4NTWA

Structure of acid-sensing ion channel in complex with snake toxin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
412
structure length
410
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Acid-sensing ion channel 1-snake toxin complex reveals open state of a na(+)-selective channel.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein/toxin
molecule keywords Acid-sensing ion channel 1
total genus 109
structure length 410
sequence length 412
ec nomenclature
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4ntwA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4ntwA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4ntwA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4ntwA02
4NTXA 3S3XA 4NTWA 2L35A 2FB5A 4NTYA 4FZ0A 1WP8A 3N27A 4FZ1A 4NYKA 3S3WA 2QTSA 3IJ4A 1WP7A
chains in the Genus database with same CATH superfamily
4LF5O 1Y67A 3A8TA 2W0FC 4P30A 5FPRA 4DV2B 1SESA 2YC0A 5CMUA 3S3WA 4ZKIA 3L9DA 2E74B 1JVMA 3ZMVA 2DMXA 1E79G 3JALA 1MOFA 4K0KB 1M9NA 5IYBO 5ITZA 2VWKA 3B40A 1MZFA 2IW5A 3ZRWA 2ITDC 2K9PA 3SJCC 4DV0O 1F51A 5IYCO 5IT9N 5FL7G 2DWDC 4FLUA 3JSNA 1NTZH 4LFBO 3CCJV 3KKYA 1HW7A 4LFCO 5H2FZ 5IJ9B 1G8MA 3JASA 3UT5A 1Z5VA 2KKWA 4GUNA 3W7TA 2RN9A 2VQEB 3K06A 1N33O 3ML0A 1U97A 4O4IA 2QM7A 1NR7A 3E35A 3ZHVA 5LXTA 4B7KA 2WA4A 4DR1B 4B3MO 4J7ZA 4XDJA 3ZRVA 1CPYA 3ZMSA 3HKCA 4FMTA 1L1FA 3LSQA 1Y6XA 1BHBA 5CB4A 4WFFA 4ZI7B 3E8FA 4LF8B 2GSMB 4NKGB 1KKDA 3RVYA 2MW2B 1N32B 3SYCA 3MHHC 3JYCA 4KFMA 4F6RB 4D6TH 3ASNC 3K08A 2YEVA 4QPJA 5E79Z 1PL4A 3LNNA 5BR8B 3AG4C 2E5LB 2IH3C 1N34B 3E22A 5IE9A 3GB7C 1H8HG 1YZBA 3ZHRA 4JAUA 1PNKA 4JI1B 2JEXA 1SZXA 4FZ1A 1K73W 2KB1A 3SJBC 2BTQB 4X62O 2JJ2G 4H44B 1N0JA 2HJDA 1XBLA 1OHHG 3OGCC 2F1MA 3AG2B 2YUAA 2LW7A 1BCCH 4DR4O 2IU3A 5EK0A 4UVBA 1H2NA 1PD3A 2YIBA 1WNSA 1AILA 4MVUA 4MVQA 4DR5O 1PL0A 3IC7A 4L87A 1RP3B 4FM0A 4HZ3A 1VQLV 2FB5A 5DM6V 1IXBA 1LNQA 1SQXH 1XDCA 3DGEA 1W0KG 4I50A 2ZNJA 1WPBA 3MHSC 1QR9A 1O9HA 3N2GA 4O2AA 3RYHB 5L3CA 4RQEA 4G28B 1L0NH 2UUCB 2H8PC 4Z1MG 4FLVA 4OPHA 4RQFA 1U96A 5EBLC 1H8EG 1YCIA 3K0GA 4ASUG 1XILA 4CH4A 2X6BA 3GVMA 4X1IA 1RSOB 5LMUO 5JVDB 1GM9A 4LF4O 2XAGA 4GKKB 5EYPB 2YEVB 4C7UA 2FMLA 5F2VO 3QNEA 4B3SO 1M1KW 3OUSA 2R72A 2X0LA 5C8YA 5J9PC 5KHJA 3HKDA 1SETA 2JIZG 5IYZA 2Q7EA 2NN4A 1EN5A 4I0XB 1H38A 4TQFA 1EBOA 1OCCC 2BTQA 2P4KA 1R6NA 3QTCA 1R6TA 3FB5C 4UCUA 2BOBC 2UUBB 5IY5B 1SQQH 4IT5A 1XOUA 1N36B 1HNXB 4U3FH 2Q73A 4JASA 1JCHA 3N2KA 3ZHQA 1Q7YW 1HNWB 1AVMA 3IGAC 5J2TA 4LF7B 2Z3YA 3ZRWB 1Z2GA 1T5EA 1KD1W 1SKVA 3STLC 2E3CA 1TVKB 3JARA 4G2KA 1GTOA 5LP6B 1CEZA 1UFIA 2XUMA 2ZD9A 3W7WA 3CB2A 2XAJA 2BSKA 5B1OA 2RCVA 2N05A 3DC6A 4LF9O 2JDIG 1GN4A 3AG1C 5KHGA 2RNBA 2BTOA 4DV4O 4U7OA 5L3GA 2Q0AA 4DV1B 4O4JB 2QM4A 4GYCB 4B7EA 4P9OA 2IBZH 4JAAA 3U0ZA 4LWSB 3WG7C 4B3RB 2ARHA 2PUSA 5BZBA 3LSSA 2P90A 2UXCB 4NTYA 4LNUA 2JS3A 3FB7C 3JALB 3JAKA 4ZHQB 5KMGB 5J2TB 1V54B 2Y69B 3CCMV 2ADPA 4DR2B 4KHPO 1OCCB 5FPOA 1M57C 4TUYA 1WP7A 1GRJA 4DR3B 2XASA 3NR7A 1QLEC 2V7QG 2IJHA 4TV9B 4QIWF 3ETQA 4JYCA 1SA0A 2DW4A 1M56C 4NTWA 1XNQO 1MZEA 4PDRA 1QU7A 1D5NA 5IJ9A 1NVPD 4FK5C 1H2GA 3OW2U 1M4UA 3TK1A 3PJSK 1K92A 3M99B 3KCXA 1AR4A 5JQGB 1JR9A 1WN7A 3JD0A 4I4TA 1JX9A 4P2ZA 3L71H 1W59A 3K5MA 1BHAA 2B1GA 5LGNA 1X59A 2VRZA 3D3QA 1YTFB 3HKCB 5B3SC 3JAKB 4ZHQA 1IDSA 4CC6A 1S5LZ 1TUBB 1IX9A 4DV6B 3UCSC 3A0RA 3CS5A 4J11A 5FNVB 1RFYA 4WFGA 3K3WA 3THOA 1MMMA 1HNZB 4RAIA 4DO2A 3OGIB 1FFXB 5EZYB 3G4SV 5B3SB 3E2EA 3OR7C 3DC5A 1KUQA 3CSXA 1K34A 3FX7A 2MK3A 1WLEA 2FKXA 2HP8A 3K59A 4DV5B 4JYAO 4W4LA 4JTAB 4WFAV 1PM9A 1ZSPA 4R50A 4JAVA 1QLEB 5LGUA 2WLLB 4JI5B 3L75H 3JATB 4DV7O 4QPKA 4X64B 1KU9A 3G80A 1NBMG 4FLYA 4CS2A 1EZVH 5LMNB 4FLZA 1HDJA 1UPGA 2HHHB 2HVJC 4Q20A 2BE3A 4UCTA 5JCOA 1CP9A 1WB8A 1DF4A 3JD1A 2ZCEA 4BIUA 4JI4O 4Q6GA 