4J7KA

The crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGQFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 40
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7kA00
2G38A 4J7KA 4J7JA 4J42A 4J41A 4W4KA 4W4LA 4KXRA 4IYIA 4J10A 4IYHA 3FX7A 2GTSA 4J11A
chains in the Genus database with same CATH superfamily
2GV9A 2M6YA 2ZR3A 4K8ZA 2CTRA 2UXDB 2XT9A 4CH6A 4JF3A 4DUYB 2BSKB 4KXRA 3RT3C 4MVMA 3A0HZ 3T1HB 2R9RB 1QBZA 1SQXH 5JWPA 3CCLV 1SERA 2ZM6B 2EIJC 2QWOB 4X9QA 4ZHQA 4A5UB 2Q0AA 1YHQV 2ZCEA 3BAAA 1HNXO 3RYHB 1VQ5V 3T2MA 3UT5A 1NQTA 2YIAA 5KA5A 4PA7A 1FS0G 4LFCB 3H9VA 3H1JH 2E5LB 2Z0AA 3ZMSA 3RVYA 1BZKA 3CHXA 2JVDA 4DR1O 3WB0A 4FFBA 1AVMA 2FB5A 3BPZA 2WLKA 3EHBB 1GN6A 4RWUA 2FYUH 4DV7O 2JEUA 3UM7A 4P9PA 1L8DA 2F23A 3JALA 4QE9A 2OCCB 3SPHA 3GWKC 4EB6A 1N36B 4JI3B 2CTPA 1Y76B 3OW2U 1S72V 3J80N 1RM1C 4J7KA 1PL0A 1Q90D 1HNZO 4JI2B 2ZXWC 1GN2A 1M90W 5EIBD 2WA4A 1TVKA 2KSDA 3JARB 1EN4A 5JCOC 1ZX3A 3HKBA 4B7KA 2VQFO 1QLEC 2FMLA 2H3OA 5FPOA 3ZHQA 5JQGB 2L6LA 1MG1A 2IBZH 2DQ3A 4NXMO 1N32O 2EINB 2H94A 3CC4V 1NI8A 5LMUB 5LHHA 1WB7A 3JCZA 1DF5A 5FPRA 4JTDB 3PJSK 4FLYA 2KG7B 1SQBH 3D36A 1O9GA 4XDJA 2YIBA 1XUQA 1FFTB 5IDJA 5EZYB 5CA3A 2B9ZA 2ZR2A 2WLJA 1Z2GA 1OZ0A 5IWAO 2EJRA 2Q7GA 2EZOA 3TJTA 3K04A 1DF4A 1WAZA 1YZBA 3NXSA 3OAAG 3ASOB 1WNSA 1HNXB 2HHHO 3EVKA 5LP6A 3KKYA 4ZKIA 4BWAA 1VF7A 4YY3O 3HKDB 2ODMA 2JGDA 2P7TC 3K3WA 5IT9N 2AGAA 1BMFG 1VQPV 5CA1B 4W4LA 1VQ9V 3FYEB 3CE2A 4O2BB 5EC1C 2LO1A 3DSQA 1WA8A 1AJNA 3OTOO 3ZRWA 3DXRB 5JH7B 3JAWA 1FYJA 2EX3A 4ZOLB 1ZWIC 1K33A 2DYRB 3SGIA 2GUZA 3CRAA 4DUZB 4XDKA 4FLWA 5J9PC 3I55V 1AP6A 2F93B 3AG4C 3QO7A 4YIOA 2UUBO 2ZIOA 2DE0X 1FXKA 1Q8IA 1A32A 4LNUB 3CC7V 2Q68A 2VQEB 1SQPH 4UV9A 4DV6O 5JJNB 4O4HA 2XAFA 3RW0A 4Z2WA 1QVGU 3TCUA 2VQFB 4RAIA 2PYLA 1KC8W 1H2GA 1N32B 2F95B 3CMEV 3FB6C 3ZRVA 1ZL8B 1I0HA 1BHBA 4JYBA 3ZMVA 4I0XB 3G4SV 3K59A 1VF5B 2P67A 4TQFA 3N27A 2QJ1A 3LUTB 5ITZA 4TQDA 2LP7A 3SYPA 4DW1A 5LMNB 3IGAC 2DYSB 3B09A 2ZQMA 3O65A 2PUSA 2OCCC 5L3GA 1PKXA 1SA0A 3D3IA 1I5YA 4O2AB 2V7QG 1N33O 1GN3A 1FAFA 1YI2V 5CA0A 4E2LA 4IIJA 2OCHA 3OFNG 2HHHB 2NN4A 4I9WA 2UUCO 2HR3A 3OUSA 3PN1A 3UQ8A 1FJGO 1WB8A 2GBOA 3ZHSA 1Q43A 4J42A 1H2LA 4JYCA 3ICXA 4YY3B 4FM0A 2Q8VA 4H0LB 2EINC 1HW7A 3JAKB 3ETEA 1HR0B 4DV0O 3ZJZA 4Q20A 3JD2A 4IYHA 1SZTA 2CH7B 3ZHVA 1MOFA 2YS8A 4MW8A 4DO2A 3W7XA 5H6RA 1NBMG 1PNLA 2KKWA 1Y67A 4MTGA 1YTFB 3HKCB 1S5LZ 2WAMA 5KUMA 4LR3A 3RYHA 1US6A 5FNVA 4LC1A 4BR6A 4N23A 4UCVA 2YI8A 2GSMB 3ZHTA 4FZ0A 1XL4A 1OV9A 3ASOC 3OMAB 4D7TA 4DV6B 4J80A 3F7VC 3FYIB 2HJDA 4B3MO 1BQZA 4MSWC 2N04A 1SQQH 5H9CA 2XAGA 3SPJA 4PA3A 3CPWU 1EN5A 4DV1O 4U3JB 1MMMA 3T4ZA 2VWKA 4GCZA 3CCQV 1AILA 2HVKC 1DLBA 1F4NA 1EZJA 3A0BZ 3OMIB 4FFBB 4WFGA 4UUJC 5A2QN 1W0JG 2ZE8A 1HP8A 4PDMA 2PTMA 4FPPA 4B3SB 4B3TO 4MT8A 3K5NA 5CMUA 4GZRB 3JALB 1Y76A 2DYRC 4P2ZA 1VQKV 4EB6B 3WG7B 1I94B 2A3QA 3CEIA 3JARA 3K57A 3OT7A 4CZZA 1HWYA 4MVUA 5JQGA 1TVKB 4B3RB 1Q6IA 2E76B 4DV4B 1J5EB 2UUCB 2F4VO 2P90A 3HKBB 1WP7A 2UUAO 4DXWA 1NJIW 1FJGB 4MVQA 2KG7A 2ADPA 3E83A 3LDEA 3KG2A 5B5EZ 1KU9A 5KLVH 1XL6A 4DR2O 1IURA 1H2MA 2DQ0A 4YHHO 1JA8A 5EZYA 1WPXA 3OGCC 4JI6B 3K03A 4LF8B 1XNQB 1S5JA 4X1IB 4K3AA 4HYOA 2OWOA 5K1XA 2B1IA 5L3DA 1NR7A 1ZLZA 3E22B 2RN9A 2YIBD 2ZDIC 3H1LH 4JI7O 4UVCA 2DOSA 2DYSC 5KUKA 4FIPC 3CRRA 2X6AA 4H13B 4LH6A 1FFXA 1GM8A 3ZN1A 1JQ0A 1CXZB 4YJ3B 5IYDO 4K35A 1BS3A 1E1RG 4PI0A 2DMXA 4JI1O 1AP5A 4EFBA 5CBGA 3F5TA 2Q7HA 5CA1A 5CN0A 2IM9A 4J10A 1FPOA 4O2BA 5J2UB 1D5AA 3GB7C 4U7OA 2NR5A 1NH2D 3LDDA 4JI5B 3CMAV 4NTWA 3DXRA 1RPOA 4IL6Z 1M9NA 4ZOLA 3N2KB 3L75H 1IBKB 4I4TB 3J7AU 3ZRWB 5D5PA 4NVPA 3JAWB 3ZMTA 1LNQA 1B04A 2JS5A 1Z5WA 4MTXA 3UKMA 2GUZB 4J7ZA 4AQYB 4PELA 3H1HH 1R1BA 1IBMB 4IGGA 5IJ9B 