2IH3C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
97
Chain Sequence
b'LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 37
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih3C00
1R3KC 5CBFA 2WLLB 2DYSC 2QKSA 1V55C 2WLIA 3R65A 2EIMC 3IFXA 4J9YB 4MVZA 5EK0A 5IY5C 2K1EA 3LNMB 3SPIA 3UM7A 1M56C 3ABKC 5E1AC 3LUTB 4GX5A 3SPGA 5CBHA 4P2ZA 1KKDA 3ABLC 3KG2A 2WLKA 4PDMA 3BEHA 5KUKA 3E86A 1G4YB 1LNQA 3PJSK 3SYOA 4H33A 4WFGA 2IH3C 4RO2A 4WFHA 5KUMA 2DYRC 4GX0A 3STZC 4CBCA 3E83A 2ITCC 4EKWA 4PDRA 3AG4C 2WLMA 3E8BA 4P9PA 3RVYA 3TCUA 2EIJC 4J9ZB 3ZJZA 3K0DA 4MVOA 5CBGA 5J9PC 3OUSA 5B1AC 3E8HA 3K0GA 3LDEA 1OCRC 3X2QC 5EC1C 4HYOA 2EILC 1R3JC 2JK5C 4PA9A 3UKMA 4MVSA 1QLEC 1ORQC 2OCCC 1P7BA 2R9RB 3LDDA 2HVJC 3T4ZA 3K04A 1OCOC 2P7TC 2W0FC 2WLLA 3AG1C 4JTDB 2IH1C 2WLJA 4XDKA 5EBWC 3T2MA 4QNHB 3AG2C 1JVMA 4P9OA 4LCUC 3HPLC 2DWDC 2EINC 3SJQC 3T1CA 3F5WC 3FB6C 2X6BA 4WFFA 3RVZA 3F7YC 4RUEA 4GX1A 5EBLC 3K08A 2ATKC 1J95A 2Y69C 4MTFA 2HG5C 1M57C 4JTCB 1OCZC 1R3LC 3E89A 4MW3A 2X6AA 4UUJC 2HFEC 4LBEC 4TWKA 3OR7C 2HJFC 4OXSA 3F7VC 4H37A 3RBZA 3SYAA 4RUFA 3ASNC 3FB5C 4MS2A 3EFFK 1K4CC 1V54C 3VOUA 1K4DC 3IGAC 3SYCA 2H8PC 3SPJA 3K06A 2A0LA 2YEVA 2Q68A 4I9WA 4PA3A 2ZD9A 4PA6A 3SYQA 3ZRSA 2A79B 5B3SC 1OCCC 3GB7C 3ABMC 2DWEC 4PA4A 4F4LA 5EC2C 3E8GA 2Q69A 2AHZA 1S5HC 2HVKC 3FB8C 4MSWC 3SYPA 2QTOA 4QE7A 4JTAB 3TETA 4MW8A 3WG7C 4PDLA 4HZ3A 3JYCA 4X89A 2KB1A 4G28B 4X88A 4G27B 2NLJC 2Q67A 4XDLA 3T4DA 2BOBC 4XDJA 1XL4A 4P30A 4ZBMA 4BW5A 4X8AA 1XL6A 3K03A 2EIKC 3LDCA 3SPHA 3OR6C 4R7CA 4GX2A 1ZWIC 2Q6AA 3SPCA 4RAIA 2WLHA 4MTGA 1R3IC 3RW0A 3FB7C 4LP8A 4DXWA 4R6ZA 4KFMA 3ASOC 4MVUA 4R50A 4R8CA 2ITDC 4WFEA 5BZBA 1BL8A 2ZXWC 4MTOA 4MVRA 2AHYA 3E8FA 3OUFA 2X6CA 3OGCC 2WLNA 3STLC 2BOCC 3AG3C 4PDVA 2A9HA 2WLIB 4MVMA 4PA7A 4QE9A 5B1BC 4MVQA 5EBMC
chains in the Genus database with same CATH superfamily
2QWRB 3S3XA 4MVZA 3A0HZ 2UXDO 4F6RB 4FZ0A 2VQFB 1Q7YW 1P49A 3ABKC 2K9PA 2QJ1A 3QO7A 3SPGA 5KUKA 1QLEB 4B3RB 3RYHB 5JCOA 4EKWA 3W7XA 4CS3A 2EINB 5B1AC 4UB6Z 3NR7A 4J7JA 4X20B 3H1KH 1OV9A 4CC5A 2M7WA 2ETNA 2VQFO 3FKSG 2CTQA 3BA9A 4JTDB 4B3RO 3CMEV 4IYIA 5CA1B 4DO2A 3T1YB 3WU2Z 2FMLA 1V54B 2ZE6A 4YJ2B 1FXKB 1EN5A 1JOYA 5IJ9B 3KCXA 2HG5C 3CCJV 2LW7A 2XTAA 2AW9A 4OXSA 4FVMA 2L6LA 5EYPA 2QGNA 2OT5A 4BWAA 3ZRWB 3OT7A 3CC4V 3W7SA 1CEZA 4I9WA 3T1YO 3JARA 2F95B 4MSWC 1S5HC 1UJWB 1IZ3A 1KB9F 3K5OA 4MW8A 3QNEA 3JYCA 1Y67A 3N2KA 4FFBA 4UCUA 1BE3H 5IDJA 2VWKA 1XL4A 2QTSA 4JF3A 1Z5WA 3CYOA 2CE4A 2FYUH 4X9QA 1R73A 1R3IC 3H01A 3D3IA 1ROPA 3L70H 4O4LB 2QM7A 3JASB 4XBFA 1X4TA 4UCVA 3HKEA 3OUFA 2X6CA 3OGCC 1FFXB 4FLUA 2DYRB 3AG3C 3DSQA 1PV0A 3VBBA 4H13B 2GTAA 4WFAV 2EIMC 1O9GA 3VQWA 1F7YA 2ODMA 5FL7G 1BQ0A 2IM9A 4UFZA 4I50B 2EBOA 1DGSA 2ITCC 3ZHTA 3AG4C 3TCUA 1U96A 4DR1B 3K0GA 2FL4A 3K58A 1YITV 1IVSA 4JV5B 3OW2U 3ZHVA 5LA6B 3LDDA 2W0FC 2V7QG 4HAMA 4JAUA 2Y0PA 2D2CB 1EM1A 2P5OA 4YHHB 4NTWA 1D2DA 4DR1O 1M57C 3CS5A 5K1XA 3N2GA 3FD9A 3E89A 4DK1A 2CDYA 2GBOA 4JV5O 4J10A 3E35A 1B06A 1YCIA 4DV3B 3SYAA 4JAVA 4UVAA 4LNUA 2H3OA 1H2MA 3IC9A 3SPJA 4ASUG 3JD2A 4I55A 3SYQA 3DC5A 3QVNA 2A79B 3Q4HA 2ZDIA 3AK2A 2AHZA 1M1KW 4YHHO 4I0XA 1K92A 3ZHRA 1AR5A 5D5QA 1NS1A 3EHBB 1YI2V 1N8RW 1R1BA 5L3BA 3S3WA 2KSDA 4ZI7B 2GUZA 3FX7A 1NTZH 5LXTA 1V55B 1YSCA 2W0XA 4DV3O 2AXTZ 4L87A 2YXLA 1BL8A 1SQFA 5CB4A 2Q7HA 4KP4A 4ICGA 3K59A 3CJHB 2ZT9B 3RGBA 4GKJB 4KHPB 2ZXWB 1COWG 3HKDA 2DYSC 1AILA 4YXWG 5IWAB 2GSMB 4DR5B 1RPRA 5JJNB 4PDMA 4IT5A 1KP2A 4F6RA 3SYOA 1QU7A 4JPRA 4TT3G 4X1KB 1IURA 2CTRA 5HFMA 1VQ6V 4QJFB 3JAMN 2YUAA 4GKJO 4KHPO 4N23A 2YI8A 2ZIOA 5IWAO 1K9MW 2ZINA 2XNDG 4OPAA 1OCRB 4B7EA 2HVJC 1ENVA 4DR5O 3AG1C 1NR1A 1BHAA 5BMVA 1KP3A 3SJQC 3FAVA 4DK0A 2RCVA 2E75B 1K73W 4PELA 3K08A 4IHJB 1Y76B 5J2TA 2JVDA 3TJTA 1FXKA 4NVPA 2DQ0A 3MD0A 4EFEA 1VF5B 4DV5B 4DR7B 1B04A 1HR0B 4UCOA 3ZX6A 3KCYA 2O57A 4JI4B 1NH2D 3IGAC 1URFA 5KMGA 2OTJV 3ZS8C 3ZRWA 3QO8A 1V9PA 3FB8C 2BSKB 4DRXB 1VIBA 5L3FA 1FFTB 2W6JG 3LSUA 4N21A 3K9AA 4G28B 2ADPA 5ITZA 5B1BB 4DV5O 4DR7O 1HR0O 3OR6C 1ZWIC 2JJ2G 2GDSA 5LOVA 4JI4O 1M93A 1N4CA 1DTOA 1G6UA 1VF7A 5FPRA 1HNWB 4R50A 2DMXA 1HNZB 4U3JA 1YEWA 4O4LA 3JASA 4O4JA 2KKWA 2YXHA 4MVQA 2P06A 5EBMC 3JCZA 1IDSA 4Z1VA 2WLLB 2QKSA 5JCOC 2K1EA 4RQEA 3K5LA 4GX5A 2DN9A 2HLDG 3OEHG 1VQ7V 5B5EZ 4ZOLB 3GWOA 1ZLZA 4J7ZA 3ICXA 1MA1A 1HNWO 1E1RG 4UCRA 4CH3A 1HNZO 2EZPA 1ZL8B 3K0DA 1ORQC 4AI8A 1GM7A 2YEVB 2VS0A 5JH7B 1L0LH 5LA6A 1N32B 1NZ6A 4B3TB 4JZ2A 2DWDC 1JA8A 3JD1A 3AK1A 4JI8B 4RUEA 1P84F 3ABMB 4EFBA 1OCZC 4ZKIA 1TA8A 4UV9A 5L3CA 5KHKA 3FB5C 3QF7A 3RYCB 1K4CC 1HNXB 2XAFA 5BXZA 3RYFA 3BPZA 3K06A 4B3TO 2XOKG 2JGDB 3D36A 1KECA 1CP9A 4QE7A 4JI8O 3L71H 1NJIW 1VQ5V 1JFFB 5FNVB 3HKBB 2AZ0A 2KG7B 4CH5A 2N74A 2Q67A 4XDLA 4JYAB 4Z1MG 1JQ0A 3SPHA 2XAHA 2WAMA 4ZI7A 4JI0B 1M56B 1HNXO 1F4NA 5KA5A 5LGUA 1EZJA 5AG2A 1AP5A 2QR4A 1AI6A 1GH6A 4I4TA 3IC7A 3UO3A 3CJHA 1WB7A 2DQ3A 1FJGB 2ZE8A 4JYAO 1VQKV 4YY3B 5KHJA 3OE7G 4J80A 4LF7B 2UU9B 1W0KG 3E86A 1AB3A 4JI0O 2BTQA 2W6IG 4WFGA 3OTOB 3J80N 4B08A 3B8MA 5CA0A 3G6EV 1OZ0A 3BABA 1SS3A 3RVYA 4X1KA 2QM4A 4FLXA 4WBNA 4FK5C 1SQVH 1I0HA 2OCCC 1P7BA 4TSFG 1FJGO 1HWYA 4AQYB 1TVKA 4LF7O 1OCOC 2UU9O 5EIBC 1G1XB 3FFQA 3JD0A 4X66B 1WPBA 3T1CA 3OTOO 2X6BA 3CMAV 3F7YC 1QR9A 3K79A 2ZNJA 1OCCB 2P4KA 4GYCB 4JZGA 4LF6B 2IW5A 4UUJC 5B66Z 4AQYO 4WCEV 3RBZA 3FYEB 3HB3B 2IJIA 5JJJB 1KUQA 3QO5A 4X66O 1F23A 4PA6A 4FMTA 3CCSV 4ABMA 4CH4A 3CC7V 4HZ3A 2BSKA 2E3CA 3JAWB 1NT2B 2Z3YA 4LF6O 1GN3A 2VQEB 5LHHA 4I5SA 4X8AA 1XL6A 3K03A 1WB8A 2EIKC 3ETQA 4Q20A 4DV1B 2H94A 3ABLB 1IBKB 3H1LH 2QKCA 3E8FA 1QVGU 4U3FH 2E5LB 3SJBC 4MVMA 2Y0IA 2PTMA 2F1MA 3L75H 2CTWA 4FZ1A 5J2UB 