1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
2IXJA 1Q5OA 3ETQA 3TNPB 1CAUB 5D1IA 4FAHA 1PMIA 3ST7A 2XLFA 5FQ0B 3LWCA 2GAUA 2ZCWA 1QXRA 1SFNA 1J59A 1ZRRA 3WW3A 1YFWA 2PTMA 1J58A 2C0ZA 2OPKA 1WGPA 1X7NA 2ET1A 3ES4A 3SMHA 4MZUA 4MGYE 1ZRDA 1QWRA 3IBMA 4H7LA 1RUOA 1O3QA 1RUNA 3DKWA 1CAVB 4R52A 3OCPA 3U10A 4UBHA 2XL9A 4MUVA 4FAGA 2HKXA 4META 4ORFA 4I09A 5LRRA 1SQ4A 1NXMA 1I5ZA 2UYAA 1CAWA 3WW4A 3MZHA 3O14A 4Q0PA 3LA7A 2P17A 4BH9A 4E2GA 4OFGA 5E1RA 4QM9A 3CLPA 3CF6E 1TQ5A 3BU7A 4EV0A 3SCHA 5I8SA 3CL1A 2D40A 1XRUA 3NL1A 5FDBA 1VR3A 2QJVA 3H3ZA 2MNGA 2XGXA 4IEPA 2GC0A 2QDRA 3NKTA 4R8HA 3PVBB 3E5XA 4HZFA 5FLJA 3H1WA 4AQ6A 1UPIA 2H6CA 3N4MA 5I8TA 5KHKA 3CJXA 5FLIA 3HQXA 4F8AA 2PA7A 3VHRA 2XHKA 3FJSA 1Y9QA 2EAAA 5I0TA 2HJIA 5BY5A 4MGZE 1QXJA 5I0SA 5LEKA 4UBGA 4QXKA 3UKTA 1CAWB 1OMIA 4XFHA 1CAXA 2QCSB 2GZWA 5JSPA 1I6XA 2B9UA 4LUMA 1EYBA 2IXKA 2BNMA 1O3RA 3KGLA 2Y0OA 2V09A 2K9ZA 4Z82A 2ATFA 2ZKLA 1OI6A 3H9AA 2GC1A 5HI0A 4MX3A 3ES1A 2VPVA 3DV8A 2WC2A 4QX5A 5E16A 1JUHA 1J3QA 2Q30A 3B02A 2PFWA 2OA2A 4XF3A 4B29A 3EBRA 1HW5A 4MV2A 2D93A 3R6SA 3D0JA 3MPBA 5CVRA 5FPXA 1FXZA 5KHJA 4FT8A 4AVCA 4Q29A 4XFGA 5JCTA 1ZZ9A 4LUKA 1OD5A 3I7DA 3GBFA 3H8UA 4I01A 3QACA 4XEZA 1QY4A 3H7YA 2DCTA 2BNOA 2O1QA 1J3RA 5LRSA 1ZZ8A 4Q0UA 3EHKA 4EWEA 3HT1A 5FCCA 3U0ZA 4MH0E 4XETA 3LA3A 1VP6A 4LEJA 2ETEA 4LTAA 2CGPA 1NE6A 1X8MA 2IXCA 3WW1A 3RYPA 3H50A 4KWJA 1UIKA 2IXLA 4RD7A 4YYOA 2E9QA 4FBFA 1FI2A 1PM7A 2BEOA 4P9GA 3NVCA 5J3UA 1LKNA 4BYYA 4J1XA 1V70A 4I3PA 1J3PA 4Z07A 4J1WA 1U12A 1EP0A 5BV6A 2D5HA 3H1YA 3I59A 5K8SA 5C8WA 3HIFA 2D5FA 2I45A 4YARA 5BXXA 1GQHA 3DL3A 2OYZA 1XE8A 3CEWA 4HN1A 2GC3A 3KGZA 1EY2A 3RDIA 3S7IA 1ZNPA 3NJZA 1ZRCA 4YRDA 1YHFA 5T3NA 1DGRA 1YWKA 1YLLA 4WZCA 1H1MA 2XLAA 2VECA 1Q43A 2QNKA 3TNQA 3BPZA 3RYKA 4DINB 1RC6A 4QM8A 4QGNA 4IEOA 2PYTA 4QGMA 1G6NA 1X8EA 3EQEA 5JSOA 4CYDA 4AVBA 1ZRFA 4BIFA 3ELNA 2F4PA 2PQQA 2Z2SB 4WVZA 3NW4A 3WW2A 1X82A 1OFNA 2PHLA 4D7TA 1DZTA 1RTVA 4MGIE 4KU8A 5KBFA 1WLTA 1UCXA 1ZVFA 4AXOA 3FE5A 1ZX5A 3LOIA 4Q0QA 4IERA 4BHPA 2PAEA 5J48A 1RGSA 1ZZ7A 4IEYA 5CU1A 2B5HA 2ET7A 4ZU5A 2BGCA 5CADA 5EZWA 1CAUA 3IDBB 1H1IA 2Q0AA 2UYBA 4N9IA 1ZZ6A 3SCGA 4HMZA 4EWAA 1O3SA 3S7EA 4LLOA 2CAVA 4IEUA 4PIZA 1XE7A 4YSFA 2XL7A 4MGKE 5BUVA 4Q0SA 2CAUA 1GQGA 5JAXA 4WBBA 5LEJA 1CAVA 2H6BA 1IPKA 4YNIA 5C6CA 4NVPA 4XFIA 3KMHA 3D82A 2O8QA 3E6DA 1WA4A 2CV6A 2Q1ZB 3I54A 5FPZA 2XLGA 1LB2A 2WFPA 5AVPA 2B8MA 2XKOA 4QMAA 3C3VA 4I2OA 1CX4A 5JR7B 4ZU4A 3FHIB 4AVAA 4L11A 4X6QB 2PHDA 3MYXA 3LZZA 1NZCA 1O7FA 1UIJA 4XFFA 3FWEA 5KHIA 3ZDSA 3L2HA 3NSTA 3UKNA 1CAXB 2MPFA 3M70A 5I8YA 4IETA 3SCFA 4O9EA 5F1RA 3M3IA 4ZU7A 3OGJA 2XKPA 4O9GA 1FT9A 4E2QA 5KHGA 3DN7A 4OLLA 3PNAA 4F7ZA 2KXLA 4LA2A 3JZVA 1ZREA 4PJYA 5BPXA 2BYVE 4HLTA 5EFUA 5J7MA 3E5QA 5I91A 5I0UA 1NYWA 2GC2A 3RNSA 3D0SA 3SXWA 2GU9A 3OD0A 4KWLA 3FFQA 3G7DA 1YFXA 1O5LA 3OTFA 4JVAA 3E6CC 2N7GA 1UW8A 4I02A 3BCWA 2OZ6A 3H1MA 4D7SA 1L3JA 3E97A 4JTOA 4XFAA 3H7JA 2Z69A 1VJ2A 4KL1A 4TLFA 3LAGA 4JTNA 4LA3A 2BNNA 4X6RB 3BB6A 3ACLA 4K8FA 4JV4A 3OF1A 3HT2A 3IDCB 1IPJA 4AQ2A 5FLHA 2IXIA 4L2NA 4Q0VA 1O5UA 4XFCA 4XF0A 2IC1A 3RPQA 4A2UA 1LRHA 1RL3A 4N9HA 4IEWA 3ROUA 5JSRA 3EJKA 4XF4A 4E2SA 4IESA 3IWZA 3U11A 2FQPA 1YFYA 1DGWA 2PAMA 3KCCA 5I93A 3I59B 3SHRA 4XF1A 4KWKA 2Q4SA 4EWDA 1EPZA 4XF9A 3IIAA 1SEFA 3FX3A 2EA7A 3RYRA 3BALA 4I0BA 2IXHA 4I0AA 2UY9A 1Y3TA 5FQ0A 1LR5A 4HBNA 1Q3EA 4IEQA 2EVXA 4HVQA 4ONUA 3E6BA 3KSCA 4PIXA 4IEZA 1DZRA 2PAKA 1O3TA 2GH2A 1J1LA 3MDPA 3QOPA 4GULA 4IEVA 1NE4A 1CGPA 3FZ3A 4HN0A 2FMYA 3EO6A 2H0VA 3USSA 4HSLA 2MHFA 1ZZBA 1O4TA 3S0MA 4IEXA 1YUDA 2QVSB 1YFUA 2K0GA 4LULA 4XFBA 5I0RA 2OZJA 3PLQA 4KU7A 3CO2A 5KHHA 4UXAA 3LA2A 3UKVA 4HSJA 3GYDA 4HVRA 2UY8A 4HVOA 4PIYA 2VQAA 4EROA 1ZZCA 4QGLA 3E5UA 3RZZA 1UD1A 3H3UA
chains in the Genus database with same CATH superfamily
4W50A 4X88A 5FZIA 3P3PA 3UNPA 3AX4A 1O91A 4PDWA 4CDWA 5GZEA 2RMU2 1KKCA 2C0ZA 1GTOA 1HXS1 2P6CA 2CL2A 3Q8FA 4RYDA 2AZ0A 4RR3C 1CAVB 4FTBA 1RUH3 5FZ0A 4I50B 1EV12 1S5LZ 4DV7O 4K8RB 1K12A 5BNNC 4B3NA 4B1MA 2A3QA 2WWWA 3LD8A 3BU7A 4UW6A 1X9TA 1QJY1 4FK5C 2ZKNA 2F43G 3PVNA 1PNMA 4FTEA 3VQWA 1WNSA 5BXZA 1AJKA 5FY0A 3CJXA 4UFLA 1HP8A 4IUGA 2JJ6A 2B46X 1JCHA 4K21A 3MO4A 4HXCA 4QPGA 5DECA 4EFEA 1S0CA 1VBB2 4FFIA 2TEPA 4P9PA 4QX1A 3TWIA 3TRSB 5GONB 4YJ3B 3WG2A 4AEMA 1MS0A 3AG4C 1K4CC 5DDJ3 1G4YB 1IGOA 1N47A 1J95A 5GTIZ 2BNMA 1AJNA 2RMKB 4MS2A 4JI2B 5FUNA 3CMGA 1OI6A 3H9AA 1COV1 2VW2A 1FMD1 4XQWA 5ABJA 1W8FA 2FDHA 1U97A 1RVF3 2ZHKA 4QX5A 5L36A 4CDQA 4NROA 2JGDB 2I74A 5F32A 4I0XB 4RQFA 1XREA 3R6SA 1N0NA 4BK5A 1PZ8A 1TAEA 4FPGA 3K59A 3S5AA 3JQXA 3GBFA 3H8UA 1NA1A 3N9PA 2XWJB 4MVUA 5EYPB 3KD4A 3VDDB 3IIIA 5GW7A 2VTXA 3OGGA 1VP6A 1OV9A 1M9NA 4F6EA 2ARBA 3C7OA 4D6SA 2WNUB 2RN9A 1X8MA 3WSOA 3ME2A 1AR83 2HVKC 4JF3A 3ZSLA 2JDPA 4P9GA 4RA0A 5A80A 4R7CA 3N2GB 1R1A2 1RHI1 2YXLA 2AGAA 3M3CA 2D5HA 4KGQA 4RHV3 2A79B 1VQ4V 2JB8A 2ZBJA 1C3HA 2HWF2 2Z4FA 1WP8A 3CIHA 1IDSA 3ETEA 5FNVB 4D0QA 5IK5A 5KC6A 1Q82W 2VECA 1WD3A 