1Q43A

Hcn2i 443-640 in the presence of camp, selenomethionine derivative
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
189
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for modulation and agonist specificity of HCN pacemaker channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 55
structure length 189
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1q43A01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1q43A02
4YRDA 2QDRA 3EHKA 5I0UA 4E2GA 3GYDA 2XHKA 1X7NA 1CAXA 4D7SA 2VQAA 2IXLA 3LA3A 4KL1A 1QXJA 4ZU4A 3M3IA 2CGPA 3CLPA 4IEQA 4Q0VA 3SHRA 2IC1A 4AXOA 1G6NA 3S7EA 4XFBA 3E6DA 4J1WA 3BB6A 3H50A 3SCGA 2OYZA 5J3UA 2D5HA 5CADA 5I8YA 4K8FA 3E6CC 2HJIA 4XFHA 1UIKA 2GC3A 4EWDA 4MV2A 1SEFA 4IEXA 1Y3TA 4O9GA 3PLQA 4KU7A 4R52A 4RD7A 2QNKA 1L3JA 4PJYA 3UKTA 2XLGA 5D1IA 5FQ0B 1ZRDA 5FLHA 4HLTA 4AVBA 2VPVA 1EYBA 1ZNPA 3ROUA 1RC6A 2PAKA 1NE4A 2Q30A 2XKPA 2PA7A 2DCTA 2VECA 1EP0A 5LEKA 4IEVA 4WZCA 4HMZA 4MZUA 3U0ZA 4YYOA 4JV4A 2BNMA 3E5XA 4KU8A 4Q0PA 3H7YA 1CAXB 1LB2A 1YFWA 2GAUA 4IERA 4OFGA 1GQGA 1VJ2A 2OPKA 3OF1A 1YLLA 2CV6A 4D7TA 4GULA 1O7FA 5FCCA 5I8TA 1Q43A 1O3SA 2Q0AA 2PQQA 5I93A 1LRHA 4MGKE 2B8MA 5LRRA 4E2QA 1J3QA 4PIYA 3H1YA 4MH0E 1WLTA 4XFIA 1U12A 1YFUA 5KHGA 4YSFA 1NYWA 2MHFA 1O3RA 4Q0QA 3NW4A 4PIZA 3E6BA 4CYDA 2WFPA 3NSTA 5LRSA 4EWAA 1JUHA 5C6CA 3H8UA 5EZWA 2PHLA 3LAGA 4UBHA 1O5UA 3RNSA 3JZVA 5JR7B 5I0TA 3FWEA 3MDPA 3KCCA 3HQXA 4EV0A 2WC2A 3KSCA 5T3NA 3ACLA 1XRUA 3HT2A 3I59B 3LA7A 4EROA 5JAXA 2ETEA 1IPKA 3SCFA 4QGLA 4A2UA 3BALA 3RYPA 1H1MA 4F7ZA 4LA3A 3IDBB 3UKNA 1VP6A 1FI2A 3MZHA 1YUDA 4MUVA 2GZWA 4XF3A 2B9UA 1ZX5A 1NZCA 5FLIA 4LUMA 1ZRFA 2F4PA 4N9HA 3S7IA 2KXLA 1LKNA 2XGXA 4QM8A 3RYKA 3H7JA 3LZZA 3FX3A 4EWEA 4FAHA 3ES1A 4NVPA 1CAWB 1J3RA 1WGPA 3LWCA 3S0MA 3BPZA 3I59A 3PVBB 1CAUB 3OTFA 3O14A 1QWRA 2QCSB 3LA2A 3OD0A 4LULA 5J7MA 2EVXA 5I0SA 3EJKA 4XEZA 1UD1A 4UBGA 1CAUA 4ORFA 3H9AA 4QXKA 4Z82A 2XKOA 4IEPA 2IXHA 2K0GA 1Y9QA 2ET7A 3ES4A 3OGJA 3SCHA 2XLFA 4HSJA 4ZU7A 1Q3EA 1NE6A 4MGZE 1ZZ6A 4XF9A 4Q29A 1DZTA 3IDCB 2UYBA 3CEWA 3E97A 1YFXA 5KHKA 3PNAA 3H1MA 1O3TA 3EQEA 4I09A 2ATFA 3BCWA 1VR3A 1RTVA 4HBNA 5BUVA 1J59A 4KWJA 3OCPA 1EY2A 4BH9A 4L2NA 3U11A 2EA7A 1O5LA 4WVZA 3I7DA 1O4TA 4I2OA 2PAMA 1SQ4A 2FQPA 2XL9A 1ZZ7A 5BV6A 3NJZA 4MGYE 4JVAA 3DL3A 4HN0A 1HW5A 4KWKA 5FPXA 1QY4A 1X8MA 4N9IA 1ZRRA 1EPZA 4YNIA 2MPFA 4O9EA 3RPQA 3ZDSA 4H7LA 1I5ZA 4Z07A 3LOIA 3TNPB 1CAWA 3B02A 5AVPA 4FT8A 5CU1A 2GC1A 1ZZCA 1Q5OA 4HN1A 5BY5A 4XFGA 2O1QA 3KGZA 2QJVA 4BHPA 5BPXA 3C3VA 5KHIA 2PFWA 5E1RA 2V09A 1UIJA 2D93A 1TQ5A 3WW2A 4IEYA 1CAVB 3RDIA 4BYYA 2GC0A 4LTAA 2PTMA 1H1IA 3ELNA 4IETA 1PMIA 2IXKA 1YHFA 5HI0A 1RUNA 1RUOA 3NVCA 4TLFA 4FBFA 1CGPA 5FLJA 3D82A 3FJSA 2H6BA 5J48A 4DINB 2OZ6A 4IEUA 1ZZ9A 4JTOA 4I02A 3HT1A 2IXJA 2BGCA 3U10A 4OLLA 3FFQA 2HKXA 3ST7A 4XF4A 3GBFA 3SXWA 2GU9A 3MPBA 4UXAA 5F1RA 3CJXA 3H1WA 1XE8A 4XFAA 5JSRA 4XFCA 1UPIA 5CVRA 1LR5A 1OFNA 2CAVA 4HVQA 1OD5A 4AVAA 3FZ3A 3IBMA 4HSLA 5JSPA 4QMAA 2BYVE 2ZCWA 3USSA 4E2SA 5E16A 3NKTA 1IPJA 2UY8A 4QX5A 4XF0A 3N4MA 3D0JA 4P9GA 1NXMA 4HVRA 2O8QA 3IWZA 3E5QA 2PYTA 4FAGA 2BEOA 2OZJA 5KBFA 1OMIA 3TNQA 3G7DA 5I8SA 5JSOA 4QM9A 1ZVFA 3KMHA 3R6SA 2UYAA 4LUKA 4LEJA 4XF1A 3ETQA 2D5FA 2H0VA 3D0SA 2IXIA 3VHRA 2UY9A 4HVOA 1UW8A 5K8SA 1WA4A 3FE5A 1FT9A 2GH2A 4Q0UA 2Z69A 3SMHA 4R8HA 3BU7A 1J58A 4YARA 3QOPA 3NL1A 2XL7A 4KWLA 2B5HA 5LEJA 2N7GA 4X6RB 4ZU5A 1GQHA 3EBRA 4L11A 3FHIB 1DGRA 3RZZA 3RYRA 4META 2BNNA 5C8WA 5I0RA 2H6CA 1SFNA 4JTNA 1O3QA 1J1LA 2QVSB 2PHDA 3UKVA 3CL1A 2Q1ZB 2XLAA 4MX3A 2CAUA 1V70A 5BXXA 1X82A 4IEZA 5I91A 1YWKA 1ZREA 5FPZA 4QGNA 4Q0SA 4I0BA 1RL3A 3M70A 2C0ZA 3E5UA 4LLOA 4ONUA 3WW3A 3L2HA 3QACA 2P17A 5FDBA 2EAAA 5KHJA 4XFFA 2D40A 4IEOA 2K9ZA 3CF6E 2I45A 4XETA 4B29A 2OA2A 4X6QB 3DN7A 1X8EA 3IIAA 3H3UA 5EFUA 2ZKLA 2GC2A 4IEWA 3WW4A 1CX4A 1DZRA 3EO6A 3DKWA 1I6XA 4I01A 1ZZBA 1XE7A 3H3ZA 3WW1A 1ZZ8A 4BIFA 2Q4SA 3I54A 1FXZA 1PM7A 4AQ2A 1QXRA 4MGIE 4I0AA 4AQ6A 5FQ0A 2E9QA 3HIFA 4HZFA 5KHHA 3DV8A 4LA2A 4F8AA 2Z2SB 1CAVA 2IXCA 3CO2A 1OI6A 2ET1A 4J1XA 2BNOA 4PIXA 1UCXA 3MYXA 4WBBA 2PAEA 3KGLA 2FMYA 2MNGA 1J3PA 5JCTA 1ZRCA 2Y0OA 4AVCA 1YFYA 1RGSA 4QGMA 4IESA 1DGWA 4I3PA
chains in the Genus database with same CATH superfamily
1TMF3 5FZFA 4GUNA 5I0UA 1BEV1 4JX0A 3SJBC 4QU2A 4NYKA 1X7NA 2ZGQA 2CE4A 2BSKB 4XIKA 4XFBA 3IC7A 3H1IH 5G05L 3ZHTA 2G9GA 2VQUA 4EWDA 1UL9A 3WNXA 2R7EB 4Q1PA 4PJYA 3B09A 1NZIA 1R6TA 2YIAA 5C9AC 2ETNA 4OPHA 5L3EA 4P08A 2VQ0A 3M2MA 5LEKA 1EP0A 4WZCA 4FVMA 1WD3A 2VNRA 2H3OA 1MOFA 2YXYA 2BP6A 3KCXA 5KXEA 1RUE3 1YO8A 1YLLA 1OCZC 2ZMKA 2CV6A 4DR7B 3MV01 3QBQA 3T2TA 1MG1A 4F6RB 1QVFU 3POGA 2BW8A 4FM0A 1N32O 1ZA7A 4MXVA 5GLZA 4Z8BA 1MS9A 4YSFA 2UUBB 1YNAA 3K46A 2HBTA 4GWMA 2BOCC 1VBE3 1YITV 1U5ZA 1E5HA 2HWC2 3CCRV 4LBEC 3APOA 3H8UA 2WN3A 1HRV3 2ADEA 3ZXEA 2WRAA 2H8PC 4E4HA 4FO9A 4YW2A 3KSCA 5T3NA 2ZIMA 1RSOB 4DMIA 3VDAA 4KGQA 3T0BA 1IPKA 2B9VA 4QKNA 4W4ZA 4CUCA 3D8CA 2JS3A 1AJPA 2QWRB 1Z7S2 2VW1A 3ZX7A 2WT1A 2WS92 1NZCA 3WQ1A 1TGOA 2NQYA 3OFNG 3THTA 3PVBB 2WNVB 1MZFA 