1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
4HSLA 4IEXA 4HSJA 5JR7B 1SEFA 1YLLA 4XEZA 4Q0PA 1O3QA 4Q29A 4YRDA 3QACA 2D5FA 4KWKA 5I93A 5LRSA 4KWLA 1XE7A 5FQ0A 1GQGA 3LOIA 5FPXA 4YNIA 1QXJA 1ZRRA 4BHPA 3MZHA 2CGPA 3LAGA 4D7TA 4IEUA 3RDIA 3H7JA 5FCCA 3ELNA 3PLQA 4UBHA 2K9ZA 4QGLA 1CAUB 4I2OA 4R8HA 1PM7A 1UD1A 4LUMA 3TNQA 1L3JA 3IBMA 1Q5OA 2PAKA 4HZFA 4L2NA 2I45A 3U11A 5I0RA 4JVAA 4Q0QA 1YFYA 2N7GA 3DL3A 2IXJA 2Q30A 4KU7A 2BEOA 1LRHA 2C0ZA 3NW4A 4FBFA 1U12A 3R6SA 2V09A 1DGRA 2XKOA 5JAXA 4IEYA 4MH0E 2B8MA 2P17A 3IDBB 4LA2A 3KSCA 3ACLA 1ZZ7A 3U10A 4O9EA 3H3ZA 4H7LA 1YUDA 3EHKA 2Q1ZB 2GC1A 5I8TA 4X6RB 1OI6A 3RYRA 1YWKA 4OFGA 3M70A 1OFNA 1WLTA 3QOPA 3LA7A 4MV2A 3SCHA 1RL3A 4L11A 4EV0A 5FLJA 3SXWA 3MYXA 2PHDA 3RZZA 4I0BA 1QWRA 2OPKA 4DINB 2OZJA 2QDRA 3D82A 4HVOA 1ZZ6A 5FQ0B 2WFPA 3FWEA 1J58A 1J3QA 2ZCWA 3EJKA 3RPQA 3OTFA 1SFNA 4QGMA 4LTAA 2IXIA 3FHIB 3LA2A 3ES4A 2ETEA 1QXRA 3E97A 1H1MA 5CADA 1HW5A 4MGZE 1ZVFA 3NSTA 4LUKA 4LEJA 1FT9A 2CAUA 3WW4A 4K8FA 1O7FA 3DKWA 3H50A 3OF1A 5J7MA 1ZRCA 2H6CA 4BH9A 2FQPA 2Z69A 5KHJA 1EY2A 5KBFA 4I0AA 4X6QB 2XGXA 1OD5A 5T3NA 3IWZA 1X7NA 5I8YA 4KL1A 3ETQA 1RUOA 3BPZA 2BYVE 2CAVA 5FPZA 2GU9A 3DN7A 3JZVA 3TNPB 3PNAA 3BALA 3EBRA 1DZTA 3IIAA 3OD0A 4Q0UA 5J48A 2QNKA 4YYOA 4EWDA 1UIKA 1IPJA 1J3RA 3D0JA 1I5ZA 1NE4A 3MPBA 4I02A 4ZU4A 5BV6A 2O1QA 4HVRA 5C6CA 5F1RA 2FMYA 3B02A 3HT1A 4NVPA 4GULA 1CAWB 1EP0A 2XHKA 3FJSA 4XFGA 3ZDSA 4J1WA 5K8SA 4LULA 5BXXA 3LA3A 2IC1A 2IXHA 3U0ZA 3DV8A 4HMZA 1NYWA 1LR5A 3ES1A 4QMAA 3O14A 2QJVA 4MGKE 1YHFA 3I54A 4E2SA 3H7YA 3E6CC 1TQ5A 4FT8A 5BPXA 3ROUA 4OLLA 1FXZA 3C3VA 4IEPA 4PJYA 4IESA 1NZCA 4MZUA 3EQEA 3WW3A 4MGYE 1YFUA 3NVCA 2QVSB 3BU7A 2PFWA 3H8UA 4META 5AVPA 4XF0A 1XE8A 2XL7A 3H1MA 1G6NA 1CAVB 3HT2A 5J3UA 2MNGA 5JCTA 3H1YA 1ZZBA 1UCXA 3ST7A 4AVAA 2XLFA 4XFBA 2O8QA 3E5QA 1ZNPA 5EFUA 4A2UA 1YFXA 2ET7A 4AQ6A 5JSPA 3CEWA 3KGZA 1ZZ8A 1CAWA 3USSA 5BUVA 1RC6A 4QGNA 4XFCA 3OGJA 4HN0A 2IXKA 3BCWA 4F7ZA 3KCCA 5I0SA 2MPFA 4KU8A 2PAMA 1WA4A 5CU1A 4KWJA 4R52A 4RD7A 1I6XA 1CX4A 2HKXA 4Z07A 1X8EA 2D5HA 5KHIA 4JTNA 4YSFA 5KHGA 3E5XA 2VQAA 2VECA 5KHKA 3KMHA 1RGSA 5E1RA 2UY8A 4HN1A 4WBBA 4QM8A 2BNNA 5HI0A 2UYBA 4AXOA 2PTMA 4JV4A 2Q0AA 4UBGA 2K0GA 1J1LA 2H0VA 2Q4SA 4AVBA 3E6DA 2XLAA 3SMHA 2OZ6A 4EROA 2EAAA 2GC2A 4B29A 4BYYA 1O5UA 4UXAA 3N4MA 2F4PA 4WVZA 1LB2A 5I0UA 1FI2A 2UYAA 1YFWA 1UW8A 1IPKA 3H9AA 1EPZA 5FLIA 3SCFA 5JSRA 1J3PA 1CAVA 1XRUA 2B5HA 3RNSA 3IDCB 4XF3A 4O9GA 4XFIA 5I8SA 4F8AA 3L2HA 1VR3A 1VJ2A 1UPIA 1O3TA 4BIFA 4XFFA 2MHFA 1CAXA 4PIZA 1O4TA 1O3RA 5I0TA 1Q43A 2GC3A 4IETA 4ZU5A 1EYBA 4CYDA 2BGCA 3UKNA 3M3IA 4HVQA 1JUHA 3I7DA 2PQQA 4P9GA 2GZWA 3S7IA 2XLGA 3S7EA 2IXCA 4IEQA 2D40A 4EWAA 4IEVA 3H1WA 1CGPA 2GC0A 2PAEA 3GYDA 2UY9A 4N9IA 4XFAA 2OYZA 4LLOA 1O5LA 3HIFA 4YARA 1GQHA 1Y9QA 3RYPA 4I3PA 2XKPA 4Z82A 2VPVA 2CV6A 5FDBA 1DZRA 1QY4A 1VP6A 2KXLA 1Y3TA 1ZREA 3BB6A 3CF6E 2EA7A 4QXKA 3FFQA 4HBNA 4TLFA 2GAUA 4D7SA 1PMIA 3FE5A 4FAGA 2HJIA 4EWEA 3OCPA 4PIYA 3LWCA 3NKTA 4XF1A 2OA2A 3LZZA 2PA7A 4ORFA 3PVBB 2WC2A 4E2GA 4QM9A 4I09A 3I59B 3D0SA 1NE6A 1ZZ9A 3H3UA 3SCGA 3WW2A 5LEKA 5KHHA 2ATFA 1ZZCA 3EO6A 4XF9A 4E2QA 4HLTA 1CAXB 1O3SA 3MDPA 4IEZA 3NL1A 1X8MA 1ZX5A 3E6BA 1V70A 5EZWA 3NJZA 2H6BA 3VHRA 3CJXA 3SHRA 2Z2SB 4AQ2A 3WW1A 2IXLA 4IERA 4JTOA 2BNOA 3HQXA 4MX3A 4IEOA 4AVCA 3CO2A 1LKNA 4LA3A 1H1IA 5FLHA 1NXMA 2PYTA 3S0MA 4PIXA 1CAUA 1DGWA 4MUVA 1J59A 2D93A 2XL9A 2Y0OA 1ZRFA 4ZU7A 2ET1A 2BNMA 4XFHA 1ZRDA 2QCSB 1WGPA 3UKVA 4XF4A 1SQ4A 5E16A 3I59A 4Q0SA 2DCTA 2B9UA 4I01A 3E5UA 3RYKA 1UIJA 5D1IA 5C8WA 5CVRA 5I91A 4FAHA 3CL1A 4Q0VA 3UKTA 2E9QA 5LEJA 4IEWA 4J1XA 4ONUA 5JSOA 3FX3A 1RTVA 1Q3EA 1OMIA 5LRRA 4MGIE 4N9HA 3G7DA 3GBFA 3CLPA 4WZCA 2PHLA 2ZKLA 2GH2A 2EVXA 3KGLA 1X82A 5BY5A 4XETA 1RUNA 4QX5A 3FZ3A
chains in the Genus database with same CATH superfamily
1SCRA 5EK0A 2HH9A 3WB2A 2VTFA 3PDQA 3TWIA 4QQOA 1ZRRA 4BB3A 3PTRB 2AREA 4LHKA 3ZXGA 3CSXA 5JCOA 3RDIA 4PDVA 1B35A 2ZEWA 2K9ZA 3QLQA 2YB7A 5JJJB 3CE2A 2HHHO 2ZGPA 4P5HA 2K9PA 1OOPA 1Q6UA 2JDNA 1R1ZA 5A7SA 2C0ZA 4JI8O 2VMFA 4CXWA 5FRAA 2B8MA 1AX1A 2XOKG 3JAWA 1WW7A 3M7AA 4PA7A 3JD71 3EHKA 4RQPC 2G4IA 3RYRA 4D94A 1FXKA 2YPDA 5EBMC 2X6AA 2ZMNA 2QDRA 1YJNV 1P84F 4BMEA 2DJVA 1F31A 1GM9A 4NRMA 2ZGOA 2C26A 4OXSA 5ISLA 4JDOA 1K9MW 4FXGB 1AUYA 5FK8A 4FFBB 4H0LB 2VQ0A 5TISZ 4R9AA 4ASUG 1RUD3 1C1FA 1S0FA 3ECQA 4QQLA 1JOPA 4EZ4A 3GBGA 1XI1A 1G9DA 3W7SA 2QQJA 1GOFA 4NTXA 3IWZA 3T1YB 4XZUG 3MDSA 2VUCA 4IV1B 2HP8A 5HXVA 1DGWX 3ZFEB 4DW0A 3IIAA 2Q8VA 5J48A 4PDLA 3ABKC 4QQHA 3GZAA 4UUJC 3SJQC 3JCIA 4GULA 3NAPB 1F15A 2XHKA 4XFGA 3SR2C 3EXUA 3VD9A 4LULA 2ZNJA 1BKZA 3JALA 2YU2A 4FVVA 4JTAB 4XC9A 4OVEA 5LMNB 3SC7X 4LBJA 1ZBA1 5BPXA 2RR12 2YGLA 1FXVA 3NQHA 1B35C 4LF4B 2VUJA 3UGFA 1PNLA 5FJHA 1OOPC 1F4AA 5AVPA 3VD4A 4LLFA 1JH5A 3HT2A 3MHZA 3WG7C 1VALA 2R043 1Z78A 3HB3B 1CPNA 3TN93 2KB1A 3PMSA 4E9KA 1UY0A 1KITA 3D5OA 4LNUA 3KCCA 1SDDB 1PX4A 5I0SA 1ZTEA 3AXEA 4BQ4A 2Y33A 1RUE1 1WA4A 1HQNA 2VQTA 4PHZA 1QHDA 4XVHA 4AVTA 