2IH3C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 37
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih3C00
4PDLA 2ZXWC 1BL8A 1OCZC 2IH3C 3SYCA 3E83A 4J9ZB 4LCUC 4WFFA 3LDCA 3F7VC 2K1EA 1OCCC 2Q68A 3F7YC 3BEHA 3HPLC 3OR6C 2W0FC 3OR7C 3OUFA 3OUSA 4MVRA 4R50A 3TCUA 5J9PC 2WLIA 4PA7A 3SYOA 4PA6A 4WFHA 1M57C 2QKSA 4RUFA 1KKDA 3K0DA 2WLLA 3SJQC 3UKMA 4PDMA 1S5HC 2AHZA 2NLJC 3AG3C 3LNMB 3F5WC 3SYAA 4X8AA 5BZBA 4GX1A 4P9OA 2EIMC 5B1BC 3K03A 4ZBMA 3T2MA 2HVJC 2ITDC 4KFMA 3AG1C 1P7BA 1OCOC 4HZ3A 3RBZA 2A9HA 2Y69C 2EIJC 4LP8A 4OXSA 4I9WA 3K0GA 4G28B 3RW0A 2JK5C 3ASOC 2DWEC 4MVUA 3T4DA 2HG5C 2Q69A 2AHYA 2DYSC 2HJFC 1LNQA 3LDEA 4GX0A 2H8PC 4MTOA 4MW8A 3AG2C 4UUJC 4R6ZA 4P30A 1J95A 1ZWIC 3FB5C 3ABLC 4JTCB 3RVZA 3SPCA 3E86A 5CBGA 3K08A 3IGAC 2Q6AA 2EIKC 2HVKC 3FB6C 4GX5A 3SPHA 2P7TC 4JTDB 4BW5A 2WLHA 4QE9A 1XL6A 3OGCC 4X88A 3JYCA 4MVQA 2DYRC 2BOBC 2WLKA 3E89A 3FB8C 1XL4A 4H37A 4LBEC 1K4DC 1M56C 3ABMC 4MVOA 2WLNA 4J9YB 2X6AA 1R3IC 4MTGA 4RUEA 4MS2A 2WLJA 2EILC 3E8GA 3STZC 3T4ZA 1ORQC 2ZD9A 5KUKA 4TWKA 4H33A 1V55C 4MW3A 5EC2C 1R3LC 5E1AC 1R3JC 4PA4A 4RO2A 4EKWA 5B3SC 3SPIA 2IH1C 2WLMA 3IFXA 4MVZA 2ATKC 2OCCC 2QTOA 5B1AC 5KUMA 3SPGA 5CBHA 1V54C 3AG4C 5IY5C 3SYQA 3K04A 4HYOA 4MTFA 4QE7A 4DXWA 3E8BA 4R8CA 1JVMA 2HFEC 3VOUA 2EINC 4PA3A 4JTAB 3PJSK 3X2QC 3STLC 3ZRSA 3K06A 3GB7C 3SPJA 3KG2A 4G27B 4WFEA 4WFGA 2X6CA 4R7CA 2WLIB 1K4CC 1OCRC 3LDDA 2A0LA 4XDLA 3EFFK 4MVMA 2R9RB 2KB1A 2WLLB 3SYPA 2ITCC 5EBLC 3ABKC 5CBFA 5EBMC 3FB7C 3LUTB 5EBWC 5EC1C 4F4LA 4CBCA 4GX2A 3UM7A 4XDKA 3T1CA 4QNHB 4PDRA 4MSWC 3RVYA 3ASNC 2YEVA 4X89A 5EK0A 4PDVA 3E8FA 2Q67A 3WG7C 4XDJA 3R65A 1G4YB 4MVSA 3TETA 3E8HA 4RAIA 2DWDC 2BOCC 3ZJZA 4P2ZA 2X6BA 4P9PA 1QLEC 1R3KC 4PA9A 2A79B
chains in the Genus database with same CATH superfamily
3K5MA 5DEDA 2G38A 3F7YC 2JEXA 4D7SA 1PNMA 4DV5O 2DOSA 5IJ0A 2Q7GA 2PUSA 2QKSA 1GKFA 3W7TA 1GO3F 3JARA 3CWBH 2CAZC 3WB2A 2JRIA 3NXSA 3JD3A 2DJVA 4X64O 4JYCA 5H9CA 3BCCH 3MHSC 3OTOB 1VQNV 3C90A 4LF5O 4UUJC 2Q0AA 2LQTA 1S76D 4JTCB 4DR3B 1N36B 1R1BA 4JI3B 1VQ8V 2UUCO 4JI7O 2V7QG 3K59A 4I5SA 3D36A 4MVOA 1M90W 5BR8O 3CCJV 3ASOB 4NXNB 4CH4A 2DYSB 2VQEB 4X62O 3E2EA 2PTMA 3G71V 3JCUZ 1QR8A 4DR7B 4JASA 5EIBD 1Y76B 3QF7A 1JMKC 4DV1O 1QBZA 1XNQB 2N04A 1F7YA 4ASUG 5JCOA 5EBWC 4B08A 2H94A 4N23A 2PGGA 3ASNC 1S72V 3D3IA 1S77D 1V9PA 3WG7C 4IHJA 5KLVH 3RYFB 3G6BA 3W7UA 3QVNA 4FLTA 5LOVA 3OM3B 1H38A 5IJ9B 2YUAA 4JI4O 4NTWA 2CDYA 2JS5A 4WFFA 3OR6C 4R50A 1BHAA 1XOUA 4CS4A 2KSDA 4JI0O 3K0DA 3F5WC 4IIJA 2Q8VA 4NR1A 2EIMC 2VRZA 2Y69B 4JYBA 1Y6XA 2H3OA 2Q69A 2ZXWB 4MTOA 4GX0A 1J95A 1ZWIC 1I94O 1SZTA 4CC6A 2EIKC 4DV3B 3SPHA 1YSCA 5L3GA 4I55B 3F5TA 2XOKG 5LMUO 1FKAO 1VQLV 2CH7A 4DYLA 4RUEA 1TAEA 2EX3A 2IH1C 1WPBA 5D5PA 1V54B 2OIEA 2DMXA 3H01A 2E5LO 1G8MA 3HKDA 1BQZA 1RSOB 1VF6C 5IWAO 2YIDA 1JFFB 1SKVA 3H1JH 3ML0A 2E76B 2KG7A 2WLLB 3ABUA 4KHPB 1AI4A 3ABKB 1V55B 4LF7O 1Q82W 4I7ZB 4X89A 1KB9F 3CRRA 4DR6O 1RM1B 2CTWA 5FPOA 1FJGO 1AR4A 4EB6B 2FMLA 3E8HA 4O2BA 1M4UA 2YDEA 4O4HA 4FJCC 4H0LB 1XHZA 2RN9A 4GKJB 3Q4HB 3FAVB 1JR9A 5KHHA 2GSMB 1OCZB 1VQKV 3JAMN 3E22B 5L3CA 4YJ2B 3QNEA 3OUSA 4LF4B 2ZE8A 4PA7A 1M57C 4UB6Z 5CA0A 1KKDA 2ILMA 4K0KO 4JV5B 1Q6IA 3D36C 2B9ZA 4UFZA 1RPOA 4DV4O 1K7DA 5JWPA 5J2TB 4BR6A 3AG1B 1OCOC 4HZ3A 2GUZB 4OXSA 1VF5B 2GTSA 4O4IA 1R6TA 3T4DA 3BY6A 5CA3A 1H8EG 1IXBA 1NT2B 1XQ8A 3FB5C 2QWPB 2CE4A 3E35A 1XL6A 5JVDB 4X20B 3JYCA 5GONA 4ICGA 3W7SA 4FVMA 1XEQA 1K92A 5IJ0B 1N33B 3JCZA 3LSUA 1GAXA 1L8DA 1SESA 4ZKIA 4MS2A 5KX5A 4XBFA 2YI9A 4TWKA 3ZHQA 1K8AW 1KQSU 2CK3G 3DXRB 5B3SC 3IFXA 4YHHB 2F4VO 3ZBHA 1AR5A 3K04A 3S3XA 4X1YB 4LF9B 2ZE7A 1MABG 2HFEC 3CYOA 4TQDA 3CC2V 1S5JA 2EINC 4LF6O 2Y48A 4K8XA 1GM7A 3FX7A 4X1IA 4BIUA 3CCVV 2PY5A 4K35A 4FLWA 2Q5ZA 4LF6B 4FK5C 5GTHZ 1IVSA 3CPWU 1DK1A 4B3RB 1E79G 2UXXA 3ZCCA 1UJWB 2JJ1G 1SQVH 2X7RB 2ITCC 3JAKB 3SJAC 5JH7A 5IYZA 4GT1A 4BIOA 1J5EB 4TUYA 2BTQA 2KQXA 3E8FA 4HBNA 4DV0O 4XDJA 4UCUA 5KHGA 2P22C 4LF8O 4CH6A 4PDLA 2IH3C 3CCLV 1IZ3A 4AILC 2QGNA 4TV9B 3TXSA 2OIGA 3TCUA 1UPGA 1AILA 4JAVA 2WPDG 1S3JA 4AHCA 2PYJA 4DUYO 3OMNB 4GX1A 1SQPH 2RDCA 2ITDC 1H2SB 4KP4A 1P7BA 3ZHVA 2O57A 4W4KA 2EIJC 5D5QA 3WU2Z 3B2EE 1ZAUA 3LSQA 3SJCC 4JI8O 3L70H 1QCEA 3LDEA 1Y4MA 2ZR2A 4P30A 2R9IA 4JYAO 4X1KB 4IYHA 3G6EV 1PPJH 2FYUH 3IGAC 1HR0B 5LP6C 2JS3A 2YI8A 5LMNO 1PD3A 4GX5A 2BSKA 2IJIA 4FPPA 3OT7A 1BSMA 3OAAG 1M93A 5H2FZ 1Y67A 2Y0IA 2YS8A 4O4JA 2R72A 4TV8A 2C2AA 1SQQH 5E1AC 2Q4PA 4NKGB 1XHXA 4GYCB 3CMEV 1WAZA 5IT9N 3SYQA 5IY5B 3T1HO 5ITZA 3VBBA 1M1KW 4JTAB 3CP1A 2L35A 4BIZA 5BXZA 2QDOA 3R66A 3JASA 3ZHSA 2RQ6A 3ZRVA 3HKEA 4GX2A 1TA8A 1ZSPA 3ETDA 2ZNIA 1GN6A 5TISZ 2JGUA 5LXTA 4DV7B 3UT5A 3RYHB 2XAQA 1I08A 3QTCA 2GV9A 1M5IA 3OR7C 5J9PC 1DF4A 4U3JB 5K1PA 3ZHRA 1CPYA 3M8AA 3SR2C 4B3MB 4PI0A 1EZVH 2KG7B 3P30A 4ZHQA 1XMOB 2PI5A 2XAFA 5KHIA 1AVMA 4YIOA 5CB4A 5LYJB 1QNMA 1MMMA 3EXAA 4O2BB 1FFTB 1SQFA 2XNDG 3C3SA 3K08A 2VQFB 5C8YB 3ETEA 3CE2A 1URFA 1ZL8B 2ZKOA 4H37A 1M56C 4DV2O 2WLNA 5EYPA 5CA1B 1R3IC 4H33A 3UQ8A 4WFAV 1IBKB 3BHPA 3ETQA 4FFBA 3P32A 5B1AC 1WA8A 2OCCB 3NR7A 4JGSA 3CCQV 2F93B 3JSLA 4HYOA 5H5NA 3QO5A 3VOUA 4DV6B 2UXBB 3PJSK 1PV0A 3GWKC 2HR3A 3G80A 3LDDA 3SYPA 2KB1A 2HHHO 2UU9B 3QO7A 1IX9A 3A2FA 1EN4A 4O2AA 1XDCA 3R65A 1X4TA 1VQ7V 2JEUA 5FNVA 5KX5B 1NBMG 3OW2U 3A8TA 4LFBO 3B8MA 2VWJA 2DQ0A 3H1KH 3TXQA 1ZX3A 1FYJA 3EVKA 3MD0A 3CRQA 1OCRB 3SJBC 4JPRA 1VQPV 4X9QA 4ZIBA 4NB5A 3KKYA 2F23A 4JI6O 3UKMA 5L3BA 4LFAB 2UUBO 3CCEV 3LSSA 4P9OA 2WWWA 3CRCA 4Z1MG 5B66Z 4CS2A 5IYZB 2QM8A 1HNZB 1OJHA 3JALA 3ASOC 4C7UA 3L9DA 2DYSC 4DRXA 2ZCEA 1N32O 2LO1A 2Y4TA 1VF6A 1DTOA 3ABLB 2GBOA 4DV5B 4UCSA 4PD4F 