2HJDA

Crystal structure of a second quorum sensing antiactivator tram2 from a. tumefaciens strain a6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
FELRPVIGLTRGLSSADIETLTANAIRLHRQLLEKADQLFQVLPDDIKIGTAAGGEQHLEYIEAMIEMHAQMSAVNTLVGLLGFIPKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mechanism of TraM2, a Second Quorum-Sensing Antiactivator of Agrobacterium tumefaciens Strain A6.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Signaling protein
molecule keywords Quorum-sensing antiactivator
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2hjdA00
1URFA 4NB5A 1RFYA 1UPGA 4IGGA 2HJDA 2RMKB 1CXZB 4DYLA 2Q0OC 1US6A 4NKGB
chains in the Genus database with same CATH superfamily
1GN4A 3CP1A 4WFGA 4K0KO 1NI8A 4LFAO 5JJJB 3OEHG 2XAJA 2QM4A 1PL4A 1OCOB 2LJ2A 1PD3A 2HJFC 3JD3A 3RYHB 3E8GA 2LP7A 4IL6Z 1H2MA 1DTOA 1JA8A 1S5HC 1ZWIC 3AG4C 3KKYA 1BGYH 3JYCA 2LFRA 3WB2A 2ZIOA 1BHBA 2IJKA 1IXBA 2P5OA 3PJSK 4DV7O 5FL7G 3B09A 3FAVB 5IDJA 5LP6A 3LNNA 2EIJB 5LP6B 2PUSA 2EIMB 3CXCU 1N32O 3QG5A 1HNWB 1VEWA 2AZ2A 2Q73A 4GLXA 1AP5A 2YUAA 4W4LA 5A9GA 4ZOLA 2DYSC 3D8CA 4JV5B 4NTXA 3RYCB 1KKDA 1GM8A 5CA0B 2JEUA 1JOYA 3JATB 2P22C 2E75B 3UM7A 4FM2A 3ZHSA 3ABKB 2ZNIA 1VQ7V 1O9GA 1SQFA 2YS8A 4I50A 1M56B 1KP2A 3SDLA 3ABTA 3RYIB 5B3SC 2YXLA 4P9PA 2IW5A 1PP9H 4JZ2A 2Y0IA 4Z1VA 1XOUA 3WG7C 3C3SA 4DV2B 3OGIB 1P4RA 2CTRA 2IM9A 1Z5WA 4WFHA 1DF5A 2QM8A 4JAUA 2Q4PA 3I5DA 4U7NA 2Q0AA 1WB7A 1Y74B 2RN9A 4JGSA 1YZBA 1AVMA 4BW5A 4X65B 3HKEA 3K0DA 4NTWA 3H1IH 2HVKC 1XHZA 1SA0B 3M7MX 1EN4A 4NVPA 4DR1O 4DV5O 2KQXA 1SZXA 4ABMA 4DR6B 4LFCO 1FXHA 1AILA 2Q7HA 5L3FA 3W7SA 4NXMO 4UXNA 1EBOA 1P7GA 2ZINA 4DR2O 4UCTA 1VQOV 4LF8O 1JVMA 4MVRA 3WB1A 5LOVB 1G4YB 5LGNA 3CRMA 1HNXO 5J9PC 1M5IA 4OX9O 1AR4A 1L8DA 4H13B 1EZVH 2P4VA 5IY5B 4TUYB 2ZE7A 5BY1A 2QTSA 5BXZA 4HNAA 4DR4O 3O65A 2W6IG 3SYQA 4JTDB 5IYDO 1SC5B 3FAVA 1CXZB 1VARA 4JYCA 5LMUB 1KBHA 5H2FZ 1UPGA 2QGNA 3B40A 1YXBA 4DV3B 3LSQA 1H8HG 4TV8B 1LUVA 3L70H 1AJQA 3CMEV 3VOUA 1QQCA 5K1PA 2YSUB 1GRJA 3IAYA 3JSNA 3G71V 3ZRWB 1ZSPA 2QSAA 2VWJA 3JCZA 4DR3B 3JAMN 3LSUA 4CBCA 4RAIA 1N0NA 1SERA 4D6TH 1YCIA 1K5SA 1SQPH 1F51A 1UJWB 2KG7A 3G67A 3STLC 3UT5B 1AROP 3D36C 4RWUA 3K5MA 3HR0A 3ZHTA 3BCCH 2ITDC 1FFXA 2XHBA 4LP8A 3T1YO 1D2DA 4LFBO 3TCUA 1CEZA 2E3CA 5EC1C 3OTFA 4FLZA 3T4ZA 3CSXA 1KP3A 3SJBC 1JJOA 3ZN0A 1S76D 3I55V 4K3AA 4O4IB 2ZT9B 1TUBB 1FXKC 5J2UB 1SF9A 4MT8A 1VQ4V 2LGQA 2JJ1G 2WLHA 3CYOA 4B7KA 4PA9A 2OYQA 2KKWA 1ZUQA 4YJ3A 2F95B 1WAZA 3QTCA 3ZMTA 1TUBA 1LUWA 3JARA 3O9OA 3X2QC 3MHSC 2XAQA 1K5QA 1NR1A 4IT5A 3ZN1A 2WLLA 2OT5A 3BA9A 4CS3A 2DJVA 5BMVB 5H6RA 1NTKH 2CGNA 5CA3A 1Z5VA 1OCRC 3MHHC 4Z1MG 1WP8A 3OMIB 2LGWA 2Y48A 4U7OA 1ROPA 4P9OA 3K03A 1PKXA 1SQQH 2AHZA 1V55B 4I50B 5C8YB 4DV5B 4RUFA 2QWQB 2XNDG 1TGOA 3G6EV 3BHPA 5FNVA 2BSKA 5HFMA 2IU3A 2DYRC 2HG5C 4KP4A 3JASA 3HKDB 4DV7B 3HKDA 1BCCH 4EB6B 1OZ0A 4O2BB 5JWPA 2Z0AA 4BIUA 1JX9A 1N34B 2CTQA 4UCRA 5JJEB 4FLTA 4TWKA 2EJ7A 2PGGA 2YXYA 3R66A 3EHBB 1JJ2U 1NH2D 4IIJB 3UO3A 4O4HA 1QVFU 4PELA 1N36O 1GM7A 3PN1A 1CPYA 4JI8O 4JAVA 3D3QA 1JCHA 2YI8A 4X1IA 5EC2C 1S5JA 3AK3A 4P2ZA 1FJGB 3DXRB 5KHHA 5FPOA 1NBMG 4YJ2A 4WFAV 1Q8IA 4NB5A 1S77D 1VQKV 4DR5B 1MABG 4JYYA 4QJFB 2ITCC 4DK1A 4K0KB 3WB0A 4J7JA 2HVJC 3T4DA 4GKJO 2VQEO 1DK1A 2GBOA 2Y69B 4TV9B 1XREA 2RJZA 5E1AC 1YJNV 1K4CC 2EIMC 3OMNB 4X64O 2RQ6A 1MNGA 3FKSG 4MVQA 4TOIA 3CCRV 1BSMA 2HHHO 3SGIA 2UXNA 2ZE8A 4TQDA 1LNQA 5K1XA 4AHCA 3JALB 3RT3C 4DV4O 3T2MA 3BVOA 5EYPA 4JI6O 1LR1A 3K06A 1HDJA 2UUCO 5DN6G 3BY6A 4XBFA 2HLDG 2VQFO 5BMVA 3K3WA 4K35A 3ZRWA 3ZMSA 5EBMC 5LHGA 3IGAC 3SR2C 4J7KA 1XQ8A 4BIZA 2WLNA 3LUTB 5KHGA 4J9ZB 3JASB 4DV0B 1VQ6V 2QKCA 1F4NA 1KC8W 5LOVA 3QF7A 5C8YA 1TUEB 1K34A 2UXDB 2VQFB 2ZE5A 2HP8A 4LFCB 1QVGU 5ITZB 3EVKA 1WNSA 1BMFG 