5CB4B 2F66C 5DM6V 1AI7A 4I55B 5KHHA 1FXKB 5EYPA 1Y6XA 2YIDA 4HAMA 3BEHA 1SS3A 4KFMA 1F51A 4UCTA 1PPJH 3STZC 2UUAB 4DR7O 2PZSA 3I56V 3K9SA 4MS2A 3DC6A 4I0XA 2ILMA 1DTOA 2YXLA 1OCOB 4WBNA 3L74H 4DV3O 2M7WA 5IJ0A 5ITZB 3BA8A 3OMNB 2X6BA 4F6RB 5H2FZ 4DV2O 4FFKA 1KD1W 4O2AA 4JI7B 3RYIB 4FJCC 5JJEB 2HFEC 1V9PA 1SA0B 4YJ2B 5BR8B 3QF7A 3E8GA 4R6ZA 3WG7C 1S77D 4MVSA 4EFEA 5CA0B 4LF7O 3B77A 4IIJB 3SYOA 3CRQA 1T5EA 3JAKA 4DR4B 3RYCB 4PDVA 5BY1A 4RO2A 1M4UA 5B3SC 1VQ8V 4R50A 2CH7A 4X62O 2DWDC 4X64O 3B4SA 5FL7G 3FB8C 2Q7EA 3D36C 3CS5A 3AK2A 1L0NH 5LL6Y 4K0KO 3HKCA 3ZN0A 2UU9O 2H8PC 1K5QA 1W0KG 1TGOA 5EBMC 1VQLV 1OCRC 1EFRG 4I5SA 2RJZA 4PI2A 2PF4E 5FNVB 1YJWV 4X20A 4LF4B 4MTOA 3RFRA 1IVSA 2LW7A 5CBFA 3FB5C 4DR6B 4PV1B 4LFAB 1VQMV 1FXHA 1NVPB 5LP6C 2QTOA 3OUFA 3M8AA 3VOUA 2UXCO 5IYZA 4U3JA 3B8NA 4P9OA 1H2KA 3ASNB 5B66Z 4OGQB 4DR7B 4GT1A 2HLDG 3K06A 1EM1A 2XNDG 3ETGA 4PDLA 2ZE6A 3RVZA 2VS0A 1S0VA 2HP8A 4ZI7B 1YJNV 1XHXA 1ZUQA 1S3JA 2EIMB 4DV3B 2PGGA 1VMGA 5LYJB 1CEZA 2Z3YA 3MHHC 4U7NA 3T1YO 4ZIBA 2MW2B 3UCSC 5KHKA 4DV2B 1Q6UA 3JSLA 3LNMB 2FKXA 1FKAO 4OPAA 1XNRO 1JPXA 3BA9A 3CXHF 1HNWB 1K9MW 1HDJA 4H37A 1SESA 2WPDG 4N21A 3ZX6A 4X1YA 5L3BA 1GH6A 1AI5A 1FXKC 3ETDA 1NTKH 2PY5A 4DR5O 1R3IC 3F7YC 3ABKB 1AI4A 1UFIA 1PL4A 3SYCA 2P6JA 1Q6HA 3MD0A 4GUNA 4X1IA 4KP4A 3LSSA 1GN4A 3ABMB 1D5NA 1RSOB 1OCOC 3H01A 3SPGA 1VQ7V 3E22A 2IW5A 4C7UA 2ITCC 4GKJO 4H44B 3OE7G 1YJ9V 4WFBV 4O4LB 2WWWA 2UU9B 2YICA 4UVBA 1B06A 1KYOF 3ZRXA 4JASA 5AG2A 1VF6C 1EN6A 3K0GA 2AHYA 1K73W 3OM3B 4L87A 4YJ3A 4CS4A 1BCCH 1Q81W 1FFXB 2WLMA 3G67A 2UXBO 4OPHA 4JYAO 4LWSB 3NR7A 1VQNV 5E1AC 3MAQA 2EILB 5KHGA 4EKWA 1KECA 5J2UA 1IDSA 4RQFA 1Y74B 1VARA 3IC7A 1K4DC 1KP3A 3WU2Z 4DR1B 4UCOA 3FFQA 2ITDC 2OTJV 1MZEA 4UV8A 3N2KA 3CRCA 1JCHA 3IC9A 4Q6GA 3Q4HA 4I4TA 1RFYA 4XBFA 1XMOO 3AG3B 1PM9A 4DV7B 4LF6O 5D5QA 2RMKB 3DGEA 3T1YB 4UVAA 5IJ9A 5LBQA 2XTAA 5CB4A 2WLIB 5BMVB 3SR2C 4I55A 4TV8A 1HNZB 5A9GA 5EBLC 2W6JG 2O57A 2CDYA 1CPYA 5EYPB 2YEVB 5BZBA 1Q7YW 3E8HA 3BVOA 4NXMB 1MSDA 2AZ0A 5C8YA 4J41A 4FLXA 3OEEG 3RYFA 4G2KA 4TV9A 3OGIB 3CCMV 4DV5O 3JD0A 3ASNC 2XAHA 5LA6A 1NZ6A 4QE7A 2QWPB 4QGPA 4JPRA 4WBNB 4F6RA 1Y66A 4TWKA 3CXCU 1VF6A 5IJ0B 3M7MX 1DK1A 4GKJB 5L3FA 3RYIA 5L3EA 2F1MA 2C2AA 4YJ2A 5IWAB 1QLNA 3LSUA 4JAUA 4JAVA 4BW5A 1P7GA 1WPBA 4NR1A 2QM8A 2B5UA 3W7WA 3SDLA 2R72A 3L73H 4NXNO 1N0NA 5EK0A 3QVNA 4P30A 3RYCA 1R6NA 1M1KW 3P30A 4FLTA 1JOYA 2P22C 1N34O 1XHZA 1K97A 2XUMA 4QPKA 4LF5O 4K8XA 1SC5B 1BGYH 4D6TH 1YXBA 3HB3B 3OTOB 1XMOB 2EBOA 1M5IA 3JATB 4KUMA 2A0LA 3QNEA 2HVJC 4JTCB 2UXXA 2QKSA 2IU0A 2HG5C 1LUWA 5JVDA 1M56B 1YTFD 4FLVA 4UCUA 3T4DA 2CTWA 2P4VA 2P5OA 2UUBB 2ZINA 1K8AW 3OR6C 4X20B 1AR1B 5C93A 2LJ2A 1FD9A 1U97A 4UB6Z 3TK1A 1TUBB 3LSQA 2BE3A 1NT2B 3ZRSA 5IYZB 3C3TA 1P49A 4X66O 2UXNA 1Q3EA 1QR8A 1E79G 2EILC 3RWRD 3U11A 3BFRA 4ZI7A 3JD4A 3LDCA 3BY6A 4WFAV 4AILC 4DV5B 5LYJA 3AG7A 3TXQA 4UB8Z 4O4IA 4WFEA 3AG3C 3RGBA 2AHZA 4GX0A 5BXZA 2WLNA 1ORQC 5H5NA 2R70A 4TT3G 5B1BB 3F5WC 4LF9O 3WB1A 1N33B 4J11A 4X1YB 1N8RW 2RCVA 3STLC 1GO3F 3VQVA 2XOKG 1P4RA 4Z1VA 4YIPA 4NXNB 4DR3O 3K0DA 2E75B 2GTAA 3TETA 4FLUA 2PYJA 2A9HA 3T1CA 3BHPA 2WLLB 1RSOA 4DV0B 3CCUV 5F2VO 2Y69B 2BCCH 3JASA 2MK3A 4O4LA 4QIWF 4IHJB 1XOUA 4CH3A 3C3SA 3OTFA 3JCUZ 1P84F 3JAMN 5HFMA 2ZD9A 3CWBH 2AXTZ 2OYQA 4DYLA 4CS2A 5KAFZ 1FXVA 1QR9A 4PA4A 5B1AB 2Q73A 3JD1A 4LWSA 1PD3A 2R9AA 1GMGA 1YEWA 4B3MB 2V4DA 4CC5A 1Y74A 3MHSC 1KP2A 2QTSA 4X89A 4NYKA 3ABTA 4DV1B 4CBCA 2IH3C 2ADQB 2LFSA 3WFVA 1K5SA 2EULA 3K5LA 3Q4HB 1NS1A 4JI0O 2EIKB 1IXMA 3CCEV 4B3TB 2WLIA 5BMVA 4DUYO 4ZBMA 4BAYA 2RNBA 1O9HA 3LNNA 2B1GA 3T1HO 1S76D 4AHCA 2OIEA 4TV8B 1GAXA 2ZM6O 1SQFA 2YEVA 4J9YB 4R8CA 2HJFC 4NTYA 2ZXWB 3G80A 3ZHRA 4YXWG 1BE3H 3C90A 4JV5O 