1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
3UKNA 3H7YA 5FDBA 5KHGA 1NXMA 3QOPA 3TNPB 3IDCB 3LZZA 1ZRDA 2IXJA 2PAEA 2P17A 4J1WA 2D93A 1CAWB 2PQQA 1YWKA 2HJIA 3NJZA 1OD5A 3PVBB 4ZU7A 3EBRA 3DKWA 5JAXA 3D0JA 1HW5A 4D7SA 1WA4A 4R8HA 4I01A 2IC1A 3MPBA 2OYZA 5C6CA 1V70A 3FE5A 2OZ6A 2BNOA 1U12A 4LA2A 4XFAA 1RGSA 4CYDA 1CAUA 2I45A 4KU7A 5T3NA 3UKTA 5J48A 4XFCA 1UW8A 2ETEA 1Q3EA 3CO2A 3DV8A 4AVAA 2PFWA 3LOIA 1QXJA 5FLJA 3H1YA 1J3QA 3USSA 5BUVA 1X7NA 4PIYA 4OLLA 2C0ZA 3E97A 3MZHA 1LB2A 3MDPA 3SMHA 2Z2SB 1O3QA 3ES1A 1CAXA 4HVRA 1ZX5A 4FAGA 3BPZA 3IDBB 1YFXA 2GAUA 4FBFA 3FHIB 1QXRA 5FQ0B 2DCTA 3WW3A 3RZZA 4YNIA 3E5QA 3H3ZA 3SHRA 4BIFA 1IPKA 2N7GA 1YLLA 2QVSB 4AXOA 3CF6E 5I93A 1LRHA 2XGXA 2BEOA 5CADA 1ZZ9A 2BGCA 4KWJA 4XFHA 2B9UA 1Y9QA 5E16A 4X6QB 3H3UA 2H0VA 1JUHA 1CAXB 1CAWA 3H1MA 3IBMA 1RUOA 2PHDA 3GBFA 2IXIA 4OFGA 4AVBA 1OFNA 4I0BA 2FQPA 4QM8A 4XF3A 3N4MA 4ORFA 1QWRA 4I09A 2GZWA 3NSTA 1Y3TA 2PHLA 1VP6A 3GYDA 4XETA 4LUMA 3MYXA 4WZCA 4AQ2A 4A2UA 2PYTA 3S7IA 3LA2A 4I0AA 2WC2A 4EWDA 4LULA 4MZUA 1ZZ7A 4MGYE 3R6SA 1O3RA 4HN0A 4Z07A 3DL3A 3EQEA 4BYYA 1EP0A 3NVCA 3I59A 3KGLA 1CAUB 4MGKE 1WGPA 4HVQA 2HKXA 4IEXA 4LEJA 1O5LA 4O9EA 2QCSB 4PJYA 1G6NA 1ZZ8A 1OI6A 2EVXA 3E5XA 3SCHA 4QXKA 4UBGA 1VJ2A 3H7JA 3SCGA 2PAMA 4ZU4A 4FT8A 1XRUA 3LA7A 2OZJA 3H9AA 1ZZCA 3I59B 5I8YA 1ZRFA 5J3UA 1DZTA 3UKVA 4XF9A 4KWKA 1WLTA 4QGMA 3RYKA 4IEWA 3KGZA 4DINB 4KL1A 3JZVA 2GC2A 1CAVA 5I0TA 3M3IA 4P9GA 1UPIA 3KSCA 4QM9A 4YRDA 4EV0A 2CV6A 3NKTA 2BNNA 1I5ZA 1O5UA 1LKNA 2KXLA 2ZKLA 1Q43A 4IETA 5LRSA 3CJXA 2PA7A 3HQXA 1PMIA 4KU8A 4XF0A 4MV2A 2MPFA 4UBHA 1IPJA 4J1XA 4ZU5A 4QMAA 5FLIA 1CGPA 2Q0AA 4UXAA 5FPXA 5KBFA 4Q0UA 4HZFA 5FPZA 4E2GA 4F7ZA 1YUDA 3OCPA 3CEWA 2UYAA 5I0RA 1X82A 5LEKA 1YHFA 4IEUA 4I02A 5JR7B 2MNGA 2XHKA 4MX3A 2IXCA 3OD0A 4HSJA 5EZWA 4Q0SA 4HLTA 3EJKA 4B29A 4N9IA 2O1QA 3LAGA 5KHHA 2GU9A 5C8WA 5JSRA 1X8MA 1XE7A 3G7DA 4TLFA 5JCTA 4WVZA 2D5FA 1Q5OA 4EWEA 5BPXA 2CGPA 5I8TA 4AQ6A 2K0GA 5I0UA 4YSFA 2D40A 3LWCA 1ZRRA 1H1MA 3TNQA 3D0SA 1H1IA 3SXWA 3ETQA 2XLFA 4QX5A 5KHJA 4JTOA 1O4TA 4IEZA 4KWLA 3OF1A 1O7FA 4F8AA 5D1IA 3M70A 2GC1A 2E9QA 5BXXA 4MGIE 1J3PA 3H1WA 4IERA 2XKOA 5JSPA 3BALA 3E6CC 4EWAA 3CLPA 1YFYA 4MH0E 4BH9A 3FJSA 4IEVA 2ET1A 3C3VA 3EHKA 4R52A 2UYBA 1J1LA 4HBNA 4MUVA 3L2HA 1EY2A 2OA2A 3H8UA 1ZREA 5FLHA 1RL3A 4D7TA 5FCCA 4N9HA 2FMYA 4HVOA 5JSOA 3ZDSA 3H50A 1ZNPA 1PM7A 3U11A 2IXKA 1DGWA 3EO6A 5I91A 4GULA 4E2SA 2Z69A 1UCXA 2CAUA 3B02A 2B8MA 3BB6A 1EPZA 4XFFA 3S0MA 4JVAA 4I3PA 2IXLA 5BY5A 4BHPA 3BU7A 3KMHA 4Q0QA 4JTNA 5I8SA 2UY9A 3FZ3A 4QGLA 4ONUA 5KHIA 3U0ZA 5FQ0A 2XL7A 3E6DA 4HN1A 3IIAA 1ZVFA 1CAVB 2B5HA 3RYPA 1DZRA 4Z82A 3VHRA 2IXHA 2XKPA 2EA7A 1FI2A 2GC3A 2Q4SA 4LTAA 1YFUA 5EFUA 4MGZE 5J7MA 4Q0PA 4XFBA 4XEZA 4XFIA 4IEOA 3PLQA 2XLAA 1I6XA 4QGNA 4YYOA 3HT1A 4FAHA 1UD1A 2Q1ZB 3FX3A 2QDRA 3WW1A 2CAVA 3QACA 3NW4A 1O3SA 5E1RA 1GQGA 4AVCA 3HIFA 1NYWA 1VR3A 1CX4A 4META 4WBBA 5F1RA 4HMZA 4IEYA 1GQHA 5AVPA 3KCCA 2VECA 1TQ5A 2F4PA 3I7DA 3RDIA 2BYVE 3U10A 1ZRCA 2XLGA 2XL9A 3FFQA 1J3RA 2ET7A 3CL1A 1YFWA 5LRRA 2VQAA 3SCFA 3I54A 3S7EA 3BCWA 3ELNA 4YARA 1RTVA 3WW4A 4PIXA 2EAAA 1RUNA 3NL1A 1LR5A 3ACLA 2ZCWA 1DGRA 5CU1A 1ZZBA 2D5HA 1SQ4A 4NVPA 1OMIA 2V09A 2H6CA 1J58A 1L3JA 1SFNA 2OPKA 1X8EA 1NZCA 4JV4A 4X6RB 4XF1A 1UIKA 2Q30A 4LUKA 2MHFA 4Q0VA 5HI0A 3DN7A 1ZZ6A 1NE6A 3HT2A 1O3TA 5BV6A 2PAKA 4IEPA 1EYBA 4HSLA 5K8SA 1FT9A 2GH2A 4L2NA 4LA3A 3ES4A 4O9GA 1NE4A 5KHKA 4PIZA 1XE8A 3PNAA 4RD7A 4XFGA 3RYRA 3OGJA 2ATFA 5I0SA 4H7LA 2O8QA 2WFPA 1UIJA 4LLOA 4IESA 3D82A 3ROUA 5LEJA 4E2QA 1QY4A 4XF4A 1SEFA 3WW2A 2BNMA 2QJVA 3O14A 1J59A 2VPVA 5CVRA 4EROA 4I2OA 2UY8A 2Y0OA 1FXZA 3E6BA 2K9ZA 2GC0A 4L11A 3RPQA 1RC6A 3RNSA 3FWEA 3IWZA 2PTMA 4K8FA 3ST7A 4IEQA 2H6BA 4Q29A 3OTFA 3LA3A 2QNKA 3E5UA
chains in the Genus database with same CATH superfamily
4UWDA 2WLKA 2QTSA 2HWB3 3QOPA 1YNAA 3N9QA 3PVBB 4ZU7A 4Z2WA 1NY72 1W0PA 1AR63 3L2YA 1C5IA 3VKOA 4K21A 3PVOA 4QJFB 1DK1A 1UX7A 4TV8A 3BPSA 3MPPG 3ZIWA 4OYUA 1W39A 5FY5A 2M7WA 2A73B 3CCEV 3F7VC 1IKQA 1PK6A 4LO4B 2JDZA 3SJBC 1RUI2 3VD3A 1HXS3 2FYUH 4UXNA 3WX5A 2WKKA 3WHTA 3OB8A 1ZX5A 4JZRA 4JI0B 2KKWA 3LSDA 4A6SA 4DR3B 1UY4A 2BVVA 3WQ1A 1CPYA 2QVSB 2ZGPA 4JGYB 4DB5A 4IIJA 2QKCA 1SQFA 1HV1A 3GJBA 4X6QB 4LE4A 1VF7A 2Q8OA 4ZOLA 2ZOEB 1CAXB 4IGGA 3GZAA 5EIBC 2IXIA 4NXMB 2ADEA 4PDRA 1AI7A 4PHZA 3ETGA 2Y64A 3KD4A 1N1SA 3HR0A 5L7OC 3JALA 2FCTA 2Q67A 3KLSA 3AK3A 2XHNA 5BNQA 1WCUA 2R7EB 1VQKV 4MZUA 3HVDA 2DYSB 4GX5A 1KB9F 2ZINA 4I55A 3QH7A 3K3OA 2WNVC 2MEV2 3OM3B 4YW2A 2ITCC 1S1AA 2HKXA 1EM1A 1APNA 1R092 1ZZ8A 4N43A 4COZA 2HEYF 2VU9A 1ZZCA 3I59B 4L97A 2LTNA 3UKVA 4AI2A 1OJHA 4C7UA 3KGZA 2CH7B 4DV3O 3M3IA 4NB5A 1OA4A 4QQPA 1O5UA 4JGYA 4WVWA 1XEQA 1TE1B 4YG6A 4J1XA 2XAHA 1W04A 3OUFA 2VNVA 4FK5C 4ZKTB 2UUAO 4CCLA 3AL6A 2QWRB 2I2SA 3ZFGA 2UYAA 1JFFB 4DR6O 2QWOB 2XHKA 3O1TA 5KXCA 1SFYA 1FX5A 2JDYA 3OOXA 4J9ZB 1GV9A 5FMOL 2R062 1K97A 4KBZA 1COV2 3RQ0A 2JS5A 4YGBA 1Q6IA 3FUOA 1X8MA 5J2UB 2B9ZA 3ILNA 3U4XA 2EJ7A 