4J7KA

The crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGQFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords secreted protein EsxB
total genus 40
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7kA00
4J7KA 4J41A 4W4KA 4IYHA 4J10A 2G38A 2GTSA 4J11A 4KXRA 4J42A 4J7JA 4IYIA 4W4LA 3FX7A
chains in the Genus database with same CATH superfamily
4HNAA 1EBOA 5LHHA 5B3SB 1V55C 2YI9A 1Q90D 1XBLA 5LGTA 1IXBA 4UCVA 3SPJA 1OCCB 2HG5C 1FXKC 1KB9F 4FZ1A 3R66A 2Y0IA 2BSKA 4CS3A 3K04A 3R65A 2CUGA 2QM8A 2CDYA 5EBWC 2UUCO 3TXSA 2ADPA 5GONB 4JI0O 4WFAV 5JH7A 2UU9B 4DXWA 4J9ZB 1YI2V 1JJ2U 1BHBA 2AXTZ 3IC7A 1SZXA 4I55B 3ZHRA 3CRMA 3CYOA 4W4LA 1FXKB 5IY5C 3Q4HB 3T1YO 2BCCH 3RN4A 4UCUA 4UV8A 4O4LA 4D7TA 2DYSB 3WFVA 4B3RO 1YEWA 4IYIA 2ETNA 2NLJC 2OTLV 2NR5A 2JRIA 1Q6IA 3F5WC 4JTDB 2LW7A 2CTRA 1TAEA 3TJTA 4IIJB 3SJQC 1FJGO 3JCUZ 3AG2C 2JGUA 4NB5A 3K0GA 1BCCH 4MVMA 4NTXA 1HWYA 4QPJA 2EZPA 1Z5WA 2DN9A 4X1KA 2HHHO 4K0KO 1XREA 2ZE5A 3E86A 2P22C 4H37A 1HNZB 4J9YB 1YJNV 4QNHB 1RPRA 2IJJA 4MT8A 4JPRA 1BSMA 2DWEC 3AG4C 4OGQB 2QSAA 1CP9A 1SA0A 2CK3G 4O4IA 1P4RA 3L70H 4BW9A 1BT8A 4KP4A 3HKEB 1AR5A 2P7TC 1NI8A 1GN2A 1ZL8B 2UXDB 4J41A 4BIZA 4RQEA 5GONA 3G6EV 4JI7O 2FMLA 4LF8O 1GK9A 2R70A 2FTKA 3BAAA 2UXBO 2JGDB 3F7YC 1NR7A 5IE9A 3B77A 1COWG 5LBQA 2DYRC 2HHHB 3S3XA 1H2NA 1TVKA 3W7WA 2HVJC 1I5YA 2WLMA 3HKCB 4TT3G 1GM7A 1YZBA 3B09A 3JALB 1Y76A 1UFIA 2EILC 3BRCA 2XAHA 4X65O 1FD9A 4GLXA 5KMGB 4TV8B 1O9GA 2HLDG 2OT5A 3ZEDA 2JVDA 3M7MX 5J2UA 4YHHO 4DR4O 2OIGA 4LP8A 3NR7A 4WFBV 3P3NA 2P06A 1QR8A 2DQ3A 3WG7C 3CCEV 2FB5A 4AHCA 1E79G 1MOFA 2UXCO 3BA9A 2GV9A 1JMKC 1H8EG 3LDEA 5L3BA 1GTOA 2IJKA 4HYOA 4PA6A 2HR3A 4PD4F 3C90A 1J5EB 4DR7O 2Y69C 3F5TA 5FNVA 4DUYB 4FVMA 1S77D 1S3JA 1XMOB 4J10A 1FPOA 4LWSA 2YEVB 1SQVH 4RUEA 5DM6V 2X0LA 4LWSB 4TWKA 5LHGA 2H94A 5BMVB 1JFFB 3CCRV 3CS5A 2DMXA 1WJZA 1YDXA 4ZI7A 2NN4A 4FFBB 1XNRB 2A9HA 1DK1A 5GW7A 4F6RB 1B06A 1TA8A 4J42A 5BY1A 2AZ0A 5F2VO 5KHKA 5LMUO 2B1IA 3KG2A 3MHHC 3ETQA 4EB6A 3X2QB 5L3CA 2CGNA 3QO7A 4PA9A 5EIBD 1M56C 4O4IB 2QWOB 5LXTA 3DXRA 3CSXA 2YICA 3P30A 1B6QA 3CEIA 3SPGA 3QO5A 3JASA 1ZL8A 5IDJA 3H9VA 3BY6A 2ADQB 1QVFU 4G2KA 2Q69A 3A8TA 3M99B 2X6BA 5B1NA 2IU3A 1NT2B 1AI6A 4PDVA 2YSUB 3RYCA 1NH2B 4DUYO 1B04A 3OFNG 1X4TA 1XOUA 2Q68A 2UUBB 4I9WA 5L3DA 1Y6XA 2X7RB 5IWAB 3SJAC 1VEWA 2B5UA 1N8RW 4W4KA 2AGAA 4LF4O 4QE9A 2GDSA 3RYIA 3E8GA 2EZOA 1BZKA 4UCRA 4OXSA 4YIPA 1AJQA 5JVDA 2UXXA 3K9SA 3VQVA 4DO2A 1IURA 1IDSA 1OCRB 3ZHUA 4Z1MG 1D5NA 1P49A 5B1OA 3ASNB 1SKVA 4JI6B 2OWOA 1YTFD 2EX3A 1G4YB 2ZXWB 3OR7C 4JYAO 3OGCC 2ZR2A 1Q81W 4JTCB 3LSSA 3OUSA 1VQPV 5K1XA 3ABKC 3AG7A 4TV8A 3T4ZA 3WU2Z 5H6RA 2R72A 1HNWO 1AILA 4LF5B 3BHPA 5JQGB 2Z0AA 1VARA 4DK1A 1VQ9V 5CBGA 4CS4A 2ZDIA 5IWAO 4O2BA 2GSMB 4GT1A 3B4SA 3X2QC 4FM0A 5IYDO 3WB0A 4LF4B 3VQWA 4DRXB 2CAZC 3B8NA 4UFZA 1NH2D 2E74B 3LSQA 1M5IA 4RO2A 5JCOC 2X6AA 4ZBMA 3UT5B 2OTJV 1DGSA 4MTXA 2EIKC 2BTQB 4EB6B 1V9PA 1Q6HA 1R6NA 1S0VA 1UPGA 5L3GA 1SERA 5IY5B 2W6JG 5BR8O 1QVGU 3QF7A 4O4JA 1JJOA 2UUAO 3BVOA 2LO1A 4FMTA 3OTFA 2RDCA 2A06H 1KU9A 1H2KA 4YIOA 1SQBH 3CB2A 4MSWC 4BAYA 3RYIB 5JH7B 4YJ2A 2K9PA 3JSLA 2E75B 2E3CA 1OZ0A 1URFA 2D2CB 3CWBH 2UXNA 5IYZB 1FFTB 4L8JA 3ZMVA 3K08A 4JYAB 5DEDA 1OCRC 3EHBB 3CCSV 4O4LB 3W7SA 5ITZA 1N34B 4B3MB 1PL4A 5LL6Y 1P7GA 1MSDA 2HP8A 1VF6C 4Q6GA 5KHJA 3LNMB 1BQ0A 4A5UB 3D8CA 2P6JA 4DV6B 4X62B 4HBNA 1Q7YW 4MTGA 4O4JB 3UKMA 1NTZH 4DV7B 3D3IA 4MTOA 3CRCA 4N23A 3RFRA 5HFLA 2HEPA 3B8MA 3K58A 4GX1A 2HKOA 4P9PA 2Q8VA 1U96A 2JJ1G 2UU9O 4DRXA 4DK0A 2IW5A 4CBCA 3SYQA 2QKSA 4U7NA 3C3SA 2PF4E 4JGSA 3G6BA 1M57C 5A2QN 4U3JA 1FS0G 1OCCC 5E79Z 3QG5A 5EK0A 4O2BB 3K59A 5BMVA 3H1JH 4K3AA 1K5SA 4FLVA 4B3MO 2Q0AA 4IYHA 3U0ZA 3IJ4A 3ABTA 3CXHF 4B7EA 