1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
3SCFA 1WA4A 4XFFA 4QX5A 4AVBA 2OYZA 4I01A 3UKVA 4XF1A 1ZNPA 3ES4A 2H6CA 2PFWA 4UBGA 5CU1A 3KGZA 4N9IA 4HZFA 5JSRA 5KHKA 3LAGA 4HVRA 2VPVA 4KWJA 4K8FA 4MX3A 1ZX5A 1XE7A 3H3UA 4YSFA 1RTVA 1NZCA 2GAUA 3LA2A 1NXMA 4EWDA 4I3PA 4WBBA 3FHIB 3BCWA 2IXHA 4RD7A 4QGNA 3IWZA 4META 4FT8A 2N7GA 1UD1A 4H7LA 5KHHA 5D1IA 3G7DA 1QWRA 4HN1A 4Q0UA 2DCTA 4FBFA 2XLFA 1SEFA 4MZUA 5KBFA 4LUMA 5I8TA 3S0MA 4F7ZA 4J1XA 3BALA 2Q4SA 4PJYA 1YUDA 4E2QA 1L3JA 2ETEA 2H0VA 1CAXB 3MYXA 1FXZA 1CAWA 3SMHA 1RUNA 3I59A 1O3RA 5JSOA 2UY8A 4R52A 1XRUA 1LRHA 1DGRA 5C8WA 5F1RA 3JZVA 4WVZA 4LULA 2GC0A 5FLIA 5LEJA 2Y0OA 4XF0A 1VJ2A 5BPXA 4Z82A 1LR5A 3MPBA 1HW5A 1DZRA 2MPFA 2GZWA 3DV8A 3CEWA 3CO2A 4XFHA 2IC1A 3H1WA 1WLTA 5J48A 3RDIA 1CAVB 3DN7A 2D93A 3HT1A 4LTAA 3U11A 3TNPB 2ZCWA 2D5HA 3CL1A 2GC1A 2BYVE 2B8MA 2MHFA 4P9GA 1X8EA 2FQPA 1RUOA 2HKXA 5EZWA 3RYPA 1EP0A 2Z2SB 3KSCA 3LA7A 1NE4A 1U12A 4IESA 1QY4A 5BXXA 2XHKA 1Q43A 3NL1A 1H1IA 2KXLA 4EV0A 5LRRA 2WC2A 3NJZA 4Z07A 2ET1A 2CV6A 2PHDA 5I0RA 3R6SA 1PM7A 3ES1A 1YHFA 1ZRCA 2ET7A 1J3RA 3ELNA 5FQ0B 3FX3A 5I91A 1O5UA 2BNMA 3GBFA 1O7FA 4JTNA 2O1QA 1GQGA 4O9EA 2QCSB 1YFYA 2VECA 1RL3A 4OLLA 1X82A 4YRDA 3IDCB 3E5XA 3RYKA 4LA3A 4A2UA 4ZU7A 1YFUA 2UYAA 1G6NA 2PA7A 2GC3A 5E16A 4I09A 4D7SA 1CX4A 5BUVA 1EPZA 3NSTA 4X6RB 1H1MA 2IXCA 4HVOA 3QACA 1OMIA 4EWAA 2Q0AA 3DL3A 3KGLA 3EJKA 2H6BA 3I54A 3S7EA 4B29A 4IEZA 1NE6A 1NYWA 1SQ4A 4JTOA 4XFBA 5JAXA 1ZZCA 4IEXA 5I0UA 4HN0A 5BY5A 1ZRFA 3OD0A 4PIXA 4EROA 3U0ZA 3S7IA 5K8SA 2XLGA 3DKWA 1VR3A 2GH2A 2OPKA 5FLJA 3IIAA 1TQ5A 4HMZA 5HI0A 3OCPA 4XF3A 5CVRA 3LWCA 1CAUA 4IEQA 4XEZA 1QXRA 5C6CA 4FAGA 4LLOA 4AVAA 1ZREA 4JVAA 3RPQA 1OD5A 5I0SA 3H9AA 1LB2A 1Q5OA 5KHGA 2UY9A 4ZU5A 2PYTA 3E97A 3EO6A 4O9GA 3O14A 5J3UA 1FI2A 3SXWA 2HJIA 1O3SA 3E5QA 1UCXA 2D5FA 2BEOA 5JCTA 4HSLA 1XE8A 4NVPA 5LEKA 3ZDSA 2GC2A 4HSJA 5FDBA 3WW1A 1UW8A 3QOPA 4L11A 5BV6A 4YYOA 3EBRA 4LUKA 1DZTA 3IBMA 4XFIA 1OFNA 5KHJA 1YLLA 5EFUA 4BIFA 3H1YA 4LA2A 3UKNA 4AQ6A 2XGXA 1CAWB 4QMAA 1WGPA 2XL7A 3I59B 4KU7A 1EYBA 2B5HA 3H1MA 3L2HA 1O3QA 2MNGA 3PVBB 3H50A 4KWLA 2O8QA 4KWKA 1I5ZA 4XFAA 4Q29A 2QJVA 2GU9A 4L2NA 4MGKE 4AVCA 3OF1A 1I6XA 2VQAA 1ZZ7A 4IEYA 1DGWA 3C3VA 1FT9A 2FMYA 5FCCA 4JV4A 3OGJA 3USSA 3PNAA 4XFCA 2UYBA 4BH9A 5E1RA 1Y3TA 4I02A 3LA3A 4I2OA 3BB6A 1ZVFA 3EQEA 3BU7A 1LKNA 4E2SA 4Q0PA 1X8MA 4YARA 4PIZA 4OFGA 3SHRA 3PLQA 4X6QB 5FPZA 4KU8A 1PMIA 2QVSB 1ZRRA 3EHKA 4MUVA 3U10A 2BNOA 1RC6A 4IEVA 3M3IA 2PHLA 4XF4A 4AXOA 2BNNA 4IEWA 2K9ZA 4Q0QA 3KMHA 4Q0VA 5I8SA 1J58A 2IXIA 4UBHA 2EA7A 4ZU4A 2C0ZA 2BGCA 4KL1A 3WW4A 1CAXA 1O3TA 1ZRDA 3E6DA 4IETA 3FFQA 4MGIE 1Y9QA 1UIJA 2XKPA 3FWEA 4MH0E 2B9UA 1JUHA 2QNKA 4CYDA 1VP6A 3WW3A 4PIYA 1EY2A 3I7DA 4D7TA 3FE5A 3RNSA 1ZZ8A 3NKTA 2OA2A 2Z69A 1UPIA 5KHIA 4LEJA 4HLTA 4GULA 1ZZ9A 3IDBB 2WFPA 4WZCA 3RZZA 4DINB 2I45A 5FPXA 2CGPA 4I0BA 4HBNA 1CAVA 1X7NA 3ETQA 2V09A 3NW4A 4ONUA 5I93A 2XL9A 2K0GA 4MV2A 4QM8A 3BPZA 3ROUA 2OZJA 1SFNA 3M70A 3MDPA 2PTMA 4BYYA 2IXJA 2D40A 2P17A 1IPJA 1RGSA 3HT2A 1IPKA 2PAEA 2OZ6A 1J59A 4UXAA 3CF6E 5CADA 1ZZBA 4YNIA 1CAUB 1YFXA 4QGMA 5I8YA 3OTFA 3VHRA 2PQQA 3ACLA 3UKTA 4FAHA 4MGYE 3E5UA 4QXKA 3CLPA 3HIFA 3NVCA 4XFGA 3HQXA 2CAVA 2ZKLA 1J3QA 3D0JA 3SCGA 4I0AA 2CAUA 3D0SA 3MZHA 3E6BA 3LOIA 4MGZE 1YFWA 5FQ0A 2IXLA 3FZ3A 4J1WA 1GQHA 2Q30A 1UIKA 3H3ZA 1V70A 2F4PA 5LRSA 4IEUA 2PAMA 2E9QA 2QDRA 3FJSA 4XF9A 2XLAA 1QXJA 4Q0SA 3H8UA 1J1LA 3D82A 4E2GA 5JSPA 4IERA 3E6CC 2EAAA 1ZZ6A 4N9HA 4XETA 5FLHA 4BHPA 3TNQA 3B02A 3SCHA 4IEPA 1J3PA 4F8AA 1O5LA 1YWKA 4ORFA 2PAKA 5AVPA 3ST7A 4QGLA 4EWEA 2XKOA 4AQ2A 2EVXA 5J7MA 1OI6A 3GYDA 3H7JA 4R8HA 2IXKA 1Q3EA 4IEOA 5T3NA 3RYRA 3CJXA 3LZZA 1CGPA 3KCCA 4TLFA 3H7YA 5JR7B 3WW2A 4QM9A 5I0TA 3N4MA 4HVQA 1O4TA 2ATFA 2Q1ZB
chains in the Genus database with same CATH superfamily
5JMOA 2GP3A 1HDKA 4QX5A 1OVSA 1UZYA 4JI6O 3BU0A 2HHHB 4ZONA 2VPVA 2HVKC 4MX3A 1UAIA 4XDPA 4LFBO 4PQQA 4I3PA 1XI1A 3VBOB 4Q4Y1 2WYFA 4JI2O 1Q90D 3PUSA 1NG0A 1D5AA 5DUUA 1Z78A 5CNAA 3MF6A 3S0MA 4F7ZA 3OT7A 1OFSA 3N9LA 3WZ1A 3A4UA 1DHKB 3CHXA 2R49A 4QKNA 4Q8KA 4TV8B 1W90A 1XYOA 3HOBA 1AZDA 1UY0A 3E22A 1QNMA 3ZXDA 5FIXA 2RDRA 2JDYA 5C8WA 5JH7A 2XJVA 3T0DA 2LGQA 5A1FA 1W9FA 3T4ZA 3OE7G 2WL1A 2UU9O 2RS52 3C3SA 1ZLZA 5KMGA 3J7HA 3I2FA 3M1HA 3JD73 4AL9A 5ACA1 2HHHO 4QHZA 1ND2C 2HEPA 5A6QA 2GC1A 4CA9A 4WM7C 2VVEA 1PKXA 3V65A 3CJIC 4XTMA 2L9LA 1Y74A 1MS8A 3LEMA 3AP7A 1RUD3 3ZXLA 3MIBA 2ZGMA 4KUMA 4A7ZA 1IS3A 1QY4A 1G9AA 4QQLA 3W59A 4LBNA 3NRUA 1UU4A 3NAPA 3VBBA 4Y1VA 2QZ2A 1ULOA 2W1WA 4PV1B 1N32B 4MHUA 4XVHA 2GC3A 1PVC1 1EPZA 3QTCA 1EZJA 3DL3A 4XJAA 2G38A 2QQWA 3ZPOA 5J98B 3KS7A 3OD0A 1BQPA 4CEYB 4CPBA 3USUA 3Q8CA 2VOTA 1HRI1 4CU6A 4DR1B 1K3IA 5DUWA 5FY4A 3W7SA 2BBAA 1CAUA 4XEZA 4TWTA 3L9JT 2HEYF 2YROA 4AFAA 4LLOA 4RHV1 3OY8A 3RBZA 4BQ2A 2RMU2 3FHQA 3VKMA 3WF4A 1JU4A 1CIWA 1JTZX 1NVPB 3TETA 1W3XA 1F2NA 3ZDSA 3CPWU 5FYVA 1N32O 1URXA 3EBRA 2ZOEB 4RQPC 1AR93 1OT5A 2EIJC 5A32A 1M4WA 1PNGA 4XIOA 4EN9B 4NRMA 