1SS3A 1DFQA 5BNNA 3VKFC 5E89A 1W03A 3AKPA 1Y9GA 4AHXA 1YTFD 2NMOA 3MI8A 5FY1A 1R6NA 3APQA 5FZOB 5EIBD 3ETPA 3TJTA 5A3LA 5T52A 1RUF3 4FM1A 1IBLB 1T6BX 2VNGA 4PQQA 5KR7A 1F4HA 1JJ2U 1QEXA 2PUSA 5FZBA 5FXZA 2B42B 4Q4V1 1O4ZA 5LP6C 3T30A 1RUE2 4ASUG 3LB9A 1GKBA 4N9HA 2FMYA 4HVOA 1BZKA 4PV1B 5FYBA 4LHLA 3SQOA 2A6WA 4ASMB 3RZMA 3WB1A 5J2UA 2YUEA 4EB6A 3FZ3A 4FZ0A 1Y66A 1VB2A 3ASIA 4PCRA 1EAH1 5B3SC 4Q6GA 4HN1A 5FZAA 2EIMC 1YSCA 1FMD3 1QJX3 1REFA 2B1GA 4LTAA 1YFUA 1I6XA 1FMD2 4Y1XA 1TME2 3WF1A 2BGOA 2F93B 2Y6GA 3HIFA 4JX0A 4XILA 4JYCA 1XMOO 5B1NA 2ZM6O 5FP9A 5KMGB 2BYVE 3SPGA 4FFBA 3DEMA 4GB31 5FNVB 3H8RA 2VQFB 4LF5B 4YVWA 1W90A 2G38A 4LF9O 1MZ5A 2H94A 3ELNA 4CEYC 4AEKA 3SJCC 2A6VA 4CXWA 2A6XA 2ZCWA 2A7AA 4B7KA 4BW5A 5LMNB 1BHBA 3WUCA 1SQVH 1AL22 1NZCA 3TN92 4JV5O 2W87A 2LROA 1SC5B 3T08A 1BMV1 1ZZ6A 3MUZ1 5JOZA 2ADPA 2Y0IA 1S0DA 3ES4A 2AH2A 5JJNB 3L71H 1QNWA 3PNAA 4W4KA 3VDBA 3URFA 2XDVA 4FPYA 3AMPA 1US2A 1I1EA 1XQ8A 1PM9A 4B4QA 1HLCA 4CXXA 1QDCA 4PBPA 3WW2A 3NAPA 4LBJA 3JXSA 4ZXKA 2QQOA 3I2OA 1DP0A 3CC2V 4U7OA 2O8OA 1FXZA 2C4XA 3E6BA 5EYPB 4F6RA 1LOAA 4XVHA 4D69A 3WF0A 5A32A 4DPNA 3V0AB 2Z5WA 4OGQB 3TOJA 1NZ6A 2UXNA 2WAAA 4CDXB 1EV12 4J1WA 4QX2A 5K1XA 1YWKA 2NQYA 3ZBHA 1W6NA 1WA4A 1XMQB 2BNOA 3KKYA 2P6CA 4XTMA 2NNUA 4C8DA 3Q8CA 1CQ9A 1BL8A 1JYTA 1H0BA 4DR7O 1N3PA 4JZGA 1JXNA 4OLLA 2C0ZA 2YXSA 3E97A 1EV11 3POBA 1K45A 3R4DB 2YEVB 4FSJA 4I4TB 4CDXC 5F39A 3LSEA 1MSWD 3LFMA 1KQRA 4CBCA 1COV3 5FP4A 1FXKC 4LF6B 1JVMA 1JHNA 4PDWA 1MS4A 4ZBMA 3FN9A 4GQ7A 1VQPV 2YSUB 2R9AA 1WLDA 3VD4A 2XQXA 1SQGA 5FY4A 2H0VA 2ETNA 4J25A 2BRTA 4IV1A 1J83A 1N1VA 4XOGA 3TEWA 5C3QA 2WS93 2YIDA 1L8DA 5A1AA 3ZFFB 4ES8A 4EN9B 2IZWA 4YVWC 4ZS2A 1DQ2A 3THCA 3O0WA 1CVNA 2VBPA 3IPVB 1JU3A 2XB6C 2QTWB 2VMGA 1STMA 1XNTA 3ZXAC 4G27B 1GOFA 1VMGA 3LDCA 3K57A 2UURA 5B5EZ 1PGSA 3KGLA 1GP5A 2BSKB 4JC1A 2RR13 1MQTA 2P5BA 3AG1C 1PO11 4AVSA 3PN1A 4YGCA 4R8CA 4DRRA 1XSRA 1WA8B 4FXKB 4DY5A 2VXRA 1HN1A 4FT8A 1XRUA 1D2SA 3H9AA 2PHXA 2J1VA 1ZRFA 1OOPB 4TV9B 1OBNA 2G4IA 2VJXA 4IEWA 3WQBA 2WT2A 3KSCA 3ZRVA 5EV7A 4X8AA 1SPPA 4QXHA 2AR6A 1U5YA 4O2AA 1PKXA 2W68A 5ACA1 3SPHA 2GNBA 4MW3A 1C3HA 4KU8A 1WLEA 2C24A 1QJY3 3DF0A 3MHHC 4W6XA 1AR71 3STLC 1CGPA 5FPZA 4E2GA 1W0JG 5D8AA 1SQBH 3CEWA 3VHNA 3VD5A 1KFUL 5JXIA 4IEUA 1FOD2 5JJJB 4H44B 3NKGA 3MV11 3EJKA 4P02B 5FYHA 3QBQA 2JG8A 4JGZB 1XNKA 3ZEDA 1MZ6A 2BWCA 3I2JA 2OIIA 2JDAA 3RYIA 4AQ6A 2P4EA 3NNGA 1DGSA 5LA6A 5G04L 4MTXA 1ZSPA 1OOPA 1GFF2 3TBDA 1PO21 3TWIA 3X2QB 3BN6A 5A3OA 1UNBA 4EN0A 2P22C 4HL0A 1NQJA 4DV0B 2QEXV 3IDEA 1BQ0A 4EWAA 3VDAA 3CLPA 1YFYA 2E32A 3C3VA 4Q4Y3 4B3RB 2DMXA 4X89A 5CA0A 4IV3C 2VL4A 3UCSC 3U11A 5A3NA 3M7AA 4OUEA 4BQ4A 4LOTA 4LBKA 3BB6A 3B02A 1GAXA 1NA1B 5BY5A 3JAKA 5IFPA 1K5SA 4L9BA 2F43G 5KXBA 3OE7G 4ONUA 4CCJA 3H01A 5KHIA 1F51A 3H3LA 3IIAA 1WA8A 1X4TA 1U0AA 1S0GA 4Z82A 1BBT1 3WG7C 2L9LA 1VP7A 3OGGA 1LUWA 1TAEA 2UU9B 4TV9A 2Q4SA 1ZA4A 5CFCA 3PLQA 3MV01 4YW6A 2XLAA 3VZOA 4FAHA 4TUYA 1MS8A 4QPJA 1GRJA 1JR9A 2WN3A 3TB0A 1H9WA 1V6OA 2A79B 3VHPA 2KG7B 1VQLV 5CBHA 3RT3C 5L3GA 1N34O 5E1RA 3OUSA 2ZEXA 4XDPA 1Q81W 3JD0A 5AVPA 4UFMA 1WMFA 4TSVA 1UU6A 2P7TC 3QLQA 4LWSB 3M8AA 4Z1VA 1YTFB 1H8TC 1JCHA 2UWCA 3LCPA 3W20A 1UMHA 1W9WA 3C7EA 1R3LC 1KITA 3VHOA 3B69A 3GCXA 1V6KA 2HEWF 1OUSA 4L99A 3WP3A 1OF3A 4XJAA 2QQVA 4EFEA 2PAKA 1UOBA 4GJYA 1FT9A 3Q9OA 1BZWA 3LSSA 4YHHB 4F4LA 4CEWC 3T2MA 3UESA 2Y69C 2Z4FA 3ROUA 5JH7A 2JKXA 2W5FA 1CWPA 5GTHZ 1JOPA 4FLXA 3AL5A 2K2SA 4UFKA 4ASLA 2WZR3 1ULDA 2VOWA 3SKJE 2R9IA 3IWZA 3E8GA 4P9JA 1LGBA 1AR82 4AI3A 5FDBA 2DE0X 3OEHG 3LZZA 1BVVA 1D5NA 1VRBA 2PQQA 1PVC1 4GKKO 4FQZA 5H9RA 1ZTEA 1K92A 1V70A 2C5DA 4PJ0Z 1N36B 3N35A 3VV1A 2YDEA 3J81N 2D3SA 3CO2A 3DV8A 1QJU3 3H1YA 2ZGOA 4ITCA 3UQ8A 2FDFA 2XOMA 3K77A 4CPBD 1W0OA 4NTXA 1R1A1 3OUHA 4K20A 5M0TA 4LFCO 3BPZA 1HRI2 2X53S 5BR8B 2A1XA 2GNMA 2Q73A 1VQOV 1S5JA 4WBNB 4NIIA 3ZXEA 4QD2A 2R70A 3KQ4B 1XNCA 3G6JB 5HCHA 1Y9QA 2RNBA 4P9OA 5FK8A 1E1QG 4UV8A 1R1A2 3AKRA 1LEDA 4K9SA 2CY6A 1O9GA 4RQPC 2ORZA 3ZFEA 1DQ6A 3THPA 1UZWA 5KLVH 4JASA 3FUQA 2JDHA 4XZUG 1W9YA 2HWC3 4Q1PA 3PVEA 1FKAO 3H0OA 1DCSA 1GM9A 2YIBD 2YB7A 4CE8A 4NO4A 4LUMA 1FXKB 4OCTA 4JRAA 3PTRB 2WABA 1K5MC 4IGPA 2FD8A 3E35A 3NMBA 3F7YC 3EQEA 4DO0A 1HRI1 4IEXA 1UMZA 4KNCA 1XBLA 1RSOB 3ZXFA 4UBGA 4FFHA 4TSFG 4NHXA 3LFIA 4PA3A 2XJSA 3K51A 1IQAA 3FAVB 3JCUZ 2ODMA 3IAPA 2BBAA 4OX9O 2FBEA 5IYZB 3JU9A 4GZ9A 4ZI7A 1NU1H 1Y6XA 1CIWA 1RYYA 3NJYA 2PA7A 4AFBA 1PMIA 4IL7A 1IPJA 2LM3A 2R30A 3OPZA 3ZFFA 1UU4A 4UXAA 5A6XA 4DEVA 2OTJV 2WSSG 4JI4B 5HCBA 5K4LA 1ODNA 3IJ4A 2RVAA 2BV4A 2HFEC 2DJVA 3AKQA 1Q86W 2PHRA 3T4ZA 4HLTA 1KD1W 4B29A 2R6QA 3WG7B 3LAGA 4Y5SA 3OY8A 5A7QA 1MZEA 2WZR1 1PO23 3WP6A 4UFZA 1MEC3 4SBVA 4JDMA 3USUB 3L73H 4RSUA 1UF2C 2D97A 5ANQA 2QGNA 1GM7A 4R9DA 5EJZB 4PDWB 1O7FA 1GWLA 4Z2AA 1BVP1 2DQ0A 4QX7A 3AG1B 2ZE7A 5BXXA 4JI5O 2VZOA 4KP4A 1ZBA1 4AEDC 3VBOC 3VBUB 1XI1A 3C3TA 3T1HB 4BH9A 4IEVA 4C91A 1SBDA 3ATGA 2A5ZA 5C9AA 1KP3A 3VQXA 3L2HA 1Z7S2 2F17A 5JSOA 1BBT2 