4PA4A 4NXMB 4FM2A 4ZOLA 3ZRWB 4JI5B 1FFXB 1N0NA 2AZ2A 1WP7A 3MD0A 1N36O 2O57A 3AG1C 1AROP 2DW4A 5CA0B 2RN9A 4FM1A 2QTSA 3CC4V 4UUJC 2B1GA 1V54C 2JS5A 3HKCA 3CJHA 4WFGA 4ICGA 2Q0OC 1NZ6A 4DV4O 4R7CA 3QO8A 3G67A 4R6ZA 3FFQA 2QWRB 5JWPA 5EZYB 2ZNJA 3APQA 4D6TH 4K8ZA 1KC8W 3JAMN 1N32O 2VWJA 1WAZA 3J7AU 2HJDA 4YXWG 4WF9V 3Q4HA 4K8XA 2EIMB 3FAVA 3PN1A 4UVBA 2EIJC 3ETDA 3IC9A 4JI1O 4B08A 3JD1A 5KAIZ 5KX5A 4DV0B 4YJ2B 1JQ0A 3K06A 1ZWIC 2WLLA 2WSSG 3HR0A 3UO2A 1Z2GA 1FYJA 2GHYA 4JI5O 4J7JA 1LNQA 3F7VC 4JI7B 2ITDC 4PDLA 4ZHQB 2IM9A 4DV2B 3GWOA 1VF5B 1I08A 4GUNA 4CC6A 2BOCC 1SF9A 1HNXO 3RGBA 4B3TO 1QU7A 1TUEB 2YEVA 5LGUA 2W6IG 3A0BZ 1K4CC 1WA8A 2V1DA 2YIBA 3T2MA 2UXBB 4CC5A 2CTPA 1U97A 4X20A 2EINB 1IXMA 3ZRVA 4O2AB 3DC6A 3CCMV 1KKCA 3SYCA 4FFBA 5EIBC 5EBMC 3FKSG 2HVKC 3JAWB 3SJBC 1IBLO 4KFMA 2ZT9B 4DW1A 3WB2A 4DV1B 4IGGA 4X8AA 4FLYA 3AG3B 4DYLA 3HKEA 2UXCB 4UVAA 1N33B 5ITZB 2QKCA 4DV3O 1KECA 4JI2O 4EEQA 1VQ5V 1YCIA 4H44B 5L3FA 1QR9A 3T1YB 4LFCB 1Q6UA 3EXAA 3SPCA 3G80A 1PNKA 4RAIA 4U7OA 1Q8IA 1FKAO 3D36A 3H1LH 1KP3A 1WA8B 2H3OA 1EZVH 3VQXA 1FJGB 1VQ8V 2QGNA 4MVZA 2ZINA 4HZ3A 3ZMUA 1BE3H 2H8PC 5B1AB 1X59A 5LYJB 1F7YA 2XAGA 5LA6A 3LNNA 1LR1A 2VQEO 2ZDIC 1ROPA 1M57B 5J9PC 4FLTA 2E5LB 4YJ3B 2L35A 5CB4B 3RYHB 1KQSU 2Z5UA 1K5QA 4MVOA 4HAMA 1EZJA 5JJJB 4LFCO 2V4DA 3OR6C 3K03A 4PHZA 4BWAA 4X1IB 4AI8A 1VQ6V 3STZC 4DR5O 1N4CA 4U3JB 1XL6A 2IH1C 2Y69B 1F4MA 1XDCA 4CH6A 4B3SB 5B1AC 2ZNIA 2XAFA 2CH7A 5LMNO 3JATB 2E76B 3OAAG 1JA8A 1YITV 3L71H 2WLIB 4I4TB 2Y48A 4O4HB 4EFEA 3RVYA 4EFBA 1IBMB 4LF8B 3ZS8C 5CBHA 4ZOLB 1WP8A 4XDLA 3UQ8A 5LP6A 3JAWA 2F4VO 3WB1A 4JI6O 4LF9B 1PM9A 1WN7A 5KUKA 1LUWA 2ZM6B 4UVCA 3OMIB 1F51A 2KQXA 1HDJA 3SDLA 1V54B 3CMAV 3WG7B 4BR6A 1WB8A 2ZE6A 2KG7B 3DGEA 1AI5A 4H0LB 2BE3A 1PPJH 3HPLC 3TCUA 5B5EZ 2VQEB 5J2UB 2F43G 2JEUA 4J7ZA 1B3QA 2WLHA 1MZEA 1MSWD 1P84F 1M9NA 5H5NA 2Q4PA 1K34A 1K33A 4FLWA 1DLBA 3NXSA 4X66B 5JJNB 1XEQA 4BW5A 1QQCA 4IIJA 5HFMA 1GM9A 4R8CA 1NS1A 4LNUA 2JGDA 2YXLA 1NTKH 1XMOO 2F66C 4DUZO 1PKXA 4DR4B 4TV9A 4I0XA 1H2GA 2QA4V 3ZX6A 2ZR3A 1Q82W 3T1CA 3SJCC 2R9AA 1HR0O 4DV5O 1GAXA 3RYHA 5LMNB 1S76D 5LXTB 3CMEV 2VRZA 3N2KB 3CE2A 1GMGA 3FB8C 4GKJB 1JFFA 2W0FC 4KUMA 2KG7A 5IJ9A 2Q7GA 3TXQA 3ZHTA 3TK1A 3J81N 2LP7A 3K3WA 5E1AC 1Q3EA 1NBMG 5C8YB 3K57A 2XASA 1WPBA 3LSUA 4JYBA 2ZCEA 4FLUA 2N04A 5LOVB 1JPXA 4X66O 1AR1B 2BTOA 4PV1B 1VQKV 3O65A 4IL6Z 4DR3O 3ZHVA 4P30A 4X64O 2RNBA 2PGGA 1HW7A 4WBNA 1Q43A 3ETGA 3BABA 2M6YA 5KHHA 2Q7EA 2WPDG 3L72H 1S5LZ 4LFAO 5KAFZ 2Q67A 2VWKA 4PA3A 3CCJV 1SQGA 2IJIA 4F4LA 1QCEA 4NVPA 1YJWV 1GN3A 3ABUA 1NKDA 4LF6O 5EC2C 1AB3A 5CMUA 2YXYA 3OEEG 1VQLV 2OIEA 2ITCC 4NTYA 3CRQA 1AJPA 4FIPC 4KHPO 4JAAA 3JARA 3OW2U 1GRJA 1OHHG 3D36C 1M56B 3ABMB 4LF7B 1G6UA 1Q86W 3O9OA 1KBHA 4H33A 3I55V 3AK2A 3OE7G 4LR3A 3E2EA 3ZRXA 4JF3A 3KKYA 5LGNA 2QR4A 4YY3O 4GKKB 2LFRA 4DV4B 4PA7A 4G28B 4YJ3A 3STLC 4NXMO 4X1YA 4ABMA 5IT9N 4ASUG 3EVKA 4X9QA 1SZTA 4I4TA 1IVSA 2QM4A 3SGIA 1E1RG 3CP1A 4GYCB 1AP5A 2EJRA 1PNLA 3LDDA 4LFBB 1XUQA 4I9QA 1NR1A 1SA0B 2C2AA 5H2FZ 4MVSA 3ABKB 4X64B 2FYUH 3SYAA 2GTAA 4E2LA 3H1HH 1O9HA 1XHXA 1YJ9V 2WAMA 2N74A 3I5DA 5IJ0A 2YUAA 1Y66A 2VS0A 1HNWB 5A9GA 1DF5A 3EFFK 4DW0A 4DV2O 1GM8A 1RM1C 4JZGA 1Y74B 3W7UA 1J95A 3AG4B 1XL4A 4CZZA 3I56V 1VQ4V 4F6EA 3HKBA 1PP9H 2WLIA 1AI7A 3RT3C 4GKKO 3UM7A 5EBLC 4BIUA 1J5EO 4DR7B 4KHPB 3B40A 4I55A 4MVUA 2XAJA 1Y67A 4GX2A 3JALA 4GCZA 4LF7O 3E22A 1HNXB 1FXKA 4JZ2A 4N21A 4AQYB 4JI3O 3MAQA 3QTCA 2PI5A 3ABLB 1H38A 1FXHA 4JI4O 1EN5A 3L74H 4GZRB 1VF6A 1IZ3A 2WWWA 5CBFA 5GTIZ 4CH5A 1R3KC 1QLNA 1F23A 4DV7O 1GKFA 3JARB 5LA6B 1I94O 2R9RB 5BXZA 5KX5B 5C93A 2VQFB 3FD9A 1MMMA 1MNGA 1BQZA 2L6LA 2F1MA 2YXHA 5LP6C 2QKAA 4QJFB 3W7XA 2B9ZA 2N05A 3DC5A 1T5EA 5H6QA 