1VQLV 3LUTB 3KG2A 4DV1O 2A06H 2OWOA 4OGQB 3A0BZ 2DE0X 4EB6A 1IBKO 1M5IA 5GTIZ 1Q43A 2E5LO 2NR5A 2XHBA 1GM8A 5LMNB 4MVOA 4LFAB 3GWKC 5IYZB 2EILC 1VQ8V 4PI0A 2NN4A 1KYOF 2EX3A 2PGGA 3U10A 3CCEV 4FM2A 1DK1A 1KQSU 3CPWU 2YS8A 1JVMA 4HBNA 5E79Z 1P7GA 1Q6HA 4UV8A 1SA0B 5KHIA 3F5WC 5IYDO 3N27A 5LMNO 2QA4V 4LFAO 1AP6A 3ZHSA 4MW3A 4DW0A 4LBEC 4TWKA 3UO2A 2VWJA 3SDLA 1YTFB 4ZHQB 3UCSC 3VOUA 1SQQH 3R66A 2HR3A 2DWEC 3CB2A 1AROP 3SYPA 4CZZA 3IAYA 5GTHZ 2GTSA 5C93A 4LF9B 2JGDA 4U7NA 4WFBV 4X1YA 2ZCEA 3HKBA 2GV9A 1O9HA 3JALB 2FTKA 1Y4MA 2F4VB 2EULA 3E2EA 4G2KA 3ABKB 2QE7G 4JI5B 2XAGA 1SQXH 4B3SB 3U0ZA 4PDVA 3ASOB 1QVFU 2WLIB 4LF9O 2PI4A 1FPOA 3SYCA 4TV8B 2R72A 1JX9A 5B1AB 4UCTA 1TAEA 2RMKB 4P2ZA 2ARHA 2WLKA 5JQGB 4I9QA 2F4VO 1RM1C 3I56V 1GAXA 1FKAO 2WSSG 4LWSB 5FPOA 4JI5O 4B3SO 2XASA 1S77D 4IIJB 1QQCA 2ZNIA 2ZM6B 3UT5A 2Y48A 5BY1A 3OEEG 5JJEB 3G6BA 2CUGA 3H1IH 4CS4A 1PKXA 2MW2B 1QHTA 1FS0G 4IL6Z 1YVWA 4L8JA 3VQYA 1I5XA 1IBMB 2ZM6O 4YJ3A 4QPJA 1Z5VA 3OR7C 1YDXA 2QSAA 1W59A 2DJVA 4RUFA 1VQ9V 2ZR3A 1AJQA 2OYQA 1Z2GA 1YJ9V 5B3SC 1XHXA 4AHCA 2HJDA 3TXSA 2Y4TA 4GUNA 3OMIB 3CRCA 3AG3B 1WLEA 3E22B 3JAWA 4HNAA 1MZFA 2IJKA 3K5MA 1Q8IA 2EIMB 4RAIA 3RW0A 1H38A 1IX9A 2ZXWC 1R6TA 3KKYA 3CRQA 3QG5A 2Z5UA 3LSQA 1P4RA 5GONB 2D3OW 4Z2WA 5LGNA 4D7SA 3EVKA 5CMUA 5J2UA 1TUBA 4PJ0Z 3JAKB 3D3QA 1F4MA 2UUAB 3CC2V 2RJZA 1MSDA 3QTCA 1D5AA 4H0LB 3OUSA 1OCRC 4TV9B 4O2AB 4LC1A 1J5EB 1JPXA 1M57B 3X2QB 1N34B 1FXVA 1D5NA 2JRIA 1XREA 3AG2C 4BR6A 1ZTEA 2OTLV 2UUAO 1H2GA 1SA0A 1WNSA 3RYHA 3CHXA 1XNRB 5F2VO 2Q0OC 1NVPB 1R6NA 4JTCB 4O4IB 1AJNA 4GLXA 1ZAUA 3A8TA 4LFCB 1BZKA 1XMQB 4X20A 5DN6G 2Y69B 1J5EO 5JVDB 1N34O 1I94B 1K5QA 3MHHC 4O4HB 5CA3A 1PPJH 1S76D 4PI2A 1SZXA 1Q6UA 4ZHQA 5IE9A 3E8GA 2QWOB 4K8XA 4K0KB 5CA1A 1N0NA 1XNRO 5K1PA 4KUMA 3O65A 5B1OA 4YJ2A 1VQPV 1KBHA 4LFCO 5IJ9A 2ILMA 2HP8A 1AJPA 2XT9A 4NYKA 1XMQO 2LGWA 1N36B 4R7CA 1XI1A 1SERA 2DYSB 1I94O 4A5UB 4J7KA 5LHIA 3C90A 4DV2B 2CTPA 3I5DA 4NXNB 4K0KO 1SESA 2WLNA 2A3QA 1R6KA 1I08A 2A9HA 3M7MX 4PA7A 2MK3A 1RPOA 4BIZA 2WLIA 3R65A 5EK0A 4JI3B 1QR8A 1LUWA 3SPIA 5IT9N 1N36O 4D7TA 1VMGA 3ZMSA 1CPYA 1YJWV 3BEHA 2Q9LA 5JQGA 4DV2O 3AG1B 1PNMA 3E83A 1VQMV 3OAAG 1Y74B 1AR4A 4NXNO 4K3AA 2WLMA 2EIJC 2UXNA 1RP3B 1GTOA 4O2BB 1XEQA 4IIJA 1FFXA 4X1IB 4JI3O 1WN7A 2QEXV 4Q6GA 4H44B 5LGTA 4J41A 1H2KA 1VP7A 2LFRA 2V1DA 1H2SB 4WFFA 4BW9A 5JWPA 3G4SV 4I50A 2AZ2A 1WP7A 3BA8A 1M9NA 4DV6B 2PUSA 3A2FA 4AILC 2RNBA 4IGGA 3ZBHA 1OHHG 4UCSA 4F6EA 3ASNC 1KD1W 4NKGB 2H8PC 1FAFA 4PA3A 1WA8B 2IU0A 5LYJB 3RN4A 1SETA 1EFRG 3JD4A 2PY5A 1L0NH 2YC0A 1MOFA 3CCLV 1YHQV 1RSOB 3OGIB 3L9DA 2QWPB 3APOA 4OX9B 2Q6AA 3E22A 5DECA 1N32O 4R6ZA 2CGNA 5BZBA 2UXCB 2JS3A 1PNKA 3JSLA 2VRZA 2CK3G 2R70A 1M90W 3W7WA 4DUZB 3ZJZA 1L8DA 4LR3A 1VQNV 4UVBA 1U97A 1GMGA 3BFRA 5GONA 4CS2A 4OX9O 3I55V 1GN4A 4GX0A 1UFIA 3B40A 2UXCO 3JAKA 2Q7GA 1XBLA 4D6TH 4MT8A 4J9ZB 1JJOA 3MAQA 3LDEA 5KLVH 4DUZO 2P67A 4UB8Z 4MTXA 5L3GA 5TISZ 4LH6A 4TV9A 1BT8A 1OCZB 4O2AA 3JARB 5KHGA 1GN2A 4E4EA 3F5TA 2WLJA 4QNHB 2UUCB 3WB2A 1AVMA 1T5EA 1JR9A 1GM9A 5EZYB 1BCCH 1I5YA 3H1HH 2WA4A 3ZRVA 1B3QA 3P3PA 3D8CA 3ZN0A 1HW7A 2M6YA 4YY3O 4NB5A 4NR1A 2LP7A 2UUCO 1K33A 2B1GA 4QPKA 4PA4A 3CWBH 4NTXA 3TETA 3MDSA 3WG7C 3CXCU 5LBQA 2RDCA 2P22C 2XAQA 4FFKA 3G80A 4X88A 2YI9A 1H8EG 1W0JG 3ZMUA 4X64B 3T4DA 2YIAA 4IHJA 4ZBMA 1AR1B 1Y76A 3RFRA 2ZDIC 3WFVA 1NU1H 5H6RA 4W4LA 4FPPA 2WLHA 2ADQB 3G67A 4LP8A 4FLYA 5LP6B 4DXWA 3ZEDA 3CD6V 1EZVH 2EJRA 2NNUA 1UPGA 3HKCB 3BAAA 2XAJA 2HHHB 1GO3F 3ZCCA 4DRXA 3VQVA 3J81N 4X64O 5IY5C 3AEIA 2LJ2A 2Z0AA 1THZA 3IJ4A 5CBHA 2OCCB 1CXZB 1OCOB 1XILA 3CCMV 1ZUQA 4DUYB 1S5LZ 3N2GB 2N05A 1VARA 2V4DA 1NQTA 1Y74A 3SGIA 5IJ0B 1K97A 2HHHO 4HYOA 1KKCA 2B1IA 4FLZA 1QLEC 1GN6A 2LFSA 2VQEO 4LNUB 3P3NA 1WJZA 2P7TC 2WLLA 3Q4HB 4XDKA 3T2MA 5DM6V 3HPLC 3EXAA 2EINC 4I0XB 2ZR2A 4ZOLA 3K5NA 4DUYO 3ABTA 4JI6B 5L3DA 2OIGA 5EBLC 3G71V 3C3SA 4DR6B 2JS5A 1R3LC 3WB0A 1YZBA 1ZL8A 2HFEC 1TUEB 1VF6A 2ZIMA 3F7VC 1IXBA 4JAAA 5CB4B 1V54C 1FXKC 2A0LA 2YEVA 2Q68A 4GT1A 4GZRB 4JGSA 5KAIZ 5KHHA 5JH7A 2LQTA 4K8ZA 5A2QN 1SQBH 4GCZA 5FLXN 4JI6O 2IBZH 4X89A 4WF9V 1NBMG 4DR6O 2BOBC 4IYHA 2QDOA 1KU9A 1XQ8A 4GX2A 1RSOA 5KX5B 4FLVA 2QWNB 4X62B 3ASOC 3DXRB 3RYCA 2E76B 4K35A 3CCVV 5GW7A 3C3TA 2BTOA 1LUVA 2DOSA 2OIEA 5H9CA 4B3MB 2WWWA 4FM0A 1SQPH 3L72H 2LGQA 4DV0B 5IYBO 1JFFA 5FNVA 4CC6A 5BMVB 2EILB 2KG7A 3UM7A 3CXHF 3FAVB 4TQDA 1DLBA 3ETGA 1PL0A 2IH3C 4RO2A 2DYRC 4X62O 1L1FA 5J2TB 3OMAB 2YIBA 4B3MO 1K34A 5B1NA 5IYCO 2CH7B 1Q81W 5EC1C 1R3JC 3UKMA 4MVSA 4DV0O 2FKXA 1H8HG 5KMGB 3HR0A 3J7AU 2IH1C 1YIJV 1YJNV 1MSWD 3H1JH 2BE3A 2HKOA 3W7TA 2YICA 5ITZB 1Q86W 1K8AW 1S3JA 2IU3A 3ZIAG 5EZYA 2LO1A 4JI1B 5EIBD 2JJ1G 5LOVB 1OJHA 4JI2B 2F43G 3ZMTA 4U7OA 3THOA 2X0LA 3EFFK 5KA6A 4U3JB 1PP9H 2IJJA 2N04A 4FLTA 4O4JB 2ZD9A 3CX5F 2R9AA 2BCCH 1NKDA 2P6JA 1AI5A 3ZRXA 3NXSA 4G27B 3H9VA 1WAZA 2X7RB 3APQA 4JI1O 4XDJA 1NTMH 3ZHUA 1Q3EA 3LNNA 4TUYB 2R9IA 4JI2O 3D36C 1RFYA 3BCCH 1BS3A 4C7UA 2P4VA 4UVCA 1KC8W 4YIOA 4R8CA 3CCUV 1RM1B 2WPDG 3A0RA 5LP6A 3STLC 3ETDA 5LL6Y 1B6QA 1SRYA 1NH2B 4OPHA 1VQ4V 2PYJA 3HKCA 1IBMO 4DR2B 1R3KC 2Y4UA 1V55C 1BQZA 4EEQA 3LNMB 1FYJA 3OTFA 3W7UA 1KKDA 1VQOV 4UXNA 3PJSK 4TQFA 2Q8VA 2LW1A 4H33A 4WFHA 1DF5A 1MABG 5KUMA 1G8MA 3RT3C 4PDRA 2Q5ZA 3E8BA 4P9PA 4ZIBA 3BHPA 1XHZA 1YTFD 5J9PC 4J42A 2B9ZA 3CP1A 3X2QC 3GVMA 3AG4B 4DR2O 4LF4B 3M99B 3BY6A 5IJ0A 3CRMA 3RYFB 4FLWA 2F93B 3K04A 3TK1A 5C8YB 4DYLA 5EBWC 1F51A 4P9OA 4LF5B 3JATB 1Y66A 3SJAC 2L35A 2QKAA 1ZX3A 3RVZA 1SZTA 3PN1A 4QGPA 4GX1A 5B3SB 2Y69C 1XUQA 4LF4O 5H6QA 4JASA 2HJFC 5IYZA 4H37A 3B8NA 5HFLA 1GRJA 4LF5O 4KL1A 1FD9A 3ZRSA 3GB7C 1NI8A 5EC2C 4I4TB 