3ZIXA 4NPMA 4FPJA 3JASA 1YYNA 1YQ6A 5GM0A 2RS11 2O0OA 4JGZA 1CZVA 4NAMA 3E8HA 3MIEA 3N7LA 4Q8KA 4FP2A 4PDMA 3NAPB 4J41A 3F2ZA 1FPN1 3CXHF 4EEQA 2IXHA 1SCRA 2WFF2 2ZS6B 3J7HA 1SLAA 5A32B 3V0AA 1XOUA 4N90A 1G9DA 1R1ZA 3L72H 3RW0A 1Y9MA 1NXD1 2JDKA 2QDRA 2GSMB 4LNUA 2ZA9A 1Y7BA 3PDQA 5L3EA 1GQGA 4PT6A 1ZBE3 3Q8EA 1NYWA 1HR0O 1VR3A 3HBKA 4JHTA 3NAPC 4HMZA 3ZDVA 2WA4A 1LHOA 1PO22 2QQWA 3MBWA 4UF0A 4CUBA 1OVPA 3I3EA 2LUWA 2YC4A 4GH4B 3VZKA 2BOCC 2ZZQA 2PLV1 4Q4Y2 1RUI3 4QQHA 3KVBA 3WB0A 2VMEA 1BXHA 4X1KA 3E22A 1WD3A 1VAMA 3UT0A 4UB8Z 2YMZA 4RFT0 2RS53 4A45A 3BU0A 2YI9A 2Q30A 1DYPA 2WDBA 4LUKA 1C4RA 1W8WA 1MSDA 1TVKA 3PJQA 3IMMA 4LXLA 1HXS2 3W21A 3I2DA 3WXPA 1EN5A 1XE8A 3UJQA 2O8QA 2EX3A 1UN1A 4RQPA 5A3TA 4JAAA 5BY1A 1DQ5A 2D3OW 5CBLA 4FLUA 1SQXH 5IVCA 4LORA 1QBZA 1IQDC 2JDIG 1AJNA 2BW8A 2VPVA 2Z5UA 3IC7A 1JZ7A 5F7UA 1GO3F 3CZJA 4GWJA 2XG3A 2FDKA 4JRLA 3FWEA 4TZDA 1L7RA 3RVYA 3VZNA 5DECA 2VOVA 5AFBA 2OIGA 1WCSA 1XL6A 1CPMA 4XJUA 1XC6A 1CAWB 1REDA 4G28B 2OUJA 4ZZ8A 2Y6FA 5CBFA 5FYIA 2D44A 1RGSA 5JMOA 5T3NA 4IYHA 2ZT9B 5J48A 4IE0A 4QE9A 2R071 4JYYA 1FPOA 5C4WC 5CFDC 3G6BA 3UO2A 4Q4V2 4GX0A 1OQ1A 4FQ4A 1TME1 1ZA7A 4HVRA 1NCRA 5F5IA 1QLEB 4FOQA 3WW3A 3T4HB 3HKDB 3ABZA 3H3ZA 2XJVA 2VC9A 3VBRC 3CJHA 1G4YB 4CH6A 2RJKA 1NCQB 3OG2A 3DYMA 3FLTA 5IWAB 4QNHB 1DQ4A 1RB8G 4IUGA 3BY6A 1Q8QA 4QE7A 4H37A 4OHXA 1G9BA 1RUOA 1TVGA 2VVDA 5A33A 5LY2A 2VE1A 3B01A 4DV2O 4Y22A 2F1MA 2W95A 4URAA 4CUGA 1JZ3A 3BODA 4OZOA 1EUTA 1I0HA 1POV1 1VMFA 1GWKA 1XYOA 3S7IA 5DAQA 4O4HA 2CH7A 1UO9A 1ZZ7A 4U2AA 3OW2U 5LZ6A 5B2GB 1UZZA 4MGTA 4HVQA 1H2MA 1IX9A 2XMLA 4CDXA 4BIZA 4QXKA 4XIOA 5IT9N 1SDDB 2EIKC 5JZGB 4XDOA 5FPBA 4AZZA 1SERA 4EE2A 5F2VO 3MW2A 4DINB 5C3OA 3CYOA 1RJ7A 4GMP1 4BE3A 2FTKA 3VBHB 5DUVA 4X64B 1QNYA 2BNNA 1S5LZ 5LRSA 4K3UA 1N0NA 1W8NA 2VMHA 1NS1A 4X9QA 4I30A 4MV2A 3ZN5A 2VMFA 3LQCA 4DUZO 3RZHA 4PI2A 4RUEA 5FRAA 1BEV2 1BMV2 4LKEA 5LEKA 5L9RA 2MNGA 2L6LA 1BMFG 1OA3A 3A23A 3AMHA 5DN6G 4O4HB 1YI7A 1GBGA 5EIYB 5AC93 5EC1C 1VMHA 1Y4MA 4DV1O 4LBOA 3FB8C 5GONB 5EC2C 3ETDA 1KKCA 1FAYA 3C7GA 5C5UA 4DXZA 3G6EV 3C7FA 3RWNA 3CXCU 2EXHA 4XTPA 5EHDA 2EINC 3D36A 1XNAA 3D0SA 3WNXA 3TEYA 4UCRA 2HWC2 5ANNA 2F6BA 1JJOA 5DZFA 4JAUA 3MO4A 2MEV1 3CD6V 5DG1A 4FTBA 2OS2A 3MF6A 3TN91 3DYOA 3ZKYA 2E7AA 2XKOA 1UMIA 4AFMA 1R083 1DLLA 4BQYA 2FDJA 4RS5C 3CCMV 2XJTA 2IH1C 5FZOA 2HHHB 4DR2O 5JQGA 4G9SB 3RS6A 5LA2A 2OA2A 4D7TA 5C3SA 4Q4X1 4CSWA 2P67A 2DYRC 2QTOA 2HBUA 4OHZA 1AVMA 2AW9A 4R4XA 3VKNA 4BQXA 2DWDC 5FREA 3BU7A 4O61A 4PD4F 1ZYBA 4K8XA 3IFXA 3U0ZA 1QU0A 2P3IA 1JYIA 4XE9A 4HZ3A 5GZDA 2ARXA 4XEZA 2P5OA 4QGNA 4BLJA 3HT1A 4FFKA 3LIGA 5GJ6A 1H6YA 1LOFA 3I97A 3HB3B 2LALA 4K8RB 1WP8A 2YS8A 4NAOA 4CC5A 4JKMA 1IS4A 3EHBB 2VW0A 3B3QE 4HFSA 2VCBA 4IEYA 4LFAB 5B1BB 1GQHA 5JCOC 1N1YA 2GP3A 2ZX4A 1TQ5A 3J7NA 4QQ2A 2Q8EA 2XL9A 4Q27A 1CD3G 3OYWA 1W28A 4GIQA 2D6KA 4UCTA 5FP3A 4MHRA 1B35C 3ABTA 3VBRA 4AEDB 1BBT3 2ATKC 2E33A 5CKQA 1RUNA 4C1WA 3E83A 3RYCA 4FPGA 1SZTA 1ZZBA 4RS5A 2H6CA 2D7FA 1N3QA 3OMIB 4X6RB 3AG7A 2DQ3A 5HI0A 2DCYA 4JQRA 3A0HZ 4HSLA 4CPBA 3RZGA 3KZIZ 2CE4A 4D7YA 2W1SA 3AZXA 2GMEA 2LS6A 3RYHA 4Q4V3 2YPJA 4DZGA 3JCZA 2IFRA 4IV3A 4IHJB 4OPHA 4K35A 4TYSA 3OEEG 2OCCB 2RS12 3BI3A 4WCEV 3RVZA 2JE8A 4O4LB 1XREA 3RNSA 1F4MA 3N27A 5FZDA 1R6TA 1QQP3 5FYYA 1M9NA 2UXDO 3KT7A 5KHGA 4O4IA 4E4HA 2PI4A 5IVFA 2WNVB 2WQ4A 4D94A 1POQA 4QPIB 1OD5A 3DKWA 1K12A 2IC1A 3OTOB 2NZ9A 3A0BZ 3FE5A 2OZ6A 4H3WA 4MXWA 1AR4A 3UKTA 5KAFZ 4E4ZA 4X1YB 4N21A 4DV7O 1ST8A 2UXXA 5F6KA 1RUC3 3NR7A 5FQ0B 1SDWA 4QKFA 1SACA 3E5QA 5LBCA 4LBQD 4N7UA 1W8FA 1YLLA 4AXOA 3T0DA 1JHJA 2GTAA 4QXCA 2WQ8A 2WLIB 3RRDA 1Y4WA 3AYCA 1NCRB 1QQP2 1RVF1 2Q6AA 1WMEA 4PELA 3UGFA 5IWFA 3FFZA 3HKBB 1RUI1 3QNEA 2VVEA 1OFNA 2G1MA 3A0KA 5HXMA 2Q68A 2GP5A 4WZCA 1SQQH 4X1IB 4EWDA 4NHMA 4X66O 2EINB 4IW3A 4BYYA 5A33B 2VAUA 1DZQA 1AILA 4MGKE 5LOVB 1VF5B 1W0KG 2XAJA 1W05A 3JAWA 1DGWX 5IAVA 4JI0O 4J80A 4PDVA 1YRZA 4Y4RA 1HP8A 4O2BA 1D2QA 1YJLA 1JYCA 1US6A 4NUBA 4AHWA 1RXFA 2K1EA 1C28A 3CRAA 3AZZA 1OC1A 2YFUA 3HKCA 4ZPIA 5EXOA 1JOJA 4NRQA 1B35A 3AMNA 4MTFA 3UJOA 1NTKH 3ZFEC 2YI8A 4JI2O 2Y38A 1HKDA 1S77D 2ZGSA 3OBAA 3UGGA 2IXCA 4OXSA 4KFMA 1D4M2 2X6AA 4Q0SA 2WWSA 2ZGNA 2ZHLA 4CEWA 1C5HA 1PX3A 4I9WA 4MADA 2D5FA 2ZMNA 4X1KB 1IDSA 3ACFA 4C0BA 4QQLA 3C7OA 4GT1A 5KC6A 1PP9H 3ZFEB 3N7KA 1TME3 4QX5A 2NLRA 4GJZA 2WS92 2BWAA 1JX9A 1LODA 1ZL8B 5IW0A 4DV3B 3FHAA 2IUWA 1B09A 2J1TA 3VBFB 4LCUC 2GNDA 1K42A 3FJSA 2JGDA 3M3QA 1B35B 4HANA 2YHJA 5LP6B 3IZOA 2PLV3 2X5IA 3ALQA 4DMIA 4CP0A 1OCCC 1H2GA 3H50A 5HFMA 1FFXB 1M56C 1VQMV 1OXCA 4UAPA 2B8MA 2IVIB 1MACA 2JGUA 5DDJ2 5ITZA 2W2IA 4YG0A 4XYXA 2PELA 4CDQB 5EZYB 3E6DA 3RYPA 1AJOA 4AL9A 4YVSB 1MS0A 3A22A 4ATFA 4LITA 3M99B 2ZX2A 5HFLA 3JASB 5H9PA 2Q1ZB 4KUMA 5GLUA 2FZ1A 4YG3A 2HLDG 3OSDA 1OUXA 2B45X 3CC4V 4YFWA 4HK9A 1D4M3 4QPWA 1G8WA 4AVCA 5IY5B 1IBLO 4W4LA 4WBBA 5FZMA 3T3YA 5DUXA 2VECA 1QU7A 4YVSC 2OWOA 2W6IG 5FYCA 4DQAA 5B66Z 2E51A 4OUSA 1Y74B 5CA0B 3ZRXA 1GMMA 3APBA 3VL9A 3ZJZA 