5E89A 4B3MO 1GWKA 3I2OA 1I5ZA 4LHSA 5CKNA 3T2TA 2HWB1 1K3EA 1I6XA 2BTVC 3LPGA 5CFCB 2VQAA 2F23A 5A3LA 3K9SA 2V5DA 1BEV3 1PO23 1IXMA 4XDOA 4LF9B 4DR1O 3OGJA 1QLNA 1DDLA 3RYHA 3ZXEA 1Y3TA 4I02A 3FLPA 1IQAA 3PVOA 4JYBA 2B1IA 2VL4A 4BPZA 4BQ1A 4ABMA 5J96B 5EYXA 2QJ1A 4ET7A 2ZHKA 1PMIA 1V6KA 5LP6C 1XBLA 2AHZA 3FL7A 1R3KC 4XDLA 2DVAA 1ULPA 5FKBA 3Q8BA 2GUZB 1D2DA 3CMEV 3M2MA 3LDEA 3NJXA 2BGCA 2VTFA 5LHIA 2X5IA 5FJKA 2QE7G 1UIJA 2XKPA 1L0LH 3J7LA 2W6IG 1F8VA 4LO7A 1ASJ3 4L9BA 2W0XA 4PIYA 4MS2A 1LESA 5EYYA 4AILC 1ZZ8A 4LF9O 3H1LH 3PIJA 4M00A 3VBRA 3N27A 4UCUA 3NNFA 5A2QN 3MDPA 4M4PA 2PTMA 4BYYA 4XMAA 1REDA 1IPJA 5FP8A 1GN4A 2BJSA 4YW5A 2QA4V 1SBFA 2RDNA 4W4ZA 2ZKOA 2XQXA 2QQVA 2BOIA 1AR63 4B7KA 5FY9A 2G4IA 3AG3C 4FQ4A 1GQHA 3C8XA 2RM22 3UGHA 4RR3C 1IS4A 2PAMA 3PMSA 1K5QA 4U3JB 2YSUB 4QPGA 2RMKB 1EAH2 1G7YA 3PUAA 1NTMH 2DV9A 1MACA 3FX7A 3AZYA 1TUBB 5C8YB 4B4RA 1IOAA 1SPPA 5IW0A 1YWKA 1WZXA 2R0FA 2BTOA 3VOUA 4NWWA 4OI4A 1BK0A 4ZBMA 2D3RA 4ASKA 1GFF2 5K9YA 3ZIXA 3HB3B 4XJWA 1MZ5A 5HXVA 2CTVA 1TVGA 1KYOF 3CJXA 5CAZA 1GNYA 5C3QA 1O4TA 1PZ8A 2CH7B 2LROA 4GJYA 4XIKA 4I01A 5FY8A 3UKVA 1I1EA 2VQEB 1SQGA 2RHPA 2AEZA 2RS31 5M0TA 2DYRC 3M3OA 3RVHA 2CE4A 1GV9A 4XILA 4HNAB 1V6JA 4Q0UA 1R3LC 2HFEC 5AVAA 3H1IH 5FUIA 3ZR5A 4LUMA 3OSDA 2ZMNA 5JCOA 2ZAHA 3MAQA 1NZ6A 4PJYA 3GXUA 4JZGA 4TUYA 4GKXA 1HXS1 5IT6A 3DC6A 4LNVA 3ORJA 1XRUA 3M4FA 5F32A 5FLIA 2YEVB 1SQXH 1F5JA 1R1A2 4Z82A 2ARHA 2B1GA 1RMU3 2VQEO 1XBFA 3D3IA 1G8WA 2VZPA 1FXKB 2JE9A 1VB4A 3DN7A 1F9KA 4YVSA 4O4IB 4FQZA 2WLJA 4R6ZA 2LO1A 3X2QC 1BMV2 4P9GA 2A6WA 5EZWA 2J1TA 4JKKA 4MHRA 3LA7A 2YU1A 4UUJC 3H1JH 3JASB 5BXXA 3BKZA 3HKBB 3ZFGC 1E79G 1S0GA 2XAGA 2XJPA 1KBHA 5EXOA 1ZA4A 4CC6A 1FV3A 4Y20A 5B3SC 1ZRCA 3ACHA 3ELNA 5FQ0B 2RG4A 2OQ6A 1PGW1 1XNRB 1RINA 5EYPB 2EIBA 1UQXA 5BNPB 4AEKA 3IDCB 3E5XA 1XREA 4ZU7A 2VVDA 2ZX1A 3JSNA 2QQPA 1JBCA 4NPRA 1UKRA 1WA6X 4CS4A 1DYKA 1V9U2 5A3MA 2PHXA 5T5JA 1W6MB 2L35A 2IH3C 1NA1C 4B29A 3VQVA 3ZX7A 1ZM1A 4DXRA 4CDWC 4D7YA 4J41A 4CCEA 3RN4A 4FSJA 1VBA3 2XH6A 4DW1A 3S7IA 3VDDB 3NV4A 4KG0A 1JOBA 2V4DA 3DKWA 5EBLC 2A1XA 2YBSA 4HMZA 3N7MA 3OCPA 2ZGLA 5C6CA 4GAZA 4NTYA 2VCBA 1VBD2 2LUWA 1Y6XA 2R9RB 3WDYA 2P37A 4WVVA 1QJEA 5J3UA 4LF8B 1XNRO 5LBEA 2W87A 3R0RA 2Q73A 1NY72 1B06A 2WAAA 1Q8QA 4I3GA 4YVWA 2QWQB 3CRRA 1YLLA 5EFUA 5GLVA 4RGAA 2VXRA 3G6BA 1XMOO 4JTCB 2XL7A 5FZCA 1V9PA 3FB6C 1M56C 1VARA 4D8MA 4OCTA 4Q20A 1AX2A 5C8CB 4UFJA 2XVKA 1V54B 4H55A 5L9RA 3O0VA 4FMTA 5T54A 2XOMA 1DGSA 1EFRG 3ZMNA 2ZX4A 4I0XB 5JI7A 2VOXA 2VMCA 4W6WA 4OQ9A 2P4KA 1RUG2 4LF8O 3WXPA 1BQ0A 3ILRA 4QX7A 1DQ0A 3LKJA 1RXGA 2JWPA 4GWMA 4RGGA 1ULDA 1D2QA 5JXGA 1FYUA 3UGGA 2CTQA 1WLEA 3ZCCA 4NB5A 4PCRA 2Y6LA 1QLEC 2X8KA 2F6BA 2WQZC 3Q8AA 4GWIA 1PGL2 4GX0A 5A6ZA 3B93A 4LIUA 1KDMA 2GTAA 3BTXA 1NVPD 1Y7BA 3SYOA 3IC7A 4KHPB 1RHI1 4DINB 2YB7A 3BN6A 1SC5B 4LF5O 1PIV1 3AM2A 1QH7A 2ZDIC 1AR73 4AGVA 2ODMA 2D40A 3M8LA 3N7JA 2PAEA 3JARA 1VQNV 2YGMA 4BQWA 4X20B 5A1LA 2EIDA 2A6ZA 3ZRWA 3L70H 1VE0A 1WB8A 2DU0A 3FZ3A 1XNBA 2B4KA 5SV8A 3ALQA 2WJSA 1W6QA 1QXJA 3SQOA 4BQXA 5DAVA 1R093 4XAEA 4LITA 2VCAA 4Q26A 4Q4V3 4X65B 2JDMA 5F39A 4JC1A 4RYDA 5D8AB 4PDWA 5AVPA 3ST7A 5JI9A 4KHPO 2JKBA 4NPLA 1XXNA 3KF5A 4NE9A 2BPA2 1DLLA 1YVWA 3PVNA 3JATB 3WW2A 1ENVA 1XU2A 1FOD2 4BCUA 2J1SA 2UXDB 4OHZA 2A0LA 3GBWA 2BDRA 3VD5A 2RDQA 3ZMOA 1LTEA 4NROA 3BODA 2WR9A 3POIA 4OGQB 2QQJA 1JCHA 5FYUA 3JAKB 1SQQH 5IVCA 2VNOA 1K92A 3ZX6A 5KHHA 1KS4A 2Q8VA 2H0BA 1S5HC 1Z2GA 5SV5A 4FBFA 2Y4TA 2BOCC 1UFIA 1RUD1 3AG2B 5T52A 3BALA 4E2QA 3WF3A 2HG5C 3AZXA 3R4SA 1PK6C 1UXZA 3O1PA 4FIPC 3NV3A 5F1RA 4XDQA 3OTOB 4LULA 3N2KA 2QQMA 5FZMA 3ZXGA 2C1FA 1CVNA 1JX9A 2WLPA 3GJAA 4QPWA 3HPLC 4Y1XA 1W2UA 1AJQA 4OI1A 3N9PA 1THZA 1H6YA 1CPYA 1P4RA 5FP3A 4C91A 2OKXA 3T1MA 3RYPA 5DZEA 5EIBD 3AMHA 3OBTA 2FB5A 4IV1B 4YGCA 2N04A 3CCRV 2XHKA 1PV0A 3SJBC 1Q43A 4EV0A 4AZZA 1AYN1 4J9YB 3AK0A 3K08A 3K3WA 4EKWA 3R6SA 2AC1A 4XJ8A 5J36A 4LCUC 4JQRA 1QHDA 4LO4B 2HP8A 5C7GA 2DF7A 5GLWA 3VQWA 5HPOA 3ETGA 2FBEA 4U2AA 3ML0A 2RJKA 4R4ZA 3FAVB 3OTOO 4JGYC 2WYSA 5E16A 2FMDA 2VZQA 1DLBA 1W2NA 2OWOA 4PBPA 1NX9A 4EWAA 2YGLA 1U5ZA 4DOUA 1FMD2 1DF5A 1NE6A 4AAPA 1BQZA 2ZZQA 2EBOA 3SYQA 2QSAA 1AR91 3GM8A 2XOKG 1QKQA 2R72A 2RCVA 3POBA 2FDHA 2BOJA 3I2DA 4WV8A 3VBSC 3RWNA 1J1TA 4CEWA 4FAGA 3T0BA 2Y69B 1BEV1 1PO21 2WFF3 4O9GA 3OW2U 4URTA 1S2KA 5FYIA 1K5SA 4HFSA 2BEOA 5CZKA 2WZPP 2C4XA 3LFMA 2AUYA 5BNNB 3IDAA 1W04A 1RUH1 4MXWA 4DB5A 5IWFA 3DPRB 4CXXA 1OFNA 1VAVA 1WMDA 4WVWA 4FLYA 1D7PM 4DK0A 4QDRA 2ZNJA 1A3KA 5IT9N 3VUOA 2F66C 3IPVA 4PELA 4QHBA 4HPKA 5FAXA 4AI3A 4Q4W2 3WHTA 5F8PA 3WUCA 1K42A 3SGIA 5A3UA 4NRPA 1D5NA 2UYBA 4AR2A 4BH9A 3K3NA 1ASJ1 3FBYA 1XHXA 4I2OA 2KD7A 5DAWA 4TSFG 4LK7A 4Q0PA 3WP5A 3WQ0A 2WNUA 4R9CA 1XSRA 3I4IA 2QWPB 3VL9A 3CZJA 2EIGA 4H7MA 1PMHX 5FPVA 4QE7A 1NU1H 1TGOA 3Q8FA 2BNNA 1JFFB 2P7TC 5IVBA 4O4LA 4Q0VA 3KV6A 3K75B 2ZE5A 2OCCB 3CC4V 3CJIA 4OQ8A 3ZHTA 3E6DA 1K9MW 1AR61 3IMNA 3OB8A 4MH0E 4NXNB 5JUVA 3KCXA 1QEXA 4V2WA 1NUKA 5C93A 1UOJA 