1H8HG 2OT5A 4L87A 4BW5A 2WLHA 2GTAA 1BE3H 1KUQA 1TUBB 1XL4A 1K33A 1H2NA 4N21A 4X64B 3K57A 3L71H 2HJDA 3E8GA 4H13B 5DM6V 1U97A 3BABA 3AG2B 4LF5B 1YITV 2JIZG 3EHBB 3AG4B 5K1XA 2ZIOA 1EN6A 2UUCB 2UXCO 4JI7B 1BS3A 3CRMA 5BR8B 2R9RB 2BSKB 3ZRWB 1VARA 3B77A 5EC1C 4F4LA 4QNHB 4LFCO 4X62B 2ARHA 5EZYA 4MT8A 4RQFA 2LFRA 1YZBA 4O4JB 2AGAA 3J7AU 5LHIA 2ZNJA 1YIJV 4DV1B 1FXKB 2ZXWC 4E2LA 3LDCA 5ITZB 3OD4A 1OCCC 1TGOA 3DSQA 3ZS8C 3K3WA 1HNXO 1IBLO 2WLIA 2P06A 5B1OA 1GMGA 1Q6UA 1FD9A 2OTLV 1NU1H 1VQ6V 5BZBA 5B1BC 1SA0A 1OZ0A 2UUAO 1AJNA 3K0GA 2JK5C 3M99B 1E1QG 4F6RA 4JI4B 5JQGB 2UXDO 1F4NA 3DC6A 4TSFG 3HB3B 1AR1B 2FB5A 3FB6C 1SZXA 3BAAA 4JI0B 1JOYA 4B3TO 1Y74A 3OGCC 2XASA 3ZEDA 1HW7A 2X0LA 3CSXA 1HNWO 4LWSA 4OX9O 4J9YB 5CN0A 3FYIB 1TVKA 1NZ6A 4O4LA 3OE7G 3RYIA 1V55C 4MW3A 1B6QA 5DECA 3N27A 4DR2O 1F51A 5FLXN 2QKAA 4ZHQB 3JATA 1S0VA 2ATKC 1YHQV 5KUMA 4DR5O 1I94B 3RWRD 3STLC 1KKCA 2YXHA 1VIBA 3UO3A 2OTJV 4R7CA 5LMUB 4ZOLB 1WN7A 2A06H 4CBCA 2R70A 1NR1A 1THZA 5EK0A 2JVDA 2P4KA 1CXZB 2YEVA 3ASNB 4G2KA 4DW0A 3VQXA 3TETA 4P2ZA 2E5LB 1L0LH 1OHHG 4QPJA 4J7ZA 5LP6A 4X66O 4UV9A 5BMVB 5IWAB 1WA8B 2K1EA 2W0FC 2NN4A 3CJHA 3SYOA 2A3QA 4DUZO 1G6UA 4LF7B 5KA5A 1S5HC 4RWUA 5FL7G 1VQOV 3IC7A 4DR6B 1FJGB 1W0KG 1XMQO 1OV9A 2IJHA 1PKXA 1NVPB 4BAYA 2DWEC 1AJPA 1QR9A 3OMIB 5H6QA 1LR1A 3L75H 4L8JA 3BA8A 2PYLA 3JAWA 2WSSG 4JYYA 5CBGA 1BMFG 3H1LH 2Q6AA 4QGPA 2EIKB 1KBHA 2A7WA 4K0KB 1MNGA 1EBOA 3FB8C 4DV4B 1I0HA 4YIPA 3N2KA 4JI2O 2V1DA 2E74B 2EILC 4PV1B 1JX9A 1ENVA 1NH2B 1I5YA 3HKCB 1D5AA 1NI8A 1H2MA 1R6KA 2IBZH 2QTOA 3B09A 3CEIA 3JD2A 4CS3A 1QHTA 4IYIA 2Q73A 2JGDA 3OGIB 5DN6G 4DR1O 4F6EA 2PF4E 2A0LA 2Z0AA 1X59A 2HEPA 3JARB 1E1RG 3K9SA 3CHXA 2YIAA 1K9MW 4FM0A 3T1CA 4HNAA 3RN4A 4NXMO 2AXTZ 4JI1O 3ZIAG 3W7XA 1NR7A 2F4VB 2YC0A 4D7TA 1BCCH 3OEEG 4ZI7A 1Q86W 2Y0PA 4UXNA 3BVOA 2FTKA 1B06A 3E83A 4LCUC 3I56V 1EM1A 4ABMA 4Q6GA 3OEHG 3CS5A 1M57B 1ZLZA 4J42A 5L3DA 2B1IA 4Z2WA 1FXHA 4IL6Z 1PM9A 4DV0B 3VQWA 1OCOB 4NTYA 4LF8B 1XNRO 3A0HZ 1K3EA 4NTXA 1SC5B 1VQ9V 4B3SO 3BPZA 4UCRA 4QE9A 1VQ5V 2HLDG 4DUYB 2XAJA 1K4DC 2BCCH 5KUKA 4JI8B 2WA4A 2XAHA 3O9OA 4IHJB 1H2KA 3APQA 4DR4O 1R3LC 4PA4A 4EKWA 1EZJA 4DR4B 1I5XA 1EN5A 5B3SB 4UCTA 5A2QN 5LOVB 4JYAB 3SPGA 4WFBV 5IE9A 1Q43A 1FXVA 1XBLA 4J11A 5LMNB 4DK0A 2EINB 4DO2A 2JDIG 3J80N 1NKDA 4WFEA 4I9QA 4YY3O 3UCSC 5LGUA 5CBFA 4IIJB 3FB7C 1Y74B 3VQVA 5JJNB 4FLVA 2VS0A 4MSWC 2ZE6A 2QA4V 1Z5VA 2Q67A 5FPRA 1KECA 4LWSB 3I5DA 3S3WA 1G4YB 2LFSA 4UB8Z 2QEXV 3T1HB 3OTFA 4O4LB 5C93A 3OFNG 3ZX6A 1HP8A 3JATB 1Y76A 3T4ZA 1GK9A 2YXYA 3BEHA 4KL1A 1DF5A 3CC7V 1NQTA 5CMUA 3RYCA 3CC4V 2XAGA 5GW7A 5HFLA 1SQBH 4JZ2A 2CH7B 1AI5A 2HVJC 4KFMA 1YTFD 3RBZA 2A9HA 4DW1A 3HKBA 3RYFA 2YEVB 4AI8A 4GCZA 4LNUA 2W6JG 4OGQB 3HKDB 2P4VA 2F95B 3AG7A 1COWG 1N34O 5LP6B 4EFEA 3MHHC 5LBQA 1CP9A 2P7TC 4JTDB 2ADPA 4JI5O 1Q81W 2DYRC 4MTXA 1L1FA 1GN4A 3T1YO 2DN9A 1N0JA 1FPOA 4MTGA 4A5UB 1MG1A 1SQGA 3JD4A 2ZM6O 1SQXH 2F1MA 2EJRA 4O4HB 4GKKO 2HP8A 3L74H 3IAYA 4FMTA 4DXWA 4CC5A 4UVBA 3TJTA 2IM9A 3CB2A 1MOFA 1NTZH 1VEWA 1K73W 4U7OA 3SPJA 1GM8A 1KC8W 1OCRC 1KP3A 5CA0B 2BTOA 4AQYO 2DE0X 4DV2B 5LA6A 4X65O 4I55A 1JQ0A 1GM9A 1Q6HA 4UCOA 3LNNA 2WAMA 3RT3C 3N2KB 4O4IB 3DTUB 2CGOA 2MK3A 4PA9A 1JA8A 2EULA 4J10A 4U7NA 3QO8A 2HHHB 5GONB 4WFHA 2JGDB 2WLLA 2AHZA 3ETGA 3JSNA 3N2GA 1SRYA 2IU0A 1N8RW 3K79A 2OWOA 4LFBB 1VQMV 2QM4A 2UXNA 4J7KA 1A32A 4HNAB 2ZQMA 3OMAB 1IBMO 2HJFC 3ICXA 2AZ0A 3AG2C 4UVAA 3Q4HA 3FAVA 4GUNA 1R6NA 4X1IB 3E22A 1US6A 4YJ2A 3AG3B 1K34A 4JI6B 3U11A 1O9HA 5KHKA 3THOA 1G1XB 1YJNV 1U96A 2UUBB 2LP7A 4K3AA 2LGWA 3P3PA 5JH7B 2L6LA 3STZC 5J2TA 1JCHA 2BTQB 4TUYB 4QJFB 3BA9A 2LW7A 3APOA 2GUZA 4RO2A 1N32B 3AK3A 2QE7G 3SPIA 5L3FA 5B1AB 1D2DA 4R8CA 1JVMA 4UCVA 4PA3A 1K97A 5KAIZ 1PNKA 3ZRSA 2VWKA 2BE3A 1AB3A 3KG2A 1FXKC 1K4CC 3ABMB 4X20A 5JVDA 3ABTA 3RFRA 4TQFA 4XDKA 4PI2A 1GTOA 2V4DA 4IT5A 5KMGA 4FFKA 4FLXA 4RAIA 3DXRA 2X6BA 4P9PA 5LHHA 3OTOO 1XUQA 3X2QB 3K5NA 5LGNA 2CTQA 4X1YA 2A79B 3CD6V 2QTSA 2UXCB 1MSWD 1WB7A 4FZ1A 3D3QA 3OUFA 4DR3O 1N36O 4JI3O 1P7GA 1PL4A 4LFCB 3LNMB 3AEIA 3JAKA 3IJ4A 4TV8B 4ZBMA 3ZMZA 1QLEB 5JJJB 2Y69C 5GTIZ 4NXNO 2Z5UA 1R73A 1Q3EA 2VQEO 2YXLA 2HG5C 2ZINA 2ZDIA 2H8PC 2LW1A 1BHBA 3RVZA 1IBLB 1HNXB 1YI2V 1KYOF 1XREA 4TV9A 4DR7O 3JASB 2QJ1A 4W4LA 1P4RA 4MVQA 4FM2A 1XNQO 2WLKA 3PN1A 1LUVA 2AZ2A 2AW9A 3CMAV 2YIBD 1BGYH 3HKEB 2UUAB 3RYCB 2ZE5A 3W7WA 3ZN1A 1W2BU 5A9GA 3ZRXA 4UV8A 3A0RA 1Q90D 4OPHA 5LXTB 2E3CA 2UXDB 3UT5B 5EIBC 1V54C 3HKBB 1VF7A 1WJZA 4X1KA 5IDJA 3BFRA 3ZN0A 4B3TB 4LNUB 4WFGA 1SERA 1HNWB 2D2CB 2IJKA 4OX9B 3EFFK 1NVPD 5EBLC 4PJ0Z 3MAQA 1P49A 3ABKC 1CEZA 5EBMC 4B7EA 3UM7A 4WF9V 4PDRA 4DR2B 1SF9A 1WB8A 4EEQA 1RM1C 3C3TA 4MVSA 4DR5B 1UFIA 2DWDC 4E4EA 3L73H 1ZUQA 5CB4B 4JZGA 3D8CA 2FL4A 1BL8A 1OCZC 3CXCU 2B5UA 1DGSA 3F7VC 3HPLC 4I0XA 3H9VA 3SGIA 1OCCB 4WBNA 1VP7A 1AI6A 4PA6A 1NH2D 2DW4A 2R9AA 4DV3O 5LGTA 1B3QA 4I4TA 3SJQC 1JJ2U 3WG7B 1W59A 5EYPB 4FLZA 3K5OA 3KCYA 5LA6B 5B1BB 3AG1C 1K5SA 1YVWA 3DC5A 4FFBB 1JPXA 2RNBA 1GN3A 4FIPC 4X66B 4BW9A 4MW8A 3RYHA 4R6ZA 1PL0A 1RFYA 3VQYA 2HVKC 1AROP 4DUZB 2B1GA 4U3JA 4WCEV 4IGGA 2P5OA 2EIMB 4U3FH 3G4SV 3B8NA 1XMQB 4KHPO 3SDLA 3WFVA 2QWOB 5IYDO 2ZD9A 4O2AB 2W6IG 3N2GB 5J2UA 5FNVB 2XUMA 3WB1A 2WLMA 5L3EA 2QR4A 4J7JA 4QE7A 4NVPA 5LYJA 3CCUV 1Z2GA 3ZHUA 4GKJO 4CH5A 1S5LZ 3UO2A 5C8YA 2PI4A 1NS1A 1VMGA 4XDLA 1ZL8A 4FM1A 4LF4O 3M7MX 1Q5OA 4JI2B 4YXWG 3LUTB 1FFXA 4JV5O 5CA1A 1W0JG 1ROPA 3B4SA 3KCXA 3JALB 1SS3A 1M9NA 1L0NH 2Q9LA 2ZDIC 2MW2B 4DRXB 4Q20A 1R3KC 2OYQA 3RGBA 2RCVA 2M6YA 2HKOA 1Q8IA 2N05A 3GVMA 4DR1B 4J9ZB 3JD1A 4MVRA 3MDSA 4LR3A 4JAAA 2EZPA 4KXRA 4YJ3A 2ZR3A 2LGQA 4H44B 4PDMA 