4J7KA

The crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
90
structure length
90
Chain Sequence
NAMAEIKITPEELERIAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGQFIQSKQAMQQYIPILEGISTDLKRIADKFRNTDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a secreted protein EsxB (Mutant E54Q) from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Unknown function
molecule keywords secreted protein EsxB
total genus 40
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.850 Mainly Alpha Orthogonal Bundle Helix Hairpins HP0062-like domain 4j7kA00
4W4LA 4J7KA 4J42A 4W4KA 4KXRA 2GTSA 3FX7A 2G38A 4IYIA 4J10A 4J11A 4IYHA 4J7JA 4J41A
chains in the Genus database with same CATH superfamily
3L72H 4LCUC 2KSDA 4XBFA 4CS3A 3WG7B 3EFFK 1AJPA 3P30A 3RYHB 2Y4UA 3HKCB 2CTRA 4HNAA 3MD0A 3N2GA 1NBMG 4JTDB 3ZHRA 4DV1B 3BA9A 3LUTB 3SYQA 3ABKC 5IYZB 1PNKA 3FYIB 2GSMB 2GBOA 3K5MA 1GM9A 1K92A 4B3SO 2EIMB 2QWRB 1WJZA 3A0BZ 4DW1A 4MVUA 5A2QN 1HWYA 3ZX6A 3E8FA 5JCOA 1FJGB 3HKDA 3VBBA 4JI4O 4WFFA 2UXXA 2PYJA 1VIBA 3ZN0A 4B3RO 1O9HA 4PA9A 3CWBH 5JWPA 1L0NH 4J11A 1XREA 5KA5A 2W6IG 5IYBO 1N33O 2HHHO 4B3MB 2ZNIA 4B7KA 2ATKC 4JI2B 4LF7O 4FM1A 2HEPA 4B08A 2JGUA 4DV0B 1NQTA 4Z1VA 2CDYA 5KHHA 4X9QA 1M9NA 4ZBMA 3F5TA 2YICA 1CEZA 1R6TA 3SR2C 3OEHG 4PDMA 1ZL8B 3L74H 2VWKA 4LBEC 1S5HC 1R3KC 4DV5O 3OEEG 1S5LZ 3K06A 4GLXA 1LUVA 1GKFA 3TETA 3K57A 2UU9B 2V7QG 2QR4A 4WFBV 4GKJB 3OTOO 2LP7A 2Z3YA 2EIKC 4YIPA 3WFVA 4CC6A 4PI0A 5IYZA 1XHZA 2WPDG 3CC4V 2AXTZ 1B06A 2ZXWC 3N2GB 2EJ7A 4LF6O 4DK0A 1VQNV 5EYPA 2DE0X 3B8NA 1QU7A 1TUBA 2R9RB 1FPOA 3ZRWB 4DR7B 4JI6O 2PF4E 3K9SA 5IYDO 1DTOA 3CCEV 4CH4A 4X20B 3RWRD 4DXWA 4DK1A 1OCZC 5C8YA 1MG1A 5CA1B 2E3CA 4PHZA 4BW9A 2UXCO 1K5QA 2Y69B 1YEWA 5JVDA 1S76D 3MAQA 4K3AA 2K1EA 2ZXWB 2X6AA 4QPJA 1TUEB 1FAFA 1I94O 2RCVA 3AG7A 1H2MA 1QBZA 2JGDB 3OFNG 1I5YA 3CCMV 3SJAC 5IE9A 2ZE5A 4J9ZB 4LH6A 2LGQA 2PTMA 1F7YA 3ZHSA 5FLXN 2AHYA 1S72V 1QNMA 2H94A 5CN0A 1YJNV 1Q82W 3IC7A 1CPYA 3CRQA 4DR6B 5HFMA 4LP8A 5CA0B 5CA0A 1G6UA 3OAAG 1FYJA 2RDCA 2UXBO 2ZKOA 4GX0A 5LMNO 4JZ2A 4RWUA 3RYCA 3WU2Z 1AR1B 5BMVA 4D7TA 4PDVA 4X89A 1XNRO 2A3QA 5JH7A 5BMVB 1HR0B 1Q86W 5LXTB 1NJIW 3JD3A 3E2EA 1IZ3A 4PA4A 2L35A 4DR3O 4OX9B 3E22A 2JRIA 3NR7A 1GK9A 3S3XA 5A9GA 4NXMB 3B40A 3K79A 1BSMA 3B77A 1ZUQA 1EN6A 3ASOB 1Y76A 2K9PA 1HW7A 1KU9A 2E74B 4LF8O 2A06H 3OMAB 3QF7A 3K9AA 3R66A 2HJDA 5JQGB 1W2BU 3HR0A 2QM7A 5LBQA 4X1IA 2LW7A 2FB5A 2OWOA 3RYFB 3MDSA 1V9PA 3EVKA 2UUCO 4F6RB 2JS3A 2CGOA 2HG5C 4H0LB 4FLTA 1GN4A 1OV9A 5GW7A 1US6A 4ZI7B 1JFFB 3C90A 1Y66A 3A8TA 5BZBA 2WA3A 2IJJA 1HNXB 3KZIZ 1SZXA 3K3WA 2A0LA 1IVSA 5J9PC 2ZD9A 1WP8A 3ASOC 4JI3B 1UPGA 2ADQB 5KX5B 2DMXA 1HNZB 4DO2A 1VF6C 4MT8A 3GVMA 2IM9A 4QJFB 4MVOA 4MVQA 5JJNB 4KL1A 3Q4HB 3LDEA 3L71H 1PP9H 2WSSG 3E35A 2JEXA 1FJGO 4JI4B 5JCOC 1M4UA 3AG2C 2PUSA 2QSAA 2A7WA 3FFQA 2CK3G 1M57B 2QTSA 4JI7B 3UKMA 3ABKB 3T4DA 1FXKB 1SRYA 3AK2A 4LFCB 3ABLC 4GX5A 1FKAO 4RO2A 4J7JA 2Y0PA 4RAIA 5EBLC 4KUMA 4IGGA 2CTQA 4UCSA 4FMTA 4LF6B 3SPJA 3LSSA 4DV2B 3JSLA 1Q6IA 4UXNA 1VQPV 5KUMA 3CPWU 3HKEA 3PN1A 3VQYA 4ZOLA 4H44B 1FFXA 4I0XA 4X62O 4GT1A 4ZOLB 1G4YB 2OCCC 1N0NA 4LF5O 4YHHO 1Q6UA 1IXBA 4PA6A 3RVYA 2DYSB 4G2KA 1QLEC 3CCSV 2QDOA 1Q8IA 5KHIA 5H5NA 4EKWA 2NR5A 4X1YB 3OGCC 2OCHA 1M56B 2B1IA 3SJQC 3ZHTA 4I0XB 5D5PA 1B04A 1OCRC 1YJWV 2Q73A 4XDJA 3ZHQA 4H33A 3OE7G 1GAXA 4KFMA 2BSKA 3D8CA 1FD9A 3ABTA 5IWAB 5BXZA 1ZLZA 4MVSA 3LSUA 1GN3A 3T1CA 1H8HG 2XAQA 1G8MA 4JI0B 3E8BA 1NU1H 4FIPC 2XAHA 3CCJV 1I5XA 2WLLA 1AI5A 2KG7B 4CBCA 2KQXA 2AW9A 2QTOA 3KCYA 1HNWO 3OTFA 4JYBA 4IIJB 3D36C 4WF9V 5L3GA 3ZEDA 1XEQA 4OPAA 4JTAB 1YI2V 1EN5A 1YXBA 3GB7C 3IFXA 2NN4A 1ZTEA 1SQBH 1KKDA 1BGYH 3K08A 1X4TA 5LHGA 5LA6A 1GO3F 1D5NA 1RP3B 1QQCA 5B1BB 4WFHA 2P06A 4JAUA 2YUAA 3K58A 3IGAC 