2IH3C

Ion selectivity in a semi-synthetic k+ channel locked in the conductive conformation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
98
structure length
97
Chain Sequence
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ion Selectivity in a Semisynthetic K+ Channel Locked in the Conductive Conformation.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords FAB Heavy Chain
total genus 37
structure length 97
sequence length 98
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2ih3C00
4P30A 4GX5A 1XL4A 2IH1C 3JYCA 2HJFC 2ITDC 4LP8A 4MVZA 3SPHA 4UUJC 1XL6A 4PA7A 2W0FC 3PJSK 2R9RB 2Y69C 3E89A 3E8GA 3K0DA 3RBZA 2H8PC 4PDVA 5EC1C 4WFEA 3AG4C 2A79B 2WLJA 2ATKC 3SYOA 2HFEC 3LDDA 1OCCC 3ABKC 1R3IC 3SYPA 2A0LA 3ZJZA 3RW0A 2EIJC 4MVUA 5BZBA 4MVOA 3SYCA 1KKDA 3ZRSA 1P7BA 2DWDC 3WG7C 4RO2A 5CBFA 2WLNA 3FB5C 3T4ZA 5KUKA 4WFHA 4PA3A 1S5HC 4RUFA 5B3SC 1ZWIC 4PDRA 3RVYA 2WLKA 4PA9A 2HVJC 2WLLA 1R3JC 1OCRC 3R65A 4R6ZA 1LNQA 1OCZC 4MTFA 4XDLA 3E8BA 3OR6C 4PDMA 3ABMC 2QTOA 4GX0A 4X88A 2HG5C 5E1AC 4MSWC 4MVSA 1K4DC 2EINC 4LCUC 4WFGA 5KUMA 3OGCC 4HZ3A 2IH3C 1M56C 3IFXA 3K04A 3LDCA 2P7TC 2YEVA 3OR7C 4WFFA 2NLJC 3SPCA 3SPGA 5IY5C 4I9WA 2EIMC 2WLHA 2WLMA 5EK0A 2BOCC 3F7VC 2JK5C 3K08A 4RAIA 3E8HA 1G4YB 4RUEA 4P2ZA 3AG3C 5B1BC 3E8FA 1V55C 3AG1C 4PA4A 3ABLC 3FB6C 1BL8A 2Q67A 3X2QC 3F5WC 2ITCC 4X89A 2OCCC 2X6CA 3RVZA 1JVMA 4F4LA 3GB7C 4H37A 2DWEC 4JTAB 2QKSA 3E86A 3SJQC 2HVKC 1J95A 2KB1A 3HPLC 4QE9A 4EKWA 5J9PC 3ASNC 3OUFA 1QLEC 2EILC 3E83A 1V54C 4MS2A 4XDJA 3SPIA 4LBEC 3UM7A 4DXWA 4MTOA 5EBWC 3T4DA 2ZXWC 2X6AA 2AHZA 2X6BA 3LNMB 3OUSA 3T1CA 4BW5A 4P9PA 3VOUA 2Q6AA 4XDKA 2A9HA 3SYQA 3K03A 3LDEA 4MTGA 3UKMA 3LUTB 4JTCB 4H33A 4PA6A 3K06A 3AG2C 4G27B 5CBGA 3SYAA 4J9YB 4MW3A 4KFMA 3SPJA 2K1EA 3EFFK 5EBLC 4ZBMA 3ASOC 2WLLB 1ORQC 2DYSC 4R7CA 5B1AC 4GX2A 4MVQA 4G28B 4P9OA 2WLIB 5EBMC 4MW8A 1R3KC 3TCUA 1K4CC 3STLC 1R3LC 3KG2A 3TETA 4R8CA 3IGAC 4HYOA 2Q68A 1OCOC 4J9ZB 4TWKA 4OXSA 4CBCA 3FB8C 2AHYA 2DYRC 3BEHA 3K0GA 4MVRA 4MVMA 2ZD9A 4X8AA 4QE7A 2Q69A 2WLIA 4QNHB 5CBHA 1M57C 2EIKC 2BOBC 3FB7C 4GX1A 3STZC 4PDLA 3T2MA 4R50A 3F7YC 5EC2C 4JTDB
chains in the Genus database with same CATH superfamily
4BR6A 1ENVA 2JRIA 2O57A 3CHXA 1CEZA 4NXMB 3KKYA 3U0ZA 2ETNA 4U3JA 4JI1O 1G8MA 2PTMA 3ZMVA 5LGNA 4WFAV 3ZN1A 1NH2D 4FM1A 1PL0A 5BZBA 3JASA 5BMVB 4GKKB 2CH7B 5GW7A 4FLYA 4XDLA 2EILB 2VRZA 1WN7A 2HP8A 3QO8A 4IGGA 4I0XA 1WLEA 1H2KA 2QWNB 4IIJA 4WFGA 3BHPA 3HKBA 3OEHG 4FFKA 3NXSA 3UCSC 4LWSB 2F93B 4RAIA 1WNSA 4TT3G 3CCMV 3BFRA 1YTFD 1OJHA 2YIBD 4B3RO 1N8RW 2EULA 1SQPH 3H1HH 1Z2GA 2YXLA 4O4IB 5KX5B 3OT7A 3UM7A 2DJVA 2ZXWC 3SJBC 4YIPA 4X9QA 3CRRA 2KSDA 4LNUB 2EIKB 2ZNIA 1L0LH 2LFRA 4UV9A 2K1EA 3EFFK 1FFXA 1O9HA 1Q82W 2IU0A 4YIOA 1YSCA 2IM9A 5EYPA 5C8YB 3IGAC 2CTQA 5DEDA 4B08A 4JI0O 2DYRC 2QWRB 3IC7A 3DSQA 2Y48A 2GTSA 4P30A 4JV5B 4DV7B 3CB2A 4JI5O 4UUJC 3HKBB 1XHZA 4NTWA 2R9RB 4ZOLB 1Y4MA 1ROPA 2WLJA 2YIDA 3K9SA 4UXNA 1V55B 2R72A 2XAJA 3OE7G 2ZM6B 1Q8IA 4BAYA 2R9AA 2PUSA 4MTFA 1MSWD 3HKCB 4QGPA 4FZ0A 3MAQA 2EINC 4JI3O 1I5XA 2CDYA 3N2KB 3E22B 3F7VC 3L70H 5B1BC 3CD6V 1V55C 3AG1C 4PA4A 5LGTA 1OV9A 1RSOA 4EFBA 2UUBO 5DM6V 4H44B 5L3CA 4K8XA 1VQ4V 3UT5A 1QVFU 3KCXA 4XDJA 2AHZA 2YIAA 2YIBA 1WA8A 3T1CA 1JQ0A 1L1FA 2QKCA 1R6NA 4X20B 3RFRA 4JYYA 4JPRA 1IZ3A 5IYDO 5KLVH 5CA1A 3H1IH 2WLLB 4Z1MG 3RYFA 1JPXA 4BIOA 1RM1B 3B4SA 3TCUA 1THZA 1IBLB 1BMFG 2EIMB 3D36C 3SR2C 4F6RA 4O4HB 4CBCA 3FB8C 2X7RB 3A8TA 2UUBB 2Y0IA 1RFYA 3QVNA 3FX7A 3GWKC 3VQVA 2Q73A 5EC2C 1SKVA 2Y4TA 3OTOB 2GHYA 4IL6Z 1ZX3A 5LP6A 3JCZA 3K0DA 1JX9A 3QO7A 1H2LA 4GYCB 3CPWU 2ZNJA 3BCCH 3SYPA 3BRCA 2N04A 4MVUA 1H8HG 1WA8B 1QQCA 2EJ7A 2D3OW 3EHBB 4E2LA 4DW1A 4YY3B 4FM2A 4ABMA 2OYQA 4DW0A 3JAKA 1K33A 1K5SA 1NTMH 4X66O 5KX5A 5L3DA 3J7AU 1N34O 4HZ3A 5LA6A 1AILA 5LA6B 2BOCC 1FKAO 1R1BA 3ZRWA 5LP6C 3BA8A 3K3WA 4DV1B 3OW2U 4YJ3A 3FB6C 3EVKA 4JI7O 1F4NA 1PPJH 1HR0O 4O4HA 1XNQO 3MD0A 1XQ8A 4JYCA 4FLZA 1QLEC 3MHHC 5D5PA 1IVSA 1MZFA 1YIJV 2A9HA 3SYQA 4MTGA 3CSXA 1BQ0A 2FB5A 2GV9A 1JOYA 3OTFA 4H13B 4JI4B 1F51A 2HHHO 1Q5OA 3O65A 5JVDA 1LR1A 4N21A 1QU7A 3WB2A 3TXQA 4WBNA 1FS0G 3CCRV 1XI1A 1B3QA 4JTDB 4B3TB 5H5NA 3JYCA 1TUBA 2HJFC 2RQ6A 4GZRB 2WPDG 1AP6A 1X4TA 3WB0A 4UCUA 2UXNA 5CMUA 1TA8A 1AR5A 4KUMA 3SYOA 2HFEC 4D7TA 1KKDA 2V4DA 5H6QA 1S5HC 3N2GA 5KA5A 1K34A 1EN4A 4U7OA 3CRQA 4O4IA 4OX9O 3HKDB 3G80A 2UXCO 3E8BA 1GM9A 5IJ0B 2XHBA 1QLNA 3SPGA 2UU9B 1HNWO 1MMMA 3K08A 1Q7YW 4DYLA 4A5UB 1N34B 4IIJB 3ABLC 3I5DA 3MDSA 1FD9A 1K92A 3H1JH 4K8ZA 2GTAA 3APQA 2DWEC 5LMUO 2ZXWB 2EILC 2RJZA 3AG4B 4NXNB 4EB6B 4XBFA 4DR1O 1NT2B 1FXKB 4I5SA 4DV3O 4I9QA 1F23A 2ZDIA 4X1KA 3O9OA 1IBKO 4DR7O 4UVBA 4ZI7A 2HKOA 3G6EV 5EBLC 4U3FH 1MG1A 1S72V 4TUYA 4MVQA 3DC5A 2Q7HA 5LBQA 1R3KC 5KHIA 1K4CC 1H38A 1K8AW 4JI2O 4QJFB 1WJZA 5CN0A 1GM7A 2ZD9A 1JFFB 1Z5VA 1RM1C 5LHGA 4DUZO 2YC0A 2BTOA 1OCOB 3BABA 2R9IA 2LJ2A 3IC9A 4CS2A 1YTFB 2W0FC 2DYSB 1B04A 1HW7A 1HNZB 2H8PC 4JGSA 2YUAA 2F23A 1DGSA 3LDDA 4ZHQB 3RYHA 3RYCB 1BGYH 1K97A 1AR4A 1Q3EA 3T4ZA 3FB5C 4WFHA 1J5EO 4LF9O 1AI6A 5LXTB 2NR5A 3B2EE 5CB4B 1OHHG 1NZ6A 1Y76B 1R3JC 3ABKB 2B5UA 3E22A 4PDMA 1KQSU 2RCVA 3N2KA 5CA0A 2P4VA 3LDCA 3SPCA 1YXBA 1XREA 2M7WA 2B1IA 4FFBA 3E8FA 3VQYA 3JAMN 5C8YA 1PNKA 3F5WC 3CCVV 3CE2A 2QTSA 2QKAA 3K79A 3JSLA 1URFA 1KU9A 1TGOA 3CCSV 2ZM6O 1V54C 2KKWA 1EZJA 4LF7O 3K5MA 2PI5A 4J7ZA 1O9GA 3VOUA 4JYAB 4DR1B 3FAVA 4DV2B 2Z0AA 2Y0PA 2HLDG 4R7CA 3KCYA 4FVMA 4GLXA 5EBMC 4JV5O 1JFFA 2AZ2A 1VQMV 2Q68A 3ZHRA 4TWKA 1XEQA 1NR7A 1ZAUA 4MVRA 1R6KA 5IYZA 4PDLA 1H2SB 3UQ8A 4O2BA 4CH5A 4DXWA 4GX5A 1XL4A 5FL7G 5FPOA 3ZBHA 1VQKV 4CS3A 4UVCA 2CE4A 1K3EA 2IJIA 4PA7A 4YJ2B 1FXKA 3JALA 3RBZA 2UXXA 1FJGB 