4NTWA

Structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
412
structure length
410
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/toxin
molecule keywords Acid-sensing ion channel 1
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
total genus 109
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntwA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntwA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntwA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntwA02
1WP8A 3IJ4A 2FB5A 4NTWA 4NYKA 3S3WA 4FZ1A 2QTSA 4NTXA 3S3XA 1WP7A 4NTYA 3N27A 4FZ0A 2L35A
chains in the Genus database with same CATH superfamily
1K92A 4JF3A 4EB6A 2XAJA 3I55V 5GW7A 4GZRB 4LR3A 1QBZA 1PL4A 1O9GA 3N2KB 3RGBA 4P30A 3N2KA 4N23A 4GYCB 1DF4A 2WLNA 1XDCA 2Z5UA 4LH6A 4FFBB 3CEIA 4FFBA 3A0HZ 1YHQV 4MVRA 4BIUA 2UUCO 2UUBO 5EZYB 3PJSK 2ZE6A 4OPHA 3ZRWB 4U7NA 1JVMA 3ZMSA 2Y69B 5EZYA 3ZRWA 2RJZA 4OX9O 1K9MW 3AG2C 1M57C 3GWKC 1Q86W 3E8HA 1NTKH 2RMKB 4C7UA 5J2TB 3ABLB 1EN5A 2ZE5A 1N32O 2B9ZA 5KHHA 4XDKA 3T1HO 4DV5O 1SQPH 3CJHB 4PELA 5IY5B 2HHHB 4KP4A 3CJHA 1XI1A 1W0KG 1SZTA 1YTFB 4OPAA 4CH6A 2R70A 4UUJC 1M90W 1M93A 2XUMA 1H2NA 2N04A 4NKGB 3C3TA 3JAWB 1BS3A 2W0FC 4PDVA 4UCSA 5DECA 2JJ1G 3JAWA 4DR2O 4BW5A 1PPJH 4LBEC 1YEWA 5FL7G 2XAGA 3ZS8C 2ZCEA 4TSFG 1MSDA 4JI8B 1HNXO 5LGUA 1XNQO 4LH7A 2WLMA 2XAHA 3K5LA 3K5OA 3F5WC 2IBZH 3BVOA 1NQTA 5B1BB 4JI1O 4I9WA 4CC5A 2HLDG 2E76B 3FAVB 3KCYA 1ZX3A 3FAVA 1NVPB 4H44B 4P9PA 4U3FH 3RBZA 1Q6UA 1WA8B 1DLBA 1TVKB 1WA8A 3ML0A 2EILC 1URFA 4YXWG 4DV5B 1GN6A 1TVKA 3HB3B 1PNKA 4FVMA 2F4VB 1Q90D 1AR1B 1G1XB 1U97A 1AR5A 1N0NA 4IIJB 1LUWA 2Q68A 3VOUA 1AI6A 4MTXA 3SPIA 5IYZB 2Q67A 1AI5A 2KG7A 2PGGA 5IYZA 4QNHB 2R72A 3W7UA 4UFZA 3P3NA 4DUYB 2Y0IA 1Q6IA 4ZBMA 3CE2A 4F6RB 2HEPA 3H01A 1K3EA 1HNXB 1MZFA 5ITZB 4F6RA 4I7ZB 3ABKB 3UO2A 5BMVB 4B7EA 5ITZA 5F2VO 1THZA 4HYOA 2NNUA 5BMVA 1Y66A 1N34O 1X4TA 1WPXA 4PI2A 1SQGA 3A0RA 4P9OA 4E4EA 5A2QN 3K3WA 4FM1A 3DC6A 4DW0A 2VS0A 2KB1A 3BRCA 4MTGA 4NVPA 2YIBD 4X9QA 3C3SA 1Q3EA 1YXBA 1IBKB 1OCCC 1QR8A 2DE0X 1OV9A 4I5SA 2YDEA 5EC1C 2WA4A 4O2BB 5LMUO 1XEQA 4DR6B 2QEXV 1RP3B 4O2BA 5IWAB 2P4KA 2ZR3A 2LW7A 1NH2B 3FX7A 4DV3B 3OD4A 3K58A 1M57B 1V54C 3ZHUA 4DV2O 1KC8W 3ASNC 1KP2A 4TV9A 2PZSA 1FFTB 1RM1C 4Z2WA 2EJRA 3I5DA 3ZRXA 1FPOA 3H9VA 3K03A 2YXLA 3JATB 3O9OA 3IC9A 2DN9A 3BPZA 1Y76B 3JATA 1JR9A 1I7FA 3FD9A 3P30A 1Y76A 3G80A 1GRJA 1W0JG 3QG5A 3W7XA 4JYBA 1OZ0A 4YHHB 4JYAB 3CMAV 4DV0O 3CCLV 3L72H 3X2QB 3S3WA 4NB5A 5CA1B 4DV4B 1BHBA 1JPXA 1R3KC 5CA1A 1VIBA 3E35A 1MOFA 1HWYA 1HNWO 4KHPO 1S0VA 4JGSA 3WG7C 3K04A 4WFAV 1AJNA 2BSKB 3CS5A 2E74B 4NTXA 3SPJA 2BSKA 1N36B 3CCJV 1QVFU 4DV2B 3RVYA 2ARHA 4FZ0A 5JJEB 4DYLA 2F1MA 2YI9A 1MMMA 1XL6A 4UVCA 1BZKA 2AZ2A 3CCVV 3H1HH 3BABA 4LF4B 3IAYA 2JVDA 3E8BA 2CTPA 4O4LB 4RUFA 3F7YC 1K97A 3JD1A 4O4LA 4X1YB 3L70H 1NJIW 5IT9N 1ZL8B 3MDSA 3U11A 4X1YA 2VWKA 3JYCA 1OCRB 2ZXWB 1ZL8A 2N05A 2QR4A 3W7SA 2F43G 1SESA 2H3OA 4FZ1A 2EIKC 4B3MO 4NXMB 1IZ3A 3ZCCA 4X8AA 1RSOB 2JGUA 4YIPA 3A8TA 1RSOA 1N33O 4DR4B 5CBHA 4GUNA 3QVNA 1FXHA 1H8HG 2KQXA 5IYCO 1D5NA 2YS8A 2EINC 3CSXA 3OMAB 4YY3O 4JI5O 2X7RB 1KU9A 2QM4A 3OTOB 4LC1A 4DV7O 4FFKA 1Q43A 1PM9A 2ETNA 2Q6AA 3CCEV 4I55A 1GM8A 3RWRD 1VF5B 2CAZC 3LDCA 1K5QA 3ZHTA 1AP6A 3ZX6A 4GKKO 1ORQC 3UKMA 2AHYA 3EXAA 4HNAB 1W2BU 2ZR2A 5B66Z 1GH6A 3A0BZ 4HNAA 1M1KW 2BTOA 1J5EO 3Q4HA 5FPOA 1JJ2U 3SPGA 2B1GA 3GB7C 2R9IA 3ASOC 4IGGA 2X6BA 5LP6C 1ZTEA 4LCUC 5H9CA 4X66B 1R6KA 3E83A 2E3CA 2RN9A 3MAQA 4MW3A 1M56B 2ADPA 1Z5VA 5CBFA 4LFBB 3OEEG 5B1NA 2ZE7A 1VP7A 1NKDA 3B09A 4H37A 5IJ9B 3OR6C 4X65B 5IJ9A 3J80N 2K9PA 5AG2A 1NU1H 4DV7B 4WF9V 3NXSA 1RFYA 2Q7EA 4MW8A 1QCEA 2DYSC 2FL4A 5KA5A 1OCOC 1GN4A 1P4RA 2P06A 3FYIB 1YSCA 3RW0A 4PD4F 2BTQB 1NI8A 3SJQC 2X0LA 