4J7KA

The crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
b'NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGQFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords secreted protein EsxB
publication title The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
total genus 40
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7kA00
4J11A 4J7KA 4IYHA 4J41A 4J10A 4KXRA 4J42A 4IYIA 4W4KA 3FX7A 4J7JA 2GTSA 2G38A 4W4LA
chains in the Genus database with same CATH superfamily
4AQYO 3QG5A 2A9HA 3L75H 1QLEC 4J10A 4QNHB 3ZHUA 3CCUV 1YEWA 1D5AA 1K4CC 2AW9A 3LUTB 2BTOA 1KKCA 3OUFA 2MW2B 2QE7G 4FK5C 5AG2A 4JI2B 2ITCC 1TVKA 1SQXH 1CXZB 1I0HA 3MD0A 2JGDB 4NKGB 4NVPA 3N2KB 2YI8A 4H13B 3JATA 2A7WA 3FKSG 2RMKB 1N36O 2R70A 4WFAV 2Q8VA 2B5UA 4TWKA 1NH2B 2ETNA 3AEIA 4AILC 4Z1MG 4FM1A 3CRAA 1AR4A 5J2UA 2P22C 2ZM6O 4I5SA 1EZJA 4DV1O 1EZVH 1R6NA 1AB3A 5KX5B 1H8EG 2YSUB 4DV3B 4MVSA 1AI5A 1K34A 4HZ3A 4JYCA 4MW8A 4O4LA 3RGBA 3L72H 4I7ZB 4QE9A 2OTJV 1S5JA 4FLXA 5LYJB 3IFXA 4LF6B 4FLUA 3E35A 5CA1A 2RN9A 1AJQA 1Q43A 4R7CA 3ZRVA 4JZ2A 2PI5A 1YITV 5IJ9B 2N04A 2ARHA 4NXNO 4FLYA 1RSOA 5EBMC 1OCCC 4UB8Z 3W7SA 1N33O 3L70H 4KFMA 1RPRA 4YIPA 1V9PA 5DECA 4GKKO 4PI2A 2OCHA 4WBNB 1JCHA 5KAIZ 4X1IB 2CGNA 3SYAA 2Q7GA 2WLJA 1OCZB 1QHTA 1H2NA 5EC1C 1FFTB 1QCEA 4F6RA 2CDYA 1Q90D 2GTAA 4H33A 1NI8A 2ODMA 4GKJO 4K8ZA 3GWKC 5L3CA 1K73W 5H2FZ 4LFCB 2EBOA 4JASA 4YHHB 4GCZA 2ZKOA 1AR1B 2AGAA 4HNAA 2Y0IA 4MTOA 1XBLA 2QM4A 1KD1W 2WWWA 1P7BA 4OX9O 1TVKB 5JWPA 5L3EA 1FXVA 1SF9A 2UXDO 4DR2B 3PN1A 3JATB 5LXTA 1AVMA 4UUJC 3JASA 3A0RA 5KHHA 4UVCA 1YF2A 5K1XA 4PA3A 2GSMB 1NVPD 5IYBO 1KP3A 4Z2WA 1K4DC 4NTYA 5KLVH 2OCCB 3C90A 3M99B 5J2UB 3OW2U 1M5IA 1XNQO 4DUZO 3BCCH 2DYSB 3D3IA 4O2AB 2BOCC 3CCRV 1BCCH 1DK1A 3ABLC 4X64B 2OWOA 4X88A 2P6JA 4QPKA 5LP6A 1A32A 2DOSA 1I5XA 1QLEB 5LHIA 2HHHB 2F1MA 4I50A 5CA1B 4R6ZA 2E5LO 4MVQA 3AG1C 4KUMA 4DR4O 3CRQA 3OTOO 2ZD9A 4YJ2A 3OFNG 3F5WC 2UUCB 3ETDA 4P9PA 5B1NA 3VBBA 2KSDA 2OIGA 1RSOB 1OCRB 1RP3B 3QVNA 2G38A 1R3JC 2N05A 4DUYB 3MAQA 1BT8A 3SPJA 3K5OA 5BMVA 1S72V 3QO5A 1CP9A 1VF6A 2WA3A 1NTKH 3CC7V 1YDXA 2DYRC 4WFHA 2KB1A 3P30A 2GV9A 3LDDA 4F6RB 3OMNB 1XOUA 3RVYA 2ZDIC 4JV5O 3I5DA 2DMXA 3IC9A 1B6QA 4J42A 2CTQA 5LL6Y 3KCYA 1F23A 5B3SB 5LMNO 1NH2D 4PA6A 1DF4A 1VQNV 2F43G 2Y69C 4TQDA 4I0XB 5LXTB 2R72A 5BY1A 3JAKA 3ZRWA 1H2SB 1B04A 3ABKB 2M6YA 4JI2O 3SJAC 3CRRA 5J2TB 3Q4HA 3JYCA 2F23A 4JPRA 3W7XA 3H9VA 2YXYA 3DXRA 1WA8A 2YIBA 2CE4A 2PGGA 2XT9A 4FJCC 5BR8B 4IIJA 3SYQA 4UXNA 3UKMA 2A06H 2X6AA 1S0VA 2PF4E 5CB4A 1WPBA 2FB5A 2CAZC 3JALA 5KHJA 4JTCB 1LUVA 1PM9A 3FAVA 1KECA 2ZT9B 2D3OW 3HPLC 3G6BA 1M90W 1ENVA 5LP6B 2EIMC 1SQFA 2QTOA 4FLTA 4CZZA 3VOUA 5LHGA 3U11A 4MTXA 4BIOA 2PZSA 4BIUA 4I50B 1M56B 1WNSA 4J41A 2DN9A 3G80A 4FLVA 2YIAA 2RDCA 2YIDA 4LF6O 4YJ2B 5GTIZ 4JI0B 4WCEV 4JZGA 1F51A 1AI4A 3FD9A 3ETGA 2FKXA 2XNDG 4X20A 3OGCC 1JOYA 2QWNB 3ETEA 2W0FC 2F4VB 3ZN1A 2E76B 4LFBO 1ZL8A 3E86A 4CH5A 4PDMA 2LO1A 1KC8W 2ZE7A 4NTXA 5CA0B 2RQ6A 1XMOB 4WFGA 2QKSA 2LQTA 4AHCA 2QSAA 2VQFB 3STZC 4O4JA 4DO2A 3FYEB 3LSQA 1XL6A 2EINC 3EHBB 1YJ9V 3QO8A 1I94B 4RAIA 3OTFA 1UPGA 1WB8A 1OJHA 4W4LA 1OV9A 2WLHA 4UCOA 2FYUH 5F2VO 3ABMB 3RW0A 1HNWB 4FMTA 3JD1A 4X65O 1Y76A 1MSWD 4LFCO 2Q7HA 3QTCA 1FS0G 3JAKB 2BOBC 2DJVA 4J7JA 1PPJH 3K58A 3SYCA 4D7SA 3HKDB 1E79G 3ASNC 4DR2O 4TV9B 3DXRB 1WA8B 3K0DA 3BABA 3FYIB 4RO2A 4XBFA 4IIJB 2JGDA 2H94A 3N2KA 2QGNA 1KP2A 1I5YA 3CC2V 1XDCA 3JALB 1KQSU 1KMIZ 3CD6V 3FAVB 1TUEB 4L8JA 4JI1B 5H6RA 5C93A 2VS0A 1NS1A 1H2KA 2ZXWC 1E1RG 3JD4A 2HJFC 1G8MA 2ZIMA 1GRJA 4DV6B 1H2GA 1AP6A 5KMGB 3WU2Z 4UVBA 1XREA 5L3DA 1NBMG 1SQVH 4RQEA 4ZHQA 3ZHSA 3FB6C 2HHHO 4H37A 4DR6B 2XTAA 3X2QC 1Q86W 2YDEA 1H8HG 1V55C 2Z5UA 5BXZA 1HNXB 5KA5A 4CC6A 2IU3A 1FXKB 