4WCEV 4X62O 1ENVA 3RWRD 2UUBO 3J80N 3E83A 3UCSC 3AG1B 4I50B 2DJVA 4JASA 5IYBO 4I50A 3ZJZA 5B1BC 1QHTA 1H2LA 1THZA 2E5LO 2QJ1A 2BTQA 2V7QG 5JCOA 1IBKB 4X65B 4QGPA 1MABG 3M8AA 1N32B 5IYCO 2FL4A 2M7WA 2JEXA 4MW3A 2Z3YA 3AEIA 4DR5B 1R1BA 5CB4A 4DR1O 3ETEA 5H9CA 2ODMA 1W2BU 3OTOB 4JI4B 3FAVB 4CH4A 4CH3A 1SC5B 1RFYA 4ZKIA 1ORQC 1M90W 2ZKOA 1RSOB 4NYKA 2JDIG 3JD3A 3ASNC 2P90A 4JTAB 4WFEA 3CCQV 2DWDC 5B3SC 3ZMZA 1N0JA 5FPRA 4CS2A 2DE0X 4WBNB 3E8FA 4DR2O 1K7DA 1VQMV 1XNRO 1I7FA 4X89A 1NU1H 2XAQA 2KSDA 3VOUA 4FZ0A 2OCCB 3IFXA 1RP3B 2R9IA 1JR9A 2WA4A 3CPWU 4D7SA 1SQFA 3ZN1A 4DR1B 4DV1O 3ZHSA 1A32A 4WFFA 3ZMSA 3W7TA 4JAVA 1H2MA 3N2KA 1AVMA 1W59A 1OCOB 4DV0O 1SQQH 1BS3A 3RYCB 5EC1C 1N33O 3AK3A 3G71V 2EINC 3OEHG 4TQFA 3AG3C 1MZFA 4UXNA 5FL7G 5C8YA 1M93A 2RJZA 5J2TB 1M4UA 3OGIB 3CXCU 4JYYA 1K8AW 2FKXA 1BMFG 4O2AA 2JJ2G 1ZAUA 3H1IH 3UT5A 1HR0B 2F23A 2UXDO 4DR2B 1R3LC 1IX9A 1I5XA 1HNZO 2OCHA 3ASOC 1CXZB 2IU0A 4HNAB 4PJ0Z 1R6KA 2XTAA 2AHYA 2BSKB 3LUTB 4JAUA 2LGWA 2Y4TA 3OMAB 1L8DA 1PL0A 1AR4A 1VP7A 2F93B 2XUMA 4TSFG 3AK1A 2Q7HA 2P4KA 1SESA 1Z5VA 3JSNA 1NQTA 1QLEC 5K1PA 4TUYA 4P9OA 5IJ0B 2ZQMA 3CCUV 3TGUH 4RWUA 2XT9A 3CD6V 2QWQB 1JX9A 1XI1A 4MS2A 5DECA 2WA3A 2P5OA 4JI2B 1LUVA 3JYCA 3C3TA 1D5AA 2ZXWC 1AJNA 4AILC 2ZIOA 2LFSA 3E8BA 2EJ7A 3ZHQA 4FLXA 2QWNB 3ASOB 5EYPA 5KLVH 3ZRWA 1PNMA 1ZX3A 3H1KH 2EILB 4UB6Z 5EYPB 2YC0A 2W0XA 4JI8O 5KUMA 2G38A 2HFEC 1ZSPA 3SYOA 5L3EA 5CA0A 3JATA 1N36B 4FLZA 3SYPA 2F4VB 2X6CA 4XBFA 4LNUB 1H2SB 4LFAB 4LF9O 1EFRG 2WLJA 5BR8B 3CJHB 2Q9LA 1P7BA 2UUAB 4MVRA 3K5OA 2Q73A 5IJ9B 1YVWA 2XOKG 3FYIB 2DOSA 4LC1A 1S72V 3K9AA 3GB7C 2LW1A 1ZTEA 2QE7G 1TUBA 1YF2A 1K92A 4TUYB 2AW9A 2ATKC 3HKDB 1FXVA 1WNSA 1JOYA 1HP8A 5B66Z 3HKDA 5CA1B 2CTWA 4LH6A 2A0LA 2WLLB 2QWPB 2IH3C 3JD4A 4FK5C 4BIOA 4KXRA 5CA1A 4UCTA 1AP6A 3DXRB 4QPKA 4JI0B 3K5LA 3CC2V 1W0KG 4EKWA 2LJ2A 1TUBB 4FPPA 3A0HZ 5JQGA 1BGYH 4JYCA 3GVMA 4G27B 1M1KW 2EULA 3K0DA 4DV6O 3E35A 5B1BB 1GN4A 3D3QA 5FPOA 3OT7A 3FB6C 4H13B 1BL8A 2P4VA 4B3TB 3OM3B 3P3PA 3ZMTA 1JCHA 3CRRA 2GBOA 3AG2B 1OCZB 2QTOA 4LFBO 5CA3A 4WFHA 4TV9B 3OMNB 4Z1VA 2RQ6A 1SRYA 4PDRA 2ZM6O 4U3FH 2Q6AA 4MTFA 2YI8A 3E89A 2WLNA 3CC7V 1WLEA 1PV0A 2CGOA 5KA5A 1E1QG 1XILA 4R50A 3K5MA 3K79A 4NTWA 4FFKA 1K97A 2GUZA 3ABMC 4OPAA 2QEXV 3U10A 4DV5B 4K0KB 1VQ7V 3UO3A 3CX5F 4NKGB 2AHZA 5CN0A 1RPOA 2RMKB 1SQXH 2A79B 5IYZA 1UJWB 1R6TA 2XHBA 3HB3B 1VF7A 1OCZC 5KHGA 1Q5OA 2GUZB 1XHZA 3P32A 2A7WA 2ZD9A 3L9DA 1YHQV 4I7ZB 2YIDA 4ZHQA 2KB1A 3BFRA 1KD1W 4X1IA 4DUZB 1VQOV 1I94B 1KUQA 3ICXA 2EBOA 3RW0A 4UV9A 2ARHA 3RYFA 3LDCA 4X20B 2K1EA 1US6A 1ZUQA 1I0HA 4C7UA 4E4EA 3THOA 1MA1A 1ZLZA 1YSCA 1EN4A 2LQTA 1XMQO 2ZE8A 2ILMA 3CHXA 3BPZA 1G1XB 1RM1B 4IT5A 4PDMA 2F95B 2KKWA 2QDOA 2XNDG 3L75H 2VQFO 1XNQO 2ZIMA 3K5NA 3HKBB 1FFXA 3IGAC 5FNVB 1YTFB 5KHIA 3APOA 1S5JA 1Y74A 4YHHB 3BEHA 4LF5O 3L73H 3ZN0A 1WPXA 3JD0A 4RUFA 3JCZA 4P2ZA 5AG2A 2CTQA 3RYFB 1NVPB 5TISZ 1KP2A 1N34O 4B3SO 1K4DC 2PYJA 5JJEB 4O4HA 5D5PA 2YDEA 4XDKA 1KKDA 2A3QA 3ZBHA 2D3OW 1FAFA 5KMGA 4PI2A 1IBMO 3B2EE 1R73A 2GTSA 3FB7C 1AI4A 1R3IC 3JAKA 4IHJB 3CCVV 2EIJB 4PI0A 3T1HB 3IAYA 4OX9B 5JVDB 2Q5ZA 2NNUA 3JAKB 4IHJA 1JVMA 4LCUC 4DR6O 2CE4A 1IBLB 4GX5A 4MVQA 3QNEA 1NJIW 4K35A 1XNQB 3N2GB 5J2TA 3DTUB 1GH6A 5BZBA 1Y76B 1SETA 3OD4A 3OTOO 3N2GA 5EZYA 3CCLV 2PTMA 1L0LH 1DTOA 4UCOA 2LGQA 5LYJA 3RBZA 5LOVA 1DF4A 3E8HA 4DV3B 1XMQB 5LMUB 2BOBC 2PYLA 1TGOA 1GN6A 3DSQA 4X88A 3MHSC 1VMGA 1BHAA 2OCCC 4NXNB 1YXBA 1K3EA 4Z2WA 3MDSA 2HJFC 2ZE7A 4J7KA 2PI4A 3PJSK 4OPHA 1CEZA 1KMIZ 4J11A 2IJHA 3BCCH 3SPIA 5LHIA 3KCXA 1EN6A 2MW2B 2JK5C 3QVNA 1VQNV 4LH7A 2Y4UA 2YIAA 4LBEC 1WB7A 3JD2A 1XQ8A 3U11A 2OYQA 3SR2C 1K73W 4AQYO 4ZI7B 3SPHA 3N27A 4RQFA 2JIZG 3GWKC 4I0XB 4JV5O 1QLEB 4GKJO 3VQYA 3ABLC 