2DMXA

Solution structure of the j domain of dnaj homolog subfamily b member 8
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GSSGSSGMANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRAGGGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily B member 8
publication title Solution structure of the J domain of DnaJ homolog subfamily B member 8
rcsb
source organism Homo sapiens
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2006-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2dmxA00
2YUAA 2LO1A 2PF4E 2Y4TA 2EJ7A 1FAFA 1GH6A 4J7ZA 4J80A 3APQA 2DN9A 2N04A 2GUZA 1WJZA 2QWRB 2L6LA 2CTWA 3AG7A 3BVOA 2QWQB 2QWPB 3UO2A 1HDJA 1N4CA 2Y4UA 2QSAA 1FPOA 2DMXA 2N05A 1XBLA 2CTPA 2CTRA 2OCHA 1NZ6A 2QWOB 1BQ0A 2GUZB 3APOA 2CUGA 4RWUA 2LGWA 2M6YA 2CTQA 4IT5A 2YS8A 3UO3A 3UCSC 1BQZA 1IURA 2QWNB 2KQXA
chains in the Genus database with same CATH superfamily
4LF4B 4I5SA 5JJEB 3P3PA 1EN6A 3SJAC 3ZX6A 4QIWF 3ZRWB 1IXBA 4GX5A 4FK5C 2VQEB 3ABMC 5B3SB 4GZRB 2CTPA 1V55C 2ITDC 4TT3G 1BZKA 2PY5A 5IJ0A 4DR4B 2PYJA 2YIDA 1YJNV 4B3TO 4O4JA 3K0DA 5LYJB 1JVMA 3STZC 5K1XA 5C8YA 4FZ1A 3BVOA 2CGNA 1AJNA 3CSXA 1VQ7V 5A2QN 1JX9A 4E2LA 4LF6B 4NXNO 4JAUA 5LXTB 3HKEB 2FL4A 3JYCA 3E8BA 4DV5B 1XMQO 4MW8A 4JI1B 4TQFA 1AJQA 1ZSPA 1HNZO 2Q5ZA 5GONA 3LNNA 3X2QC 3SPGA 3WB0A 3K03A 3J7AU 4C7UA 1F51A 1XQ8A 1I0HA 3CCQV 2QM8A 1WPBA 1VQLV 5KHKA 1Q6IA 5KA6A 4CH4A 2X6BA 4DYLA 1XHZA 3VOUA 4I55A 1Z5WA 2C2AA 4L8JA 1N34B 5JJNB 4A5UB 4JI4B 4X1YA 5CBFA 1IX9A 3CYOA 2WLIB 4RO2A 4H37A 1TAEA 1XOUA 4PI0A 2QA4V 2ZNJA 3BAAA 5KHJA 5LOVA 2D2CB 1TUEB 2K1EA 5KHGA 4FJCC 4K0KO 1AI5A 2VWJA 3CCEV 1R3IC 4FLYA 3U0ZA 3ASOB 3ZRVA 3ABMB 5CA0B 3GWOA 1K5QA 5IYZB 5EIBC 4JV5O 2HG5C 5H5NA 3AG3B 4JI6O 2XAHA 2UXDB 1BT8A 5IJ9A 1ORQC 4NTXA 5CN0A 1ZL8B 2UXNA 2WLLB 3K9SA 3K5MA 2IJKA 5JWPA 3ZHVA 5BMVB 3CCJV 4WFGA 4ZHQB 2DMXA 5CA1A 1NI8A 2P7TC 1AVMA 3OAAG 3C3SA 5LMUB 2OYQA 1H2KA 4LWSA 3B09A 2UUCB 1EM1A 4JASA 2Y4TA 1E1RG 2AXTZ 4UB6Z 3GB7C 4PDRA 1FJGB 2ZDIC 4O2BB 1Q8IA 5L3FA 4U7NA 4G28B 3QF7A 3O9OA 4P9OA 4KL1A 1WA8A 3HPLC 2GTSA 4B7EA 5LMNO 2LFRA 3A2FA 3OD4A 4I0XB 2X0LA 2Q73A 2DWEC 3JAKA 4N23A 3ZBHA 4DRXB 1VIBA 1UPGA 3EXAA 4R7CA 1IVSA 5A9GA 1HDJA 1AI4A 1KKDA 2JGUA 3CS5A 4ABMA 3RGBA 2IW5A 4O4IB 1JFFB 3JALA 3FB8C 4J7KA 4NXMO 2Y69C 1HNWO 2LFSA 3E86A 3TK1A 1VF5B 3G67A 4BAYA 1PPJH 2XOKG 4QE9A 3ETEA 2Q68A 4FLVA 2UU9O 4FFBA 2HEPA 3FD9A 4DR3B 4DV6O 1PD3A 3CCLV 4K35A 4EFEA 2GBOA 3D36A 3E89A 3WU2Z 3B77A 1E1QG 3BEHA 1VMGA 2DN9A 1AR4A 1VARA 4JI5O 3AG4C 3L9DA 3B2EE 2A06H 4UCRA 2L6LA 3ETGA 4DR2B 3IC9A 5DN6G 3CC4V 2PGGA 2EILC 1DK1A 3ABTA 4ZBMA 3T1YB 1F23A 1WN7A 2LGWA 4CS3A 3DGEA 3TCUA 2GTAA 4QGPA 1S76D 4RQEA 5EYPA 1PM9A 3SPJA 2OCCC 3W7TA 1J95A 3J80N 5KUMA 3R66A 1NT2B 5L3GA 1RSOA 1QR8A 2ZE7A 2A0LA 2Z3YA 1OCOC 4LH6A 3IAYA 3BA9A 2FYUH 2VQFO 3JATA 4LR3A 3K58A 1EZJA 4AHCA 1B06A 1FXKB 3WB2A 2YEVA 4L87A 4GKJO 2QM7A 2ZD9A 3ASNC 1XL6A 4W4KA 5LP6A 1OCCB 3FB6C 3G6BA 2CTQA 3WG7B 1THZA 4PELA 1PNKA 2WWWA 3I56V 1AP5A 3HKBB 4JI0B 1RFYA 4UCVA 4XBFA 2WA3A 3K5NA 4MVMA 4MTOA 4JGSA 1YIJV 1Q43A 4B3SO 2MW2B 4LF4O 2KG7B 1O9GA 1KP3A 1MABG 1FS0G 1SF9A 3OTFA 3QVNA 4DK0A 4JYYA 1NZ6A 2GUZB 2VQEO 4OX9B 3ZRWA 1CEZA 2HLDG 3AG4B 3ZRXA 3LDDA 3OMAB 2Q6AA 1CP9A 2XT9A 5D5PA 1FD9A 3VBBA 1G4YB 2YC0A 5FLXN 2XAQA 3APQA 2ADQB 1NQTA 2EILB 3AG1B 2ZINA 1IBLB 2M7WA 4DR4O 3A8TA 4KFMA 1IBKB 4X66B 3E2EA 3ZHSA 4X8AA 5IYCO 5LYJA 1S0VA 4LCUC 4IL6Z 4NR1A 1Q3EA 1OCZC 4I9WA 5JQGB 3LNMB 3TGUH 2OCCB 4LF6O 4R8CA 5L3BA 3N27A 1DGSA 3ABLB 3SJCC 1K8AW 5LXTA 1LUWA 3HKEA 4U7OA 4LFAB 3G71V 2ZKOA 1VQMV 4YIOA 4JI1O 2R72A 1A32A 1OCOB 2HVKC 2WPDG 4H13B 2DYSC 4R6ZA 4PJ0Z 2XUMA 2EIJC 1VF7A 3FB5C 1MZEA 3ASNB 4PA3A 1VQ8V 5KAFZ 4JI7O 1URFA 5EC2C 1FFXB 2JK5C 1ZTEA 1N34O 3LSQA 2ZXWB 1DF5A 4JI4O 2FMLA 3RWRD 4WFEA 3LDEA 1F4MA 2XASA 2EZPA 1SQXH 3CJHB 1FKAO 1V9PA 1KD1W 1U96A 2WLIA 1N8RW 2HFEC 1PV0A 1K97A 4K8ZA 4MT8A 5JH7B 1PNMA 3EFFK 1XNQB 