1I7FA 3CS5A 5LYJA 1SQGA 1ZSPA 1GKFA 2Q68A 4IGGA 2YI9A 2UUCO 4JI5B 4X20B 2Y0PA 4JI3B 1MA1A 1EM1A 2NLJC 3AG2C 3OD4A 4DUYO 1YCIA 1VF5B 1AP5A 3SPIA 5L3FA 5LMUB 4X1KB 3K5LA 1VQKV 5B1AC 3CMEV 2DQ3A 2RNBA 3J7AU 3KCXA 1R3KC 3CRCA 3C3SA 3T4ZA 4WBNA 2Q0AA 5KUMA 2XAJA 1QVGU 3OEEG 1AJNA 1EN6A 1KBHA 4FFKA 4NXMB 2WAMA 5B5EZ 2XHBA 1QU7A 4YY3B 2EILB 2F93B 4I9QA 2OIEA 2RJZA 5KAFZ 4K8XA 3APOA 4X8AA 3ETQA 3IJ4A 4NR1A 2LGWA 4O2BA 1U96A 1JQ0A 1S76D 3UM7A 1NQTA 3E89A 3DSQA 2W6JG 1Y4MA 4XDKA 3G4SV 4JAUA 1KU9A 3J81N 3OAAG 2UXBB 4LP8A 2IBZH 4QIWF 5GTHZ 3RYCA 2JDIG 2KG7B 4JAAA 4N21A 4PV1B 4YXWG 5EC2C 5JCOA 2WLLA 3JAMN 3AG3B 3M8AA 1HDJA 4D6TH 4O2AA 4OXSA 4G2KA 4J80A 1VEWA 1Q6IA 5E1AC 2ZE6A 3B2EE 4X62O 2ZQMA 1NT2B 3U10A 1JFFA 4ZHQB 3K5NA 1S5HC 3E8FA 5A2QN 4PI0A 3CJHB 4JI6B 2OYQA 2IJIA 4OGQB 3RYFB 4MT8A 2QKAA 3ZHQA 5CBHA 2A0LA 2ITDC 1N32B 2GDSA 3ZN0A 2Q7EA 4EB6A 5LA6A 2JRIA 1VQ8V 2Y48A 2HP8A 1OCOB 2EZPA 4JI0O 4GYCB 4ZIBA 1P49A 4DYLA 2ADPA 3DTUB 1VIBA 4LBEC 4B08A 1J95A 5EK0A 1QQCA 3CP1A 5HFMA 1RM1B 3D36C 1F4MA 1PNLA 1EBOA 4XDJA 5HFLA 4EKWA 1GN2A 2F4VO 2EJ7A 2DWDC 2QTSA 1GM7A 4O4HB 1XMQO 2QKCA 4B7KA 5JQGA 4J9YB 4FM2A 2ZXWB 2UUBO 4J9ZB 4RUEA 1XMOO 1Q5OA 2P4VA 3S3XA 3ZRXA 3SJCC 2CGOA 3LDEA 4FZ1A 5EYPA 1TAEA 5GONB 3T2MA 5JH7A 4CH6A 2CTPA 5IYDO 1V55B 1HNWO 2QDOA 4X66B 3K06A 4O2BB 5EBLC 1BSMA 3TETA 3KZIZ 1N34B 3UT5A 4E2LA 4LNUB 4DV0B 4I0XA 1MABG 4BW9A 1LUWA 1WAZA 4B3RB 3AG2B 5J2TA 4JYAB 1K97A 3F7YC 5ITZA 4OPAA 3G71V 1HP8A 3IGAC 3JSNA 4IL6Z 3ZS8C 4UV8A 3RYCB 2L35A 2E3CA 4MTGA 3K0GA 2ATKC 4TV8B 2H3OA 2WLLB 1PNKA 5FPRA 4JI1O 4ZI7B 4I9WA 3K79A 1R1BA 1SZXA 1JJ2U 1JFFB 1HNZB 1M93A 3SPCA 5C8YB 2Q0OC 4X1YA 4LF7B 2UXXA 2B9ZA 4DV6O 3LSSA 2WLKA 3O65A 2LJ2A 1ROPA 5IY5C 5EBWC 2IJJA 4PDRA 1IZ3A 1W0JG 1FKAO 4BR6A 3OE7G 4EB6B 3HKBA 5LA6B 3VQXA 3PJSK 1VQ6V 2PTMA 3BEHA 3LNNA 5IYZB 2Q67A 3OMIB 1Q81W 4EFEA 2HR3A 1WP8A 1J5EB 4GLXA 3FFQA 2HEPA 3UQ8A 3T1YB 2ZNIA 2KKWA 4WFBV 4JI3O 2N74A 1K5SA 3FB7C 5JQGB 5CBGA 2JK5C 2K9PA 4B3MB 2DE0X 4DR1B 4UCRA 2UU9B 5CA0A 3CCEV 2Y4TA 1HR0B 4DV2O 1OHHG 1XUQA 5EYPB 1QLNA 1M57C 5JH7B 4BW5A 5IE9A 1Y6XA 4NXMO 3JSLA 4LCUC 3AK3A 5K1PA 4YY3O 1N0NA 4LF5B 3WFVA 4YJ3A 2NNUA 3UCSC 2OT5A 1BMFG 3UT5B 2EIJC 2LP7A 1N4CA 3TXSA 3N27A 2UUAB 4HBNA 5GW7A 4FIPC 4MSWC 2EJRA 3ZHTA 3ZEDA 1YJWV 4LF8B 1XI1A 3DGEA 5L3BA 3B09A 4FLZA 4AQYB 1GTOA 3SJBC 5ITZB 1SETA 3FX7A 5EZYB 2GTSA 3HKDA 5IWAB 1GK9A 1SRYA 4TV9A 1Q82W 1GN6A 1OCCB 2CH7B 2R9AA 2YEVB 1L1FA 4P9OA 3TGUH 2UXBO 3ABTA 2ZNJA 1L0NH 4DXWA 3VQYA 3G6EV 1U97A 4NB5A 3QF7A 2Q6AA 1R6TA 3E8GA 2YXLA 1R73A 3BHPA 4MTFA 3MHHC 3JCZA 1IXBA 4JAVA 3ICXA 5JVDA 4X1YB 3KKYA 4QJFB 5B1OA 3ZMZA 1PD3A 2Q4PA 4A5UB 4GZRB 3VQWA 3R66A 1SQQH 3BA8A 4DV3O 1MNGA 1GO3F 3CCJV 4FLWA 4JI6O 4RQFA 1BE3H 4NYKA 3OM3B 5KMGA 3HKBB 3WG7C 1FPOA 2XOKG 1Z5VA 1VQ4V 4TT3G 3JAWA 4IHJB 2WLMA 2EIKC 3H1HH 1N32O 5LGUA 1X59A 3OGIB 2WPDG 1VQPV 1FXKA 4RWUA 3ABUA 1BHAA 4ZOLA 2AZ0A 3J80N 2QWRB 1MG1A 1JPXA 1XHXA 1NTMH 3ZBHA 3ZMUA 1QBZA 4U3FH 2QA4V 1AILA 2A3QA 2V1DA 4ICGA 4ZBMA 2HJDA 5DN6G 1FJGB 2HVKC 4N23A 4WFFA 4X1KA 3ABLB 3CCLV 1PKXA 1BS3A 2XAFA 3HB3B 3OEHG 1GMGA 3BY6A 2E75B 2YICA 1MOFA 2B1GA 1S77D 1N33B 2XAGA 1THZA 1W0KG 2X7RB 3H1KH 3AK2A 1TGOA 4GKKB 4Q20A 1GN4A 3D8CA 3SJQC 2X6BA 2KQXA 4YJ3B 2HVJC 3ML0A 1K5QA 4YHHO 4G27B 3AG1B 4JYBA 1W2BU 4FVMA 5KHKA 1N34O 2BE3A 3HKCB 4K3AA 4PDVA 4GKJB 4MW3A 4DV0O 1DLBA 3CSXA 4P30A 2QWOB 4JI7B 1D2DA 4B3RO 4LWSA 3L9DA 4DV4B 5KHIA 1Y74B 3H1JH 1IBKB 3LDCA 4R8CA 4JI4B 4TQFA 2DYRB 2JIZG 3CXCU 3O9OA 5FPOA 1R3IC 1K3EA 1V54C 2VWKA 5H9CA 2P7TC 2XASA 4EEQA 4MS2A 3EFFK 3K3WA 4J7KA 5L3GA 5JVDB 3TJTA 2KG7A 4PA4A 2XUMA 1VF7A 4MVRA 3ZHVA 5E79Z 4LFAB 1M57B 2GUZA 4X64O 3RYHA 1HNZO 4LF7O 1S5LZ 4K0KB 1XNQB 3CRMA 3LNMB 2XAQA 3JAWB 4C7UA 1AI7A 1QR8A 5D5QA 