1TAEA 4NXNO 2BTQA 3JCUZ 1NVPD 1KMIZ 2A3QA 3D8CA 4I9QA 1PD3A 3AG4C 2EIJB 1XUQA 3B8NA 5BR8B 3B4SA 1AJQA 2YIBA 3UM7A 3K57A 3CRMA 1MABG 3K79A 2AW9A 1IX9A 4Z1MG 1H38A 1VQ8V 1PNMA 3LNMB 2NLJC 5LMNB 2JS5A 2HFEC 2Y0PA 1SRYA 1XBLA 3ZHVA 4TWKA 3CC7V 2WPDG 2GV9A 4NYKA 3E22B 1MSWD 1XNRO 1VF7A 2B5UA 2DYRB 3E22A 1D5AA 3VQXA 4J42A 4X88A 3SGIA 1BQ0A 4FLUA 1DGSA 4BAYA 2R9RB 4DR3O 3GVMA 3W7TA 2CK3G 4RQFA 1B6QA 2PTMA 4WFBV 4JV5O 2JDIG 3LUTB 1KKDA 1R3IC 4L87A 3SR2C 5L3GA 2QJ1A 4J41A 2JIZG 3K0DA 4UVBA 2ATKC 2QWQB 5HFLA 1BMFG 5LYJB 3RT3C 1K4DC 2DQ0A 5LYJA 4GKJO 4CH4A 1VQ4V 5B3SC 4DV1B 3FB6C 1LNQA 4EFEA 2QGNA 3M7MX 4K0KO 3FB7C 2IU0A 2ADQB 3SJAC 5KHGA 4FPPA 2JEUA 4UCRA 4Q6GA 1YJ9V 4JZ2A 4DR5O 5LP6B 5J2UB 4CH3A 1ZAUA 1WPBA 5LP6A 5J2UA 5JWPA 1HR0O 2UXDO 1JCHA 3ABMC 2Q73A 4YJ3B 5CBGA 3HKCB 4R7CA 5EYPB 5CB4B 1SERA 4YJ3A 3HKCA 5EYPA 5CB4A 2LGWA 3G4SV 4GX5A 3T4DA 3ZHQA 1AP5A 4MT8A 3JSNA 2G38A 3U10A 2D3OW 2Q0OC 4JV5B 3GWOA 5JH7B 5EIBC 1AI7A 2L6LA 2EIMB 2M7WA 4H33A 2HG5C 4BIZA 1BGYH 4J9ZB 3WB1A 2DYSB 4KUMA 3IFXA 1H8EG 5B5EZ 1GN2A 1L8DA 2GBOA 2C2AA 1HDJA 4X64B 3D36C 3RYIB 3CCMV 4J11A 5TISZ 3RYIA 1BE3H 1SA0B 4Q20A 1SA0A 4K3AA 5EBWC 3RN4A 1IXMA 3F7VC 2YSUB 2IJIA 2FB5A 4G27B 1XHZA 2WSSG 5LGTA 2OIEA 3CC2V 2R9AA 4LFCB 4ZKIA 1R1BA 1KECA 3ZMUA 1FD9A 1OCZC 5D5PA 4TUYB 4JAAA 2OCCB 4JI2O 3E86A 4TUYA 3JD3A 1XQ8A 3K0GA 5JVDB 4RWUA 2YEVB 4W4KA 5JVDA 2YEVA 5DEDA 2ZIOA 4J7JA 2Z3YA 3AK3A 1AILA 4JI3O 5FLXN 5IJ0B 1GK9A 1I5XA 4PDLA 5IJ0A 1DTOA 2CDYA 4G28B 1YIJV 3N2GB 3H1JH 4J7ZA 4KFMA 4UCVA 3LSUA 3ABUA 3N2GA 2WLKA 4K8ZA 4QGPA 4X1KB 4MSWC 4EKWA 1LUVA 3OAAG 4DK0A 4X1KA 2UUCB 2UUBB 1QLEC 4B3TO 4JZGA 1VF6C 3TGUH 1IXBA 1UPGA 2AXTZ 4K8XA 4OX9B 4FLXA 4UV9A 4FLYA 1JJOA 1BCCH 1V55B 2LP7A 1N32B 4LF9O 2A79B 1GM9A 3T1HB 5B3SB 2OYQA 3DGEA 4CZZA 5LOVB 1CPYA 1IBMO 5A9GA 4LWSB 1XMQO 5LOVA 4U7OA 4LWSA 1BL8A 2QWPB 4FLVA 2W6JG 2OIGA 1EBOA 3C90A 3B2EE 4RUEA 3QNEA 2A0LA 2LJ2A 2KG7B 3JARB 3L73H 1PKXA 4MS2A 4P2ZA 3P32A 3JARA 1L0LH 4DR2B 1WJZA 5C8YB 5IE9A 4D7TA 3CRCA 4JAUA 3E2EA 2ODMA 1HNZO 5C8YA 3U0ZA 4DR1O 3CYOA 3HR0A 3DXRB 3S3XA 3SYOA 1XNQB 3AG3B 1EZVH 3DXRA 4QPKA 1J95A 3CCUV 1IBLO 1BSMA 2CGNA 1S76D 5BXZA 4JI1B 2HP8A 3PN1A 2UU9O 2VQEO 1E79G 2DWEC 3WB0A 4B7KA 1FXKC 4JYCA 4O4HA 4N21A 5B1AC 2ZDIC 1B04A 1WN7A 1Z2GA 1R6NA 4PI0A 1K34A 5JJNB 1YZBA 2ZD9A 1VQMV 4X20B 4H13B 1H2GA 1XMQB 4X20A 5IDJA 2JJ2G 4HBNA 1WP8A 4XBFA 3OW2U 3QO5A 4O4JB 2L35A 4MVQA 2XHBA 4O4JA 4UV8A 1T5EA 3AG2B 5CA0B 2GDSA 2YICA 2PI4A 1MG1A 4B3SO 4TV9B 3G71V 1MA1A 5CA0A 4A5UB 2DWDC 1N0JA 2QWNB 3CCRV 1OCZB 2OT5A 3BA8A 3WFVA 1CEZA 1K73W 5JCOC 3BCCH 2CUGA 3FKSG 2WLHA 2V1DA 3OR7C 4L8JA 3ZBHA 1N4CA 1N34B 4TQFA 4GCZA 4LF8O 2ZE8A 3CP1A 2VQFO 1VARA 5L3DA 4CH5A 4B3RO 1G8MA 5KUMA 2YUAA 3H1KH 3VQWA 3FFQA 2F93B 4MVZA 2E75B 5LA6B 2V7QG 3HKEB 1SKVA 5LA6A 5LMUB 1NR1A 3HKEA 2QTOA 1S3JA 1FYJA 2YXYA 2EBOA 1EN6A 2DQ3A 2PYLA 5H6RA 5KX5B 2Q9LA 1FXVA 3EHBB 4OGQB 3K5NA 5KX5A 5H6QA 1R73A 3LSSA 1VQ5V 1SC5B 2KKWA 2EILB 2HKOA 4RAIA 2JGDB 2ZNJA 3ETEA 3AK2A 4J80A 2JGDA 4TQDA 5GONB 1IDSA 5GONA 2Q0AA 2P6JA 3DSQA 1XL4A 4LF8B 4WCEV 2VQFB 4U3JB 4DV0B 1YVWA 4U3JA 1GTOA 1XMOO 3L71H 4KL1A 1PNLA 4JPRA 3G67A 4XDJA 1TUEB 5KMGB 1SS3A 3OGCC 4LP8A 2ITDC 1HNWB 5KMGA 4KHPB 5KHKA 1YF2A 2PY5A 4LF5O 3IJ4A 3UT5B 2EJ7A 1P49A 3OFNG 1WP7A 3UT5A 4AI8A 4I50B 2CTQA 4JI6O 2H8PC 4I50A 1NZ6A 4RQEA 2ZM6O 4AHCA 1JMKC 4I55B 5CN0A 3JASB 4YIOA 1H2LA 3JASA 3L74H 1KP3A 2HVKC 4WFEA 5KHJA 2Y4TA 1H2KA 2HR3A 2UXCO 5JJJB 2MW2B 4PDMA 3Q4HB 4BWAA 4GX2A 1OCCB 3QO8A 2Q7HA 3L9DA 1Y4MA 4X1IB 4GX1A 4X1IA 4FJCC 1XMOB 4JI4O 2QKSA 4BW9A 4B3MB 5H2FZ 1S5JA 5KAIZ 1V54B 4O4IB 3ASNB 1AI4A 4O4IA 1RM1B 1N33B 1NR7A 1S5LZ 3AG1C 3SYCA 1VEWA 2WWWA 1R6TA 3ICXA 4JI5B 4YY3B 4GT1A 1SQBH 5DN6G 4ABMA 1P84F 3E8FA 3SYAA 1HW7A 2F23A 5LBQA 3CPWU 3B40A 