5EC1C 2Z5UA 4J80A 1Q6UA 3ABKC 3RW0A 1H2MA 3K58A 3P32A 1BHBA 3AG3B 5LMNB 4O4JB 3ABUA 3T1HO 2QDOA 1H2GA 4JZGA 1FPOA 3BA9A 1J5EB 3E2EA 1AI5A 1ZTEA 4JAUA 3W7WA 4DV0O 3RWRD 1BHAA 3L74H 5KUKA 4HNAB 4Q20A 2VQFB 2NLJC 5LL6Y 5EK0A 3ETQA 2Q5ZA 1DF4A 1SRYA 4WFBV 3WB1A 5KHHA 2IJKA 3QNEA 2E76B 2NNUA 4KL1A 2PYLA 1SQBH 2BTQA 2HVKC 3B09A 1DF5A 5FPRA 5ITZA 5IWAB 1AI4A 4HBNA 2ZINA 5FNVA 3T1HB 1AJPA 3OUSA 4BW5A 1G1XB 1T5EA 1Q81W 5LP6B 1ORQC 1JCHA 4JYAO 1PV0A 5EIBC 2OTJV 4P9OA 3W7SA 2OCCB 4TQFA 1RPOA 1U97A 1NJIW 2Z3YA 4L8JA 1IXBA 3OGIB 4ASUG 3ABLB 5JCOC 5KHGA 4RQEA 3CJHB 3STZC 1HP8A 3ZHUA 1IURA 1M9NA 1H2NA 2IH1C 1NR1A 3VBBA 4I55B 4D6TH 4O4JA 2UUAB 1GK9A 5CA1B 3RYCA 4PJ0Z 4UCSA 2EIJC 3SJCC 2F95B 1DTOA 3ZRSA 2QR4A 5CBFA 3JASB 1M57B 5KHKA 5E79Z 4CH6A 2HHHB 1LUVA 3B8MA 3D8CA 3R65A 1OCZC 2QGNA 2CTWA 5JJNB 2IBZH 5IY5B 3AK3A 4GT1A 4B3TO 3U11A 1Q6IA 2JK5C 5K1XA 1R6TA 4YHHB 3FAVB 1BL8A 2XT9A 4I55A 3X2QC 3RN4A 1VQ5V 2UXBO 3N2GB 1SZTA 4BIUA 3CP1A 2A06H 3K9AA 3K59A 2KB1A 1D5NA 2M6YA 4JF3A 3E83A 4MS2A 5EBWC 2ILMA 4WCEV 2JIZG 2XASA 5B66Z 3CCEV 1VF6C 4RQFA 1K73W 3K03A 5H2FZ 4PA6A 5B1AB 2QEXV 2AXTZ 1XUQA 1A32A 4X1YB 2FKXA 3FD9A 4CC5A 1TUEB 1GN6A 1QHTA 4X20A 2UU9O 1HNWB 1S76D 3JAWB 3C90A 1Q43A 1WP8A 5IDJA 2A7WA 4X8AA 1MOFA 2CGNA 3EXAA 2P67A 4GX1A 1IDSA 4LFCO 3DTUB 3ETEA 4FLVA 2L35A 2ITDC 2C2AA 1TVKA 3HKEA 4DR5B 4NXNO 1K7DA 2ZIOA 1XOUA 3ZHQA 3CEIA 2G38A 4J7JA 2WA3A 1HNXB 1Z5WA 1P84F 2OWOA 1ZL8B 5JVDB 2P5OA 5KMGA 1B06A 2WLNA 3R66A 2E74B 2FYUH 1VQ9V 5JJJB 4DR2O 4IHJB 2WLKA 2HVJC 1OCCB 3S3WA 4KHPB 3OR6C 2DN9A 2IW5A 2VS0A 1QR8A 1VQLV 5GONA 1VARA 3RYIB 2LW7A 2W0XA 3IFXA 1GO3F 1BE3H 1KKCA 5JH7B 1Q90D 3UO2A 4FM0A 3AEIA 5L3GA 4B3SB 5C93A 1YI2V 2JGUA 1XHXA 2P22C 4YHHO 2AZ0A 1SQGA 3ML0A 4DR4B 5J9PC 4QE9A 5IYZB 4J10A 1B6QA 4F6EA 1XBLA 2DMXA 1PNLA 5L3FA 2OIGA 4LFBO 2X6BA 4LR3A 4CS4A 1PP9H 1SQFA 3C3SA 5J2UB 3LUTB 4O2AB 1VQ6V 2W6JG 1V9PA 1KUQA 4JYBA 4J7KA 3ZRWB 3RYHB 4DV1O 4MW8A 1BQZA 3G67A 3CCQV 4H0LB 1RSOB 1SERA 4JI5B 1NU1H 5L3EA 4X62O 3ZS8C 1HR0B 4LF4O 2AHYA 2JJ2G 2R70A 4UCTA 3ZRVA 1KB9F 3M99B 5KA6A 3SPHA 1NVPD 2ZQMA 1XL6A 4LH7A 4WBNB 3K57A 5H6RA 2HJDA 3M7MX 4GKJB 4JI4O 2YXYA 1EFRG 4WFEA 2DQ0A 2PI4A 4F6RB 3ZMUA 1AI7A 4UCOA 3LSUA 4RO2A 4D7SA 1XDCA 5J2UA 2F43G 4IYIA 4TQDA 1BCCH 3OMAB 4GUNA 4X64B 1WP7A 4FLWA 1AROP 4K0KB 1I7FA 1BZKA 4OPHA 1HWYA 5KUMA 1M93A 5LOVA 3CC4V 3OR7C 5DECA 2ZR3A 1E79G 3HKCA 1SA0A 2YEVB 3SGIA 2IU3A 4RUEA 2UXBB 1SC5B 2JJ1G 1SQXH 3H1LH 2CH7A 1XMQO 4GKJO 2HR3A 4QIWF 3L72H 4NR1A 5AG2A 3GVMA 2L6LA 1NVPB 2UXCB 4TV8A 1VQ7V 1TAEA 1BT8A 3AG7A 3B40A 1KC8W 3ZN0A 4NB5A 2MW2B 4K0KO 3SPJA 2LQTA 4DV0B 4YJ3B 4BWAA 3AG2B 1S77D 4HAMA 1WPBA 2CUGA 4NYKA 4EFEA 4DV6B 2GUZB 3J81N 4HYOA 1RP3B 1Y74A 1NKDA 1NS1A 3D36A 4OXSA 2FMLA 4EB6A 1WB7A 2AGAA 1QLEB 3HR0A 4QNHB 4FZ1A 1GN3A 4LF4B 2YI9A 1YCIA 1E1QG 5L3BA 4LP8A 3ZIAG 4MVZA 1X59A 3RGBA 2KQXA 4JI3B 5LOVB 1IXMA 5GONB 1E1RG 1EZVH 1FXKC 2QWPB 3SYCA 1UFIA 1P7BA 4DR6O 2B1GA 2KG7B 4OGQB 3F5TA 4DK0A 2FTKA 4X1IB 4RUFA 3UO3A 4KHPO 3E35A 3OMNB 2GBOA 3QG5A 3RVYA 4JI6O 1G6UA 2WLLA 4R6ZA 1LNQA 2QM8A 2XOKG 1SF9A 4X88A 1IX9A 1AJNA 4LNUA 1EN6A 1K4DC 2BSKA 2YXHA 2H94A 4AILC 4OPAA 5JJEB 2E3CA 2WLMA 5IJ0A 1P7GA 1SQVH 1S3JA 1AB3A 3AG3C 2P90A 4J42A 2P06A 2WAMA 3JD4A 3L75H 3TXSA 2ITCC 1S5LZ 1H8EG 1KD1W 1VEWA 4KP4A 2PYJA 3ZHSA 1PL4A 1OCZB 3AK1A 2QJ1A 4LBEC 2JGDB 4MTOA 3T4DA 4I7ZB 4TUYB 2WA4A 3OMIB 3BPZA 3ZRXA 2ADPA 4MTXA 4U3JB 4XDKA 4RWUA 5B3SB 3K06A 4LC1A 1QR9A 1IBMB 2LW1A 2Q7EA 3RYFB 3ASOC 4X62B 3B77A 1PKXA 4K3AA 2VQEO 4FLUA 4FLXA 5LYJA 5ITZB 5JCOA 1MABG 4QE7A 2Q69A 2WLIA 5LYJB 5IJ9A 1M57C 2EIKC 5J2TB 3FB7C 4GCZA 4PELA 3TJTA 5JQGB 3FYEB 4X65O 3X2QB 1W59A 4I50A 4IT5A 4E4EA 4Z2WA 4L87A 5LHIA 1BSMA 5DN6G 1I5YA 1VF6A 2F4VO 3AG4C 5TISZ 4KXRA 2ATKC 3GWOA 3CYOA 2XAGA 1IBMO 3CMAV 4AQYO 4DV4O 4AI8A 3CXCU 5B3SC 1GMGA 1LUWA 1XNRB 4NTYA 2F1MA 4TOIA 3JAKB 3NR7A 5A2QN 4PA9A 4DR6B 1FFXB 2VWKA 1ZL8A 1YJWV 5FNVB 5BY1A 4TV8B 3P3PA 2CGOA 3JD1A 2QE7G 2QTOA 4GX0A 1N33O 3AK2A 2X0LA 1KP3A 2IH3C 2V7QG 2P7TC 4UVAA 2Q0AA 4LFCB 1YITV 5IY5C 2WLHA 3THOA 3AG1B 2LP7A 4JI8O 4P2ZA 3WG7B 2ZE6A 1KYOF 1NH2B 2EINB 2BE3A 4C7UA 3RVZA 4Q6GA 5H9CA 4PHZA 1Y6XA 1JVMA 1VQ8V 2UXDB 3SJQC 3L71H 1GRJA 1COWG 3SPIA 2ZCEA 4JAVA 4X1YA 1XNRO 4QPKA 2Q6AA 1PNMA 3CWBH 1K5QA 4ZKIA 1YJNV 3MHSC 2ZE5A 4DV6O 4B3MO 3BAAA 2LFSA 3HB3B 2H3OA 2Q8VA 4R8CA 3G71V 1U96A 3CXHF 1XNQB 1W2BU 4FK5C 1ZUQA 1HNZO 4B3SO 3ZEDA 2CTPA 2DYRB 5IWAO 5BXZA 1M5IA 1N0JA 4DO2A 3DGEA 2GUZA 1N0NA 2PF4E 4NKGB 5B1OA 4DR2B 4B7EA 2B9ZA 5EIBD 4X65B 5BMVA 3PJSK 2K9PA 2EZPA 4IHJA 1N36O 3D3IA 1S0VA 1YDXA 1GM8A 2IJJA 3JARA 2LGWA 3ABMB 4DK1A 4PA3A 3CC2V 1KECA 3WFVA 5F2VO 3C3TA 3I56V 2PGGA 5LMUB 2EIJB 4DV4B 1RPRA 3LSSA 3ABTA 1WPXA 3ASNB 3K5LA 5E1AC 3TGUH 2VWJA 4UV8A 3ZX6A 4MVSA 1IBKB 4ZHQA 2YEVA 1UPGA 2N74A 4LF5B 4IYHA 3LNNA 1M4UA 2PY5A 2ODMA 1EN5A 2LO1A 3CJHA 2BSKB 3JAWA 3L73H 4X89A 4LWSA 4JI0B 2XTAA 1FAFA 3GB7C 4I4TB 4JTAB 5CA3A 2YI8A 3CS5A 4EKWA 3JSNA 5LGUA 1I0HA 2EX3A 3JD2A 4J11A 5A9GA 1MSDA 3ASOB 3P30A 4DV7O 1YEWA 4UCRA 4K35A 3JD3A 4H33A 2RDCA 3AG2C 4G27B 3SYAA 4I50B 3N27A 2JEXA 5KMGB 4ZBMA 2ARHA 1MNGA 3OFNG 5IYCO 3ZHVA 3CCJV 3Q4HB 1VP7A 1YHQV 3TETA 3KG2A 1SETA 2CK3G 2XUMA 2BTQB 2JS5A 1OCOC 4LF9B 2DW4A 3T1YO 3K0GA 3W7TA 2QWQB 3QO5A 2FL4A 3F7YC 4LF6O 3H01A 2E75B 1WAZA 2QA4V 3G6BA 1FYJA 3L9DA 2ZE7A 3CRMA 3IAYA 1CXZB 2Y69C 5CA0B 1Q86W 4O2AA 3CCLV 1Q6HA 4Z1VA 2E5LB 2JGDA 4X64O 1R3IC 3U10A 4DV5O 3WG7C 1I94O 4NXMO 3IJ4A 4I0XB 1CPYA 4JI1B 2VQFO 1DK1A 1M56B 1PD3A 1N33B 4DRXA 1XILA 5HFLA 4MT8A 4TSFG 3OAAG 1XMQB 4JASA 4YJ2A 1N4CA 4UCVA 2XAQA 3A0RA 4UB6Z 1NBMG 2EIMC 2XAHA 5EZYA 2Y4UA 3CX5F 2LGQA 4O2BB 1NQTA 2RNBA 3DC6A 1R73A 4PI0A 2Q9LA 1XMOO 2AW9A 3M8AA 