4B3TB 3I3QA 2HWE1 1OUSA 3WNLA 5BNPB 5FOBB 2PYTA 1XHXA 1UF2C 3FAVB 3L73H 2E63A 1AYN3 5F2WA 1U5XA 2W47A 1GWLA 2PQQA 1AI7A 3BYWA 2R0FA 3KQ4B 2IVJA 3B94A 3K0GA 4D7TA 3CCUV 2PXJA 1ND2C 4L0PA 4CUAA 3ON7A 3IFXA 1VRH2 4P9WA 1SA0A 1US3A 3LEKA 4FPKA 5EZYA 3ZMNA 2YIAA 2E5LB 1R6NA 4I4TB 1QOTA 2C9AA 2VO5A 5T54A 3K4DA 1XE7A 3BTAA 5BUVA 1WLEA 2BRTA 3ASOB 1CAVA 5C6CA 1XNTA 3KMHA 1C8M3 4J7KA 1BCCH 2P6JA 1Q8SA 4QQLA 1ULGA 3ICXA 3C7GA 5JR7B 5E1AC 2E7TA 5JI9A 4PQ9A 4W6XA 4B1LA 5H9CA 3LZZA 4AAPA 3UKNA 4QIWF 1V6OA 2MPFA 5FYSA 1UAIA 2IWGB 4JI3O 3ALQA 2C26A 2Z42A 3O1TA 4JYAO 1CJPA 1URXA 2IM9A 5KHGA 3UO3A 3DN7A 1YTFD 1RUI1 5A6YA 1IG0A 4DFSA 1W8UA 4Q4X2 4QPIA 2ZPXA 4CUCA 4AHXA 5I91A 1GQPA 3SXWA 2DN9A 2YBSA 5GONA 4YJ3A 3CYOA 3AK2A 1HIXA 1MSWD 3E97A 4LF5B 1VJ2A 2WSVA 4UFKA 4LF9O 3LEGA 4GKYA 1VBC3 2IXIA 4NPLA 4DV0O 1SQQH 4O61A 1CZSA 1RL3A 1Z78A 3MUY1 5HCFA 2JGDA 5D8AA 5FZ9A 4JASA 4DRRA 5AG2A 1ND3B 4NUBA 3OB8A 3FUOA 3KCCA 4YHHB 4JGZC 4IGGA 1LNSA 3KHCA 2OUHA 2QQWA 5EYPA 2RS33 2VBBA 1JODA 3VDDA 4JTAB 4MADA 5J9PC 3SH4A 1Y3TA 2FZ1A 4PDVA 1D4M3 2W08A 4A7ZA 1PP9H 2HWD3 5FLXN 4S2HA 2WNUA 1OHHG 3E6BA 3ZMVA 4B3RO 2QDNA 3I3BA 2D6LX 5BNQA 3WNPA 3DYOA 3FZ3A 3KM5A 3NNFA 4GWNA 2H0VA 1PV0A 5CA1B 4DQAA 1O4TA 1WP7A 1YEWA 2QEXV 2RMU3 3CCLV 2ZXQA 2OZJA 5J36A 3AYDA 4KBZA 3GYDA 4FXKB 4BJ0A 1ZZCA 2CGNA 3E5UA 2OKXA 1RUI2 1EV13 1W6PB 5FNVA 1QQP1 4UCVA 3WB2A 3ZHVA 5C8CB 2OPKA 3FAVA 4GQ7A 1QDOA 1R081 4X66B 2WAAA 4PT6A 2QA4V 1DYPA 3CJIC 2WO3A 1VQMV 3WW4A 1IVSA 3D3AA 2VTFA 1D0GA 3WNOA 4B3SO 2BBVA 4LH6A 2JDAA 1IOAA 3CCJV 5DAWA 5I8TA 4UCOA 3ZSJA 1W3XA 1M4WA 2J1UA 3I3DA 3ZO0B 1DQ5A 5A7PA 2YGLA 1WA6X 4UW3A 2XVLA 4FPJA 1QXJA 5LATA 4AI0A 1G9DA 1WWYA 1OMIA 2BCCH 3GZTB 4LKSA 1WB8A 3DC6A 2ARXA 5IJ9B 5A7NA 2Y26A 5LGTA 1WAZA 3IT8A 1W05A 2RS11 1RPRA 1JYVA 2ZTNA 1QEXA 5LXTB 5JMCA 2A6WA 4UCRA 4DRVA 2RJKA 4W6YA 4D6QA 4EN0A 1PIV1 3KF3A 3ZFFC 3OMAB 4DR6B 3FHAA 2ZEZA 5KXDA 3L75H 2ZJCA 2QQKA 2XHNA 1MVQA 3UETA 1LJ7A 5FR3A 1QY4A 4LF8B 1DU3D 5LRSA 1S0BA 1R1A3 3RQ0A 4Q4V3 2EIGA 4MH0E 2ZM6B 4FFGA 1UNBA 4D6TH 3T4VA 4GALA 3DUIA 3WF2A 4IGOA 1NTKH 3H50A 1VB4A 4E2LA 2HWF3 1UIKA 1ONAA 3B4SA 1I94B 2IU0A 1SQFA 3HN1A 4I3PA 3VHPA 5IAVA 2RS51 3OPZA 4PQQA 3VBFC 3G80A 2CTWA 5F3GA 1VAVA 4EN6B 3GGLA 4TYSA 1Y74B 3WX5A 3ATGA 3RI9A 4ZXEA 1XOUA 1OLME 2X6CA 2C5DA 2ZQMA 4X62O 1ASJ1 1VRH3 5IYCO 1RC6A 3QO8A 3I3EA 4QGMA 3UGFA 1X8EA 2VZPA 3K75B 1Z7S2 5CA1A 2M7WA 1W8OA 3PUHA 2F1MA 2DF7A 3NNMA 3NW4A 1Y7BA 1PGSA 1NH2B 4EQVA 1CZVA 3KKYA 2R9IA 1QVFU 2J7MA 3LOIA 1HDJA 5J48A 2VE1A 5JJNB 4ZU5A 2P90A 2Y6JA 1PL0A 4DV3B 4BQ1A 4Q8LA 4LO8A 1N36O 3FB5C 1BHAA 4B3MB 5BNOB 4Q0SA 4H37A 4JI5O 1QHTA 4YGBA 1SRYA 2R30A 2JG9C 1W0OA 4GT1A 3VBRB 2VQUA 4Z92B 1US6A 2VJXA 4Q4X3 1S0IA 2B4KA 3FX7A 4JAUA 3C90A 1YDXA 3LOBA 3NSTA 1HRV3 3OW2U 2CWMA 2UUAO 4ASMB 1OPMA 2ZR3A 1C57A 5FFOC 1AL21 3BUCA 3ACGA 1FT9A 4G3YC 4U2AA 5F3CA 1MACA 1GNYA 1OLMA 3ETPA 1G1XB 3EXUA 4AEDC 1SLCA 3S57A 3OR7C 2R071 5T55A 3DEMA 1AR91 3RRDA 1CN1A 3ABZA 3MLKA 1KU9A 1W0PA 5IJ9A 5EK0A 4D7SA 4ZHQB 3ZN0A 2GNDA 4KL1A 5HBAA 3ZM8A 3GHNA 4UOJA 4PBOA 1V9U2 4QX3A 5LXTA 1DCSA 4K8FA 3DPRB 1S0EA 4W4KA 3DTUB 3AP7A 2YEVB 2JICA 2Q8EA 2CTPA 3EJKA 3WVJA 1SERA 3U11A 5LOVB 3U4SA 2KG7B 4AHCA 2J1SA 2DV9A 1J5EO 4Q2FA 4I0BA 5LHIA 3MGUA 1WCSA 2V7QG 2Y69B 2OTLV 1BEV1 4LT5A 4DUYO 4O2BB 4IEZA 4DV4O 3QOPA 2ZGPA 5F6LB 2W6IG 3FC0A 1MG1A 1K5MB 1CGPA 1VF5B 1PGW2 1BQZA 5FPRA 3K2OA 3KV9A 5DXDA 2QWQB 4CDXA 1LECA 2VBPA 4CH3A 3E86A 1IZ3A 2RR12 2BERA 4XOGA 5KWRA 4KG8A 1Y74A 3N9LA 4HKWA 4PIYA 3APBA 3WG7B 4NHLA 3WCRA 2CUGA 1THZA 5KC5A 3HEIA 4XQ4A 3T1YO 4Y5Z0 1POQA 1V9PA 2Q8DA 4XHBA 2QE7G 2GN3A 2XLFA 2WINB 2GAUA 1QXRA 1SFNA 1J59A 3RT3C 5IJ0B 1TG7A 2AW9A 1UO9A 3LEIA 2CE4A 4MZUA 4H7LA 3J8F3 4L9BA 1NKGA 1RUNA 2LFSA 2EIMC 1TMF1 1Q8QA 1ENSA 1IS4A 4RUEA 3H1KH 4DV6B 1RFYA 2JDIG 1RUG1 1YJWV 2QWNB 4Q0PA 3ZHRA 2P22C 4OHWA 2BDRA 3JD2A 2BJSA 3SYCA 4CH4A 5B1AB 4B7EA 4MLOA 4U3JB 5FO8B 4A7KA 1HNWB 2H0BA 5BNOA 4DR4B 3TXSA 5JJEB 5FLJA 4DXZA 2B5UA 5LA9A 3IJ4A 1PMJX 4Q4Y1 3AG2B 4WFHA 1FYJA 3H0OA 2ZX2A 4AFBA 1V54C 5I0TA 3CEIA 1XL6A 1DK1A 1XNRO 3VBRA 1YQCA 3E22B 1EAH3 3JBG1 1SLAA 4KGGA 2BU9A 4X65O 4WBNB 4NAMA 4UB6Z 5JWPA 3OR6C 4JYBA 3KGLA 2HP8A 2K9ZA 5L9RA 3DKQA 1W6QA 1RUC2 4WVVA 2JE9A 4M0HA 2XOMA 3IN9A 1PX3A 2HBTA 3O1VA 1HNZO 1RUF3 5FZ6A 2W3JA 3POIA 1QMJA 4IIJB 1ZTEA 4N53B 1PVC2 5CVRA 4CVUA 2R061 5KHJA 1M57B 2F95B 3AB0A 4Q29A 1ZBA1 2UXBO 2WLIB 3I7DA 1GH6A 5DUXA 3QACA 2WZR2 3O12A 1AI6A 2N05A 1K3IA 1ZZ8A 1PL4A 1LGBA 5L3BA 3LE0A 5JI7A 1QDCA 3AK3A 1VBA2 3AKPA 3DPRA 5JCOC 2IXCA 4RQPB 3WCSA 3WHTA 2ZX1A 3QCWA 1W9WA 2BEOA 3ABMC 2WLJA 1XHZA 3N9OA 2PHUA 4BYYA 1V70A 3KS7A 3KV5A 2AR6A 5LOVA 1D0HA 2BTOA 2JDMA 2KG7A 3L9JT 1Z7S3 1OA3A 3OT7A 4DR3O 1RXGA 1UU5A 3ZBHA 3SPGA 2P67A 4DPNA 4LFCB 4AEKA 2VNRA 4JI6B 3BKZA 3FLTA 1K5MA 5CKMA 2X5IB 1R64A 4CYDA 5L7OB 2YB7A 2ZEWA 2UWAA 3BN6A 1ZRFA 4BIFA 1W9TA 4G9SB 1IBLB 2DVGA 2EIJB 3WF0A 1PX4A 2WNVB 1E57A 5B3SC 1WLTA 3RWNA 4UFJA 1YTFB 4RFRB 1H30A 1YQ5A 4CA9A 5DEDA 4MXWB 1RMU3 5CU1A 