3CCVV 1VQ8V 4O4LA 1FXKA 2AHYA 3BFRA 1GN3A 3L73H 4KP4A 4N21A 5B1AC 5HFLA 4DV3O 4RUEA 4CS3A 3W7SA 4R8CA 5J2UB 1E1QG 2PZSA 3T4ZA 4NXMB 3M8AA 1BE3H 1AJNA 1R73A 4CH6A 3CEIA 4FFBB 2QJ1A 3HB3B 1R3KC 1IVSA 4LF6O 5ITZB 4UVCA 2Y4UA 4YHHB 5FNVA 1WB7A 2AZ2A 4UFZA 2DOSA 2FTKA 2RQ6A 5C93A 2N04A 2ZM6O 2OTLV 1UJWB 2ZXWC 3T1HB 5L3FA 4IYHA 2A9HA 1FJGB 3OM3B 4CS4A 1I08A 1I7FA 2Q69A 1Q6UA 3D36C 5IYZB 2NLJC 2CH7B 2UU9O 4DR6O 1DTOA 3OMAB 1V9PA 4DUZO 4LWSA 3CRCA 3CYOA 1R3LC 4L8JA 2HR3A 3AG4B 1XUQA 2R9AA 1PP9H 3NXSA 1MABG 5J2UA 3CXHF 1QLNA 3OE7G 5CB4B 4O2BB 4YIOA 1J5EO 3VOUA 1VF6C 3O65A 4IHJA 5EIBC 3E8GA 1Y74A 2NNUA 4UCOA 3OFNG 5KAIZ 5KUKA 3MAQA 2QA4V 1SQPH 3A2FA 1EN4A 1S0VA 4YJ3B 2IJKA 3SJAC 4JI2O 1ENVA 1PV0A 4IIJA 3QO7A 5CA0B 4O4HA 3G67A 1KMIZ 3OEEG 2A7WA 3A0HZ 3N2GB 1NTKH 3CXCU 3OTOO 2BSKB 3G71V 3WU2Z 4Z2WA 3P32A 3T1YB 5EC2C 2CH7A 4PI0A 4DW1A 2HFEC 2VQFO 2YI8A 4LF5B 4JI6B 4O4JA 2R9RB 3CRQA 4LC1A 4DV2O 4X65O 3D3IA 5BMVA 2CGOA 3ZBHA 3B8MA 3CP1A 5H6QA 3SDLA 2XAHA 4AQYO 5JJEB 4LNUB 1XMOO 3T4DA 2IJJA 4PDMA 4IHJB 1S5JA 1JJOA 4K0KO 2UUAO 4OGQB 2VS0A 4QGPA 4LBEC 2QTSA 3SPHA 4QJFB 3RYCB 2QWRB 4TUYB 2M7WA 1FS0G 2JS5A 4DV0B 4NR1A 4Z1VA 4JZGA 1BQ0A 1XNRO 5LYJA 2QSAA 1BL8A 3BCCH 2WPDG 3QO8A 1I5XA 1F7YA 4LFAO 3BABA 1K3EA 3ETGA 4YY3O 3SYQA 1I94O 1FPOA 3UQ8A 2VQEO 1V55C 2UXDB 4OPAA 3AEIA 4UB8Z 1M56B 2IH1C 2GV9A 2OCHA 4DR1O 4IL6Z 2X6AA 3SPIA 2C2AA 4BAYA 5A2QN 3IJ4A 4WBNB 5K1XA 3STZC 3HKBB 4I55A 5EYPA 1SS3A 3ABMC 2DE0X 1GH6A 2IJIA 2YXYA 4DXWA 5LL6Y 4LF8O 3TXSA 2F4VB 3VQWA 2Q4PA 5H5NA 1XMQB 3LDEA 3SR2C 2DJVA 5C8YB 1H2LA 2CAZC 3HKDB 4WFHA 2GHYA 2HLDG 1VQ9V 4EEQA 2Y0PA 2UXBB 4DR7O 1NKDA 1MNGA 4X66O 2LGWA 3L70H 3BA9A 1P7BA 2QE7G 3DXRB 5IWAB 1M57B 3AK3A 4MSWC 2EULA 2B1IA 4BW9A 3X2QB 4AHCA 1NJIW 3HKEB 2F95B 4JYYA 2LGQA 1LUVA 1IBKO 2IU0A 1XI1A 4J7JA 2WA3A 3ZHUA 4WCEV 1URFA 5JWPA 1KBHA 2ZE7A 2WSSG 5DECA 1FKAO 2WWWA 1SA0B 2G38A 1SF9A 2CTPA 4JI0B 1ZUQA 4DR5B 5JJNB 2QTOA 1ZAUA 1NZ6A 2HKOA 4B3TO 2XHBA 1QQCA 3J80N 2ZDIA 4UCSA 2EBOA 4RO2A 1S72V 1D5AA 1NVPB 5DEDA 2CTWA 3BPZA 1FXKB 4GX0A 5KLVH 2Q68A 4GZRB 2UUCO 1YI2V 5JCOC 2WLIA 3FYEB 1L0LH 2LFSA 1AR5A 1WA8A 2PYLA 3CC4V 1TUBA 2YXLA 1Y74B 1K8AW 4JF3A 3RWRD 4EFBA 4NVPA 3RYIA 4MVZA 5D5QA 3K79A 3J7AU 1FXKC 3ZRXA 4FFBA 3ZHTA 1S77D 4JV5O 5EC1C 1RPOA 5H6RA 3R66A 2XAQA 4PI2A 3G6EV 2W6JG 2RDCA 2R9IA 3JAWA 4UXNA 4B3SB 1ZX3A 2YICA 4JPRA 3AG2C 2OT5A 3ABTA 2ZQMA 4ICGA 3F5TA 2ZXWB 5LA6A 4TT3G 3SJQC 1VQOV 2UUBO 3HKEA 1VEWA 3ZMUA 2PI5A 3RT3C 2QWOB 1FXVA 3QVNA 1Y66A 3BY6A 1OCZB 4PHZA 4FLXA 3K5OA 1QBZA 4YJ2A 4MS2A 1WP8A 4DUYO 1N32O 3KCYA 3VQYA 4X89A 2PGGA 1AJPA 2ZR2A 3F7VC 2H94A 5BR8O 3AK1A 4IIJB 5LYJB 4JI8O 2W6IG 2GTAA 2ZIMA 1H2SB 2QM8A 1LUWA 1ZL8A 5EZYA 2LFRA 1MA1A 2JVDA 3OUFA 1Q90D 3OEHG 3CC7V 4DW0A 1ROPA 2YI9A 4CZZA 1YHQV 1K4CC 1IBMB 2R70A 3FKSG 4K8ZA 3SYPA 1BSMA 4PA9A 4X62B 3K5LA 4GKJB 4UV8A 2F93B 3L72H 5B5EZ 5LOVA 2QWPB 4WBNA 4FLTA 2ZT9B 4H13B 2P4VA 3IC9A 2JGDA 2B5UA 1PNMA 2CDYA 4ZBMA 1AP6A 1K9MW 3EVKA 4KHPB 3K03A 2ADQB 1XREA 2Q7GA 4LCUC 4EKWA 4DR3O 5LHGA 2VWJA 4J80A 4UCRA 4TV8A 4HAMA 2XNDG 2WLJA 3OAAG 4BIZA 3SYOA 1BQZA 1Q8IA 1XNQB 2CK3G 5LP6C 2YXHA 2JRIA 1GN2A 4J9ZB 1B06A 1R3JC 3TJTA 1K33A 4QE7A 3RGBA 1NS1A 1YF2A 1K5QA 1B04A 3H1IH 4LF4B 4D7TA 4GKKO 4PA3A 1VARA 3ABKC 2WLNA 1P4RA 4GX5A 1SQVH 1YDXA 1X4TA 3LDCA 1F23A 3B09A 2EIJC 4FLWA 1RPRA 1SQBH 4W4KA 2KSDA 4XDKA 1HR0O 3KG2A 4R7CA 1BGYH 4PV1B 3K0DA 4RUFA 2ILMA 3EXAA 2OTJV 1HNZO 1M90W 1YVWA 4X1YB 1IXMA 4JTCB 2O57A 2Q0OC 3H1HH 2Q7HA 3C3SA 3UO3A 5BMVB 2HEPA 4MTOA 1RSOA 2LW1A 1YEWA 2ZR3A 3BHPA 4WFBV 4I4TB 2A06H 2OWOA 2ATKC 2UXXA 3DXRA 1WA8B 5KUMA 1XL4A 2RJZA 3D36A 3ZMZA 1HNWO 1DF5A 1DLBA 2JGDB 4LF7O 2QKCA 5GTIZ 4X1KA 4BWAA 1KC8W 4RWUA 1AR1B 3RYCA 4K8XA 3ZX6A 4DV7B 3CC2V 1R3IC 4JI7B 1ZWIC 2A3QA 4NXNB 5LMNO 4YXWG 3JD3A 3RYFB 4DYLA 1VF6A 