1GWKA 5KHGA 1ZBE1 1FXKC 4P2ZA 2VVEA 1WA6X 4TSVA 4FPHA 2JIGA 5C9AC 2A3WA 4E4DX 2UY8A 5E88A 1XPWA 1E5RA 2Z5WA 3JB4C 3VQVA 4BDVB 2QGNA 1PO11 1W0KG 3ETGA 5FYUA 1UW8A 5ABJA 1CAVA 3RNSA 4XF3A 2J1EA 2ZX3A 1ASJ2 1PL0A 3ASNC 2WZR1 1EN5A 1MVEA 1V0AA 2AHYA 2WPDG 4QXBA 1ZM1A 1RYYA 1DP0A 4CU9A 2UUCO 1FPN2 5FMOL 2GC3A 5A7WB 3LSQA 4ZHQA 2KR2A 3K04A 4LF8O 1IG3A 3CRAA 2PHWA 2VMGA 4M01A 3AKQA 4JI3O 4QKFA 2QTOA 3ASOB 3R4UA 1MS9A 3CEIA 4XAAA 3SQOA 3ML0A 4JI6B 2XKPA 2W87A 4IHJB 5D5PA 4K8RB 4PA9A 1HNXO 2JJ1G 1IS6A 5F39A 1H9WA 3OEAA 5A32B 4K21A 1KC8W 3OGVA 4LOTA 5A6ZA 4LBEC 1D5AA 1PVC2 3GVMA 2L35A 4NYKA 1NTZH 1PGSA 5B5EZ 4NIAA 2WN3A 2A7WA 3CCRV 5JPMB 2G1MA 1L7RA 4XDOA 3JARA 1UY1A 3WXPA 3RYCA 3MIBA 5LBBA 2W9XA 4XILA 1PM9A 1ZX5A 4I55B 4AAPA 1XREA 1LHVA 5C3PA 3WW1A 1OCCC 4OI0A 4LHSA 1NXMA 2A0LA 2EIMB 5EC2C 2XUMA 4JZGA 4Z1VA 2XT9A 4IGGA 1Q8VA 1H0BA 3M99B 1SQ4A 1OQEA 2JGDB 1UY2A 5FMOS 4U2AA 4AHZA 3J8F2 2P6HA 3ZPYA 2VWJA 1URXA 5ERLA 4NKGB 3OUSA 3CCJV 1QJU3 1S0BA 1H2LA 1UZWA 4N8MA 4UCSA 5ABJC 1KDKA 5GLZA 4NIIA 3ACGA 3X2QB 2FDJA 1W2AX 5FZ8A 1C8NA 4MW8A 4IGOA 1MS1A 4NN0A 4QX5A 1E5HA 4HSLA 2OX0A 2OUJA 2C9AA 3LEIA 3ZFFA 4J9ZB 4QE7A 1N36B 5GLVA 3RYFB 3VZOA 3JAKB 1MSWD 3C3TA 4J41A 1QVGU 2VAUA 1F5FA 1MQTB 5JVDB 3AC0A 2ZMLA 1RPOA 2A75A 2I45A 2RS52 5I0RA 1U5IA 4UCTA 1VE0A 1GM8A 2HWB2 5A1AA 2JG8A 4QDSA 1DGRA 2LW8A 2XKOA 4O4IA 2P17A 3IDBB 3FAVB 4W4KA 4L9BA 2ZGSA 3T1YO 4DXZA 4JC1A 4Y33A 4AFBA 3LNNA 3OYWA 3RYIA 5FP4A 5IE9A 1NUKA 4GX5A 3MYXA 3JBG1 2HVKC 2XXZA 2JDPA 3FB8C 4JI4B 4PQ9A 4C0BA 1OUXA 2W92A 2WO1A 2WFPA 1AR71 3CX5F 4DEVA 2IXIA 3MI8A 4NWWA 3QNEA 5C3OA 1N1SA 5LMNO 1G9AA 3BTAA 4Q1PA 2WS93 4FTSA 3LDDA 1AYN1 1RUH3 1ZRCA 4LF4O 1UYYA 5C3RA 1Q56A 3G6EV 3N27A 4IGQA 4OX9O 2Y26A 1OD5A 2ZGLA 2DVFA 1X7NA 3ILNA 4NIHA 1D4M3 5D8AC 3G80A 5JOWA 5C70A 1SQFA 1RUG1 2BSKA 4YFWA 4UCOA 4J7ZA 1HXS2 2VY0A 4YYOA 4X62B 2WLLB 3UESA 4XMIA 3G6BA 1PGL2 1NA1B 3RVHA 4QQPA 3ZFFC 3ZIWA 3OAAG 1LR5A 4QMAA 1RUC1 2AXTZ 1PL4A 1TQ5A 4FT8A 1ZYBA 1M90W 3UM7A 2A6YA 4IESA 1AR93 1WAZA 4DR6B 5KMGB 5B4NA 2JGUA 3AFGA 3RRDA 2DVDA 4M00A 5CKMA 3J80N 3MHSC 2LW1A 4DV5B 2PFWA 3FD9A 1EPWA 2XR4A 1GZTA 2JG8C 2WR9A 3E5QA 2P3IA 3C7EA 1E5IA 3M2MA 4YVWB 4LQRA 3TAYA 4MW3A 4EE2A 1WUVA 4AVSA 4JGYA 4EN0A 4XHBA 5FKCA 2P22C 4P9OA 3G67A 3H0OA 3AYEA 4QJFB 2X09A 4DR1B 1JZ5A 1GKFA 4ZXEA 1RGSA 3WD5A 1W8ZA 1RUF2 2PYJA 4JI6O 2H0VA 2AZ2A 5JJNB 3NO8A 1H8HG 4DRXA 5DDJ2 4TV9B 1LB2A 5GONA 5BR8B 1R1BA 4BQ5A 2VL4A 3IDCB 1SKVA 2OVUA 4YZ5A 5A1FA 2JE8A 4W4ZA 1V9U3 1UZYA 1XQNA 3VV1A 3B4SA 5A7QA 3P30A 2Q5TA 5J2TA 3S7IA 4F83A 3KT7A 4CCNA 2IXCA 3RGBA 1MS4A 5K7PA 4B1MA 4B8EA 1JOYA 2IM9A 3ZN1A 3AG7A 3T4VA 4I5SA 4FLYA 3GF6A 4W8JA 1PK6A 3B2EE 2IWGB 2WN2A 2BVBA 1QY4A 3WDUA 1ZREA 1G7YA 1AL0G 2EA7A 5CA1A 4F3JA 1HNZB 1YQ2A 1EBOA 2ZE6A 4YW1A 3SEEA 3ZXLA 1RHI3 3O1TA 3ZKUA 5K1PA 2DUPA 5D5QA 2J1AA 1BBT1 1IS5A 5A6XA 3EO6A 3KV4A 1V6JA 1VQPV 4BK4A 1XC6A 4K1ZA 1O3SA 5LGUA 3EMRA 2OQ7A 2Y38A 5L3DA 1EV11 2WQ8A 1HX6A 5HBAA 2ES3A 2AACA 2P7TC 2IXLA 4JTOA 5BMVA 1N36O 4BQXA 2D6NA 2PYTA 4TYSA 3RI8A 1DGWA 4CPBD 5IYZB 2JX9A 2BP6A 5IVJA 1Y67A 1GSLA 2QCSB 3NNJA 2WLPA 4XF4A 5JIAA 3VKNA 1ULGA 4Q0SA 5DAVA 3S5QA 2OWOA 1H1AA 3ACFA 3I3BA 5I91A 3N9OA 3I3DA 2LFSA 2XB6C 1L1FA 4IXLA 4COWA 3D3AA 4AQYO 2W95A 3M8LA 4IEWA 4LP8A 1GOGA 1NU1H 1QJY2 1CR7A 3CLPA 2A6VA 4DPNA 2GV9A 2BBAA 1XNQB 1SEFA 2FL4A 1SERA 3IDEA 3QACA 1SA0A 3JD73 2V5DA 3T30A 1UU4A 2ZX2A 5LRSA 4QU1A 2J22A 3FKSG 4DXWA 5LP6B 4Q4Y2 1XJAA 3VBRB 1GQGA 4F4LA 1GZWA 4JI4O 1H2MA 2SLIA 3P1IA 4GWMA 3LNMB 1CPMA 2YZ4A 1JJ2U 1HQLA 4LT5A 4NTYA 4UV9A 4XXAA 4QGLA 1PD3A 1F23A 1QKQA 5AVAA 3PN1A 1PK6C 3JQWA 4KG0A 2Q8DA 3PTYA 2EULA 3FMGA 4UW5A 1M57B 3I4IA 3UJOA 1VMJA 4Q0QA 3OGRA 2D6LX 3VDDC 2VW0A 2FCTA 3R6SA 4F6RA 4AAXA 5KLVH 4PCRA 2FMDA 1N47A 3H1IH 3FLTA 2QM7A 1DCSA 3IAQA 4Q4W1 3EYPA 3AMQA 4CXXA 1GZCA 1BMV2 4HPKA 5IVYA 3A22A 1OC1A 3HKDA 2QQMA 4YVSB 3CS5A 2HFEC 3K59A 4X62O 4K1YA 1CIWA 3U37A 2EXKA 3RZZA 2R6QA 4DINB 3ZIAG 4RHV1 2PELA 4J80A 2ZCWA 1ALYA 4A6SA 4Y4YA 2Y69C 2ZTNA 3LA2A 2VVDA 2ETEA 3ES4A 2DFBA 2YMZA 5T55A 3GZUC 1HW5A 2Y6FA 4QB1A 1GFF2 4TUYA 3ABTA 2A6WA 1RMU1 1SLTA 2ZDIA 1FYUA 5A33A 1E5SA 4OHVA 4IYIA 1TNRA 1ZBA3 4R9DA 4AEJA 4DR6O 4I30A 2JK5C 1EUUA 4HFSA 1MR5A 3FUQA 4EB6A 4DV5O 4BMBA 2R9IA 4CEWA 1K5SA 2JXAA 5FLXN 2G9FA 3NNGA 1LNQA 1IPJA 5BY1A 1KKDA 5BV6A 4QX0A 3IPVB 4NJ4A 1RUE3 2EZPA 5E89A 2XAHA 2GTSA 2A3XA 3VBSB 3MLLA 1W0NA 1ZBE3 3H7YA 3TEXA 3E6CC 2QQIA 1TVKA 3KLSA 1SC5B 5L9RA 5J2UB 2R061 4M3CF 2XHBA 4H14A 3Q8AA 5FPOA 1WWYA 1DLCA 3NVCA 5BR8O 4O2AB 1ZWIC 5CZKA 3ZMNA 5EBLC 2Y6JA 5F3EA 2WZR3 2A6XA 4ZKTB 1QNWA 3B9CA 2AGSA 2YIDA 4AI1A 2JS5A 2RJZA 4B3TB 1K45A 3LIHA 1VQOV 4X1IA 3UJQA 3RZKA 1XNBA 3MLJA 4Z07A 4IQPA 4INDA 4OCTA 2XJPA 4I50B 2NPIA 4QB2A 2Y60A 4JI0O 3G6JB 3TCUA 5H9QA 1XL6A 1S2BA 3PHMA 2YC4A 5FLIA 5JZGB 2BTQA 1LUWA 2ZDIC 3MPPG 1M56C 1UX6A 2YICA 1KYOF 1ENSA 1SPPB 3ZRWB 4TV8A 4PIZA 1HW7A 4W6WA 4CEWC 4H37A 2RE9A 4N90A 3ZHRA 1GN4A 2XLGA 4K35A 3I2JA 4UXNA 4IEQA 2X7RB 3DTUB 3MICA 1CGPA 2VZVA 