1S3JA 1OJHA 2JGDB 1OZ0A 3HKDB 1Z2GA 5H6RA 3RVZA 1ENVA 3CHXA 4I50B 3E35A 4MTFA 1WB7A 3ZJZA 3UKMA 4UVBA 2WSSG 2UXDO 4NKGB 4RQFA 3CEIA 3GVMA 3JASB 4XDLA 1VEWA 2QJ1A 4F6EA 1YEWA 2Y4UA 4QPKA 2GSMB 4X65B 2WLLA 1H8HG 3CMAV 1KYOF 1SQGA 3BFRA 4GX2A 3BPZA 1YITV 1WPXA 5JVDB 1XREA 4LFCB 1RM1B 1KP2A 3ZN0A 2FKXA 1Y66A 4IIJB 1N36B 2UUCO 4I7ZB 1CXZB 3CXHF 1K4DC 3W7XA 2EIJB 1FJGO 3M8AA 2CTRA 3B40A 2ZNIA 4O2BA 1L0NH 5TISZ 2LW1A 2YI9A 4IYHA 5KA5A 1MSWD 1AR1B 4GT1A 3OW2U 2AZ2A 1SRYA 1IZ3A 2AGAA 3U11A 1K9MW 5HFMA 1YZBA 1QBZA 3F7VC 3H1IH 1GKFA 1YDXA 1JQ0A 4H0LB 5J9PC 4YJ2A 3ZHTA 4DRXA 2RCVA 4CZZA 1PKXA 2DJVA 1HR0B 1S5LZ 1RPOA 2CH7B 2HJFC 4TOIA 3ZMSA 4YXWG 3ABKB 1XDCA 4FLTA 1EBOA 2JDIG 5BR8B 1X4TA 1MG1A 2IJHA 1K73W 3BHPA 1Q5OA 4PV1B 5CB4A 1QVFU 1Q6HA 1EN4A 1MOFA 2F23A 1NVPB 3OE7G 5KX5B 4RWUA 1TVKB 4X62B 4X1KB 2BOBC 4DR3O 5IY5C 1H38A 4B7KA 4QJFB 3B8MA 1MSDA 1YCIA 3OEHG 1GM7A 3SYOA 3MD0A 2IBZH 2Y0PA 2BSKB 4UXNA 4I4TA 1FXHA 2QWOB 4DR2O 3HR0A 4FLXA 2A79B 3AEIA 2ZE6A 1M56C 5D5QA 4HBNA 3T1YO 3CWBH 4HNAA 2YUAA 3LSSA 3H1KH 4Q6GA 2X6AA 4GUNA 4JTAB 1S5HC 4YJ3B 2BTQB 4LNUB 3ZMZA 4JZ2A 4HYOA 3ZN1A 2CDYA 4KP4A 5IYDO 1M57B 2ZR3A 3ETDA 3K0GA 1S77D 2OTLV 1V54B 1VQ6V 1UFIA 2XHBA 4UV9A 1VP7A 2QWNB 3UQ8A 4O4HB 3B8NA 2ODMA 4J7ZA 3SJBC 4MTXA 3CRMA 1IBMB 5ITZB 4P9PA 4P2ZA 3BCCH 2YDEA 3KZIZ 3NXSA 5EBWC 1SERA 3A0HZ 1H2SB 4F4LA 2M6YA 1FXKA 1PNLA 4TSFG 2FB5A 2H8PC 3AG2C 3ZMTA 2HR3A 4J80A 1FFTB 2QTOA 4JI0O 2RNBA 3LUTB 3HKBA 3L70H 2YICA 5C93A 1H2GA 2UUAB 5BXZA 1DF4A 2KG7A 1SQPH 5KHIA 3CD6V 2P22C 4OX9O 3OR7C 1VQPV 2GUZA 3ZHUA 2LW7A 4BR6A 1V55B 1XEQA 2NR5A 5B1BC 1IBLO 4MVSA 3K5OA 1IBKO 4X66O 2PUSA 5J2TB 1PL0A 2YS8A 4FMTA 5FPOA 4FLWA 4K8XA 1KMIZ 1VQNV 1BE3H 4FM2A 4DV2B 5J2UA 3FAVB 3JD2A 3QTCA 4LF5B 5JQGA 1OCRC 2UXBB 1AJPA 2AHZA 4LFAO 2QKCA 3WFVA 4LH7A 2IJIA 3P30A 3TXSA 3CB2A 4O4LB 4DV0B 2F93B 4EB6B 1G1XB 1SA0A 4WFAV 3CP1A 3X2QB 2EIMC 3SYAA 1Q82W 1GN2A 3AG7A 4X1IB 3HKCB 2Y48A 3TXQA 4TQDA 3THOA 2Q8VA 2IU0A 3FKSG 4YY3B 5LHHA 5JCOA 5F2VO 5GTHZ 1GN4A 3C3TA 1R6NA 1DLBA 5EBLC 3T1CA 4PA7A 4DR7B 3CJHA 3RYCB 4JYCA 1MMMA 1HNXB 3E22B 4B08A 4U3FH 1SC5B 2ZQMA 1SQVH 1XNQO 2WLKA 1K4CC 2Q0OC 2N74A 3H1HH 2CUGA 1Y4MA 1GN6A 2EZOA 3HKDA 1IURA 3A0RA 4DUYB 3HB3B 1JMKC 3JARB 1N33B 2ZE5A 2CAZC 4I50A 1D2DA 1N0NA 4JZGA 4HZ3A 3QO8A 4B3RB 4UVCA 1FPOA 4TV9B 2E74B 3STLC 3Q4HB 1ROPA 3JSLA 2YIBD 3N2GA 1JR9A 2QDOA 3JASA 4X65O 5LGUA 3CC2V 1VF6A 5FL7G 1MNGA 4K3AA 4Z1MG 4JI3B 5GW7A 1P84F 1I94B 3LSUA 2EIKC 2OIGA 1QLNA 2DYRC 5FNVB 2Q7GA 4LFCO 3CCUV 1UJWB 4JAVA 2WLMA 1BCCH 3L75H 1AROP 3CRQA 4CC5A 1N36O 4IIJA 5EZYA 3OMNB 4MS2A 2P4KA 4EKWA 3CCMV 5B1AC 1US6A 4TV8A 2B1IA 4P30A 5IJ0B 3QG5A 1N32B 1EZVH 5IT9N 1DTOA 4JI2B 3RYHB 3G4SV 4OGQB 5B66Z 3K57A 3FB7C 1Y6XA 3DXRA 4AILC 3JD0A 1XUQA 1K34A 4X88A 3IJ4A 2PF4E 3MAQA 4J9YB 2ZE8A 1HR0O 2CE4A 3OR6C 1K7DA 3JCUZ 1Z5VA 4OXSA 1K3EA 4BW5A 5BR8O 2Y69B 1KECA 2ITCC 1VQ9V 3OEEG 5GONB 4U3JB 3T4ZA 4NB5A 3ICXA 4MVZA 4UV8A 2EINC 1SQQH 2PTMA 4ZKIA 3CRAA 4X62O 1TVKA 2JEUA 1W59A 3ZMVA 3C90A 3H9VA 1SQFA 2HVJC 4PDVA 4N21A 3CCSV 5KHHA 4PI2A 1SETA 1BQ0A 2DQ0A 4D7TA 3OM3B 2DYRB 2Y0IA 4PDLA 2UUBB 3DSQA 3W7WA 2A9HA 4PDMA 2K9PA 4KHPB 5LL6Y 3M99B 2LP7A 3CMEV 2JJ1G 3MHHC 2R9RB 4DO2A 3U10A 1WP7A 1MA1A 3D3IA 3D8CA 2BTQA 1RPRA 4FFKA 1QLEC 1KUQA 4CH6A 2ZIOA 1R73A 2ZR2A 1M1KW 1O9HA 5IJ9B 3T1HB 5L3EA 3SYQA 1QQCA 1N0JA 4DV5O 3D36C 4O4HA 1IBMO 2PZSA 1Y74B 3UT5B 1VF6C 3O65A 2R9IA 4PA4A 4X89A 1WP8A 1QHTA 4B3MB 2KSDA 3K59A 1JJ2U 4DV3B 1NVPD 1EN5A 1W0KG 4YHHB 4XDJA 1XMOB 4NTYA 2AHYA 2BOCC 3NR7A 2QWQB 4IYIA 1X59A 1SZXA 2WLNA 4JF3A 4J42A 1E79G 1J5EB 2UUAO 4FM1A 1JOYA 1OHHG 5EK0A 5LHIA 4ZI7B 1AB3A 4CH5A 4WCEV 5KUKA 3JAKB 2QSAA 4DK1A 5JJJB 5CA0A 5IYZA 5LHGA 2JS5A 2AW9A 2W0XA 4UCSA 1S5JA 2BCCH 2N04A 4LFBB 3JALB 2Z0AA 3FYEB 5LP6C 1WNSA 4WFFA 3J81N 1GMGA 4DV2O 1OCZB 5LA6B 1ZL8A 4R50A 4LF5O 1KC8W 2UXBO 4O2AB 3FAVA 4G27B 3AK1A 1SZTA 2KB1A 5BMVA 4ZHQA 1GH6A 2JRIA 3CC7V 