1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
1X8MA 2IXHA 4J1XA 4AQ6A 2UYAA 1EY2A 5KHJA 1ZRDA 3U11A 1EPZA 5FLHA 1O3RA 1CAWB 3OTFA 3I54A 2BYVE 1J58A 2O8QA 4IEYA 5FCCA 4LLOA 3PLQA 4AXOA 2UY8A 1LB2A 2IXLA 3ZDSA 3NKTA 2OYZA 1PM7A 4AVAA 3S7EA 1VJ2A 3E5QA 4NVPA 1ZRFA 2QDRA 2K9ZA 1QWRA 2IXCA 3NL1A 5EZWA 3U0ZA 1GQGA 4K8FA 2IXJA 1J3RA 3H1YA 4MGYE 5F1RA 1CAXA 1LKNA 3RZZA 2D5FA 1QXJA 5LRSA 2PHLA 3E5UA 2GU9A 5LEKA 4O9EA 1NE6A 3G7DA 4L11A 2BNNA 5BUVA 4XFGA 5JCTA 1DGRA 3TNPB 3M70A 2B9UA 3E97A 3BU7A 5I0TA 3ACLA 3CL1A 2PFWA 4HN1A 3D0JA 4XFCA 3B02A 4LULA 1O3SA 2OZ6A 3UKVA 1VP6A 5FLIA 3FHIB 1WLTA 4E2SA 3SCGA 2D93A 2QJVA 2EVXA 5I8SA 3LWCA 3O14A 2IC1A 3SHRA 5I0UA 4I0AA 4FAGA 2MHFA 2F4PA 4QM8A 5C6CA 1J3PA 3KSCA 1XRUA 1YUDA 4QMAA 3ES4A 3EO6A 2PAEA 3R6SA 3FJSA 1LRHA 4QXKA 5KBFA 2XL7A 4IEOA 2BNOA 4MUVA 3MZHA 4YARA 2BEOA 1UW8A 4ZU5A 3WW1A 1H1IA 1CX4A 5I8TA 3RYRA 2OZJA 3H50A 3D82A 4R8HA 2B8MA 1ZZ9A 1XE7A 3BALA 4HZFA 1TQ5A 2Q4SA 4IERA 1EP0A 2PHDA 4HVRA 3SXWA 4E2GA 4AVBA 1LR5A 1NXMA 5D1IA 1SEFA 5FDBA 3IBMA 4X6RB 2H6BA 1X8EA 4UXAA 3MPBA 4PIYA 5BXXA 4UBHA 3USSA 3E6DA 1Q3EA 4B29A 4QGMA 2WC2A 3IIAA 5FPZA 2VQAA 1UPIA 4MX3A 3FZ3A 3SMHA 3OGJA 5J3UA 1I5ZA 2GC1A 1X7NA 4XFHA 3CEWA 2Q30A 3MYXA 3ETQA 1YLLA 4EWDA 1Y3TA 2VPVA 1DZRA 2GZWA 3M3IA 5KHKA 1NYWA 3ES1A 1RC6A 1NE4A 1UIKA 2XLGA 3DN7A 5I8YA 3N4MA 4XF3A 5AVPA 4EWAA 5CU1A 2H0VA 2KXLA 2B5HA 1UD1A 3WW4A 3HT1A 3MDPA 3L2HA 3IWZA 2D40A 3DKWA 1J59A 3S0MA 4OFGA 1YFXA 1IPJA 1OD5A 4JTOA 4XFIA 3WW3A 3FWEA 5C8WA 1EYBA 2ATFA 4MGZE 4YYOA 4HSJA 3CO2A 1FT9A 2ETEA 4N9HA 3PNAA 4META 3E5XA 4P9GA 2PTMA 3S7IA 3UKNA 2N7GA 5EFUA 1YFYA 5KHHA 2BNMA 5I0RA 4EWEA 3TNQA 1CAWA 4I3PA 5I0SA 5FPXA 4IEQA 3LA3A 3PVBB 1H1MA 4X6QB 2Y0OA 3ST7A 5I91A 1NZCA 4D7TA 2GC3A 2CAVA 4MGKE 4QX5A 4Q0VA 4XEZA 4LA2A 4PIZA 2C0ZA 2GH2A 4XF9A 4LEJA 2EA7A 4WVZA 4HSLA 3HT2A 4JVAA 3KGZA 1ZNPA 4PJYA 3RYKA 5CVRA 2HKXA 5JSOA 3CLPA 3H7YA 3DL3A 4L2NA 4YNIA 4IESA 4MZUA 1RTVA 2ZKLA 3EJKA 2FMYA 2XKOA 4BH9A 2XLFA 3GYDA 2Z69A 4HVOA 4JTNA 3FX3A 3EBRA 2PA7A 4IETA 1GQHA 4MV2A 1V70A 3JZVA 4EV0A 5J7MA 4XFBA 4I09A 5LEJA 4Q29A 1CAUB 4I0BA 1J1LA 2DCTA 4QGLA 2XKPA 4TLFA 5FQ0B 3KGLA 5FLJA 4I2OA 4ORFA 3ELNA 3NW4A 4AVCA 1ZREA 3E6BA 4DINB 1HW5A 3EQEA 4KWKA 2ET7A 1CAVA 4HBNA 1DGWA 2PYTA 4R52A 1ZZCA 1ZRCA 4HVQA 1ZX5A 3BCWA 5CADA 3H7JA 1Q5OA 2ZCWA 3LAGA 5JAXA 2CGPA 5K8SA 4EROA 5JSPA 4IEZA 3KMHA 4Z07A 4ONUA 1Q43A 2O1QA 4PIXA 4LTAA 4KU7A 4HN0A 2V09A 3NJZA 1ZVFA 2QVSB 2QNKA 1J3QA 4I01A 2MPFA 4WZCA 1X82A 2BGCA 2PAMA 3OF1A 1WA4A 4F8AA 3HIFA 1UIJA 3HQXA 4ZU4A 2Q0AA 3LA2A 1ZZBA 3CJXA 1U12A 4D7SA 4GULA 1ZZ7A 3VHRA 4BIFA 4KL1A 4RD7A 1YFUA 3FFQA 2XL9A 2Z2SB 3WW2A 4KU8A 4WBBA 3LZZA 1DZTA 1OI6A 3RDIA 1CAVB 1O5UA 2GC0A 1XE8A 1VR3A 1I6XA 4Q0PA 5BV6A 3H1MA 1CAXB 1RL3A 2PQQA 2ET1A 5J48A 2P17A 1RUOA 4H7LA 5I93A 2QCSB 1O3TA 3IDCB 2E9QA 4XF0A 2OA2A 5JR7B 2CV6A 3H9AA 4Z82A 3I59B 5BY5A 1QY4A 5HI0A 3CF6E 4YRDA 4KWLA 4IEXA 3IDBB 4FT8A 3QACA 4IEWA 2HJIA 3NSTA 2EAAA 3H8UA 4XF1A 3OCPA 4XF4A 2WFPA 3BPZA 4LUMA 4ZU7A 2UY9A 1G6NA 1RUNA 3ROUA 1FI2A 1O4TA 3OD0A 4O9GA 4HMZA 2FQPA 1O5LA 5KHIA 2XLAA 3LA7A 1ZZ6A 3C3VA 4IEPA 2XHKA 4CYDA 4QGNA 1QXRA 2OPKA 4XFAA 4XFFA 2GAUA 4J1WA 5KHGA 1OFNA 2CAUA 2PAKA 3BB6A 1JUHA 5FQ0A 3H3ZA 3RPQA 2XGXA 3H3UA 4N9IA 5T3NA 2Q1ZB 5BPXA 3RYPA 3H1WA 1FXZA 4UBGA 4F7ZA 3DV8A 4QM9A 1ZZ8A 1UCXA 1OMIA 4Q0SA 3EHKA 1PMIA 2GC2A 4LUKA 3I59A 4XETA 3E6CC 4OLLA 3NVCA 4AQ2A 1YFWA 4YSFA 3LOIA 3KCCA 4LA3A 1YWKA 3GBFA 1IPKA 4HLTA 1RGSA 2IXIA 3D0SA 4KWJA 2IXKA 1WGPA 1ZRRA 3RNSA 4I02A 4Q0QA 2K0GA 3QOPA 4FBFA 5LRRA 1L3JA 4BYYA 2D5HA 3UKTA 1O7FA 3I7DA 4IEVA 4JV4A 2MNGA 2H6CA 3SCHA 4MH0E 3SCFA 3U10A 4MGIE 5JSRA 1Y9QA 3FE5A 5E1RA 1YHFA 1SFNA 1O3QA 4A2UA 1CGPA 4BHPA 2VECA 2UYBA 1CAUA 4Q0UA 4E2QA 4IEUA 2I45A 4FAHA 5E16A 1SQ4A
chains in the Genus database with same CATH superfamily
4PA6A 3LSDA 2W6IG 4YM3A 4DQAA 1QBZA 4TV8B 3SPGA 1R64A 1XMOO 2ARCA 1BMV1 4N53C 4LLOA 1SLAA 2JWPA 1LB2A 1RM1B 3BOWA 1JXNA 1A78A 2EIKC 2ZNJA 2XNDG 3AKQA 1AP6A 3TWIA 3FL7A 1EV13 2PHTA 1YEWA 3OPWA 4TN7A 3CZUA 2RJZA 4WBNB 1P4RA 4J7KA 2W92A 3RYHB 2BNNA 3PUAA 1DYPA 3GZEA 2WPDG 5J9PC 2RJ2A 3KT7A 5JWPA 2IZWA 1VP6A 4IGPA 2D93A 2VD7A 3ZRXA 2IWGB 5GLZA 2ZDIC 2VO5A 2VR4A 5L3EA 4ZHQB 2QQJA 3FJSA 3VD5A 4D0QA 1RUG2 4IEOA 1VEWA 1EPWA 4JASA 3VDDC 3JQWA 3OB8A 1BBT3 5C3SA 1RVF1 2RV9A 4CU7A 1SBDA 4HNAB 3L70H 1JN2P 1LR5A 4DNYA 4QKNA 1PL0A 3BIEA 3SKJE 2H6BA 5FK7A 2HEVF 5LBCA 1NH2D 1NKDA 3A22A 1APNA 1ENXA 3J7MA 3T1YO 1Y3TA 1DZRA 1VB4A 3OAAG 2W1SA 2ZTNA 5E6HA 1YXBA 3C7HA 3CMEV 3CJHA 3LSUA 4R50A 3ZHQA 4RHV2 1OPOA 4K6BA 3H0OA 4EB6B 5J2UA 4EN7B 2RS33 2HLDG 1CXZB 5H6QA 1SFYA 2R49A 1XSQA 5GLVA 2EALA 5DUVA 4O2AB 3K03A 2DJVA 4RQFA 2RMU1 1TVKB 3AG4B 2BSKA 3DGEA 3PJQA 5GM0A 3PJSK 1JR9A 3Q4HB 2QWQB 3QF7A 4X88A 2E7QA 3VBHA 4B3RO 3ST7A 1S5LZ 5F3GA 3ZFEB 4I0WB 4LA2A 3DYOA 2FB5A 2Q7GA 4RHV3 3JBG2 2CYFA 5FV3A 3P5BA 2QJ1A 4DV3B 2RR11 2HKXA 1EUTA 5C9AA 3ZR5A 5APAA 1DQ5A 2DQ0A 3BABA 2CWSA 4J7JA 3BYWA 3KT1A 4XTMA 1AHSA 2BRTA 2PA7A 5LHHA 