1MG1A 5LXTB 2YEVA 2CGOA 2ZM6O 2Y4UA 3LDEA 3X2QB 4Q6GA 2NN4A 2JVDA 4YY3B 3L73H 5H5NA 3JATA 5ITZA 4TV8A 4A5UB 5J2TA 4J9YB 1NKDA 4DV2O 4BW9A 4QPJA 4DV6O 3ETGA 4FVMA 5B66Z 5IWAO 1OCRB 4IGGA 2R72A 1NH2B 2DWDC 4MTFA 2IH3C 3OAAG 3BEHA 3DC5A 3K79A 1R3JC 4YY3O 3EXAA 3K58A 1ZL8B 4MTOA 4DR6O 2M7WA 2A7WA 2EULA 4X66O 1E1QG 5JVDB 1KMIZ 3CCJV 3JD1A 3HKCA 4WCEV 2W0FC 3HKCB 2AGAA 3RYIA 5KUKA 4UVAA 1WA8B 1FPOA 1OCOC 3CRRA 3N2KB 3CCQV 4QGPA 4DUYB 4ICGA 2JK5C 3TETA 2YIBD 1RSOB 1IBLO 2H94A 5JH7A 1KQSU 1KB9F 2RDCA 1ENVA 1L0NH 3N2KA 2BE3A 3OTOO 3BRCA 2DQ0A 1F23A 2R70A 1GTOA 5LMNO 2P90A 1YEWA 2GDSA 2AZ0A 2FB5A 5GW7A 3CC4V 1ZLZA 2YDEA 2HR3A 5JCOC 1COWG 1J5EO 2QR4A 4O2AB 4O2AA 4CC6A 3AG3B 1R3KC 1WP7A 3E35A 3SPGA 1F4MA 3ETQA 4DW0A 5BR8B 4R8CA 5CB4B 1JR9A 4LF5B 1US6A 1L1FA 2GTSA 1BL8A 1M1KW 2FTKA 2EZPA 4O4HB 4QNHB 2YI9A 1YF2A 3OM3B 4NXMB 1XI1A 4JZGA 4MVUA 3B77A 4FLUA 3AG3C 4UUJC 3RVZA 4DW1A 4GX0A 1TAEA 4DR1B 3K57A 2DMXA 2E5LO 5B1AC 2EINC 3OE7G 2YIAA 4CH6A 4NR1A 2W6JG 1HP8A 2QJ1A 2V1DA 3LDCA 4LWSA 5L3GA 1Y74A 2ZQMA 3N2GA 3JD0A 2LQTA 4I9WA 4C7UA 5IYBO 4EB6A 4JTAB 5B1BB 4UV8A 4JI1B 1ZL8A 2F66C 2KB1A 4X62O 5B1AB 2UUBB 1IDSA 4B3TO 3A0HZ 1XDCA 5JVDA 3UKMA 4UB6Z 5D5QA 4UCUA 3UQ8A 3JD2A 2JJ2G 1R6TA 2ATKC 4TQFA 1NVPB 3ZS8C 2NR5A 2ODMA 3ETEA 4GX1A 2UXCB 4YJ2B 1M57C 1IBLB 4BIOA 4I55A 1N32B 5CA1A 1FFXB 2ZDIA 3FB8C 3SJCC 4LF4B 4KHPB 1VP7A 5F2VO 3SJQC 2OCCC 1E79G 1S3JA 4JASA 5L3CA 3RN4A 3GVMA 3IJ4A 4PDLA 3VBBA 1Y76B 1DGSA 1L0LH 2ZXWC 3LNMB 3B8NA 3G4SV 4DUZB 4G27B 5KA6A 2WLIB 4F6RB 3KG2A 4UVBA 1SQGA 4WFBV 1WLEA 1IBKB 1Q7YW 2D2CB 4TSFG 4LF5O 2IBZH 2QWPB 4CS2A 4OPAA 4DRXB 5LGTA 2WSSG 4TT3G 4CH5A 2OCCB 4HAMA 2Q67A 1AI6A 1XILA 2EZOA 5H6QA 3VQWA 4X8AA 2GTAA 5D5PA 4UCOA 3ZCCA 3JCUZ 3CCLV 4X66B 4UCVA 3CD6V 2QWNB 4KFMA 2X0LA 1H38A 3L9DA 2F23A 1OCCB 1VF7A 4AQYO 4JI2O 3ABLB 3L72H 3CPWU 1IZ3A 2FMLA 2ZIMA 3OEEG 4DUZO 3TK1A 4N21A 3BFRA 4H0LB 2RMKB 4B7EA 2UUBO 4DV0O 2XTAA 5KA5A 3A0RA 4JI4B 3K5OA 1IURA 3H1HH 3AG2C 4IYHA 1SESA 4DR7B 2WAMA 2LW7A 3BABA 2AW9A 3M99B 5EK0A 1S5LZ 4LF6B 1HW7A 4X9QA 4JI8B 2F93B 1PV0A 5JH7B 4BAYA 4DV1B 1SA0A 2UXBB 3ML0A 3E22A 4HYOA 4UCSA 3DXRA 4IYIA 4B3SO 2R9AA 3APOA 3ETDA 2F1MA 4D7SA 4LR3A 1NTZH 1K92A 3DSQA 3ASOB 3AG2B 2P4KA 2ZE6A 3ZJZA 3AK1A 1SQVH 2LFSA 4LF8B 1QNMA 1QR9A 3B8MA 4G2KA 2BOCC 1HNZB 1YTFB 4R7CA 1KKCA 4I55B 3W7WA 1BQZA 1Q5OA 1Q6UA 3ZMZA 2YICA 3FFQA 2B1IA 2HHHB 1Y4MA 1XL4A 1RFYA 3RYFB 2DQ3A 1F7YA 5KAIZ 1I94O 3OFNG 1SQXH 2VRZA 4PA4A 1EZJA 1FXVA 4OGQB 4DV4B 2AHYA 4JPRA 5GTIZ 1NR7A 3ZHUA 1RPRA 1B3QA 2DE0X 3RYFA 4UB8Z 2FKXA 4GX2A 1MSDA 3MDSA 4ZOLB 5IY5C 2OIGA 4J7ZA 1QBZA 1N36B 1FJGO 2ETNA 1NZ6A 5KHKA 4LCUC 1AI5A 5B1NA 3S3WA 4G28B 4X65O 2GV9A 3NXSA 4H37A 1EM1A 3AK2A 2OWOA 2WWWA 4FM1A 3SJAC 4HBNA 1VQ8V 4ZHQB 1ORQC 3K5LA 3AG1C 2EJRA 4JI2B 1WPXA 4DR5O 4FFKA 3OW2U 2R9RB 5E79Z 5IJ0B 5DECA 2B1GA 2Q8VA 1K9MW 3RWRD 2Q7EA 5C93A 2DYRB 5KAFZ 5JCOA 3SYPA 3SYCA 4AILC 2CH7B 1W2BU 1R1BA 1Y66A 2N04A 4WFFA 5FPRA 1N4CA 5IJ0A 2ADPA 3T1YB 4LNUB 2FYUH 3TXQA 1JMKC 1URFA 3IC7A 1JQ0A 2NNUA 1B6QA 2OTLV 1N34O 4I5SA 4LF7B 3CRAA 5HFLA 2WPDG 3G80A 2UU9B 4E2LA 2D3OW 2C2AA 5J2UA 1SS3A 3K08A 4ZBMA 2YXHA 1QCEA 5EIBC 4EFEA 4GX5A 3F5TA 1D5AA 5LHIA 3BAAA 2BOBC 1MA1A 2ZKOA 1AJNA 2XOKG 1XEQA 4HNAB 5LYJB 2GHYA 5CMUA 3HB3B 3U10A 3K59A 1AB3A 2WLLB 4U3FH 1OCZB 3CHXA 4F6EA 3OR6C 1K7DA 4X1YB 4DR2B 3RVYA 2Q0OC 3ABKC 4PDMA 2HFEC 3E86A 5KX5B 4EKWA 3SYOA 2QKAA 3APQA 1XMOB 2Y4TA 2UXCO 4GZRB 4DYLA 2UUCB 5CBHA 1VQLV 4J80A 4O4LB 5EZYA 1GN3A 5GTHZ 4O4LA 3SPCA 3K9AA 4NXNO 1R3IC 2WA3A 4GKKB 4K8ZA 2FL4A 4ZI7B 1Q3EA 4I9QA 2AXTZ 2HKOA 2PYJA 1QLEC 4OPHA 5H9CA 1GM9A 3DTUB 1Z2GA 4PV1B 2L6LA 4YXWG 2CUGA 1NTMH 5LXTA 4JI4O 1K3EA 1KU9A 1Q82W 4KL1A 4Z2WA 4MVSA 4NYKA 1GN6A 4YHHB 3MD0A 4YIOA 4I0XB 3P30A 2DOSA 3E8FA 1XMQB 2UXDO 