5LHIA 4X64B 2ARHA 4YIOA 2Q7HA 2W6JG 2ZE7A 4O4LA 4TUYA 3JD1A 3OMIB 4HBNA 5L3FA 1RM1C 4TV9A 1K9MW 1AI7A 1JFFA 2QKAA 4UFZA 2X0LA 1NTKH 3H9VA 2CH7B 2YSUB 2QJ1A 4FK5C 1AP6A 3C3SA 3P32A 3CP1A 1E1QG 4O2AB 4JI1O 4X65O 5LMUB 2LO1A 2ZT9B 2OIEA 2VWJA 5GTHZ 4Z2WA 4DV6B 5H6RA 3BRCA 4YY3O 1N0JA 5IY5B 3JAWA 3RYFA 4FLUA 3RFRA 4FJCC 1MZEA 1LNQA 1NTMH 1H8EG 4Q6GA 1ROPA 2N74A 3QO7A 4JI7O 4TUYB 3X2QB 1Q43A 1WN7A 2F43G 2FMLA 4TWKA 1YITV 4LWSA 3CS5A 2MW2B 4O4JB 1H2SB 5L3EA 4L87A 1NH2B 2AHZA 1F51A 4P9OA 1VQ5V 1SA0B 1DK1A 1BE3H 1PNMA 3UCSC 3T1HB 3D36A 1H2GA 4W4LA 4G28B 3D3QA 3AK3A 1U96A 3ZJZA 1WP7A 4MW8A 2EBOA 1V55C 1P7BA 4WBNB 4DV7B 3RYCB 2EILC 5J2UB 2O57A 2RQ6A 2KG7A 1EM1A 5EZYA 4NTWA 3WG7C 2Q5ZA 4CS4A 2P7TC 2IW5A 4FLZA 3W7WA 3J81N 5B1AB 1VP7A 3OUSA 3CCUV 4XDKA 4I50A 3JAMN 1P49A 5GONA 2YIBD 2ITDC 1R6NA 1N4CA 1M57C 1JQ0A 2M7WA 1IBLB 2ODMA 4JF3A 4EB6B 4FLXA 1DF5A 3H01A 3CC7V 3L70H 3CXCU 3JATB 4KP4A 2IJIA 1NS1A 3RVZA 1SQFA 3EXAA 3M8AA 2HP8A 5AG2A 3SJBC 4DV0O 3MHHC 3A0RA 2MK3A 1A32A 2RNBA 4UVAA 2HFEC 2WLJA 2LQTA 3K0DA 1L1FA 2PI5A 1MSDA 4HNAB 1YHQV 1JR9A 4JYAO 3SGIA 2HR3A 4WFGA 2Q6AA 4O4IB 5LGNA 1PM9A 1FXKC 4UCRA 1PL0A 1NI8A 3ZHVA 4PDLA 1WA8A 3B2EE 4QE9A 1KUQA 5DM6V 4LC1A 4O2BA 4U3JA 1VQ6V 4P2ZA 2YIDA 2YI9A 2Q9LA 2VQFB 1KD1W 2QEXV 4I55A 3AG1C 4F6EA 3ZIAG 2EIKB 3CX5F 3TK1A 4X65B 5IJ0A 2QA4V 4UB8Z 4F6RA 3K04A 1K3EA 2FL4A 3I56V 3SJCC 3LDCA 1AP5A 2Y48A 1YJ9V 4BWAA 4GKKB 1KMIZ 1GM7A 1NKDA 2VRZA 1I94B 3KKYA 1PV0A 1Q90D 1WA8B 1PL4A 3CJHA 4MTXA 4H37A 4ABMA 3BHPA 1XL6A 1VARA 3CCRV 1X59A 2HVJC 1NZ6A 2YEVA 4GCZA 3ZN1A 2ZR3A 5LP6B 4DR7O 4TV8A 5KX5A 2XHBA 4HZ3A 1NVPD 1AJNA 2EIMC 2Q67A 4BAYA 1O9GA 4O4HB 2VS0A 4JV5B 2DQ0A 4FPPA 2GTSA 2WWWA 1YVWA 1UFIA 5LXTA 1VQ4V 3JATA 1QR9A 4E2LA 2UUCB 2WLKA 2XAJA 3JCZA 3HKBA 1T5EA 1HR0O 1NR7A 2A9HA 1XNRB 1AR5A 4PA3A 4DV7O 1JCHA 3FB5C 2OYQA 1M93A 3AG4B 4JPRA 2C2AA 3CCLV 4R7CA 4J7KA 3QO8A 1TVKB 1UJWB 4ZKIA 2V4DA 4ICGA 1PPJH 4LF8B 1DF4A 1ZX3A 3CCQV 4DRXB 3ETDA 3AG3C 2YXYA 1COWG 1N32B 1CP9A 4FVMA 2B9ZA 3LDDA 1JJ2U 3E22B 5CBFA 2NLJC 4HYOA 2OTJV 4JYCA 1QVGU 1YIJV 2ADPA 2XTAA 3SYAA 2P90A 2F66C 3JAWB 3CB2A 3ZHUA 4IYIA 4DV1O 4IHJB 1DLBA 3T4ZA 2F23A 2JIZG 5B1BC 1E79G 1FXVA 1TA8A 3SPCA 3OM3B 2XT9A 3CEIA 4J80A 2LFSA 2CH7A 3W7TA 2QM4A 4K0KO 1KP2A 1WNSA 1R3IC 1KECA 4PDRA 4YY3B 2ILMA 2DYRC 5IY5C 4NXMO 2WLMA 1HNZO 4NXNB 1OCCC 4DUYO 4BW5A 2M6YA 5FPRA 4QIWF 1WB7A 1EZJA 3K0GA 5FL7G 4B3RB 1IXMA 1GMGA 2IU0A 5B1OA 1W0JG 4X1KA 3STZC 1TUBB 1WPXA 3CJHB 1SKVA 2DOSA 2B5UA 5B5EZ 1SQVH 4OXSA 3FAVA 1VF7A 4F4LA 3ML0A 5IJ0B 5H9CA 5C93A 1SQXH 3ZS8C 3SYPA 5EIBD 2JDIG 1OHHG 3T1YO 2XUMA 4GZRB 1LR1A 4E4EA 1BZKA 2XNDG 5CA1A 4DR2B 1VQ8V 1VMGA 2HLDG 1I08A 4PV1B 4UVBA 2RJZA 2DW4A 4R50A 1IBKB 3TXQA 2XAFA 2CE4A 2F4VB 4CC5A 5E1AC 4ASUG 3BY6A 4X66O 3TCUA 2L6LA 1PNLA 5LOVB 4X88A 4IT5A 3CYOA 1EFRG 1IBLO 1KKCA 3F5WC 3JARA 5FNVB 4Q20A 3ABMB 5HFLA 4LF5B 4P9PA 3CHXA 1BQ0A 2WLHA 1AVMA 2E76B 3QVNA 5IYCO 1F4MA 4JAVA 2BTQA 4DR5O 4DR1O 1Y4MA 3G4SV 1S77D 1BHAA 4DW0A 4MTGA 4ZHQB 4J42A 4I5SA 1SESA 2ZQMA 5LGTA 4X64O 2YXLA 4LR3A 3ZCCA 1HP8A 2YS8A 2R9IA 1VF6A 2ZDIA 3R65A 3P3NA 4DV3O 2KB1A 3H1IH 3ASNC 5L3CA 3O65A 1EN4A 5EC1C 1HNWB 1K7DA 1WLEA 5IJ9B 5K1PA 2F95B 4QPKA 2WLNA 2EILB 4I7ZB 4WFAV 2UUBO 3APQA 2EIJC 2VQFO 2UUAB 3ZMTA 2ZNJA 5IT9N 3VQXA 1S0VA 3I55V 1KP3A 1YTFB 2Q8VA 3K5OA 4UCTA 4UUJC 3SPGA 1H38A 5IDJA 1XDCA 4EEQA 3AG3B 5KLVH 1JMKC 3QG5A 1NVPB 1K33A 1QLNA 2E75B 3P3PA 3UO3A 4UV8A 2R9AA 1XMOB 4R8CA 2FTKA 4NVPA 2WA4A 1FXKA 3G71V 4LF9O 3JSNA 4PD4F 4MSWC 1Q5OA 4NR1A 4JGSA 5KMGB 2P4VA 5GTIZ 2Z0AA 4JI1B 2JK5C 4UV9A 2HJFC 5KHGA 1VQKV 1Z5WA 2Z5UA 3WB1A 3DXRB 3J7AU 2R72A 1EBOA 4A5UB 5CB4B 3Q4HA 4YJ2B 5CA3A 2BOCC 4LFBB 2JJ1G 3E89A 5J2TB 2P67A 3F7YC 1R73A 3T1YB 2Y4TA 3BCCH 3J80N 2WLIA 2DYRB 2Q4PA 2ETNA 3APOA 5LHHA 4ZIBA 3JAKA 4RQEA 3ZRVA 1XMQO 1GM8A 1BMFG 1NR1A 3JASA 4LF4O 4ZI7A 1PKXA 3JYCA 4DV5B 4O2AA 3M99B 4X1KB 2N04A 5LMUO 2AGAA 1Q6HA 1AI4A 2LGWA 3H1KH 3FYEB 3ETQA 2BE3A 3LNMB 5KAIZ 2OTLV 2YIBA 1YF2A 3VOUA 3U10A 2Q7GA 3ZMUA 2CUGA 2YIAA 1AROP 1V54C 5B66Z 2LW1A 1KQSU 3VQWA 4FFBA 4GKJO 1KYOF 4BIUA 1HNXO 1BHBA 3BVOA 2EULA 3THOA 1NH2D 1XOUA 4DR5B 4JI3O 5LGUA 2P5OA 4Z1MG 2AZ0A 1Y76B 2Q69A 3W7SA 3W7XA 3AEIA 4WFEA 2EZOA 1YZBA 2YDEA 2CGNA 1ZSPA 1JA8A 4IHJA 4GUNA 3B09A 2WAMA 2ZIOA 4FFBB 2UXDB 3KG2A 1L8DA 2P22C 2E5LO 3UT5A 3UT5B 3CRAA 5JH7B 3FD9A 3ZMSA 2ZE6A 3TJTA 2XASA 4AILC 1D5AA 1GN6A 3RT3C 4NB5A 1XQ8A 4MTOA 2G38A 4I9QA 1Q3EA 3ABLB 2ZM6O 5H6QA 3JASB 4AQYO 5JJJB 1LUWA 5LP6C 1H2LA 2UUBB 2EINB 3RGBA 3NXSA 3BFRA 1XNQB 3AG2B 3TGUH 2PY5A 3JD4A 4X20A 3IAYA 4TV8B 5LP6A 1F4NA 2R70A 4KXRA 3M7MX 4U7OA 3HKBB 2QKCA 3L9DA 4PA7A 5CB4A 4YJ3B 3X2QC 4EFBA 3UM7A 2RMKB 5B1NA 1EZVH 3ZRXA 4EFEA 2X6BA 3FAVB 1JOYA 4J41A 1M56C 1AR4A 1SZTA 1VQOV 4YHHB 4KHPO 2EZPA 1I7FA 1QLEB 3U11A 3N2KA 5KMGA 3G80A 4X66B 5B3SB 1NTZH 3K59A 3SPHA 2GV9A 1K97A 1JVMA 4YJ2A 4AHCA 4NTXA 1GRJA 2EINC 3G67A 5C8YB 1SQGA 3DXRA 1M90W 1S5JA 2HVKC 3AK1A 4JTCB 4UCUA 5BR8B 2X7RB 4TT3G 4B3TO 1GTOA 3SYOA 4JYAB 5D5QA 1XHXA 2DQ3A 1Y74A 5B1AC 3SYCA 1WB8A 4O4IA 4DR4B 5DEDA 4QE7A 1R3JC 4XDLA 1RPRA 2QGNA 2F1MA 3ABMC 1OCOC 2ZR2A 4K8ZA 1OZ0A 4N21A 3ICXA 4JI8O 4JYYA 2GUZA 4CH5A 4TOIA 2YXHA 2Q7EA 3LSQA 1J5EB 2F93B 3E8HA 3CD6V 2WLLB 4PELA 1KC8W 1N36B 5H2FZ 1AI6A 2LJ2A 4UB6Z 4GKKO 4UCVA 2BSKB 2UUAO 5EK0A 3A2FA 1TGOA 5DECA 5E79Z 5EBWC 1W59A 3FB6C 2YI8A 5KAFZ 4X1YA 5EZYB 1BCCH 4I4TB 1QR8A 3OUFA 1XMQB 4JV5O 5JJEB 1XMOO 3SPIA 3CRRA 3DGEA 1F23A 2GUZB 3RN4A 2BCCH 1Z5VA 4P30A 2W0FC 4B3MO 1GH6A 4BR6A 1Q7YW 1AB3A 1B6QA 1ORQC 3FB8C 1N8RW 1MSWD 1K4DC 1MZFA 4MVZA 3OTOB 3UQ8A 1Y74B 3DTUB 1N33B 2HHHB 2BTQB 2ZM6B 1THZA 3FKSG 3HKDB 3CSXA 2QWOB 2DWEC 2IU3A 2JVDA 4FLYA 2DWDC 2UXNA 1IBMO 3K5NA 2ZINA 1VQLV 1QHTA 3ABUA 3H1JH 5FPOA 2D2CB 1P4RA 3ZMZA 4B3SB 3E86A 2UXDO 3T1HO 1N32O 5K1XA 4O2BB 4U3JB 4YXWG 5LL6Y 4MW3A 4FFKA 4GX1A 4O4JA 1FS0G 3S3WA 1IURA 2AZ2A 3N27A 2ZCEA 1K73W 4YJ3A 4JI5B 5EIBC 1DGSA 4WCEV 2FYUH 4NKGB 4DR2O 4LFAO 3H1HH 1KB9F 2Y69C 1BQZA 3N2KB 4DYLA 1TAEA 3QO5A 3CC2V 3ASNB 3B4SA 5BR8O 4NXNO 1SS3A 5ITZB 1AJQA 2QKSA 1QVFU 5LA6B 3OW2U 5LYJA 2QWNB 4JI6B 1IBKO 2KKWA 3JALB 3AG1B 3BABA 4CS2A 4X8AA 4TV9B 1BS3A 2DYSC 4H13B 3T2MA 4D6TH 3CXHF 3E8GA 3ZBHA 4DUZB 4D7SA 2E5LB 4KHPB 4DR6O 4J10A 5KHKA 4DV4O 2PZSA 2OCCB 1XL4A 2QE7G 5JQGA 1D2DA 2UXBB 5LMNB 2JEUA 4I50B 3BAAA 1OCZB 3CRCA 3HB3B 4IL6Z 3K03A 2Q0OC 3CRMA 3U0ZA 4FM2A 4AQYB 3JCUZ 3W7UA 4LNUB 1IX9A 2Q68A 1R3LC 4NYKA 2XAGA 1B3QA 2QWPB 1URFA 4MVRA 1ENVA 3QTCA 4I4TA 4PJ0Z 1SF9A 1Z2GA 1VEWA 3JD0A 3ETGA 4G27B 2F4VO 1K34A 1S3JA 2OT5A 3WB0A 1KBHA 4JI8B 1ZL8A 2PI4A 2PYLA 2ZIMA 1Y67A 3LNNA 5CMUA 1V54B 1TVKA 4CZZA 4FLWA 2VQEB 2JS5A 2QM8A 3JD2A 2GDSA 4U3FH 3H1LH 4QNHB 1MNGA 4LWSB 1XUQA 1SQPH 5GONB 4B7EA 2JJ2G 4BIOA 4JZGA 4DR1B 1H2NA 3GWKC 2X6CA 4LFBO 2YEVB 3OT7A 3B8MA 2GHYA 4UCOA 4DV6O 2IH1C 4OX9O 3BEHA 1FFTB 1ZAUA 1WAZA 4J9YB 2JGDA 3FX7A 4RUEA 1MABG 2GTAA 1N34O 1K8AW 5EBMC 4DR3B 4WBNA 4QGPA 2IH3C 4IYHA 3CMAV 1OCCB 4FZ0A 1XILA 1XI1A 1YCIA 4JI2O 2DJVA 4I55B 1OJHA 5KA6A 5CBGA 4AI8A 4J7ZA 2FKXA 2EIJB 3RW0A 1P84F 3DC6A 4TSFG 1AILA 3RYHA 2OIGA 3VQVA 2LFRA 3AG4C 3DC5A 3DSQA 1ZWIC 4NTYA 3MHSC 3ZRWA 1VQ9V 4JI5O 1OCOB 1WPBA 1VQ7V 3WB2A 2B1GA 3SDLA 5L3DA 4LFAB 4HAMA 2N05A 2P4KA 3RYIB 4K35A 1SETA 1U97A 1E1RG 3UO2A 1VF5B 2EJRA 1MOFA 3OR7C 4TQFA 3BPZA 3HKCA 3G6EV 1HDJA 3IJ4A 4LF9B 1NT2B 3QNEA 4OPHA 4LF4B 4RUFA 3ETEA 1BL8A 3I5DA 1GN2A 4FLVA 3STLC 1RFYA 2RN9A 2IJHA 3O9OA 3HPLC 2V1DA 4JASA 1YSCA 4MS2A 4X1IB 4K0KB 4DV4B 1MA1A 1FXHA 1XNQO 3GWOA 4PI2A 4LFCO 5IJ9A 2CTPA 1JX9A 4DUYB 4ZHQA 4RQFA 2NNUA 4CH3A 1H2KA 4MVMA 2P6JA 1K5SA 2BOBC 