5FY5A 2IUWA 1S2BA 5FRAA 2NNUA 3CX5F 3FD9A 4C0HA 1TEIA 5FYSA 4CE8A 1MEC1 2HYKA 1AI6A 4HK9A 1HQNA 4ABMA 2DBNA 3K57A 1ZREA 3UT5B 1ZLZA 1VBC3 4MXVA 2FDHA 2DUOA 5B1OA 1Y74B 3SJAC 1YYNA 3U14A 3AKSA 1WCQA 3UGFA 4DV1O 2AZ5A 4OULA 5FYBA 1ROPA 3LEGA 3WF2A 4LHLA 1J3QA 4UFJA 1MS8A 2RS13 2D3PA 2GP3A 1XNTA 4UFIA 4FLUA 3D3IA 1AR63 3OGCC 4P30A 1ZZ7A 2P6CA 1OCRC 4WBBA 1EAH1 1UQXA 1JW6A 1QR9A 2YBPA 2QE3A 4CPBA 1ZWIC 1SACA 1DHKB 1FYUA 1AVMA 1M06G 1YF2A 3T4HB 1F7YA 1W6PA 4J42A 1O4ZA 4YRDA 1XYNA 2ZX0A 1SC5B 2QTOA 1REFA 2WLNA 1W6QA 2L6LA 4W65A 2UY9A 5FIXA 1FS0G 4Y22B 1V6LA 4DV2O 2PHRA 4LO7A 5KHGA 2YS8A 2OT7A 4MADA 4COYA 2HEYF 4QGPA 2WFF2 2XVGA 1QJEA 1KDKA 4DV2B 2PXJA 3T3YA 1WJZA 3AVRA 4WM7B 1VRBA 4A42A 5L7OB 5BMVA 1KKCA 2VWKA 4ZY9A 1YWKA 3AKPA 1J84A 2RMU3 5IJRA 3BTXA 1J1TA 3D6EA 5K0UB 2ADEA 2CL2A 4LCUC 2C26A 4K1ZA 4HPKB 4FVMA 1H8VA 3AM2A 1VMJA 2RDQA 5CMUA 3SKVA 3ZMNA 4IYHA 2A79B 2PYJA 5E1RA 1RVF2 4BHPA 4E2QA 3AG3C 4ZZ5A 3DPRA 1QKQA 2IXHA 1S77D 1EY2A 1HN1A 2A5ZA 3M7AA 1CAWB 4NRQA 1GMMA 3PVNA 2W2IA 2D6NA 1M4WA 3I3QA 3PLQA 3ZFGA 3ZSLA 1Y4MA 4QPKA 1OKQA 1K45A 5IFPA 2Y60A 3NJYA 2IXCA 3IMMA 1RUE2 2QTSA 1TNFA 2WT0A 3MDSA 5L3FA 5A32A 1V9PA 2E32A 2PHLA 2FCUA 2GU9A 2XAJA 1NT0A 1V9U1 3T2MA 4KBZA 1FKAO 4O61A 2Q8CA 2Q69A 3E97A 5IFTA 5FREA 1NLRA 4QX0A 3D0JA 2VOTA 1O3SA 3HR9A 2OPWA 4UCVA 1W6QB 4AR2A 2I74A 4O4JA 3POGA 3RI9A 1DDLA 2Z4FA 2WJSA 3I2IA 3VL8A 1YUDA 5AC93 3W20A 5FLXN 5HV0A 2PAEA 3SISA 5KA6A 3SYCA 3TRSB 4B1MA 4RR3C 1ZX3A 2VAUA 5FR3A 4FXKB 2DW4A 1H2GA 3TBDA 2G9ZA 3WB0A 2A6YA 5FPLA 4L92A 4GT1A 1L7QA 4PQ9A 3L74H 4Q4X3 3K75B 3BALA 4LFAO 4N43C 4QT6A 2BFUL 1S72V 4GKKB 4MVMA 4MT8A 1NA1B 4QE7A 2ARXA 3BVOA 3SEEA 1GNZA 4CP2A 4NHMA 4AFCA 5GZDA 3PVOA 1TA8A 4MX3A 2QWOB 2YEVB 4L0PA 1WD4A 5C8CA 4B7KA 4BA6A 4QDSA 3E1F1 1UOBA 3QVNA 2QBXA 5F2VO 2Y33A 4WVWA 4I0XA 3N4MA 5CU1A 4QX7A 4NE9A 1ENVA 1EN5A 3L2HA 3VDDA 4JAVA 4ZONA 2D40A 2QM7A 3TN93 2DU0A 2W94A 5IJ9A 3OEHG 2VMIA 1RITA 5IVCA 4C0BA 1RUI2 4XJAA 5HFLA 3RVZA 3AP4A 4XC9A 4META 4A5UB 3CU7A 1SZBA 1YFYA 3DCQA 4NXNO 4CPBD 4LNVA 5A6YA 1H2MA 4LBEC 2ZEZA 2XBO1 3IKWA 4GKXA 3K5MA 1OFSA 4Q4Y1 4Q4W1 4QX8A 2BOBC 2XHBA 5IVYA 4KNCA 1HRV2 5FYTA 1NY71 2EA7A 3KGZA 4FFGA 3RYKA 3KVAA 4EYUA 3E22A 4AEKA 4TV8A 3HVDA 1XNCA 4MTGA 2Q8EA 1BZWA 3HQRA 3WXPA 4JTNA 1COV1 1D5NA 5BXZA 1YDXA 1RMU1 3SYQA 1K3IA 2WSUA 2QKAA 1CAUB 4LFCO 4L99A 2N74A 4P9OA 1XQ8A 1VBC1 2JE9A 1YIFA 2QWPB 1XMOB 4ORFA 1PZ8A 3EQEA 4FTEA 5BNNA 1XHZA 4R8CA 4JGSA 1ZZCA 3WEZA 4CDWB 2YSUB 2Y69B 2ZGTA 2CGPA 5CBFA 3G71V 1PL4A 2RJKA 2R071 2BWCA 4KU7A 4CEYB 2UUAB 3UNPA 4TUYB 1XPWA 4NB5A 2ZXWB 4O2BB 3I2OA 3KCXA 4MVOA 5FZ3A 4ZOLA 1GH6A 2WZR2 3ETDA 5EPAA 5IUQA 1SRYA 4XUTA 2VUJA 2PLV2 4XYXA 3RDIA 2ZGSA 4CU8A 3NRUA 2A0LA 3U37A 3AZYA 4W4LA 4PHZA 1GWMA 3LDRA 5EJZB 1CEZA 2QCSB 2XVKA 4TT3G 2OCCC 4HYOA 2E9QA 4ZHNA 3OEEG 2MEV1 4Q4X1 2QQIA 5CEHA 3HD8B 5LYJA 4KWLA 5L73A 3IDBB 1UZYA 3H1JH 5JCOA 1G9DA 4HOOA 2PY5A 4XF4A 1G6NA 4PA3A 1UY1A 1O4TA 3LGRA 4OUEA 2QQPA 4IHJA 1BL8A 2RR13 4A6SA 1QXRA 4X62B 3B5LB 4I0XB 2WWSA 4GD4A 3UK9A 4NPRA 1PVC3 3ZSJA 1R093 1T6GC 5FPAA 3ZX6A 3WDVA 1KKDA 1LJ7A 4COWA 1YRZA 4F83A 1BVP1 4LUKA 4CC6A 4Q4Y2 3ITQA 3GZTB 5LY2A 1F5FA 4CXWA 1RGSA 3C3TA 5LMNB 1FV2A 1QQP3 5JPMB 4I9QA 1S55A 3ZM8A 4W50A 5L3CA 4JCKA 5DMYA 5IVFA 5IT9N 2FHRA 2MNGA 1GOFA 3VUOA 2D3SA 4YM1A 3SCHA 4NJ4A 3ALQA 5TISZ 5KMGA 1W6OB 1XYOA 3B94A 1KFUL 2DMXA 1RUH1 5I0DA 4AQ6A 5ANQA 5A6QA 1MS3A 3MICA 4AI2A 1J58A 1K92A 5BYNA 1B04A 2ZZQA 1NZ6A 4QPJA 1VQ5V 1PM7A 3VQXA 4PBOA 2KKWA 1L0NH 1H8TC 3NL1A 5G05L 2Z0AA 2QWNB 1BQPA 3H1YA 1K73W 2W39A 4AHZA 2ZM6B 4AQYB 1U5IA 4UFZA 5FO7B 5F32A 4QE9A 5L3DA 4O9EA 4CVUA 5HCBA 1O8PA 4WVMA 5KXBA 4FPGA 5FPUA 4CCOA 4DR4B 4JRAA 2GBOA 2PF4E 1JVMA 1WLTA 2PYLA 4P5YA 2VQFO 3RS6A 2P4EA 1Q81W 2RM22 4LF8B 2ADQB 1MQTB 5C6CA 2WT1A 4W6WA 4TOIA 2HG5C 2Y0PA 3A4UA 3ES4A 1MPXA 3R6SA 4AVVA 2A06H 1LOEA 4LH7A 1N1TA 4LE4A 4LLFA 5FZAA 3JCZA 4YARA 1FOD1 3NNLA 3ZYRA 5F3EA 1E5RA 2J1AA 2FDIA 4F6RA 4D6RA 3VZNA 4AHWA 2UUAO 2RVAA 3CCRV 3MW3A 2Q8OA 2A3YA 3AXDA 3M7MX 3T0BA 3CCMV 1DZQA 3N7JA 4DUYB 5IWFA 1GNYA 1RUE1 5BXXA 2YC0A 4LITA 4GX1A 3E6DA 4WCEV 1S5HC 4QGMA 1RUJ3 1FMD3 4LXLA 2ZBJA 3WY6A 2YFUA 2ARHA 3B9CA 1GSLA 1PK6C 3RVHA 1VBD2 2JDPA 4ZS3A 1SCRA 1PGW2 4JI1O 3JD3A 3M8AA 4XF3A 4DV1B 1BGYH 1R6KA 3RYFB 3NV1A 1JZ7A 4B3NA 1J59A 4UVBA 4QB1A 1GZCA 3A21A 4YYOA 2DDUA 2A71A 3CO2A 5LP6C 1GOHA 3OG2A 1TVGA 2YGMA 2RCVA 1JFFA 3AMPA 3S7IA 1W6PB 4CXXA 1N8RW 3TETA 5IVEA 2AREA 4JYCA 4U36A 4G28B 1H1MA 3U4XA 3V65A 1ND3A 1N33O 1AR61 3AFKA 4MGKE 3BFRA 4AEJA 1N1YA 3I5DA 3JD73 3C3SA 1D2DA 1AJNA 2WS91 3AXEA 5JXJA 2AXTZ 4MO3M 4FFKA 1DF5A 3JASA 4AL9A 5EYPB 3SYPA 2G9GA 5HBAA 4JC1A 2KQXA 4MV2A 1JYCA 3HKBA 2ZMLA 1EN4A 5J7MA 4DOUA 2QQUA 4LJHA 2DCTA 3R4SA 1NTMH 3HNBM 5DG1A 1AXZA 3JYCA 1JU4A 1GN2A 3INAA 3L72H 4FPOB 2R061 4AVCA 5EC1C 4OMCA 2F43G 1CAVA 2D6PA 5A3NA 1XMQO 5CADA 4WM7C 3N36A 1G4YB 4YW7A 5AVAA 4ATEA 3DYMA 1FOD2 3OPZA 4FQ4A 3CQOA 3T1CA 2EBOA 4QHZA 4XAEA 4O4JB 1X50A 4HN0A 1F31A 2IH3C 3NR7A 3OF1A 2WWUA 