1VQ7V 1VMGA 3STLC 4JTCB 1EM1A 1UFIA 1B3QA 4GKKB 1AR4A 3B77A 1Q8IA 3APOA 4LF7O 3CCQV 1JQ0A 3G6EV 2RCVA 1J5EB 5CMUA 5BY1A 4CS3A 3SJCC 3WG7B 1H2SB 1Y6XA 4JI4B 4D6TH 1RPOA 3AK1A 4FM0A 5H5NA 1Y74A 2UXBO 4NTWA 5E79Z 2B1IA 4IL6Z 1F23A 4EFBA 4F4LA 1YCIA 2YC0A 3ZRSA 1EZJA 2GTAA 5B1OA 4MVUA 3RYFB 2Y69C 3ABTA 4MVSA 4UB8Z 3I56V 3RYFA 1QNMA 2JK5C 3ZJZA 1YJNV 4TV8B 3AG7A 4UVAA 3KG2A 3CXCU 1K33A 3ABLC 4TV8A 2QM7A 2EIKB 2P4VA 3IGAC 4LFAO 4DR7O 4XDLA 5EIBD 5IY5C 4NXNB 2QDOA 3T1YO 3KKYA 4RO2A 5L3CA 1AROP 3SJBC 2QA4V 3ZMTA 2A06H 3T1CA 2EINB 2F66C 1GAXA 2P90A 4WBNB 1AJPA 1JA8A 1Y67A 4WBNA 1YI2V 1K4CC 3T4ZA 2CTWA 4AQYO 3HKBB 3JAKB 2DJVA 1TA8A 3HKBA 5C93A 3JAKA 1KB9F 3ETQA 3UO3A 3CRQA 4DV6O 3H1LH 1K8AW 4J9YB 3CX5F 2D2CB 4DW1A 4DUZO 4JAVA 1FKAO 2EZOA 5B1BC 4JI7O 2Q8VA 2MK3A 4FIPC 3BEHA 3O65A 4G2KA 2E5LO 4EEQA 4X89A 2ZQMA 1Z5WA 1XNRB 4LNUB 2UXXA 2RQ6A 4OXSA 3ASOB 4LNUA 1WB7A 1SF9A 3K08A 3P3PA 3TXQA 1COWG 3T1YB 4DR3B 4J7KA 1ZUQA 2NR5A 3E8GA 1VQPV 2HJDA 5CA3A 1VQ6V 2Y4UA 2P5OA 4ZIBA 1TGOA 2WLLB 1OCOB 2WLLA 1XILA 4PA3A 4DV6B 2DW4A 4UCOA 4GKJB 1EFRG 1P7GA 2GUZB 3ABKC 2GUZA 4ZI7B 1PV0A 4JI0O 3THOA 3JAMN 3ETGA 1Q82W 4ZI7A 3ETDA 4PV1B 5GTIZ 1QHTA 2CTRA 2VRZA 4K0KB 2XNDG 1PP9H 1V9PA 4NR1A 3AG4B 5LHGA 4DR5B 3QF7A 3OE7G 1HR0B 2UXDB 1WLEA 1JX9A 3EFFK 3QO7A 2CE4A 3BFRA 2RNBA 4JI8O 2A9HA 2EX3A 4TT3G 4DRXB 3KZIZ 4JTAB 4DRXA 3ZHSA 2HJFC 4TOIA 3JD0A 3TJTA 2WAMA 1W59A 2IH1C 2CGOA 4ZHQB 5L3BA 4ZHQA 1AVMA 3VQVA 5J2TA 3RVZA 3CMEV 2WA3A 2CH7B 3DTUB 2QTSA 4JI0B 2CH7A 2F4VO 3J7AU 3BAAA 1Q5OA 1XREA 2P22C 3K9SA 2BOCC 3IC7A 1R3JC 3X2QC 2ZNIA 3A2FA 5L3FA 3B8MA 1XOUA 1G6UA 1M9NA 3UCSC 4DUYO 2LFRA 1K7DA 3AEIA 3VQYA 4MVMA 4JI2B 3LNNA 2GSMB 2WLIB 2AHZA 3LDEA 1WB8A 2QSAA 2WLIA 3APQA 2P67A 4JI3B 1FFXB 4AILC 4PHZA 2YIDA 1L1FA 4ICGA 1CXZB 1FFXA 1VQOV 2OTLV 2ZINA 3OUFA 3ABMB 4PA9A 3OTFA 4CS2A 1IBKO 4FM2A 2LQTA 1OCRC 2ZXWC 3STZC 1OHHG 4IIJA 4DR6O 4CBCA 4B3TB 5IWAO 2FTKA 3TXSA 3BA9A 3RFRA 4IT5A 4PA4A 3QTCA 4DV3O 2PYJA 1GKFA 3HKDB 4O4HB 3CRAA 1F4MA 2P7TC 3HKDA 4D7SA 4UCUA 3TETA 2YI8A 1VQ9V 2Q7GA 3CRRA 4LF9B 1GO3F 3CXHF 5K1PA 2Q69A 3R65A 1M5IA 2QM8A 3D36A 3OEHG 4PA7A 4WFGA 3ZEDA 1IBMB 5EK0A 4KXRA 4YHHO 1I94O 4JYAO 5EBLC 5EC2C 1QVGU 4DV4O 2FYUH 1S72V 5IYBO 5KHIA 1EN4A 1GM7A 4DO2A 1HNZB 4DR1B 2AGAA 3T2MA 1P7BA 3H1IH 3W7WA 1IBLB 2FMLA 2DOSA 3FYEB 1FS0G 1N36O 1SQVH 1FJGO 4QIWF 2UU9B 2YIAA 2VQEB 1IURA 1SQXH 1M56C 4UCTA 4HZ3A 3ZHRA 4YJ2B 2N74A 1K5SA 2XTAA 3CB2A 4YJ2A 2IU3A 3JD2A 4LF4O 1NT2B 4Z1VA 4WFHA 5JQGB 1KYOF 4X62O 4BR6A 2A7WA 2QWOB 2XAFA 2PUSA 5JQGA 5KA6A 2LGQA 1WAZA 4MVOA 2ITCC 3MHSC 4LF6O 1I94B 1SQQH 1QLEB 2IM9A 1VF6A 4NXMO 3ZMVA 4B3SB 1S5HC 4ASUG 3MHHC 4UB6Z 5J9PC 3OGIB 4FLZA 3K06A 4DR4O 4QPJA 1F51A 1VQNV 1H2MA 3RYCB 2ZIMA 2EIJC 3RYCA 3ZIAG 3OTOO 1FJGB 3D3IA 2X6CA 1KBHA 2EZPA 2JRIA 4PDRA 1YDXA 2IH3C 4B3RB 2EULA 1NTMH 2XAQA 1E1RG 3OUSA 1U96A 1ZWIC 4MTFA 2KSDA 3FB8C 4X62B 3ZMZA 2HVJC 3MD0A 5HFMA 2JEXA 5FNVB 1BHAA 4LF6B 3CD6V 5FNVA 4IYHA 2DYRC 2OWOA 5D5QA 2WLJA 4MTOA 1WNSA 1G4YB 4X66O 4E2LA 2ILMA 3K5MA 1QQCA 4DK1A 4QE9A 4LFBO 4QE7A 1FXKB 2RDCA 3LSQA 5KLVH 4PJ0Z 4FMTA 3SYQA 3CC4V 5B1AB 4UXNA 1FXKA 1QLNA 3UQ8A 3N27A 4BIOA 2ZDIA 2LW1A 1RPRA 3CHXA 3J81N 2LFSA 2W0XA 4X65O 1AB3A 1MNGA 1I5YA 2BCCH 2IJKA 1I0HA 1TUBB 5IYDO 3OT7A 1TUBA 1BT8A 2LO1A 2V4DA 4CC6A 3OMIB 1XHXA 3L75H 5BZBA 4NTYA 1NS1A 1SQFA 5LGNA 4LF5B 2Q5ZA 3CCSV 2QKCA 5JCOA 3TK1A 1JFFB 1JFFA 1D2DA 4JI6B 3WB2A 5BR8O 3LDDA 1M4UA 2Q4PA 2ZM6B 2QKAA 3VBBA 3FB5C 5L3EA 3SPCA 1YTFD 4PA6A 1O9HA 2BOBC 4R6ZA 1S77D 2UUAO 3M99B 2QE7G 4H0LB 3RYHB 5LL6Y 3ZRVA 5KAFZ 2OCHA 4FLTA 3RYHA 5LMNO 1E1QG 2UXCB 3OMNB 1Q7YW 1PL0A 2EIMC 1ENVA 1DF5A 3SYPA 2PF4E 3SPHA 1SZXA 1DK1A 1GN3A 1KUQA 3CWBH 4JYYA 1Y74B 1VQLV 2PI5A 1MZEA 1VQKV 3K9AA 4HAMA 1Q81W 1F7YA 4R50A 1L0NH 2VWJA 2AZ0A 