4PJ0Z 1Y76A 3FFQA 5L3DA 1O9GA 2PTMA 5LA6B 4DV4B 2QWQB 1VIBA 4DV1O 4OX9B 1S3JA 2OYQA 3APQA 3EHBB 3SGIA 5IDJA 1RM1C 5EIBD 1AJQA 3JSLA 5LXTB 4X20B 1FYJA 1QR8A 2EIJB 4JGSA 3FB6C 4I7ZB 3ICXA 4B08A 2UXCO 1TVKA 3JARB 4I9WA 4NXMO 4JI3O 2RMKB 5JH7B 2ZDIC 4XDLA 1RM1B 4GLXA 3BAAA 4DK0A 1GM8A 3VQXA 2WAMA 4MTXA 1IBLO 1Q6IA 2ZM6B 3SYAA 3X2QC 3E22B 3RBZA 3U10A 4MVOA 4O4LB 1KP2A 1VQ6V 1GN6A 1H2MA 5IJ0A 4JZ2A 4U3JB 1Y76B 3E89A 1NU1H 1JPXA 3JCZA 1V54C 1AROP 2Y69C 2M6YA 1NH2D 4FPPA 5CBHA 5HFMA 4CBCA 4DUZB 4X20A 3B8NA 3KZIZ 1FXHA 1AI6A 4DK1A 1GAXA 1NT2B 3ZJZA 4MW3A 5EBMC 1YITV 1XHXA 1TA8A 2EINB 5B1NA 3DTUB 2LQTA 3HKBA 4I55B 4TV9A 1Q5OA 1J5EB 2E5LO 5AG2A 4DV6O 5CA1B 2ZKOA 1QNMA 2OCCC 4UVAA 3ZIAG 1LR1A 1Q82W 2QDOA 4H0LB 4IYIA 4JI1O 1AB3A 3CMAV 4BIOA 2AW9A 4HYOA 4J41A 3HPLC 4U3JA 2WLIB 2OCCB 4LP8A 3UKMA 2ITCC 1GMGA 3G6BA 1IZ3A 2VQFB 4DV5O 1YXBA 2GUZB 4JYAB 1PKXA 1WPXA 2HJFC 4P9PA 3HR0A 4O2BA 3H1JH 5CBFA 3ASOC 4X65B 3R65A 3U11A 3APOA 5JH7A 1GM7A 4N23A 1KQSU 3QF7A 5JVDA 2P67A 2BCCH 2UXNA 4X64O 3LDDA 3ZHSA 2JEUA 2L6LA 1JQ0A 5TISZ 1VF5B 3E8HA 5KX5A 1KKCA 5CA0A 2UUAB 2DYRB 3CJHB 2YSUB 1D2DA 3OMIB 4JI4B 4X1YA 3DSQA 3K57A 2KG7A 2Q8VA 3ZCCA 3P30A 1YJ9V 4E2LA 1I5YA 1ORQC 2XAFA 4GT1A 1N0NA 4UB6Z 2CE4A 2LP7A 3CD6V 4X8AA 5GW7A 1VQ7V 3CCEV 3H01A 2A0LA 3ABUA 4PELA 3WB0A 1K97A 3B2EE 4K35A 1TGOA 4X1KB 1QVFU 3LSUA 1FFTB 4CC5A 4GCZA 4YIPA 4LF6B 3WFVA 4LFBB 2EIKB 2B9ZA 2AXTZ 4HBNA 2Y0IA 4LFCB 3MDSA 3C3TA 1SQFA 1ZL8B 1JA8A 3K5NA 5B1AB 3CJHA 1XMQO 3OR6C 4E4EA 1N33B 5LBQA 3CCUV 1G6UA 5B1BC 3UM7A 3QG5A 4B3MB 4PA4A 3ASOB 1JOYA 1HNXO 2EX3A 1JMKC 4DR7B 1KECA 3ZN0A 5LOVB 1JFFB 3H1KH 4J9YB 4X66B 3L74H 3ABLC 2P22C 2WLMA 4LH7A 2WLKA 3B77A 1VQ4V 1G1XB 1EFRG 5IWAO 1Q86W 2ZE8A 5B1BB 1DK1A 5KA6A 1VQPV 1N8RW 4BW5A 4YJ2B 3CWBH 1N34O 5KMGA 4AI8A 1MSDA 1NTMH 3K9SA 2Y48A 1US6A 3RVZA 4LF9B 2CUGA 4JI2B 1K5SA 1OV9A 4U7NA 3BRCA 3CRMA 1Q81W 2KG7B 1S5HC 5D5PA 4BR6A 2XOKG 3CCQV 3RW0A 3T1YO 1A32A 3CRRA 3H9VA 3N27A 2QEXV 4B3RO 3ZRSA 1VQKV 2XT9A 2CTQA 1SQGA 3ABKB 2W0XA 1GO3F 3CCRV 4DR4B 2HG5C 3T2MA 1KB9F 3BEHA 1S76D 5FLXN 2GTSA 2X6CA 2F43G 1AI7A 5IY5C 2IM9A 4AQYB 1NQTA 2ZNIA 3Q4HA 1XMOB 1PNLA 2AGAA 2DQ3A 1SC5B 4JTDB 5KAFZ 4TQDA 1SERA 5CBGA 4OXSA 2DYSC 3TGUH 1OCOB 2DQ0A 5LHIA 2WLHA 3CCSV 4WF9V 5CN0A 3H1LH 3CPWU 4ZOLB 3IFXA 4AILC 1XNRB 4TV8B 3W7UA 3AG7A 5GONA 3JD4A 2E76B 3E86A 2DYSB 4MTFA 2JGUA 4LFAB 4FM2A 1OCOC 5LMUB 4YY3B 1R1BA 5E1AC 5H9CA 2Q6AA 3AG3B 1P49A 4JYBA 2LJ2A 4FVMA 2UXDO 3CCLV 1OJHA 3I5DA 2N74A 3RFRA 1VQMV 2GBOA 1R6KA 2V1DA 2QKAA 4GX2A 5KA5A 3B4SA 3CRAA 4UUJC 4NTXA 3OMNB 4FIPC 4CH5A 3MD0A 1XL6A 5LP6A 4PDVA 1J95A 4MTGA 4DUYB 3WB2A 2AZ0A 1OCRC 2Q5ZA 1YJWV 1B6QA 2JJ1G 4KL1A 1FAFA 4KXRA 1H2KA 2ZIOA 3LUTB 3I56V 1B3QA 4ZOLA 1N36O 3E8BA 4DRXA 4JI8B 1JJ2U 2UXBO 3D8CA 1E1RG 2AHZA 2Q9LA 2D3OW 4F4LA 3FAVB 1K7DA 1G4YB 1HWYA 5BXZA 4EB6A 3C90A 2DN9A 1OCRB 5L3EA 3ZN1A 1N4CA 3TCUA 1F4MA 4GKJO 4IGGA 2OIEA 3SPCA 4QE9A 1AI4A 1THZA 2HHHO 3P3PA 1IBKB 2PY5A 2YDEA 4MVMA 1EN6A 1YIJV 3AK2A 4ABMA 4FZ0A 2LO1A 5LHHA 3E83A 4PA6A 2OIGA 4G27B 2X7RB 4JI0O 2A79B 3JAMN 5KX5B 5L3BA 2H3OA 4NB5A 4R6ZA 3RYFA 1W0JG 2F23A 4MT8A 4B3TB 1CXZB 3ASNB 1OCZC 1YJNV 1IURA 1NI8A 2QKSA 4DRXB 3I55V 2EINC 1L8DA 4DV3B 1WAZA 1NH2B 4MW8A 3JCUZ 3QO5A 1M5IA 2YS8A 3PN1A 1MSWD 3FD9A 4F6EA 1NR1A 1XQ8A 4DR2O 2YIAA 5KHHA 1QCEA 3SPJA 5A9GA 3JD2A 1AP5A 1YTFD 3IAYA 2V4DA 1PPJH 5LGTA 4PDLA 2PI4A 4J10A 3O9OA 3ZEDA 3T1HO 4JV5B 3EFFK 4YJ3A 2EZPA 4FFKA 2K1EA 1FJGO 3JASB 3ETDA 3UT5B 1VQ5V 5K1PA 3RN4A 4I0XA 3ZMTA 3GWKC 4O4HB 1Z5WA 4O4IB 4TOIA 5DN6G 4DR6B 1BT8A 4EB6B 1SRYA 1P84F 2GUZA 4O2AB 4ZIBA 2P6JA 3RYHA 3FB8C 3VQVA 3K04A 3CMEV 4LH6A 2BOCC 1XEQA 5IYDO 3TXQA 2DYRC 4I9QA 2WLLA 1VQNV 3JATA 3K58A 1AI5A 2QGNA 5EBWC 4FM1A 4WFEA 4TSFG 3S3XA 2Z0AA 3JAWB 2ZINA 2E75B 2YIBD 2EIMC 5CA1A 1Q3EA 1YSCA 4H37A 