3CJHA 4Q6GA 1IBLB 3EVKA 2D2CB 5FNVB 3K59A 2PI4A 1P7GA 2Y69B 3RYFA 2EZOA 4RUFA 1Z5WA 4DK0A 3ASOC 3K9AA 2Q5ZA 3W7WA 1JJOA 5JJEB 4ZOLB 5H6QA 1NVPB 3RYIA 2IM9A 2IH1C 4GX1A 4TSFG 1YHQV 1AJPA 2QR4A 2Z3YA 1ZX3A 4DR4B 2WA4A 2R9RB 1PNMA 3OTOB 3B40A 3SDLA 4JTDB 4ASUG 1IBMB 1H2MA 3BA9A 4B3MO 4EFBA 1SC5B 3K5MA 4O4HA 4B3TB 1YZBA 2EIMB 1TUBB 3OR7C 3B8NA 4DRXA 1NJIW 1TA8A 1HR0O 4DR3B 2JS5A 3AG4C 5FL7G 3T1CA 3I55V 3JD0A 1SA0B 2X6CA 1FFXA 5IYCO 3TXQA 4D7TA 2JGUA 2OCCC 4FFBB 2DYSC 4LF5O 5GONA 5JJJB 1JMKC 2F66C 2WLIA 3CCMV 1EN4A 3RFRA 2UUAO 2UXCB 4LWSB 4LF8O 3A0BZ 1DGSA 5LOVA 4JYYA 5LMNB 3B4SA 4QE7A 4LNUA 4JF3A 2V4DA 5IWAO 4ABMA 5BR8O 4HYOA 1ZAUA 1OZ0A 2JVDA 3A0HZ 1PL0A 4R50A 1L0LH 3CE2A 3JD2A 2VRZA 2GBOA 4TV8A 2GUZB 4LF9B 3THOA 2VWJA 1UFIA 3RYHB 1P4RA 1Q8IA 1OCRC 2EULA 4ZI7A 2P4KA 2EINB 3BPZA 4FZ0A 1EN5A 2LGQA 4CBCA 3STLC 5C8YA 1XQ8A 3RWRD 1BQ0A 1AR5A 1X4TA 3ZMSA 3L73H 4TUYA 1VQ9V 3M7MX 2BSKA 2P06A 2P90A 3RYIB 4UCSA 4B3SB 3ASNB 3CEIA 5IYZA 4PD4F 1UJWB 4I55A 1Q6UA 1K7DA 4X89A 4DW0A 3ZCCA 4P2ZA 3QNEA 1YXBA 4MVZA 1DTOA 2HKOA 1FAFA 1YTFB 3SPGA 1BZKA 5B3SC 4GX5A 2UXNA 4IT5A 1T5EA 1V54B 3H1IH 4WFEA 3A8TA 1VARA 4XDLA 4B7EA 1YI2V 1RPOA 1KUQA 4LH7A 2Q73A 3ABKC 1FJGO 1ZWIC 4DRXB 3K08A 2WSSG 2IW5A 1GN3A 4WF9V 1L8DA 1NU1H 1JX9A 2VQFO 1FFXB 5A9GA 2NR5A 4PJ0Z 4LFBB 2YIBD 3MHSC 1WLEA 1Y67A 3CWBH 2P67A 1YVWA 4JI8B 4PELA 5BZBA 1I94O 3X2QB 4G28B 1IVSA 4DV7B 3FB8C 2CTRA 2YC0A 2IJKA 1YJNV 1W59A 4GT1A 2WLIB 3ASOB 1M9NA 5CMUA 5H5NA 2F95B 4J11A 1Q6HA 4CS2A 3OR6C 5LP6C 1D5NA 5LOVB 1XNRB 1R3LC 4KHPB 1K92A 1GAXA 3BFRA 4IYIA 5LGNA 4X65B 4JI7O 5CA3A 3RT3C 3D36A 4DV4O 1MMMA 4I4TA 1M56C 3B8MA 5EZYA 3SR2C 1IBKO 5J9PC 1R6KA 4DR5B 4JI4O 4GUNA 4PHZA 4LR3A 2CH7A 2YEVA 3NXSA 5B1AB 3JARA 2AHZA 1CEZA 2P5OA 1IDSA 1XILA 1FXHA 4LH6A 3OT7A 2FL4A 5IJ0A 3AG4B 1H38A 2E74B 1IXMA 2YUAA 4LFAO 5IT9N 1VF6C 1WB7A 3KG2A 1BQZA 2YXHA 4W4KA 4LC1A 1RFYA 1DF5A 3WB1A 4K0KO 3FB5C 1IURA 3R65A 4TUYB 2QM8A 5EIBD 2ZR2A 4K35A 1IBLO 4DR6O 3DC5A 2BSKB 3CB2A 3F5TA 2DQ0A 1VMGA 3TK1A 5LHHA 4DW1A 2FMLA 1HNXO 3H01A 4I55B 4IHJA 1Q7YW 4JGSA 4QGPA 1SZTA 4DR7B 1ORQC 5LGTA 1MZFA 3DC6A 2O57A 1KKDA 4O4LB 2NN4A 1O9GA 4JI5O 3AG7A 4CH3A 3D3QA 3T4DA 4UCUA 3CXHF 1Q3EA 3ABMC 3CCSV 2LFRA 2L6LA 1WPXA 2BCCH 1JVMA 2ADQB 3CCQV 1HW7A 1LNQA 3K03A 1XHZA 3P3NA 1IBMO 2AHYA 2VQEB 5LMUO 1VQ5V 1WN7A 5CBFA 4U3JA 1SESA 1VQLV 4LF4B 5DM6V 3E8HA 3T1HB 2JEXA 4DV5B 4B3TO 2QWQB 1G1XB 3UO3A 4DR3O 1K33A 2PY5A 2Q9LA 1QNMA 5DEDA 3I56V 1SQBH 1US6A 5KHGA 4PA7A 1E1QG 1ZTEA 2HFEC 4F4LA 2RCVA 3C3TA 1BGYH 3BAAA 2JJ1G 1JR9A 5IDJA 4MVOA 2WLNA 2HLDG 2UXCO 3HKCA 2JEUA 4I4TB 4DK1A 1MZEA 2W6IG 4HNAB 3EXAA 2QWPB 4H44B 4MVMA 2C2AA 3ZRSA 1Y74A 3JARB 3W7TA 5KUKA 4UCVA 3JASB 4UCTA 1FXKC 3VQVA 4MVUA 1YIJV 2CK3G 5B66Z 5IJ0B 3S3WA 2PYJA 1KYOF 4FPPA 3U0ZA 1Y66A 4LF9O 2BTQA 1N36B 1AI6A 4F6EA 1K8AW 3L71H 5KA6A 3P3PA 1WJZA 3BVOA 3HR0A 1KB9F 5EIBC 1PP9H 2ZDIA 1YTFD 1YSCA 3P32A 5B1BC 2ZM6B 4DV1B 3RBZA 3H1LH 1N8RW 1FD9A 1ZLZA 3TCUA 4CH4A 2V7QG 4UVAA 5FNVA 2W0XA 4X62B 1M4UA 1NR7A 4ZKIA 3WB2A 4B3SO 2ZCEA 4O4IA 3JD3A 1SQPH 4Z1VA 3CPWU 2ZIOA 2Y4UA 4U7NA 1ZUQA 3B77A 3E22A 3SGIA 1S3JA 2EILC 1URFA 4U3JB 5TISZ 3APQA 4KP4A 2LFSA 1XL4A 2ZINA 1Z2GA 3CHXA 4H0LB 1JA8A 2JS3A 4NXNB 5BMVB 2Z0AA 1LR1A 2X0LA 3CX5F 2B1IA 3RVZA 3A2FA 1CPYA 2IH3C 1TUBA 1XMQB 3ZHRA 5IY5B 4OPHA 4BWAA 3SYPA 1AROP 5CN0A 1P84F 4JI8O 2UUBB 1SA0A 3CYOA 4DV7O 3ZIAG 4E4EA 4BIZA 4FM0A 2DW4A 4X66O 4FFBA 4BAYA 4UB6Z 3AG3C 1VQOV 2EX3A 1IX9A 4UFZA 2GHYA 2AZ2A 1SS3A 1XNRO 4KHPO 3IC7A 4GX2A 3CCVV 3AK1A 1N0JA 1NTZH 4YIOA 1BL8A 1GH6A 3QO7A 2LW1A 2MK3A 3CC4V 3HKEA 4JYAO 3N2GA 4QPJA 3ZRWB 2H8PC 4DR5O 4UV9A 4OX9B 1COWG 1F7YA 1QVFU 2YS8A 1HWYA 2UXDB 2CTWA 3Q4HB 5D5PA 1BHBA 3ZMTA 1OCOC 1XEQA 3E8BA 4KXRA 2BTQB 3OMAB 3SPHA 2K1EA 