2HJDA

Crystal structure of a second quorum sensing antiactivator tram2 from a. tumefaciens strain a6
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
89
structure length
89
Chain Sequence
FELRPVIGLTRGLSSADIETLTANAIRLHRQLLEKADQLFQVLPDDIKIGTAAGGEQHLEYIEAMIEMHAQMSAVNTLVGLLGFIPKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Quorum-sensing antiactivator
publication title Crystal Structure and Mechanism of TraM2, a Second Quorum-Sensing Antiactivator of Agrobacterium tumefaciens Strain A6.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 29
structure length 89
sequence length 89
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 2hjdA00
4NKGB 2HJDA 2RMKB 1URFA 1US6A 4IGGA 2Q0OC 1UPGA 1CXZB 1RFYA 4NB5A 4DYLA
chains in the Genus database with same CATH superfamily
2E76B 1OHHG 1XMQO 1S5HC 3R65A 3OD4A 2DOSA 2P5OA 2E3CA 4AQYB 5EBWC 4I7ZB 3H1LH 5AG2A 2Q73A 1N0NA 1PL4A 3W7TA 4Z2WA 1UFIA 2WWWA 1RM1B 1EBOA 4ZHQA 4H33A 3K58A 2DYSB 2CUGA 4TV8A 2XT9A 4UB6Z 1QLNA 3QTCA 1MZFA 3OGCC 1M90W 1GM8A 4BIUA 1S3JA 2QM4A 4B3MO 4O4IB 3T1HO 2DE0X 2P06A 1V54B 3L75H 3SPCA 2Q68A 4DV6O 4DW1A 3STZC 2Q7EA 4KHPO 1IDSA 4UCTA 4ZI7A 5JJJB 4DK0A 3TK1A 3ABLC 5CA1B 2KG7B 3D36C 5C8YB 2HR3A 4R8CA 1YJWV 1E79G 1HDJA 2V7QG 1V9PA 1SQPH 1L1FA 4B3SO 2LFSA 4L8JA 3I55V 1Q5OA 3K04A 2NR5A 5EBLC 1N33B 1JX9A 3ETEA 3JAWB 4FLYA 4GX5A 4DV0B 3CRQA 2OTLV 2W6JG 5KHKA 5IJ9A 1Z2GA 3F7VC 1HNZB 2OTJV 4NR1A 4OPAA 3C90A 1VQOV 1AI6A 1ZTEA 4FK5C 5DECA 4OX9B 4DV2O 2ODMA 3ASNB 3N27A 1MSDA 4DUZO 3ZIAG 2PZSA 4LF8O 1BQZA 4MVOA 4KFMA 1HNXB 1EN6A 4B3TO 2WLJA 1OZ0A 4UCUA 4CS3A 5CBHA 4IHJA 1QLEB 1PPJH 1VF6A 3SYOA 4K8ZA 2W6IG 4F6EA 1ZL8A 2GDSA 3W7SA 1Q3EA 5EK0A 4JI1O 4JI5O 4JZGA 1S0VA 3M99B 1I7FA 4B3MB 2Y48A 5LXTB 2PY5A 3T1HB 2AZ0A 1Q81W 1FJGB 4WBNB 4P2ZA 3D8CA 1SQGA 3K79A 1RFYA 1FYJA 3RYHB 3J7AU 2JGUA 3EXAA 3RYIB 3STLC 2YIBA 4KHPB 4EEQA 1PV0A 4QE7A 3CB2A 3ZHUA 2XOKG 4R6ZA 1OV9A 2X6BA 5CN0A 5DN6G 5J2UB 4MT8A 3ABKC 4D7TA 1P4RA 2WLIA 1ZAUA 1N8RW 3QO8A 1XILA 5JJNB 4X88A 1K4CC 4RWUA 4LFBO 2L6LA 2CTWA 2P7TC 4DR7O 5CB4A 1AROP 1QHTA 5LGNA 4PJ0Z 4G28B 1YIJV 1F4NA 4JI4O 1TGOA 1N0JA 3ZS8C 3B8MA 3CRRA 2QSAA 5JJEB 2EZOA 1WNSA 1AI4A 1VP7A 3AG2C 4J7JA 4JTCB 1IBKO 2YSUB 1DF4A 2VQFO 5BMVB 4PDLA 3T1YB 3CRAA 2UUBB 4B3TB 5ITZB 2LQTA 3JAKB 1WN7A 2AZ2A 1GH6A 2GUZB 2XHBA 4RUFA 4JI3O 2UXDO 3WG7C 3MHSC 3BABA 3ICXA 2IH3C 3BVOA 1AILA 1IBMO 3JYCA 4EB6B 1M1KW 4FM0A 4UVCA 5TISZ 1FS0G 3P3PA 3Q4HB 1DTOA 1V55B 3RYCA 1FAFA 4PDRA 5H5NA 3WFVA 4U3JA 3LUTB 3UO3A 4QIWF 5KX5B 1WPXA 5LYJA 5IWAB 4FLZA 5IY5C 2Q8VA 1FFXA 1GM9A 3JALA 4TQFA 2E5LB 2ILMA 2Q7HA 3U11A 1VQ7V 1M9NA 4MW8A 2EIKB 1IXMA 3K5MA 4DR4B 2VS0A 4QE9A 4JYBA 5K1PA 4FZ1A 2EINC 1H2KA 2X6AA 4CBCA 1VQ6V 1GK9A 3CPWU 2KKWA 4GX1A 4DR7B 1Q6IA 4MTGA 4JYYA 2AW9A 2BTOA 1LNQA 3JD4A 5HFLA 4JI4B 2HHHO 3JSNA 3AK2A 4JAAA 4X9QA 4KL1A 4O4IA 1W59A 5LHHA 5BR8O 3UT5B 4ZHQB 2ZM6B 4ZIBA 1U96A 2DW4A 2QGNA 1MG1A 1LUVA 3ZHSA 5EC2C 2RDCA 1MABG 4CH4A 4WFBV 4DV3B 3CRCA 1VARA 4X89A 3JAMN 2KG7A 1YDXA 2Q69A 4JI3B 4B08A 3H1HH 3OGIB 1AR4A 4ZI7B 3JAWA 1NTKH 5IYZA 2ZCEA 4NTXA 3G6EV 1NJIW 1IBMB 4I5SA 4JI0O 1WB8A 3ASOC 4LF7B 4DV5B 4QPJA 5JWPA 2GTSA 3ZHRA 2A3QA 2K1EA 4CC6A 1IBLB 2Q7GA 1WJZA 2FB5A 4DV4O 2ADQB 2XAHA 2RN9A 1I0HA 5IJ9B 4YJ2A 4BW9A 2HVJC 3FKSG 4WFGA 1K5SA 4UV9A 1L0LH 3J80N 3K59A 3L74H 2XASA 3WU2Z 1N34O 1KECA 1S5JA 1XDCA 4UVBA 2F4VO 4PI2A 4DUYO 1SQVH 1JMKC 1K97A 1RM1C 1G6UA 4IYHA 2OIGA 3RW0A 2UXBB 2DYSC 4WCEV 3KKYA 2A0LA 5LXTA 1EZVH 3C3SA 1YHQV 4FLWA 3AG4B 1XL6A 3ABTA 4K0KB 1NT2B 1ZL8B 