2WPDG 4K0KB 1G86A 1LOGA 1JYNA 4L87A 2CY6A 1AL0G 4N9IA 3VBFA 5HV0A 2BOCC 2Y60A 3BIEA 2HJFC 1E1QG 4JGYC 4BPZA 5JIUA 1SG3A 1VQ6V 4NB5A 5BZBA 5FZEA 1CX1A 1C5IA 3OJBA 3C3VA 1LUVA 4YVSB 2VUCA 5JR2A 2EULA 5J2TB 2X8KA 3BODA 2DU1A 1NLSA 1CAXB 2BWAA 4YW1A 1WA8B 1P7GA 2OIGA 1W2BU 5CN0A 4DO2A 4ZONA 2QM7A 5HXMA 2WS91 4I55B 4BU2A 1W9FA 4CS2A 1WMFA 3K58A 5HCBA 1V9U3 4XACA 4YW3A 3PJSK 2GNTA 3AJZA 2X53S 1T6BX 4CBCA 4ZZ5A 4GMP1 3E22A 4KWLA 3T09A 4CCEA 1N4CA 5K4LA 3RGBA 4GUNA 4QQHA 4WBNA 2CWSA 2ZXWB 3LFMA 1C5HA 2JWPA 2W52A 4H2AA 3E35A 5JIAA 1I5PA 1PNFA 5LP6C 3IDAA 4LO5B 2JG9A 4DYLA 3RPQA 2PI4A 3RWKX 5DABA 4IEWA 5FMOS 4MTXA 1JXNA 5GLUA 2GTSA 4E2SA 4TSFG 3LSUA 3VLBB 4N53A 4XZPA 3LNMB 4XF1A 2WLIA 2ENRA 5IT9N 5JQGB 4HT1T 4FI9A 5JOYA 1UYYA 2DTWA 2UY9A 1OURA 2WR9A 5C33A 3CXHF 2JIJA 3PTRB 1Q3EA 4RS5B 3BU0A 5EYYA 4TQDA 4HVQA 1IX9A 4LK6A 4RQPA 1AYM2 1AROP 4LITA 4QU2A 1CIYA 2KSDA 3N9MA 4MG2A 5C70A 3C3SA 1Y4MA 3JQWA 4XMIA 5CKNA 1DTOA 3OEEG 5I0RA 3CO2A 1W0KG 4UXAA 2VZVA 3M3EA 4FP3A 4AVTA 3NWKA 2Y38A 5LMUO 3UM7A 3WQ7A 2CH7B 3RWRD 4XDPA 4KHPO 4EN7B 2YIDA 1WGPA 5L7OA 1VIBA 4AVSA 1I7FA 3H3LA 1QJX3 3DKWA 1OLRA 5TISZ 2SBAA 2WNVA 5FAXA 2OCCC 4YW5A 2VWKA 3FN9A 3SH5A 2P2KA 1ZWIC 1POV3 4MXWA 1A8DA 1NY71 4YZ2A 1XEQA 1GNZA 3SCHA 1REFA 4IV3B 1KS5A 1DGRN 2H94A 1SFPA 1OA4A 2RQ6A 1NCRB 1X50A 1O8SA 4BQWA 1OCCC 4UFMA 4BXFA 2QM8A 5LWBA 4BQ2A 1RUC3 2XHKA 2WFF1 1IQAA 3INAA 4CC5A 3D3QA 4P5HA 5LBCA 5J2TA 1KDMA 4QXKA 4HONA 4QQPA 4CU9A 2Q5ZA 2XJUA 4XFHA 1CAXA 5GZCA 4LUMA 1PVC3 3MLJA 2VMGA 2JX9A 2A70A 2WZR3 3M8AA 4C1XA 2ZE6A 1SCRA 1UZ0A 4I55A 3MIBA 4QX0A 4CCNA 4OGQB 3J7HA 5A6XA 4WVMB 1VBA3 2YICA 1UQXA 4MV2A 3MF6A 3WG4A 1M4UA 4IHJB 2WRAA 1OOPA 2D6MA 4XFGA 1FPN2 1GZCA 3ZCCA 2KQXA 1ENXA 3T2PA 4I0WB 1R3LC 3EHKA 5LA6A 2DQ3A 3AKSA 3LKJA 5FZ1A 4W8JA 3JCIA 4K1ZA 3HPLC 2PF4E 3NV3A 2DW4A 4H13B 3QH7A 4A41A 2GN7A 1LKNA 2O14A 1LODA 2WAOA 2DQ0A 2ADEA 2ARAA 1MS5A 5A7WA 2DYSC 3ZN5A 1W6OB 4HN1A 3I5DA 3KT7A 2OIIA 2JD9A 4JYYA 4BIZA 2PHWA 2XR4A 4RS5A 1GO3F 4YJ2A 2XLAA 4I7ZB 1W03A 2RDQA 5C9AB 3RZMA 1QNMA 5LB6A 4IEOA 3W7TA 1OCOC 4P2ZA 3LDRA 1DYOA 2Y4TA 5CFCB 5FOJB 3ZHSA 5APAA 1DG6A 3ZFGC 2ZEYA 4CXWA 4UFHA 4P9YA 2LUWA 2ZDIA 3HJRA 4URTA 3LF7A 4QDSA 4CCKA 4QGPA 4IERA 4WFAV 2VUDA 3PJYA 4SBVA 3J7MA 3O1RA 2IJJA 4P9IA 1G9CA 1BMV1 1V6KA 5FK7A 3CE2A 2VL4A 2CH7A 3S7EA 2JKXA 1F51A 4MGKE 1H6XA 4TOIA 5IVVA 5ISLA 2P34A 3DC5A 1FOD1 1V00A 4NVPA 1Y43B 2L35A 2QQIA 2WT1A 2NR5A 1NAEA 1CX4A 5C8YB 3IMMA 3BOPA 4L92A 4DR1O 4FFKA 1E5HA 3A23A 2W9XA 4IV3A 2IFWA 4JDNA 1D5AA 2ZMNA 2P3KA 4Q4W2 1NCRA 2ZE7A 1TME2 2E31A 3PVOA 2EILB 4ASUG 1W8TA 1WW7A 5F3IA 5IK7A 5HPOA 3VOUA 2PLV2 1A8MA 2QQUA 2HHHO 1ULFA 4KWUA 4BW9A 1L8DA 1E5SA 3VD4A 4YZ1A 2PELA 1T5EA 3ZMTA 1AR61 2RM23 2EF6A 1OC1A 1L3JA 3WDUA 2Z69A 1W99A 4JKKA 4TLFA 2LJ2A 2RV9A 4LA3A 3E8HA 1VBD1 2VNVA 3MHHC 4AQ2A 3KV4A 2YZ4A 1KD1W 2EIKC 4WVMA 4ZOLA 1CPNA 2OYQA 1LOBA 3OUIA 5IDJA 1YF2A 3SPHA 3K48A 2PMWB 1J83A 1PO12 1LOEA 2JIZG 3KV6A 1XMOB 1HXS3 4C0HA 2XB6C 2ZE5A 1W90A 1STMA 2Y69C 3GCXA 5JPNB 3K3NA 1LR1A 2PYLA 4FLYA 3R66A 4PA9A 5C93A 1S0GA 4XFBA 3X2QB 3B69A 2VOVA 4CC6A 1UPGA 1ZBE2 3T0AA 2QDOA 1J1TA 3NAPB 1B35B 2VZ3A 2BSKB 3GHMA 4YY3O 2RDCA 3SYPA 5C9AA 2WQ8A 3H01A 2DVDA 3RJRA 4O4IB 4ZHNA 2E74B 4AI8A 3CQOA 3AZVA 2P1BA 4FPPA 4RL7A 2JJ2G 4UBHA 3OAAG 2WSUA 4FAGA 1SACA 2AHYA 2UU9O 4ORFA 3RYIA 3GNEA 5FREA 3VZOA 4CH6A 3D36C 2Q73A 3JCUZ 1R73A 2UWBA 1YSCA 5JJJB 4EV0A 1RB8G 2P3JA 1TUBA 2QGNA 5HXVA 3ZHTA 3JU9A 1ZA4A 1WMDA 2AGSA 3R4DB 1SPPB 4F8AA 4RFT0 2G38A 3DYPA 1JFFB 1CIWA 1FFXA 3OTOB 2ODMA 2JRIA 4MGZE 5FBZA 2QUOA 4A4AA 5IWAB 5FZHA 2VVEA 4OHZA 2C2AA 2UXDO 2Q7GA 1L0NH 3ES1A 3ZFEB 1LHOA 4N8MA 4WM8C 2Y33A 2YFUA 3E1F1 3UL2A 5L3GA 2Q30A 4RQEA 1W2OA 1T6GC 3ZYJB 4FCAA 5FYBA 2YGMA 2GUZB 4UWDA 2HWC2 2WO7A 3PUQA 5J2UA 4LBKA 4TZDA 2RJLA 3TGUH 4ATFA 1KBHA 2O1QA 2ZZJA 1KQRA 5IJRA 3STLC 4LEJA 4LBEC 1SFYA 5TSWA 1AUYA 4DV5O 4A44A 4BLJA 1MEC1 4LBQB 3AKRA 1Y76B 1NR7A 3K57A 4CEWB 1SQXH 1PNGA 3MBWA 4LR3A 3ZHUA 1KECA 3H1YA 4DR5B 1BZWA 2D5FA 3LPGA 3UESA 3VBOC 1SKVA 1LUWA 4NAOA 1AX1A 4W6WA 4XMAA 1X9PA 1SBDA 4DXWA 2V4DA 4HNAA 3CDZB 2XAHA 1HNXB 3ZIXA 3T1HB 3DXTA 3VD7A 2WZEA 4CP9B 1FXKB 2X10A 2YS8A 4CCMA 2E53A 3MV01 5GLVA 2ZNJA 1AJPA 1RUJ2 4LFAB 5LYJB 4BR6A 4AI3A 3STZC 4ICGA 4CU7A 2H8PC 1VF6A 4QXHA 2BSKA 2QZ2A 2WYFA 5A2QN 4QU1A 2JJ1G 2K2SA 2IJKA 1ZZ6A 3O65A 2Q4PA 3IAYA 5HCAA 2WA3A 1AR71 3W7WA 3ZR5A 2UURA 2H6BA 2Y6LA 3VBHB 3D82A 4QPYA 2EXHA 2Q1ZB 4Q4W3 5DQ0A 4NRPA 2ETNA 2B8MA 4DXTA 4C8DA 2EICA 1NTZH 1BJQA 1KITA 5JOWA 1FJGB 4NPRA 2BBAA 2Y0PA 3JALA 2D6PA 4LO6B 3T1LA 1OH4A 1ACCA 3OPWA 3VKMA 3ZFGA 3BAAA 2P5BA 3AMQA 3N7MA 3AMNA 4EN9B 5FP8A 1PO22 3CNAA 1OCRC 5IY5C 4AGVA 2FCTA 4YM3A 3QG5A 1SPPA 1C1LA 2G9GA 1JU3A 4JI8B 1Z5WA 1JFFA 1GN6A 5FZCA 5GM0A 2W1UA 4DXRA 3HKDA 5FWJA 3H8XA 1QIQA 2QWOB 1B3QA 4XTMA 4O7XA 4J25A 2FHRA 4JTOA 4ZY9A 4OQ8A 3K03A 5T5PA 5DMYA 3N9QA 5GLZA 2V4AA 1MZ5A 2W1WA 2EIBA 3ZMZA 4OMDA 1JHJA 2V5YA 5IYZB 4QKNA 4LF7B 2VMHA 2GUZA 2VMCA 4K8ZA 4L8QA 1PZ7A 1QQP3 3LDCA 2VOTA 