2IBZH 1RSOA 1TVKB 3FB5C 5LP6B 1EM1A 5KA6A 5DN6G 4OX9O 1NVPD 3T1HO 3FYEB 1K9MW 3E22B 3ML0A 4NR1A 1QNMA 4DR6B 3VBBA 4J80A 3ZCCA 4JI1B 2CH7B 4NXNO 3BA8A 1V55B 3S3WA 1MG1A 4XDJA 4JI3B 3CRAA 2UUCB 2EIKB 3TETA 4DR3B 2PZSA 4X1YB 4PELA 1VIBA 5D5QA 2DYSC 2YS8A 2RCVA 2DYRB 3A2FA 1L0NH 4TOIA 4GX0A 4F6RA 1QBZA 3T4DA 1GO3F 4I5SA 4QE7A 5GTHZ 4X1KB 1W0JG 3H01A 4B7KA 3ZIAG 3FX7A 1PD3A 4MW8A 1G8MA 2PUSA 4KL1A 3KCYA 4B3RB 1S5HC 1OJHA 3A0RA 4LF6B 2MK3A 3JASB 1OCOC 4ZIBA 2P67A 4TQDA 4JI8B 2JS3A 1D2DA 1IBKO 4Q20A 1NTMH 4UCSA 2Y0PA 1KYOF 4L87A 2YIBD 4UB8Z 1SS3A 1YIJV 2DQ0A 1R3JC 2EIMC 2WLKA 3G4SV 1OV9A 3KZIZ 2PY5A 4QIWF 1L1FA 3OUFA 1SQPH 1CPYA 4JV5B 4FJCC 3RVZA 4YY3B 1F4NA 3ZRSA 1H8HG 2QM7A 1Y4MA 5FLXN
chains in the Genus database with same CATH topology
4J7KA 4J41A 4W4KA 4IYHA 4J10A 2G38A 2GTSA 4J11A 4KXRA 4J42A 4J7JA 4IYIA 4W4LA 3FX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7K A;  4J41 A;  4W4K A;  4IYH A;  4J10 A;  2G38 A;  2GTS A;  4J11 A;  4KXR A;  4J42 A;  4J7J A;  4IYI A;  4W4L A;  3FX7 A; 
#chains in the Genus database with same CATH topology
 4HNA A;  1EBO A;  5LHH A;  5B3S B;  1V55 C;  2YI9 A;  1Q90 D;  1XBL A;  5LGT A;  1IXB A;  4UCV A;  3SPJ A;  1OCC B;  2HG5 C;  1FXK C;  1KB9 F;  4FZ1 A;  3R66 A;  2Y0I A;  2BSK A;  4CS3 A;  3K04 A;  3R65 A;  2CUG A;  2QM8 A;  2CDY A;  5EBW C;  2UUC O;  3TXS A;  2ADP A;  5GON B;  4JI0 O;  4WFA V;  5JH7 A;  2UU9 B;  4DXW A;  4J9Z B;  1YI2 V;  1JJ2 U;  1BHB A;  2AXT Z;  3IC7 A;  1SZX A;  4I55 B;  3ZHR A;  3CRM A;  3CYO A;  4W4L A;  1FXK B;  5IY5 C;  3Q4H B;  3T1Y O;  2BCC H;  3RN4 A;  4UCU A;  4UV8 A;  4O4L A;  4D7T A;  2DYS B;  3WFV A;  4B3R O;  1YEW A;  4IYI A;  2ETN A;  2NLJ C;  2OTL V;  2NR5 A;  2JRI A;  1Q6I A;  3F5W C;  4JTD B;  2LW7 A;  2CTR A;  1TAE A;  3TJT A;  4IIJ B;  3SJQ C;  1FJG O;  3JCU Z;  3AG2 C;  2JGU A;  4NB5 A;  3K0G A;  1BCC H;  4MVM A;  4NTX A;  1HWY A;  4QPJ A;  2EZP A;  1Z5W A;  2DN9 A;  4X1K A;  2HHH O;  4K0K O;  1XRE A;  2ZE5 A;  3E86 A;  2P22 C;  4H37 A;  1HNZ B;  4J9Y B;  1YJN V;  4QNH B;  1RPR A;  2IJJ A;  4MT8 A;  4JPR A;  1BSM A;  2DWE C;  3AG4 C;  4OGQ B;  2QSA A;  1CP9 A;  1SA0 A;  2CK3 G;  4O4I A;  1P4R A;  3L70 H;  4BW9 A;  1BT8 A;  4KP4 A;  3HKE B;  1AR5 A;  2P7T C;  1NI8 A;  1GN2 A;  1ZL8 B;  2UXD B;  4J41 A;  4BIZ A;  4RQE A;  5GON A;  3G6E V;  4JI7 O;  2FML A;  4LF8 O;  1GK9 A;  2R70 A;  2FTK A;  3BAA A;  2UXB O;  2JGD B;  3F7Y C;  1NR7 A;  5IE9 A;  3B77 A;  1COW G;  5LBQ A;  2DYR C;  2HHH B;  3S3X A;  1H2N A;  1TVK A;  3W7W A;  2HVJ C;  1I5Y A;  2WLM A;  3HKC B;  4TT3 G;  1GM7 A;  1YZB A;  3B09 A;  3JAL B;  1Y76 A;  1UFI A;  2EIL C;  3BRC A;  2XAH A;  4X65 O;  1FD9 A;  4GLX A;  5KMG B;  4TV8 B;  1O9G A;  2HLD G;  2OT5 A;  3ZED A;  2JVD A;  3M7M X;  5J2U A;  4YHH O;  4DR4 O;  2OIG A;  4LP8 A;  3NR7 A;  4WFB V;  3P3N A;  2P06 A;  1QR8 A;  2DQ3 A;  3WG7 C;  3CCE V;  2FB5 A;  4AHC A;  1E79 G;  1MOF A;  2UXC O;  3BA9 A;  2GV9 A;  1JMK C;  1H8E G;  3LDE A;  5L3B A;  1GTO A;  2IJK A;  4HYO A;  4PA6 A;  2HR3 A;  4PD4 F;  3C90 A;  1J5E B;  4DR7 O;  2Y69 C;  3F5T A;  5FNV A;  4DUY B;  4FVM A;  1S77 D;  1S3J A;  1XMO B;  4J10 A;  1FPO A;  4LWS A;  2YEV B;  1SQV H;  4RUE A;  5DM6 V;  2X0L A;  4LWS B;  4TWK A;  5LHG A;  2H94 A;  5BMV B;  1JFF B;  3CCR V;  3CS5 A;  2DMX A;  1WJZ A;  1YDX A;  4ZI7 A;  2NN4 A;  4FFB B;  1XNR B;  2A9H A;  1DK1 A;  5GW7 A;  4F6R B;  1B06 A;  1TA8 A;  4J42 A;  5BY1 A;  2AZ0 A;  5F2V O;  5KHK A;  5LMU O;  2B1I A;  3KG2 A;  3MHH C;  3ETQ A;  4EB6 A;  3X2Q B;  5L3C A;  2CGN A;  3QO7 A;  4PA9 A;  5EIB D;  1M56 C;  4O4I B;  2QWO B;  5LXT A;  3DXR A;  3CSX A;  2YIC A;  3P30 A;  1B6Q A;  3CEI A;  3SPG A;  3QO5 A;  3JAS