1WP7A 3TK1A 4X8AA 3ZMUA 3GWOA 4NXMB 5JCOC 4JI1B 2ZT9B 1N33O 3T2MA 2XT9A 3U0ZA 1P84F 4LP8A 1YJ9V 3AK2A 3RW0A 4DK1A 5KMGB 1I7FA 3FYEB 1DLBA 4YHHO 2CTRA 1YJWV 3QG5A 4LF9O 3E86A 1GN2A 1KU9A 1WPXA 1IXMA 1NTMH 1T5EA 2BOBC 4LC1A 4B3RO 1HDJA 3WB0A 1AJQA 3CCMV 2QSAA 1K5QA 3KZIZ 2WLJA 2EILB 5EZYB 1BQ0A 4I50A 1XNRB 1J5EO 1LUWA 1R3JC 3HR0A 5F2VO 4LH7A 1AI7A 4MVZA 1MSDA 1QVGU 5IY5C 4MTFA 4B3SB 3E8BA 2E75B 3O65A 2DQ3A 3K58A 1BZKA 1AP6A 1RP3B 4G27B 3B40A 4JAUA 5H6RA 2WLIB 3A0BZ 1BT8A 1TUEB 1EFRG 3BRCA 1TUBA 2IJJA 1MZEA 3FKSG 2Y4UA 1B04A 1MZFA 1SA0B 1Y66A 2ODMA 1KMIZ 1F23A 3ZMTA 1RPRA 2QM7A 4F6RB 2P6JA 3AK1A 4KUMA 5E79Z 3SPCA 1FS0G 4J80A 2YICA 2WA3A 1JJOA 4YY3B 1HR0O 4RUFA 2W0XA 3ZRWA 5B1NA 1TVKB 3K03A 3RYIB 2Q0OC 1Z5WA 4I9WA 1GH6A 1SETA 2GHYA 2IU3A 4MVUA 2K9PA 2GDSA 1N0NA 3U10A 4CH3A 1GRJA 3IC9A 1FXKA 1PP9H 2ETNA 4X88A 1QQCA 4UVCA 3TGUH 3L72H 4WBNB 4I0XB 3K5LA 2LJ2A 3E89A 1QLNA 2JJ2G 4HAMA 1MA1A 1HWYA 2NR5A 4FZ0A 5JJEB 4GLXA 2P90A 2X6AA 2EIJB 2Z3YA 4I4TB 4Z1VA 3ZHTA 1XI1A 1YCIA 5EC2C 5KAFZ 5IYBO 5BY1A 5IJ9A 2OCCC 4J41A 2QKCA 3CXHF 2N74A 3H1IH 3JD0A 5JQGA 4DV7O 1F4MA 3FD9A 1N34B 3CCRV 2ZIMA 3K06A 4OPAA 4JI5B 1IDSA 2PZSA 3CJHB 1NJIW 4RQEA 3T1YB 1D5NA 2YSUB 4MVMA 4GZRB 4B3MO 3J81N 2ZM6B 2EZOA 1YDXA 4PDVA 2XHBA 1XMOO 1FAFA 4GKKB 1KD1W 2BOCC 3ZJZA 4NYKA 5AG2A 5J2UB 3CCSV 3JAWB 1YF2A 3SYCA 2Q68A 1WP8A 2EJ7A 3K9AA 4AQYB 4X65B 2VQFO 2NNUA 4ZOLA 5LHGA 1VQ4V 2NLJC 2QWRB 3AG3C 3P3NA 2P67A 3SYAA 2QWNB 4FLUA 4QPKA 4D6TH 3G67A 1H2LA 1FFXB 1AP5A 4PHZA 2IW5A 4G28B 2YIBA 1IBKO 1O9GA 2XTAA 2AHYA 2RMKB 1QU7A 4EFBA 1LNQA 1RSOA 2Q7EA 5HFMA 5LL6Y 5KHJA 3H1HH 3ABLC 5BMVA 2RJZA 1NTKH 1JFFA 1IURA 4DV6O 1WLEA 2UXBO 2CUGA 1YTFB 4FLYA 2F66C 2DYRB 4LBEC 3ABMC 2F43G 4YJ3B 2UU9O 3FFQA 4EB6A 3ZMSA 1ZTEA 1ORQC 3I55V 1QVFU 2Q7HA 4K8ZA 1N4CA 2OCHA 1IBMB 2FKXA 4BWAA 2D3OW 5CBHA 4QIWF 3AG4C 4ZI7B 1YEWA 1KP2A 2EBOA 1Q7YW 3X2QC 2CGNA 5KA6A 3GB7C 4PELA 1M56B 2X6CA 3DGEA 4CZZA 1PNLA 2QWQB 2CTPA 3ZMVA 2ADQB 1YXBA 2KKWA 3CX5F 4B7KA 3RVYA 4LFAO 5IYCO 1XILA 3HKCA 4TT3G 1WNSA 2M7WA 4TOIA 4LH6A 1HNZO 4I50B 1QLEC 1H2GA 3CRAA 5B5EZ 4JF3A
chains in the Genus database with same CATH topology
1BL8A 1OCZC 3CXCU 2B5UA 3E83A 4LCUC 3I56V 3F7VC 3F7YC 2JEXA 3HPLC 3OR7C 1OCCB 5J9PC 1PNMA 1DF4A 1AI6A 3OEHG 4PA6A 1NH2D 2DW4A 1CPYA 1M57B 2QKSA 5LGTA 1GKFA 3W7TA 1GO3F 3SJQC 1JJ2U 5L3DA 2B1IA 3WG7B 1FXHA 3NXSA 3P30A 3JD3A 5B1BB 2PI5A 2XAFA 3AG1C 4JYCA 1K5SA 1OCOB 5H9CA 3MHSC 1VQNV 1JPXA 1K3EA 4FIPC 4MW8A 4UUJC 4R6ZA 1S76D 1FFTB 4JTCB 2XNDG 1VQ9V 1PL0A 3K08A 2HVKC 1AROP 2B1GA 4QE9A 3ETEA 1VQ8V 4WCEV 1VQ5V 2HLDG 2V7QG 2XAJA 2EIMB 3G4SV 3B8NA 4H37A 4I5SA 1K4DC 1M56C 3D36A 4MVOA 1M90W 2WLNA 3CCJV 1R3IC 3WFVA 3ASOB 5IYDO 2ZD9A 5KUKA 4H33A 2XAHA 2DYSB 2W6IG 1R3LC 4WFAV 4PA4A 4EKWA 1EZJA 1I5XA 3E2EA 5B3SB 3P32A 2WLMA 5L3EA 5B1AC 2OCCB 3SPGA 3G71V 4WFBV 4JGSA 3CCQV 4HYOA 4QE7A 3CCUV 1QR8A 3QO5A 3VOUA 1FXVA 2EINB 4DO2A 3PJSK 4JASA 2JDIG 1NKDA 1QBZA 2HR3A 2PI4A 4WFEA 3LDDA 4XDLA 4ASUG 5LGUA 3SYPA 2KB1A 5CBFA 4YXWG 3FB7C 3LUTB 3QO7A 5EBWC 2H94A 4N23A 4MSWC 3ASNC 1W0JG 1S72V 2QA4V 3D3IA 1S77D 2Q67A 3WG7C 1KECA 1ROPA 3R65A 1G4YB 2LFSA 2QEXV 1M9NA 2JEUA 1VQ7V 1NBMG 3OW2U 3W7UA 2ZDIC 3B8MA 5C93A 4Q20A 3OFNG 2DQ0A 1R3KC 3OM3B 1H38A 2HKOA 3MD0A 1OCRB 4J9ZB 4WFFA 3JD1A 3T4ZA 3OR6C 1GK9A 4MVRA 3BEHA 4R50A 1BHAA 4JPRA 1DF5A 1VQPV 3CC7V 2EZPA 1NQTA 5CMUA 2ZR3A 3CC4V 2XAGA 3K0DA 3UKMA 4PDMA 5L3BA 5GW7A 5HFLA 3F5WC 3TK1A 4X8AA 3ZMUA 3GWOA 3CCEV 3LSSA 4P9OA 2EIMC 1AI5A 3T2MA 2WWWA 2HVJC 4KFMA 4Z1MG 1YTFD 2QM8A 2A9HA 3RBZA 4LP8A 2Y69B 4JYBA 1YJ9V 3RW0A 3ASOC 5LBQA 2YEVB 3FYEB 2Q69A 1DLBA 2DYSC 2ZXWB 4MTOA 4GX0A 4GCZA 1DTOA 2W6JG 1J95A 1ZWIC 3ABLB 1YJWV 3E86A 1SZTA 1COWG 2EIKC 1WPXA 3MHHC 1CP9A 2P7TC 1H8HG 3SPHA 2OT5A 4JTDB 4L87A 1YSCA 4BW5A 2WLHA 5L3GA 1IXMA 1Q81W 2DYRC 2BOBC 4MTXA 4LC1A 1L1FA 1XL4A 2XOKG 1K33A 1AJQA 1VQLV 3CCMV 4N21A 1K5QA 4MTGA 4RUEA 2WLJA 1MG1A 3E8GA 2EILB 5DM6V 3JD4A 1R3JC 3AG2B 2EJRA 1YITV 2JIZG 2IH1C 1AI7A 4MVZA 3EHBB 1QVGU 4FMTA 5IY5C 1V54B 3AG4B 4MTFA 4DXWA 3E8BA 4UVBA 3H01A 1G8MA 2DQ3A 1MOFA 1K73W 4U7OA 4G27B 1GM8A 3SPJA 5H6RA 4JAUA 2WLIB 1KC8W 1OCRC 3ML0A 1KP3A 1TUEB 1EFRG 2R9RB 2WLLB 2IJJA 3ABUA 3ZRWB 1JQ0A 1AI4A 1GM9A 3ABKB 3B77A 1V55B 5EC1C 3FKSG 4F4LA 4QNHB 1Q82W 2WAMA 1Y66A 4X89A 1F23A 4MT8A 3ZMTA 1RM1B 1RPRA 4RQFA 2LFRA 2QM7A 3E8HA 3DTUB 4FJCC 2P6JA 5LHIA 2MK3A 1YIJV 4PA9A 4KUMA 3SPCA 1FS0G 2GSMB 1FXKB 2ZXWC 4E2LA 1OCZB 1VQKV 3LDCA 5L3CA 1OCCC 4U7NA 3QNEA 3OUSA 3K3WA 3QO8A 2WLIA 4PA7A 5B1OA 4WFHA 1M57C 4RUFA 1KKDA 1GMGA 2WLLA 3ZRWA 2AHZA 3ETGA 2OTLV 1RPOA 1VQ6V 1SRYA 5BZBA 1K7DA 5B1NA 2IU0A 5B1BC 3K03A 1N8RW 3K79A 1OZ0A 3AG1B 1OCOC 4HZ3A 4OXSA 1VQMV 4I9WA 1AJNA 2UXNA 3K0GA 2JK5C 1SETA 2GHYA 2IU3A 4MVUA 3T4DA 3M99B 1E1QG 3BY6A 2ZQMA 3OMAB 5CA3A 2HJFC 1H8EG 3AG2C 1F4NA 4UVAA 3FB5C 4TSFG 1FXKA 1R6NA 3HB3B 1AR1B 3FB6C 3AG3B 1K34A 1JOYA 3E35A 1XL6A 3OGCC 4X88A 3JYCA 4UVCA 1YJNV 2XASA 2LP7A 3E89A 3W7SA 1QLNA 2X0LA 1K92A 2JJ2G 4HAMA 1HWYA 3JCZA 2P90A 4J9YB 2X6AA 2EIJB 5CN0A 1SESA 3FYIB 2Z3YA 3STZC 4MS2A 4ZKIA 1JCHA 4QJFB 3OE7G 4XBFA 4TWKA 1V55C 4MW3A 5EC2C 1B6QA 1K8AW 4RO2A 1KQSU 2CK3G 1F51A 5IYBO 2QE7G 5B3SC 3SPIA 1S0VA 3IFXA 2ATKC 2OCCC 5L3FA 5B1AB 5KUMA 1YHQV 3K04A 3JD0A 4R8CA 1MABG 1JVMA 2HFEC 1F4MA 3CYOA 3CC2V 2EINC 2Y48A 4PA3A 1K97A 1GM7A 1PNKA 3CCRV 4BIUA 3CCVV 3STLC 3ZRSA 3K06A 4FK5C 3CPWU 3KG2A 2OTJV 1FXKC 4R7CA 1K4CC 3ABMB 1NJIW 4RQEA 1E79G 2UXXA 3ABTA 3ZCCA 1UJWB 2YSUB 2JJ1G 4MVMA 2X7RB 2ITCC 4GT1A 4CBCA 4XDKA 1GTOA 2EZOA 1NR1A 1THZA 2YEVA 3ASNB 5EK0A 4PDVA 3E8FA 4G2KA 4XDJA 3TETA 1KD1W 4RAIA 2BOCC 3ZJZA 4P2ZA 2X6BA 4P9PA 5LHHA 3X2QB 5LGNA 