2D2CB 3OTOB 3P3NA 3CE2A 4NXNO 3UO2A 4TWKA 1ZLZA 5BY1A 4UV9A 3J81N 2NR5A 3TETA 3BVOA 4JI6O 3LNMB 2EIMB 2GDSA 1XHZA 1IBMO 3K9AA 2P7TC 4JI5O 2EIKC 4HNAB 1SZTA 4OX9O 3T1CA 3OTFA 1MG1A 1QVGU 4ZI7A 3OT7A 3N2KB 4KUMA 2FL4A 4J7KA 1BZKA 2ODMA 1M93A 1BS3A 4JI3B 3F5WC 3WG7B 2PYJA 1HP8A 2EILC 2JK5C 4PD4F 1Q43A 2KQXA 1VMGA 4QNHB 2P06A 2Q67A 3ABLB 4I5SA 4NYKA 3WB1A 1IBLB 2F66C 2Y4TA 1I94B 1JFFA 1FD9A 4J42A 3VBBA 4A5UB 4X1IB 2EILB 2CGNA 1ZTEA 4PA7A 3AG1B 5CA3A 4HNAA 1K4DC 5GTHZ 4YHHO 2XTAA 3CHXA 1QHTA 5JJJB 2ZE5A 1W2BU 2ZE6A 1VP7A 4UCVA 1TUEB 2ETNA 2F4VO 3ZS8C 2EJRA 4EFEA 4MVSA 3AG3C 3ETEA 1KYOF 2PF4E 2EZOA 4X9QA 4K3AA 5KHIA 5B66Z 2QR4A 2L35A 1FFXA 1WJZA 3OD4A 2UU9B 1HR0B 5IJ0B 4I50B 2YIDA 1TAEA 3F7YC 3SPGA 1KP3A 1P7GA 1EZJA 4H33A 3ABMB 1F4NA 4X88A 4XBFA 3M7MX 2FYUH 1OZ0A 3FAVA 3FYIB 1GK9A 3CX5F 3BA8A 1GKFA 4GX1A 4LR3A 4CH3A 3Q4HB 1COWG 1Y4MA 1VF7A 5JQGA 2Z5UA 2QWNB 3W7XA 4FJCC 2HVKC 2P5OA 3RYIB 1V55B 4F6RA 3GWOA 2DWEC 5KHKA 2EJ7A 1I0HA 1EM1A 4JI7O 1Q6HA 1DGSA 5GONB 3A0BZ 4D7SA 4MVRA 2CTRA 1BMFG
chains in the Genus database with same CATH topology
4NTXA 3S3XA 4NTWA 2L35A 2FB5A 4NTYA 4FZ0A 1WP8A 3N27A 4FZ1A 4NYKA 3S3WA 2QTSA 3IJ4A 1WP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTX A;  3S3X A;  4NTW A;  2L35 A;  2FB5 A;  4NTY A;  4FZ0 A;  1WP8 A;  3N27 A;  4FZ1 A;  4NYK A;  3S3W A;  2QTS A;  3IJ4 A;  1WP7 A; 
#chains in the Genus database with same CATH topology
 4LF5 O;  1Y67 A;  3A8T A;  2W0F C;  4P30 A;  5FPR A;  4DV2 B;  1SES A;  2YC0 A;  5CMU A;  3S3W A;  4ZKI A;  3L9D A;  2E74 B;  1JVM A;  3ZMV A;  2DMX A;  1E79 G;  3JAL A;  1MOF A;  4K0K B;  1M9N A;  5IYB O;  5ITZ A;  2VWK A;  3B40 A;  1MZF A;  2IW5 A;  3ZRW A;  2ITD C;  2K9P A;  3SJC C;  4DV0 O;  1F51 A;  5IYC O;  5IT9 N;  5FL7 G;  2DWD C;  4FLU A;  3JSN A;  1NTZ H;  4LFB O;  3CCJ V;  3KKY A;  1HW7 A;  4LFC O;  5H2F Z;  5IJ9 B;  1G8M A;  3JAS A;  3UT5 A;  1Z5V A;  2KKW A;  4GUN A;  3W7T A;  2RN9 A;  2VQE B;  3K06 A;  1N33 O;  3ML0 A;  1U97 A;  4O4I A;  2QM7 A;  1NR7 A;  3E35 A;  3ZHV A;  5LXT A;  4B7K A;  2WA4 A;  4DR1 B;  4B3M O;  4J7Z A;  4XDJ A;  3ZRV A;  1CPY A;  3ZMS A;  3HKC A;  4FMT A;  1L1F A;  3LSQ A;  1Y6X A;  1BHB A;  5CB4 A;  4WFF A;  4ZI7 B;  3E8F A;  4LF8 B;  2GSM B;  4NKG B;  1KKD A;  3RVY A;  2MW2 B;  1N32 B;  3SYC A;  3MHH C;  3JYC A;  4KFM A;  4F6R B;  4D6T H;  3ASN C;  3K08 A;  2YEV A;  4QPJ A;  5E79 Z;  1PL4 A;  3LNN A;  5BR8 B;  3AG4 C;  2E5L B;  2IH3 C;  1N34 B;  3E22 A;  5IE9 A;  3GB7 C;  1H8H G;  1YZB A;  3ZHR A;  4JAU A;  1PNK A;  4JI1 B;  2JEX A;  1SZX A;  4FZ1 A;  1K73 W;  2KB1 A;  3SJB C;  2BTQ B;  4X62 O;  2JJ2 G;  4H44 B;  1N0J A;  2HJD A;  1XBL A;  1OHH G;  3OGC C;  2F1M A;  3AG2 B;  2YUA A;  2LW7 A;  1BCC H;  4DR4 O;  2IU3 A;  5EK0 A;  4UVB A;  1H2N A;  1PD3 A;  2YIB A;  1WNS A;  1AIL A;  4MVU A;  4MVQ A;  4DR5 O;  1PL0 A;  3IC7 A;  4L87 A;  1RP3 B;  4FM0 A;  4HZ3 A;  1VQL V;  2FB5 A;  5DM6 V;  1IXB A;  1LNQ A;  1SQX H;  1XDC A;  3DGE A;  1W0K G;  4I50 A;  2ZNJ A;  1WPB A;  3MHS C;  1QR9 A;  1O9H A;  3N2G A;  4O2A A;  3RYH B;  5L3C A;  4RQE A;  4G28 B;  1L0N H;  2UUC B;  2H8P C;  4Z1M G;  4FLV A;  4OPH A;  4RQF A;  1U96 A;  5EBL C;  1H8E G;  1YCI A;  3K0G A;  4ASU G;  1XIL A;  4CH4 A;  2X6B A;  3GVM A;  4X1I A;  1RSO B;  5LMU O;  5JVD B;  1GM9 A;  4LF4 O;  2XAG A;  4GKK B;  5EYP B;  2YEV B;  4C7U A;  2FML A;  5F2V O;  3QNE A;  4B3S O;  1M1K W;  3OUS A;  2R72 A;  2X0L A;  5C8Y A;  5J9P C;  5KHJ A;  3HKD A;  1SET A;  2JIZ G;  5IYZ A;  2Q7E A;  2NN4 A;  1EN5 A;  4I0X B;  1H38 A;  4TQF A;  1EBO A;  1OCC C;  2BTQ A;  2P4K A;  1R6N A;  3QTC A;  1R6T A;  3FB5 C;  4UCU A;  2BOB C;  2UUB B;  5IY5 B;  1SQQ H;  4IT5 A;  1XOU A;  1N36 B;  1HNX B;  4U3F H;  2Q73 A;  4JAS A;  1JCH A;  3N2K A;  3ZHQ A;  1Q7Y W;  1HNW B;  1AVM A;  3IGA C;  5J2T A;  4LF7 B;  2Z3Y A;  3ZRW B;  1Z2G A;  1T5E A;  1KD1 W;  1SKV A;  3STL C;  2E3C A;  1TVK B;  3JAR A;  4G2K A;  1GTO A;  5LP6 B;  1CEZ A;  1UFI A;  2XUM A;  2ZD9 A;  3W7W A;  3CB2 A;  2XAJ A;  2BSK A;  5B1O A;  2RCV A;  2N05 A;  3DC6 A;  4LF9 O;  2JDI G;  1GN4 A;  3AG1 C;  5KHG A;  2RNB A;  2BTO A;  4DV4 O;  4U7O A;  5L3G A;  2Q0A A;  4DV1 B;  4O4J B;  2QM4 A;  4GYC B;  4B7E A;  4P9O A;  2IBZ H;  4JAA A;  3U0Z A;  4LWS B;  3WG7 C;  4B3R B;  2ARH A;  2PUS A;  5BZB A;  3LSS A;  2P90 A;  2UXC B;  4NTY A;  4LNU A;  2JS3 A;  3FB7 C;  3JAL B;  3JAK A;  4ZHQ B;  5KMG B;  5J2T B;  1V54 B;  2Y69 B;  3CCM V;  2ADP A;  4DR2 B;  4KHP O;  1OCC B;  5FPO A;  1M57 C;  4TUY A;  1WP7 A;  1GRJ A;  4DR3 B;  2XAS A;  3NR7 A;  1QLE C;  2V7Q G;  2IJH A;  4TV9 B;  4QIW F;  3ETQ A;  4JYC A;  1SA0 A;  2DW4 A;  1M56 C;  4NTW A;  1XNQ O;  1MZE A;  4PDR A;  1QU7 A;  1D5N A;  5IJ9 A;  1NVP D;  4FK5 C;  1H2G A;  3OW2 U;  1M4U A;  3TK1 A;  3PJS K;  1K92 A;  3M99 B;  3KCX A;  1AR4 A;  5JQG B;  1JR9 A;  1WN7 A;  3JD0 A;  4I4T A;  1JX9 A;  4P2Z A;  3L71 H;  1W59 A;  3K5M A;  1BHA A;  2B1G A;  5LGN A;  1X59 A;  2VRZ A;  3D3Q A;  1YTF B;  3HKC B;  5B3S C;  3JAK B;  4ZHQ A;  1IDS A;  4CC6 A;  1S5L Z;  1TUB B;  1IX9 A;  4DV6 B;  3UCS C;  3A0R A;  3CS5 A;  4J11 A;  5FNV B;  1RFY A;  4WFG A;  3K3W A;  3THO A;  1MMM A;  1HNZ B;  4RAI A;  4DO2 A;  3OGI B;  1FFX B;  5EZY B;  3G4S V;  5B3S B;  3E2E A;  3OR7 C;  3DC5 A;  1KUQ A;  3CSX A;  1K34 A;  3FX7 A;  2MK3 A;  1WLE A;  2FKX A;  2HP8 A;  3K59 A;  4DV5 B;  4JYA O;  4W4L A;  4JTA B;  4WFA V;  1PM9 A;  1ZSP A;  4R50 A;  4JAV A;  1QLE B;  5LGU A;  2WLL B;  4JI5 B;  3L75 H;  3JAT B;  4DV7 O;  4QPK A;  4X64 B;  1KU9 A;  3G80 A;  1NBM G;  4FLY A;  4CS2 A;  1EZV H;  5LMN B;  4FLZ A;  1HDJ A;  1UPG A;  2HHH B;  2HVJ C;  4Q20 A;  2BE3 A;  4UCT A;  5JCO A;  1CP9 A;  1WB8 A;  1DF4 A;  3JD1 A;  2ZCE A;  4BIU A;  4JI4 O;  4Q6G A;  3CCV V;  1VQ8 V;  4O4L A;  1FXK A;  2AHY A;  3BFR A;  1GN3 A;  3L73 H;  4KP4 A;  4N21 A;  5B1A C;  5HFL A;  4DV3 O;  4RUE A;  4CS3 A;  3W7S A;  4R8C A;  5J2U B;  1E1Q G;  2PZS A;  3T4Z A;  4NXM B;  3M8A A;  1BE3 H;  1AJN A;  1R73 A;  4CH6 A;  3CEI A;  4FFB B;  2QJ1 A;  3HB3 B;  1R3K C;  1IVS A;  4LF6 O;  5ITZ B;  4UVC A;  2Y4U A;  4YHH B;  5FNV A;  1WB7 A;  2AZ2 A;  4UFZ A;  2DOS A;  2FTK A;  2RQ6 A;  5C93 A;  2N04 A;  2ZM6 O;  2OTL V;  1UJW B;  2ZXW C;  3T1H B;  5L3F A;  4IYH A;  2A9H A;  1FJG B;  3OM3 B;  4CS4 A;  1I08 A;  1I7F A;  2Q69 A;  1Q6U A;  3D36 C;  5IYZ B;  2NLJ C;  2CH7 B;  2UU9 O;  4DR6 O;  1DTO A;  3OMA B;  1V9P A;  4DUZ O;  4LWS A;  3CRC A;  3CYO A;  1R3L C;  4L8J A;  2HR3 A;  3AG4 B;  1XUQ A;  2R9A A;  1PP9 H;  3NXS A;  1MAB G;  5J2U A;  3CXH F;  1QLN A;  3OE7 G;  5CB4 B;  4O2B B;  4YIO A;  1J5E O;  3VOU A;  1VF6 C;  3O65 A;  4IHJ A;  5EIB C;  3E8G A;  1Y74 A;  2NNU A;  4UCO A;  3OFN G;  5KAI Z;  5KUK A;  3MAQ A;  2QA4 V;  1SQP H;  3A2F A;  1EN4 A;  1S0V A;  4YJ3 B;  2IJK A;  3SJA C;  4JI2 O;  1ENV A;  1PV0 A;  4IIJ A;  3QO7 A;  5CA0 B;  4O4H A;  3G67 A;  1KMI Z;  3OEE G;  2A7W A;  3A0H Z;  3N2G B;  1NTK H;  3CXC U;  3OTO O;  2BSK B;  3G71 V;  3WU2 Z;  4Z2W A;  3P32 A;  3T1Y B;  5EC2 C;  2CH7 A;  4PI0 A;  4DW1 A;  2HFE C;  2VQF O;  2YI8 A;  4LF5 B;  4JI6 B;  4O4J A;  2R9R B;  3CRQ A;  4LC1 A;  4DV2 O;  4X65 O;  3D3I A;  5BMV A;  2CGO A;  3ZBH A;  3B8M A;  3CP1 A;  5H6Q A;  3SDL A;  2XAH A;  4AQY O;  5JJE B;  4LNU B;  1XMO O;  3T4D A;  2IJJ A;  4PDM A;  4IHJ B;  1S5J A;  1JJO A;  4K0K O;  2UUA O;  4OGQ B;  2VS0 A;  4QGP A;  4LBE C;  2QTS A;  3SPH A;  4QJF B;  3RYC B;  2QWR B;  4TUY B;  2M7W A;  1FS0 G;  2JS5 A;  4DV0 B;  4NR1 A;  4Z1V A;  4JZG A;  1BQ0 A;  1XNR O;  5LYJ A;  2QSA A;  