3C3TA 4DV2O 5L3BA 4EB6A 4IIJA 1J95A 5KHJA 5BY1A 1RSOB 5FNVA 3JARB 1RPOA 3CCVV 1G1XB 4LNUA 1IBMB 1RM1B 1JPXA 2ITCC 3EHBB 5F2VO 1PD3A 2ZE8A 3IC9A 2UXCB 3FB7C 2Q0AA 2ZDIC 1FFXB 4LF7B 5DN6G 3HKEB 3RBZA 4X62B 1BT8A 5KUKA 2VQEO 4R6ZA 3KCXA 3PJSK 3L73H 5CBHA 3CE2A 4CH6A 5J2UA 4B3TB 1OCRB 2PGGA 4JAAA 1MMMA 5LOVA 2CAZC 1XBLA 4UVCA 3A0HZ 1SC5B 4FZ1A 3E83A 1JJOA 2H8PC 2QWQB 1R6KA 2W0XA 4GYCB 1M1KW 3OR6C 2BTOA 2IJKA 3OGIB 3F7VC 4C7UA 3CMEV 1SA0A 2H3OA 4OGQB 1N34B 5B3SC 4O4HA 1P7GA 4MTFA 1Y6XA 2UU9O 4W4KA 1SERA 5IWAO 2HKOA 1YTFD 1SQQH 3D3IA 4JI0O 1N36O 3OMNB 2XOKG 1VQMV 2D3OW 2EX3A 3K5LA 1RSOA 4DUZO 3BA8A 2A79B 1Q81W 4L8JA 1I0HA 3G6BA 1YDXA 1K4CC 4N23A 4K8XA 3L75H 2YC0A 5TISZ 4DR4O 4BIZA 4U7NA 1V55B 3JALA 5JVDB 1QCEA 4GX2A 1W0KG 5LYJB 5EC2C 4DV3B 5EYPB 1IDSA 5ITZA 3ZRSA 2Y0IA 1M5IA 3JAKB 2IBZH 4O4LB 2CTWA 2DN9A 1CXZB 3TXSA 4LH7A 1L0LH 1R1BA 4TQDA 4I9WA 3RYIA 2WLIB 4DRXA 4FM0A 5J2TA 3OD4A 3ZMVA 1J5EO
chains in the Genus database with same CATH topology
4W4LA 4J7KA 4J42A 4W4KA 4KXRA 2GTSA 3FX7A 2G38A 4IYIA 4J10A 4J11A 4IYHA 4J7JA 4J41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W4L A;  4J7K A;  4J42 A;  4W4K A;  4KXR A;  2GTS A;  3FX7 A;  2G38 A;  4IYI A;  4J10 A;  4J11 A;  4IYH A;  4J7J A;  4J41 A; 
#chains in the Genus database with same CATH topology
 3L72 H;  4LCU C;  2KSD A;  4XBF A;  4CS3 A;  3WG7 B;  3EFF K;  1AJP A;  3P30 A;  3RYH B;  2Y4U A;  3HKC B;  2CTR A;  4HNA A;  3MD0 A;  3N2G A;  1NBM G;  4JTD B;  3ZHR A;  4DV1 B;  3BA9 A;  3LUT B;  3SYQ A;  3ABK C;  5IYZ B;  1PNK A;  3FYI B;  2GSM B;  2GBO A;  3K5M A;  1GM9 A;  1K92 A;  4B3S O;  2EIM B;  2QWR B;  1WJZ A;  3A0B Z;  4DW1 A;  4MVU A;  5A2Q N;  1HWY A;  3ZX6 A;  3E8F A;  5JCO A;  1FJG B;  3HKD A;  3VBB A;  4JI4 O;  4WFF A;  2UXX A;  2PYJ A;  1VIB A;  3ZN0 A;  4B3R O;  1O9H A;  4PA9 A;  3CWB H;  5JWP A;  1L0N H;  4J11 A;  1XRE A;  5KA5 A;  2W6I G;  5IYB O;  1N33 O;  2HHH O;  4B3M B;  2ZNI A;  4B7K A;  2ATK C;  4JI2 B;  4LF7 O;  4FM1 A;  2HEP A;  4B08 A;  2JGU A;  4DV0 B;  1NQT A;  4Z1V A;  2CDY A;  5KHH A;  4X9Q A;  1M9N A;  4ZBM A;  3F5T A;  2YIC A;  1CEZ A;  1R6T A;  3SR2 C;  3OEH G;  4PDM A;  1ZL8 B;  3L74 H;  2VWK A;  4LBE C;  1S5H C;  1R3K C;  4DV5 O;  3OEE G;  1S5L Z;  3K06 A;  4GLX A;  1LUV A;  1GKF A;  3TET A;  3K57 A;  2UU9 B;  2V7Q G;  2QR4 A;  4WFB V;  4GKJ B;  3OTO O;  2LP7 A;  2Z3Y A;  2EIK C;  4YIP A;  3WFV A;  4CC6 A;  4PI0 A;  5IYZ A;  1XHZ A;  2WPD G;  3CC4 V;  2AXT Z;  1B06 A;  2ZXW C;  3N2G B;  2EJ7 A;  4LF6 O;  4DK0 A;  1VQN V;  5EYP A;  2DE0 X;  3B8N A;  1QU7 A;  1TUB A;  2R9R B;  1FPO A;  3ZRW B;  4DR7 B;  4JI6 O;  2PF4 E;  3K9S A;  5IYD O;  1DTO A;  3CCE V;  4CH4 A;  4X20 B;  3RWR D;  4DXW A;  4DK1 A;  1OCZ C;  5C8Y A;  1MG1 A;  5CA1 B;  2E3C A;  4PHZ A;  4BW9 A;  2UXC O;  1K5Q A;  2Y69 B;  1YEW A;  5JVD A;  1S76 D;  3MAQ A;  4K3A A;  2K1E A;  2ZXW B;  2X6A A;  4QPJ A;  1TUE B;  1FAF A;  1I94 O;  2RCV A;  3AG7 A;  1H2M A;  1QBZ A;  2JGD B;  3OFN G;  1I5Y A;  3CCM V;  3SJA C;  5IE9 A;  2ZE5 A;  4J9Z B;  4LH6 A;  2LGQ A;  2PTM A;  1F7Y A;  3ZHS A;  5FLX N;  2AHY A;  1S72 V;  1QNM A;  2H94 A;  5CN0 A;  1YJN V;  1Q82 W;  3IC7 A;  1CPY A;  3CRQ A;  4DR6 B;  5HFM A;  4LP8 A;  5CA0 B;  5CA0 A;  1G6U A;  3OAA G;  1FYJ A;  2RDC A;  2UXB O;  2ZKO A;  4GX0 A;  5LMN O;  4JZ2 A;  4RWU A;  3RYC A;  3WU2 Z;  1AR1 B;  5BMV A;  4D7T A;  4PDV A;  4X89 A;  1XNR O;  2A3Q A;  5JH7 A;  5BMV B;  1HR0 B;  1Q86 W;  5LXT B;  1NJI W;  3JD3 A;  3E2E A;  1IZ3 A;  4PA4 A;  2L35 A;  4DR3 O;  4OX9 B;  3E22 A;  2JRI A;  3NR7 A;  1GK9 A;  3S3X A;  5A9G A;  4NXM B;  3B40 A;  3K79 A;  1BSM A;  3B77 A;  1ZUQ A;  1EN6 A;  3ASO B;  1Y76 A;  2K9P A;  1HW7 A;  1KU9 A;  2E74 B;  4LF8 O;  2A06 H;  3OMA B;  