4PA6A 4D7TA 1X59A 3FYIB 2Z3YA 1BT8A 4KXRA 3SYAA 2QA4V 2PF4E 1NJIW 1P49A 3CC2V 4B3TB 1B06A 1V54B 3JAKA 4J42A 3TGUH 4O4IA 4LWSB 2BTOA 4LF7O 2YIBA 3HPLC 4RO2A 3VQYA 1QR8A 2XAFA 3E2EA 1HNXB 4TV9A 3L74H 2YC0A 1NVPD 3CCSV 2ZXWB 2NLJC 1SZTA 3N27A 3ZEDA 1R3LC 2JGUA 2LW1A 5JJNB 4MSWC 1PM9A 3KCYA 1YIJV 4X1YA 3A2FA 4NKGB 2PI4A 4JYAO 4FZ1A 2P67A 2GSMB 1YJWV 4LF6O 2A9HA 2Z5UA 3QNEA 1NQTA 2CE4A 1P7BA 3T1HB 3C90A 1XMQO 1Y67A 2EIKC 3CE2A 1M56C 4XDLA 2QKSA 3CCUV 1OHHG 3ZX6A 5LL6Y 5B3SB 1RM1B 2ZR3A 1AP6A 1SETA 1JFFB 1ZX3A 5IJ9A 4H33A 4QIWF 4O2BA 2ZCEA 1NS1A 1TVKA 1IBMO 4DV6B 2JRIA 2WA4A 2DYSB 1GN2A 5FNVB 4GCZA 4GKKO 1GO3F 4ZIBA 1XNQB 3P32A 4X20B 2QTOA 3RBZA 1KUQA 2EINB 2X6BA 2DW4A 2OIEA 5CBGA 4MVMA 4O4JB 2XAGA 5KUMA 2EBOA 3CXHF 2PYLA 4CS4A 4CZZA 1ZTEA 2YEVB 1Y6XA 4PDVA 1OJHA 3RGBA 1VQ5V 4FIPC 3CC7V 1JPXA 2IJIA 5CA0A 1GAXA 4U3JB 2XT9A 3JAWB 5IE9A 1K73W 3UO2A 3ASNB 4FM0A 3W7XA 1B04A 1IXMA 3B4SA 1RPOA 3EFFK 4UV9A 4KHPO 2UXBO 4ZHQA 3THOA 1VMGA 2GUZA 3CJHA 2F4VO 1K8AW 2MK3A 2GUZB 3A0BZ 5LYJA 3CMAV 3H1JH 1Q6IA 4KUMA 4FJCC 3RFRA 3F7VC 1WA8A 2XAHA 4FLYA 3N2GB 4QPKA 3ABMC 1W0JG 1K33A 3HKEB 1FKAO 5AG2A 4UVCA 1FD9A 3M8AA 3WFVA 1Q6HA 4MS2A 1DF4A 3D3IA 1R6NA 2H3OA 4I4TB 1YI2V 1I5YA 4JI1O 5CA1B 3SPIA 1IX9A 1RSOA 1J95A 2V7QG 5EZYB 3T1HO 4WF9V 3CWBH 1RP3B 3FB5C 2M6YA 4R6ZA 1MZFA 2UUAB 4DR7O 1H2SB 4WBNA 3FB7C 1Q43A 5EBWC 3J7AU 1CP9A 1XHXA 2E74B 5CB4A 5KHJA 2H8PC 3KZIZ 4XDJA 2VWKA 4IHJA 3JD4A 2P06A 1HNWO 4LC1A 4Q20A 2EIJC 3CRCA 5LP6C 5KLVH 1SQBH 2QWOB 5KMGA 1YHQV 2BTQA 4JAAA 2X6AA 3DC6A 3OUFA 4UFZA 1U96A 3NR7A 4JYAB 1OCZC 3HKBB 1XNRO 2CDYA 5IT9N 1R73A 4RQEA 1KD1W 1XUQA 2JS3A 1AR1B 1IBKO 2ILMA 5TISZ 3SPHA 1VQ9V 4DR4B 1MSWD 4F4LA 1M90W 3RYCA 1MZEA 1GH6A 4FLWA 1DLBA 1H2LA 3H1KH 2KG7B 2YIDA 5L3EA 2IJJA 4W4KA 1FFTB 2G38A 4U3JA 3T1CA 5LMNB 1G8MA 4ZKIA 4DV3O 2PZSA 1U97A 5IWAB 5DM6V 1AJPA 2JDIG 3CCVV 2N74A 3OT7A 3CJHB 4H44B 4R50A 4MW3A 2WLMA 4JI6B 1K4DC 2Y0PA 4PI2A 2VQEB 2RNBA 1BZKA 4I4TA 1I94B 4GYCB 4IIJA 2ZM6B 5L3DA 3E8BA 3BPZA 4PI0A 2A3QA 1V55C 4WFEA 4BR6A 1H2GA 4JI7O 3S3XA 4GT1A 2ADQB 3E22B 2P7TC 1YTFD 1HWYA 2QEXV 3FYEB 3VQVA 4RUEA 1H2KA 4LF9O 3E89A 3QO5A 4MTGA 1JFFA 3OD4A 2Q69A 3L75H 2X6CA 3LDDA 2HEPA 3ASNC 1Y76A 3ASOC 4B3SB 3E8HA 1AR5A 1TA8A 1P84F 3AEIA 4PJ0Z 1R6KA 4RQFA 4YJ3B 2R9IA 5IYZB 3DGEA 1Q90D 4GKJB 4CC5A 3K0GA 4DRXA 1XNQO 3ABUA 3W7UA 1SRYA 4AI8A 1FXKB 1M93A 3JARB 1N0JA 5LA6A 5GONB 4QE9A 4FPPA 4CH4A 2JEXA 1I5XA 2QWRB 1UFIA 5FLXN 5KMGB 3IFXA 3H01A 5CN0A 4J11A 3GWKC 3LSSA 4JI0O 2EILC 5LA6B 1H8EG 4X64B 4FFBB 1M9NA 3K04A 1GKFA 3G6BA 3STZC 2UXXA 4B3MO 3HKBA 5IJ9B 1FS0G 2ZNJA 3U0ZA 1WN7A 1YITV 2BSKB 1SKVA 1YJ9V 4QE7A 4FFBA 2X7RB 2B5UA 3F7YC 4CH3A 2IJHA 4X89A 5L3BA 4LF4O 1K97A 3ZMUA 1MMMA 2Q68A 5KHIA 2CH7A 2ARHA 2V4DA 4YHHO 2E76B 2WLKA 2Q7GA 4LH6A 1QLNA 2F43G 2A06H 4XDKA 3CRQA 1I0HA 3QO8A 4DO2A 4B3MB 3AG4B 1D5NA 3CCMV 4DUYO 3UCSC 1YDXA 1FYJA 4X62B 4YIPA 4FK5C 3ZHQA 5A2QN 3KCXA 2JGDB 3FB6C 4JI3O 1ZAUA 4JI5O 3ZBHA 4JI7B 2UUAO 4FLXA 1VQMV 3ABLC 2O57A 1AI4A 1GK9A 4PD4F 4NXNB 4K8XA 4MTXA 4X88A 2B9ZA 2CK3G 3Q4HA 4PA3A 2QE7G 2QDOA 3CB2A 1HR0O 3CS5A 3OR7C 1PNMA 4TUYA 3TXSA 1YSCA 4LFBB 2VS0A 2Q9LA 5IYCO 2ZR2A 1IBMB 3H9VA 3QO7A 4AQYB 3JALA 2CTPA 1I7FA 4X1KB 4DK0A 3VQXA 5EYPB 3AG1B 4JI5B 3L71H 3MAQA 1I08A 1N33O 4EEQA 4DV1O 5B5EZ 4JYBA 2W0XA 4WBNB 1O9HA 4ZI7A 5BZBA 1WB8A 5EIBD 5EBLC 4EFBA 3U11A 4JF3A 3A8TA 1NT2B 1QLEB 1GMGA 4B08A 1WPBA 1T5EA 2E5LB 2BCCH 1S0VA 1PPJH 5CBFA 4FZ0A 3IC9A 5DEDA 5B1BC 4PDRA 3CX5F 3JSLA 4E4EA 2JIZG 4J41A 2PTMA 1TVKB 3CEIA 4BWAA 1VF6C 2A0LA 1Q81W 3OTOB 4LNUA 4OXSA 1X4TA 1IVSA 4N23A 1KECA 2DWEC 3J81N 1EN5A 4X20A 4ASUG 3C3TA 4JTCB 5B1OA 3CCEV 2IH1C 5J2TB 1V54C 2UU9O 4JI3B 5JQGB 3GB7C 3H1LH 1V9PA 1NU1H 1S72V 1E1RG 5LGUA 2JGDA 1VF6A 1MOFA 1Q86W 4JV5O 2A79B 3OMAB 4MW8A 