3TEXA 3ZFFB 5LB6A 2A9HA 1WA6X 1QJX2 3EVKA 3HJRA 1VF6C 1OF4A 1B3QA 4E4DX 1ENRA 2Z2SB 4XUQA 3AK0A 3BI3A 1I94O 4OHVA 1I6XA 1F23A 2VZ3A 4KWUA 3IAQA 2J1VA 2ET1A 1R091 4L87A 3JARB 3V0AA 5BNNC 4YVWA 4JI2B 1O3TA 4RGKA 1Q6IA 2XPJA 4GKYA 5CIRA 5HI0A 5KAIZ 2WQ4A 4IEXA 3VL9A 5LATA 3T30A 4J80A 2CU5A 3NSTA 1LHNA 3P30A 2CTQA 2F23A 1FXHA 4CUBA 4HKLA 4ZU7A 3FB8C 3JD4A 4GX5A 1JYNA 5C5UA 1UWWA 5F2WA 5JVDB 4H33A 2YC4A 3G6JB 4QKFA 4RQPB 5KC5A 4QX1A 1RM1C 4NR1A 2XGXA 2EXHA 4QM9A 5FMOL 2X5IC 1ZZ8A 3IDAA 3FBYA 2IFRA 2VMCA 1GO3F 4OLLA 2JJ2G 1YFWA 4XBNA 4LF5O 3VN4A 1FFXA 4CP0A 3VQWA 3D0SA 4NHYA 2RMU2 3RNSA 3QOPA 2P06A 5LRRA 3H1LH 1OCCC 2A70A 2E53A 1WPXA 3KWVA 2H6CA 2JDYA 1QHDA 1MMMA 2E5LO 4R9AA 4FZ1A 2FKXA 4MVZA 1N0NA 3VLBB 5LBEA 4J1XA 2JVDA 1JPXA 3LFIA 4CCJA 1PKXA 1MS5A 3OTFA 1WNSA 2O8QA 5HCFA 1M5IA 2BCCH 3K59A 2JD4A 4I3GA 4UW3A 4AXOA 2MW2B 2OYZA 1K42A 1UL9A 1IBLO 5B5EZ 3OBAA 4Y4RA 2GH8A 5A1LA 4D3WA 1ZL8A 5DXDA 4OPAA 1QXPA 3AEIA 4C90A 1DGWX 3O7OA 1J5EB 2ZX4A 5L7OC 1JODA 4TV9A 1JYWA 1QQCA 1UX7A 5BNOB 5T5LA 3CZJA 2ZGOA 4EN6B 5C3RA 2EIJC 5F3CA 3K5LA 4JGZB 1RUJ2 4BWOA 4P5HA 3LWCA 1N36B 1HNZB 3SHRA 3ZSKA 4DR3B 2VQ0A 4FAGA 3L73H 1NCQB 2DURA 1NCRB 4XDLA 1J3PA 5C3QA 4TYSA 1VLNA 1DF0A 1LHUA 1O6UA 5FY4A 5GTHZ 1HX6A 1XNQO 1N3OA 2YI9A 1IXBA 3H9VA 5DUWA 3HBKA 3TEWA 5LASA 2ZAHA 2ZAAA 4NN0A 1W05A 1JOPA 5KR7A 5KXEA 1XSRA 3ORJA 1K4CC 1PNFA 4UF0A 1JZ4A 1FPOA 3VZLA 1BCCH 4H37A 1EBOA 1EZJA 1PP9H 3WF4A 1IKPA 2FZ2A 2VUDA 4RS5C 2ZEYA 2RDSA 3CEWA 4KHPB 3AFGA 1RJ7A 2VPVA 5JVDA 4UYBA 4OPHA 1NYWA 1VP7A 2I07B 1RSOA 1JYVA 5I8YA 5D5QA 5SV8A 4YJ2A 1HXS3 4LBQD 3OGRA 5J36A 2P6JA 1KMIZ 3OYWB 1ND2A 2V4AA 1F9KA 1WW4A 5F5AA 3SH4A 4GMP3 4UCOA 4P9JA 1ONAA 1W2OA 4HSJA 4KMQA 4FCAA 4F4LA 2ETEA 1W6OA 4AHYA 2WABA 3I3DA 3DC5A 2N04A 2FL4A 4I55A 1PO12 4B7EA 1H9PA 1GBGA 5EBMC 3AX4A 1URXA 1LOFA 3AP7A 1J83A 3LDDA 3P6BA 2Y6LA 3OFNG 1NZCA 3ZXAC 4BB3A 4YXWG 1YZBA 4XEZA 1CWPA 1S0EA 1SMVA 2IJKA 1W03A 2L9LA 4B3MB 3ZFFA 2D3OW 1LULA 4PJYA 4FOWA 5A7WB 4KXRA 3CLPA 2DFBA 3ZFGC 4XZUG 1C3HA 2XWJB 3A2FA 2ZKLA 1QQP2 4NIAA 3E8GA 5IK7A 3FX3A 4YY3O 2WQ8A 3BU0A 4DV3O 5GTIZ 1I5XA 4XFBA 1OD3A 4I09A 1OF3A 1E5HA 1P7GA 3RZMA 4IE7A 4JDOA 5JOYA 3T2PA 5L9BA 3ELNA 1I9RA 2C9KA 2LUWA 2VTFA 3JALA 5CZKA 4FP3A 4K3AA 3VKOA 2OVUA 4V2VA 1T2XA 5JAXA 4UF0B 1E1QG 3CJHB 2DWEC 4Z07A 2YIDA 1V55B 3A0BZ 4YZ1A 3UM7A 4XUNA 2RDNA 1OLQA 3N9MA 1AYN3 1SQFA 3FUQA 4CDQA 2VULA 3TEYA 4ZKIA 4CZSA 1D4M2 3CCVV 1PV0A 4CCNA 2A3QA 1RHI1 2ZE7A 1GN3A 3UL2A 5C5TA 5LOVB 2E63A 3UKMA 5A7OA 2JIJA 2ETNA 5A3PA 3I49A 4MG2A 2WNUA 2P17A 3P3NA 1QOSA 1AR71 3ZYFA 3WLUA 1K3EA 4EKWA 1V9U3 3I59B 2EXIA 1LOAA 3JD0A 5FYCA 4CCEA 4O2BA 2EAAA 5EWSA 2XJVA 4XF1A 2VOKA 3B93A 4G2KA 4A7ZA 5IK8A 1J95A 3U75A 3C3VA 3ILRA 5IYBO 3ZMZA 4UVAA 4UFHA 3V0BB 3DV8A 3MV11 3F7VC 1UPSA 1SLIA 2OS2A 1V6JA 4DV5B 4KG8A 1GQPA 2JS3A 2R073 1R3IC 4XETA 2P6HA 3NVCA 5B4NA 4YJ3A 3JAMN 4KHPO 3E8FA 4UCTA 1W8FA 3PMSA 1ACCA 4D6TH 4E4EA 1BXHA 3I3BA 5CA0B 2ZNIA 4AFBA 3SDLA 5E89A 4RAIA 4CEWC 4QIWF 5C3PA 1QU7A 2UXBO 1EZVH 1LESA 3JQXA 4TQFA 5JJJB 2PHXA 4IV1A 4FPCA 4JTCB 3TB0A 2BGPA 3SCFA 1NVPB 5FY0A 1GV9A 4LWSA 5GLUA 5JOWA 3FN9A 3SJQC 1CGPA 3LNMB 1W90A 4Q0UA 4DV7B 3CHXA 2F4VB 1YI9A 3O65A 5CFCC 2Q8DA 4TUYA 2WZPP 3VQVA 4PBPA 4CS4A 3K2OA 1CX1A 1PD3A 2X09A 4AZZA 3H01A 4HK8A 3WNMA 4Y20B 2F4VO 3ABUA 1VIBA 4LF8O 1O9HA 1HP8A 4QX3A 5FWEA 5F1RA 3G67A 5LRSA 5JJEB 1U5ZA 1D5AA 4X64O 2UWBA 1YQ6A 1NCRC 1OLRA 2WS93 3BRCA 2RDCA 3J8F1 2EIMB 3JSLA 4NXNB 4JAAA 1REEA 1WAZA 5CNAA 4QM8A 1DIWA 4JYBA 4ZXEA 4UI9L 3BTYA 5FK8A 3N9QA 2OYQA 1BZKA 1MVEA 1SF9A 1KD1W 5GZEA 3URFA 1ZBE1 1WKYA 4KBBA 3UYJA 5EYPA 4WVVA 3UJOA 2RS53 3OUFA 1VF5B 2BOIA 3JALB 1OQ1A 2EINC 2Q4SA 3AYDA 4HVRA 4TQDA 4MOAA 4K7JA 3NMBA 2QQMA 1ULOA 4B3SO 4UXAA 4CDUC 4YW6A 4PIYA 1MEC2 2VOWA 4UBHA 3JXSA 1Z5VA 3WHUA 4B29A 5A3WA 1AL22 4CU9A 1S2KA 3WF1A 2WNUC 2P4VA 4AG4A 1FMD2 4DXTA 4P9LA 3ZXFA 3ETQA 1VMFA 4AHXA 1FXVA 1H6XA 4BIUA 1F15A 3HWJA 5EP9A 1Y7BA 2YGLA 2XLGA 1QDCA 4GUNA 3CXHF 3SEPA 1HQWA 3JBG1 2CGOA 3RZLA 2VMHA 4YPJA 1IPJA 1PIV3 1SQQH 4CP9A 1K5MB 1JMKC 1HRI2 4P9YA 4YM0A 2W9XA 5CFDB 1K5JA 1QLEC 2D7FA 1D2QA 2QQVA 3HR0A 1KP3A 3ZX7A 5F2SA 2VZ1A 1M1KW 2Z5UA 5FPXA 3UQ8A 1Y67A 3HKDB 5I91A 2J1UA 4D7TA 1RPRA 3PU8A 4Q0VA 1OLME 2DTWA 2GH2A 4EE2A 3AKTA 4HSLA 4DR5B 1H8TA 4UV9A 1BHBA 3OPTA 5JSOA 3T4VA 5FO9B 1UYYA 1R1ZA 4BIZA 4TTGA 4YHHO 3CJIA 3ZPOA 2X6CA 1SDWA 4DO0A 2Y64A 1W04A 4LHSA 2FD8A 2XKPA 2BOCC 3MIHA 5DABA 1AJKA 5FZEA 3PUHA 2C2AA 5FLJA 3B7MA 4M01A 4W6YA 3NW4A 4X65O 1V6IA 1LTEA 3TXSA 3GXUA 2PHUA 4L9BA 4NIGA 1UAIA 1NTZH 2DU1A 1K4DC 1RUC2 2WIIB 5KUMA 1XNBA 1YIJV 2W46A 1UMHA 3FYIB 4KFMA 1XNKA 1RUG1 3AG2B 1SLTA 4YW2A 5F6LB 1S0GA 1BSMA 1MS0A 5GALA 4G27B 2QVSB 1NCRA 3J7NA 4ES8A 2JJ6A 4ARXA 1VQOV 4Y20A 4ZU4A 3O1UA 4LMFA 3FMGA 1Z7S1 4Y5TA 3FFQA 4AGGA 3C8XA 2NLJC 2GC0A 1IS4A 2BQPA 1YIPA 2XH6A 4QPGB 2ZIOA 2OW4A 2GTAA 3ZN1A 4FFFA 2DWDC 5FWJA 4JI4B 5I93A 1ODMA 1TUEB 2YV8A 2ZE5A 4PI2A 1V6MA 1XNRB 4MLOA 2VMDA 1RHI2 1QY4A 1UYPA 4UVCA 2VU9A 1OJHA 5KA5A 3W7WA 