4I0XB 4FLWA 1B06A 3R66A 5LHHA 5DM6V 4I0XA 3DC5A 2QWRB 4R8CA 1ROPA 4QJFB 4FK5C 3E89A 1YITV 2IJJA 3ZN0A 3F5TA 1YJWV 1GMGA 2Z0AA 5LHIA 2H94A 5LXTB 1FAFA 3JD4A 2UUAB 3KCXA 4ZOLB 5LXTA 2OCCC 1LR1A 4ZOLA 2Y48A 3BY6A 4CS4A 4I4TB 4LF7B 4DV1O 2O57A 1HP8A 4I4TA 5EBMC 4IHJB 2IW5A 2XT9A 2K1EA 4IHJA 3M8AA 2X6AA 3OM3B 1ZSPA 1X59A 4K35A 4DXWA 2UXBB 1US6A 1IVSA 4JTDB 3SDLA 1JOYA 4JASA 1QR9A 3TCUA 2FKXA 2IJHA 2ZKOA 1KKCA 1F4NA 1ZLZA 5K1XA 4GLXA 2JS3A 1V55C 2ZT9B 1N8RW 5GTHZ 2UXNA 1OJHA 2F95B 4LFAB 1A32A 4X64O 1SETA 5KUKA 4DR7B 1KQSU 5FPRA 1NH2D 3NR7A 2XASA 1NBMG 1Q6HA 3ZN1A 1CP9A 2DMXA 3AG1B 3BHPA 2BE3A 3EVKA 3G6BA 3JSLA 4O2AB 4GX0A 3JALB 1NTZH 4O2AA 4IYIA 4F6EA 3JALA 4WFFA 3HPLC 4AQYB 1QU7A 4W4LA 3D3QA 4LFCO 2GHYA 1BQZA 2W6IG 1KD1W 3K59A 2OTJV 1R3LC 2GTSA 3AG3C 3WU2Z 4DUZB 4J10A 3JCZA 2XOKG 2NN4A 2HHHO 1UJWB 4JI7B 2M6YA 5E1AC 2YXHA 2E5LB 5JH7A 1I08A 4B08A 4EB6B
chains in the Genus database with same CATH topology
1WP8A 3IJ4A 2FB5A 4NTWA 4NYKA 3S3WA 4FZ1A 2QTSA 4NTXA 3S3XA 1WP7A 4NTYA 3N27A 4FZ0A 2L35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP8 A;  3IJ4 A;  2FB5 A;  4NTW A;  4NYK A;  3S3W A;  4FZ1 A;  2QTS A;  4NTX A;  3S3X A;  1WP7 A;  4NTY A;  3N27 A;  4FZ0 A;  2L35 A; 
#chains in the Genus database with same CATH topology
 1K92 A;  4JF3 A;  4EB6 A;  2XAJ A;  3I55 V;  5GW7 A;  4GZR B;  4LR3 A;  1QBZ A;  1PL4 A;  1O9G A;  3N2K B;  3RGB A;  4P30 A;  3N2K A;  4N23 A;  4GYC B;  1DF4 A;  2WLN A;  1XDC A;  2Z5U A;  4LH6 A;  4FFB B;  3CEI A;  4FFB A;  3A0H Z;  1YHQ V;  4MVR A;  4BIU A;  2UUC O;  2UUB O;  5EZY B;  3PJS K;  2ZE6 A;  4OPH A;  3ZRW B;  4U7N A;  1JVM A;  3ZMS A;  2Y69 B;  5EZY A;  3ZRW A;  2RJZ A;  4OX9 O;  1K9M W;  3AG2 C;  1M57 C;  3GWK C;  1Q86 W;  3E8H A;  1NTK H;  2RMK B;  4C7U A;  5J2T B;  3ABL B;  1EN5 A;  2ZE5 A;  1N32 O;  2B9Z A;  5KHH A;  4XDK A;  3T1H O;  4DV5 O;  1SQP H;  3CJH B;  4PEL A;  5IY5 B;  2HHH B;  4KP4 A;  3CJH A;  1XI1 A;  1W0K G;  1SZT A;  1YTF B;  4OPA A;  4CH6 A;  2R70 A;  4UUJ C;  1M90 W;  1M93 A;  2XUM A;  1H2N A;  2N04 A;  4NKG B;  3C3T A;  3JAW B;  1BS3 A;  2W0F C;  4PDV A;  4UCS A;  5DEC A;  2JJ1 G;  3JAW A;  4DR2 O;  4BW5 A;  1PPJ H;  4LBE C;  1YEW A;  5FL7 G;  2XAG A;  3ZS8 C;  2ZCE A;  4TSF G;  1MSD A;  4JI8 B;  1HNX O;  5LGU A;  1XNQ O;  4LH7 A;  2WLM A;  2XAH A;  3K5L A;  3K5O A;  3F5W C;  2IBZ H;  3BVO A;  1NQT A;  5B1B B;  4JI1 O;  4I9W A;  4CC5 A;  2HLD G;  2E76 B;  3FAV B;  3KCY A;  1ZX3 A;  3FAV A;  1NVP B;  4H44 B;  4P9P A;  4U3F H;  3RBZ A;  1Q6U A;  1WA8 B;  1DLB A;  1TVK B;  1WA8 A;  3ML0 A;  2EIL C;  1URF A;  4YXW G;  4DV5 B;  1GN6 A;  1TVK A;  3HB3 B;  1PNK A;  4FVM A;  2F4V B;  1Q90 D;  1AR1 B;  1G1X B;  1U97 A;  1AR5 A;  1N0N A;  4IIJ B;  1LUW A;  2Q68 A;  3VOU A;  1AI6 A;  4MTX A;  3SPI A;  5IYZ B;  2Q67 A;  1AI5 A;  2KG7 A;  2PGG A;  5IYZ A;  4QNH B;  2R72 A;  3W7U A;  4UFZ A;  3P3N A;  4DUY B;  2Y0I A;  1Q6I A;  4ZBM A;  3CE2 A;  4F6R B;  2HEP A;  3H01 A;  1K3E A;  1HNX B;  1MZF A;  5ITZ B;  4F6R A;  4I7Z B;  3ABK B;  3UO2 A;  5BMV B;  4B7E A;  5ITZ A;  5F2V O;  1THZ A;  4HYO A;  2NNU A;  5BMV A;  1Y66 A;  1N34 O;  1X4T A;  1WPX A;  4PI2 A;  1SQG A;  3A0R A;  4P9O A;  4E4E A;  5A2Q N;  3K3W A;  4FM1 A;  3DC6 A;  4DW0 A;  2VS0 A;  2KB1 A;  3BRC A;  4MTG A;  4NVP A;  2YIB D;  4X9Q A;  3C3S A;  1Q3E A;  1YXB A;  1IBK B;  1OCC C;  1QR8 A;  2DE0 X;  1OV9 A;  4I5S A;  2YDE A;  5EC1 C;  2WA4 A;  4O2B B;  5LMU O;  1XEQ A;  4DR6 B;  2QEX V;  1RP3 B;  4O2B A;  5IWA B;  2P4K A;  2ZR3 A;  2LW7 A;  1NH2 B;  3FX7 A;  4DV3 B;  3OD4 A;  3K58 A;  1M57 B;  1V54 C;  3ZHU A;  4DV2 O;  1KC8 W;  3ASN C;  1KP2 A;  4TV9 A;  2PZS A;  1FFT B;  1RM1 C;  4Z2W A;  2EJR A;  3I5D A;  3ZRX A;  1FPO A;  3H9V A;  3K03 