5F2VO 2NN4A 1LULA 1NCRB 3WHUA 4DR2O 2FDHA 3BA9A 4BIOA 3X29B 2SBAA 3LUTB 1JZ6A 5FDBA 1PIV2 1RUI1 3ZHSA 1QBZA 3OR6C 2VZRA 4TLFA 3OY8A 3WEZA 5EXOA 1C8M1 2DBNA 4XDPA 4YJ2A 2P2KA 5H6QA 1QQCA 1Y4WA 4XF1A 1MS5A 4RSUA 4ORFA 1LGCA 3H1JH 3Q8CA 5DUXA 1W6OA 1QJFA 3POYA 1TME1 3ZHQA 4E2QA 2CK3G 5FZ9A 4HLTA 4IEZA 4CDWA 4LF5B 1XNQO 2RN9A 3IAYA 4ATEA 2QM8A 2Z2SB 2J1RA 4AQ2A 3MV01 3ZFGA 3T09A 4FI9A 5DQ0A 2RV9A 3VBOB 4D6SA 2HR3A 1WW5A 3ZMSA 3VDAA 3F2ZA 1ZRFA 5EIYB 3KT4A 3J9SA 1NTMH 3AP4A 3ZJZA 1GWMA 1WA8B 3LPFA 3SNMA 1UIJA 5JXIA 4DR4B 4GLXA 3LFMA 1ENVA 1ONAA 3JATA 4JAUA 1K3IA 4ONUA 1PKXA 3E8HA 3B40A 1Q8QA 1WW4A 3CDZB 1I7FA 1RUNA 1V54C 1CIYA 2R1DA 4BLJA 4JGZB 1W6PA 2KKWA 4IIJB 4LFBB 4DR7B 1MVQA 4CP1A 4UFLA 4QD2A 4Y22A 2Q69A 4GMP0 2AZ0A 2BOBC 3BY6A 1GOHA 3SYPA 2A73B 1YIPA 2YPJA 2Q6AA 3NV3A 2H94A 3JBG3 2VC9A 2DYRB 1QLNA 1HDKA 4MT8A 3RMXA 2QWRB 4LFCB 5EYYA 1AR73 4DK0A 3THDA 4IW3A 2WL1A 1T2XA 4EEQA 4LR3A 3HWJA 2Q30A 3NMBA 3I56V 2Q73A 4EYUA 2JKBA 1AYN3 2VRZA 5GZGA 2Q8OA 2PYLA 3AG1C 2UXCO 1CQ9A 1BVP1 4X6RB 2F4VB 1OI6A 4WM8A 1ND2B 2ZR3A 1WLTA 3JXSA 1RUG3 1VQLV 3ZN0A 3SH3A 2EAKA 4OULA 2QQVA 4MVMA 1UXXX 4Y20A 3F7YC 1F5JA 3DC5A 2OUHA 1W6NA 2PF4E 1V9PA 4K8ZA 2LALA 2VUAA 3UO2A 3K58A 1AB3A 3RZLA 1Z0HA 3BAAA 5LL6Y 3BUCA 3E2EA 5DEDA 1OH4A 1YJLA 3WY6A 4ZHNA 5IT6A 1RUC3 4X88A 1H4HA 2OCCC 5FYZA 1NLSA 4ZXKA 3DKWA 3USUA 1WBLA 3DYMA 5KHJA 3SGIA 2Y48A 3ITQA 1AI5A 2GDSA 1F4HA 2XGXA 1XYNA 4DV1B 4YZ3A 4P14A 1HQWA 1XUQA 2LM3A 4LO7A 4GZRB 1LNSA 1RUD2 3AZYA 1POQA 1GLHA 3OM3B 3BALA 5T52A 1NE4A 3VD3A 4B3TO 4TSFG 3E22A 3VBHB 3B02A 2HWF1 4UF0B 1XNRB 2ENRA 2ZZJA 5JLVA 4KNCA 2E7AA 2W1WA 3FLPA 2QJVA 3HKBB 3RJ2X 3R05A 1OPMA 3SH5A 3DXRA 3ZKYA 2PUSA 2QTWB 4N7IA 1SBDA 3TK1A 3D4KA 2DCJA 4DY3A 3VDBA 5BNPB 2W52A 2XAFA 2ZGQA 5GM0A 3BVCA 4MGYE 2GDFA 4UFIA 2F43G 1OVSA 4AHWA 3K08A 5LY1A 1JQ0A 4JASA 2XL7A 3HNYM 2DWEC 2HEPA 1ZZBA 4AVAA 4X1KA 2WA3A 1JYXA 4AQ6A 3L9JT 3KGZA 1AILA 4J9YB 2V4VA 5BUVA 4DRRA 3N2GA 4HN0A 4P02B 3KCYA 2QEXV 2GH8A 1N0NA 2LTNA 4KI5M 3AVRA 1X8EA 1M9NA 2YBKA 2D5HA 5GZCA 3TN92 4PDWB 2V7QG 4Q6GA 5KHKA 2LW7A 3K5LA 4GH4A 2BNNA 4KGQA 2DBIA 1ND3A 4J7KA 3JB8A 4JV4A 1W59A 2KQXA 3WQ0A 5FMCA 5B1AC 4QU2A 4DUZB 4LH6A 4N23A 5CBGA 2F4PA 5FK7A 2UYAA 1IPKA 1EPZA 2B42B 4YW4A 3OBZA 3ZYBA 4XOGA 4QKNA 1KD7A 5L3EA 5FYCA 1UPIA 1J95A 2VZ3A 1L0NH 4NHXA 3OT7A 5I0TA 1YI2V 3H3LA 5IJ0A 3CXCU 3I7DA 3O65A 4XBLA 4RS5A 4UW3A 4G27B 1X9TA 1W04A 5IK4A 1RXFA 2K1EA 4LF5O 3LIGA 4IGPA 3I2KA 1S5JA 4Q4V3 2RJ2A 3ALQA 1JMKC 5DECA 2NLRA 3ZXFA 1EV13 3HIFA 1CX1A 3H8OA 2ZBJA 4A42A 1Y3TA 4HANA 2ZEXA 1H2SB 3E83A 4AK3A 2CTRA 3O1MA 3J26N 3O1RA 4DR4O 2PQSA 3T3YA 5F3IA 2OCHA 5FZMA 3WW2A 3LDKA 1AVMA 1JU3A 1FNZA 4RAIA 2ATFA 1SZTA 2DOSA 2A9HA 3ILRA 1L7LA 3O0WA 3VBFB 4BM8A 4LFBO 3VHRA 4DR7O 1W2OA 4FPLA 2JENA 1G6UA 2PI4A 1AJNA 4LA3A 1H1IA 4QE9A 2CDYA 1VBA1 3RZHA 3QO7A 4ZIBA 1A34A 2EXIA 4K8XA 4DO2A 3ACHA 4LFCO 3UKVA 3SKVA 4GH4C 4X20B 2E76B 3K06A 1HRI1 5D1IA 3T08A 5CVRA 1XMOB 3POBA 3AG2B 1X9PA 1SQPH 2IH3C 1JPXA 3W7UA 1LHNA 1OMIA 3FX3A 2DYSB 1Y74A 2XAGA 4J42A 4MGIE 2QSAA 2JB4A 1GMMA 1C57A 4BISA 4ES8A 1X82A 2YHJA 4XETA 5BY5A 5F2WA 4G9SB 4HSJA 1W2BU 3DYOA 2Y64A 1NXD1 5SV8A 4J10A 4Q4W3 2D5FA 1ST8A 2F4VO 3CRRA 1QXPA 1GBGA 3JD4A 3GHNA 1AR5A 2R9AA 1FNYA 1X50A 4XXPA 5A3WA 4RHV3 4FPCA 5LY2A 2VQFO 1IBKB 2EF6A 5DXDA 2KG7B 1G1XB 3H9VA 3RT3C 2ZIMA 4PF5A 4Y1ZA 3TXSA 1RMU3 1JTZX 4ET7A 4I3GA 4DV1O 3B3QE 2D98A 4FOWA 1BHAA 5IDJA 1ZLZA 3ZMOA 3WHTA 2QDOA 3SDLA 2GHYA 3CYOA 4LHNA 5DAPA 3LA7A 2TNFA 4L11A 3TXQA 1DZQA 2X0LA 1RJ8A 3THPA 4UI9L 3D82A 3M3OA 1JYTA 2C6SA 5FXWA 4COYA 5IVVA 3CC4V 4QHZA 4AI2A 4XCAA 4RQFA 3AG3C 1QXRA 1MEC1 1MG1A 3T2OA 3N3HA 3SYQA 2FDFA 2JE9A 3QF7A 2IVJA 1VBC1 2OIEA 1WJZA 4OZXA 3O1PA 5DPNA 4D69A 1OOPB 4OYUA 2R063 4Y1VA 1ZAUA 3AMPA 2P3YA 1O4ZA 5KBFA 1S0GA 1RPRA 2ARHA 2WS92 3K51A 2FMLA 3O0VA 1YDXA 3V0AA 1H2NA 1UU5A 3TNPB 1TUBB 2JDKA 1P4RA 1DZTA 3JAWB 3CRCA 1QU0A 2DCKA 3UKMA 4LKDA 3WG1A 1D2SA 1D4M2 5B2GB 1J3RA 4LO4B 3BTXA 3BODA 2QQKA 2JG9A 2XONA 4EFEA 4HVRA 1KP3A 5F1RA 2H8PC 1MACA 2FMYA 4JZ2A 2EINC 1UKGA 1UF2C 3FJSA 1XL4A 3IMNA 4JKKA 3HKCB 3WQBA 1UQXA 4DW1A 3AKRA 2G19A 2Q5ZA 1JZ7A 3FYIB 2DQ3A 5ITZB 3C3VA 1YRZA 1QGLA 3BRCA 4GT1A 1ZA7A 1LHOA 1LOCA 4WFFA 4NAMA 4EKWA 1R1A1 3H8UA 2G38A 2Q4PA 1AR92 4A7YA 4G3YC 4GX0A 2J42A 3ZXEA 1G4YB 1K5JA 4MXWA 1CESA 1YFXA 1A8DA 5CNAA 3S57A 1IQDC 1RC6A 4XFCA 1OLME 2BU9A 4F7ZA 2VXJA 1STMA 2PAMA 5C4WA 1UYZA 2OS2A 3RZJA 4CDQB 1R3LC 3AZVA 2VOKA 4PF1A 1FFXA 2LUWA 2Y34A 4CU7A 3JALB 5EC1C 2PTMA 5FZOA 3RVYA 5A3TA 3DYPA 5KXEA 1O5UA 1RUI3 4FQ4A 3H9AA 4UVAA 5LBCA 3P3PA 2OKXA 5K9YA 3JAMN 1C8M3 3U78A 1VR3A 2WAOA 1W0PA 3GNEA 1K12A 3CHXA 4I0XB 1OD3A 5JXHA 1E79G 5GKAC 1JZ8A 4PQQA 4MXVA 3V65A 4WZFA 2ZXWC 1EYBA 4AI9A 2BGCA 3M3IA 4NXMB 1JUHA 4D8MA 1TME3 4Y1YA 4QX1A 1H8TA 1U97A 3T2PA 4NHYA 4IV3B 4LNUB 2WKKA 3GCWA 3GYDA 2EJ7A 1GRJA 5FMBA 2JG9C 4Y4RA 2CH7A 2Z5UA 4WV8A 1WP8A 2AW9A 1OV9A 5IK5A 3B94A 1BZKA 5HFLA 2RS31 2DTWA 4TZDA 3C3SA 2VUDA 4NOTA 2Q68A 2C5DA 1VF7A 4FAGA 1QLEB 1H6XA 