1US6A 2R72A 2AHZA 3S3XA 3F5TA 4NXMB 3SPIA 2UXXA 1FPOA 4I0XA 2Y4UA 1V54C 1YVWA 3L73H 4JASA 3G4SV 4H44B 1URFA 1HP8A 2GSMB 2PI5A 3CJHA 1G8MA 3CRMA 1AP6A 5IY5B 4UCOA 3DC5A 4XDKA 4PDMA 4MVUA 4EFEA 2HG5C 1GN6A 1SQQH 1JQ0A 5KHJA 5FPOA 1J5EB 3ABUA 4JI0B 3DXRA 3SJAC 5KHIA 2LGWA 2UUAO 2EINB 3KG2A 4EFBA 5JCOA 2BTQB 2H8PC 3ZMTA 4AQYO 2F93B 4YHHB 1O9HA 4X66O 1EZJA 3MAQA 3OTFA 4DV4B 2WAMA 3A0BZ 5CB4B 4AI8A 4MVMA 3MDSA 2LW7A 3K0GA 4MTOA 3E83A 5LL6Y 3ASNC 1RSOA 5BMVA 3ZCCA 2A7WA 1KBHA 5EC1C 3BAAA 2RMKB 1XNRB 5J9PC 2IU0A 4OGQB 2GTAA 4HNAA 3JAKA 1KMIZ 3ZN1A 1S72V 3T1CA 4B7EA 2GUZA 4DUYB 3ZMZA 1FXVA 4NXNO 4DK1A 3I5DA 1I5XA 4CH6A 1S76D 1QLEC 1K3EA 4GX2A 1H8HG 2CH7A 1FFTB 1NZ6A 4GX0A 1YTFD 1JPXA 3SPHA 2R9IA 4I9WA 4NYKA 1AP5A 3K08A 5B3SB 3CC7V 2Y0PA 1SC5B 4RQFA 1R6NA 1N33O 2UUCB 1MOFA 1OCZC 5KX5A 2DMXA 2ITDC 5LMUO 3OEEG 4JPRA 3RGBA 4DR6O 3RWRD 3RYCB 3K9AA 4O4LA 1Q6HA 5LYJB 2CGOA 2VQEB 1Z5WA 3LDDA 1FFXB 2MK3A 2JRIA 2G38A 4Q20A 3JALB 1D2DA 2UUAB 3JASB 2W0XA 2LP7A 3CC2V 3SJCC 1XI1A 3CCSV 4X1KA 2IJHA 4I50A 1HNXO 4WFFA 1YXBA 1F7YA 2Z0AA 4NKGB 2ZDIC 3DTUB 3CWBH 1Y66A 3L72H 1K92A 4X66B 1IURA 2HEPA 2AGAA 4UV8A 5JCOC 1NVPD 3FB8C 3UT5A 3CCQV 1Q90D 2YI8A 1AJQA 3ZRVA 4CH5A 2BCCH 2YXHA 2UXNA 1NH2B 4FFKA 4O2AB 2CK3G 1K5QA 3OEHG 2QTSA 4TQDA 1XNQO 1N4CA 4DV1O 3CE2A 1FJGO 3SYPA 3JCUZ 1BZKA 4NXNB 3AG1B 1X59A 3PJSK 3ZX6A 1WA8B 4AILC 1IVSA 2A79B 3K0DA 3B8NA 2KSDA 4PV1B 5LGUA 4DR1O 3PN1A 1QR9A 3BFRA 4CH3A 1KP2A 4W4KA 3A2FA 5B1NA 3ZMUA 5IYZB 2DYRB 4LNUA 4IYIA 3KZIZ 3N2GA 2RQ6A 4RAIA 3SR2C 1V55C 5LMUB 2ZQMA 3IC7A 2ARHA 4DR6B 2JIZG 4DR2O 4FVMA 3SYQA 2X0LA 1F23A 2EULA 4I55A 2EIKC 3D3IA 3O9OA 2GBOA 4YJ2B 3IAYA 5LMNO 3WB2A 2WSSG 4KP4A 3CMEV 3JD1A 3T1YO 1GM7A 2N05A 2UUBO 4F4LA 1VMGA 3G80A 1I5YA 1L0NH 4A5UB 4HBNA 4GLXA 1NKDA 1N32B 1XL4A 1VF5B 2QWRB 3JD2A 1JOYA 1KD1W 1PL0A 3JD3A 3TETA 1XNQB 1JFFB 3OMNB 4DV1B 3GB7C 3HKDA 2BE3A 3FB5C 4X62O 1OCZB 4YIPA 1PD3A 2X6CA 1OCCC 4I0XB 4JYAO 3JSLA 2DQ0A 4WF9V 3ETGA 5IWAO 3B40A 4TT3G 4ZBMA 3CJHB 2YXYA 1GAXA 2E5LO 4QJFB 4DR1B 1GN3A 3LSQA 5L3DA 4DR4O 4RQEA 4FIPC 2BTQA 1YITV 3A0RA 4FMTA 2UU9O 2H94A 1NTMH 3CMAV 5L3CA 3GWOA 5JH7A 5D5PA 2Q9LA 2PUSA 4LF9O 3B09A 3DXRB 4J80A 4FLXA 4UVAA 1XMOO 5JQGB 1HWYA 1VQNV 4B3RO 5KAFZ 4HAMA 1Q82W 4DR2B 2P4VA 1K73W 3VQVA 4YXWG 5IYBO 2B9ZA 3LNMB 2Q0OC 4XDJA 1R3KC 4BIOA 4GKJO 1SS3A 4GCZA 2CDYA 2LFRA 2RJZA 2XAJA 2Q5ZA 2ZM6O 2FTKA 3ZBHA 4UCSA 2P6JA 1TVKA 2B1GA 2ZKOA 4CS2A 2OT5A 5LMNB 1PM9A 4FM2A 1RSOB 2JS3A 1H2NA 2Q6AA 4DV3O 3ZRWA 2ZT9B 1M93A 3K5OA 2PI4A 4HNAB 2WLHA 3N2KA 1OCRC 5B5EZ 5LHGA 2ZNJA 3MD0A 2PGGA 5HFMA 1VF6C 1P7GA 3AG4C 4LFAB 1GTOA 4RUEA 4TOIA 2CH7B 2QWPB 5EIBD 1SQBH 4FLUA 2Y0IA 3TCUA 4LF7O 1XBLA 4X62B 1IZ3A 4AHCA 4DV5O 3THOA 2P4KA 3FAVA 2Z5UA 1SZTA 4LBEC 2ITCC 2ZD9A 4P9OA 4JYAB 5EBMC 1IBLO 4WFHA 4EKWA 2R9RB 2CTPA 1BL8A 5BXZA 1SETA 3HKCA 4BR6A 1NTZH 1VQPV 3JASA 3OAAG 3D3QA 4PDVA 4C7UA 4Q6GA 4O4JA 1KKDA 4O4LB 2UU9B 1E1QG 1S77D 3G6BA 4U7NA 4F6RA 2CTQA 1EN4A 4LF9B 3UQ8A 4LFCB 1FXKA 1SF9A 3DGEA 3AK3A 3A0HZ 1XMOB 3H1JH 4Z1MG 4NB5A 4B3RB 3QG5A 4TV9B 4X1KB 3CCEV 4PI0A 4I50B 4O2AA 3CC4V 2PYLA 4OPHA 2UXBO 5GONA 1HW7A 1P84F 4GKJB 1M4UA 4G2KA 1ZX3A 2JK5C 3E35A 1Y4MA 3B2EE 3UCSC 1M56C 3G71V 4K0KO 3LSSA 1H8EG 2IJKA 2ZIMA 4DXWA 3I56V 4NXMO 5LHIA 4JI2O 1WA8A 1G1XB 1OCOB 1Y74A 3SGIA 1J95A 3H9VA 1OCCB 1X4TA 3CSXA 2Z3YA 1JCHA 3B77A 4WFAV 4ZKIA 2EBOA 4JYCA 2WLKA 2F1MA 2CAZC 5IYDO 5J2TA 1T5EA 4JAVA 1J5EO 3K9SA 3A8TA 5B3SC 5C93A 4JTDB 4QPKA 4DRXB 5BZBA 2EJ7A 4TSFG 3ZMSA 2C2AA 4J7ZA 4X20A 1WPBA 4H13B 5KHGA 1NU1H 