1BL8 A;  3BCC H;  2WPD G;  3QO8 A;  1I5X A;  1F7Y A;  4LFA O;  3BAB A;  1K3E A;  3ETG A;  4YY3 O;  3SYQ A;  1I94 O;  1FPO A;  3UQ8 A;  2VQE O;  1V55 C;  2UXD B;  4OPA A;  3AEI A;  4UB8 Z;  1M56 B;  2IH1 C;  2GV9 A;  2OCH A;  4DR1 O;  4IL6 Z;  2X6A A;  3SPI A;  2C2A A;  4BAY A;  5A2Q N;  3IJ4 A;  4WBN B;  5K1X A;  3STZ C;  3HKB B;  4I55 A;  5EYP A;  1SS3 A;  3ABM C;  2DE0 X;  1GH6 A;  2IJI A;  2YXY A;  4DXW A;  5LL6 Y;  4LF8 O;  3TXS A;  2F4V B;  3VQW A;  2Q4P A;  5H5N A;  1XMQ B;  3LDE A;  3SR2 C;  2DJV A;  5C8Y B;  1H2L A;  2CAZ C;  3HKD B;  4WFH A;  2GHY A;  2HLD G;  1VQ9 V;  4EEQ A;  2Y0P A;  2UXB B;  4DR7 O;  1NKD A;  1MNG A;  4X66 O;  2LGW A;  3L70 H;  3BA9 A;  1P7B A;  2QE7 G;  3DXR B;  5IWA B;  1M57 B;  3AK3 A;  4MSW C;  2EUL A;  2B1I A;  4BW9 A;  3X2Q B;  4AHC A;  1NJI W;  3HKE B;  2F95 B;  4JYY A;  2LGQ A;  1LUV A;  1IBK O;  2IU0 A;  1XI1 A;  4J7J A;  2WA3 A;  3ZHU A;  4WCE V;  1URF A;  5JWP A;  1KBH A;  2ZE7 A;  2WSS G;  5DEC A;  1FKA O;  2WWW A;  1SA0 B;  2G38 A;  1SF9 A;  2CTP A;  4JI0 B;  1ZUQ A;  4DR5 B;  5JJN B;  2QTO A;  1ZAU A;  1NZ6 A;  2HKO A;  4B3T O;  2XHB A;  1QQC A;  3J80 N;  2ZDI A;  4UCS A;  2EBO A;  4RO2 A;  1S72 V;  1D5A A;  1NVP B;  5DED A;  2CTW A;  3BPZ A;  1FXK B;  4GX0 A;  5KLV H;  2Q68 A;  4GZR B;  2UUC O;  1YI2 V;  5JCO C;  2WLI A;  3FYE B;  1L0L H;  2LFS A;  1AR5 A;  1WA8 A;  2PYL A;  3CC4 V;  1TUB A;  2YXL A;  1Y74 B;  1K8A W;  4JF3 A;  3RWR D;  4EFB A;  4NVP A;  3RYI A;  4MVZ A;  5D5Q A;  3K79 A;  3J7A U;  1FXK C;  3ZRX A;  4FFB A;  3ZHT A;  1S77 D;  4JV5 O;  5EC1 C;  1RPO A;  5H6R A;  3R66 A;  2XAQ A;  4PI2 A;  3G6E V;  2W6J G;  2RDC A;  2R9I A;  3JAW A;  4UXN A;  4B3S B;  1ZX3 A;  2YIC A;  4JPR A;  3AG2 C;  2OT5 A;  3ABT A;  2ZQM A;  4ICG A;  3F5T A;  2ZXW B;  5LA6 A;  4TT3 G;  3SJQ C;  1VQO V;  2UUB O;  3HKE A;  1VEW A;  3ZMU A;  2PI5 A;  3RT3 C;  2QWO B;  1FXV A;  3QVN A;  1Y66 A;  3BY6 A;  1OCZ B;  4PHZ A;  4FLX A;  3K5O A;  1QBZ A;  4YJ2 A;  4MS2 A;  1WP8 A;  4DUY O;  1N32 O;  3KCY A;  3VQY A;  4X89 A;  2PGG A;  1AJP A;  2ZR2 A;  3F7V C;  2H94 A;  5BR8 O;  3AK1 A;  4IIJ B;  5LYJ B;  4JI8 O;  2W6I G;  2GTA A;  2ZIM A;  1H2S B;  2QM8 A;  1LUW A;  1ZL8 A;  5EZY A;  2LFR A;  1MA1 A;  2JVD A;  3OUF A;  1Q90 D;  3OEH G;  3CC7 V;  4DW0 A;  1ROP A;  2YI9 A;  4CZZ A;  1YHQ V;  1K4C C;  1IBM B;  2R70 A;  3FKS G;  4K8Z A;  3SYP A;  1BSM A;  4PA9 A;  4X62 B;  3K5L A;  4GKJ B;  4UV8 A;  2F93 B;  3L72 H;  5B5E Z;  5LOV A;  2QWP B;  4WBN A;  4FLT A;  2ZT9 B;  4H13 B;  2P4V A;  3IC9 A;  2JGD A;  2B5U A;  1PNM A;  2CDY A;  4ZBM A;  1AP6 A;  1K9M W;  3EVK A;  4KHP B;  3K03 A;  2ADQ B;  1XRE A;  2Q7G A;  4LCU C;  4EKW A;  4DR3 O;  5LHG A;  2VWJ A;  4J80 A;  4UCR A;  4TV8 A;  4HAM A;  2XND G;  2WLJ A;  3OAA G;  4BIZ A;  3SYO A;  1BQZ A;  1Q8I A;  1XNQ B;  2CK3 G;  5LP6 C;  2YXH A;  2JRI A;  1GN2 A;  4J9Z B;  1B06 A;  1R3J C;  3TJT A;  1K33 A;  4QE7 A;  3RGB A;  1NS1 A;  1YF2 A;  1K5Q A;  1B04 A;  3H1I H;  4LF4 B;  4D7T A;  4GKK O;  4PA3 A;  1VAR A;  3ABK C;  2WLN A;  1P4R A;  4GX5 A;  1SQV H;  1YDX A;  1X4T A;  3LDC A;  1F23 A;  3B09 A;  2EIJ C;  4FLW A;  1RPR A;  1SQB H;  4W4K A;  2KSD A;  4XDK A;  1HR0 O;  3KG2 A;  4R7C A;  1BGY H;  4PV1 B;  3K0D A;  4RUF A;  2ILM A;  3EXA A;  2OTJ V;  1HNZ O;  1M90 W;  1YVW A;  4X1Y B;  1IXM A;  4JTC B;  2O57 A;  2Q0O C;  3H1H H;  2Q7H A;  3C3S A;  3UO3 A;  5BMV B;  2HEP A;  4MTO A;  1RSO A;  2LW1 A;  1YEW A;  2ZR3 A;  3BHP A;  4WFB V;  4I4T B;  2A06 H;  2OWO A;  2ATK C;  2UXX A;  3DXR A;  1WA8 B;  5KUM A;  1XL4 A;  2RJZ A;  3D36 A;  3ZMZ A;  1HNW O;  1DF5 A;  1DLB A;  2JGD B;  4LF7 O;  2QKC A;  5GTI Z;  4X1K A;  4BWA A;  1KC8 W;  4RWU A;  1AR1 B;  3RYC A;  4K8X A;  3ZX6 A;  4DV7 B;  3CC2 V;  1R3I C;  4JI7 