1OHHG 4QPJA 3CCSV 2A79B 3CD6V 4UV9A 4PDLA 1MSWD 2IH3C 3SYCA 3CCLV 2K1EA 2Q68A 3OUFA 2W0FC 3K9AA 3TCUA 4JAVA 2WPDG 3SYOA 1S3JA 2NNUA 5LHGA 1VQ4V 5KA5A 1S5HC 2NLJC 3AG3C 3AEIA 3LNMB 5FL7G 2P67A 1VQOV 3SYAA 3IC7A 3OMNB 4GX1A 4ZBMA 4QPKA 1W0KG 2ITDC 4KP4A 3ZMZA 1P7BA 1QLEB 2Y69C 2EIJC 2Z5UA 1R73A 2IW5A 4G28B 2IJHA 1PKXA 3LSQA 4BAYA 2DWEC 1NVPB 2HG5C 1AJPA 1QR9A 1QCEA 2ZDIA 2AHYA 1LNQA 3LDEA 2H8PC 1BHBA 1Y4MA 2ZR2A 5HFMA 3OMIB 5H6QA 4P30A 2R9IA 2WSSG 3ABLC 3G6EV 3RVZA 5CBGA 1BMFG 3IGAC 2Q6AA 1YI2V 1WLEA 1PD3A 2EIKB 4GX5A 2IJIA 4FPPA 1YTFB 3OAAG 1P4RA 4MVQA 1EBOA 2DYRB 2WLKA 3FB8C 3CMAV 4LBEC 3ABMC 2F43G 2V1DA 3W7WA 3ZN1A 2EILC 3ZMSA 1ORQC 1W2BU 1JX9A 2C2AA 1ENVA 3I55V 3ZRXA 4UV8A 1QVFU 3A0RA 1NH2B 1I5YA 5E1AC 3CMEV 1R6KA 2QTOA 2D3OW 5CBHA 4QIWF 1V54C 3AG4C 3SYQA 5IY5B 1KP2A 2EBOA 3JD2A 3VBBA 1M1KW 4JTAB 1Q7YW 3CP1A 5IDJA 4BIZA 3X2QC 3ZN0A 5KA6A 3GB7C 4PELA 5DN6G 4WFGA 1SERA 1M56B 2X6CA 3DGEA 4CZZA 1PNLA 2A0LA 3ZMVA 2IJKA 3EFFK 1NVPD 1E1RG 5EBLC 1CEZA 3ABKC 5EBMC 3ZRVA 1K9MW 4GX2A 3ETDA 3UM7A 3T1CA 4WF9V 4PDRA 3RVYA 5IYCO 1RM1C 3ZIAG 3W7XA 1NR7A 4MVSA 4TT3G 2M7WA 2DWDC 1QLEC 1H2GA 3OEEG 4JF3A 2XAQA 1Q86W 4UXNA 2FTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDL A;  2ZXW C;  1BL8 A;  1OCZ C;  2IH3 C;  3SYC A;  3E83 A;  4J9Z B;  4LCU C;  4WFF A;  3LDC A;  3F7V C;  2K1E A;  1OCC C;  2Q68 A;  3F7Y C;  3BEH A;  3HPL C;  3OR6 C;  2W0F C;  3OR7 C;  3OUF A;  3OUS A;  4MVR A;  4R50 A;  3TCU A;  5J9P C;  2WLI A;  4PA7 A;  3SYO A;  4PA6 A;  4WFH A;  1M57 C;  2QKS A;  4RUF A;  1KKD A;  3K0D A;  2WLL A;  3SJQ C;  3UKM A;  4PDM A;  1S5H C;  2AHZ A;  2NLJ C;  3AG3 C;  3LNM B;  3F5W C;  3SYA A;  4X8A A;  5BZB A;  4GX1 A;  4P9O A;  2EIM C;  5B1B C;  3K03 A;  4ZBM A;  3T2M A;  2HVJ C;  2ITD C;  4KFM A;  3AG1 C;  1P7B A;  1OCO C;  4HZ3 A;  3RBZ A;  2A9H A;  2Y69 C;  2EIJ C;  4LP8 A;  4OXS A;  4I9W A;  3K0G A;  4G28 B;  3RW0 A;  2JK5 C;  3ASO C;  2DWE C;  4MVU A;  3T4D A;  2HG5 C;  2Q69 A;  2AHY A;  2DYS C;  2HJF C;  1LNQ A;  3LDE A;  4GX0 A;  2H8P C;  4MTO A;  4MW8 A;  3AG2 C;  4UUJ C;  4R6Z A;  4P30 A;  1J95 A;  1ZWI C;  3FB5 C;  3ABL C;  4JTC B;  3RVZ A;  3SPC A;  3E86 A;  5CBG A;  3K08 A;  3IGA C;  2Q6A A;  2EIK C;  2HVK C;  3FB6 C;  4GX5 A;  3SPH A;  2P7T C;  4JTD B;  4BW5 A;  2WLH A;  4QE9 A;  1XL6 A;  3OGC C;  4X88 A;  3JYC A;  4MVQ A;  2DYR C;  2BOB C;  2WLK A;  3E89 A;  3FB8 C;  1XL4 A;  4H37 A;  4LBE C;  1K4D C;  1M56 C;  3ABM C;  4MVO A;  2WLN A;  4J9Y B;  2X6A A;  1R3I C;  4MTG A;  4RUE A;  4MS2 A;  2WLJ A;  2EIL C;  3E8G A;  3STZ C;  3T4Z A;  1ORQ C;  2ZD9 A;  5KUK A;  4TWK A;  4H33 A;  1V55 C;  4MW3 A;  5EC2 C;  1R3L C;  5E1A C;  1R3J C;  4PA4 A;  4RO2 A;  4EKW A;  5B3S C;  3SPI A;  2IH1 C;  2WLM A;  3IFX A;  4MVZ A;  2ATK C;  2OCC C;  2QTO A;  5B1A C;  5KUM A;  3SPG A;  5CBH A;  1V54 C;  3AG4 C;  5IY5 C;  3SYQ A;  3K04 A;  4HYO A;  4MTF A;  4QE7 A;  4DXW A;  3E8B A;  4R8C A;  1JVM A;  2HFE C;  3VOU A;  2EIN C;  4PA3 A;  4JTA B;  3PJS K;  3X2Q C;  3STL C;  3ZRS A;  3K06 A;  3GB7 C;  3SPJ A;  3KG2 A;  4G27 B;  4WFE A;  4WFG A;  2X6C A;  4R7C A;  2WLI B;  1K4C C;  1OCR C;  3LDD A;  2A0L A;  4XDL A;  3EFF K;  4MVM A;  2R9R B;  2KB1 A;  2WLL B;  3SYP A;  2ITC C;  5EBL C;  3ABK C;  5CBF A;  5EBM C;  3FB7 C;  3LUT B;  5EBW C;  5EC1 C;  4F4L A;  4CBC A;  4GX2 A;  3UM7 A;  4XDK A;  3T1C A;  4QNH B;  4PDR A;  4MSW C;  3RVY A;  3ASN C;  2YEV A;  4X89 A;  5EK0 A;  4PDV A;  3E8F A;  2Q67 A;  3WG7 C;  4XDJ A;  3R65 A;  1G4Y B;  4MVS A;  3TET A;  3E8H A;  4RAI A;  2DWD C;  2BOC C;  3ZJZ A;  4P2Z A;  2X6B A;  4P9P A;  1QLE C;  1R3K C;  4PA9 A;  2A79 B; 
#chains in the Genus database with same CATH topology
 3K5M A;  5DED A;  2G38 A;  3F7Y C;  2JEX A;  4D7S A;  1PNM A;  4DV5 O;  2DOS A;  5IJ0 A;  2Q7G A;  2PUS A;  2QKS A;  1GKF A;  3W7T A;  1GO3 F;  3JAR A;  3CWB H;  2CAZ C;  3WB2 A;  2JRI A;  3NXS A;  3JD3 A;  2DJV A;  4X64 O;  4JYC A;  5H9C A;  3BCC H;  3MHS C;  3OTO B;  1VQN V;  3C90 A;  4LF5 O;  4UUJ C;  2Q0A A;  2LQT A;  1S76 D;  4JTC B;  4DR3 B;  1N36 B;  1R1B A;  4JI3 B;  1VQ8 V;  2UUC O;  4JI7 O;  2V7Q G;  3K59 A;  4I5S A;  3D36 A;  4MVO A;  1M90 W;  5BR8 O;  3CCJ V;  3ASO B;  4NXN B;  4CH4 A;  2DYS B;  2VQE B;  4X62 O;  3E2E A;  2PTM A;  3G71 V;  3JCU Z;  1QR8 A;  4DR7 B;  4JAS A;  5EIB D;  1Y76 B;  3QF7 A;  1JMK C;  4DV1 O;  1QBZ A;  1XNQ B;  2N04 A;  1F7Y A;  4ASU G;  5JCO A;  5EBW C;  4B08 A;  2H94 A;  4N23 A;  2PGG A;  3ASN C;  1S72 V;  3D3I A;  1S77 D;  1V9P A;  3WG7 C;  4IHJ A;  5KLV H;  3RYF B;  3G6B A;  3W7U A;  3QVN A;  4FLT A;  5LOV A;  3OM3 B;  1H38 A;  5IJ9 B;  2YUA A;  4JI4 O;  4NTW A;  2CDY A;  2JS5 A;  4WFF A;  3OR6 C;  4R50 A;  1BHA A;  1XOU A;  4CS4 A;  2KSD A;  4JI0 O;  3K0D A;  3F5W C;  4IIJ A;  2Q8V A;  4NR1 A;  2EIM C;  2VRZ A;  2Y69 B;  4JYB A;  1Y6X A;  2H3O A;  2Q69 A;  2ZXW B;  4MTO A;  4GX0 A;  1J95 A;  1ZWI C;  1I94 O;  1SZT A;  4CC6 A;  2EIK C;  4DV3 B;  3SPH A;  1YSC A;  5L3G A;  4I55 B;  3F5T A;  2XOK G;  5LMU O;  1FKA O;  1VQL V;  2CH7 A;  4DYL A;  4RUE A;  1TAE A;  2EX3 A;  2IH1 C;  1WPB A;  5D5P A;  1V54 B;  2OIE A;  2DMX A;  3H01 A;  2E5L O;  1G8M A;  3HKD A;  1BQZ A;  1RSO B;  1VF6 C;  5IWA O;  2YID A;  1JFF B;  1SKV A;  3H1J H;  3ML0 A;  2E76 B;  2KG7 A;  2WLL B;  3ABU A;  4KHP B;  1AI4 A;  3ABK B;  1V55 B;  4LF7 O;  1Q82 W;  4I7Z B;  4X89 A;  1KB9 F;  3CRR A;  4DR6 O;  1RM1 B;  2CTW A;  5FPO A;  1FJG O;  1AR4 A;  4EB6 B;  2FML A;  3E8H A;  4O2B A;  1M4U A;  2YDE A;  4O4H A;  4FJC C;  4H0L B;  1XHZ A;  2RN9 A;  4GKJ B;  3Q4H B;  3FAV B;  1JR9 A;  