A;  1ZL8 A;  5IDJ A;  3H9V A;  3BY6 A;  2ADQ B;  1QVF U;  4G2K A;  2Q69 A;  3A8T A;  3M99 B;  2X6B A;  5B1N A;  2IU3 A;  1NT2 B;  1AI6 A;  4PDV A;  2YSU B;  3RYC A;  1NH2 B;  4DUY O;  1B04 A;  3OFN G;  1X4T A;  1XOU A;  2Q68 A;  2UUB B;  4I9W A;  5L3D A;  1Y6X A;  2X7R B;  5IWA B;  3SJA C;  1VEW A;  2B5U A;  1N8R W;  4W4K A;  2AGA A;  4LF4 O;  4QE9 A;  2GDS A;  3RYI A;  3E8G A;  2EZO A;  1BZK A;  4UCR A;  4OXS A;  4YIP A;  1AJQ A;  5JVD A;  2UXX A;  3K9S A;  3VQV A;  4DO2 A;  1IUR A;  1IDS A;  1OCR B;  3ZHU A;  4Z1M G;  1D5N A;  1P49 A;  5B1O A;  3ASN B;  1SKV A;  4JI6 B;  2OWO A;  1YTF D;  2EX3 A;  1G4Y B;  2ZXW B;  3OR7 C;  4JYA O;  3OGC C;  2ZR2 A;  1Q81 W;  4JTC B;  3LSS A;  3OUS A;  1VQP V;  5K1X A;  3ABK C;  3AG7 A;  4TV8 A;  3T4Z A;  3WU2 Z;  5H6R A;  2R72 A;  1HNW O;  1AIL A;  4LF5 B;  3BHP A;  5JQG B;  2Z0A A;  1VAR A;  4DK1 A;  1VQ9 V;  5CBG A;  4CS4 A;  2ZDI A;  5IWA O;  4O2B A;  2GSM B;  4GT1 A;  3B4S A;  3X2Q C;  4FM0 A;  5IYD O;  3WB0 A;  4LF4 B;  3VQW A;  4DRX B;  2CAZ C;  3B8N A;  4UFZ A;  1NH2 D;  2E74 B;  3LSQ A;  1M5I A;  4RO2 A;  5JCO C;  2X6A A;  4ZBM A;  3UT5 B;  2OTJ V;  1DGS A;  4MTX A;  2EIK C;  2BTQ B;  4EB6 B;  1V9P A;  1Q6H A;  1R6N A;  1S0V A;  1UPG A;  5L3G A;  1SER A;  5IY5 B;  2W6J G;  5BR8 O;  1QVG U;  3QF7 A;  4O4J A;  1JJO A;  2UUA O;  3BVO A;  2LO1 A;  4FMT A;  3OTF A;  2RDC A;  2A06 H;  1KU9 A;  1H2K A;  4YIO A;  1SQB H;  3CB2 A;  4MSW C;  4BAY A;  3RYI B;  5JH7 B;  4YJ2 A;  2K9P A;  3JSL A;  2E75 B;  2E3C A;  1OZ0 A;  1URF A;  2D2C B;  3CWB H;  2UXN A;  5IYZ B;  1FFT B;  4L8J A;  3ZMV A;  3K08 A;  4JYA B;  5DED A;  1OCR C;  3EHB B;  3CCS V;  4O4L B;  3W7S A;  5ITZ A;  1N34 B;  4B3M B;  1PL4 A;  5LL6 Y;  1P7G A;  1MSD A;  2HP8 A;  1VF6 C;  4Q6G A;  5KHJ A;  3LNM B;  1BQ0 A;  4A5U B;  3D8C A;  2P6J A;  4DV6 B;  4X62 B;  4HBN A;  1Q7Y W;  4MTG A;  4O4J B;  3UKM A;  1NTZ H;  4DV7 B;  3D3I A;  4MTO A;  3CRC A;  4N23 A;  3RFR A;  5HFL A;  2HEP A;  3B8M A;  3K58 A;  4GX1 A;  2HKO A;  4P9P A;  2Q8V A;  1U96 A;  2JJ1 G;  2UU9 O;  4DRX A;  4DK0 A;  2IW5 A;  4CBC A;  3SYQ A;  2QKS A;  4U7N A;  3C3S A;  2PF4 E;  4JGS A;  3G6B A;  1M57 C;  5A2Q N;  4U3J A;  1FS0 G;  1OCC C;  5E79 Z;  3QG5 A;  5EK0 A;  4O2B B;  3K59 A;  5BMV A;  3H1J H;  4K3A A;  1K5S A;  4FLV A;  4B3M O;  2Q0A A;  4IYH A;  3U0Z A;  3IJ4 A;  3ABT A;  3CXH F;  4B7E A;  4PA4 A;  4NXM B;  4FM2 A;  4ZOL A;  3ZRW B;  4JI5 B;  1FFX B;  1N0N A;  2AZ2 A;  1WP7 A;  3MD0 A;  1N36 O;  2O57 A;  3AG1 C;  1ARO P;  2DW4 A;  5CA0 B;  2RN9 A;  4FM1 A;  2QTS A;  3CC4 V;  4UUJ C;  2B1G A;  1V54 C;  2JS5 A;  3HKC A;  3CJH A;  4WFG A;  4ICG A;  2Q0O C;  1NZ6 A;  4DV4 O;  4R7C A;  3QO8 A;  3G67 A;  4R6Z A;  3FFQ A;  2QWR B;  5JWP A;  5EZY B;  2ZNJ A;  3APQ A;  4D6T H;  4K8Z A;  1KC8 W;  3JAM N;  1N32 O;  2VWJ A;  1WAZ A;  3J7A U;  2HJD A;  4YXW G;  4WF9 V;  3Q4H A;  4K8X A;  2EIM B;  3FAV A;  3PN1 A;  4UVB A;  2EIJ C;  3ETD A;  3IC9 A;  4JI1 O;  4B08 A;  3JD1 A;  5KAI Z;  5KX5 A;  4DV0 B;  4YJ2 B;  1JQ0 A;  3K06 A;  1ZWI C;  2WLL A;  2WSS G;  3HR0 A;  3UO2 A;  1Z2G A;  1FYJ A;  2GHY A;  4JI5 O;  4J7J A;  1LNQ A;  3F7V C;  4JI7 B;  2ITD C;  4PDL A;  4ZHQ B;  2IM9 A;  4DV2 B;  3GWO A;  1VF5 B;  1I08 A;  4GUN A;  4CC6 A;  2BOC C;  1SF9 A;  1HNX O;  3RGB A;  4B3T O;  1QU7 A;  1TUE B;  2YEV A;  5LGU A;  2W6I G;  3A0B Z;  1K4C C;  1WA8 A;  2V1D A;  2YIB A;  3T2M A;  2UXB B;  4CC5 A;  2CTP A;  1U97 A;  4X20 A;  2EIN B;  1IXM A;  3ZRV A;  4O2A B;  3DC6 A;  3CCM V;  1KKC A;  3SYC A;  4FFB A;  5EIB C;  5EBM C;  3FKS G;  2HVK C;  3JAW B;  3SJB C;  1IBL O;  4KFM A;  2ZT9 B;  4DW1 A;  3WB2 A;  4DV1 B;  4IGG A;  4X8A A;  4FLY A;  3AG3 B;  4DYL A;  