3CCRV 5LMUO 1XNRB 3VQVA 2W6JG 4DV0O 5B1NA 5CMUA 2DYSB 4EB6A 4ZOLB 1IDSA 1Q6UA 3ETQA 2RDCA 1SQBH 2H3OA 4DR6B 1XILA 5KMGB 5K1PA 3VQXA 3AK3A 3UO3A 1TA8A 4X1IA 3HKCA 4YY3O 2QKAA 5KAIZ 2E5LB 1I7FA 1M90W 2UXCB 4BWAA 5L3DA 3N2KB 4I0XA 3K08A 1PP9H 5IWAB 1SS3A 1KU9A 2N05A 4CBCA 4DR7O 5EC1C 2GDSA 1HNXO 4OPAA 1GTOA 3RYCA 4IT5A 4UCTA 1XHXA 2Q7HA 2QEXV 4DW0A 2EX3A 2Q9LA 4DUYO 4I9QA 4O4IA 1M5IA 2ARHA 1JFFA 1N33O 1NBMG 2LGQA 4JI8B 2QR4A 3JARA 4AQYB 3JATB 4B3RO 1WAZA 3OTOB 3ZMUA 5DECA 1PL4A 4JAAA 1R6KA 2IJJA 2PI4A 1OV9A 1Q86W 3KCXA 2Q69A 4NTWA 1L8DA 5LP6B 2HP8A 4TV9A 4Z2WA 2QKSA 1H2NA 2JJ2G 5H2FZ 3Q4HA 3CRRA 4JI3O 4DW1A 1I94O 4CS2A 2Z5UA 2WLJA 4ASUG 5FNVA 1BQZA 1BMFG 2EJRA 2X6CA 3SJQC 3I5DA 1QR9A 4W4LA 1WJZA 3JCZA 1CPYA 4LF9B 4X64B 5CBHA 3ASOC 1NTMH 1R1BA 2Q7EA 3M7MX 2ZDIA 4ICGA 4LF8B 1ZUQA 3G6EV 4J7JA 2E75B 2XTAA 3AG3C 3EHBB 2ILMA 1N32O 1QNMA 5CA3A 2QM4A 2ZM6B 4JI2O 2IH3C 1G8MA 2GV9A 1JCHA 1WB8A 2P6JA 1VQ4V 1KKCA 3RYHA 1NS1A 4GLXA 2AZ0A 1M93A 4UVAA 4GKKB 2OT5A 3T4DA 5EIBD 5FPRA 2ZT9B 3OGCC 2IM9A 4RUFA 4MVUA 5LGTA 2RQ6A 3IC7A 3ZHRA 2P5OA 1MZFA 1NH2B 2A7WA 2KKWA 4XDKA 2E76B 3OFNG 4U3JA 4PD4F 3K06A 4WBNB 1GK9A 3SPIA 1K92A 3IGAC 2PYLA 1B3QA 5IY5B 4G2KA 4Z1VA 2DOSA 4LBEC 3JD4A 3G80A 4JI7B 2UXXA 4DUZB 2JIZG 2Q67A 3F7YC 3F5TA 4DV1B 4PA9A 1QVGU 1COWG 1GAXA 1EFRG 2P06A 2UUBO 1HWYA 1S72V 2XAJA 4KHPO 3RYIB 3FYIB 1M56B 1XI1A 1Q90D 3PN1A 2JS3A 2HHHB 2W0FC 3S3WA 2F4VB 1I5XA 4QE7A 4E4EA 2LO1A 2YI8A 4IHJB 3DTUB 2CGOA 1Y76B 4Q20A 1NKDA 2OTJV 1JPXA 2R9AA 5B5EZ 4X20B 1AILA 3T1HO 1ZLZA 5IYBO 1NJIW 4PHZA 4H44B 5LGNA 5H6QA 2OWOA 2YIBA 1Y74A 3UT5A 4BIOA 4B3MO 1K33A 3SPCA 3QO7A 3CE2A 2BE3A 4DV3O 5EBMC 4YHHO 2CTWA 2B1GA 3RBZA 4GX0A 3AK2A 1XMOO 4PA6A 3E8GA 2YXYA 4DV7B 3B4SA 1GO3F 4DV4B 4MTGA 3AG2B 1FFXA 3TJTA 1AI7A 1M4UA 1ZAUA 1J5EO 4DR5B 3SDLA 4BIUA 4JYAB 3ML0A 5DM6V 3CX5F 4QNHB 3OUSA 5BY1A 1XL4A 4LF7B 1NR1A 4JTCB 1YJ9V 3BA8A 1W2BU 1BL8A 3RYFB 1TUBB 3ZEDA 4ZI7A 3JD1A 3APOA 5JH7A 3E8FA 2JGDA 5IDJA 2V1DA 1D5AA 4YJ2B 1YTFD 1I5YA 1IXMA 1L0LH 3E8HA 4EFBA 1FXVA 3WB1A 4BIZA 5B1BB 2XAGA 4J10A 2DE0X 4LFBO 1D5NA 1FXKC 3TETA 3I55V 1H8EG 5E1AC 4DR1B 4JYBA 4EEQA 3JAWB 1YI2V 3BABA 2F1MA 3H1JH 3CPWU 1LUVA 1OCCC 4X9QA 2G38A 5CB4B 4H33A 3WG7C 1HP8A 5LA6A 1OCRB 1LNQA 4CH3A 4O2AA 4F6RB 1Q81W 2YXLA 4OPHA 4TUYB 1N4CA 5JVDA 1LR1A 1XNRO 4WF9V 3KCYA 5GTIZ 3BRCA 4D7SA 3FFQA 2RMKB 2EIMB 1L1FA 4I4TB 4ZOLA 3F5WC 4DR6O 1HW7A 1NTKH 2MK3A 4J11A 3K5LA 2V4DA 1JA8A 2W6IG 5KMGA 4WFHA 2ADPA 2CK3G 1JJOA 5IE9A 4HNAB 2E5LO 3AG1C 3SPHA 2UXCO 1BHBA 1YXBA 4FPPA 5AG2A 4O4JB 1U97A 4IGGA 1RP3B 4GYCB 4B3TB 5C8YB 5IWAO 3N2KA 4LC1A 3K04A 2QGNA 1FAFA 4JTDB 3ZIAG 1BSMA 2F43G 1BS3A 2YSUB 3K3WA 4BW9A 1P4RA 3ABLC 4NXNB 2DQ3A 4JPRA 2QE7G 2CH7A 1QCEA 1ZX3A 1AI6A 2WLHA 2Q0AA 1XMQB 4JI8O 3PJSK 3A0BZ 1P7GA 3ZS8C 4AQYO 4UUJC 2VRZA 2WA4A 3OTOO 1HNZB 2ETNA 2ATKC 4FM0A 1T5EA 3H1LH 1NTZH 3R65A 5KX5A 2RN9A 4X1KA 3L74H 5JCOC 4MVRA 4I55B 4KUMA 4DXWA 1GM9A 1R3LC 1YF2A 5E79Z 3RN4A 4NYKA 3JSNA 4X1YB 1GN3A 2ZXWC 4UCUA 1P49A 2GHYA 2BSKA 2EIKB 3P32A 2X7RB 2EJ7A 3KKYA 2DW4A 1YSCA 4AI8A 4MVQA 5LOVB 3L72H 3ABUA 2HKOA 4FLUA 2ZCEA 4WFBV 4K0KB 4LF9O 2LQTA 4X64O 4YJ3A 1F4NA 1YTFB 1R6TA 3L73H 5B1AB 3UCSC 4LF8O 4LNUA 3MHSC 1R3JC 1P7BA 2OIEA 4UB8Z 4JV5B 3OT7A 2YXHA 3S3XA 2ZM6O 5DEDA 3CXCU 2H94A 4CC6A 4JI6B 1BHAA 1W0JG 2IU3A 4GKKO 2L35A 4D6TH 5J2UB 3D3QA 2FTKA 5ITZA 2WAMA 1Y67A 3KG2A 2KQXA 1G6UA 2QTSA 3P3NA 5CA1B 3OMIB 1VQKV 5KLVH 1NR7A 1BGYH 2P67A 3ZCCA 1RM1C 2QWRB 3K79A 3SYCA 4LWSB 2DWDC 2B9ZA 3ZRSA 1SA0B 2XNDG 1VQ5V 1B04A 2V7QG 3RFRA 2NNUA 2EINB 2O57A 4WBNA 2Q4PA 2RJZA 1WA8B 2R70A 1ZWIC 4DUZO 3EVKA 3DC6A 3BY6A 4GCZA 4DV1O 3UO2A 4J9ZB 5LMNB 4FVMA 2JEXA 1GRJA 3RVYA 2YIAA 1K5SA 2D3OW 3IFXA 5BZBA 1I08A 3RYIA 4CS4A 5LBQA 2HHHO 3SGIA 2F4VO 3W7UA 5J2TA 2A3QA 3ABKC 4QPJA 1AR5A 1TGOA 3JD3A 4NXMB 1AP6A 2IH1C 2LJ2A 1NU1H 1R3KC 1QLEB 5HFLA 1HNWB 1VQOV 1SESA 1H2MA 4IHJA 4J41A 3VQWA 3LDCA 1Y76A 4FFBB 4FIPC 