3MDSA 4U7OA 3E83A 3SYOA 1RM1C 1H2LA 3L74H 5CB4B 4L87A 4CC5A 1VQ7V 4PDLA 4DUZB 2DWEC 1NR1A 4HAMA 5LBQA 2EIJB 4J7ZA 1VQMV 1NKDA 1OCZC 3BRCA 3ZX6A 2PUSA 3IAYA 3W7UA 4O4IB 4PA9A 1MSDA 2LW7A 3E2EA 5KX5A 1B3QA 4DR7O 3GB7C 4CS4A 2FTKA 1SKVA 1J5EO 3E22B 3GVMA 3WB0A 2AXTZ 2ZE5A 3NR7A 3ZJZA 3T1YO 2ILMA 1QR9A 2E5LB 2ZE8A 3K04A 2QJ1A 3UO2A 4NTWA 2OTLV 1WP7A 3LSUA 4JTAB 3K9SA 3JCUZ 3CMAV 2IJHA 3GWOA 1VP7A 4AI8A 4X9QA 1M1KW 2VQEO 3OUSA 5FLXN 1G6UA 1F4NA 1G4YB 4LF4O 4DR1O 1EFRG 2HG5C 2UU9O 1B06A 3T1HO 1SERA 5IJ9A 4DV5O 2XAHA 1ZL8B 3RN4A 3K57A 5JJNB 5B1BB 1GM9A 1PV0A 1I08A 3WG7B 4KL1A 1NZ6A 1K9MW 5JCOC 2JJ2G 4GX0A 2QM7A 2EIKB 2QEXV 4O4JB 1O9HA 2M7WA 4DV2B 1FYJA 2ZR3A 4X1IA 2PYLA 1GM8A 1PL4A 2Q69A 2IU0A 3G67A 4CS3A 4TOIA 4JV5B 1Y76B 3ZMVA 2A79B 3F7VC 2CUGA 3HKEB 4IYHA 3N2GB 2R9IA
chains in the Genus database with same CATH topology
4J11A 4J7KA 4IYHA 4J41A 4J10A 4KXRA 4J42A 4IYIA 4W4KA 3FX7A 4J7JA 2GTSA 2G38A 4W4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J11 A;  4J7K A;  4IYH A;  4J41 A;  4J10 A;  4KXR A;  4J42 A;  4IYI A;  4W4K A;  3FX7 A;  4J7J A;  2GTS A;  2G38 A;  4W4L A; 
#chains in the Genus database with same CATH topology
 4AQY O;  3QG5 A;  2A9H A;  3L75 H;  1QLE C;  4J10 A;  4QNH B;  3ZHU A;  3CCU V;  1YEW A;  1D5A A;  1K4C C;  2AW9 A;  3LUT B;  2BTO A;  1KKC A;  3OUF A;  2MW2 B;  2QE7 G;  4FK5 C;  5AG2 A;  4JI2 B;  2ITC C;  1TVK A;  1SQX H;  1CXZ B;  1I0H A;  3MD0 A;  2JGD B;  4NKG B;  4NVP A;  3N2K B;  2YI8 A;  4H13 B;  3JAT A;  2A7W A;  3FKS G;  2RMK B;  1N36 O;  2R70 A;  4WFA V;  2Q8V A;  2B5U A;  4TWK A;  1NH2 B;  2ETN A;  3AEI A;  4AIL C;  4Z1M G;  4FM1 A;  3CRA A;  1AR4 A;  5J2U A;  2P22 C;  2ZM6 O;  4I5S A;  1EZJ A;  4DV1 O;  1EZV H;  1R6N A;  1AB3 A;  5KX5 B;  1H8E G;  2YSU B;  4DV3 B;  4MVS A;  1AI5 A;  1K34 A;  4HZ3 A;  4JYC A;  4MW8 A;  4O4L A;  3RGB A;  3L72 H;  4I7Z B;  4QE9 A;  2OTJ V;  1S5J A;  4FLX A;  5LYJ B;  3IFX A;  4LF6 B;  4FLU A;  3E35 A;  5CA1 A;  2RN9 A;  1AJQ A;  1Q43 A;  4R7C A;  3ZRV A;  4JZ2 A;  2PI5 A;  1YIT V;  5IJ9 B;  2N04 A;  2ARH A;  4NXN O;  4FLY A;  1RSO A;  5EBM C;  1OCC C;  4UB8 Z;  3W7S A;  1N33 O;  3L70 H;  4KFM A;  1RPR A;  4YIP A;  1V9P A;  5DEC A;  4GKK O;  4PI2 A;  2OCH A;  4WBN B;  1JCH A;  5KAI Z;  4X1I B;  2CGN A;  3SYA A;  2Q7G A;  2WLJ A;  1OCZ B;  1QHT A;  1H2N A;  5EC1 C;  1FFT B;  1QCE A;  4F6R A;  2CDY A;  1Q90 D;  2GTA A;  4H33 A;  1NI8 A;  2ODM A;  4GKJ O;  4K8Z A;  3GWK C;  5L3C A;  1K73 W;  5H2F Z;  4LFC B;  2EBO A;  4JAS A;  4YHH B;  4GCZ A;  2ZKO A;  1AR1 B;  2AGA A;  4HNA A;  2Y0I A;  4MTO A;  1XBL A;  2QM4 A;  1KD1 W;  2WWW A;  1P7B A;  4OX9 O;  1TVK B;  5JWP A;  5L3E A;  1FXV A;  1SF9 A;  2UXD O;  4DR2 B;  3PN1 A;  3JAT B;  5LXT A;  1AVM A;  4UUJ C;  3JAS A;  3A0R A;  5KHH A;  4UVC A;  1YF2 A;  5K1X A;  4PA3 A;  2GSM B;  1NVP D;  5IYB O;  1KP3 A;  4Z2W A;  1K4D C;  4NTY A;  5KLV H;  2OCC B;  3C90 A;  3M99 B;  5J2U B;  3OW2 U;  1M5I A;  1XNQ O;  4DUZ O;  3BCC H;  2DYS B;  3D3I A;  4O2A B;  2BOC C;  3CCR V;  1BCC H;  1DK1 A;  3ABL C;  4X64 B;  2OWO A;  4X88 A;  2P6J A;  4QPK A;  5LP6 A;  1A32 A;  2DOS A;  1I5X A;  1QLE B;  5LHI A;  2HHH B;  2F1M A;  4I50 A;  5CA1 B;  4R6Z A;  2E5L O;  4MVQ A;  3AG1 C;  4KUM A;  4DR4 O;  3CRQ A;  3OTO O;  2ZD9 A;  4YJ2 A;  3OFN G;  3F5W C;  2UUC B;  3ETD A;  4P9P A;  5B1N A;  3VBB A;  2KSD A;  2OIG A;  1RSO B;  1OCR B;  1RP3 B;  3QVN A;  2G38 A;  1R3J C;  2N05 A;  4DUY B;  3MAQ A;  1BT8 A;  3SPJ A;  3K5O A;  5BMV A;  1S72 V;  3QO5 A;  1CP9 A;  1VF6 A;  2WA3 A;  1NTK H;  3CC7 V;  1YDX A;  2DYR C;  4WFH A;  2KB1 A;  3P30 A;  2GV9 A;  3LDD A;  4F6R B;  3OMN B;  1XOU A;  3RVY A;  2ZDI C;  4JV5 O;  3I5D A;  2DMX A;  3IC9 A;  