3TEXA 4X1KB 3MIGA 4RGKA 4LBMA 5FZKA 3SISA 4GX1A 4M3CF 1BCXA 1URFA 3WD5A 4JGZA 1OA2A 1WCDJ 1C8M1 1C5HA 1VQ5V 4CDQA 3AXDA 4DR6B 2VMHA 4CEYC 3ABMB 3OTFA 3VHRA 1HJFA 2WABA 1CZVA 2A71A 4NTWA 2XWBB 3DXTA 2ZKLA 5F2VO 3SCGA 3VBUB 1W8HA 1WW7A 2KKWA 3UO2A 3GHNA 4IUGA 4O61A 1SCRA 4RA0A 3OMAB 5DZFA 4BDVB 1JJOA 1LAJA 3ZXAC 5JSPA 4CUAA 4CS3A 2JENA 1HNZB 3IFXA 2Y64A 2AREA 2D6LX 2EVXA 1FAFA 5BY1A 4RFRB 3WV6A 2XJRA 4GD4A 2UXBB 3KHBA 4XUQA 4PA4A 1OXCA 1OF3A 1I08A 3WSOA 1IPSA 1VBC3 2DFBA 4DR6O 2JK5C 3P3NA 4DRVA 4GYCB 3OYWA 3PUQA 3ILNA 2W6JG 1AR83 2B42B 4NIGA 3H01A 1AYM1 3VQYA 2FMLA 3J8F1 4WBNA 4K8FA 1R092 3KV5A 1XE7A 1RTVA 4K21A 1SDDB 3LA2A 5GLZA 3PVEA 2QQIA 1RMU1 1LU1A 4LFAO 1WWYA 2WWUA 4WFAV 3G7DA 2DYCA 4HN1A 4HAMA 1MMMA 2HWF2 5HCBA 3ZFEA 3I2IA 5FZEA 1HNZO 1GZWA 5FRAA 1CAXB 3G4SV 1CAWA 1OCOB 1N1VA 3JB4C 3UQ8A 3JBG2 3TBDA 2RS13 5A7WB 2UXBO 4TN7A 3ZM8A 3M3EA 2FDJA 3U4SA 3S30A 1ND3B 1CZTA 1SZTA 5C9AB 1KS5A 2GZWA 4B3RB 2Q4PA 4W4KA 2VVFA 3AFGA 3LDBA 3UNPA 4K6BA 3GZAA 4CCOA 1TUBA 3FYEB 2ZCWA 2BYVE 1VBE3 2XBO2 3RVZA 3KSCA 4LBOA 4YJ2B 3RYFB 4GB31 1VBA1 3NXSA 2ZEZA 3BTAA 2WS91 1P84F 2F43G 1YHFA 5LZ6A 5KA6A 1D4M3 4DUZB 3MICA 4WM8B 4UCVA 3L9DA 2WSUA 3N2GA 3RQ0A 3SH5A 5GZEA 5CA3A 2WZ8A 4EJRA 3EMRA 2VUCA 1W0KG 1OUXA 2DURA 1CX4A 1VQ6V 2YV8A 3NSTA 1H1MA 3UT0A 4CUCA 4B3RO 2R072 3ZEDA 3KGLA 2K9PA 2R062 5EIBC 4DW0A 1LGCA 1C1FA 4MADA 5LL6Y 2ZXWB 3VDAA 1LOBA 1AF9A 5I0UA 1BK1A 3VDBA 1W9WA 5K8SA 2XLGA 5GM0A 1SQPH 5LA6A 1GP6A 3OUJA 1BKZA 1TQ5A 5HI0A 1SESA 4EZ4A 1M5IA 4JDOA 1W6OA 3F95A 3T0AA 3RI8A 4RL7A 5D5QA 3E97A 3L75H 3UESA 1JOPA 4DUZO 4LKFA 1GRJA 2XMLA 4MSWC 4N53B 1LOEA 3M99B 3W58A 1PNLA 2JEMA 4HSLA 4DR4B 3IC9A 1YO8A 4HL0A 4AGRA 3WW1A 1K73W 2F4LA 1JI6A 2ARCA 1Q6UA 2XJSA 4N23A 4E27A 1NKDA 1BHBA 3ILFA 5KHJA 3KB5A 2R042 4LWSA 2WZEA 5JVDA 3GB7C 3TN93 3HKBA 3B9IA 4MTGA 2Q5ZA 1T2XA 1O3QA 1UKGA 1YXWA 2YZ4A 1S0BA 4KWKA 4ZZ8A 4LBQA 3AK3A 3BAAA 3OF1A 1VRH3 1FT9A 2FMYA 4UF0B 2AACA 3PNAA 3DC5A 3OR6C 1JZ8A 1WJZA 1TZOA 3CP1A 3BU7A 3CIHA 2Z3YA 1FXKC 4CDUA 3N9QA 3EXUA 4GZ9A 2F1MA 5BR8B 2JKXA 2ZPXA 4YXWG 4DV5O 1AR1B 4YJ3A 4DEVA 1GN2A 2HEWF 2DUOA 1JYCA 4HG6B 3T4HB 2Y6HA 3VBFA 3OBZA 1L7RA 2YU2A 5LHHA 4ITCA 5F7UA 4TZDA 5E79Z 2GDFA 3AK2A 4GQ7A 1PD3A 3G71V 3ZFGA 1RPRA 4Y5Z0 2VQTA 1VALA 3WG3A 1HKDA 4S2GA 2DBIA 4IE4A 1M1KW 3C7FA 1BCCH 4HLTA 3WY6A 3U07A 1AP6A 1BMFG 4UCSA 1MR5A 3IM0A 5B66Z 4Q4V1 1FPN3 3MIFA 3GCXA 2XJQA 3WB2A 4QAWA 3NV1A 3BPZA 2HYXA 2F93B 3UT5B 1WCUA 2P17A 2WAOA 5BR8O 1QOTA 1YZBA 5EC1C 5EJ1B 1QVGU 3SNMA 4QQ2A 1VMJA 1NA1A 5FZDA 2YFZA 1K4DC 4ISRA 3NVCA 2X6AA 1Q56A 5ISLA 5H2FZ 3V0BB 5K1XA 1QU0A 5IYZB 5FZ9A 2Q30A 1UIKA 1WNSA 1XB9A 3H3ZA 3MHHC 2UUBB 2F4PA 5BNQA 4XW3A 4TV9B 1K34A 2QDRA 4L99A 4L8JA 4HETA 4EB6B 1YQ8A 5C33A 5EZYB 1SQVH 1AR5A 4KP4A 5FZOA 1GSLA 1OOPA 2GMMA 3CSXA 1DP0A 5JXHA 4GWNA 4QDSA 3GYDA 5B1BB 5CG8A 3N7KA 4ZHQB 2A3YA 2W1SA 1K5JA 1V54C 5JR7B 2IVJA 2ZACA 1O4ZA 3I3QA 5DAPA 3L72H 5CBHA 3VD4A 4XC9A 5KHKA 5FYBA 3OUFA 3BTYA 3FMGA 1MSWD 4DPNA 2XWJB 2VMFA 3LPFA 1QOSA 3FHIB 3B69A 4ASUG 4META 1MS4A 3WX5A 5LBCA 2UUBO 5ERLA 3WQBA 5L7OA 5FMOL 3WF1A 1KDKA 4GX2A 3WDUA 4DUWA 1VBC2 2RR12 2ETEA 2NP0A 2H0VA 5IFPA 1US3A 5FYZA 2DWRA 2EAKA 4CTEA 5AC92 3CX5F 5FZHA 1WW6A 4QB2A 3VBHC 4X66B 4AFDA 2XONA 1VJ2A 5GZDA 1SZXA 4QPYA 3M7MX 5JOWA 2YI9A 3ZHRA 3RWKX 1Q8IA 3RYIB 5JXIA 2IUWA 4V2VA 2JE7A 4LTAA 1EPWA 4OYUA 2Q68A 1JQ0A 4NHYA 1UZZA 1S0VA 1TNFA 3MW4A 4IESA 5DDJ3 4UB6Z 3AK1A 4LKSA 5FOJB 1VBB2 4CCKA 2CV6A 2HYKA 1PM7A 5C4WA 4FPLA 1SLAA 3U4XA 1EAH1 1F4AA 3E1F1 3MBWA 2Y34A 4LT5A 4YRDA 1ZBE3 1C1LA 1Z0HA 1LODA 2V4AA 4X66O 5H6RA 3K06A 4EFEA 3WDVA 4X6RB 4YY3B 2VWJA 4M3CE 2Q7EA 1OMIA 4BXSV 2Q0AA 4JAVA 4HKLA 1UU5A 1N47A 3JAMN 4LHLA 4MTXA 2ZABA 4XCAA 1EM1A 3TEWA 5D8AC 2VJXA 5CBLA 1W9SA 2XUMA 5JQGA 2JS5A 4O65A 5BNOB 3C90A 3BCCH 5FFOC 3UJQA 4B08A 3HKEA 3AG7A 5LMUB 5FZGA 4UFLA 3IIAA 1KMIZ 1W2OA 1R6KA 2JDPA 4AVSA 1MA1A 1RUC2 3POEA 4XTPA 3A8TA 1S0CA 4COVA 3O14A 2G9GA 4E9KA 3RVYA 1QQCA 3D5OA 1O3SA 1Z7S3 1RB8G 3IZOA 1H2LA 4NVPA 2GC2A 1YRZA 1UW8A 1YJNV 5CBGA 4HKWA 1W05A 4KGGA 3AG1B 4YY3O 2CSGA 3JU9A 3SEPA 4YGDA 1JZ4A 3T1LA 4YWAA 4LBLA 4AVVA 3FFZA 2YS8A 3E22B 3DCQA 4E4HA 4CU9A 5JH7B 2O8QA 1K5MC 1HQNA 1G9FA 4XFAA 1R1ZA 4L2NA 1PVXA 3D3AA 4B1LA 2WA3A 1JOYA 3ZXKA 1ZBA3 5LMUO 5EPAA 2IVIB 5KMGB 1VAKA 4NN0A 1BMV1 4AVTA 2LS6A 5ITZB 3SYCA 1B35A 3SEEA 1OKQA 5CFDC 1X8MA 2BWCA 1FKAO 2JJ6A 3I97A 2KSDA 1RJ8A 1W59A 3SR2C 4C1WA 5A6YA 3GZEA 1FJGO 3AZWA 3MHZA 4GCZA 4W6YA 4CP2A 3LOBA 1C5IA 4QX2A 2P5OA 4IV1C 3NAPB 4LO6B 3WDXA 2QQNA 5HBAA 3TEZA 4XUNA 1TVKA 3POFA 1RUJ3 4MW8A 4YM3A 5IVJA 1ZRDA 4NR1A 2RN9A 1LGBA 1JUHA 1N8RW 4FI9A 4XXPA 2N74A 3J81N 2F4VB 4J7ZA 3AYCA 2W3JA 4GULA 3RZHA 2QGNA 2WFPA 3RZZA 4FP3A 5CKQA 4COUA 4CCCA 4DS0A 4LKEA 2K0GA 3SJCC 1H2NA 4DFSA 5H6QA 2QR4A 4DK1A 2QM8A 1N3PA 3TCUA 3USUB 3JD1A 4PDVA 4Q8LA 5LMNB 4YNIA 2PYJA 1CAUB 5CKMA 1DQ4A 1R6NA 3OY8B 1K8AW 3HIFA 4JDMA 2W47A 3HQXA 1NY71 2Y69C 1J3QA 2MW2B 2YY1A 4I0AA 3H8XA 3MZHA 1Q6HA 3VBSA 1AR81 2JGDA 4FPKA 5G05L 1XILA 