2VWJA 1CR7A 4RQFA 2LP7A 3T1HB 3WXPA 2I74A 2VNOA 4LR3A 1BQ0A 3SPCA 1GN4A 2ZM6B 3APQA 2ZGTA 4B3TB 4NTWA 1B35A 3HKBB 5EYPB 3I56V 1S55A 5C4WC 1YFXA 1K5MC 5FZ3A 4DR2B 3O7OA 3K58A 3PUSA 3I3BA 1Q8SA 3WCRA 4GMP0 1JI6A 5T5OA 2GSYA 2QQPA 3DECA 2RS12 2ZGNA 2EIKC 1N32B 3TXSA 3K5LA 4BQXA 4OXSA 1VQ5V 1FKAO 2V7QG 1XILA 2FQPA 5D8AB 3WOGA 5FPXA 1G8WA 4DRXA 2ZPXA 1PMJX 1JJOA 2XVGA 5H6QA 2Y0PA 4Y5TA 1M4UA 4B3SO 3K5OA 3QTCA 2VZPA 2F23A 5JMCA 3ZXKA 3ZOIA 5BPXA 5JXIA 5FNVB 4BMEA 4PF1A 4UW6A 3CRMA 1FYUA 2A3WA 4CP9A 4DR4B 4IGGA 5K1XA 3ZIXA 5A3TA 1QQP3 5FZEA 3AMPA 1S0VA 2BGPA 5IVJA 4QAWA 3OMIB 4QPIC 2YC0A 4IE6A 1OHHG 3KS7A 4DXRA 2WPDG 2BGOA 3ECQA 1NTZH 4R4ZA 4JYBA 1AJQA 3LEIA 3I4IA 1GH6A 4HNAB 5LYJA 3RFRA 1S0FA 4TQDA 1Z7S3 1HB3A 3VN4A 2R1DA 4HNAA 3SPJA 5C5TA 1EBOA 2LS6A 4EN9B 1W59A 1HQNA 2ZCEA 3FLRA 3CRQA 5F1RA 1BL8A 4CCKA 3DSQA 1XE8A 3AG7A 3ABKC 4X20B 2RM21 4KMQA 1ND2C 1F15A 4ZZ8A 3IBMA 4OI4A 3LDDA 2ZXWC 5CKQA 1OVSA 4LFCB 1BVVA 3WF2A 4MW3A 4XHXA 3ATGA 3EXUA 3VDBA 4YW1A 1XDCA 2A5ZA 4XCBA 1W6PA 2RVAA 4UCSA 2KD7A 1AVMA 2UYAA 4LEJA 4CRQA 2OW4A 4UCOA 2KM2A 3ZFEA 2W39A 4IGOA 2D5FA 5FY8A 1JYVA 2HJFC 2H0VA 5FWJA 3VHRA 2DUPA 1H38A 4BQ4A 3J81N 3SJCC 3K4ZA 3M3EA 1OJHA 5FXWA 3QOPA 3WDUA 5LEJA 2XJTA 4CS2A 1RHI1 4JI3B 1C8M1 4QPGB 5KMGB 5ANNA 1W8UA 4TV9A 1RVF3 2HWB3 5HFMA 4P9PA 3SPHA 3ZHSA 2QQWA 3PUAA 2GDSA 3BUCA 1H6YA 2V4VA 4Q4Y1 4SBVA 1W04A 3AVRA 2JD9A 4XETA 4DEVA 4B29A 4X6QB 4OUMA 2R30A 2WNVA 4CS3A 4K3UA 1OZ0A 2PUSA 1AR61 1CONA 3L71H 3N2KB 1DZRA 1P4RA 4JZGA 1DQ4A 2LUWA 2BFUL 4AQ6A 5FQ0A 1W03A 5CFCB 3P5BA 2IU3A 2Z2SB 1RSOA 3AP6A 3HEIA 3AYDA 4C7UA 3N9MA 3JAWB 3MIFA 3ZYRA 1JYXA 3ETEA 5JWPA 1FOD2 1QLEC 4HKLA 4JDMA 1RJ7A 3ZVXA 4Y4YA 4C1XA 1V0AA 5FP7A 1I3HA 1BBT3 3GCWA 2HWD1 5H9CA 4IEQA 4UWDA 4Z2AA 4EN7B 3ZXFA 3WB2A 3JAWA 1YJLA 5A9GA 1MS3A 1YQ6A 3Q8AA 2J1AA 4XJ8A 4JAVA 2BERA 1SEFA 2BBVA 2QNKA 4AFCA 4O4HB 1UYPA 5FQ0B 4BK5A 2DU0A 3CMAV 3CSXA 4CP9B 3T4ZA 1WCDJ 1BBT2 2DWRA 4PLMA 1IKPA 1FOD3 2Z42A 2UXXA 2YSUB 5H2FZ 1DTOA 2BU9A 5DZGA 1AL21 3BABA 2A6ZA 1SACA 4AI1A 4UCUA 3WD5A 1KDMA 2E75B 1V9U1 1ASJ2 3FX7A 1RUJ2 3U4SA 4LIUA 3HR9A 4N21A 4RGAA 2F4VB 3CD6V 1H2KA 4ES9A 1H1AA 4EB6B 2HBUA 4LBKA 1BBT1 1RINA 2QQJA 1DLBA 2Y8KA 2VOWA 3ALQA 3NV4A 1BK0A 1R3IC 4DV2B 5FJKA 4CVUA 3NSTA 3HMYA 4LO5B 3D36C 2JKBA 4UBHA 3HVDA 1S2EA 2W46A 4WFGA 5FLXN 1PO12 4RAIA 1QDOA 1TEIA 4A7YA 3UT0A 3C90A 2WLLB 1YJKA 1FOD1 4ET7A 4NE9A 4JKMA 2XT9A 3OEEG 3GXUA 2Y4UA 5T55A 2RNBA 4LOTA 2XGXA 3VZLA 4Y5SA 3FKSG 3OB8A 1KKCA 2XTAA 2PELA 4X62B 1UKRA 2P3YA 3ZMVA 1CAUB 5JH7B 4N43C 5JOWA 1MVQA 5JVDA 4AYUA 1PVXA 3AKRA 4HPKB 1CAUA 2ZDIC 3OBTA 3W5MA 4CBCA 1N34B 1E5IA 2R042 2BOBC 2PYLA 2QM8A 4DV6O 5KA6A 2Y6HA 5FV3A 4G27B 3E35A 1WA6X 1MMMA 2E3CA 3RVZA 1O8PA 2XHNA 1AR81 3JUUA 4LBJA 5A7QA 4IV3B 4KWJA 1YDXA 1RUC1 4FXKB 4BW9A 1ENSA 4RR3A 2Z4FA 1IQDC 4ARYA 3IJ4A 5JQGB 1LU2A 1DHKB 3KB5A 1LHVA 3JBG2 1EPZA 2ZX3A 3D5OA 5FPBA 3TNPB 5J2UB 3HBKA 4NIHA 3KGZA 2LTNA 4WBNA 4FLVA 1H9PA 1KS4A 4H33A 2UURA 1LOFA 2VUJA 3CJIA 5LHHA 3F5TA 2WWSA 4ASKA 1RUH2 5L3GA 1QKQA 5HXMA 1FPN1 1PHMA 4BYYA 3WINE 4LTAA 3ELNA 5B1AC 5HCAA 3NWKA 3D82A 3OYWA 3S3XA 5FZ9A 1OSGA 3F2ZA 3N7LA 3STLC 2P3KA 3E83A 4LHLA 1PZ7A 1G9FA 4F3JA 4KUMA 1JHNA 5K7PA 2R70A 4JTCB 1ULCA 3LFMA 5LL6Y 4OLLA 3FFQA 2P4KA 2QR4A 4XDPA 3PIJA 4S2DA 1OXCA 1SLIA 4FOYA 3AEIA 3SXWA 5DAQA 3AVSA 3G80A 1YVWA 1BS3A 3IC9A 4WCEV 3WP5A 2DYRC 2WWJA 1XQ8A 2DF7A 4ASMB 5KC6A 3VZMA 1Z5WA 1Y76A 2PXJA 2VBDA 1OLQA 2JJ1G 4M3CA 4X9QA 2JDUA 1J5EO 4LXLA 2A79B 4X1YA 2O8QA 4RFRB 4I4TB 4NRPA 2DQ0A 1IPSA 2WT2A 1VBB2 2YI8A 3ACIA 4CEWA 3E1F1 5L7OC 4ZZ5A 2G19A 4XUPA 1ENRA 5FO8B 4OX9B 4B3RO 1N1TA 1YJWV 2VAUA 1AYN2 2YBSA 3ZN5A 3VBRB 1GQHA 1M57C 3EHBB 3V65A 3V0AA 2BNNA 2Q4PA 3OTOO 2ZEWA 5JOXA 2YC2A 3LE0A 1R091 1HRI1 1FPN2 3O1PA 2CAUA 2RDQA 4UFHA 1AR72 1RUH3 2RR11 3B93A 3KT4A 1RM1C 1VQLV 1PO23 4EN6B 3GALA 3TETA 3DN7A 2ZXQA 5EFUA 4EE2A 3D3AA 2GC2A 3VOUA 2AGSA 3WW4A 4I01A 4J6GA 4MYEA 2RG4A 2XJQA 4AZZA 1L0LH 2W68A 4MGIE 3IAYA 3KG2A 2UXBO 3WP6A 1GP4A 2ZGOA 4LA2A 3T0AA 1RYYA 4QB6A 4U7NA 2VUCA 5C33A 2H0BA 1R73A 1UYYA 1W6OB 5FZCA 1WD4A 2YPDA 4EEQA 2EXJA 4A6OA 3VZNA 4WFFA 4D7SA 2KQXA 5JI7A 1D4VB 4COWA 1X33A 4K1YA 2RDCA 1W6PB 3VZJA 1B04A 3M7MX 4QD2A 1NTKH 3NNMA 2XHBA 3AG3C 2LM3A 4XACA 3ABMB 1URXA 3ASOC 5B1AB 4HG6B 5ANQA 4IEXA 2MEV1 3GHNA 5DAXA 1AZDA 3FYEB 4LR4A 4KG8A 4ZOLB 2Q30A 4Y1VA 2DCTA 3RWRD 5JPMB 2W6IG 5A6QA 3K5MA 4LBQB 4AEMA 1SBEA 4JV4A 3BN6A 2LJ2A 1WMEA 3C7EA 3I3QA 4YY3O 1AR91 4XAEA 5KLVH 4CUBA 4WFHA 4Y26A 3OY8A 2ORXA 3WNLA 4KBZA 5KXDA 1IBLB 3TGUH 3PIGA 3CKHA 5A6ZA 3W9AA 1U12A 4OPAA 4MXWA 4FFKA 4NAMA 3SR2C 3JD2A 2YI9A 3IPVA 4YXWG 4P14A 3LEMA 4CCEA 3VB9A 5C6CA 1JZ4A 1VRH1 4DXSA 2ZACA 1IVSA 4IDZA 5J96B 3RYIA 4RS5C 1ASJ3 1LAJA 2CDPA 2XAGA 1D4M1 2WC2A 2DJVA 4G4FA 5HXVA 5FZMA 1YQ2A 2KSDA 1M9NA 4WFEA 5JAXA 2BDRA 3ZXDA 2F6BA 4HETA 2UUAB 2VVEA 4QXBA 4Y20B 4CTEA 3N9OA 2CGOA 5IVVA 4AR2A 2CU5A 4EB6A 4IHJB 1ZRFA 2RJZA 2ADPA 1W6MA 2OYQA 2IFWA 4Q4X2 1MEC3 1S2BA 3S0MA 3VKOA 1QWRA 3BAAA 1UOGA 1YXWA 3SYQA 5A7WA 2WYFA 5A3NA 2EZPA 2FCUA 1PIV1 2BWAA 