1I08A 4X1IA 1F7YA 1YF2A 1QVGU 2RN9A 4H37A 3A0HZ 2Q7GA 5GTHZ 1JJ2U 1Y67A 3ASNC 1SS3A 2WWWA 4PI2A 5D5QA 3OM3B 3G4SV 4W4LA 3CCUV 3H1KH 1CP9A 2ZR2A 3JARB 1WB8A 4P9PA 1ZLZA 2QM7A 4CZZA 4O4LA 3KZIZ 1MA1A 3JCUZ 3CC7V 3S3XA 3H9VA 2JVDA 3STLC 4DV3B 3W7UA 3K5OA 3BEHA 5EZYB 4DR4O 2UUAO 3SJAC 4ZOLA 2JDIG 4PV1B 4R50A 4LFBB 4LF7B 1L0NH 1FFTB 1OZ0A 4JI2B 3FYIB 5IT9N 3I55V 4CH4A 4LF6B 3ZMTA 1JJOA 3LSQA 1W0JG 1FXVA 3BY6A 1YZBA 2P6JA 1NTKH 3ZJZA 2JS3A 5B1BB 1Y76A 2DWDC 4JAAA 1GTOA 5EYPB 4CH3A 1ZWIC 2EJRA 2VQEB 2XAFA 5BR8B 4DV5B 1QNMA 1I94B 1OCRC 3OEEG 4UB8Z 5IE9A 1SA0B 3ABMC 4MSWC 3P3NA 4NVPA 4LCUC 2DQ3A 1D5AA 3VQXA 5LHHA 1GH6A 1GN2A 1TVKB 4LF8O 1UJWB 2BCCH 4TV9A 1D2DA 1NI8A 2YS8A 2F4VB 4FMTA 5IYBO 3ZMSA 2W6IG 4ICGA 1VQPV 2JEUA 2Q4PA 2X6AA 5BR8O 3LNMB 3VQWA 3OD4A 4N23A 4ZI7B 5CBGA 2QSAA 5B1AC 3ETGA 3BVOA 2Q0OC 2GSMB 4EEQA 4LF8B 3ZHTA 1N32B 2MK3A 4UFZA 2IJHA 4FFBB 1GAXA 1HDJA 4J41A 4LFAB 1GN4A 4MVMA 3PN1A 4FJCC 1P4RA 5CBHA 4OX9B 3A0BZ 2YSUB 1HNXO 5GTIZ 1VMGA 4AQYB 1SESA 4FIPC 3B8NA 2HEPA 2KG7A 4PDVA 4DUYO 4TV9B 4JZ2A 3DXRA 2UUCO 2ZE8A 1OCCC 2A0LA 1AVMA 1Y74B 2ZT9B 3HKDA 3CRCA 3OTOO 4PDRA 2EBOA 1KP2A 1MZEA 5B1NA 1VIBA 4LH6A 2DOSA 1Y66A 4GKKO 2EZOA 1YVWA 1W0KG 3QTCA 3HKEB 1DLBA 4LFAO 3FKSG 4DR7B 1M56C 4I9WA 1IBLO 1AJQA 3RT3C 3E8HA 2PZSA 4I4TA 2WSSG 4X66B 5KAIZ 2Q67A 3TK1A 4DUYB 2UUCB 1US6A 1QCEA 3APOA 4F4LA 3JATA 4B3RB 2QKSA 3E86A 5KHJA 4JI6B 5J2TA 1J95A 3HPLC 1AR1B 4B3MB 3OUFA 3ICXA 2CAZC 3DXRB 4DUZB 2OTLV 1SZXA 4X1KB 1QBZA 1NTZH 1P49A 1KMIZ 4JI7B 2A3QA 3LDEA 3UKMA 5CB4A 4JTCB 2QWOB 4MW3A 1VF7A 3D3QA 2RMKB 2OCHA 2WLIB 4YY3O 2ZIMA 1ZSPA 1JR9A 1VQOV 4FPPA 4LF5O 1L8DA 5FLXN 4J9ZB 3QF7A 5HFMA 1SQQH 5JH7A 1N32O 2XNDG 2D2CB 1N36B 2OIEA 2BOBC 1PM9A 2NN4A 5B5EZ 1KBHA 1OCRB 1S5JA 3W7XA 3J80N 4HNAA 1JMKC 2ZKOA 2DE0X 3FFQA 2P4KA 3E89A 3E8GA 2A79B 1YJ9V 4FLTA 1VQNV 4MVOA 4ZIBA 1FXHA 1BS3A 2F66C 4BW9A 1F4MA 4O4LB 3Q4HA 2GDSA 1AP5A 4DR3B 4WF9V 1K9MW 3T1YB 2HG5C 1TUBB 5JQGA 1M1KW 2N05A 4DR5O 3OGCC 3K04A 4WFFA 4W4KA 2YDEA 4DV2O 1G4YB 4G2KA 3JATB 4YXWG 2ADQB 5KAFZ 4NTXA 1V54B 2OCCC 2X6CA 2E5LO 3JD0A 4AHCA 3WU2Z 3ZCCA 1EBOA 2QM4A 3CRAA 2OT5A 5LXTA 1JA8A 5JWPA 4DRXB 1EM1A 4QPJA 2YICA 3K5NA 2ZDIC 3SDLA 4DR3O 2CTRA 2V1DA 4PD4F 4J9YB 4KFMA 3JALB 4U7NA 3A2FA 1FJGO 2DYSC 4BIZA 4JI8B 4GX2A 4G28B 5IJ9B 1M90W 2Y69B 4CC6A 1R3LC 5LMNO 3UT5B 3RYIA 2UXDO 3CMEV 4B7KA 1XMOB 1VF5B 1GKFA 5K1PA 3ZMZA 3T2MA 3ETDA
chains in the Genus database with same CATH topology
1OCOB 1ENVA 3H01A 1CEZA 2R9IA 3M99B 2QA4V 5KA6A 3SPHA 1NVPD 2ZQMA 1G8MA 1XL6A 1YTFB 2W0FC 3ZMVA 2DYSB 2Y69C 5LGNA 5H6RA 1Q86W 2H8PC 4JGSA 3CCLV 1EFRG 4WFEA 4WFAV 3ZN1A 1NH2D 2DQ0A 3LDDA 2PI4A 1R3IC 1PL0A 1K97A 3ZMUA 5BZBA 1AI7A 3WG7C 4RO2A 3T4ZA 3FB5C 4WFHA 1CPYA 1AI6A 1OHHG 2F43G 1M56B 1PD3A 5GW7A 1R3JC 4XDLA 3ABKB 5HFLA 2B5UA 4MT8A 3OMAB 2EILB 4PDMA 1KQSU 3QO8A 1AROP 1WLEA 4TSFG 3OAAG 4JASA 1HWYA 4WFGA 5KUMA 3CC4V 3OEHG 2XAQA 3LDCA 3OR7C 3NXSA 3SPCA 3A0RA 1NBMG 2EIMC 1E79G 2XAHA 2ZR3A 2M7WA 2B1IA 2YEVB 4RAIA 2IU3A 4RUEA 4TT3G 3CCMV 3E8FA 1YTFD 1NQTA 2JJ1G 1R73A 1PNKA 3F5WC 3CCVV 1N8RW 2HR3A 3K79A 4QIWF 1QVGU 4H37A 1JJ2U 3ASNC 3G4SV 2WWWA 3CCSV 1NVPB 3OM3B 1V54C 3UM7A 3CCUV 1EZJA 2ZXWC 1VQ7V 1CP9A 2ZR2A 2PI5A 4P9PA 3VOUA 2EIKB 1KC8W 2QM7A 4CZZA 2LFRA 3ZN0A 4UV9A 3SPJA 2K1EA 3EFFK 2HLDG 3AG2B 4R7CA 1Q82W 1S77D 2IU0A 3CC7V 4HAMA 5EBMC 1YSCA 3STLC 3IGAC 1VQMV 4HYOA 2Q68A 3W7UA 1NKDA 4TWKA 3D36A 4OXSA 1NR7A 3BEHA 2DYRC 4MVRA 1R6KA 1QLEB 4QNHB 3IC7A 4PDLA 2JDIG 4R50A 2Y48A 1E1QG 4P30A 4DXWA 4GX5A 1FFTB 1XL4A 5L3BA 1OZ0A 5FL7G 4LP8A 3ZIAG 3FYIB 1VQKV 4MVZA 4UVCA 4UUJC 3I55V 1IXMA 1K3EA 2IJIA 4PA7A 1E1RG 3ZMTA 2R9RB 1FXKA 3RBZA 2UXXA 3LSQA 1FXKC 1FXVA 1W0JG 3BY6A 5EC1C 2P6JA 2Z5UA 1Y4MA 1ROPA 2WLJA 3ABKC 4UXNA 3ZJZA 3RW0A 3P32A 1V55B 3SYCA 1BHBA 3AG3B 1P7BA 2DWDC 5B1BB 2B1GA 2XAJA 1GTOA 3OE7G 2FTKA 3ABUA 4RUFA 1ZWIC 2EJRA 2XAFA 3E35A 3OMNB 1H2GA 4BAYA 3RVYA 2WLLA 4R6ZA 1OCRC 1LNQA 3OEEG 4MTFA 3E2EA 2QM8A 1MSWD 1AI5A 1K73W 2XOKG 3ABMC 3W7WA 4JAUA 4X88A 4MSWC 1AJNA 1K4DC 2EINC 4LCUC 1BHAA 2DQ3A 2H94A 5LHHA 5KUKA 4Q20A 2NLJC 1I5XA 2WLMA 1UJWB 5EK0A 3F7VC 1S3JA 3AG3C 1DF4A 2P90A 5B1BC 1V55C 3CD6V 1SRYA 4WFBV 2WAMA 3AG1C 3JD4A 4PA4A 5LGTA 2IJKA 3QNEA 2ITCC 5DM6V 5L3CA 1H8EG 2NNUA 1KD1W 4FMTA 5IYBO 3ZMSA 4KP4A 1VQ4V 2W6IG 2HVKC 1OCZB 1DF5A 1QVFU 1VQPV 2JEUA 4XDJA 4LBEC 1AI4A 4MTOA 3T4DA 2X6AA 2AHZA 1AJPA 3OMIB 3LNMB 3OUSA 3T1CA 4N23A 3ZRXA 4BW5A 1JQ0A 1L1FA 4MTXA 4XDKA 1R6NA 5B3SB 4JPRA 3K06A 4LC1A 1QR9A 5CBGA 5IYDO 1Q81W 3ASOC 2WLLB 4Z1MG 1ORQC 5B1AC 3ETGA 1JCHA 3B77A 1PKXA 1JPXA 2GSMB 1RM1B 2OTJV 4P9OA 3TCUA 3W7SA 1THZA 2OCCB 1RPOA 1BMFG 2EIMB 2MK3A 2IJHA 1NJIW 2Z3YA 4CBCA 3FB8C 2X7RB 4MVMA 4ASUG 1MABG 3ABLB 1P4RA 4FJCC 2Q69A 2WLIA 4QE7A 5CBHA 1M57C 2EIKC 4RQEA 2YSUB 3FB7C 4GCZA 3STZC 4PELA 5EC2C 1M9NA 2IH1C 3FYEB 3X2QB 1NR1A 3VBBA 4L87A 2GHYA 5LHIA 1SESA 4FIPC 3B8NA 3JCZA 5DN6G 3K0DA 1I5YA 1GK9A 1JX9A 4PDVA 3QO7A 3CPWU 3AG4C 2ATKC 3SYPA 1OCCC 3GWOA 2A0LA 3CYOA 2XAGA 2EIJC 4MVUA 1H8HG 3CMAV 1DTOA 3ZRSA 5CBFA 1M57B 3CXCU 5B3SC 2D3OW 3EHBB 4PDRA 4E2LA 2EBOA 1KP2A 1GMGA 3B8MA 5B1NA 4PA9A 1Y66A 3R65A 2EZOA 1W0KG 1OCZC 1YJWV 1K33A 1K5SA 1DLBA 3JD1A 2QE7G 2QTOA 4GX0A 3FKSG 5L3DA 5IY5B 2X0LA 4GT1A 4HZ3A 1KP3A 1M56C 2IH3C 2V7QG 2P7TC 4UVAA 1YITV 5IY5C 4I9WA 2WLHA 1AJQA 3AG1B 2BOCC 2LP7A 2JK5C 3E8HA 3ZRWA 4P2ZA 3K3WA 2WSSG 3WG7B 3OW2U 3FB6C 1BL8A 2EINB 2Q67A 1NH2B 3X2QC 3TK1A 3RVZA 5H9CA 1F4NA 1VQ5V 1QCEA 1JVMA 1SZTA 4F4LA 3MD0A 1VQ8V 4BIUA 3CP1A 2QKSA 3E86A 4JYCA 3K9AA 3SJQC 1J95A 2KB1A 3HPLC 1AR1B 4JF3A 3OUFA 1QLEC 3MHHC 3E83A 4MS2A 1COWG 3SPIA 5EBWC 2OTLV 4JAVA 4WCEV 1QBZA 2JIZG 2XASA 4QPKA 3CCEV 1YIJV 2Q6AA 4RQFA 2A9HA 3SYQA 