1JJ2U 2ZE7A 1TGOA 4BAYA 4KXRA 3ZN1A 1FXHA 3SR2C 4BW5A 2BTQB 2Q73A 3BVOA 3RWRD 3RYIB 5CA0B 5KX5A 4MVUA 1BGYH 2ITDC 1SQGA 3FYIB 4WBNB 4JI7B 3OFNG 4DR3B 3DXRA 5B1BC 1TVKB 2E74B 5D5PA 4DV4B 2YDEA 1G4YB 3B77A 1MG1A 1GK9A 3JALA 3AG7A 2PYLA 2KQXA 2G38A 3K3WA 1VEWA 3STZC 5L3EA 3AG2B 3ML0A 4JI7O 4DR3O 2JGUA 4DW1A 3CRAA 3CCQV 4YIPA 3ETEA 4RWUA 1S5JA 1Y6XA 2DW4A 2CH7A 1S72V 4TV8A 2YSUB 1BHBA 4DV4O 1AI4A 4LCUC 4W4KA 1GKFA 3B09A 3FB6C 1VF6C 2EJ7A 1PNLA 1JCHA 1MZEA 4LWSA 1EN6A 1J95A 2GHYA 2P90A 2JEXA 2JEUA 2Q4PA 2F23A 1H2LA 3DC6A 1X59A 3UQ8A 2PZSA 4MS2A 1QNMA 1IXMA 4PV1B 3ABMC 2Q69A 2HVKC 3CRRA 2F66C 2KB1A 3MHSC 3BRCA 3B2EE 5CN0A 3LDCA 3K9SA 4I7ZB 2JDIG 1BMFG 3L73H 2CAZC 3SPCA 4EB6B 4MTGA 3FB7C 4TUYA 3JSNA 4NXMB 4FJCC 1PL4A 2AGAA 4JYBA 5DEDA 1E79G 2AHYA 1N33B 3L74H 5LHGA 1SKVA 4DV6O 5CBFA 2EIJB 4J9YB 3IFXA 2FB5A 4LH7A 1M56C 1XNQB 1Q5OA 1LNQA 2UUBB 2QWQB 3DGEA 1NVPD 4NXMO 2RN9A 3ZMZA 2PI5A 3P32A 2UXXA 1N33O 1MNGA 1XDCA 3E8HA 3P30A 3JD3A 2IJHA 2JK5C 4PA9A 3VQXA 2R9RB 1E1QG 1XNQO 1PD3A 1US6A 2JIZG 1A32A 2UUBO 1EN4A 5C8YA 2WA3A 3ASNB 4RQFA 3JATA 4LFBB 4X1YB 3CSXA 2ATKC 2B5UA 2X6AA 2QM8A 5EYPB 1Q6IA 1M4UA 3ZHQA 1NR7A 5H5NA 2HEPA 1OCCC 1PM9A 1EBOA 4LFBO 3N2KB 3AK3A 3K57A 4JTAB 4FFBB 3B4SA 4DV7B 1XMOB 2UXBB 4J11A 1JMKC 3ABUA 1Q90D 5LP6C 4O4IA 2PF4E 2ZKOA 1HDJA 1IBLB 2ZQMA 2RQ6A 4TOIA 3CCRV 3HKEB 5JVDA 3OMNB 3RYIA 4WFEA 4O4HA 4MTOA 3UT5B 3TXQA 2OCHA 2ZE5A 3DTUB 2BOCC 2YXYA 4DV7O 1XMOO 3CEIA 4QE9A 2UXBO 2YIDA 1K7DA 4X65B 1LR1A 1QBZA 4GKKB 4JYYA 5E1AC 4QIWF 1ZSPA 3ABLC 1BSMA 2CGOA 1IBLO 1QCEA 4PD4F 2A7WA 5LMUB 3M8AA 4CBCA 1QLNA 4YJ3B 3O9OA 1HP8A 2Q7EA 1AI7A 1I7FA 5CBGA 1SF9A 4X65O 1XOUA 4GKKO 3ZMVA 4BIUA 3T4ZA 1WPXA 1DF4A 3CE2A 1YF2A 3T1HB 5LMUO 2EZOA 4LF8B 3LSSA 4FIPC 4B7KA 1YXBA 4HNAB 4MTFA 1KMIZ 3WG7B 5H2FZ 4O2BA 5BR8B 4I55B 4X1IA 1K5SA 4FM1A 1K4DC 3U11A 4CH6A 3T1HO 1S0VA 3OM3B 3JCUZ 4LF8O 1MMMA 4F4LA 1H2NA 4JYCA 3TGUH 4DR4B 2QTOA 2C2AA 4PDLA 1K3EA 5A9GA 2GUZB 2NLJC 1WP8A 5KAFZ 4PHZA 5LXTB 4P30A 2YIBD 2UXDB 1TUBB 5BR8O 1Q82W 1SC5B 1NTKH 1W2BU 5IY5B 1N0JA 3OD4A 2EIKB 4KFMA 4MVRA 2XUMA 3WB1A 4DR4O 3SJCC 3KZIZ 4BIOA 2Q0AA 1WA8A 3HKDB 5LYJA 4NTYA 4E2LA
chains in the Genus database with same CATH topology
1R3KC 3IC7A 4BIZA 1V55C 2WLIA 2DQ3A 3R65A 4MVZA 5EK0A 1QR8A 1VQKV 3LNMB 3SPIA 3OE7G 1Q7YW 3ABKC 3QO7A 3ZMSA 3SPGA 3W7UA 1VQOV 1CPYA 1KKDA 4UXNA 1QLEB 5KUKA 1YJWV 3BEHA 1W0KG 3E86A 3PJSK 2W6IG 4H33A 4WFGA 4WFHA 1DF5A 1MABG 5KUMA 3AG1B 3B8MA 1PNMA 3E83A 1G8MA 1VQMV 3OAAG 4EKWA 3G6EV 4PDRA 3W7XA 2EINB 1OZ0A 2WLMA 3E8BA 4P9PA 3RVYA 2EIJC 1YTFD 2UXNA 5J9PC 1GTOA 5B1AC 3CP1A 4FK5C 3X2QC 3AG4B 3M99B 2OCCC 1P7BA 3BY6A 4TSFG 1HWYA 2M7WA 3FKSG 3K04A 1OCOC 3TK1A 4JTDB 2QEXV 5EBWC 1F51A 4P9OA 3CMEV 3JD0A 4DO2A 5LGTA 1Y66A 3T1CA 2V1DA 2LFRA 1V54B 2X6BA 3CMAV 4WFFA 3RVZA 1SZTA 1FXKB 3F7YC 1QR9A 3K79A 1JOYA 3G4SV 4GX1A 5B3SB 1OCCB 2Y69C 1M9NA 2HG5C 3CCJV 2IW5A 4UUJC 5H6QA 1OHHG 4JASA 2HJFC 4OXSA 4H37A 4WCEV 3RBZA 3FYEB 3B8NA 2OT5A 3ASNC 3ZRWB 3HB3B 1KD1W 5HFLA 3CC4V 2IJIA 3W7SA 1CEZA 2H8PC 3QO5A 4PA3A 4I9WA 1F23A 4PA6A 2IU0A 3ZRSA 3GB7C 4FMTA 5EC2C 4MSWC 1SETA 1S5HC 3CCSV 1UJWB 1EFRG 3JD4A 4MW8A 1JJ2U 3CC7V 3QNEA 4HZ3A 3JYCA 1MOFA 2Z3YA 3CCLV 4BAYA 3ZN1A 5IDJA 1YHQV 5LHHA 1FXHA 4BW5A 1XL4A 4I5SA 4JF3A 3CYOA 4X8AA 1XL6A 3K03A 2EIKC 4Q20A 2Q6AA 1R73A 1R3IC 3H01A 2H94A 3D3IA 1ROPA 4R6ZA 3ABLB 4MVUA 2QM7A 2ITDC 5BZBA 4XBFA 1PNKA 3FYIB 3E8FA 3OFNG 1QVGU 3OUFA 2CK3G 2X6CA 3OGCC 2DYRB 3AG3C 1M90W 3W7WA 4MVMA 5B1BC 3VBBA 3ZJZA 4WFAV 2EIMC 1VQNV 4UVBA 5FL7G 1VQLV 3LUTB 1GMGA 3KG2A 3I55V 1G4YB 3B77A 1MG1A 1GK9A 2EBOA 4GX0A 3K3WA 3STZC 5L3EA 3AG2B 2ITCC 3ML0A 3AG4C 3TCUA 4MT8A 3CCQV 1GM8A 4J9ZB 4MVOA 3LDEA 3ETEA 3K0GA 2EILC 1VQ8V 2P67A 4MTXA 5L3GA 2DW4A 1YITV 3OW2U 3CCEV 3LDDA 1S72V 1OCZB 1KQSU 2YSUB 2W0FC 3CPWU 1BHBA 2V7QG 2WLJA 4HAMA 4QNHB 1AI4A 4JAUA 1JVMA 4LCUC 4UV8A 3F5WC 1GKFA 5IYDO 3FB6C 1PNLA 1GM9A 1JCHA 1J95A 1I5YA 2QA4V 2GHYA 1M57C 2P90A 3E89A 4MW3A 2JEXA 4LBEC 3ZRVA 2JEUA 4TWKA 3ZN0A 3E35A 1YTFB 2LP7A 3SYAA 4JAVA 4MS2A 4UVAA 3VOUA 3SPJA 4ASUG 3JD2A 3SYQA 1K33A 2B1GA 1IXMA 2A79B 4QPKA 2HR3A 2DWEC 3ABMC 2ZDIA 4PA4A 1AROP 2Q69A 2AHZA 3SYPA 2HVKC 4CZZA 1M1KW 3TETA 1K92A 3WG7C 3CXCU 5C93A 5LBQA 2XAQA 3EHBB 4U7NA 4WFBV 1YI2V 2KB1A 3MHSC 4X88A 1N8RW 1H8EG 1W0JG 3ZMUA 5L3BA 5CN0A 3T4DA 4ZBMA 1AR1B 2ZDIC 3LDCA 3WFVA 5H6RA 2FTKA 1Y4MA 1V55B 1BMFG 1YSCA 2JDIG 4FPPA 3SPCA 2WLHA 4MTGA 3E2EA 4L87A 3FB7C 4G2KA 4LP8A 3ABKB 4DXWA 3CD6V 4FJCC 4JYBA 2EJRA 2QE7G 1BL8A 1E79G 2AHYA 2NNUA 2XAGA 4KP4A 5LHGA 4PDVA 3ASOB 1QVFU 2WLIB 2XAJA 2PI4A 3SYCA 2ZXWB 1GO3F 1COWG 3ZCCA 5CBFA 2DYSC 2EIJB 1JX9A 3IFXA 4J9YB 5B1AB 4YXWG 5IY5C 3AEIA 2GSMB 1M56C 1THZA 4P2ZA 1RPRA 5CBHA 2OCCB 2WLKA 4PDMA 1KP2A 1LNQA 3SYOA 3DGEA 1RM1C 1NVPD 4JPRA 3I56V 4TT3G 3ZMZA 3CCMV 1OCOB 2PI5A 2WSSG 3P32A 2UXXA 5HFMA 1VQ6V 2XASA 4QJFB 1S77D 3E8HA 1NQTA 1K97A 3JD3A 2IJHA 3P30A 2Y48A 2B1IA 2JK5C 4HYOA 4PA9A 4N23A 3OEEG 1QLEC 2LFSA 2R9RB 1E1QG 1K9MW 2XNDG 1OCRB 2HVJC 1ENVA 2P7TC 2WLLA 3AG1C 1PD3A 1NR1A 4XDKA 1PKXA 3T2MA 2JIZG 1BHAA 5DM6V 3HPLC 2EINC 1KP3A 3SJQC 1FS0G 2ZR2A 3ASNB 4RQFA 3ABTA 1K73W 4PELA 5L3DA 1I5XA 5EBLC 3K08A 2ATKC 3G71V 2B5UA 1FXKA 4QPJA 1R3LC 2DQ0A 2X6AA 3MD0A 2QM8A 2HFEC 1TUEB 3OR7C 3F7VC 4RUFA 1VQ9V 1V54C 2ZR3A 1AJQA 1NH2D 3IGAC 1YJ9V 1FXKC 2A0LA 1NR7A 2Q68A 2YEVA 4GT1A 4JGSA 2OTJV 5B3SC 3ZRWA 1OCCC 3QO8A 3FB8C 1EBOA 4GCZA 4JTAB 5L3FA 1FFTB 2W6JG 4X89A 4WF9V 1NBMG 4N21A 3K9AA 4G28B 3OMIB 3AG3B 2BOBC 3ABUA 1WLEA 5B1BB 3OR6C 4GX2A 2IJKA 1ZWIC 2JJ2G 2EIMB 4RAIA 3RW0A 2ZQMA 1DTOA 3CCRV 1H38A 3ASOC 3OMNB 4R50A 4WFEA 2ZXWC 4MTOA 3CCVV 5GW7A 5H9CA 3DTUB 2BOCC 4QE9A 