1B6Q A;  4J42 A;  2CTQ A;  5LL6 Y;  3KCY A;  1F23 A;  5B3S B;  5LMN O;  1NH2 D;  4PA6 A;  1DF4 A;  1VQN V;  2F43 G;  2Y69 C;  4TQD A;  4I0X B;  5LXT B;  2R72 A;  5BY1 A;  3JAK A;  3ZRW A;  1H2S B;  1B04 A;  3ABK B;  2M6Y A;  4JI2 O;  3SJA C;  3CRR A;  5J2T B;  3Q4H A;  3JYC A;  2F23 A;  4JPR A;  3W7X A;  3H9V A;  2YXY A;  3DXR A;  1WA8 A;  2YIB A;  2CE4 A;  2PGG A;  2XT9 A;  4FJC C;  5BR8 B;  4IIJ A;  3SYQ A;  4UXN A;  3UKM A;  2A06 H;  2X6A A;  1S0V A;  2PF4 E;  5CB4 A;  1WPB A;  2FB5 A;  2CAZ C;  3JAL A;  5KHJ A;  4JTC B;  1LUV A;  1PM9 A;  3FAV A;  1KEC A;  2ZT9 B;  2D3O W;  3HPL C;  3G6B A;  1M90 W;  1ENV A;  5LP6 B;  2EIM C;  1SQF A;  2QTO A;  4FLT A;  4CZZ A;  3VOU A;  5LHG A;  3U11 A;  4MTX A;  4BIO A;  2PZS A;  4BIU A;  4I50 B;  1M56 B;  1WNS A;  4J41 A;  2DN9 A;  3G80 A;  4FLV A;  2YIA A;  2RDC A;  2YID A;  4LF6 O;  4YJ2 B;  5GTI Z;  4JI0 B;  4WCE V;  4JZG A;  1F51 A;  1AI4 A;  3FD9 A;  3ETG A;  2FKX A;  2XND G;  4X20 A;  3OGC C;  1JOY A;  2QWN B;  3ETE A;  2W0F C;  2F4V B;  3ZN1 A;  2E76 B;  4LFB O;  1ZL8 A;  3E86 A;  4CH5 A;  4PDM A;  2LO1 A;  1KC8 W;  2ZE7 A;  4NTX A;  5CA0 B;  2RQ6 A;  1XMO B;  4WFG A;  2QKS A;  2LQT A;  4AHC A;  2QSA A;  2VQF B;  3STZ C;  4O4J A;  4DO2 A;  3FYE B;  3LSQ A;  1XL6 A;  2EIN C;  3EHB B;  1YJ9 V;  3QO8 A;  1I94 B;  4RAI A;  3OTF A;  1UPG A;  1WB8 A;  1OJH A;  4W4L A;  1OV9 A;  2WLH A;  4UCO A;  2FYU H;  5F2V O;  3ABM B;  3RW0 A;  1HNW B;  4FMT A;  3JD1 A;  4X65 O;  1Y76 A;  1MSW D;  4LFC O;  2Q7H A;  3QTC A;  1FS0 G;  3JAK B;  2BOB C;  2DJV A;  4J7J A;  1PPJ H;  3K58 A;  3SYC A;  4D7S A;  3HKD B;  1E79 G;  3ASN C;  4DR2 O;  4TV9 B;  3DXR B;  1WA8 B;  3K0D A;  3BAB A;  3FYI B;  4RO2 A;  4XBF A;  4IIJ B;  2JGD A;  2H94 A;  3N2K A;  2QGN A;  1KP2 A;  1I5Y A;  3CC2 V;  1XDC A;  3JAL B;  1KQS U;  1KMI Z;  3CD6 V;  3FAV B;  1TUE B;  4L8J A;  4JI1 B;  5H6R A;  5C93 A;  2VS0 A;  1NS1 A;  1H2K A;  2ZXW C;  1E1R G;  3JD4 A;  2HJF C;  1G8M A;  2ZIM A;  1GRJ A;  4DV6 B;  1H2G A;  1AP6 A;  5KMG B;  3WU2 Z;  4UVB A;  1XRE A;  5L3D A;  1NBM G;  1SQV H;  4RQE A;  4ZHQ A;  3ZHS A;  3FB6 C;  2HHH O;  4H37 A;  4DR6 B;  2XTA A;  3X2Q C;  1Q86 W;  2YDE A;  1H8H G;  1V55 C;  2Z5U A;  5BXZ A;  1HNX B;  5KA5 A;  4CC6 A;  2IU3 A;  1FXK B;  1I7F A;  3CS5 A;  5LYJ A;  1SQG A;  1ZSP A;  1GKF A;  2Q68 A;  4IGG A;  2YI9 A;  2UUC O;  4JI5 B;  4X20 B;  2Y0P A;  4JI3 B;  1MA1 A;  1EM1 A;  2NLJ C;  3AG2 C;  3OD4 A;  4DUY O;  1YCI A;  1VF5 B;  1AP5 A;  3SPI A;  5L3F A;  5LMU B;  4X1K B;  3K5L A;  1VQK V;  5B1A C;  3CME V;  2DQ3 A;  2RNB A;  3J7A U;  3KCX A;  1R3K C;  3CRC A;  3C3S A;  3T4Z A;  4WBN A;  2Q0A A;  5KUM A;  2XAJ A;  1QVG U;  3OEE G;  1AJN A;  1EN6 A;  1KBH A;  4FFK A;  4NXM B;  2WAM A;  5B5E Z;  2XHB A;  1QU7 A;  4YY3 B;  2EIL B;  2F93 B;  4I9Q A;  2OIE A;  2RJZ A;  5KAF Z;  4K8X A;  3APO A;  4X8A A;  3ETQ A;  3IJ4 A;  4NR1 A;  2LGW A;  4O2B A;  1U96 A;  1JQ0 A;  1S76 D;  3UM7 A;  1NQT A;  3E89 A;  3DSQ A;  2W6J G;  1Y4M A;  4XDK A;  3G4S V;  4JAU A;  1KU9 A;  3J81 N;  3OAA G;  2UXB B;  4LP8 A;  2IBZ H;  4QIW F;  5GTH Z;  3RYC A;  2JDI G;  2KG7 B;  4JAA A;  4N21 A;  4PV1 B;  4YXW G;  5EC2 C;  5JCO A;  2WLL A;  3JAM N;  3AG3 B;  3M8A A;  1HDJ A;  4D6T H;  4O2A A;  4OXS A;  4G2K A;  4J80 A;  1VEW A;  1Q6I A;  5E1A C;  2ZE6 A;  3B2E E;  4X62 O;  2ZQM A;  1NT2 B;  3U10 A;  1JFF A;  4ZHQ B;  3K5N A;  1S5H C;  3E8F A;  5A2Q N;  4PI0 A;  3CJH B;  4JI6 B;  2OYQ A;  2IJI A;  4OGQ B;  3RYF B;  4MT8 A;  2QKA A;  3ZHQ A;  5CBH A;  2A0L A;  2ITD C;  1N32 B;  2GDS A;  3ZN0 A;  2Q7E A;  4EB6 A;  5LA6 A;  2JRI A;  1VQ8 V;  2Y48 A;  2HP8 A;  1OCO B;  2EZP A;  4JI0 O;  4GYC B;  4ZIB A;  1P49 A;  4DYL A;  2ADP A;  3DTU