4J7KA

The crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGQFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
total genus 40
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7kA00
4J7KA 4J7JA 3FX7A 4J10A 2G38A 4IYIA 2GTSA 4IYHA 4KXRA 4W4KA 4W4LA 4J11A 4J41A 4J42A
chains in the Genus database with same CATH superfamily
4DR2O 5EYPA 3MDSA 2GSMB 1ZL8B 4FLZA 2CH7A 2A06H 4MTFA 3A0BZ 1V55B 3UT5B 4A5UB 3OEEG 5BY1A 4CS4A 2ZR2A 4KUMA 3RYFA 1EN6A 4OXSA 4O2BA 1PV0A 4DV6B 1I5YA 3QG5A 4ZKIA 3ASOC 1QCEA 4DV0O 3SYOA 2A3QA 4QPJA 4ZIBA 1R6TA 2ETNA 1Q6UA 4X66O 2ARHA 3ABTA 2UXCB 4GCZA 2UXBO 3RYIB 2ZM6O 4FIPC 1E79G 4R7CA 1NQTA 4JI0O 4DXWA 5CB4A 2ZE5A 3DSQA 2QGNA 2CTPA 5IJ9B 4PV1B 2PZSA 3AG2B 4JI2B 1GM9A 1PKXA 4GT1A 1VQ4V 2L35A 2LW7A 4GKKO 2IU0A 3ZRWA 5LXTA 3CCJV 4G2KA 3W7TA 3WB0A 5BR8O 1OCZB 4ABMA 4P9OA 4HBNA 4BWAA 1YCIA 2PY5A 1SQQH 2CTQA 5DEDA 2LGWA 5IWAB 3I55V 4JTCB 3N2GA 3IC9A 1JFFA 4W4LA 4DR3O 4DR6B 1WAZA 5L3BA 1GN3A 4DV5O 4X1KB 4IL6Z 2DW4A 4CC5A 2K9PA 3CE2A 1WLEA 2EINB 1BHAA 2ZKOA 2YIBD 3JASA 1BE3H 4I4TA 4K3AA 3CCRV 1XILA 3N27A 2DMXA 4H0LB 3G71V 2ZIMA 3ZHSA 2YI9A 5IYZB 4TT3G 1HR0O 2ZE6A 2RCVA 1NTMH 4GKJO 2Q8VA 4DW0A 1JCHA 2QA4V 3T1YO 1R3LC 1GN4A 3OEHG 3BY6A 3IJ4A 4LF7O 4IGGA 2QEXV 1ZUQA 3OMIB 1R73A 5AG2A 3MHHC 1QU7A 2WLLB 3RN4A 4DR7B 3RYHA 2E5LO 1SRYA 1YXBA 1N33O 1SERA 2BSKA 2UXDB 1CXZB 1Q6IA 2QTSA 4LF4B 4DW1A 1X59A 4L87A 2C2AA 5BMVA 1Y6XA 4IHJA 4ASUG 5B3SC 3AK3A 3T4DA 5LMUO 4GX1A 4QIWF 2E3CA 5IYBO 5LHGA 3L70H 4IYHA 4LF9B 5LA6B 2AZ0A 2XAFA 1TUBA 3B77A 1AR5A 1M1KW 2DQ0A 4GX5A 2UU9B 5KX5B 2QTOA 3JCUZ 4K8ZA 4NXNB 1SESA 2VQFO 2LFSA 1VQ7V 4DK0A 4XDKA 2EILB 1OZ0A 3WFVA 3HR0A 1WPBA 4I50B 3K5NA 1S5HC 3K79A 4DV2O 5IYDO 4FMTA 1Y66A 2D2CB 4RUEA 1FAFA 1AP6A 5CMUA 4TV9B 1YZBA 2BTQA 3M99B 5CA1B 1NH2D 1YJ9V 1M56B 2R72A 3JAMN 3STZC 1KP2A 1IBKB 4U7OA 1AJQA 4K0KO 3M7MX 1TA8A 3AG1B 4Q6GA 1YJNV 4JYAO 2A0LA 2CUGA 3LSQA 2PGGA 1JR9A 1F4NA 5KHGA 3F5WC 1IX9A 1H38A 2X6BA 1E1RG 1N4CA 1XI1A 1DK1A 5KHKA 1Y76B 2IH1C 5H5NA 2W6JG 4J9YB 1SQFA 1UPGA 4DR2B 3ZHQA 5GW7A 2DWEC 4JI7B 1Q43A 4FM0A 3PJSK 1SETA 4MTGA 4WF9V 1WP7A 1FYJA 1NZ6A 2EBOA 4PDRA 1YEWA 2JGUA 5KUMA 3OUSA 4B7KA 4Q20A 2QM7A 1N34O 1RPRA 5FNVB 5LHIA 5KLVH 4MW3A 4F6EA 2DQ3A 1KECA 3ZN0A 1TAEA 5L3CA 4QE7A 4ZI7B 1R6NA 2ZM6B 4B3MB 3JALA 4I55B 3OTOO 3J81N 4X1IA 3A8TA 2UUBO 3LNMB 2VQEO 5DM6V 3VQYA 1EN5A 3RYCB 5B66Z 1S5JA 1ZX3A 3SPHA 3JSNA 3THOA 3K9AA 3T1HO 2IJHA 4GKKB 2LW1A 4YXWG 1PPJH 4EB6B 3JD4A 1AJPA 5BR8B 2CGOA 5ITZA 5C8YA 2JGDA 4FJCC 4ZOLB 3LSSA 4NXMO 1N0JA 3JAWB 4LH7A 4MVRA 2PF4E 3MD0A 4B08A 3GWOA 4TV8B 2M7WA 4RQEA 4GYCB 2ZCEA 4DRXB 4QNHB 3DC5A 3SYAA 5KAFZ 1VMGA 3CXHF 2QKAA 5IJ0A 1OCCB 4AQYB 4DV3O 2PTMA 3P32A 4HZ3A 3GWKC 2DYSB 2RQ6A 4O4HA 3CYOA 3N2KA 3GVMA 4FLWA 1GM8A 1G1XB 2LFRA 1AR4A 3SGIA 3AEIA 1AI7A 4YJ2A 2OTJV 4LWSB 3SR2C 2Q0OC 4PELA 4GKJB 1GM7A 5KA5A 3FB8C 1SA0A 4PI0A 1NR1A 3T1YB 4F6RA 4X1YA 3JD0A 3W7UA 2CTRA 4PD4F 5TISZ 1ORQC 4LF7B 3D3IA 4TOIA 4NTWA 2WLNA 2EILC 2GBOA 1XMQB 2WLIA 5K1XA 4UVBA 5KMGB 4GUNA 4EEQA 2E5LB 2JK5C 1GAXA 4DUZB 4MTXA 4U3FH 2WA3A 4JI2O 2QE7G 3CXCU 4O4JA 3CSXA 1RSOA 1H2NA 3HB3B 1FXKC 1P4RA 4O4LB 1HNZB 4LCUC 4H33A 3JARA 1IXMA 1SZTA 2YEVA 4N23A 5K1PA 1R3KC 3CCMV 1XL4A 2YIBA 4H13B 3FD9A 1GK9A 2DJVA 3ASOB 3ZIAG 3FFQA 2N05A 1NTZH 1VQ5V 3SJAC 2QJ1A 1S0VA 4DR6O 3CMAV 4DR5O 2GUZA 1URFA 2BE3A 4RUFA 3D8CA 2F66C 2F43G 1W59A 3RT3C 5CA0B 3SYPA 2DYRC 2JVDA 1W2BU 1COWG 2HLDG 5L3GA 5BZBA 2WLMA 3Q4HA 1FPOA 2EJRA 3KKYA 2CE4A 2Y48A 4K0KB 4JI4O 2B1IA 5JJEB 3K58A 4JYAB 5L3DA 1V54C 5LP6A 3BRCA 4J42A 2VWJA 1YDXA 3CJHA 4J10A 5C93A 3UO2A 1RFYA 3OAAG 1JJOA 4TSFG 2UXXA 4LFCO 4UB8Z 1WNSA 4FVMA 2YDEA 1K3EA 2XASA 3CS5A 3CCUV 2UXDO 1R1BA 2ADPA 1LR1A 4X65O 1NI8A 5EZYB 4FK5C 1QR8A 