3HKE A;  2UXC B;  4UVA A;  1N33 B;  5ITZ B;  2QKC A;  4DV3 O;  1KEC A;  4JI2 O;  4EEQ A;  1VQ5 V;  1YCI A;  4H44 B;  5L3F A;  1QR9 A;  3T1Y B;  4LFC B;  1Q6U A;  3EXA A;  3SPC A;  3G80 A;  1PNK A;  4RAI A;  4U7O A;  1Q8I A;  1FKA O;  3D36 A;  3H1L H;  1KP3 A;  1WA8 B;  2H3O A;  1EZV H;  3VQX A;  1FJG B;  1VQ8 V;  2QGN A;  4MVZ A;  2ZIN A;  4HZ3 A;  3ZMU A;  1BE3 H;  2H8P C;  5B1A B;  1X59 A;  5LYJ B;  1F7Y A;  2XAG A;  5LA6 A;  3LNN A;  1LR1 A;  2VQE O;  2ZDI C;  1ROP A;  1M57 B;  5J9P C;  4FLT A;  2E5L B;  4YJ3 B;  2L35 A;  5CB4 B;  3RYH B;  1KQS U;  2Z5U A;  1K5Q A;  4MVO A;  4HAM A;  1EZJ A;  5JJJ B;  4LFC O;  2V4D A;  3OR6 C;  3K03 A;  4PHZ A;  4BWA A;  4X1I B;  4AI8 A;  1VQ6 V;  3STZ C;  4DR5 O;  1N4C A;  4U3J B;  1XL6 A;  2IH1 C;  2Y69 B;  1F4M A;  1XDC A;  4CH6 A;  4B3S B;  5B1A C;  2ZNI A;  2XAF A;  2CH7 A;  5LMN O;  3JAT B;  2E76 B;  3OAA G;  1JA8 A;  1YIT V;  3L71 H;  2WLI B;  4I4T B;  2Y48 A;  4O4H B;  4EFE A;  3RVY A;  4EFB A;  1IBM B;  4LF8 B;  3ZS8 C;  5CBH A;  4ZOL B;  1WP8 A;  4XDL A;  3UQ8 A;  5LP6 A;  3JAW A;  2F4V O;  3WB1 A;  4JI6 O;  4LF9 B;  1PM9 A;  1WN7 A;  5KUK A;  1LUW A;  2ZM6 B;  4UVC A;  3OMI B;  1F51 A;  2KQX A;  1HDJ A;  3SDL A;  1V54 B;  3CMA V;  3WG7 B;  4BR6 A;  1WB8 A;  2ZE6 A;  2KG7 B;  3DGE A;  1AI5 A;  4H0L B;  2BE3 A;  1PPJ H;  3HPL C;  3TCU A;  5B5E Z;  2VQE B;  5J2U B;  2F43 G;  2JEU A;  4J7Z A;  1B3Q A;  2WLH A;  1MZE A;  1MSW D;  1P84 F;  1M9N A;  5H5N A;  2Q4P A;  1K34 A;  1K33 A;  4FLW A;  1DLB A;  3NXS A;  4X66 B;  5JJN B;  1XEQ A;  4BW5 A;  1QQC A;  4IIJ A;  5HFM A;  1GM9 A;  4R8C A;  1NS1 A;  4LNU A;  2JGD A;  2YXL A;  1NTK H;  1XMO O;  2F66 C;  4DUZ O;  1PKX A;  4DR4 B;  4TV9 A;  4I0X A;  1H2G A;  2QA4 V;  3ZX6 A;  2ZR3 A;  1Q82 W;  3T1C A;  3SJC C;  2R9A A;  1HR0 O;  4DV5 O;  1GAX A;  3RYH A;  5LMN B;  1S76 D;  5LXT B;  3CME V;  2VRZ A;  3N2K B;  3CE2 A;  1GMG A;  3FB8 C;  4GKJ B;  1JFF A;  2W0F C;  4KUM A;  2KG7 A;  5IJ9 A;  2Q7G A;  3TXQ A;  3ZHT A;  3TK1 A;  3J81 N;  2LP7 A;  3K3W A;  5E1A C;  1Q3E A;  1NBM G;  5C8Y B;  3K57 A;  2XAS A;  1WPB A;  3LSU A;  4JYB A;  2ZCE A;  4FLU A;  2N04 A;  5LOV B;  1JPX A;  4X66 O;  1AR1 B;  2BTO A;  4PV1 B;  1VQK V;  3O65 A;  4IL6 Z;  4DR3 O;  3ZHV A;  4P30 A;  4X64 O;  2RNB A;  2PGG A;  1HW7 A;  4WBN A;  1Q43 A;  3ETG A;  3BAB A;  2M6Y A;  5KHH A;  2Q7E A;  2WPD G;  3L72 H;  1S5L Z;  4LFA O;  5KAF Z;  2Q67 A;  2VWK A;  4PA3 A;  3CCJ V;  1SQG A;  2IJI A;  4F4L A;  1QCE A;  4NVP A;  1YJW V;  1GN3 A;  3ABU A;  1NKD A;  4LF6 O;  5EC2 C;  1AB3 A;  5CMU A;  2YXY A;  3OEE G;  1VQL V;  2OIE A;  2ITC C;  4NTY A;  3CRQ A;  1AJP A;  4FIP C;  4KHP O;  4JAA A;  3JAR A;  3OW2 U;  1GRJ A;  1OHH G;  3D36 C;  1M56 B;  3ABM B;  4LF7 B;  1G6U A;  1Q86 W;  3O9O A;  1KBH A;  4H33 A;  3I55 V;  3AK2 A;  3OE7 G;  4LR3 A;  3E2E A;  3ZRX A;  4JF3 A;  3KKY A;  5LGN A;  2QR4 A;  4YY3 O;  4GKK B;  2LFR A;  4DV4 B;  4PA7 A;  4G28 B;  4YJ3 A;  3STL C;  4NXM O;  4X1Y A;  4ABM A;  5IT9 N;  4ASU G;  3EVK A;  4X9Q A;  1SZT A;  4I4T A;  1IVS A;  2QM4 A;  3SGI A;  1E1R G;  3CP1 A;  4GYC B;  1AP5 A;  2EJR A;  1PNL A;  3LDD A;  4LFB B;  1XUQ A;  4I9Q A;  1NR1 A;  1SA0 B;  2C2A A;  5H2F Z;  4MVS A;  3ABK B;  4X64 B;  2FYU H;  3SYA A;  2GTA A;  4E2L A;  3H1H H;  1O9H A;  1XHX A;  1YJ9 V;  2WAM A;  2N74 A;  3I5D A;  5IJ0 A;  2YUA A;  1Y66 A;  2VS0 A;  1HNW B;  5A9G A;  1DF5 A;  3EFF K;  4DW0 A;  4DV2 O;  1GM8 A;  1RM1 C;  4JZG A;  1Y74 B;  3W7U A;  1J95 A;  3AG4 B;  1XL4 A;  4CZZ A;  3I56 V;  1VQ4 V;  4F6E A;  3HKB A;  1PP9 H;  2WLI A;  1AI7 A;  3RT3 C;  4GKK O;  3UM7 A;  5EBL C;  4BIU A;  1J5E O;  4DR7 B;  4KHP B;  3B40 A;  4I55 A;  4MVU A;  2XAJ A;  