5H6RA 4ES9A 1NUKA 1DGRA 4BCUA 3MFAA 1QHTA 4LO6B 1DGRN 1S2KA 2OPWA 2PF4E 1ZM1A 5C8YB 3HT2A 1BYHA 3WV6A 1AR83 2B7YA 1T5EA 4L2NA 5CB4B 1X50A 5EP9A 3RYIB 4AG4A 5F9TA 3GHMA 3ZRWB 1Y43B 2MEV3 3KS7A 1VBA1 3FAVA 3QH6A 2VR4A 5B1OA 3ZLIA 3PMSA 4LF7O 4LBNA 2ZBJA 4DR6B 2JE7A 5JOXA 4ZI7B 2RS13 4CDQA 4MXVA 3USUA 4EN6B 1DHKB 3H1HH 2QNKA 3UKNA 4YM3A 4ASKA 5JPNB 3RJ2X 1O59A 4E9KA 4BDVB 2JJ2G 4U3FH 5F3GA 2OYZA 4PA9A 1PK6C 4EN8B 4BQ5A 5DPNA 2UXBO 2NP0A 2I45A 1AI5A 4IQPA 1S5HC 3V0BB 4JV5B 5T5LA 4X8NA 4IHJA 5E88A 3RJRA 2XJQA 1QXJA 3WY6A 1BHGA 2ADDA 3MGUA 1S76D 1O9HA 2FDIA 1F35A 3ZMSA 4ZY9A 3TRSB 2YXLA 5FAXA 1KXGA 2RHPA 1JODA 1HB4A 3PMEA 4RGAA 4EQVA 4IXLA 2DUPA 1R093 1QXRA 5LK5A 1RVF3 4UOJA 4O4JB 4GKJO 5B4XA 3JARA 1ASJ1 1NLQA 1NJIW 2J1SA 1LULA 4LFCB 5BR8O 4JZ2A 1QVGU 3AJYA 4RS5B 4PA6A 4CU8A 3LUTB 4V2WA 5L3BA 2QJ1A 4ZHNA 1UY0A 4DEQA 3W58A 5JVDB 2WFF3 5KAIZ 1F7YA 4XF3A 5GLVA 2KD7A 5J2TA 3THDA 5FFOC 2PHLA 4I0WB 5FPOA 4JI6B 4FFIA 2J42A 4FFFA 1GR3A 4LHKA 2V4AA 2VZQA 4Q4X3 2XT9A 2ARBA 4LIVA 1S0JA 1A32A 3O1RA 3AXDA 2QCSB 2VQEO 4Q4X2 1JU4A 3J8F2 1XMOB 1RVF2 2P06A 2VRZA 1V9U1 5LP6A 4ZU4A 4J6GA 2YEVA 1H8TB 5JDBA 1DZTA 1L1FA 2K46A 3RYKA 3ZMTA 5GALA 2GC2A 4BQ1A 1NG0A 1GOGA 3LDRA 4DUWA 4XUOA 2ZR2A 4EV0A 4IE5A 3DTUB 4TWTA 4EB6B 3BFRA 3HQXA 4UCUA 1V54B 3T1YB 5CA1A 5A7SA 3DPRA 4CU9A 1DDLA 2P34A 2DN9A 4Q5OA 3DUIA 2GMMA 4CC6A 3GJAA 3N36A 4LO8A 3CMGA 2VTFA 2LGQA 3AYDA 1OHHG 4LOSA 3ZPOA 3BA8A 4AK3A 5IHRA 3BIEA 1GZ9A 1Z5WA 5CMUA 3MLKA 1M56B 4DUYB 1XU2A 3LWCA 1OD3A 1U5ZA 1VBD1 3VDDA 1ZRIA 5A3MA 3VQWA 1R1A3 2ZX1A 1N32O 1AR91 3C7HA 1CN1A 2JJ1G 4KI5M 3ORJA 1Z2GA 4NPLA 4JKLA 5B3SB 2ZGRA 3EMRA 4M4RA 4CH5A 3CZUA 2UUCO 2RS32 2WNOA 2D98A 3ZVXA 5F3CA 4XBFA 4LBQB 4CP2A 1WCDJ 2VQUA 3DECA 1XMQO 2UYBA 4JI1O 1WLWA 5KX5B 4JI5B 3W7UA 4W50A 1AR73 3WF3A 2XPJA 5JOWA 3JBG2 1Q56A 2BSKA 1PGL1 3S5QA 4QKBA 3JQXA 5JIAA 4YVWB 3DSQA 2CWSA 1IPSA 4XMIA 4KXRA 3V65A 1S0BA 2YBSA 4BHPA 5C8YA 5I8SA 1HRV2 1AYN2 1WMXA 3B4SA 4AQYO 2VG9A 4CS2A 3ZYPA 1POV0 1HX6A 3ENRA 4N53B 2EA7A 4LH6A 4CDWC 3WLUA 1GN6A 1QDOA 1G9AA 4XACA 5FZ8A 4B4RA 2WLLB 4RL7A 1E5SA 2XWBB 4PA7A 3BAAA 4RO2A 2Q8CA 2DBIA 1QR9A 2TNFA 1AL21 2A0LA 1KYOF 3WCRA 1DLCA 1Q7YW 4QX8A 4DXWA 2EXKA 3RI9A 3POEA 1AHSA 4JQTA 2DVBA 3RDIA 3WG3A 3SISA 3ZHVA 4RHV2 4Y1UA 3AZWA 2A3XA 1HR0B 1XYPA 4YJ2B 1DU3D 5FZLA 4JI3B 3VBFC 4JGZC 4PIXA 2BDRA 2V5YA 3JSNA 1NCQA 2W52A 1K5MA 2KR2A 4GAZA 2H0BA 4JV4A 1SG3A 4P5HA 4W65A 2ZEWA 1MR5A 4XC9A 2A70A 2QKAA 5IVVA 4UCSA 1Z5VA 3S5AA 4AEDA 5H2FZ 4FPKA 3MUY1 4XIKA 3SH3A 5HCAA 2DFCA 2PGGA 3AVSA 1UIJA 4HPKB 1I94O 4DO2A 2X5IB 2JEXA 4GZRB 1RUF2 1RPOA 1XILA 3A21A 1RUG3 3FBYA 1NT2B 2DV9A 2EIJC 2ZHKA 1RUH3 2PTMA 4MOAA 4NPRA 2ADQB 4G2KA 3INAA 4R7CA 4U7NA 3IAYA 5LBBA 1SCSA 3IDCB 1SBEA 3ICXA 5ACA3 1YHQV 2RJ2A 3RZJA 2VCMA 4UFHA 3NNJA 4DV6B 3HAGA 1IKPA 4C1XA 1U12A 4MTOA 3JCIA 1VAKA 4YXWG 4JGSA 4TXWA 2E76B 4LF8B 4QX3A 1NTZH 4J11A 3CWBH 4GWIA 1PMHX 1SLIA 2VOXA 1WD4A 3H1KH 3LOIA 3AMQA 4E4EA 2X10A 3T1MA 3MDPA 3SMHA 3D3QA 4A3ZA 2UUAB 4B7EA 1LGNA 1IZ3A 4FAGA 3IDBB 5JQGB 1B06A 3FHIB 3DXRB 4QPGA 2WNUC 4CCDA 5F8PA 2FZ2A 5FPAA 4NHYA 1JYVA 4NJ4A 2P90A 3CDZB 4FI9A 4XDQA 4TN7A 5E16A 4BPZA 2RM22 1KUQA 2ID4A 1RFYA 2V4VA 3OGRA 5C71A 3KVAA 3ABLB 4BW9A 4FPEA 5FY7A 1JMUB 1K33A 4QM8A 1AJPA 3O12A 4ORFA 1MPXA 3NSTA 4Q4Y1 4K6BA 2I74A 1D2DA 1GN4A 2CYFA 2QQUA 1DGLA 5L9VA 1V55C 1OCRC 4MGYE 3AP5A 3H1IH 3KQRA 2W0XA 3B7MA 4MHUA 1EP0A 4XDKA 3FC0A 2EILC 1JFFA 4WZFA 1VBD2 3AG2B 3MAQA 2QQLA 3FKSG 2TBVA 1K5QA 4B3MO 2YG0A 5J3UA 5C33A 3HKBA 4XQ4A 5FO9B 2WNVA 3M3CA 1LOGA 5I0TA 1CAVA 1NOVA 5KC5A 1I3HA 1RMU3 3CMEV 4HKOA 4BR6A 2ZKLA 1PIV3 4M3CA 1X33A 4JDOA 3SC7X 1R6KA 2JS3A 2B1IA 4JYBA 1QJY2 4N43C 3NXSA 2HYKA 4HK8A 4XUTA 2VMDA 4D0QA 4L87A 5A1LA 4MX3A 3AVRA 2Y6HA 5JLVA 1MS3A 2FMDA 3HN1A 1MMMA 1G1XB 2EULA 4H2AA 3SNMA 2ZXWC 5J98B 5CKNA 5FPRA 3I56V 1RUG1 3G7DA 1W6MB 3HNBM 4LPLA 1VQNV 5DAPA 5FPVA 2DWRA 4JI7O 5DN2A 1PM4A 2PXJA 3O1SA 2VQFO 2RR12 4DUVA 3B94A 4F6EA 2PHTA 1UPGA 3GNEA 3AXEA 3N9PA 2OIEA 3PJSK 3ZO0B 4E27A 2GC1A 4QKNA 2AXTZ 3LEMA 5FBZA 4CUCA 4P9LA 3O1VA 3ML0A 3T4VA 1W6QB 2OX0A 2OT7A 4IE6A 2BUKA 5CA3A 2ARAA 1UXXX 2BTQA 5IK8A 4BMEA 1OA2A 5FLHA 2XVLA 5IFTA 1Q8OA 1WAZA 3T0AA 1A34A 3E86A 4LKSA 1FMD1 1EN6A 2Z69A 4YW7A 2CAUA 1QQCA 2QM7A 2VZUA 1GZCA 3CKHA 5LK7B 1N1TA 1ULOA 4FOVA 4IE4A 3RYCB 1W9SA 4K1ZA 2DW4A 3AMMA 5FV3A 2OT5A 1KS4A 1J1TA 3A0RA 2AACA 2DCJA 2G9ZA 1C1LA 3H9VA 4XFBA 2GH8A 1MEC1 1BQPA 2Q5ZA 2X5IC 2BE3A 4YYOA 5JJEB 3FL7A 1RSOA 4HXCA 1KP2A 4MGQA 1RIRA 5BNOB 1UY2A 3L9JT 3VUOA 5L3FA 2X8KA 4C90A 2K9PA 1RHI3 1PNMA 4H33A 4QHZA 1ENXA 3T1HO 1M90W 4JYAO 4JF3A 1MEC2 4D6SA 2B9VA 4H55A 1V6MA 1H38A 4Y4YA 2BZDA 3E89A 4XXPA 3NL1A 2NMNA 3ACLA 2H3OA 4FPLA 1XBFA 3QVNA 4FIPC 3S3WA 1OMIA 1X8EA 3RMYA 5FZGA 5CAZA 4Y20B 3OGCC 4NIDA 3VZLA 3BYWA 5KHKA 2D6LX 4DNYA 4LBMA 3O5SA 4BWAA 4LLOA 1S2EA 4I0XA 2A06H 4FVVA 2Y33A 1WN7A 4IESA 1AR5A 3MD0A 3M7MX 5IYCO 4I2OA 2VZTA 3WOGA 3CP1A 1HIXA 4Z1MG 2P1BA 3A2FA 3SYQA 4DW0A 2QUOA 3LA3A 3ITQA 3J7LA 3UT5B 5FTTC 2YUAA 