2WWWA 4MVQA 5EBMC 2Z5UA 1K7DA 3JCZA 2WLLB 2QKSA 3LSQA 1P4RA 5IYBO 2K1EA 1QBZA 4RQEA 2D3OW 2EILB 3UM7A 5E1AC 4QIWF 4GX5A 2HLDG 3OEHG 5LGNA 1VQ7V 3ABLC 1DLBA 3ETGA 3GWOA 5CMUA 1QCEA 1PL0A 2IH3C 4RO2A 1F4MA 2DYRC 1E1RG 4CBCA 1L1FA 1QLNA 3CC2V 3OMAB 2EZPA 1K34A 1AI7A 5CBGA 3K0DA 5B1NA 3OUSA 5IYCO 1OCRC 1Q81W 5EC1C 1R3JC 3UKMA 4MVSA 4LC1A 1ORQC 1JPXA 1H8HG 1M57B 1GM7A 2YEVB 3X2QB 3ZMVA 3T4ZA 1FXVA 4BIUA 1WPXA 2IH1C 3AG2C 1YIJV 1DF4A 1YJNV 1MSWD 2DWDC 3JD1A 2EZOA 2OTLV 2HKOA 3LSSA 3W7TA 4FIPC 1H2GA 4RUEA 1Q86W 1K8AW 3ABMB 1S3JA 2IU3A 4MTFA 1NVPB 3ZIAG 1R6NA 4JTCB 1OCZC 1AJNA 3WG7B 4ZKIA 2JJ1G 5DN6G 2Y69B 4UV9A 2F43G 3ZMTA 5L3CA 4U7OA 1K5SA 1K5QA 3FB5C 3MHHC 2X0LA 3EFFK 1K4CC 5CA3A 5KA6A 2IJJA 1K4DC 2XAFA 3K06A 2XOKG 1S76D 2ZD9A 1S0VA 3OM3B 4F4LA 4JYCA 3E8GA 3D36A 1KECA 2QTOA 1CP9A 4QE7A 1NKDA 2C2AA 4PDLA 1NJIW 1K3EA 1VQ5V 2P6JA 4KUMA 1AI5A 3ZRXA 5B1OA 1VQPV 3NXSA 2NLJC 4G27B 2Q67A 2X7RB 4XDLA 4XDJA 4P30A 1AJPA 4Z1MG 1JQ0A 1Q82W 3SPHA 2R9IA 4R7CA 1W2BU 2XAHA 1SERA 2WAMA 2DYSB 5IY5B 4UVCA 5LHIA 1M56B 2EIKB 1KC8W 4KFMA 1F4NA 4R8CA 3CCUV 5KA5A 4MVRA 5LGUA 1EZJA 1RM1B 2WPDG 3A0RA 1SESA 2WLNA 3STLC 3ETDA 1B6QA 1R6KA 2A9HA 1SRYA 1NH2B 4PA7A 1AI6A 2MK3A 1RPOA 4E2LA 1VQ4V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3K C;  5CBF A;  2WLL B;  2DYS C;  2QKS A;  1V55 C;  2WLI A;  3R65 A;  2EIM C;  3IFX A;  4J9Y B;  4MVZ A;  5EK0 A;  5IY5 C;  2K1E A;  3LNM B;  3SPI A;  3UM7 A;  1M56 C;  3ABK C;  5E1A C;  3LUT B;  4GX5 A;  3SPG A;  5CBH A;  4P2Z A;  1KKD A;  3ABL C;  3KG2 A;  2WLK A;  4PDM A;  3BEH A;  5KUK A;  3E86 A;  1G4Y B;  1LNQ A;  3PJS K;  3SYO A;  4H33 A;  4WFG A;  2IH3 C;  4RO2 A;  4WFH A;  5KUM A;  2DYR C;  4GX0 A;  3STZ C;  4CBC A;  3E83 A;  2ITC C;  4EKW A;  4PDR A;  3AG4 C;  2WLM A;  3E8B A;  4P9P A;  3RVY A;  3TCU A;  2EIJ C;  4J9Z B;  3ZJZ A;  3K0D A;  4MVO A;  5CBG A;  5J9P C;  3OUS A;  5B1A C;  3E8H A;  3K0G A;  3LDE A;  1OCR C;  3X2Q C;  5EC1 C;  4HYO A;  2EIL C;  1R3J C;  2JK5 C;  4PA9 A;  3UKM A;  4MVS A;  1QLE C;  1ORQ C;  2OCC C;  1P7B A;  2R9R B;  3LDD A;  2HVJ C;  3T4Z A;  3K04 A;  1OCO C;  2P7T C;  2W0F C;  2WLL A;  3AG1 C;  4JTD B;  2IH1 C;  2WLJ A;  4XDK A;  5EBW C;  3T2M A;  4QNH B;  3AG2 C;  1JVM A;  4P9O A;  4LCU C;  3HPL C;  2DWD C;  2EIN C;  3SJQ C;  3T1C A;  3F5W C;  3FB6 C;  2X6B A;  4WFF A;  3RVZ A;  3F7Y C;  4RUE A;  4GX1 A;  5EBL C;  3K08 A;  2ATK C;  1J95 A;  2Y69 C;  4MTF A;  2HG5 C;  1M57 C;  4JTC B;  1OCZ C;  1R3L C;  3E89 A;  4MW3 A;  2X6A A;  4UUJ C;  2HFE C;  4LBE C;  4TWK A;  3OR7 C;  2HJF C;  4OXS A;  3F7V C;  4H37 A;  3RBZ A;  3SYA A;  4RUF A;  3ASN C;  3FB5 C;  4MS2 A;  3EFF K;  1K4C C;  1V54 C;  3VOU A;  1K4D C;  3IGA C;  3SYC A;  2H8P C;  3SPJ A;  3K06 A;  2A0L A;  2YEV A;  2Q68 A;  4I9W A;  4PA3 A;  2ZD9 A;  4PA6 A;  3SYQ A;  3ZRS A;  2A79 B;  5B3S C;  1OCC C;  3GB7 C;  3ABM C;  2DWE C;  4PA4 A;  4F4L A;  5EC2 C;  3E8G A;  2Q69 A;  2AHZ A;  1S5H C;  2HVK C;  3FB8 C;  4MSW C;  3SYP A;  2QTO A;  4QE7 A;  4JTA B;  3TET A;  4MW8 A;  3WG7 C;  4PDL A;  4HZ3 A;  3JYC A;  4X89 A;  2KB1 A;  4G28 B;  4X88 A;  4G27 B;  2NLJ C;  2Q67 A;  4XDL A;  3T4D A;  2BOB C;  4XDJ A;  1XL4 A;  4P30 A;  4ZBM A;  4BW5 A;  4X8A A;  1XL6 A;  3K03 A;  2EIK C;  3LDC A;  3SPH A;  3OR6 C;  4R7C A;  4GX2 A;  1ZWI C;  2Q6A A;  3SPC A;  4RAI A;  2WLH A;  4MTG A;  1R3I C;  3RW0 A;  3FB7 C;  4LP8 A;  4DXW A;  4R6Z A;  4KFM A;  3ASO C;  4MVU A;  4R50 A;  4R8C A;  2ITD C;  4WFE A;  5BZB A;  1BL8 A;  2ZXW C;  4MTO A;  4MVR A;  2AHY A;  3E8F A;  3OUF A;  2X6C A;  3OGC C;  2WLN A;  3STL C;  2BOC C;  3AG3 C;  4PDV A;  2A9H A;  2WLI B;  4MVM A;  4PA7 A;  4QE9 A;  5B1B C;  4MVQ A;  5EBM C; 
#chains in the Genus database with same CATH topology
 2QWR B;  3S3X A;  4MVZ A;  3A0H Z;  2UXD O;  4F6R B;  4FZ0 A;  2VQF B;  1Q7Y W;  1P49 A;  3ABK C;  2K9P A;  2QJ1 A;  3QO7 A;  3SPG A;  5KUK A;  1QLE B;  4B3R B;  3RYH B;  5JCO A;  4EKW A;  3W7X A;  4CS3 A;  2EIN B;  5B1A C;  4UB6 Z;  3NR7 A;  4J7J A;  4X20 B;  3H1K H;  1OV9 A;  4CC5 A;  2M7W A;  2ETN A;  2VQF O;  3FKS G;  2CTQ A;  3BA9 A;  4JTD B;  4B3R O;  3CME V;  4IYI A;  5CA1 B;  4DO2 A;  3T1Y B;  3WU2 Z;  2FML A;  1V54 B;  2ZE6 A;  4YJ2 B;  1FXK B;  1EN5 A;  1JOY A;  5IJ9 B;  3KCX A;  2HG5 C;  3CCJ V;  2LW7 A;  2XTA A;  2AW9 A;  4OXS A;  4FVM A;  2L6L A;  5EYP A;  2QGN A;  2OT5 A;  4BWA A;  3ZRW B;  3OT7 A;  3CC4 V;  3W7S A;  1CEZ A;  4I9W A;  3T1Y O;  3JAR A;  2F95 B;  4MSW C;  1S5H C;  1UJW B;  1IZ3 A;  1KB9 F;  3K5O A;  4MW8 A;  3QNE A;  3JYC A;  1Y67 A;  3N2K A;  4FFB A;  4UCU A;  1BE3 H;  5IDJ A;  2VWK A;  1XL4 A;  2QTS A;  4JF3 A;  1Z5W A;  3CYO A;  2CE4 A;  2FYU H;  4X9Q A;  1R73 A;  1R3I C;  3H01 A;  3D3I A;  1ROP A;  3L70 H;  4O4L B;  2QM7 A;  3JAS B;  4XBF A;  1X4T A;  4UCV A;  3HKE A;  3OUF A;  2X6C A;  3OGC C;  1FFX B;  4FLU A;  2DYR B;  3AG3 C;  3DSQ A;  1PV0 A;  3VBB A;  4H13 B;  2GTA A;  4WFA V;  2EIM C;  1O9G A;  3VQW A;  1F7Y A;  2ODM A;  5FL7 G;  1BQ0 A;  2IM9 A;  4UFZ A;  4I50 B;  2EBO A;  1DGS A;  2ITC C;  3ZHT A;  3AG4 C;  3TCU A;  1U96 A;  4DR1 B;  3K0G A;  2FL4 A;  3K58 A;  1YIT V;  1IVS A;  4JV5 B;  3OW2 U;  3ZHV A;  5LA6 B;  3LDD A;  2W0F C;  2V7Q G;  4HAM A;  4JAU A;  2Y0P A;  2D2C B;  1EM1 A;  2P5O A;  4YHH B;  4NTW A;  1D2D A;  4DR1 O;  1M57 C;  3CS5 A;  5K1X A;  3N2G A;  3FD9 A;  3E89 A;  4DK1 A;  2CDY A;  2GBO A;  4JV5 O;  4J10 A;  3E35 A;  1B06 A;  1YCI A;  4DV3 B;  3SYA A;  4JAV A;  4UVA A;  4LNU A;  2H3O A;  1H2M A;  3IC9 A;  3SPJ A;  4ASU G;  3JD2 A;  4I55 A;  3SYQ A;  3DC5 A;  3QVN A;  2A79 B;  3Q4H A;  2ZDI