1Y74A 3P3NA 1K33A 2JDIG 1SZXA 4YHHO 4MVOA 1AROP 1U96A 1K8AW 2JS3A 3JD1A 2Z0AA 2ZNJA 3RGBA 1N34B 2ZE8A 1K4CC 1XUQA 2FL4A 3K0GA 3G67A 1OCCC 4AILC 4MTOA 4LF9O 2XAQA 2N04A 1QNMA 5JQGB 1FXVA 1AP5A 3KCXA 4D7TA 1BGYH 1XDCA 1S5LZ 3JATB 4KFMA 2KB1A 3OTFA 5JCOC 4BIOA 3OTOB 4P30A 5J2TB 1EZJA 4GZRB 4I5SA 1CEZA 5CBHA 3DC6A 4FFBA 1R6KA 2LO1A 2EZOA 3ZX6A 4GX2A 4LR3A 3D36A 4UB6Z 3T1HB 4AI8A 1ZL8A 3B2EE 5EK0A 4U3JB 4X20A 3F5TA 4GLXA 4X89A 5EBMC 2Q9LA 2EZPA 1U97A 2HJDA 4OPAA 5B3SB 4FFKA 3A2FA 4OX9O 4O4IA 5GTIZ 2Q6AA 1JMKC 3ZJZA 2HJFC 2YI8A 1MA1A 2HFEC 4WBNA 5DECA 1IZ3A 1O9GA 4JI7O 1VF7A 3WB2A 2XOKG 3E22A 4YJ3B 1I0HA 2X7RB 3J7AU 4LFAO 2KG7B 4TUYB 3H1JH 1NBMG 5LGUA 2E76B 1M57C 1FS0G 1UFIA 3CRAA 1SQXH 3DTUB 3CC7V 1F51A 1QLEC 1Q8IA 1PD3A 3IAYA 2YS8A 3HKCB 1L1FA 3ICXA 4H44B 3K59A 2O57A 2OIEA 4B3MO 1WA8B 2QM8A 3OR7C 4E2LA 4E4EA 1Q6HA 4DV1O 3F7YC 4JYBA 4JPRA 4NKGB 2M6YA 3TJTA 1WPXA 3H1LH 4GX0A 1Q5OA 2Q69A 2RMKB 4DR4O 4UVAA 3JD2A 4IT5A 2WAMA 1BSMA 4UCOA 1WB8A 1KMIZ 4R8CA 1HW7A 2ZXWC 4JI6O 1F7YA 1XNRB 3TK1A 3WG7C 3FYEB 2A7WA 2YIDA 1BQZA 1KUQA 2GDSA 5IYZA 3ETGA 3RYFB 3ZRXA 1AI4A 4LBEC 5EIBC 3BEHA 1RM1C 2QWPB 4O2BB 2H94A 4TWKA 1TUEB 4ZHQA 4AQYO 4I0XA 4AHCA 5D5PA 4DR5B 2OCCC 4X88A 5E1AC 4WFAV 2F23A 1Q82W 2VRZA 2OWOA 3OT7A 1DLBA 5CB4B 1QBZA 3JYCA 4FLYA 2WWWA 2QM4A 3UKMA 4KHPB 2P4VA 2QSAA 1NJIW 3HKEA 1F4MA 3ZRWB 5DN6G 5LXTB 2NNUA 4JI4B 2F93B 4RAIA 1H2SB 1K4DC 1IBLO 1J95A 3L75H 3AG7A 3HKDA 5KUKA 1XMQO 4LNUA 2F1MA 3MHSC 1F23A 5LA6A 5JVDA 4LFCB 3N2GB 4YY3B 1JFFB 1XREA 4DUZO 4CC6A 1TGOA 2QWQB 3H9VA 4MVZA 4UVCA 4I9WA 4X65B 1HNXB 1JA8A 2V4DA 1BT8A 4TQDA 1HNZO 4LF8O 1MG1A 4YHHB 1NVPB 3JASB 3HKBA 4WFHA 4JYYA 2EIKC 4I4TB 3VQXA 2NR5A 5CA1A 3OR6C 2D3OW 2MW2B 4KP4A 2A9HA 5GONA 3JAKA 4DV7B 2NN4A 1ZWIC 3LUTB 1VQOV 3W7XA 3SPCA 3E83A 1GRJA 4LH6A 1DF4A 2LQTA 3D36C 4F4LA 1ENVA 2BSKB 3OM3B 2CAZC 2ZD9A 1W0JG 1AVMA 1G4YB 4DR1B 3ZHRA 1VEWA 1VF5B 1FXKB 4QGPA 2IU3A 5BMVB 1Z5WA 3TXSA 2EIJC 4CBCA 3ABKC 4P9PA 4OX9B 1VQNV 1OCRC 1Z2GA 2E74B 1YITV 1Y4MA 4D7SA 3BABA 4PA6A 1FFXA 4EFBA 2RDCA 1THZA 3LDEA 1K7DA 2KKWA 5LHHA 1SQGA 3J80N 1XL6A 3F7VC 3ZMVA 4LFAB 3S3WA 1T5EA 4QE9A 5HFMA 2DYRB 1SC5B 3L71H 2L6LA 3RFRA 4LF5O 2F95B 1VF6A 4UFZA 3ABMC 5F2VO 1TVKA 2BTQB 2DN9A 3P3PA 2YXHA 3CEIA 4ZOLA 2YICA 1AB3A 3SYQA 1MZEA 1K5QA 1PL0A 2IM9A 1ZTEA 3BFRA 3ETEA 2QWNB 3ZRSA 2ODMA 4IIJA 2WPDG 4JI8O 1V54B 5IY5C 3OMNB 4DV1B 3X2QC 4DR4B 3DGEA 3OGCC 2OTLV 4QPKA 2WSSG 3SPJA 1KBHA 3BA9A 2GV9A 5EC1C 4JI6B 3CCEV 3I56V 4R6ZA 4RQFA 3L9DA 4H37A 2RNBA 3SYCA 2R9IA 4K35A 1VARA 4FPPA 4Z1VA 3IFXA 1SQPH 3CRCA 4ICGA 1MABG 3ZHVA 3B4SA 1YSCA 3JALB 1QHTA 5KA6A 2V1DA 3D3QA 3CD6V 4LFBB 5LBQA 1L0NH 1ZLZA 4X1IB 5EC2C 2F4VO 2JEUA 3FAVA 1EZVH 3CC4V 3EXAA 5A9GA 3W7SA 3SPGA 1Q90D 3WU2Z 4NVPA 5ITZB 5C8YB 2JGDB 1VQPV 1B6QA 1VQMV 2JJ1G 3ML0A 1IBLB 2W6IG 1H8HG 3SJCC 2H3OA 2R70A 1BL8A 3RW0A 3K5LA 4FLXA 3R65A 4X8AA 4JTAB 4WCEV 1JOYA 1NVPD 5B1BC 5IJ0B 3LDDA 2WLJA 4J7KA 3ASNC 4MSWC 3VOUA 4JI3O 3T4ZA 1K34A 2ILMA 2Q0AA 1LUWA 1SF9A 1QQCA 1ZSPA 5LYJA 4JF3A 1G8MA 3TGUH 4FLVA 4B7EA 4I7ZB 5J9PC 4LF8B 2JIZG 1XNRO 4O4HB 1GO3F 2Q67A 3N2KB 1GTOA 1IBMB 3CCLV 3AK1A 3CRRA 4FLUA 4PJ0Z 2Y69C 2GTSA 5IYCO 4YJ2B 1VIBA 5L3EA 3QO8A 5BXZA 1FKAO 4O2AB 4BIZA 1M57B 1AI5A 3RVYA 1KD1W 1QLEB 4HNAA 4F6RB 2Y4UA 4X1YB 1W0KG 5LMNB 3BA8A 2Y0PA 2HEPA 1IVSA 5E79Z 3G6EV 4BIUA 4RO2A 2H8PC 4C7UA 2WLIB 1LUVA 5JJNB 3DXRA 3ABLB 3OGIB 3EHBB 2HR3A 4KHPO 2VS0A 2R9RB 4PDMA 4O4JB 1S77D 2EIMC 3TETA 4PA3A 2ZXWB 2QWRB 3JARB 2YEVB 1PNMA 2HHHO 1EM1A 3WG7B 5J2UA 5LOVA 3E89A 2DOSA 1RM1B 4YY3O 2EJ7A 3O65A 4CS2A 2XUMA 3BHPA 3JATA 4CH5A 2QWOB 1NU1H 3HPLC 3ZMSA 1KKCA 2OCCB 2GUZB 1HNXO 4J11A 1AILA 4UUJC 1FFTB 1ZAUA 2PYJA 5IE9A 3NXSA 4L8JA 4JV5O 3K57A 1H2LA 1YF2A 4LF5B 1VF6C 