4Y33A 1Q8VA 4DR1O 4UW4A 2WNUA 1QQP1 1UPSA 2W92A 4D7SA 1TZOA 2B4KA 3M4FA 1V55B 1H2LA 4LA2A 2L35A 4LNUB 5DAVA 1UOGA 3AZYA 3EXUA 3DGTA 3PJYA 3OTOO 1C8M1 4MO3M 2VZPA 4YW5A 4CA9A 3ES1A 4Q4W3 4PI0A 1QJY1 4RHV1 2BOIA 5C9AB 5GLZA 4LJHA 1WWYA 4P9PA 2QQNA 1NA1C 4XCAA 4J10A 1HQNA 3OUJA 2QDNA 5I93A 1WLCA 2BEOA 5T5OA 3WQ7A 2QWQB 3VBHA 4XAEA 2LO1A 1M06G 1ULCA 3GXUA 3CJHB 4JCKA 5JUVA 1RUE3 1OFSA 3AC0A 3RN4A 3JSLA 1PL4A 1DYKA 1KGYA 4GXLA 1QWRA 4UW6A 2X6CA 4Q20A 3AEIA 5D5QA 1HNWO 3MYXA 3VLBB 1AJKA 1FYUA 4GKXA 2V73A 1V6LA 3B8NA 4LULA 4DRXA 3VBSA 3R6SA 1W2BU 1O3RA 2Z79A 3K59A 2C6SA 4ARXA 3K58A 5LWBA 1O5LA 5ISLA 4B3RO 1G6NA 3LIHA 5EBMC 4BXSV 5FP8A 5DQ0A 4BU2A 1LUVA 4FM2A 1VJ2A 4LMFA 2ZGUA 2SBAA 1TUBB 3BIWE 4LK6A 1HRV3 2WO1A 4O65A 1ULFA 5FR3A 4QGMA 1XNRO 2QM8A 3CHXA 5FZIA 1F5FA 2WWUA 4D6TH 2BGPA 4ZS3A 4YRDA 4D3WA 1U97A 1QJFA 4OZXA 1KJRA 3WUDA 4IETA 2FB5A 3N2GA 3JAKB 4UCVA 4XF0A 4AAXA 2ZMKA 4IL6Z 4I7ZB 4QPKA 5KBFA 3GBWA 3GALA 2QQPA 4F7ZA 1TVKB 3VQYA 5LA0A 5A2QN 2EZPA 2ZD9A 3ZX6A 1SA0B 2ILMA 5JR2A 3I3MA 3ABMB 3I4IA 4XJ8A 4XUPA 2BOJA 5JSRA 2F23A 2VD7A 4NIHA 2RS51 2PN5A 3WNLA 2IJIA 4ZIBA 1Q5OA 2CNAA 1W9TA 5A3UA 4R6ZA 4MVUA 1ZRRA 5GZCA 1L7LA 1GNYA 2XUMA 3SXWA 1KJLA 2HBTA 4KWLA 4LK7A 4YJ2A 2E7QA 2R072 4YGDA 5IAXA 5LYJB 2CSGA 1HV0A 2EILB 1MG1A 1M57C 1LEMA 3HKEB 4QB2A 3AYEA 4RGGA 5H9SA 5LMUB 4ABMA 2XBO3 3N9MA 3ILRA 3PHMA 1V9U2 1DTOA 5JOYA 2D2CB 5FCCA 1YJNV 5DXDA 4H7MA 4BLIA 1DGWA 1IURA 5FZKA 3BTAA 1ZX3A 2I07B 2JD4A 2N74A 3FX7A 4JVAA 2J1UA 1OV9A 3T1LA 4YY3O 2UY9A 1PV0A 1V9PA 2LGWA 4X65B 1ENQA 1PNGA 1UYXA 1YXWA 4I50A 1ND3A 3TEXA 1HN0A 3SPIA 3O1OA 4JAVA 4OHYA 2RN9A 3J80N 4MGZE 4UI9L 2VMCA 2A7WA 4PF1A 3APOA 1WA6X 5C8CB 3U1XA 3HOBA 1RUH1 3MFCA 4BA6A 5FYSA 4TQDA 3WG2A 3WW1A 3QACA 1AZDA 1IS3A 4GKKB 3ZHUA 2LW1A 5LXTA 4TQFA 3GGLA 2WWWA 4IT5A 3K0DA 1BGYH 2Y6JA 4F3JA 3P1IA 3PUHA 5FY8A 3O0XA 3BRCA 1PIV2 5BNPC 1HQWA 1ND3C 2Q1MA 5FPLA 4OPAA 2JEMA 1VBE1 4EZ4A 4ARYA 5DABA 1ONAA 3O7OA 1UZ0A 1YC61 4AFCA 3U07A 4LBQA 3AP4A 1ND2B 2G9FA 3KWVA 2CUGA 1UYPA 2R16A 4LWSA 4CTEA 1ZLZA 1NT0A 1ROPA 5A3WA 1EYBA 4FLWA 4CCNA 1IXMA 4LA3A 1NQTA 4XFGA 5CFCC 1ZUQA 2ZNIA 3H8XA 4XF4A 5F2SA 2HVKC 3LSQA 3WG4A 2Q7GA 3R4SA 4OHWA 5K1PA 3RYFA 1UAIA 1WW7A 1JBCA 4SLIA 4HOOA 5LASA 4CEYB 1NA1A 5FZ3A 2GC0A 5IYYA 2IU0A 2QQKA 1WKYA 3WG1A 1MOFA 3OTFA 1F5JA 3SKVA 2PHUA 5JVVA 1QLEC 5LHIA 5SV8A 3VDDC 5CFCB 1HRI3 2LJ2A 2R042 1QH7A 3ZHRA 1H4GA 4NIGA 4WM8A 1UOFA 1P49A 3SR2C 3NV1A 4NRPA 2E75B 4O4LA 5KUKA 5FKBA 4WV8A 3O65A 1PHMA 4GX1A 1IBMB 3OGIB 2BTVC 5FLJA 4LBEC 3CEIA 1A8DA 5FO8B 3MZHA 2CTWA 1LB2A 1VF6C 5IDJA 4RQEA 3DCQA 3MICA 3K04A 4ATEA 4B1LA 1HWYA 1YDXA 4Q4W2 4XJWA 5JVDA 3JUUA 2LFSA 2HHHO 3H42B 3JD71 1VLNA 1NR7A 1EAH3 1GP6A 1ACCA 4J42A 2XGXA 1YJKA 1OQDA 4O7XA 1AVBA 1HQLA 3RI8A 3QO8A 2WUHA 3T09A 4ZZ5A 4QB6A 1YI2V 2UWBA 3WSOA 1W2NA 4XZPA 4GKJB 3ASOC 3IBMA 1YIPA 3POWA 2ZACA 4OFGA 4OQ9A 2J1RA 1TMF2 1O6UA 2W9XA 1DQ0A 1Y3TA 3GZEA 4WVVA 5EZYA 3SGIA 3SYPA 5CKMA 1W3XA 4EKWA 5LYJA 1MNGA 5J2TB 3MIGA 3ZHTA 1WZXA 3IMNA 4MTGA 1KEXA 5EBWC 3J26N 5FBJA 2PYJA 4X62O 3PU8A 4LEJA 3TETA 5J09A 1PD3A 2VQ0A 2B46X 3M8LA 1I9RA 4DK0A 2Y60A 2PAMA 4KGGA 3WHUA 1RUC1 1VARA 1OHFA 2Y4TA 2VNRA 5T5PA 1GNZA 5EYXA 1OQEA 4QM9A 1H8TA 4UYBA 2VCAA 3W5MA 1I5ZA 1AX2A 3KV5A 2EIDA 3CNAA 5JMCA 4QMAA 2WRAA 4LFBO 5FZFA 1LTEA 1UZVA 4HZFA 4NWVA 4PDLA 4AFAA 3HR9A 5LHGA 5I0RA 3KB5A 2XR4A 2PLV2 1CJPA 3U75A 2FL4A 1RUD3 1R1BA 3T1YO 2CTVA 4UV9A 1XOYA 1GP4A 1ZBA3 2Y0PA 4QX1A 1UXZA 2X7RB 2GU9A 3ZXKA 4TLGA 4B3NA 3JAWB 2X09A 2A71A 4B08A 2HWB1 4JHZA 4FOWA 1G9FA 3ZXLA 1H1MA 3TNQA 2YIBA 4Y3OA 2GN7A 2XLFA 1BE3H 4IEZA 3OJBA 1L0LH 1P4RA 1OF4A 1G9CA 4CDWB 3JD3A 1XNBA 4MGIE 4RUFA 3ZSJA 4IERA 2W91A 5SV5A 1SETA 4COYA 2ZGMA 5CFDA 4NR1A 4R52A 4XDJA 3MIDA 4N23A 1A78A 4RR3C 4F83A 1ZREA 3P32A 1Y74A 1VBE2 3ZFGB 2ZDIC 4LKDA 5LOVA 1FJGB 5IJ9A 4GULA 3WEZA 3TAYA 4XFFA 1EPZA 4OULA 3NNMA 3R66A 1ZBE2 1ENSA 2ZTNA 5FMCA 2A75A 1E5RA 2P3KA 2IJHA 4JPRA 4LF4O 5FJKA 2YBKA 4OHVA 3GB7C 1RUD1 3MDSA 1COWG 3ZSKA 2GC3A 5J7MA 3CRRA 4KH9A 2P2KA 3I2KA 2XVKA 4PLMA 3B93A 3FX3A 2KG7A 5HXVA 1POV3 1CX4A 1IGOA 4Y5Z0 1YJWV 4MXWB 4OI0A 2ITDC 5F2WA 2QWPB 4FTSA 2ZDIA 1LENA 1YFWA 5IJ0A 3VN4A 3NV4A 3Q4HB 1YEWA 3PUQA 5C8CC 3SLIA 5FO7B 1OCZC 3U4SA 1BS3A 3JYCA 4NN0A 3WDUA 1B6QA 2QKDA 4RQFA 2FMLA 1E1RG 4X88A 3A7QA 5IWAO 3DN7A 1RMU2 2CDOA 5D8AB 4DXRA 1QR8A 5DM6V 2WNUB 3WINE 1S0CA 1UWWA 3HD8B 1F2NA 2GH2A 4O9GA 4DXSA 1VBB2 2YV8A 2B5UA 1YIJV 4WM8C 2JENA 3NO8A 5IATA 3CJIB 3P3PA 2YYOA 1K3EA 1F8VA 2UXCB 2BNMA 3K5NA 1XL4A 1J59A 3K4AA 2JG8C 2Y0OA 3JALB 4JI2B 1I94B 5FYVA 4YM0A 2QQJA 5CNAA 3ST7A 1RP3B 3POIA 2E5LO 5B1BC 2JDUA 2HWD2 1VBE3 2IVJA 2JJ6A 1NXMA 4KG0A 1RM1B 2KSDA 3NJZA 1D0HA 5ITZB 2ZQMA 3HMYA 4Y24A 4R8HA 4Q26A 2IJJA 4XFAA 4CYDA 2JIGA 5JI9A 2BTQB 1UW8A 1QKQA 2Z42A 2PFWA 3B9IA 2IFWA 3ZIAG 4DV6O 2WT1A 2HYXA 1UFIA 2ZEYA 1TA8A 2VS0A 5BUVA 4PIYA 2SLIA 1XXNA 3WNPA 3WT3A 4AW7A 1FOD3 4RFRB 4CH4A 2UUBO 2FCVA 4U36A 4K8ZA 1ULGA 4YPJA 1YQ2A 5CADA 1WW4A 5AFEA 3KV9A 2QBXA 2B9UA 1NKDA 2Q8VA 