1ZUQA 1WCUA 1A78A 3A8TA 1AR63 1JR9A 2W3JA 3AZVA 1VB2A 1RP3B 3E97A 4CPBA 4WVMB 5HCHA 5B4XA 1KYOF 3SISA 2J7MA 5LGUA 2R072 4YW3A 5GZFA 3VBUC 3TYJA 1TMF1 1FJGO 1G9CA 3O0WA 1RTVA 2P7TC 4TN7A 2ZJCA 1TME2 2OCCB 4L2NA 2QWNB 2V5DA 1DP0A 1K3IA 2VC9A 4NHMA 2R9AA 3ETGA 3L9JT 3AXDA 3WG7C 2FZ1A 4IV3C 3WHUA 2HEVF 4HN0A 1XNDA 2Q69A 2WNUA 1PK6A 1BSMA 2E7QA 2BVVA 3DTUB 4HN1A 1IQAA 1I08A 2QBXA 2R0FA 2BTQA 5FOJB 1QHTA 3M4FA 4PD4F 4JV5O 3FAVA 1TQ5A 3N2GA 4XABA 4LF4B 1R6NA 5LY2A 5IT6A 1AXKA 1H1IA 3K9SA 1GWKA 1RUNA 2HWB2 4TLFA 2FCVA 3ETDA 2ZAHA 4X8NA 5FKBA 5J48A 4JV5B 1UX6A 1I9RA 2IXJA 5JIAA 2EALA 3B00A 2WDBA 3GZAA 2F4LA 4UVBA 3HNMA 2SLIA 2VZRA 4O4JB 2EIEA 4LT5A 1UY4A 3VDDA 5K0UC 3C3TA 4XDQA 1R3LC 1QBZA 1HB1A 2W9XA 5JSRA 2YZ4A 2TNFA 3CIHA 2VXRA 4C8DA 4JDNA 2OWOA 1NXMA 1REDA 4DUZB 1DDLA 5LMUO 1QQP1 3STZC 4DS0A 4FPFA 1W9SA 2OX0A 2J1SA 4K8XA 3VV1A 3KMHA 3MDSA 1WWYA 3ETQA 5LBQA 1F4NA 3CCJV 3VKNA 4MVOA 3U78A 4X1IB 4BPZA 4GB32 2Y6KA 1RPOA 2BZDA 2VVDA 5EV7A 3PDQA 3POYA 3A0KA 1NY72 3WG7B 2VR4A 4PT6A 4JTNA 4X65O 3A2FA 5DM6V 1KJLA 3T2PA 3VUOA 1VBB3 3K2OA 3UKVA 3Q8CA 1UWWA 5BXXA 3WF4A 2FDIA 3E5UA 2NLRA 3GDBA 5KC5A 3AP7A 5E89A 3ACHA 1NCQA 5FZHA 2D6LX 1XEQA 1W8HA 3H3UA 2QWQB 3WP4A 3UESA 1PNMA 3DKQA 4HYOA 4XPVA 4LFAO 2VZOA 1I6XA 2E32A 2Q4SA 2V5YA 3JD72 1W3XA 3BCCH 2VD7A 3FLPA 4AQYO 3BOWA 3ZHUA 3SH3A 3NJYA 3CZUA 4DXWA 4JAUA 2IZWA 4YM2A 3JAKB 2ZE5A 3LEKA 2ZE8A 3DXUA 5LMNO 3JD0A 5AC92 1ZRCA 3MIBA 3Q8EA 2OIEA 5FNVA 4C0BA 3B9IA 5EBWC 4QGMA 1P7GA 2HP8A 2PLV3 4RD7A 4GKKO 3EHKA 3S5AA 5LCWL 3A0RA 1CAXA 3MW3A 3L9DA 1OF3A 1V55C 4TWKA 1ZA4A 4XW3A 2XASA 4J25A 3DF0A 2VOKA 5EPAA 2XAJA 2GMMA 3ZFEB 4Q0VA 1KP2A 4JI2B 4UW3A 2WLPA 5SV5A 1YIJV 2EINC 4EYUA 1BYHA 3RZLA 3SCGA 4CCNA 5JOZA 1OFSA 2VTXJ 4QPIA 5LA6A 4UB6Z 1F7YA 3ROUA 5A3MA 5GKAC 2AZ5A 2L9LA 3DC5A 1AR82 1NOVA 5K0UB 3RWKX 4X66O 3M3QA 3T2MA 5LXTA 2GAUA 2V4AA 2JIGA 1CPMA 5FCCA 1FNYA 2VULA 1AR5A 3CCVV 2ITDC 2PQQA 5FZ1A 3K51A 3SDLA 1BKZA 3KHCA 2JDMA 4DEQA 1YFUA 4W8JA 4COYA 5B3SC 1NYWA 3O0XA 1F51A 4O2AA 3JARA 4HT1T 2ZBJA 3AMMA 2Q1FA 1NVPD 4EWAA 4YGBA 1SQQH 5FO7B 1V00A 2IH1C 1RUE2 2JDAA 2ZM6O 5I0DA 4ZY9A 3ACLA 1XRUA 1NY71 3HKEA 1WLDA 4C91A 4L9BA 1W90A 3S57A 4OQ9A 2W47A 1HP8A 5A33A 1GP5A 3UO3A 2P5OA 2N74A 1JPXA 5H6RA 1LKNA 4J10A 2LALA 2F43G 3CS5A 2VMFA 3ES1A 4DB5A 3T2QA 1SPPA 1K5QA 1PO21 2W1UA 1W8OA 1WLCA 4QQOA 4AQTA 2JX9A 4NXNB 1S77D 3OGJA 2Q1MA 2ZINA 4MVTA 1ZZ6A 2FZ2A 5KUMA 2GN3A 1NA1A 3ZSLA 3M99B 3PNAA 3B3QE 3CQOA 4QXHA 2ATFA 1VR3A 1C8M3 2Z0AA 2D2CB 1GANA 2YB7A 4WVZA 3B77A 2XL9A 2PQSA 2XNDG 2ZX0A 1K97A 4UT5A 2FDGA 4HPKA 4LBOA 3TXQA 3F5WC 1V55B 2B5UA 2MPFA 4O9EA 5AG2A 3DUIA 1RMU2 1CAWA 2DBIA 5GLTA 4QX3A 1GSLA 1L0NH 2HWD2 1KFXL 1QEXA 2ZEXA 5KHIA 3RYHB 4LF7O 4AGGA 4MVSA 5FZAA 5FYTA 3N9LA 1SG3A 2VUDA 2W94A 2CNAA 1G7YA 1JZ6A 3OPWA 5FZ8A 1KRIA 5FLJA 5B5EZ 2VOXA 2VRZA 3TBDA 2QKAA 1UNBA 1ALYA 4JTOA 3H1KH 5KA5A 5FYSA 3I3EA 4UFJA 1EAH2 2WYSA 3TEZA 3U75A 1GKBA 4LO6B 4XFAA 4ZI7A 1OPOA 5JI9A 1OD5A 4AVAA 1GWMA 1S4CA 1GMMA 4B7EA 1PIV2 2BYVE 1H2LA 3BY6A 1YEWA 4IQPA 5BMVA 5H9PA 2TUNA 3HNBM 2VUAA 4FAGA 2BEOA 5LZ6A 1H0BA 3CCEV 3MIEA 3AZYA 5JSOA 1MS0A 2G38A 4QM9A 1NUKA 1I94O 1LHOA 2ZZQA 3KD4A 1VMGA 1JS9A 4WBNB 3ZLIA 3OBZA 1UU5A 4J41A 2UY9A 2F66C 4AW7A 3FE5A 4ATEA 2Z3YA 3ZMTA 4JQRA 4QPKA 3PJSK 3JCZA 2NNUA 1GK9A 3TN91 1SFNA 4M0NA 3SPGA 5LP6B 2BTQB 2KKWA 4I0XA 1H8TA 2Q1ZB 3U1XA 1ZREA 4KHPO 4P9OA 5J09A 3ZR5A 2P17A 1MZ5A 1WZXA 3QO7A 2UUCO 2E76B 4DY5A 4HFSA 2BE3A 4FCAA 3H1LH 2X05A 4OCTA 4K6BA 5BNOA 1VLNA 5DABA 4DV7O 1AJOA 1OVPA 3D3QA 1WW5A 1XL6A 4GZ9A 4HK8A 4LPLA 2O57A 2A3QA 1AF9A 2JG9C 5K4LA 4YFWA 2IFRA 3K79A 4DV2O 2Q8OA 2EIKB 3S5QA 2DVBA 4ZBMA 1M4WA 5FYHA 2ET1A 2IM9A 4H37A 4QB2A 1E5SA 4LF9B 4YGEA 1Y74B 1BQZA 3KGLA 1H30A 4FPHA 2WLLA 2QQMA 2D3SA 3ZSKA 3GYDA 2W5FA 2DN9A 2LFSA 5KR7A 2IJJA 2X29A 3LA3A 1BHAA 1I0HA 3VQWA 1N33B 3OUHA 3KKYA 4AILC 3AG4B 4NPMA 5JCOA 3OYWB 3IDEA 4O7XA 3OR6C 1UIKA 2AZ0A 3ICXA 5D1IA 1NLQA 4CDUB 3G67A 1LGCA 4N7UA 2VPVA 4LIVA 2JENA 1ZBA2 5FXXA 4JYYA 2HJDA 3LB9A 4A3XA 5HV4A 1SQXH 1D2SA 1JX9A 1AR1B 4MZUA 3PU3A 1WP7A 1L7QA 1KQSU 5CAZA 3KCYA 4WM8A 1CAXB 1RUD2 1LB2A 2ZR2A 1V6NA 3NQHA 1HQLA 4OMCA 4D7TA 4URAA 2WAOA 5DMYA 1F5FA 5L36A 3I2HA 5FREA 3I2OA 3K9AA 4DPNA 3CYOA 2D3PA 2MEV3 4E2QA 2ZMNA 1IG3A 3CMGA 1C3HA 3HKDB 4KI5M 1LUWA 3ZXJA 5DDJ2 3LOBA 4W4LA 4PLNA 1GOGA 1US2A 1LOAA 1NI8A 2OCHA 1EN4A 3KCCA 3LPGA 4FFFA 1R092 4D6RA 1HB4A 1HDJA 3HT2A 2DV9A 4PCRA 4U3JA 4QPGC 4A2UA 3INAA 4ISQA 3X2QB 2WABA 2HWE2 5K9YA 3GZTB 4RYDA 1YUDA 5J9PC 2YMZA 4JKLA 4LF6O 4Q26A 2SBAA 3JD1A 3L70H 1WBLA 4CU9A 3J80N 2P22C 4XJZA 2RR13 3FX3A 3JQXA 3PHMA 3BVOA 3LDBA 1F4AA 2HEWF 2UXDB 4XEZA 4TZDA 4CP2A 2JS5A 5FY4A 4ORFA 4QXKA 4CS4A 4IEPA 1IG0A 2VGDA 3EVKA 4FOWA 4Q27A 3AK2A 1DZTA 1QNWA 4AGRA 1O3TA 1FXHA 1WMXA 1DYPA 5FIXA 3VD9A 1R1A2 2XBO1 2K46A 4LC1A 5C93A 1MSDA 3ASNB 5D5PA 3UNPA 1HB2A 1R093 2EF6A 2WFF1 1REEA 1VIWB 3OD4A 2YIDA 4WM7A 1SQ4A 1ZZ7A 2BBAA 1YQ5A 3LDRA 2O0OA 3O1RA 4Z1MG 2CTPA 5L3CA 5FL7G 2UU9B 5D8AC 4Z07A 1F5JA 4FPCA 1CZVA 2D6OX 3IIIA 1RXGA 1IS5A 5H9QA 1HR0B 4O2BB 