5KHH A;  2GSM B;  1OCZ B;  1VQK V;  3JAM N;  3E22 B;  5L3C A;  4YJ2 B;  3QNE A;  3OUS A;  4LF4 B;  2ZE8 A;  4PA7 A;  1M57 C;  4UB6 Z;  5CA0 A;  1KKD A;  2ILM A;  4K0K O;  4JV5 B;  1Q6I A;  3D36 C;  2B9Z A;  4UFZ A;  1RPO A;  4DV4 O;  1K7D A;  5JWP A;  5J2T B;  4BR6 A;  3AG1 B;  1OCO C;  4HZ3 A;  2GUZ B;  4OXS A;  1VF5 B;  2GTS A;  4O4I A;  1R6T A;  3T4D A;  3BY6 A;  5CA3 A;  1H8E G;  1IXB A;  1NT2 B;  1XQ8 A;  3FB5 C;  2QWP B;  2CE4 A;  3E35 A;  1XL6 A;  5JVD B;  4X20 B;  3JYC A;  5GON A;  4ICG A;  3W7S A;  4FVM A;  1XEQ A;  1K92 A;  5IJ0 B;  1N33 B;  3JCZ A;  3LSU A;  1GAX A;  1L8D A;  1SES A;  4ZKI A;  4MS2 A;  5KX5 A;  4XBF A;  2YI9 A;  4TWK A;  3ZHQ A;  1K8A W;  1KQS U;  2CK3 G;  3DXR B;  5B3S C;  3IFX A;  4YHH B;  2F4V O;  3ZBH A;  1AR5 A;  3K04 A;  3S3X A;  4X1Y B;  4LF9 B;  2ZE7 A;  1MAB G;  2HFE C;  3CYO A;  4TQD A;  3CC2 V;  1S5J A;  2EIN C;  4LF6 O;  2Y48 A;  4K8X A;  1GM7 A;  3FX7 A;  4X1I A;  4BIU A;  3CCV V;  2PY5 A;  4K35 A;  4FLW A;  2Q5Z A;  4LF6 B;  4FK5 C;  5GTH Z;  1IVS A;  3CPW U;  1DK1 A;  4B3R B;  1E79 G;  2UXX A;  3ZCC A;  1UJW B;  2JJ1 G;  1SQV H;  2X7R B;  2ITC C;  3JAK B;  3SJA C;  5JH7 A;  5IYZ A;  4GT1 A;  4BIO A;  1J5E B;  4TUY A;  2BTQ A;  2KQX A;  3E8F A;  4HBN A;  4DV0 O;  4XDJ A;  4UCU A;  5KHG A;  2P22 C;  4LF8 O;  4CH6 A;  4PDL A;  2IH3 C;  3CCL V;  1IZ3 A;  4AIL C;  2QGN A;  4TV9 B;  3TXS A;  2OIG A;  3TCU A;  1UPG A;  1AIL A;  4JAV A;  2WPD G;  1S3J A;  4AHC A;  2PYJ A;  4DUY O;  3OMN B;  4GX1 A;  1SQP H;  2RDC A;  2ITD C;  1H2S B;  4KP4 A;  1P7B A;  3ZHV A;  2O57 A;  4W4K A;  2EIJ C;  5D5Q A;  3WU2 Z;  3B2E E;  1ZAU A;  3LSQ A;  3SJC C;  4JI8 O;  3L70 H;  1QCE A;  3LDE A;  1Y4M A;  2ZR2 A;  4P30 A;  2R9I A;  4JYA O;  4X1K B;  4IYH A;  3G6E V;  1PPJ H;  2FYU H;  3IGA C;  1HR0 B;  5LP6 C;  2JS3 A;  2YI8 A;  5LMN O;  1PD3 A;  4GX5 A;  2BSK A;  2IJI A;  4FPP A;  3OT7 A;  1BSM A;  3OAA G;  1M93 A;  5H2F Z;  1Y67 A;  2Y0I A;  2YS8 A;  4O4J A;  2R72 A;  4TV8 A;  2C2A A;  1SQQ H;  5E1A C;  2Q4P A;  4NKG B;  1XHX A;  4GYC B;  3CME V;  1WAZ A;  5IT9 N;  3SYQ A;  5IY5 B;  3T1H O;  5ITZ A;  3VBB A;  1M1K W;  4JTA B;  3CP1 A;  2L35 A;  4BIZ A;  5BXZ A;  2QDO A;  3R66 A;  3JAS A;  3ZHS A;  2RQ6 A;  3ZRV A;  3HKE A;  4GX2 A;  1TA8 A;  1ZSP A;  3ETD A;  2ZNI A;  1GN6 A;  5TIS Z;  2JGU A;  5LXT A;  4DV7 B;  3UT5 A;  3RYH B;  2XAQ A;  1I08 A;  3QTC A;  2GV9 A;  1M5I A;  3OR7 C;  5J9P C;  1DF4 A;  4U3J B;  5K1P A;  3ZHR A;  1CPY A;  3M8A A;  3SR2 C;  4B3M B;  4PI0 A;  1EZV H;  2KG7 B;  3P30 A;  4ZHQ A;  1XMO B;  2PI5 A;  2XAF A;  5KHI A;  1AVM A;  4YIO A;  5CB4 A;  5LYJ B;  1QNM A;  1MMM A;  3EXA A;  4O2B B;  1FFT B;  1SQF A;  2XND G;  3C3S A;  3K08 A;  2VQF B;  5C8Y B;  3ETE A;  3CE2 A;  1URF A;  1ZL8 B;  2ZKO A;  4H37 A;  1M56 C;  4DV2 O;  2WLN A;  5EYP A;  5CA1 B;  1R3I C;  4H33 A;  3UQ8 A;  4WFA V;  1IBK B;  3BHP A;  3ETQ A;  4FFB A;  3P32 A;  5B1A C;  1WA8 A;  2OCC B;  3NR7 A;  4JGS A;  3CCQ V;  2F93 B;  3JSL A;  4HYO A;  5H5N A;  3QO5 A;  3VOU A;  4DV6 B;  2UXB B;  3PJS K;  1PV0 A;  3GWK C;  2HR3 A;  3G80 A;  3LDD A;  3SYP A;  2KB1 A;  2HHH O;  2UU9 B;  3QO7 A;  1IX9 A;  3A2F A;  1EN4 A;  4O2A A;  1XDC A;  3R65 A;  1X4T A;  1VQ7 V;  2JEU A;  5FNV A;  5KX5 B;  1NBM G;  3OW2 U;  3A8T A;  4LFB O;  3B8M A;  2VWJ A;  2DQ0 A;  3H1K H;  3TXQ A;  1ZX3 A;  1FYJ A;  3EVK A;  3MD0 A;  3CRQ A;  1OCR B;  3SJB C;  4JPR A;  1VQP V;  4X9Q A;  4ZIB A;  4NB5 A;  3KKY A;  2F23 A;  4JI6 O;  3UKM A;  5L3B A;  4LFA B;  2UUB O;  3CCE V;  3LSS A;  4P9O A;  2WWW A;  3CRC A;  4Z1M G;  5B66 Z;  4CS2 A;  5IYZ B;  2QM8 A;  1HNZ B;  1OJH A;  3JAL A;  3ASO C;  4C7U A;  3L9D A;  2DYS C;  4DRX A;  2ZCE A;  1N32 O;  2LO1 A;  2Y4T A;  1VF6 A;  1DTO A;  3ABL B;  2GBO A;  4DV5 B;  4UCS A;  4PD4 F;  1H8H G;  2OT5 A;  4L87 A;  4BW5 A;  2WLH A;  2GTA A;  1BE3 H;  1KUQ A;  1TUB B;  1XL4 A;  1K33 A;  1H2N A;  4N21 A;  4X64 B;  3K57 A;  3L71 H;  2HJD A;  3E8G A;  4H13 B;  5DM6 V;  1U97 A;  3BAB A;  3AG2 B;  4LF5 B;  1YIT V;  2JIZ G;  3EHB B;  3AG4 B;  5K1X A;  2ZIO A;  1EN6 A;  2UUC B;  2UXC O;  4JI7 B;  1BS3 A;  3CRM A;  5BR8 B;  2R9R B;  2BSK B;  3ZRW B;  1VAR A;  3B77 A;  5EC1 C;  4F4L A;  4QNH B;  4LFC O;  4X62 B;  2ARH A;  5EZY A;  4MT8 A;  4RQF A;  2LFR A;  1YZB A;  4O4J B;  2AGA A;  3J7A U;  5LHI A;  2ZNJ A;  1YIJ V;  4DV1 B;  1FXK B;  2ZXW C;  4E2L A;  3LDC A;  5ITZ B;  3OD4 A;  1OCC C;  1TGO A;  3DSQ A;  3ZS8 C;  3K3W A;  1HNX O;  1IBL O;  2WLI A;  2P06 A;  5B1O A;  1GMG A;  1Q6U A;  1FD9 A;  2OTL V;  1NU1 H;  1VQ6 V;  5BZB A;  5B1B C;  1SA0 A;  1OZ0 A;  2UUA O;  1AJN A;  3K0G A;  2JK5 C;  3M99 B;  1E1Q G;  4F6R A;  4JI4 B;  5JQG B;  2UXD O;  1F4N A;  3DC6 A;  4TSF G;  3HB3 B;  1AR1 B;  2FB5 A;  3FB6 C;  1SZX A;  3BAA A;  4JI0 B;  1JOY A;  4B3T O;  1Y74 A;  3OGC C;  2XAS A;  3ZED A;  1HW7 A;  2X0L A;  3CSX A;  1HNW O;  4LWS A;  4OX9 O;  4J9Y B;  5CN0 A;  3FYI B;  1TVK A;  1NZ6 A;  4O4L A;  3OE7 G;  3RYI A;  1V55 C;  4MW3 A;  1B6Q A;  5DEC A;  3N27 A;  4DR2 O;  1F51 A;  5FLX N;  2QKA A;  4ZHQ B;  3JAT A;  1S0V A;  2ATK C;  1YHQ V;  5KUM A;  4DR5 O;  1I94 B;  3RWR D;  3STL C;  1KKC A;  2YXH A;  1VIB A;  3UO3 A;  2OTJ V;  4R7C A;  5LMU B;  4ZOL B;  1WN7 A;  2A06 H;  4CBC A;  2R70 A;  1NR1 A;  1THZ A;  5EK0 A;  2JVD A;  2P4K A;  1CXZ B;  2YEV A;  3ASN B;  4G2K A;  4DW0 A;  3VQX A;  3TET A;  4P2Z A;  2E5L B;  1L0L H;  1OHH G;  4QPJ A;  4J7Z A;  5LP6 A;  4X66 O;  4UV9 A;  5BMV B;  5IWA B;  1WA8 B;  2K1E A;  2W0F C;  2NN4 A;  3CJH A;  3SYO A;  2A3Q A;  4DUZ O;  1G6U A;  4LF7 B;  5KA5 A;  