A;  3AK2 A;  2AHZ A;  1M1K W;  4YHH O;  4I0X A;  1K92 A;  3ZHR A;  1AR5 A;  5D5Q A;  1NS1 A;  3EHB B;  1YI2 V;  1N8R W;  1R1B A;  5L3B A;  3S3W A;  2KSD A;  4ZI7 B;  2GUZ A;  3FX7 A;  1NTZ H;  5LXT A;  1V55 B;  1YSC A;  2W0X A;  4DV3 O;  2AXT Z;  4L87 A;  2YXL A;  1BL8 A;  1SQF A;  5CB4 A;  2Q7H A;  4KP4 A;  4ICG A;  3K59 A;  3CJH B;  2ZT9 B;  3RGB A;  4GKJ B;  4KHP B;  2ZXW B;  1COW G;  3HKD A;  2DYS C;  1AIL A;  4YXW G;  5IWA B;  2GSM B;  4DR5 B;  1RPR A;  5JJN B;  4PDM A;  4IT5 A;  1KP2 A;  4F6R A;  3SYO A;  1QU7 A;  4JPR A;  4TT3 G;  4X1K B;  1IUR A;  2CTR A;  5HFM A;  1VQ6 V;  4QJF B;  3JAM N;  2YUA A;  4GKJ O;  4KHP O;  4N23 A;  2YI8 A;  2ZIO A;  5IWA O;  1K9M W;  2ZIN A;  2XND G;  4OPA A;  1OCR B;  4B7E A;  2HVJ C;  1ENV A;  4DR5 O;  3AG1 C;  1NR1 A;  1BHA A;  5BMV A;  1KP3 A;  3SJQ C;  3FAV A;  4DK0 A;  2RCV A;  2E75 B;  1K73 W;  4PEL A;  3K08 A;  4IHJ B;  1Y76 B;  5J2T A;  2JVD A;  3TJT A;  1FXK A;  4NVP A;  2DQ0 A;  3MD0 A;  4EFE A;  1VF5 B;  4DV5 B;  4DR7 B;  1B04 A;  1HR0 B;  4UCO A;  3ZX6 A;  3KCY A;  2O57 A;  4JI4 B;  1NH2 D;  3IGA C;  1URF A;  5KMG A;  2OTJ V;  3ZS8 C;  3ZRW A;  3QO8 A;  1V9P A;  3FB8 C;  2BSK B;  4DRX B;  1VIB A;  5L3F A;  1FFT B;  2W6J G;  3LSU A;  4N21 A;  3K9A A;  4G28 B;  2ADP A;  5ITZ A;  5B1B B;  4DV5 O;  4DR7 O;  1HR0 O;  3OR6 C;  1ZWI C;  2JJ2 G;  2GDS A;  5LOV A;  4JI4 O;  1M93 A;  1N4C A;  1DTO A;  1G6U A;  1VF7 A;  5FPR A;  1HNW B;  4R50 A;  2DMX A;  1HNZ B;  4U3J A;  1YEW A;  4O4L A;  3JAS A;  4O4J A;  2KKW A;  2YXH A;  4MVQ A;  2P06 A;  5EBM C;  3JCZ A;  1IDS A;  4Z1V A;  2WLL B;  2QKS A;  5JCO C;  2K1E A;  4RQE A;  3K5L A;  4GX5 A;  2DN9 A;  2HLD G;  3OEH G;  1VQ7 V;  5B5E Z;  4ZOL B;  3GWO A;  1ZLZ A;  4J7Z A;  3ICX A;  1MA1 A;  1HNW O;  1E1R G;  4UCR A;  4CH3 A;  1HNZ O;  2EZP A;  1ZL8 B;  3K0D A;  1ORQ C;  4AI8 A;  1GM7 A;  2YEV B;  2VS0 A;  5JH7 B;  1L0L H;  5LA6 A;  1N32 B;  1NZ6 A;  4B3T B;  4JZ2 A;  2DWD C;  1JA8 A;  3JD1 A;  3AK1 A;  4JI8 B;  4RUE A;  1P84 F;  3ABM B;  4EFB A;  1OCZ C;  4ZKI A;  1TA8 A;  4UV9 A;  5L3C A;  5KHK A;  3FB5 C;  3QF7 A;  3RYC B;  1K4C C;  1HNX B;  2XAF A;  5BXZ A;  3RYF A;  3BPZ A;  3K06 A;  4B3T O;  2XOK G;  2JGD B;  3D36 A;  1KEC A;  1CP9 A;  4QE7 A;  4JI8 O;  3L71 H;  1NJI W;  1VQ5 V;  1JFF B;  5FNV B;  3HKB B;  2AZ0 A;  2KG7 B;  4CH5 A;  2N74 A;  2Q67 A;  4XDL A;  4JYA B;  4Z1M G;  1JQ0 A;  3SPH A;  2XAH A;  2WAM A;  4ZI7 A;  4JI0 B;  1M56 B;  1HNX O;  1F4N A;  5KA5 A;  5LGU A;  1EZJ A;  5AG2 A;  1AP5 A;  2QR4 A;  1AI6 A;  1GH6 A;  4I4T A;  3IC7 A;  3UO3 A;  3CJH A;  1WB7 A;  2DQ3 A;  1FJG B;  2ZE8 A;  4JYA O;  1VQK V;  4YY3 B;  5KHJ A;  3OE7 G;  4J80 A;  4LF7 B;  2UU9 B;  1W0K G;  3E86 A;  1AB3 A;  4JI0 O;  2BTQ A;  2W6I G;  4WFG A;  3OTO B;  3J80 N;  4B08 A;  3B8M A;  5CA0 A;  3G6E V;  1OZ0 A;  3BAB A;  1SS3 A;  3RVY A;  4X1K A;  2QM4 A;  4FLX A;  4WBN A;  4FK5 C;  1SQV H;  1I0H A;  2OCC C;  1P7B A;  4TSF G;  1FJG O;  1HWY A;  4AQY B;  1TVK A;  4LF7 O;  1OCO C;  2UU9 O;  5EIB C;  1G1X B;  3FFQ A;  3JD0 A;  4X66 B;  1WPB A;  3T1C A;  3OTO O;  2X6B A;  3CMA V;  3F7Y C;  1QR9 A;  3K79 A;  2ZNJ A;  1OCC B;  2P4K A;  4GYC B;  4JZG A;  4LF6 B;  2IW5 A;  4UUJ C;  5B66 Z;  4AQY O;  4WCE V;  3RBZ A;  3FYE B;  3HB3 B;  2IJI A;  5JJJ B;  1KUQ A;  3QO5 A;  4X66 O;  1F23 A;  4PA6 A;  4FMT A;  3CCS V;  4ABM A;  4CH4 A;  3CC7 V;  4HZ3 A;  2BSK A;  2E3C A;  3JAW B;  1NT2 B;  2Z3Y A;  4LF6 O;  1GN3 A;  2VQE B;  5LHH A;  4I5S A;  4X8A A;  1XL6 A;  3K03 A;  1WB8 A;  2EIK C;  3ETQ A;  4Q20 A;  4DV1 B;  2H94 A;  3ABL B;  1IBK B;  3H1L H;  2QKC A;  3E8F A;  1QVG U;  4U3F H;  2E5L B;  3SJB C;  4MVM A;  2Y0I A;  2PTM A;  2F1M A;  3L75 H;  2CTW A;  4FZ1 A;  5J2U B;  1VQL V;  3LUT B;  3KG2 A;  4DV1 O;  2A06 H;  2OWO A;  4OGQ B;  3A0B Z;  2DE0 X;  4EB6 A;  1IBK O;  1M5I A;  5GTI Z;  1Q43 A;  2E5L O;  2NR5 A;  2XHB A;  1GM8 A;  5LMN B;  4MVO A;  4LFA B;  3GWK C;  5IYZ B;  2EIL C;  1VQ8 V;  4PI0 A;  2NN4 A;  1KYO F;  2EX3 A;  2PGG A;  3U10 A;  3CCE V;  4FM2 A;  1DK1 A;  1KQS U;  3CPW U;  2YS8 A;  1JVM A;  4HBN A;  5E79 Z;  1P7G A;  1Q6H A;  4UV8 A;  1SA0 B;  5KHI A;  3F5W C;  5IYD O;  3N27 A;  5LMN O;  2QA4 V;  4LFA O;  1AP6 A;  3ZHS A;  4MW3 A;  4DW0 A;  4LBE C;  4TWK A;  3UO2 A;  2VWJ A;  3SDL A;  1YTF B;  4ZHQ B;  3UCS C;  3VOU A;  1SQQ H;  3R66 A;  2HR3 A;  2DWE C;  3CB2 A;  1ARO P;  3SYP A;  4CZZ A;  3IAY A;  5GTH Z;  2GTS A;  5C93 A;  4LF9 B;  2JGD A;  4U7N A;  4WFB V;  4X1Y A;  2ZCE A;  3HKB A;  2GV9 A;  1O9H A;  3JAL B;  2FTK A;  1Y4M A;  2F4V B;  2EUL A;  3E2E A;  4G2K A;  3ABK B;  2QE7 G;  4JI5 B;  2XAG A;  1SQX H;  4B3S B;  3U0Z A;  4PDV A;  3ASO B;  1QVF U;  2WLI B;  4LF9 O;  2PI4 A;  1FPO A;  3SYC A;  4TV8 B;  2R72 A;  1JX9 A;  5B1A B;  4UCT A;  1TAE A;  2RMK B;  4P2Z A;  2ARH A;  2WLK A;  5JQG B;  4I9Q A;  2F4V O;  1RM1 C;  3I56 V;  1GAX A;  1FKA O;  2WSS G;  4LWS B;  5FPO A;  4JI5 O;  4B3S O;  2XAS A;  1S77 D;  4IIJ B;  1QQC A;  2ZNI A;  2ZM6 B;  3UT5 A;  2Y48 A;  5BY1 A;  3OEE G;  5JJE B;  3G6B A;  2CUG A;  3H1I H;  4CS4 A;  1PKX A;  2MW2 B;  1QHT A;  1FS0 G;  4IL6 Z;  1YVW A;  4L8J A;  3VQY A;  1I5X A;  1IBM B;  2ZM6 O;  4YJ3 A;  4QPJ A;  1Z5V A;  3OR7 C;  1YDX A;  2QSA A;  1W59 A;  2DJV A;  4RUF A;  1VQ9 V;  2ZR3 A;  1AJQ A;  2OYQ A;  1Z2G A;  1YJ9 V;  5B3S C;  1XHX A;  4AHC A;  2HJD A;  3TXS A;  2Y4T A;  4GUN A;  3OMI B;  3CRC A;  3AG3 B;  1WLE A;  3E22 B;  3JAW A;  4HNA A;  1MZF A;  2IJK A;  3K5M A;  1Q8I A;  2EIM B;  4RAI A;  3RW0 A;  1H38 A;  1IX9 A;  2ZXW C;  1R6T A;  3KKY A;  3CRQ A;  3QG5 A;  2Z5U A;  