5DM6V 2E3CA 3ABLC 1SS3A 2WFPA 1G7YA 3BPZA 4FXGB 3KV9A 1O91A 4Q4V2 5AC92 3CNAA 3E86A 4BAYA 2XLAA 3CMAV 1QOOA 4DEVA 1BQZA 1PVC1 4J1WA 2CDOA 1JOBA 3T2QA 3ZXKA 4PDWB 3OTOO 1RPOA 4DV6O 2NYYA 1TNRA 1G6UA 3WNNA 4EN8B 4XBQA 3WHTA 3MBWA 3E6CC 5JXIA 2HJDA 2HEWF 2VW1A 2BJSA 3KCCA 4GB31 4IIJB 5GONA 1F2NA 1VBB1 3POIA 1VBA3 4XJWA 1WGPA 4DXZA 3MIFA 5A3OA 4YM2A 1TUBB 2AH2A 4EZHA 4XBFA 4G4FA 1QQP1 4CDWA 2ZQMA 1KYOF 4DV0O 3MIEA 5CFDA 4D8MA 4LHKA 4FAHA 3PUQA 3OUSA 4LC1A 3ZPYA 1EPZA 2ZE8A 2R042 4LQRA 5FZDA 3UT5A 5LHGA 1V0AA 1X36A 3B4SA 4R9CA 3IGAC 3WVJA 5JXGA 1UYZA 2XAQA 3VBSB 1ZRFA 2YMZA 3M8LA 2Q67A 1LEDA 3SPHA 4GKJO 3GM8A 4ATFA 1W6NA 2GALA 1UX6A 1PIV2 5ACA1 3F7YC 4LF4O 4DY3A 5IYCO 3CJIC 2BTOA 4WFGA 1LEMA 2EXJA 4U2AA 2QKCA 5FP8A 4Y5Z0 2R9AA 5LY1A 1P84F 4MVRA 1AROP 1PVC2 3T0AA 2Y6HA 1HXS1 4IGGA 3AYEA 5T5PA 4OYUA 4NIDA 2YICA 4S2HA 1CP9A 4J9YB 2FCTA 1XRUA 1CZVA 3K51A 4YVWC 4MSVA 1RUD1 4NTWA 4FFIA 4UW4A 3ML0A 4GALA 4QXKA 2YXYA 3L9DA 5ABJC 2VZSA 4AI9A 1N34O 4XBLA 2FMDA 2DYCA 3RWKX 1NU1H 5GJ6A 2OZJA 3ZFGB 2CAZC 2R063 1JUIA 2QKSA 5A9GA 4QJFB 1EP0A 4QKBA 4B1LA 4A41A 1IBKO 2GSMB 2Q73A 1ULCA 1Z7S2 4QAWA 2LFSA 4DW1A 1C8M3 2HWD1 2M7WA 1LOFC 3I2DA 3WG4A 2WC2A 1MSDA 5FPZA 3R0RA 1M93A 4NWVA 4GWIA 4BW9A 3GGLA 3A7QA 3IAPA 4NHLA 1YQ5A 4PF1A 1C8M2 4PELA 1F35A 1Q90D 2X10A 2OCHA 1FFTB 2VW2A 3AJZA 1GP5A 4LO8A 3WDUA 2CGNA 3S3WA 3IAYA 1VBE3 5IYYA 1QU0A 2JXAA 3WNKA 1JFFB 4QXCA 3LPFA 1IQAA 4MGSA 4EFEA 5FYIA 4FI9A 1OV9A 1VBA1 2ORXA 3WSOA 5CKNA 2QEXV 4C1XA 2BNMA 4MTXA 1CAWA 4AFMA 2DUPA 2QZ2A 2Y0OA 3STLC 3CRQA 2BWAA 3WNPA 4PIZA 2EIEA 5BNOA 4IUGA 3POYA 4JVAA 3MAQA 3AMNA 3T1HO 2EXKA 2GNTA 4TWTA 3DL3A 3VBOA 5IVBA 1ND3C 2EIMC 1HRV3 4MZUA 3W9AA 4I4TB 5H5NA 2HHHB 4PDVA 4NXMO 3BY6A 4IETA 3E22B 1DLCA 3VD7A 4O4IB 5JCOC 2OX0A 5FXWA 3SPIA 4I0BA 4QGLA 3TYJA 1D7PM 1CPYA 4X66O 1OUSA 3ZLIA 4IL6Z 2ITDC 3WG2A 1OSGA 4DINB 1UY2A 1ZX5A 3WV6A 3AG4C 1P49A 2WUHA 4EROA 4JV5B 1LUWA 4FLXA 4Q5OA 5C93A 2Q4PA 1Q43A 2EJ7A 4I7ZB 3MUZ1 3WX5A 4X1IA 3ZHUA 2CWMA 5IHRA 3HIFA 5AFEA 5J1XA 2HWF1 4UT5A 2B4KA 1RUF3 3LZZA 2QM4A 1A6CA 1RB8G 1GKFA 1C5IA 4MTOA 5GW7A 4QDQA 2YEVA 3V56A 1ZRIA 5FY1A 1ZBE2 3B00A 3MHSC 3GF6A 4XPVA 4GMP1 2LQTA 2AEYA 2FZ1A 3O1PA 4FPEA 4FM0A 5FYHA 3UJQA 1XL4A 3T2TA 1Q56A 2RS11 4XQDA 1ORQC 1AR92 4FT8A 4CXYA 2WLQA 4BLIA 3FUOA 3NJVA 3NV2A 4K40A 2XT9A 5A32B 1ZSPA 1WPBA 1YJKA 1QNWA 1RUNA 1FI2A 1REDA 1IBKB 2FYUH 2CDYA 2XAGA 4YW5A 2CAUA 1JHNA 4QQHA 4RQEA 1HR0B 3FFZA 3H1WA 2X6AA 2A3XA 2IJHA 3W21A 1HN0A 2IFWA 3WINE 1KRIA 1LAJA 3B40A 4AQ2A 3CDZB 1WW6A 1LOCA 5IVJA 5LXTA 1M57C 4GWJA 1PMJX 2K0GA 3ACIA 5T52A 2G38A 3I7DA 1EM1A 4YZ3A 1OA2A 1E5SA 3K5NA 1XB9A 2C4XA 4UFKA 5FZ1A 1MNGA 3U10A 2JG9C 4DV4O 1W3VA 1OURA 4WZFA 3JD71 1R081 3G6BA 4PDMA 5K7PA 2Z79A 4QU1A 1DQ1A 3VBSA 1IHMA 2NM1A 4WFAV 1K33A 3CJIB 1VQ4V 3ZDSA 4JYAB 1MEC3 3RYIA 5IY5B 3LQCA 5LA2A 3FAVA 3RZJA 2K9ZA 4K0KB 4LBKA 3LDEA 2K1EA 1IBLB 2UWAA 4BDVB 2D5FA 3E5UA 4UAPA 1K8AW 4XTPA 1FXKC 2HWE2 4A3XA 3EB7A 4UW5A 3M70A 4FLWA 4OUMA 1COWG 1VPHA 4K9SA 3AP5A 3MEPA 3UKVA 1MQTC 4CH6A 4X1IB 1RSOB 3DXTA 3H1HH 1KS5A 3SITA 1R1A2 5IDJA 4CH3A 4N90A 1LRHA 1WP8A 2VXJA 2XL7A 3HQUA 2BEOA 2UUBB 2WWWA 1AR72 2MK3A 4URAA 2R72A 4HT1T 4HZFA 4HL0A 3VBFA 1Y76B 4XOGA 4C8DA 4DXWA 1CZTA 3DKQA 5EIBD 4X1YB 1D4M1 5H6RA 1G8MA 1HLCA 1N3PA 2LP7A 3K4AA 1H2LA 3FZ3A 3SMHA 1AR91 4B08A 3GB7C 3VKFC 5JR2A 4F3JA 3NNMA 4COVA 1AYM1 4K20A 1NE4A 1MZEA 3N2KB 2EZOA 2R1BA 2KXLA 2EILC 3IWZA 5KWRA 1UZZA 2D6MA 1QF3A 2ATFA 3WQ7A 4JI6B 5A80A 2NZ9A 3X29B 1W39A 3QO7A 4JI0B 3TJTA 1PO23 2CUGA 2C5DA 3VKMA 2WSSG 4N43B 5FZ7A 2XONA 1NR7A 1TME3 4JZGA 4J7ZA 5BNPA 1KUQA 2OIIA 4DR1B 1BBT2 4RA0A 3AYCA 4UV8A 2ZHKA 2UU9B 1W2TA 5B3SB 2AACA 3VBUA 2OKXA 4AAPA 5JQGA 3WU2Z 3SPCA 2E26A 4MW8A 3ACFA 4IESA 2ZKNA 3GBGA 1RTVA 3OMAB 2XKOA 4DV4B 1NZIA 3W58A 2VWJA 1FAYA 1V70A 3JZVA 1OXCA 1HB4A 4XJUA 1SG3A 2DQ3A 4URTA 3WZ1A 4Q29A 5DN2A 1VAVA 3RZHA 2WZ8A 2KD7A 4Q27A 5B1BC 3V0BA 2HH9A 2ET7A 1S1AA 4L8JA 2ZZJA 4OUSA 5A3UA 1G8WA 1BHAA 3AVSA 5K8SA 2LW1A 3PMEA 1WN7A 4K0KO 1RVF3 1IBMB 5CKQA 2W6JG 3PIGA 3ZMOA 4FFBB 5DZGA 3UT0A 4MTFA 1TME2 4Z8BA 4JTAB 3WP6A 2QNKA 3N2GA 1X82A 2JG8A 1J5EO 5HPOA 1LNQA 3O1MA 2JGDA 1SQBH 4CTEA 2DOSA 5FPVA 1Y66A 1H8TB 1OT5A 3W7SA 2GNDA 2VH9A 4PCRA 2GTSA 3H8OA 4MVQA 3IC9A 2EICA 4LHNA 4KU8A 3SJCC 3SLIA 4CDUA 5C4WA 5EK0A 1AR83 1WMEA 1GNHA 3CRCA 3APOA 2CV6A 3H9AA 3D36C 2HFEC 4QPGA 2Q8VA 1TAEA 1OVPA 2CTVA 5T5OA 4PLNA 2WYSA 1BEV2 3ABKB 5FZLA 3J80N 1D2SA 4JQRA 1ULDA 1H9WA 2UXCB 4O9GA 2FQPA 4Y26A 3ZMUA 3BKZA 3HKEB 4NAMA 2GAUA 3C7FA 3VBUB 4YGEA 1UN1A 5EYXA 2QQWA 1KD7A 4OHXA 2Q1ZB 4JI7O 1W9FA 4NMIA 4R6ZA 2H3OA 1QNMA 2O0OA 5H9SA 1ND3B 4BM8A 2OXBA 2XASA 3RWNA 1GM8A 4HLTA 1UOGA 4KWJA 1NR1A 2YBKA 5FZ0A 1HNWB 4OHZA 2HWE3 1HXS2 1LOBA 1JU3A 4P9XA 3FE5A 1YHFA 3G80A 2EIKB 2ZPXA 1UZVA 4ZI7A 4GWNA 1AR93 4P9PA 4AILC 2RQ6A 4LKDA 1E57A 3TXQA 2Y6FA 5BNPC 3N9LA 1NKGA 3WB2A 4NVPA 2Y4TA 2QDRA 1UOJA 2QQNA 2G4IA 4YG6A 2DYRB 2VNGA 2WN2A 1RFYA 2LW8A 2F93B 4ES9A 4ASUG 4DUZB 4BXFA 2WZEA 2QQOA 1W8OA 4I4TA 