B;  1ZWI C;  2A3Q A;  4NXN B;  5LMN O;  4YXW G;  3JD3 A;  3RYF B;  4DYL A;  1VF6 A;  4PJ0 Z;  1Y76 A;  3FFQ A;  5L3D A;  1O9G A;  2PTM A;  5LA6 B;  4DV4 B;  2QWQ B;  1VIB A;  4DV1 O;  4OX9 B;  1S3J A;  2OYQ A;  3APQ A;  3EHB B;  3SGI A;  5IDJ A;  1RM1 C;  5EIB D;  1AJQ A;  3JSL A;  5LXT B;  4X20 B;  1FYJ A;  1QR8 A;  2EIJ B;  4JGS A;  3FB6 C;  4I7Z B;  3ICX A;  4B08 A;  2UXC O;  1TVK A;  3JAR B;  4I9W A;  4NXM O;  4JI3 O;  2RMK B;  5JH7 B;  2ZDI C;  4XDL A;  1RM1 B;  4GLX A;  3BAA A;  4DK0 A;  1GM8 A;  3VQX A;  2WAM A;  4MTX A;  1IBL O;  1Q6I A;  2ZM6 B;  3SYA A;  3X2Q C;  3E22 B;  3RBZ A;  3U10 A;  4MVO A;  4O4L B;  1KP2 A;  1VQ6 V;  1GN6 A;  1H2M A;  5IJ0 A;  4JZ2 A;  4U3J B;  1Y76 B;  3E89 A;  1NU1 H;  1JPX A;  3JCZ A;  1V54 C;  1ARO P;  2Y69 C;  2M6Y A;  1NH2 D;  4FPP A;  5CBH A;  5HFM A;  4CBC A;  4DUZ B;  4X20 A;  3B8N A;  3KZI Z;  1FXH A;  1AI6 A;  4DK1 A;  1GAX A;  1NT2 B;  3ZJZ A;  4MW3 A;  5EBM C;  1YIT V;  1XHX A;  1TA8 A;  2EIN B;  5B1N A;  3DTU B;  2LQT A;  3HKB A;  4I55 B;  4TV9 A;  1Q5O A;  1J5E B;  2E5L O;  5AG2 A;  4DV6 O;  5CA1 B;  2ZKO A;  1QNM A;  2OCC C;  4UVA A;  3ZIA G;  1LR1 A;  1Q82 W;  2QDO A;  4H0L B;  4IYI A;  4JI1 O;  1AB3 A;  3CMA V;  4BIO A;  2AW9 A;  4HYO A;  4J41 A;  3HPL C;  4U3J A;  2WLI B;  2OCC B;  4LP8 A;  3UKM A;  2ITC C;  1GMG A;  3G6B A;  1IZ3 A;  2VQF B;  4DV5 O;  1YXB A;  2GUZ B;  4JYA B;  1PKX A;  1WPX A;  2HJF C;  4P9P A;  3HR0 A;  4O2B A;  3H1J H;  5CBF A;  3ASO C;  4X65 B;  3R65 A;  3U11 A;  3APO A;  5JH7 A;  1GM7 A;  4N23 A;  1KQS U;  3QF7 A;  5JVD A;  2P67 A;  2BCC H;  2UXN A;  4X64 O;  3LDD A;  3ZHS A;  2JEU A;  2L6L A;  1JQ0 A;  5TIS Z;  1VF5 B;  3E8H A;  5KX5 A;  1KKC A;  5CA0 A;  2UUA B;  2DYR B;  3CJH B;  2YSU B;  1D2D A;  3OMI B;  4JI4 B;  4X1Y A;  3DSQ A;  3K57 A;  2KG7 A;  2Q8V A;  3ZCC A;  3P30 A;  1YJ9 V;  4E2L A;  1I5Y A;  1ORQ C;  2XAF A;  4GT1 A;  1N0N A;  4UB6 Z;  2CE4 A;  2LP7 A;  3CD6 V;  4X8A A;  5GW7 A;  1VQ7 V;  3CCE V;  3H01 A;  2A0L A;  3ABU A;  4PEL A;  3WB0 A;  1K97 A;  3B2E E;  4K35 A;  1TGO A;  4X1K B;  1QVF U;  3LSU A;  1FFT B;  4CC5 A;  4GCZ A;  4YIP A;  4LF6 B;  3WFV A;  4LFB B;  2EIK B;  2B9Z A;  2AXT Z;  4HBN A;  2Y0I A;  4LFC B;  3MDS A;  3C3T A;  1SQF A;  1ZL8 B;  1JA8 A;  3K5N A;  5B1A B;  3CJH A;  1XMQ O;  3OR6 C;  4E4E A;  1N33 B;  5LBQ A;  3CCU V;  1G6U A;  5B1B C;  3UM7 A;  3QG5 A;  4B3M B;  4PA4 A;  3ASO B;  1JOY A;  1HNX O;  2EX3 A;  1JMK C;  4DR7 B;  1KEC A;  3ZN0 A;  5LOV B;  1JFF B;  3H1K H;  4J9Y B;  4X66 B;  3L74 H;  3ABL C;  2P22 C;  2WLM A;  4LH7 A;  2WLK A;  3B77 A;  1VQ4 V;  1G1X B;  1EFR G;  5IWA O;  1Q86 W;  2ZE8 A;  5B1B B;  1DK1 A;  5KA6 A;  1VQP V;  1N8R W;  4BW5 A;  4YJ2 B;  3CWB H;  1N34 O;  5KMG A;  4AI8 A;  1MSD A;  1NTM H;  3K9S A;  2Y48 A;  1US6 A;  3RVZ A;  4LF9 B;  2CUG A;  4JI2 B;  1K5S A;  1OV9 A;  4U7N A;  3BRC A;  3CRM A;  1Q81 W;  2KG7 B;  1S5H C;  5D5P A;  4BR6 A;  2XOK G;  3CCQ V;  3RW0 A;  3T1Y O;  1A32 A;  3CRR A;  3H9V A;  3N27 A;  2QEX V;  4B3R O;  3ZRS A;  1VQK V;  2XT9 A;  2CTQ A;  1SQG A;  3ABK B;  2W0X A;  1GO3 F;  3CCR V;  4DR4 B;  2HG5 C;  3T2M A;  1KB9 F;  3BEH A;  1S76 D;  5FLX N;  2GTS A;  2X6C A;  2F43 G;  1AI7 A;  5IY5 C;  2IM9 A;  4AQY B;  1NQT A;  2ZNI A;  3Q4H A;  1XMO B;  1PNL A;  2AGA A;  2DQ3 A;  1SC5 B;  4JTD B;  5KAF Z;  4TQD A;  1SER A;  5CBG A;  4OXS A;  2DYS C;  3TGU H;  1OCO B;  2DQ0 A;  5LHI A;  2WLH A;  3CCS V;  4WF9 V;  5CN0 A;  3H1L H;  3CPW U;  4ZOL B;  3IFX A;  4AIL C;  1XNR B;  4TV8 B;  3W7U A;  3AG7 A;  5GON A;  3JD4 A;  2E76 B;  3E86 A;  2DYS B;  4MTF A;  2JGU A;  4LFA B;  4FM2 A;  1OCO C;  5LMU B;  4YY3 B;  1R1B A;  5E1A C;  5H9C A;  2Q6A A;  3AG3 B;  1P49 A;  4JYB A;  2LJ2 A;  4FVM A;  2UXD O;  3CCL V;  1OJH A;  