3K03A 3LDEA 1PNMA 4MTGA 1K5QA 3UKMA 4JTCB 4ZKIA 4PA6A 5B1AB 1YJNV 4MW3A 3MHSC 2QEXV 1JOYA 2LFSA 3HB3B 1F51A 1TUEB 2WLIB 1VQOV 4FPPA 1S76D 4R8CA 3G71V 4J9ZB 1W2BU 5HFMA 4FK5C 5IDJA 4N21A 4X8AA 1MOFA 2XNDG 2BOBC 2P67A 4GX1A 2DYRB 1FS0G 1OCRB 4DO2A 3W7XA 3CCRV 3DGEA 4JTDB 3DTUB 3JYCA 2HJFC 3ETEA 5B1OA 2ITDC 2WPDG 2C2AA 1K7DA 3PJSK 3E89A 2UXNA 3E8GA 5CMUA 2EZPA 4KUMA 2A79B 1YJ9V 3SYOA 2HFEC 3D3IA 1S0VA 1VQNV 4MVOA 1FXHA 1GM8A 1KKDA 2IJJA 5H6QA 2WLNA 3ABMB 4PA3A 1S5HC 5KA5A 3CC2V 1F4MA 1K34A 1KECA 1VQ9V 3WFVA 4U7OA 3I56V 2WLKA 2HVJC 2EIJB 1OCCB 1RPRA 3E8BA 3LSSA 3ABTA 3OR6C 4WF9V 1GM9A 1WPXA 3ASNB 1K9MW 2IW5A 1QR8A 2HG5C 5E1AC 4UV8A 4MVSA 1VQLV 1M1KW 1QLNA 3OGCC 3IFXA 3K04A 4WFFA 2YEVA 3SPGA 1GO3F 3K08A 1G4YB 1Q7YW 4G2KA 3AEIA 4YXWG 3ABLC 5L3GA 5C93A 1K92A 1V54B 4X89A 1YI2V 2OCCC 2X6CA 3JD0A 3GB7C 2DWEC 4JTAB 3ZCCA 5CA3A 3ML0A 1EBOA 4EKWA 5J9PC 2ZXWB 4QE9A 5LGUA 1B6QA 2EILC 3AG4B 3JD2A 2OT5A 4XBFA 1PNLA 5L3FA 3ASOB 3P30A 2X6BA 4I5SA 1FXKB 1F23A 2ZDIA 4QPJA 2ZDIC 4UVBA 3LUTB 3JD3A 4H33A 3AG2C 4G27B 2V1DA 3SYAA 4J9YB 2HKOA 4KFMA 2JEXA 3G6EV 1VQ6V 2W6JG 4U7NA 5EBLC 4ZBMA 1MG1A 4JYBA 1S72V 2DYSC 4BIZA 4GX2A 3ZRWB 3OFNG 4MVQA 5IYCO 3CCJV 4G28B 1M90W 5LBQA 4MW8A 1R3KC 3CCQV 1YHQV 2Y69B 1K4CC 3TETA 1R3LC 1SETA 2CK3G 3KG2A 1H38A 1SERA 1K8AW 5L3EA 4QJFB 5CN0A 1OCOC 1GM7A 2DW4A 3CMEV 2AHYA 3K0GA 3W7TA 2JJ2G 2ZD9A 3QO5A 1GKFA 1RM1C 5LHGA 3ZMZA 3ZRVA 3T2MA 3ETDA 3F7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P30 A;  4GX5 A;  1XL4 A;  2IH1 C;  3JYC A;  2HJF C;  2ITD C;  4LP8 A;  4MVZ A;  3SPH A;  4UUJ C;  1XL6 A;  4PA7 A;  2W0F C;  3PJS K;  2R9R B;  2Y69 C;  3E89 A;  3E8G A;  3K0D A;  3RBZ A;  2H8P C;  4PDV A;  5EC1 C;  4WFE A;  3AG4 C;  2A79 B;  2WLJ A;  2ATK C;  3SYO A;  2HFE C;  3LDD A;  1OCC C;  3ABK C;  1R3I C;  3SYP A;  2A0L A;  3ZJZ A;  3RW0 A;  2EIJ C;  4MVU A;  5BZB A;  4MVO A;  3SYC A;  1KKD A;  3ZRS A;  1P7B A;  2DWD C;  3WG7 C;  4RO2 A;  5CBF A;  2WLN A;  3FB5 C;  3T4Z A;  5KUK A;  4WFH A;  4PA3 A;  1S5H C;  4RUF A;  5B3S C;  1ZWI C;  4PDR A;  3RVY A;  2WLK A;  4PA9 A;  2HVJ C;  2WLL A;  1R3J C;  1OCR C;  3R65 A;  4R6Z A;  1LNQ A;  1OCZ C;  4MTF A;  4XDL A;  3E8B A;  3OR6 C;  4PDM A;  3ABM C;  2QTO A;  4GX0 A;  4X88 A;  2HG5 C;  5E1A C;  4MSW C;  4MVS A;  1K4D C;  2EIN C;  4LCU C;  4WFG A;  5KUM A;  3OGC C;  4HZ3 A;  2IH3 C;  1M56 C;  3IFX A;  3K04 A;  3LDC A;  2P7T C;  2YEV A;  3OR7 C;  4WFF A;  2NLJ C;  3SPC A;  3SPG A;  5IY5 C;  4I9W A;  2EIM C;  2WLH A;  2WLM A;  5EK0 A;  2BOC C;  3F7V C;  2JK5 C;  3K08 A;  4RAI A;  3E8H A;  1G4Y B;  4RUE A;  4P2Z A;  3AG3 C;  5B1B C;  3E8F A;  1V55 C;  3AG1 C;  4PA4 A;  3ABL C;  3FB6 C;  1BL8 A;  2Q67 A;  3X2Q C;  3F5W C;  2ITC C;  4X89 A;  2OCC C;  2X6C A;  3RVZ A;  1JVM A;  4F4L A;  3GB7 C;  4H37 A;  2DWE C;  4JTA B;  2QKS A;  3E86 A;  3SJQ C;  2HVK C;  1J95 A;  2KB1 A;  3HPL C;  4QE9 A;  4EKW A;  5J9P C;  3ASN C;  3OUF A;  1QLE C;  2EIL C;  3E83 A;  1V54 C;  4MS2 A;  4XDJ A;  3SPI A;  4LBE C;  3UM7 A;  4DXW A;  4MTO A;  5EBW C;  3T4D A;  2ZXW C;  2X6A A;  2AHZ A;  2X6B A;  3LNM B;  3OUS A;  3T1C A;  4BW5 A;  4P9P A;  3VOU A;  2Q6A A;  4XDK A;  2A9H A;  3SYQ A;  3K03 A;  3LDE A;  4MTG A;  3UKM A;  3LUT B;  4JTC B;  4H33 A;  4PA6 A;  3K06 A;  3AG2 C;  4G27 B;  5CBG A;  3SYA A;  4J9Y B;  4MW3 A;  4KFM A;  3SPJ A;  2K1E A;  3EFF K;  5EBL C;  4ZBM A;  3ASO C;  2WLL B;  1ORQ C;  2DYS C;  4R7C A;  5B1A C;  4GX2 A;  4MVQ A;  4G28 B;  4P9O A;  2WLI B;  5EBM C;  4MW8 A;  1R3K C;  3TCU A;  1K4C C;  3STL C;  1R3L C;  3KG2 A;  3TET A;  4R8C A;  3IGA C;  4HYO A;  2Q68 A;  1OCO C;  4J9Z B;  4TWK A;  4OXS A;  4CBC A;  3FB8 C;  2AHY A;  2DYR C;  3BEH A;  3K0G A;  4MVR A;  4MVM A;  2ZD9 A;  4X8A A;  4QE7 A;  2Q69 A;  2WLI A;  4QNH B;  5CBH A;  1M57 C;  2EIK C;  2BOB C;  3FB7 C;  4GX1 A;  3STZ C;  4PDL A;  3T2M A;  4R50 A;  3F7Y C;  5EC2 C;  4JTD B; 
#chains in the Genus database with same CATH topology
 4BR6 A;  1ENV A;  2JRI A;  2O57 A;  3CHX A;  1CEZ A;  4NXM B;  3KKY A;  3U0Z A;  2ETN A;  4U3J A;  4JI1 O;  1G8M A;  2PTM A;  3ZMV A;  5LGN A;  4WFA V;  3ZN1 A;  1NH2 D;  4FM1 A;  1PL0 A;  5BZB A;  3JAS A;  5BMV B;  4GKK B;  2CH7 B;  5GW7 A;  4FLY A;  4XDL A;  2EIL B;  2VRZ A;  1WN7 A;  2HP8 A;  3QO8 A;  4IGG A;  4I0X A;  1WLE A;  1H2K A;  2QWN B;  4IIJ A;  4WFG A;  3BHP A;  3HKB A;  3OEH G;  4FFK A;  3NXS A;  3UCS C;  4LWS B;  2F93 B;  4RAI A;  1WNS A;  4TT3 G;  3CCM V;  3BFR A;  1YTF D;  1OJH A;  2YIB D;  4B3R O;  1N8R W;  2EUL A;  1SQP H;  3H1H H;  1Z2G A;  2YXL A;  4O4I B;  5KX5 B;  3OT7 A;  3UM7 A;  2DJV A;  2ZXW C;  3SJB C;  4YIP A;  4X9Q A;  3CRR A;  2KSD A;  4LNU B;  2EIK B;  2ZNI A;  1L0L H;  2LFR A;  4UV9 A;  2K1E A;  3EFF K;  1FFX A;  1O9H A;  1Q82 W;  2IU0 A;  4YIO A;  1YSC A;  2IM9 A;  5EYP A;  5C8Y B;  3IGA C;  2CTQ A;  5DED A;  4B08 A;  4JI0 O;  2DYR C;  2QWR B;  3IC7 A;  3DSQ A;  2Y48 A;  2GTS A;  4P30 A;  4JV5 B;  4DV7 B;  3CB2 A;  4JI5 O;  4UUJ C;  3HKB B;  1XHZ A;  4NTW A;  2R9R B;  4ZOL B;  1Y4M A;  1ROP A;  2WLJ A;  2YID A;  3K9S A;  4UXN A;  1V55 B;  2R72 A;  2XAJ A;  3OE7 G;  2ZM6 B;  1Q8I A;  4BAY A;  2R9A A;  2PUS A;  4MTF A;  1MSW D;  3HKC B;  4QGP A;  4FZ0 A;  3MAQ A;  2EIN C;  4JI3 O;  1I5X A;  2CDY A;  3N2K B;  3E22 B;  3F7V C;  3L70 H;  5B1B C;  3CD6 V;  1V55 C;  3AG1 C;  4PA4 A;  5LGT A;  1OV9 A;  1RSO A;  4EFB A;  2UUB O;  5DM6 V;  4H44 B;  5L3C A;  4K8X A;  1VQ4 V;  3UT5 A;  1QVF U;  3KCX A;  4XDJ A;  2AHZ A;  2YIA A;  2YIB A;  1WA8 A;  3T1C A;  1JQ0 A;  1L1F A;  2QKC A;  1R6N A;  4X20 B;  3RFR A;  4JYY A;  4JPR A;  1IZ3 A;  5IYD O;  5KLV H;  5CA1 A;  3H1I H;  2WLL