B;  1VIB A;  4LBE C;  4B08 A;  1J95 A;  5EK0 A;  1QQC A;  3CP1 A;  5HFM A;  1RM1 B;  3D36 C;  1F4M A;  1PNL A;  1EBO A;  4XDJ A;  5HFL A;  4EKW A;  1GN2 A;  2F4V O;  2EJ7 A;  2DWD C;  2QTS A;  1GM7 A;  4O4H B;  1XMQ O;  2QKC A;  4B7K A;  5JQG A;  4J9Y B;  4FM2 A;  2ZXW B;  2UUB O;  4J9Z B;  4RUE A;  1XMO O;  1Q5O A;  2P4V A;  3S3X A;  3ZRX A;  3SJC C;  2CGO A;  3LDE A;  4FZ1 A;  5EYP A;  1TAE A;  5GON B;  3T2M A;  5JH7 A;  4CH6 A;  2CTP A;  5IYD O;  1V55 B;  1HNW O;  2QDO A;  4X66 B;  3K06 A;  4O2B B;  5EBL C;  1BSM A;  3TET A;  3KZI Z;  1N34 B;  3UT5 A;  4E2L A;  4LNU B;  4DV0 B;  4I0X A;  1MAB G;  4BW9 A;  1LUW A;  1WAZ A;  4B3R B;  3AG2 B;  5J2T A;  4JYA B;  1K97 A;  3F7Y C;  5ITZ A;  4OPA A;  3G71 V;  1HP8 A;  3IGA C;  3JSN A;  4IL6 Z;  3ZS8 C;  4UV8 A;  3RYC B;  2L35 A;  2E3C A;  4MTG A;  3K0G A;  2ATK C;  4TV8 B;  2H3O A;  2WLL B;  1PNK A;  5FPR A;  4JI1 O;  4ZI7 B;  4I9W A;  3K79 A;  1R1B A;  1SZX A;  1JJ2 U;  1JFF B;  1HNZ B;  1M93 A;  3SPC A;  5C8Y B;  2Q0O C;  4X1Y A;  4LF7 B;  2UXX A;  2B9Z A;  4DV6 O;  3LSS A;  2WLK A;  3O65 A;  2LJ2 A;  1ROP A;  5IY5 C;  5EBW C;  2IJJ A;  4PDR A;  1IZ3 A;  1W0J G;  1FKA O;  4BR6 A;  3OE7 G;  4EB6 B;  3HKB A;  5LA6 B;  3VQX A;  3PJS K;  1VQ6 V;  2PTM A;  3BEH A;  3LNN A;  5IYZ B;  2Q67 A;  3OMI B;  1Q81 W;  4EFE A;  2HR3 A;  1WP8 A;  1J5E B;  4GLX A;  3FFQ A;  2HEP A;  3UQ8 A;  3T1Y B;  2ZNI A;  2KKW A;  4WFB V;  4JI3 O;  2N74 A;  1K5S A;  3FB7 C;  5JQG B;  5CBG A;  2JK5 C;  2K9P A;  4B3M B;  2DE0 X;  4DR1 B;  4UCR A;  2UU9 B;  5CA0 A;  3CCE V;  2Y4T A;  1HR0 B;  4DV2 O;  1OHH G;  1XUQ A;  5EYP B;  1QLN A;  1M57 C;  5JH7 B;  4BW5 A;  5IE9 A;  1Y6X A;  4NXM O;  3JSL A;  4LCU C;  3AK3 A;  5K1P A;  4YY3 O;  1N0N A;  4LF5 B;  3WFV A;  4YJ3 A;  2NNU A;  3UCS C;  2OT5 A;  1BMF G;  3UT5 B;  2EIJ C;  2LP7 A;  1N4C A;  3TXS A;  3N27 A;  2UUA B;  4HBN A;  5GW7 A;  4FIP C;  4MSW C;  2EJR A;  3ZHT A;  3ZED A;  1YJW V;  4LF8 B;  1XI1 A;  3DGE A;  5L3B A;  3B09 A;  4FLZ A;  4AQY B;  1GTO A;  3SJB C;  5ITZ B;  1SET A;  3FX7 A;  5EZY B;  2GTS A;  3HKD A;  5IWA B;  1GK9 A;  1SRY A;  4TV9 A;  1Q82 W;  1GN6 A;  1OCC B;  2CH7 B;  2R9A A;  2YEV B;  1L1F A;  4P9O A;  3TGU H;  2UXB O;  3ABT A;  2ZNJ A;  1L0N H;  4DXW A;  3VQY A;  3G6E V;  1U97 A;  4NB5 A;  3QF7 A;  2Q6A A;  1R6T A;  3E8G A;  2YXL A;  1R73 A;  3BHP A;  4MTF A;  3MHH C;  3JCZ A;  1IXB A;  4JAV A;  3ICX A;  5JVD A;  4X1Y B;  3KKY A;  4QJF B;  5B1O A;  3ZMZ A;  1PD3 A;  2Q4P A;  4A5U B;  4GZR B;  3VQW A;  3R66 A;  1SQQ H;  3BA8 A;  4DV3 O;  1MNG A;  1GO3 F;  3CCJ V;  4FLW A;  4JI6 O;  4RQF A;  1BE3 H;  4NYK A;  3OM3 B;  5KMG A;  3HKB B;  3WG7 C;  1FPO A;  2XOK G;  1Z5V A;  1VQ4 V;  4TT3 G;  3JAW A;  4IHJ B;  2WLM A;  2EIK C;  3H1H H;  1N32 O;  5LGU A;  1X59 A;  3OGI B;  2WPD G;  1VQP V;  1FXK A;  4RWU A;  3ABU A;  1BHA A;  4ZOL A;  2AZ0 A;  3J80 N;  2QWR B;  1MG1 A;  1JPX A;  1XHX A;  1NTM H;  3ZBH A;  3ZMU A;  1QBZ A;  4U3F H;  2QA4 V;  1AIL A;  2A3Q A;  2V1D A;  4ICG A;  4ZBM A;  2HJD A;  5DN6 G;  1FJG B;  2HVK C;  4N23 A;  4WFF A;  4X1K A;  3ABL B;  3CCL V;  1PKX A;  1BS3 A;  2XAF A;  3HB3 B;  3OEH G;  1GMG A;  3BY6 A;  2E75 B;  2YIC A;  1MOF A;  2B1G A;  1S77 D;  1N33 B;  2XAG A;  1THZ A;  1W0K G;  2X7R B;  3H1K H;  3AK2 A;  1TGO A;  4GKK B;  4Q20 A;  1GN4 A;  3D8C A;  3SJQ C;  2X6B A;  2KQX A;  4YJ3 B;  2HVJ C;  3ML0 A;  1K5Q A;  4YHH O;  4G27 B;  3AG1 B;  4JYB A;  1W2B U;  4FVM A;  5KHK A;  1N34 O;  2BE3 A;  3HKC B;  4K3A A;  4PDV A;  4GKJ B;  4MW3 A;  4DV0 O;  1DLB A;  3CSX A;  4P30 A;  2QWO B;  4JI7 B;  1D2D A;  4B3R O;  4LWS A;  3L9D A;  4DV4 B;  5KHI A;  1Y74 B;  3H1J H;  1IBK B;  3LDC A;  4R8C A;  4JI4 B;  4TQF A;  2DYR