3K4AA 5JWPA 4BAYA 1NT2B 2XAHA 2A3WA 2F4VO 2HWE2 5A32B 2YICA 3HNBM 1IDSA 4BISA 2X6CA 3DPRC 4YM1A 1UOBA 4B3NA 2DUPA 2TUNA 5L19A 4DXTA 3CCJV 5FXXA 4NHLA 1GWMA 5T3NA 3P30A 4HKOA 5C5UA 3QO5A 4DUYB 3CCLV 3N4MA 3RYHB 3VN4A 1WA4A 4AVBA 4JRAA 3MLJA 5ACA3 3SPGA 3KCYA 3LDDA 2QQOA 2ILMA 4RWUA 2WT0A 2R6QA 4H0LB 3LD8A 4X1KA 2RVAA 1H4GA 2LRPA 5DXDA 4QGNA 3UYJA 4XBQA 3JD4A 1PZ7A 1W6NA 4KNCA 1RUF3 3RJ2X 4AE2A 5D1IA 1H8TA 3TJTA 4YFZA 1TMF2 4DR2B 2UUCB 4P9LA 3V0AA 4LORA 4D6RA 2QFEA 4KI5M 1LHWA 4MGTA 3FB5C 5DABA 5FP7A 2X5IB 2WAMA 4CH3A 1VPHA 3I59A 5JSOA 1HRV3 1SQBH 1XJAA 2UU8A 1RP3B 1DBNA 1PVC3 1QJY2 2O57A 1D4M1 4I5SA 2DTWA 1M93A 4DUYO 1LR5A 2JDIG 1HW5A 3MUZ1 1V6IA 2J1UA 2ZE7A 3ZBHA 2ZNIA 4UCRA 1EV13 2IC1A 1T6BX 1ORQC 1GR3A 1POV0 4DR5B 3CRQA 4FFBA 1SETA 1SZBA 4CCJA 4P9XA 4YG0A 4A45A 4D94A 1YHQV 1A34A 1QQP1 4AG4A 3CBNA 3WVJA 1HRI3 5EQUA 2HWC3 1GZCA 3BI3A 4DR2O 2UUCO 1PNMA 3CCQV 2AENA 2FDGA 5IVEA 4QPIC 1S2EA 2PHDA 5I0RA 5AFEA 1FATA 3CE2A 2PHFA 3WF2A 3P1IA 1W8OA 1UOFA 1JUIA 3VBUC 1YFYA 2CHHA 2HWD2 4QPGB 1XOUA 1QCEA 1QR8A 5EC2C 2ZZJA 2JB4A 1YFUA 4I09A 1JYWA 5IYDO 4QHOA 4X62O 1SPPB 2PF4E 3PJSK 2AZ0A 1XHZA 4P08A 2EIMB 4H44B 3NO8A 1N3OA 4BQ3A 4DR5O 4B7EA 2WO1A 2Z5WA 5E6HA 2BOBC 4JRLA 4KFMA 5GLUA 3TN91 2EINB 2GH2A 2XQRA 4LF6B 5FZ7A 2PYLA 4X64B 2KM2A 4RS5B 1WLWA 4G28B 3LSDA 1KEXA 1AL22 1H9PA 2YPJA 1PO12 4QDQA 3H3LA 5LY2A 3RMYA 1UCXA 3TRSB 4JTAB 2VZRA 4M4RA 2VUDA 4K3UA 2A6VA 1N1YA 1VQMV 2B9ZA 3WP6A 5KWRA 3QOPA 3IBMA 2Y60A 2ZMKA 4XQWA 4NOTA 1WW5A 4TUYB 4QMAA 3FLTA 3O1MA 3HMYA 4BXFA 5A7NA 3H1MA 5LBFA 2ZD9A 3ZLIA 2DQ3A 1K45A 3K04A 1OCOC 1YNAA 4MGKE 2GU9A 2QKDA 5L3DA 1LU2A 2ZGOA 3ZDVA 5FBZA 3OGIB 3DSQA 3KKYA 1R6TA 5IWAB 2VG9A 4Q6GA 4TYSA 3DYMA 4LF6O 2DE0X 2R9AA 4X64O 1ND3C 1HNWO 3IIIA 3E8HA 3LA3A 5C9AC 1EN4A 5JIUA 4YVSB 2GNBA 5KA5A 1ZVFA 4Z1MG 3RYCA 1LKNA 4JYYA 4UFMA 3AYAA 4YARA 1DQ1A 4MVTA 5GKAC 1I5PA 4CRQA 2OPWA 5FPZA 4PLNA 1F4HA 5IK5A 5FZFA 3U10A 3O1RA 4I50B 1BVP1 4QX3A 2PELA 1GKFA 4DV0B 4Y4RA 5IJ9A 1G86A 4CDXC 2G9FA 1OD3A 4Y20B 4UBHA 1W3VA 1BSMA 4QB6A 3WHUA 2IFRA 4LKDA 2JECA 4TXWA 3ZSKA 4U3FH 4DV6B 1SKVA 2CUGA 3B8MA 3AYEA 4CYDA 2VRZA 5LASA 1UX6A 1PX3A 4ZXEA 4LNUA 3RNSA 5FUNA 1VQPV 1H6XA 2WSVA 1Y66A 3ATGA 2CL2A 3ZKUA 2CGPA 1F4NA 4QJFB 4ZIBA 2HLEA 1AI7A 4FM0A 2J22A 1NR7A 4GZRB 1PHMA 2VC9A 2ZEYA 4QD2A 5A7QA 4OI2A 2NLJC 3WCSA 3LNMB 2EXJA 4MYEA 1GM9A 3ABLB 4AHCA 1RVF2 5IJ0A 2XTAA 2ADQB 4R9AA 5EV7A 5CG9A 1O8PA 4L97A 3ACLA 1UJWB 3E5UA 2RS33 4MVUA 2E74B 1DYPA 2M6YA 3O9OA 4J1WA 4Y22A 2XT9A 1AX1A 3PURA 3VKFC 5KR7A 1K12A 2M7WA 1QNWA 3VB9A 5LRSA 4PQ9A 4CCDA 4N53C 1COV2 4JTDB 4QKDA 5BMVA 4URAA 3RZJA 4YVWB 1YI7A 5T5PA 3FYIB 2EAAA 4XETA 1Q8PA 4Q4X3 1AI5A 2XASA 4BIZA 4Q4W1 1HXS3 4ORFA 3AVRA 3I49A 1VB2A 4QGLA 3DKQA 1CJDA 1QMJA 1WLDA 1Q3EA 1WMEA 3ASNB 1V6MA 5EHDA 3VHPA 3RYRA 3KCCA 4Q4Y2 3VHNA 4QM9A 5I0TA 1IG0A 5E1AC 1DQ5A 1R64A 3N35A 2PLV2 5F6KA 2DUQA 3ES4A 2FDIA 3T09A 1MEC3 1MS3A 4DXSA 2PHTA 2VCMA 3KF3A 4EWDA 5IYBO 4INDA 3WG7B 3AKRA 4LFCB 3BOWA 1BBT2 2N7GA 2ARXA 1V6OA 2ZKNA 2AH2A 4IV3C 1PPJH 2NMNA 4CPBD 3ZVXA 1UYYA 4BE3A 2JDNA 1FXZA 4NIAA 5DDJ1 2OIEA 1W0PA 4F3JA 2EICA 1S2BA 5EJZB 3CRCA 5G04L 5F37A 3BIWE 2E51A 1GN3A 4JHZA 1HV1A 1DZRA 5CYYA 4QQPA 4XOGA 2LALA 1YQ6A 4IL7A 2VE1A 4Y1UA 4Z92B 3O0WA 4COZA 1JN2P 3SH4A 4J7KA 1F23A 2BUKA 2HKXA 4LFCO 3CNAA 3ZYGA 1IBLO 1QH6A 3BABA 3JARB 3J7AU 4ZHQA 4PDRA 1H2SB 5F5IA 3ZJZA 4BR6A 2YIAA 1V6NA 2DCZA 4YG6A 1D0HA 3ZRWB 1V0AA 3FX3A 5I91A 1KECA 4X9QA 1O7FA 4OLLA 4HXCA 4EFBA 1W9YA 1OLQA 2UYAA 2DBNA 1VF6A 4D7SA 1APNA 5LK7B 1Z7S1 3KM5A 4HVOA 5B4NA 2ZJCA 3VZJA 4PDWB 3B09A 4XABA 4LO8A 5J37A 2E31A 3OEEG 3AFKA 4RHV2 3ACGA 3IGAC 1SLBA 3DXUA 2JB8A 4Q27A 1XPWA 4GKYA 1VR3A 1JZ3A 2A3QA 3SJQC 5TISZ 3DECA 2JXAA 1H8EG 4GWJA 2F17A 5JDBA 3A0NA 1ZBA1 3VD3A 4LXLA 2UY9A 4K40A 4JI3B 1LOGA 4D69A 3EO6A 4DV1B 4LE3A 1DZQA 2W1UA 5JJJB 3E86A 4MGSA 4L87A 1XE8A 1YIJV 1LUWA 2Y26A 5BYNA 2HWB2 4LUKA 3JSLA 1JYIA 1DZTA 2EF6A 5IHRA 3K46A 3S6PA 4BIFA 1R083 1YTFB 3T3YA 4UXNA 2LGWA 3L2HA 3NNGA 4YHHB 4I55A 5CA0A 4W65A 4J42A 3AL6A 3EVKA 3N2KB 4HOOA 4BM8A 4OPAA 4IEYA 4JI2B 5HFLA 2GNDA 3KVBA 2ZX2A 1XEQA 1RHI3 4FLXA 5JZGC 4P00B 5DPNA 1JR9A 3ECQA 3RS6A 1PIV3 4JI3O 3QLQA 2BVVA 5LA0A 2VZTA 4DV1O 2QTOA 3VBHA 5KC5A 3LEIA 3W7UA 5B1AB 3GZTB 1PL4A 4JI8O 1OV9A 4FOQA 3CXCU 2DYSB 4XQ4A 3TEYA 3TOJA 4NO4A 1RIRA 1A78A 2AEYA 4WVMA 3UK9A 1ONAA 1YC61 3DEMA 4COYA 3K79A 4YHHO 5GTIZ 4IGPA 3CC2V 2QNKA 4K35A 1M90W 1LENA 2R061 2BV4A 3WW3A 1WAZA 4K0KB 2MEV2 3ETPA 5LA9A 3ETDA 4OUSA 3LSEA 4LBKA 4YFWA 4GALA 4LEJA 4QXCA 1Z5VA 2OS2A 1UMIA 4YPJA 3BPSA 3N3HA 4HBNA 2P6JA 1BGYH 3ABKC 1H30A 3DYOA 2DQ0A 5BNOC 2ZS6B 5A7PA 1GUIA 4CEWB 4ASMB 1US2A 1W0JG 3POYA 3C7GA 4BU2A 4JI0O 2Q8OA 4KQ7A 4MGYE 1ROPA 1CESA 3CLPA 2GV9A 1RSOA 5F3EA 1S3JA 3JALA 4MGZE 3ZS8C 2A73B 5K0UC 3KT7A 5FWJA 4R50A 5ITZA 1ODMA 5FL7G 1JZ6A 4K0KO 4MXWB 1GANA 1CN1A 2E75B 1J95A 5FXVA 1RUF1 4BHPA 4YZ3A 3AP4A 4IEPA 4U7NA 1K33A 1QJU1 1G9CA 2Q8CA 1TA8A 4A6SA 2XHBA 3IPVB 2RV9A 1JYNA 1FFXA 4HPKB 1WCSA 4JI7B 1QDOA 