3GVM A;  3GWO A;  2ZCE A;  2VWK A;  3F7Y C;  1XQ8 A;  4YY3 B;  2RN9 A;  2JJ2 G;  4LCU C;  4I5S A;  4DR4 O;  3B8M A;  2F4V B;  1AIL A;  3LSS A;  5B3S C;  4UCT A;  1BQ0 A;  1P7G A;  4FLT A;  1A32 A;  4DR6 O;  1GK9 A;  4I4T B;  4FLV A;  2JGD B;  3X2Q B;  3MD0 A;  4BW5 A;  3UQ8 A;  3N2K B;  1D2D A;  5IYB O;  1AR4 A;  3W7T A;  3FB8 C;  5EC2 C;  1SQV H;  3JYC A;  1W0K G;  3K9S A;  1GN4 A;  1EM1 A;  5CMU A;  2Y4U A;  2JRI A;  2X6A A;  4WBN B;  2LFS A;  4NTX A;  4PDR A;  1LUW A;  4K8Z A;  1YTF B;  2PYJ A;  1SC5 B;  4QPK A;  4QIW F;  1QQC A;  5JVD A;  1Q82 W;  3ABM C;  2FYU H;  1QLE B;  1VF6 C;  4JI0 O;  3IJ4 A;  3RT3 C;  3J80 N;  3JAL B;  4XBF A;  4EB6 B;  5C93 A;  5HFM A;  4TV8 B;  4DR6 B;  1Y74 B;  4PDM A;  4HNA A;  4NKG B;  1NKD A;  1F4M A;  1I5Y A;  3TET A;  2WLK A;  4DO2 A;  3ZN0 A;  2O57 A;  3P32 A;  4HBN A;  3BHP A;  1V55 C;  1OCC C;  3D3I A;  4LH7 A;  4IGG A;  5C8Y B;  2QWP B;  1SF9 A;  4B3S O;  4TUY A;  5J2T A;  3CCE V;  3K03 A;  4PA9 A;  3J7A U;  3RBZ A;  1O9G A;  1ZTE A;  1S76 D;  4BR6 A;  1QR8 A;  3QNE A;  1URF A;  1UJW B;  1H2G A;  1F23 A;  3JD2 A;  5KHI A;  4B7E A;  4YIO A;  4UCS A;  5LXT B;  1UFI A;  1H2N A;  1BHB A;  1XMO O;  2XAH A;  5BZB A;  1YIT V;  2P22 C;  2HFE C;  3SYO A;  1HWY A;  3AG1 C;  3F7V C;  4I55 A;  4B7K A;  4B3S B;  3G71 V;  4N23 A;  1VMG A;  2Q7G A;  2KG7 B;  1K5Q A;  1N36 O;  3SDL A;  1ZLZ A;  5KA6 A;  3K58 A;  4JI2 B;  4F6R B;  3QG5 A;  1WB7 A;  4P9O A;  3QO5 A;  1W2B U;  3DTU B;  1K3E A;  3CCV V;  1KYO F;  1GN3 A;  4K0K O;  1XRE A;  2BE3 A;  2Q67 A;  5LGN A;  1BSM A;  1R6N A;  1QBZ A;  1PNM A;  1FFX A;  1HNW O;  4ASU G;  1KUQ A;  4CC5 A;  3A0H Z;  3ABL C;  3QO8 A;  2CH7 A;  4GX0 A;  4C7U A;  3KCX A;  4ZBM A;  3RVY A;  3ZHT A;  2P4K A;  1XL6 A;  4ZIB A;  3B4S A;  1N36 B;  1PNK A;  4BIO A;  1E79 G;  2IU0 A;  1TUB A;  4DV4 O;  1VQO V;  3W7W A;  1DK1 A;  3CJH B;  2HVJ C;  4U3F H;  3ZIA G;  4X66 O;  4I9Q A;  3CRC A;  1TAE A;  3CE2 A;  4K0K B;  2MW2 B;  3B77 A;  1AP6 A;  4GX1 A;  5B1O A;  4DUY O;  1M9N A;  2XND G;  2CK3 G;  4AQY O;  1Z2G A;  2GSM B;  1JCH A;  1WJZ A;  1NVP D;  1NTK H;  1M57 B;  3ABK B;  4UVC A;  2ZR3 A;  4I4T A;  2BOB C;  2JGD A;  4WFE A;  4DXW A;  4DV4 B;  1M4U A;  4DRX B;  1KKC A;  1E1Q G;  2Q73 A;  4X66 B;  1YVW A;  5LBQ A;  4F6E A;  1EN5 A;  3OUF A;  4CH4 A;  4WBN A;  3RWR D;  5B1B B;  2F1M A;  3ZHR A;  4AQY B;  4GZR B;  4CZZ A;  4QE9 A;  4U3J B;  4EEQ A;  3JAL A;  3L71 H;  4EB6 A;  2PY5 A;  4TV8 A;  3SJA C;  1Y74 A;  1K7D A;  2ETN A;  4CH3 A;  5IT9 N;  4J7J A;  1WN7 A;  2DE0 X;  4LF4 O;  1VAR A;  2XUM A;  4DR2 O;  1PNL A;  3THO A;  3ZRW B;  5KHH A;  1GN2 A;  1JFF B;  2JS3 A;  5C8Y A;  3I5D A;  3CRQ A;  3ZHU A;  2B1I A;  4RQE A;  1F4N