3FD9A 2K9PA 1VQPV 3E83A 4NTYA 1BE3H 2EIKB 2RCVA 3Q4HB 2IU0A 4B3RO 3OGCC 3F5WC 3B2EE 3R65A 4FMTA 4FLVA 1FXKA 3RW0A 2EX3A 1AI7A 2MW2B 2OTJV 3SPJA 2PI5A 2ZDIC 1M4UA 3K5NA 5LMUO 1OCCC 3BA8A 1W59A 2Y69C 3RYHA 1HR0B 1QHTA 3ZHVA 1PNKA 1N8RW 1KYOF 2XUMA 1W0KG 3AG7A 4LF9B 4JI0B 2CAZC 3D36A 4MVZA 1XMOO 2ZD9A 3W7TA 2K1EA 3WG7B 1J5EB 1HNZO 4I7ZB 1THZA 5IYZA 2F4VB 3FX7A 1VQNV 2P6JA 2L35A 5LBQA 5BR8O 1A32A 2JS5A 2BTQB 2OCHA 4L8JA 1PL0A 1FAFA 2WLIA 4F6RA 4P30A 5GONA 1BQ0A 4IHJB 4MVOA 4O4JA 3ICXA 2WLJA 4J10A 4X1IB 1XBLA 2Q5ZA 1G6UA 4I0XA 3JAWA 2DN9A 3J80N 4L87A 2N05A 4DXWA 4PA7A 3ZIAG 3ZMVA 3ZRXA 1N33B 3OUSA 1WJZA 3GWOA 1OV9A 5JQGA 3JAKB 3K9SA 2EILB 4OX9B 1QU7A 3P3PA 3WU2Z 4GUNA 2QM7A 3TJTA 3I56V 2LO1A 2PY5A 1BS3A 1VIBA 1VF5B 4PHZA 4LBEC 2CTWA 2HJDA 2XASA 3ZRSA 1XNRB 1XL6A 1PNLA 1M57B 4LH7A 2KSDA 3UT5A 4HZ3A 3P3NA 5KX5A 4LFAB 4B3RB 3ZHRA 1YVWA 1BHAA 1G1XB 4DR3O 5LHHA 1RM1C 3ABMB 1EFRG 2Q6AA 3ZRVA 3QVNA 4X1KA 1H2NA 1EN6A
chains in the Genus database with same CATH topology
1URFA 4NB5A 1RFYA 1UPGA 4IGGA 2HJDA 2RMKB 1CXZB 4DYLA 2Q0OC 1US6A 4NKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URF A;  4NB5 A;  1RFY A;  1UPG A;  4IGG A;  2HJD A;  2RMK B;  1CXZ B;  4DYL A;  2Q0O C;  1US6 A;  4NKG B; 
#chains in the Genus database with same CATH topology
 1GN4 A;  3CP1 A;  4WFG A;  4K0K O;  1NI8 A;  4LFA O;  5JJJ B;  3OEH G;  2XAJ A;  2QM4 A;  1PL4 A;  1OCO B;  2LJ2 A;  1PD3 A;  2HJF C;  3JD3 A;  3RYH B;  3E8G A;  2LP7 A;  4IL6 Z;  1H2M A;  1DTO A;  1JA8 A;  1S5H C;  1ZWI C;  3AG4 C;  3KKY A;  1BGY H;  3JYC A;  2LFR A;  3WB2 A;  2ZIO A;  1BHB A;  2IJK A;  1IXB A;  2P5O A;  3PJS K;  4DV7 O;  5FL7 G;  3B09 A;  3FAV B;  5IDJ A;  5LP6 A;  3LNN A;  2EIJ B;  5LP6 B;  2PUS A;  2EIM B;  3CXC U;  1N32 O;  3QG5 A;  1HNW B;  1VEW A;  2AZ2 A;  2Q73 A;  4GLX A;  1AP5 A;  2YUA A;  4W4L A;  5A9G A;  4ZOL A;  2DYS C;  3D8C A;  4JV5 B;  4NTX A;  3RYC B;  1KKD A;  1GM8 A;  5CA0 B;  2JEU A;  1JOY A;  3JAT B;  2P22 C;  2E75 B;  3UM7 A;  4FM2 A;  3ZHS A;  3ABK B;  2ZNI A;  1VQ7 V;  1O9G A;  1SQF A;  2YS8 A;  4I50 A;  1M56 B;  1KP2 A;  3SDL A;  3ABT A;  3RYI B;  5B3S C;  2YXL A;  4P9P A;  2IW5 A;  1PP9 H;  4JZ2 A;  2Y0I A;  4Z1V A;  1XOU A;  3WG7 C;  3C3S A;  4DV2 B;  3OGI B;  1P4R A;  2CTR A;  2IM9 A;  1Z5W A;  4WFH A;  1DF5 A;  2QM8 A;  4JAU A;  2Q4P A;  3I5D A;  4U7N A;  2Q0A A;  1WB7 A;  1Y74 B;  2RN9 A;  4JGS A;  1YZB A;  1AVM A;  4BW5 A;  4X65 B;  3HKE A;  3K0D A;  4NTW A;  3H1I H;  2HVK C;  1XHZ A;  1SA0 B;  3M7M X;  1EN4 A;  4NVP A;  4DR1 O;  4DV5 O;  2KQX A;  1SZX A;  4ABM A;  4DR6 B;  4LFC O;  1FXH A;  1AIL A;  2Q7H A;  5L3F A;  3W7S A;  4NXM O;  4UXN A;  1EBO A;  1P7G A;  2ZIN A;  4DR2 O;  4UCT A;  1VQO V;  4LF8 O;  1JVM A;  4MVR A;  3WB1 A;  5LOV B;  1G4Y B;  5LGN A;  3CRM A;  1HNX O;  5J9P C;  1M5I A;  4OX9 O;  1AR4 A;  1L8D A;  4H13 B;  1EZV H;  2P4V A;  5IY5 B;  4TUY B;  2ZE7 A;  5BY1 A;  2QTS A;  5BXZ A;  4HNA A;  4DR4 O;  3O65 A;  2W6I G;  3SYQ A;  4JTD B;  5IYD O;  1SC5 B;  3FAV A;  1CXZ B;  1VAR A;  4JYC A;  5LMU B;  1KBH A;  5H2F Z;  1UPG A;  2QGN A;  3B40 A;  1YXB A;  4DV3 B;  3LSQ A;  1H8H G;  4TV8 B;  1LUV A;  3L70 H;  1AJQ A;  3CME V;  3VOU A;  1QQC A;  5K1P A;  2YSU B;  1GRJ A;  3IAY A;  3JSN A;  3G71 V;  3ZRW B;  1ZSP A;  2QSA A;  2VWJ A;  3JCZ A;  4DR3 B;  3JAM N;  3LSU A;  4CBC A;  4RAI A;  1N0N A;  1SER A;  4D6T H;  1YCI A;  1K5S A;  1SQP H;  1F51 A;  1UJW B;  2KG7 A;  3G67 A;  3STL C;  3UT5 B;  1ARO P;  3D36 C;  4RWU A;  3K5M A;  3HR0 A;  3ZHT A;  3BCC H;  2ITD C;  1FFX A;  2XHB A;  4LP8 A;  3T1Y O;  1D2D A;  4LFB O;  3TCU A;  1CEZ A;  2E3C A;  5EC1 C;  3OTF A;  4FLZ A;  3T4Z A;  3CSX A;  1KP3 A;  3SJB C;  1JJO A;  3ZN0 A;  1S76 D;  3I55 V;  4K3A