1UY4A 1SZTA 4D7YA 5FXXA 5LBFA 3ABKB 1H2SB 2IXHA 3H1JH 4XJ9A 1RUD2 4Y4RA 2Y4UA 4IEQA 3PURA 1R083 2Q69A 1ZBE3 5H9QA 4TWTA 3V56A 2QSAA 3H1HH 4LBQA 1Y76A 3DXUA 2QKAA 4FFFA 3N27A 4CEWA 1JZ4A 1IBMO 1D2QA 4MW8A 4HSLA 2VOWA 1SLLA 5JLVA 4LBLA 4LULA 3PLQA 3KLSA 4AI2A 2NN8A 3CZJA 1AHSA 1JZ3A 1QNYA 2UY8A 2FYUH 4FZ0A 1R3KC 3RZZA 2M6YA 3JAKA 4NIIA 1PMIA 5FQ0B 4D94A 4DUZO 4G28B 4QPKA 4MSWC 3VZJA 1Y9MA 3CC7V 3D4KA 4MGYE 5H9SA 1QWRA 4CP9A 1FXKA 2FCVA 3U10A 2XL9A 5B1BB 4META 1CPYA 3SPIA 3VDAA 4XILA 3HD8B 1WBFA 1C28A 2V5DA 2VQFB 2PHTA 5CFDB 2BFUS 3ECQA 3G6BA 4M3CF 1VBE2 1QLEC 3CL1A 1N1VA 2BTVC 1PIV3 2Y8KA 2AHZA 4MVTA 5FMOL 3PVBB 4AQ6A 2FD8A 5FPLA 4MT8A 4GMP0 4Z8BA 2P5OA 5J37A 3QBQA 1OFSA 2AENA 4PA7A 2Y6GA 1AX2A 1WCUA 4L97A 2VMFA 3CRAA 1IXMA 1GK9A 4FLVA 1UZWA 2QCSB 4KNCA 3B7MA 2HWC3 4H0LB 3QO5A 1AVBA 2ZKLA 2QBXA 5B2GB 1WCQA 3JAWB 1YITV 2UXXA 2YMZA 1YQ6A 3WDYA 3X29B 2WC2A 3B77A 5CB7A 4XAAA 3POGA 4IV1B 3B02A 2OA2A 5JH7B 1MQTC 4KXRA 4XEZA 4HKOA 2ZGQA 3K06A 4OX9B 2YXSA 4ABMA 1W8ZA 1OXCA 1V6IA 1M90W 1LTEA 1E5IA 1PK6B 3RYPA 1NQJA 4H33A 3WNNA 3WP5A 4GKXA 2J22A 1TGOA 3CXCU 5J3UA 5IYZA 4E4DX 4QHOA 4UCSA 4EN8B 4GB32 5KAIZ 4U3FH 4J1WA 1GWMA 2ZGLA 5AC91 2FCUA 1XYOA 2LQTA 5FZOB 3TN91 2OUJA 1F7YA 2ZMLA 1B6QA 2OYZA 4OUEA 2ZM6O 4XUPA 5CMUA 2ERFA 4JV5O 3U1XA 3SR2C 1AILA 1RUJ3 3ZRVA 4FLWA 3QF7A 3F7VC 4LO7A 2ZIMA 1JOYA 1G6NA 1F15A 3CS5A 1NVPB 1YI7A 4OXSA 5ACA2 4XE9A 2Y64A 2KD7A 3MLLA 2GMEA 1RTVA 2JENA 1GP5A 4LHNA 1SQGA 4YM2A 2DJVA 2JE8A 4A6SA 4BHPA 1BYHA 1PM4A 2KR2A 1GICA 2XQRA 1SLTA 4Q27A 1A78A 2QR4A 1NCQC 4JKLA 3CU7A 4X64O 1ODNA 1DHKB 4NR1A 1R1ZA 4IEUA 4YSFA 3LSQA 3U37A 1JJ2U 1GQGA 2QTOA 1UWWA 1AR93 1IPKA 2CTVA 4XFIA 5AFEA 1PO23 4QPJA 3O0XA 2C9KA 3I54A 1OD3A 2IVIB 1QU7A 3ZRSA 5J09A 2PYJA 2EIDA 4Z2AA 3PN1A 5CFDA 4P14A 4DV3O 1PNKA 4XFFA 1UJWB 1O7FA 4COZA 1UYPA 1RITA 5FYHA 1EN4A 2LGQA 2A3XA 2WWJA 1IBKO 3B00A 5F3EA 3R65A 5DDJ1 4ZU7A 1A32A 1WBLA 1EN5A 3A4UA 2FL4A 4JZGA 4XBQA 3JZVA 2W95A 3ACFA 3AZXA 1RVF1 2GC2A 2JDNA 1BEV3 2QQJA 3JSNA 5FK8A 4NIHA 2ZCEA 4N7IA 1FATA 1LHVA 1DLCA 3UGHA 1JOPA 4XQDA 4OI4A 2WQZC 2XBO1 3ZN6B 3P5BA 2R32A 4GYCB 2BGOA 2BNNA 4GKKO 5FZBA 1SQBH 3OF1A 4ZI7A 3HT2A 1JH5A 2IC1A 4QKDA 1RUH2 1V6MA 3RS6A 4A3ZA 3ROUA 4AGRA 3ILNA 1K3EA 4JCKA 5FKBA 1AR81 2VZSA 1XBFA 4E9KA 2BZDA 4N43B 3I59B 1HN0A 4HETA 1RUE2 1AB3A 4EWDA 1LEDA 4EKWA 2TNFA 2QQVA 4F3JA 3URFA 4MVQA 2BOBC 4MVOA 4ONUA 4JI3B 3ASIA 1XPWA 1AI4A 4CEYC 5FZ8A 4JYAB 1NXD1 3KZ4C 4J6GA 4LO4B 4BMBA 2LS6A 2WLLB 3JCZA 1H0BA 3HR9A 5FZOA 5I0DA 1W28A 1XU2A 3LA2A 4EJRA 1XQNA 3WINE 1VF7A 1ZL8A 2SLIA 1RM1C 1WD4A 1Y9QA 1W2UA 1Q5OA 4KMQA 2WWUA 4GZ9A 4E4HA 1WCKA 4LF9B 3JD72 3ZN4A 1PKXA 3T2QA 1VBE3 5LA0A 1X7NA 1BXHA 4S2FA 2QKCA 2FMLA 3A2FA 4RGAA 5B66Z 3SLIA 4GH4C 4LOSA 3AG7A 2HWB1 2P17A 3VBUB 3WB1A 1GBGA 3WF1A 1HV0A 2D98A 1K33A 2GHYA 5H5NA 3OMNB 2LTNA 5IVBA 2XGXA 4LBJA 3ZEDA 4R8HA 1UXZA 2YI9A 1UU6A 4B3RB 1SC5B 2E7QA 4CCLA 4CDWB 2OS2A 4RHV2 5EQUA 3UKMA 1R092 3AG1C 2C24A 3VV1A 2PGGA 1W8HA 4B4RA 2XWBB 2A6YA 1VEWA 2F6BA 1DDLA 4NXNO 3UKTA 1ENQA 3TK1A 4TXWA 4DR4O 1OSGA 5LK5A 5A7QA 2Y0OA 3GZEA 3VHOA 2BPA2 4E8DA 2DURA 2P4KA 1N33B 4P9XA 1AYN2 2Q67A 1GLHA 1B06A 2O0OA 2B7YA 4YLZA 2DOSA 1NI8A 2V73A 2W0FC 1REEA 4FT8A 4NJ4A 1HR0O 3ZX6A 2VWJA 5DPNA 1VIWB 3OUJA 4CRQA 3RZKA 1U0AA 4GB33 2ZX3A 2DCTA 2ZGSA 2WNEA 4JHTA 4V1PA 1QJU2 3LA3A 3HR0A 2VZOA 4OI1A 4B3SB 2RS31 2CGPA 4NOTA 3AG3B 1AXYA 1CEZA 5KXCA 1D4M1 2WWSA 3NJXA 2HWD1 4CPBD 4YYOA 3CX5F 1C8M2 2GBOA 4EE2A 4F83A 4Q6GA 2ZINA 5C3QA 3P30A 1A34A 5ABJB 3Q8AA 4PDMA 4Z07A 1V55C 4I3GA 1KYOF 5BV6A 2JG8C 1TUEB 3I59A 3HIFA 4CP0A 5KLVH 4Y20A 4B8EA 2RMU1 1PNLA 2WABA 3D8CA 2K46A 1XNBA 3ZYFA 4MYEA 2C1FA 3M1HA 1YLLA 1M93A 1V6LA 4WZCA 1VQ5V 3TNQA 4DINB 1EV11 3JASB 1I08A 2YG0A 2RDRA 1MQTA 1AXZA 4N90A 5LZ6A 5C4WA 3EQEA 5JUVA 4PA6A 3CB2A 2WLLA 2VTXJ 3ELNA 3OEBA 3AK1A 3HMYA 3S3WA 2ZGOA 1XBLA 1FV2A 1ZM1A 5KAFZ 1WMXA 5IFPA 1EZJA 4WM7C 3S5QA 1PZ9A 1F5JA 1NZ6A 3C8XA 2NM1A 2ORZA 5IWFA 2OT5A 3P6BA 3IMNA 1Q90D 1XILA 4LKEA 3B09A 5SV8A 3EYPA 3AK0A 2WS93 4CP2A 4LP8A 3DGTA 1M56C 1YHQV 1VBC2 3RYFA 1AR4A 2UXCB 2DBNA 1VBB1 1IBLO 2JEUA 2VZQA 5L3FA 1OZ0A 3FLRA 1I5YA 3L2YA 4ISRA 1JZ5A 3P1IA 3CC4V 3E6DA 5FPZA 2WFPA 5FKCA 3I2HA 1UOJA 5FPAA 4K0KO 1AJOA 4LHLA 2HWD2 3ABLC 4X6QB 3H1LH 3MYXA 4QX8A 3L2HA 2E26A 1ZYBA 3FYEB 1W8WA 3OBZA 4O9EA 4P00B 4CTEA 2DVBA 3VKFC 3UJQA 5C7GA 4YVWC 2YYOA 5CAZA 4Y5TA 1G9BA 1UOGA 5FYMA 4RGKA 4OHXA 5HV4A 3AKQA 1ENVA 4Y1VA 1NCQA 4BQXA 4V2WA 1MZ6A 4F6RB 3AXDA 3N3HA 4J80A 4AR2A 3CRRA 3ASNB 1YXBA 4NXMO 1RUE3 1R1A1 5BR8O 3IDCB 2DCYA 1N36B 4XDOA 1NQDA 4ZZ8A 1HB1A 4N9HA 4AGGA 2WLMA 3ZKYA 1U5YA 2HWF1 2DVAA 2C4XA 4DK1A 3MV11 4K7JA 3LQCA 5IW0A 1HRI2 2EINC 4YW2A 4QPIB 3V64A 1BCXA 4QQ2A 2CDOA 5DG1A 4FLUA 3VZKA 2EA7A 4JAAA 3W7SA 4HBNA 2Q7HA 1ENRA 2WKKA 4B7KA 1I0HA 2UUAB 4K9SA 1JHNA 3GM8A 3KSCA 5K9YA 4QB1A 2GSMB 1DZRA 4FO9A 3SYQA 1LEMA 2XAJA 4ARYA 2ORXA 4WFEA 3POSA 5CBHA 5L3DA 3EO6A 4CCOA 1VQ9V 5IYBO 1VRH1 3TAYA 4DV1B 3S0MA 5JZGB 3JD73 2K0GA 3MEPA 4Y26A 5D8AB 3C7FA 