A;  2YXL A;  3JAT B;  3O9O A;  3IC9 A;  2DN9 A;  3BPZ A;  1Y76 B;  3JAT A;  1JR9 A;  1I7F A;  3FD9 A;  3P30 A;  1Y76 A;  3G80 A;  1GRJ A;  1W0J G;  3QG5 A;  3W7X A;  4JYB A;  1OZ0 A;  4YHH B;  4JYA B;  3CMA V;  4DV0 O;  3CCL V;  3L72 H;  3X2Q B;  3S3W A;  4NB5 A;  5CA1 B;  4DV4 B;  1BHB A;  1JPX A;  1R3K C;  5CA1 A;  1VIB A;  3E35 A;  1MOF A;  1HWY A;  1HNW O;  4KHP O;  1S0V A;  4JGS A;  3WG7 C;  3K04 A;  4WFA V;  1AJN A;  2BSK B;  3CS5 A;  2E74 B;  4NTX A;  3SPJ A;  2BSK A;  1N36 B;  3CCJ V;  1QVF U;  4DV2 B;  3RVY A;  2ARH A;  4FZ0 A;  5JJE B;  4DYL A;  2F1M A;  2YI9 A;  1MMM A;  1XL6 A;  4UVC A;  1BZK A;  2AZ2 A;  3CCV V;  3H1H H;  3BAB A;  4LF4 B;  3IAY A;  2JVD A;  3E8B A;  2CTP A;  4O4L B;  4RUF A;  3F7Y C;  1K97 A;  3JD1 A;  4O4L A;  4X1Y B;  3L70 H;  1NJI W;  5IT9 N;  1ZL8 B;  3MDS A;  3U11 A;  4X1Y A;  2VWK A;  3JYC A;  1OCR B;  2ZXW B;  1ZL8 A;  2N05 A;  2QR4 A;  3W7S A;  2F43 G;  1SES A;  2H3O A;  4FZ1 A;  2EIK C;  4B3M O;  4NXM B;  1IZ3 A;  3ZCC A;  4X8A A;  1RSO B;  2JGU A;  4YIP A;  3A8T A;  1RSO A;  1N33 O;  4DR4 B;  5CBH A;  4GUN A;  3QVN A;  1FXH A;  1H8H G;  2KQX A;  5IYC O;  1D5N A;  2YS8 A;  2EIN C;  3CSX A;  3OMA B;  4YY3 O;  4JI5 O;  2X7R B;  1KU9 A;  2QM4 A;  3OTO B;  4LC1 A;  4DV7 O;  4FFK A;  1Q43 A;  1PM9 A;  2ETN A;  2Q6A A;  3CCE V;  4I55 A;  1GM8 A;  3RWR D;  1VF5 B;  2CAZ C;  3LDC A;  1K5Q A;  3ZHT A;  1AP6 A;  3ZX6 A;  4GKK O;  1ORQ C;  3UKM A;  2AHY A;  3EXA A;  4HNA B;  1W2B U;  2ZR2 A;  5B66 Z;  1GH6 A;  3A0B Z;  4HNA A;  1M1K W;  2BTO A;  1J5E O;  3Q4H A;  5FPO A;  1JJ2 U;  3SPG A;  2B1G A;  3GB7 C;  2R9I A;  3ASO C;  4IGG A;  2X6B A;  5LP6 C;  1ZTE A;  4LCU C;  5H9C A;  4X66 B;  1R6K A;  3E83 A;  2E3C A;  2RN9 A;  3MAQ A;  4MW3 A;  1M56 B;  2ADP A;  1Z5V A;  5CBF A;  4LFB B;  3OEE G;  5B1N A;  2ZE7 A;  1VP7 A;  1NKD A;  3B09 A;  4H37 A;  5IJ9 B;  3OR6 C;  4X65 B;  5IJ9 A;  3J80 N;  2K9P A;  5AG2 A;  1NU1 H;  4DV7 B;  4WF9 V;  3NXS A;  1RFY A;  2Q7E A;  4MW8 A;  1QCE A;  2DYS C;  2FL4 A;  5KA5 A;  1OCO C;  1GN4 A;  1P4R A;  2P06 A;  3FYI B;  1YSC A;  3RW0 A;  4PD4 F;  2BTQ B;  1NI8 A;  3SJQ C;  2X0L A;  1TAE A;  4NXN O;  2BTQ A;  3JCU Z;  1NVP D;  1KMI Z;  2A3Q A;  3D8C A;  4I9Q A;  1PD3 A;  3AG4 C;  2EIJ B;  1XUQ A;  3B8N A;  5BR8 B;  3B4S A;  1AJQ A;  2YIB A;  3UM7 A;  3K57 A;  3CRM A;  1MAB G;  3K79 A;  2AW9 A;  1IX9 A;  4Z1M G;  1H38 A;  1VQ8 V;  1PNM A;  3LNM B;  2NLJ C;  5LMN B;  2JS5 A;  2HFE C;  2Y0P A;  1SRY A;  1XBL A;  3ZHV A;  4TWK A;  3CC7 V;  2WPD G;  2GV9 A;  4NYK A;  3E22 B;  1MSW D;  1XNR O;  1VF7 A;  2B5U A;  2DYR B;  3E22 A;  1D5A A;  3VQX A;  4J42 A;  4X88 A;  3SGI A;  1BQ0 A;  4FLU A;  1DGS A;  4BAY A;  2R9R B;  4DR3 O;  3GVM A;  3W7T A;  2CK3 G;  4RQF A;  1B6Q A;  2PTM A;  4WFB V;  4JV5 O;  2JDI G;  3LUT B;  1KKD A;  1R3I C;  4L87 A;  3SR2 C;  5L3G A;  2QJ1 A;  4J41 A;  2JIZ G;  3K0D A;  4UVB A;  2ATK C;  2QWQ B;  5HFL A;  1BMF G;  5LYJ B;  3RT3 C;  1K4D C;  2DQ0 A;  5LYJ A;  4GKJ O;  4CH4 A;  1VQ4 V;  5B3S C;  4DV1 B;  3FB6 C;  1LNQ A;  4EFE A;  2QGN A;  3M7M X;  4K0K O;  3FB7 C;  2IU0 A;  2ADQ B;  3SJA C;  5KHG A;  4FPP A;  2JEU A;  4UCR A;  4Q6G A;  1YJ9 V;  4JZ2 A;  4DR5 O;  5LP6 B;  5J2U B;  4CH3 A;  1ZAU A;  1WPB A;  5LP6 A;  5J2U A;  5JWP A;  1HR0 O;  2UXD O;  1JCH A;  3ABM C;  2Q73 A;  4YJ3 B;  5CBG A;  3HKC B;  4R7C A;  5EYP B;  5CB4 B;  1SER A;  4YJ3 A;  3HKC A;  5EYP A;  5CB4 A;  2LGW A;  3G4S V;  4GX5 A;  3T4D A;  3ZHQ A;  1AP5 A;  4MT8 A;  3JSN A;  2G38 A;  3U10 A;  2D3O W;  2Q0O C;  4JV5 B;  3GWO A;  5JH7 B;  5EIB C;  1AI7 A;  2L6L A;  2EIM B;  2M7W A;  4H33 A;  2HG5 C;  4BIZ A;  1BGY H;  4J9Z B;  3WB1 A;  2DYS B;  4KUM A;  3IFX A;  1H8E G;  5B5E Z;  1GN2 A;  1L8D A;  