5F8PA 2BUKA 1JI6A 4QXBA 4QD2A 5BUVA 3OW2U 1UYXA 4TZDA 1OBNA 5A6XA 1B09A 4KGQA 1X4TA 1VBD3 1NS1A 1WA8B 5FPBA 1WBFA 1HNXB 2XAFA 1ASJ3 3CMGA 4I0AA 2SLIA 4A6OA 4C7UA 4Y22A 4XHXA 3JCIA 4O4HA 4COZA 3ABZA 5JZGC 5K1PA 1AYM3 1AR1B 1NT2B 4I50A 1US2A 1HW7A 3FYEB 4MUVA 2VQEB 2R70A 4NUBA 1SLBA 5FOBB 1XOYA 1ASJ2 2OTJV 1QNYA 2D6OX 1CX4A 1I7FA 2BERA 1ZZ9A 3I2FA 2MEV3 4J25A 3BUCA 1XE7A 4NHXA 4FLTA 1NX9A 1GM7A 1JS9A 1U5YA 5D1IA 4P9WA 2WYFA 5AC91 4OI0A 3VZOA 4M3CA 1S4CA 3WNOA 3WCRA 3TN91 3OMIB 2RE9A 1B35B 2LALA 3OGJA 1H6YA 3CRRA 4GMP0 2Q30A 4C1WA 4B3SB 3ZBHA 1R083 4HFSA 4E9KA 3QTCA 1WD3A 5KHKA 1U97A 1URFA 2ZGPA 3FLTA 1IG0A 1XU1A 5CISA 4DR3O 1V00A 2HBTA 4Q20A 4OI2A 4IE6A 3KHCA 5FMCA 1GWKA 2R7EB 4WV8A 2UXCO 3ABMB 4D94A 2WRAA 3JAWA 5IWAO 4RFT0 2Q7HA 1WCUA 3JB4C 4KI5M 5I0SA 4XUPA 3MLKA 3MHZA 1HB3A 1VQ9V 3K3NA 4JGYA 5FJKA 2ADDA 4E4SA 4CCDA 4UUJC 1OA3A 2J22A 3ASIA 3EMRA 2JKXA 2JRIA 2HWE1 1N3QA 3WDTA 4N7UA 3WQBA 4GH4C 1VARA 4L2NA 1LHOA 4U7OA 1KU9A 1BCXA 4XIOA 1U0AA 1NOVA 3DXRA 2XBO3 3EBRA 2ZABA 1NTKH 1F4MA 5LEJA 4X20A 3B8MA 1NH2B 2VGDA 3PTRB 1GZWB 3HKBB 3FX7A 3VBBA 3K0DA 1NLQA 4BLJA 1K34A 1DGRN 1CPMA 1DGWA 1YJ9V 2JD9A 5DAXA 4PJ0Z 2BOJA 4TXWA 5DUUA 1RUH3 2LM3A 1R082 1PGW1 1YITV 1N33B 4X65B 1K9MW 1Q8VA 4PIXA 4BXSV 3VDCA 1C28A 4LKSA 4LR4A 1AI5A 3N7MA 5T50A 3H1IH 5E1AC 3NJZA 1Z2GA 4W4ZA 1RXFA 1N32O 3CXCU 4GIQA 2HVKC 5FZ4A 4F8AA 1UIJA 3KV4A 4DR2O 1U12A 4RD7A 3WW2A 1PO21 1UU6A 2YZ4A 4GYCB 1I5PA 4RFRB 3W59A 1RL3A 5FP7A 2CTWA 1PGSA 2P3IA 5EYYA 1LGCA 3LEKA 4FQZA 4XCBA 1OPMA 4DRRA 4DB5A 4LO6B 4EFBA 2Y8KA 4DUWA 4EN0A 2FDKA 4CZZA 2UUBO 4XILA 4Z1VA 1NUKA 4U3JB 3M99B 2VQEO 2BVVA 3H8UA 5KXDA 1DU3D 1GOGA 2QDNA 2RS12 4AI3A 3K46A 2JG9A 1GUIA 4FFHA 4LPLA 3VBHC 2GMEA 3RMYA 2DWRA 5JXHA 3PU3A 1L7LA 5KC6A 1UFIA 1YJWV 4NPLA 3VBSC 2YIAA 2HBUA 3ATGA 1TMF3 4GCZA 4YSFA 2WLJA 2E6VA 1XXNA 3BAAA 3T1HB 2H94A 1XE0A 4AAXA 2HWF2 2DF7A 2DE0X 4WFHA 3NV4A 2ZGRA 3B3QE 4UW6A 3GALA 1UKGA 2PMWB 1XHXA 3F5TA 1BKZA 3ZO0B 3P3PA 5T55A 1NQJA 4FPFA 3VDDB 3J7HA 1TMF2 4JV4A 5CBLA 4X1KB 3RG0A 1JZ3A 1QJU3 1RUG3 1Q7YW 4S2FA 1IPSA 4DMIA 2PUSA 3GCXA 2VCAA 3WFVA 2Q0OC 5K0UC 1BYHA 5KHJA 4B4PA 1T6BX 1JHJA 2AGAA 3I4IA 2VZPA 1KECA 2B9ZA 4P2ZA 2VBBA 4LBQA 1PM4A 4E27A 3AZVA 2A6WA 3ZIWA 2WKKA 3K08A 4AVAA 2CE4A 3E5QA 1HNWO 2WO3A 1LENA 2VMEA 1NXD1 1SFPA 2RS32 1IURA 2ZGMA 3FAVB 5IYDO 3EHBB 4Y1XA 4CDQB 1COV3 4KH9A 1P8JA 3WG1A 4LFBB 2GUZB 5FNVB 1DGRA 3TNPB 2B9UA 5A3MA 3L9JT 1DG6A 4AEDC 3FHIB 4G9SB 3SCGA 1W8NA 5IJ0A 3LCPA 3OBTA 3E8HA 4EQVA 3SYOA 1DLLA 2Y6KA 1R3JC 5J37A 3CIHA 5LA9A 1VBA2 1UZWA 4P9IA 3TGUH 4Q4X2 1KJLA 2BNOA 4JHZA 3W7XA 3ZYBA 2A73B 4AGVA 4FPLA 3H3LA 1QVGU 2A1XA 1KQSU 4R8HA 2JG8B 5LMUB 5JOZA 1WB7A 3N7KA 3DGTA 4NRMA 3WG7B 5J96B 3ZKUA 4XJ9A 4EN9B 3PHMA 4J6GA 2CNAA 2P2KA 2OWOA 3MPBA 1WUVA 4UXNA 5EZYB 1IKQA 1S0IA 4DRVA 2VQAA 2DFCA 5DAVA 1AX2A 2HEPA 5L9VA 1FXKB 3UGGA 2DVFA 1OH4A 2R072 3KLSA 1ZA7A 2YDEA 1BLZA 4FK5C 3WW4A 2W52A 3D3AA 3C7GA 3H8RA 2X53S 1AX1A 3ZHSA 1GLHA 1W3XA 2P5BA 4NHKA 1DP0A 4H0LB 3MW4A 3PNAA 4FM2A 4DXSA 1DGLA 4ZIBA 4S2DA 2DUQA 4JI7B 5EFUA 2K9PA 1JTZX 3K4ZA 2WBKA 4IEQA 4FOVA 1Q8IA 3M3OA 4XDPA 5LHIA 1E5IA 1OQEA 4LK7A 4FPJA 1UKRA 2C0ZA 5KMGB 1KITA 4WM8B 4LNUA 1FPN1 4QPIC 5FZGA 3T1YB 1NY72 4FP2A 1HRV1 3NNJA 5HCHA 3K3WA 4M00A 1GANA 2R9RB 5ANNA 2PI4A 3EJKA 4XZPA 4MVTA 5B4XA 3FHAA 1QJX3 3I2KA 4IV3A 4CDXB 3ZRWA 3W7TA 4X89A 5JH7A 1SLLA 4XURA 4BR6A 1CPNA 1YC61 4MVUA 3IPVA 4AFAA 1AX0A 3E6BA 4CEYC 4UWDA 5HV4A 4IV1B 4X1KA 1HJGA 1IG3A 1WZXA 2ZJCA 1AP5A 1JZ8A 4LOSA 4N43A 3APBA 3ECQA 2JDMA 4B3RB 3LUTB 5A3TA 1BMFG 1PNKA 3JD2A 4IYIA 1I1EA 4ARYA 1A3KA 5GZFA 2BGCA 4CDWC 4FFBA 2QE7G 2PQSA 5B1BB 5CBGA 1HV0A 4KP4A 4Q26A 1ZZBA 2W47A 3VHRA 1UXXX 4AWDA 4AEDA 2P3JA 1OQDA 1RJ8A 4XABA 3AB0A 3LF7A 3POJA 4UCRA 5BV6A 3H1MA 2ZM6O 1CAXB 4AQYO 1QJY2 1UMIA 1BEV3 2VBDA 5K9YA 1GYKA 1X59A 4OI4A 4UB8Z 4Q4V1 3AMMA 3C2UA 4X8NA 2BSKB 1YJLA 4XDJA 1MVQA 3KD4A 1N34B 1K5QA 2JDIG 3CEIA 1CR7A 2KM2A 2VNRA 4CS3A 2XHNA 4UCSA 2BW8A 3OD0A 3J9SA 3B69A 3AG1C 4CYDA 5L9RA 5KX5A 1VIWB 2BBVA 1JOJA 4IW3A 1OFNA 3ZYGA 1Y9GA 2HWB3 5FQ0A 5JQGB 4N9IA 4CUGA 1M9NA 4F7ZA 1N36O 3D4KA 3HAGA 2D6LX 2VE1A 1S0CA 4V1PA 2XQRA 4N53B 1SETA 3CRMA 2KA3A 3GCWA 5EBLC 3CRAA 5FYUA 4FBFA 4AQSA 2XJTA 3VBUC 2WNUB 2VBPA 3Q4HA 1AJPA 4O65A 3UESA 3LB9A 4MHRA 3AMQA 1G9CA 4C91A 1FNYA 1SERA 3J26N 4NTXA 2UXDO 3JU9A 5LBBA 1Y9QA 2XJRA 3ZHVA 5GKAC 3CCEV 4WM8A 2I45A 2VUAA 5E16A 2GHYA 1LGBA 1CVNA 1A8MA 3ZVXA 1HQLA 4QDRA 5FYVA 1O3RA 4IE4A 2CY6A 4EJRA 5J2UB 4EB6A 1XJAA 1S0VA 2P4KA 3ZFEA 1TG7A 1SDDB 3OM3B 3ZMTA 4R7CA 4QKDA 4LNUB 4AFDA 5FZ6A 4LF6O 5JMOA 1ZBA1 5EHDA 1J3RA 4QU2A 1GP4A 4LF9O 4I30A 2BDRA 5DAWA 1QJZA 2WFF1 5IVVA 1G1XB 4E8DA 3G7DA 3B09A 2AR6A 2YU1A 3QH7A 1H8HG 1EAH3 1JBCA 4CEWB 2WLIA 4LKFA 2VVEA 4D69A 5F6KA 1PMHX 4LULA 2KG7B 5CB4B 5FZIA 4E2SA 3NKGA 2RM23 2EVXA 3O14A 5IE9A 2IH1C 2W1UA 2VCCA 1N47A 5ABJB 3ZN6A 3RT3C 1W6MB 1ND2B 3AK3A 2R16A 2P7TC 1MZ6A 4GZ9A 2ZGKA 3MZHA 2QR4A 1UW8A 1MS4A 3VHPA 4HPKA 4PA7A 4JQTA 5CKMA 3LEIA 4MW3A 2JEUA 4ZS2A 