1H8EG 3AG3B 5FPUA 3H1MA 4JTAB 3T2TA 1O91A 4Y1VA 3HBZA 1XHXA 4P00B 4R9AA 4I09A 3PURA 4UT5A 4UFJA 2XH6A 4XXAA 4A3XA 1LAJA 2KA3A 1S0IA 5C70A 4AQ2A 2UXBB 2AUYA 2YBPA 3Q8BA 4MYEA 4MT8A 3AG3C 2WSVA 2JIZG 3N7JA 2HLEA 4Z07A 3IPVA 3OBRA 1H2SB 3I59A 2RJZA 1CAUB 3QCWA 1WGPA 1S55A 4WF9V 2EVXA 1WBFA 3SCHA 3CJIC 1PVC2 2R1BA 3UL2A 1WPBA 1JZ5A 5IJRA 3W7XA 4UVAA 2RR11 1NVPB 4EZHA 3GWOA 3OMAB 2FKXA 4KL1A 3I2IA 3THTA 2CV6A 4B3MB 1JZ8A 2CHHA 2MPFA 4Q4W1 2OQ7A 2AREA 3WNOA 1GSLA 1X82A 2GSYA 1YHFA 2YIAA 1YQCA 2HWE2 5APAA 3BTXA 4P9YA 1EBOA 2JDPA 2EIBA 5EZWA 4K0KO 5CYYA 3WDWA 5J37A 5C8WA 1WW6A 5FXXA 3UK9A 2EICA 3OBZA 4AE2A 3EXAA 4YW4A 1S0VA 5I0UA 1QF3A 2VULA 3W7SA 5A3PA 2ZE8A 3UNPA 1OCOB 3OF1A 3K08A 2EJRA 1OURA 2HWF1 3O9OA 1VBC1 3VBFA 2R0FA 1J3PA 3H1WA 2W46A 4DV4B 1U5XA 1HRV1 3B40A 2J1EA 3FMGA 3BALA 3E6CC 3HNMA 3IT8A 2GMPA 4CRQA 3Q8FA 1A8MA 2BPA2 3QO7A 2YFZA 1WP7A 1GMGA 1EUUA 4MUVA 5A70A 4MG2A 1EY2A 4LP8A 1RL3A 4R9CA 1K7DA 2OCCC 1PM7A 2IXKA 2O57A 2D6MA 3JB4C 1X36A 4CP9A 3EVKA 5C4WA 3S0MA 1PO13 1NQDA 1GZWA 3UKMA 3N2KB 5D21A 2EIGA 1N33B 4AQSA 2QDOA 2AZ0A 5A7WB 4O4IB 2ZPXA 2A3QA 1W6OB 3EFFK 1LESA 3JATA 2NLJC 4CVUA 5JXHA 1AI6A 4XBQA 5F5QA 4S2FA 2UWAA 3PIGA 1J95A 2R32A 5EK0A 5CISA 2XAGA 1I5YA 2CTPA 3BCCH 1XPWA 5C3RA 4TV8B 2RE9A 1JW6A 1K73W 2DOSA 5FL7G 1I7FA 1W8OA 2UUCB 2WLNA 3VKMA 3K48A 2YZ4A 4DXTA 5FY9A 1Y76A 4PQ9A 2RG4A 1ZRCA 1RUC2 3NV2A 2IWGB 1NX9A 1LNQA 3KG2A 4NXNB 2A3YA 2XOKG 2W1WA 3SCFA 3S7EA 3PVNA 3RZKA 4PBOA 1AF9A 3WW4A 2Q7EA 4E4DX 3LEGA 1JZ4A 3NQHA 3ZSLA 3E22B 1LOEA 4UF0B 3LNNA 4HKLA 1PX4A 2A3WA 4GB33 3RMXA 2D5HA 4GWMA 4RR3B 3ZOIA 3NRUA 5A7WA 2C26A 2VM9A 3CJIA 3S3XA 2RMU2 3RVHA 3SH5A 3L9DA 3FHQA 2RV9A 1XNQO 4IEPA 1EPWA 2P6JA 4FLVA 2WLJA 4PIZA 5IK7A 3A8TA 2NM1A 1E5IA 2N04A 1JYXA 2YC0A 3L70H 1LNSA 4HETA 5BNNC 1OLMA 3E8BA 1QY4A 1W6MA 5A7OA 2HR3A 2QSAA 3H8OA 4DR5O 2JB8A 1MS1A 1W8ZA 3CRCA 1Q8PA 5FZ9A 2HWC1 4PLOA 3LDKA 4K8FA 3K5LA 3ZN0A 4MS2A 1BK0A 1RUJ1 2IXJA 4NTWA 1OKOA 4COUA 2XNDG 1W59A 1P7BA 4BISA 1PNLA 4L92A 4QU1A 2EXIA 5FYUA 2OW4A 1OSGA 3MHZA 2JXAA 1AUYA 3SJAC 1DF4A 1O4YA 4S2GA 1EZVH 1NI8A 4AVAA 2VZRA 3ZKUA 2VOTA 1BK1A 1F4AA 2NPIA 4QPIA 2VNOA 2Z2SB 1AR93 1C8M3 2RDSA 1CAXA 1BCCH 3HEIA 2D3RA 2R063 2RS31 2YU1A 2DCTA 4LE3A 3K0GA 4WFFA 4CDUC 3SHRA 4DIQA 1SF9A 3CSXA 2HJDA 4QT6A 3K9AA 5FMBA 1RITA 4AGRA 2BGCA 4M00A 3K79A 1LOBA 2DURA 5IK5A 4MVZA 3RYHB 5ABJA 1SLTA 2MK3A 5LB6A 1UYZA 5H6QA 5BMVB 4AVBA 4P2ZA 1JZ2A 1NBMG 5EBLC 3N4MA 5FOJB 3SPJA 1ND2C 1VP6A 2EAKA 1D0GA 1R3JC 2WYFA 2VW1A 3LA2A 2DUOA 3RWKX 5BXZA 1SZBA 1JOYA 4FPFA 4QQOA 3N3HA 3LDDA 2P6HA 4XCBA 3VDDB 2A6ZA 2WSUA 1J5EB 5EWSA 3BTYA 4XQDA 4KBBA 3VBRB 3QO5A 3H1LH 3SCGA 3I55V 4CCCA 5A6ZA 4YWAA 4UFLA 2BTOA 2VTXJ 3OYWB 2NN4A 4NMIA 2VZVA 5E79Z 1SLBA 4E8CA 4DR4B 3PTYA 4NHKA 4COVA 1GUIA 3M3OA 1YZBA 4B3TO 4AEMA 4XPVA 2JEUA 2IJKA 4JI3O 2KXLA 1BQZA 1URFA 5J96B 5LATA 4ZU5A 4HNAB 3ABKB 1HJFA 2R49A 2RCVA 2DVDA 2QZ3A 4HG6B 2GUZA 5GZEA 5DMYA 3MIHA 4LIUA 2WNEA 5LA1A 1H6XA 5JR7B 2WN2A 3MIBA 4ISRA 4YZ1A 2E26A 1GH6A 1I5XA 2O1QA 1F15A 4IV1C 4WBNA 1SMVA 5JCTA 4WVZA 1FAFA 3JD1A 3KZ4C 4HPKA 2D40A 1MZFA 2HJFC 2OQ6A 1V6IA 3LE0A 3ZPYA 2PY5A 1ULEA 3ETQA 3ZHQA 4FJCC 3POGA 5KA5A 3NNFA 2VQTA 1IS5A 2E9QA 3HQRA 4V2VA 3B9CA 1S0EA 4AVVA 5GTIZ 4CCKA 3VKLA 1JPXA 3J4UH 1N47A 2H8PC 2ET1A 3K46A 4YIOA 1N4CA 2Z3YA 2VTXA 1OCCB 4LR4A 5T55A 1V54C 4UUJC 4QX0A 1DF5A 3CS5A 1GNHA 5FZ0A 2Q0OC 2YXHA 5LMUO 4FCAA 5AC92 3JBG3 4I3PA 1XHZA 3N2KA 5DZEA 1FATA 2B39A 3KMHA 4O4JA 1E57A 1W6OA 2XAFA 1OCRB 4Z8BA 2XL7A 3I3BA 5KWRA 3UO3A 4H13B 2IW5A 1QCEA 1W8HA 4P30A 3KCYA 1IG0A 2XKPA 3J7MA 2WS91 4JI7B 3CRMA 5EFUA 1VQ4V 1YI9A 1TNFA 4GH4A 1HNXO 2VXJA 2R1DA 3W7WA 2P4VA 3O1PA 3TYJA 4URTA 4CDUA 4JI8B 2XJRA 5FY0A 2GN3A 5FKCA 1QJU1 1W6QA 4UFIA 3ZYRA 1LGCA 3VB9A 4GH4C 4META 1AROP 4GUNA 1R73A 5B1AC 1OCOC 1HNZO 2F4PA 1KDKA 1SESA 1VBB1 3CCLV 3V0BA 2WO7A 5GLTA 3THOA 1NCQC 3FFQA 4HKWA 2RDCA 4XBNA 3ZRSA 3VZMA 1UZYA 4DS0A 2VQAA 1QMJA 3I54A 3OGVA 2OVUA 3ZYFA 1RTVA 2VZ3A 3CE2A 1A3KA 4OI4A 1IHMA 4D6RA 5FXWA 3CCQV 1HDJA 2WIIB 4OMDA 2FCUA 3MW4A 4Q0VA 1VBA2 3ACGA 2HWF2 1C1FA 5A6YA 4BQ2A 4LQRA 1QLNA 5BV6A 3CCVV 3P5BA 5K8SA 5FZ4A 1AXKA 4E2LA 1W2OA 4BMBA 5F37A 3OGJA 2WO3A 2KM2A 3BUCA 3LDBA 4JGYC 3PU3A 4QGPA 5FUIA 4PF5A 4JI6O 2QJVA 3SDLA 4AEJA 1PIV1 3OFNG 4AI1A 1UKGA 2K9ZA 3B00A 2PQSA 4BB3A 3I3QA 4L11A 1YO8A 2C9KA 2HWE1 2H6BA 5CB4A 2RDRA 2YC2A 4FXGB 3F95A 3BKZA 1MABG 3T0BA 2QZ2A 1DYOA 4QDRA 3WP5A 3D0JA 4CXYA 1HW5A 3S30A 4KHPO 3KF3A 1I08A 1HB3A 2HP8A 3FYEB 5JIUA 2OXBA 4B3SB 4KU7A 4NWWA 2ZM6B 1V6JA 3EB7A 1BJQA 5IE9A 4OMCA 5FUNA 2Q5TA 4LLFA 3SH4A 3USSA 1PNFA 3S57A 4LF5O 1K4DC 5CFDB 3A4UA 3J8F1 4B1MA 4Y1ZA 1IBMO 2GAUA 1B04A 3D5OA 1PPJH 1L7QA 5EJ3A 3DPRB 5GZFA 3KHCA 1NLRA 4WM7A 5IT6A 4UVBA 3CF6E 3X2QC 2IH3C 1RHI2 1YJ9V 4KWJA 1OLQA 5F6LB 2WJSA 4A7YA 4CP1A 1WW5A 1CX1A 1JUHA 4YLZA 4UB6Z 5TISZ 4CUAA 3GBFA 2LP7A 1OPMA 5FK7A 1IBKB 1Q6UA 1LHUA 2WYSA 4I0BA 3BEHA 1FXKA 1WNSA 1V6NA 4IGOA 4A2UA 4CS3A 1FPN3 4CDUB 1KRIA 2WQZC 1PVXA 4HN0A 4BQWA 2X05A 3NVCA 