1ND3B 2JWPA 3LF7A 3B5LB 2IVJA 5FTTC 1XB9A 1UIJA 2D93A 2IWGB 1PGL1 3QF7A 1W6MB 1CPNA 2R9RB 1Z7S1 1RUD3 3HBZA 4BIUA 2NR5A 5FBJA 4DR4O 5IATA 5J36A 4OI1A 3K77A 4CDXC 1DQ5A 4Y20A 2G9ZA 1NZ6A 1PX3A 2QQNA 2YY1A 3USUA 3WG1A 2RS53 1EV11 3GBFA 4FFGA 5ERLA 1RM1B 1SPPB 3ZO0B 4L8JA 1Q8QA 1IBMB 1VIBA 1UPIA 1DGSA 1MEC1 1XSQA 1GN3A 2P67A 4H44B 4CUAA 5C71A 1VQ7V 2OS2A 1NU1H 4MT8A 4XJAA 3LSEA 3JD3A 1W06A 2RS32 3N4MA 3PVNA 1OA3A 4I0WB 3IWZA 4UVAA 2ARAA 2PYTA 5FYZA 5L9RA 3ZDVA 4FMTA 4GKJO 3HKEB 1N36O 2M6YA 1POV1 2PI5A 2FB5A 1LOGA 2QDNA 3AMHA 3FN9A 3B94A 1QJY3 2AENA 4E4ZA 1NX9A 4BQYA 4IE0A 3MW2A 4DW0A 2YC4A 3WP3A 4DFSA 4UW4A 1PO11 2GN7A 2VCMA 4MO3M 3J7LA 5BZBA 3ACGA 2VQEO 3T4DA 2EULA 1M5IA 3QNEA 1W6NB 2XVLA 2JXAA 4URTA 3KT7A 3W7UA 5FZKA 3IMNA 3ZFGB 2XONA 4PLOA 5F2VO 1PVC3 4PDVA 3AJZA 5A7OA 3KZIZ 3AP4A 2R062 2QQVA 1TVGA 4GH4A 3ENRA 5FRAA 5FDBA 2Q9LA 3Q8BA 4NIDA 2CYFA 1COV3 2YGMA 4YW6A 3AXEA 1AP6A 4LF8B 4UCTA 4QDRA 2E31A 1W8NA 1CX4A 3NNFA 3VBOA 1ST8A 3H3ZA 4YIPA 3GM8A 1NS1A 2EXHA 2P90A 3DC6A 1IX9A 4MXWB 1V9U3 1H4GA 4HKOA 1A8MA 1O6UA 5BNQA 2GUZB 5KHHA 5JUVA 4DV3O 2CTVA 1AVBA 4UB8Z 3NNGA 4X1KB 4QWNA 4RR3C 4DUYB 5IJ0B 5IYZA 4UW5A 3SJQC 1VRH2 3ZFEC 2VQAA 3KHBA 4FQZA 1JZ5A 4NROA 4Q8KA 1PNKA 4AEKA 4GALA 4EN8B 4L8QA 1YI2V 1EPWA 2WZ8A 1W8ZA 5KUKA 5FYMA 3CJIC 2D5HA 1D0GA 1Y4WA 2YG0A 2WLKA 1AR92 4Z1VA 4FTEA 4O9GA 1TVKA 3AG4C 4AI8A 4CH4A 5FAXA 3UKTA 1WLEA 1FMD1 1XHZA 3JXSA 1CQ9A 3VD7A 1YQCA 2E74B 2XAHA 4EFBA 1XYPA 1SERA 2Z5WA 4HMZA 1HN0A 3WB0A 4D7YA 2IH3C 2YGLA 3VBRC 3VQXA 1RUE1 2XVKA 5F5AA 1JBCA 4O4LA 1TME1 1X36A 5IJ9B 4GKKB 4IERA 3ZRVA 5IYYA 1NA1C 2P2KA 2C9AA 3ZYIB 1Q43A 4QPYA 3ABLB 4YM3A 1STMA 5IHRA 4K0KB 1LRHA 2ZGPA 4MH0E 2Y0IA 2RJKA 2FDJA 3POBA 4GH4C 1GNYA 4FLUA 4NHKA 4Q0QA 3E6BA 4JGZC 2WFPA 3MEPA 5HV0A 2ILMA 1PGW2 1XU1A 5LRSA 2VMHA 2OCCC 2PHLA 3U37A 2BSKA 1XSRA 5I0TA 4I7ZB 2ES3A 1C8M2 4FFIA 4AEDB 1H9WA 1HJFA 1F23A 5C8CB 1AYM2 5F3EA 4A45A 3MF9A 2W1SA 2Q67A 3LSDA 3OSDA 1VF7A 1XI1A 5EJ3A 2ZHKA 5F6LB 4K9SA 2VZVA 4XQ4A 2B9UA 4LUMA 2F4PA 2K2SA 5EYXA 3CRCA 1HWYA 2RE9A 3BPZA 5FR3A 4RGGA 3APBA 1UO9A 3AFKA 4BM8A 5I0SA 4V2WA 3SPIA 2TEPA 5CYYA 5EIYB 3CJIB 4QX7A 3V64A 2IXHA 3VHNA 2QQIA 1WA8B 1V6LA 5FYYA 2PYJA 1RVF1 3IDCB 1HRI3 1I7FA 4G3YC 4P00B 2JDPA 2NN4A 2PLV1 3I3MA 4CZZA 5FYCA 4RR3B 2X5IC 3NV2A 5H9SA 3WNNA 4FTSA 4XDKA 3I7DA 5TISZ 2QTWB 1V9PA 3OGSA 2B7YA 5IWAO 4KWUA 4AFAA 2I07B 3ZDSA 2XOKG 3M3CA 4TSFG 4JI5B 1E57A 4GKXA 3WNMA 2PFWA 2PZSA 5E1RA 1BQPA 1W2NA 3JASB 2EIGA 3OGIB 1LHNA 2A3YA 3WW2A 3L75H 1H4HA 4IETA 5LATA 4COVA 1N0NA 1K5SA 3BYWA 4JF3A 4JGSA 2C26A 1QNMA 4WV8A 3FJSA 1WJZA 4LCUC 3I49A 1XMQO 1GZWB 1S0JA 4PQ9A 3RZJA 2F95B 2XB6C 4IEUA 2WA3A 5C8CC 1AR83 5JZGB 4G2KA 2GP5A 3DYMA 1EV13 3CXCU 3AM2A 2OT7A 4X8PA 4DZGA 2GU9A 4Q8LA 3AK3A 3MW4A 4LJHA 2DYCA 4XFCA 5CVRA 1VF6C 5C5UA 3R05A 4ZHNA 5F39A 1D7PM 1IPJA 3N7MA 1Q6HA 1SZTA 4XBFA 2UY8A 2V4DA 1PNGA 3M7AA 3MLLA 5GW7A 1BEV2 4JRLA 4OHVA 1CP9A 5KBFA 2X09A 4P9WA 4NPRA 1VQNV 1S2KA 5FK7A 2KA3A 2YHJA 3ZYPA 2RJLA 1PGW1 2XBO3 1VQ4V 1AYM1 2I2SA 3G71V 1Q82W 2CL2A 5L7OB 2LROA 1MNGA 4X64B 4KWLA 3ILRA 4YIOA 3AZZA 5LBBA 1UXXX 3T30A 1HNXB 1M1KW 5C8WA 3CC4V 5BR8O 4MVMA 2GNDA 5LGTA 4B8EA 1BCXA 2ZMLA 3T4VA 1SRYA 1JU4A 4ONUA 3ZPOA 4AI0A 3Q8FA 3ETPA 3QACA 1GNHA 1HXS2 4FLXA 2D6PA 2EAAA 2JEUA 5B66Z 2OA2A 4AAXA 3UJOA 2GTAA 2BTVC 5CEHA 1H8HG 4CA9A 1PZ8A 2QKDA 4N8MA 4GX5A 3U07A 3E86A 4FJCC 3CP1A 3MHSC 2ADQB 3USUB 3ZXGA 3I2DA 1AJNA 5DG1A 3JSLA 1VBC2 4ATFA 2GSMB 1NLSA 3T1YO 4XDOA 1AHSA 4I4TA 4FP2A 4LORA 3QO8A 4XDLA 2JICA 1MABG 1QNYA 1VBE1 2WWWA 1A32A 3I2FA 1UY1A 2AZ2A 2XHKA 1BMV2 3K4AA 2N04A 4AVSA 3JD4A 4G28B 4DK1A 2FL4A 1F8VA 2YBPA 4CDUC 3E6CC 3GHMA 3VDCA 3K4DA 4MV2A 4K3AA 1Y3TA 3T09A 4DUWA 2J1RA 3AKPA 3PLQA 2A6YA 1DBNA 1F9KA 4AI9A 2OT5A 3ASOB 5EIBD 4NRQA 2PAKA 4AHCA 1MQTA 2PA7A 2BVBA 3K48A 1QR9A 3U0ZA 3KLSA 4YZ4A 3LNNA 4B4PA 4JI7O 4NIAA 3E5XA 4INDA 2FHRA 2ZGUA 1FXKA 3C7FA 3KWVA 1NT0A 1BXHA 4GULA 5C4WA 1O7FA 1XE0A 4RWUA 2QWPB 2B39A 3HAGA 3UGFA 2B9ZA 2NZ9A 3P30A 4LFBB 4CDQA 1GLHA 2J1UA 1N1VA 4LHSA 4DRRA 5FMBA 3F7VC 4MG2A 4PELA 3BIEA 5J98B 3RYHA 5FMCA 2ZAAA 1WN7A 3WSOA 1JUHA 2JDIG 2AEYA 3U14A 4W6YA 3MDPA 3HQXA 3GNEA 2WBKA 4PI2A 4BZ4A 3HKCB 4Y1UA 1ZBE2 1I1EA 4QX2A 2JG9A 4CDWB 3JARB 4LWSB 1ULDA 1WCSA 3RYPA 1GOHA 1VP6A 4ZONA 4LE3A 1NH2D 4LNUA 3OGVA 1QOTA 4WFAV 4PDWC 1IHMA 2E51A 1XQNA 2CWSA 3S7IA 5F5IA 2KXLA 1FAYA 4LO7A 4L92A 3O14A 3JATB 5IWFA 2QCSB 3EJKA 3N36A 2Y6JA 2P3IA 2K1EA 3K57A 1OLRA 1HW7A 4HSJA 3LSQA 1UKGA 3BPSA 4YM1A 2VOTA 2CTQA 1C1LA 2UYBA 5C9AB 1K34A 2PF4E 1A3KA 5CNAA 4DW1A 3BOPA 4QE7A 1JTZX 4FLWA 1C8NA 1SESA 2LW1A 3BRCA 3ZMOA 4D3WA 4XMAA 4I2OA 5C3OA 4GA9A 3MIDA 1OCZB 4MGYE 3I2GA 1PMHX 4KWKA 5IUQA 1X8MA 4K7JA 1RUG1 2EZOA 4IW3A 2XXZA 3IT8A 1XOUA 4OYUA 1GV9A 3RW0A 1ENQA 4BHPA 2ZZJA 1LHUA 1SA0A 5IVCA 3ZS8C 1N1SA 2FTKA 5DUWA 4DV0B 2R16A 4OULA 5EZYB 4DYLA 1VF6A 2PHWA 4P9XA 4QPWA 5FZ0A 4KNCA 1POQA 5EZYA 2WFF3 3UM7A 4JI6O 1J83A 2ZNJA 2V72A 1XHXA 2BGCA 4JI4O 3JD71 4DV4B 1W2OA 4WM8C 5LY1A 3DXRB 2DURA 3KV9A 2VBPA 4ES8A 1ROPA 2OUJA 4YHHB 1VQOV 4JI6B 