4YHHO 1HR0B 4LNUB 5H2FZ 5H6QA 3N2GB 1RPRA 5A2QN 3QO5A 4LR3A 2JEUA 1RP3B 2PF4E 3LSUA 4ABMA 1Z5VA 4J9ZB 3H1KH 1PNKA 3FD9A 1PNMA 3GVMA 4X1IA 3DSQA 5LBQA 4OXSA 2LO1A 2GHYA 1XEQA 1RPOA 3LDCA 2BOCC 1XNRO 4I55B 3CXCU 3ZJZA 1H2GA 3OR6C 2EJRA 1VQMV 1M5IA 3RN4A 1EFRG 5D5QA 2QM7A 1OCRB 2IJIA 1YI2V 3BA8A 2F95B 4U3FH 3ZN0A 2QA4V 1JFFA 2JGDA 2OYQA 1XREA 2YS8A 5EYPA 2IBZH 1WLEA 4PA3A 1VIBA 4JI2B 1S5LZ 1B06A 1QVGU 1D5NA 1QR8A 2UUCO 1Y76A 3AG3B 2BOBC 3AG1C 3HKDB 2IW5A 3H01A 4FM1A 3BY6A 4LH7A 3TXQA 4TUYA 4LF6B 3EFFK 2XUMA 5KHHA 4R50A 3SDLA 2JDIG 1KUQA 4LF4O 2VQEO 2YDEA 1YCIA 4YY3O 5JQGA 2Y4TA 2DYRC 2O57A 4K8XA 1GMGA 3U10A 2XAQA 2Y69C 4BWAA 5KA5A 5LP6B 2ZIOA 1PKXA 3VQWA 5JH7B 1BQ0A 2QWNB 4DR5O 3NR7A 2ZXWC 3WB0A 3W7XA 4U7OA 1R6KA 1AI5A 5IJ0A 3G67A 2E74B 2OWOA 4MVSA 1DGSA 3OTOB 1M56B 3B4SA 3KCYA 3OMAB 5H6RA 3FYEB 1W2BU 2A9HA 4HZ3A 1M57B 1TVKB 4J42A 1DLBA 3FFQA 1KU9A 3CX5F 2NNUA 1YF2A 1VQKV 3HKBA 5K1XA 4IL6Z 3ZRWB 1IX9A 3CCJV 3QO7A 3N2KB 1Q6UA 4PA4A 1QVFU 2QWQB 3HKEA 2QM8A 3HPLC 4LP8A 3C3TA 1I94B 3D36A 2YEVB 4JI6B 1W0KG 4HYOA 4QGPA 2EIJB 2XTAA 3OUFA 4JI7O 3TGUH 1CPYA 5KMGA 2ZINA 3FAVB 1MA1A 1VEWA 1UPGA 3K06A 2JEXA 3JATB 4CC5A 1UJWB 5JVDA 4GKKO 4LF4B 5DM6V 3JCZA 3HKCB 3P30A 3SYAA 3ZMVA 3ZRSA 4JI8O 4UUJC 1OJHA 4YY3B 2CGNA 5KA6A 1FD9A 2ZE7A 5FNVA 4O4JB 4TV9A 1BHAA 1NR7A 2XAGA 3CCMV 3CCRV 3FB6C 2DQ3A 1HNWB 4F6RB 4DR5B 1FXKB 1Q43A 2V4DA 3BA9A 3BCCH 1N32O 4N23A 2NLJC 3X2QB 1JVMA 1CP9A 1QNMA 2LGQA 3L70H 4X8AA 5GONB 2V1DA 2YICA 4JGSA 1AI7A 3E8GA 3FB7C 2XAFA 2HLDG 2IJJA 2WA4A 4GYCB 2KB1A 3E86A 3K5LA 4UXNA 1H2MA 1GRJA 1SA0B 4J9YB 5EZYA 1Y74B 3F7YC 1MMMA 1L8DA 1A32A 5FL7G 2P67A 2N04A 3TXSA 1QQCA 5FLXN 2EX3A 4MVZA 4DRXA 4PD4F 4GZRB 2D3OW 5B1BC 4O2BB 2CE4A 2QJ1A 1ZLZA 3S3WA 4IIJB 5GTIZ 5J2TB 2D2CB 2IM9A 2HKOA 2Y69B 1R1BA 3E8FA 4FJCC 4JI7B 2BSKB 1XQ8A 4JAUA 4J7KA 2ZXWB 2YI9A 3L71H 4X20B 3AG7A 2DJVA 4DO2A 1NR1A 4GKKB 5KLVH 5A9GA 1CEZA 3RFRA 3BEHA 5F2VO 5DEDA 4UB8Z 1KKCA 3U0ZA 4JI8B 4X1YA 3M8AA 4G27B 4X1IB 3JD0A 4X65O 3CCLV 1W0JG 2QR4A 2B1IA 2YC0A 2JJ1G 2EIMC 4LC1A 3SJQC 2QTOA 2Q67A 3ABMB 1SERA 4JV5B 2FL4A 3JARB 4O4HB 2PYJA 1XMQB 5B1AB 1BCCH 1ZUQA 2M7WA 5KUKA 1VQ5V 3ZHVA 4NTYA 3RVZA 1THZA 4LFAO 3ETDA 1QU7A 2QKSA 2JGDB 3M7MX 4H37A 1TAEA 2YIBD 2FYUH 2JS5A 1BHBA 4PELA 1OCOC 5EYPB 5H9CA 4MTFA 1CXZB 2HVKC 1SZXA 1F4MA 1BSMA 4CS4A 2RCVA 4YIOA 1SRYA 2ZNIA 1Y76B 2DWDC 2JVDA 4UCRA 1SKVA 2KQXA 2F43G 1MSWD 2MW2B 1TA8A 4TUYB 5CA3A 2W0FC 3ZHTA 4BW5A 1ORQC 4UCVA 4DV6B 4P30A 2AXTZ 5LP6A 2QEXV 4ZOLB 1AR5A 1EM1A 2LJ2A 3RVYA 1K7DA 4LFCO 2F23A 3EHBB 1N36O 1K9MW 2OCCB 1B6QA 3OMIB 4DR3O 1BS3A 1IXBA 5L3EA 1AVMA 4FFBA 1P49A 4B3SB 4KUMA 4QNHB 1COWG 2QKCA 1YZBA 4WFEA 4J11A 3UO2A 4FLTA 5LA6A 2QDOA 4LWSA 4D7SA 5LOVA 5L3BA 5IJ0B 4XBFA 3CYOA 2QE7G 1DK1A 2LW1A 4JF3A 1AR1B 1KC8W 4X65B 5CA0B 2QKAA 1LR1A 4DV2B 4FLVA 4MS2A 3ETQA 3WB1A 4DUZB 2WLNA 4LF8B 2ZE6A 4YJ3A 3HKBB 4IGGA 1TUBB 1I08A 5B1OA 2YEVA 3VBBA 2YXLA 5B1BB 1VQ8V 3APQA 2ZR2A 3HKEB 4N21A 4DV7O 1H2LA 1WB7A 1PP9H 1Y6XA 2K9PA 3ABLB 2IH1C 3AG3C 2WLLA 3E22A 5CBFA 3OR7C 3JATA 3LDEA 1JJOA 5LGTA 1DF5A 2GV9A 4JI1B 4JI5B 1HR0O 2OCHA 3T4DA 5IDJA 4I4TA 5KMGB 1R73A 2ZE5A 4MW3A 4P9PA 1ROPA 3RYFB 5JVDB 1U97A 3BHPA 5CBGA 1G4YB 1YTFB 5IE9A 1EN5A 1NH2D 1N36B 3R66A 2CTRA 5LP6C 1K8AW 2EIMB 3BPZA 4DR3B 3K03A 1Q8IA 3ML0A 5FNVB 1XUQA 1E1RG 1ZWIC 1R6TA 3LNNA 2H3OA 3IFXA 2ZR3A 1XHZA 4LFBB 1GKFA 4DW0A 1BMFG 1GN4A 3KCXA 3E2EA 1H2SB 1ZSPA 2IU3A 3IJ4A 1MNGA 4R7CA 1SA0A 2FMLA 3K5NA 1M57C 5CMUA 4LF5O 1VF7A 4MSWC 5IT9N 4KXRA 1PNLA 1BGYH 1AB3A 4Z1VA 2FKXA 1IBKB 