2F4VB 3QO5A 2OT5A 4PA6A 3FKSG 2QKCA 2DJVA 3AK1A 2E74B 3J81N 4LFCO 4FVMA 5C8YB 1QLEB 2E3CA 3RYFB 3A8TA 2E5LO 4TV9B 1AR5A 4DR2B 5IYBO 3L70H 4YHHB 4F6EA 5LA6B 1V55B 1TA8A 2ATKC 4BIUA 4LH7A 4MVOA 5KMGB 1AR4A 3W7UA 4PDRA 2CAZC 1IXBA 4LFBO 3DTUB 2Z5UA 3CJHB 5B1BC 1N0JA 2Q67A 4JI3O 3X2QB 5EBWC 1X4TA 4JI2O 4I50B 4JI1B 2Y0PA 3TXSA 2JRIA 2LQTA 2JEXA 1VQ4V 5K1PA 4Z1MG 4PA9A 1SQVH 4WFHA 2IJIA 4DRXA 2QWNB 1GKFA 3HPLC 3JATA 1LUVA 5LOVB 4MTFA 2Y69C 1L1FA 2BTQB 2LGQA 5GTIZ 4CH5A 1SQGA 1R6TA 1D2DA 5JVDB 1K34A 1XREA 4HNAB 1AJPA 4JYYA 4HZ3A 2Q69A 1M57B 1YIJV 5B1OA 1GM9A 5J2TA 2EZPA 1TUBA 3AG4B 5IY5B 1K7DA 5LXTB 1UJWB 1PP9H 5B1AC 1DGSA 1X59A 4JV5B 4ICGA 1OJHA 3KZIZ 1NVPD 1H8HG 4WCEV 1GRJA 4HBNA 4GX2A 3GVMA 4TSFG 1IBLO 4GX5A 3R66A 4I7ZB 4WFFA 3ZCCA 1QQCA 3HKEA 2YXHA 3M99B 3VQXA 1NKDA 1E1QG 3QO8A 2X6CA 3EFFK 4FLZA 3ML0A 1H8EG 4O4IB 2N05A 2QWRB 1K92A 4J7JA 3U10A 2EIKC 4X65O 1JMKC 4OX9O 3CX5F 3THOA 1YDXA 4LFBB 4CC6A 4QNHB 2ZNJA 2D3OW 4E4EA 2WA3A 5DECA 4DUZO 5DEDA 2CTQA 3RBZA 2A7WA 4LF7B 1KB9F 4OXSA 1EZVH 1URFA 4FM2A 3IFXA 3K08A 3A0RA 3L72H 3CCSV 2VQEO 2QDOA 3I5DA 2WLLA 2IH1C 2CGOA 3OEHG 4G27B 5HFLA 5KA6A 5IYCO 1V54B 3JD3A 4UXNA 4X62B 2W0XA 4X64B 4F4LA 2AW9A 3E2EA 3ZMUA 1Q86W 3RN4A 3FAVB 4LP8A 4U3FH 2LGWA 1V55C 2D2CB 4IHJA 3JASB 4X1KB 2ZNIA 4K0KB 2ARHA 2DN9A 2WLHA 1VQ6V 1AROP 5FLXN 1F23A 1ZAUA 1SKVA 1QHTA 1MSWD 3CP1A 5LMNO 4FM1A 4X8AA 2CK3G 3L9DA 1CP9A 4MW3A 3FX7A 3K9AA 3K79A 2QR4A 3ZMZA 4X88A 3X2QC 2CGNA 4L8JA 2AZ2A 2UXCB 1Q82W 1KMIZ 1MA1A 3K5OA 2ETNA 4JAAA 1XBLA 1QU7A 1UPGA 3G6EV 2L35A 3B2EE 2XHBA 2X0LA 3K58A 2VRZA 1THZA 1IBLB 4RUEA 3QTCA 3BRCA 4JZ2A 5GW7A 1WJZA 1HR0O 3P3PA 3UO2A 1OCCB 1KBHA 1ENVA 4O4JB 2G38A 5LGTA 3D8CA 4UCSA 2QA4V 2IJJA 2QGNA 3CCJV 5H6QA 2XAQA 4X65B 3G71V 2IJKA 4OX9B 4JI8O 3OD4A 1XNRB 1IX9A 3AG2B 2PI4A 3N2GB 2LFRA 1M93A 1M57C 5L3CA 1B3QA 4GX1A 2Q4PA 5JCOA 4DR5B 5IY5C 1VP7A 2W0FC 4I9QA 1XEQA 1PNMA 2JJ2G 2JK5C 2RDCA 3APOA 1JX9A 3P32A 2K1EA 1PNKA 1U96A 5B1NA 5CBHA 4UCRA 5KX5A 2QSAA 2Q0OC 2A06H 1H2SB 2ZKOA 1EBOA 2W6IG 3ETQA 5KMGA 3ZHUA 1K3EA 2JGUA 1VEWA 1WP8A 3E86A 3SJAC 4IYIA 1H38A 1JFFB 2EIMC 1R3LC 1NTMH 4BW9A 1XMQO 4KL1A 1JR9A 1WLEA 2V1DA 5GONA 2BTOA 2P4KA 5EC2C 3CJHA 4B3SO 2YI9A 2F43G 1I08A 3B8MA 4JI4O 1JJOA 2A79B 1PV0A 4DK0A 4I50A 2UXBB 1I94O 3A2FA 1RPRA 3SJQC 4TUYB 4JYAB 1AB3A 4JZGA 1Z5VA 2Y4UA 1W2BU 1MNGA 3R65A 5EIBC 2BOBC 4R7CA 1YSCA 3SJCC 3SYQA 2N74A 1MABG 3ABKC 4B3RO 4IT5A 4DV4O 1J5EO 1XILA 1ZTEA 3H1IH 5LOVA 4D7SA 1YITV 4DRXB 1NU1H 2BTQA 3ABMC 1V54C 2XASA 1GK9A 3IAYA 1G6UA 3JSNA 4LF6B 3CC2V 2EJ7A 2BSKA 3ABLB 1SF9A 4JI6O 3VQYA 1G8MA 4LF8O 4HNAA 1XNQO 2KQXA 5IE9A 2YUAA 4FZ1A 4NKGB 2NLJC 2JS3A 4AI8A 1QCEA 4JI8B 5LXTA 5E79Z 3CCVV 5J2TB 2PI5A 1L0LH 5KAIZ 3S3XA 4ZHQB 3E8FA 4NTXA 1TUEB 3MDSA 4PJ0Z 3UT5B 4QPJA 3WB2A 4GLXA 1OCZB 2BOCC 4PD4F 2Y0IA 4LCUC 1KUQA 1IZ3A 4DW0A 3CB2A 3E35A 3HKEB 2R9IA 4FK5C 2WSSG 1QNMA 4GKKO 2ZE5A 1ZSPA 4JI5O 3G6BA 1SETA 1J95A 2Q6AA 1AJQA 1OCCC 3P3NA 1IBKO 4PHZA 1XMQB 4B08A 3CSXA 5DN6G 2YC0A 3W7SA 4KHPO 2FL4A 4JI4B 4XDLA 1GM7A 3E89A 4AQYO 3OR7C 3AG2C 4UFZA 5GTHZ 1R73A 1IBMO 1VIBA 1NR1A 1N4CA 2Y4TA 2CE4A 3AG1B 1I5XA 5LHGA 4B7EA 3IJ4A 3ABUA 2Y48A 1SZXA 2JDIG 3GWOA 3VQWA 1YCIA 2XAJA 1N34B 1S5HC 4LF5B 3FAVA 1BQ0A 5LHIA 2JIZG 2DW4A 5KHJA 4EEQA 4X1KA 2VWJA 3K5MA 5B3SB 1R3JC 4RQEA 2QE7G 4JTAB 3BABA 5LGNA 3S3WA 4RUFA 3UO3A 1LR1A 3U0ZA 1K4CC 4J9ZB 2GDSA 4H33A 2OIGA 3H1KH 2QM7A 3CRMA 1VQOV 3HR0A 3KCXA 3KCYA 2EIJB 4CS3A 3SJBC 1H2NA 1G4YB 1WN7A 1YVWA 1OCRB 2Q5ZA 2LW1A 1W59A 5JJJB 3DC5A 3CD6V 1BT8A 5KHIA 1Y4MA 5BR8O 1COWG 2YDEA 4NB5A 2RQ6A 1YF2A 2NNUA 3APQA 2ZT9B 1GTOA 5LP6B 4X66B 1XDCA 2CUGA 3SYAA 3E8BA 2HEPA 3HKDA 1JVMA 1AI6A 3VBBA 4DR4O 3FB7C 2Q9LA 2YXYA 3CYOA 2QKAA 1NH2B 2UXDO 1BHAA 2JGDB 