B;  4Z1M G;  3RYF A;  1JPX A;  4BIO A;  1RM1 B;  3B4S A;  3TCU A;  1THZ A;  1IBL B;  1BMF G;  2EIM B;  3D36 C;  3SR2 C;  4F6R A;  4O4H B;  4CBC A;  3FB8 C;  2X7R B;  3A8T A;  2UUB B;  2Y0I A;  1RFY A;  3QVN A;  3FX7 A;  3GWK C;  3VQV A;  2Q73 A;  5EC2 C;  1SKV A;  2Y4T A;  3OTO B;  2GHY A;  4IL6 Z;  1ZX3 A;  5LP6 A;  3JCZ A;  3K0D A;  1JX9 A;  3QO7 A;  1H2L A;  4GYC B;  3CPW U;  2ZNJ A;  3BCC H;  3SYP A;  3BRC A;  2N04 A;  4MVU A;  1H8H G;  1WA8 B;  1QQC A;  2EJ7 A;  2D3O W;  3EHB B;  4E2L A;  4DW1 A;  4YY3 B;  4FM2 A;  4ABM A;  2OYQ A;  4DW0 A;  3JAK A;  1K33 A;  1K5S A;  1NTM H;  4X66 O;  5KX5 A;  5L3D A;  3J7A U;  1N34 O;  4HZ3 A;  5LA6 A;  1AIL A;  5LA6 B;  2BOC C;  1FKA O;  1R1B A;  3ZRW A;  5LP6 C;  3BA8 A;  3K3W A;  4DV1 B;  3OW2 U;  4YJ3 A;  3FB6 C;  3EVK A;  4JI7 O;  1F4N A;  1PPJ H;  1HR0 O;  4O4H A;  1XNQ O;  3MD0 A;  1XQ8 A;  4JYC A;  4FLZ A;  1QLE C;  3MHH C;  5D5P A;  1IVS A;  1MZF A;  1YIJ V;  2A9H A;  3SYQ A;  4MTG A;  3CSX A;  1BQ0 A;  2FB5 A;  2GV9 A;  1JOY A;  3OTF A;  4H13 B;  4JI4 B;  1F51 A;  2HHH O;  1Q5O A;  3O65 A;  5JVD A;  1LR1 A;  4N21 A;  1QU7 A;  3WB2 A;  3TXQ A;  4WBN A;  1FS0 G;  3CCR V;  1XI1 A;  1B3Q A;  4JTD B;  4B3T B;  5H5N A;  3JYC A;  1TUB A;  2HJF C;  2RQ6 A;  4GZR B;  2WPD G;  1AP6 A;  1X4T A;  3WB0 A;  4UCU A;  2UXN A;  5CMU A;  1TA8 A;  1AR5 A;  4KUM A;  3SYO A;  2HFE C;  4D7T A;  1KKD A;  2V4D A;  5H6Q A;  1S5H C;  3N2G A;  5KA5 A;  1K34 A;  1EN4 A;  4U7O A;  3CRQ A;  4O4I A;  4OX9 O;  3HKD B;  3G80 A;  2UXC O;  3E8B A;  1GM9 A;  5IJ0 B;  2XHB A;  1QLN A;  3SPG A;  2UU9 B;  1HNW O;  1MMM A;  3K08 A;  1Q7Y W;  4DYL A;  4A5U B;  1N34 B;  4IIJ B;  3ABL C;  3I5D A;  3MDS A;  1FD9 A;  1K92 A;  3H1J H;  4K8Z A;  2GTA A;  3APQ A;  2DWE C;  5LMU O;  2ZXW B;  2EIL C;  2RJZ A;  3AG4 B;  4NXN B;  4EB6 B;  4XBF A;  4DR1 O;  1NT2 B;  1FXK B;  4I5S A;  4DV3 O;  4I9Q A;  1F23 A;  2ZDI A;  4X1K A;  3O9O A;  1IBK O;  4DR7 O;  4UVB A;  4ZI7 A;  2HKO A;  3G6E V;  5EBL C;  4U3F H;  1MG1 A;  1S72 V;  4TUY A;  4MVQ A;  3DC5 A;  2Q7H A;  5LBQ A;  1R3K C;  5KHI A;  1K4C C;  1H38 A;  1K8A W;  4JI2 O;  4QJF B;  1WJZ A;  5CN0 A;  1GM7 A;  2ZD9 A;  1JFF B;  1Z5V A;  1RM1 C;  5LHG A;  4DUZ O;  2YC0 A;  2BTO A;  1OCO B;  3BAB A;  2R9I A;  2LJ2 A;  3IC9 A;  4CS2 A;  1YTF B;  2W0F C;  2DYS B;  1B04 A;  1HW7 A;  1HNZ B;  2H8P C;  4JGS A;  2YUA A;  2F23 A;  1DGS A;  3LDD A;  4ZHQ B;  3RYH A;  3RYC B;  1BGY H;  1K97 A;  1AR4 A;  1Q3E A;  3T4Z A;  3FB5 C;  4WFH A;  1J5E O;  4LF9 O;  1AI6 A;  5LXT B;  2NR5 A;  3B2E E;  5CB4 B;  1OHH G;  1NZ6 A;  1Y76 B;  1R3J C;  3ABK B;  2B5U A;  3E22 A;  4PDM A;  1KQS U;  2RCV A;  3N2K A;  5CA0 A;  2P4V A;  3LDC A;  3SPC A;  1YXB A;  1XRE A;  2M7W A;  2B1I A;  4FFB A;  3E8F A;  3VQY A;  3JAM N;  5C8Y A;  1PNK A;  3F5W C;  3CCV V;  3CE2 A;  2QTS A;  2QKA A;  3K79 A;  3JSL A;  1URF A;  1KU9 A;  1TGO A;  3CCS V;  2ZM6 O;  1V54 C;  2KKW A;  1EZJ A;  4LF7 O;  3K5M A;  2PI5 A;  4J7Z A;  1O9G A;  3VOU A;  4JYA B;  4DR1 B;  3FAV A;  4DV2 B;  2Z0A A;  2Y0P A;  2HLD G;  4R7C A;  3KCY A;  4FVM A;  4GLX A;  5EBM C;  4JV5 O;  1JFF A;  2AZ2 A;  1VQM V;  2Q68 A;  3ZHR A;  4TWK A;  1XEQ A;  1NR7 A;  1ZAU A;  4MVR A;  1R6K A;  5IYZ A;  4PDL A;  1H2S B;  3UQ8 A;  4O2B A;  4CH5 A;  4DXW A;  4GX5 A;  1XL4 A;  5FL7 G;  5FPO A;  3ZBH A;  1VQK V;  4CS3 A;  4UVC A;  2CE4 A;  1K3E A;  2IJI A;  4PA7 A;  4YJ2 B;  1FXK A;  3JAL A;  3RBZ A;  2UXX A;  1FJG B;  5EC1 C;  2Z5U A;  4J80 A;  1Q6U A;  3ABK C;  3RW0 A;  1H2M A;  3K58 A;  3P32 A;  1BHB A;  3AG3 B;  5LMN B;  4O4J B;  3ABU A;  3T1H O;  2QDO A;  1H2G A;  4JZG A;  1FPO A;  3BA9 A;  1J5E B;  3E2E A;  1AI5 A;  1ZTE A;  4JAU A;  3W7W A;  4DV0 O;  3RWR D;  1BHA A;  3L74 H;  5KUK A;  4HNA B;  4Q20 A;  2VQF B;  2NLJ C;  5LL6 Y;  5EK0 A;  3ETQ A;  2Q5Z A;  1DF4 A;  1SRY A;  4WFB V;  3WB1 A;  5KHH A;  2IJK A;  3QNE A;  2E76 B;  2NNU A;  4KL1 A;  2PYL A;  1SQB H;  2BTQ A;  2HVK C;  3B09 A;  1DF5 A;  5FPR A;  5ITZ A;  5IWA B;  1AI4 A;  4HBN A;  2ZIN A;  5FNV A;  3T1H B;  1AJP A;  3OUS A;  4BW5 A;  1G1X B;  1T5E A;  1Q81 W;  5LP6 B;  1ORQ C;  1JCH A;  4JYA O;  1PV0 A;  5EIB C;  2OTJ V;  4P9O A;  3W7S A;  2OCC B;  4TQF A;  1RPO A;  1U97 A;  1NJI W;  2Z3Y A;  4L8J A;  1IXB A;  3OGI B;  4ASU G;  3ABL B;  5JCO C;  5KHG A;  4RQE A;  3CJH B;  3STZ C;  1HP8 A;  3ZHU A;  1IUR A;  1M9N A;  1H2N A;  2IH1 C;  1NR1 A;  3VBB A;  4I55 B;  4D6T H;  4O4J A;  2UUA B;  1GK9 A;  5CA1 B;  3RYC A;  4PJ0 Z;  4UCS A;  2EIJ C;  3SJC C;  2F95 B;  1DTO A;  3ZRS A;  2QR4 A;  5CBF A;  3JAS B;  1M57 B;  5KHK A;  5E79 Z;  4CH6 A;  2HHH B;  1LUV A;  3B8M A;  3D8C A;  3R65 A;  1OCZ C;  2QGN A;  2CTW A;  5JJN B;  2IBZ H;  5IY5 B;  3AK3 A;  4GT1 A;  4B3T O;  3U11 A;  1Q6I A;  2JK5 C;  5K1X A;  1R6T A;  4YHH B;  3FAV B;  1BL8 A;  2XT9 A;  4I55 A;  3X2Q C;  3RN4 A;  1VQ5 V;  2UXB O;  3N2G B;  1SZT A;  4BIU A;  3CP1 A;  2A06 H;  3K9A A;  3K59 A;  2KB1 A;  1D5N A;  2M6Y A;  4JF3 A;  3E83 A;  4MS2 A;  5EBW C;  2ILM A;  4WCE V;  2JIZ G;  2XAS A;  5B66 Z;  3CCE V;  1VF6 C;  4RQF A;  1K73 W;  3K03 A;  5H2F Z;  4PA6 A;  5B1A B;  2QEX V;  2AXT Z;  1XUQ A;  1A32 A;  4X1Y B;  2FKX A;  3FD9 A;  4CC5 A;  1TUE B;  1GN6 A;  1QHT A;  4X20 A;  2UU9 O;  1HNW B;  1S76 D;  3JAW B;  3C90 A;  1Q43 A;  1WP8 A;  5IDJ A;  2A7W A;  4X8A A;  1MOF A;  2CGN A;  3EXA A;  2P67 A;  4GX1 A;  1IDS A;  4LFC O;  3DTU B;  3ETE A;  4FLV A;  2L35 A;  2ITD C;  2C2A A;  1TVK A;  3HKE A;  4DR5 B;  4NXN O;  1K7D A;  2ZIO A;  1XOU A;  3ZHQ A;  3CEI A;  2G38 A;  4J7J A;  2WA3 A;  1HNX B;  1Z5W A;  1P84 F;  2OWO A;  1ZL8 B;  5JVD B;  2P5O