2ATKC 4KP4A 3WNKA 3AYEA 4HK9A 2DYRC 5LHHA 2F23A 1XNCA 3ETDA 4QGLA 5FZ4A 5IK4A 4CU8A 1DQ1A 3BIWE 3QD6A 5CIRA 2W46A 4JZ2A 3W9AA 4FAHA 4JDMA 2FMDA 3ST7A 1V6JA 3KQRA 2WFF3 4NRMA 4UI9L 2ZCWA 3JASA 2J1AA 2KM2A 2UUBB 3UGGA 3SEPA 2PTMA 1FXHA 1SBFA 5A1LA 1P8JA 4MUVA 4S2GA 4QNHB 5LRRA 4I09A 3BGAA 5CG9A 2QZ3A 5FMBA 4CEYA 4K3UA 3LA7A 4Q4V2 3O7OA 5FL7G 1R093 2ARHA 2A06H 1J5EB 4E27A 1HX6A 4OUMA 2D40A 2WN3A 4Q4X1 4XVHA 4TWKA 2AYHA 4DUYB 1L0LH 1JMUB 2NQYA 2ZX4A 2CTRA 2CSGA 2HVJC 4FPCA 4DV4B 4OHVA 3HNMA 1H8TB 2ZD9A 3I4IA 3D5OA 4H44B 3ETGA 3THOA 5FYUA 4TV8B 4DOUA 1CESA 4CDUC 4N7UA 5BY5A 4FLZA 1I9RA 4X89A 3M2MA 1W0JG 3H8OA 3O0WA 5F5IA 1BQPA 4ZIBA 3D3IA 1GFF2 3ZS8C 1UN1A 1CWPA 1EYBA 3T1YB 1XU1A 4GAZA 3K5LA 1Q6IA 4BXSV 2HBUA 5F39A 1BS3A 3O0VA 3BVOA 2HEWF 1TA8A 1D5NA 1QJU3 4XURA 1NKDA 4OZXA 1JUHA 4P5YA 3SYOA 3CJHB 2AREA 1ULOA 2QQMA 2RNBA 4X8AA 4F6RA 4LPLA 3IM0A 4CU6A 3EVKA 1LCLA 2R1DA 2YY1A 2UUCO 5DN2A 1BBT2 3USUB 2D97A 4RR3B 3A21A 1FI2A 4FVVA 1PM7A 1H9WA 2ZR2A 4Y5SA 3WP4A 2DBIA 3HOBA 5BNNB 4QT6A 2YPJA 3MUZ1 2MW2B 3ZSEA 2BFUL 4J7ZA 2WT2A 5C8WA 1XNRB 4YARA 3CCMV 1HRV2 3KGZA 2HLDG 3WY6A 1DQ0A 2Y0IA 5H9RA 5T3NA 5A3TA 1YWKA 4LWSB 1Q8OA 3W5NA 4JRLA 2Z5WA 5F2SA 3JUUA 3K3WA 4NTYA 2R16A 4R6ZA 4PELA 2JD4A 3POBA 5JZGA 1GP4A 1GN3A 2JEMA 3WNMA 3SGIA 4YG3A 3AG4B 4AWDA 4MGIE 4RGGA 2XXZA 4AHWA 4KU8A 5KXBA 1UCXA 4AXOA 2UXBB 5F9TA 4YGDA 5FJHA 3ITQA 3I8TA 4FLXA 2XMLA 3PDQA 4PA3A 2L9LA 1S2KA 2DFCA 4SLIA 1F4HA 3THPA 4BOWA 4EWAA 2DU0A 4PIZA 3BI3A 5FUIA 5GZDA 4BQYA 3VZNA 3F2ZA 1IKQA 4OVEA 4JZRA 5LEJA 1GRJA 4IT5A 4YNIA 3OMIB 4E8CA 1S3JA 2DYCA 3B93A 1KC8W 1K7DA 3K9AA 1BZKA 1WW4A 1UIJA 4A5UB 3ZDSA 4XIKA 4XBFA 4IETA 2ZAHA 3OYWA 3ZR6A 3THDA 4O65A 4WM7A 1X36A 1S5HC 4DR2O 4E2QA 5M0TA 1CXZB 4FPFA 4EFBA 1H8TA 1AVMA 2KXLA 4XBNA 4ZXKA 3LSEA 3IDEA 1ZREA 1NX9A 3WG1A 3HKCA 2A7AA 2GSYA 4TV8A 1LHUA 3RNSA 1RINA 5FRAA 3FFQA 2EJRA 4P02B 3I97A 4GLXA 1XUQA 2XAFA 4G27B 3NQHA 4HK8A 1HRI3 3H7JA 1MABG 1HJFA 4UVCA 4DV2O 4K3AA 3J4UH 3J8F2 3HBZA 4MGQA 1CP9A 1Q86W 4J11A 2P4VA 1FS0G 3A0RA 3CJHA 5A3NA 1ND2B 1QH6A 3LDDA 2XTAA 2WYSA 3A8TA 5K1XA 3OUHA 1DGWA 3QLQA 3W21A 1UMHA 1SEFA 2IW5A 3FX3A 2YI8A 4URAA 4LJHA 2FDKA 1FPOA 2MEV2 1VPHA 4OMCA 1Z7S1 4LR4A 3USUA 2VULA 4UT5A 1AI5A 1WB7A 2VQ0A 1VQ8V 4RR3A 5A6QA 4R50A 2NP0A 1EN6A 1FYUA 1KD7A 4FZ1A 2FMYA 2ARCA 3RN4A 2NPIA 5BNNA 1NT2B 2P4EA 1SESA 2EIEA 1EAH2 1GP6A 4FMTA 2Q8OA 3WUCA 4HSJA 5DZGA 4ARXA 2X29A 3GWOA 1EM1A 3OSDA 4EROA 4D8MA 4Z2WA 5E6HA 3PVEA 4A7YA 2GTAA 4LWSA 1I5XA 1Z5VA 2RJZA 1JZ6A 1RUF2 2YXHA 5IVEA 4E4EA 3SEEA 1UOBA 4AK3A 2OX0A 3C3TA 4BLIA 3G67A 4PCRA 5FYVA 4LF4O 3VBSC 1XYNA 2JKBA 3JARA 3RSJA 5E79Z 3V0BB 1CAWA 4IE4A 3W20A 4HKLA 1WCDJ 3THCA 3AMHA 1G6UA 4CDXB 1UPSA 4W4LA 3BY6A 5A3OA 5LBQA 4YFZA 2QDRA 3VL9A 1M1KW 5JXJA 3NNGA 1Q8VA 2D3PA 4PDWC 4JGZB 4H14A 2JGUA 1EPWA 5ITZA 3K4ZA 3K77A 1P84F 2FDIA 3HKEB 1V9U1 1MPXA 1S4CA 3PHMA 1K45A 1VMJA 3WXPA 4MGSA 4IE7A 4NHMA 5FPVA 4B4QA 4BMEA 5F7UA 2NZ9A 4KG0A 2WNOA 4KHPB 5T5OA 1EBOA 3GWKC 2W0XA 1BBT3 2PFWA 4AF9A 1Y66A 3K08A 3I2IA 2VNOA 5EYXA 5FPXA 3SPJA 1RMU2 1WZXA 4GX1A 1GU3A 3MD0A 1OD5A 4LUKA 5FP7A 2J1RA 2XVKA 5KA6A 4QPGC 4TQFA 3GCWA 5EP9A 2YC4A 3NMBA 5FCCA 3OUSA 2UU8A 3U0ZA 4CUBA 1PGW1 4XETA 1NR1A 4NHKA 3SQOA 4HAMA 4IDZA 4CDUA 1SETA 2E9QA 2RR11 1W6QB 2JVDA 3ZMSA 3CJIB 3WZ1A 1ND2A 1LGCA 5T5LA 5B1OA 4O2AA 4BW5A 4CDQC 4LF6O 1SS3A 4HOOA 3LGRA 3G71V 3G6JB 4O4HB 1DGRA 4I9QA 4QDRA 1NA1C 2BOIA 5DUWA 3CRQA 1A3KA 3GJAA 5FZ7A 4YW4A 4BB3A 5F37A 5FO9B 4JI7O 1BGYH 4UV9A 2KA3A 1HQWA 3EMRA 4FPOB 4Q5OA 4Z1VA 1DZTA 4YWAA 1MNGA 1K9MW 4AILC 1X33A 4RN5A 1PGL2 1QF3A 1Y4WA 3WG3A 4AAXA 1N8RW 1ZZ7A 1H8HG 3B2EE 1DLLA 5LGUA 3SJQC 1POV1 1H1IA 2Q0AA 3T1HO 2UYBA 2LW1A 1O3SA 4LLOA 3ZFFB 5K0UC 2ITCC 1OCZC 5CYYA 2WT0A 3HVDA 1S5JA 1OT5A 1Y6XA 3KF5A 3V0BA 4DK0A 5LMNO 5EJ1B 1SMVA 1JYIA 4QMAA 5EBWC 1RUC1 4WF9V 3A0BZ 2YU1A 3NJVA 1R1BA 3FWEA 2DCZA 4K8XA 1NU1H 4UFIA 3Q9OA 2VQEO 5I8YA 4MTFA 1GYKA 3E89A 4NWWA 1PVC1 1GWKA 4OLLA 4LE3A 3PNAA 1PMHX 3VBFB 4F7ZA 3NXSA 3ZYPA 1UYXA 4LA2A 2WZR1 4JGZA 5BPXA 4HLTA 3NNJA 3JAMN 3CCRV 3TJTA 1JU4A 1D2DA 3HKEA 1VBA1 2R042 2YROA 1KP3A 1ULDA 4M4PA 2XJRA 3HBKA 1BK0A 3CWBH 3ZKUA 1HV1A 4I02A 1HLCA 3VKLA 1W6MA 3S3XA 4JTNA 4I5SA 1MA1A 3BB6A 4Q20A 3NO8A 4JV4A 1QJX2 1AF9A 1GOFA 5GZFA 4JI8O 2MEV3 4XF0A 1DGLA 1V6NA 2P37A 1YRZA 3E2EA 5A1AA 4WFGA 2LM3A 3OEAA 5JVVA 1N34B 2FQPA 4DUXA 1YFYA 5D2AA 4KWKA 4QPIC 4FIPC 2VCMA 1IS3A 5FY1A 4DS0A 3T4ZA 3SC7X 2CK3G 4QX7A 3OGSA 4XXAA 3HN3A 2DCJA 4A45A 3BVCA 3GZAA 2GH2A 1FFTB 3L72H 1VMFA 1P7BA 4GULA 4EYUA 4YPJA 3CJIA 3KCXA 4HN0A 1JQ0A 2JG9B 3USSA 2MHFA 3TEWA 1LOAA 4ZPIA 4X1KB 2RDSA 3NV4A 4HL0A 4LXLA 3ZDVA 2HHHB 2YIBA 3UKVA 3W59A 3U75A 1MZFA 2AZ5A 3LDBA 4COYA 1QBZA 3DSQA 3T4HB 4O4HA 2E51A 3PUSA 4XCAA 1VB2A 2IJIA 5IAXA 1IG3A 1NUKA 2Q5TA 3VDDC 1IS5A 3WW3A 1ULPA 4YG0A 3ZYHA 3WDVA 3SMHA 4AEDB 2WNUC 3IBMA 2CNAA 2JIGA 1TE1B 4AL9A 1QR9A 3I3MA 1PM9A 4AFDA 3O14A 3I2GA 3O1UA 1Q7YW 4OFGA 1PD3A 4PV1B 2CGOA 5F2VO 3SKVA 3B9CA 1JYTA 3R05A 1WW5A 5FPOA 4CZSA 5FDBA 