4X62O 2Y4TA 1ROPA 2VWKA 3Q4HB 1SQVH 1H2MA 1D5NA 3ZS8C 5JWPA 1YVWA 4UCVA 4DV7O 1N32O 2ZE7A 4BW5A 4DUYO 4JI8B 1YIJV 1OHHG 3CJHB 1XOUA 2YC0A 1DGSA 4IYIA 5H6RA 2BOBC 1KC8W 3AK2A 4CH6A 3ZMUA 3QNEA 3UT5A 5H6QA 3LNNA 4DR1O 4MVMA 1PP9H 4HAMA 4MVQA 2GHYA 2YUAA 3GB7C 3CPWU 5CBGA 4TQFA 2EIKB 5JH7B 3ZBHA 5IDJA 1M4UA 1NS1A 2YXLA 3OFNG 4J7ZA 1GN2A 3K5OA 1P84F 2LJ2A 3H1KH 1I5XA 1BCCH 5LL6Y 3RBZA 1Q86W 4X9QA 4CH3A 3CWBH 2V7QG 3RYIA 4JI5B 1WA8A 2OYQA 3KZIZ 4JZ2A 1BQ0A 1N36O 3AG4C 3U10A 1OJHA 1NR7A 5IJ9A 2F4VB 1EFRG 1WJZA 1B06A 4KL1A 4UCRA 1X4TA 4NTYA 3K5MA 2IJKA 4X20B 3L72H 4MW8A 3FB5C 3ZMTA 3PN1A 4FZ1A 3K3WA 1OCOB 1QVFU 1D2DA 1QVGU 1I7FA 2EIJB 3ABKB 1OCRB 1A32A 4O4IB 3ZRVA 3C3TA 2XHBA 3ABLC 4X1KA 1YTFB 1CPYA 1S76D 4JI3B 4D6TH 3LDCA 3K03A 1O9HA 1OV9A 4WBNB 5EYPB 3RVZA 1FJGB 1FXHA 2CH7B 2Q7HA 2YIAA 3E22B 1KU9A 4JZGA 3E35A 1DTOA 3CRQA 2OCHA 1SKVA 1L8DA 3AG3B 1Q7YW 4JASA 1XNQO 4LC1A 4JI1O 3ABMB 4J41A 5CA3A 4FM1A 2HKOA 3E8BA 4JAUA 2IBZH 2X6AA 1MOFA 3E86A 3UCSC 4B3RB 2AXTZ 3K04A 1PM9A 2HG5C 4LFBO 1KYOF 2WLLA 1MMMA 3G80A 5IY5B 2CTWA 1GKFA 3H1IH 1LNQA 5B1AC 4FM2A 1QLNA 5FPRA 3X2QB 2FYUH 1M5IA 3T2MA 1US6A 4J7JA 1Z5VA 2RN9A 5EIBD 3TXQA 3BPZA 1XEQA 3E8FA 1M90W 4PI2A 2Q68A 5LP6C 3R66A 2HHHB 1S72V 2IJJA 4PDVA 3CRMA 4DV4O 5FPOA 2UUCB 4DYLA 4J80A 4ZHQB 5CBFA 2AHZA 4I0XB 4B3TO 5KX5A 2XNDG 1I94B 3E8HA 1H8EG 3U0ZA 3QO5A 3QF7A 4I50A 5EBWC 4WFFA 2UUAO 2IJIA 1M93A 4OGQB 3L73H 2W0XA 4JV5B 1XMOB 4TV9A 1IBMO 2FKXA 2Z3YA 4X62B 1K5SA 3FB6C 3EFFK 1PNKA 4CH4A 2Y0IA 2ITDC 2DE0X 1BMFG 3VBBA 1BHBA 3HKEB 1FXKA 2HVKC 1N32B 4ZBMA 1JX9A 4DUYB 1P49A 1S3JA 4LF6O 3A0HZ 3LSUA 3UM7A 5LMNO 2P5OA 5GTHZ 3C90A 4NB5A 4UV9A 1R3IC 2XAJA 4EKWA 3HKDB 1N0NA 2BOCC 1YHQV 1BS3A 4LNUB 3VQWA 5JVDB 1Y76A 1HP8A 3RYHB 3TCUA 4B3SB 2JS5A 5B1BB 5B5EZ 1Y67A 3ABUA 1KKDA 3ASNB 4PA4A 4XBFA 1V55C 1RPOA 3B8NA 5FL7G 1SQBH 1JQ0A 1OCOC 2N74A 4IHJB 3HKBB 5LGTA 3ZEDA 2HVJC 5FNVA 3EVKA 2Y69B 4JAVA 1J5EB 2EX3A 1MSDA 1G6UA 4U7NA 1BZKA 5GONB 1VQ9V 1I08A 1TUBB 3JAKB 4ZI7A 3B8MA 3JSLA 4BW9A 4I55A 2UXNA 3E8GA 2Q4PA 2AZ2A 5EBLC 2ZT9B 1N36B 1KP3A 2A79B 4X64B 2JEXA 3RYCA 3AG3C 3AG2C 1JVMA 4UCTA 4G27B 3OW2U 3G4SV 2ZDIA 4WFBV 3FB7C 1HNWO 4EB6A 3KG2A 3ZN1A 1OCZC 4RWUA 3H1HH 4UCUA 2EIMB 1VQ6V 3JAWA 1YTFD 4JTDB 1K92A 4CZZA 4TV8A 1CP9A 5A2QN 2ADQB 4DRXA 4Z2WA 4I9QA 2FMLA 3IC7A 4DV0B 1VQLV 3OMAB 2EULA 2LP7A 4LP8A 1VQ8V 3E2EA 4X66B 2LGQA 2E75B 1FFXB 3UQ8A 4YIOA 2ZINA 2P4KA 2EINC 2QKCA 4R50A 4BR6A 2UXBB 2IH3C 2R9AA 4JI0B 4WFEA 2P90A 4P2ZA 4JAAA 1YI2V 1RP3B 5JCOA 2Z5UA 4G28B 3QTCA 3FX7A 4NYKA 2YXYA 4W4KA 1B04A 1KQSU 4LWSA 4N21A 1XNQB 3FYIB 4PA9A 4XDLA 3O9OA 4JI1B 1TVKB 1IURA 3ZHTA 1AI6A 3ETDA 1GMGA 4JGSA 1WN7A 4JI5O 2BCCH 2ZNIA 3JD3A 3BCCH 4IIJB 3STLC 2QKSA 3K9SA 5KMGA 2CK3G 1K9MW 3QVNA 1IDSA 4DR3B 2HP8A 2DWDC 4K8XA 4DV5B 3ZMZA 3CC2V 4DO2A 3BAAA 4O4LA 2WA4A 4MT8A 1NT2B 2QDOA 1JPXA 1D5AA 5H2FZ 3CX5F 2Q7GA 2QR4A 5JJJB 5H9CA 1H2KA 3FKSG 1H2GA 1WP8A 3ZHUA 1HR0B 4O2AA 4DV6O 1GH6A 2K1EA 4DV4B 1YJWV 5KHIA 1VP7A 2YSUB 2X0LA 3A0RA 4MVSA 5B1OA 4MVUA 2CGNA 4B3TB 1VQKV 5B1NA 3RWRD 2UXCO 3CCQV 3JCZA 3KCYA 1FJGO 5CA0A 2X6CA 2PYLA 2AGAA 2ZIOA 1HWYA 1Q81W 1XHZA 2UUAB 3CMEV 3W7WA 1UJWB 5D5QA 3CHXA 3BVOA 1IXBA 4FLTA 2ZR3A 3AG4B 3K0DA 2Q5ZA 1XQ8A 5L3FA 1N33B 3P30A 3APOA 3FAVB 3K06A 4JYCA 3APQA 3S3XA 4OPHA 1M56C 3QO7A 3MAQA 1SA0B 2OIGA 3AG1C 3SJBC 2FB5A 5KHHA 1Q3EA 3SPIA 4B3RO 5LMUB 4LF6B 3L74H 4EFEA 3M8AA 4YIPA 2B9ZA 5KHJA 2OT5A 1GN6A 2KSDA 5IWAO 2ATKC 2B5UA 4CS3A 3CB2A 4UXNA 4MS2A 2KQXA 1M9NA 1NTKH 5EZYA 5LYJB 2XTAA 1RSOB 4WFGA 2VQFB 2IW5A 4PHZA 1MZFA 4DV2B 3CCVV 2AW9A 5HFLA 2B1GA 3UO3A 1MNGA 2CDYA 4UCSA 2JRIA 2PI4A 1K97A 1WB7A 2UUCO 5JQGA 1E1QG 1KB9F 2AHYA 4HNAB 2NLJC 1I94O 2ITCC 3WB1A 2XAHA 3CP1A 3G6BA 1EN4A 5J2TA 