4TV8B 1NQTA 2Q4PA 3EVKA 4LF6O 4K35A 3OT7A 4E4EA 4O2BA 1NVPB 2VQFB 5EZYB 1H38A 1NI8A 4LCUC 4L87A 1KQSU 4H0LB 4IIJA 3CXHF 1WP8A 3OUSA 5CA1A 3RT3C 3BRCA 3SPGA 5C8YA 2DWEC 2BSKA 4DV7B 2EIJC 3T4ZA 4JZ2A 2UXDB 2EILC 1B3QA 3ZEDA 3ABKB 5IYCO 3OE7G 1WP7A 1YJNV 1BE3H 2UXCO 1XOUA 2JJ2G 3OTOO 5L3GA 1QBZA 4K3AA 5BY1A 4J41A 3GWKC 3CD6V 5EIBC 2EZPA 4NTWA 5L3FA 4X1YB 1QCEA 3JARA 3CS5A 4O4HA 1VQ9V 4UFZA 1JR9A 3VQXA 4DYLA 1FXKC 1TUEB 3ZHQA 3AG2B 1BT8A 3ZRXA 2DN9A 4PA9A 2YIAA 4XDLA 3X2QC 1AJNA 1MZEA 1NS1A 2ETNA 5GW7A 5GTHZ 1KYOF 1JA8A 1F51A 3UKMA 4FZ0A 4J10A 1I94O 1R3IC 2AHYA 2P90A 4JI6O 2NN4A 4ICGA 4LF5B 2HHHB 3CHXA 3MHHC 3SJBC 2YIDA 3WG7B 4MVQA 4IHJB 5BR8B 2ATKC 2QWOB 2WPDG 4WBNA 3T2MA 2M6YA 1SQFA 4E2LA 3J81N 1R3LC 1D5AA 2R9AA 3RYHA 1LUWA 4CZZA 2PTMA 1K33A 2ZE8A 3IGAC 4GUNA 3RYIA 1B04A 4ZOLA 3P32A 2OIEA 3OFNG 2HJFC 2B5UA 5E1AC 3QNEA 3DC6A 1O9GA 5J2UA 1WAZA 1HNWO 4D6TH 1K34A 5FPRA 4GT1A 4X64O 1KB9F 4RO2A 1P7BA 3E8BA 3AEIA 1JJ2U 2VWJA 1Q86W 5B66Z 2WA3A 2ZDIA 3HB3B 4I9QA 3CEIA 2HFEC 4FFBB 3TJTA 2VWKA 3L9DA 1FKAO 2UXCB 2A06H 1R3JC 2R70A 3UM7A 4PA6A 3CP1A 2YUAA 3O65A 2WLIB 4LH6A 2HP8A 5LA6B 5CA0A 3E8HA 3FYIB 4PA7A 4PHZA 4LWSB 3K57A 1SESA 4JTAB 5LOVB 1KP3A 1Y67A 3E89A 3QF7A 3H1IH 1YJ9V 2F66C 3ABMC 1VQ4V 4BIZA 2WLMA 3CCVV 1GO3F 1TUBA 1SQXH 3HR0A 5B1AC 5ITZA 3APOA 2VRZA 3RBZA 1N34B 3CCUV 3OM3B 2F4VB 3QVNA 5E79Z 3VOUA 3OW2U 4YJ3B 1AJPA 5KAIZ 1VQLV 5KUMA 2E75B 3F5WC 4MVRA 4FPPA 3NXSA 2HJDA 2XNDG 4MTXA 2EILB 4EB6A 1YEWA 2ADPA 3W7WA 4NVPA 1Q7YW 4ASUG 1XHXA 4TWKA 2WLLB 3E22B 3SPJA 3K3WA 3SYCA 1YSCA 3Q4HA 3RYFA 3ASOB 4BAYA 3IC9A 4I4TB 3W7UA 4DV0O 2P22C 1GN2A 2X7RB 2N74A 4B7KA 2L35A 1FXHA 1NBMG 4W4LA 4IT5A 3P3NA 1K4DC 2RNBA 3FX7A 1HNZO 4U3JB 2OCCC 2Q0AA 4X64B 4JV5O 3AK1A 3VQYA 1ENVA 4OX9O
chains in the Genus database with same CATH topology
4NKGB 2HJDA 2RMKB 1URFA 1US6A 4IGGA 2Q0OC 1UPGA 1CXZB 1RFYA 4NB5A 4DYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKG B;  2HJD A;  2RMK B;  1URF A;  1US6 A;  4IGG A;  2Q0O C;  1UPG A;  1CXZ B;  1RFY A;  4NB5 A;  4DYL A; 
#chains in the Genus database with same CATH topology
 2E76 B;  1OHH G;  1XMQ O;  1S5H C;  3R65 A;  3OD4 A;  2DOS A;  2P5O A;  2E3C A;  4AQY B;  5EBW C;  4I7Z B;  3H1L H;  5AG2 A;  2Q73 A;  1N0N A;  1PL4 A;  3W7T A;  4Z2W A;  1UFI A;  2WWW A;  1RM1 B;  1EBO A;  4ZHQ A;  4H33 A;  3K58 A;  2DYS B;  2CUG A;  4TV8 A;  2XT9 A;  4UB6 Z;  1QLN A;  3QTC A;  1MZF A;  3OGC C;  1M90 W;  1GM8 A;  4BIU A;  1S3J A;  2QM4 A;  4B3M O;  4O4I B;  3T1H O;  2DE0 X;  2P06 A;  1V54 B;  3L75 H;  3SPC A;  2Q68 A;  4DV6 O;  4DW1 A;  3STZ C;  2Q7E A;  4KHP O;  1IDS A;  4UCT A;  4ZI7 A;  5JJJ B;  4DK0 A;  3TK1 A;  3ABL C;  5CA1 B;  2KG7 B;  3D36 C;  5C8Y B;  2HR3 A;  4R8C A;  1YJW V;  1E79 G;  1HDJ A;  2V7Q G;  1V9P A;  1SQP H;  1L1F A;  4B3S O;  2LFS A;  4L8J A;  3I55 V;  1Q5O A;  3K04 A;  2NR5 A;  5EBL C;  1N33 B;  1JX9 A;  3ETE A;  3JAW B;  4FLY A;  4GX5 A;  4DV0 B;  3CRQ A;  2OTL V;  2W6J G;  5KHK A;  5IJ9 A;  1Z2G A;  3F7V C;  1HNZ B;  2OTJ V;  4NR1 A;  4OPA A;  3C90 A;  1VQO V;  1AI6 A;  1ZTE A;  4FK5 C;  5DEC A;  4OX9 B;  4DV2 O;  2ODM A;  3ASN B;  3N27 A;  1MSD A;  4DUZ O;  3ZIA G;  2PZS A;  4LF8 O;  1BQZ A;  4MVO A;  4KFM A;  1HNX B;  1EN6 A;  4B3T O;  2WLJ A;  1OZ0 A;  4UCU A;  4CS3 A;  5CBH A;  4IHJ A;  1QLE B;  1PPJ H;  1VF6 A;  3SYO A;  4K8Z A;  2W6I G;  4F6E A;  1ZL8 A;  2GDS A;  3W7S A;  1Q3E A;  5EK0 A;  4JI1 O;  4JI5 O;  4JZG A;  1S0V A;  3M99 B;  1I7F A;  4B3M B;  2Y48 A;  5LXT B;  2PY5 A;  3T1H