2GBO A;  2C2A A;  1HDJ A;  4X64 B;  3D36 C;  3RYI B;  3CCM V;  4J11 A;  5TIS Z;  3RYI A;  1BE3 H;  1SA0 B;  4Q20 A;  1SA0 A;  4K3A A;  5EBW C;  3RN4 A;  1IXM A;  3F7V C;  2YSU B;  2IJI A;  2FB5 A;  4G27 B;  1XHZ A;  2WSS G;  5LGT A;  2OIE A;  3CC2 V;  2R9A A;  4LFC B;  4ZKI A;  1R1B A;  1KEC A;  3ZMU A;  1FD9 A;  1OCZ C;  5D5P A;  4TUY B;  4JAA A;  2OCC B;  4JI2 O;  3E86 A;  4TUY A;  3JD3 A;  1XQ8 A;  3K0G A;  5JVD B;  4RWU A;  2YEV B;  4W4K A;  5JVD A;  2YEV A;  5DED A;  2ZIO A;  4J7J A;  2Z3Y A;  3AK3 A;  1AIL A;  4JI3 O;  5FLX N;  5IJ0 B;  1GK9 A;  1I5X A;  4PDL A;  5IJ0 A;  1DTO A;  2CDY A;  4G28 B;  1YIJ V;  3N2G B;  3H1J H;  4J7Z A;  4KFM A;  4UCV A;  3LSU A;  3ABU A;  3N2G A;  2WLK A;  4K8Z A;  4QGP A;  4X1K B;  4MSW C;  4EKW A;  1LUV A;  3OAA G;  4DK0 A;  4X1K A;  2UUC B;  2UUB B;  1QLE C;  4B3T O;  4JZG A;  1VF6 C;  3TGU H;  1IXB A;  1UPG A;  2AXT Z;  4K8X A;  4OX9 B;  4FLX A;  4UV9 A;  4FLY A;  1JJO A;  1BCC H;  1V55 B;  2LP7 A;  1N32 B;  4LF9 O;  2A79 B;  1GM9 A;  3T1H B;  5B3S B;  2OYQ A;  3DGE A;  4CZZ A;  5LOV B;  1CPY A;  1IBM O;  5A9G A;  4LWS B;  1XMQ O;  5LOV A;  4U7O A;  4LWS A;  1BL8 A;  2QWP B;  4FLV A;  2W6J G;  2OIG A;  1EBO A;  3C90 A;  3B2E E;  4RUE A;  3QNE A;  2A0L A;  2LJ2 A;  2KG7 B;  3JAR B;  3L73 H;  1PKX A;  4MS2 A;  4P2Z A;  3P32 A;  3JAR A;  1L0L H;  4DR2 B;  1WJZ A;  5C8Y B;  5IE9 A;  4D7T A;  3CRC A;  4JAU A;  3E2E A;  2ODM A;  1HNZ O;  5C8Y A;  3U0Z A;  4DR1 O;  3CYO A;  3HR0 A;  3DXR B;  3S3X A;  3SYO A;  1XNQ B;  3AG3 B;  1EZV H;  3DXR A;  4QPK A;  1J95 A;  3CCU V;  1IBL O;  1BSM A;  2CGN A;  1S76 D;  5BXZ A;  4JI1 B;  2HP8 A;  3PN1 A;  2UU9 O;  2VQE O;  1E79 G;  2DWE C;  3WB0 A;  4B7K A;  1FXK C;  4JYC A;  4O4H A;  4N21 A;  5B1A C;  2ZDI C;  1B04 A;  1WN7 A;  1Z2G A;  1R6N A;  4PI0 A;  1K34 A;  5JJN B;  1YZB A;  2ZD9 A;  1VQM V;  4X20 B;  4H13 B;  1H2G A;  1XMQ B;  4X20 A;  5IDJ A;  2JJ2 G;  4HBN A;  1WP8 A;  4XBF A;  3OW2 U;  3QO5 A;  4O4J B;  2L35 A;  4MVQ A;  2XHB A;  4O4J A;  4UV8 A;  1T5E A;  3AG2 B;  5CA0 B;  2GDS A;  2YIC A;  2PI4 A;  1MG1 A;  4B3S O;  4TV9 B;  3G71 V;  1MA1 A;  5CA0 A;  4A5U B;  2DWD C;  1N0J A;  2QWN B;  3CCR V;  1OCZ B;  2OT5 A;  3BA8 A;  3WFV A;  1CEZ A;  1K73 W;  5JCO C;  3BCC H;  2CUG A;  3FKS G;  2WLH A;  2V1D A;  3OR7 C;  4L8J A;  3ZBH A;  1N4C A;  1N34 B;  4TQF A;  4GCZ A;  4LF8 O;  2ZE8 A;  3CP1 A;  2VQF O;  1VAR A;  5L3D A;  4CH5 A;  4B3R O;  1G8M A;  5KUM A;  2YUA A;  3H1K H;  3VQW A;  3FFQ A;  2F93 B;  4MVZ A;  2E75 B;  5LA6 B;  2V7Q G;  3HKE B;  1SKV A;  5LA6 A;  5LMU B;  1NR1 A;  3HKE A;  2QTO A;  1S3J A;  1FYJ A;  2YXY A;  2EBO A;  1EN6 A;  2DQ3 A;  2PYL A;  5H6R A;  5KX5 B;  2Q9L A;  1FXV A;  3EHB B;  4OGQ B;  3K5N A;  5KX5 A;  5H6Q A;  1R73 A;  3LSS A;  1VQ5 V;  1SC5 B;  2KKW A;  2EIL B;  2HKO A;  4RAI A;  2JGD B;  2ZNJ A;  3ETE A;  3AK2 A;  4J80 A;  2JGD A;  4TQD A;  5GON B;  1IDS A;  5GON A;  2Q0A A;  2P6J A;  3DSQ A;  1XL4 A;  4LF8 B;  4WCE V;  2VQF B;  4U3J B;  4DV0 B;  1YVW A;  4U3J A;  1GTO A;  1XMO O;  3L71 H;  4KL1 A;  1PNL A;  4JPR A;  3G67 A;  4XDJ A;  1TUE B;  5KMG B;  1SS3 A;  3OGC C;  4LP8 A;  2ITD C;  1HNW B;  5KMG A;  4KHP B;  5KHK A;  1YF2 A;  2PY5 A;  4LF5 O;  3IJ4 A;  3UT5 B;  2EJ7 A;  1P49 A;  3OFN G;  1WP7 A;  3UT5 A;  4AI8 A;  4I50 B;  2CTQ A;  4JI6 O;  2H8P C;  4I50 A;  1NZ6 A;  4RQE A;  2ZM6 O;  4AHC A;  1JMK C;  4I55 B;  5CN0 A;  3JAS B;  4YIO A;  1H2L A;  3JAS A;  3L74 H;  1KP3 A;  2HVK C;  4WFE A;  5KHJ A;  2Y4T A;  1H2K A;  2HR3 A;  2UXC O;  5JJJ B;  2MW2 B;  4PDM A;  3Q4H B;  4BWA A;  4GX2 A;  1OCC B;  3QO8 A;  2Q7H A;  3L9D A;  1Y4M A;  4X1I B;  4GX1 A;  4X1I A;  4FJC C;  1XMO B;  4JI4 O;  2QKS A;  4BW9 A;  4B3M B;  5H2F Z;  1S5J