B;  2JIZ G;  3CXC U;  3O9O A;  5FPO A;  1R3I C;  1K3E A;  1V54 C;  2VWK A;  5H9C A;  2P7T C;  2XAS A;  4EEQ A;  4MS2 A;  3EFF K;  3K3W A;  4J7K A;  5L3G A;  5JVD B;  3TJT A;  2KG7 A;  4PA4 A;  2XUM A;  1VF7 A;  4MVR A;  3ZHV A;  5E79 Z;  4LFA B;  1M57 B;  2GUZ A;  4X64 O;  3RYH A;  1HNZ O;  4LF7 O;  1S5L Z;  4K0K B;  1XNQ B;  3CRM A;  3LNM B;  2XAQ A;  3JAW B;  4C7U A;  1AI7 A;  1QR8 A;  5D5Q A;  3CJH A;  4Q6G A;  1IBL B;  3EVK A;  2D2C B;  5FNV B;  3K59 A;  2PI4 A;  1P7G A;  2Y69 B;  3RYF A;  2EZO A;  4RUF A;  1Z5W A;  4DK0 A;  3ASO C;  3K9A A;  2Q5Z A;  3W7W A;  1JJO A;  5JJE B;  4ZOL B;  5H6Q A;  1NVP B;  3RYI A;  2IM9 A;  2IH1 C;  4GX1 A;  4TSF G;  1YHQ V;  1AJP A;  2QR4 A;  2Z3Y A;  1ZX3 A;  4DR4 B;  2WA4 A;  2R9R B;  1PNM A;  3OTO B;  3B40 A;  3SDL A;  4JTD B;  4ASU G;  1IBM B;  1H2M A;  3BA9 A;  4B3M O;  4EFB A;  1SC5 B;  3K5M A;  4O4H A;  4B3T B;  1YZB A;  2EIM B;  1TUB B;  3OR7 C;  3B8N A;  4DRX A;  1NJI W;  1TA8 A;  1HR0 O;  4DR3 B;  2JS5 A;  3AG4 C;  5FL7 G;  3T1C A;  3I55 V;  3JD0 A;  1SA0 B;  2X6C A;  1FFX A;  5IYC O;  3TXQ A;  4D7T A;  2JGU A;  2OCC C;  4FFB B;  2DYS C;  4LF5 O;  5GON A;  5JJJ B;  1JMK C;  2F66 C;  2WLI A;  3CCM V;  1EN4 A;  3RFR A;  2UUA O;  2UXC B;  4LWS B;  4LF8 O;  3A0B Z;  1DGS A;  5LOV A;  4JYY A;  5LMN B;  3B4S A;  4QE7 A;  4LNU A;  4JF3 A;  2V4D A;  5IWA O;  4ABM A;  5BR8 O;  4HYO A;  1ZAU A;  1OZ0 A;  2JVD A;  3A0H Z;  1PL0 A;  4R50 A;  1L0L H;  3CE2 A;  3JD2 A;  2VRZ A;  2GBO A;  4TV8 A;  2GUZ B;  4LF9 B;  3THO A;  2VWJ A;  1UFI A;  3RYH B;  1P4R A;  1Q8I A;  1OCR C;  2EUL A;  4ZI7 A;  2P4K A;  2EIN B;  3BPZ A;  4FZ0 A;  1EN5 A;  2LGQ A;  4CBC A;  3STL C;  5C8Y A;  1XQ8 A;  3RWR D;  1BQ0 A;  1AR5 A;  1X4T A;  3ZMS A;  3L73 H;  4TUY A;  1VQ9 V;  3M7M X;  2BSK A;  2P06 A;  2P90 A;  3RYI B;  4UCS A;  4B3S B;  3ASN B;  3CEI A;  5IYZ A;  4PD4 F;  1UJW B;  4I55 A;  1Q6U A;  1K7D A;  4X89 A;  4DW0 A;  3ZCC A;  4P2Z A;  3QNE A;  1YXB A;  4MVZ A;  1DTO A;  2HKO A;  1FAF A;  1YTF B;  3SPG A;  1BZK A;  5B3S C;  4GX5 A;  2UXN A;  4IT5 A;  1T5E A;  1V54 B;  3H1I H;  4WFE A;  3A8T A;  1VAR A;  4XDL A;  4B7E A;  1YI2 V;  1RPO A;  1KUQ A;  4LH7 A;  2Q73 A;  3ABK C;  1FJG O;  1ZWI C;  4DRX B;  3K08 A;  2WSS G;  2IW5 A;  1GN3 A;  4WF9 V;  1L8D A;  1NU1 H;  1JX9 A;  2VQF O;  1FFX B;  5A9G A;  2NR5 A;  4PJ0 Z;  4LFB B;  2YIB D;  3MHS C;  1WLE A;  1Y67 A;  3CWB H;  2P67 A;  1YVW A;  4JI8 B;  4PEL A;  5BZB A;  1I94 O;  3X2Q B;  4G28 B;  1IVS A;  4DV7 B;  3FB8 C;  2CTR A;  2YC0 A;  2IJK A;  1YJN V;  1W59 A;  4GT1 A;  2WLI B;  3ASO B;  1M9N A;  5CMU A;  5H5N A;  2F95 B;  4J11 A;  1Q6H A;  4CS2 A;  3OR6 C;  5LP6 C;  1D5N A;  5LOV B;  1XNR B;  1R3L C;  4KHP B;  1K92 A;  1GAX A;  3BFR A;  4IYI A;  5LGN A;  4X65 B;  4JI7 O;  5CA3 A;  3RT3 C;  3D36 A;  4DV4 O;  1MMM A;  4I4T A;  1M56 C;  3B8M A;  5EZY A;  3SR2 C;  1IBK O;  5J9P C;  1R6K A;  4DR5 B;  4JI4 O;  4GUN A;  4PHZ A;  4LR3 A;  2CH7 A;  2YEV A;  3NXS A;  5B1A B;  3JAR A;  2AHZ A;  1CEZ A;  2P5O A;  1IDS A;  1XIL A;  1FXH A;  4LH6 A;  3OT7 A;  2FL4 A;  5IJ0 A;  3AG4 B;  1H38 A;  2E74 B;  1IXM A;  2YUA A;  4LFA O;  5IT9 N;  1VF6 C;  1WB7 A;  3KG2 A;  1BQZ A;  2YXH A;  4W4K A;  4LC1 A;  1RFY A;  1DF5 A;  3WB1 A;  4K0K O;  3FB5 C;  1IUR A;  3R65 A;  4TUY B;  2QM8 A;  5EIB D;  2ZR2 A;  4K35 A;  1IBL O;  4DR6 O;  3DC5 A;  2BSK B;  3CB2 A;  3F5T A;  2DQ0 A;  1VMG A;  3TK1 A;  5LHH A;  4DW1 A;  2FML A;  1HNX O;  3H01 A;  4I55 B;  4IHJ A;  1Q7Y W;  4JGS A;  4QGP A;  1SZT A;  4DR7 B;  1ORQ C;  5LGT A;  1MZF A;  3DC6 A;  2O57 A;  1KKD A;  4O4L B;  2NN4 A;  1O9G A;  4JI5 O;  3AG7 A;  4CH3 A;  3D3Q A;  3T4D A;  4UCU A;  3CXH F;  1Q3E A;  3ABM C;  3CCS V;  2LFR