B;  2AZ0 A;  1Q81 W;  1FJG B;  4WBN B;  4P2Z A;  3D8C A;  1SQG A;  3K79 A;  1RFY A;  1FYJ A;  3RYH B;  3J7A U;  2JGU A;  3EXA A;  3RYI B;  3STL C;  2YIB A;  4KHP B;  4EEQ A;  1PV0 A;  4QE7 A;  3CB2 A;  3ZHU A;  2XOK G;  4R6Z A;  1OV9 A;  2X6B A;  5CN0 A;  5DN6 G;  5J2U B;  4MT8 A;  3ABK C;  4D7T A;  1P4R A;  2WLI A;  1ZAU A;  1N8R W;  3QO8 A;  1XIL A;  5JJN B;  4X88 A;  1K4C C;  4RWU A;  4LFB O;  2L6L A;  2CTW A;  2P7T C;  4DR7 O;  5CB4 A;  1ARO P;  1QHT A;  5LGN A;  4PJ0 Z;  4G28 B;  1YIJ V;  1F4N A;  4JI4 O;  1TGO A;  1N0J A;  3ZS8 C;  3B8M A;  3CRR A;  2QSA A;  5JJE B;  2EZO A;  1WNS A;  1AI4 A;  1VP7 A;  3AG2 C;  4J7J A;  4JTC B;  1IBK O;  2YSU B;  1DF4 A;  2VQF O;  5BMV B;  4PDL A;  3T1Y B;  3CRA A;  2UUB B;  4B3T B;  5ITZ B;  2LQT A;  3JAK B;  1WN7 A;  2AZ2 A;  1GH6 A;  2GUZ B;  2XHB A;  4RUF A;  4JI3 O;  2UXD O;  3WG7 C;  3MHS C;  3BAB A;  3ICX A;  2IH3 C;  3BVO A;  1AIL A;  1IBM O;  3JYC A;  4EB6 B;  1M1K W;  4FM0 A;  4UVC A;  5TIS Z;  1FS0 G;  3P3P A;  3Q4H B;  1DTO A;  1V55 B;  3RYC A;  1FAF A;  4PDR A;  5H5N A;  3WFV A;  4U3J A;  3LUT B;  3UO3 A;  4QIW F;  5KX5 B;  1WPX A;  5LYJ A;  5IWA B;  4FLZ A;  5IY5 C;  2Q8V A;  1FFX A;  1GM9 A;  3JAL A;  4TQF A;  2E5L B;  2ILM A;  2Q7H A;  3U11 A;  1VQ7 V;  1M9N A;  4MW8 A;  2EIK B;  1IXM A;  3K5M A;  4DR4 B;  2VS0 A;  4QE9 A;  4JYB A;  5K1P A;  4FZ1 A;  2EIN C;  1H2K A;  2X6A A;  4CBC A;  1VQ6 V;  1GK9 A;  3CPW U;  2KKW A;  4GX1 A;  4DR7 B;  1Q6I A;  4MTG A;  4JYY A;  2AW9 A;  2BTO A;  1LNQ A;  3JD4 A;  5HFL A;  4JI4 B;  2HHH O;  3JSN A;  3AK2 A;  4JAA A;  4X9Q A;  4KL1 A;  4O4I A;  1W59 A;  5LHH A;  5BR8 O;  3UT5 B;  4ZHQ B;  2ZM6 B;  4ZIB A;  1U96 A;  2DW4 A;  2QGN A;  1MG1 A;  1LUV A;  3ZHS A;  5EC2 C;  2RDC A;  1MAB G;  4CH4 A;  4WFB V;  4DV3 B;  3CRC A;  1VAR A;  4X89 A;  3JAM N;  2KG7 A;  1YDX A;  2Q69 A;  4JI3 B;  4B08 A;  3H1H H;  3OGI B;  1AR4 A;  4ZI7 B;  3JAW A;  1NTK H;  5IYZ A;  2ZCE A;  4NTX A;  3G6E V;  1NJI W;  1IBM B;  4I5S A;  4JI0 O;  1WB8 A;  3ASO C;  4LF7 B;  4DV5 B;  4QPJ A;  5JWP A;  2GTS A;  3ZHR A;  2A3Q A;  2K1E A;  4CC6 A;  1IBL B;  2Q7G A;  1WJZ A;  2FB5 A;  4DV4 O;  2ADQ B;  2XAH A;  2RN9 A;  1I0H A;  5IJ9 B;  4YJ2 A;  4BW9 A;  2HVJ C;  3FKS G;  4WFG A;  1K5S A;  4UV9 A;  1L0L H;  3J80 N;  3K59 A;  3L74 H;  2XAS A;  3WU2 Z;  1N34 O;  1KEC A;  1S5J A;  1XDC A;  4UVB A;  2F4V O;  4PI2 A;  4DUY O;  1SQV H;  1JMK C;  1K97 A;  1RM1 C;  1G6U A;  4IYH A;  2OIG A;  3RW0 A;  2UXB B;  2DYS C;  4WCE V;  3KKY A;  2A0L A;  5LXT A;  1EZV H;  3C3S A;  1YHQ V;  4FLW A;  3AG4 B;  1XL6 A;  3ABT A;  4K0K B;  1NT2 B;  1ZL8 B;  1US6 A;  2R72 A;  2AHZ A;  3S3X A;  3F5T A;  4NXM B;  3SPI A;  2UXX A;  1FPO A;  4I0X A;  2Y4U A;  1V54 C;  1YVW A;  3L73 H;  4JAS A;  3G4S V;  4H44 B;  1URF A;  1HP8 A;  2GSM B;  2PI5 A;  3CJH A;  1G8M A;  3CRM A;  1AP6 A;  5IY5 B;  4UCO A;  3DC5 A;  4XDK A;  4PDM A;  4MVU A;  4EFE A;  2HG5 C;  1GN6 A;  1SQQ H;  1JQ0 A;  5KHJ A;  5FPO A;  1J5E B;  3ABU A;  4JI0 B;  3DXR A;  3SJA C;  5KHI A;  2LGW A;  2UUA O;  2EIN B;  3KG2 A;  4EFB A;  5JCO A;  2BTQ B;  2H8P C;  3ZMT A;  4AQY O;  2F93 B;  4YHH B;  1O9H A;  4X66 O;  1EZJ A;  3MAQ A;  3OTF A;  4DV4 B;  2WAM A;  3A0B Z;  5CB4 B;  4AI8 A;  4MVM A;  3MDS A;  2LW7 A;  3K0G A;  4MTO A;  3E83 A;  5LL6 Y;  3ASN C;  1RSO A;  5BMV A;  3ZCC A;  2A7W A;  1KBH A;  5EC1 C;  3BAA A;  2RMK B;  1XNR B;  5J9P C;  2IU0 A;  4OGQ B;  2GTA A;  4HNA A;  3JAK A;  1KMI Z;  3ZN1 A;  1S72 V;  3T1C A;  4B7E