1CZTA 2XVGA 3RWNA 4FO9A 3B01A 2JDYA 1T5EA 2VG9A 3U4SA 2VD7A 1L7QA 2B39A 3H3UA 4U7OA 3ZCCA 1GAXA 2B9ZA 4LO8A 2JECA 3IFXA 1LEMA 3ZLIA 2UUAB 1TMF1 2QQOA 3MLKA 1RHI2 2RMU2 2W3JA 3IN9A 2YFUA 3SHRA 4NO4A 4YG6A 5CFDA 2WNUB 3OGCC 3VB9A 5IJ9A 1Y43B 5LYJA 2BTVC 2PHXA 3WDXA 4CEYB 5CAZA 3UGHA 1JS9A 5FLHA 2TEPA 4O2BA 4CU8A 2BNMA 4YY3B 2YU1A 1IBKO 4OHWA 1MPXA 3CMGA 1MOFA 1PNKA 2HEWF 2WA4A 2D3RA 2OPWA 4RR3A 5CEHA 1LU2A 4Y5SA 1LGBA 1Q3EA 3CRQA 2QQNA 2ARAA 1SLAA 2O14A 4WZCA 4Z2AA 2GH2A 3FZ3A 3TB0A 1BK1A 3JARB 3NJXA 4Q29A 1SS3A 4JI1O 4I0WB 1HJFA 2WNVB 4H7MA 3M7MX 1SLLA 3LOIA 1H8TC 3N35A 2DF7A 3FHQA 4BHPA 4IYHA 3MZHA 1AL23 1ZUQA 4O65A 4K9SA 1QQP1 3H7JA 3ELNA 3PLQA 5JXJA 1XILA 1PM7A 1UD1A 3OGGA 3I55V 1FJGB 1YC61 1XSRA 2Y6HA 2BFUS 3VZLA 4JQRA 1VAMA 5FZ1A 3RVZA 3OUJA 3ZXKA 1BXHA 4LMFA 1AXKA 4LA2A 1W06A 1JZ3A 1OCOB 3R0RA 1RITA 2Q1ZB 2VZ1A 2Z42A 4K0KB 1NOVA 5IYDO 1POV0 5JR2A 1OSGA 2YI9A 1VBE1 4CPBA 3ZN6B 2HWC2 3ZFFB 3ZX6A 2BJSA 5C5TA 1V55C 3RW0A 1K73W 1Q7YW 4DV2O 1BLZA 2E7TA 4P9WA 3PUQA 5CFDC 3G4SV 2HWF3 2YS8A 2Z79A 5LA2A 5EPAA 5BNQA 3I49A 1R64A 5CIRA 1N1VA 1COWG 1VBB1 3T1CA 2Z69A 1UOBA 2VMDA 3GCXA 2XAJA 5B1BC 3GJAA 4FPJA 2VTXJ 1VMGA 4C1WA 1Z7S1 4RR3C 3DN7A 3AK1A 2PXJA 1ZBA2 3PNAA 2LJ2A 5LHIA 4AI0A 4CP9B 1JFFA 2LFRA 2IJJA 2AGAA 4I02A 3PUSA 3LB9A 4CDUB 2HBTA 2CTWA 3ZYPA 2QR4A 1D0HA 4FFBA 2WZEA 2E51A 4J6GA 1S5LZ 1AF9A 3WDTA 4DY5A 3ABLB 4E2SA 3BFRA 3B77A 4FLVA 3UQ8A 2DFCA 1RUE2 4NPRA 2YXYA 5JH7B 1ZBE2 4IV1A 5H9CA 1TE1B 3IM0A 3ZFEA 1K3EA 4XF0A 5B3SB 4U3FH 2ZKOA 2VZPA 1HLCA 2DU1A 2XVLA 4P5YA 3QD6A 2ET7A 3NV2A 1PO12 1ZZ8A 4W6XA 2BSKB 1NQDA 1XNAA 4FQZA 3OGJA 1KD1W 4EJRA 3QH6A 1VARA 2P4KA 4DUYO 4NXMO 2WZR2 4MSWC 3MW4A 2V5YA 4ASLA 2EXJA 2QE3A 1Q6HA 1FYJA 1W8UA 4D6TH 2VECA 1RFYA 2JDZA 3W20A 1N0JA 3K3OA 3WU2Z 2VNVA 4XUOA 1AR4A 4ZONA 4M0HA 3RN4A 1NVPD 2B1GA 2XLAA 3MUY1 3V0BB 1YQ5A 3ABMB 3WDYA 5JI9A 3ETEA 1F4MA 4V2VA 5HPOA 1WPXA 4WFHA 1LOEA 1WMXA 4QPYA 2FDGA 4JRAA 4E2LA 5H9RA 4DXSA 1MMMA 4MG2A 4U3JB 2QA4V 1RM1B 1HB4A 4XTMA 2PQQA 2DUQA 2ZXQA 5FKBA 2UUAO 1UU6A 3I2HA 1YQCA 1FV2A 4JGYB 1GZ9A 2PHFA 4ZS3A 2HWE1 5FZ7A 4E4HA 2UXDB 1W6QB 5J98B 2R0HA 2VQUA 1VQ6V 2O8OA 5EIBD 3KZIZ 2WO2A 4AE2A 2D3PA 5LZ6A 1UZ0A 1KQSU 4QXKA 5IW0A 1VBA3 5FNVA 3A4UA 4YY3O 3OMNB 4DRXB 2EXHA 1UMZA 4PIYA 3DUIA 4DEQA 1XOYA 1J1TA 3GGLA 4BW5A 5A7WA 1NE6A 3W7WA 1HRI3 3VKOA 4I7ZB 4IV1C 4FM0A 5FL7G 3CCLV 3ZFEC 4LO5B 4A5UB 1T6BX 4BJ0A 1JW6A 1BEV1 5J2TB 3N9NA 1VPHA 4YM1A 3UT5B 2WSUA 3TOJA 3PUIA 2XPJA 1D2DA 2XH6A 2RDSA 1DGSA 1VIWB 1MZ6A 3W7TA 4EN6B 1PK6B 2JVDA 3IAPA 2AYHA 1VRH1 2ZD9A 1JI6A 3RFRA 5FY0A 2GALA 4DNYA 1TAEA 4H13B 3OG2A 3ZSKA 3AKTA 3WNOA 1FJGO 1N32B 4DXRA 1DHKB 2GMPA 2VOTA 1G8MA 2HLEA 4D6RA 3OEBA 5LA6B 3Q4HA 5EBWC 2VU9A 5IUQA 3CPWU 4I55A 4TWTA 2YROA 2HLDG 1HIXA 4XEZA 5FZDA 2GP3A 4B7EA 4K0KO 3ZMTA 3WNXA 1YYNA 5C8CA 4LIVA 1JJOA 5FZHA 1VMFA 5IAVA 4CS2A 1UOGA 3IMMA 1QH6A 2Y69B 5BMVB 1R082 3CP1A 2ZGRA 3FBMA 1CWPA 2JGDA 3LDCA 1Q8PA 1OHHG 1NY72 3O9OA 5L19A 3TNQA 3IBMA 3JBG2 2JIJA 3JYCA 1MEC3 4AI3A 3RSJA 3WQ1A 5K1XA 1AR72 4ISRA 3HVDA 2CWSA 5FYTA 2I74A 5LOVA 1Y76B 2WDBA 3ACLA 2RS11 3WDWA 4RUEA 2VE1A 5L3FA 3AG4B 3KF3A 3WG4A 3MIEA 4Z8BA 3RYFA 2DQ0A 2E26A 4OFGA 1AYN2 1S1AA 3CCEV 1OF4A 1QJEA 1IDSA 2YUAA 2VMHA 2BWCA 1QDCA 3ASOC 1MQTA 1OFSA 2OZJA 4IE0A 5A3MA 4HVOA 5JVDA 1YI7A 4AILC 1CJDA 1J3QA 3ZYJB 1XOUA 1RUG2 4ICGA 5CG8A 4CC5A 4N53A 5LWBA 4LCUC 1GN6A 3LOBA 3CZJA 1X33A 2FBEA 3WW4A 2VZTA 3FAVA 5GTIZ 3C2UA 5EYPA 1FFTB 4WM7B 2ZX4A 4QPWA 5LK5A 5I8YA 3BPZA 1K5QA 1RUC2 4F6RB 2CAVA 3K0GA 3AJZA 4NWVA 1V6KA 3QTCA 2GU9A 4AGRA 5FBZA 4J11A 2FB5A 2NQYA 3KG2A 2YEVB 1DQ0A 3KV9A 3PJQA 4NXNO 3HKDB 4C7UA 3VGIA 1UFIA 1CAWB 4K7JA 1O4YA 2YIBA 3WX5A 3ZDSA 5FZKA 1GUIA 4XTPA 5C8CC 1BL8A 4JGSA 2EIMC 3HJRA 2BDRA 2F6BA 1KMIZ 1ULDA 1BQPA 4GB31 1UOJA 1XMQB 1R73A 2VBPA 4Q8KA 4JZRA 5C5UA 2D3SA 3AKSA 2UU9O 2EIKB 5JMCA 4TTGA 2UWAA 5EZYA 5ANNA 4MVUA 1GV9A 1MS3A 2JEXA 1O59A 3X2QC 4F6EA 3WCSA 4IE5A 2WLLA 5A3NA 4A2UA 5EFUA 3VKLA 2ZGTA 2QWNB 1NT0A 2EZOA 3I2GA 3J7AU 1JU4A 4UOJA 2EILC 5FZGA 3DPRB 5HCBA 3HNBM 4UW4A 2W46A 1MQTC 3VUOA 2CDPA 3T4HB 3AYAA 3OMAB 4PI0A 4AVBA 1AI7A 2RS33 4N53C 4EN9B 2OXBA 2IZWA 2ZX1A 1RB8G 4XHXA 4LHLA 3FB5C 3FBYA 5JSRA 1SFPA 1J3PA 2B5HA 1NZ6A 5IFTA 5FWEA 2GNDA 2QQUA 2XASA 2XJTA 4YVWA 1SLIA 4C90A 4GX2A 2V72A 1CAXA 2D6KA 5DUWA 4CCOA 2LRPA 1NG0A 1ULFA 5IVCA 1IKQA 2VWKA 3U1XA 4YW6A 1QJX1 2R071 3UV9A 4FSJA 1DGLA 4JHZA 4Y3OA 1I08A 3D8CA 4XDJA 1TMF3 1F8VA 4GXLA 4CP0A 4OI1A 1BBT2 3KV6A 5L9VA 1SQVH 5FTTC 1GQHA 5CISA 4MO3M 4M4RA 5EJZB 5CBLA 1UZVA 1BE3H 2ZGKA 2VCBA 3MBWA 3HQUA 2RDQA 4Q1RA 1EV12 4K20A 4CSWA 3RBZA 4LBMA 1GN2A 1YF2A 1AR82 5LHGA 4B08A 4LFAO 1N32O 3I59B 4OHYA 4MSVA 3SITA 3SCGA 2VMEA 5APAA 5LEKA 1XHXA 1FMD1 3DGEA 3VBUB 1LU1A 4AQSA 5L3GA 2P67A 4E4SA 3DC6A 5FMDA 3GB7C 4CH4A 2VH9A 1DQ2A 1NLQA 3BI3A 1GN3A 4CU6A 5EZWA 1TVGA 5LMUO 3CJXA 3ZYGA 1XQ8A 1OA3A 2N74A 5C9AA 3CO2A 1JYNA 4RO2A 1IURA 2J1SA 3K0DA 4H55A 3C7OA 3KF5A 3M1HA 1CAUA 2CSGA 3OMIB 4XDQA 1V6NA 4XFHA 1ZRDA 3BEHA 1QQP3 