A;  5KAI Z;  1V54 B;  4O4I B;  3ASN B;  1AI4 A;  4O4I A;  1RM1 B;  1N33 B;  1NR7 A;  1S5L Z;  3AG1 C;  3SYC A;  1VEW A;  2WWW A;  1R6T A;  3ICX A;  4JI5 B;  4YY3 B;  4GT1 A;  1SQB H;  5DN6 G;  4ABM A;  1P84 F;  3E8F A;  3SYA A;  1HW7 A;  2F23 A;  5LBQ A;  3CPW U;  3B40 A;  1VQ7 V;  1VMG A;  3STL C;  4JTC B;  1EM1 A;  1UFI A;  1B3Q A;  4GKK B;  1AR4 A;  3B77 A;  1Q8I A;  3APO A;  4LF7 O;  3CCQ V;  1JQ0 A;  3G6E V;  2RCV A;  1J5E B;  5CMU A;  5BY1 A;  4CS3 A;  3SJC C;  3WG7 B;  1H2S B;  1Y6X A;  4JI4 B;  4D6T H;  1RPO A;  3AK1 A;  4FM0 A;  5H5N A;  1Y74 A;  2UXB O;  4NTW A;  5E79 Z;  2B1I A;  4IL6 Z;  1F23 A;  4EFB A;  4F4L A;  1YCI A;  2YC0 A;  3ZRS A;  1EZJ A;  2GTA A;  5B1O A;  4MVU A;  3RYF B;  2Y69 C;  3ABT A;  4MVS A;  4UB8 Z;  3I56 V;  3RYF A;  1QNM A;  2JK5 C;  3ZJZ A;  1YJN V;  4TV8 B;  3AG7 A;  4UVA A;  3KG2 A;  3CXC U;  1K33 A;  3ABL C;  4TV8 A;  2QM7 A;  2EIK B;  2P4V A;  3IGA C;  4LFA O;  4DR7 O;  4XDL A;  5EIB D;  5IY5 C;  4NXN B;  2QDO A;  3T1Y O;  3KKY A;  4RO2 A;  5L3C A;  1ARO P;  3SJB C;  2QA4 V;  3ZMT A;  2A06 H;  3T1C A;  2EIN B;  2F66 C;  1GAX A;  2P90 A;  4WBN B;  1AJP A;  1JA8 A;  1Y67 A;  4WBN A;  1YI2 V;  1K4C C;  3T4Z A;  2CTW A;  4AQY O;  3HKB B;  3JAK B;  2DJV A;  1TA8 A;  3HKB A;  5C93 A;  3JAK A;  1KB9 F;  3ETQ A;  3UO3 A;  3CRQ A;  4DV6 O;  3H1L H;  1K8A W;  4J9Y B;  3CX5 F;  2D2C B;  4DW1 A;  4DUZ O;  4JAV A;  1FKA O;  2EZO A;  5B1B C;  4JI7 O;  2Q8V A;  2MK3 A;  4FIP C;  3BEH A;  3O65 A;  4G2K A;  2E5L O;  4EEQ A;  4X89 A;  2ZQM A;  1Z5W A;  1XNR B;  4LNU B;  2UXX A;  2RQ6 A;  4OXS A;  3ASO B;  4LNU A;  1WB7 A;  1SF9 A;  3K08 A;  3P3P A;  3TXQ A;  1COW G;  3T1Y B;  4DR3 B;  4J7K A;  1ZUQ A;  2NR5 A;  3E8G A;  1VQP V;  2HJD A;  5CA3 A;  1VQ6 V;  2Y4U A;  2P5O A;  4ZIB A;  1TGO A;  2WLL B;  1OCO B;  2WLL A;  1XIL A;  4PA3 A;  4DV6 B;  2DW4 A;  4UCO A;  4GKJ B;  1EFR G;  1P7G A;  2GUZ B;  3ABK C;  2GUZ A;  4ZI7 B;  1PV0 A;  4JI0 O;  3THO A;  3JAM N;  3ETG A;  1Q82 W;  4ZI7 A;  3ETD A;  4PV1 B;  5GTI Z;  1QHT A;  2CTR A;  2VRZ A;  4K0K B;  2XND G;  1PP9 H;  1V9P A;  4NR1 A;  3AG4 B;  5LHG A;  4DR5 B;  3QF7 A;  3OE7 G;  1HR0 B;  2UXD B;  1WLE A;  1JX9 A;  3EFF K;  3QO7 A;  2CE4 A;  3BFR A;  2RNB A;  4JI8 O;  2A9H A;  2EX3 A;  4TT3 G;  4DRX B;  3KZI Z;  4JTA B;  4DRX A;  3ZHS A;  2HJF C;  4TOI A;  3JD0 A;  3TJT A;  2WAM A;  1W59 A;  2IH1 C;  2CGO A;  4ZHQ B;  5L3B A;  4ZHQ A;  1AVM A;  3VQV A;  5J2T A;  3RVZ A;  3CME V;  2WA3 A;  2CH7 B;  3DTU B;  2QTS A;  4JI0 B;  2CH7 A;  2F4V O;  3J7A U;  3BAA A;  1Q5O A;  1XRE A;  2P22 C;  3K9S A;  2BOC C;  3IC7 A;  1R3J C;  3X2Q C;  2ZNI A;  3A2F A;  5L3F A;  3B8M A;  1XOU A;  1G6U A;  1M9N A;  3UCS C;  4DUY O;  2LFR A;  1K7D A;  3AEI A;  3VQY A;  4MVM A;  4JI2 B;  3LNN A;  2GSM B;  2WLI B;  2AHZ A;  3LDE A;  1WB8 A;  2QSA A;  2WLI A;  3APQ A;  2P67 A;  4JI3 B;  1FFX B;  4AIL C;  4PHZ A;  2YID A;  1L1F A;  4ICG A;  1CXZ B;  1FFX A;  1VQO V;  2OTL V;  2ZIN A;  3OUF A;  3ABM B;  4PA9 A;  3OTF A;  4CS2 A;  1IBK O;  4FM2 A;  2LQT A;  1OCR C;  2ZXW C;  3STZ C;  1OHH G;  4IIJ A;  4DR6 O;  4CBC A;  4B3T B;  5IWA O;  2FTK A;  3TXS A;  3BA9 A;  3RFR A;  4IT5 A;  4PA4 A;  3QTC A;  4DV3 O;  2PYJ A;  1GKF A;  3HKD B;  4O4H B;  3CRA A;  1F4M A;  2P7T C;  3HKD A;  4D7S A;  4UCU A;  3TET A;  2YI8 A;  1VQ9 V;  2Q7G A;  3CRR A;  4LF9 B;  1GO3 F;  3CXH F;  5K1P A;  2Q69 A;  3R65 A;  1M5I A;  2QM8 A;  3D36 A;  3OEH G;  4PA7 A;  4WFG A;  3ZED A;  1IBM B;  5EK0 A;  4KXR A;  4YHH O;  1I94 O;  4JYA O;  5EBL C;  5EC2 C;  1QVG U;  4DV4 O;  2FYU H;  1S72 V;  5IYB O;  5KHI A;  1EN4 A;  1GM7 A;  4DO2 A;  1HNZ B;  4DR1 B;  2AGA A;  3T2M A;  1P7B A;  3H1I H;  3W7W A;  1IBL B;  2FML A;  2DOS A;  3FYE B;  