2HJDA 2B5UA 1YVWA 3DC5A 2UU9B 4X20A 4FZ0A 4DV6B 4KXRA 1KQSU 1Q7YW 2EBOA 1YHQV 1NH2D 3N2GB 4ZIBA 4MSWC 4UCOA 2QWPB 3K9AA 2VWKA 4O4LA 3ZHQA 2F95B 2P90A 1KBHA 1F7YA 2BTOA 2OCHA 2PI5A 4TWKA 2ZIMA 4UFZA 5B3SC 4JI5B 3UM7A 3H01A 4DV7O 3FX7A 3CRCA 4DV4O 2NN4A 5H9CA 1H2LA 5EZYB 3QNEA 3RT3C 4YIPA 2XAFA 3SR2C 4LP8A 1YJWV 4DR5O 4JYAO 5L3CA 4TV8B 5EYPB 4LF7O 1GM8A 1M57C 3OUFA 1SKVA 4HAMA 1V54C 3E22A 3RYFA 1TUBA 1RSOB 2E3CA 3DXRB 3RW0A 4RUEA 2P4VA 1B6QA 3QO5A 2VS0A 5CBGA 2EULA 3T2MA 1XBLA 3E83A 2JVDA 2VQFB 1WLEA 2YEVB 1FYJA 3GWKC 4MVOA 3W7SA 4DR1O 4GKJB 3SYPA 4MW3A 4NVPA 3JAWA 3VQYA 4FLZA 1KB9F 2NLJC 4RAIA 4GX1A 3CCVV 1QU7A 1M9NA 3MDSA 3JAMN 3OGIB 3L71H 2F66C 4F6RA 4B3SB 5B1OA 4TUYA
chains in the Genus database with same CATH topology
2YUAA 2LO1A 2PF4E 2Y4TA 2EJ7A 1FAFA 1GH6A 4J7ZA 4J80A 3APQA 2DN9A 2N04A 2GUZA 1WJZA 2QWRB 2L6LA 2CTWA 3AG7A 3BVOA 2QWQB 2QWPB 3UO2A 1HDJA 1N4CA 2Y4UA 2QSAA 1FPOA 2DMXA 2N05A 1XBLA 2CTPA 2CTRA 2OCHA 1NZ6A 2QWOB 1BQ0A 2GUZB 3APOA 2CUGA 4RWUA 2LGWA 2M6YA 2CTQA 4IT5A 2YS8A 3UO3A 3UCSC 1BQZA 1IURA 2QWNB 2KQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUA A;  2LO1 A;  2PF4 E;  2Y4T A;  2EJ7 A;  1FAF A;  1GH6 A;  4J7Z A;  4J80 A;  3APQ A;  2DN9 A;  2N04 A;  2GUZ A;  1WJZ A;  2QWR B;  2L6L A;  2CTW A;  3AG7 A;  3BVO A;  2QWQ B;  2QWP B;  3UO2 A;  1HDJ A;  1N4C A;  2Y4U A;  2QSA A;  1FPO A;  2DMX A;  2N05 A;  1XBL A;  2CTP A;  2CTR A;  2OCH A;  1NZ6 A;  2QWO B;  1BQ0 A;  2GUZ B;  3APO A;  2CUG A;  4RWU A;  2LGW A;  2M6Y A;  2CTQ A;  4IT5 A;  2YS8 A;  3UO3 A;  3UCS C;  1BQZ A;  1IUR A;  2QWN B;  2KQX A; 
#chains in the Genus database with same CATH topology
 4LF4 B;  4I5S A;  5JJE B;  3P3P A;  1EN6 A;  3SJA C;  3ZX6 A;  4QIW F;  3ZRW B;  1IXB A;  4GX5 A;  4FK5 C;  2VQE B;  3ABM C;  5B3S B;  4GZR B;  2CTP A;  1V55 C;  2ITD C;  4TT3 G;  1BZK A;  2PY5 A;  5IJ0 A;  4DR4 B;  2PYJ A;  2YID A;  1YJN V;  4B3T O;  4O4J A;  3K0D A;  5LYJ B;  1JVM A;  3STZ C;  5K1X A;  5C8Y A;  4FZ1 A;  3BVO A;  2CGN A;  1AJN A;  3CSX A;  1VQ7 V;  5A2Q N;  1JX9 A;  4E2L A;  4LF6 B;  4NXN O;  4JAU A;  5LXT B;  3HKE B;  2FL4 A;  3JYC A;  3E8B A;  4DV5 B;  1XMQ O;  4MW8 A;  4JI1 B;  4TQF A;  1AJQ A;  1ZSP A;  1HNZ O;  2Q5Z A;  5GON A;  3LNN A;  3X2Q C;  3SPG A;  3WB0 A;  3K03 A;  3J7A U;  4C7U A;  1F51 A;  1XQ8 A;  1I0H A;  3CCQ V;  2QM8 A;  1WPB A;  1VQL V;  5KHK A;  1Q6I A;  5KA6 A;  4CH4 A;  2X6B A;  4DYL A;  1XHZ A;  3VOU A;  4I55 A;  1Z5W A;  2C2A A;  4L8J A;  1N34 B;  5JJN B;  4A5U B;  4JI4 B;  4X1Y A;  5CBF A;  1IX9 A;  3CYO A;  2WLI B;  4RO2 A;  4H37 A;  1TAE A;  1XOU A;  4PI0 A;  2QA4 V;  2ZNJ A;  3BAA A;  5KHJ A;  5LOV A;  2D2C B;  1TUE B;  2K1E A;  5KHG A;  4FJC C;  4K0K O;  1AI5 A;  2VWJ A;  3CCE V;  1R3I C;  4FLY A;  3U0Z A;  3ASO B;  3ZRV A;  3ABM B;  5CA0 B;  3GWO A;  1K5Q A;  5IYZ B;  5EIB C;  4JV5 O;  2HG5 C;  5H5N A;  3AG3 B;  4JI6 O;  2XAH A;  2UXD B;  1BT8 A;  5IJ9 A;  1ORQ C;  4NTX A;  5CN0 A;  1ZL8 B;  2UXN A;  2WLL B;  3K9S A;  3K5M A;  2IJK A;  5JWP A;  3ZHV A;  5BMV B;  3CCJ V;  4WFG A;  4ZHQ B;  2DMX A;  5CA1 A;  1NI8 A;  2P7T C;  1AVM A;  3OAA G;  3C3S A;  5LMU B;  2OYQ A;  1H2K A;  4LWS A;  3B09 A;  2UUC B;  1EM1 A;  4JAS A;  2Y4T A;  1E1R G;  2AXT Z;  4UB6 Z;  3GB7 C;  4PDR A;  1FJG B;  2ZDI C;  4O2B B;  1Q8I A;  5L3F A;  4U7N A;  4G28 B;  3QF7 A;  3O9O A;  4P9O A;  4KL1 A;  1WA8 A;  3HPL C;  2GTS A;  4B7E A;  5LMN O;  2LFR A;  3A2F A;  3OD4 A;  4I0X B;  2X0L A;  2Q73 A;  2DWE C;  3JAK A;  4N23 A;  3ZBH A;  4DRX B;  1VIB A;  1UPG A;  3EXA A;  4R7C A;  1IVS A;  5A9G A;  1HDJ A;  1AI4 A;  1KKD A;  2JGU A;  3CS5 A;  4ABM A;  3RGB A;  2IW5 A;  4O4I B;  1JFF B;  3JAL A;  3FB8 C;  4J7K A;  4NXM O;  2Y69 C;  1HNW O;  2LFS A;  3E86 A;  3TK1 A;  1VF5 B;  3G67 A;  4BAY A;  1PPJ H;  2XOK G;  4QE9 A;  3ETE A;  2Q68 A;  4FLV A;  2UU9 O;  4FFB A;  2HEP A;  3FD9 A;  4DR3 B;  