4QAWA 3VHOA 5IK8A 2DCTA 2GNBA 3GBWA 3OY8B 4FAHA 4OI4A 3VZKA 3GM8A 4JTDB 4AHCA 3W7XA 1P8JA 4AHXA 5C93A 1VQMV 4DV4B 3ZYRA 2PHLA 2XBO1 2FZ1A 3KGLA 3CJHA 4G4FA 5LASA 4YVWC 2K2SA 5FYSA 5LXTA 4BE3A 4DIQA 3NNMA 2DVAA 1DG6A 1O91A 1GU3A 4DV3B 5FPVA 2J7MA 4CDWB 2EICA 5FQ0A 2CYFA 3PUHA 4FZ1A 5IYZA 1VBE3 5FP9A 4XZPA 3BPSA 3ZFGB 1NAEA 2CGPA 3LAGA 5IHRA 2BUKA 5KA6A 4MYEA 5FIXA 4UBHA 2B7YA 4DFSA 1RJ7A 1Q5OA 1CVNA 2IUWA 4NUBA 5HCHA 4A44A 4JYYA 4P9JA 2N7GA 2BRTA 5FY4A 3ATGA 2BEOA 2EIGA 2V09A 3JSNA 2N04A 1VBB3 2VQEB 2C4XA 2UUBB 4A6OA 4FOVA 5I0DA 4HONA 2CTVA 1PIV1 3J7HA 4QPGB 5F5AA 4H7LA 3R66A 1RMU2 5LP6A 4RFT0 3VBRA 1Z7S3 2E32A 4O7XA 2VBBA 4QHOA 1W6PB 1Y6XA 1R6NA 2OPKA 5C33A 1PP9H 1IBMB 1FOD2 1J83A 4COUA 1DGRN 5A3PA 2NMOA 3SH4A 4YGCA 4YXWG 5F7UA 1W90A 4NRQA 5CBFA 3OF1A 5CFCB 1XMQO 4OUSA 2QWOB 4LF6B 3UNPA 1EY2A 3VQYA 1XYOA 5E8AA 1RUOA 2YC0A 1AXZA 3C90A 1COV1 2JS3A 1NR1A 2R062 5F5CA 1FAFA 1VQ5V 5FZLA 2DU0A 2WNEA 4MGQA 1UIKA 2ZHKA 3ICXA 3KHCA 2C24A 4WM8B 2XVKA 2B4KA 1MA1A 3KT1A 2VNRA 3NRUA 3L75H 2A79B 1YJWV 1AZDA 5A3LA 1V6IA 1UZZA 3I54A 1OCRC 1XU2A 1JOBA 3POJA 5IFPA 5LBFA 4R4ZA 2ZGUA 2WQZC 4CVUA 2ZR2A 3A0NA 3USUB 2ZGMA 1TZOA 5DUUA 2QM4A 4FCAA 2JEMA 2WSSG 4LC1A 2XTAA 1G6NA 3OR7C 4SLIA 1Q81W 3WV6A 1QF3A 2YSUB 3I8TA 2BBVA 5B66Z 4DR3B 3ZPOA 1AR61 4L8QA 5FZIA 2IXKA 3L73H 5LP6C 5KX5B 1N33B 3VBRC 3VBSA 4WVMB 5KHIA 2RM21 4BA6A 4N43A 5A3UA 5J2UA 3T0DA 1JYWA 4TLGA 2V4DA 2HWE3 5GZDA 1KJRA 4BIUA 4AXOA 4UBGA 2Q0AA 1LGNA 5E1AC 1PO21 5ANQA 3DGTA 1M57C 4KGGA 3CB2A 4P9PA 4WVZA 3WSOA 2XJRA 3K03A 3SCFA 4TN7A 5KA5A 1XRUA 1J5EB 3OSDA 5CA6A 3L2HA 5D8AA 4YW5A 2MW2B 3JD0A 3NR7A 2KD7A 2UXBB 1JZ4A 3F5WC 4ZU5A 1I3HA 1C8M2 1AJQA 4LBQD 2JDAA 4YVSC 2GZWA 4X9QA 3W21A 1TNFA 2AR6A 1HDJA 3S30A 3BIWE 4OQ8A 3LSSA 3MF9A 3AEIA 1BEV3 1TME2 2E74B 1ENXA 3PIGA 4X1YB 2X53S 4I3PA 1OLQA 2ZOEB 1W8TA 5J9PC 4B4PA 1VP6A 2GN3A 1WCDJ 5LBEA 4E8DA 1ND3B 3WNKA 1N3QA 1VRH3 2HJIA 2ITDC 2WINB 4EWEA 4KWUA 4TT3G 3I3QA 5F5IA 4KBBA 3DF0A 3M3CA 1VIBA 4I09A 4KXRA 1JYCA 1H6YA 3ZR5A 1EAH1 2BVVA 5F6KA 1X8MA 3W9AA 1NCRA 2CWMA 2TUNA 3K75B 5IJ0B 1V70A 2AHZA 5CB4A 4AGVA 4DV3O 4RS5B 1HRV1 2P3JA 4AG4A 4MX3A 4IEOA 1MZEA 4CCDA 4TXWA 3VBSC 1DQ6A 1UYPA 3THCA 2X29A 4N43C 4FIPC 3T2TA 4WFBV 3MHHC 3MIDA 5E16A 5KWRA 2E9QA 4OUMA 3HKEA 4U7NA 2WT0A 4MVQA 4DV0B 5LRRA 1R6KA 3IC7A 2P37A 1UKRA 2UUBO 3T2QA 1YLLA 4OHXA 4UCUA 1OCZB 3O1VA 2RS13 4XAEA 4H2AA 4ISQA 4NHMA 3LPGA 1MS0A 3N2KB 1DQ1A 1WKYA 5F8PA 4FOYA 4QT6A 3TJTA 1GO3F 1OZ0A 1N34B 4JI2B 4MTXA 4LKFA 2QWPB 3FFZA 1IBMO 2ZNIA 5G04L 1AVBA 1WA8A 3HPNA 4M4PA 1YQ8A 3UCSC 5C8YB 3T0AA 4GIQA 4Q27A 4I9WA 5JZGC 1YFYA 4BQ1A 1Q86W 2IXJA 5IATA 3EXAA 1ZL8B 2XJVA 2YUEA 3BHPA 1MZFA 5JAXA 4LF6O 3HMYA 1QCEA 1JZ2A 5BNOB 3KSCA 4BWAA 1AJOA 3BOPA 1YWKA 1VQ7V 2EINB 3WP5A 2GTAA 1NCRC 1F2NA 2AENA 4MTFA 4CZSA 4RQEA 3OTFA 2GP5A 4AGGA 3O1UA 2ZAHA 4MTOA 4YIPA 1K34A 3RYHA 2HJFC 4JV5B 4I4TA 1S0JA 1YITV 2ZZQA 4N21A 1HWYA 4K8FA 1PM4A 2YC2A 4XYXA 1O8SA 4GB33 4X64B 1S2KA 5CKNA 4GWNA 2NLJC 1B09A 3VN4A 2EJRA 3ETQA 2WSVA 1LAJA 3ZMVA 3DEMA 3IGAC 1SMVA 3DSQA 1WD4A 2QNKA 3OBTA 4EWDA 1KQRA 4XCBA 3F95A 3RJRA 4NVPA 3WP4A 1N33O 2BOJA 1ODNA 4FTBA 1G8WA 4HMZA 1M1KW 5AFEA 4XUTA 2NR5A 1Q8IA 2LGWA 1XYPA 1LTEA 1LJ7A 3CC7V 5F6LB 4YJ3A 3VDDA 2IJHA 5FBJA 3URFA 4R4XA 3FX7A 4QPIA 1H2KA 2A5ZA 5AG2A 3OD4A 4AVVA 4TWKA 1LEDA 3H1MA 5A2QN 4MVOA 3IC9A 2XLFA 1JR9A 5JWPA 2BERA 4XACA 3VBHA 1Y9MA 1A78A 4UF0A 1Y66A 4LF7B 2CGNA 2R70A 2VZSA 4YG3A 4Q4V1 1OA2A 1QJX3 2R073 3LE0A 4YM3A 1JBCA 3MFCA 2EIEA 2VQAA 2DYRC 3OW2U 1SCSA 2LGQA 1VB2A 3QG5A 2HWD2 3UGGA 2F4LA 1RUJ1 3UL2A 1Q6IA 2UYBA 3MAQA 4BOWA 1S77D 1ACCA 1J1LA 4R50A 1W8HA 2R16A 4JI8B 2ZHMA 5J36A 4DOUA 2WYFA 5HV4A 1K4DC 4KH9A 5EV7A 1HN1A 5LB6A 2CDOA 1ROPA 4R6ZA 5EJ1B 3IDAA 4BIFA 2P4EA 1E57A 1I0HA 3CMAV 4JKMA 5FZ6A 4FLUA 4IDZA 1FMD3 1S76D 3MD0A 5CA0A 4YZ1A 2GC0A 2UY9A 2D3OW 5C4WB 3O12A 1IOAA 4A7ZA 3SJBC 4CUCA 1SETA 1FFXB 1SRYA 3SJAC 3SLIA 4MLOA 5FOBB 4HBNA 4XURA 4OPHA 4KFMA 4DMIA 3BVOA 4S2FA 2Y6KA 2A7AA 3INAA 1APNA 2Q8EA 1VBA2 4QPIC 4DV0O 4RFRB 1BZWA 4QKDA 1W05A 4XPVA 1PZ9A 3SPCA 2FHRA 2XBO3 1HRI2 1Y7BA 5JI7A 3VBHC 2E31A 4LBLA 1H8TB 1BGYH 1XXNA 2RHPA 4B3RB 1RVF1 5BNNA 3HQXA 4Q4X1 2LO1A 1AP5A 2X5IB 2QKCA 4JI2O 2WLNA 4HNAB 2WAMA 1U0AA 2XL9A 2ADQB 4UFJA 4M3CB 3PVOA 1ULCA 1QR9A 4LK6A 1E1QG 2O57A 5DABA 1WGPA 1IXMA 1J84A 3ASIA 4R8CA 4UVBA 3GALA 1JXNA 1GP5A 3JU9A 1KFXL 3HNMA 5LHHA 3Q8FA 5CG9A 3CCMV 3PUAA 2R7EB 1IKPA 2C2AA 2CGOA 4QPJA 1FAYA 1PHMA 2EVXA 1N1TA 1SQQH 1OUSA 2F93B 2CTQA 1W3XA 3AZWA 4Q0PA 2E5LB 4YRDA 1PIV3 5FPLA 4XBFA 3J81N 2Q7GA 1SF9A 4QX7A 5LK7B 5IVBA 4CCEA 4B4RA 2HKOA 1TUEB 2DVGA 2VZOA 1YCIA 3LDBA 2F1MA 1FS0G 1IBLB 3EVKA 4LR4A 4CH3A 3K9SA 3LEKA 3UETA 4I2OA 4DR1O 4FPGA 1NZIA 3Q9OA 4PLOA 5JPNB 2M6YA 4RYDA 4A45A 3D3IA 3NV4A 4GKYA 4JV5O 2W0FC 3U11A 1LODA 1QH7A 3MUZ1 3K5OA 5B1BB 1KJLA 1UO9A 4IEYA 2ADDA 4QIWF 2JB8A 3MV11 2W6IG 1MEC2 4LF8B 5A6QA 4FXKB 3U10A 3ETPA 5FPBA 5L73A 1VBC2 5FXZA 2AC1A 5I8TA 1COV3 4CUBA 3M70A 2P5BA 4HL0A 5DG2A 1M4UA 2BW8A 4EV0A 