1I9RA 1NH2B 1VF7A 2GNTA 3ME2A 2W46A 5EK0A 4TLFA 3SJAC 1XMQB 4JX0A 1HRV1 2E3CA 3CCMV 4XFFA 4FZ1A 4AI2A 1X4TA 4DO0A 1ZNPA 2H6CA 4A42A 3WNMA 3UM7A 1RITA 2IZWA 2WNUB 3HN3A 1W6PA 2ZGKA 1NCQA 1EV11 4B3MB 3BOPA 1QDCA 4FCAA 2OTJV 3UETA 5AG2A 1BT8A 4MZUA 1AYN3 1YXBA 4O4LB 5CFDA 1KGYA 3LDRA 4JZRA 2HWC1 3CJIB 3NAPC 3MYXA 4CH6A 2GDSA 5L9BA 4OZOA 2PUSA 4CCLA 4N43A 1B3QA 4JI7O 4R52A 3JZVA 2NNUA 5C71A 3KVAA 1XMQO 2RQ6A 1QJX3 4FPJA 1QXPA 2AZ5A 3C3TA 4QX1A 2YUAA 1RUE2 1WLTA 3MEPA 1LOFA 5L9VA 4PT6A 2E63A 1RUI1 4JGZB 3TNPB 1HQLA 2P3JA 2D43A 2ZTNA 3L73H 2B8MA 3WU2Z 2WO7A 4CDQB 3APQA 1PGW2 1WD4A 1QOOA 1NE4A 1W2BU 1U12A 5B5EZ 2IWGB 2UWBA 2Q0OC 4YLZA 5CISA 5J1XA 3NL1A 3HEIA 3HVDA 4Z07A 2J1AA 5KC6A 1JMKC 2E33A 1JODA 3ES1A 4W8JA 5FZ3A 4FXKB 2VQFB 1GQGA 2VECA 4UW4A 3FUOA 4B8EA 4AFBA 2BERA 4LH7A 3PN1A 1RUH3 1G6NA 5JIAA 5BUVA 5FPAA 3AYDA 2YIBA 2R7EB 1L7QA 1MQTA 3UJOA 2FZ1A 4DYLA 4IIJA 1S0FA 5J2TA 5HV0A 4QX0A 3BFRA 2ZAAA 2VOKA 3AG4C 4XQDA 4X8PA 4BMEA 1H8HG 5CB7A 1N34B 4P5HA 1TME1 2EIJB 1WBLA 3OYWB 5JVVA 2P2KA 3SPJA 3LF7A 1W0NA 2QUOA 1LB2A 1Q5OA 4WBNB 5KHGA 4XZPA 1G9DA 4IT5A 4HONA 3EB7A 1UY4A 1QF3A 2VZ1A 4TOIA 2VQFO 2Y33A 3A21A 3ZO0B 2WZR3 2JG9C 5LEKA 1H9WA 4BIUA 1C28A 3NNMA 4BWOA 1XOYA 2RR11 5I0DA 1ULFA 1XNTA 3ZFEB 1Y9MA 1GZWB 4EN8B 1H1AA 2XGXA 1SBDA 1CAWB 5LP6B 4IDZA 2IJKA 3WINE 2MNGA 3CU7A 2ZE8A 3AMMA 2X5IC 4GMP3 4DQAA 2KG7A 1N34O 3O1UA 2Q1FA 3OGCC 2ZX3A 5FZ4A 1GO3F 4RFT0 3T08A 1DLCA 4XFCA 3O7OA 1FX5A 3HBZA 3TWIA 4CZSA 3CWBH 3QCWA 3VBRC 3S3WA 1C8M3 3T4VA 2J1RA 4S2HA 1FYJA 2Y6GA 1OA4A 4PD4F 3HN1A 1AJNA 1VBB1 3EHKA 1FNZA 4FOYA 4NYKA 4XF4A 1L7LA 4C0BA 5GLTA 1MS9A 5GJ6A 2DVBA 2BE3A 5DECA 5IVFA 1WKYA 3VZMA 5E8AA 1JU3A 4XUTA 3E8FA 2VMDA 1L1FA 2W08A 5JPNB 4AWDA 3WDTA 3N2GB 1HB2A 5ABJA 3NNJA 5FZAA 4RS5A 1W2TA 4DV2B 1GOHA 5T5OA 2LQTA 1OSGA 1P8JA 4LLFA 4QPGC 4E4EA 3OOXA 4D7TA 5HCAA 2Z69A 5KHIA 2NPIA 4DY5A 3ZMUA 2A75A 3WNPA 2ZQMA 5T55A 2W1QA 3GJBA 2C2AA 5LOVB 2EIMC 4Q4X1 4CXWA 5IYCO 1CP9A 4CU8A 1RUC1 1OCZB 2EIKC 5LA6B 2RJ2A 4FFKA 1GLHA 4WCEV 2JG8A 3CCEV 3K5NA 2OZ6A 1YTFD 1J59A 1JZ2A 4QGMA 3A7QA 2ARAA 2MK3A 1W6OB 1AYM3 3P3PA 2DCJA 3RZGA 2RDSA 3J8F3 2OIGA 4EN7B 4G9SB 3CQOA 5KUMA 3D0SA 2YFUA 2BTQA 4FM1A 2WN3A 3J9SA 4DV2O 1MEC1 4CCNA 4OULA 2DVFA 2E9QA 5LGTA 4XF9A 2JDZA 4Q0SA 3E6CC 4YW3A 1OLME 4QT6A 4QU2A 4LWSB 4AEDC 1BYHA 5IFTA 5JVDB 4I50A 1HP8A 5E88A 4AF9A 2PAKA 1XYPA 4E8DA 2B45X 2CYFA 4LBQB 2QTWB 1IKPA 4MVOA 2D7FA 2QKAA 2D6OX 1OCRB 4ZKTB 1CPNA 3JD72 1LNSA 4LK6A 5EJ3A 3AEIA 1XYNA 3K2OA 4O4HA 5FXWA 3THCA 4YW4A 1LHVA 3K4DA 2WNVA 1ENSA 2C9KA 5FMCA 4QXHA 1U96A 3LAGA 4FOWA 2IJJA 2VW2A 3H3UA 2XAQA 4YVSC 4CDUB 1RUD2 1OQDA 4FPCA 1XMOB 4JKLA 2JE8A 4AEMA 3BCWA 5KXCA 5IATA 4YW1A 4IE6A 3RT3C 1JW6A 4YJ3B 1U5IA 3M3CA 1AI4A 4N7UA 3NR7A 5FWEA 4GB33 5CA1A 5LYJA 1DGWX 2WS93 1VIWB 5I8TA 2H3OA 1OKOA 2NR5A 4A41A 2R1BA 2FD8A 3VBFB 5FO8B 3MF9A 1BS3A 3X2QB 3R66A 2TNFA 2Y38A 4Y5TA 1YI2V 4NHKA 3ZFGB 3CCVV 3I2GA 4CDXA 2DMXA 1G6UA 5B3SB 2FCUA 1WB7A 3N9NA 4B4PA 2CDOA 1ZA7A 3VKOA 3HT1A 2MHFA 3B9CA 5J09A 3RI9A 4N21A 3RSJA 4UFHA 4AYUA 1W8UA 5A3PA 3ABLC 3Q9OA 1C3HA 1NA1B 5JOZA 3CJHA 1PX4A 4H3WA 2E53A 2KXLA 4AHYA 4RQEA 4GX5A 1EUUA 4FVMA 1NH2D 1UPSA 2ET7A 3CCSV 2BNMA 2FCTA 4BJ0A 2NMOA 5A9GA 1STMA 1FS0G 4LF5B 2HWE1 1X82A 3T2MA 1MVEA 2VUAA 1AR92 2WINB 3QO8A 5D21A 4WFBV 3T2QA 5T5LA 2TEPA 3WG1A 4JAUA 5FZOB 1OOPB 3B40A 4P9OA 3MHSC 2H6BA 2XVLA 2RS53 2ZINA 3KV4A 1WP7A 1BEV2 1PO22 1ZZCA 3STLC 3A2FA 4IEXA 4HN0A 1R081 3POSA 2VMEA 4PIXA 3B01A 4YZ4A 2R30A 2YBPA 4AI0A 1ODNA 1AR4A 1TAEA 5CVRA 4XF3A 1M56B 3BEHA 2WO3A 2IU3A 3OFNG 1SHWB 1IGOA 3EYPA 1S0IA 2QBXA 5GONA 1GBGA 1FI2A 4LQRA 4D0QA 3NMBA 2Q8EA 2A3XA 5L7OB 5B4XA 3WG7C 1IKQA 4HSJA 1XNCA 3WEZA 1UF2C 4DNYA 1Q8SA 5JJNB 5A7OA 3ZRSA 2JD4A 1X9TA 2VY0A 1ASJ2 4KU7A 4AHZA 4RQFA 3I2KA 4NPMA 4AVCA 2K2SA 4IV3A 2HBTA 2D97A 1VQ7V 4OUMA 4O4JA 3E8BA 3CEIA 4KH9A 3MLLA 5E1RA 3A23A 1AX0A 1QLEB 2QKSA 3EQEA 4ZI7B 2JJ1G 1UN1A 4FO9A 1H38A 2Q7GA 5A7SA 2Y6JA 4XXAA 1WW4A 3M8AA 1S5LZ 2RMU3 1FXHA 4XUOA 4XJ9A 1S72V 3W7TA 1KKDA 1AR62 4C1XA 3VHOA 2K9ZA 5TSWA 3KWVA 3IJ4A 3MUY1 4R4XA 1GMGA 5FV3A 5I8SA 5C4WB 2X10A 5LA1A 5FY1A 3AMPA 1IHMA 1EN5A 4KL1A 2P6HA 5FMDA 3NV2A 1AVMA 4X8NA 3ZHQA 2D6PA 3I3MA 4ZOLA 1JYXA 2GNMA 3K9AA 4P9JA 2FL4A 1UPIA 5B1NA 4Y1ZA 2ZHLA 3O5SA 1ZX3A 4LOSA 4PDWC 2B9VA 1J84A 5JQGB 1CAVA 1GH6A 3ETQA 4P2ZA 1VMFA 4W6XA 1DG6A 2VWKA 2X09A 1SLCA 3D3QA 3OUHA 5F2WA 2JIGA 3HKEB 4FLZA 2CWSA 2IXJA 4COWA 1IBMB 1RGSA 2XDVA 1SLIA 4PF1A 4XPVA 5LHGA 2VAUA 1M4UA 1AL21 1P7BA 3IN9A 1PO11 3KT1A 5JPMB 3VD9A 1ACCA 1I94B 4TLGA 2WLNA 3SKVA 2XXZA 2IXLA 3PU8A 3KHCA 4OPHA 4G27B 3L2YA 2JS3A 2W94A 3W20A 3HWJA 3LB9A 4OX9B 1P49A 4WFGA 3MFCA 3SCHA 1GNZA 3OEAA 5FY7A 1P7GA 4UT5A 4N7IA 4D6SA 5J7MA 1E5RA 4Z2AA 3QD6A 1W99A 2BGOA 3O1OA 3OUIA 1YJLA 4DZGA 3AKQA 1TEIA 4FFGA 4ATEA 4GH4A 1RMU2 1IBMO 5HFMA 1SDWA 4PBOA 2BBVA 1MSDA 2BSKA 1B35B 3KGZA 4TQFA 1S5JA 1QJX1 1I94O 3M7AA 3BHPA 2GAUA 4WF9V 2KR2A 1N36O 1YSCA 4DXZA 4Q1PA 3H8OA 4F6RA 4PF5A 4AW7A 2HJDA 1Y76A 1KC8W 5J2UA 