A;  2GUZ A;  4DUY B;  3ZMZ A;  1FXV A;  4NXN O;  4DK1 A;  3I5D A;  1I5X A;  4CH6 A;  1S76 D;  1QLE C;  1K3E A;  4GX2 A;  1H8H G;  2CH7 A;  1FFT B;  1NZ6 A;  4GX0 A;  1YTF D;  1JPX A;  3SPH A;  2R9I A;  4I9W A;  4NYK A;  1AP5 A;  3K08 A;  5B3S B;  3CC7 V;  2Y0P A;  1SC5 B;  4RQF A;  1R6N A;  1N33 O;  2UUC B;  1MOF A;  1OCZ C;  5KX5 A;  2DMX A;  2ITD C;  5LMU O;  3OEE G;  4JPR A;  3RGB A;  4DR6 O;  3RWR D;  3RYC B;  3K9A A;  4O4L A;  1Q6H A;  5LYJ B;  2CGO A;  2VQE B;  1Z5W A;  3LDD A;  1FFX B;  2MK3 A;  2JRI A;  2G38 A;  4Q20 A;  3JAL B;  1D2D A;  2UUA B;  3JAS B;  2W0X A;  2LP7 A;  3CC2 V;  3SJC C;  1XI1 A;  3CCS V;  4X1K A;  2IJH A;  4I50 A;  1HNX O;  4WFF A;  1YXB A;  1F7Y A;  2Z0A A;  4NKG B;  2ZDI C;  3DTU B;  3CWB H;  1Y66 A;  3L72 H;  1K92 A;  4X66 B;  1IUR A;  2HEP A;  2AGA A;  4UV8 A;  5JCO C;  1NVP D;  3FB8 C;  3UT5 A;  3CCQ V;  1Q90 D;  2YI8 A;  1AJQ A;  3ZRV A;  4CH5 A;  2BCC H;  2YXH A;  2UXN A;  1NH2 B;  4FFK A;  4O2A B;  2CK3 G;  1K5Q A;  3OEH G;  2QTS A;  4TQD A;  1XNQ O;  1N4C A;  4DV1 O;  3CE2 A;  1FJG O;  3SYP A;  3JCU Z;  1BZK A;  4NXN B;  3AG1 B;  1X59 A;  3PJS K;  3ZX6 A;  1WA8 B;  4AIL C;  1IVS A;  2A79 B;  3K0D A;  3B8N A;  2KSD A;  4PV1 B;  5LGU A;  4DR1 O;  3PN1 A;  1QR9 A;  3BFR A;  4CH3 A;  1KP2 A;  4W4K A;  3A2F A;  5B1N A;  3ZMU A;  5IYZ B;  2DYR B;  4LNU A;  4IYI A;  3KZI Z;  3N2G A;  2RQ6 A;  4RAI A;  3SR2 C;  1V55 C;  5LMU B;  2ZQM A;  3IC7 A;  2ARH A;  4DR6 B;  2JIZ G;  4DR2 O;  4FVM A;  3SYQ A;  2X0L A;  1F23 A;  2EUL A;  4I55 A;  2EIK C;  3D3I A;  3O9O A;  2GBO A;  4YJ2 B;  3IAY A;  5LMN O;  3WB2 A;  2WSS G;  4KP4 A;  3CME V;  3JD1 A;  3T1Y O;  1GM7 A;  2N05 A;  2UUB O;  4F4L A;  1VMG A;  3G80 A;  1I5Y A;  1L0N H;  4A5U B;  4HBN A;  4GLX A;  1NKD A;  1N32 B;  1XL4 A;  1VF5 B;  2QWR B;  3JD2 A;  1JOY A;  1KD1 W;  1PL0 A;  3JD3 A;  3TET A;  1XNQ B;  1JFF B;  3OMN B;  4DV1 B;  3GB7 C;  3HKD A;  2BE3 A;  3FB5 C;  4X62 O;  1OCZ B;  4YIP A;  1PD3 A;  2X6C A;  1OCC C;  4I0X B;  4JYA O;  3JSL A;  2DQ0 A;  4WF9 V;  3ETG A;  5IWA O;  3B40 A;  4TT3 G;  4ZBM A;  3CJH B;  2YXY A;  1GAX A;  2E5L O;  4QJF B;  4DR1 B;  1GN3 A;  3LSQ A;  5L3D A;  4DR4 O;  4RQE A;  4FIP C;  2BTQ A;  1YIT V;  3A0R A;  4FMT A;  2UU9 O;  2H94 A;  1NTM H;  3CMA V;  5L3C A;  3GWO A;  5JH7 A;  5D5P A;  2Q9L A;  2PUS A;  4LF9 O;  3B09 A;  3DXR B;  4J80 A;  4FLX A;  4UVA A;  1XMO O;  5JQG B;  1HWY A;  1VQN V;  4B3R O;  5KAF Z;  4HAM A;  1Q82 W;  4DR2 B;  2P4V A;  1K73 W;  3VQV A;  4YXW G;  5IYB O;  2B9Z A;  3LNM B;  2Q0O C;  4XDJ A;  1R3K C;  4BIO A;  4GKJ O;  1SS3 A;  4GCZ A;  2CDY A;  2LFR A;  2RJZ A;  2XAJ A;  2Q5Z A;  2ZM6 O;  2FTK A;  3ZBH A;  4UCS A;  2P6J A;  1TVK A;  2B1G A;  2ZKO A;  4CS2 A;  2OT5 A;  5LMN B;  1PM9 A;  4FM2 A;  1RSO B;  2JS3 A;  1H2N A;  2Q6A A;  4DV3 O;  3ZRW A;  2ZT9 B;  1M93 A;  3K5O A;  2PI4 A;  4HNA B;  2WLH A;  3N2K A;  1OCR C;  5B5E Z;  5LHG A;  2ZNJ A;  3MD0 A;  2PGG A;  5HFM A;  1VF6 C;  1P7G A;  3AG4 C;  4LFA B;  1GTO A;  4RUE A;  4TOI A;  2CH7 B;  2QWP B;  5EIB D;  1SQB H;  4FLU A;  2Y0I A;  3TCU A;  4LF7 O;  1XBL A;  4X62 B;  1IZ3 A;  4AHC A;  4DV5 O;  3THO A;  2P4K A;  3FAV A;  2Z5U A;  1SZT A;  4LBE C;  2ITC C;  2ZD9 A;  4P9O A;  4JYA B;  5EBM C;  1IBL O;  4WFH A;  4EKW A;  2R9R B;  2CTP A;  1BL8 A;  5BXZ A;  1SET A;  3HKC A;  4BR6 A;  1NTZ H;  1VQP V;  3JAS A;  3OAA G;  3D3Q A;  4PDV A;  4C7U A;  4Q6G A;  4O4J A;  1KKD A;  4O4L B;  2UU9 B;  1E1Q G;  1S77 D;  3G6B A;  4U7N A;  4F6R A;  