1FFXA 5FZ6A 1Q8IA 4JI1B 2C9AA 3K5OA 1VQ6V 2JECA 3W7TA 2GTSA 1G8MA 3VD9A 4JYAB 1HB2A 2HWB2 3G80A 5AVAA 3I8TA 4WFEA 1ASJ3 2QE7G 5HPOA 3NKTA 5FP7A 5LHHA 2AYHA 3GM8A 3CJXA 2PMWB 3VOUA 4UW3A 4DUXA 3HKCB 1FNZA 2J1AA 2XBO2 5DG2A 4MVOA 4RYDA 4QWNA 3ZCCA 4ZHQA 3K06A 2FDHA 3LNMB 5CZKA 1SQPH 3C90A 1NVPD 3B09A 2XHBA 3OD0A 1FXHA 3ASOB 1UJWB 1HNWB 3AZVA 4LFBB 1URXA 1GTOA 1TMF1 2ZKNA 2ZZJA 2PHWA 4EWEA 2AEZA 4NHLA 5BPXA 4UVCA 5BNOC 5B4NA 5A9GA 4MVRA 4WM7B 1Z7S1 3WCSA 1HB1A 3VD7A 1CPNA 4AAPA 1H1AA 4JTOA 4CEWB 5FMDA 3I2FA 2D6NA 5D1IA 3M70A 5F5CA 1LR1A 1VB4A 2PZSA 3AKSA 3ZM8A 4LNVA 4CZSA 3ZFFC 1T2XA 4TT3G 1MVEA 4QPYA 1V9U3 3RYFB 1RUF1 3K3NA 1C57A 1AYM1 2WLLA 2WA3A 3WNNA 4QB1A 1GM8A 4MVQA 4LBLA 2QQIA 4QDQA 1RUD2 1WPXA 5FWJA 4DV5B 4I5SA 1LU2A 5I91A 2IM9A 1XUQA 5DUUA 2W3JA 1C8M2 3KHBA 2RQ6A 5L3CA 1RUG2 2NR5A 5EYPA 3ZXJA 4CEYA 5LBQA 3GHNA 1NLSA 4PDWC 4QGLA 2Y8KA 1TUEB 3UYJA 4AHCA 1ULPA 2Q1FA 1W9FA 4CH3A 3N9OA 1LHNA 3A0NA 2XXZA 4Q8LA 5IYBO 1ND2A 3IAQA 1P8JA 3LD8A 5CG9A 5IJ9B 2EIKB 4YW3A 1VBD3 2RM23 2RDQA 3IDAA 3RSJA 3AG4B 1S3JA 4LC1A 1UD1A 2W1UA 4IV1B 3O0VA 4XMAA 4LF4B 1QIQA 3MLJA 3VBHC 1DLBA 5A80A 2AHZA 3PUSA 3C8XA 3WF2A 2WLQA 5F1RA 4LF8O 1K3IA 1RM1C 1FV2A 1S2BA 3I7DA 3NWKA 1H8VA 2XWJB 3DKQA 1J3RA 2WAOA 1OLME 2CTQA 5FXVA 2ZXQA 2RM21 2VMIA 1R081 4OI1A 1TEIA 3LEKA 4TWKA 1UYYA 4B4PA 5LGTA 5FZCA 3CCRV 3KCXA 3L74H 1SFPA 1VRH2 1FS0G 1SQ4A 4YY3B 1RINA 4S2HA 2WINB 4FPOB 3MEPA 1TNRA 2LRPA 3EYPA 5F3IA 3BGAA 1PGW2 1K5JA 5JXJA 4LH7A 4XDLA 1QH6A 3ECQA 3RYRA 1GN2A 4H7LA 1LOCA 2JG9C 1IG3A 3MHSC 4DR3O 4IE7A 3VL8A 5BYNA 4AHZA 3AP6A 3D82A 4E2QA 3R65A 4AI8A 3WU2Z 2DU1A 4Q1RA 1ZL8A 5CVRA 3O1MA 3JARB 3KV4A 4BAYA 1LOFC 2UU9O 2UXCO 3E5UA 1AXZA 5IK4A 1P7GA 1XQNA 5CB7A 2W47A 3IGAC 1OH4A 2VCCA 1JTZX 2DTWA 4DW1A 2DFBA 2E5LB 3ZMUA 2CAZC 5JCOA 1D7PM 3DC6A 3P6BA 4NIAA 4ET7A 1N34B 1JZ6A 4M4PA 1TMF3 1Q6HA 2E3CA 2Y48A 4XFCA 4COWA 2VBDA 2O14A 2VH9A 1Q3EA 4YW1A 3FB7C 4BWOA 5FMOS 4KWUA 3OUIA 4D8MA 2ZGKA 1THZA 1OOPC 4LO7A 2BVBA 2AZ2A 1O3QA 1BLZA 4G4FA 3WVJA 2HH9A 1LU1A 4AGGA 4YZ5A 1NTMH 1GK9A 2X0LA 3V64A 2FHRA 3ZYGA 5C5TA 4O2BB 1VBC3 4P9WA 3N2GB 4U3JB 1AR61 1W2AX 4K40A 3FBMA 3BTZA 1KU9A 1VE0A 1XE0A 4E4SA 2CWMA 3LOBA 1K4CC 2WZPP 3SJQC 1TGOA 2WZEA 1CAWA 3J8F3 3N9LA 2E6VA 3LDEA 1QJZA 4MSWC 3W9AA 4BK5A 1BKZA 2GZWA 1CEZA 1SA0A 3I3DA 1AJQA 3IM0A 1BCXA 1Z78A 1AB3A 2PYTA 3BABA 4YZ3A 2ZX3A 5LCWL 1UOJA 1W06A 3QG5A 1TUBA 4QIWF 4JTDB 5BNNB 2AENA 3D3AA 1XNDA 3LA7A 5T50A 2WLMA 2WLHA 4KWKA 2BQPA 5LBFA 1AYN1 4DRXB 3VBSB 1JUIA 5J36A 5EQUA 1N36O 4Q2FA 1UPIA 3OPWA 2ZEZA 1ENVA 1LKNA 4XAAA 1ALYA 5L73A 1KMIZ 1MVQA 2XQRA 3T4DA 3J7AU 3M1HA 1QJX2 2BJSA 5FLIA 3LPFA 2DVFA 5EJ1B 5F3EA 3E2EA 5FPXA 2VZSA 5FZ1A 3CCSV 1CJDA 3B8MA 1A6CA 2OYQA 2WPDG 1MS9A 3VBSC 5JZGC 3U37A 4CU6A 5ABJB 2ZGTA 1Q90D 4BM8A 3RGBA 1N3OA 2Q8DA 2Z0AA 2JB4A 3J9SA 3LEIA 4MGSA 1Q82W 4M3CF 4CCEA 1WBLA 1YQ8A 3OR7C 3UM7A 1QOOA 4YSFA 2CK3G 4NE9A 3GCWA 3AFKA 2QWNB 3VBBA 3WNKA 3FLPA 5GW7A 4WFHA 4GLXA 2VUAA 1UKRA 2JWPA 3M2MA 3HKEA 1OVSA 3CIHA 2HEPA 2R073 5KMGA 1KQSU 1KDMA 2VUDA 4I4TA 1OKQA 3AP9A 1MQTC 3VBUC 4MH0E 3CMAV 4YIPA 2E63A 3T2OA 4LF6O 5K7PA 1FV3A 3FLRA 4LF9B 2ZKOA 1H2KA 5K9YA 4QAWA 4P5YA 1XU1A 3EO6A 1D5AA 3ACIA 4OQ8A 4WM7C 1VPHA 1YITV 3R0RA 3OR6C 1C8NA 2IXLA 1PZ8A 2OKXA 5LMNO 4OX9B 3TEZA 4DK1A 3AKTA 1IS6A 1JS9A 5E8AA 1V00A 3MIFA 1K9MW 2GALA 2DTYA 2B5HA 4LT5A 3VHRA 1MS5A 4H0LB 3TGUH 3P3NA 3UV9A 5BMVA 3ILFA 4XFIA 4IEOA 1N33O 3HWJA 2OTLV 4DR1B 3UT5A 2YPDA 3RBZA 4N7IA 1DIWA 5E1AC 2JD9A 4DOUA 3KV6A 4IIJB 4MW8A 4FLTA 3ZYJB 3GWKC 4D6QA 2CTRA 1FYJA 5C9AC 4N8MA 1H30A 3CL1A 2VBBA 4OVEA 3E8FA 1W2TA 3H1JH 3G71V 4M01A 1FJGO 3HJRA 1US3A 4CS4A 3ZHSA 4X62B 1EV13 4NXNO 4X20A 3GF6A 2RMU3 1J58A 3JD2A 5DDJ3 1SFNA 4XF1A 1AR62 2GBOA 1W6PA 4RR3A 1MA1A 2MHFA 3CCJV 4X20B 3KM5A 3CQOA 1RPRA 2GDFA 1VAVA 4A44A 2GUZB 1CONA 2F4VB 1KC8W 1NE4A 1KECA 2R9RB 1T6GC 5FZ7A 1R3KC 5FYMA 1RUE1 3ASNB 2AHYA 1KD7A 4P9XA 2P4KA 1XNQB 1SEFA 4P08A 1LHWA 3SPCA 2EBOA 4JDNA 2UY8A 2RDNA 2OUHA 2TEPA 1M5IA 3RPQA 1RC6A 2WLPA 1WB8A 1R64A 2ZHMA 4AGVA 4H14A 2PAEA 1W2UA 1LHVA 3Q4HA 5HV0A 1SBFA 2E31A 3KT4A 3POJA 4M0HA 1XNRB 3CBNA 4M3CB 2KB1A 4YZ2A 4HYOA 3WDXA 3ZN1A 1EFRG 3VBOB 5LA9A 4GYCB 2ETEA 5CN0A 4GCZA 5FUPA 1J3QA 3S6PA 1PGL2 2G19A 1PNKA 4AILC 2R043 1VQ5V 2JK5C 1PGW1 4KQ7A 3RZZA 4YNIA 2ZGQA 5FJHA 3I49A 4F6RB 2Y6LA 1QOSA 3F5WC 1IPKA 1WCQA 3GBGA 4QHBA 2EIMB 4INDA 5CG8A 1LRHA 4NXMO 3WB2A 3NJVA 3ZXGA 2YROA 4XFHA 1K34A 1NH2B 4I0XB 4MVMA 2PHDA 3I2HA 2LW7A 5GONA 4BQ3A 4QKDA 2N05A 5CA6A 4L8QA 1CESA 5ABJC 5D8AC 2XJUA 3GYDA 3VBOA 3ABKC 3K4ZA 3WR0A 2E74B 2HVJC 4BIUA 2DVGA 4I0AA 3PUIA 5FZEA 3JAMN 1VIBA 4WFAV 1ENRA 2WBKA 4UW5A 1W8UA 3CCUV 1PVC3 2ZJCA 2ZR3A 2VY0A 1XJAA 4PJYA 1AYM3 1JH5A 1DG6A 3ASNC 2XUEA 1RUH2 1GWMA 5C93A 1BEV3 2OZJA 3WD5A 1AYM2 3T1CA 1PZ9A 5FZHA 4A4AA 1B3QA 4V1PA 1GOHA 1OCZB 1GZTA 3JZVA 2UUBB 5BNPA 1AP6A 1DBNA 4P9GA 1SHWB 4J7ZA 4DV0O 1YIFA 4X65O 2VWKA 1BHAA 3K4DA 1CXZB 4RHV3 4B3TB 1CR7A 4OI2A 5CBGA 4QDSA 4AFDA 1E79G 2V1DA 2XTAA 5A7NA 1PK6B 4EJRA 