5B1AC 4OX9O 1JH5A 2D98A 2XVGA 4A4AA 1D0GA 5JZGA 3ZFFA 4A5UB 2RM23 3CD6V 5LA2A 4P14A 2AZ2A 1NCRC 3H0OA 4J1XA 3OGVA 3I5DA 1TVKB 1KUQA 1EAH3 3BGAA 2O0OA 2ZIMA 2VM9A 3SMHA 4LF4B 2UXXA 3VKNA 2ZGNA 1SG3A 4HYOA 3ZYBA 1E1RG 2Y0OA 4LOTA 3I3BA 3VBOC 4BQYA 4OMCA 3DTUB 3QG5A 2J7MA 3ZYJB 4JI5B 3I8TA 1RFYA 3CS5A 1RVF1 4GB32 1VBA2 3NKGA 1HW7A 4CP9A 5DAQA 4Z1VA 2FQPA 4EN6B 2C24A 3ZHVA 4M0NA 1HB1A 4CEWC 5DM6V 4MO3M 3ZMSA 2V1DA 4LBQD 2ET1A 1E57A 2WWWA 2FZ2A 2KQXA 5A1AA 3VBSB 3ABUA 2JGDB 5JLVA 3GBFA 4LF4O 5L3FA 2VOVA 1SRYA 2N05A 3CRMA 1JYVA 3WUDA 1XNKA 4ZZ5A 4IW3A 5L73A 3B94A 5IAVA 2WZR1 2XNDG 4ZKIA 1RYYA 4JI5O 4WZFA 1R1A3 3EJKA 3OM3B 5K0UA 1ND2A 4LHKA 3PUHA 3AX4A 4WM7A 3DYPA 5A6XA 2PLV1 3ON7A 3HR0A 3JCIA 1BJQA 4GMP1 1W8NA 5AFBA 1FXVA 2A7AA 4XAAA 4IEQA 5A3OA 2GTSA 1ZREA 1OD5A 5I0SA 1BBT1 1KB9F 5FYCA 4K3AA 2GMPA 1KXGA 2WNUC 5JXJA 1NQDA 2HJIA 5KAIZ 1W6NB 3E5QA 2D5FA 2P3YA 1YF2A 1H8TB 4ICGA 1D4VB 5FDBA 4HT1T 5BV6A 4ES9A 3V0AB 2W5FA 1YCIA 3B2EE 4W4LA 4LA2A 4MGQA 4O2BA 4ZXKA 2W2IA 4JQTA 3I59B 1EYBA 3MGUA 1V9U3 4Q29A 4XBFA 1JZ5A 3B7MA 3HKDA 3UV9A 4A7KA 5C3OA 3VLBB 1KD7A 4LFAB 2YC0A 1DGWA 1S0DA 4ASLA 3O12A 1R73A 3C3VA 2CNAA 2EJ7A 5LW9A 4BW5A 3OJBA 1LUVA 1I3HA 5F3CA 4BK5A 1OZ0A 3D36C 3BVCA 1AR72 4FFBB 3LIGA 4E2SA 5L36A 1OJHA 4M0HA 4MLOA 5L3GA 2YHJA 1IG3A 4NIIA 4JGZC 1VBD3 1NT0A 1DU3D 1OUSA 2VGDA 3M3IA 4CDQC 2YYOA 5CN0A 4AXOA 3LE0A 5FO7B 4RQPA 5CFCC 1J83A 5CEHA 1Q82W 3N36A 2PHWA 5C70A 5JOYA 2ZXQA 1W06A 1SA0A 3ACIA 1AJPA 5FK8A 4Q4V2 2B9UA 2OW4A 2VZOA 4A6OA 3ZN6A 3T1YB 2Y4UA 2ITDC 2IJIA 4JASA 3U1XA 1F7YA 3W5NA 3V56A 4S2DA 3K48A 1YQ5A 4MTOA 5LP6A 1N1SA 4A7YA 4FTSA 4QNHB 4UYBA 2R32A 2JIJA 3AJYA 4UXAA 3CF6E 5CADA 2BGPA 1RUG3 2Z4FA 4ZS3A 2VBDA 4ARYA 2ZR2A 4H2AA 3GWKC 2XJTA 2CAUA 5IJRA 3POJA 5EWSA 2ZIOA 1OLRA 3O65A 4IEUA 1AILA 4CUBA 3FJSA 1PGSA 1TE1B 4AQYB 3T1YO 3BY6A 5FLHA 1OHFA 3S3XA 3ZFEC 5FPLA 4MG2A 2W39A 1WA8A 3GWOA 3SITA 1O5LA 4YZ2A 1IVSA 1QJZA 1M9NA 4EWEA 2CU5A 2XKOA 2JG9A 3ZN4A 3HKCA 3SYAA 4O2AA 1HX6A 4LBJA 5FTTC 2ZGTA 1AXYA 2WT2A 3H7YA 1NOVA 1JA8A 1XE0A 3C2UA 3WQ1A 2JICA 4X1YA 3S5AA 1HDJA 4E4SA 2ADPA 3ZYIB 4NIHA 3W9AA 3RYCB 5JSRA 1FAYA 3OG2A 4KWJA 4XHBA 5H9PA 1NJIW 2ZGQA 3ZMTA 2BW8A 2JX9A 1QQP3 4LR3A 2FTKA 4RR3A 3H42B 5LOVA 1VP7A 1I7FA 5IVYA 4Y33A 5IJ9B 4QX8A 1SEFA 4AQYO 1WUVA 3U75A 1L3JA 3WLUA 2WLKA 2CDYA 1AI6A 1LGNA 2YPDA 1SBEA 2HBUA 2MEV1 5B1OA 4Y24A 4BOWA 3MV11 2UY8A 3E2EA 4DRRA 5FLXN 4KWUA 1ZSPA 1AVBA 1UMHA 2GC0A 5F3IA 4LNUB 3SC7X 4DV5B 3MPBA 1ENQA 3THDA 2BWAA 3MW3A 3WCRA 1LHOA 2WNOA 3CO2A 2ZGSA 5LGNA 2OUJA 1FOD3 2VBBA 4GLXA 3CYOA 3U11A 5B2GB 1POQA 2ERFA 1YI9A 1L8DA 2RS51 5IJ0B 1TNRA 1OCZC 4OUEA 2C9AA 4K1YA 4JYAB 5FZ1A 2WFF2 5LBBA 3G6EV 4JKMA 4ZHNA 4DR7B 3CCUV 1ZL8A 2XAJA 1O4YA 2EJRA 1J3RA 3LNNA 4UVBA 4Y22B 4D6TH 3AB0A 4PA9A 3PTRB 1AXZA 1CONA 1FFTB 5C5TA 5BMVB 4A3ZA 3URFA 1R1BA 4KBZA 1GP5A 3WB0A 4BQ4A 1REFA 2VBPA 4FPHA 1CJPA 4XCBA 2AW9A 1Z5WA 2C6SA 3N7LA 5IAXA 1TG7A 1SQ4A 4D6QA 1UU6A 5JAXA 5BY5A 4LH6A 1AP5A 5JOXA 1AXKA 2X6BA 3CXHF 4Y26A 5FYYA 3C7EA 4AEDA 1OCRC 1WCQA 4HZ3A 5BNPC 2X0LA 4JYAO 3R05A 1OHHG 4DR7O 3RMXA 4JVAA 1UZWA 1MVQA 4QU1A 1W9TA 5ANNA 3J4UH 3AP6A 3A0HZ 4CDUC 5IUQA 4K8ZA 4B3SB 4NMIA 2OQ7A 1A32A 1XC6A 2BFUS 4LHNA 4CS2A 2DCYA 5F5AA 2P22C 3BRCA 4NRQA 1CD3G 5DG2A 5FZ6A 2RMU1 1AJKA 3VDDC 4FFFA 4UFKA 3VBFC 2PXJA 3RGBA 1UY3A 3RJRA 3K58A 4CDWA 4IHJA 2B5HA 2Q67A 3VZNA 1OBNA 3H8RA 2QE3A 1X50A 2QJVA 2JRIA 1FMD3 3SKJE 1RUE1 4F83A 4E2LA 1KITA 4QPKA 4JV4A 3DXRA 1JS9A 2WN2A 5CB4A 1LJ7A 1H2GA 5HXMA 3OBAA 3JCUZ 2GSMB 2TBVA 4OFGA 3SHRA 3PLQA 3A0RA 2Q7HA 4MXVA 4B3SO 2BNOA 2WLLA 1B6QA 4BLIA 4IEWA 4PA3A 3HJRA 1UOGA 5C8CC 1BZWA 4W50A 4BLJA 3SYPA 4KXRA 4N8MA 5FYHA 2WA4A 4CXYA 4ZU4A 3VGIA 1Y43B 2HEVF 4QQHA 5D5PA 2DVDA 3H1HH 3LGRA 1GICA 5KLVH 2A06H 5H9SA 2E26A 1EZVH 4CE8A 4PDMA 3ENRA 4WFFA 1QJFA 2OA2A 4Q4W3 2SLIA 2J1EA 2WLIA 3WP3A 4WZCA 1VQOV 1IURA 1OOPC 4I0BA 3AP5A 2BZDA 3LEKA 4NIDA 1JZ7A 3M70A 4DRXA 4X1IA 1AR82 2OX0A 2DU1A 1UXXX 1IPKA 1ENXA 3WFVA 4ZPIA 1LNQA 4EE2A 4XZUG 2ZHNA 5F6LB 2VR4A 3KLSA 4DUVA 2OYQA 2EXIA 5EBMC 5I8YA 2Z79A 4H37A 2VXJA 2VNVA 5LWBA 4QXKA 3OR7C 1IS5A 2XJUA 4CSWA 5KXBA 2LW7A 5FY5A 4ZI7A 4AFCA 1BLZA 5F5QA 3ASOB 5L7OC 4XJZA 5JJEB 2JEUA 1I5YA 3AMNA 4ZY9A 4N9HA 1HN0A 2WRAA 1SQFA 2RS12 1WN7A 1PMJX 2RM21 4I55B 5CA0B 4YIOA 4E8CA 2ZDIA 2WQ4A 3GHMA 2IW5A 3D4KA 2JDKA 3ZYFA 1G1XB 2W52A 5A3WA 3BA8A 1F51A 4AI8A 2PN5A 4XF1A 3ETEA 1RM1B 4X88A 3BIEA 1VBE2 2L6LA 4I7ZB 1U5XA 1W8FA 5DN2A 2OT5A 4OHVA 1ZX5A 4NHXA 3VBHB 1NZCA 4CCMA 1JHJA 4BMBA 1W0OA 2ZE6A 1DQ2A 5FKCA 3V64A 4LMFA 3ZKYA 1LCLA 1IS6A 4SLIA 1CWPA 3FHAA 4FTBA 3O0XA 2NYYA 3W5MA 3B77A 5LXTA 5KBFA 1D4M2 4JGSA 2CGOA 1HQWA 1POV1 4WVMB 4Z8BA 1YUDA 3CMAV 1I5XA 1SACA 5C4WC 2UXCB 2BCCH 1YIPA 2UXNA 3P32A 2DWDC 1XNAA 4DV3B 4R9BA 3N9OA 2JDAA 1LRHA 2IBZH 4KMQA 4WVZA 3IDEA 3JAWA 3Q4HA 1XQNA 2P3KA 1FJGB 1QQP2 5FJHA 2WSSG 2QTSA 3HQRA 5J48A 3RZLA 2BFUL 4CZZA 4A44A 4KG8A 3AG2C 5F3GA 1R1A1 4QB1A 1LEDA 5L3BA 4UVCA 4UV8A 1YDXA 3POGA 1PL0A 3JD3A 2WC2A 3NJZA 1RSOB 2HWF3 