1N8RW 3B09A 2P6JA 2XT9A 2GTAA 4DR7O 4Z1MG 3NR7A 4QJFB 1XMOO 3CCSV 5B1AB 2JJ2G 3DXRB 3SJQC 3U11A 2ZDIC 1AR1B 3ETQA 3C3SA 1HNWB 4NTXA 4LF4O 4U3JA 2W0FC 1AJNA 1DF5A 2BTOA 5FLXN 4UV8A 3I5DA 2RJZA 3VQVA 5JH7A 2XAGA 5LP6B 2G38A 2P22C 1P7BA 1XBLA 1MSWD 5J2UB 2P7TC 5LOVB 4J9ZB 1R3JC 2WLHA 4HYOA 4PA7A 4NR1A 4XDJA 1JJ2U 1L0LH 4B3SO 1QR9A 5LGNA 1V9PA 2UU9O 3T1CA 2DYSC 1P7GA 1SS3A 4YJ3A 3IGAC 3OE7G 4NXNO 4BAYA 2PUSA 3OD4A 1Y74B 1PL4A 2KG7A 2UUBB 1PNLA 4TUYA 3ZCCA 1EBOA 2VQEB 1HDJA 2Q7EA 3H01A 1FD9A 1NKDA 1J5EO 1XHXA 4KXRA 3SDLA 3HKCA 4FZ0A 1IBKO 2FTKA 5KAIZ 2Q73A 3OUFA 4NXMB 3K08A 1K73W 2MK3A 3B40A 5CN0A 1B3QA 1NH2B 4PDLA 2ZQMA 4X64O 2PI5A 2P06A 2P67A 4DV3B 4FFBB 2WLKA 5IT9N 4DK1A
chains in the Genus database with same CATH topology
4J7KA 4J7JA 3FX7A 4J10A 2G38A 4IYIA 2GTSA 4IYHA 4KXRA 4W4KA 4W4LA 4J11A 4J41A 4J42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7K A;  4J7J A;  3FX7 A;  4J10 A;  2G38 A;  4IYI A;  2GTS A;  4IYH A;  4KXR A;  4W4K A;  4W4L A;  4J11 A;  4J41 A;  4J42 A; 
#chains in the Genus database with same CATH topology
 4DR2 O;  5EYP A;  3MDS A;  2GSM B;  1ZL8 B;  4FLZ A;  2CH7 A;  2A06 H;  4MTF A;  3A0B Z;  1V55 B;  3UT5 B;  4A5U B;  3OEE G;  5BY1 A;  4CS4 A;  2ZR2 A;  4KUM A;  3RYF A;  1EN6 A;  4OXS A;  4O2B A;  1PV0 A;  4DV6 B;  1I5Y A;  3QG5 A;  4ZKI A;  3ASO C;  1QCE A;  4DV0 O;  3SYO A;  2A3Q A;  4QPJ A;  4ZIB A;  1R6T A;  2ETN A;  1Q6U A;  4X66 O;  2ARH A;  3ABT A;  2UXC B;  4GCZ A;  2UXB O;  3RYI B;  2ZM6 O;  4FIP C;  1E79 G;  4R7C A;  1NQT A;  4JI0 O;  4DXW A;  5CB4 A;  2ZE5 A;  3DSQ A;  2QGN A;  2CTP A;  5IJ9 B;  4PV1 B;  2PZS A;  3AG2 B;  4JI2 B;  1GM9 A;  1PKX A;  4GT1 A;  1VQ4 V;  2L35 A;  2LW7 A;  4GKK O;  2IU0 A;  3ZRW A;  5LXT A;  3CCJ V;  4G2K A;  3W7T A;  3WB0 A;  5BR8 O;  1OCZ B;  4ABM A;  4P9O A;  4HBN A;  4BWA A;  1YCI A;  2PY5 A;  1SQQ H;  2CTQ A;  5DED A;  2LGW A;  5IWA B;  3I55 V;  4JTC B;  3N2G A;  3IC9 A;  1JFF A;  4W4L A;  4DR3 O;  4DR6 B;  1WAZ A;  5L3B A;  1GN3 A;  4DV5 O;  4X1K B;  4IL6 Z;  2DW4 A;  4CC5 A;  2K9P A;  3CE2 A;  1WLE A;  2EIN B;  1BHA A;  2ZKO A;  2YIB D;  3JAS A;  1BE3 H;  4I4T A;  4K3A A;  3CCR V;  1XIL A;  3N27 A;  2DMX A;  4H0L B;  3G71 V;  2ZIM A;  3ZHS A;  2YI9 A;  5IYZ B;  4TT3 G;  1HR0 O;  2ZE6 A;  2RCV A;  1NTM H;  4GKJ O;  2Q8V A;  4DW0 A;  1JCH A;  2QA4 V;  3T1Y O;  1R3L C;  1GN4 A;  3OEH G;  3BY6 A;  3IJ4 A;  4LF7 O;  4IGG A;  2QEX V;  1ZUQ A;  3OMI B;  1R73 A;  5AG2 A;  3MHH C;  1QU7 A;  2WLL B;  3RN4 A;  4DR7 B;  3RYH A;  2E5L O;  1SRY A;  1YXB A;  1N33 O;  1SER A;  2BSK A;  2UXD B;  1CXZ B;  1Q6I A;  2QTS A;  4LF4 B;  4DW1 A;  1X59 A;  4L87 A;  2C2A A;  5BMV A;  1Y6X A;  4IHJ A;  4ASU G;  5B3S C;  3AK3 A;  3T4D A;  5LMU O;  4GX1 A;  4QIW F;  2E3C A;  5IYB O;  5LHG A;  3L70 H;  4IYH A;  4LF9 B;  5LA6 B;  2AZ0 A;  2XAF A;  1TUB A;  3B77 A;  1AR5 A;  1M1K W;  2DQ0 A;  4GX5 A;  2UU9 B;  5KX5 B;  2QTO A;  3JCU Z;  4K8Z A;  4NXN B;  1SES A;  2VQF O;  2LFS A;  1VQ7 V;  4DK0 A;  4XDK A;  2EIL B;  1OZ0 A;  3WFV A;  3HR0 A;  1WPB A;  4I50 B;  3K5N A;  1S5H C;  3K79 A;  4DV2 O;  5IYD O;  4FMT A;  1Y66 A;  2D2C B;  4RUE A;  1FAF A;  1AP6 A;  5CMU A;  4TV9 B;  1YZB A;  2BTQ A;  3M99 B;  5CA1 B;  1NH2 D;  1YJ9 V;  1M56 B;  2R72 A;  3JAM N;  3STZ C;  1KP2 A;  1IBK B;  4U7O A;  1AJQ A;  4K0K O;  3M7M X;  1TA8 A;  3AG1 B;  4Q6G A;  1YJN V;  4JYA O;  2A0L A;  2CUG A;  3LSQ A;  2PGG A;  1JR9 A;  1F4N A;  5KHG A;  3F5W C;  1IX9 A;  1H38 A;  2X6B A;  1E1R G;  1N4C A;  1XI1 A;  1DK1 A;  5KHK A;  1Y76 B;  2IH1 C;  5H5N A;  2W6J G;  4J9Y B;  1SQF A;  1UPG A;  4DR2 B;  3ZHQ A;  5GW7 A;  2DWE C;  4JI7 B;  1Q43 A;  4FM0 A;  3PJS K;  1SET A;  4MTG A;  4WF9 V;  