5LW9A 1JN2P 3ZN4A 1QJEA 2HKOA 4CCMA 5KX5A 3CRQA 4S2DA 4HSJA 4MSVA 5L19A 3ABMC 5KA6A 3DYPA 3SITA 5DDJ1 1SRYA 4XHXA 1XSQA 1YF2A 4CDWA 1UY3A 3AK2A 5F5AA 5HBAA 4FZ1A 4U3JA 1QGLA 4Y26A 2K0GA 3B77A 3DPRC 3K03A 3ZX7A 4DFSA 3G4SV 2WL1A 4M3CE 4XURA 2F95B 4DV2B 1XDCA 1O4TA 4XBLA 1PL0A 3MW3A 5C3PA 4YJ3A 3DXRA 5T54A 3TXSA 2DCKA 3FD9A 4ISQA 3WDTA 1Y76B 1FNYA 2WWJA 4XUNA 4Z92B 4NYKA 2GHYA 4YJ3B 4QPGC 5FWEA 5IVEA 1NR1A 1Z0HA 2VO5A 3H8UA 5KXEA 2JIJA 3GVMA 2DWEC 3RZLA 4BIOA 2HWD1 1RJ8A 1NY71 1X9TA 2EF6A 4HT1T 4AI0A 1UCXA 3OAAG 5IYZA 4AYUA 3LKJA 4RWUA 4JTNA 1OZ0A 4K0KB 4X64O 4FOYA 5AC91 5BZBA 2BU9A 3ZSEA 3D6EA 2QR4A 4FPPA 3ZXDA 1FI2A 5LGUA 4YHHO 4DUZB 4Q0PA 3IN9A 3SYOA 4CP9B 4GALA 4FVMA 2ZABA 3BOWA 2WFF1 3NW4A 1FPN2 2MW2B 1FXVA 3KT1A 1AR1B 2ZIMA 2VGDA 1O8SA 1RHI1 1M93A 2E53A 2F66C 1GKFA 1VALA 5BNPB 4ZKIA 4FLYA 1H4HA 2NYYA 3VDCA 1G7YA 5H9QA 1TG7A 2Y6KA 4JI8O 2ET7A 5IUQA 3WZ1A 4RQPB 5FIXA 2VZ1A 1AR81 4PA4A 5LY1A 2J22A 3T2QA 3K5MA 2EAAA 5J9PC 1LR5A 3TCUA 1GZWB 3G67A 1RMU1 3ZN6B 3JD72 4K7JA 2V09A 3VBUA 5C4WB 2EALA 5JH7B 2DU0A 4A41A 3POFA 4JI4O 3JD73 1WCKA 1NE6A 4FLZA 5KXDA 1PZ7A 1Y67A 4RD7A 5I0SA 2WFPA 4IGQA 3W5NA 1M57B 5LEJA 2JKBA 2Y4UA 3O14A 4DRVA 2EIJB 3ZMNA 3M3EA 4EROA 2ZAHA 1ODMA 3AFGA 2DYRB 4R50A 4I02A 3H7YA 5FOBB 2JE9A 3SYAA 4MLOA 2P17A 2D93A 2XONA 5T5JA 3ZMOA 3AK0A 3BOPA 4DR7B 2ZE5A 5HCFA 5C6CA 5K0UB 4NOTA 1CAUA 4XABA 3W59A 2WAMA 5G05L 4K1YA 4HONA 3ZRWA 1CP9A 4EFBA 4NRMA 3ZYHA 3HN3A 4GMP3 4XJZA 4WVMA 5LGNA 1VBB3 1VQ9V 4JKKA 1K8AW 1YFXA 3B2EE 3BHPA 2BFUS 5D2AA 2G9GA 1AP5A 4BIFA 4I3GA 4AHYA 3AB0A 3AK1A 3FB5C 4I50B 1E5HA 1D4VB 1VF6A 1ND3B 1ZZ9A 5FLXN 3WDYA 2HEVF 3ZN6A 4FTEA 5A1FA 4ICGA 3H3UA 2JG8B 4CDQC 2YXYA 1REEA 4RN5A 1GU3A 2IBZH 3SYCA 1W3VA 2Q9LA 4ZONA 2XBO1 4XETA 2ZCEA 3STZC 3DXUA 1FOD1 5DAXA 2JGDB 3ACHA 3MF9A 2AGAA 1QNMA 1XB9A 4W6YA 1SKVA 2KQXA 2WC2A 2Y34A 2VOKA 3R4UA 1K5MB 5A7PA 4XHBA 2BOBC 3WFVA 2ZNJA 3MLLA 4YGEA 1JYNA 2JRIA 1NCRC 2JG9B 1RUJ2 2YGLA 2R72A 3AJZA 1OI6A 3E5XA 3K75B 3X29B 3U14A 5ACA2 1XYNA 5FYZA 2D6PA 3T2PA 5I8YA 4WFBV 3C2UA 3PIJA 1WMDA 1DF0A 3HPLC 1AI4A 2ARHA 4QPIC 3NV3A 4Y1YA 1GN3A 1AL23 3CB2A 3WF4A 4UBHA 3IC9A 4BZ4A 2C2AA 2W94A 1YUDA 3OCPA 4RA0A 5L7OA 3CPWU 3CC7V 1AR72 1SPPB 1UY1A 3OGSA 1QOTA 3AP7A 3RG0A 1KFXL 4ZXEA 4R4ZA 3AG4C 5LA6B 4W4ZA 4PLNA 1J5EO 1RUJ3 1H8HG 1VMJA 1GLHA 3E1F1 2JG9A 5A6QA 4GKYA 2P37A 1X59A 3D3IA 4J7JA 2QM4A 2E7TA 1Q8SA 5KHJA 3WNMA 5IJ0B 4CZZA 4DR4O 2EIEA 4E8DA 4J9YB 2EXJA 4NROA 3K3WA 3ABUA 4AR2A 4YM1A 3TK1A 1M4UA 5JSPA 4WM8B 1ORQC 3I5DA 4X1IA 1BEV1 4G3YC 1W8TA 3EHKA 1VEWA 1QVFU 1J1LA 2AC1A 1YXBA 3ZFGC 4FMTA 3ZDSA 3WP4A 5J1XA 1GYKA 1YVWA 1SLCA 1R3IC 1CIYA 3JB8A 1BSMA 1O8PA 4Q0QA 4N53A 2CU5A 1JA8A 4DV5O 4R9BA 5FQ0A 4XW3A 4CCOA 4GWNA 4OUMA 2DYSC 5DZGA 4AOCA 1AYN3 1ZVFA 2GDSA 1AXYA 1ASJ2 1ZBE1 4FO9A 2BERA 4RGKA 4BOWA 3ZSMA 3ZS8C 5LBEA 2YGMA 4BK4A 4FFGA 3ZMZA 5CA1B 2XJPA 4Y5TA 2CAVA 2YICA 1O3SA 1IXBA 2DBNA 2CGOA 2VVFA 2W39A 1V0AA 1P84F 1FFTB 1QJU2 2W6JG 2ZIOA 1FD9A 2RS33 2R061 4WFGA 3KCCA 3PUAA 2W1QA 1N8RW 5B1AB 1EZJA 2VUJA 3DXTA 1AR92 1HJGA 3JQWA 1ZWIC 5JXGA 2M6YA 1Z7S3 1HDKA 3JBG1 3BCWA 4IDZA 4LO5B 2JICA 1RXGA 1QJX1 3BVOA 1AL0G 4NKGB 3OY8B 2ZXWB 4FPCA 1WJZA 5ERLA 5CU1A 3K2OA 5IYDO 3NNLA 2ES3A 2ZMLA 4DYLA 2OPKA 1S4CA 1VQ8V 3LSUA 1UIKA 5E6HA 4EN7B 2PYLA 4FFBB 1JOBA 3HPNA 3SEEA 1IVSA 1H9PA 4ZHQB 1O3TA 3R05A 2QA4V 3V56A 2DYCA 4X1YA 2UU8A 3OEBA 4BXFA 3QF7A 2ATFA 3QTCA 3VQVA 5LL6Y 4DV1B 2CDYA 2ZE6A 3DC5A 4AVTA 1CZSA 3FB6C 5KUMA 1YCIA 2F4LA 2NN8A 3VZJA 3Q8AA 3LPGA 5DEDA 2LW8A 1HNZB 1NH2D 1AX1A 3DGEA 4Q29A 5L7OB 1L0NH 3TNPB 1ZRDA 5TSWA 3AX4A 1F23A 2HJIA 3CU7A 2VW2A 2JVDA 3EBRA 5JAXA 2RMU1 4I01A 3MPBA 3ZYBA 4QU2A 4GB32 3C3SA 3OMNB 4LHNA 2FDGA 4O2AB 4P14A 2V7QG 2DVAA 1M1KW 3PL0A 3POYA 4TOIA 2DCZA 2V4DA 3GDBA 2LFRA 1X7NA 1JQ0A 4JTCB 5IY5C 2JX9A 3ZYIB 3RWRD 5FYTA 1UL9A 2BFUL 2QKSA 2ARCA 5FNVA 1PO12 4FBFA 4W8JA 2RJLA 4A5UB 3O1UA 2WZ8A 4DY3A 1KKDA 2N7GA 2LQTA 3RFRA 1DQ1A 2YY1A 4J7KA 3I2GA 5JI7A 3IKWA 1VBA3 3GZTB 1X9PA 1ZAUA 5H9CA 1U5IA 1KS5A 2PHFA 2DF7A 1HXS1 4N53C 2FQPA 4LFAO 4HNAA 4A7ZA 4CU7A 1UU5A 1S72V 4KHPB 5H5NA 2CGNA 4MVTA 5CEHA 1S0FA 2V5DA 2CL2A 2XAQA 1PMJX 1HNXB 1EN4A 4DV4O 4YM2A 4LF7B 3FYIB 2HWF3 3NJXA 2CDPA 5BNOA 3DL3A 4O9EA 5GZGA 2P3JA 3H7JA 2R041 2WT0A 4UCOA 3OT7A 4L0PA 2D6OX 1SLLA 2HWE3 4XF9A 4KMQA 4KG8A 1NZIA 1M4WA 1WLTA 1VIWB 3ABLC 1GANA 2WLIA 1I5PA 4X8PA 3ON7A 4MVSA 3HNYM 3UGHA 1Q43A 1COV1 4GMP0 4GX2A 4W6WA 5IVYA 5K0UA 3TN93 4HAMA 2PI5A 1R091 1BT8A 3WQ0A 1D4M1 4DR2B 2C1FA 3IB3A 1LJ7A 1WB7A 1F31A 3D36C 5AG2A 2ERFA 1R082 2Q0AA 4NTYA 2EZOA 3OEAA 4Q0UA 4A7KA 1IBKO 3ZMVA 1MQTB 1G86A 4A6OA 2X6BA 1ZBA2 4EYUA 5HV4A 3N9NA 4AQTA 2GV9A 1KBHA 1JMKC 2UXDB 4N9IA 5GKAC 1F9KA 5KHHA 4ZOLB 3QD6A 2YU2A 3N7MA 1J84A 5IVBA 3ME2A 1XE7A 4GA9A 4TLFA 1VBC2 2A9HA 5JZGA 4AF9A 3U78A 2CGPA 1G6UA 4QXBA 5I8TA 1W99A 5EPAA 1F4NA 2P3YA 4XJ9A 1H1IA 2QFEA 3OPTA 2BCCH 1OPOA 2DDUA 2VWJA 4F8AA 4N43B 3CX5F 1SZXA 3OD4A 4DV7B 2Y69B 4AI9A 1WUVA 3GZUC 5C7GA 4I55B 2RMKB 3P30A 2Q69A 5LXTB 4IYIA