4BIZA 4O4JA 3AK3A 2JJ1G 3BCCH 2YSUB 4GKKB 2GHYA 4DK1A 2GTSA 3ABLC 5JH7A 3N2GA 1OHHG 1M56C 4QJFB 4W4KA 1WA8B 4LF9B 4WF9V 4KHPB 1RM1B 2OTLV 4MVZA 1P7BA 3SPIA 3ZS8C 3W7TA 4LF4O 1F7YA 4LNUA 4BIOA 4DR3B 4DR6O 2K9PA 1BL8A 3FD9A 4LFAO 3O9OA 1KKCA 2P06A 2QM4A 2X7RB 1OCZC 4O4HB 3SPCA 4JGSA 4GYCB 5KX5B 2ZE7A 1R6KA 1TAEA 4LBEC 1KQSU 1JFFA 1ZL8A 2KB1A 3L71H 4ABMA 4CH4A 3ZBHA 2HKOA 5LGUA 5GONB 2ZDIA 5TISZ 4ASUG 1MZFA 3JYCA 1F4MA 3ZEDA 1N36O 1QVFU 1JJ2U 4TUYA 3CCRV 1KKDA 2QEXV 1ROPA 3D3QA 1Q5OA 3EXAA 3ZIAG 1HNWO 1G1XB 1NTZH 4TOIA 3AEIA 2FTKA 1I7FA 1SRYA 2DWEC 2QWQB 2IJHA 4MVRA 3AG1C 4FMTA 3TGUH 1R3KC 3QG5A 5LMUO 1RP3B 1BSMA 4G28B 3B40A 2ZIMA 1XQ8A 2IU3A 1XI1A 1B6QA 4JI0B
chains in the Genus database with same CATH topology
2G38A 4J7KA 4J7JA 4J42A 4J41A 4W4KA 4W4LA 4KXRA 4IYIA 4J10A 4IYHA 3FX7A 2GTSA 4J11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G38 A;  4J7K A;  4J7J A;  4J42 A;  4J41 A;  4W4K A;  4W4L A;  4KXR A;  4IYI A;  4J10 A;  4IYH A;  3FX7 A;  2GTS A;  4J11 A; 
#chains in the Genus database with same CATH topology
 2GV9 A;  2M6Y A;  2ZR3 A;  4K8Z A;  2CTR A;  2UXD B;  2XT9 A;  4CH6 A;  4JF3 A;  4DUY B;  2BSK B;  4KXR A;  3RT3 C;  4MVM A;  3A0H Z;  3T1H B;  2R9R B;  1QBZ A;  1SQX H;  5JWP A;  3CCL V;  1SER A;  2ZM6 B;  2EIJ C;  2QWO B;  4X9Q A;  4ZHQ A;  4A5U B;  2Q0A A;  1YHQ V;  2ZCE A;  3BAA A;  1HNX O;  3RYH B;  1VQ5 V;  3T2M A;  3UT5 A;  1NQT A;  2YIA A;  5KA5 A;  4PA7 A;  1FS0 G;  4LFC B;  3H9V A;  3H1J H;  2E5L B;  2Z0A A;  3ZMS A;  3RVY A;  1BZK A;  3CHX A;  2JVD A;  4DR1 O;  3WB0 A;  4FFB A;  1AVM A;  2FB5 A;  3BPZ A;  2WLK A;  3EHB B;  1GN6 A;  4RWU A;  2FYU H;  4DV7 O;  2JEU A;  3UM7 A;  4P9P A;  1L8D A;  2F23 A;  3JAL A;  4QE9 A;  2OCC B;  3SPH A;  3GWK C;  4EB6 A;  1N36 B;  4JI3 B;  2CTP A;  1Y76 B;  3OW2 U;  1S72 V;  3J80 N;  1RM1 C;  4J7K A;  1PL0 A;  1Q90 D;  1HNZ O;  4JI2 B;  2ZXW C;  1GN2 A;  1M90 W;  5EIB D;  2WA4 A;  1TVK A;  2KSD A;  3JAR B;  1EN4 A;  5JCO C;  1ZX3 A;  3HKB A;  4B7K A;  2VQF O;  1QLE C;  2FML A;  2H3O A;  5FPO A;  3ZHQ A;  5JQG B;  2L6L A;  1MG1 A;  2IBZ H;  2DQ3 A;  4NXM O;  1N32 O;  2EIN B;  2H94 A;  3CC4 V;  1NI8 A;  5LMU B;  5LHH A;  1WB7 A;  3JCZ A;  1DF5 A;  5FPR A;  4JTD B;  3PJS K;  4FLY A;  2KG7 B;  1SQB H;  3D36 A;  1O9G A;  4XDJ A;  2YIB A;  1XUQ A;  1FFT B;  5IDJ A;  5EZY B;  5CA3 A;  2B9Z A;  2ZR2 A;  2WLJ A;  1Z2G A;  1OZ0 A;  5IWA O;  2EJR A;  2Q7G A;  2EZO A;  3TJT A;  3K04 A;  1DF4 A;  1WAZ A;  1YZB A;  3NXS A;  3OAA G;  3ASO B;  1WNS A;  1HNX B;  2HHH O;  3EVK A;  5LP6 A;  3KKY A;  4ZKI A;  4BWA A;  1VF7 A;  4YY3 O;  3HKD B;  2ODM A;  2JGD A;  2P7T C;  3K3W A;  5IT9 N;  2AGA A;  1BMF G;  1VQP V;  5CA1 B;  4W4L A;  1VQ9 V;  3FYE B;  3CE2 A;  4O2B B;  5EC1 C;  2LO1 A;  3DSQ A;  1WA8 A;  1AJN A;  3OTO O;  3ZRW A;  3DXR B;  5JH7 B;  3JAW A;  1FYJ A;  2EX3 A;  4ZOL B;  1ZWI C;  1K33 A;  2DYR B;  3SGI A;  2GUZ A;  3CRA A;  4DUZ B;  4XDK A;  4FLW A;  5J9P C;  3I55 V;  1AP6 A;  2F93 B;  3AG4 C;  3QO7 A;  4YIO A;  2UUB O;  2ZIO A;  2DE0 X;  1FXK A;  1Q8I A;  1A32 A;  4LNU B;  3CC7 V;  2Q68 A;  2VQE B;  1SQP H;  4UV9 A;  4DV6 O;  5JJN B;  4O4H A;  2XAF A;  3RW0 A;  4Z2W A;  1QVG U;  3TCU A;  2VQF B;  4RAI A;  2PYL A;  1KC8 W;  1H2G A;  1N32 B;  2F95 B;  3CME V;  3FB6 C;  3ZRV A;  1ZL8 B;  1I0H A;  1BHB A;  4JYB A;  3ZMV A;  4I0X B;  3G4S V;  3K59 A;  1VF5 B;  2P67 A;  4TQF A;  3N27 A;  2QJ1 A;  3LUT B;  5ITZ A;  4TQD A;  2LP7 A;  3SYP A;  4DW1 A;  5LMN B;  3IGA C;  2DYS B;  3B09 A;  2ZQM A;  3O65 A;  2PUS A;  2OCC C;  5L3G A;  1PKX A;  1SA0 A;  3D3I A;  1I5Y A;  4O2A B;  2V7Q G;  1N33 O;  1GN3 A;  1FAF A;  1YI2 V;  5CA0 A;  4E2L A;  4IIJ A;  2OCH