3LSQ A;  1P4R A;  5GON B;  2D3O W;  4Z2W A;  5LGN A;  4D7S A;  3EVK A;  5CMU A;  5J2U A;  1TUB A;  4PJ0 Z;  3JAK B;  3D3Q A;  1F4M A;  2UUA B;  3CC2 V;  2RJZ A;  1MSD A;  3QTC A;  1D5A A;  4H0L B;  3OUS A;  1OCR C;  4TV9 B;  4O2A B;  4LC1 A;  1J5E B;  1JPX A;  1M57 B;  3X2Q B;  1N34 B;  1FXV A;  1D5N A;  2JRI A;  1XRE A;  3AG2 C;  4BR6 A;  1ZTE A;  2OTL V;  2UUA O;  1H2G A;  1SA0 A;  1WNS A;  3RYH A;  3CHX A;  1XNR B;  5F2V O;  2Q0O C;  1NVP B;  1R6N A;  4JTC B;  4O4I B;  1AJN A;  4GLX A;  1ZAU A;  3A8T A;  4LFC B;  1BZK A;  1XMQ B;  4X20 A;  5DN6 G;  2Y69 B;  1J5E O;  5JVD B;  1N34 O;  1I94 B;  1K5Q A;  3MHH C;  4O4H B;  5CA3 A;  1PPJ H;  1S76 D;  4PI2 A;  1SZX A;  1Q6U A;  4ZHQ A;  5IE9 A;  3E8G A;  2QWO B;  4K8X A;  4K0K B;  5CA1 A;  1N0N A;  1XNR O;  5K1P A;  4KUM A;  3O65 A;  5B1O A;  4YJ2 A;  1VQP V;  1KBH A;  4LFC O;  5IJ9 A;  2ILM A;  2HP8 A;  1AJP A;  2XT9 A;  4NYK A;  1XMQ O;  2LGW A;  1N36 B;  4R7C A;  1XI1 A;  1SER A;  2DYS B;  1I94 O;  4A5U B;  4J7K A;  5LHI A;  3C90 A;  4DV2 B;  2CTP A;  3I5D A;  4NXN B;  4K0K O;  1SES A;  2WLN A;  2A3Q A;  1R6K A;  1I08 A;  2A9H A;  3M7M X;  4PA7 A;  2MK3 A;  1RPO A;  4BIZ A;  2WLI A;  3R65 A;  5EK0 A;  4JI3 B;  1QR8 A;  1LUW A;  3SPI A;  5IT9 N;  1N36 O;  4D7T A;  1VMG A;  3ZMS A;  1CPY A;  1YJW V;  3BEH A;  2Q9L A;  5JQG A;  4DV2 O;  3AG1 B;  1PNM A;  3E83 A;  1VQM V;  3OAA G;  1Y74 B;  1AR4 A;  4NXN O;  4K3A A;  2WLM A;  2EIJ C;  2UXN A;  1RP3 B;  1GTO A;  4O2B B;  1XEQ A;  4IIJ A;  1FFX A;  4X1I B;  4JI3 O;  1WN7 A;  2QEX V;  4Q6G A;  4H44 B;  5LGT A;  4J41 A;  1H2K A;  1VP7 A;  2LFR A;  2V1D A;  1H2S B;  4WFF A;  4BW9 A;  5JWP A;  3G4S V;  4I50 A;  2AZ2 A;  1WP7 A;  3BA8 A;  1M9N A;  4DV6 B;  2PUS A;  3A2F A;  4AIL C;  2RNB A;  4IGG A;  3ZBH A;  1OHH G;  4UCS A;  4F6E A;  3ASN C;  1KD1 W;  4NKG B;  2H8P C;  1FAF A;  4PA3 A;  1WA8 B;  2IU0 A;  5LYJ B;  3RN4 A;  1SET A;  1EFR G;  3JD4 A;  2PY5 A;  1L0N H;  2YC0 A;  1MOF A;  3CCL V;  1YHQ V;  1RSO B;  3OGI B;  3L9D A;  2QWP B;  3APO A;  4OX9 B;  2Q6A A;  3E22 A;  5DEC A;  1N32 O;  4R6Z A;  2CGN A;  5BZB A;  2UXC B;  2JS3 A;  1PNK A;  3JSL A;  2VRZ A;  2CK3 G;  2R70 A;  1M90 W;  3W7W A;  4DUZ B;  3ZJZ A;  1L8D A;  4LR3 A;  1VQN V;  4UVB A;  1U97 A;  1GMG A;  3BFR A;  5GON A;  4CS2 A;  4OX9 O;  3I55 V;  1GN4 A;  4GX0 A;  1UFI A;  3B40 A;  2UXC O;  3JAK A;  2Q7G A;  1XBL A;  4D6T H;  4MT8 A;  4J9Z B;  1JJO A;  3MAQ A;  3LDE A;  5KLV H;  4DUZ O;  2P67 A;  4UB8 Z;  4MTX A;  5L3G A;  5TIS Z;  4LH6 A;  4TV9 A;  1BT8 A;  1OCZ B;  4O2A A;  3JAR B;  5KHG A;  1GN2 A;  4E4E A;  3F5T A;  2WLJ A;  4QNH B;  2UUC B;  3WB2 A;  1AVM A;  1T5E A;  1JR9 A;  1GM9 A;  5EZY B;  1BCC H;  1I5Y A;  3H1H H;  2WA4 A;  3ZRV A;  1B3Q A;  3P3P A;  3D8C A;  3ZN0 A;  1HW7 A;  2M6Y A;  4YY3 O;  4NB5 A;  4NR1 A;  2LP7 A;  2UUC O;  1K33 A;  2B1G A;  4QPK A;  4PA4 A;  3CWB H;  4NTX A;  3TET A;  3MDS A;  3WG7 C;  3CXC U;  5LBQ A;  2RDC A;  2P22 C;  2XAQ A;  4FFK A;  3G80 A;  4X88 A;  2YI9 A;  1H8E G;  1W0J G;  3ZMU A;  4X64 B;  3T4D A;  2YIA A;  4IHJ A;  4ZBM A;  1AR1 B;  1Y76 A;  3RFR A;  2ZDI C;  3WFV A;  1NU1 H;  5H6R A;  4W4L A;  4FPP A;  2WLH A;  2ADQ B;  3G67 A;  4LP8 A;  4FLY A;  5LP6 B;  4DXW A;  3ZED A;  3CD6 V;  1EZV H;  2EJR A;  2NNU A;  1UPG A;  3HKC B;  3BAA A;  2XAJ A;  2HHH B;  1GO3 F;  3ZCC A;  4DRX A;  3VQV A;  3J81 N;  4X64 O;  5IY5 C;  3AEI A;  2LJ2 A;  2Z0A A;  1THZ A;  3IJ4 A;  5CBH A;  2OCC B;  1CXZ B;  1OCO B;  1XIL A;  3CCM V;  1ZUQ A;  4DUY B;  1S5L Z;  3N2G B;  2N05 A;  1VAR A;  2V4D A;  1NQT A;  1Y74 A;  3SGI A;  5IJ0 B;  1K97 A;  2HHH O;  4HYO A;  1KKC A;  2B1I A;  4FLZ A;  1QLE C;  1GN6 A;  2LFS A;  2VQE O;  4LNU B;  3P3N A;  1WJZ A;  2P7T C;  2WLL A;  3Q4H B;  4XDK A;  3T2M A;  5DM6 V;  3HPL C;  3EXA A;  2EIN C;  4I0X B;  2ZR2 A;  4ZOL A;  3K5N A;  4DUY O;  3ABT A;  4JI6 B;  5L3D A;  2OIG A;  5EBL C;  3G71 V;  3C3S A;  4DR6 B;  2JS5 A;  1R3L C;  3WB0 A;  1YZB A;  1ZL8 A;  2HFE C;  1TUE B;  1VF6 A;  2ZIM A;  3F7V C;  1IXB A;  4JAA A;  5CB4 B;  1V54 C;  1FXK C;  2A0L A;  2YEV A;  2Q68 A;  4GT1 A;  4GZR B;  4JGS A;  5KAI Z;  5KHH A;  5JH7 A;  2LQT A;  4K8Z A;  5A2Q N;  1SQB H;  4GCZ A;  5FLX N;  4JI6 O;  2IBZ H;  4X89 A;  4WF9 V;  1NBM G;  4DR6 O;  2BOB C;  4IYH A;  2QDO A;  1KU9 A;  1XQ8 A;  4GX2 A;  1RSO A;  5KX5 B;  4FLV A;  2QWN B;  4X62 B;  3ASO C;  3DXR B;  3RYC A;  2E76 B;  4K35 A;  3CCV V;  5GW7 A;  3C3T A;  2BTO A;  1LUV A;  2DOS A;  2OIE A;  5H9C A;  4B3M B;  2WWW A;  4FM0 A;  1SQP H;  3L72 H;  2LGQ A;  4DV0 B;  5IYB O;  1JFF A;  5FNV A;  4CC6 A;  5BMV B;  2EIL B;  2KG7 A;  3UM7 A;  3CXH F;  3FAV B;  4TQD A;  1DLB A;  3ETG A;  1PL0 A;  2IH3 C;  4RO2 A;  2DYR C;  4X62 O;  1L1F A;  5J2T B;  3OMA B;  2YIB A;  4B3M O;  1K34 A;  5B1N A;  5IYC O;  2CH7 B;  1Q81 W;  5EC1 C;  1R3J C;  3UKM A;  4MVS A;  4DV0 O;  2FKX A;  1H8H G;  5KMG B;  3HR0 A;  3J7A U;  2IH1 C;  1YIJ V;  1YJN V;  1MSW D;  3H1J H;  2BE3 A;  2HKO A;  3W7T A;  2YIC A;  5ITZ B;  1Q86 W;  1K8A W;  1S3J A;  2IU3 A;  3ZIA G;  5EZY A;  2LO1 A;  4JI1 B;  5EIB D;  2JJ1 G;  5LOV B;  1OJH A;  4JI2 B;  2F43 G;  3ZMT A;  4U7O A;  3THO A;  2X0L A;  3EFF K;  5KA6 A;  4U3J B;  1PP9 H;  2IJJ A;  2N04 A;  4FLT A;  4O4J B;  2ZD9 A;  3CX5 F;  2R9A A;  2BCC H;  1NKD A;  2P6J A;  1AI5 A;  3ZRX A;  3NXS A;  4G27 B;  3H9V A;  1WAZ A;  2X7R B;  3APQ A;  4JI1 O;  4XDJ A;  1NTM H;  3ZHU A;  1Q3E A;  3LNN A;  4TUY B;  2R9I A;  4JI2 O;  3D36 C;  1RFY A;  3BCC H;  1BS3 A;  4C7U A;  2P4V A;  4UVC A;  1KC8 W;  4YIO A;  4R8C A;  3CCU V;  1RM1 B;  2WPD G;  