3W7XA 3AKTA 3MPPG 3ZFFA 2H6CA 5FJKA 1HWYA 5H9PA 3R4SA 4XUOA 5BNPC 2D3OW 2VY0A 2UWCA 2EAAA 2LW7A 2ZACA 1RPOA 1VQLV 1N3QA 2QQOA 2VGDA 1HB4A 4LHSA 3JYCA 1N1SA 1WLDA 4UV8A 2QE3A 2EXJA 2XJVA 4XTPA 3T2OA 3WR0A 1ORQC 1JYXA 4Z82A 1H8VA 1K4DC 4YY3B 3RBZA 5L19A 3DXRA 2XJPA 1K92A 2A73B 2GP3A 2E7AA 2YSUB 4ZS3A 1YVWA 2ILMA 3WD5A 4LFBO 3BPSA 1WN7A 4HZ3A 4XIOA 3ASOC 1DFQA 2UU9B 1VLNA 5JCTA 3QH6A 5GLWA 3RJ2X 4JI0O 4NHYA 1AYM1 2LALA 4Q8KA 4KI5M 2R1BA 4Q0UA 4MTOA 1U96A 5CB4A 3CSXA 2ETEA 1NE6A 3MW3A 4JRAA 2A6VA 2EIMB 4LNVA 4KFMA 1W04A 1K5SA 1RXFA 4BK4A 3LCPA 4JHZA 4UCUA 2TUNA 1FAFA 2D2CB 2BOJA 3SJCC 5IT6A 4OX9O 4TV9A 1JYWA 1OF4A 4NHXA 5IATA 2QTSA 2RG4A 2QJ1A 1OUXA 2GC3A 2ZA9A 1EY2A 3C2UA 1OOPB 4M4RA 1BE3H 2OW4A 3SISA 2JDZA 4QHZA 5LA6B 2UXDB 3RYKA 4QM8A 2BGPA 2GNBA 1XQ8A 1OVPA 3N2KB 4AHZA 1V54B 1XI1A 2O57A 3U4XA 1VP7A 4AW7A 4X1KA 1SHWB 4WVZA 4AOCA 4AHYA 4AQYO 3WW2A 5LA2A 1XDCA 2VUAA 2RM22 5EBLC 1D4VB 2A0LA 5GTHZ 1GZ9A 5A7WB 4KH9A 1OF3A 1ND3C 2JK5C 5DZEA 2QWRB 4IEYA 1DLBA 2OTJV 1VQOV 1YCIA 5CA6A 3IKWA 2CAZC 3P32A 4D6RA 2WO1A 4LMFA 1REDA 4B08A 1N32O 1F8VA 1H38A 4FXGB 2VMIA 4DV5B 4FLTA 1GSLA 3UT5A 4YJ2B 1HN1A 4AEDA 1UY0A 1CR7A 2D3SA 3WEZA 4QQOA 4WBBA 4JI1B 1JBCA 3BTYA 1QH7A 2O8QA 4MHRA 4JKMA 2XBO3 3QVNA 4UYBA 2W6JG 1IURA 2XLGA 1LB2A 5HCHA 1NOVA 5BMVB 1HXS2 1HB3A 3CCEV 5HFMA 2D6NA 2AC1A 5KHIA 1GR3A 3KT1A 2E75B 2R043 4QJFB 1CJDA 2DWEC 3ABMB 3ZMOA 4DRXB 5DAPA 5EIYB 2YDEA 4XYXA 3R4UA 3FL7A 2P3IA 3VGIA 1FPN1 1QJY2 4G4FA 5FZLA 1NLRA 2N74A 5C8CC 4PJYA 2EXIA 2BYVE 1UX6A 5I0UA 5KR7A 3PJQA 2JE7A 2QQLA 3WQ1A 4XCBA 4YW6A 3QTCA 5K0UA 1W6NA 3H1MA 1GM8A 4CS4A 4FJCC 5EBMC 1YJLA 1KKDA 1R3IC 4Q1PA 4O4JB 1H1AA 3ZSMA 4OUSA 5FYCA 2R9RB 3WP3A 5B3SB 4KUMA 1COV2 1UKRA 1DYKA 4IQPA 4AYUA 1FMD2 2PAMA 1KFXL 3ZN1A 1Q8IA 1XNQB 1JA8A 1OLQA 3QNEA 3WHUA 1OHFA 4JAVA 1XL4A 3WF3A 3VD3A 4JGYB 2DDUA 1B04A 4EEQA 4CE8A 1BHGA 3K79A 1H2LA 3J26N 2HWB3 4I50A 4UVBA 3AMMA 4L8JA 1Q81W 4ZOLB 5ANNA 4DR7O 2ZHMA 1R6KA 2P7TC 2JS3A 2ZZQA 1FX5A 5FBJA 5A7SA 2W68A 1L7QA 1RHI2 3H3UA 4FFHA 2A71A 3MIDA 4EZ4A 1F9KA 3N2KA 2XJSA 3OG2A 3BA9A 4CXYA 3PMSA 1H9PA 3OCPA 3OM3B 2VRZA 3K5OA 4XUQA 2HWE2 4K6BA 1I5ZA 2UYAA 3BEHA 4Q4W1 4MVMA 4BZ4A 1TME1 4CDXC 3ZXDA 5LP6B 3AJYA 1DF4A 2PLV1 2FBEA 2XH6A 2WL1A 3ACHA 3E5XA 1ZLZA 2NLRA 1LESA 4Y33A 1MVEA 2XONA 4I0XA 4IE0A 1QJZA 1IBMB 2OPWA 3VHRA 2FKXA 3JB8A 1UU4A 2NLJC 1O4YA 5BMVA 2PQSA 3NV2A 3RYIB 5LL6Y 1KB9F 5JCOA 4IXLA 3MDSA 5C3OA 5J98B 2WLNA 1I6XA 1JYCA 1O3RA 2XVGA 1KJRA 4DRXA 2YC0A 3WNXA 1YQ8A 3BHPA 4DUZB 1TUBB 2VPVA 4HG6B 2XUMA 5BY1A 3N2GA 2D44A 2G9ZA 2YXYA 3RVHA 5CBLA 1PO11 5C3RA 5BNOC 5H6QA 3HNYM 2PI5A 2HFEC 2VVDA 5C3SA 3AC0A 2VXJA 2ZOEB 3UCSC 1FXZA 4AZZA 4UW4A 5L3CA 3AFGA 1FFXB 5IE9A 3VBRC 1ZA7A 1IS6A 1XNKA 1N33O 3SJBC 1XMQO 2CDYA 5BNPA 1DQ6A 1RJ8A 2P6HA 4O4JA 1SBEA 2A1XA 2F4VB 1ZBE1 2OCCB 5FUPA 1FAYA 5FP3A 3AL5A 1K73W 1WPBA 2L6LA 5K8SA 4J42A 1O9HA 1XE8A 1P49A 1W2NA 1BSMA 4AFMA 1VBB3 3WFVA 3S7IA 4I4TA 4JGYA 5J2UB 4PDRA 3Q8EA 5EC2C 1UY3A 1OCCB 2VUJA 3AZYA 1U5ZA 4IE6A 3RZHA 4Y3OA 1X59A 3LUTB 1LOCA 2WJSA 4AVBA 3DPRC 3HWJA 1OH3A 3I2KA 2ZGRA 1OFNA 2XJQA 3A22A 1IKPA 1SCSA 3CP1A 5KBFA 4DY3A 2Z0AA 1JR9A 4J10A 3VB9A 4H7MA 4O4LB 2F17A 3MW2A 5FY8A 3OGVA 4LH7A 1B09A 2ET7A 5E88A 2BGCA 2R9AA 2D6OX 1GMGA 4S2DA 4BDVB 5ANQA 1F35A 4DZGA 4DEVA 1WUVA 2XL7A 4C7UA 4YG6A 4HNAB 2CAUA 4Y1ZA 4WZFA 2LO1A 2VXRA 5LK7B 1QNWA 1QQP2 2VOXA 3CD6V 3N7LA 2CV6A 1K5MC 4BWOA 2IH3C 5AVPA 2Y48A 4I2OA 5LA1A 2EBOA 5JDBA 1QJY3 1DQ4A 2P3YA 2HEYF 3T1MA 1R082 1YIPA 5LP6A 2UXCO 2JECA 3U78A 2ZGTA 3W7UA 4JV5B 3SCFA 1N3OA 3WG7C 4Q26A 2HWC1 1F31A 1AP6A 1E1RG 2DYSB 1ND3A 5IYYA 2HJDA 1S0VA 3M99B 3LDKA 2GU9A 4X8PA 2WIIB 4JGSA 1KQSU 3BTZA 3E6CC 5FYTA 4ASLA 5T52A 1COV3 3WUDA 5DG2A 3JD4A 1EUTA 1FMD3 2BQPA 2Q1FA 1F4AA 2HG5C 3JALB 3LAGA 1OCOB 5H6RA 1BLZA 2BE3A 4X64B 3ZMUA 3CCQV 3ZFGB 5B1AC 3JD3A 1BVP1 1MSDA 4XFCA 1UMZA 4ZKTB 2HH9A 4NN0A 4RUFA 1K97A 2RS12 2A6XA 1ZAUA 1HDKA 4IGPA 3FBMA 3AG2C 3K5MA 4DW1A 3PL0A 1W6PA 2IU3A 3HKDB 4XJWA 3RYRA 4W65A 1PIV2 1UFIA 2Q8CA 3IPVB 5C8CA 3T1CA 4FTSA 1IBKB 3HB3B 4BIUA 5D21A 1RUJ1 1UZZA 2LRPA 2Y6FA 1RHI3 3EFFK 2VNGA 2CTQA 2QM4A 4NE9A 2OWOA 5EJ3A 4LK7A 2QVSB 4OPHA 1S76D 1TNFA 1BKZA 3POYA 5KHHA 1MR5A 2V72A 5DUUA 1POV0 4JI4B 3J7AU 2VAUA 4KBBA 3B40A 1W06A 2XDVA 4N53C 3WDWA 1M57C 2RS52 2HWE3 3TNPB 3NJYA 2A5ZA 4JI2O 1AZDA 3POJA 3LWCA 4D3WA 1KFUL 4QWNA 4GKKB 3NKGA 4DV1O 2VZ1A 2VCCA 4PLNA 2QWPB 4CH5A 1RUOA 2WSSG 1K5QA 4RQPC 5JOXA 2IH1C 5IK8A 1ASJ2 1EFRG 1PVXA 4P30A 1SQ4A 5SV5A 1W9SA 3VQXA 3K46A 1VQKV 1LU1A 1PO21 3GBGA 4O4LA 5E1RA 3CF6E 3VBBA 4PHZA 3KCYA 4PBPA 2BWCA 2UUBO 1FNYA 1GANA 1UZYA 3U07A 2DMXA 1VR3A 2EIKB 2Z5UA 3TEZA 5GALA 2MNGA 1FXVA 1V0AA 4OPAA 3JAKB 2Q1MA 5A3LA 1UPIA 3N4MA 1OQEA 2YUAA 2GALA 5KHKA 1QOSA 3ZXJA 4TLGA 3AL6A 3I2FA 3A0HZ 3E8FA 5KMGB 1QGLA 4DO0A 3FJSA 2X5IC 5B1NA 1HQLA 5L7OC 2WZPP 3F5WC 1XNAA 5LEKA 4UBGA 2EIJC 2WNVC 2W2IA 3OGRA 4R4ZA 5L9BA 3MIHA 5JSPA 3B8NA 1S72V 3JSLA 1XYPA 2V09A 3ZXKA 2ATFA 3AVRA 2W94A 4B3TO 4QXBA 1RUI3 4MX3A 2EZOA 