A;  3OFN G;  2HHH B;  2NN4 A;  4I9W A;  2UUC O;  2HR3 A;  3OUS A;  3PN1 A;  3UQ8 A;  1FJG O;  1WB8 A;  2GBO A;  3ZHS A;  1Q43 A;  4J42 A;  1H2L A;  4JYC A;  3ICX A;  4YY3 B;  4FM0 A;  2Q8V A;  4H0L B;  2EIN C;  1HW7 A;  3JAK B;  3ETE A;  1HR0 B;  4DV0 O;  3ZJZ A;  4Q20 A;  3JD2 A;  4IYH A;  1SZT A;  2CH7 B;  3ZHV A;  1MOF A;  2YS8 A;  4MW8 A;  4DO2 A;  3W7X A;  5H6R A;  1NBM G;  1PNL A;  2KKW A;  1Y67 A;  4MTG A;  1YTF B;  3HKC B;  1S5L Z;  2WAM A;  5KUM A;  4LR3 A;  3RYH A;  1US6 A;  5FNV A;  4LC1 A;  4BR6 A;  4N23 A;  4UCV A;  2YI8 A;  2GSM B;  3ZHT A;  4FZ0 A;  1XL4 A;  1OV9 A;  3ASO C;  3OMA B;  4D7T A;  4DV6 B;  4J80 A;  3F7V C;  3FYI B;  2HJD A;  4B3M O;  1BQZ A;  4MSW C;  2N04 A;  1SQQ H;  5H9C A;  2XAG A;  3SPJ A;  4PA3 A;  3CPW U;  1EN5 A;  4DV1 O;  4U3J B;  1MMM A;  3T4Z A;  2VWK A;  4GCZ A;  3CCQ V;  1AIL A;  2HVK C;  1DLB A;  1F4N A;  1EZJ A;  3A0B Z;  3OMI B;  4FFB B;  4WFG A;  4UUJ C;  5A2Q N;  1W0J G;  2ZE8 A;  1HP8 A;  4PDM A;  2PTM A;  4FPP A;  4B3S B;  4B3T O;  4MT8 A;  3K5N A;  5CMU A;  4GZR B;  3JAL B;  1Y76 A;  2DYR C;  4P2Z A;  1VQK V;  4EB6 B;  3WG7 B;  1I94 B;  2A3Q A;  3CEI A;  3JAR A;  3K57 A;  3OT7 A;  4CZZ A;  1HWY A;  4MVU A;  5JQG A;  1TVK B;  4B3R B;  1Q6I A;  2E76 B;  4DV4 B;  1J5E B;  2UUC B;  2F4V O;  2P90 A;  3HKB B;  1WP7 A;  2UUA O;  4DXW A;  1NJI W;  1FJG B;  4MVQ A;  2KG7 A;  2ADP A;  3E83 A;  3LDE A;  3KG2 A;  5B5E Z;  1KU9 A;  5KLV H;  1XL6 A;  4DR2 O;  1IUR A;  1H2M A;  2DQ0 A;  4YHH O;  1JA8 A;  5EZY A;  1WPX A;  3OGC C;  4JI6 B;  3K03 A;  4LF8 B;  1XNQ B;  1S5J A;  4X1I B;  4K3A A;  4HYO A;  2OWO A;  5K1X A;  2B1I A;  5L3D A;  1NR7 A;  1ZLZ A;  3E22 B;  2RN9 A;  2YIB D;  2ZDI C;  3H1L H;  4JI7 O;  4UVC A;  2DOS A;  2DYS C;  5KUK A;  4FIP C;  3CRR A;  2X6A A;  4H13 B;  4LH6 A;  1FFX A;  1GM8 A;  3ZN1 A;  1JQ0 A;  1CXZ B;  4YJ3 B;  5IYD O;  4K35 A;  1BS3 A;  1E1R G;  4PI0 A;  2DMX A;  4JI1 O;  1AP5 A;  4EFB A;  5CBG A;  3F5T A;  2Q7H A;  5CA1 A;  5CN0 A;  2IM9 A;  4J10 A;  1FPO A;  4O2B A;  5J2U B;  1D5A A;  3GB7 C;  4U7O A;  2NR5 A;  1NH2 D;  3LDD A;  4JI5 B;  3CMA V;  4NTW A;  3DXR A;  1RPO A;  4IL6 Z;  1M9N A;  4ZOL A;  3N2K B;  3L75 H;  1IBK B;  4I4T B;  3J7A U;  3ZRW B;  5D5P A;  4NVP A;  3JAW B;  3ZMT A;  1LNQ A;  1B04 A;  2JS5 A;  1Z5W A;  4MTX A;  3UKM A;  2GUZ B;  4J7Z A;  4AQY B;  4PEL A;  3H1H H;  1R1B A;  1IBM B;  4IGG A;  5IJ9 B;  5CB4 B;  2F66 C;  5DM6 V;  1AI7 A;  4I55 B;  5KHH A;  1FXK B;  5EYP A;  1Y6X A;  2YID A;  4HAM A;  3BEH A;  1SS3 A;  4KFM A;  1F51 A;  4UCT A;  1PPJ H;  3STZ C;  2UUA B;  4DR7 O;  2PZS A;  3I56 V;  3K9S A;  4MS2 A;  3DC6 A;  4I0X A;  2ILM A;  1DTO A;  2YXL A;  1OCO B;  4WBN A;  3L74 H;  4DV3 O;  2M7W A;  5IJ0 A;  5ITZ B;  3BA8 A;  3OMN B;  2X6B A;  4F6R B;  5H2F Z;  4DV2 O;  4FFK A;  1KD1 W;  4O2A A;  4JI7 B;  3RYI B;  4FJC C;  5JJE B;  2HFE C;  1V9P A;  1SA0 B;  4YJ2 B;  5BR8 B;  3QF7 A;  3E8G A;  4R6Z A;  3WG7 C;  1S77 D;  4MVS A;  4EFE A;  5CA0 B;  4LF7 O;  3B77 A;  4IIJ B;  3SYO A;  3CRQ A;  1T5E A;  3JAK A;  4DR4 B;  3RYC B;  4PDV A;  5BY1 A;  4RO2 A;  1M4U A;  5B3S C;  1VQ8 V;  4R50 A;  2CH7 A;  4X62 O;  2DWD C;  4X64 O;  3B4S A;  5FL7 G;  3FB8 C;  2Q7E A;  3D36 C;  3CS5 A;  3AK2 A;  1L0N H;  5LL6 Y;  4K0K O;  3HKC A;  3ZN0 A;  2UU9 O;  2H8P C;  1K5Q A;  1W0K G;  1TGO A;  5EBM C;  1VQL V;  1OCR C;  1EFR G;  4I5S A;  2RJZ A;  4PI2 A;  2PF4 E;  5FNV B;  1YJW V;  4X20 A;  4LF4 B;  4MTO A;  3RFR A;  1IVS A;  2LW7 A;  5CBF A;  3FB5 C;  4DR6 B;  4PV1 B;  4LFA B;  1VQM V;  1FXH A;  1NVP B;  5LP6 C;  2QTO A;  3OUF A;  3M8A A;  3VOU A;  2UXC O;  5IYZ A;  4U3J A;  3B8N A;  4P9O A;  1H2K A;  3ASN B;  5B66 Z;  4OGQ B;  4DR7 