2Y38A 3O1RA 2V72A 4NROA 4IERA 3RMXA 1EAH2 1X9PA 5H2FZ 5LA0A 1I08A 1NXMA 3KF5A 3SJBC 4O4LB 4X6RB 4JYYA 4JRLA 5LA1A 2RN9A 2VZUA 3OJBA 4FIPC 2W1WA 1IQDC 2YY1A 2UU8A 1GN6A 1I5ZA 2IJIA 1Z0HA 4NIHA 1POV1 1UO9A 3ZRSA 5H9RA 5D5PA 1U5XA 1BJQA 4XDQA 2IBZH 1R092 2H0VA 3OY8B 4PDWA 1TUBA 2UXXA 1UD1A 4RS5A 3MF6A 1WCSA 3MDPA 4AVTA 4DFSA 3S0MA 2F1MA 1FV3A 1NQTA 2AZ0A 1IDSA 2B1IA 3FWEA 1OLMA 5BMVB 3IMNA 2ATKC 2A6VA 2D44A 1H0BA 4P9GA 3K0GA 3QCWA 2VTXA 3USUA 1YVWA 1AILA 3CWBH 2XB6C 4I3PA 3JAWB 2AHZA 1LHVA 2O8OA 4U3JA 4Y24A 1W28A 4JZRA 2GMMA 3WOGA 1DQ6A 5FJHA 1WCDJ 4OQ9A 4XF9A 2OUJA 1XQNA 1M56B 3HT2A 2V7QG 4JI3B 1Z5WA 3H1KH 1WP7A 3NNFA 3DXUA 1K5MC 2RMKB 4O4IA 4BE3A 2F66C 4MGTA 4OMDA 1KB9F 4HVOA 2Z69A 4RSUA 1SHWB 4YGDA 1GQHA 2WL1A 3IT8A 4J10A 1XBFA 4WM8C 1XEQA 3ME2A 3UGHA 1WW7A 3J8F3 3GVMA 2XOKG 1ST8A 5DZFA 4ASKA 3E83A 2ZEXA 3A23A 4YG0A 1LOGA 3CKHA 4HBNA 2ID4A 2JECA 4R52A 5T54A 4YGCA 3H7JA 5EJ1B 5H9CA 1BQ0A 5FZHA 4RGGA 5ITZB 5FZCA 1AR62 3RRDA 2O1QA 2EIBA 1YCIA 4QNHB 2VC9A 4JI5O 2OCCB 2R6QA 2HWC1 2UUCB 3K77A 4I01A 4CSWA 3C90A 2ZD9A 4X8PA 2HWC2 1KEXA 2VMGA 2EZPA 3TK1A 2VZRA 1US3A 4B8EA 3W7UA 4KL1A 5DDJ1 1W59A 2XL9A 2JE7A 4ZI7B 5B2GB 3N9OA 4PV1B 2YBSA 4LR3A 1VBB3 5J48A 3HNMA 4QQPA 2WLPA 1LU2A 4K8ZA 2OA2A 1RUC3 2VVDA 2O57A 3BOPA 1UY0A 3JATB 2EIJB 1CQ9A 1YI2V 1AL23 5IK4A 1ZA4A 3LDKA 2PZSA 1PZ7A 1Y6XA 3HB3B 2JICA 2B9VA 2YPJA 3LSQA 1ALYA 2JDNA 1FXKA 3AYAA 3D36A 4M0HA 4H2AA 5T5JA 4QGNA 2JKBA 4XFAA 1O59A 1L0LH 2VQTA 3RPQA 4UBGA 3EXUA 1RUE3 2WLHA 2P3KA 2LS6A 1PMIA 1S0FA 3ACGA 2R0FA 4BW5A 1S0JA 4AYUA 1FYJA 5C70A 5CFCB 1RMU3 3GBFA 1GZTA 2ZHNA 2W0XA 3OUIA 2XMLA 5HXMA 1YQ8A 2IVJA 3TN92 4ZXKA 1L8DA 3JARA 1VE0A 4JI4O 2ZGNA 3CCSV 2DYRC 1VAMA 1QH6A 4Y3OA 1LCLA 3OGVA 4JZ2A 1C1FA 2AGSA 4BIOA 5EIYB 3ZN6B 4GH4A 4MYEA 4XAAA 1LECA 4MXWA 5FZOA 3ZS8C 1YQCA 4IEUA 3GBWA 2WNVB 5IATA 4GLXA 3ZXDA 2WT2A 4DO2A 1ASJ1 1PGL2 3MW2A 1JH5A 3NJXA 3GWOA 1Q8PA 5JMCA 1JYIA 2UY8A 3DC6A 3JATA 4B3TO 2FDFA 2ARBA 5LL6Y 2BTVC 4P00B 4Q6GA 2I2SA 2Y6GA 4PF5A 2W1QA 1ULGA 5A7SA 1W9WA 2WLKA 3KM5A 1RUH2 4M4RA 1WLDA 5GONB 2XG3A 4XQ4A 2ZDIA 1WA8A 2X0LA 5CBHA 5FUNA 4YZ2A 3BU7A 4FSJA 1SCSA 2F6BA 4HN1A 2BBAA 3VGIA 5LK7B 1AB3A 2HWB2 2JDKA 1H2KA 3GWKC 1SQXH 2E33A 3BTAA 4BQ1A 2Q68A 5BZBA 3POEA 1BK0A 1RIRA 1JYTA 1SZXA 3WUDA 3RWRD 5HFMA 2UWCA 3ZFEC 4IXLA 3VBRC 4FO9A 4GWMA 5FMOS 3CC2V 2X6BA 4CH4A 4XE9A 2B8MA 3WQ1A 3IDEA 4M3CB 5JZGA 2X5IA 4SBVA 5GZGA 1Q6UA 1W06A 3MUY1 1LHWA 1ZL8B 3JSNA 3C7OA 1W8TA 5JH7B 4ZZ8A 2QFEA 3RYHA 1UPIA 5DZEA 1X7NA 3LFMA 3MYXA 5D8AB 5FUIA 2VJXA 3CCLV 3K48A 2AZ2A 3ES1A 3UO2A 2BV4A 1UIKA 1XNAA 2XAHA 1W8UA 2B5HA 3M4FA 3ZR6A 1YTFB 4QQOA 1US6A 3PIJA 3QLQA 2VZTA 4OFGA 5JI7A 1YFXA 1UNBA 4GB33 3WW3A 5A70A 4IDZA 5CG8A 1DFQA 4CCCA 3K79A 2VOXA 1OCOB 4N9HA 1W0PA 2QSAA 1QJU2 2VRZA 4XW3A 4JI6O 5F3IA 3OR7C 3BODA 3POBA 2LW7A 5K0UA 3WB1A 3VBRB 1FOD3 2HWD2 1F51A 4AQTA 3HKCA 4PLMA 2YB7A 3PVBB 1EV11 4K1YA 4AOCA 3CCQV 2CTRA 4RO2A 4NYKA 4QX5A 2BTQB 4RGAA 4FPYA 4FZ0A 4LEJA 3QBQA 2HWC3 2QZ3A 3WT3A 1VBE1 4HETA 2Q6AA 4CA9A 5F39A 1AJOA 3T08A 2WR9A 1GFF2 4F6RB 5ACA3 4DR5O 4BQWA 5FUPA 1UOFA 2FMYA 1JA8A 4AEMA 4YVSC 4OVEA 1RMU2 1SPPA 3VB9A 2RJLA 1J1LA 5C8CC 4TLFA 1FJGO 4H55A 1S0DA 4J41A 2X7RB 4BQ3A 1HW5A 4KWKA 5LCWL 1PHMA 4JI3O 3PDQA 1KQRA 4OGQB 1ZRCA 3CD6V 2VUCA 2P37A 4FTBA 1OUXA 3S57A 4IEZA 3RW0A 4IHJB 1WCKA 5A6ZA 4Q4W2 3HMYA 3PVEA 4X62O 2A3WA 3AL5A 3ZXEA 1JZ2A 2ZGQA 3B9IA 4JTDB 3IFXA 1AR5A 5FXXA 1WA4A 2VL4A 2QWRB 4CEWA 1D4M3 4D7SA 1F4NA 4HXCA 2VOVA 4YFZA 1VQ8V 3FHQA 1P7BA 1OZ0A 1PX3A 3CBNA 3Q8CA 1WMDA 1ZM1A 3LE0A 3QH6A 1L1FA 4H7LA 4X66B 3GHMA 2CHHA 1BBT1 3IDCB 2WA4A 1GR3A 4Q2FA 5TSWA 1WBLA 2Z5WA 2Y0IA 4LBOA 4JYAO 5E8AA 3VBRA 3BEHA 4LO4B 2VVFA 1DBNA 3OCPA 4JGZA 1XYPA 3O1TA 2A7AA 2VCMA 1LODA 2LRPA 1E1RG 5ABJA 4LKEA 4E8CA 2F17A 1PGL1 3LDCA 1MS9A 2G1MA 2WLIB 5J09A 4LF7O 3H3UA 1FXZA 2LROA 1K97A 2L35A 2JGDB 3CP1A 4KGGA 4Q4Y3 2V5YA 2FDGA 1AYM2 4Y5SA 5LMNO 4COUA 2KR2A 1C5HA 3E35A 1QJX1 3RYCB 2VMFA 2IXIA 1AXYA 3CE2A 2ZX3A 1R1A3 4Q0QA 4OQ8A 3DPRC 1NI8A 1CIYA 1EFRG 1IGOA 3UKTA 4XCAA 2E7AA 4IEVA 1AR81 4DR4O 2R1DA 3ACHA 4DW0A 3HEIA 5JSRA 4QHOA 1SFNA 4EEQA 1WLEA 1X8MA 3AG7A 4XUOA 2R32A 4BOWA 5FLHA 3APQA 3VQYA 3I54A 2BYVE 5BNNB 5IAVA 1XNQB 2YU2A 3I97A 3VHOA 2J1RA 5FCCA 3OYWA 3FLRA 3T4ZA 3BCCH 2V4DA 1V54C 4Q8LA 5CA1A 3KS7A 5CFDC 3RI8A 2N05A 3CCJV 3Q8AA 2WNVC 1OOPC 5KUKA 3U0ZA 4JAUA 3F2ZA 1I94B 4R9DA 3ZHTA 3MFAA 2ZINA 2DTYA 2JG9B 4LF5B 5LEKA 1H30A 2LGWA 1RUC1 2WS92 4SLIA 4N8MA 2E75B 3AP9A 1Q6HA 3ACLA 4XXAA 4XFCA 4MS2A 5LA6A 5DDJ2 2ZT9B 2UXBB 2QJVA 5I8SA 4QHBA 3T1MA 1RHI3 2IC1A 5K4LA 2LGQA 3W5NA 1S5JA 1HJFA 2Y6JA 2WNEA 3KSCA 4JKKA 1W2NA 2XUMA 1I3HA 2VZOA 2WO7A 1AR4A 5EBWC 4DR7O 1RP3B 1QCEA 5JVVA 1H1IA 1KP2A 1VQNV 3I3MA 4X8AA 1JJOA 5FO8B 2WSVA 3ZMVA 5L36A 2RS31 2KG7A 5CB4A 1SEFA 2G19A 1RUD3 1X8EA 1W99A 3MIDA 3P1IA 3USSA 5LMUO 2SBAA 1OCZC 5FTTC 3NO8A 4X64B 4WFFA 4Z2WA 4O7XA 4CH5A 4XJZA 1CD3G 4S2GA 5GLWA 2CDPA 2PGGA 3L75H 4LH6A 3RYIB 1C57A 3U07A 3QD6A 2AEZA 4EWDA 3MV01 2R30A 3SYAA 2ZX2A 