4IYHA 2ZX4A 2Y60A 1KUQA 2VMIA 3ZN1A 4MSVA 5DECA 4UF0B 1MS5A 2M7WA 4HVRA 1XMOB 2HHHB 5A2QN 1OMIA 3LEGA 2MK3A 4NO4A 1JW6A 3B7MA 4MVQA 3R6SA 4EN0A 4LUKA 1E1RG 1W8FA 2B42B 5LBEA 1XOYA 5FZDA 1Y76B 2O8OA 4ARXA 5C4WB 2WNUC 3GGLA 4XBQA 1CESA 3EXAA 2PHRA 4R8HA 3BU7A 4WM7B 2G1MA 4QQLA 5BR8B 4NTYA 3OR7C 4L87A 4CEYC 3NNLA 1XNQB 1KU9A 1X82A 1OUSA 3C7OA 1SS3A 4YZ2A 3AKTA 4H2AA 2ID4A 3ZEDA 5HCBA 2Q7EA 1Q8VA 5T5JA 2WZR3 4LKDA 2VS0A 4CH5A 1S0EA 1HRI2 5IYBO 3POJA 4DXZA 3SKJE 2LW8A 1JYWA 2EIMB 3CJHA 2ZABA 1QXRA 1QDCA 4LH6A 3KV4A 1OOPC 3HIFA 2DYSB 2EILC 4FPKA 3ZN6A 1QMJA 2ZE6A 3OUIA 2MNGA 2C6SA 3K59A 1D2DA 2WL1A 2Q8CA 1VB4A 4GLXA 1XNRB 2BWCA 3BIWE 3AMQA 3DGEA 4NHXA 5CISA 4Q4V2 2Y33A 2LGQA 3BB6A 1U96A 3CCMV 2Q7GA 4K8FA 2Q68A 4LITA 3H3LA 1ENVA 3E2EA 4KU7A 1KFUL 2DCYA 1RC6A 5F2WA 4JI5O 3T1YB 1D0HA 2UXCO 2R0HA 1W2AX 1AL23 2E5LO 4WM8B 1Q8OA 3F95A 5ACA1 1DF0A 3A4UA 1JQ0A 2PHFA 4BAYA 5A80A 4CCOA 1VBA3 4XJ9A 3AP5A 4J9ZB 3RZKA 2CTWA 3K04A 3W20A 4WF9V 3J4UH 1DQ6A 3A0NA 4QX8A 3VD3A 1D5NA 3KM5A 4QPGA 3ZM8A 4MVUA 4I9WA 3RZGA 2Q8EA 2IBZH 4JTAB 2VMEA 3O65A 4MHRA 3PTRB 2YXHA 1VMJA 1MS4A 1TNFA 4B3MO 4FPOB 3RI8A 2GNBA 1HNXO 1Q90D 4DV7B 1RUJ1 5IT9N 2DTYA 3TOJA 2HWF1 3MV11 1W05A 4AL9A 3CMEV 3JZVA 5JR7B 2GNMA 3VBOC 4Y24A 3V0BB 4YWAA 1SLCA 2EAKA 3LA7A 3CCUV 4CEYB 3BGAA 1LNSA 1OKQA 3AZWA 4J7JA 2XJVA 4PDLA 5C3QA 4JI8B 1W39A 1Y4MA 2R043 1XC6A 5GLWA 1BMV1 1ND2B 2W1WA 3VQYA 3H7JA 4DR5O 2ARBA 3LWCA 5JMOA 3I59A 4BE3A 3D3IA 1OHFA 3OD0A 3WQ7A 2RJ2A 2EVXA 5FYUA 2C24A 4FSJA 4J42A 1LOEA 1Y9QA 2UWBA 4AWDA 5FMDA 3SCHA 3FHAA 4LBQA 3M8AA 1NE6A 1FV2A 1SBFA 3UJQA 2JGDB 1NCRA 4FPEA 4JI8O 2VG9A 2ODMA 4MGQA 1H2SB 4HBNA 1GQPA 1JVMA 3K5NA 1V6JA 1COV2 2UWCA 1SFYA 4E9KA 1GN6A 2E7AA 3DL3A 3CZJA 1NT2B 5A3PA 5T5PA 3IMMA 3THDA 1PM9A 3LOIA 1QLEB 2W0XA 1HDKA 2FMLA 1XNCA 2QJVA 1EFRG 2XAQA 1EAH3 1LEDA 1FV3A 1K8AW 1BZWA 5FZ4A 4AFDA 1T5EA 4B4RA 4EQVA 2Q73A 5JCOC 3VHPA 2HEPA 3B2EE 3NJXA 2GC0A 1AUYA 1PMIA 5JOYA 3FB5C 1GTOA 1LNQA 1KD1W 4ZHQA 4DINB 3ML0A 1K92A 1JZ8A 1A34A 1P7BA 1LOCA 2VZQA 4V2VA 1ZAUA 2Y69C 3R4DB 2X10A 2XMLA 4LNVA 3MPBA 3X29B 4UXAA 4AGVA 3I2JA 5IVFA 3GCXA 3T1CA 1VBD2 1SFPA 3ZRSA 3I2IA 1QH6A 1OA2A 3IN9A 5JSPA 2Y34A 1SMVA 4QMAA 3USSA 3URFA 4YW7A 4MGSA 2WLIA 4FTBA 4QU1A 4YVSC 5JR2A 2VY0A 1GMGA 1ZVFA 1Q56A 5A1FA 4CCJA 4XF1A 3O1SA 3ZBHA 4U3JB 1UMHA 2FYUH 4B3NA 2ARXA 3NV3A 2Z69A 4N53C 4R8CA 2WIIB 4X1KA 3JU9A 4LF9O 2GUZA 3WNKA 1R1ZA 2FBEA 3J7MA 4I0XB 3L73H 5I0RA 1DGLA 4F83A 2HHHO 1GYKA 4DV1O 4KGGA 4PDWA 1POV0 5LOVA 3UV9A 2OXBA 4QKDA 4Q5OA 4BDVB 5G04L 2JIJA 1JJ2U 2JIZG 1FAFA 2ZDIA 2NMOA 3HQUA 2JB8A 4LP8A 1JODA 4KHPB 1R081 4XTPA 3WDWA 1UOJA 4NHYA 3ZFGA 4AQ2A 3ASNC 2RS11 4I0AA 5FPRA 1FFXB 4A4AA 3JAMN 3DV8A 3KQRA 1CAVA 5T50A 5A33B 2WR9A 1XXNA 5FO9B 2WT0A 5JDBA 2FMYA 1ZL8A 1Y43B 3G4SV 3ZR6A 2ZGSA 2CWMA 4YZ5A 2IUWA 4QT6A 3I8TA 4CC5A 4E4DX 1UU6A 2NP0A 1QXJA 3GZUC 4CC6A 5FP8A 2OUHA 3HNYM 1I94B 1RPRA 3AL5A 3S7EA 5CADA 1GRJA 2CK3G 3FL7A 2WS91 5F7UA 1OUXA 3VBFB 1K5MA 3CCQV 4I55A 2A73B 3ZX6A 1LODA 2BFUS 4E27A 2VZUA 4LNUB 1DF4A 1IGOA 2X53S 1KDKA 1OCCC 5EHDA 1W9TA 4WVMA 5FWEA 5B1OA 3M1HA 2QKCA 2AR6A 1V6KA 4QHBA 5EP9A 2WLMA 1PNLA 5JVDB 3TK1A 3HD8B 2OPKA 5LMNB 4D6SA 1KB9F 2HWC1 1X59A 3QCWA 1COV1 4YVWA 2EXIA 3WG4A 4W6WA 4TUYA 2ZGRA 4IL7A 5F37A 1N0JA 1OC1A 1OPMA 4MGKE 4BIOA 4FPGA 4QDQA 2YIBD 4DV1B 4N7IA 3H9VA 2JE7A 2A70A 1H8TB 2P6HA 1QR8A 3OGGA 1O4YA 3NW4A 3J8F3 1M90W 2D3RA 1GBGA 3ZRWB 1WNSA 3PMEA 1YXBA 3LAGA 5CB7A 5KXCA 4LLFA 4P5YA 3RNSA 2ITCC 1X9PA 3AP9A 3THCA 5LGNA 2A3XA 4YPJA 3JALA 4YFZA 3O1TA 1QLNA 1VBD3 1WAZA 5F6KA 3B01A 5KWRA 1M57B 4GKJB 1FI2A 5FUNA 2ZGKA 1SA0B 3WNPA 1XYNA 5FLIA 3THPA 5IJRA 4QM8A 4ZPIA 4CE8A 1SZBA 4XUQA 2QEXV 3DPRB 1RUI2 4NMIA 4NXNO 3TB0A 1LENA 2XDVA 4K8RB 2FDHA 3OUSA 4BQ5A 1C4RA 1IBMO 4H3WA 5AVAA 4RA0A 1VE0A 4FPPA 1ND3A 3PURA 4ZS3A 5DN2A 3JBG1 4S2HA 4XE9A 1DGWX 5IK8A 5ITZB 1MS1A 4IIJA 3TN93 5LMUB 4I09A 1P49A 3UT5B 3FB8C 5KAFZ 2KG7B 1VAKA 3D4KA 5EJ1B 5E8AA 1I5YA 2ZGLA 3K08A 1Q81W 1GOFA 4XYXA 4CXWA 1AX2A 4N9IA 4M3CF 3KF3A 4BQWA 1AJKA 3AK1A 2R6QA 3AK0A 1Q6UA 5A3UA 1QU0A 4OHYA 4LK7A 2P6CA 1HV1A 1QQCA 3AKSA 5A7PA 2IJIA 1ZSPA 1REFA 2VMCA 1XUQA 2X6AA 3LGRA 1QJX1 4IEYA 3WQ0A 1QJFA 2PTMA 3OBAA 1RUOA 1RUI3 1L1FA 4NXMO 1OCRB 4ITCA 4TT3G 5A1LA 4O4JA 3PVEA 4DXTA 1C57A 2O14A 4N90A 3S3WA 4Y33A 3K0GA 3WUCA 4XF4A 3WHTA 1NA1B 3WFVA 2JDHA 4LBMA 4CCLA 5KXBA 3HN1A 5L7OA 2P6JA 2Y69B 4MS2A 5GTIZ 2WQ4A 1YJ9V 3NAPB 4YVWC 4XC9A 2F93B 1AXZA 3BFRA 4AE2A 1PIV3 1KQRA 2BJSA 5A3WA 2VU9A 1I5PA 3VKMA 4E2SA 1AX1A 1W0JG 1IURA 5LBFA 4KG0A 4JCKA 2R1BA 2QQLA 1OQ1A 3TEXA 1OURA 3UQ8A 3RBZA 1GU3A 2NPIA 3ABMC 2WA4A 2OPWA 1TME3 1BJQA 1R1BA 1UMIA 5J1XA 1WA4A 1O8SA 2UXNA 4Q0UA 2HYXA 4FP3A 4PDMA 1LR1A 1CIWA 2X5IB 3EBRA 3C2UA 3FHIB 1AI4A 3IFXA 4J80A 1DYOA 1YI7A 4DR1B 5HFLA 1O3QA 3MD0A 4JI3O 1J1LA 4AQYB 2HKOA 1GZWA 5A3OA 2A6WA 1EN6A 4Q0SA 1RL3A 4RQEA 3M70A 2VOVA 2YU2A 5KHJA 5F32A 4ZXKA 3T4HB 1YSCA 4UV9A 4C90A 4GCZA 5A3LA 4X1IA 2UU8A 1SC5B 3DPRA 2WZR2 2KB1A 1U0AA 1CD3G 1UXZA 2Y48A 1FXVA 4BIFA 4OHXA 1PM7A 4PJ0Z 2ZEZA 2GALA 4UCRA 4Q20A 