B;  4GT1 A;  2HLD G;  3K06 A;  1EM1 A;  2XND G;  3ETG A;  4PDL A;  2ZE6 A;  3RVZ A;  2VS0 A;  1S0V A;  2HP8 A;  4ZI7 B;  1YJN V;  1XHX A;  1ZUQ A;  1S3J A;  2EIM B;  4DV3 B;  2PGG A;  1VMG A;  5LYJ B;  1CEZ A;  2Z3Y A;  3MHH C;  4U7N A;  3T1Y O;  4ZIB A;  2MW2 B;  3UCS C;  5KHK A;  4DV2 B;  1Q6U A;  3JSL A;  3LNM B;  2FKX A;  1FKA O;  4OPA A;  1XNR O;  1JPX A;  3BA9 A;  3CXH F;  1HNW B;  1K9M W;  1HDJ A;  4H37 A;  1SES A;  2WPD G;  4N21 A;  3ZX6 A;  4X1Y A;  5L3B A;  1GH6 A;  1AI5 A;  1FXK C;  3ETD A;  1NTK H;  2PY5 A;  4DR5 O;  1R3I C;  3F7Y C;  3ABK B;  1AI4 A;  1UFI A;  1PL4 A;  3SYC A;  2P6J A;  1Q6H A;  3MD0 A;  4GUN A;  4X1I A;  4KP4 A;  3LSS A;  1GN4 A;  3ABM B;  1D5N A;  1RSO B;  1OCO C;  3H01 A;  3SPG A;  1VQ7 V;  3E22 A;  2IW5 A;  4C7U A;  2ITC C;  4GKJ O;  4H44 B;  3OE7 G;  1YJ9 V;  4WFB V;  4O4L B;  2WWW A;  2UU9 B;  2YIC A;  4UVB A;  1B06 A;  1KYO F;  3ZRX A;  4JAS A;  5AG2 A;  1VF6 C;  1EN6 A;  3K0G A;  2AHY A;  1K73 W;  3OM3 B;  4L87 A;  4YJ3 A;  4CS4 A;  1BCC H;  1Q81 W;  1FFX B;  2WLM A;  3G67 A;  2UXB O;  4OPH A;  4JYA O;  4LWS B;  3NR7 A;  1VQN V;  5E1A C;  3MAQ A;  2EIL B;  5KHG A;  4EKW A;  1KEC A;  5J2U A;  1IDS A;  4RQF A;  1Y74 B;  1VAR A;  3IC7 A;  1K4D C;  1KP3 A;  3WU2 Z;  4DR1 B;  4UCO A;  3FFQ A;  2ITD C;  2OTJ V;  1MZE A;  4UV8 A;  3N2K A;  3CRC A;  1JCH A;  3IC9 A;  4Q6G A;  3Q4H A;  4I4T A;  1RFY A;  4XBF A;  1XMO O;  3AG3 B;  1PM9 A;  4DV7 B;  4LF6 O;  5D5Q A;  2RMK B;  3DGE A;  3T1Y B;  4UVA A;  5IJ9 A;  5LBQ A;  2XTA A;  5CB4 A;  2WLI B;  5BMV B;  3SR2 C;  4I55 A;  4TV8 A;  1HNZ B;  5A9G A;  5EBL C;  2W6J G;  2O57 A;  2CDY A;  1CPY A;  5EYP B;  2YEV B;  5BZB A;  1Q7Y W;  3E8H A;  3BVO A;  4NXM B;  1MSD A;  2AZ0 A;  5C8Y A;  4J41 A;  4FLX A;  3OEE G;  3RYF A;  4G2K A;  4TV9 A;  3OGI B;  3CCM V;  4DV5 O;  3JD0 A;  3ASN C;  2XAH A;  5LA6 A;  1NZ6 A;  4QE7 A;  2QWP B;  4QGP A;  4JPR A;  4WBN B;  4F6R A;  1Y66 A;  4TWK A;  3CXC U;  1VF6 A;  5IJ0 B;  3M7M X;  1DK1 A;  4GKJ B;  5L3F A;  3RYI A;  5L3E A;  2F1M A;  2C2A A;  4YJ2 A;  5IWA B;  1QLN A;  3LSU A;  4JAU A;  4JAV A;  4BW5 A;  1P7G A;  1WPB A;  4NR1 A;  2QM8 A;  2B5U A;  3W7W A;  3SDL A;  2R72 A;  3L73 H;  4NXN O;  1N0N A;  5EK0 A;  3QVN A;  4P30 A;  3RYC A;  1R6N A;  1M1K W;  3P30 A;  4FLT A;  1JOY A;  2P22 C;  1N34 O;  1XHZ A;  1K97 A;  2XUM A;  4QPK A;  4LF5 O;  4K8X A;  1SC5 B;  1BGY H;  4D6T H;  1YXB A;  3HB3 B;  3OTO B;  1XMO B;  2EBO A;  1M5I A;  3JAT B;  4KUM A;  2A0L A;  3QNE A;  2HVJ C;  4JTC B;  2UXX A;  2QKS A;  2IU0 A;  2HG5 C;  1LUW A;  5JVD A;  1M56 B;  1YTF D;  4FLV A;  4UCU A;  3T4D A;  2CTW A;  2P4V A;  2P5O A;  2UUB B;  2ZIN A;  1K8A W;  3OR6 C;  4X20 B;  1AR1 B;  5C93 A;  2LJ2 A;  1FD9 A;  1U97 A;  4UB6 Z;  3TK1 A;  1TUB B;  3LSQ A;  2BE3 A;  1NT2 B;  3ZRS A;  5IYZ B;  3C3T A;  1P49 A;  4X66 O;  2UXN A;  1Q3E A;  1QR8 A;  1E79 G;  2EIL C;  3RWR D;  3U11 A;  3BFR A;  4ZI7 A;  3JD4 A;  3LDC A;  3BY6 A;  4WFA V;  4AIL C;  4DV5 B;  5LYJ A;  3AG7 A;  3TXQ A;  4UB8 Z;  4O4I A;  4WFE A;  3AG3 C;  3RGB A;  2AHZ A;  4GX0 A;  5BXZ A;  2WLN A;  1ORQ C;  5H5N A;  2R70 A;  4TT3 G;  5B1B B;  3F5W C;  4LF9 O;  3WB1 A;  1N33 B;  4J11 A;  4X1Y B;  1N8R W;  2RCV A;  3STL C;  1GO3 F;  3VQV A;  2XOK G;  1P4R A;  4Z1V A;  4YIP A;  4NXN B;  4DR3 O;  3K0D A;  2E75 B;  2GTA A;  3TET A;  4FLU A;  2PYJ A;  2A9H A;  3T1C A;  3BHP A;  2WLL B;  1RSO A;  4DV0 B;  3CCU V;  5F2V O;  2Y69 B;  2BCC H;  3JAS A;  2MK3 A;  4O4L A;  4QIW F;  4IHJ B;  1XOU A;  4CH3 A;  3C3S A;  3OTF A;  3JCU Z;  1P84 F;  3JAM N;  5HFM A;  2ZD9 A;  3CWB H;  2AXT Z;  2OYQ A;  4DYL A;  4CS2 A;  5KAF Z;  1FXV A;  1QR9 A;  4PA4 A;  5B1A B;  2Q73 A;  