4DV6 O;  1PD3 A;  3CCL V;  4K35 A;  4EFE A;  2GBO A;  3D36 A;  3E89 A;  3WU2 Z;  3B77 A;  1E1Q G;  3BEH A;  1VMG A;  2DN9 A;  1AR4 A;  1VAR A;  4JI5 O;  3AG4 C;  3L9D A;  3B2E E;  2A06 H;  4UCR A;  2L6L A;  3ETG A;  4DR2 B;  3IC9 A;  5DN6 G;  3CC4 V;  2PGG A;  2EIL C;  1DK1 A;  3ABT A;  4ZBM A;  3T1Y B;  1F23 A;  1WN7 A;  2LGW A;  4CS3 A;  3DGE A;  3TCU A;  2GTA A;  4QGP A;  1S76 D;  4RQE A;  5EYP A;  1PM9 A;  3SPJ A;  2OCC C;  3W7T A;  1J95 A;  3J80 N;  5KUM A;  3R66 A;  1NT2 B;  5L3G A;  1RSO A;  1QR8 A;  2ZE7 A;  2A0L A;  2Z3Y A;  1OCO C;  4LH6 A;  3IAY A;  3BA9 A;  2FYU H;  2VQF O;  3JAT A;  4LR3 A;  3K58 A;  1EZJ A;  4AHC A;  1B06 A;  1FXK B;  3WB2 A;  2YEV A;  4L87 A;  4GKJ O;  2QM7 A;  2ZD9 A;  3ASN C;  1XL6 A;  4W4K A;  5LP6 A;  1OCC B;  3FB6 C;  3G6B A;  2CTQ A;  3WG7 B;  1THZ A;  4PEL A;  1PNK A;  2WWW A;  3I56 V;  1AP5 A;  3HKB B;  4JI0 B;  1RFY A;  4UCV A;  4XBF A;  2WA3 A;  3K5N A;  4MVM A;  4MTO A;  4JGS A;  1YIJ V;  1Q43 A;  4B3S O;  2MW2 B;  4LF4 O;  2KG7 B;  1O9G A;  1KP3 A;  1MAB G;  1FS0 G;  1SF9 A;  3OTF A;  3QVN A;  4DK0 A;  4JYY A;  1NZ6 A;  2GUZ B;  2VQE O;  4OX9 B;  3ZRW A;  1CEZ A;  2HLD G;  3AG4 B;  3ZRX A;  3LDD A;  3OMA B;  2Q6A A;  1CP9 A;  2XT9 A;  5D5P A;  1FD9 A;  3VBB A;  1G4Y B;  2YC0 A;  5FLX N;  2XAQ A;  3APQ A;  2ADQ B;  1NQT A;  2EIL B;  3AG1 B;  2ZIN A;  1IBL B;  2M7W A;  4DR4 O;  3A8T A;  4KFM A;  1IBK B;  4X66 B;  3E2E A;  3ZHS A;  4X8A A;  5IYC O;  5LYJ A;  1S0V A;  4LCU C;  4IL6 Z;  4NR1 A;  1Q3E A;  1OCZ C;  4I9W A;  5JQG B;  3LNM B;  3TGU H;  2OCC B;  4LF6 O;  4R8C A;  5L3B A;  3N27 A;  1DGS A;  3ABL B;  3SJC C;  1K8A W;  5LXT A;  1LUW A;  3HKE A;  4U7O A;  4LFA B;  3G71 V;  2ZKO A;  1VQM V;  4YIO A;  4JI1 O;  2R72 A;  1A32 A;  1OCO B;  2HVK C;  2WPD G;  4H13 B;  2DYS C;  4R6Z A;  4PJ0 Z;  2XUM A;  2EIJ C;  1VF7 A;  3FB5 C;  1MZE A;  3ASN B;  4PA3 A;  1VQ8 V;  5KAF Z;  4JI7 O;  1URF A;  5EC2 C;  1FFX B;  2JK5 C;  1ZTE A;  1N34 O;  3LSQ A;  2ZXW B;  1DF5 A;  4JI4 O;  2FML A;  3RWR D;  4WFE A;  3LDE A;  1F4M A;  2XAS A;  2EZP A;  1SQX H;  3CJH B;  1FKA O;  1V9P A;  1KD1 W;  1U96 A;  2WLI A;  1N8R W;  2HFE C;  1PV0 A;  1K97 A;  4K8Z A;  4MT8 A;  5JH7 B;  1PNM A;  3EFF K;  1XNQ B;  1S3J A;  1OJH A;  2JGD B;  1OZ0 A;  3HKD B;  1Z2G A;  5H6R A;  3RVZ A;  1ENV A;  3CHX A;  4I50 B;  3E35 A;  4MTF A;  1WB7 A;  3ZJZ A;  3UKM A;  4UVB A;  2WSS G;  2UXD O;  4NKG B;  4RQF A;  3CEI A;  3GVM A;  3JAS B;  4XDL A;  1VEW A;  2QJ1 A;  4F6E A;  1YEW A;  2Y4U A;  4QPK A;  2GSM B;  4X65 B;  2WLL A;  1H8H G;  3CMA V;  1KYO F;  1SQG A;  3BFR A;  4GX2 A;  3BPZ A;  1YIT V;  1WPX A;  5JVD B;  1XRE A;  4LFC B;  1RM1 B;  1KP2 A;  3ZN0 A;  2FKX A;  1Y66 A;  4IIJ B;  1N36 B;  2UUC O;  4I7Z B;  1CXZ B;  3CXH F;  1K4D C;  3W7X A;  2EIJ B;  1FJG O;  3M8A A;  2CTR A;  3B40 A;  2ZNI A;  4O2B A;  1L0N H;  5TIS Z;  2LW1 A;  2YI9 A;  4IYH A;  5KA5 A;  1MSW D;  1AR1 B;  4GT1 A;  3OW2 U;  2AZ2 A;  1SRY A;  1IZ3 A;  2AGA A;  3U11 A;  1K9M W;  5HFM A;  1YZB A;  1QBZ A;  3F7V C;  3H1I H;  1GKF A;  1YDX A;  1JQ0 A;  4H0L B;  5J9P C;  4YJ2 A;  3ZHT A;  4DRX A;  2RCV A;  4CZZ A;  1PKX A;  2DJV A;  1HR0 B;  1S5L Z;  1RPO A;  2CH7 B;  2HJF C;  4TOI A;  3ZMS A;  4YXW G;  3ABK B;  1XDC A;  4FLT A;  1EBO A;  2JDI G;  5BR8 B;  1X4T A;  1MG1 A;  2IJH A;  1K73 W;  3BHP A;  1Q5O A;  4PV1 B;  5CB4 A;  1QVF U;  1Q6H A;  1EN4 A;  1MOF A;  2F23 A;  1NVP B;  3OE7 G;  5KX5 B;  4RWU A;  1TVK B;  4X62 B;  4X1K B;  2BOB C;  4DR3 O;  5IY5 C;  1H38 A;  4B7K A;  4QJF B;  3B8M A;  1MSD A;  1YCI A;  3OEH G;  1GM7 A;  3SYO A;  3MD0 A;  2IBZ H;  2Y0P A;  2BSK B;  4UXN A;  4I4T A;  1FXH A;  2QWO B;  4DR2 O;  3HR0 A;  4FLX A;  2A79 B;  3AEI A;  2ZE6 A;  1M56 C;  5D5Q A;  4HBN A;  3T1Y O;  3CWB H;  4HNA A;  2YUA A;  3LSS A;  3H1K H;  4Q6G A;  2X6A A;  4GUN A;  4JTA B;  1S5H C;  4YJ3 B;  2BTQ B;  4LNU