5L9BA 2VJXA 3AYCA 4X89A 3E35A 4I0BA 5L7OB 1AJPA 4EN7B 3TRSB 5D21A 2LP7A 2KG7A 4L97A 4JCKA 1XB9A 1NCQB 4LTAA 5F9TA 5GLTA 2P1BA 5BNNC 1NTKH 1WCUA 3S5AA 5J37A 4IE6A 4LUKA 3QCWA 2RMU1 4LO6B 1I5YA 3FB6C 4LEJA 2QQLA 4A3ZA 5J7MA 4WCEV 4CTEA 1GTOA 2FQPA 4LBNA 2W2IA 1R091 2VZQA 1HNZO 4XUQA 3OPZA 3K48A 2GBOA 4XIKA 5LGNA 3P32A 4E4ZA 2RMKB 5FZBA 3CKHA 4HAMA 2WLHA 2ZMKA 3HBZA 4PA6A 1HV1A 4Q0UA 5IY5B 1GANA 5FP3A 3A0HZ 2QKDA 3VBFC 3K4ZA 4LF7O 5B4XA 1AR63 2ZKNA 1R1A2 3KM5A 2MEV1 5K8SA 5JDBA 2IXHA 2Z3YA 2FTKA 3D36A 1F7YA 5EIBC 3FC0A 3PIJA 1BYHA 2RM23 1YHFA 4LK7A 2JDMA 5H9PA 4OLLA 4ASMB 1FXZA 1TGOA 2ILMA 3UT0A 1BJQA 3HOBA 2RDCA 1PO23 2D6OX 3AG2C 4BAYA 4XDLA 1TUBA 2QQPA 2DYSC 4FPYA 1W0OA 3HR9A 3DXTA 5ACA2 5EWSA 2A06H 1BVVA 5J3UA 2HBUA 2Q7HA 3PMEA 5JSPA 4NTWA 2Y0IA 3AVSA 5K0UB 3SISA 1JX9A 1N3PA 1JFFB 3CJIB 3ZRXA 3HKCA 4R52A 2HKXA 4K3UA 4HKLA 2VM9A 1XE0A 4P9LA 1K5MB 1ZSPA 2W91A 5ITZA 4QM8A 4R7CA 4PLNA 3QO5A 3N9QA 2K0GA 1WW6A 1UAIA 3AL6A 2EAAA 1VF5B 2ERFA 5KUKA 2HWC1 4S2DA 4XFIA 3KQ4B 5CYYA 1X36A 2RS32 4O4HB 1EZVH 1C4RA 2EIDA 1GNYA 3LEGA 5FP7A 1O3RA 2AH2A 2UXXA 3K5NA 4NHLA 4A7KA 2E75B 4ZOLB 3O5SA 2YYOA 3STZC 3AK0A 4CDQA 1EAH3 2XUEA 4QHBA 1A8MA 4QKBA 3B8NA 1HN0A 4UT5A 2VZUA 1O5LA 4B3RO 4BLIA 3L74H 1H8VA 4X8NA 5T5LA 4LPLA 1HRV3 1TEIA 3E86A 5JCOC 1U5ZA 1IG0A 1RSOA 1TMF2 2KXLA 3D36C 3S3WA 3ENRA 4OX9B 3GWKC 3TGUH 1S0CA 3L2YA 1DF4A 2YIBD 2VULA 3FE5A 4NROA 4BW9A 3OCPA 5KXCA 1GR3A 4I0XA 4X8AA 3B00A 2PA7A 1US3A 4QPKA 1SQGA 1BK0A 4HT1T 3Q8BA 3ZYHA 5FO7B 5IYYA 3K5MA 4IV3A 2W1SA 1P7GA 2E53A 3NL1A 1V6OA 2E5LO 4P9XA 3IIIA 2VOVA 5DUVA 5FUNA 3S3XA 1W6MA 2Q0OC 3IZOA 1UOFA 1AL21 1LKNA 2WABA 3S0MA 1J59A 1S4CA 3MIGA 4CH6A 1IBLO 4XUPA 4YLZA 2BV4A 5JQGB 2WFF1 2E6VA 1H4GA 5DN2A 4CBCA 2B9UA 2ZABA 3RYKA 5FNVB 1W99A 5DG1A 1A3KA 2PZSA 4PDRA 2CUGA 1QQP2 4N9HA 3G7DA 3POWA 4GAZA 4IE7A 2WZPP 2DUOA 2WNUA 1US6A 1IGOA 2OTLV 4Y1UA 5FYBA 2W39A 2Q67A 3CU7A 2E63A 1S0DA 4CEYA 2DE0X 5DM6V 1EFRG 1QR8A 2EIJB 4TQFA 4CDXB 4YNIA 1QXJA 4CDQC 4X65B 2WT2A 1K8AW 3UO3A 4ZZ5A 4D7TA 2D43A 1GM7A 3HR0A 5FCCA 3A2FA 3E8BA 1QHTA 3WOGA 1VBE2 1ULPA 3WF1A 2PAKA 4Z2WA 4NR1A 4JDNA 4JVAA 1VQ4V 3ZSJA 1WN7A 2JJ2G 5DZFA 3KB5A 2B5UA 3GHMA 4MH0E 1W28A 3WINE 2XMLA 4PBOA 4FPFA 3K57A 3WF3A 1L0LH 1S3JA 4RN5A 2OW4A 4XJ8A 1UJWB 3Q4HB 2DCZA 2OT5A 2WNVA 3SJCC 1QDOA 3DXUA 1RL3A 3AP5A 1VBB2 4X8PA 4IV3C 4FFHA 1DQ5A 2ZHLA 2RJLA 4AEDB 3K79A 2VCAA 3OTOB 5C8CB 4QQ2A 3FWEA 3NWKA 2R042 1Z7S2 5FOJB 4NMIA 4NRPA 5JUVA 3P3NA 3DKQA 1SFNA 2H3OA 2WLIB 3FHIB 1QEXA 4HZ3A 5CN0A 1FV3A 4PA4A 2GUZA 2LQTA 1M06G 1QLEC 3SYCA 3A23A 1KDMA 1UY3A 3QO8A 2H6CA 2E3CA 4YWAA 2JDUA 4RWUA 4X6QB 4GKKB 2NN8A 3GXUA 5T3NA 3T1MA 3O0XA 1A32A 2AZ5A 5L3BA 2VW2A 1MSDA 3WLUA 1US2A 3WP6A 5LOVB 1PV0A 3ZN6A 1PZ8A 1HB2A 1I5ZA 3LKJA 2EILB 3AJYA 4JQTA 1NKGA 5DAWA 3ORJA 2O1QA 2WNUC 1DBNA 3POFA 3HT1A 4LIUA 1EP0A 4WVWA 1S0EA 4AYUA 4CEYC 4ABMA 3FL7A 4XBNA 3ES1A 2YBSA 4PT6A 4QDQA 1WNSA 3FHAA 1A6CA 4N53B 1UL9A 3EHBB 3STLC 2WQ4A 1C28A 1RUJ3 1H2GA 4JAAA 1KRIA 4AQYB 4NAOA 4Y26A 2W5FA 1HR0B 5CBHA 3NNLA 1AYM1 4QX3A 4GKXA 2JEUA 5EYPB 5FUIA 1R081 4CP9A 4OHZA 4XFBA 1NY71 4PV1B 1SLCA 4CDUA 2AUYA 5FWJA 1B6QA 3USSA 4FZ0A 1OLMA 2HEVF 3CWBH 3JD3A 3JASB 1R3JC 2WNVC 3ZIXA 3N7LA 3LD8A 4IT5A 3GZTB 5LA9A 2LS6A 1BCXA 5DZGA 2I07B 2RQ6A 4E27A 5LCWL 1W9WA 3FUOA 1BS3A 5FXXA 5JH7A 1G86A 3POEA 5BYNA 3QVNA 1OURA 2J1VA 3SYOA 4H3WA 2D97A 1FXHA 1R3KC 2HWE2 2ZS6B 3C7FA 1KS5A 1I9RA 4IE4A 2XJSA 1O3TA 5LATA 5EZYB 5E79Z 1IS4A 1IXBA 5A1LA 1OCOC 3VKMA 3FLRA 4JKLA 2V73A 1KS4A 2OIGA 1XEQA 3KS7A 3AZZA 3SKJE 4RQPB 1NS1A 2K46A 4HKWA 2DMXA 5IVEA 1QJU2 1YJ9V 3O1OA 1RXGA 5AC91 3BGAA 4RA0A 5T50A 4XBQA 1B3QA 4XQWA 3TEWA 4GWJA 3V0BA 4GMP1 1Y9QA 1RVF3 3OJBA 4Q4X3 4JHTA 1IHMA 1DLLA 2QZ2A 1WCQA 3WVJA 3FFQA 3WCRA 3WR0A 1GICA 3L70H 5H2FZ 3J7NA 1UPSA 4GX1A 1BEV2 3AP9A 3JQXA 4JYAB 2ZINA 4GCZA 3LZZA 4AL9A 2WC2A 1KKCA 3AK2A 3BN6A 3M3EA 3M3QA 4U3JA 1VBD1 5M0TA 3JCUZ 4CS3A 1VRH2 5FY9A 2V4AA 2R9RB 2D6MA 4ITCA 4AHYA 2FDKA 1OPOA 1W2UA 4KUMA 1CAXB 1PGW2 5FFOC 1XNDA 3LGRA 2PLV1 1OKOA 3ABKB 3E6BA 1W6QA 3NJZA 2QKSA 4CDUC 4PJ0Z 4BK5A 2YXHA 1DYOA 4H33A 1REFA 4E4EA 3ABLC 4X65O 4Q5OA 2PMWB 1XNRO 4XABA 4LORA 4YW3A 2DN9A 4O61A 4WVVA 3CQOA 1B35B 1OHFA 3A7QA 3E5UA 3ACIA 4Q0VA 5LEJA 4C91A 4J1XA 3WNLA 1VF6A 4QX8A 1Z5VA 4LBQA 5B3SC 2WZ8A 3ZN5A 1HP8A 4GJYA 1YQ6A 2ZEZA 4ES9A 3B7MA 3WG7B 2GMEA 3H1KH 5JR7B 1RUH2 3UT5A 4CCLA 1WPBA 5GTHZ 5I93A 1V6MA 1XE7A 3M4FA 1B06A 3I2FA 3K3NA 1YVWA 4XQDA 4JI0B 1GWLA 4O4JA 1FXKB 3AMHA 3OB8A 3OTOO 2RS12 3WDVA 2W94A 2R30A 5C9AB 3CIHA 4D7YA 1CAUB 2WAAA 2E33A 3CC2V 2DWRA 4LUMA 4TOIA 3M8AA 4HZFA 3ABMC 2I2SA 5LA6A 2GSMB 1DK1A 2RMU3 1LRHA 1ULOA 1U12A 2ZT9B 4DUZO 3AL5A 4HETA 3ASNB 4FLWA 4GKKO 2CTPA 2B45X 4CCKA 1R093 3WF2A 4O9EA 4ZI7A 1RM1C 3WG2A 1O9HA 3LSUA 3CJHB 3ZO0B 4JAVA 2QZ3A 5LXTB 2XDVA 1HKDA 4DR2B 2H0BA 4Z92B 1AR81 3W58A 4JGYC 2ZM6B 5FQ0B 2W08A 1KU9A 2JRIA 2J1UA 4KQ7A 4G2KA 1OCRB 1CN1A 2YXLA 3PJSK 2MEV3 4MS2A 4XJ9A 5CADA 3PL0A 2JD9A 3LEMA 4AWDA 4Y1XA 5IYBO 3E1F1 4FFIA 2WWUA 