3QF7 A;  3K9A A;  3R66 A;  2HJD A;  5JQG B;  1W2B U;  3HR0 A;  2QM7 A;  5LBQ A;  4X1I A;  2LW7 A;  2FB5 A;  2OWO A;  3RYF B;  3MDS A;  1V9P A;  3EVK A;  2UUC O;  4F6R B;  2JS3 A;  2CGO A;  2HG5 C;  4H0L B;  4FLT A;  1GN4 A;  1OV9 A;  5GW7 A;  1US6 A;  4ZI7 B;  1JFF B;  3C90 A;  1Y66 A;  3A8T A;  5BZB A;  2WA3 A;  2IJJ A;  1HNX B;  3KZI Z;  1SZX A;  3K3W A;  2A0L A;  1IVS A;  5J9P C;  2ZD9 A;  1WP8 A;  3ASO C;  4JI3 B;  1UPG A;  2ADQ B;  5KX5 B;  2DMX A;  1HNZ B;  4DO2 A;  1VF6 C;  4MT8 A;  3GVM A;  2IM9 A;  4QJF B;  4MVO A;  4MVQ A;  5JJN B;  4KL1 A;  3Q4H B;  3LDE A;  3L71 H;  1PP9 H;  2WSS G;  3E35 A;  2JEX A;  1FJG O;  4JI4 B;  5JCO C;  1M4U A;  3AG2 C;  2PUS A;  2QSA A;  2A7W A;  3FFQ A;  2CK3 G;  1M57 B;  2QTS A;  4JI7 B;  3UKM A;  3ABK B;  3T4D A;  1FXK B;  1SRY A;  3AK2 A;  4LFC B;  3ABL C;  4GX5 A;  1FKA O;  4RO2 A;  4J7J A;  2Y0P A;  4RAI A;  5EBL C;  4KUM A;  4IGG A;  2CTQ A;  4UCS A;  4FMT A;  4LF6 B;  3SPJ A;  3LSS A;  4DV2 B;  3JSL A;  1Q6I A;  4UXN A;  1VQP V;  5KUM A;  3CPW U;  3HKE A;  3PN1 A;  3VQY A;  4ZOL A;  4H44 B;  1FFX A;  4I0X A;  4X62 O;  4GT1 A;  4ZOL B;  1G4Y B;  2OCC C;  1N0N A;  4LF5 O;  4YHH O;  1Q6U A;  1IXB A;  4PA6 A;  3RVY A;  2DYS B;  4G2K A;  1QLE C;  3CCS V;  2QDO A;  1Q8I A;  5KHI A;  5H5N A;  4EKW A;  2NR5 A;  4X1Y B;  3OGC C;  2OCH A;  1M56 B;  2B1I A;  3SJQ C;  3ZHT A;  4I0X B;  5D5P A;  1B04 A;  1OCR C;  1YJW V;  2Q73 A;  4XDJ A;  3ZHQ A;  4H33 A;  3OE7 G;  1GAX A;  4KFM A;  2BSK A;  3D8C A;  1FD9 A;  3ABT A;  5IWA B;  5BXZ A;  1ZLZ A;  4MVS A;  3LSU A;  1GN3 A;  3T1C A;  1H8H G;  2XAQ A;  1G8M A;  4JI0 B;  3E8B A;  1NU1 H;  4FIP C;  2XAH A;  3CCJ V;  1I5X A;  2WLL A;  1AI5 A;  2KG7 B;  4CBC A;  2KQX A;  2AW9 A;  2QTO A;  3KCY A;  1HNW O;  3OTF A;  4JYB A;  4IIJ B;  3D36 C;  4WF9 V;  5L3G A;  3ZED A;  1XEQ A;  4OPA A;  4JTA B;  1YI2 V;  1EN5 A;  1YXB A;  3GB7 C;  3IFX A;  2NN4 A;  1ZTE A;  1SQB H;  1KKD A;  1BGY H;  3K08 A;  1X4T A;  5LHG A;  5LA6 A;  1GO3 F;  1D5N A;  1RP3 B;  1QQC A;  5B1B B;  4WFH A;  2P06 A;  4JAU A;  2YUA A;  3K58 A;  3IGA C;  5LHI A;  4X64 B;  2ARH A;  4YIO A;  2Q7H A;  2W6J G;  2ZE7 A;  4O4L A;  4TUY A;  3JD1 A;  3OMI B;  4HBN A;  5L3F A;  1RM1 C;  4TV9 A;  1K9M W;  1AI7 A;  1JFF A;  2QKA A;  4UFZ A;  2X0L A;  1NTK H;  3H9V A;  2CH7 B;  2YSU B;  2QJ1 A;  4FK5 C;  1AP6 A;  3C3S A;  3P32 A;  3CP1 A;  1E1Q G;  4O2A B;  4JI1 O;  4X65 O;  5LMU B;  2LO1 A;  2ZT9 B;  2OIE A;  2VWJ A;  5GTH Z;  4Z2W A;  4DV6 B;  5H6R A;  3BRC A;  4YY3 O;  1N0J A;  5IY5 B;  3JAW A;  3RYF A;  4FLU A;  3RFR A;  4FJC C;  1MZE A;  1LNQ A;  1NTM H;  1H8E G;  4Q6G A;  1ROP A;  2N74 A;  3QO7 A;  4JI7 O;  4TUY B;  3X2Q B;  1Q43 A;  1WN7 A;  2F43 G;  2FML A;  4TWK A;  1YIT V;  4LWS A;  3CS5 A;  2MW2 B;  4O4J B;  1H2S B;  5L3E A;  4L87 A;  1NH2 B;  2AHZ A;  1F51 A;  4P9O A;  1VQ5 V;  1SA0 B;  1DK1 A;  1BE3 H;  1PNM A;  3UCS C;  3T1H B;  3D36 A;  1H2G A;  4W4L A;  4G28 B;  3D3Q A;  3AK3 A;  1U96 A;  3ZJZ A;  1WP7 A;  4MW8 A;  2EBO A;  1V55 C;  1P7B A;  4WBN B;  4DV7 B;  3RYC B;  2EIL C;  5J2U B;  2O57 A;  2RQ6 A;  2KG7 A;  1EM1 A;  5EZY A;  4NTW A;  3WG7 C;  2Q5Z A;  4CS4 A;  2P7T C;  2IW5 A;  4FLZ A;  3W7W A;  3J81 N;  5B1A B;  1VP7 A;  3OUS A;  3CCU V;  4XDK A;  4I50 A;  3JAM N;  1P49 A;  5GON A;  2YIB D;  2ITD C;  1R6N A;  1N4C A;  1M57 C;  1JQ0 A;  2M7W A;  1IBL B;  2ODM A;  4JF3 A;  4EB6 B;  4FLX A;  1DF5 A;  3H01 A;  3CC7 V;  3L70 H;  3CXC U;  3JAT B;  4KP4 A;  2IJI A;  1NS1 A;  3RVZ A;  1SQF A;  3EXA A;  3M8A A;  2HP8 A;  5AG2 A;  3SJB C;  4DV0 O;  3MHH C;  3A0R A;  2MK3 A;  1A32 A;  2RNB A;  4UVA A;  2HFE C;  2WLJ A;  2LQT A;  3K0D A;  1L1F A;  2PI5 A;  1MSD A;  4HNA B;  1YHQ V;  1JR9 A;  4JYA O;  3SGI A;  