3CXHF 4X65B 4LFCO 4HZFA 4BLJA 3P1IA 4NXMB 2VJXA 3RYFA 4K21A 5E6HA 1OI6A 2YPJA 3R65A 1ULOA 5JCTA 2DMXA 1UZYA 2ENRA 3KV5A 3KV6A 1YZBA 1DGWA 5CMUA 1MR5A 4R9CA 2E33A 1UYXA 3ABUA 3OMNB 3H01A 4R7CA 2WLNA 3RGBA 3RYIB 2PHUA 2CUGA 3CDZB 3IKWA 1TNRA 2VQFO 4UI9L 1W6QA 5IK5A 1RVF2 3JB8A 3IPVB 4LBLA 5M0TA 2NLJC 3WQBA 4DO0A 5FP3A 2OTJV 4R52A 4CEYA 1PGL2 3GWKC 3AYCA 3OY8B 3ACFA 4AVBA 4E8DA 4YG3A 4XCAA 1OQEA 1EYBA 4XTMA 2YROA 5FY7A 4CDQC 1BCCH 1S0BA 2VECA 4Y1YA 1FD9A 2D44A 1LHWA 1Z0HA 5IY5B 3J9SA 1THZA 3GJBA 1VBD1 3H7YA 2A06H 1DQ1A 3OPZA 1GQGA 2UXCB 4JQTA 4P9LA 2JG8C 1ONAA 1TZOA 3WY6A 1UPSA 4ZKTB 5GM0A 5I93A 4DR2O 2VTXA 3OGRA 5LRRA 5C3RA 3H1JH 4HAMA 1MQTC 4XFIA 4UOJA 1GP6A 1XNQO 2Y26A 3JCIA 1ZX3A 3CJHB 4YLZA 4D8MA 2DWDC 1CXZB 5BMVB 2D6NA 1KP3A 4JZRA 4W65A 1F2NA 2CH7B 3T1HO 1UZWA 1E5RA 5DDJ3 1OLME 3CU7A 4RQPC 3TEWA 2D43A 3B4SA 2IJHA 3CE2A 3UYJA 1YF2A 1ULGA 2Q5TA 2QQKA 4JHZA 3FLTA 1XBFA 1JCHA 2GZWA 4L99A 5FZ7A 1LJ7A 2WO2A 4XBNA 2ZTNA 5EWSA 1NQJA 3HQRA 4YVSA 1WGPA 4QQHA 2P1BA 1B35B 4O4IB 5AC93 4YHHO 1BLZA 4GJYA 3H9AA 2Z79A 4RSUA 3ES4A 2XLFA 2H94A 5JXGA 3PU8A 4OVEA 3I97A 3SLIA 4LKFA 2C2AA 1SF9A 2UUBO 1SETA 3FUOA 3AG1C 1Y6XA 1LU1A 2XAFA 2C5DA 1WCQA 5FPAA 4E4SA 4IT5A 1J5EB 2ZX2A 4BA6A 4B3MB 1LCLA 3IDAA 3ABKB 4UF0A 4OZOA 3K3NA 2A7WA 4JC1A 2OKXA 4AEDC 4PA3A 3LDCA 1RUF2 4NOTA 3WDVA 1SQFA 4CEWB 1ZBE3 1VALA 1HLCA 3SEPA 1SQVH 5CA0B 5TSWA 1MA1A 4PBPA 4JKKA 2J1EA 2WNUB 4YJ2A 4YM0A 5CA6A 3PMSA 3P3NA 1AI6A 4GB33 3MPPG 5KX5B 1Y66A 4WM7C 1CGPA 2GMEA 3ZYJB 1RUC2 2YDEA 3O1MA 1PVC1 2EXKA 1V6IA 2GV9A 4I02A 4D6QA 4N43A 1VAMA 4GAZA 3LDEA 4AEJA 5IK4A 2RDRA 4GWNA 5FY9A 1FS0G 1AP5A 4LHNA 5LA6B 1OFNA 2CAVA 1DGRN 2RHPA 4HVQA 3RJ2X 4XURA 3FZ3A 1ZL8B 5BXZA 2ZCWA 2VZTA 3JBG3 5FZBA 5J2TB 4XF0A 4LQRA 1OLMA 2B46X 4W6XA 4XDJA 1W6QB 1FFXA 2VW0A 1M56B 2A75A 4GMP1 1FMD2 1EUUA 4SLIA 4GYCB 3GF6A 3PTYA 5A7NA 1QOSA 3DXRA 3MBWA 1KMIZ 1UJWB 2VMGA 4OUSA 5JJEB 1R6KA 1CZSA 1VAVA 2WO1A 1UU4A 3UGHA 2RS31 1D5AA 3WDYA 1K3EA 3NL1A 3WVJA 2XL7A 5FUPA 4BIZA 4K20A 1VBA2 4E2LA 4XJUA 1EZJA 1AILA 5LOVB 2VZ3A 1EN5A 1W8WA 4MTXA 5J2TA 3W21A 4LFBO 1ASJ1 3CC7V 4MX3A 4GX2A 2W91A 3BTZA 3BA8A 1NAEA 5F9TA 3LPFA 2QTOA 2JK5C 1XU2A 2L6LA 5FZOA 4ZS2A 3HKCA 5CKMA 3ZPYA 3OMAB 1KGYA 1OH3A 4QNHB 1DIWA 1ZZBA 5F3IA 1W2BU 4PA7A 1QVGU 2RV9A 5FY5A 2QKSA 4ZKIA 2YU1A 2CGNA 4DR3O 1K33A 1C5HA 2F1MA 3C7HA 4NRMA 4UUJC 2PAEA 1M06G 1Y67A 4I55B 4AVCA 2VO5A 5FZLA 3FD9A 2AHYA 4IESA 2FDFA 4OX9O 1HRV1 4KXRA 2QE7G 4B1MA 3K3WA 1AX0A 5CBHA 5K1PA 3FB6C 4AFMA 1H2GA 1WBFA 2VZ1A 4EZHA 4KL1A 5L3FA 2ZKOA 2AREA 3MO4A 5LA0A 4AXOA 2W08A 4RFT0 1G86A 5E88A 4DV4O 3AFGA 4UFIA 2AYHA 3KZ4C 1M56C 5FMOS 1OOPA 2Y4TA 1QJY2 5JXJA 1VBC1 2WZPP 3D6EA 4QPIB 4LWSA 3E8GA 1L3JA 1UMZA 3NAPA 5FLHA 1NG0A 5EBMC 4ICGA 4BMBA 4Y1XA 1NE4A 1PD3A 1DLLA 1DFQA 3AG2B 3N35A 4MTOA 3NXSA 4OHWA 2WSSG 4OHZA 1EV12 1W0OA 2A9HA 5EQUA 2VNVA 3RN4A 3UGGA 2Q6AA 3W7TA 4YZ3A 1KBHA 1H8TC 1SLTA 3TWIA 4GZRB 5DXDA 1J3QA 4RN5A 2ZXWB 2CDOA 5IAXA 2BUKA 4YJ2B 4JI2O 1RXFA 1HR0O 3ZSEA 3O9OA 4ASUG 1BEV3 1RHI2 2EINB 1VEWA 1XREA 3PN1A 4IGQA 1JN2P 3G6JB 4YG0A 3GVMA 2JG8A 1R3KC 5F3CA 5IFPA 1XNKA 1C1FA 3P32A 1CVNA 1B09A 2XWBB 1ND2A 2VE1A 3DYOA 3U4XA 4RHV1 5FP4A 1ZX5A 3LSSA 2VCBA 1W0PA 1ODMA 5DEDA 1YHQV 3OE7G 4DUZO 2JE8A 3MLKA 2EJRA 4PDRA 1U97A 2JE9A 4NVPA 4DV6B 1OQDA 3WZ1A 4D0QA 4YGDA 3T0DA 5L9BA 1QF3A 4AG4A 5FBZA 2WFF2 1HNZO 3W58A 3OBRA 2OIGA 1URFA 5LWBA 2WWUA 1TA8A 4IUGA 1QJEA 4JYCA 4MGZE 5EXOA 1VBB1 1Q8IA 2Q8VA 5DUUA 5KHKA 3H1MA 1UN1A 2E5LB 2HR3A 4DOUA 1CJPA 3T08A 3SC7X 3AC0A 1UX7A 3IZOA 3K75B 5L73A 1J59A 3IB3A 3SH4A 1EY2A 2AEZA 3ZHRA 2W92A 3A21A 3C7GA 2J42A 3VQVA 1OV9A 2PAMA 4MLOA 3POEA 1AR73 4A7KA 4DO2A 3IGAC 1JZ7A 1N4CA 4YNIA 3TRSB 3A0HZ 3MICA 4H7LA 1N8RW 2VQTA 1N33O 3H8RA 1O91A 1ZYBA 4TTGA 3UO2A 3JCUZ 4JI7B 3C3VA 5GZDA 1IS3A 1XL4A 2AXTZ 4WZFA 3RDIA 4IXLA 5DZFA 3JD73 1G4YB 5FXZA 3N2GB 5FPUA 4UFKA 4EZ4A 1DK1A 2H6BA 4IHJA 1K42A 1QQP2 1W8TA 3LNMB 4GQ7A 1CWPA 2VQFB 4C1WA 3OW2U 3ST7A 1ULPA 3NR7A 2ZA9A 3WF3A 3GJAA 1DZQA 5LYJB 1N3QA 2UUCB 1LR5A 5A1AA 1AYM3 2NYYA 5LBCA 3ZMZA 1HJGA 4HSLA 4R6ZA 3D0JA 1RUD1 3J7HA 4P9GA 1JH5A 3MUY1 5EBLC 5F3GA 1Z5VA 3TNQA 3G7DA 2LQTA 2R32A 2YEVB 1ZBA1 2A7AA 3J7AU 1WW7A 1OH4A 3OM3B 2XJUA 2IXIA 4DK0A 2QA4V 5IWAB 1JOBA 4R9BA 4HK9A 1N3PA 5D8AA 5K8SA 3B40A 3SMHA 3SNMA 3J26N 1HNZB 1NJIW 5BNOC 1GICA 4YW5A 5JJNB 1KD7A 1G9DA 4META 3O5SA 4PI0A 4JAAA 4R9AA 4CSWA 3MHHC 5CG8A 4IEZA 1K45A 5LP6C 2X8KA 1PL0A 2C0ZA 3HKBA 5EYPA 3J8F1 2EIDA 4XFFA 2XOMA 1L7RA 3RSJA 3CCLV 1S0GA 2RCVA 5F8PA 3JYCA 4IEWA 1QU7A 2P06A 4YY3B 4FI9A 1BE3H 1XE7A 2QWOB 2D6MA 5IYCO 5F2SA 5CN0A 1TUEB 4QE9A 3MFAA 1GAXA 4H14A 1NKGA 1L7LA 1KITA 2VL4A 4BWAA 2JG9B 1YQ8A 1VRH3 2C4XA 2XUEA 4QGPA 1TG7A 1RUC3 1YFYA 1RMU1 2HVKC 4Q4X3 3D36A 4YW4A 4BCUA 3CX5F 4LF7B 5C3SA 4QKBA 4A3ZA 1AL22 2E63A 5D5QA 4ZU4A 4FOVA 4UAPA 4RS5B 1XNAA 1OKOA 4XBLA 3H50A 2QDOA 1RUF1 2CSGA 4X88A 3KF5A 1XBLA 4PA4A 2R073 2X6CA 3A23A 1PO13 5JJJB 4BQ1A 1Q7YW 5H9RA 3AKQA 3ZN6B 1VBA1 3TAYA 1DG6A 2R063 4C0HA 2DVFA 4PHZA 5CFCA 4COZA 2Q5ZA 3V0AB 3ZCCA 1NTMH 2E6VA 3NJVA 