1S5H C;  4RWU A;  5FL7 G;  1VQO V;  3IC7 A;  4DR6 B;  1FJG B;  1W0K G;  1XMQ O;  1OV9 A;  2IJH A;  1PKX A;  1NVP B;  4BAY A;  2DWE C;  1AJP A;  1QR9 A;  3OMI B;  5H6Q A;  1LR1 A;  3L75 H;  4L8J A;  3BA8 A;  2PYL A;  3JAW A;  2WSS G;  4JYY A;  5CBG A;  1BMF G;  3H1L H;  2Q6A A;  4QGP A;  2EIK B;  1KBH A;  2A7W A;  4K0K B;  1MNG A;  1EBO A;  3FB8 C;  4DV4 B;  1I0H A;  4YIP A;  3N2K A;  4JI2 O;  2V1D A;  2E74 B;  2EIL C;  4PV1 B;  1JX9 A;  1ENV A;  1NH2 B;  1I5Y A;  3HKC B;  1D5A A;  1NI8 A;  1H2M A;  1R6K A;  2IBZ H;  2QTO A;  3B09 A;  3CEI A;  3JD2 A;  4CS3 A;  1QHT A;  4IYI A;  2Q73 A;  2JGD A;  3OGI B;  5DN6 G;  4DR1 O;  4F6E A;  2PF4 E;  2A0L A;  2Z0A A;  1X59 A;  2HEP A;  3JAR B;  1E1R G;  3K9S A;  3CHX A;  2YIA A;  1K9M W;  4FM0 A;  3T1C A;  4HNA A;  3RN4 A;  4NXM O;  2AXT Z;  4JI1 O;  3ZIA G;  3W7X A;  1NR7 A;  2F4V B;  2YC0 A;  4D7T A;  1BCC H;  3OEE G;  4ZI7 A;  1Q86 W;  2Y0P A;  4UXN A;  3BVO A;  2FTK A;  1B06 A;  3E83 A;  4LCU C;  3I56 V;  1EM1 A;  4ABM A;  4Q6G A;  3OEH G;  3CS5 A;  1M57 B;  1ZLZ A;  4J42 A;  5L3D A;  2B1I A;  4Z2W A;  1FXH A;  4IL6 Z;  1PM9 A;  4DV0 B;  3VQW A;  1OCO B;  4NTY A;  4LF8 B;  1XNR O;  3A0H Z;  1K3E A;  4NTX A;  1SC5 B;  1VQ9 V;  4B3S O;  3BPZ A;  4UCR A;  4QE9 A;  1VQ5 V;  2HLD G;  4DUY B;  2XAJ A;  1K4D C;  2BCC H;  5KUK A;  4JI8 B;  2WA4 A;  2XAH A;  3O9O A;  4IHJ B;  1H2K A;  3APQ A;  4DR4 O;  1R3L C;  4PA4 A;  4EKW A;  1EZJ A;  4DR4 B;  1I5X A;  1EN5 A;  5B3S B;  4UCT A;  5A2Q N;  5LOV B;  4JYA B;  3SPG A;  4WFB V;  5IE9 A;  1Q43 A;  1FXV A;  1XBL A;  4J11 A;  5LMN B;  4DK0 A;  2EIN B;  4DO2 A;  2JDI G;  3J80 N;  1NKD A;  4WFE A;  4I9Q A;  4YY3 O;  3UCS C;  5LGU A;  5CBF A;  4IIJ B;  3FB7 C;  1Y74 B;  3VQV A;  5JJN B;  4FLV A;  2VS0 A;  4MSW C;  2ZE6 A;  2QA4 V;  1Z5V A;  2Q67 A;  5FPR A;  1KEC A;  4LWS B;  3I5D A;  3S3W A;  1G4Y B;  2LFS A;  4UB8 Z;  2QEX V;  3T1H B;  3OTF A;  4O4L B;  5C93 A;  3OFN G;  3ZX6 A;  1HP8 A;  3JAT B;  1Y76 A;  3T4Z A;  1GK9 A;  2YXY A;  3BEH A;  4KL1 A;  1DF5 A;  3CC7 V;  1NQT A;  5CMU A;  3RYC A;  3CC4 V;  2XAG A;  5GW7 A;  5HFL A;  1SQB H;  4JZ2 A;  2CH7 B;  1AI5 A;  2HVJ C;  4KFM A;  1YTF D;  3RBZ A;  2A9H A;  4DW1 A;  3HKB A;  3RYF A;  2YEV B;  4AI8 A;  4GCZ A;  4LNU A;  2W6J G;  4OGQ B;  3HKD B;  2P4V A;  2F95 B;  3AG7 A;  1COW G;  1N34 O;  5LP6 B;  4EFE A;  3MHH C;  5LBQ A;  1CP9 A;  2P7T C;  4JTD B;  2ADP A;  4JI5 O;  1Q81 W;  2DYR C;  4MTX A;  1L1F A;  1GN4 A;  3T1Y O;  2DN9 A;  1N0J A;  1FPO A;  4MTG A;  4A5U B;  1MG1 A;  1SQG A;  3JD4 A;  2ZM6 O;  1SQX H;  2F1M A;  2EJR A;  4O4H B;  4GKK O;  2HP8 A;  3L74 H;  3IAY A;  4FMT A;  4DXW A;  4CC5 A;  4UVB A;  3TJT A;  2IM9 A;  3CB2 A;  1MOF A;  1NTZ H;  1VEW A;  1K73 W;  4U7O A;  3SPJ A;  1GM8 A;  1KC8 W;  1OCR C;  1KP3 A;  5CA0 B;  2BTO A;  4AQY O;  2DE0 X;  4DV2 B;  5LA6 A;  4X65 O;  4I55 A;  1JQ0 A;  1GM9 A;  1Q6H A;  4UCO A;  3LNN A;  2WAM A;  3RT3 C;  3N2K B;  4O4I B;  3DTU B;  2CGO A;  2MK3 A;  4PA9 A;  1JA8 A;  2EUL A;  4J10 A;  4U7N A;  3QO8 A;  2HHH B;  5GON B;  4WFH A;  2JGD B;  2WLL A;  2AHZ A;  3ETG A;  3JSN A;  3N2G A;  1SRY A;  2IU0 A;  1N8R W;  3K79 A;  2OWO A;  4LFB B;  1VQM V;  2QM4 A;  2UXN A;  4J7K A;  1A32 A;  4HNA B;  2ZQM A;  3OMA B;  1IBM O;  2HJF C;  3ICX A;  2AZ0 A;  3AG2 C;  4UVA A;  3Q4H A;  3FAV A;  4GUN A;  1R6N A;  4X1I B;  3E22 A;  1US6 A;  4YJ2 A;  3AG3 B;  1K34 A;  4JI6 B;  3U11 A;  1O9H A;  5KHK A;  3THO A;  1G1X B;  1YJN V;  1U96 A;  2UUB B;  2LP7 A;  4K3A A;  2LGW A;  3P3P A;  5JH7 B;  2L6L A;  3STZ C;  5J2T A;  1JCH A;  2BTQ B;  4TUY B;  4QJF B;  3BA9 A;  2LW7 A;  3APO A;  2GUZ A;  4RO2 A;  1N32 B;  3AK3 A;  2QE7 G;  3SPI A;  5L3F A;  5B1A B;  1D2D A;  4R8C A;  1JVM A;  4UCV A;  4PA3 A;  1K97 A;  5KAI Z;  1PNK A;  3ZRS A;  2VWK A;  2BE3 A;  1AB3 A;  3KG2 A;  1FXK C;  1K4C C;  3ABM B;  4X20 A;  5JVD A;  3ABT A;  3RFR A;  4TQF A;  4XDK A;  4PI2 A;  1GTO A;  2V4D A;  4IT5 A;  5KMG A;  4FFK A;  4FLX A;  4RAI A;  3DXR A;  2X6B A;  4P9P A;  5LHH A;  3OTO O;  1XUQ A;  3X2Q B;  3K5N A;  5LGN A;  2CTQ A;  4X1Y A;  2A79 B;  3CD6 V;  2QTS A;  2UXC B;  1MSW D;  1WB7 A;  4FZ1 A;  3D3Q A;  3OUF A;  4DR3 O;  1N36 O;  4JI3 O;  1P7G A;  1PL4 A;  4LFC B;  3LNM B;  3AEI A;  3JAK A;  3IJ4 A;  4TV8 B;  4ZBM A;  3ZMZ A;  1QLE B;  5JJJ B;  2Y69 C;  5GTI Z;  4NXN O;  2Z5U A;  1R73 A;  1Q3E A;  2VQE O;  2YXL A;  2HG5 C;  2ZIN A;  2ZDI A;  2H8P C;  2LW1 A;  1BHB A;  3RVZ A;  1IBL B;  1HNX B;  1YI2 V;  1KYO F;  1XRE A;  4TV9 A;  4DR7 O;  3JAS B;  2QJ1 A;  4W4L A;  1P4R A;  4MVQ A;  4FM2 A;  1XNQ O;  2WLK A;  3PN1 A;  1LUV A;  2AZ2 A;  2AW9 A;  3CMA V;  2YIB D;  1BGY H;  3HKE B;  2UUA B;  3RYC B;  2ZE5 A;  3W7W A;  3ZN1 A;  1W2B U;  5A9G A;  3ZRX A;  4UV8 A;  3A0R A;  1Q90 D;  4OPH A;  5LXT B;  2E3C A;  2UXD B;  3UT5 B;  5EIB C;  1V54 C;  3HKB B;  1VF7 A;  1WJZ A;  4X1K A;  5IDJ A;  3BFR A;  3ZN0 A;  4B3T B;  4LNU B;  4WFG A;  1SER A;  1HNW B;  2D2C B;  2IJK A;  4OX9 B;  3EFF K;  1NVP D;  5EBL C;  4PJ0 Z;  3MAQ A;  1P49 A;  3ABK C;  1CEZ A;  5EBM C;  4B7E A;  3UM7 A;  4WF9 V;  4PDR A;  4DR2 B;  1SF9 A;  1WB8 A;  4EEQ A;  1RM1 C;  3C3T A;  4MVS A;  4DR5 B;  1UFI A;  2DWD C;  4E4E A;  3L73 H;  1ZUQ A;  5CB4 B;  4JZG A;  3D8C A;  2FL4 A;  1BL8 A;  1OCZ C;  3CXC U;  2B5U A;  1DGS A;  3F7V C;  3HPL C;  4I0X A;  3H9V A;  3SGI A;  1OCC B;  4WBN A;  1VP7 A;  1AI6 A;  4PA6 A;  1NH2 D;  2DW4 A;  2R9A A;  4DV3 O;  5LGT A;  1B3Q A;  4I4T A;  3SJQ C;  1JJ2 U;  3WG7 B;  1W59 A;  5EYP B;  4FLZ A;  3K5O A;  3KCY A;  5LA6 B;  5B1B B;  3AG1 C;  1K5S A;  