A;  1H8E G;  2ZDI A;  4W4K A;  1PM9 A;  5FNV B;  2DOS A;  3MHS C;  3SPI A;  3E35 A;  2F23 A;  5L3C A;  4WF9 V;  5IJ9 B;  4JI6 O;  2UXX A;  4R50 A;  3DC6 A;  4P30 A;  3M99 B;  3RN4 A;  2V1D A;  2GBO A;  5LXT A;  4DR2 B;  2N04 A;  4FZ0 A;  1DF4 A;  5LOV B;  3H1H H;  1P49 A;  2ZD9 A;  2HVK C;  2RCV A;  1MOF A;  1WPB A;  3WU2 Z;  2X7R B;  4UVB A;  1LUV A;  2BOC C;  2KG7 A;  3BAB A;  5EZY B;  3SPC A;  1ZAU A;  1O9H A;  2JK5 C;  4FM0 A;  2EIM B;  1SER A;  4QE7 A;  4TT3 G;  3UCS C;  4F6R A;  4JI6 B;  2OCC C;  2YIA A;  5FLX N;  4MW8 A;  4UVA A;  1LR1 A;  2P4V A;  3K9A A;  1L1F A;  2KQX A;  3WFV A;  3G6B A;  4H0L B;  4ABM A;  3H01 A;  3EHB B;  5EYP B;  2N05 A;  5LMU B;  3IC9 A;  4RWU A;  3RYI B;  1PL4 A;  2YDE A;  2YEV B;  2ATK C;  3DSQ A;  3JAK A;  1K33 A;  4Z2W A;  2A06 H;  1SQG A;  3RVZ A;  1OCZ B;  2XAF A;  3CJH A;  1YXB A;  1ZWI C;  1J5E O;  5KX5 B;  4YIP A;  1PD3 A;  4JI7 B;  1I0H A;  5KMG B;  4DUZ B;  2NLJ C;  3U11 A;  2IM9 A;  2YI8 A;  3K5O A;  3ZED A;  1FXV A;  1RFY A;  1YF2 A;  4O4L B;  4O2B B;  2AW9 A;  5ITZ B;  3O65 A;  1PKX A;  4DRX A;  1M5I A;  3N2G B;  1FXK B;  3AG2 C;  1L0N H;  2RNB A;  1NR7 A;  1NS1 A;  3CS5 A;  3VQW A;  5D5P A;  1YCI A;  1HNZ O;  1CPY A;  2XAQ A;  3LSU A;  1AI7 A;  4G28 B;  2Q9L A;  5LP6 C;  2JS5 A;  2DYR B;  4U3J A;  3OE7 G;  1KP3 A;  3JSL A;  4DR5 O;  1GAX A;  3U10 A;  4MS2 A;  5E79 Z;  3A2F A;  2E76 B;  4JYB A;  3CPW U;  1I94 O;  1XNR O;  3ZRW A;  3ZS8 C;  1JVM A;  2UUC O;  1JFF A;  1HNZ B;  3CC7 V;  3IAY A;  4LH6 A;  3HKC B;  1BMF G;  2UUA O;  1N33 O;  3APO A;  1ROP A;  1S5L Z;  2LP7 A;  2Q69 A;  3CCR V;  5FNV A;  4JI3 O;  1YJN V;  5IWA B;  2LFR A;  2DWD C;  4DV5 O;  3IC7 A;  5IJ9 A;  4XDL A;  3SYQ A;  3OMI B;  5JJE B;  3OMN B;  4ICG A;  3WG7 B;  4ZOL B;  4D6T H;  1I94 B;  5J2U B;  3H1K H;  2IH1 C;  2W0F C;  1Q90 D;  3DC5 A;  5LOV A;  1XNR B;  2Q7H A;  5B66 Z;  4RO2 A;  2UUC B;  3OUS A;  5B1A C;  1KEC A;  5EBL C;  5H9C A;  1T5E A;  1NU1 H;  3A0B Z;  3T2M A;  2HJF C;  3JAW B;  4IYH A;  4H33 A;  3H1I H;  3G4S V;  2JVD A;  1OCO C;  3CCU V;  4X1K B;  1GH6 A;  4JI3 B;  5EZY A;  3IFX A;  3SGI A;  5B3S B;  1XOU A;  1PL0 A;  4X1I B;  1K9M W;  3T1H O;  1IUR A;  1R73 A;  2RQ6 A;  1BHA A;  4GX2 A;  1WA8 B;  2BTQ B;  4DW0 A;  1N8R W;  2QWR B;  4UV9 A;  3OT7 A;  1WNS A;  3ZN1 A;  5EYP A;  4PA3 A;  3AEI A;  2PI4 A;  1N32 B;  5K1X A;  2YID A;  3RYI A;  4OX9 B;  2YEV A;  2AHZ A;  4IIJ B;  5CA3 A;  1HNX B;  3TXS A;  3ABM B; 
#chains in the Genus database with same CATH homology
 4FZ0 A;  1WP7 A;  3N27 A;  2FB5 A;  4NTX A;  4FZ1 A;  3IJ4 A;  3S3W A;  2L35 A;  1WP8 A;  2QTS A;  4NTW A;  4NYK A;  3S3X A;  4NTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...