A;  2L6L A;  1WPX A;  2BCC H;  1JVM A;  2ADQ B;  3CCQ V;  1HW7 A;  1LNQ A;  3K03 A;  1XHZ A;  3P3N A;  1IBM O;  2AHY A;  2VQE B;  5LMU O;  1VQ5 V;  1WN7 A;  5CBF A;  4U3J A;  1SES A;  1VQL V;  4LF4 B;  5DM6 V;  3E8H A;  3T1H B;  2JEX A;  4DV5 B;  4B3T O;  2QWQ B;  1G1X B;  3UO3 A;  4DR3 O;  1K33 A;  2PY5 A;  2Q9L A;  1QNM A;  5DED A;  3I56 V;  1SQB H;  1US6 A;  5KHG A;  4PA7 A;  1E1Q G;  1ZTE A;  2HFE C;  4F4L A;  2RCV A;  3C3T A;  1BGY H;  3BAA A;  2JJ1 G;  1JR9 A;  5IDJ A;  4MVO A;  2WLN A;  2HLD G;  2UXC O;  3HKC A;  2JEU A;  4I4T B;  4DK1 A;  1MZE A;  2W6I G;  4HNA B;  3EXA A;  2QWP B;  4H44 B;  4MVM A;  2C2A A;  3ZRS A;  1Y74 A;  3JAR B;  3W7T A;  5KUK A;  4UCV A;  3JAS B;  4UCT A;  1FXK C;  3VQV A;  4MVU A;  1YIJ V;  2CK3 G;  5B66 Z;  5IJ0 B;  3S3W A;  2PYJ A;  1KYO F;  4FPP A;  3U0Z A;  1Y66 A;  4LF9 O;  2BTQ A;  1N36 B;  1AI6 A;  4F6E A;  1K8A W;  3L71 H;  5KA6 A;  3P3P A;  1WJZ A;  3BVO A;  3HR0 A;  1KB9 F;  5EIB C;  1PP9 H;  2ZDI A;  1YTF D;  1YSC A;  3P32 A;  5B1B C;  2ZM6 B;  4DV1 B;  3RBZ A;  3H1L H;  1N8R W;  1FD9 A;  1ZLZ A;  3TCU A;  4CH4 A;  2V7Q G;  4UVA A;  5FNV A;  2W0X A;  4X62 B;  1M4U A;  1NR7 A;  4ZKI A;  3WB2 A;  4B3S O;  2ZCE A;  4O4I A;  3JD3 A;  1SQP H;  4Z1V A;  3CPW U;  2ZIO A;  2Y4U A;  4U7N A;  1ZUQ A;  3B77 A;  3E22 A;  3SGI A;  1S3J A;  2EIL C;  1URF A;  4U3J B;  5TIS Z;  3APQ A;  4KP4 A;  2LFS A;  1XL4 A;  2ZIN A;  1Z2G A;  3CHX A;  4H0L B;  1JA8 A;  2JS3 A;  4NXN B;  5BMV B;  2Z0A A;  1LR1 A;  2X0L A;  3CX5 F;  2B1I A;  3RVZ A;  3A2F A;  1CPY A;  2IH3 C;  1TUB A;  1XMQ B;  3ZHR A;  5IY5 B;  4OPH A;  4BWA A;  3SYP A;  1ARO P;  5CN0 A;  1P84 F;  4JI8 O;  2UUB B;  1SA0 A;  3CYO A;  4DV7 O;  3ZIA G;  4E4E A;  4BIZ A;  4FM0 A;  2DW4 A;  4X66 O;  4FFB A;  4BAY A;  4UB6 Z;  3AG3 C;  1VQO V;  2EX3 A;  1IX9 A;  4UFZ A;  2GHY A;  2AZ2 A;  1SS3 A;  1XNR O;  4KHP O;  3IC7 A;  4GX2 A;  3CCV V;  3AK1 A;  1N0J A;  1NTZ H;  4YIO A;  1BL8 A;  1GH6 A;  3QO7 A;  2LW1 A;  2MK3 A;  3CC4 V;  3HKE A;  4JYA O;  3N2G A;  4QPJ A;  3ZRW B;  2H8P C;  4DR5 O;  4UV9 A;  4OX9 B;  1COW G;  1F7Y A;  1QVF U;  2YS8 A;  1HWY A;  2UXD B;  2CTW A;  3Q4H B;  5D5P A;  1BHB A;  3ZMT A;  1OCO C;  1XEQ A;  3E8B A;  4KXR A;  2BTQ B;  3OMA B;  3SPH A;  2K1E A;  3MDS A;  4U7O A;  3E83 A;  3SYO A;  1RM1 C;  1H2L A;  3L74 H;  5CB4 B;  4L87 A;  4CC5 A;  1VQ7 V;  4PDL A;  4DUZ B;  2DWE C;  1NR1 A;  4HAM A;  5LBQ A;  2EIJ B;  4J7Z A;  1VQM V;  1NKD A;  1OCZ C;  3BRC A;  3ZX6 A;  2PUS A;  3IAY A;  3W7U A;  4O4I B;  4PA9 A;  1MSD A;  2LW7 A;  3E2E A;  5KX5 A;  1B3Q A;  4DR7 O;  3GB7 C;  4CS4 A;  2FTK A;  1SKV A;  1J5E O;  3E22 B;  3GVM A;  3WB0 A;  2AXT Z;  2ZE5 A;  3NR7 A;  3ZJZ A;  3T1Y O;  2ILM A;  1QR9 A;  2E5L B;  2ZE8 A;  3K04 A;  2QJ1 A;  3UO2 A;  4NTW A;  2OTL V;  1WP7 A;  3LSU A;  4JTA B;  3K9S A;  3JCU Z;  3CMA V;  2IJH A;  3GWO A;  1VP7 A;  4AI8 A;  4X9Q A;  1M1K W;  2VQE O;  3OUS A;  5FLX N;  1G6U A;  1F4N A;  1G4Y B;  4LF4 O;  4DR1 O;  1EFR G;  2HG5 C;  2UU9 O;  1B06 A;  3T1H O;  1SER A;  5IJ9 A;  4DV5 O;  2XAH A;  1ZL8 B;  3RN4 A;  3K57 A;  5JJN B;  5B1B B;  1GM9 A;  1PV0 A;  1I08 A;  3WG7 B;  4KL1 A;  1NZ6 A;  1K9M W;  5JCO C;  2JJ2 G;  4GX0 A;  2QM7 A;  2EIK B;  2QEX V;  4O4J B;  1O9H A;  2M7W A;  4DV2 B;  1FYJ A;  2ZR3 A;  4X1I A;  2PYL A;  1GM8 A;  1PL4 A;  2Q69 A;  2IU0 A;  3G67 A;  4CS3 A;  4TOI A;  4JV5 B;  1Y76 B;  3ZMV A;  2A79 B;  3F7V C;  2CUG A;  3HKE B;  4IYH A;  3N2G B;  2R9I A; 
#chains in the Genus database with same CATH homology
 4J11 A;  4J7K A;  4IYH A;  4J41 A;  4J10 A;  4KXR A;  4J42 A;  4IYI A;  4W4K A;  3FX7 A;  4J7J A;  2GTS A;  2G38 A;  4W4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...