2Y34A 2ZAAA 4XF3A 3WOGA 4GIQA 1AL22 1RUD1 2VH9A 3GJBA 3MPBA 5EPAA 3ZIAG 2A3YA 2PY5A 5L3EA 2ZEXA 2BNOA 3KHBA 2FTKA 4HPKB 3HT1A 3H42B 4YVSC 1JX9A 3T2TA 4P08A 3UQ8A 2E5LO 1WKYA 4LTAA 2R072 1O6UA 4ATEA 1AR92 4CCJA 4YIPA 4UF0B 4RD7A 2NYYA 3OOXA 1QHDA 1JI6A 3MHZA 3KZIZ 4XDLA 2UXNA 1GMMA 5EJZB 3CKHA 4GWJA 4NXNB 1G8MA 3F7YC 4LNUB 3IPVA 1OOPC 5FY4A 1ZRCA 4YRDA 3O1SA 2FZ2A 3GB7C 2OVUA 3H8RA 4UXNA 3HQUA 4LKDA 5JMOA 2QNKA 3OGCC 2ZXWC 1VQPV 5J96B 4MOAA 2BVVA 1I3HA 1YO8A 3WV6A 1BEV2 1L1FA 3RMXA 4WV8A 3ZSKA 1ULEA 2GDFA 1ST8A 1VBE1 2PHLA 4TUYB 1QR8A 1DQ2A 2PHFA 1HR0B 4OZOA 4FPHA 4RSUA 4YW7A 3POFA 5FXWA 3WDTA 4LF5O 4WM8B 4NWVA 3GBWA 1HJGA 4HMZA 5FYZA 2YBKA 4RS5C 4GWIA 4R9CA 1FKAO 2XOKG 4QE9A 2J1EA 3Q4HB 4N23A 2BTQB 4YHHO 1DBNA 3ZRWB 3RFRA 1FD9A 4ZHQA 2Y6HA 2DVFA 2FDGA 3POWA 2ZDIC 1OQ1A 2PHDA 4M00A 1TMF2 5FZ3A 3MHSC 5FMDA 2LP7A 4OI2A 5DAQA 1RUG2 5F1RA 2YEVA 5FIXA 3OGJA 3VKNA 4O9GA 4J9ZB 1KXGA 2XAQA 3LFIA 1YYNA 4XDJA 5KMGA 1K5JA 4G2KA 2OQ6A 3VBOB 5B4XA 3FD9A 2YBPA 2WAMA 1W2AX 5CNAA 2DTYA 5A3WA 1WPXA 4Q4Y2 3OTFA 2N7GA 2RS13 2OXBA 5FV3A 4O2BA 4IL7A 3VUOA 4GB31 4R8CA 1VAKA 4X6RB 3JBG2 1SQPH 1TNRA 4L2NA 4IV3C 1LRHA 1XB9A 5A32B 4X66O 1W59A 3S30A 1XSRA 1NCRC 1NZIA 5K7PA 4GKJB 3POEA 4COVA 2R49A 1K8AW 4LBQD 4JQTA 4YXWG 3PUIA 3HKBB 4V2VA 2F66C 4HPKA 3BALA 5IUQA 1TEIA 3AZZA 2ADQB 4P9OA 5EWSA 4GX2A 2R062 5IJ0A 4GJZA 5ACA1 4K1YA 4XDKA 1ZBA2 3HAGA 1MS4A 2OIEA 1N1TA 1W9YA 4YM1A 4Y22B 4UVAA 4UF0A 5IVYA 5FYIA 2RS53 1KRIA 1TVKB 3D36A 3ZPOA 4ZI7B 2VMDA 3VDBA 1YUDA 2BUKA 1JOBA 3MF9A 1YNAA 5B4NA 5C5TA 3RW0A 2H3OA 3K04A 1VMGA 4U3JA 4LNUA 2VQAA 5FMCA 3KVAA 1AX0A 4DV7B 2HYKA 1VMHA 1ASJ3 1O4ZA 1OCRB 2IXJA 3ETQA 5IY5B 1CAUB 3TOJA 4NXMB 1GZTA 2DUPA 2DUOA 3RVYA 1OKQA 5BR8B 1YFWA 3VQVA 1J58A 2XASA 3FHQA 1LU2A 2PZSA 4PI2A 3CPWU 4Y1UA 3K3OA 3SJAC 3ZYRA 4R52A 3N9NA 2WBKA 4DR6O 1KDKA 3DCQA 3FB6C 1WLWA 2HKXA 4YFWA 4TUYA 3NNLA 1NXMA 3T2MA 4YM0A 4LF8O 3BCCH 4BIOA 1ZL8B 2WZ8A 4WM8A 4INDA 5I8SA 3CBNA 3D6EA 2W1QA 5A9GA 5CBGA 5IVCA 1DIWA 1H4HA 4JYCA 4IEPA 3NKTA 3OBRA 3H1WA 5A33B 2B39A 2EXKA 4X1YB 1QVGU 1I94O 4IIJA 1C1FA 2I07B 5L73A 4C90A 3OBAA 4XJ8A 3E83A 2J1TA 4AFAA 5C9AC 1LULA 4TTGA 1GM9A 3Q4HA 2WLHA 1XC6A 2BTQA 4BQ4A 5CFCC 3ZRWA 3C7HA 5I0SA 1BL8A 3H1IH 1AR5A 5IVFA 4PA4A 1RYYA 2RR13 1AL23 1O8PA 1RUH1 5A3PA 2J1VA 4GA9A 4LLFA 3AZWA 1W3VA 4QD2A 1HKDA 1Z0HA 1TVGA 1Z2GA 4FOWA 4Y1XA 3DV8A 1RUE1 3MIEA 4GWMA 4CUGA 3VBOA 1YQ2A 3EBRA 1SF9A 2R073 2D93A 2HEVF 4MVZA 4BE3A 2WS92 3ILRA 2DFBA 2VZUA 3A7QA 3K0DA 4I01A 2Q9LA 1SZXA 4FQ4A 5A70A 3W5MA 2X5IA 1YIFA 4B3MO 3WW1A 2VZRA 3HNBM 5A32A 2XHBA 5DAXA 3NVCA 3LSSA 4XC9A 2X7RB 4J1XA 1M06G 1GKBA 1JN2P 3WLUA 1JMKC 1EP0A 2EILC 3K4AA 1LHNA 4YZ5A 1QLEB 3HKBA 3JD71 3B3QE 3K51A 3UV9A 1MZEA 1ZNPA 1YHFA 4OI0A 4UCTA 2Z3YA 3RYHB 5CA3A 4LE4A 3F5TA 4Y22A 2Q7EA 4HYOA 1TVKA 3BA8A 5FPBA 5JSOA 3LDEA 2F4PA 2VC9A 1VQNV 4QPWA 2YV8A 4YVSA 3V0AB 2W87A 3TETA 2VQTA 2AXTZ 3TBDA 2LROA 2GV9A 1ZX5A 3LPFA 3WB0A 1WA8A 2B5HA 4Y20B 3THTA 2WA4A 1CAUA 2UUCB 3OD4A 5EZWA 1D7PM 3IDBB 4RHV1 1R6TA 1R091 3SCGA 3MIGA 3AFKA 1TMF3 2YUEA 5JAXA 1XNDA 1RUG3 1MQTB 3RMYA 5F5CA 5C4WB 3T4DA 3FLPA 3KVBA 2XKOA 3PIJA 4MHUA 2NMNA 4AVAA 4L11A 1AYN1 3X2QC 4R9AA 3ZXAC 2HR3A 3WQ0A 3TXQA 3M70A 1QCEA 5G04L 3ZXGA 2X0LA 5EIBD 4D69A 3IAPA 3NAPC 4Q4Y3 1B35C 1YIJV 1VF6C 5A33A 1NY72 2QQNA 4X1YA 1Q8PA 3RYFB 1DZQA 4MVSA 4QXCA 2B9ZA 4DV0B 3JBG3 5J7MA 4FP2A 5JQGA 1K34A 1QJU1 4ES9A 1F5FA 2WQ4A 3OD0A 3ACIA 3G7DA 4AI9A 2AEZA 4MW3A 3JATB 1C8M1 2OZ6A 5CBFA 2WFF2 3SDLA 4LOTA 3RVZA 4FPLA 5CZKA 1US2A 4MVRA 4Y4YA 4OULA 2Q6AA 3OUFA 4NIDA 1PPJH 3OBTA 4JTCB 2QQPA 4A2UA 3LEMA 3ZHQA 1CQ9A 4DUVA 5JSRA 2R063 1LAJA 3OY8B 4EB6B 1VQ7V 3IC9A 1ZBA3 3RI8A 2N04A 3JD1A 2A75A 4DV6O 1D2SA 3ZPYA 1UKGA 2JDYA 1NCQB 3CHXA 4GX5A 1VRBA 4X20B 2YFZA 1HNWO 2JB4A 2VM9A 4PIXA 2ZIOA 4DR2B 1Q56A 2WN2A 2CDPA 2OT7A 1N34O 2IZWA 1R3JC 1LHWA 4M01A 5DZFA 3ZFEC 2PUSA 2LW8A 3B8MA 4IEXA 1YFUA 4Z1MG 1VBC1 3RYCB 2V4VA 2XPJA 3HQRA 1ZSPA 1JW6A 5C5UA 2K9PA 2EALA 2JS5A 2B1GA 3AYAA 1NVPD 5FZKA 3HPNA 1UXXX 4XABA 3RYHA 4XUNA 3ZOIA 5D1IA 1GKFA 3RZGA 4BM8A 1G9FA 4UB8Z 1DF0A 4FFBB 4DV2B 1ZRRA 3U14A 1IPSA 3CRCA 3ORJA 2ET1A 3VHNA 3AYCA 3ES4A 3T3YA 3E8GA 3V0AA 1IHMA 3ZYGA 2ZGUA 2QKSA 4CEWC 1N3PA 5AFBA 4R9DA 1GUIA 1MS1A 3BFRA 4BH9A 2BV4A 1H2MA 5ERLA 1GOGA 1YJ9V 1YXWA 3E8BA 1JUIA 3UK9A 4FM1A 3H9VA 1HQNA 4PD4F 3NL1A 1GOHA 2QJVA 2GC0A 1YJNV 1JS9A 2WUHA 3BABA 1ZX3A 2AUYA 4RO2A 5J1XA 3HQXA 4LORA 1BMV2 1AYM3 4IHJA 4OYUA 4LHKA 1CVNA 3CMEV 3M3OA 2FDJA 1NBMG 3W58A 1SZBA 1FXKC 1FOD2 1S1AA 1F2NA 4ES8A 1XXNA 4CEYB 3WQBA 2VCAA 3T0BA 1VALA 2WLQA 4LFCO 2ZGMA 2KKWA 4JI6O 4TSVA 1Y9GA 2BW8A 2JDUA 5HI0A 1HRI1 3JD0A 3J80N 2R72A 4LBOA 3OPTA 2G9FA 5A1FA 3SITA 4NKGB 4W4ZA 1HW7A 3GDBA 1JPXA 4GMP3 4B29A 4LF4B 1CD3G 1HB2A 4ISQA 1W6OA 3B9IA 1RM1B 4JC1A 3VBHC 4NRQA 3H7YA 4YGCA 3JATA 5GLTA 5CISA 4EWEA 4QAWA 5JXHA 3AXEA 3LIGA 4RAIA 4IYHA 5IHRA 1WMEA 4H55A 4DXSA 3EHBB 5CFCA 1AR62 4Q1RA 2NNUA 1OKOA 4KWJA 4FBFA 2MK3A 4X62B 3PIGA 3OY8A 4EB6A 4GH4B 4DUWA 3I55V 1LENA 