3A0R A;  5LP6 A;  3STL C;  3ETD A;  5LL6 Y;  1B6Q A;  1SRY A;  1NH2 B;  4OPH A;  1VQ4 V;  2PYJ A;  3HKC A;  1IBM O;  4DR2 B;  1R3K C;  2Y4U A;  1V55 C;  1BQZ A;  4EEQ A;  3LNM B;  1FYJ A;  3OTF A;  3W7U A;  1KKD A;  1VQO V;  4UXN A;  3PJS K;  4TQF A;  2Q8V A;  2LW1 A;  4H33 A;  4WFH A;  1DF5 A;  1MAB G;  5KUM A;  1G8M A;  3RT3 C;  4PDR A;  2Q5Z A;  3E8B A;  4P9P A;  4ZIB A;  3BHP A;  1XHZ A;  1YTF D;  5J9P C;  4J42 A;  2B9Z A;  3CP1 A;  3X2Q C;  3GVM A;  3AG4 B;  4DR2 O;  4LF4 B;  3M99 B;  3BY6 A;  5IJ0 A;  3CRM A;  3RYF B;  4FLW A;  2F93 B;  3K04 A;  3TK1 A;  5C8Y B;  4DYL A;  5EBW C;  1F51 A;  4P9O A;  4LF5 B;  3JAT B;  1Y66 A;  3SJA C;  2L35 A;  2QKA A;  1ZX3 A;  3RVZ A;  1SZT A;  3PN1 A;  4QGP A;  4GX1 A;  5B3S B;  2Y69 C;  1XUQ A;  4LF4 O;  5H6Q A;  4JAS A;  2HJF C;  5IYZ A;  4H37 A;  3B8N A;  5HFL A;  1GRJ A;  4LF5 O;  4KL1 A;  1FD9 A;  3ZRS A;  3GB7 C;  1NI8 A;  5EC2 C;  4I4T B;  1JJ2 U;  2ZE7 A;  1TGO A;  4BAY A;  4KXR A;  3ZN1 A;  1FXH A;  3SR2 C;  4BW5 A;  2BTQ B;  2Q73 A;  3BVO A;  3RWR D;  3RYI B;  5CA0 B;  5KX5 A;  4MVU A;  1BGY H;  2ITD C;  1SQG A;  3FYI B;  4WBN B;  4JI7 B;  3OFN G;  4DR3 B;  3DXR A;  5B1B C;  1TVK B;  2E74 B;  5D5P A;  4DV4 B;  2YDE A;  1G4Y B;  3B77 A;  1MG1 A;  1GK9 A;  3JAL A;  3AG7 A;  2PYL A;  2KQX A;  2G38 A;  3K3W A;  1VEW A;  3STZ C;  5L3E A;  3AG2 B;  3ML0 A;  4JI7 O;  4DR3 O;  2JGU A;  4DW1 A;  3CRA A;  3CCQ V;  4YIP A;  3ETE A;  4RWU A;  1S5J A;  1Y6X A;  2DW4 A;  2CH7 A;  1S72 V;  4TV8 A;  2YSU B;  1BHB A;  4DV4 O;  1AI4 A;  4LCU C;  4W4K A;  1GKF A;  3B09 A;  3FB6 C;  1VF6 C;  2EJ7 A;  1PNL A;  1JCH A;  1MZE A;  4LWS A;  1EN6 A;  1J95 A;  2GHY A;  2P90 A;  2JEX A;  2JEU A;  2Q4P A;  2F23 A;  1H2L A;  3DC6 A;  1X59 A;  3UQ8 A;  2PZS A;  4MS2 A;  1QNM A;  1IXM A;  4PV1 B;  3ABM C;  2Q69 A;  2HVK C;  3CRR A;  2F66 C;  2KB1 A;  3MHS C;  3BRC A;  3B2E E;  5CN0 A;  3LDC A;  3K9S A;  4I7Z B;  2JDI G;  1BMF G;  3L73 H;  2CAZ C;  3SPC A;  4EB6 B;  4MTG A;  3FB7 C;  4TUY A;  3JSN A;  4NXM B;  4FJC C;  1PL4 A;  2AGA A;  4JYB A;  5DED A;  1E79 G;  2AHY A;  1N33 B;  3L74 H;  5LHG A;  1SKV A;  4DV6 O;  5CBF A;  2EIJ B;  4J9Y B;  3IFX A;  2FB5 A;  4LH7 A;  1M56 C;  1XNQ B;  1Q5O A;  1LNQ A;  2UUB B;  2QWQ B;  3DGE A;  1NVP D;  4NXM O;  2RN9 A;  3ZMZ A;  2PI5 A;  3P32 A;  2UXX A;  1N33 O;  1MNG A;  1XDC A;  3E8H A;  3P30 A;  3JD3 A;  2IJH A;  2JK5 C;  4PA9 A;  3VQX A;  2R9R B;  1E1Q G;  1XNQ O;  1PD3 A;  1US6 A;  2JIZ G;  1A32 A;  2UUB O;  1EN4 A;  5C8Y A;  2WA3 A;  3ASN B;  4RQF A;  3JAT A;  4LFB B;  4X1Y B;  3CSX A;  2ATK C;  2B5U A;  2X6A A;  2QM8 A;  5EYP B;  1Q6I A;  1M4U A;  3ZHQ A;  1NR7 A;  5H5N A;  2HEP A;  1OCC C;  1PM9 A;  1EBO A;  4LFB O;  3N2K B;  3AK3 A;  3K57 A;  4JTA B;  4FFB B;  3B4S A;  4DV7 B;  1XMO B;  2UXB B;  4J11 A;  1JMK C;  3ABU A;  1Q90 D;  5LP6 C;  4O4I A;  2PF4 E;  2ZKO A;  1HDJ A;  1IBL B;  2ZQM A;  2RQ6 A;  4TOI A;  3CCR V;  3HKE B;  5JVD A;  3OMN B;  3RYI A;  4WFE A;  4O4H A;  4MTO A;  3UT5 B;  3TXQ A;  2OCH A;  2ZE5 A;  3DTU B;  2BOC C;  2YXY A;  4DV7 O;  1XMO O;  3CEI A;  4QE9 A;  2UXB O;  2YID A;  1K7D A;  4X65 B;  1LR1 A;  1QBZ A;  4GKK B;  4JYY A;  5E1A C;  4QIW F;  1ZSP A;  3ABL C;  1BSM A;  2CGO A;  1IBL O;  1QCE A;  4PD4 F;  2A7W A;  5LMU B;  3M8A A;  4CBC A;  1QLN A;  4YJ3 B;  3O9O A;  1HP8 A;  2Q7E A;  1AI7 A;  1I7F A;  5CBG A;  1SF9 A;  4X65 O;  1XOU A;  4GKK O;  3ZMV A;  4BIU A;  3T4Z A;  1WPX A;  1DF4 A;  3CE2 A;  1YF2 A;  3T1H B;  5LMU O;  2EZO A;  4LF8 B;  3LSS A;  4FIP C;  4B7K A;  1YXB A;  4HNA B;  4MTF A;  1KMI Z;  3WG7 B;  5H2F Z;  4O2B A;  5BR8 B;  4I55 B;  4X1I A;  1K5S A;  4FM1 A;  1K4D C;  3U11 A;  4CH6 A;  3T1H O;  1S0V A;  3OM3 B;  3JCU Z;  4LF8 O;  1MMM A;  4F4L A;  1H2N A;  4JYC A;  3TGU H;  4DR4 B;  2QTO A;  2C2A A;  4PDL A;  1K3E A;  5A9G A;  2GUZ B;  2NLJ C;  1WP8 A;  5KAF Z;  4PHZ A;  5LXT B;  4P30 A;  2YIB D;  2UXD B;  1TUB B;  5BR8 O;  1Q82 W;  1SC5 B;  1NTK H;  1W2B U;  5IY5 B;  1N0J A;  3OD4 A;  2EIK B;  4KFM A;  4MVR A;  2XUM A;  3WB1 A;  4DR4 O;  3SJC C;  3KZI Z;  4BIO A;  2Q0A A;  1WA8 A;  3HKD B;  5LYJ A;  4NTY A;  4E2L A; 
#chains in the Genus database with same CATH homology
 1R3K C;  3IC7 A;  4BIZ A;  1V55 C;  2WLI A;  2DQ3 A;  3R65 A;  4MVZ A;  5EK0 A;  1QR8 A;  1VQK V;  3LNM B;  3SPI A;  3OE7 G;  1Q7Y W;  3ABK C;  3QO7 A;  3ZMS A;  3SPG A;  3W7U A;  1VQO V;  1CPY A;  1KKD A;  4UXN A;  1QLE B;  5KUK A;  1YJW V;  3BEH A;  1W0K G;  3E86 A;  3PJS K;  2W6I G;  4H33 A;  4WFG A;  4WFH A;  1DF5 A;  1MAB G;  5KUM A;  3AG1 B;  3B8M A;  1PNM A;  3E83 A;  1G8M A;  1VQM V;  3OAA G;  4EKW A;  3G6E V;  4PDR A;  3W7X A;  2EIN B;  1OZ0 A;  2WLM A;  3E8B A;  4P9P A;  3RVY A;  2EIJ C;  1YTF D;  2UXN A;  5J9P C;  1GTO A;  5B1A C;  3CP1 A;  4FK5 C;  3X2Q C;  3AG4 B;  3M99 B;  2OCC C;  1P7B A;  3BY6 A;  4TSF G;  1HWY A;  2M7W A;  3FKS G;  3K04 A;  1OCO C;  3TK1 A;  4JTD B;  2QEX V;  5EBW C;  1F51 A;  4P9O A;  3CME V;  3JD0 A;  4DO2 A;  5LGT A;  1Y66 A;  3T1C A;  2V1D A;  2LFR A;  1V54 B;  2X6B A;  3CMA V;  4WFF A;  3RVZ A;  1SZT A;  1FXK B;  3F7Y C;  1QR9 A;  3K79 A;  1JOY A;  3G4S V;  4GX1 A;  5B3S B;  1OCC B;  2Y69 C;  1M9N A;  2HG5 C;  3CCJ V;  2IW5 A;  4UUJ C;  5H6Q A;  1OHH G;  4JAS A;  2HJF C;  4OXS A;  4H37 A;  4WCE V;  3RBZ A;  3FYE B;  3B8N A;  2OT5 A;  3ASN C;  3ZRW B;  3HB3 B;  1KD1 W;  5HFL A;  3CC4 V;  2IJI A;  3W7S A;  1CEZ A;  2H8P C;  3QO5 A;  4PA3 A;  4I9W A;  1F23 A;  4PA6 A;  2IU0 A;  3ZRS A;  3GB7 C;  4FMT A;  5EC2 C;  4MSW C;  1SET A;  1S5H C;  3CCS V;  1UJW B;  1EFR G;  3JD4 