B;  3ZMZ A;  4JZ2 A;  4HYO A;  3ZN1 A;  2CDY A;  4KP4 A;  5IYD O;  1M57 B;  2ZR3 A;  3ETD A;  3K0G A;  1S77 D;  2OTL V;  1V54 B;  1VQ6 V;  1UFI A;  2XHB A;  4UV9 A;  1VP7 A;  2QWN B;  3UQ8 A;  4O4H B;  3B8N A;  2ODM A;  4J7Z A;  3SJB C;  4MTX A;  3CRM A;  1IBM B;  5ITZ B;  4P9P A;  4P2Z A;  3BCC H;  2YDE A;  3KZI Z;  3NXS A;  5EBW C;  1SER A;  3A0H Z;  1H2S B;  4F4L A;  2M6Y A;  1FXK A;  1PNL A;  4TSF G;  2FB5 A;  2H8P C;  3AG2 C;  3ZMT A;  2HR3 A;  4J80 A;  1FFT B;  2QTO A;  4JI0 O;  2RNB A;  3LUT B;  3HKB A;  3L70 H;  2YIC A;  5C93 A;  1H2G A;  2UUA B;  5BXZ A;  1DF4 A;  2KG7 A;  1SQP H;  5KHI A;  3CD6 V;  2P22 C;  4OX9 O;  3OR7 C;  1VQP V;  2GUZ A;  3ZHU A;  2LW7 A;  4BR6 A;  1V55 B;  1XEQ A;  2NR5 A;  5B1B C;  1IBL O;  4MVS A;  3K5O A;  1IBK O;  4X66 O;  2PUS A;  5J2T B;  1PL0 A;  2YS8 A;  4FMT A;  5FPO A;  4FLW A;  4K8X A;  1KMI Z;  1VQN V;  1BE3 H;  4FM2 A;  4DV2 B;  5J2U A;  3FAV B;  3JD2 A;  3QTC A;  4LF5 B;  5JQG A;  1OCR C;  2UXB B;  1AJP A;  2AHZ A;  4LFA O;  2QKC A;  3WFV A;  4LH7 A;  2IJI A;  3P30 A;  3TXS A;  3CB2 A;  4O4L B;  4DV0 B;  2F93 B;  4EB6 B;  1G1X B;  1SA0 A;  4WFA V;  3CP1 A;  3X2Q B;  2EIM C;  3SYA A;  1Q82 W;  1GN2 A;  3AG7 A;  4X1I B;  3HKC B;  2Y48 A;  3TXQ A;  4TQD A;  3THO A;  2Q8V A;  2IU0 A;  3FKS G;  4YY3 B;  5LHH A;  5JCO A;  5F2V O;  5GTH Z;  1GN4 A;  3C3T A;  1R6N A;  1DLB A;  5EBL C;  3T1C A;  4PA7 A;  4DR7 B;  3CJH A;  3RYC B;  4JYC A;  1MMM A;  1HNX B;  3E22 B;  4B08 A;  4U3F H;  1SC5 B;  2ZQM A;  1SQV H;  1XNQ O;  2WLK A;  1K4C C;  2Q0O C;  2N74 A;  3H1H H;  2CUG A;  1Y4M A;  1GN6 A;  2EZO A;  3HKD A;  1IUR A;  3A0R A;  4DUY B;  3HB3 B;  1JMK C;  3JAR B;  1N33 B;  2ZE5 A;  2CAZ C;  4I50 A;  1D2D A;  1N0N A;  4JZG A;  4HZ3 A;  3QO8 A;  4B3R B;  4UVC A;  1FPO A;  4TV9 B;  2E74 B;  3STL C;  3Q4H B;  1ROP A;  3JSL A;  2YIB D;  3N2G A;  1JR9 A;  2QDO A;  3JAS A;  4X65 O;  5LGU A;  3CC2 V;  1VF6 A;  5FL7 G;  1MNG A;  4K3A A;  4Z1M G;  4JI3 B;  5GW7 A;  1P84 F;  1I94 B;  3LSU A;  2EIK C;  2OIG A;  1QLN A;  2DYR C;  5FNV B;  2Q7G A;  4LFC O;  3CCU V;  1UJW B;  4JAV A;  2WLM A;  1BCC H;  3L75 H;  1ARO P;  3CRQ A;  4CC5 A;  1N36 O;  4IIJ A;  5EZY A;  3OMN B;  4MS2 A;  2P4K A;  4EKW A;  3CCM V;  5B1A C;  1US6 A;  4TV8 A;  2B1I A;  4P30 A;  5IJ0 B;  3QG5 A;  1N32 B;  1EZV H;  5IT9 N;  1DTO A;  4JI2 B;  3RYH B;  3G4S V;  4OGQ B;  5B66 Z;  3K57 A;  3FB7 C;  1Y6X A;  3DXR A;  4AIL C;  3JD0 A;  1XUQ A;  1K34 A;  4X88 A;  3IJ4 A;  2PF4 E;  3MAQ A;  4J9Y B;  2ZE8 A;  1HR0 O;  2CE4 A;  3OR6 C;  1K7D A;  3JCU Z;  1Z5V A;  4OXS A;  1K3E A;  4BW5 A;  5BR8 O;  2Y69 B;  1KEC A;  2ITC C;  1VQ9 V;  3OEE G;  5GON B;  4U3J B;  3T4Z A;  4NB5 A;  3ICX A;  4MVZ A;  4UV8 A;  2EIN C;  1SQQ H;  2PTM A;  4ZKI A;  3CRA A;  4X62 O;  1TVK A;  2JEU A;  1W59 A;  3ZMV A;  3C90 A;  3H9V A;  1SQF A;  2HVJ C;  4PDV A;  4N21 A;  3CCS V;  5KHH A;  4PI2 A;  1SET A;  1BQ0 A;  2DQ0 A;  4D7T A;  3OM3 B;  2DYR B;  2Y0I A;  4PDL A;  2UUB B;  3DSQ A;  3W7W A;  2A9H A;  4PDM A;  2K9P A;  4KHP B;  5LL6 Y;  3M99 B;  2LP7 A;  3CME V;  2JJ1 G;  3MHH C;  2R9R B;  4DO2 A;  3U10 A;  1WP7 A;  1MA1 A;  3D3I A;  3D8C A;  2BTQ A;  1RPR A;  4FFK A;  1QLE C;  1KUQ A;  4CH6 A;  2ZIO A;  1R73 A;  2ZR2 A;  1M1K W;  1O9H A;  5IJ9 B;  3T1H B;  5L3E A;  3SYQ A;  1QQC A;  1N0J A;  4DV5 O;  3D36 C;  4O4H A;  1IBM O;  2PZS A;  1Y74 B;  3UT5 B;  1VF6 C;  3O65 A;  2R9I A;  4PA4 A;  4X89 A;  1WP8 A;  1QHT A;  4B3M B;  2KSD A;  3K59 A;  1JJ2 U;  4DV3 B;  1NVP D;  1EN5 A;  1W0K G;  4YHH B;  4XDJ A;  1XMO B;  4NTY A;  2AHY A;  2BOC C;  3NR7 A;  2QWQ B;  4IYI A;  1X59 A;  1SZX A;  2WLN A;  4JF3 A;  4J42 A;  1E79 G;  1J5E B;  2UUA O;  4FM1 A;  1JOY A;  1OHH G;  5EK0 A;  5LHI A;  4ZI7 B;  1AB3 A;  4CH5 A;  4WCE V;  5KUK A;  3JAK B;  2QSA A;  4DK1 A;  5JJJ B;  5CA0 A;  5IYZ A;  5LHG A;  2JS5 A;  2AW9 A;  2W0X A;  4UCS