2HR3 A;  4WFG A;  2Q6A A;  4O4I B;  5LGN A;  1PM9 A;  1FXK C;  4UCR A;  1PL0 A;  1NI8 A;  3ZHV A;  4PDL A;  1WA8 A;  3B2E E;  4QE9 A;  1KUQ A;  5DM6 V;  4LC1 A;  4O2B A;  4U3J A;  1VQ6 V;  4P2Z A;  2YID A;  2YI9 A;  2Q9L A;  2VQF B;  1KD1 W;  2QEX V;  4I55 A;  3AG1 C;  4F6E A;  3ZIA G;  2EIK B;  3CX5 F;  3TK1 A;  4X65 B;  5IJ0 A;  2QA4 V;  4UB8 Z;  4F6R A;  3K04 A;  1K3E A;  2FL4 A;  3I56 V;  3SJC C;  3LDC A;  1AP5 A;  2Y48 A;  1YJ9 V;  4BWA A;  4GKK B;  1KMI Z;  1GM7 A;  1NKD A;  2VRZ A;  1I94 B;  3KKY A;  1PV0 A;  1Q90 D;  1WA8 B;  1PL4 A;  3CJH A;  4MTX A;  4H37 A;  4ABM A;  3BHP A;  1XL6 A;  1VAR A;  3CCR V;  1X59 A;  2HVJ C;  1NZ6 A;  2YEV A;  4GCZ A;  3ZN1 A;  2ZR3 A;  5LP6 B;  4DR7 O;  4TV8 A;  5KX5 A;  2XHB A;  4HZ3 A;  1NVP D;  1AJN A;  2EIM C;  2Q67 A;  4BAY A;  1O9G A;  4O4H B;  2VS0 A;  4JV5 B;  2DQ0 A;  4FPP A;  2GTS A;  2WWW A;  1YVW A;  1UFI A;  5LXT A;  1VQ4 V;  3JAT A;  1QR9 A;  4E2L A;  2UUC B;  2WLK A;  2XAJ A;  3JCZ A;  3HKB A;  1T5E A;  1HR0 O;  1NR7 A;  2A9H A;  1XNR B;  1AR5 A;  4PA3 A;  4DV7 O;  1JCH A;  3FB5 C;  2OYQ A;  1M93 A;  3AG4 B;  4JPR A;  2C2A A;  3CCL V;  4R7C A;  4J7K A;  3QO8 A;  1TVK B;  1UJW B;  4ZKI A;  2V4D A;  4ICG A;  1PPJ H;  4LF8 B;  1DF4 A;  1ZX3 A;  3CCQ V;  4DRX B;  3ETD A;  3AG3 C;  2YXY A;  1COW G;  1N32 B;  1CP9 A;  4FVM A;  2B9Z A;  3LDD A;  1JJ2 U;  3E22 B;  5CBF A;  2NLJ C;  4HYO A;  2OTJ V;  4JYC A;  1QVG U;  1YIJ V;  2ADP A;  2XTA A;  3SYA A;  2P90 A;  2F66 C;  3JAW B;  3CB2 A;  3ZHU A;  4IYI A;  4DV1 O;  4IHJ B;  1DLB A;  3T4Z A;  2F23 A;  2JIZ G;  5B1B C;  1E79 G;  1FXV A;  1TA8 A;  3SPC A;  3OM3 B;  2XT9 A;  3CEI A;  4J80 A;  2LFS A;  2CH7 A;  3W7T A;  2QM4 A;  4K0K O;  1KP2 A;  1WNS A;  1R3I C;  1KEC A;  4PDR A;  4YY3 B;  2ILM A;  2DYR C;  5IY5 C;  4NXM O;  2WLM A;  1HNZ O;  4NXN B;  1OCC C;  4DUY O;  4BW5 A;  2M6Y A;  5FPR A;  4QIW F;  1WB7 A;  1EZJ A;  3K0G A;  5FL7 G;  4B3R B;  1IXM A;  1GMG A;  2IU0 A;  5B1O A;  1W0J G;  4X1K A;  3STZ C;  1TUB B;  1WPX A;  3CJH B;  1SKV A;  2DOS A;  2B5U A;  5B5E Z;  1SQV H;  4OXS A;  3FAV A;  1VF7 A;  4F4L A;  3ML0 A;  5IJ0 B;  5H9C A;  5C93 A;  1SQX H;  3ZS8 C;  3SYP A;  5EIB D;  2JDI G;  1OHH G;  3T1Y O;  2XUM A;  4GZR B;  1LR1 A;  4E4E A;  1BZK A;  2XND G;  5CA1 A;  4DR2 B;  1VQ8 V;  1VMG A;  2HLD G;  1I08 A;  4PV1 B;  4UVB A;  2RJZ A;  2DW4 A;  4R50 A;  1IBK B;  3TXQ A;  2XAF A;  2CE4 A;  2F4V B;  4CC5 A;  5E1A C;  4ASU G;  3BY6 A;  4X66 O;  3TCU A;  2L6L A;  1PNL A;  5LOV B;  4X88 A;  4IT5 A;  3CYO A;  1EFR G;  1IBL O;  1KKC A;  3F5W C;  3JAR A;  5FNV B;  4Q20 A;  3ABM B;  5HFL A;  4LF5 B;  4P9P A;  3CHX A;  1BQ0 A;  2WLH A;  1AVM A;  2E76 B;  3QVN A;  5IYC O;  1F4M A;  4JAV A;  2BTQ A;  4DR5 O;  4DR1 O;  1Y4M A;  3G4S V;  1S77 D;  1BHA A;  4DW0 A;  4MTG A;  4ZHQ B;  4J42 A;  4I5S A;  1SES A;  2ZQM A;  5LGT A;  4X64 O;  2YXL A;  4LR3 A;  3ZCC A;  1HP8 A;  2YS8 A;  2R9I A;  1VF6 A;  2ZDI A;  3R65 A;  3P3N A;  4DV3 O;  2KB1 A;  3H1I H;  3ASN C;  5L3C A;  3O65 A;  1EN4 A;  5EC1 C;  1HNW B;  1K7D A;  1WLE A;  5IJ9 B;  5K1P A;  2F95 B;  4QPK A;  2WLN A;  2EIL B;  4I7Z B;  4WFA V;  2UUB O;  3APQ A;  2EIJ C;  2VQF O;  2UUA B;  3ZMT A;  2ZNJ A;  5IT9 N;  3VQX A;  1S0V A;  3I55 V;  1KP3 A;  1YTF B;  2Q8V A;  3K5O A;  4UCT A;  4UUJ C;  3SPG A;  1H38 A;  5IDJ A;  1XDC A;  4EEQ A;  3AG3 B;  5KLV H;  1JMK C;  3QG5 A;  1NVP B;  1K33 A;  1QLN A;  2E75 B;  3P3P A;  3UO3 A;  4UV8 A;  2R9A A;  1XMO B;  4R8C A;  2FTK A;  4NVP A;  2WA4 A;  1FXK A;  3G71 V;  4LF9 O;  3JSN A;  4PD4 F;  4MSW C;  1Q5O A;  4NR1 A;  4JGS A;  5KMG B;  2P4V A;  5GTI Z;  2Z0A A;  4JI1 B;  2JK5 C;  4UV9 A;  2HJF C;  5KHG A;  1VQK V;  1Z5W A;  2Z5U A;  3WB1 A;  3DXR B;  3J7A U;  2R72 A;  