2CTQ A;  1EN4 A;  4LF9 B;  3UQ8 A;  4LFC B;  1FXK A;  1SF9 A;  3DGE A;  3AK3 A;  3A0H Z;  1XMO B;  3H1J H;  4Z1M G;  4NB5 A;  4B3R B;  3QG5 A;  4TV9 B;  4X1K B;  3CCE V;  4PI0 A;  4I50 B;  4O2A A;  3CC4 V;  2PYL A;  4OPH A;  2UXB O;  5GON A;  1HW7 A;  1P84 F;  4GKJ B;  1M4U A;  4G2K A;  1ZX3 A;  2JK5 C;  3E35 A;  1Y4M A;  3B2E E;  3UCS C;  1M56 C;  3G71 V;  4K0K O;  3LSS A;  1H8E G;  2IJK A;  2ZIM A;  4DXW A;  3I56 V;  4NXM O;  5LHI A;  4JI2 O;  1WA8 A;  1G1X B;  1OCO B;  1Y74 A;  3SGI A;  1J95 A;  3H9V A;  1OCC B;  1X4T A;  3CSX A;  2Z3Y A;  1JCH A;  3B77 A;  4WFA V;  4ZKI A;  2EBO A;  4JYC A;  2WLK A;  2F1M A;  2CAZ C;  5IYD O;  5J2T A;  1T5E A;  4JAV A;  1J5E O;  3K9S A;  3A8T A;  5B3S C;  5C93 A;  4JTD B;  4QPK A;  4DRX B;  5BZB A;  2EJ7 A;  4TSF G;  3ZMS A;  2C2A A;  4J7Z A;  4X20 A;  1WPB A;  4H13 B;  5KHG A;  1NU1 H;  4YHH O;  1HR0 B;  4LNU B;  5H2F Z;  5H6Q A;  3N2G B;  1RPR A;  5A2Q N;  3QO5 A;  4LR3 A;  2JEU A;  1RP3 B;  2PF4 E;  3LSU A;  4ABM A;  1Z5V A;  4J9Z B;  3H1K H;  1PNK A;  3FD9 A;  1PNM A;  3GVM A;  4X1I A;  3DSQ A;  5LBQ A;  4OXS A;  2LO1 A;  2GHY A;  1XEQ A;  1RPO A;  3LDC A;  2BOC C;  1XNR O;  4I55 B;  3CXC U;  3ZJZ A;  1H2G A;  3OR6 C;  2EJR A;  1VQM V;  1M5I A;  3RN4 A;  1EFR G;  5D5Q A;  2QM7 A;  1OCR B;  2IJI A;  1YI2 V;  3BA8 A;  2F95 B;  4U3F H;  3ZN0 A;  2QA4 V;  1JFF A;  2JGD A;  2OYQ A;  1XRE A;  2YS8 A;  5EYP A;  2IBZ H;  1WLE A;  4PA3 A;  1VIB A;  4JI2 B;  1S5L Z;  1B06 A;  1QVG U;  1D5N A;  1QR8 A;  2UUC O;  1Y76 A;  3AG3 B;  2BOB C;  3AG1 C;  3HKD B;  2IW5 A;  3H01 A;  4FM1 A;  3BY6 A;  4LH7 A;  3TXQ A;  4TUY A;  4LF6 B;  3EFF K;  2XUM A;  5KHH A;  4R50 A;  3SDL A;  2JDI G;  1KUQ A;  4LF4 O;  2VQE O;  2YDE A;  1YCI A;  4YY3 O;  5JQG A;  2Y4T A;  2DYR C;  2O57 A;  4K8X A;  1GMG A;  3U10 A;  2XAQ A;  2Y69 C;  4BWA A;  5KA5 A;  5LP6 B;  2ZIO A;  1PKX A;  3VQW A;  5JH7 B;  1BQ0 A;  2QWN B;  4DR5 O;  3NR7 A;  2ZXW C;  3WB0 A;  3W7X A;  4U7O A;  1R6K A;  1AI5 A;  5IJ0 A;  3G67 A;  2E74 B;  2OWO A;  4MVS A;  1DGS A;  3OTO B;  1M56 B;  3B4S A;  3KCY A;  3OMA B;  5H6R A;  3FYE B;  1W2B U;  2A9H A;  4HZ3 A;  1M57 B;  1TVK B;  4J42 A;  1DLB A;  3FFQ A;  1KU9 A;  3CX5 F;  2NNU A;  1YF2 A;  1VQK V;  3HKB A;  5K1X A;  4IL6 Z;  3ZRW B;  1IX9 A;  3CCJ V;  3QO7 A;  3N2K B;  1Q6U A;  4PA4 A;  1QVF U;  2QWQ B;  3HKE A;  2QM8 A;  3HPL C;  4LP8 A;  3C3T A;  1I94 B;  3D36 A;  2YEV B;  4JI6 B;  1W0K G;  4HYO A;  4QGP A;  2EIJ B;  2XTA A;  3OUF A;  4JI7 O;  3TGU H;  1CPY A;  5KMG A;  2ZIN A;  3FAV B;  1MA1 A;  1VEW A;  1UPG A;  3K06 A;  2JEX A;  3JAT B;  4CC5 A;  1UJW B;  5JVD A;  4GKK O;  4LF4 B;  5DM6 V;  3JCZ A;  3HKC B;  3P30 A;  3SYA A;  3ZMV A;  3ZRS A;  4JI8 O;  4UUJ C;  1OJH A;  4YY3 B;  2CGN A;  5KA6 A;  1FD9 A;  2ZE7 A;  5FNV A;  4O4J B;  4TV9 A;  1BHA A;  1NR7 A;  2XAG A;  3CCM V;  3CCR V;  3FB6 C;  2DQ3 A;  1HNW B;  4F6R B;  4DR5 B;  1FXK B;  1Q43 A;  2V4D A;  3BA9 A;  3BCC H;  1N32 O;  4N23 A;  2NLJ C;  3X2Q B;  1JVM A;  1CP9 A;  1QNM A;  2LGQ A;  3L70 H;  4X8A A;  5GON B;  2V1D A;  2YIC A;  4JGS A;  1AI7 A;  3E8G A;  3FB7 C;  2XAF A;  2HLD G;  2IJJ A;  2WA4 A;  4GYC B;  2KB1 A;  3E86 A;  3K5L A;  4UXN A;  1H2M A;  1GRJ A;  1SA0 B;  4J9Y B;  5EZY A;  1Y74 B;  3F7Y C;  1MMM A;  1L8D A;  1A32 A;  5FL7 G;  2P67 A;  2N04 A;  3TXS A;  1QQC A;  5FLX N;  2EX3 A;  4MVZ A;  4DRX A;  4PD4 F;  4GZR B;  2D3O W;  5B1B C;  4O2B B;  2CE4 A;  2QJ1 A;  1ZLZ A;  3S3W A;  4IIJ B;  5GTI Z;  5J2T B;  2D2C B;  