1WP7 A;  1FYJ A;  1NZ6 A;  2EBO A;  4PDR A;  1YEW A;  2JGU A;  5KUM A;  3OUS A;  4B7K A;  4Q20 A;  2QM7 A;  1N34 O;  1RPR A;  5FNV B;  5LHI A;  5KLV H;  4MW3 A;  4F6E A;  2DQ3 A;  1KEC A;  3ZN0 A;  1TAE A;  5L3C A;  4QE7 A;  4ZI7 B;  1R6N A;  2ZM6 B;  4B3M B;  3JAL A;  4I55 B;  3OTO O;  3J81 N;  4X1I A;  3A8T A;  2UUB O;  3LNM B;  2VQE O;  5DM6 V;  3VQY A;  1EN5 A;  3RYC B;  5B66 Z;  1S5J A;  1ZX3 A;  3SPH A;  3JSN A;  3THO A;  3K9A A;  3T1H O;  2IJH A;  4GKK B;  2LW1 A;  4YXW G;  1PPJ H;  4EB6 B;  3JD4 A;  1AJP A;  5BR8 B;  2CGO A;  5ITZ A;  5C8Y A;  2JGD A;  4FJC C;  4ZOL B;  3LSS A;  4NXM O;  1N0J A;  3JAW B;  4LH7 A;  4MVR A;  2PF4 E;  3MD0 A;  4B08 A;  3GWO A;  4TV8 B;  2M7W A;  4RQE A;  4GYC B;  2ZCE A;  4DRX B;  4QNH B;  3DC5 A;  3SYA A;  5KAF Z;  1VMG A;  3CXH F;  2QKA A;  5IJ0 A;  1OCC B;  4AQY B;  4DV3 O;  2PTM A;  3P32 A;  4HZ3 A;  3GWK C;  2DYS B;  2RQ6 A;  4O4H A;  3CYO A;  3N2K A;  3GVM A;  4FLW A;  1GM8 A;  1G1X B;  2LFR A;  1AR4 A;  3SGI A;  3AEI A;  1AI7 A;  4YJ2 A;  2OTJ V;  4LWS B;  3SR2 C;  2Q0O C;  4PEL A;  4GKJ B;  1GM7 A;  5KA5 A;  3FB8 C;  1SA0 A;  4PI0 A;  1NR1 A;  3T1Y B;  4F6R A;  4X1Y A;  3JD0 A;  3W7U A;  2CTR A;  4PD4 F;  5TIS Z;  1ORQ C;  4LF7 B;  3D3I A;  4TOI A;  4NTW A;  2WLN A;  2EIL C;  2GBO A;  1XMQ B;  2WLI A;  5K1X A;  4UVB A;  5KMG B;  4GUN A;  4EEQ A;  2E5L B;  2JK5 C;  1GAX A;  4DUZ B;  4MTX A;  4U3F H;  2WA3 A;  4JI2 O;  2QE7 G;  3CXC U;  4O4J A;  3CSX A;  1RSO A;  1H2N A;  3HB3 B;  1FXK C;  1P4R A;  4O4L B;  1HNZ B;  4LCU C;  4H33 A;  3JAR A;  1IXM A;  1SZT A;  2YEV A;  4N23 A;  5K1P A;  1R3K C;  3CCM V;  1XL4 A;  2YIB A;  4H13 B;  3FD9 A;  1GK9 A;  2DJV A;  3ASO B;  3ZIA G;  3FFQ A;  2N05 A;  1NTZ H;  1VQ5 V;  3SJA C;  2QJ1 A;  1S0V A;  4DR6 O;  3CMA V;  4DR5 O;  2GUZ A;  1URF A;  2BE3 A;  4RUF A;  3D8C A;  2F66 C;  2F43 G;  1W59 A;  3RT3 C;  5CA0 B;  3SYP A;  2DYR C;  2JVD A;  1W2B U;  1COW G;  2HLD G;  5L3G A;  5BZB A;  2WLM A;  3Q4H A;  1FPO A;  2EJR A;  3KKY A;  2CE4 A;  2Y48 A;  4K0K B;  4JI4 O;  2B1I A;  5JJE B;  3K58 A;  4JYA B;  5L3D A;  1V54 C;  5LP6 A;  3BRC A;  4J42 A;  2VWJ A;  1YDX A;  3CJH A;  4J10 A;  5C93 A;  3UO2 A;  1RFY A;  3OAA G;  1JJO A;  4TSF G;  2UXX A;  4LFC O;  4UB8 Z;  1WNS A;  4FVM A;  2YDE A;  1K3E A;  2XAS A;  3CS5 A;  3CCU V;  2UXD O;  1R1B A;  2ADP A;  1LR1 A;  4X65 O;  1NI8 A;  5EZY B;  4FK5 C;  1QR8 A;  1Y74 A;  3P3N A;  1K33 A;  2JDI G;  1SZX A;  4YHH O;  4MVO A;  1ARO P;  1U96 A;  1K8A W;  2JS3 A;  3JD1 A;  2Z0A A;  2ZNJ A;  3RGB A;  1N34 B;  2ZE8 A;  1K4C C;  1XUQ A;  2FL4 A;  3K0G A;  3G67 A;  1OCC C;  4AIL C;  4MTO A;  4LF9 O;  2XAQ A;  2N04 A;  1QNM A;  5JQG B;  1FXV A;  1AP5 A;  3KCX A;  4D7T A;  1BGY H;  1XDC A;  1S5L Z;  3JAT B;  4KFM A;  2KB1 A;  3OTF A;  5JCO C;  4BIO A;  3OTO B;  4P30 A;  5J2T B;  1EZJ A;  4GZR B;  4I5S A;  1CEZ A;  5CBH A;  3DC6 A;  4FFB A;  1R6K A;  2LO1 A;  2EZO A;  3ZX6 A;  4GX2 A;  4LR3 A;  3D36 A;  4UB6 Z;  3T1H B;  4AI8 A;  1ZL8 A;  3B2E E;  5EK0 A;  4U3J B;  4X20 A;  3F5T A;  4GLX A;  4X89 A;  5EBM C;  2Q9L A;  2EZP A;  1U97 A;  2HJD A;  4OPA A;  5B3S B;  4FFK A;  3A2F A;  4OX9 O;  4O4I A;  5GTI Z;  2Q6A A;  1JMK C;  3ZJZ A;  2HJF C;  2YI8 A;  1MA1 A;  2HFE C;  4WBN A;  5DEC A;  1IZ3 A;  1O9G A;  4JI7 O;  1VF7 A;  3WB2 A;  2XOK G;  3E22 A;  4YJ3 B;  1I0H A;  2X7R B;  3J7A U;  4LFA O;  2KG7 B;  4TUY B;  3H1J H;  1NBM G;  5LGU A;  2E76 B;  1M57 C;  1FS0 G;  1UFI A;  3CRA A;  1SQX H;  3DTU B;  3CC7 V;  1F51 A;  1QLE C;  1Q8I A;  1PD3 A;  3IAY A;  2YS8 A;  3HKC B;  1L1F A;  3ICX A;  4H44 B;  3K59 A;  2O57 A;  2OIE A;  4B3M O;  1WA8 B;  2QM8 A;  3OR7 C;  4E2L A;  4E4E A;  1Q6H A;  4DV1 O;  