1EBO A;  4A5U B;  5CB4 B;  3Q4H A;  4YJ2 B;  5CA3 A;  2BOC C;  4LFB B;  2JJ1 G;  3E89 A;  5J2T B;  2P67 A;  3F7Y C;  1R73 A;  3T1Y B;  2Y4T A;  3BCC H;  3J80 N;  2WLI A;  2DYR B;  2Q4P A;  2ETN A;  3APO A;  5LHH A;  4ZIB A;  3JAK A;  4RQE A;  3ZRV A;  1XMQ O;  1GM8 A;  1BMF G;  1NR1 A;  3JAS A;  4LF4 O;  4ZI7 A;  1PKX A;  3JYC A;  4DV5 B;  4O2A A;  3M99 B;  4X1K B;  2N04 A;  5LMU O;  2AGA A;  1Q6H A;  1AI4 A;  2LGW A;  3H1K H;  3FYE B;  3ETQ A;  2BE3 A;  3LNM B;  5KAI Z;  2OTL V;  2YIB A;  1YF2 A;  3VOU A;  3U10 A;  2Q7G A;  3ZMU A;  2CUG A;  2YIA A;  1ARO P;  1V54 C;  5B66 Z;  2LW1 A;  1KQS U;  3VQW A;  4FFB A;  4GKJ O;  1KYO F;  4BIU A;  1HNX O;  1BHB A;  3BVO A;  2EUL A;  3THO A;  1NH2 D;  1XOU A;  4DR5 B;  4JI3 O;  5LGU A;  2P5O A;  4Z1M G;  2AZ0 A;  1Y76 B;  2Q69 A;  3W7S A;  3W7X A;  3AEI A;  4WFE A;  2EZO A;  1YZB A;  2YDE A;  2CGN A;  1ZSP A;  1JA8 A;  4IHJ A;  4GUN A;  3B09 A;  2WAM A;  2ZIO A;  4FFB B;  2UXD B;  3KG2 A;  1L8D A;  2P22 C;  2E5L O;  3UT5 A;  3UT5 B;  3CRA A;  5JH7 B;  3FD9 A;  3ZMS A;  2ZE6 A;  3TJT A;  2XAS A;  4AIL C;  1D5A A;  1GN6 A;  3RT3 C;  4NB5 A;  1XQ8 A;  4MTO A;  2G38 A;  4I9Q A;  1Q3E A;  3ABL B;  2ZM6 O;  5H6Q A;  3JAS B;  4AQY O;  5JJJ B;  1LUW A;  5LP6 C;  1H2L A;  2UUB B;  2EIN B;  3RGB A;  3NXS A;  3BFR A;  1XNQ B;  3AG2 B;  3TGU H;  2PY5 A;  3JD4 A;  4X20 A;  3IAY A;  4TV8 B;  5LP6 A;  1F4N A;  2R70 A;  4KXR A;  3M7M X;  4U7O A;  3HKB B;  2QKC A;  3L9D A;  4PA7 A;  5CB4 A;  4YJ3 B;  3X2Q C;  4EFB A;  3UM7 A;  2RMK B;  5B1N A;  1EZV H;  3ZRX A;  4EFE A;  2X6B A;  3FAV B;  1JOY A;  4J41 A;  1M56 C;  1AR4 A;  1SZT A;  1VQO V;  4YHH B;  4KHP O;  2EZP A;  1I7F A;  1QLE B;  3U11 A;  3N2K A;  5KMG A;  3G80 A;  4X66 B;  5B3S B;  1NTZ H;  3K59 A;  3SPH A;  2GV9 A;  1K97 A;  1JVM A;  4YJ2 A;  4AHC A;  4NTX A;  1GRJ A;  2EIN C;  3G67 A;  5C8Y B;  1SQG A;  3DXR A;  1M90 W;  1S5J A;  2HVK C;  3AK1 A;  4JTC B;  4UCU A;  5BR8 B;  2X7R B;  4TT3 G;  4B3T O;  1GTO A;  3SYO A;  4JYA B;  5D5Q A;  1XHX A;  2DQ3 A;  1Y74 A;  5B1A C;  3SYC A;  1WB8 A;  4O4I A;  4DR4 B;  5DED A;  4QE7 A;  1R3J C;  4XDL A;  1RPR A;  2QGN A;  2F1M A;  3ABM C;  1OCO C;  2ZR2 A;  4K8Z A;  1OZ0 A;  4N21 A;  3ICX A;  4JI8 O;  4JYY A;  2GUZ A;  4CH5 A;  4TOI A;  2YXH A;  2Q7E A;  3LSQ A;  1J5E B;  2F93 B;  3E8H A;  3CD6 V;  2WLL B;  4PEL A;  1KC8 W;  1N36 B;  5H2F Z;  1AI6 A;  2LJ2 A;  4UB6 Z;  4GKK O;  4UCV A;  2BSK B;  2UUA O;  5EK0 A;  3A2F A;  1TGO A;  5DEC A;  5E79 Z;  5EBW C;  1W59 A;  3FB6 C;  2YI8 A;  5KAF Z;  4X1Y A;  5EZY B;  1BCC H;  4I4T B;  1QR8 A;  3OUF A;  1XMQ B;  4JV5 O;  5JJE B;  1XMO O;  3SPI A;  3CRR A;  3DGE A;  1F23 A;  2GUZ B;  3RN4 A;  2BCC H;  1Z5V A;  4P30 A;  2W0F C;  4B3M O;  1GH6 A;  4BR6 A;  1Q7Y W;  1AB3 A;  1B6Q A;  1ORQ C;  3FB8 C;  1N8R W;  1MSW D;  1K4D C;  1MZF A;  4MVZ A;  3OTO B;  3UQ8 A;  1Y74 B;  3DTU B;  1N33 B;  2HHH B;  2BTQ B;  2ZM6 B;  1THZ A;  3FKS G;  3HKD B;  3CSX A;  2QWO B;  2DWE C;  2IU3 A;  2JVD A;  4FLY A;  2DWD C;  2UXN A;  1IBM O;  3K5N A;  2ZIN A;  1VQL V;  1QHT A;  3ABU A;  3H1J H;  5FPO A;  2D2C B;  1P4R A;  3ZMZ A;  4B3S B;  3E86 A;  2UXD O;  3T1H O;  1N32 O;  5K1X A;  4O2B B;  4U3J B;  4YXW G;  5LL6 Y;  4MW3 A;  4FFK A;  4GX1 A;  4O4J A;  1FS0 G;  3S3W A;  1IUR A;  2AZ2 A;  3N27 A;  2ZCE A;  1K73 W;  4YJ3 A;  4JI5 B;  5EIB C;  1DGS A;  4WCE V;  2FYU H;  4NKG B;  4DR2 O;  4LFA O;  3H1H H;  1KB9 F;  2Y69 C;  1BQZ A;  3N2K B;  4DYL A;  1TAE A;  3QO5 A;  3CC2 V;  3ASN B;  3B4S A;  5BR8 O;  4NXN O;  1SS3 A;  5ITZ B;  1AJQ A;  2QKS A;  1QVF U;  5LA6 B;  3OW2 U;  5LYJ A;  2QWN B;  4JI6 B;  1IBK O;  2KKW A;  3JAL B;  3AG1 B;  3BAB A;  4CS2 A;  4X8A A;  4TV9 B;  1BS3 A;  2DYS C;  4H13 B;  3T2M A;  