1YVW A;  3DC5 A;  4FFB B;  1JPX A;  2RNB A;  1GN3 A;  4FIP C;  4X66 B;  4BW9 A;  4MW8 A;  3RYH A;  4R6Z A;  1PL0 A;  1RFY A;  3VQY A;  2HVK C;  1ARO P;  4DUZ B;  2B1G A;  4U3J A;  4WCE V;  4IGG A;  2P5O A;  2EIM B;  4U3F H;  3G4S V;  3B8N A;  1XMQ B;  4KHP O;  3SDL A;  3WFV A;  2QWO B;  5IYD O;  2ZD9 A;  4O2A B;  2W6I G;  3N2G B;  5J2U A;  5FNV B;  2XUM A;  3WB1 A;  2WLM A;  5L3E A;  2QR4 A;  4J7J A;  4QE7 A;  4NVP A;  5LYJ A;  3CCU V;  1Z2G A;  3ZHU A;  4GKJ O;  4CH5 A;  1S5L Z;  3UO2 A;  5C8Y A;  2PI4 A;  1NS1 A;  1VMG A;  4XDL A;  1ZL8 A;  4FM1 A;  4LF4 O;  3M7M X;  1Q5O A;  4JI2 B;  4YXW G;  3LUT B;  1FFX A;  4JV5 O;  5CA1 A;  1W0J G;  1ROP A;  3B4S A;  3KCX A;  3JAL B;  1SS3 A;  1M9N A;  1L0N H;  2Q9L A;  2ZDI C;  2MW2 B;  4DRX B;  4Q20 A;  1R3K C;  2OYQ A;  3RGB A;  2RCV A;  2M6Y A;  2HKO A;  1Q8I A;  2N05 A;  3GVM A;  4DR1 B;  4J9Z B;  3JD1 A;  4MVR A;  3MDS A;  4LR3 A;  4JAA A;  2EZP A;  4KXR A;  4YJ3 A;  2ZR3 A;  2LGQ A;  4H44 B;  4PDM A;  1WP7 A;  3TK1 A;  4X8A A;  3ZMU A;  3GWO A;  4NXM B;  5JCO C;  4JI1 B;  2ZT9 B;  1N33 O;  3T2M A;  2XT9 A;  3U0Z A;  1P84 F;  4LP8 A;  1YJ9 V;  3AK2 A;  3RW0 A;  4DK1 A;  5KMG B;  1I7F A;  3FYE B;  1DLB A;  4YHH O;  2CTR A;  1YJW V;  3QG5 A;  4LF9 O;  3E86 A;  1GN2 A;  1KU9 A;  1WPX A;  1IXM A;  1NTM H;  1T5E A;  2BOB C;  4LC1 A;  4B3R O;  1HDJ A;  3WB0 A;  1AJQ A;  3CCM V;  2QSA A;  1K5Q A;  3KZI Z;  2WLJ A;  2EIL B;  5EZY B;  1BQ0 A;  4I50 A;  1XNR B;  1J5E O;  1LUW A;  1R3J C;  3HR0 A;  5F2V O;  4LH7 A;  1AI7 A;  4MVZ A;  1MSD A;  1QVG U;  5IY5 C;  4MTF A;  4B3S B;  3E8B A;  2E75 B;  3O65 A;  2DQ3 A;  3K58 A;  1BZK A;  1AP6 A;  1RP3 B;  4G27 B;  3B40 A;  4JAU A;  5H6R A;  2WLI B;  3A0B Z;  1BT8 A;  1TUE B;  1EFR G;  3BRC A;  1TUB A;  2IJJ A;  1MZE A;  3FKS G;  2Y4U A;  1B04 A;  1MZF A;  1SA0 B;  1Y66 A;  2ODM A;  1KMI Z;  1F23 A;  3ZMT A;  1RPR A;  2QM7 A;  4F6R B;  2P6J A;  3AK1 A;  4KUM A;  5E79 Z;  3SPC A;  1FS0 G;  4J80 A;  2YIC A;  2WA3 A;  1JJO A;  4YY3 B;  1HR0 O;  4RUF A;  2W0X A;  3ZRW A;  5B1N A;  1TVK B;  3K03 A;  3RYI B;  2Q0O C;  1Z5W A;  4I9W A;  1GH6 A;  1SET A;  2GHY A;  2IU3 A;  4MVU A;  2K9P A;  2GDS A;  1N0N A;  3U10 A;  4CH3 A;  1GRJ A;  3IC9 A;  1FXK A;  1PP9 H;  2ETN A;  4X88 A;  1QQC A;  4UVC A;  3TGU H;  3L72 H;  4WBN B;  4I0X B;  3K5L A;  2LJ2 A;  3E89 A;  1QLN A;  2JJ2 G;  4HAM A;  1MA1 A;  1HWY A;  2NR5 A;  4FZ0 A;  5JJE B;  4GLX A;  2P90 A;  2X6A A;  2EIJ B;  2Z3Y A;  4I4T B;  4Z1V A;  3ZHT A;  1XI1 A;  1YCI A;  5EC2 C;  5KAF Z;  5IYB O;  5BY1 A;  5IJ9 A;  2OCC C;  4J41 A;  2QKC A;  3CXH F;  2N74 A;  3H1I H;  3JD0 A;  5JQG A;  4DV7 O;  1F4M A;  3FD9 A;  1N34 B;  3CCR V;  2ZIM A;  3K06 A;  4OPA A;  4JI5 B;  1IDS A;  2PZS A;  3CJH B;  1NJI W;  4RQE A;  3T1Y B;  1D5N A;  2YSU B;  4MVM A;  4GZR B;  4B3M O;  3J81 N;  2ZM6 B;  2EZO A;  1YDX A;  4PDV A;  2XHB A;  1XMO O;  1FAF A;  4GKK B;  1KD1 W;  2BOC C;  3ZJZ A;  4NYK A;  5AG2 A;  5J2U B;  3CCS V;  3JAW B;  1YF2 A;  3SYC A;  2Q68 A;  1WP8 A;  2EJ7 A;  3K9A A;  4AQY B;  4X65 B;  2VQF O;  2NNU A;  4ZOL A;  5LHG A;  1VQ4 V;  2NLJ C;  2QWR B;  3AG3 C;  3P3N A;  2P67 A;  3SYA A;  2QWN B;  4FLU A;  4QPK A;  4D6T H;  3G67 A;  1H2L A;  1FFX B;  1AP5 A;  4PHZ A;  2IW5 A;  4G28 B;  2YIB A;  1IBK O;  1O9G A;  2XTA A;  2AHY A;  2RMK B;  1QU7 A;  4EFB A;  1LNQ A;  1RSO A;  2Q7E A;  5HFM A;  5LL6 Y;  5KHJ A;  3H1H H;  3ABL C;  5BMV A;  2RJZ A;  1NTK H;  1JFF A;  1IUR A;  4DV6 O;  1WLE A;  2UXB O;  2CUG A;  1YTF B;  4FLY A;  2F66 C;  2DYR B;  4LBE C;  3ABM C;  2F43 G;  4YJ3 B;  2UU9 O;  3FFQ A;  4EB6 A;  3ZMS A;  1ZTE A;  1ORQ C;  3I55 V;  1QVF U;  2Q7H A;  4K8Z A;  1N4C A;  2OCH A;  1IBM B;  2FKX A;  4BWA A;  2D3O W;  5CBH A;  4QIW F;  3AG4 C;  4ZI7 B;  1YEW A;  1KP2 A;  2EBO A;  1Q7Y W;  3X2Q C;  2CGN A;  5KA6 A;  3GB7 C;  4PEL A;  1M56 B;  2X6C A;  3DGE A;  4CZZ A;  1PNL A;  2QWQ B;  2CTP A;  3ZMV A;  2ADQ B;  1YXB A;  2KKW A;  3CX5 F;  4B7K A;  3RVY A;  4LFA O;  5IYC O;  1XIL A;  3HKC A;  4TT3 G;  1WNS A;  2M7W A;  4TOI A;  4LH6 A;  1HNZ O;  4I50 B;  1QLE C;  1H2G A;  3CRA A;  5B5E Z;  4JF3 A; 
#chains in the Genus database with same CATH homology
 1BL8 A;  1OCZ C;  3CXC U;  2B5U A;  3E83 A;  4LCU C;  3I56 V;  3F7V C;  3F7Y C;  2JEX A;  3HPL C;  3OR7 C;  1OCC B;  5J9P C;  1PNM A;  1DF4 A;  1AI6 A;  3OEH G;  4PA6 A;  1NH2 D;  2DW4 A;  1CPY A;  1M57 B;  2QKS A;  5LGT A;  1GKF A;  3W7T A;  1GO3 F;  3SJQ C;  1JJ2 U;  5L3D A;  2B1I A;  3WG7 B;  1FXH A;  3NXS A;  3P30 A;  3JD3 A;  5B1B B;  2PI5 A;  2XAF A;  3AG1 C;  4JYC A;  1K5S A;  1OCO B;  5H9C A;  3MHS C;  1VQN V;  1JPX A;  1K3E A;  4FIP C;  4MW8 A;  4UUJ C;  4R6Z A;  1S76 D;  1FFT B;  4JTC B;  2XND G;  1VQ9 V;  1PL0 A;  3K08 A;  2HVK C;  1ARO P;  2B1G A;  4QE9 A;  3ETE A;  1VQ8 V;  4WCE V;  1VQ5 V;  2HLD G;  2V7Q G;  2XAJ A;  2EIM B;  3G4S V;  3B8N A;  4H37 A;  4I5S A;  1K4D C;  1M56 C;  3D36 A;  4MVO A;  1M90 W;  2WLN A;  3CCJ V;  1R3I C;  3WFV A;  3ASO B;  5IYD O;  2ZD9 A;  5KUK A;  4H33 A;  2XAH A;  2DYS B;  2W6I G;  1R3L C;  4WFA V;  4PA4 A;  4EKW A;  1EZJ A;  1I5X A;  3E2E A;  5B3S B;  3P32 A;  2WLM A;  5L3E A;  5B1A C;  2OCC B;  3SPG A;  3G71 V;  4WFB V;  4JGS A;  3CCQ V;  4HYO A;  4QE7 A;  3CCU V;  1QR8 A;  3QO5 A;  3VOU A;  1FXV A;  2EIN B;  4DO2 A;  3PJS K;  4JAS A;  2JDI G;  1NKD A;  1QBZ A;  2HR3 A;  2PI4 A;  4WFE A;  3LDD A;  4XDL A;  4ASU G;  5LGU A;  3SYP A;  2KB1 A;  5CBF A;  4YXW G;  3FB7 C;  3LUT B;  3QO7 A;  5EBW C;  2H94 A;  4N23 A;  4MSW C;  3ASN C;  1W0J G;  1S72 V;  2QA4 V;  3D3I A;  1S77 