1GM9A 2BNMA 2VZSA 2Y6FA 2R061 3WEZA 3DPRC 1YFWA 5CFDC 3B8NA 2XUMA 1NH2B 1JOJA 1XJAA 5B4NA 3E8FA 3ZYFA 3R66A 4EJRA 1NQTA 2ZNIA 1LOBA 3J8F2 4D94A 3TJTA 3POSA 2VWKA 2F17A 3M3OA 3OPTA 4IE5A 4LBQD 4OUEA 1WLTA 4O2AB 3GBGA 5KHGA 1UYZA 1BHBA 3HJRA 5ABJA 4NJ4A 1S5JA 3VBUB 5J2UA 4MOAA 3BKZA 2RMU1 5JIUA 5EZWA 1F31A 1XNTA 4NWVA 3QLQA 2ARHA 3ILFA 4EV0A 5FMOL 1GO3F 4AHYA 3LSUA 3JATA 4FPYA 4J7KA 2X6BA 5FK8A 1N36B 4F7ZA 3VL8A 2ADDA 4TLGA 4NWWA 4TV8B 5LASA 3RS6A 2JECA 4XF3A 5IVYA 3NMBA 4MSWC 1MZ6A 3X2QC 1UF2C 2LGWA 3HOBA 4N9HA 3S30A 2WLQA 3UK9A 3MAQA 1F4MA 5CA0A 3EMRA 1YCIA 1R1A3 3WCSA 4EWEA 1J3RA 1CAWB 1GZ9A 1POV3 3OTFA 4LF8O 3SGIA 1W3VA 5BNPB 3BTYA 1WW4A 4UBGA 4X20A 2DVGA 4Q1RA 5IVBA 3UKMA 3WG3A 1UFIA 1QH7A 1SCRA 3ZIAG 3VBFC 2XJRA 3RI9A 2EBOA 4UYBA 2YFUA 1UY2A 1TAEA 3AJYA 4QX1A 1KJRA 2IW5A 3ZYBA 1LEMA 4M3CB 1QIQA 1AB3A 5CBFA 4NIIA 1O5LA 3VBOB 2WINB 2DVAA 4JZ2A 4MTGA 4JYAB 4CEWC 3NJZA 3G6BA 4UVCA 2QUOA 4XHBA 3RVYA 3JALB 3RPQA 3ZYHA 3NKGA 4XQWA 4A5UB 4FT8A 5CU1A 1Q5OA 2ATKC 5BY5A 1CPYA 1QXPA 2UU9O 1N47A 1OT5A 4E8CA 4V1PA 3RVHA 2V09A 2QSAA 1NCQB 3WDXA 3NV1A 1CAVB 2DBNA 4W4KA 2IXKA 5HI0A 3NVCA 2QJ1A 2P37A 4KP4A 2DFCA 4DV0O 4FM2A 5FYBA 1ZZ9A 4B08A 3N7KA 3W7SA 4DUVA 3POFA 2D3OW 4DR6O 2BQPA 5CFDB 2HKXA 1O4ZA 1BT8A 2ZGMA 3C8XA 3CJXA 1W9WA 1FPN3 1Q8PA 2ARCA 5APAA 1CX1A 1OD3A 2YV8A 4GH4B 4QX5A 1Z78A 2FDKA 1JHJA 4Q4W3 2RQ6A 5I8SA 1RITA 5F5QA 3ZHQA 5LXTB 1K9MW 3RYCB 3HR0A 5B2GB 4JGYC 2WO3A 3VD5A 2BV4A 5K0UA 3WDTA 3R0RA 4NR1A 4JGZB 3D0SA 4AI3A 4HVOA 1UW8A 1YRZA 2B1GA 4Y5Z0 4RUEA 1FT9A 4BQ3A 3MIGA 4R9DA 1G1XB 1WKYA 1C5IA 4GJZA 1J58A 4YZ1A 1QCEA 3OAAG 3OOXA 4ZU5A 1E79G 4L11A 1PL4A 2BRTA 5CBLA 3ZMUA 1O9HA 2ZE7A 2PHDA 5B1BB 3CL1A 3AL6A 2W1QA 3AX4A 1WA8A 2B1IA 5FPZA 3FBYA 1UZZA 2N05A 2JDKA 3WW3A 1AYN1 1CJDA 3SITA 3T2OA 1N34O 3FAVB 4A42A 2YS8A 2DYRB 1IS6A 3CF6E 3LIHA 1AR93 5DQ0A 1QJZA 3IIAA 3ASIA 3N9NA 2UXDO 1LOFC 1GZTA 3ZMSA 2CY6A 4NUBA 5EYYA 2JJ6A 3WW1A 4JRAA 4FXGB 1PK6B 3RYFB 4YVSB 1FXZA 4I3GA 4X8AA 3OG2A 2NMNA 2CTRA 1DQ2A 1XMQB 2JRIA 2R041 4IV1B 1MACA 5IYDO 3MLJA 3EYPA 4QQ2A 1S0IA 5C8CA 4HXCA 1J3PA 1NBMG 4AEDA 3LKJA 4LE4A 4FK5C 4FZ0A 4Q2FA 4E2GA 4MHUA 2DTWA 1H2MA 5D2AA 1HV0A 4QPJA 1CEZA 2IXLA 2QQOA 4GKYA 2WS93 3LQCA 3WG2A 1BVP1 2JKXA 3CLPA 5JLVA 2W87A 1SLAA 4U7OA 3SH5A 1SZXA 4O4HA 4GWIA 5C7GA 4HANA 2DQ3A 2XLGA 1ZLZA 3DXTA 3AG2C 5CIRA 4QJFB 4J9YB 1K4CC 4JGYA 1VMHA 4Y4RA 4NIGA 4O4LB 3A7QA 4IEVA 1PVC2 1WB8A 2HWC3 4YYOA 4IGPA 1UZVA 2WNEA 4XXAA 4H13B 5EC1C 1MEC2 2YUEA 3TN92 5JZGC 1IS4A 5FXVA 1VJ2A 3ZYGA 3FFZA 1G9BA 1B35C 5FYIA 1HQWA 4DIQA 2BCCH 2QZ3A 5FPVA 1T6GC 5GZCA 1O3SA 4MTFA 1VBC3 3ME2A 1JMKC 2Z5UA 1VQ6V 2B8MA 1Z2GA 4PIYA 2QZ2A 3AG1B 2UWAA 4BW5A 2R49A 1XNBA 3DGTA 1KXGA 5JVVA 1ULFA 2J22A 4CPBD 2EX3A 3VBHB 3ZKUA 3GWOA 1O5UA 2RS33 5IYZB 2RMKB 2HWB1 2HWD3 3FWEA 2AH2A 3IM0A 1B06A 3VBSB 2Y38A 5BNNB 1W99A 4QQPA 3BALA 1AR4A 3I2KA 4DR5B 5B1BC 3UKNA 3FBMA 1NR7A 1IXBA 1NCRB 4FAHA 2XBO2 4PA6A 5GONA 5AFEA 5CG9A 2BOJA 4X64O 4XXPA 3JSNA 2JEXA 4DNYA 2K0GA 2OQ6A 4A41A 1W28A 1VMFA 2IJKA 1HX6A 3SYAA 1QOOA 2YEVA 3E22B 1HKDA 2QM7A 1V54B 2ZEYA 1AR62 1NKDA 1F4HA 2ZT9B 2XG3A 4ZIBA 1PZ9A 4CP0A 4GX0A 2PHXA 4XUOA 2E7TA 3SYCA 3W59A 1RMU3 1R3JC 2W95A 4CDWA 4BH9A 2UUAO 2EA7A 4LO4B 1HNWB 4PV1B 1ACCA 3CC2V 3QH7A 4AQSA 1U5XA 2G9FA 3OUFA 4P9JA 3RG0A 1HW5A 2ZD9A 2WAMA 3BU0A 1IBKO 2P34A 1ZRRA 5CA1B 2EJ7A 3W7XA 5IJ9A 3WF0A 2GC1A 5C70A 5IK7A 3BA9A 3HB3B 4AVVA 1JFFA 2O1QA 1WW6A 1FX5A 5CB4B 2EIJC 1UOBA 3RMYA 3OEAA 3CCSV 1WMFA 3KT1A 2G4IA 1YHFA 1PM4A 4AI2A 1SDWA 1LGBA 2RR12 4UV8A 4RS5A 1WPBA 1X4TA 3E8HA 1PO22 3U10A 5C8YA 5BNNC 3KVAA 3VBRA 4DRXB 4H7MA 2JG8B 1XNRO 3MHZA 2HWE3 4X89A 2A6VA 2KR2A 1LUVA 1G6UA 3WB1A 1UOFA 1W2TA 3MGUA 1JU3A 2LO1A 4S2FA 2A6XA 3ZJZA 5AC91 3GZEA 3SQOA 4YG6A 3NKTA 2VH9A 3RYCA 3ABTA 4YVWB 5E1AC 1KEXA 1R1A1 3E5QA 4FLTA 1IZ3A 4DQAA 5A32A 1LESA 4FZ1A 2OZJA 1JYTA 4TSVA 3P6BA 1GFF2 1AI5A 4NTXA 2V1DA 4QHZA 2ZIOA 1NVPB 4HONA 4K40A 4ASLA 1AROP 1VPHA 4F6RA 1V54C 4PA9A 4FQ4A 1ODNA 1JXNA 1AI7A 2P4VA 3LUTB 2MEV2 5DN6G 2VCAA 1GNZA 1GN2A 4MW8A 2GH2A 4Z2WA 4CU8A 1TUBA 3ZKYA 2WN2A 2B5HA 3VBUA 5CFDA 1IOAA 3KVBA 2JDYA 4XAAA 4CDWC 4P2ZA 2YICA 4JASA 1SLLA 2DCKA 1V70A 1FPOA 2YUAA 3NO8A 4QGNA 1US3A 3J7NA 4B3TO 1PNFA 3PJYA 4FLYA 3VZKA 4JI0O 1K12A 4DY3A 1C28A 1PGSA 3VZOA 2W2IA 4IL6Z 1X8EA 5CBGA 2A1XA 1WCKA 4QB1A 1S0DA 4FFBB 3FC0A 4CCDA 5FZIA 2AHZA 2YIBA 3BVCA 4M01A 3SKVA 2AUYA 1TVKB 5JQGA 4I9QA 4F8AA 3ZXAC 4P5HA 3CO2A 1WLWA 4IE4A 4PIXA 4IV3A 1PX4A 3VD4A 1BGYH 4GXLA 3ZSJA 4M4PA 2AW9A 4BXFA 4YRDA 2OVUA 3ZMNA 3EFFK 1W9FA 3K0DA 2GHYA 2YBKA 2B4KA 3M3IA 1JZ2A 2CGPA 2QTSA 3SHRA 1G6NA 1OCOC 2K9PA 1FXKC 3E6DA 5L3BA 4PF5A 5BNPA 5J3UA 3EB7A 4Q6GA 4XFHA 2P3JA 4BK4A 1S5HC 1K4DC 1A6CA 5IJ0A 3CRRA 4OGQB 2C1FA 3POWA 2AC1A 1VARA 2VM9A 3LCPA 4RHV3 5SV8A 3QG5A 4CDXA 4AAPA 2R72A 4HOOA 5JPNB 4XZPA 1PKXA 5GLUA 3K06A 1P84F 4KU8A 4Q0PA 2WO7A 3W7WA 5A7SA 5C8YB 3OF1A 1S3JA 1DCSA 2HLDG 1B6QA 4H55A 3QVNA 4X1YB 1FATA 4DUYO 3VGIA 1WP8A 5DUVA 5DPNA 2WZR1 4HL0A 3TCUA 4B4QA 3FB7C 4LF6B 3V56A 5GTHZ 2WJSA 4DV3B 2CHHA 4D6TH 3KQ4B 1O3RA 