1PK6A 2JDHA 3JALB 4K20A 2UXCO 5K4LA 5A33A 4DV3O 2O1QA 2QCSB 5K7PA 4DY3A 2JJ2G 2RJZA 4M3CA 4LA3A 1F5FA 1WCKA 4MW3A 5FNVA 3TN92 4FPPA 3JBG3 5GZCA 2Q8DA 4GA9A 1IBKB 4YG3A 1E1QG 3R65A 1ULCA 1JPXA 3JD71 1FFXB 1VRH2 1NYWA 3TXSA 4MVRA 3CKHA 5FYSA 4QE9A 3F7VC 2QQKA 2F95B 3NJVA 4EROA 1TUEB 3U0ZA 3OGRA 4V1PA 1OPMA 3T1CA 1V9U1 1NLQA 4X65O 2XBO3 2EULA 2YXHA 1K5MB 1QU7A 3BTZA 1MZEA 2Z0AA 4XYXA 2PYTA 5EIYB 1Q8OA 1B35C 1W6PB 4R7CA 2ORZA 1NCQB 2HKOA 3OPTA 3SDLA 5H9RA 1GP4A 2GH8A 2P1BA 1A8DA 2YXSA 4JGYA 4L11A 4DXWA 4AQSA 2UXDO 3PTYA 1VBD1 3TAYA 5CFDB 2CGNA 2R70A 3PJYA 4UAPA 1IBKO 4OVEA 1K7DA 1EN6A 2PHRA 3C7HA 4N90A 4NAMA 4N43B 2QDNA 2CDPA 4CU7A 2E5LB 4YZ5A 3PVBB 3H50A 4JDNA 2R073 2HR3A 2R063 3MPPG 3SLIA 3CRAA 1BHGA 4DO2A 1VMHA 2VOWA 1NCRA 4FXGB 1ULEA 3FB7C 2VQUA 1FPN2 1CPMA 3FKSG 4CP1A 5BZBA 2QEXV 2O14A 4J10A 1HR0B 3I56V 2ARBA 3BB6A 3ZMZA 5BNNC 4U7OA 2PGGA 4XBLA 1B09A 3TK1A 1SLLA 5L3EA 5CA6A 4KU8A 5EBWC 3VBOA 3PL0A 1O9GA 3B00A 3JD0A 3APBA 2I74A 5FBJA 4UW6A 2D6NA 3WOGA 4PJ0Z 2B39A 4ES8A 4QIWF 5DQ0A 1H8VA 1JVMA 3STZC 3W7WA 1FNYA 3T30A 3ICXA 1RUG1 4B1MA 4TV8A 2OUHA 2IJHA 2E5LO 1OF4A 3H9VA 4MGIE 2R043 3G6JB 5FYTA 1VP6A 2JEXA 4P9PA 1EY2A 3F2ZA 1W39A 4FPEA 1Y67A 2DJVA 1QJU3 1MQTB 2IM9A 3AKSA 4IIJB 3LEGA 1ZZ9A 5J2TB 1HR0O 4BWAA 3IAPA 3A0BZ 4AHXA 1LECA 3IMMA 1N3QA 4UB8Z 2V09A 4ONUA 1Q7YW 1PGL1 2OCCC 1XUQA 1X36A 1K97A 1XSQA 2X53S 4AI1A 1NKGA 2IU0A 4IQPA 1MG1A 4H33A 1YJKA 3DGTA 5DZGA 1QVFU 1YFXA 3ZOIA 4BB3A 3ZIWA 3UKTA 4J7JA 1WP8A 4X62B 4P5YA 4XFGA 4FPOB 2ATKC 1UYZA 4UW3A 2ZMLA 1MABG 2YUEA 3ZMVA 1A8MA 1V70A 1O59A 3P6BA 4RUFA 3E35A 1H8TC 4JZ2A 5C3PA 4EEQA 4DMIA 3MLKA 4XACA 3ABMC 5GALA 2KG7B 4QKFA 4R8HA 4BZ4A 1E5HA 2IXKA 4TT3G 4ARXA 4QPJA 1BXHA 4NKGB 4CEYA 1PZ9A 1SF9A 2P6CA 1X33A 3DF0A 3BYWA 3MO4A 4YGBA 1UWWA 2LFRA 4TQDA 2J42A 3AMQA 3OPWA 4HZFA 1RUI3 1W8WA 5A80A 4NHMA 5HV4A 4XMIA 1Q6IA 4RD7A 2WWJA 3S5QA 3KV9A 3IWZA 1RJ7A 3WNOA 5DDJ2 4YM0A 1FOD1 1SFYA 1Y9GA 2ZEWA 4H7LA 3UKMA 1C57A 4NJ4A 3D36A 2WLMA 3RRDA 5FPOA 5IDJA 2G19A 2QQLA 3LSQA 3THOA 3G67A 4IE5A 3OMIB 2ZEXA 1HNWB 1C8NA 3KZ4C 1ZBE2 5ABJB 3RW0A 3OD4A 2ADDA 3KZIZ 5EP9A 1IQDC 4Z2WA 1V00A 4FP2A 2XUEA 1V55B 4KBBA 1DGRA 3TXQA 4JI1B 1IZ3A 2J1VA 3CC7V 4I30A 2HJFC 1S0JA 5LEJA 2V72A 4QPIB 5CFCA 1HB3A 2CWMA 4RSUA 1EUTA 1JJ2U 1GMMA 3CEWA 5DMYA 3H1WA 4MOAA 4C90A 1Y4MA 2LW1A 2VD7A 5FREA 3CL1A 3MDSA 4IL6Z 1KKCA 1X8EA 1TME3 4NXNO 2JG8B 2GALA 1OQ1A 1F35A 4JCKA 5LATA 1UX7A 3CB2A 3PU3A 3MIDA 1BZKA 1ST8A 3GZUC 2GUZA 1KFXL 1Z7S2 2BTQB 4LC1A 1N1TA 3AL5A 1U97A 4HK8A 4Y4YA 4JTNA 3D6EA 2RR13 2G1MA 4JI1O 3K0DA 3RYKA 4A2UA 2JDUA 2VW0A 1GYKA 2E32A 5AC93 4FJCC 4X89A 1XNDA 5J9PC 3HR9A 2X29A 1ZAUA 4P30A 4IEZA 2GSYA 1ZBA2 4PI0A 4CVUA 3J80N 4GXLA 1O9HA 1HB4A 4O4HB 4WM8C 2VH9A 4UFIA 2UWCA 3A0KA 2GN3A 2O8OA 2WNVB 1FMD1 4IYHA 1JOJA 2NN8A 4NUBA 3JD2A 5F2SA 3S57A 2CY6A 3L71H 1VBB3 1AJOA 1NS1A 5CA1B 5LYJB 4K8RB 2ZXWC 1CZSA 4U3JA 1GOFA 2Q1MA 1RUJ2 1FPOA 1M57B 2WNEA 1CIYA 4S2FA 5C8YA 2VZVA 2YXLA 2VZSA 4JF3A 1B04A 4CC5A 4CDXB 5LB6A 1GM8A 4M01A 5GZFA 1DTOA 1A6CA 5C3SA 4AK3A 3ZIAG 2CH7A 2D6MA 4MVZA 2CTPA 1UYPA 3QH6A 2PY5A 1RUC3 4PIZA 4IE0A 4LO5B 1GU3A 4FFIA 1HN1A 3INAA 3WDWA 2AYHA 1FV2A 1OURA 3CJHB 1GM7A 2I2SA 4HNAA 1WMXA 1GZ9A 5FMOS 3RZMA 1KQRA 1JMUB 4J9ZB 4OHXA 3PHMA 2Y0PA 1OH4A 4MSVA 1ZUQA 3WW4A 3T2OA 4IETA 4BA6A 3FN9A 4YGEA 3K77A 4UW5A 3T2PA 1S77D 1IX9A 2B46X 4X8AA 3KQRA 1IBLB 1NR1A 2YEVA 3F7YC 3LQCA 3H1KH 3AJZA 3K57A 1N0NA 1ZTEA 2QDOA 4LJHA 1W2AX 2ES3A 1W03A 5CMUA 2YG0A 1KU9A 2WO2A 1YQCA 1FXKA 1X7NA 2YC4A 5D2AA 5I93A 3F5WC 4O4IA 3ROUA 5ACA2 1M06G 3HT2A 2DTYA 4FLTA 3J7MA 2WIIB 4GMP0 1WMFA 3APOA 4ISQA 3W7XA 3JASA 5FZ0A 2P67A 5GONB 2H94A 5IK4A 1RUF2 4AEJA 3E83A 2OVUA 1QJU2 2QWRB 3Q8EA 5FQ0A 1QGLA 4PI2A 5EYPA 2A79B 1AHSA 3EHBB 4F6EA 1MS0A 5BNPA 4I4TB 2HLDG 2XPJA 2R9IA 5IYYA 3BUCA 2XLAA 4G3YC 2Y0IA 3D82A 3FUQA 4Q1RA 5LGUA 2PI4A 1HRV2 3B02A 3TNQA 5CBFA 2NQYA 2A7WA 2PHUA 1YEWA 1W6MA 4AQTA 2C5DA 2XR4A 1N4CA 1NI8A 3WG2A 1PVC2 4D3WA 1SERA 3IAYA 1Y4WA 3K03A 4DR4O 3UCSC 5A3TA 1Q8VA 4IV3B 4LP8A 4MVQA 4IYIA 4O4JB 1AR71 3VDDA 1EV12 1SLTA 1VIBA 2EXKA 2CK3G 3P5BA 4HVQA 1YYNA 3SCFA 4C0HA 2P90A 3O1TA 1HLCA 4C8DA 4UBGA 2E76B 1GNHA 4F4LA 4IGQA 4N9IA 5FPBA 4HVRA 1C4RA 1RPOA 3VDCA 2V4VA 1HRI2 3GNEA 3FB8C 2HWC2 2LW8A 2IXHA 4FZ0A 2YIBD 3TYJA 3OGSA 3ZYRA 4JV5B 4LIVA 2D44A 1VQ9V 2NZ9A 1VEWA 4UCOA 1PNFA 5B1BC 4CH4A 2W68A 2XLFA 4FFHA 1R091 1S0EA 2W92A 4DV7B 5FZBA 1YIFA 3HNMA 2QM7A 2HWE3 1O3RA 2ZX0A 1NLRA 1DFQA 4J6GA 1RUI2 2HWF1 3B3QE 5H9CA 5C8CA 4ZOLB 3GVMA 4QGPA 2VUJA 1VF6C 4JI8B 3ABZA 4PDLA 5FZ8A 3A22A 5DG1A 1JHNA 3JBG1 1CAVB 4FLUA 3ZYPA 4I0XA 4Y5SA 2A5ZA 1HWYA 4NAOA 2EILB 2VTXA 4JV5O 3LSSA 2OTLV 5IY5B 4XDJA 1LOAA 4I9WA 5FZIA 3ZN5A 1NQTA 5GZGA 3HAGA 3JYCA 3B8NA 4EZHA 4WFHA 2FYUH 4FPGA 4DV7O 4AHWA 1TMF3 3IAQA 4JPRA 2XBO1 1O5UA 1VRBA 3POWA 1G8MA 2OIIA 1ULGA 2VZ3A 4JAAA 3LCPA 5FY0A 2PZSA 2W95A 1E5SA 1AUYA 3M3QA 3ASOC 4FTEA 2IXCA 2RJLA 1TME2 3ZRVA 3QACA 2B7YA 1QJY3 3MIHA 4K8XA 2OCHA 2W91A 3I54A 3S7EA 4JI0B 1G9BA 1UY1A 