3F7Y C;  4JYB A;  4JPR A;  4NKG B;  2M6Y A;  3TJT A;  1WPX A;  3H1L H;  4GX0 A;  1Q5O A;  2Q69 A;  2RMK B;  4DR4 O;  4UVA A;  3JD2 A;  4IT5 A;  2WAM A;  1BSM A;  4UCO A;  1WB8 A;  1KMI Z;  4R8C A;  1HW7 A;  2ZXW C;  4JI6 O;  1F7Y A;  1XNR B;  3TK1 A;  3WG7 C;  3FYE B;  2A7W A;  2YID A;  1BQZ A;  1KUQ A;  2GDS A;  5IYZ A;  3ETG A;  3RYF B;  3ZRX A;  1AI4 A;  4LBE C;  5EIB C;  3BEH A;  1RM1 C;  2QWP B;  4O2B B;  2H94 A;  4TWK A;  1TUE B;  4ZHQ A;  4AQY O;  4I0X A;  4AHC A;  5D5P A;  4DR5 B;  2OCC C;  4X88 A;  5E1A C;  4WFA V;  2F23 A;  1Q82 W;  2VRZ A;  2OWO A;  3OT7 A;  1DLB A;  5CB4 B;  1QBZ A;  3JYC A;  4FLY A;  2WWW A;  2QM4 A;  3UKM A;  4KHP B;  2P4V A;  2QSA A;  1NJI W;  3HKE A;  1F4M A;  3ZRW B;  5DN6 G;  5LXT B;  2NNU A;  4JI4 B;  2F93 B;  4RAI A;  1H2S B;  1K4D C;  1IBL O;  1J95 A;  3L75 H;  3AG7 A;  3HKD A;  5KUK A;  1XMQ O;  4LNU A;  2F1M A;  3MHS C;  1F23 A;  5LA6 A;  5JVD A;  4LFC B;  3N2G B;  4YY3 B;  1JFF B;  1XRE A;  4DUZ O;  4CC6 A;  1TGO A;  2QWQ B;  3H9V A;  4MVZ A;  4UVC A;  4I9W A;  4X65 B;  1HNX B;  1JA8 A;  2V4D A;  1BT8 A;  4TQD A;  1HNZ O;  4LF8 O;  1MG1 A;  4YHH B;  1NVP B;  3JAS B;  3HKB A;  4WFH A;  4JYY A;  2EIK C;  4I4T B;  3VQX A;  2NR5 A;  5CA1 A;  3OR6 C;  2D3O W;  2MW2 B;  4KP4 A;  2A9H A;  5GON A;  3JAK A;  4DV7 B;  2NN4 A;  1ZWI C;  3LUT B;  1VQO V;  3W7X A;  3SPC A;  3E83 A;  1GRJ A;  4LH6 A;  1DF4 A;  2LQT A;  3D36 C;  4F4L A;  1ENV A;  2BSK B;  3OM3 B;  2CAZ C;  2ZD9 A;  1W0J G;  1AVM A;  1G4Y B;  4DR1 B;  3ZHR A;  1VEW A;  1VF5 B;  1FXK B;  4QGP A;  2IU3 A;  5BMV B;  1Z5W A;  3TXS A;  2EIJ C;  4CBC A;  3ABK C;  4P9P A;  4OX9 B;  1VQN V;  1OCR C;  1Z2G A;  2E74 B;  1YIT V;  1Y4M A;  4D7S A;  3BAB A;  4PA6 A;  1FFX A;  4EFB A;  2RDC A;  1THZ A;  3LDE A;  1K7D A;  2KKW A;  5LHH A;  1SQG A;  3J80 N;  1XL6 A;  3F7V C;  3ZMV A;  4LFA B;  3S3W A;  1T5E A;  4QE9 A;  5HFM A;  2DYR B;  1SC5 B;  3L71 H;  2L6L A;  3RFR A;  4LF5 O;  2F95 B;  1VF6 A;  4UFZ A;  3ABM C;  5F2V O;  1TVK A;  2BTQ B;  2DN9 A;  3P3P A;  2YXH A;  3CEI A;  4ZOL A;  2YIC A;  1AB3 A;  3SYQ A;  1MZE A;  1K5Q A;  1PL0 A;  2IM9 A;  1ZTE A;  3BFR A;  3ETE A;  2QWN B;  3ZRS A;  2ODM A;  4IIJ A;  2WPD G;  4JI8 O;  1V54 B;  5IY5 C;  3OMN B;  4DV1 B;  3X2Q C;  4DR4 B;  3DGE A;  3OGC C;  2OTL V;  4QPK A;  2WSS G;  3SPJ A;  1KBH A;  3BA9 A;  2GV9 A;  5EC1 C;  4JI6 B;  3CCE V;  3I56 V;  4R6Z A;  4RQF A;  3L9D A;  4H37 A;  2RNB A;  3SYC A;  2R9I A;  4K35 A;  1VAR A;  4FPP A;  4Z1V A;  3IFX A;  1SQP H;  3CRC A;  4ICG A;  1MAB G;  3ZHV A;  3B4S A;  1YSC A;  3JAL B;  1QHT A;  5KA6 A;  2V1D A;  3D3Q A;  3CD6 V;  4LFB B;  5LBQ A;  1L0N H;  1ZLZ A;  4X1I B;  5EC2 C;  2F4V O;  2JEU A;  3FAV A;  1EZV H;  3CC4 V;  3EXA A;  5A9G A;  3W7S A;  3SPG A;  1Q90 D;  3WU2 Z;  4NVP A;  5ITZ B;  5C8Y B;  2JGD B;  1VQP V;  1B6Q A;  1VQM V;  2JJ1 G;  3ML0 A;  1IBL B;  2W6I G;  1H8H G;  3SJC C;  2H3O A;  2R70 A;  1BL8 A;  3RW0 A;  3K5L A;  4FLX A;  3R65 A;  4X8A A;  4JTA B;  4WCE V;  1JOY A;  1NVP D;  5B1B C;  5IJ0 B;  3LDD A;  2WLJ A;  4J7K A;  3ASN C;  4MSW C;  3VOU A;  4JI3 O;  3T4Z A;  1K34 A;  2ILM A;  2Q0A A;  1LUW A;  1SF9 A;  1QQC A;  1ZSP A;  5LYJ A;  4JF3 A;  1G8M A;  3TGU H;  4FLV A;  4B7E A;  4I7Z B;  5J9P C;  4LF8 B;  2JIZ G;  1XNR O;  4O4H B;  1GO3 F;  2Q67 A;  3N2K B;  1GTO A;  1IBM B;  3CCL V;  3AK1 A;  3CRR A;  4FLU A;  4PJ0 Z;  2Y69 C;  2GTS A;  5IYC O;  4YJ2 B;  1VIB A;  5L3E A;  3QO8 A;  5BXZ A;  1FKA O;  4O2A B;  4BIZ A;  1M57 B;  1AI5 A;  3RVY A;  1KD1 W;  1QLE B;  4HNA A;  4F6R B;  2Y4U A;  4X1Y B;  1W0K G;  5LMN B;  3BA8 A;  2Y0P A;  2HEP A;  1IVS A;  5E79 Z;  3G6E V;  4BIU A;  4RO2 A;  2H8P C;  4C7U A;  2WLI B;  