1Y67 A;  4GX2 A;  3JAL A;  4GCZ A;  4LF7 O;  3E22 A;  1HNX B;  1FXK A;  4JZ2 A;  4N21 A;  4AQY B;  4JI3 O;  3MAQ A;  3QTC A;  2PI5 A;  3ABL B;  1H38 A;  1FXH A;  4JI4 O;  1EN5 A;  3L74 H;  4GZR B;  1VF6 A;  1IZ3 A;  2WWW A;  5CBF A;  5GTI Z;  4CH5 A;  1R3K C;  1QLN A;  1F23 A;  4DV7 O;  1GKF A;  3JAR B;  5LA6 B;  1I94 O;  2R9R B;  5BXZ A;  5KX5 B;  5C93 A;  2VQF B;  3FD9 A;  1MMM A;  1MNG A;  1BQZ A;  2L6L A;  2F1M A;  2YXH A;  5LP6 C;  2QKA A;  4QJF B;  3W7X A;  2B9Z A;  2N05 A;  3DC5 A;  1T5E A;  5H6Q A;  4WCE V;  4X62 O;  1ENV A;  3RWR D;  2UUB O;  3J80 N;  3E83 A;  3UCS C;  3AG1 B;  4I50 B;  2DJV A;  4JAS A;  5IYB O;  4I50 A;  3ZJZ A;  5B1B C;  1QHT A;  1H2L A;  1THZ A;  2E5L O;  2QJ1 A;  2BTQ A;  2V7Q G;  5JCO A;  1IBK B;  4X65 B;  4QGP A;  1MAB G;  3M8A A;  1N32 B;  5IYC O;  2FL4 A;  2M7W A;  2JEX A;  4MW3 A;  2Z3Y A;  3AEI A;  4DR5 B;  1R1B A;  5CB4 A;  4DR1 O;  3ETE A;  5H9C A;  2ODM A;  1W2B U;  3OTO B;  4JI4 B;  3FAV B;  4CH4 A;  4CH3 A;  1SC5 B;  1RFY A;  4ZKI A;  1ORQ C;  1M90 W;  2ZKO A;  1RSO B;  4NYK A;  2JDI G;  3JD3 A;  3ASN C;  2P90 A;  4JTA B;  4WFE A;  3CCQ V;  2DWD C;  5B3S C;  3ZMZ A;  1N0J A;  5FPR A;  4CS2 A;  2DE0 X;  4WBN B;  3E8F A;  4DR2 O;  1K7D A;  1VQM V;  1XNR O;  1I7F A;  4X89 A;  1NU1 H;  2XAQ A;  2KSD A;  3VOU A;  4FZ0 A;  2OCC B;  3IFX A;  1RP3 B;  2R9I A;  1JR9 A;  2WA4 A;  3CPW U;  4D7S A;  1SQF A;  3ZN1 A;  4DR1 B;  4DV1 O;  3ZHS A;  1A32 A;  4WFF A;  3ZMS A;  3W7T A;  4JAV A;  1H2M A;  3N2K A;  1AVM A;  1W59 A;  1OCO B;  4DV0 O;  1SQQ H;  1BS3 A;  3RYC B;  5EC1 C;  1N33 O;  3AK3 A;  3G71 V;  2EIN C;  3OEH G;  4TQF A;  3AG3 C;  1MZF A;  4UXN A;  5FL7 G;  5C8Y A;  1M93 A;  2RJZ A;  5J2T B;  1M4U A;  3OGI B;  3CXC U;  4JYY A;  1K8A W;  2FKX A;  1BMF G;  4O2A A;  2JJ2 G;  1ZAU A;  3H1I H;  3UT5 A;  1HR0 B;  2F23 A;  2UXD O;  4DR2 B;  1R3L C;  1IX9 A;  1I5X A;  1HNZ O;  2OCH A;  3ASO C;  1CXZ B;  2IU0 A;  4HNA B;  4PJ0 Z;  1R6K A;  2XTA A;  2AHY A;  2BSK B;  3LUT B;  4JAU A;  2LGW A;  2Y4T A;  3OMA B;  1L8D A;  1PL0 A;  1AR4 A;  1VP7 A;  2F93 B;  2XUM A;  4TSF G;  3AK1 A;  2Q7H A;  2P4K A;  1SES A;  1Z5V A;  3JSN A;  1NQT A;  1QLE C;  5K1P A;  4TUY A;  4P9O A;  5IJ0 B;  2ZQM A;  3CCU V;  3TGU H;  4RWU A;  2XT9 A;  3CD6 V;  2QWQ B;  1JX9 A;  1XI1 A;  4MS2 A;  5DEC A;  2WA3 A;  2P5O A;  4JI2 B;  1LUV A;  3JYC A;  3C3T A;  1D5A A;  2ZXW C;  1AJN A;  4AIL C;  2ZIO A;  2LFS A;  3E8B A;  2EJ7 A;  3ZHQ A;  4FLX A;  2QWN B;  3ASO B;  5EYP A;  5KLV H;  3ZRW A;  1PNM A;  1ZX3 A;  3H1K H;  2EIL B;  4UB6 Z;  5EYP B;  2YC0 A;  2W0X A;  4JI8 O;  5KUM A;  2G38 A;  2HFE C;  1ZSP A;  3SYO A;  5L3E A;  5CA0 A;  3JAT A;  1N36 B;  4FLZ A;  3SYP A;  2F4V B;  2X6C A;  4XBF A;  4LNU B;  1H2S B;  4LFA B;  4LF9 O;  1EFR G;  2WLJ A;  5BR8 B;  3CJH B;  2Q9L A;  1P7B A;  2UUA B;  4MVR A;  3K5O A;  2Q73 A;  5IJ9 B;  1YVW A;  2XOK G;  3FYI B;  2DOS A;  4LC1 A;  1S72 V;  3K9A A;  3GB7 C;  2LW1 A;  1ZTE A;  2QE7 G;  1TUB A;  1YF2 A;  1K92 A;  4TUY B;  2AW9 A;  2ATK C;  3HKD B;  1FXV A;  1WNS A;  1JOY A;  1HP8 A;  5B66 Z;  3HKD A;  5CA1 B;  2CTW A;  4LH6 A;  2A0L A;  2WLL B;  2QWP B;  2IH3 C;  3JD4 A;  4FK5 C;  4BIO A;  4KXR A;  5CA1 A;  4UCT A;  1AP6 A;  3DXR B;  4QPK A;  4JI0 B;  3K5L A;  3CC2 V;  1W0K G;  4EKW A;  2LJ2 A;  1TUB B;  4FPP A;  3A0H Z;  5JQG A;  1BGY H;  4JYC A;  3GVM A;  4G27 B;  1M1K W;  2EUL A;  3K0D A;  4DV6 O;  3E35 A;  5B1B B;  1GN4 A;  3D3Q A;  5FPO A;  3OT7 A;  3FB6 C;  4H13 B;  1BL8 A;  2P4V A;  4B3T B;  3OM3 B;  3P3P A;  3ZMT A;  1JCH A;  3CRR A;  2GBO A;  3AG2 B;  1OCZ B;  2QTO A;  4LFB O;  5CA3 A;  4WFH A;  4TV9 B;  3OMN B;  4Z1V A;  2RQ6 A;  1SRY A;  4PDR A;  2ZM6 O;  4U3F