1FT9A 2Y6LA 3NJVA 1W8OA 1QNYA 3NKGA 3WUDA 1Y76A 4FP2A 1CONA 3DCQA 3O7OA 1HR0O 1O6UA 2JICA 4FLXA 3KKYA 1XBFA 2WLKA 1JHJA 2IH1C 4HK9A 4B3SB 2IVIB 3H8XA 4GB32 1VF6C 3EBRA 1F35A 1W2NA 3AKPA 3D0JA 2ZPXA 3ILFA 3I2DA 4OUEA 4QGPA 1NX9A 4UCVA 4S2GA 4AFDA 1V9U2 1OCCB 4J1WA 3U0ZA 4QNHB 2VTXA 3DV8A 2Z4FA 5FYMA 2P34A 1PVXA 4BCUA 2Q1FA 2M7WA 3H1LH 3WT3A 3RZMA 4WM7A 5C71A 1JODA 1F9KA 1DFQA 3ON7A 4N7UA 1URFA 1T6GC 1VP7A 3HAGA 2VMIA 3BU7A 4OGQB 1LUVA 1D5NA 4GYCB 2WRAA 2VW1A 2HWC3 2C1FA 2YEVA 1LECA 4YIOA 2R32A 1D4VB 5ABJB 4B3MB 1XMOO 1CAVB 4DYLA 2OTJV 3WNMA 1ZNPA 5DAQA 3CNAA 3KCXA 1O8PA 4OMCA 2X6BA 1CAWA 2BTOA 2RR11 4B1LA 3WF4A 3L9DA 4KU8A 3ZVXA 3JD2A 2ZACA 4ZHQB 4XE9A 2W1QA 5J1XA 4LWSA 4MVZA 5FY5A 5E1RA 5HI0A 5GLUA 1LHWA 1QJX2 1D0GA 2R072 5JMOA 1IX9A 3LCPA 2CL2A 2FCUA 3E6DA 3OGIB 4EROA 4DZGA 4OPAA 4UXAA 1AJKA 3SPGA 5I0UA 3K4AA 1HV0A 4JYAO 4U36A 1FOD1 5I8SA 3RMYA 2UXCB 1VLNA 1OQDA 1AI4A 4XFFA 1NR7A 3PVEA 1AROP 3AG4C 3N7KA 1FX5A 3AYDA 3UKNA 3ZEDA 3DPRA 1BHGA 2VNGA 3RYCB 1R6TA 4EWAA 3H1WA 4QXCA 3BOWA 5JVVA 3K3WA 2VXRA 1FMD2 2P90A 2ZHNA 1ASJ1 4GJZA 4XW3A 4N43B 2CV6A 4RGAA 1UY4A 3JD72 1Q90D 1FPN1 3OBAA 3CF6E 3ZDVA 3RZGA 2ADEA 4D7SA 1PMIA 4O4LA 1PO13 3H42B 2CY6A 4OQ9A 4WM7C 4WBNA 3ZHTA 2WFF3 2ZQMA 4E2GA 4XQ4A 2VOXA 1B04A 3HN1A 1ENQA 1DF0A 5D8AB 5KHHA 1ZZCA 3APBA 3WG3A 1M5IA 4XF9A 1KEXA 4UYBA 2CHHA 2DWDC 2ZCEA 3B9IA 5A7PA 3KZ4C 4CA9A 2GMMA 4C8DA 3TETA 1YJKA 4AR2A 2H6BA 2EIBA 1P49A 2DTYA 1PVC1 1YIFA 2BNOA 4JTCB 3B5LB 2XBO2 1EZJA 4MUVA 4JYBA 5DAXA 2ET1A 4YW7A 3ZHVA 2GN7A 2TBVA 2XNDG 3N9MA 3I59A 5FYYA 4KBZA 2EIKC 3A0KA 4CUGA 4P9IA 2P4VA 2XJUA 3VBUA 4JYCA 1MZ5A 1RTVA 2FZ2A 5JXGA 4LOSA 3GBFA 2ATKC 2JG8B 1W8FA 4J7JA 3ABZA 4AF9A 1WCSA 4O4IB 5H9SA 2FCVA 4D6QA 4IEXA 5IK7A 3J7MA 3RWRD 4URAA 4LKSA 2NZ9A 1UMHA 1QOOA 3E8FA 2JDIG 1I1EA 2VGDA 3OYWB 3C7HA 3DPRC 3RYIB 5CB4B 3J8F1 5FPXA 2JIZG 4ZKIA 2YY1A 2YI8A 2ZM6O 3N9PA 1JUIA 3ZBHA 3SEPA 1KFUL 4R8HA 4CCMA 3T1LA 1L3JA 4HYOA 2IJKA 3SPJA 4FPEA 2WT1A 4CC6A 3O1SA 3HKEB 2Y0PA 2RJKA 3ZRVA 4BWOA 2BCCH 1W0JG 4B3SO 3D6EA 2GC1A 3D3QA 4K3AA 2GNTA 5LGTA 3ZRSA 1OFNA 3QOPA 3SCHA 2EX3A 5FLJA 3SXWA 3C7GA 3MFAA 2BOIA 5H5NA 5GW7A 3N7JA 3NAPA 1DF5A 1DLBA 2RS51 2P5OA 3TEZA 1VB4A 1QWRA 3MW3A 2Q8CA 1COV2 1J58A 4BU2A 3CMEV 2HWB1 5LBQA 3GDBA 3VHPA 2VCMA 3K46A 2G9ZA 2RG4A 1OVPA 1YIJV 3HBKA 1UN1A 5H6RA 4ZS2A 2DVBA 4AFMA 3IT8A 3K4DA 4BH9A 4GA9A 1C5HA 3AM2A 1S0VA 1AXYA 4QPGA 3W59A 1X59A 2BQPA 2F66C 3MIFA 4KHPB 3S6PA 3VBUC 4CUAA 1AYM3 3JZVA 5J09A 4B3MO 3I3MA 3ABUA 4AI8A 1R083 1TA8A 4FMTA 2VS0A 1VQ8V 5TSWA 3A0BZ 3H1HH 3K2OA 3WFVA 2VVFA 3ZMZA 3BKZA 2FDIA 5BXXA 2IC1A 1QIQA 3HD8B 4MHUA 3U75A 3O14A 4MADA 5CFCA 1FATA 1AR62 2WUHA 5A6YA 2UWBA 3LFIA 3RYHB 1OA4A 4LE3A 2FKXA 1XU1A 5CB7A 1HXS1 1NZCA 4I4TB 3TBDA 2R0FA 2RM22 4NB5A 2W47A 4NPLA 5C3SA 1PGL1 3CCUV 3OEEG 4META 3OPWA 2B9VA 5GONB 1UPGA 3OFNG 1PO22 1YHQV 3ST7A 1AR1B 2P06A 4CP2A 4QGNA 4CDWC 3BCWA 5FY1A 3H8RA 3WB0A 5FZFA 4I9QA 1K33A 3POSA 1EN6A 2WLJA 4JTNA 3ZFGC 2NMNA 2VQFB 1X4TA 4L8JA 3NAPC 4DV6B 1DU3D 3KMHA 5E6HA 5AC93 4IHJA 4GQ7A 4CRQA 2IW5A 5CMUA 1YEWA 1WLCA 4DUXA 1S2EA 5A32A 5HV0A 4R9BA 4GMP3 5FZAA 2GC2A 3IKWA 3GWOA 3R4SA 3H01A 2ITCC 2X05A 4YJ3B 3VDDB 4J25A 5CA1B 3IB3A 4QPIB 2XAQA 1VJ2A 3KVAA 1GMGA 2RDRA 2WJSA 5JOZA 1JHNA 3VHNA 4QPGC 1Q43A 3I5DA 1VBD3 5KX5A 1RUF1 2BWAA 4CE8A 4GWIA 4WVMA 4LH7A 4HVQA 3TYJA 1GQPA 1W39A 4Y5Z0 1RINA 1JMUB 5A7NA 5DDJ1 3B8MA 2PLV3 1XBLA 4N9IA 5KAFZ 2OYZA 3PU8A 3QBQA 1WMFA 3VKFC 4Z82A 1EAH2 4FPOB 3BB6A 2PHRA 4DQAA 4YHHB 4MOAA 4P30A 1CZSA 3AMNA 5CFCC 1HRV2 4IL6Z 3NV1A 3LWCA 3NKTA 1WLEA 3CCSV 3KHBA 4FPPA 4WFGA 3D0SA 2Q9LA 2DURA 5HFMA 5FP8A 5A80A 3MDPA 1U96A 2L6LA 5CKQA 2R72A 1REEA 4WM8C 3K77A 3ZR6A 1Q8SA 3A8TA 4BQ2A 2X8KA 4X1YA 5CA0B 3JAKA 1IPSA 3LSEA 5KR7A 1L8DA 1POV1 3A21A 1SA0B 4HXCA 2X6CA 1I94B 2RNBA 4ZY9A 3RG0A 4AVCA 4Q20A 3ZX7A 2P6JA 2B1IA 2QDNA 1GZWB 5FZEA 4ZZ8A 1WLDA 3LDEA 2ZIOA 1PZ7A 1F51A 4S2HA 4FM2A 3LQCA 3J4UH 3W5NA 3ZN4A 4P08A 3UKTA 3T4DA 2L9LA 2HWD1 3CCQV 1HB1A 1W2TA 4GALA 2X10A 1BBT3 2A70A 4V2WA 1V6LA 1YI9A 3B69A 1AHSA 4KWKA 3VLBB 4HPKB 3VZMA 4YZ2A 2ADPA 4LBKA 1DYKA 1BMFG 3ZYFA 1FKAO 1AR83 4W50A 5BNNB 4UB6Z 1NVPB 4IEUA 4D0QA 1S5HC 3T4ZA 1QJY1 4CH5A 1WCKA 1CZVA 3B09A 1D7PM 1LENA 5KAIZ 3MW2A 1U5XA 4OMDA 2DDUA 3DL3A 4KU7A 4FOQA 4TUYB 3NW4A 4UVCA 4Q4Y1 5A33B 1M56B 1REDA 4AQTA 1OLRA 1ZZ7A 4KHPO 3N2KA 4JPRA 1GKBA 4EB6B 1BSMA 1JA8A 4CEWB 3RS6A 2QJ1A 3TEYA 4HOOA 1NA1A 1GNHA 2WLMA 1NJIW 5C8YA 4AZZA 1KB9F 2DW4A 1OJHA 4BQ3A 3RPQA 1HNWB 4QGMA 3VDCA 4IL7A 3E97A 1H1MA 4RGKA 2QUOA 2UXDO 1ND3C 4MGZE 1ZVFA 3UYJA 3NSTA 1ZL8A 5HXMA 3AP6A 5KMGA 1YNAA 1BMV1 1CPYA 3QH7A 4C0HA 3ZYIB 3I97A 3H50A 1TVKB 1MNGA 4DK1A 5BNOA 3DECA 1KECA 3HPLC 5IWFA 3CRMA 4ARXA 1BQZA 5FPZA 1SG3A 1QMJA 2ZE5A 3PURA 5IJRA 2BGPA 4GZ9A 5EP9A 5F32A 3VQXA 4ZU4A 2WWWA 4PBPA 1QNMA 4RS5C 4AEMA 4YZ4A 5IVFA 2RR13 2F23A 1GP6A 2YDEA 2XOMA 3LA3A 4X1IB 3N36A 5GZEA 4CCCA 4DV6O 3J7LA 1LOGA 5EYXA 4ZPIA 2ETNA 3VZJA 2GNMA 4TV9A 2R1BA 5K4LA 4NPMA 1IQAA 3ZHUA 1P7BA 4PLMA 4Q4V2 