A;  4O4I B;  2ZT9 B;  1TUB B;  1FXK C;  5J2U B;  1SF9 A;  4MT8 A;  1VQ4 V;  2LGQ A;  2JJ1 G;  2WLH A;  3CYO A;  4B7K A;  4PA9 A;  2OYQ A;  2KKW A;  1ZUQ A;  4YJ3 A;  2F95 B;  1WAZ A;  3QTC A;  3ZMT A;  1TUB A;  1LUW A;  3JAR A;  3O9O A;  3X2Q C;  3MHS C;  2XAQ A;  1K5Q A;  1NR1 A;  4IT5 A;  3ZN1 A;  2WLL A;  2OT5 A;  3BA9 A;  4CS3 A;  2DJV A;  5BMV B;  5H6R A;  1NTK H;  2CGN A;  5CA3 A;  1Z5V A;  1OCR C;  3MHH C;  4Z1M G;  1WP8 A;  3OMI B;  2LGW A;  2Y48 A;  4U7O A;  1ROP A;  4P9O A;  3K03 A;  1PKX A;  1SQQ H;  2AHZ A;  1V55 B;  4I50 B;  5C8Y B;  4DV5 B;  4RUF A;  2QWQ B;  2XND G;  1TGO A;  3G6E V;  3BHP A;  5FNV A;  2BSK A;  5HFM A;  2IU3 A;  2DYR C;  2HG5 C;  4KP4 A;  3JAS A;  3HKD B;  4DV7 B;  3HKD A;  1BCC H;  4EB6 B;  1OZ0 A;  4O2B B;  5JWP A;  2Z0A A;  4BIU A;  1JX9 A;  1N34 B;  2CTQ A;  4UCR A;  5JJE B;  4FLT A;  4TWK A;  2EJ7 A;  2PGG A;  2YXY A;  3R66 A;  3EHB B;  1JJ2 U;  1NH2 D;  4IIJ B;  3UO3 A;  4O4H A;  1QVF U;  4PEL A;  1N36 O;  1GM7 A;  3PN1 A;  1CPY A;  4JI8 O;  4JAV A;  3D3Q A;  1JCH A;  2YI8 A;  4X1I A;  5EC2 C;  1S5J A;  3AK3 A;  4P2Z A;  1FJG B;  3DXR B;  5KHH A;  5FPO A;  1NBM G;  4YJ2 A;  4WFA V;  1Q8I A;  4NB5 A;  1S77 D;  1VQK V;  4DR5 B;  1MAB G;  4JYY A;  4QJF B;  2ITC C;  4DK1 A;  4K0K B;  3WB0 A;  4J7J A;  2HVJ C;  3T4D A;  4GKJ O;  2VQE O;  1DK1 A;  2GBO A;  2Y69 B;  4TV9 B;  1XRE A;  2RJZ A;  5E1A C;  1YJN V;  1K4C C;  2EIM C;  3OMN B;  4X64 O;  2RQ6 A;  1MNG A;  3FKS G;  4MVQ A;  4TOI A;  3CCR V;  1BSM A;  2HHH O;  3SGI A;  2UXN A;  2ZE8 A;  4TQD A;  1LNQ A;  5K1X A;  4AHC A;  3JAL B;  3RT3 C;  4DV4 O;  3T2M A;  3BVO A;  5EYP A;  4JI6 O;  1LR1 A;  3K06 A;  1HDJ A;  2UUC O;  5DN6 G;  3BY6 A;  4XBF A;  2HLD G;  2VQF O;  5BMV A;  3K3W A;  4K35 A;  3ZRW A;  3ZMS A;  5EBM C;  5LHG A;  3IGA C;  3SR2 C;  4J7K A;  1XQ8 A;  4BIZ A;  2WLN A;  3LUT B;  5KHG A;  4J9Z B;  3JAS B;  4DV0 B;  1VQ6 V;  2QKC A;  1F4N A;  1KC8 W;  5LOV A;  3QF7 A;  5C8Y A;  1TUE B;  1K34 A;  2UXD B;  2VQF B;  2ZE5 A;  2HP8 A;  4LFC B;  1QVG U;  5ITZ B;  3EVK A;  1WNS A;  1BMF G;  1MG1 A;  5LXT B;  2YEV A;  2CGO A;  2ZM6 O;  2Y4U A;  3LDE A;  3X2Q B;  4Q6G A;  2NN4 A;  2JVD A;  4YY3 B;  3L73 H;  5H5N A;  3JAT A;  5ITZ A;  4TV8 A;  4A5U B;  5J2T A;  4J9Y B;  1NKD A;  4DV2 O;  4BW9 A;  4QPJ A;  4DV6 O;  3ETG A;  4FVM A;  5B66 Z;  5IWA O;  1OCR B;  4IGG A;  2R72 A;  1NH2 B;  2DWD C;  4MTF A;  2IH3 C;  3OAA G;  3BEH A;  3DC5 A;  3K79 A;  1R3J C;  4YY3 O;  3EXA A;  3K58 A;  1ZL8 B;  4MTO A;  4DR6 O;  2M7W A;  2A7W A;  2EUL A;  4X66 O;  1E1Q G;  5JVD B;  1KMI Z;  3CCJ V;  3JD1 A;  3HKC A;  4WCE V;  2W0F C;  3HKC B;  2AGA A;  3RYI A;  5KUK A;  4UVA A;  1WA8 B;  1FPO A;  1OCO C;  3CRR A;  3N2K B;  3CCQ V;  4QGP A;  4DUY B;  4ICG A;  2JK5 C;  3TET A;  2YIB D;  1RSO B;  1IBL O;  2H94 A;  5JH7 A;  1KQS U;  1KB9 F;  2RDC A;  1ENV A;  1L0N H;  3N2K A;  2BE3 A;  3OTO O;  3BRC A;  2DQ0 A;  1F23 A;  2R70 A;  1GTO A;  5LMN O;  2P90 A;  1YEW A;  2GDS A;  2AZ0 A;  2FB5 A;  5GW7 A;  3CC4 V;  1ZLZ A;  2YDE A;  2HR3 A;  5JCO C;  1COW G;  1J5E O;  2QR4 A;  4O2A B;  4O2A A;  4CC6 A;  3AG3 B;  1R3K C;  1WP7 A;  3E35 A;  3SPG A;  1F4M A;  3ETQ A;  4DW0 A;  5BR8 B;  4R8C A;  5CB4 B;  1JR9 A;  4LF5 B;  1US6 A;  1L1F A;  2GTS A;  1BL8 A;  1M1K W;  2FTK A;  2EZP A;  4O4H B;  4QNH B;  2YI9 A;  1YF2 A;  3OM3 B;  4NXM B;  1XI1 A;  4JZG A;  4MVU A;  3B77 A;  4FLU A;  3AG3 C;  4UUJ C;  3RVZ A;  4DW1 A;  4GX0 A;  1TAE A;  4DR1 B;  3K57 A;  2DMX A;  2E5L O;  5B1A C;  2EIN C;  3OE7 G;  2YIA A;  4CH6 A;  4NR1 A;  2W6J G;  1HP8 A;  2QJ1 A;  2V1D A;  3LDC A;  4LWS A;  5L3G A;  1Y74 A;  2ZQM A;  3N2G A;  3JD0 A;  2LQT A;  4I9W A;  4C7U A;  5IYB O;  4EB6 A;  4JTA B;  5B1B B;  4UV8 A;  