A;  5KMG A;  1B06 A;  2WLN A;  3R66 A;  2E74 B;  2FYU H;  1VQ9 V;  5JJJ B;  4DR2 O;  4IHJ B;  2WLK A;  2HVJ C;  1OCC B;  3S3W A;  4KHP B;  3OR6 C;  2DN9 A;  2IW5 A;  2VS0 A;  1QR8 A;  1VQL V;  5GON A;  1VAR A;  3RYI B;  2LW7 A;  2W0X A;  3IFX A;  1GO3 F;  1BE3 H;  1KKC A;  5JH7 B;  1Q90 D;  3UO2 A;  4FM0 A;  3AEI A;  5L3G A;  4B3S B;  5C93 A;  1YI2 V;  2JGU A;  1XHX A;  2P22 C;  4YHH O;  2AZ0 A;  1SQG A;  3ML0 A;  4DR4 B;  5J9P C;  4QE9 A;  5IYZ B;  4J10 A;  1B6Q A;  4F6E A;  1XBL A;  2DMX A;  1PNL A;  5L3F A;  2OIG A;  4LFB O;  2X6B A;  4LR3 A;  4CS4 A;  1PP9 H;  1SQF A;  3C3S A;  5J2U B;  3LUT B;  4O2A B;  1VQ6 V;  2W6J G;  1V9P A;  1KUQ A;  4JYB A;  4J7K A;  3ZRW B;  3RYH B;  4DV1 O;  4MW8 A;  1BQZ A;  3G67 A;  3CCQ V;  4H0L B;  1RSO B;  1SER A;  4JI5 B;  1NU1 H;  5L3E A;  4X62 O;  3ZS8 C;  1HR0 B;  4LF4 O;  2AHY A;  2JJ2 G;  2R70 A;  4UCT A;  3ZRV A;  1KB9 F;  3M99 B;  5KA6 A;  3SPH A;  1NVP D;  2ZQM A;  1XL6 A;  4LH7 A;  4WBN B;  3K57 A;  5H6R A;  2HJD A;  3M7M X;  4GKJ B;  4JI4 O;  2YXY A;  1EFR G;  4WFE A;  2DQ0 A;  2PI4 A;  4F6R B;  3ZMU A;  1AI7 A;  4UCO A;  3LSU A;  4RO2 A;  4D7S A;  1XDC A;  5J2U A;  2F43 G;  4IYI A;  4TQD A;  1BCC H;  3OMA B;  4GUN A;  4X64 B;  1WP7 A;  4FLW A;  1ARO P;  4K0K B;  1I7F A;  1BZK A;  4OPH A;  1HWY A;  5KUM A;  1M93 A;  5LOV A;  3CC4 V;  3OR7 C;  5DEC A;  2ZR3 A;  1E79 G;  3HKC A;  1SA0 A;  2YEV B;  3SGI A;  2IU3 A;  4RUE A;  2UXB B;  1SC5 B;  2JJ1 G;  1SQX H;  3H1L H;  2CH7 A;  1XMQ O;  4GKJ O;  2HR3 A;  4QIW F;  3L72 H;  4NR1 A;  5AG2 A;  3GVM A;  2L6L A;  1NVP B;  2UXC B;  4TV8 A;  1VQ7 V;  1TAE A;  1BT8 A;  3AG7 A;  3B40 A;  1KC8 W;  3ZN0 A;  4NB5 A;  2MW2 B;  4K0K O;  3SPJ A;  2LQT A;  4DV0 B;  4YJ3 B;  4BWA A;  3AG2 B;  1S77 D;  4HAM A;  1WPB A;  2CUG A;  4NYK A;  4EFE A;  4DV6 B;  2GUZ B;  3J81 N;  4HYO A;  1RP3 B;  1Y74 A;  1NKD A;  1NS1 A;  3D36 A;  4OXS A;  2FML A;  4EB6 A;  1WB7 A;  2AGA A;  1QLE B;  3HR0 A;  4QNH B;  4FZ1 A;  1GN3 A;  4LF4 B;  2YI9 A;  1YCI A;  1E1Q G;  5L3B A;  4LP8 A;  3ZIA G;  4MVZ A;  1X59 A;  3RGB A;  2KQX A;  4JI3 B;  5LOV B;  1IXM A;  5GON B;  1E1R G;  1EZV H;  1FXK C;  2QWP B;  3SYC A;  1UFI A;  1P7B A;  4DR6 O;  2B1G A;  2KG7 B;  4OGQ B;  3F5T A;  4DK0 A;  2FTK A;  4X1I B;  4RUF A;  3UO3 A;  4KHP O;  3E35 A;  3OMN B;  2GBO A;  3QG5 A;  3RVY A;  4JI6 O;  1G6U A;  2WLL A;  4R6Z A;  1LNQ A;  2QM8 A;  2XOK G;  1SF9 A;  4X88 A;  1IX9 A;  1AJN A;  4LNU A;  1EN6 A;  1K4D C;  2BSK A;  2YXH A;  2H94 A;  4AIL C;  4OPA A;  5JJE B;  2E3C A;  2WLM A;  5IJ0 A;  1P7G A;  1SQV H;  1S3J A;  1AB3 A;  3AG3 C;  2P90 A;  4J42 A;  2P06 A;  2WAM A;  3JD4 A;  3L75 H;  3TXS A;  2ITC C;  1S5L Z;  1H8E G;  1KD1 W;  1VEW A;  4KP4 A;  2PYJ A;  3ZHS A;  1PL4 A;  1OCZ B;  3AK1 A;  2QJ1 A;  4LBE C;  2JGD B;  4MTO A;  3T4D A;  4I7Z B;  4TUY B;  2WA4 A;  3OMI B;  3BPZ A;  3ZRX A;  2ADP A;  4MTX A;  4U3J B;  4XDK A;  4RWU A;  5B3S B;  3K06 A;  4LC1 A;  1QR9 A;  1IBM B;  2LW1 A;  2Q7E A;  3RYF B;  3ASO C;  4X62 B;  3B77 A;  1PKX A;  4K3A A;  2VQE O;  4FLU A;  4FLX A;  5LYJ A;  5ITZ B;  5JCO A;  1MAB G;  4QE7 A;  2Q69 A;  2WLI A;  5LYJ B;  5IJ9 A;  1M57 C;  2EIK C;  5J2T B;  3FB7 C;  4GCZ A;  4PEL A;  3TJT A;  5JQG B;  3FYE B;  4X65 O;  3X2Q B;  1W59 A;  4I50 A;  4IT5 A;  4E4E A;  4Z2W A;  4L87 A;  5LHI A;  1BSM A;  5DN6 G;  1I5Y A;  1VF6 A;  2F4V O;  3AG4 C;  5TIS Z;  4KXR A;  2ATK C;  3GWO A;  3CYO A;  2XAG A;  1IBM O;  3CMA V;  4AQY O;  4DV4 O;  4AI8 A;  3CXC U;  5B3S C;  1GMG A;  1LUW A;  1XNR B;  4NTY A;  2F1M A;  4TOI A;  3JAK B;  3NR7 A;  5A2Q N;  4PA9 A;  4DR6 B;  1FFX B;  2VWK A;  1ZL8 A;  1YJW V;  5FNV B;  5BY1 A;  4TV8 B;  3P3P A;  2CGO A;  3JD1 A;  2QE7 G;  2QTO A;  4GX0 A;  1N33 O;  3AK2 A;  2X0L A;  1KP3 A;  2IH3 C;  2V7Q G;  2P7T C;  4UVA A;  2Q0A A;  4LFC B;  1YIT V;  5IY5 C;  2WLH A;  3THO A;  3AG1 B;  2LP7 A;  4JI8 O;  4P2Z A;  3WG7 B;  2ZE6 A;  1KYO F;  1NH2 B;  2EIN B;  2BE3 A;  4C7U A;  3RVZ A;  4Q6G A;  5H9C A;  4PHZ A;  1Y6X A;  1JVM A;  1VQ8 V;  2UXD B;  3SJQ C;  3L71 H;  1GRJ A;  1COW G;  3SPI A;  2ZCE A;  4JAV A;  4X1Y A;  1XNR O;  4QPK A;  2Q6A A;  1PNM A;  3CWB H;  1K5Q A;  4ZKI A;  1YJN V;  3MHS C;  2ZE5 A;  4DV6 O;  4B3M O;  3BAA A;  2LFS A;  3HB3 B;  2H3O A;  2Q8V A;  4R8C A;  3G71 V;  1U96 A;  3CXH F;  1XNQ B;  1W2B U;  4FK5 C;  1ZUQ A;  1HNZ O;  4B3S O;  3ZED A;  2CTP A;  2DYR B;  5IWA O;  5BXZ A;  1M5I A;  1N0J A;  4DO2 A;  3DGE A;  2GUZ A;  1N0N A;  2PF4 E;  4NKG B;  5B1O A;  4DR2 B;  4B7E A;  2B9Z A;  5EIB D;  4X65 B;  5BMV A;  3PJS K;  2K9P A;  2EZP A;  4IHJ A;  1N36 O;  3D3I A;  1S0V A;  1YDX A;  1GM8 A;  2IJJ A;  3JAR A;  2LGW A;  3ABM B;  4DK1 A;  4PA3 A;  3CC2 V;  1KEC A;  3WFV A;  5F2V O;  3C3T A;  3I56 V;  2PGG A;  5LMU B;  2EIJ B;  4DV4 B;  1RPR A;  3LSS A;  3ABT A;  1WPX A;  3ASN B;  3K5L A;  5E1A C;  3TGU H;  2VWJ A;  4UV8 A;  3ZX6 A;  4MVS A;  1IBK B;  4ZHQ A;  2YEV A;  1UPG A;  2N74 A;  4LF5 B;  4IYH A;  3LNN A;  1M4U A;  2PY5 A;  2ODM A;  1EN5 A;  2LO1 A;  3CJH A;  2BSK B;  3JAW A;  3L73 H;  4X89 A;  4LWS A;  4JI0 B;  2XTA A;  1FAF A;  3GB7 C;  4I4T B;  4JTA B;  5CA3 A;  2YI8 A;  3CS5 A;  4EKW A;  3JSN A;  5LGU A;  1I0H A;  2EX3 A;  3JD2 A;  4J11 A;  5A9G A;  1MSD A;  3ASO B;  3P30 A;  4DV7 O;  1YEW A;  4UCR A;  4K35 A;  3JD3 A;  4H33 A;  2RDC A;  3AG2 C;  4G27 B;  3SYA A;  4I50 B;  3N27 A;  2JEX A;  5KMG B;  4ZBM A;  2ARH A;  1MNG A;  3OFN G;  5IYC O;  3ZHV A;  3CCJ V;  3Q4H B;  1VP7 A;  1YHQ V;  3TET A;  3KG2 A;  1SET A;  2CK3 G;  2XUM A;  2BTQ B;  2JS5 A;  1OCO C;  4LF9 B;  2DW4 A;  3T1Y O;  3K0G A;  3W7T A;  2QWQ B;  3QO5 A;  