5GZFA 3EQEA 4ZBMA 1BHBA 1JYVA 1PMHX 4AW7A 2QE7G 3P6BA 2XQRA 1RUJ2 4B3NA 2JD4A 3WZ1A 1FOD3 1XNKA 2BTQB 4JI1B 1AP6A 2PY5A 2O8QA 3AX4A 1OCZC 1V54B 4TV8B 3V64A 3N9LA 4BQWA 4IUGA 1I5XA 1Y4MA 4EZHA 5CU1A 1K4CC 4RD7A 3LDRA 1ZX3A 3L72H 1CX4A 1NA1C 3E5XA 2DYCA 2IU3A 1W9SA 3BA8A 4Y24A 3OBRA 4HN1A 4WBBA 4FFFA 1YTFB 1ASJ3 2NYYA 4YGEA 3SMHA 4DV7B 5FR3A 2OZ6A 3K9AA 2F95B 1I5PA 2R49A 4LITA 3N4MA 3N7MA 4YHHO 1D2QA 5T5PA 2ORZA 1FPN3 2G9GA 4COVA 2F17A 4BZ4A 3T2MA 4F8AA 5FREA 3OGSA 2UXNA 3B93A 1N1YA 2QKAA 4L0PA 4YJ2B 4Q2FA 5FZ4A 5BNOC 1NQTA 2MHFA 5DMYA 1OKQA 4ASKA 4XJWA 3AG1B 5SV5A 4IETA 3VOUA 1W6OB 4CYDA 1KGYA 3APOA 4PA3A 4P9GA 1OXCA 4UV8A 4DV2B 2ODMA 5A9GA 4IEVA 3P5BA 1NH2B 4XFAA 3ZXJA 4YARA 1I94O 2IFWA 3NJYA 1PVC3 4Q4W2 5IYCO 1DZRA 3THOA 4AFAA 3AK3A 3V56A 1SBFA 2OCCB 3RI9A 5IAXA 2Q1MA 1RVF2 4EFBA 2B46X 1CD3G 1AX0A 5FZ0A 4Q4X2 4LXLA 4RHV2 5F3GA 2CAZC 2KSDA 1H9PA 1Q8OA 1GP4A 3SPIA 1GK9A 1IS3A 3JATB 1ENRA 1GYKA 5JJEB 4RUFA 3ZSLA 4DUWA 3E89A 2JKXA 3ZXDA 3VL9A 1KUQA 3POGA 2XHNA 4BXSV 4ARYA 3JD1A 1K7DA 2ZE7A 5ACA1 1SFYA 1EN4A 4Y22B 1WMEA 2CNAA 4PIXA 3J8F3 3ZSMA 1U5YA 2W68A 2YXSA 2ID4A 1GH6A 4FP3A 1RSOB 4FLTA 3NNFA 4AOCA 3ZXAC 1QVFU 5C8WA 5F5QA 3BCCH 4A3XA 3BABA 5JSOA 3C8XA 3I3EA 2Q7EA 4MHRA 2ZGNA 4DUYB 2NP0A 4TQDA 4YVSA 1NQJA 1O3QA 4L92A 5KUMA 2X5IA 2XWJB 4KWLA 4HNAA 1CJPA 1S0IA 5JOYA 1VAVA 4M3CA 1S55A 5B1NA 4C1XA 2RS53 1W6MB 4Q26A 4P00B 4Y20B 1C5IA 4CS4A 1HNWO 2HWB3 1W6NB 3BYWA 1FPOA 4V1PA 4FJCC 5B1AB 4QDRA 2O0OA 1XSQA 1LOAA 4UWDA 3ZMUA 1DQ4A 4URTA 4FBFA 5CA3A 2VCCA 3FYEB 2EALA 5B1OA 2RCVA 5DZEA 4MGTA 1E1RG 3BU0A 2BFUL 5D2AA 4UW6A 2XWBB 1BT8A 1SESA 4DB5A 1YUDA 3EB7A 4PI2A 1VRBA 1K92A 2WWSA 1YXWA 5A70A 2WWJA 5FZCA 1UNBA 2WO3A 4MV2A 1JOJA 4UCRA 4RL7A 3FN9A 3IPVA 1R092 4W65A 2C9KA 2RDNA 4OI2A 5C4WC 5GJ6A 1OH3A 1THZA 4DRVA 4MGSA 1G9BA 3E22B 4XDKA 2XG3A 2ZX0A 4YM2A 1W8WA 3Q8EA 2HJDA 2PGGA 2CAUA 1O7FA 5F37A 3DXRB 4O2AA 1W3VA 2MEV2 2D6PA 1XNTA 4I0AA 1HXS3 3VD5A 4KL1A 2BYVE 3VQWA 1PNGA 3CCVV 4EQVA 1G9CA 5FO8B 1NBMG 1EM1A 2UU8A 3OD0A 5L7OA 1RUI2 5FPAA 2PHUA 4OZOA 3MPBA 3WQ7A 4X1KB 5C6CA 3ME2A 1NCQA 3OOXA 5FXVA 2AEZA 4I50A 5BZBA 4LKEA 3N2GB 4FPKA 2X5IC 4WFAV 1HB3A 1RP3B 5BXZA 3U4XA 4MGKE 4G28B 5FYHA 2WBKA 1YZBA 1RUD1 1NLRA 2BGOA 4CZZA 2FYUH 1WLWA 5GALA 2ZEYA 5JZGA 2WYSA 4GD4A 4IEPA 4DV7O 4GH4B 2GUZB 4MZUA 4BXFA 2JWPA 1SQBH 4X66B 2IBZH 4QXHA 2QVSB 3VZNA 2D44A 1SPPA 3ZRWA 2A6ZA 5FZ3A 1HJGA 5JCTA 5IWAB 1SLBA 4AFCA 4LJHA 1UCXA 3AB0A 1N8RW 3AZXA 2ARBA 4PD4F 2BOCC 2NM1A 4DV4O 1ULEA 3MF6A 1LHUA 2MPFA 1RUF3 4LBOA 1OBNA 1KBHA 2HG5C 4JI7B 1SZBA 5F3CA 4BR6A 4YSFA 4Q8LA 5DDJ3 1DIWA 1NT2B 4R9CA 4QWNA 3ETDA 2YFZA 2VO5A 3U14A 4LF9B 4JRLA 2Q4SA 5A3OA 2IFRA 2Y4TA 4DR5B 4LE4A 1M93A 4FM1A 3T1HB 1YFWA 2CE4A 5EQUA 4O9GA 4MTGA 2R041 4Z1MG 4PDMA 3TN91 4FFGA 4PELA 1CEZA 5K0UA 1JN2P 3CJIA 1NKDA 3CBNA 2VQEO 4WFEA 1W9TA 5KXBA 1M4WA 4QB6A 3WUCA 3S7EA 4FLZA 1K5MA 1W9FA 5L7OC 4QX2A 2D40A 1G9FA 3JUUA 3VBOA 4DXTA 3OUIA 2PAEA 1JVMA 4P9YA 1ORQC 1XHZA 5HCFA 5KC5A 1W9YA 4LLOA 2CU5A 5T54A 4L87A 2QWQB 1NCQC 3ZM8A 4CCJA 4M3CE 3RYPA 3HEIA 1POV3 2VPVA 3AG3B 2ZJCA 1K97A 2IU0A 5JOXA 1AX2A 3WB1A 3BTZA 4O4HA 4EN8B 3MIHA 1AL22 2YG0A 1ZA4A 4MVTA 4GKJB 1ZZ9A 4ZOLA 4RGGA 5DN6G 4JF3A 2W6JG 5JIUA 4NXNB 1WZXA 4WF9V 2E7QA 4JGZA 2HWD3 4XIOA 4IIJA 3HQRA 4B4QA 1Q82W 1Y74B 5IY5C 1VQKV 2WFF2 4UFZA 1XNCA 2J1TA 1W03A 1PMJX 3LF7A 1UYXA 4DUVA 1JYIA 3OUFA 3PJYA 1DYPA 1PX3A 3KQRA 1UXZA 3LSDA 2D93A 1H8EG 1O9GA 1AI6A 2UU9B 3WNNA 3HN3A 3SPHA 1QJY3 5C3QA 3CL1A 2A3YA 2ZA9A 4NIDA 4KMQA 4UFKA 2HWF2 2PN5A 2W1UA 1S72V 3R4DB 1NI8A 2ARXA 2HYXA 4DS0A 2WO7A 3MO4A 1BQ0A 4Q4Y3 1ND2A 4YW2A 1JCHA 1W8NA 1SZXA 2FD8A 3G71V 1C1LA 5K0UC 1H38A 2WIIB 3CJIC 2Y6GA 2JJ6A 3AFKA 4DR3O 2ARCA 5LA0A 1K42A 3IJ4A 2VMCA 1K5MC 3CXHF 2P3KA 3AXDA 3VBOC 4YG0A 5JQGA 3PVNA 4ATFA 4JI5B 3F7VC 1IVSA 5KXDA 3GZEA 2UURA 3A0RA 2HVJC 3VL8A 4FTEA 4L2NA 4FFKA 1QJU1 3KD4A 5J96B 3T0BA 5FPUA 3VD7A 2IJIA 3APQA 3JCZA 2V1DA 2QBXA 5C7GA 1J5EO 4LBQB 1QOSA 2PI5A 3H3ZA 3AMMA 2MK3A 5FYIA 3F5TA 5HCAA 4HG6B 1SDWA 2ZXWB 4BPZA 3U07A 4YGDA 4E8CA 2UXBO 3V0AB 4CDXA 2OQ6A 4JGZC 5AFBA 3E8GA 4YFZA 5LW9A 3POIA 4DO0A 2PHDA 2HYKA 5FAXA 4YM0A 1PPJH 1ZZ6A 2JG9B 1Y9GA 2LROA 3EJKA 3HKBA 3NXSA 4O4JB 1V00A 1H30A 1PGW1 2HHHB 5BNPA 4JDMA 4LNVA 2OT7A 4LFAB 1UX7A 2AEYA 1Z5WA 1DTOA 3OEHG 4B7KA 3JSLA 3ZS8C 2WLQA 4X66O 4Y5TA 4UAPA 1LOFA 4BQYA 4KP4A 2EBOA 2A71A 4K40A 5FPRA 5LMUB 5IWAO 2QTSA 5L3CA 3WNPA 4AEDA 2Y8KA 4ZI7B 3GJBA 2HEYF 2QFEA 4AEKA 1ND2C 4XUNA 4MXWB 1AYM2 1MS8A 1VEWA 2D7FA 1OF3A 1RIRA 4PDWA 2WLIA 1UMIA 1F4NA 1XDCA 2OIIA 5IT9N 4JI7O 1LR1A 1NYWA 4CXYA 1QOTA 4XJAA 2WS91 5FV3A 5LA1A 4GUNA 1RUH1 1YTFD 3EFFK 3ROUA 1R3IC 4LF9O 2VBDA 3VBBA 4PJYA 2XJQA 1KP2A 1VBC3 4COZA 4DR5O 1WB7A 1D4M1 2D2CB 3WW3A 1YFUA 5KC6A 5FZOB 3T1HO 1TG7A 2VR4A 1EUTA 1MABG 1ZRIA 1XE8A 2KA3A 2MNGA 3H1YA 4W6YA 3OPTA 4FVMA 5EHDA 2A3QA 4XJUA 1WB8A 3CEWA 2A1XA 2BZDA 1LOBA 2ZAAA 3WP3A 5T5JA 1N3OA 4KWJA 5FY7A 2EIJC 2ZE8A 1I6XA 1YSCA 1WD3A 4JX0A 1N4CA 4CDXC 2DCYA 1NH2D 1VQ9V 4UFHA 4BIZA