1Y74A 4QB2A 3ETGA 4XHBA 4BCUA 1NA1C 3VZMA 2JK5C 1T5EA 3HT1A 4ZKTB 3B01A 2ZXQA 2K46A 3T1LA 1GM9A 1W9TA 2P22C 2YXSA 5CA1B 4JTOA 3IPVB 2H0BA 5DAQA 4GJZA 3G4SV 4FLZA 3OBZA 3Q8FA 3E5XA 3BGAA 1Y9MA 2RG4A 5JUVA 3J7AU 5F37A 1OVSA 2GN3A 1CZSA 5F5QA 2VQUA 3MGUA 1QR8A 1GZWA 1VRH3 2GC3A 2YROA 1TGOA 3PJYA 4BJ0A 4W8JA 2GP5A 4DK1A 4NRPA 4LIUA 2W95A 3RFRA 5FZOB 1HWYA 1ZNPA 3ETEA 3NAPA 2XTAA 3ZYPA 2VW0A 1JOYA 3CCUV 4YNIA 2YC2A 3BPSA 4INDA 4HNAA 4XDOA 4R4ZA 4GX0A 2Z3YA 4GKKO 4NKGB 1S76D 4Y33A 4JKMA 4QB6A 3DF0A 4NXMB 3VBOC 3KGLA 5CA0A 5J98B 4I2OA 3LIGA 2B7YA 3J8F2 1C1LA 4CP9B 3ZYJB 4H3WA 2J1SA 3S5AA 4PLOA 2B46X 4JI0O 1Q5OA 2DV9A 1WLWA 2JDZA 2NP0A 1H1AA 5EZYA 2EF6A 2ZE6A 2HWF3 4LTAA 1W9YA 2PN5A 3WP3A 3WDWA 4CCMA 3KHBA 2GN7A 2PAMA 4LFBO 5FP4A 3WP4A 4BMEA 1QGLA 4LK6A 2XJQA 4YVSA 1GRJA 2XWBB 3DTUB 4BIFA 1M56C 5FKBA 4UFLA 1VQ6V 4N23A 2R0HA 4Y1YA 4RQPC 3B8NA 1VR3A 4JI8O 2PQQA 1NCQA 5EV7A 2Y34A 3POFA 4FVVA 4CDXC 3JAKB 2P67A 2DVBA 2YUAA 4BQ5A 2IM9A 4BQ2A 2WLMA 2YUEA 3WP5A 4BK4A 2ARAA 5L7OA 1OCOC 3CF6E 1ZBA2 3KB5A 2Q1MA 5B1AC 1B35A 4YZ5A 4DK0A 2AW9A 5A1AA 1FPN3 1GZ9A 3ROUA 1IVSA 5KHIA 2DBIA 5L3GA 3TCUA 2GNBA 2BFUS 1ENSA 2CTPA 4EZ4A 4AHCA 1JUHA 3ZN5A 1I5YA 5JIAA 5T3NA 4WM7A 1JQ0A 3BVCA 1N4CA 3DPRB 3O12A 1UCXA 3VBFC 2LO1A 4TWKA 3RSJA 1WMFA 4LBQB 2WZR1 4DIQA 3LOIA 4LA3A 1E79G 1V55C 5LGUA 4N7IA 1UXZA 3O0VA 3IB3A 3HN3A 5FBZA 4PD4F 4Q8KA 4LF7B 3IN9A 3POSA 4JV5O 2VG9A 2YHJA 3J4UH 3AZXA 4HKWA 1W0NA 2D6KA 1QOTA 1Z78A 2CK3G 3R4DB 1ND2C 2LFRA 1M90W 3N7LA 2PHFA 1LGNA 1SBEA 3ASNB 4OZXA 2IXLA 3NKTA 1SQPH 2A6XA 2J1EA 3K04A 3WUCA 5B1NA 3OSDA 3EFFK 1QWRA 1COV2 4AF9A 4JI5B 4QX2A 3NQHA 3KZIZ 1OCRB 1NA1A 2HP8A 1DYOA 3RZZA 1SQGA 4OHYA 1NE6A 4DPNA 1KBHA 2OIGA 2CSGA 5LWBA 4L97A 4I9WA 1AUYA 3T2OA 1PIV1 3ZRWB 4IGOA 3B02A 1QHTA 3CB2A 4NAOA 1DYKA 3O0XA 4DV0B 1XL6A 5C33A 5I0UA 2HJFC 4K21A 1H4HA 2X29A 1W0OA 2QM8A 2NQYA 2KB1A 5IK5A 3EO6A 4FLVA 4OCTA 5G04L 1RUI1 3D8CA 2QUOA 3WF0A 2UU9O 1BT8A 2HVJC 4IGQA 1OOPA 4LIVA 2C9AA 3BN6A 3K58A 4ASMB 4IQPA 2CH7A 4JDMA 3ZXJA 3WG7C 4CRQA 5EC2C 1QLNA 2Q7EA 5FZ9A 2Y4UA 4RS5B 3PURA 1H38A 4F6EA 4E2GA 5FZKA 3ZYHA 5FYYA 5IYZA 1N1SA 4CEYA 2B39A 1UMZA 4JI8B 4XVHA 3CYOA 1UU4A 2EIGA 4QWNA 1TZOA 4MSWC 4PI0A 5FKCA 2YG0A 3BHPA 3M3IA 2EILB 3A0KA 1ULEA 3T4DA 2YIBA 3U4SA 3K3OA 1FPN2 1OCZB 2ENRA 1F5JA 2ADPA 2E7TA 2W0FC 2IU3A 4XJ8A 3UV9A 5FMDA 1EYBA 4YZ4A 2ZMNA 5B3SC 5C8YA 3TOJA 5E79Z 1VRH2 1PO13 2N7GA 4XIKA 5KAFZ 4NTYA 1KJRA 1CESA 3LA3A 4NWWA 4AI1A 3I56V 1SLCA 5CA6A 1F4HA 4ZBMA 2J1TA 1GWLA 3ZSMA 1G86A 3ZMSA 4CCLA 4WVZA 4FLYA 5FZFA 1X9TA 1QLEB 3VDBA 2A7WA 1WMXA 1GP6A 2W68A 3X2QC 2NR5A 1XOUA 4QPIB 4Z92B 4O4HB 1A32A 5FPOA 1DQ4A 1BEV1 1IX9A 4DUYO 1PK6B 4CUCA 4YJ3B 2IU0A 5JLVA 2WINB 1RUJ1 3E2EA 3MO4A 1DCSA 3MLLA 4IV1C 4ZPIA 3ABLB 1W0JG 2Q9LA 3ABMC 1UZ0A 3DUIA 5FYMA 5BY1A 4CUAA 3F5WC 5FP3A 2VM9A 4P14A 2JDAA 2FCVA 4RWUA 5JSPA 1SZTA 4DXRA 1S3JA 3VBOB 2JIGA 4IIJA 1MOFA 3S30A 1OA4A 3WDXA 5LK5A 4A44A 1POV3 2EULA 4LF9B 2Y26A 2K2SA 1I0HA 2VNOA 1IBMO 2XJPA 4WZCA 3WR0A 4QQLA 3OTOB 2JEXA 4JX0A 1AXKA 4YLZA 3CJXA 1HKDA 1HRI3 4GULA 1TME1 3SQOA 1YFUA 3FKSG 1CAVB 1XE8A 4Q0PA 1W6NB 2PI5A 3N27A 3SR2C 2OQ6A 2VTXJ 4XF0A 4HAMA 2A75A 1XI1A 4K8XA 4B3TB 1AR73 5IWAB 5C4WC 2Z42A 1A8DA 1MS1A 2DCYA 5LW9A 4FPPA 3I2HA 2HJIA 3O0WA 4DR6O 3HBZA 1W8HA 4YG3A 4FOQA 4AE2A 4K35A 2WNOA 2G9FA 4DR1O 2EJRA 4HZ3A 4WF9V 3AK1A 1GU3A 1PNLA 4B3MO 4QPGC 1Y4WA 4LO5B 3H8XA 2XHKA 1CJDA 2QGNA 2ILMA 5FL7G 3JASB 2RS52 2JIZG 3GZUC 5BNOC 3H42B 5BPXA 3RYPA 2W91A 1XUQA 3MD0A 3CSXA 3DXRB 4YHHB 4YGBA 4E4HA 3ABTA 3HNYM 2WFF3 4DYLA 5BR8B 1NCQC 1MQTA 1TMF1 3WDYA 4CCKA 2UURA 2X5IB 3RZKA 3VZKA 1YTFD 1IPKA 4CDQC 1AL21 1TVKA 4A3ZA 3PTYA 1L3JA 1NLSA 3BA9A 5HCAA 1LR1A 1ZBE3 2D43A 2VY0A 1B6QA 5JDBA 3AKRA 1QH7A 1M57B 4GQ7A 5IAXA 3I8TA 5C4WB 3LSSA 5DN6G 1K5SA 4IL7A 3USUB 3JD1A 2UYAA 1ZRDA 3U11A 2TEPA 2WLLB 5C3OA 4DEQA 3MIBA 1XILA 4GJYA 2XJSA 1N32B 4IEYA 5L3BA 5A7NA 3D5OA 4JI2O 4DV6B 5FPRA 3PL0A 4CBCA 1VB2A 4E2LA 3AZZA 4K8FA 4FMTA 4PDWC 1LKNA 3CC4V 1QXJA 3FBMA 4D7YA 5IYZB 2B45X 2RR12 5BNQA 4DR7B 1K12A 1KFXL 3KT4A 4LBNA 5I0TA 1PO22 1PNMA 1V54B 2PFWA 4ICGA 2R062 1SQVH 2P1BA 4AK3A 2ZR3A 2HLEA 3EYPA 5FXVA 3ZRVA 2V4VA 1XDCA 1ZTEA 2F4PA 2Q1FA 4AW7A 1AI7A 3OMNB 5FMBA 2IW5A 4QMAA 2KSDA 4CU6A 2BTQA 2TNFA 4FPKA 1HB2A 5AG2A 1V6KA 2W5FA 3EXAA 5C71A 4CDUB 3TAYA 5CAZA 5FYZA 3WW1A 3HOBA 3O5SA 4D6SA 2XXZA 3D82A 4JGZC 2P90A 1NAEA 3MIGA 2WZR3 3POWA 3NXSA 2E5LB 3RVYA 3R4UA 1N1VA 2ZKOA 5F7UA 5M0TA 1DQ2A 3WG3A 2AHYA 5FDBA 1K5MA 3J81N 5CG9A 2WLLA 4LORA 3QO8A 2XVLA 3FB5C 5DG2A 3FLPA 4XFHA 1MZ5A 3HKCB 4CC5A 4BPZA 2GZWA 1RXGA 1S0BA 1RC6A 3DYPA 3DN7A 3U1XA 5AVPA 1JYXA 2P5OA 3C7EA 3JCUZ 3P32A 1HDJA 3JD72 1DTOA 1OD5A 1VQMV 3IM0A 2AYHA 4XFIA 4R4XA 5C8WA 3KQRA 3ASNC 1KDMA 2WDBA 3RJ2X 4B4RA 2DVGA 2JG8C 2EX3A 4GKJB 1UF2C 4FTSA 4IE0A 3AL6A 5KHHA 4XQWA 1AZDA 4EWEA 3TNQA 4FJCC 4RR3A 1AYN2 1XNDA 1CN1A 3WCSA 1Y43B 4P08A 4IT5A 4GZRB 3SH5A 4TV9B 5JPNB 4QXHA 4H7MA 2XJUA 1ODNA 2IVIB 4HG6B 1DF4A 5A1FA 3THPA 1G9BA 4LBLA 5IJ0B 2PHWA 