A;  4MW8 A;  1JJ2 U;  3CC7 V;  3QNE A;  4HZ3 A;  3JYC A;  1MOF A;  2Z3Y A;  3CCL V;  4BAY A;  3ZN1 A;  5IDJ A;  1YHQ V;  5LHH A;  1FXH A;  4BW5 A;  1XL4 A;  4I5S A;  4JF3 A;  3CYO A;  4X8A A;  1XL6 A;  3K03 A;  2EIK C;  4Q20 A;  2Q6A A;  1R73 A;  1R3I C;  3H01 A;  2H94 A;  3D3I A;  1ROP A;  4R6Z A;  3ABL B;  4MVU A;  2QM7 A;  2ITD C;  5BZB A;  4XBF A;  1PNK A;  3FYI B;  3E8F A;  3OFN G;  1QVG U;  3OUF A;  2CK3 G;  2X6C A;  3OGC C;  2DYR B;  3AG3 C;  1M90 W;  3W7W A;  4MVM A;  5B1B C;  3VBB A;  3ZJZ A;  4WFA V;  2EIM C;  1VQN V;  4UVB A;  5FL7 G;  1VQL V;  3LUT B;  1GMG A;  3KG2 A;  3I55 V;  1G4Y B;  3B77 A;  1MG1 A;  1GK9 A;  2EBO A;  4GX0 A;  3K3W A;  3STZ C;  5L3E A;  3AG2 B;  2ITC C;  3ML0 A;  3AG4 C;  3TCU A;  4MT8 A;  3CCQ V;  1GM8 A;  4J9Z B;  4MVO A;  3LDE A;  3ETE A;  3K0G A;  2EIL C;  1VQ8 V;  2P67 A;  4MTX A;  5L3G A;  2DW4 A;  1YIT V;  3OW2 U;  3CCE V;  3LDD A;  1S72 V;  1OCZ B;  1KQS U;  2YSU B;  2W0F C;  3CPW U;  1BHB A;  2V7Q G;  2WLJ A;  4HAM A;  4QNH B;  1AI4 A;  4JAU A;  1JVM A;  4LCU C;  4UV8 A;  3F5W C;  1GKF A;  5IYD O;  3FB6 C;  1PNL A;  1GM9 A;  1JCH A;  1J95 A;  1I5Y A;  2QA4 V;  2GHY A;  1M57 C;  2P90 A;  3E89 A;  4MW3 A;  2JEX A;  4LBE C;  3ZRV A;  2JEU A;  4TWK A;  3ZN0 A;  3E35 A;  1YTF B;  2LP7 A;  3SYA A;  4JAV A;  4MS2 A;  4UVA A;  3VOU A;  3SPJ A;  4ASU G;  3JD2 A;  3SYQ A;  1K33 A;  2B1G A;  1IXM A;  2A79 B;  4QPK A;  2HR3 A;  2DWE C;  3ABM C;  2ZDI A;  4PA4 A;  1ARO P;  2Q69 A;  2AHZ A;  3SYP A;  2HVK C;  4CZZ A;  1M1K W;  3TET A;  1K92 A;  3WG7 C;  3CXC U;  5C93 A;  5LBQ A;  2XAQ A;  3EHB B;  4U7N A;  4WFB V;  1YI2 V;  2KB1 A;  3MHS C;  4X88 A;  1N8R W;  1H8E G;  1W0J G;  3ZMU A;  5L3B A;  5CN0 A;  3T4D A;  4ZBM A;  1AR1 B;  2ZDI C;  3LDC A;  3WFV A;  5H6R A;  2FTK A;  1Y4M A;  1V55 B;  1BMF G;  1YSC A;  2JDI G;  4FPP A;  3SPC A;  2WLH A;  4MTG A;  3E2E A;  4L87 A;  3FB7 C;  4G2K A;  4LP8 A;  3ABK B;  4DXW A;  3CD6 V;  4FJC C;  4JYB A;  2EJR A;  2QE7 G;  1BL8 A;  1E79 G;  2AHY A;  2NNU A;  2XAG A;  4KP4 A;  5LHG A;  4PDV A;  3ASO B;  1QVF U;  2WLI B;  2XAJ A;  2PI4 A;  3SYC A;  2ZXW B;  1GO3 F;  1COW G;  3ZCC A;  5CBF A;  2DYS C;  2EIJ B;  1JX9 A;  3IFX A;  4J9Y B;  5B1A B;  4YXW G;  5IY5 C;  3AEI A;  2GSM B;  1M56 C;  1THZ A;  4P2Z A;  1RPR A;  5CBH A;  2OCC B;  2WLK A;  4PDM A;  1KP2 A;  1LNQ A;  3SYO A;  3DGE A;  1RM1 C;  1NVP D;  4JPR A;  3I56 V;  4TT3 G;  3ZMZ A;  3CCM V;  1OCO B;  2PI5 A;  2WSS G;  3P32 A;  2UXX A;  5HFM A;  1VQ6 V;  2XAS A;  4QJF B;  1S77 D;  3E8H A;  1NQT A;  1K97 A;  3JD3 A;  2IJH A;  3P30 A;  2Y48 A;  2B1I A;  2JK5 C;  4HYO A;  4PA9 A;  4N23 A;  3OEE G;  1QLE C;  2LFS A;  2R9R B;  1E1Q G;  1K9M W;  2XND G;  1OCR B;  2HVJ C;  1ENV A;  2P7T C;  2WLL A;  3AG1 C;  1PD3 A;  1NR1 A;  4XDK A;  1PKX A;  3T2M A;  2JIZ G;  1BHA A;  5DM6 V;  3HPL C;  2EIN C;  1KP3 A;  3SJQ C;  1FS0 G;  2ZR2 A;  3ASN B;  4RQF A;  3ABT A;  1K73 W;  4PEL A;  5L3D A;  1I5X A;  5EBL C;  3K08 A;  2ATK C;  3G71 V;  2B5U A;  1FXK A;  4QPJ A;  1R3L C;  2DQ0 A;  2X6A A;  3MD0 A;  2QM8 A;  2HFE C;  1TUE B;  3OR7 C;  3F7V C;  4RUF A;  1VQ9 V;  1V54 C;  2ZR3 A;  1AJQ A;  1NH2 D;  3IGA C;  1YJ9 V;  1FXK C;  2A0L A;  1NR7 A;  2Q68 A;  2YEV A;  4GT1 A;  4JGS A;  2OTJ V;  5B3S C;  3ZRW A;  1OCC C;  3QO8 A;  3FB8 C;  1EBO A;  4GCZ A;  4JTA B;  5L3F A;  1FFT B;  2W6J G;  4X89 A;  4WF9 V;  1NBM G;  4N21 A;  3K9A A;  4G28 B;  3OMI B;  3AG3 B;  2BOB C;  3ABU A;  1WLE A;  5B1B B;  3OR6 C;  4GX2 A;  2IJK A;  1ZWI C;  2JJ2 G;  2EIM B;  4RAI A;  3RW0 A;  2ZQM A;  1DTO A;  3CCR V;  1H38 A;  3ASO C;  3OMN B;  4R50 A;  4WFE A;  2ZXW C;  4MTO A;  3CCV V;  5GW7 A;  5H9C A;  3DTU B;  2BOC C;  4QE9 A;  2WWW A;  4MVQ A;  5EBM C;  2Z5U A;  1K7D A;  3JCZ A;  2WLL B;  2QKS A;  3LSQ A;  1P4R A;  5IYB O;  2K1E A;  1QBZ A;  4RQE A;  2D3O W;  2EIL B;  3UM7 A;  5E1A C;  4QIW F;  4GX5 A;  2HLD G;  3OEH G;  5LGN A;  1VQ7 V;  3ABL C;  1DLB A;  3ETG A;  3GWO A;  5CMU A;  1QCE A;  1PL0 A;  2IH3 C;  4RO2 A;  1F4M A;  2DYR C;  1E1R G;  4CBC A;  1L1F A;  1QLN A;  3CC2 V;  3OMA B;  2EZP A;  1K34 A;  1AI7 A;  5CBG A;  3K0D A;  5B1N A;  3OUS A;  5IYC O;  1OCR C;  1Q81 W;  5EC1 C;  1R3J C;  3UKM A;  4MVS A;  4LC1 A;  1ORQ C;  1JPX A;  1H8H G;  1M57 B;  1GM7 A;  2YEV B;  3X2Q B;  3ZMV A;  3T4Z A;  1FXV A;  4BIU A;  1WPX A;  2IH1 C;  3AG2 C;  1YIJ V;  1DF4 A;  1YJN V;  1MSW D;  2DWD C;  3JD1 A;  2EZO A;  2OTL V;  2HKO A;  3LSS A;  3W7T A;  4FIP C;  1H2G A;  4RUE A;  1Q86 W;  1K8A W;  3ABM B;  1S3J A;  2IU3 A;  4MTF A;  1NVP B;  3ZIA G;  1R6N A;  4JTC B;  1OCZ C;  1AJN A;  3WG7 B;  4ZKI A;  2JJ1 G;  5DN6 G;  2Y69 B;  4UV9 A;  2F43 G;  3ZMT A;  5L3C A;  4U7O A;  1K5S A;  1K5Q A;  3FB5 C;  3MHH C;  2X0L A;  3EFF K;  1K4C C;  5CA3 A;  5KA6 A;  2IJJ A;  1K4D C;  2XAF A;  3K06 A;  2XOK G;  1S76 D;  2ZD9 A;  1S0V A;  3OM3 B;  4F4L A;  4JYC A;  3E8G A;  3D36 A;  1KEC A;  2QTO A;  1CP9 A;  4QE7 A;  1NKD A;  2C2A A;  4PDL A;  1NJI W;  1K3E A;  1VQ5 V;  2P6J A;  4KUM A;  1AI5 A;  3ZRX A;  5B1O A;  1VQP V;  3NXS A;  2NLJ C;  4G27 B;  2Q67 A;  2X7R B;  4XDL A;  4XDJ A;  4P30 A;  1AJP A;  4Z1M G;  1JQ0 A;  1Q82 W;  3SPH A;  2R9I A;  4R7C A;  1W2B U;  2XAH A;  1SER A;  2WAM A;  2DYS B;  5IY5 B;  4UVC A;  5LHI A;  1M56 B;  2EIK B;  1KC8 W;  4KFM A;  1F4N A;  4R8C A;  3CCU V;  5KA5 A;  4MVR A;  5LGU A;  1EZJ A;  1RM1 B;  2WPD G;  3A0R A;  1SES A;  2WLN A;  3STL C;  3ETD A;  1B6Q A;  1R6K A;  2A9H A;  1SRY A;  1NH2 B;  4PA7 A;  1AI6 A;  2MK3 A;  1RPO A;  4E2L A;  1VQ4 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...