3I5D A;  2N74 A;  3RFR A;  1VQM V;  2GBO A;  1R6K A;  2V1D A;  2QKA A;  4GX2 A;  5KA5 A;  3B4S A;  3CRA A;  4UUJ C;  4NTX A;  3OMN B;  4FIP C;  4CH5 A;  3MD0 A;  1XL6 A;  5LP6 A;  4PDV A;  1J95 A;  4MTG A;  4DUY B;  3WB2 A;  2AZ0 A;  1OCR C;  2Q5Z A;  1YJW V;  1B6Q A;  2JJ1 G;  4KL1 A;  1FAF A;  4KXR A;  1H2K A;  2ZIO A;  3LUT B;  3I56 V;  1B3Q A;  4ZOL A;  1N36 O;  3E8B A;  4DRX A;  4JI8 B;  1JJ2 U;  2UXB O;  3D8C A;  1E1R G;  2AHZ A;  2Q9L A;  2D3O W;  4F4L A;  3FAV B;  1K7D A;  1G4Y B;  1HWY A;  5BXZ A;  4EB6 A;  3C90 A;  2DN9 A;  1OCR B;  5L3E A;  3ZN1 A;  1N4C A;  3TCU A;  1F4M A;  4GKJ O;  4IGG A;  2OIE A;  3SPC A;  4QE9 A;  1AI4 A;  1THZ A;  2HHH O;  3P3P A;  1IBK B;  2PY5 A;  2YDE A;  4MVM A;  1EN6 A;  1YIJ V;  3AK2 A;  4ABM A;  4FZ0 A;  2LO1 A;  5LHH A;  3E83 A;  4PA6 A;  2OIG A;  4G27 B;  2X7R B;  4JI0 O;  2A79 B;  3JAM N;  5KX5 B;  5L3B A;  2H3O A;  4NB5 A;  4R6Z A;  3RYF A;  1W0J G;  2F23 A;  4MT8 A;  4B3T B;  1CXZ B;  3ASN B;  1OCZ C;  1YJN V;  1IUR A;  1NI8 A;  2QKS A;  4DRX B;  3I55 V;  2EIN C;  1L8D A;  4DV3 B;  1WAZ A;  1NH2 B;  4MW8 A;  3JCU Z;  3QO5 A;  1M5I A;  2YS8 A;  3PN1 A;  1MSW D;  3FD9 A;  4F6E A;  1NR1 A;  1XQ8 A;  4DR2 O;  2YIA A;  5KHH A;  1QCE A;  3SPJ A;  5A9G A;  3JD2 A;  1AP5 A;  1YTF D;  3IAY A;  2V4D A;  1PPJ H;  5LGT A;  4PDL A;  2PI4 A;  4J10 A;  3O9O A;  3ZED A;  3T1H O;  4JV5 B;  3EFF K;  4YJ3 A;  2EZP A;  4FFK A;  2K1E A;  1FJG O;  3JAS B;  3ETD A;  3UT5 B;  1VQ5 V;  5K1P A;  3RN4 A;  4I0X A;  3ZMT A;  3GWK C;  4O4H B;  1Z5W A;  4O4I B;  4TOI A;  5DN6 G;  4DR6 B;  1BT8 A;  4EB6 B;  1SRY A;  1P84 F;  2GUZ A;  4O2A B;  4ZIB A;  2P6J A;  3RYH A;  3FB8 C;  3VQV A;  3K04 A;  3CME V;  4LH6 A;  2BOC C;  1XEQ A;  5IYD O;  3TXQ A;  2DYR C;  4I9Q A;  2WLL A;  1VQN V;  3JAT A;  3K58 A;  1AI5 A;  2QGN A;  5EBW C;  4FM1 A;  4WFE A;  4TSF G;  3S3X A;  2Z0A A;  3JAW B;  2ZIN A;  2E75 B;  2YIB D;  2EIM C;  5CA1 A;  1Q3E A;  1YSC A;  4H37 A;  2D2C B;  3OTO B;  3P3N A;  3CE2 A;  4NXN O;  3UO2 A;  4TWK A;  1ZLZ A;  5BY1 A;  4UV9 A;  3J81 N;  2NR5 A;  3TET A;  3BVO A;  4JI6 O;  3LNM B;  2EIM B;  2GDS A;  1XHZ A;  1IBM O;  3K9A A;  2P7T C;  4JI5 O;  2EIK C;  4HNA B;  1SZT A;  4OX9 O;  3T1C A;  3OTF A;  1MG1 A;  1QVG U;  4ZI7 A;  3OT7 A;  3N2K B;  4KUM A;  2FL4 A;  4J7K A;  1BZK A;  2ODM A;  1M93 A;  1BS3 A;  4JI3 B;  3F5W C;  3WG7 B;  2PYJ A;  1HP8 A;  2EIL C;  2JK5 C;  4PD4 F;  1Q43 A;  2KQX A;  1VMG A;  4QNH B;  2P06 A;  2Q67 A;  3ABL B;  4I5S A;  4NYK A;  3WB1 A;  1IBL B;  2F66 C;  2Y4T A;  1I94 B;  1JFF A;  1FD9 A;  4J42 A;  3VBB A;  4A5U B;  4X1I B;  2EIL B;  2CGN A;  1ZTE A;  4PA7 A;  3AG1 B;  5CA3 A;  4HNA A;  1K4D C;  5GTH Z;  4YHH O;  2XTA A;  3CHX A;  1QHT A;  5JJJ B;  2ZE5 A;  1W2B U;  2ZE6 A;  1VP7 A;  4UCV A;  1TUE B;  2ETN A;  2F4V O;  3ZS8 C;  2EJR A;  4EFE A;  4MVS A;  3AG3 C;  3ETE A;  1KYO F;  2PF4 E;  2EZO A;  4X9Q A;  4K3A A;  5KHI A;  5B66 Z;  2QR4 A;  2L35 A;  1FFX A;  1WJZ A;  3OD4 A;  2UU9 B;  1HR0 B;  5IJ0 B;  4I50 B;  2YID A;  1TAE A;  3F7Y C;  3SPG A;  1KP3 A;  1P7G A;  1EZJ A;  4H33 A;  3ABM B;  1F4N A;  4X88 A;  4XBF A;  3M7M X;  2FYU H;  1OZ0 A;  3FAV A;  3FYI B;  1GK9 A;  3CX5 F;  3BA8 A;  1GKF A;  4GX1 A;  4LR3 A;  4CH3 A;  3Q4H B;  1COW G;  1Y4M A;  1VF7 A;  5JQG A;  2Z5U A;  2QWN B;  3W7X A;  4FJC C;  2HVK C;  2P5O A;  3RYI B;  1V55 B;  4F6R A;  3GWO A;  2DWE C;  5KHK A;  2EJ7 A;  1I0H A;  1EM1 A;  4JI7 O;  1Q6H A;  1DGS A;  5GON B;  3A0B Z;  4D7S A;  4MVR A;  2CTR A;  1BMF G; 
#chains in the Genus database with same CATH homology
 4NTX A;  3S3X A;  4NTW A;  2L35 A;  2FB5 A;  4NTY A;  4FZ0 A;  1WP8 A;  3N27 A;  4FZ1 A;  4NYK A;  3S3W A;  2QTS A;  3IJ4 A;  1WP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...