3JD1 A;  4LWS A;  1PD3 A;  2R9A A;  1GMG A;  1YEW A;  4B3M B;  2V4D A;  4CC5 A;  1Y74 A;  3MHS C;  1KP2 A;  2QTS A;  4X89 A;  4NYK A;  3ABT A;  4DV1 B;  4CBC A;  2IH3 C;  2ADQ B;  2LFS A;  3WFV A;  1K5S A;  2EUL A;  3K5L A;  3Q4H B;  1NS1 A;  4JI0 O;  2EIK B;  1IXM A;  3CCE V;  4B3T B;  2WLI A;  5BMV A;  4DUY O;  4ZBM A;  4BAY A;  2RNB A;  1O9H A;  3LNN A;  2B1G A;  3T1H O;  1S76 D;  4AHC A;  2OIE A;  4TV8 B;  1GAX A;  2ZM6 O;  1SQF A;  2YEV A;  4J9Y B;  4R8C A;  2HJF C;  4NTY A;  2ZXW B;  3G80 A;  3ZHR A;  4YXW G;  1BE3 H;  3C90 A;  4JV5 O;  2F4V B;  3QO5 A;  2OT5 A;  4PA6 A;  3FKS G;  2QKC A;  2DJV A;  3AK1 A;  2E74 B;  3J81 N;  4LFC O;  4FVM A;  5C8Y B;  1QLE B;  2E3C A;  3RYF B;  3A8T A;  2E5L O;  4TV9 B;  1AR5 A;  4DR2 B;  5IYB O;  3L70 H;  4YHH B;  4F6E A;  5LA6 B;  1V55 B;  1TA8 A;  2ATK C;  4BIU A;  4LH7 A;  4MVO A;  5KMG B;  1AR4 A;  3W7U A;  4PDR A;  2CAZ C;  1IXB A;  4LFB O;  3DTU B;  2Z5U A;  3CJH B;  5B1B C;  1N0J A;  2Q67 A;  4JI3 O;  3X2Q B;  5EBW C;  1X4T A;  4JI2 O;  4I50 B;  4JI1 B;  2Y0P A;  3TXS A;  2JRI A;  2LQT A;  2JEX A;  1VQ4 V;  5K1P A;  4Z1M G;  4PA9 A;  1SQV H;  4WFH A;  2IJI A;  4DRX A;  2QWN B;  1GKF A;  3HPL C;  3JAT A;  1LUV A;  5LOV B;  4MTF A;  2Y69 C;  1L1F A;  2BTQ B;  2LGQ A;  5GTI Z;  4CH5 A;  1SQG A;  1R6T A;  1D2D A;  5JVD B;  1K34 A;  1XRE A;  4HNA B;  1AJP A;  4JYY A;  4HZ3 A;  2Q69 A;  1M57 B;  1YIJ V;  5B1O A;  1GM9 A;  5J2T A;  2EZP A;  1TUB A;  3AG4 B;  5IY5 B;  1K7D A;  5LXT B;  1UJW B;  1PP9 H;  5B1A C;  1DGS A;  1X59 A;  4JV5 B;  4ICG A;  1OJH A;  3KZI Z;  1NVP D;  1H8H G;  4WCE V;  1GRJ A;  4HBN A;  4GX2 A;  3GVM A;  4TSF G;  1IBL O;  4GX5 A;  3R66 A;  4I7Z B;  4WFF A;  3ZCC A;  1QQC A;  3HKE A;  2YXH A;  3M99 B;  3VQX A;  1NKD A;  1E1Q G;  3QO8 A;  2X6C A;  3EFF K;  4FLZ A;  3ML0 A;  1H8E G;  4O4I B;  2N05 A;  2QWR B;  1K92 A;  4J7J A;  3U10 A;  2EIK C;  4X65 O;  1JMK C;  4OX9 O;  3CX5 F;  3THO A;  1YDX A;  4LFB B;  4CC6 A;  4QNH B;  2ZNJ A;  2D3O W;  4E4E A;  2WA3 A;  5DEC A;  4DUZ O;  5DED A;  2CTQ A;  3RBZ A;  2A7W A;  4LF7 B;  1KB9 F;  4OXS A;  1EZV H;  1URF A;  4FM2 A;  3IFX A;  3K08 A;  3A0R A;  3L72 H;  3CCS V;  2VQE O;  2QDO A;  3I5D A;  2WLL A;  2IH1 C;  2CGO A;  3OEH G;  4G27 B;  5HFL A;  5KA6 A;  5IYC O;  1V54 B;  3JD3 A;  4UXN A;  4X62 B;  2W0X A;  4X64 B;  4F4L A;  2AW9 A;  3E2E A;  3ZMU A;  1Q86 W;  3RN4 A;  3FAV B;  4LP8 A;  4U3F H;  2LGW A;  1V55 C;  2D2C B;  4IHJ A;  3JAS B;  4X1K B;  2ZNI A;  4K0K B;  2ARH A;  2DN9 A;  2WLH A;  1VQ6 V;  1ARO P;  5FLX N;  1F23 A;  1ZAU A;  1SKV A;  1QHT A;  1MSW D;  3CP1 A;  5LMN O;  4FM1 A;  4X8A A;  2CK3 G;  3L9D A;  1CP9 A;  4MW3 A;  3FX7 A;  3K9A A;  3K79 A;  2QR4 A;  3ZMZ A;  4X88 A;  3X2Q C;  2CGN A;  4L8J A;  2AZ2 A;  2UXC B;  1Q82 W;  1KMI Z;  1MA1 A;  3K5O A;  2ETN A;  4JAA A;  1XBL A;  1QU7 A;  1UPG A;  3G6E V;  2L35 A;  3B2E E;  2XHB A;  2X0L A;  3K58 A;  2VRZ A;  1THZ A;  1IBL B;  4RUE A;  3QTC A;  3BRC A;  4JZ2 A;  5GW7 A;  1WJZ A;  1HR0 O;  3P3P A;  3UO2 A;  1OCC B;  1KBH A;  1ENV A;  4O4J B;  2G38 A;  5LGT A;  3D8C A;  4UCS A;  2QA4 V;  2IJJ A;  2QGN A;  3CCJ V;  5H6Q A;  2XAQ A;  4X65 B;  3G71 V;  2IJK A;  4OX9 B;  4JI8 O;  3OD4 A;  1XNR B;  1IX9 A;  3AG2 B;  2PI4 A;  3N2G B;  2LFR A;  1M93 A;  1M57 C;  5L3C A;  1B3Q A;  4GX1 A;  2Q4P A;  5JCO A;  4DR5 B;  5IY5 C;  1VP7 A;  2W0F C;  4I9Q A;  1XEQ A;  1PNM A;  2JJ2 G;  2JK5 C;  2RDC A;  3APO A;  1JX9 A;  3P32 A;  2K1E A;  1PNK A;  1U96 A;  5B1N A;  5CBH A;  4UCR A;  5KX5 A;  2QSA A;  2Q0O C;  2A06 H;  1H2S B;  2ZKO A;  1EBO A;  2W6I G;  3ETQ A;  5KMG A;  3ZHU A;  1K3E A;  2JGU A;  1VEW A;  1WP8 A;  3E86 A;  3SJA C;  4IYI A;  1H38 A;  