4JI1 B;  1ZL8 A;  2F66 C;  2KB1 A;  4X62 O;  5B1A B;  2UUB B;  1IDS A;  4B3T O;  3A0H Z;  1XDC A;  5JVD A;  3UKM A;  4UB6 Z;  5D5Q A;  4UCU A;  3UQ8 A;  3JD2 A;  2JJ2 G;  1R6T A;  2ATK C;  4TQF A;  1NVP B;  3ZS8 C;  2NR5 A;  2ODM A;  3ETE A;  4GX1 A;  2UXC B;  4YJ2 B;  1M57 C;  1IBL B;  4BIO A;  4I55 A;  1N32 B;  5CA1 A;  1FFX B;  2ZDI A;  3FB8 C;  3SJC C;  4LF4 B;  4KHP B;  1VP7 A;  5F2V O;  3SJQ C;  2OCC C;  1E79 G;  1S3J A;  4JAS A;  5L3C A;  3RN4 A;  3GVM A;  3IJ4 A;  4PDL A;  3VBB A;  1Y76 B;  1DGS A;  1L0L H;  2ZXW C;  3LNM B;  3B8N A;  3G4S V;  4DUZ B;  4G27 B;  5KA6 A;  2WLI B;  4F6R B;  3KG2 A;  4UVB A;  1SQG A;  4WFB V;  1WLE A;  1IBK B;  1Q7Y W;  2D2C B;  4TSF G;  4LF5 O;  2IBZ H;  2QWP B;  4CS2 A;  4OPA A;  4DRX B;  5LGT A;  2WSS G;  4TT3 G;  4CH5 A;  2OCC B;  4HAM A;  2Q67 A;  1AI6 A;  1XIL A;  2EZO A;  5H6Q A;  3VQW A;  4X8A A;  2GTA A;  5D5P A;  4UCO A;  3ZCC A;  3JCU Z;  3CCL V;  4X66 B;  4UCV A;  3CD6 V;  2QWN B;  4KFM A;  2X0L A;  1H38 A;  3L9D A;  2F23 A;  1OCC B;  1VF7 A;  4AQY O;  4JI2 O;  3ABL B;  3L72 H;  3CPW U;  1IZ3 A;  2FML A;  2ZIM A;  3OEE G;  4DUZ O;  3TK1 A;  4N21 A;  3BFR A;  4H0L B;  2RMK B;  4B7E A;  2UUB O;  4DV0 O;  2XTA A;  5KA5 A;  3A0R A;  4JI4 B;  3K5O A;  1IUR A;  3H1H H;  3AG2 C;  4IYH A;  1SES A;  4DR7 B;  2WAM A;  2LW7 A;  3BAB A;  2AW9 A;  3M99 B;  5EK0 A;  1S5L Z;  4LF6 B;  1HW7 A;  4X9Q A;  4JI8 B;  2F93 B;  1PV0 A;  5JH7 B;  4BAY A;  4DV1 B;  1SA0 A;  2UXB B;  3ML0 A;  3E22 A;  4HYO A;  4UCS A;  3DXR A;  4IYI A;  4B3S O;  2R9A A;  3APO A;  3ETD A;  2F1M A;  4D7S A;  4LR3 A;  1NTZ H;  1K92 A;  3DSQ A;  3ASO B;  3AG2 B;  2P4K A;  2ZE6 A;  3ZJZ A;  3AK1 A;  1SQV H;  2LFS A;  4LF8 B;  1QNM A;  1QR9 A;  3B8M A;  4G2K A;  2BOC C;  1HNZ B;  1YTF B;  4R7C A;  1KKC A;  4I55 B;  3W7W A;  1BQZ A;  1Q5O A;  1Q6U A;  3ZMZ A;  2YIC A;  3FFQ A;  2B1I A;  2HHH B;  1Y4M A;  1XL4 A;  1RFY A;  3RYF B;  2DQ3 A;  1F7Y A;  5KAI Z;  1I94 O;  3OFN G;  1SQX H;  2VRZ A;  4PA4 A;  1EZJ A;  1FXV A;  4OGQ B;  4DV4 B;  2AHY A;  4JPR A;  5GTI Z;  1NR7 A;  3ZHU A;  1RPR A;  1B3Q A;  2DE0 X;  3RYF A;  4UB8 Z;  2FKX A;  4GX2 A;  1MSD A;  3MDS A;  4ZOL B;  5IY5 C;  2OIG A;  4J7Z A;  1QBZ A;  1N36 B;  1FJG O;  2ETN A;  1NZ6 A;  5KHK A;  4LCU C;  1AI5 A;  5B1N A;  3S3W A;  4G28 B;  4X65 O;  2GV9 A;  3NXS A;  4H37 A;  1EM1 A;  3AK2 A;  2OWO A;  2WWW A;  4FM1 A;  3SJA C;  4HBN A;  1VQ8 V;  4ZHQ B;  1ORQ C;  3K5L A;  3AG1 C;  2EJR A;  4JI2 B;  1WPX A;  4DR5 O;  4FFK A;  3OW2 U;  2R9R B;  5E79 Z;  5IJ0 B;  5DEC A;  2B1G A;  2Q8V A;  1K9M W;  3RWR D;  2Q7E A;  5C93 A;  2DYR B;  5KAF Z;  5JCO A;  3SYP A;  3SYC A;  4AIL C;  2CH7 B;  1W2B U;  1R1B A;  1Y66 A;  2N04 A;  4WFF A;  5FPR A;  1N4C A;  5IJ0 A;  2ADP A;  3T1Y B;  4LNU B;  2FYU H;  3TXQ A;  1JMK C;  1URF A;  3IC7 A;  1JQ0 A;  2NNU A;  1B6Q A;  2OTL V;  1N34 O;  4I5S A;  4LF7 B;  3CRA A;  5HFL A;  2WPD G;  3G80 A;  2UU9 B;  4E2L A;  2D3O W;  2C2A A;  5J2U A;  1SS3 A;  3K08 A;  4ZBM A;  2YXH A;  1QCE A;  5EIB C;  4EFE A;  4GX5 A;  3F5T A;  1D5A A;  5LHI A;  3BAA A;  2BOB C;  1MA1 A;  2ZKO A;  1AJN A;  2XOK G;  1XEQ A;  4HNA B;  5LYJ B;  2GHY A;  5CMU A;  3HB3 B;  3U10 A;  3K59 A;  1AB3 A;  2WLL B;  4U3F H;  1OCZ B;  3CHX A;  4F6E A;  3OR6 C;  1K7D A;  4X1Y B;  4DR2 B;  3RVY A;  2Q0O C;  3ABK C;  4PDM A;  2HFE C;  3E86 A;  5KX5 B;  4EKW A;  3SYO A;  2QKA A;  3APQ A;  1XMO B;  2Y4T A;  2UXC O;  4GZR B;  4DYL A;  2UUC B;  5CBH A;  1VQL V;  4J80 A;  4O4L B;  5EZY A;  1GN3 A;  5GTH Z;  4O4L A;  3SPC A;  3K9A A;  4NXN O;  1R3I C;  2WA3 A;  4GKK B;  4K8Z A;  2FL4 A;  4ZI7 B;  1Q3E A;  4I9Q A;  2AXT Z;  2HKO A;  2PYJ A;  1QLE C;  4OPH A;  5H9C A;  1GM9 A;  3DTU B;  1Z2G A;  4PV1 B;  