5D8AC 2DN9A 2B42B 5E88A 3LOBA 4XXPA 1W8WA 1AR82 2B5UA 4JGYC 1UY4A 2XLFA 1R6NA 1JMUB 3HPLC 4N53A 2RM21 3FB7C 3LIHA 4RQPA 1ZUQA 5FQ0B 5LZ6A 3ZDVA 2D3RA 2Q5TA 5LP6B 3BTZA 2Q5ZA 3U78A 3QNEA 4IV3B 4CDXA 2PYTA 5FAXA 1A34A 4HVQA 3BCWA 4K8RB 2ZCWA 3LAGA 4RN5A 1SESA 1N0JA 2FDJA 2BGOA 4M3CE 3KMHA 5DDJ3 4ONUA 1UPGA 1LU1A 3RBZA 2ITCC 3IZOA 5ISLA 1HV1A 4XDKA 1VMHA 2GV9A 2RDRA 1RINA 3PUSA 4WFEA 2Q0AA 3LA2A 2V73A 1G9AA 4LBJA 3IJ4A 1Y76A 2RNBA 2ZXWC 2ZIMA 2RHPA 2GDSA 3SGIA 1O5UA 3MI8A 4I5SA 3ZN0A 4L8QA 3LNNA 4DUZO 1XNRO 2AUYA 4JGYB 1R3KC 1GK9A 4CS2A 5C8CB 3OT7A 1QEXA 1OCCB 3FC0A 1L7RA 1VALA 2EAKA 3RZGA 4Z82A 1D4VB 1W2BU 3MHHC 2ES3A 4O4LA 3M1HA 5EJ3A 3N35A 3QACA 1QJFA 3E8BA 3VBHB 2BE3A 1XC6A 1U96A 1CJPA 5CYYA 1MG1A 3DECA 4LUMA 1NG0A 1YXWA 5IJ9B 5JZGB 2J42A 4M0NA 1O4YA 5IY5C 3KV5A 1ZZ6A 1XBLA 2JB4A 2OPKA 4ASLA 3NAPB 4AI0A 4PA9A 3W5MA 2PAKA 4DV5O 3VD9A 2QQLA 2XR4A 3F95A 5FZ8A 3ZFFC 2WO2A 3HKEA 2UUCO 1MZFA 2ERFA 1IS6A 1OMIA 4BMBA 3EHKA 2WWJA 2GC2A 3KKYA 3R66A 1AI4A 3I59A 5F5IA 1W2AX 4ISRA 4DS0A 2TUNA 2VZVA 2XOMA 4KUMA 1Q8OA 2GNMA 2DYSB 4BQXA 1SA0B 1ZRRA 1KGYA 4YIOA 1RUF1 3NAPC 4Y1ZA 1QDOA 5CFCA 3N3HA 4GAZA 2D5HA 4RYDA 4M4PA 2QQKA 2V5DA 1H2SB 3LKJA 5FBJA 1POV0 2J7MA 3KQ4B 4MH0E 3AP6A 2VS0A 3I3EA 2ORZA 4ISQA 2VECA 3ASOB 3CPWU 4RUEA 1SQ4A 2PLV1 4BZ4A 2DVDA 5H9QA 5LGTA 5B1AB 3AG2C 1EV12 3GJBA 3RN4A 4NO4A 2NLRA 4R9BA 4DR2B 3ZSEA 2QA4V 1ULPA 2VZQA 3SNMA 4AEDB 4N21A 5C8YB 4X20B 1QJU1 4WBNA 1AL0G 5F5CA 5EZWA 1OKOA 1VMGA 3ON7A 5EQUA 3ZXLA 5KLVH 2C24A 2NN4A 3THOA 4BQYA 1NQDA 4L11A 4UB6Z 1V6OA 1FATA 2WAOA 2WNVA 5JI9A 1G9FA 3I2GA 2D2CB 4KQ7A 3CL1A 3Q8BA 4HANA 1WWYA 2OZ6A 2XQXA 2DCZA 1RUI3 1GTOA 4JI1B 1UY3A 2BZDA 2UXDB 1HB1A 1RUF2 3IC7A 2MHFA 4LBMA 4LT5A 1D0GA 3CC7V 2R9IA 4W4KA 1YQ2A 5EIBC 4UOJA 1AJQA 4FM1A 3KV6A 1IS5A 5KBFA 2YXLA 4NOTA 1V6NA 3ILFA 2YPDA 4Z2AA 4E4ZA 1MA1A 3I55V 1B35C 2NMOA 3ZOIA 4DUXA 1OOPB 3X2QB 1WB8A 1QJY3 1TQ5A 4LF6B 1EUUA 3SC7X 5ACA2 4AVBA 1PPJH 5B66Z 3JB8A 3IBMA 3FB6C 2E76B 3B77A 2VCBA 2OT5A 2BVBA 1Q3EA 3ZXGA 3IIAA 2HKOA 1FD9A 4DZGA 4Z1MG 3ILNA 1WW5A 1D0HA 1ZAUA 4BISA 1KS4A 3VZJA 5J2TB 2ZCEA 4ET7A 2GC1A 2XDVA 1YLLA 4OXSA 3STZC 2R041 4YW1A 2ZGUA 1VF6A 4Q1RA 3WD5A 1M4UA 2JJ1G 4EWAA 3MFCA 4G3YC 2BP6A 3OGSA 4H44B 1XU2A 1MSWD 1KXGA 1PX4A 1W0KG 1X33A 5ERLA 1XMQB 1FT9A 3AMHA 3JAKA 5JOXA 1BVVA 2IJJA 2PTMA 2HWD3 3AC0A 2H8PC 2D97A 2W08A 1LNSA 1HNZO 1VBB2 3OEAA 2TBVA 2W87A 1YI7A 3O1SA 3ZIXA 5DECA 3R65A 3K5OA 1XREA 4AGRA 1R1BA 1W8ZA 3RYCA 1TE1B 4Y1UA 5DPNA 1OHHG 1DGSA 2JX9A 5DEDA 2OTLV 3OEBA 3H7YA 3VV1A 2HHHO 2ZGLA 3OE7G 1W6MA 2C6SA 1R73A 2YXHA 4LFCB 3ZEDA 4LFAB 3GYDA 4EV0A 1ZBA3 4B4QA 4Q1PA 3IIIA 4TLGA 4QPWA 2LTNA 4A4AA 2Y48A 3TEZA 4YVSB 4PA4A 3K9AA 2ZHMA 3M3QA 5K1XA 3LD8A 3Q8EA 2WN3A 2ODMA 5DUXA 1C4RA 4PDRA 3ZYIB 1V9U2 3V0AB 3NV3A 1SBFA 4WVMB 1NBMG 3ZCCA 1WLCA 4TSFG 2GMPA 4PDLA 2JDUA 3NNGA 3RGBA 4GH4B 4JPRA 3OY8A 3BA8A 3OGGA 2LJ2A 1AYN1 1HR0O 1YO8A 3J7LA 2V09A 3D3QA 3JUUA 4W6XA 2OIEA 2MPFA 3PN1A 1H2NA 1R1A1 4OX9B 1DQ0A 5AFBA 2ZMKA 1VQLV 1SKVA 1Q82W 3LEMA 1ENQA 4CP1A 4AI8A 1DZTA 1OI6A 3VDAA 4XMAA 4YW4A 1STMA 1S2EA 5HXVA 3OR6C 5FY7A 1RUOA 2W3JA 3S5QA 5LGNA 3ETPA 4O2AA 2ZACA 5FP9A 2WO1A 1VQPV 1AVBA 4OI1A 4LWSB 4MHUA 1MR5A 2BU9A 1JZ5A 1PNGA 2Y69C 2V1DA 4JKLA 4QQ2A 1BK1A 3I2JA 1IS3A 4GXLA 3O9OA 2DCJA 4UCUA 3UO3A 3G6EV 1GAXA 2PLV3 4AVSA 3O1VA 3SPJA 4DRXB 2ZA9A 3AZWA 3N9NA 3BB6A 4GA9A 4BQ4A 2M6YA 3S6PA 2NMNA 5A3LA 4U3FH 1GKBA 4P02B 3RYFA 4Q0SA 1VBD1 1JCHA 3L2YA 5LBFA 3K06A 1OH3A 2DCKA 5FFOC 2FMLA 3MF9A 3ASOC 2F4LA 2X8KA 3V64A 4XMIA 3N2GB 4YW3A 2YI8A 5FZMA 1HRI1 1QMJA 3HPNA 3Q9OA 1OC1A 4YY3B 1Z7S3 3GJAA 3A0NA 5ITZA 4A2UA 1CIWA 1HIXA 1QIQA 5FZBA 5CB7A 3A8TA 4I55B 5C9AB 3ZJZA 2ZHLA 2JDHA 1JJ2U 4YIPA 1PM9A 3A0RA 4OHWA 5LA6B 3ZHRA 1AF9A 1FNZA 3QG5A 4Q4V3 3RQ0A 4A7KA 3GHNA 4WFBV 1FMD1 1VAKA 5DAPA 3WF3A 1FFXB 3A0HZ 3S7EA 1VJ2A 2ZOEB 3THCA 2WAMA 1DK1A 1MABG 3VBFB 1GQGA 2IXJA 3DSQA 1YSCA 4GX2A 4MGYE 1PVXA 3K4DA 1JX9A 3JBG3 1CAXA 4X1YA 1F4AA 2VNVA 2AC1A 2YYOA 3VOUA 3VD3A 4XFGA 5JCTA 5KX5B 4DRXA 3GZAA 2PELA 2DVAA 4RUFA 4UFMA 2BPA2 2ZR2A 1FAFA 1Q86W 4LOTA 1YJNV 4LP8A 5FLIA 2R043 1UJWB 1GICA 2O14A 3K9SA 4RR3B 2FTKA 3DEMA 3WNXA 1O9GA 2JEMA 2C1FA 3OGIB 4HONA 1VF7A 3WQ0A 2D98A 1PZ9A 4JF3A 5A33B 1NJIW 4PT6A 3RJRA 4J11A 4MVSA 4X9QA 2P34A 4ZU5A 3T0DA 2XUEA 4A7YA 4JHTA 1YNAA 5FY8A 5I8TA 3KG2A 3RYRA 1CONA 2JENA 3H50A 1BS3A 4OX9O 2E51A 4J9ZB 1MACA 2RS51 1VQ7V 4QPIA 4Y4YA 4HKOA 2PHDA 1EN6A 3SXWA 5FOJB 1THZA 2X05A 3AG3B 3THDA 4YWAA 1IXMA 1JZ6A 5SV5A 1ZYBA 3M3CA 2YFZA 3GNEA 4H13B 3N2KA 4ZHQA 5J3UA 2A6ZA 1ULFA 3MPPG 4IV3C 5L19A 2VXRA 4MXWB 3KF3A 1K7DA 1BHGA 4RHV1 4A45A 2YIBD 3OUJA 3SH3A 1POQA 3ZIAG 1GMGA 1KC8W 3DKWA 3LSEA 4D6QA 3B2EE 1GN4A 4MGZE 4YVWB 4LE3A 1R3LC 1W2UA 2P3YA 2E74B 3N9PA 1SA0A 4DV7O 3VKNA 3UKNA 5GLTA 1NVPD 5A7PA 5I0RA 4QPYA 3ICXA 4YFWA 3UETA 5KXCA 2MEV2 3VKLA 5IT6A 4X6QB 2CAVA 3AG1B 1YHQV 1FX5A 1O8SA 1LUVA 3PUIA 3ZN4A 3UCSC 3VHNA 1VBE2 3ENRA 2GSYA 1Q8QA 5CVRA 3KVBA 3L71H 3THTA 4MGQA 1C8M1 5FXZA 4DR6B 5A7WA 3BIWE