D;  2Q67 A;  3WG7 C;  1KEC A;  1ROP A;  3R65 A;  1G4Y B;  2LFS A;  2QEX V;  1M9N A;  2JEU A;  1VQ7 V;  1NBM G;  3OW2 U;  3W7U A;  2ZDI C;  3B8M A;  5C93 A;  4Q20 A;  3OFN G;  2DQ0 A;  1R3K C;  3OM3 B;  1H38 A;  2HKO A;  3MD0 A;  1OCR B;  4J9Z B;  4WFF A;  3JD1 A;  3T4Z A;  3OR6 C;  1GK9 A;  4MVR A;  3BEH A;  4R50 A;  1BHA A;  4JPR A;  1DF5 A;  1VQP V;  3CC7 V;  2EZP A;  1NQT A;  5CMU A;  2ZR3 A;  3CC4 V;  2XAG A;  3K0D A;  3UKM A;  4PDM A;  5L3B A;  5GW7 A;  5HFL A;  3F5W C;  3TK1 A;  4X8A A;  3ZMU A;  3GWO A;  3CCE V;  3LSS A;  4P9O A;  2EIM C;  1AI5 A;  3T2M A;  2WWW A;  2HVJ C;  4KFM A;  4Z1M G;  1YTF D;  2QM8 A;  2A9H A;  3RBZ A;  4LP8 A;  2Y69 B;  4JYB A;  1YJ9 V;  3RW0 A;  3ASO C;  5LBQ A;  2YEV B;  3FYE B;  2Q69 A;  1DLB A;  2DYS C;  2ZXW B;  4MTO A;  4GX0 A;  4GCZ A;  1DTO A;  2W6J G;  1J95 A;  1ZWI C;  3ABL B;  1YJW V;  3E86 A;  1SZT A;  1COW G;  2EIK C;  1WPX A;  3MHH C;  1CP9 A;  2P7T C;  1H8H G;  3SPH A;  2OT5 A;  4JTD B;  4L87 A;  1YSC A;  4BW5 A;  2WLH A;  5L3G A;  1IXM A;  1Q81 W;  2DYR C;  2BOB C;  4MTX A;  4LC1 A;  1L1F A;  1XL4 A;  2XOK G;  1K33 A;  1AJQ A;  1VQL V;  3CCM V;  4N21 A;  1K5Q A;  4MTG A;  4RUE A;  2WLJ A;  1MG1 A;  3E8G A;  2EIL B;  5DM6 V;  3JD4 A;  1R3J C;  3AG2 B;  2EJR A;  1YIT V;  2JIZ G;  2IH1 C;  1AI7 A;  4MVZ A;  3EHB B;  1QVG U;  4FMT A;  5IY5 C;  1V54 B;  3AG4 B;  4MTF A;  4DXW A;  3E8B A;  4UVB A;  3H01 A;  1G8M A;  2DQ3 A;  1MOF A;  1K73 W;  4U7O A;  4G27 B;  1GM8 A;  3SPJ A;  5H6R A;  4JAU A;  2WLI B;  1KC8 W;  1OCR C;  3ML0 A;  1KP3 A;  1TUE B;  1EFR G;  2R9R B;  2WLL B;  2IJJ A;  3ABU A;  3ZRW B;  1JQ0 A;  1AI4 A;  1GM9 A;  3ABK B;  3B77 A;  1V55 B;  5EC1 C;  3FKS G;  4F4L A;  4QNH B;  1Q82 W;  2WAM A;  1Y66 A;  4X89 A;  1F23 A;  4MT8 A;  3ZMT A;  1RM1 B;  1RPR A;  4RQF A;  2LFR A;  2QM7 A;  3E8H A;  3DTU B;  4FJC C;  2P6J A;  5LHI A;  2MK3 A;  1YIJ V;  4PA9 A;  4KUM A;  3SPC A;  1FS0 G;  2GSM B;  1FXK B;  2ZXW C;  4E2L A;  1OCZ B;  1VQK V;  3LDC A;  5L3C A;  1OCC C;  4U7N A;  3QNE A;  3OUS A;  3K3W A;  3QO8 A;  2WLI A;  4PA7 A;  5B1O A;  4WFH A;  1M57 C;  4RUF A;  1KKD A;  1GMG A;  2WLL A;  3ZRW A;  2AHZ A;  3ETG A;  2OTL V;  1RPO A;  1VQ6 V;  1SRY A;  5BZB A;  1K7D A;  5B1N A;  2IU0 A;  5B1B C;  3K03 A;  1N8R W;  3K79 A;  1OZ0 A;  3AG1 B;  1OCO C;  4HZ3 A;  4OXS A;  1VQM V;  4I9W A;  1AJN A;  2UXN A;  3K0G A;  2JK5 C;  1SET A;  2GHY A;  2IU3 A;  4MVU A;  3T4D A;  3M99 B;  1E1Q G;  3BY6 A;  2ZQM A;  3OMA B;  5CA3 A;  2HJF C;  1H8E G;  3AG2 C;  1F4N A;  4UVA A;  3FB5 C;  4TSF G;  1FXK A;  1R6N A;  3HB3 B;  1AR1 B;  3FB6 C;  3AG3 B;  1K34 A;  1JOY A;  3E35 A;  1XL6 A;  3OGC C;  4X88 A;  3JYC A;  4UVC A;  1YJN V;  2XAS A;  2LP7 A;  3E89 A;  3W7S A;  1QLN A;  2X0L A;  1K92 A;  2JJ2 G;  4HAM A;  1HWY A;  3JCZ A;  2P90 A;  4J9Y B;  2X6A A;  2EIJ B;  5CN0 A;  1SES A;  3FYI B;  2Z3Y A;  3STZ C;  4MS2 A;  4ZKI A;  1JCH A;  4QJF B;  3OE7 G;  4XBF A;  4TWK A;  1V55 C;  4MW3 A;  5EC2 C;  1B6Q A;  1K8A W;  4RO2 A;  1KQS U;  2CK3 G;  1F51 A;  5IYB O;  2QE7 G;  5B3S C;  3SPI A;  1S0V A;  3IFX A;  2ATK C;  2OCC C;  5L3F A;  5B1A B;  5KUM A;  1YHQ V;  3K04 A;  3JD0 A;  4R8C A;  1MAB G;  1JVM A;  2HFE C;  1F4M A;  3CYO A;  3CC2 V;  2EIN C;  2Y48 A;  4PA3 A;  1K97 A;  1GM7 A;  1PNK A;  3CCR V;  4BIU A;  3CCV V;  3STL C;  3ZRS A;  3K06 A;  4FK5 C;  3CPW U;  3KG2 A;  2OTJ V;  1FXK C;  4R7C A;  1K4C C;  3ABM B;  1NJI W;  4RQE A;  1E79 G;  2UXX A;  3ABT A;  3ZCC A;  1UJW B;  2YSU B;  2JJ1 G;  4MVM A;  2X7R B;  2ITC C;  4GT1 A;  4CBC A;  4XDK A;  1GTO A;  2EZO A;  1NR1 A;  1THZ A;  2YEV A;  3ASN B;  5EK0 A;  4PDV A;  3E8F A;  4G2K A;  4XDJ A;  3TET A;  1KD1 W;  4RAI A;  2BOC C;  3ZJZ A;  4P2Z A;  2X6B A;  4P9P A;  5LHH A;  3X2Q B;  5LGN A;  1OHH G;  4QPJ A;  3CCS V;  2A79 B;  3CD6 V;  4UV9 A;  4PDL A;  1MSW D;  2IH3 C;  3SYC A;  3CCL V;  2K1E A;  2Q68 A;  3OUF A;  2W0F C;  3K9A A;  3TCU A;  4JAV A;  2WPD G;  3SYO A;  1S3J A;  2NNU A;  5LHG A;  1VQ4 V;  5KA5 A;  1S5H C;  2NLJ C;  3AG3 C;  3AEI A;  3LNM B;  5FL7 G;  2P67 A;  1VQO V;  3SYA A;  3IC7 A;  3OMN B;  4GX1 A;  4ZBM A;  4QPK A;  1W0K G;  2ITD C;  4KP4 A;  3ZMZ A;  1P7B A;  1QLE B;  2Y69 C;  2EIJ C;  2Z5U A;  1R73 A;  2IW5 A;  4G28 B;  2IJH A;  1PKX A;  3LSQ A;  4BAY A;  2DWE C;  1NVP B;  2HG5 C;  1AJP A;  1QR9 A;  1QCE A;  2ZDI A;  2AHY A;  1LNQ A;  3LDE A;  2H8P C;  1BHB A;  1Y4M A;  2ZR2 A;  5HFM A;  3OMI B;  5H6Q A;  4P30 A;  2R9I A;  2WSS G;  3ABL C;  3G6E V;  3RVZ A;  5CBG A;  1BMF G;  3IGA C;  2Q6A A;  1YI2 V;  1WLE A;  1PD3 A;  2EIK B;  4GX5 A;  2IJI A;  4FPP A;  1YTF B;  3OAA G;  1P4R A;  4MVQ A;  1EBO A;  2DYR B;  2WLK A;  3FB8 C;  3CMA V;  4LBE C;  3ABM C;  2F43 G;  2V1D A;  3W7W A;  3ZN1 A;  2EIL C;  3ZMS A;  1ORQ C;  1W2B U;  1JX9 A;  2C2A A;  1ENV A;  3I55 V;  3ZRX A;  4UV8 A;  1QVF U;  3A0R A;  1NH2 B;  1I5Y A;  5E1A C;  3CME V;  1R6K A;  2QTO A;  2D3O W;  5CBH A;  4QIW F;  1V54 C;  3AG4 C;  3SYQ A;  5IY5 B;  1KP2 A;  2EBO A;  3JD2 A;  3VBB A;  1M1K W;  4JTA B;  1Q7Y W;  3CP1 A;  5IDJ A;  4BIZ A;  3X2Q C;  3ZN0 A;  5KA6 A;  3GB7 C;  4PEL A;  5DN6 G;  4WFG A;  1SER A;  1M56 B;  2X6C A;  3DGE A;  4CZZ A;  1PNL A;  2A0L A;  3ZMV A;  2IJK A;  3EFF K;  1NVP D;  1E1R G;  5EBL C;  1CEZ A;  3ABK C;  5EBM C;  3ZRV A;  1K9M W;  4GX2 A;  3ETD A;  3UM7 A;  3T1C A;  4WF9 V;  4PDR A;  3RVY A;  5IYC O;  1RM1 C;  3ZIA G;  3W7X A;  1NR7 A;  4MVS A;  4TT3 G;  2M7W A;  2DWD C;  1QLE C;  1H2G A;  3OEE G;  4JF3 A;  2XAQ A;  1Q86 W;  4UXN A;  2FTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...