2L6L A;  4YXW G;  2CUG A;  1NTM H;  5LXT A;  4JI4 O;  1K3E A;  1KU9 A;  1Q82 W;  4KL1 A;  4Z2W A;  4MVS A;  4NYK A;  1GN6 A;  4YHH B;  3MD0 A;  4YIO A;  4I0X B;  3P30 A;  2DOS A;  3E8F A;  1XMQ B;  2UXD O;  4PA6 A;  4D7T A;  1X59 A;  3FYI B;  2Z3Y A;  1BT8 A;  4KXR A;  3SYA A;  2QA4 V;  2PF4 E;  1NJI W;  1P49 A;  3CC2 V;  4B3T B;  1B06 A;  1V54 B;  3JAK A;  4J42 A;  3TGU H;  4O4I A;  4LWS B;  2BTO A;  4LF7 O;  2YIB A;  3HPL C;  4RO2 A;  3VQY A;  1QR8 A;  2XAF A;  3E2E A;  1HNX B;  4TV9 A;  3L74 H;  2YC0 A;  1NVP D;  3CCS V;  2ZXW B;  2NLJ C;  1SZT A;  3N27 A;  3ZED A;  1R3L C;  2JGU A;  2LW1 A;  5JJN B;  4MSW C;  1PM9 A;  3KCY A;  1YIJ V;  4X1Y A;  3A2F A;  4NKG B;  2PI4 A;  4JYA O;  4FZ1 A;  2P67 A;  2GSM B;  1YJW V;  4LF6 O;  2A9H A;  2Z5U A;  3QNE A;  1NQT A;  2CE4 A;  1P7B A;  3T1H B;  3C90 A;  1XMQ O;  1Y67 A;  2EIK C;  3CE2 A;  1M56 C;  4XDL A;  2QKS A;  3CCU V;  1OHH G;  3ZX6 A;  5LL6 Y;  5B3S B;  1RM1 B;  2ZR3 A;  1AP6 A;  1SET A;  1JFF B;  1ZX3 A;  5IJ9 A;  4H33 A;  4QIW F;  4O2B A;  2ZCE A;  1NS1 A;  1TVK A;  1IBM O;  4DV6 B;  2JRI A;  2WA4 A;  2DYS B;  1GN2 A;  5FNV B;  4GCZ A;  4GKK O;  1GO3 F;  4ZIB A;  1XNQ B;  3P32 A;  4X20 B;  2QTO A;  3RBZ A;  1KUQ A;  2EIN B;  2X6B A;  2DW4 A;  2OIE A;  5CBG A;  4MVM A;  4O4J B;  2XAG A;  5KUM A;  2EBO A;  3CXH F;  2PYL A;  4CS4 A;  4CZZ A;  1ZTE A;  2YEV B;  1Y6X A;  4PDV A;  1OJH A;  3RGB A;  1VQ5 V;  4FIP C;  3CC7 V;  1JPX A;  2IJI A;  5CA0 A;  1GAX A;  4U3J B;  2XT9 A;  3JAW B;  5IE9 A;  1K73 W;  3UO2 A;  3ASN B;  4FM0 A;  3W7X A;  1B04 A;  1IXM A;  3B4S A;  1RPO A;  3EFF K;  4UV9 A;  4KHP O;  2UXB O;  4ZHQ A;  3THO A;  1VMG A;  2GUZ A;  3CJH A;  2F4V O;  1K8A W;  2MK3 A;  2GUZ B;  3A0B Z;  5LYJ A;  3CMA V;  3H1J H;  1Q6I A;  4KUM A;  4FJC C;  3RFR A;  3F7V C;  1WA8 A;  2XAH A;  4FLY A;  3N2G B;  4QPK A;  3ABM C;  1W0J G;  1K33 A;  3HKE B;  1FKA O;  5AG2 A;  4UVC A;  1FD9 A;  3M8A A;  3WFV A;  1Q6H A;  4MS2 A;  1DF4 A;  3D3I A;  1R6N A;  2H3O A;  4I4T B;  1YI2 V;  1I5Y A;  4JI1 O;  5CA1 B;  3SPI A;  1IX9 A;  1RSO A;  1J95 A;  2V7Q G;  5EZY B;  3T1H O;  4WF9 V;  3CWB H;  1RP3 B;  3FB5 C;  2M6Y A;  4R6Z A;  1MZF A;  2UUA B;  4DR7 O;  1H2S B;  4WBN A;  3FB7 C;  1Q43 A;  5EBW C;  3J7A U;  1CP9 A;  1XHX A;  2E74 B;  5CB4 A;  5KHJ A;  2H8P C;  3KZI Z;  4XDJ A;  2VWK A;  4IHJ A;  3JD4 A;  2P06 A;  1HNW O;  4LC1 A;  4Q20 A;  2EIJ C;  3CRC A;  5LP6 C;  5KLV H;  1SQB H;  2QWO B;  5KMG A;  1YHQ V;  2BTQ A;  4JAA A;  2X6A A;  3DC6 A;  3OUF A;  4UFZ A;  1U96 A;  3NR7 A;  4JYA B;  1OCZ C;  3HKB B;  1XNR O;  2CDY A;  5IT9 N;  1R73 A;  4RQE A;  1KD1 W;  1XUQ A;  2JS3 A;  1AR1 B;  1IBK O;  2ILM A;  5TIS Z;  3SPH A;  1VQ9 V;  4DR4 B;  1MSW D;  4F4L A;  1M90 W;  3RYC A;  1MZE A;  1GH6 A;  4FLW A;  1DLB A;  1H2L A;  3H1K H;  2KG7 B;  2YID A;  5L3E A;  2IJJ A;  4W4K A;  1FFT B;  2G38 A;  4U3J A;  3T1C A;  5LMN B;  1G8M A;  4ZKI A;  4DV3 O;  2PZS A;  1U97 A;  5IWA B;  5DM6 V;  1AJP A;  2JDI G;  3CCV V;  2N74 A;  3OT7 A;  3CJH B;  4H44 B;  4R50 A;  4MW3 A;  2WLM A;  4JI6 B;  1K4D C;  2Y0P A;  4PI2 A;  2VQE B;  2RNB A;  1BZK A;  4I4T A;  1I94 B;  4GYC B;  4IIJ A;  2ZM6 B;  5L3D A;  3E8B A;  3BPZ A;  4PI0 A;  2A3Q A;  1V55 C;  4WFE A;  4BR6 A;  1H2G A;  4JI7 O;  3S3X A;  4GT1 A;  2ADQ B;  3E22 B;  2P7T C;  1YTF D;  1HWY A;  2QEX V;  3FYE B;  3VQV A;  4RUE A;  1H2K A;  4LF9 O;  3E89 A;  3QO5 A;  4MTG A;  1JFF A;  3OD4 A;  2Q69 A;  3L75 H;  2X6C A;  3LDD A;  2HEP A;  3ASN C;  1Y76 A;  3ASO C;  4B3S B;  3E8H A;  1AR5 A;  1TA8 A;  1P84 F;  3AEI A;  4PJ0 Z;  1R6K A;  4RQF A;  4YJ3 B;  2R9I A;  5IYZ B;  3DGE A;  1Q90 D;  4GKJ B;  4CC5 A;  3K0G A;  4DRX A;  1XNQ O;  3ABU A;  3W7U A;  1SRY A;  4AI8 A;  1FXK B;  1M93 