2FL4 A;  3F7Y C;  4LF6 O;  3H01 A;  2E75 B;  1WAZ A;  2QA4 V;  3G6B A;  1FYJ A;  3L9D A;  2ZE7 A;  3CRM A;  3IAY A;  1CXZ B;  2Y69 C;  5CA0 B;  1Q86 W;  4O2A A;  3CCL V;  1Q6H A;  4Z1V A;  2E5L B;  2JGD A;  4X64 O;  1R3I C;  3U10 A;  4DV5 O;  3WG7 C;  1I94 O;  4NXM O;  3IJ4 A;  4I0X B;  1CPY A;  4JI1 B;  2VQF O;  1DK1 A;  1M56 B;  1PD3 A;  1N33 B;  4DRX A;  1XIL A;  5HFL A;  4MT8 A;  4TSF G;  3OAA G;  1XMQ B;  4JAS A;  4YJ2 A;  1N4C A;  4UCV A;  2XAQ A;  3A0R A;  4UB6 Z;  1NBM G;  2EIM C;  2XAH A;  5EZY A;  2Y4U A;  3CX5 F;  2LGQ A;  4O2B B;  1NQT A;  2RNB A;  3DC6 A;  1R73 A;  4PI0 A;  2Q9L A;  1XMO O;  2AW9 A;  3M8A A;  1I08 A;  4X1I A;  1F7Y A;  1YF2 A;  1QVG U;  2RN9 A;  4H37 A;  3A0H Z;  2Q7G A;  5GTH Z;  1JJ2 U;  1Y67 A;  3ASN C;  1SS3 A;  2WWW A;  4PI2 A;  5D5Q A;  3OM3 B;  3G4S V;  4W4L A;  3CCU V;  3H1K H;  1CP9 A;  2ZR2 A;  3JAR B;  1WB8 A;  4P9P A;  1ZLZ A;  2QM7 A;  4CZZ A;  4O4L A;  3KZI Z;  1MA1 A;  3JCU Z;  3CC7 V;  3S3X A;  3H9V A;  2JVD A;  3STL C;  4DV3 B;  3W7U A;  3K5O A;  3BEH A;  5EZY B;  4DR4 O;  2UUA O;  3SJA C;  4ZOL A;  2JDI G;  4PV1 B;  4R50 A;  4LFB B;  4LF7 B;  1L0N H;  1FFT B;  1OZ0 A;  4JI2 B;  3FYI B;  5IT9 N;  3I55 V;  4CH4 A;  4LF6 B;  3ZMT A;  1JJO A;  3LSQ A;  1W0J G;  1FXV A;  3BY6 A;  1YZB A;  2P6J A;  1NTK H;  3ZJZ A;  2JS3 A;  5B1B B;  1Y76 A;  2DWD C;  4JAA A;  1GTO A;  5EYP B;  4CH3 A;  1ZWI C;  2EJR A;  2VQE B;  2XAF A;  5BR8 B;  4DV5 B;  1QNM A;  1I94 B;  1OCR C;  3OEE G;  4UB8 Z;  5IE9 A;  1SA0 B;  3ABM C;  4MSW C;  3P3N A;  4NVP A;  4LCU C;  2DQ3 A;  1D5A A;  3VQX A;  5LHH A;  1GH6 A;  1GN2 A;  1TVK B;  4LF8 O;  1UJW B;  2BCC H;  4TV9 A;  1D2D A;  1NI8 A;  2YS8 A;  2F4V B;  4FMT A;  5IYB O;  3ZMS A;  2W6I G;  4ICG A;  1VQP V;  2JEU A;  2Q4P A;  2X6A A;  5BR8 O;  3LNM B;  3VQW A;  3OD4 A;  4N23 A;  4ZI7 B;  5CBG A;  2QSA A;  5B1A C;  3ETG A;  3BVO A;  2Q0O C;  2GSM B;  4EEQ A;  4LF8 B;  3ZHT A;  1N32 B;  2MK3 A;  4UFZ A;  2IJH A;  4FFB B;  1GAX A;  1HDJ A;  4J41 A;  4LFA B;  1GN4 A;  4MVM A;  3PN1 A;  4FJC C;  1P4R A;  5CBH A;  4OX9 B;  3A0B Z;  2YSU B;  1HNX O;  5GTI Z;  1VMG A;  4AQY B;  1SES A;  4FIP C;  3B8N A;  2HEP A;  2KG7 A;  4PDV A;  4DUY O;  4TV9 B;  4JZ2 A;  3DXR A;  2UUC O;  2ZE8 A;  1OCC C;  2A0L A;  1AVM A;  1Y74 B;  2ZT9 B;  3HKD A;  3CRC A;  3OTO O;  4PDR A;  2EBO A;  1KP2 A;  1MZE A;  5B1N A;  1VIB A;  4LH6 A;  2DOS A;  1Y66 A;  4GKK O;  2EZO A;  1YVW A;  1W0K G;  3QTC A;  3HKE B;  1DLB A;  4LFA O;  3FKS G;  4DR7 B;  1M56 C;  4I9W A;  1IBL O;  1AJQ A;  3RT3 C;  3E8H A;  2PZS A;  4I4T A;  2WSS G;  4X66 B;  5KAI Z;  2Q67 A;  3TK1 A;  4DUY B;  2UUC B;  1US6 A;  1QCE A;  3APO A;  4F4L A;  3JAT A;  4B3R B;  2QKS A;  3E86 A;  5KHJ A;  4JI6 B;  5J2T A;  1J95 A;  3HPL C;  1AR1 B;  4B3M B;  3OUF A;  3ICX A;  2CAZ C;  3DXR B;  4DUZ B;  2OTL V;  1SZX A;  4X1K B;  1QBZ A;  1NTZ H;  1P49 A;  1KMI Z;  4JI7 B;  2A3Q A;  3LDE A;  3UKM A;  5CB4 A;  4JTC B;  2QWO B;  4MW3 A;  1VF7 A;  3D3Q A;  2RMK B;  2OCH A;  2WLI B;  4YY3 O;  2ZIM A;  1ZSP A;  1JR9 A;  1VQO V;  4FPP A;  4LF5 O;  1L8D A;  5FLX N;  4J9Z B;  3QF7 A;  5HFM A;  1SQQ H;  5JH7 A;  1N32 O;  2XND G;  2D2C B;  1N36 B;  2OIE A;  2BOB C;  1PM9 A;  2NN4 A;  5B5E Z;  1KBH A;  1OCR B;  1S5J A;  3W7X A;  3J80 N;  4HNA A;  1JMK C;  2ZKO A;  2DE0 X;  3FFQ A;  2P4K A;  3E89 A;  3E8G A;  2A79 B;  1YJ9 V;  4FLT A;  1VQN V;  4MVO A;  4ZIB A;  1FXH A;  1BS3 A;  2F66 C;  4BW9 A;  1F4M A;  4O4L B;  3Q4H A;  2GDS A;  1AP5 A;  4DR3 B;  4WF9 V;  1K9M W;  3T1Y B;  2HG5 C;  1TUB B;  5JQG A;  1M1K W;  2N05 A;  4DR5 O;  3OGC C;  3K04 A;  4WFF A;  4W4K A;  2YDE A;  4DV2 O;  1G4Y B;  4G2K A;  3JAT B;  4YXW G;  2ADQ B;  5KAF Z;  4NTX A;  1V54 B;  2OCC C;  2X6C A;  2E5L O;  3JD0 A;  4AHC A;  3WU2 Z;  3ZCC A;  1EBO A;  2QM4 A;  3CRA A;  2OT5 A;  5LXT A;  1JA8 A;  5JWP A;  4DRX B;  1EM1 A;  4QPJ A;  2YIC A;  3K5N A;  2ZDI C;  3SDL A;  4DR3 O;  2CTR A;  2V1D A;  4PD4 F;  4J9Y B;  4KFM A;  3JAL B;  4U7N A;  3A2F A;  1FJG O;  2DYS C;  4BIZ A;  4JI8 B;  4GX2 A;  4G28 B;  5IJ9 B;  1M90 W;  2Y69 B;  4CC6 A;  1R3L C;  5LMN O;  3UT5 B;  3RYI A;  2UXD O;  3CME V;  4B7K A;  1XMO B;  1VF5 B;  1GKF A;  5K1P A;  3ZMZ A;  3T2M A;  3ETD A; 
#chains in the Genus database with same CATH homology
 1OCO B;  1ENV A;  3H01 A;  1CEZ A;  2R9I A;  3M99 B;  2QA4 V;  5KA6 A;  3SPH A;  1NVP D;  2ZQM A;  1G8M A;  1XL6 A;  1YTF B;  2W0F C;  3ZMV A;  2DYS B;  2Y69 C;  5LGN A;  5H6R A;  1Q86 W;  2H8P C;  4JGS A;  3CCL V;  1EFR G;  4WFE A;  4WFA V;  3ZN1 A;  1NH2 D;  2DQ0 A;  3LDD A;  2PI4 A;  1R3I C;  1PL0 A;  1K97 A;  3ZMU A;  5BZB A;  1AI7 A;  3WG7 C;  4RO2 A;  3T4Z A;  3FB5 C;  4WFH A;  1CPY A;  1AI6 A;  1OHH G;  2F43 G;  1M56 B;  1PD3 A;  5GW7 A;  1R3J C;  4XDL A;  3ABK B;  5HFL A;  2B5U A;  4MT8 A;  3OMA B;  2EIL B;  4PDM A;  1KQS U;  3QO8 A;  1ARO P;  1WLE A;  4TSF G;  3OAA G;  4JAS A;  1HWY A;  4WFG A;  5KUM A;  3CC4 V;  3OEH G;  2XAQ A;  3LDC A;  3OR7 C;  3NXS A;  3SPC A;  3A0R A;  1NBM G;  2EIM C;  1E79 G;  2XAH A;  2ZR3 A;  2M7W A;  2B1I A;  2YEV B;  4RAI A;  2IU3 A;  4RUE A;  4TT3 G;  3CCM V;  3E8F A;  1YTF D;  1NQT A;  2JJ1 G;  1R73 A;  1PNK A;  3F5W C;  3CCV V;  1N8R W;  2HR3 A;  3K79 A;  4QIW F;  1QVG U;  4H37 A;  1JJ2 U;  3ASN C;  3G4S V;  2WWW A;  3CCS V;  1NVP B;  3OM3 B;  1V54 C;  3UM7 A;  3CCU V;  1EZJ A;  2ZXW C;  1VQ7 V;  1CP9 A;  2ZR2 A;  2PI5 A;  4P9P A;  3VOU A;  2EIK B;  1KC8 W;  2QM7 A;  4CZZ A;  2LFR A;  3ZN0 A;  4UV9 A;  3SPJ A;  2K1E A;  3EFF K;  2HLD G;  3AG2 B;  4R7C A;  1Q82 W;  1S77 D;  2IU0 A;  3CC7 V;  4HAM A;  5EBM C;  1YSC A;  3STL C;  