1LUV A;  5JJN B;  3DXR A;  3ABL B;  3OGI B;  3EHB B;  2HR3 A;  4KHP O;  2VS0 A;  2R9R B;  4PDM A;  4O4J B;  1S77 D;  2EIM C;  3TET A;  4PA3 A;  2ZXW B;  2QWR B;  3JAR B;  2YEV B;  1PNM A;  2HHH O;  1EM1 A;  3WG7 B;  5J2U A;  5LOV A;  3E89 A;  2DOS A;  1RM1 B;  4YY3 O;  2EJ7 A;  3O65 A;  4CS2 A;  2XUM A;  3BHP A;  3JAT A;  4CH5 A;  2QWO B;  1NU1 H;  3HPL C;  3ZMS A;  1KKC A;  2OCC B;  2GUZ B;  1HNX O;  4J11 A;  1AIL A;  4UUJ C;  1FFT B;  1ZAU A;  2PYJ A;  5IE9 A;  3NXS A;  4L8J A;  4JV5 O;  3K57 A;  1H2L A;  1YF2 A;  4LF5 B;  1VF6 C;  4X62 O;  2Y4T A;  1ROP A;  2VWK A;  3Q4H B;  1SQV H;  1H2M A;  1D5N A;  3ZS8 C;  5JWP A;  1YVW A;  4UCV A;  4DV7 O;  1N32 O;  2ZE7 A;  4BW5 A;  4DUY O;  4JI8 B;  1YIJ V;  1OHH G;  3CJH B;  1XOU A;  2YC0 A;  1DGS A;  4IYI A;  5H6R A;  2BOB C;  1KC8 W;  3AK2 A;  4CH6 A;  3ZMU A;  3QNE A;  3UT5 A;  5H6Q A;  3LNN A;  4DR1 O;  4MVM A;  1PP9 H;  4HAM A;  4MVQ A;  2GHY A;  2YUA A;  3GB7 C;  3CPW U;  5CBG A;  4TQF A;  2EIK B;  5JH7 B;  3ZBH A;  5IDJ A;  1M4U A;  1NS1 A;  2YXL A;  3OFN G;  4J7Z A;  1GN2 A;  3K5O A;  1P84 F;  2LJ2 A;  3H1K H;  1I5X A;  1BCC H;  5LL6 Y;  3RBZ A;  1Q86 W;  4X9Q A;  4CH3 A;  3CWB H;  2V7Q G;  3RYI A;  4JI5 B;  1WA8 A;  2OYQ A;  3KZI Z;  4JZ2 A;  1BQ0 A;  1N36 O;  3AG4 C;  3U10 A;  1OJH A;  1NR7 A;  5IJ9 A;  2F4V B;  1EFR G;  1WJZ A;  1B06 A;  4KL1 A;  4UCR A;  1X4T A;  4NTY A;  3K5M A;  2IJK A;  4X20 B;  3L72 H;  4MW8 A;  3FB5 C;  3ZMT A;  3PN1 A;  4FZ1 A;  3K3W A;  1OCO B;  1QVF U;  1D2D A;  1QVG U;  1I7F A;  2EIJ B;  3ABK B;  1OCR B;  1A32 A;  4O4I B;  3ZRV A;  3C3T A;  2XHB A;  3ABL C;  4X1K A;  1YTF B;  1CPY A;  1S76 D;  4JI3 B;  4D6T H;  3LDC A;  3K03 A;  1O9H A;  1OV9 A;  4WBN B;  5EYP B;  3RVZ A;  1FJG B;  1FXH A;  2CH7 B;  2Q7H A;  2YIA A;  3E22 B;  1KU9 A;  4JZG A;  3E35 A;  1DTO A;  3CRQ A;  2OCH A;  1SKV A;  1L8D A;  3AG3 B;  1Q7Y W;  4JAS A;  1XNQ O;  4LC1 A;  4JI1 O;  3ABM B;  4J41 A;  5CA3 A;  4FM1 A;  2HKO A;  3E8B A;  4JAU A;  2IBZ H;  2X6A A;  1MOF A;  3E86 A;  3UCS C;  4B3R B;  2AXT Z;  3K04 A;  1PM9 A;  2HG5 C;  4LFB O;  1KYO F;  2WLL A;  1MMM A;  3G80 A;  5IY5 B;  2CTW A;  1GKF A;  3H1I H;  1LNQ A;  5B1A C;  4FM2 A;  1QLN A;  5FPR A;  3X2Q B;  2FYU H;  1M5I A;  3T2M A;  1US6 A;  4J7J A;  1Z5V A;  2RN9 A;  5EIB D;  3TXQ A;  3BPZ A;  1XEQ A;  3E8F A;  1M90 W;  4PI2 A;  2Q68 A;  5LP6 C;  3R66 A;  2HHH B;  1S72 V;  2IJJ A;  4PDV A;  3CRM A;  4DV4 O;  5FPO A;  2UUC B;  4DYL A;  4J80 A;  4ZHQ B;  5CBF A;  2AHZ A;  4I0X B;  4B3T O;  5KX5 A;  2XND G;  1I94 B;  3E8H A;  1H8E G;  3U0Z A;  3QO5 A;  3QF7 A;  4I50 A;  5EBW C;  4WFF A;  2UUA O;  2IJI A;  1M93 A;  4OGQ B;  3L73 H;  2W0X A;  4JV5 B;  1XMO B;  4TV9 A;  1IBM O;  2FKX A;  2Z3Y A;  4X62 B;  1K5S A;  3FB6 C;  3EFF K;  1PNK A;  4CH4 A;  2Y0I A;  2ITD C;  2DE0 X;  1BMF G;  3VBB A;  1BHB A;  3HKE B;  1FXK A;  2HVK C;  1N32 B;  4ZBM A;  1JX9 A;  4DUY B;  1P49 A;  1S3J A;  4LF6 O;  3A0H Z;  3LSU A;  3UM7 A;  5LMN O;  2P5O A;  5GTH Z;  3C90 A;  4NB5 A;  4UV9 A;  1R3I C;  2XAJ A;  4EKW A;  3HKD B;  1N0N A;  2BOC C;  1YHQ V;  1BS3 A;  4LNU B;  3VQW A;  5JVD B;  1Y76 A;  1HP8 A;  3RYH B;  3TCU A;  4B3S B;  2JS5 A;  5B1B B;  5B5E Z;  1Y67 A;  3ABU A;  1KKD A;  3ASN B;  4PA4 A;  4XBF A;  1V55 C;  1RPO A;  3B8N A;  5FL7 G;  1SQB H;  1JQ0 A;  1OCO C;  2N74 A;  4IHJ B;  3HKB B;  5LGT A;  3ZED A;  2HVJ C;  5FNV A;  3EVK A;  2Y69 B;  4JAV A;  1J5E B;  2EX3 A;  1MSD A;  1G6U A;  4U7N A;  1BZK A;  5GON B;  1VQ9 V;  1I08 A;  1TUB B;  3JAK B;  4ZI7 A;  3B8M A;  3JSL A;  4BW9 A;  4I55 A;  2UXN A;  3E8G A;  2Q4P A;  2AZ2 A;  5EBL C;  2ZT9 B;  1N36 B;  1KP3 A;  2A79 B;  4X64 B;  2JEX A;  3RYC A;  3AG3 C;  