1FS0 G;  1N36 O;  1SQV H;  1FJG O;  4QIW F;  2UU9 B;  2YIA A;  2VQE B;  1IUR A;  1SQX H;  1M56 C;  4UCT A;  4HZ3 A;  3ZHR A;  4YJ2 B;  2N74 A;  1K5S A;  2XTA A;  3CB2 A;  4YJ2 A;  2IU3 A;  3JD2 A;  4LF4 O;  1NT2 B;  4Z1V A;  4WFH A;  5JQG B;  1KYO F;  4X62 O;  4BR6 A;  2A7W A;  2QWO B;  2XAF A;  2PUS A;  5JQG A;  5KA6 A;  2LGQ A;  1WAZ A;  4MVO A;  2ITC C;  3MHS C;  4LF6 O;  1I94 B;  1SQQ H;  1QLE B;  2IM9 A;  1VF6 A;  4NXM O;  3ZMV A;  4B3S B;  1S5H C;  4ASU G;  3MHH C;  4UB6 Z;  5J9P C;  3OGI B;  4FLZ A;  3K06 A;  4DR4 O;  4QPJ A;  1F51 A;  1VQN V;  1H2M A;  3RYC B;  2ZIM A;  2EIJ C;  3RYC A;  3ZIA G;  3OTO O;  1FJG B;  3D3I A;  2X6C A;  1KBH A;  2EZP A;  2JRI A;  4PDR A;  1YDX A;  2IH3 C;  4B3R B;  2EUL A;  1NTM H;  2XAQ A;  1E1R G;  3OUS A;  1U96 A;  1ZWI C;  4MTF A;  2KSD A;  3FB8 C;  4X62 B;  3ZMZ A;  2HVJ C;  3MD0 A;  5HFM A;  2JEX A;  5FNV B;  1BHA A;  4LF6 B;  3CD6 V;  5FNV A;  4IYH A;  2DYR C;  2OWO A;  5D5Q A;  2WLJ A;  4MTO A;  1WNS A;  1G4Y B;  4X66 O;  4E2L A;  2ILM A;  3K5M A;  1QQC A;  4DK1 A;  4QE9 A;  4LFB O;  4QE7 A;  1FXK B;  2RDC A;  3LSQ A;  5KLV H;  4PJ0 Z;  4FMT A;  3SYQ A;  3CC4 V;  5B1A B;  4UXN A;  1FXK A;  1QLN A;  3UQ8 A;  3N27 A;  4BIO A;  2ZDI A;  2LW1 A;  1RPR A;  3CHX A;  3J81 N;  2LFS A;  2W0X A;  4X65 O;  1AB3 A;  1MNG A;  1I5Y A;  2BCC H;  2IJK A;  1I0H A;  1TUB B;  5IYD O;  3OT7 A;  1TUB A;  1BT8 A;  2LO1 A;  2V4D A;  4CC6 A;  3OMI B;  1XHX A;  3L75 H;  5BZB A;  4NTY A;  1NS1 A;  1SQF A;  5LGN A;  4LF5 B;  2Q5Z A;  3CCS V;  2QKC A;  5JCO A;  3TK1 A;  1JFF B;  1JFF A;  1D2D A;  4JI6 B;  3WB2 A;  5BR8 O;  3LDD A;  1M4U A;  2Q4P A;  2ZM6 B;  2QKA A;  3VBB A;  3FB5 C;  5L3E A;  3SPC A;  1YTF D;  4PA6 A;  1O9H A;  2BOB C;  4R6Z A;  1S77 D;  2UUA O;  3M99 B;  2QE7 G;  4H0L B;  3RYH B;  5LL6 Y;  3ZRV A;  5KAF Z;  2OCH A;  4FLT A;  3RYH A;  5LMN O;  1E1Q G;  2UXC B;  3OMN B;  1Q7Y W;  1PL0 A;  2EIM C;  1ENV A;  1DF5 A;  3SYP A;  2PF4 E;  3SPH A;  1SZX A;  1DK1 A;  1GN3 A;  1KUQ A;  3CWB H;  4JYY A;  1Y74 B;  1VQL V;  2PI5 A;  1MZE A;  1VQK V;  3K9A A;  4HAM A;  1Q81 W;  1F7Y A;  4R50 A;  1L0N H;  2VWJ A;  2AZ0 A;  4I0X B;  4FLW A;  1B06 A;  3R66 A;  5LHH A;  5DM6 V;  4I0X A;  3DC5 A;  2QWR B;  4R8C A;  1ROP A;  4QJF B;  4FK5 C;  3E89 A;  1YIT V;  2IJJ A;  3ZN0 A;  3F5T A;  1YJW V;  1GMG A;  2Z0A A;  5LHI A;  2H94 A;  5LXT B;  1FAF A;  3JD4 A;  2UUA B;  3KCX A;  4ZOL B;  5LXT A;  2OCC C;  1LR1 A;  4ZOL A;  2Y48 A;  3BY6 A;  4CS4 A;  4I4T B;  4LF7 B;  4DV1 O;  2O57 A;  1HP8 A;  4I4T A;  5EBM C;  4IHJ B;  2IW5 A;  2XT9 A;  2K1E A;  4IHJ A;  3M8A A;  2X6A A;  3OM3 B;  1ZSP A;  1X59 A;  4K35 A;  4DXW A;  2UXB B;  1US6 A;  1IVS A;  4JTD B;  3SDL A;  1JOY A;  4JAS A;  1QR9 A;  3TCU A;  2FKX A;  2IJH A;  2ZKO A;  1KKC A;  1F4N A;  1ZLZ A;  5K1X A;  4GLX A;  2JS3 A;  1V55 C;  2ZT9 B;  1N8R W;  5GTH Z;  2UXN A;  1OJH A;  2F95 B;  4LFA B;  1A32 A;  4X64 O;  1SET A;  5KUK A;  4DR7 B;  1KQS U;  5FPR A;  1NH2 D;  3NR7 A;  2XAS A;  1NBM G;  1Q6H A;  3ZN1 A;  1CP9 A;  2DMX A;  3AG1 B;  3BHP A;  2BE3 A;  3EVK A;  3G6B A;  3JSL A;  4O2A B;  4GX0 A;  3JAL B;  1NTZ H;  4O2A A;  4IYI A;  4F6E A;  3JAL A;  4WFF A;  3HPL C;  4AQY B;  1QU7 A;  4W4L A;  3D3Q A;  4LFC O;  2GHY A;  1BQZ A;  2W6I G;  1KD1 W;  3K59 A;  2OTJ V;  1R3L C;  2GTS A;  3AG3 C;  3WU2 Z;  4DUZ B;  4J10 A;  3JCZ A;  2XOK G;  2NN4 A;  2HHH O;  1UJW B;  4JI7 B;  2M6Y A;  5E1A C;  2YXH A;  2E5L B;  5JH7 A;  1I08 A;  4B08 A;  4EB6 B; 
#chains in the Genus database with same CATH homology
 1WP8 A;  3IJ4 A;  2FB5 A;  4NTW A;  4NYK A;  3S3W A;  4FZ1 A;  2QTS A;  4NTX A;  3S3X A;  1WP7 A;  4NTY A;  3N27 A;  4FZ0 A;  2L35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...