3IGA C;  1VQM V;  4HYO A;  2Q68 A;  3W7U A;  1NKD A;  4TWK A;  3D36 A;  4OXS A;  1NR7 A;  3BEH A;  2DYR C;  4MVR A;  1R6K A;  1QLE B;  4QNH B;  3IC7 A;  4PDL A;  2JDI G;  4R50 A;  2Y48 A;  1E1Q G;  4P30 A;  4DXW A;  4GX5 A;  1FFT B;  1XL4 A;  5L3B A;  1OZ0 A;  5FL7 G;  4LP8 A;  3ZIA G;  3FYI B;  1VQK V;  4MVZ A;  4UVC A;  4UUJ C;  3I55 V;  1IXM A;  1K3E A;  2IJI A;  4PA7 A;  1E1R G;  3ZMT A;  2R9R B;  1FXK A;  3RBZ A;  2UXX A;  3LSQ A;  1FXK C;  1FXV A;  1W0J G;  3BY6 A;  5EC1 C;  2P6J A;  2Z5U A;  1Y4M A;  1ROP A;  2WLJ A;  3ABK C;  4UXN A;  3ZJZ A;  3RW0 A;  3P32 A;  1V55 B;  3SYC A;  1BHB A;  3AG3 B;  1P7B A;  2DWD C;  5B1B B;  2B1G A;  2XAJ A;  1GTO A;  3OE7 G;  2FTK A;  3ABU A;  4RUF A;  1ZWI C;  2EJR A;  2XAF A;  3E35 A;  3OMN B;  1H2G A;  4BAY A;  3RVY A;  2WLL A;  4R6Z A;  1OCR C;  1LNQ A;  3OEE G;  4MTF A;  3E2E A;  2QM8 A;  1MSW D;  1AI5 A;  1K73 W;  2XOK G;  3ABM C;  3W7W A;  4JAU A;  4X88 A;  4MSW C;  1AJN A;  1K4D C;  2EIN C;  4LCU C;  1BHA A;  2DQ3 A;  2H94 A;  5LHH A;  5KUK A;  4Q20 A;  2NLJ C;  1I5X A;  2WLM A;  1UJW B;  5EK0 A;  3F7V C;  1S3J A;  3AG3 C;  1DF4 A;  2P90 A;  5B1B C;  1V55 C;  3CD6 V;  1SRY A;  4WFB V;  2WAM A;  3AG1 C;  3JD4 A;  4PA4 A;  5LGT A;  2IJK A;  3QNE A;  2ITC C;  5DM6 V;  5L3C A;  1H8E G;  2NNU A;  1KD1 W;  4FMT A;  5IYB O;  3ZMS A;  4KP4 A;  1VQ4 V;  2W6I G;  2HVK C;  1OCZ B;  1DF5 A;  1QVF U;  1VQP V;  2JEU A;  4XDJ A;  4LBE C;  1AI4 A;  4MTO A;  3T4D A;  2X6A A;  2AHZ A;  1AJP A;  3OMI B;  3LNM B;  3OUS A;  3T1C A;  4N23 A;  3ZRX A;  4BW5 A;  1JQ0 A;  1L1F A;  4MTX A;  4XDK A;  1R6N A;  5B3S B;  4JPR A;  3K06 A;  4LC1 A;  1QR9 A;  5CBG A;  5IYD O;  1Q81 W;  3ASO C;  2WLL B;  4Z1M G;  1ORQ C;  5B1A C;  3ETG A;  1JCH A;  3B77 A;  1PKX A;  1JPX A;  2GSM B;  1RM1 B;  2OTJ V;  4P9O A;  3TCU A;  3W7S A;  1THZ A;  2OCC B;  1RPO A;  1BMF G;  2EIM B;  2MK3 A;  2IJH A;  1NJI W;  2Z3Y A;  4CBC A;  3FB8 C;  2X7R B;  4MVM A;  4ASU G;  1MAB G;  3ABL B;  1P4R A;  4FJC C;  2Q69 A;  2WLI A;  4QE7 A;  5CBH A;  1M57 C;  2EIK C;  4RQE A;  2YSU B;  3FB7 C;  4GCZ A;  3STZ C;  4PEL A;  5EC2 C;  1M9N A;  2IH1 C;  3FYE B;  3X2Q B;  1NR1 A;  3VBB A;  4L87 A;  2GHY A;  5LHI A;  1SES A;  4FIP C;  3B8N A;  3JCZ A;  5DN6 G;  3K0D A;  1I5Y A;  1GK9 A;  1JX9 A;  4PDV A;  3QO7 A;  3CPW U;  3AG4 C;  2ATK C;  3SYP A;  1OCC C;  3GWO A;  2A0L A;  3CYO A;  2XAG A;  2EIJ C;  4MVU A;  1H8H G;  3CMA V;  1DTO A;  3ZRS A;  5CBF A;  1M57 B;  3CXC U;  5B3S C;  2D3O W;  3EHB B;  4PDR A;  4E2L A;  2EBO A;  1KP2 A;  1GMG A;  3B8M A;  5B1N A;  4PA9 A;  1Y66 A;  3R65 A;  2EZO A;  1W0K G;  1OCZ C;  1YJW V;  1K33 A;  1K5S A;  1DLB A;  3JD1 A;  2QE7 G;  2QTO A;  4GX0 A;  3FKS G;  5L3D A;  5IY5 B;  2X0L A;  4GT1 A;  4HZ3 A;  1KP3 A;  1M56 C;  2IH3 C;  2V7Q G;  2P7T C;  4UVA A;  1YIT V;  5IY5 C;  4I9W A;  2WLH A;  1AJQ A;  3AG1 B;  2BOC C;  2LP7 A;  2JK5 C;  3E8H A;  3ZRW A;  4P2Z A;  3K3W A;  2WSS G;  3WG7 B;  3OW2 U;  3FB6 C;  1BL8 A;  2EIN B;  2Q67 A;  1NH2 B;  3X2Q C;  3TK1 A;  3RVZ A;  5H9C A;  1F4N A;  1VQ5 V;  1QCE A;  1JVM A;  1SZT A;  4F4L A;  3MD0 A;  1VQ8 V;  4BIU A;  3CP1 A;  2QKS A;  3E86 A;  4JYC A;  3K9A A;  3SJQ C;  1J95 A;  2KB1 A;  3HPL C;  1AR1 B;  4JF3 A;  3OUF A;  1QLE C;  3MHH C;  3E83 A;  4MS2 A;  1COW G;  3SPI A;  5EBW C;  2OTL V;  4JAV A;  4WCE V;  1QBZ A;  2JIZ G;  2XAS A;  4QPK A;  3CCE V;  1YIJ V;  2Q6A A;  4RQF A;  2A9H A;  3SYQ A;  3K03 A;  3LDE A;  1PNM A;  4MTG A;  1K5Q A;  3UKM A;  4JTC B;  4ZKI A;  4PA6 A;  5B1A B;  1YJN V;  4MW3 A;  3MHS C;  2QEX V;  1JOY A;  2LFS A;  3HB3 B;  1F51 A;  1TUE B;  2WLI B;  1VQO V;  4FPP A;  1S76 D;  4R8C A;  3G71 V;  4J9Z B;  1W2B U;  5HFM A;  4FK5 C;  5IDJ A;  4N21 A;  4X8A A;  1MOF A;  2XND G;  2BOB C;  2P67 A;  4GX1 A;  2DYR B;  1FS0 G;  1OCR B;  4DO2 A;  3W7X A;  3CCR V;  3DGE A;  4JTD B;  3DTU B;  3JYC A;  2HJF C;  3ETE A;  5B1O A;  2ITD C;  2WPD G;  2C2A A;  1K7D A;  3PJS K;  3E89 A;  2UXN A;  3E8G A;  5CMU A;  2EZP A;  4KUM A;  2A79 B;  1YJ9 V;  3SYO A;  2HFE C;  3D3I A;  1S0V A;  1VQN V;  4MVO A;  1FXH A;  1GM8 A;  1KKD A;  2IJJ A;  5H6Q A;  2WLN A;  3ABM B;  4PA3 A;  1S5H C;  5KA5 A;  3CC2 V;  1F4M A;  1K34 A;  1KEC A;  1VQ9 V;  3WFV A;  4U7O A;  3I56 V;  2WLK A;  2HVJ C;  2EIJ B;  1OCC B;  1RPR A;  3E8B A;  3LSS A;  3ABT A;  3OR6 C;  4WF9 V;  1GM9 A;  1WPX A;  3ASN B;  1K9M W;  2IW5 A;  1QR8 A;  2HG5 C;  5E1A C;  4UV8 A;  4MVS A;  1VQL V;  1M1K W;  1QLN A;  3OGC C;  3IFX A;  3K04 A;  4WFF A;  2YEV A;  3SPG A;  1GO3 F;  3K08 A;  1G4Y B;  1Q7Y W;  4G2K A;  3AEI A;  4YXW G;  3ABL C;  5L3G A;  5C93 A;  1K92 A;  1V54 B;  4X89 A;  1YI2 V;  2OCC C;  2X6C A;  3JD0 A;  3GB7 C;  2DWE C;  4JTA B;  3ZCC A;  5CA3 A;  3ML0 A;  1EBO A;  4EKW A;  5J9P C;  2ZXW B;  4QE9 A;  5LGU A;  1B6Q A;  2EIL C;  3AG4 B;  3JD2 A;  2OT5 A;  4XBF A;  1PNL A;  5L3F A;  3ASO B;  3P30 A;  2X6B A;  4I5S A;  1FXK B;  1F23 A;  2ZDI A;  4QPJ A;  2ZDI C;  4UVB A;  3LUT B;  3JD3 A;  4H33 A;  3AG2 C;  4G27 B;  2V1D A;  3SYA A;  4J9Y B;  2HKO A;  4KFM A;  2JEX A;  3G6E V;  1VQ6 V;  2W6J G;  4U7N A;  5EBL C;  4ZBM A;  1MG1 A;  4JYB A;  1S72 V;  2DYS C;  4BIZ A;  4GX2 A;  3ZRW B;  3OFN G;  4MVQ A;  5IYC O;  3CCJ V;  4G28 B;  1M90 W;  5LBQ A;  4MW8 A;  1R3K C;  3CCQ V;  1YHQ V;  2Y69 B;  1K4C C;  3TET A;  1R3L C;  1SET A;  2CK3 G;  3KG2 A;  1H38 A;  1SER A;  1K8A W;  5L3E A;  4QJF B;  5CN0 A;  1OCO C;  1GM7 A;  2DW4 A;  3CME V;  2AHY A;  3K0G A;  3W7T A;  2JJ2 G;  2ZD9 A;  3QO5 A;  1GKF A;  1RM1 C;  5LHG A;  3ZMZ A;  3ZRV A;  3T2M A;  3ETD A;  3F7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...