3AG2 C;  1JVM A;  4UCT A;  4G27 B;  3OW2 U;  3G4S V;  2ZDI A;  4WFB V;  3FB7 C;  1HNW O;  4EB6 A;  3KG2 A;  3ZN1 A;  1OCZ C;  4RWU A;  3H1H H;  4UCU A;  2EIM B;  1VQ6 V;  3JAW A;  1YTF D;  4JTD B;  1K92 A;  4CZZ A;  4TV8 A;  1CP9 A;  5A2Q N;  2ADQ B;  4DRX A;  4Z2W A;  4I9Q A;  2FML A;  3IC7 A;  4DV0 B;  1VQL V;  3OMA B;  2EUL A;  2LP7 A;  4LP8 A;  1VQ8 V;  3E2E A;  4X66 B;  2LGQ A;  2E75 B;  1FFX B;  3UQ8 A;  4YIO A;  2ZIN A;  2P4K A;  2EIN C;  2QKC A;  4R50 A;  4BR6 A;  2UXB B;  2IH3 C;  2R9A A;  4JI0 B;  4WFE A;  2P90 A;  4P2Z A;  4JAA A;  1YI2 V;  1RP3 B;  5JCO A;  2Z5U A;  4G28 B;  3QTC A;  3FX7 A;  4NYK A;  2YXY A;  4W4K A;  1B04 A;  1KQS U;  4LWS A;  4N21 A;  1XNQ B;  3FYI B;  4PA9 A;  4XDL A;  3O9O A;  4JI1 B;  1TVK B;  1IUR A;  3ZHT A;  1AI6 A;  3ETD A;  1GMG A;  4JGS A;  1WN7 A;  4JI5 O;  2BCC H;  2ZNI A;  3JD3 A;  3BCC H;  4IIJ B;  3STL C;  2QKS A;  3K9S A;  5KMG A;  2CK3 G;  1K9M W;  3QVN A;  1IDS A;  4DR3 B;  2HP8 A;  2DWD C;  4K8X A;  4DV5 B;  3ZMZ A;  3CC2 V;  4DO2 A;  3BAA A;  4O4L A;  2WA4 A;  4MT8 A;  1NT2 B;  2QDO A;  1JPX A;  1D5A A;  5H2F Z;  3CX5 F;  2Q7G A;  2QR4 A;  5JJJ B;  5H9C A;  1H2K A;  3FKS G;  1H2G A;  1WP8 A;  3ZHU A;  1HR0 B;  4O2A A;  4DV6 O;  1GH6 A;  2K1E A;  4DV4 B;  1YJW V;  5KHI A;  1VP7 A;  2YSU B;  2X0L A;  3A0R A;  4MVS A;  5B1O A;  4MVU A;  2CGN A;  4B3T B;  1VQK V;  5B1N A;  3RWR D;  2UXC O;  3CCQ V;  3JCZ A;  3KCY A;  1FJG O;  5CA0 A;  2X6C A;  2PYL A;  2AGA A;  2ZIO A;  1HWY A;  1Q81 W;  1XHZ A;  2UUA B;  3CME V;  3W7W A;  1UJW B;  5D5Q A;  3CHX A;  3BVO A;  1IXB A;  4FLT A;  2ZR3 A;  3AG4 B;  3K0D A;  2Q5Z A;  1XQ8 A;  5L3F A;  1N33 B;  3P30 A;  3APO A;  3FAV B;  3K06 A;  4JYC A;  3APQ A;  3S3X A;  4OPH A;  1M56 C;  3QO7 A;  3MAQ A;  1SA0 B;  2OIG A;  3AG1 C;  3SJB C;  2FB5 A;  5KHH A;  1Q3E A;  3SPI A;  4B3R O;  5LMU B;  4LF6 B;  3L74 H;  4EFE A;  3M8A A;  4YIP A;  2B9Z A;  5KHJ A;  2OT5 A;  1GN6 A;  2KSD A;  5IWA O;  2ATK C;  2B5U A;  4CS3 A;  3CB2 A;  4UXN A;  4MS2 A;  2KQX A;  1M9N A;  1NTK H;  5EZY A;  5LYJ B;  2XTA A;  1RSO B;  4WFG A;  2VQF B;  2IW5 A;  4PHZ A;  1MZF A;  4DV2 B;  3CCV V;  2AW9 A;  5HFL A;  2B1G A;  3UO3 A;  1MNG A;  2CDY A;  4UCS A;  2JRI A;  2PI4 A;  1K97 A;  1WB7 A;  2UUC O;  5JQG A;  1E1Q G;  1KB9 F;  2AHY A;  4HNA B;  2NLJ C;  1I94 O;  2ITC C;  3WB1 A;  2XAH A;  3CP1 A;  3G6B A;  1EN4 A;  5J2T A;  1N8R W;  3B09 A;  2P6J A;  2XT9 A;  2GTA A;  4DR7 O;  4Z1M G;  3NR7 A;  4QJF B;  1XMO O;  3CCS V;  5B1A B;  2JJ2 G;  3DXR B;  3SJQ C;  3U11 A;  2ZDI C;  1AR1 B;  3ETQ A;  3C3S A;  1HNW B;  4NTX A;  4LF4 O;  4U3J A;  2W0F C;  1AJN A;  1DF5 A;  2BTO A;  5FLX N;  4UV8 A;  3I5D A;  2RJZ A;  3VQV A;  5JH7 A;  2XAG A;  5LP6 B;  2G38 A;  2P22 C;  1P7B A;  1XBL A;  1MSW D;  5J2U B;  2P7T C;  5LOV B;  4J9Z B;  1R3J C;  2WLH A;  4HYO A;  4PA7 A;  4NR1 A;  4XDJ A;  1JJ2 U;  1L0L H;  4B3S O;  1QR9 A;  5LGN A;  1V9P A;  2UU9 O;  3T1C A;  2DYS C;  1P7G A;  1SS3 A;  4YJ3 A;  3IGA C;  3OE7 G;  4NXN O;  4BAY A;  2PUS A;  3OD4 A;  1Y74 B;  1PL4 A;  2KG7 A;  2UUB B;  1PNL A;  4TUY A;  3ZCC A;  1EBO A;  2VQE B;  1HDJ A;  2Q7E A;  3H01 A;  1FD9 A;  1NKD A;  1J5E O;  1XHX A;  4KXR A;  3SDL A;  3HKC A;  4FZ0 A;  1IBK O;  2FTK A;  5KAI Z;  2Q73 A;  3OUF A;  4NXM B;  3K08 A;  1K73 W;  2MK3 A;  3B40 A;  5CN0 A;  1B3Q A;  1NH2 B;  4PDL A;  2ZQM A;  4X64 O;  2PI5 A;  2P06 A;  2P67 A;  4DV3 B;  4FFB B;  2WLK A;  5IT9 N;  4DK1 A; 
#chains in the Genus database with same CATH homology
 4J7K A;  4J7J A;  3FX7 A;  4J10 A;  2G38 A;  4IYI A;  2GTS A;  4IYH A;  4KXR A;  4W4K A;  4W4L A;  4J11 A;  4J41 A;  4J42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...