4D6T H;  3CXH F;  3E8G A;  3ZBH A;  4DUZ B;  4D7S A;  2E5L B;  4KHP B;  4DR6 O;  4J10 A;  5KHK A;  4DV4 O;  2PZS A;  2OCC B;  1XL4 A;  2QE7 G;  5JQG A;  1D2D A;  2UXB B;  5LMN B;  2JEU A;  4I50 B;  3BAA A;  1OCZ B;  3CRC A;  3HB3 B;  4IL6 Z;  3K03 A;  2Q0O C;  3CRM A;  3U0Z A;  4FM2 A;  4AQY B;  3JCU Z;  3W7U A;  4LNU B;  1IX9 A;  2Q68 A;  1R3L C;  4NYK A;  2XAG A;  1B3Q A;  2QWP B;  1URF A;  4MVR A;  1ENV A;  3QTC A;  4I4T A;  4PJ0 Z;  1SF9 A;  1Z2G A;  1VEW A;  3JD0 A;  3ETG A;  4G27 B;  2F4V O;  1K34 A;  1S3J A;  2OT5 A;  3WB0 A;  1KBH A;  4JI8 B;  1ZL8 A;  2PI4 A;  2PYL A;  2ZIM A;  1Y67 A;  3LNN A;  5CMU A;  1V54 B;  1TVK A;  4CZZ A;  4FLW A;  2VQE B;  2JS5 A;  2QM8 A;  3JD2 A;  2GDS A;  4U3F H;  3H1L H;  4QNH B;  1MNG A;  4LWS B;  1XUQ A;  1SQP H;  5GON B;  4B7E A;  2JJ2 G;  4BIO A;  4JZG A;  4DR1 B;  1H2N A;  3GWK C;  2X6C A;  4LFB O;  2YEV B;  3OT7 A;  3B8M A;  2GHY A;  4UCO A;  4DV6 O;  2IH1 C;  4OX9 O;  3BEH A;  1FFT B;  1ZAU A;  1WAZ A;  4J9Y B;  2JGD A;  3FX7 A;  4RUE A;  1MAB G;  2GTA A;  1N34 O;  1K8A W;  5EBM C;  4DR3 B;  4WBN A;  4QGP A;  2IH3 C;  4IYH A;  3CMA V;  1OCC B;  4FZ0 A;  1XIL A;  1XI1 A;  1YCI A;  4JI2 O;  2DJV A;  4I55 B;  1OJH A;  5KA6 A;  5CBG A;  4AI8 A;  4J7Z A;  2FKX A;  2EIJ B;  3RW0 A;  1P84 F;  3DC6 A;  4TSF G;  1AIL A;  3RYH A;  2OIG A;  3VQV A;  2LFR A;  3AG4 C;  3DC5 A;  3DSQ A;  1ZWI C;  4NTY A;  3MHS C;  3ZRW A;  1VQ9 V;  4JI5 O;  1OCO B;  1WPB A;  1VQ7 V;  3WB2 A;  2B1G A;  3SDL A;  5L3D A;  4LFA B;  4HAM A;  2N05 A;  2P4K A;  3RYI B;  4K35 A;  1SET A;  1U97 A;  1E1R G;  3UO2 A;  1VF5 B;  2EJR A;  1MOF A;  3OR7 C;  4TQF A;  3BPZ A;  3HKC A;  3G6E V;  1HDJ A;  3IJ4 A;  4LF9 B;  1NT2 B;  3QNE A;  4OPH A;  4LF4 B;  4RUF A;  3ETE A;  1BL8 A;  3I5D A;  1GN2 A;  4FLV A;  3STL C;  1RFY A;  2RN9 A;  2IJH A;  3O9O A;  3HPL C;  2V1D A;  4JAS A;  1YSC A;  4MS2 A;  4X1I B;  4K0K B;  4DV4 B;  1MA1 A;  1FXH A;  1XNQ O;  3GWO A;  4PI2 A;  4LFC O;  5IJ9 A;  2CTP A;  1JX9 A;  4DUY B;  4ZHQ A;  4RQF A;  2NNU A;  4CH3 A;  1H2K A;  4MVM A;  2P6J A;  1K5S A;  2BOB C;  3C3T A;  4DV2 O;  5L3B A;  4EB6 A;  4IIJ A;  1J95 A;  5KHJ A;  5BY1 A;  1RSO B;  5FNV A;  3JAR B;  1RPO A;  3CCV V;  1G1X B;  4LNU A;  1IBM B;  1RM1 B;  1JPX A;  2ITC C;  3EHB B;  5F2V O;  1PD3 A;  2ZE8 A;  3IC9 A;  2UXC B;  3FB7 C;  2Q0A A;  2ZDI C;  1FFX B;  4LF7 B;  5DN6 G;  3HKE B;  3RBZ A;  4X62 B;  1BT8 A;  5KUK A;  2VQE O;  4R6Z A;  3KCX A;  3PJS K;  3L73 H;  5CBH A;  3CE2 A;  4CH6 A;  5J2U A;  4B3T B;  1OCR B;  2PGG A;  4JAA A;  1MMM A;  5LOV A;  2CAZ C;  1XBL A;  4UVC A;  3A0H Z;  1SC5 B;  4FZ1 A;  3E83 A;  1JJO A;  2H8P C;  2QWQ B;  1R6K A;  2W0X A;  4GYC B;  1M1K W;  3OR6 C;  2BTO A;  2IJK A;  3OGI B;  3F7V C;  4C7U A;  3CME V;  1SA0 A;  2H3O A;  4OGQ B;  1N34 B;  5B3S C;  4O4H A;  1P7G A;  4MTF A;  1Y6X A;  2UU9 O;  4W4K A;  1SER A;  5IWA O;  2HKO A;  1YTF D;  1SQQ H;  3D3I A;  4JI0 O;  1N36 O;  3OMN B;  2XOK G;  1VQM V;  2D3O W;  2EX3 A;  3K5L A;  1RSO A;  4DUZ O;  3BA8 A;  2A79 B;  1Q81 W;  4L8J A;  1I0H A;  3G6B A;  1YDX A;  1K4C C;  4N23 A;  4K8X A;  3L75 H;  2YC0 A;  5TIS Z;  4DR4 O;  4BIZ A;  4U7N A;  1V55 B;  3JAL A;  5JVD B;  1QCE A;  4GX2 A;  1W0K G;  5LYJ B;  5EC2 C;  4DV3 B;  5EYP B;  1IDS A;  5ITZ A;  3ZRS A;  2Y0I A;  1M5I A;  3JAK B;  2IBZ H;  4O4L B;  2CTW A;  2DN9 A;  1CXZ B;  3TXS A;  4LH7 A;  1L0L H;  1R1B A;  4TQD A;  4I9W A;  3RYI A;  2WLI B;  4DRX A;  4FM0 A;  5J2T A;  3OD4 A;  3ZMV A;  1J5E O; 
#chains in the Genus database with same CATH homology
 4W4L A;  4J7K A;  4J42 A;  4W4K A;  4KXR A;  2GTS A;  3FX7 A;  2G38 A;  4IYI A;  4J10 A;  4J11 A;  4IYH A;  4J7J A;  4J41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...