4NIAA 3IAQA 1ROPA 1VBD2 2PHXA 1H2KA 2FB5A 4NMIA 4DNYA 2B42B 3IGAC 4X8NA 2Q0OC 1GQHA 3CEWA 4GD4A 4GX0A 3NV1A 4FOQA 4DMIA 2GNMA 4X20A 1W0NA 2ZGKA 3NJZA 2PN5A 3K9SA 1H8EG 1QQCA 2G19A 4UFZA 3AG1B 4QGNA 1S55A 3CCVV 4AI1A 5CG8A 4Q4V1 5A3UA 2W39A 1IXBA 2ZX0A 5C8YA 1G7YA 1JOJA 1OPOA 1X82A 3J9SA 3RYCA 4JI5B 4E4ZA 4XZUG 5T50A 4Q0QA 2C6SA 1F23A 2PAEA 2XAGA 3BTXA 1FPN3 4MSVA 1LNQA 1LGNA 4WCEV 1E5RA 2FDFA 2RDNA 2B9VA 1X4TA 3ABKC 2XG3A 3TB0A 2PHRA 4U7NA 4FFBA 1F4NA 3IC7A 3VL8A 3L71H 3CMAV 1H6YA 1ULCA 3AM2A 1MS3A 2J42A 1W8NA 3PTYA 1NQTA 1WLCA 3FHIB 3TEYA 4LF6B 2OCHA 5FZAA 1MMMA 1SLBA 1AXKA 3I2OA 2XKPA 4J9YB 4YZ3A 3OEHG 3QO7A 4JI1O 1V55B 2JG8B 3WT3A 4UW5A 4JI7B 5EFUA 3EXAA 1I1EA 3D0SA 1BBT1 3GVMA 1YFXA 1H2NA 2VW1A 5B1BC 4JVAA 4BAYA 1UW8A 4YGEA 3VD5A 4MGTA 1GM7A 3PMEA 1YI9A 4XFAA 2ZABA 3FBYA 2A7WA 2GDSA 3I2JA 4TT3G 1MS8A 4B4PA 4FM2A 5F8PA 4C0BA 2E6VA 5CFDC 1A6CA 3UT0A 4C91A 1GN4A 5FP4A 4ASKA 3S6PA 3OYWB 1L7LA 1UL9A 4XXPA 1O5UA 2VVFA 2JXAA 2ZHLA 1HRV1 4WM7B 3IWZA 3ABTA 5FZFA 4KQ7A 1S2EA 4LBNA 4IYIA 1S0FA 5LGNA 5LMNB 3HKCB 4CSWA 3NAPA 1B35A 2Q4SA 1DP0A 3VDCA 1M56B 3LNNA 4NTWA 3B01A 2X05A 2A6ZA 5EIBC 4I0AA 1NT0A 1LR5A 3ML0A 1AJQA 2XNDG 2VQEB 4IE5A 4BISA 4O4IA 2Q8VA 4AEJA 2EX3A 4N21A 5FYYA 2PAKA 1J1LA 4A3XA 5LBBA 2GP5A 4LIVA 2A9HA 3WF4A 2Z79A 2R0HA 4GH4A 1APNA 1BHBA 1TME3 2DE0X 1XNQO 4OHYA 3ABLB 2LFRA 3VD9A 3TEXA 4QB6A 1MEC2 4IV1C 5AVAA 2PLV3 2GMPA 2R7EB 5FXVA 4Y1YA 2VG9A 2WLPA 3JB4C 4HVOA 2W5FA 1H4GA 3J7NA 5GJ6A 4YVWB 1UD1A 2NN4A 3M8LA 5LY1A 4XBLA 4K40A 1COWG 4FOVA 2K1EA 4CXXA 1ZRDA 1VAMA 3IZOA 1C4RA 4AVVA 1PK6C 2RHPA 3ZRXA 2CYFA 2RVAA 1O3QA 4F4LA 2X6AA 1LOFC 5F5AA 4JPRA 1UZVA 4MO3M 2ES3A 5E8AA 3CC2V 3DECA 3VN4A 5G05L 3J81N 2GMMA 4QM9A 4RWUA 3SKJE 3N36A 1U5IA 3ZFEA 4X65B 1PO13 1FOD3 4JDOA 2R6QA 3AMPA 2W91A 2EINB 1YZBA 1RP3B 5IYDO 1HNZB 2PA7A 1L7RA 3G6EV 5FY7A 3MIFA 3ZVXA 1Q6UA 4HFSA 3OE7G 1N0JA 1AR72 3DGEA 3VKOA 1MOFA 1XSQA 3JARB 3J8F1 2YU2A 2F93B 4NIGA 4Y24A 1CAWB 4PLOA 1EUUA 2B9UA 2IXKA 5A3MA 1OA2A 4I9WA 5EV7A 5LY2A 4ZS2A 1UX7A 4YZ4A 3O9OA 3O1OA 2HLEA 1O9GA 2WDBA 3T08A 2JG8A 1CZTA 1GZWB 3BOWA 5FZGA 2V1DA 1HW5A 2DYRB 1PHMA 2MEV1 4J41A 1BT8A 1AR63 1C8NA 1VARA 3NR7A 5H2FZ 2JDHA 3M7AA 4AVCA 1ZZ9A 5ITZB 3VQYA 1YC61 3MI8A 4FSJA 2ZHNA 2TBVA 1J3RA 1OQDA 1VBD3 2CU5A 3VZLA 1AP5A 3EB7A 1SDWA 4DR3B 1J84A 2RJ2A 1EAH1 4XJUA 4QHBA 1S77D 2VW0A 2XT9A 5L9VA 3C7EA 5D5PA 4H3WA 3CRMA 4DEQA 1J3PA 4U36A 5LYJA 1H2GA 1DGWX 1VE0A 2VBDA 5DN6G 1RUF1 2I45A 2G4IA 5BXXA 3DL3A 1JTZX 3RDIA 5F5QA 2BP6A 1DF5A 2VCBA 3GALA 5K1PA 2F4VO 1Q43A 5IFTA 2A3WA 4WFBV 3ABUA 3VBHA 3AP9A 3SH3A 1OBNA 4CDUB 4C1WA 3G4SV 5DM6V 4M0NA 4LFBB 3ZXLA 3AEIA 2I2SA 5FZDA 4LC1A 1ZVFA 1KS4A 1T2XA 4JI0B 4P9LA 4O2AB 1RGSA 3N35A 3UO2A 4N43C 4YVWA 5CADA 3T0DA 3I49A 4AE2A 2D6KA 5C3PA 4CS3A 2NMOA 5A7OA 2ZT9B 2CAVA 3AP5A 5IVJA 2X09A 4CP1A 2JEXA 2B1IA 3ENRA 3M4FA 4XW3A 2RE9A 5C4WC 1QLNA 1YJKA 2VMEA 1CONA 2ITDC 4LBMA 4XJAA 3ZXFA 3ILFA 2YC2A 5F6KA 3LSDA 1JZ8A 4BA6A 1NLQA 2AH2A 4BQ5A 1NZCA 1XMOO 1URFA 3FB7C 5FXZA 4R4XA 4TN7A 2ZNIA 4FPEA 3M3IA 4FOYA 1JJOA 2EZPA 3J7LA 1QJFA 2Q68A 1W2TA 4IW3A 2ZGNA 1RMU1 1RJ7A 1W39A 4AG4A 4J7JA 1KP2A 4U7OA 3E5QA 3RZLA 4AQYB 1NYWA 5JVDB 4GJYA 3DYMA 4E4SA 5EC1C 4BQ3A 1MS9A 4FM0A 1O5LA 4COWA 2JDKA 3A0NA 1ZUQA 2XJTA 5E89A 4NPMA 5LBEA 5FWEA 1NJIW 1DGSA 4I30A 2OQ7A 4XUTA 4LQRA 3VBUC 2IFRA 3ACLA 2DUQA 1N32B 5FLHA 4Q0VA 3AVSA 1GZWA 3JXSA 5LHGA 4QKFA 1UMIA 5GKAC 2G1MA 2YHJA 1XE0A 4CDWC 3WP6A 5I93A 4A42A 1EPZA 2VOKA 4XJZA 4LCUC 3IIAA 2ZE8A 4QB2A 2EAKA 5FQ0A 2VD7A 1QJEA 3M7MX 1GV9A 1MEC3 1G8WA 2IBZH 2EVXA 1O59A 3TCUA 1UOFA 4R9BA 1XJAA 4GZRB 1O3TA 3V65A 3SPCA 5LMUB 1W6MB 4M3CB 5DUVA 2HYXA 4IEVA 2XQXA 2GH8A 2RCVA 2AACA 1PGL1 2E32A 1OVSA 2Y6KA 3TYJA 1AR1B 1ZZBA 4XDQA 2R70A 2IJHA 3OTOO 5CA0B 5FY9A 1NG0A 4HVRA 5D5QA 5KXEA 4P9JA 1UYZA 1S2BA 5IWAO 4FPYA 3BRCA 5AC92 4AQTA 4ZBMA 1NTMH 3TN92 3Q8CA 4CZZA 3PUAA 4OQ9A 3L74H 1S0DA 1KGYA 5HFLA 5A6ZA 2E3CA 3MICA 1XOYA 1JZ7A 1GN2A 3AG3C 4PI0A 3A0KA 4DIQA 2AEYA 1IQDC 4JI4O 3WDXA 3PU8A 4QX2A 3Q8BA 2E76B 3RZJA 2B45X 5ABJC 2XUEA 3MZHA 1QXPA 4E2GA 3KB5A 2ADPA 3MFAA 3CLPA 2QKDA 4MTGA 2W92A 4K35A 1G9AA 1TQ5A 3JAWA 2YPDA 4DW0A 1RSOB 3MFCA 1XRUA 1AR73 1BK1A 3I56V 3H3ZA 4L99A 1RUD3 2D43A 4HZFA 4IV1A 5EXOA 5JH7A 2R041 5FLIA 2QFEA 5KX5B 4NYKA 3L70H 5KA5A 5FZMA 2CHHA 4DR5O 3F95A 2HJIA 4DR7B 3KT4A 3GXUA 2D7FA 4CCCA 1QJX1 5EHDA 4K20A 4M3CE 2GZWA 1QKQA 1OJHA 1PK6A 1QU0A 1BMFG 1BQ0A 5LASA 3ZYBA 3OGIB 1LOFA 2IUWA 1GNHA 1HNXO 2GC1A 3IB3A 4JX0A 3VZMA 3OFNG 1E79G 4CCDA 5LW9A 2P06A 5E16A 2AZ2A 1J3QA 5DDJ2 1EZVH 3LIHA 3FMGA 5JVDA 3L9DA 3D0JA 4WVWA 5JPMB 4LFAO 4EZHA 5KUKA 1NS1A 3ZLIA 1UY2A 1KEXA 3M3QA 3WU2Z 5T5JA 1RVF2 5C71A 3FB8C 1FV3A 1JZ2A 2HKOA 2IXLA 3VBSB 4LIUA 5LCWL 4GCZA 2XBO2 2QTWB 3DXRB 4PJ0Z 2ID4A 5CKQA 3KWVA 1U12A 3FUQA 3O5SA 1KJLA 2VU9A 3APQA 2ZKOA 5FTTC 3ZYIB 4X1IB 3PU3A 1ALYA 2WO2A 2DWDC 4ET7A 1FJGO 4CPBA 2VR4A 3K5NA 1AR82 2ADDA 2VS0A 1H1MA 4FVMA 1M5IA 3ASNC 3BPZA 1CPMA 4PDWB 5CB4B 4PF5A 4M3CA 1SQVH 3I2DA 4A6OA 3FKSG 1S0JA