4Y3OA 3WV6A 4XUNA 3S6PA 1RUH1 1VQKV 3RJRA 3R4SA 3BTXA 1HRV2 3AYAA 4RO2A 3RWNA 4M3CE 4CU6A 1YIPA 3VBHC 4ZHQB 1MSWD 5GLVA 1US6A 4KQ7A 4EROA 4Q4X1 3VKLA 3DCQA 4QIWF 2DFBA 2HWF2 4LA3A 4CDQB 4NKGB 3MZHA 4MUVA 1H2NA 3A22A 4H0LB 3OEHG 1EM1A 3MFCA 3T1MA 4TQFA 3PUIA 4CCMA 2Q0OC 4L97A 3OEBA 4ABMA 2QGNA 1OCOB 2VQEB 4LULA 5J7MA 3HPLC 1RB8G 1FXKB 3FYIB 3CNAA 3SYOA 1ZM1A 1WB7A 3WF1A 3ZRWA 4AHXA 3OT7A 4XF9A 4Q29A 1LULA 3JAKA 1MQTB 3CEWA 2C9KA 2ZX1A 3L74H 2DYSC 5ACA2 1H6XA 4YJ3B 2WKKA 3MF6A 3OCPA 2J1VA 5KAIZ 4TUYB 2BTOA 2CDYA 5CFCC 4LF4O 2LRPA 1Y7BA 5BV6A 2DW4A 3OGCC 1JOPA 3VBSA 1ND3C 2X0LA 1EAH1 5EK0A 1TMF2 1ZZCA 3N2KA 3H0OA 4GMP3 1DF5A 3VBHA 1QJY1 1XPWA 4Q4V3 4RQPA 1F35A 1HXS1 5IAVA 4TOIA 3UETA 4UFZA 3AZXA 5D21A 2YYOA 5FUIA 4FPJA 5KX5A 4Q4Y3 4B7KA 3LD8A 2V73A 5E79Z 1S5LZ 5EJZB 1SQBH 3WU2Z 3V0BA 3MI8A 2WLHA 4UXNA 4I50B 4FOQA 3I5DA 1FNZA 5A6YA 3RRDA 5FPLA 1YIFA 1LGNA 1SDDB 5A6XA 1V6MA 5T52A 2CH7A 3A0BZ 3I55V 3ON7A 4K35A 2P5BA 3NRUA 4JI1O 3OJBA 5FZ6A 1K5JA 2P4EA 2JB4A 5B1NA 3R4UA 2JEMA 4RUFA 4F6EA 5ACA3 1EUTA 2EIBA 5DAPA 3ILNA 1SLBA 1NR1A 1I5XA 3Q4HA 3CEIA 4BB3A 1YYNA 1N3OA 3SJAC 1E1QG 1V6OA 3ZN4A 2Y64A 2ZHMA 4BISA 5LW9A 3LDKA 3RZZA 3ZHVA 3C3SA 2ORZA 2XJPA 3L72H 4GD4A 2JGUA 2WZEA 5I91A 1YWKA 4LLOA 4O61A 1Y9GA 3L2HA 3UCSC 2D40A 4QX0A 4KBBA 3TEYA 5HBAA 3AYEA 3WR0A 2HLEA 3P3PA 2JDZA 1YC61 3I54A 4LH7A 4AHWA 1RUG3 3QD6A 1RJ8A 2GP3A 1W6NA 1T6BX 4NB5A 1SQPH 4IIJB 3ZFFC 2PLV2 4Y22B 1J95A 3JASA 3MYXA 2DUQA 2EILB 5H5NA 4I3PA 4ZI7B 1W2UA 3ITQA 4HKWA 1CZTA 5FP9A 3B69A 3Q9OA 2Y6GA 1DLCA 2CAZC 4QKFA 4N43B 2VBBA 5CZKA 4O65A 5KMGA 3WLUA 3PUHA 4JTDB 3F7YC 2A0LA 1VRBA 1IBLO 3LFIA 1ZRDA 4HLTA 1ZWIC 2WQZC 5LA2A 3O0VA 3N9QA 3E89A 2XKPA 4NHLA 2DDUA 1DU3D 1NXD1 1HN1A 4LMFA 5BNOB 4YGCA 4CDXB 2RM22 5FY0A 2PY5A 1XYOA 4JDOA 4M4RA 5FZOB 1R082 3MIHA 3B9CA 2WSVA 4B1LA 1S76D 1BK1A 3H42B 5I8TA 1J84A 4OMDA 3WX5A 1ORQC 4DR3B 2Q0AA 5GZGA 1NQDA 4XZUG 2Q7HA 4YJ3A 2MHFA 4LF5O 4B3SB 4LO8A 4MVZA 1DYKA 2DU1A 3I3DA 4CXXA 4N53B 4JI0B 5L9VA 3N3HA 1W9YA 3RQ0A 3I59B 4Y1ZA 5IFTA 4COUA 2ETEA 3VBFA 2JJ2G 1H1MA 2PN5A 2XJSA 5BYNA 3ZFFA 2RMU2 1QHDA 1J1TA 1NCRC 4Z92B 1KKDA 5A70A 4GT1A 4DRVA 1APNA 2RS13 4NN0A 4M00A 2X5IA 2R071 1AXYA 3LA2A 4BQ2A 2LW7A 2GBOA 4UFMA 2YFZA 3ZXLA 4LOSA 2XKOA 2WNVC 2ET7A 1A8DA 1RUG2 1ENXA 1G8MA 4LF5B 5FY1A 4X66B 4MVRA 2GTSA 4IE7A 4GWJA 3EQEA 4BXSV 3ZFFB 3BCWA 2Y6LA 2QE3A 3GB7C 5BUVA 4FVVA 4DUXA 1XMOO 1MS8A 1TUBB 5HPOA 1S0CA 1P8JA 5LB6A 4U3FH 4K0KO 1JA8A 1V9U2 1GZCA 4B3RB 1S1AA 3FUQA 4OZXA 4BJ0A 2RDSA 2EIJB 4DV5O 3ABLC 3B02A 2VNGA 4JHTA 3HKDA 4XFGA 4DV5B 2FMDA 4QDSA 4N23A 1KS5A 4JI4B 2PGGA 3PUQA 4MGTA 3H8OA 2ZR3A 1QGLA 5DUXA 2ZOEB 4ZXEA 2RS51 4S2GA 5IDJA 5FFOC 1GKFA 5F5CA 4M0HA 4FBFA 1U5IA 2IVIB 1S72V 1VQMV 4DR7O 2OZ6A 2JDNA 3PVOA 3JQWA 3B8MA 1CN1A 4UCVA 1JZ3A 3HT1A 2ZQMA 2YXSA 4WFBV 1RUJ3 4LFAB 1OCCB 1QJX2 1IKQA 3N9PA 5LK7B 1SKVA 1HNWO 2D97A 1DQ0A 5CKNA 4Q4V1 5L3DA 5IW0A 1QJU1 4CP1A 4RL7A 1GWLA 5E16A 5FKCA 4CH6A 1EZVH 2A71A 1HXS3 5CB4A 1D2QA 4QHOA 3H1HH 3IAPA 2UXBB 5ITZA 3BODA 3ZIWA 4FPLA 1BMFG 4FFBA 1ZRIA 1JMUB 2ERFA 1H8EG 1H8VA 1JFFB 4P30A 2OQ7A 1RIRA 4P9YA 2HG5C 3PL0A 4YARA 3POIA 3E8BA 3K3OA 3RYRA 1HIXA 3ZN0A 4KFMA 2X7RB 3DEMA 2QVSB 2VMDA 4FFHA 1SCSA 3ABZA 2XLAA 1O9GA 2D6KA 2JVDA 2HH9A 3MUZ1 1RUI1 5HCFA 4I0BA 1COWG 1YJNV 5ABJC 1QJX3 4QXCA 4AF9A 3BHPA 2GMPA 4A7ZA 4N53A 1KC8W 2ZKLA 1W0NA 4LKSA 3VDDC 3WNOA 4X62O 3EO6A 1N1YA 3DKWA 3ORJA 2FCTA 2RN9A 1CIYA 1FFTB 5DAVA 1OCRC 5A32B 1FYJA 5JXHA 3VHOA 2WSUA 3T3YA 1AR71 2RDNA 1U5YA 1YTFD 2IXCA 2XQRA 3BI3A 3CWBH 1OBNA 4J1XA 2BNOA 1UCXA 4WBBA 1QJU2 3RT3C 4Y22A 4EKWA 4CZSA 1NLRA 1GUIA 2Y0OA 5T54A 1RFYA 2DVDA 5BNNA 1BHGA 1RGSA 4I5SA 4CUGA 4O2BA 2QDRA 4XMIA 1FMD3 5LK5A 1IDSA 1SHWB 3NNJA 5BY1A 2VW2A 3CPWU 5CA3A 3ZFGC 2IC1A 2HWF3 4J1WA 2OYZA 5I8YA 4O4IA 5GZEA 4LHKA 2HJIA 2GC3A 5J37A 1MZEA 4GIQA 4XQDA 4GX1A 4FLZA 1VQPV 2NM1A 3CBNA 2D98A 1ZNPA 4A44A 1W0KG 3DYPA 3RZHA 4F4LA 2VXJA 4CCCA 2WQ8A 1SBDA 3H8XA 2J1TA 2HYKA 1YI9A 2HFEC 3O12A 4AFBA 3T1LA 4OFGA 1AYN3 2DCJA 3IAQA 5DDJ1 2GH8A 4CXYA 2B45X 1UAIA 4WVVA 3NAPC 5JH7A 1R083 4K8ZA 1X50A 2RMU3 4RGKA 2WLJA 1ULEA 2RM23 2AGAA 1MVEA 3H1YA 4AK3A 4E4EA 4BU2A 1R64A 4XUTA 2WLIB 4RHV2 1RUF3 3CB2A 2IU0A 4CH3A 4PIZA 4CYDA 3E22A 4TV8A 2PI4A 2TBVA 3VLBB 3AMNA 2W6JG 5JZGA 3AG3B 2NN8A 3GBWA 5EIBC 1MPXA 3HN3A 5GALA 1IBKB 1W6OA 5FJHA 2PMWB 3CHXA 1BZKA 1JYIA 2LFRA 3RMXA 2HVJC 2DE0X 4QGLA 3SCFA 3HWJA 1VP7A 4PDWB 2QQUA 3IDBB 5ISLA 1ZBA3 4DR1O 4P02B 1JYCA 1L8DA 3G6EV 4JI1B 4G9SB 5ABJB 4Q4W1 2XWJB 3JB4C 3RYKA 1O59A 3LZZA 4PBOA 1VF5B 4JPRA 3OUJA 2ZHNA 1X9TA 3O1VA 3VDDB 1UD1A 4BR6A 4FIPC 3Q4HB 4Z82A 2E26A 1G9AA 1PK6C 1JYNA 5FYVA 1Q3EA 4ZU7A 5BNPC 2Q8DA 3ZSMA 1OA4A 4AOCA 1K7DA 4IV1C 4KH9A 2DUOA 2HWE1 1TE1B 1PP9H 4R4XA 3SYPA 2JD4A 4P9IA 1JUIA 4LKEA 2FD8A 2VCCA 4FM1A 5GJ6A 3U11A 3HPNA 1PV0A 4Q4W2 1AL0G 2W0FC 1KECA 1O4TA 4GB31 5AFBA 3N27A 5IE9A 2DWEC 5LHIA 1UY3A 4JVAA 2F4VO 1UY0A 4JGZA 1QY4A 3LIGA 1B3QA 3O1UA 3UL2A 1IXMA 2JGDA 4DR6B 3O1OA 4NAOA 1I5ZA 5AVPA 4BLIA 1YTFB 1QJU3 3VBBA 5DG2A 4ISRA 4J7ZA 2XPJA 4I50A 4TV9B