H;  2Q6A A;  4MTF A;  2YI8 A;  3E89 A;  2WLN A;  3CC7 V;  1WLE A;  1PV0 A;  2CGO A;  5KA5 A;  1E1Q G;  1XIL A;  4R50 A;  3K5M A;  3K79 A;  4NTW A;  4FFK A;  1K97 A;  2GUZ A;  3ABM C;  4OPA A;  2QEX V;  3U10 A;  4DV5 B;  4K0K B;  1VQ7 V;  3UO3 A;  3CX5 F;  4NKG B;  2AHZ A;  5CN0 A;  1RPO A;  2RMK B;  1SQX H;  2A79 B;  5IYZ A;  1UJW B;  1R6T A;  2XHB A;  3HB3 B;  1VF7 A;  1OCZ C;  5KHG A;  1Q5O A;  2GUZ B;  1XHZ A;  3P32 A;  2A7W A;  2ZD9 A;  3L9D A;  1YHQ V;  4I7Z B;  2YID A;  4ZHQ A;  2KB1 A;  3BFR A;  1KD1 W;  4X1I A;  4DUZ B;  1VQO V;  1I94 B;  1KUQ A;  3ICX A;  2EBO A;  3RW0 A;  4UV9 A;  2ARH A;  3RYF A;  3LDC A;  4X20 B;  2K1E A;  1US6 A;  1ZUQ A;  1I0H A;  4C7U A;  4E4E A;  3THO A;  1MA1 A;  1ZLZ A;  1YSC A;  1EN4 A;  2LQT A;  1XMQ O;  2ZE8 A;  2ILM A;  3CHX A;  3BPZ A;  1G1X B;  1RM1 B;  4IT5 A;  4PDM A;  2F95 B;  2KKW A;  2QDO A;  2XND G;  3L75 H;  2VQF O;  1XNQ O;  2ZIM A;  3K5N A;  3HKB B;  1FFX A;  3IGA C;  5FNV B;  1YTF B;  5KHI A;  3APO A;  1S5J A;  1Y74 A;  4YHH B;  3BEH A;  4LF5 O;  3L73 H;  3ZN0 A;  1WPX A;  3JD0 A;  4RUF A;  3JCZ A;  4P2Z A;  5AG2 A;  2CTQ A;  3RYF B;  1NVP B;  5TIS Z;  1KP2 A;  1N34 O;  4B3S O;  1K4D C;  2PYJ A;  5JJE B;  4O4H A;  5D5P A;  2YDE A;  4XDK A;  1KKD A;  2A3Q A;  3ZBH A;  2D3O W;  1FAF A;  5KMG A;  4PI2 A;  1IBM O;  3B2E E;  1R73 A;  2GTS A;  3FB7 C;  1AI4 A;  1R3I C;  3JAK A;  4IHJ B;  3CCV V;  2EIJ B;  4PI0 A;  3T1H B;  3IAY A;  4OX9 B;  5JVD B;  2Q5Z A;  2NNU A;  3JAK B;  4IHJ A;  1JVM A;  4LCU C;  4DR6 O;  2CE4 A;  1IBL B;  4GX5 A;  4MVQ A;  3QNE A;  1NJI W;  4K35 A;  1XNQ B;  3N2G B;  5J2T A;  3DTU B;  1GH6 A;  5BZB A;  1Y76 B;  1SET A;  3OD4 A;  3OTO O;  3N2G A;  5EZY A;  3CCL V;  2PTM A;  1L0L H;  1DTO A;  4UCO A;  2LGQ A;  5LYJ A;  3RBZ A;  5LOV A;  1DF4 A;  3E8H A;  4DV3 B;  1XMQ B;  5LMU B;  2BOB C;  2PYL A;  1TGO A;  1GN6 A;  3DSQ A;  4X88 A;  3MHS C;  1VMG A;  1BHA A;  2OCC C;  4NXN B;  1YXB A;  1K3E A;  4Z2W A;  3MDS A;  2HJF C;  2ZE7 A;  4J7K A;  2PI4 A;  3PJS K;  4OPH A;  1CEZ A;  1KMI Z;  4J11 A;  2IJH A;  3BCC H;  3SPI A;  5LHI A;  3KCX A;  1EN6 A;  2MW2 B;  2JK5 C;  3QVN A;  1VQN V;  4LH7 A;  2Y4U A;  2YIA A;  4LBE C;  1WB7 A;  3JD2 A;  1XQ8 A;  3U11 A;  2OYQ A;  3SR2 C;  1K73 W;  4AQY O;  4ZI7 B;  3SPH A;  3N27 A;  4RQF A;  2JIZ G;  3GWK C;  4I0X B;  4JV5 O;  1QLE B;  4GKJ O;  3VQY A;  3ABL C;  2IBZ H;  1RSO A;  1TVK B;  3FB5 C;  5LP6 B;  1EM1 A;  5KA6 A;  5DN6 G;  4OX9 O;  1NVP D;  3T1H O;  3FYE B;  1K9M W;  3E22 B;  3ML0 A;  4NR1 A;  1QNM A;  4DR6 B;  3VBB A;  4J80 A;  3ZCC A;  4JI1 B;  2CH7 B;  4NXN O;  3BA8 A;  1V55 B;  3S3W A;  1MG1 A;  4XDJ A;  4JI3 B;  3CRA A;  2UUC B;  2EIK B;  3TET A;  4DR3 B;  2PZS A;  4X1Y B;  4PEL A;  1VIB A;  5D5Q A;  2DYS C;  2YS8 A;  2RCV A;  2DYR B;  3A2F A;  1L0N H;  4TOI A;  4GX0 A;  4F6R A;  1QBZ A;  3T4D A;  1GO3 F;  4I5S A;  4QE7 A;  5GTH Z;  4X1K B;  1W0J G;  3H01 A;  4B7K A;  3ZIA G;  3FX7 A;  1PD3 A;  4MW8 A;  1G8M A;  2PUS A;  4KL1 A;  3KCY A;  4B3R B;  1S5H C;  1OJH A;  3A0R A;  4LF6 B;  2MK3 A;  3JAS B;  1OCO C;  4ZIB A;  2P67 A;  4TQD A;  4JI8 B;  2JS3 A;  1D2D A;  1IBK O;  4Q20 A;  1NTM H;  4UCS A;  2Y0P A;  1KYO F;  4L87 A;  2YIB D;  4UB8 Z;  1SS3 A;  1YIJ V;  2DQ0 A;  1R3J C;  2EIM C;  2WLK A;  3G4S V;  1OV9 A;  3KZI Z;  2PY5 A;  4QIW F;  1L1F A;  3OUF A;  1SQP H;  1CPY A;  4JV5 B;  4FJC C;  3RVZ A;  4YY3 B;  1F4N A;  3ZRS A;  1H8H G;  2QM7 A;  1Y4M A;  5FLX N; 
#chains in the Genus database with same CATH homology
 4J7K A;  4J41 A;  4W4K A;  4IYH A;  4J10 A;  2G38 A;  2GTS A;  4J11 A;  4KXR A;  4J42 A;  4J7J A;  4IYI A;  4W4L A;  3FX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...