A;  1S5J A;  2BCC H;  2N04 A;  4LFB B;  3JAL B;  2Z0A A;  3FYE B;  5LP6 C;  1WNS A;  4WFF A;  3J81 N;  1GMG A;  4DV2 O;  1OCZ B;  5LA6 B;  1ZL8 A;  4R50 A;  4LF5 O;  1KC8 W;  2UXB O;  4O2A B;  3FAV A;  4G27 B;  3AK1 A;  1SZT A;  2KB1 A;  5BMV A;  4ZHQ A;  1GH6 A;  2JRI A;  3CC7 V;  3CCR V;  5LMU O;  1XNR B;  3VQV A;  2W6J G;  4DV0 O;  5B1N A;  5CMU A;  2DYS B;  4EB6 A;  4ZOL B;  1IDS A;  1Q6U A;  3ETQ A;  2RDC A;  1SQB H;  2H3O A;  4DR6 B;  1XIL A;  5KMG B;  5K1P A;  3VQX A;  3AK3 A;  3UO3 A;  1TA8 A;  4X1I A;  3HKC A;  4YY3 O;  2QKA A;  5KAI Z;  2E5L B;  1I7F A;  1M90 W;  2UXC B;  4BWA A;  5L3D A;  3N2K B;  4I0X A;  3K08 A;  1PP9 H;  5IWA B;  1SS3 A;  1KU9 A;  2N05 A;  4CBC A;  4DR7 O;  5EC1 C;  2GDS A;  1HNX O;  4OPA A;  1GTO A;  3RYC A;  4IT5 A;  4UCT A;  1XHX A;  2Q7H A;  2QEX V;  4DW0 A;  2EX3 A;  2Q9L A;  4DUY O;  4I9Q A;  4O4I A;  1M5I A;  2ARH A;  1JFF A;  1N33 O;  1NBM G;  2LGQ A;  4JI8 B;  2QR4 A;  3JAR A;  4AQY B;  3JAT B;  4B3R O;  1WAZ A;  3OTO B;  3ZMU A;  5DEC A;  1PL4 A;  4JAA A;  1R6K A;  2IJJ A;  2PI4 A;  1OV9 A;  1Q86 W;  3KCX A;  2Q69 A;  4NTW A;  1L8D A;  5LP6 B;  2HP8 A;  4TV9 A;  4Z2W A;  2QKS A;  1H2N A;  2JJ2 G;  5H2F Z;  3Q4H A;  3CRR A;  4JI3 O;  4DW1 A;  1I94 O;  4CS2 A;  2Z5U A;  2WLJ A;  4ASU G;  5FNV A;  1BQZ A;  1BMF G;  2EJR A;  2X6C A;  3SJQ C;  3I5D A;  1QR9 A;  4W4L A;  1WJZ A;  3JCZ A;  1CPY A;  4LF9 B;  4X64 B;  5CBH A;  3ASO C;  1NTM H;  1R1B A;  2Q7E A;  3M7M X;  2ZDI A;  4ICG A;  4LF8 B;  1ZUQ A;  3G6E V;  4J7J A;  2E75 B;  2XTA A;  3AG3 C;  3EHB B;  2ILM A;  1N32 O;  1QNM A;  5CA3 A;  2QM4 A;  2ZM6 B;  4JI2 O;  2IH3 C;  1G8M A;  2GV9 A;  1JCH A;  1WB8 A;  2P6J A;  1VQ4 V;  1KKC A;  3RYH A;  1NS1 A;  4GLX A;  2AZ0 A;  1M93 A;  4UVA A;  4GKK B;  2OT5 A;  3T4D A;  5EIB D;  5FPR A;  2ZT9 B;  3OGC C;  2IM9 A;  4RUF A;  4MVU A;  5LGT A;  2RQ6 A;  3IC7 A;  3ZHR A;  2P5O A;  1MZF A;  1NH2 B;  2A7W A;  2KKW A;  4XDK A;  2E76 B;  3OFN G;  4U3J A;  4PD4 F;  3K06 A;  4WBN B;  1GK9 A;  3SPI A;  1K92 A;  3IGA C;  2PYL A;  1B3Q A;  5IY5 B;  4G2K A;  4Z1V A;  2DOS A;  4LBE C;  3JD4 A;  3G80 A;  4JI7 B;  2UXX A;  4DUZ B;  2JIZ G;  2Q67 A;  3F7Y C;  3F5T A;  4DV1 B;  4PA9 A;  1QVG U;  1COW G;  1GAX A;  1EFR G;  2P06 A;  2UUB O;  1HWY A;  1S72 V;  2XAJ A;  4KHP O;  3RYI B;  3FYI B;  1M56 B;  1XI1 A;  1Q90 D;  3PN1 A;  2JS3 A;  2HHH B;  2W0F C;  3S3W A;  2F4V B;  1I5X A;  4QE7 A;  4E4E A;  2LO1 A;  2YI8 A;  4IHJ B;  3DTU B;  2CGO A;  1Y76 B;  4Q20 A;  1NKD A;  2OTJ V;  1JPX A;  2R9A A;  5B5E Z;  4X20 B;  1AIL A;  3T1H O;  1ZLZ A;  5IYB O;  1NJI W;  4PHZ A;  4H44 B;  5LGN A;  5H6Q A;  2OWO A;  2YIB A;  1Y74 A;  3UT5 A;  4BIO A;  4B3M O;  1K33 A;  3SPC A;  3QO7 A;  3CE2 A;  2BE3 A;  4DV3 O;  5EBM C;  4YHH O;  2CTW A;  2B1G A;  3RBZ A;  4GX0 A;  3AK2 A;  1XMO O;  4PA6 A;  3E8G A;  2YXY A;  4DV7 B;  3B4S A;  1GO3 F;  4DV4 B;  4MTG A;  3AG2 B;  1FFX A;  3TJT A;  1AI7 A;  1M4U A;  1ZAU A;  1J5E O;  4DR5 B;  3SDL A;  4BIU A;  4JYA B;  3ML0 A;  5DM6 V;  3CX5 F;  4QNH B;  3OUS A;  5BY1 A;  1XL4 A;  4LF7 B;  1NR1 A;  4JTC B;  1YJ9 V;  3BA8 A;  1W2B U;  1BL8 A;  3RYF B;  1TUB B;  3ZED A;  4ZI7 A;  3JD1 A;  3APO A;  5JH7 A;  3E8F A;  2JGD A;  5IDJ A;  2V1D A;  1D5A A;  4YJ2 B;  1YTF D;  1I5Y A;  1IXM A;  1L0L H;  3E8H A;  4EFB A;  1FXV A;  3WB1 A;  4BIZ A;  5B1B B;  2XAG A;  4J10 A;  2DE0 X;  4LFB O;  1D5N A;  1FXK C;  3TET A;  3I55 V;  1H8E G;  5E1A C;  4DR1 B;  4JYB A;  4EEQ A;  3JAW B;  1YI2 V;  3BAB A;  2F1M A;  3H1J H;  3CPW U;  1LUV A;  1OCC C;  4X9Q A;  2G38 A;  5CB4 B;  4H33 A;  3WG7 C;  1HP8 A;  5LA6 A;  1OCR B;  1LNQ A;  4CH3 A;  4O2A A;  4F6R B;  1Q81 W;  2YXL A;  4OPH A;  4TUY B;  1N4C A;  5JVD A;  1LR1 A;  1XNR O;  4WF9 V;  3KCY A;  5GTI Z;  3BRC A;  4D7S A;  3FFQ A;  2RMK B;  2EIM B;  1L1F A;  4I4T B;  4ZOL A;  3F5W C;  4DR6 O;  1HW7 A;  1NTK H;  