1JFF B;  2EIM C;  1R3L C;  1NTM H;  4BW9 A;  1XMQ O;  4KL1 A;  1JR9 A;  1WLE A;  2V1D A;  5GON A;  2BTO A;  2P4K A;  5EC2 C;  3CJH A;  4B3S O;  2YI9 A;  2F43 G;  1I08 A;  3B8M A;  4JI4 O;  1JJO A;  2A79 B;  1PV0 A;  4DK0 A;  4I50 A;  2UXB B;  1I94 O;  3A2F A;  1RPR A;  3SJQ C;  4TUY B;  4JYA B;  1AB3 A;  4JZG A;  1Z5V A;  2Y4U A;  1W2B U;  1MNG A;  3R65 A;  5EIB C;  2BOB C;  4R7C A;  1YSC A;  3SJC C;  3SYQ A;  2N74 A;  1MAB G;  3ABK C;  4B3R O;  4IT5 A;  4DV4 O;  1J5E O;  1XIL A;  1ZTE A;  3H1I H;  5LOV A;  4D7S A;  1YIT V;  4DRX B;  1NU1 H;  2BTQ A;  3ABM C;  1V54 C;  2XAS A;  1GK9 A;  3IAY A;  1G6U A;  3JSN A;  4LF6 B;  3CC2 V;  2EJ7 A;  2BSK A;  3ABL B;  1SF9 A;  4JI6 O;  3VQY A;  1G8M A;  4LF8 O;  4HNA A;  1XNQ O;  2KQX A;  5IE9 A;  2YUA A;  4FZ1 A;  4NKG B;  2NLJ C;  2JS3 A;  4AI8 A;  1QCE A;  4JI8 B;  5LXT A;  5E79 Z;  3CCV V;  5J2T B;  2PI5 A;  1L0L H;  5KAI Z;  3S3X A;  4ZHQ B;  3E8F A;  4NTX A;  1TUE B;  3MDS A;  4PJ0 Z;  3UT5 B;  4QPJ A;  3WB2 A;  4GLX A;  1OCZ B;  2BOC C;  4PD4 F;  2Y0I A;  4LCU C;  1KUQ A;  1IZ3 A;  4DW0 A;  3CB2 A;  3E35 A;  3HKE B;  2R9I A;  4FK5 C;  2WSS G;  1QNM A;  4GKK O;  2ZE5 A;  1ZSP A;  4JI5 O;  3G6B A;  1SET A;  1J95 A;  2Q6A A;  1AJQ A;  1OCC C;  3P3N A;  1IBK O;  4PHZ A;  1XMQ B;  4B08 A;  3CSX A;  5DN6 G;  2YC0 A;  3W7S A;  4KHP O;  2FL4 A;  4JI4 B;  4XDL A;  1GM7 A;  3E89 A;  4AQY O;  3OR7 C;  3AG2 C;  4UFZ A;  5GTH Z;  1R73 A;  1IBM O;  1VIB A;  1NR1 A;  1N4C A;  2Y4T A;  2CE4 A;  3AG1 B;  1I5X A;  5LHG A;  4B7E A;  3IJ4 A;  3ABU A;  2Y48 A;  1SZX A;  2JDI G;  3GWO A;  3VQW A;  1YCI A;  2XAJ A;  1N34 B;  1S5H C;  4LF5 B;  3FAV A;  1BQ0 A;  5LHI A;  2JIZ G;  2DW4 A;  5KHJ A;  4EEQ A;  4X1K A;  2VWJ A;  3K5M A;  5B3S B;  1R3J C;  4RQE A;  2QE7 G;  4JTA B;  3BAB A;  5LGN A;  3S3W A;  4RUF A;  3UO3 A;  1LR1 A;  3U0Z A;  1K4C C;  4J9Z B;  2GDS A;  4H33 A;  2OIG A;  3H1K H;  2QM7 A;  3CRM A;  1VQO V;  3HR0 A;  3KCX A;  3KCY A;  2EIJ B;  4CS3 A;  3SJB C;  1H2N A;  1G4Y B;  1WN7 A;  1YVW A;  1OCR B;  2Q5Z A;  2LW1 A;  1W59 A;  5JJJ B;  3DC5 A;  3CD6 V;  1BT8 A;  5KHI A;  1Y4M A;  5BR8 O;  1COW G;  2YDE A;  4NB5 A;  2RQ6 A;  1YF2 A;  2NNU A;  3APQ A;  2ZT9 B;  1GTO A;  5LP6 B;  4X66 B;  1XDC A;  2CUG A;  3SYA A;  3E8B A;  2HEP A;  3HKD A;  1JVM A;  1AI6 A;  3VBB A;  4DR4 O;  3FB7 C;  2Q9L A;  2YXY A;  3CYO A;  2QKA A;  1NH2 B;  2UXD O;  1BHA A;  2JGD B;  4BIZ A;  4O4J A;  3AK3 A;  2JJ1 G;  3BCC H;  2YSU B;  4GKK B;  2GHY A;  4DK1 A;  2GTS A;  3ABL C;  5JH7 A;  3N2G A;  1OHH G;  1M56 C;  4QJF B;  4W4K A;  1WA8 B;  4LF9 B;  4WF9 V;  4KHP B;  1RM1 B;  2OTL V;  4MVZ A;  1P7B A;  3SPI A;  3ZS8 C;  3W7T A;  4LF4 O;  1F7Y A;  4LNU A;  4BIO A;  4DR3 B;  4DR6 O;  2K9P A;  1BL8 A;  3FD9 A;  4LFA O;  3O9O A;  1KKC A;  2P06 A;  2QM4 A;  2X7R B;  1OCZ C;  4O4H B;  3SPC A;  4JGS A;  4GYC B;  5KX5 B;  2ZE7 A;  1R6K A;  1TAE A;  4LBE C;  1KQS U;  1JFF A;  1ZL8 A;  2KB1 A;  3L71 H;  4ABM A;  4CH4 A;  3ZBH A;  2HKO A;  5LGU A;  5GON B;  2ZDI A;  5TIS Z;  4ASU G;  1MZF A;  3JYC A;  1F4M A;  3ZED A;  1N36 O;  1QVF U;  1JJ2 U;  4TUY A;  3CCR V;  1KKD A;  2QEX V;  1ROP A;  3D3Q A;  1Q5O A;  3EXA A;  3ZIA G;  1HNW O;  1G1X B;  1NTZ H;  4TOI A;  3AEI A;  2FTK A;  1I7F A;  1SRY A;  2DWE C;  2QWQ B;  2IJH A;  4MVR A;  3AG1 C;  4FMT A;  3TGU H;  1R3K C;  3QG5 A;  5LMU O;  1RP3 B;  1BSM A;  4G28 B;  3B40 A;  2ZIM A;  1XQ8 A;  2IU3 A;  1XI1 A;  1B6Q A;  4JI0 B; 
#chains in the Genus database with same CATH homology
 2G38 A;  4J7K A;  4J7J A;  4J42 A;  4J41 A;  4W4K A;  4W4L A;  4KXR A;  4IYI A;  4J10 A;  4IYH A;  3FX7 A;  2GTS A;  4J11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...