3ZN0A 2IH1C 4GT1A 2HVJC 3DGEA 4B3TB 4XFBA 2UURA 3MW2A 4FVVA 2P4EA 1ZRFA 4L0PA 4GH4B 1DF4A 3VL8A 2JIZG 3J26N 2EIEA 5FLJA 2R071 4L92A 4RN5A 2BSKB 4YIPA 5H5NA 3LWCA 1QXRA 4A3XA 1VQLV 4AOCA 3R4DB 2PQSA 3H9AA 5FOBB 4X20A 1RM1C 2HH9A 3GALA 3SXWA 3G80A 4F6RB 4BW9A 4J25A 1VAMA 1Y76B 1OCCB 1OQEA 5J2UB 4L8QA 5JZGB 3ZFFB 4PLMA 1MS5A 4KGQA 3ZPYA 1R3JC 1VMGA 4XFIA 2HWD3 1PM4A 5L3CA 2E7QA 1OC1A 3H1YA 3JUUA 4AQ6A 1WGPA 5D8AA 5F5CA 2ZHMA 3EXAA 4B3TO 1DIWA 1W8ZA 3ZR6A 4XUPA 4MTFA 1F15A 4EYUA 1KJRA 2Q5TA 3JATA 5FCCA 2R041 1MS1A 2ENRA 3BA9A 2VCCA 2Z42A 1MZFA 4OMDA 4BQ5A 4QKBA 4CP9B 1CX1A 3NNLA 5FK7A 3RFRA 5KX5B 1UL9A 2Y6FA 3AG1C 2WFF1 4X6QB 3JAKA 2X05A 4H13B 1ZRRA 1UMZA 4MUVA 1UZ0A 4IEVA 1AL23 2RS32 1PO13 3WNNA 3JCZA 2AHYA 4Q0QA 2VS0A 2R16A 3K51A 2DDUA 2IXIA 2D2CB 2E7TA 3ABKB 1H2KA 2EA7A 2YDEA 1DGLA 2GP5A 1US6A 1K5MA 2VZUA 2ADEA 1U5YA 1NZIA 2XB6C 1QIQA 4Q4X2 4TTGA 1LHNA 1ZWIC 1HXS2 1T5EA 3FE5A 2XG3A 5FYMA 5K0UB 1ND2B 3LSUA 4RO2A 3VQXA 2I45A 5FPXA 4WM7B 2RDCA 2XL9A 4MV2A 4QM8A 3HPNA 1W28A 1SFNA 1ZYBA 2EXHA 3K5LA 1MEC2 5DN6G 1OH3A 3EFFK 3K4ZA 4BK4A 4I0WB 4IV1A 5KXDA 2K1EA 2V73A 3E6BA 1QNYA 1ENRA 5JMCA 1NCQC 1CR7A 2QM4A 4CUGA 3AC0A 4I9QA 5FP9A 3FAVA 3OBRA 3UGFA 5DAXA 1DCSA 4O2BB 3MI8A 4F8AA 5LCWL 4PA7A 2QWOB 3LDKA 1Y74B 4AQ2A 3WT3A 1CXZB 2DOSA 4N43C 3HKDB 4IE7A 4IEOA 1F4MA 4GJZA 1S76D 4GKKB 1SS3A 1CGPA 5K1PA 4QQOA 4CP0A 2ID4A 4OI0A 1S4CA 3ASIA 2ATFA 4K9SA 1V6LA 2SBAA 1RVF3 3D8CA 5APAA 1XL6A 2JVDA 2PFWA 3GGLA 4NXMB 4SBVA 1LOFC 4LE4A 4YSFA 3QVNA 5FR3A 2CTWA 1NXMA 1BE3H 3HD8B 2ZGRA 2VMIA 3WG4A 1DYOA 2JGUA 1EBOA 1UD1A 2WT1A 4GKJB 2ZBJA 4RQPB 2H8PC 1UY2A 5BNNA 3AXEA 4UOJA 2GN7A 4NWVA 3U78A 3ZSJA 3UO3A 2ZA9A 1UZVA 4AFMA 2C26A 5A70A 5FP4A 1YJ9V 3PIGA 3DPRA 1COV3 2Q4SA 2YMZA 2ZR3A 2AXTZ 3ZSMA 1SA0B 3LIHA 1GK9A 1OVPA 2WBKA 1Q86W 4G2KA 4PA6A 1QR9A 3ZN6B 4GKKO 4XF0A 1HIXA 1I0HA 3K59A 3PUIA 1VBC1 2AR6A 2YC2A 4PHZA 3B4SA 4CBCA 1MQTC 4Q4Y3 4UCTA 4NXMO 5IK7A 5AC91 2D93A 4MVSA 3WF0A 2PLV3 4XJUA 2BP6A 4DV4B 4AI9A 2FHRA 1REEA 4LR4A 3F5TA 2OT7A 4FLVA 1GTOA 1MNGA 3OPZA 2ZGPA 3O1SA 2UUAB 4GKJO 2V7QG 1G4YB 4MVMA 1BBT3 1DGRN 1JFFA 3AG4B 1OA3A 3PDQA 4YW7A 3X29B 2RE9A 1O91A 3CZUA 1KP3A 2R0HA 4DUXA 1LR1A 2XAFA 5FXZA 4BIOA 1SCSA 4P9WA 1NQJA 4TWKA 1J5EB 5LMNO 4PLOA 2RS11 4AAXA 4P02B 5FPRA 2I07B 1R082 2WPDG 2PA7A 4MT8A 3ZXFA 1WA8B 4XDKA 3IKWA 1T6GC 2QKCA 2JG9B 3AZZA 2BU9A 3HKCB 5FPUA 2P3IA 4JTOA 4FM2A 1K4CC 4O2AB 3ITQA 3NWKA 4DV4O 2D3OW 4K7JA 3JQXA 3PMEA 1RHI2 4O7XA 1VBE1 4X1YB 3HQUA 1PIV2 2UUAO 1NTKH 1COWG 4AVAA 4QPIA 3ZRXA 3AG3B 1NLSA 1N33B 5IK8A 4JHTA 4HANA 3VBUA 2VW1A 4RR3B 4GIQA 1JXNA 1WBFA 1UPGA 2LP7A 1J5EO 4IGGA 1U0AA 1YQ2A 4LBEC 3GCWA 2VNGA 2FDFA 4YYOA 1WD3A 5H9QA 3VBRB 2EINC 1HNXB 2D3PA 3UKNA 1R3IC 3JB8A 4DEQA 1O8SA 4JI4B 2EALA 1N0JA 3J7NA 3TB0A 5ABJC 4KWLA 4UFZA 4RS5C 2KA3A 3WQ7A 2YIDA 1V55C 2NLRA 4RHV3 2GHYA 2CAZC 1GOGA 3USSA 2DFCA 5LK5A 3AP9A 2WWSA 3ZSLA 5C3RA 1NXD1 1N33O 2LM3A 1GAXA 2DYRB 1DF0A 3ZN1A 3QBQA 2P5BA 5JCOC 3I55V 3FBMA 1MPXA 4ZS2A 1LOCA 2VTXJ 3FC0A 3WR0A 4H14A 4GUNA 2PI5A 4XBNA 2JG8C 2OXBA 2G9ZA 1KJLA 1FD9A 5DUXA 2ZCEA 1ZL8B 3KG2A 3THTA 1J58A 3I3EA 1HNXO 2HWB3 2EIKB 4Y3OA 1CAXA 4JI4O 1ZRIA 1Y9QA 2WKKA 4RUEA 3FWEA 2Q69A 3GBGA 5A7WA 5HCHA 4UVAA 1VRH1 1WPXA 5ANQA 2WQ8A 3VZOA 3FLRA 2FKXA 3E89A 3SPHA 1ND3A 1HJGA 5C9AA 2GMEA 1PNKA 4R8CA 1AL0G 5DEDA 3IDBB 3K5MA 3QNEA 1KRIA 3MIEA 2QZ3A 3WNLA 3NW4A 1VQKV 4Y1YA 1SMVA 2OZJA 1KD1W 2VMGA 4FK5C 4AEDB 4FOVA 1KP2A 4IGOA 3I2JA 1AB3A 1MZ6A 3AKTA 3U14A 2ZM6B 1DQ6A 4YJ2A 3RYFA 3DUIA 2V5YA 2X7RB 1VLNA 4YM2A 5T50A 2PQQA 3L74H 2WNVC 3ZHUA 1YITV 2AGSA 5KXEA 1PP9H 4YW6A 1YFWA 4WM8A 3R4UA 1AYN2 2NN4A 3ABTA 1OLMA 3KT4A 2W9XA 2Y48A 1JYTA 5GW7A 4YW2A 3VZLA 3H8UA 1XU1A 1J1LA 4E2GA 4IERA 2WDBA 3B5LB 1PM9A 3LDCA 5HCFA 5BXZA 4CDWB 1M57C 1CQ9A 2MEV3 4IHJB 3KQ4B 2P4VA 1OI6A 3H7JA 1SFPA 1QJX2 1FPN1 1LULA 5IE9A 3MFAA 2Q6AA 3SH3A 1BVVA 3DXRB 2Q1ZB 2ZM6O 4E4DX 5IVVA 2OYZA 5CB4B 5CU1A 2QWNB 2LTNA 3N9MA 2P06A 4OHWA 1KFUL 4YVWC 3MD0A 4WBBA 4XURA 1NBMG 3NJYA 4FT8A 3BVOA 5IWAO 2WUHA 2WLLB 4N53A 2EX3A 1QWRA 1YJWV 2DCTA 2DVGA 5FMBA 2Y8KA 3ASNC 3T1HB 3SPIA 1D2SA 1MOFA 1E5IA 4G4FA 2D3SA 2ZT9B 3QO7A 4IXLA 3OEHG 1GQPA 1RUH2 1RUNA 2DCKA 4OHYA 3LFIA 1L0NH 1TMF1 3U37A 4J80A 4DV0O 5BPXA 4DIQA 4Q5OA 5CIRA 1DK1A 3K0GA 3RG0A 2MPFA 4I4TA 3DV8A 4UF0A 2WLIB 3GDBA 3THPA 3HBKA 4XFHA 1OPOA 2ORXA 3RDIA 1RXFA 3O1VA 4DV6O 2D5HA 1QJY1 2P34A 4DRXB 3WNXA 4X1IB 1RUOA 3WB1A 1GKBA 1UO9A 4XHXA 1H2MA 1EP0A 2Z2SB 4Q2FA 3K3OA 4FPYA 4P9IA 5FO9B 2CTRA 2FDKA 3VV1A 3VZKA 3T1HO 3ACFA 2RNBA 1H1IA 5LRRA 3FD9A 4YZ1A 2Z5UA 1BL8A 3RWRD 2QQUA 2WZR2 2LJ2A 1UYXA 4O9EA 1RL3A 3CMGA 3SPCA 3AKPA 1ALYA 2FCVA 3WNKA 4JYCA 1H0BA 1S55A 2VU9A 2A6YA 3JQWA 1NAEA 5A3NA 2D6KA 5FUPA 2HWD1 2A9HA 2BVBA 1X59A 3E8GA 1RUE3 3RZKA 3IT8A 3UT5A 2OPKA 3ZXJA 3W21A 3OGGA 1C8M2 5F9TA 3RPQA 1QHTA 4ZU5A 5GTHZ 1WLCA 4EQVA 2GBOA 1NTZH 4FLWA 1WPBA 3V0BA 4B4QA 5IYZA 2EZOA 5JCTA 1Q81W 3AVSA 2UWAA 3I3DA 1VQ8V 1QBZA 4TSVA 1ZBE1 3K5OA 4LPLA 5LXTB 4CH5A 4TV9A 4J11A 2LFSA 4WFEA