2MK3 A;  4J11 A;  3K5L A;  2V4D A;  1JA8 A;  2W6I G;  5KMG A;  4WFH A;  2ADP A;  2CK3 G;  1JJO A;  5IE9 A;  4HNA B;  2E5L O;  3AG1 C;  3SPH A;  2UXC O;  1BHB A;  1YXB A;  4FPP A;  5AG2 A;  4O4J B;  1U97 A;  4IGG A;  1RP3 B;  4GYC B;  4B3T B;  5C8Y B;  5IWA O;  3N2K A;  4LC1 A;  3K04 A;  2QGN A;  1FAF A;  4JTD B;  3ZIA G;  1BSM A;  2F43 G;  1BS3 A;  2YSU B;  3K3W A;  4BW9 A;  1P4R A;  3ABL C;  4NXN B;  2DQ3 A;  4JPR A;  2QE7 G;  2CH7 A;  1QCE A;  1ZX3 A;  1AI6 A;  2WLH A;  2Q0A A;  1XMQ B;  4JI8 O;  3PJS K;  3A0B Z;  1P7G A;  3ZS8 C;  4AQY O;  4UUJ C;  2VRZ A;  2WA4 A;  3OTO O;  1HNZ B;  2ETN A;  2ATK C;  4FM0 A;  1T5E A;  3H1L H;  1NTZ H;  3R65 A;  5KX5 A;  2RN9 A;  4X1K A;  3L74 H;  5JCO C;  4MVR A;  4I55 B;  4KUM A;  4DXW A;  1GM9 A;  1R3L C;  1YF2 A;  5E79 Z;  3RN4 A;  4NYK A;  3JSN A;  4X1Y B;  1GN3 A;  2ZXW C;  4UCU A;  1P49 A;  2GHY A;  2BSK A;  2EIK B;  3P32 A;  2X7R B;  2EJ7 A;  3KKY A;  2DW4 A;  1YSC A;  4AI8 A;  4MVQ A;  5LOV B;  3L72 H;  3ABU A;  2HKO A;  4FLU A;  2ZCE A;  4WFB V;  4K0K B;  4LF9 O;  2LQT A;  4X64 O;  4YJ3 A;  1F4N A;  1YTF B;  1R6T A;  3L73 H;  5B1A B;  3UCS C;  4LF8 O;  4LNU A;  3MHS C;  1R3J C;  1P7B A;  2OIE A;  4UB8 Z;  4JV5 B;  3OT7 A;  2YXH A;  3S3X A;  2ZM6 O;  5DED A;  3CXC U;  2H94 A;  4CC6 A;  4JI6 B;  1BHA A;  1W0J G;  2IU3 A;  4GKK O;  2L35 A;  4D6T H;  5J2U B;  3D3Q A;  2FTK A;  5ITZ A;  2WAM A;  1Y67 A;  3KG2 A;  2KQX A;  1G6U A;  2QTS A;  3P3N A;  5CA1 B;  3OMI B;  1VQK V;  5KLV H;  1NR7 A;  1BGY H;  2P67 A;  3ZCC A;  1RM1 C;  2QWR B;  3K79 A;  3SYC A;  4LWS B;  2DWD C;  2B9Z A;  3ZRS A;  1SA0 B;  2XND G;  1VQ5 V;  1B04 A;  2V7Q G;  3RFR A;  2NNU A;  2EIN B;  2O57 A;  4WBN A;  2Q4P A;  2RJZ A;  1WA8 B;  2R70 A;  1ZWI C;  4DUZ O;  3EVK A;  3DC6 A;  3BY6 A;  4GCZ A;  4DV1 O;  3UO2 A;  4J9Z B;  5LMN B;  4FVM A;  2JEX A;  1GRJ A;  3RVY A;  2YIA A;  1K5S A;  2D3O W;  3IFX A;  5BZB A;  1I08 A;  3RYI A;  4CS4 A;  5LBQ A;  2HHH O;  3SGI A;  2F4V O;  3W7U A;  5J2T A;  2A3Q A;  3ABK C;  4QPJ A;  1AR5 A;  1TGO A;  3JD3 A;  4NXM B;  1AP6 A;  2IH1 C;  2LJ2 A;  1NU1 H;  1R3K C;  1QLE B;  5HFL A;  1HNW B;  1VQO V;  1SES A;  1H2M A;  4IHJ A;  4J41 A;  3VQW A;  3LDC A;  1Y76 A;  4FFB B;  4FIP C;  2HJD A;  2B5U A;  1YVW A;  3DC5 A;  2UU9 B;  4X20 A;  4FZ0 A;  4DV6 B;  4KXR A;  1KQS U;  1Q7Y W;  2EBO A;  1YHQ V;  1NH2 D;  3N2G B;  4ZIB A;  4MSW C;  4UCO A;  2QWP B;  3K9A A;  2VWK A;  4O4L A;  3ZHQ A;  2F95 B;  2P90 A;  1KBH A;  1F7Y A;  2BTO A;  2OCH A;  2PI5 A;  4TWK A;  2ZIM A;  4UFZ A;  5B3S C;  4JI5 B;  3UM7 A;  3H01 A;  4DV7 O;  3FX7 A;  3CRC A;  4DV4 O;  2NN4 A;  5H9C A;  1H2L A;  5EZY B;  3QNE A;  3RT3 C;  4YIP A;  2XAF A;  3SR2 C;  4LP8 A;  1YJW V;  4DR5 O;  4JYA O;  5L3C A;  4TV8 B;  5EYP B;  4LF7 O;  1GM8 A;  1M57 C;  3OUF A;  1SKV A;  4HAM A;  1V54 C;  3E22 A;  3RYF A;  1TUB A;  1RSO B;  2E3C A;  3DXR B;  3RW0 A;  4RUE A;  2P4V A;  1B6Q A;  3QO5 A;  2VS0 A;  5CBG A;  2EUL A;  3T2M A;  1XBL A;  3E83 A;  2JVD A;  2VQF B;  1WLE A;  2YEV B;  1FYJ A;  3GWK C;  4MVO A;  3W7S A;  4DR1 O;  4GKJ B;  3SYP A;  4MW3 A;  4NVP A;  3JAW A;  3VQY A;  4FLZ A;  1KB9 F;  2NLJ C;  4RAI A;  4GX1 A;  3CCV V;  1QU7 A;  1M9N A;  3MDS A;  3JAM N;  3OGI B;  3L71 H;  2F66 C;  4F6R A;  4B3S B;  5B1O A;  4TUY A; 
#chains in the Genus database with same CATH homology
 2YUA A;  2LO1 A;  2PF4 E;  2Y4T A;  2EJ7 A;  1FAF A;  1GH6 A;  4J7Z A;  4J80 A;  3APQ A;  2DN9 A;  2N04 A;  2GUZ A;  1WJZ A;  2QWR B;  2L6L A;  2CTW A;  3AG7 A;  3BVO A;  2QWQ B;  2QWP B;  3UO2 A;  1HDJ A;  1N4C A;  2Y4U A;  2QSA A;  1FPO A;  2DMX A;  2N05 A;  1XBL A;  2CTP A;  2CTR A;  2OCH A;  1NZ6 A;  2QWO B;  1BQ0 A;  2GUZ B;  3APO A;  2CUG A;  4RWU A;  2LGW A;  2M6Y A;  2CTQ A;  4IT5 A;  2YS8 A;  3UO3 A;  3UCS C;  1BQZ A;  1IUR A;  2QWN B;  2KQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...