A;  3JAR B;  1N0J A;  5LA6 A;  5GON B;  4QE9 A;  4FPP A;  4CH4 A;  2JEX A;  1I5X A;  2QWR B;  1UFI A;  5FLX N;  5KMG B;  3IFX A;  3H01 A;  5CN0 A;  4J11 A;  3GWK C;  3LSS A;  4JI0 O;  2EIL C;  5LA6 B;  1H8E G;  4X64 B;  4FFB B;  1M9N A;  3K04 A;  1GKF A;  3G6B A;  3STZ C;  2UXX A;  4B3M O;  3HKB A;  5IJ9 B;  1FS0 G;  2ZNJ A;  3U0Z A;  1WN7 A;  1YIT V;  2BSK B;  1SKV A;  1YJ9 V;  4QE7 A;  4FFB A;  2X7R B;  2B5U A;  3F7Y C;  4CH3 A;  2IJH A;  4X89 A;  5L3B A;  4LF4 O;  1K97 A;  3ZMU A;  1MMM A;  2Q68 A;  5KHI A;  2CH7 A;  2ARH A;  2V4D A;  4YHH O;  2E76 B;  2WLK A;  2Q7G A;  4LH6 A;  1QLN A;  2F43 G;  2A06 H;  4XDK A;  3CRQ A;  1I0H A;  3QO8 A;  4DO2 A;  4B3M B;  3AG4 B;  1D5N A;  3CCM V;  4DUY O;  3UCS C;  1YDX A;  1FYJ A;  4X62 B;  4YIP A;  4FK5 C;  3ZHQ A;  5A2Q N;  3KCX A;  2JGD B;  3FB6 C;  4JI3 O;  1ZAU A;  4JI5 O;  3ZBH A;  4JI7 B;  2UUA O;  4FLX A;  1VQM V;  3ABL C;  2O57 A;  1AI4 A;  1GK9 A;  4PD4 F;  4NXN B;  4K8X A;  4MTX A;  4X88 A;  2B9Z A;  2CK3 G;  3Q4H A;  4PA3 A;  2QE7 G;  2QDO A;  3CB2 A;  1HR0 O;  3CS5 A;  3OR7 C;  1PNM A;  4TUY A;  3TXS A;  1YSC A;  4LFB B;  2VS0 A;  2Q9L A;  5IYC O;  2ZR2 A;  1IBM B;  3H9V A;  3QO7 A;  4AQY B;  3JAL A;  2CTP A;  1I7F A;  4X1K B;  4DK0 A;  3VQX A;  5EYP B;  3AG1 B;  4JI5 B;  3L71 H;  3MAQ A;  1I08 A;  1N33 O;  4EEQ A;  4DV1 O;  5B5E Z;  4JYB A;  2W0X A;  4WBN B;  1O9H A;  4ZI7 A;  5BZB A;  1WB8 A;  5EIB D;  5EBL C;  4EFB A;  3U11 A;  4JF3 A;  3A8T A;  1NT2 B;  1QLE B;  1GMG A;  4B08 A;  1WPB A;  1T5E A;  2E5L B;  2BCC H;  1S0V A;  1PPJ H;  5CBF A;  4FZ0 A;  3IC9 A;  5DED A;  5B1B C;  4PDR A;  3CX5 F;  3JSL A;  4E4E A;  2JIZ G;  4J41 A;  2PTM A;  1TVK B;  3CEI A;  4BWA A;  1VF6 C;  2A0L A;  1Q81 W;  3OTO B;  4LNU A;  4OXS A;  1X4T A;  1IVS A;  4N23 A;  1KEC A;  2DWE C;  3J81 N;  1EN5 A;  4X20 A;  4ASU G;  3C3T A;  4JTC B;  5B1O A;  3CCE V;  2IH1 C;  5J2T B;  1V54 C;  2UU9 O;  4JI3 B;  5JQG B;  3GB7 C;  3H1L H;  1V9P A;  1NU1 H;  1S72 V;  1E1R G;  5LGU A;  2JGD A;  1VF6 A;  1MOF A;  1Q86 W;  4JV5 O;  2A79 B;  3OMA B;  4MW8 A;  3FD9 A;  2K9P A;  1VQP V;  3E83 A;  4NTY A;  1BE3 H;  2EIK B;  2RCV A;  3Q4H B;  2IU0 A;  4B3R O;  3OGC C;  3F5W C;  3B2E E;  3R65 A;  4FMT A;  4FLV A;  1FXK A;  3RW0 A;  2EX3 A;  1AI7 A;  2MW2 B;  2OTJ V;  3SPJ A;  2PI5 A;  2ZDI C;  1M4U A;  3K5N A;  5LMU O;  1OCC C;  3BA8 A;  1W59 A;  2Y69 C;  3RYH A;  1HR0 B;  1QHT A;  3ZHV A;  1PNK A;  1N8R W;  1KYO F;  2XUM A;  1W0K G;  3AG7 A;  4LF9 B;  4JI0 B;  2CAZ C;  3D36 A;  4MVZ A;  1XMO O;  2ZD9 A;  3W7T A;  2K1E A;  3WG7 B;  1J5E B;  1HNZ O;  4I7Z B;  1THZ A;  5IYZ A;  2F4V B;  3FX7 A;  1VQN V;  2P6J A;  2L35 A;  5LBQ A;  5BR8 O;  1A32 A;  2JS5 A;  2BTQ B;  2OCH A;  4L8J A;  1PL0 A;  1FAF A;  2WLI A;  4F6R A;  4P30 A;  5GON A;  1BQ0 A;  4IHJ B;  4MVO A;  4O4J A;  3ICX A;  2WLJ A;  4J10 A;  4X1I B;  1XBL A;  2Q5Z A;  1G6U A;  4I0X A;  3JAW A;  2DN9 A;  3J80 N;  4L87 A;  2N05 A;  4DXW A;  4PA7 A;  3ZIA G;  3ZMV A;  3ZRX A;  1N33 B;  3OUS A;  1WJZ A;  3GWO A;  1OV9 A;  5JQG A;  3JAK B;  3K9S A;  2EIL B;  4OX9 B;  1QU7 A;  3P3P A;  3WU2 Z;  4GUN A;  2QM7 A;  3TJT A;  3I56 V;  2LO1 A;  2PY5 A;  1BS3 A;  1VIB A;  1VF5 B;  4PHZ A;  4LBE C;  2CTW A;  2HJD A;  2XAS A;  3ZRS A;  1XNR B;  1XL6 A;  1PNL A;  1M57 B;  4LH7 A;  2KSD A;  3UT5 A;  4HZ3 A;  3P3N A;  5KX5 A;  4LFA B;  4B3R B;  3ZHR A;  1YVW A;  1BHA A;  1G1X B;  4DR3 O;  5LHH A;  1RM1 C;  3ABM B;  1EFR G;  2Q6A A;  3ZRV A;  3QVN A;  4X1K A;  1H2N A;  1EN6 A; 
#chains in the Genus database with same CATH homology
 1URF A;  4NB5 A;  1RFY A;  1UPG A;  4IGG A;  2HJD A;  2RMK B;  1CXZ B;  4DYL A;  2Q0O C;  1US6 A;  4NKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...