2IM9 A;  2HKO A;  2Y69 B;  1R1B A;  3E8F A;  4FJC C;  4JI7 B;  2BSK B;  1XQ8 A;  4JAU A;  4J7K A;  2ZXW B;  2YI9 A;  3L71 H;  4X20 B;  3AG7 A;  2DJV A;  4DO2 A;  1NR1 A;  4GKK B;  5KLV H;  5A9G A;  1CEZ A;  3RFR A;  3BEH A;  5F2V O;  5DED A;  4UB8 Z;  1KKC A;  3U0Z A;  4JI8 B;  4X1Y A;  3M8A A;  4G27 B;  4X1I B;  3JD0 A;  4X65 O;  3CCL V;  1W0J G;  2QR4 A;  2B1I A;  2YC0 A;  2JJ1 G;  2EIM C;  4LC1 A;  3SJQ C;  2QTO A;  2Q67 A;  3ABM B;  1SER A;  4JV5 B;  2FL4 A;  3JAR B;  4O4H B;  2PYJ A;  1XMQ B;  5B1A B;  1BCC H;  1ZUQ A;  2M7W A;  5KUK A;  1VQ5 V;  3ZHV A;  4NTY A;  3RVZ A;  1THZ A;  4LFA O;  3ETD A;  1QU7 A;  2QKS A;  2JGD B;  3M7M X;  4H37 A;  1TAE A;  2YIB D;  2FYU H;  2JS5 A;  1BHB A;  4PEL A;  1OCO C;  5EYP B;  5H9C A;  4MTF A;  1CXZ B;  2HVK C;  1SZX A;  1F4M A;  1BSM A;  4CS4 A;  2RCV A;  4YIO A;  1SRY A;  2ZNI A;  1Y76 B;  2DWD C;  2JVD A;  4UCR A;  1SKV A;  2KQX A;  2F43 G;  1MSW D;  2MW2 B;  1TA8 A;  4TUY B;  5CA3 A;  2W0F C;  3ZHT A;  4BW5 A;  1ORQ C;  4UCV A;  4DV6 B;  4P30 A;  2AXT Z;  5LP6 A;  2QEX V;  4ZOL B;  1AR5 A;  1EM1 A;  2LJ2 A;  3RVY A;  1K7D A;  4LFC O;  2F23 A;  3EHB B;  1N36 O;  1K9M W;  2OCC B;  1B6Q A;  3OMI B;  4DR3 O;  1BS3 A;  1IXB A;  5L3E A;  1AVM A;  4FFB A;  1P49 A;  4B3S B;  4KUM A;  4QNH B;  1COW G;  2QKC A;  1YZB A;  4WFE A;  4J11 A;  3UO2 A;  4FLT A;  5LA6 A;  2QDO A;  4LWS A;  4D7S A;  5LOV A;  5L3B A;  5IJ0 B;  4XBF A;  3CYO A;  2QE7 G;  1DK1 A;  2LW1 A;  4JF3 A;  1AR1 B;  1KC8 W;  4X65 B;  5CA0 B;  2QKA A;  1LR1 A;  4DV2 B;  4FLV A;  4MS2 A;  3ETQ A;  3WB1 A;  4DUZ B;  2WLN A;  4LF8 B;  2ZE6 A;  4YJ3 A;  3HKB B;  4IGG A;  1TUB B;  1I08 A;  5B1O A;  2YEV A;  3VBB A;  2YXL A;  5B1B B;  1VQ8 V;  3APQ A;  2ZR2 A;  3HKE B;  4N21 A;  4DV7 O;  1H2L A;  1WB7 A;  1PP9 H;  1Y6X A;  2K9P A;  3ABL B;  2IH1 C;  3AG3 C;  2WLL A;  3E22 A;  5CBF A;  3OR7 C;  3JAT A;  3LDE A;  1JJO A;  5LGT A;  1DF5 A;  2GV9 A;  4JI1 B;  4JI5 B;  1HR0 O;  2OCH A;  3T4D A;  5IDJ A;  4I4T A;  5KMG B;  1R73 A;  2ZE5 A;  4MW3 A;  4P9P A;  1ROP A;  3RYF B;  5JVD B;  1U97 A;  3BHP A;  5CBG A;  1G4Y B;  1YTF B;  5IE9 A;  1EN5 A;  1NH2 D;  1N36 B;  3R66 A;  2CTR A;  5LP6 C;  1K8A W;  2EIM B;  3BPZ A;  4DR3 B;  3K03 A;  1Q8I A;  3ML0 A;  5FNV B;  1XUQ A;  1E1R G;  1ZWI C;  1R6T A;  3LNN A;  2H3O A;  3IFX A;  2ZR3 A;  1XHZ A;  4LFB B;  1GKF A;  4DW0 A;  1BMF G;  1GN4 A;  3KCX A;  3E2E A;  1H2S B;  1ZSP A;  2IU3 A;  3IJ4 A;  1MNG A;  4R7C A;  1SA0 A;  2FML A;  3K5N A;  1M57 C;  5CMU A;  4LF5 O;  1VF7 A;  4MSW C;  5IT9 N;  4KXR A;  1PNL A;  1BGY H;  1AB3 A;  4Z1V A;  2FKX A;  1IBK B;  4TV8 B;  1NQT A;  2Q4P A;  3EVK A;  4LF6 O;  4K35 A;  3OT7 A;  4E4E A;  4O2B A;  1NVP B;  2VQF B;  5EZY B;  1H38 A;  1NI8 A;  4LCU C;  4L87 A;  1KQS U;  4H0L B;  4IIJ A;  3CXH F;  1WP8 A;  3OUS A;  5CA1 A;  3RT3 C;  3BRC A;  3SPG A;  5C8Y A;  2DWE C;  2BSK A;  4DV7 B;  2EIJ C;  3T4Z A;  4JZ2 A;  2UXD B;  2EIL C;  1B3Q A;  3ZED A;  3ABK B;  5IYC O;  3OE7 G;  1WP7 A;  1YJN V;  1BE3 H;  2UXC O;  1XOU A;  2JJ2 G;  3OTO O;  5L3G A;  1QBZ A;  4K3A A;  5BY1 A;  4J41 A;  3GWK C;  3CD6 V;  5EIB C;  2EZP A;  4NTW A;  5L3F A;  4X1Y B;  1QCE A;  3JAR A;  3CS5 A;  4O4H A;  1VQ9 V;  4UFZ A;  1JR9 A;  3VQX A;  4DYL A;  1FXK C;  1TUE B;  3ZHQ A;  3AG2 B;  1BT8 A;  3ZRX A;  2DN9 A;  4PA9 A;  2YIA A;  4XDL A;  3X2Q C;  1AJN A;  1MZE A;  1NS1 A;  2ETN A;  5GW7 A;  5GTH Z;  1KYO F;  1JA8 A;  1F51 A;  3UKM A;  4FZ0 A;  4J10 A;  1I94 O;  1R3I C;  2AHY A;  2P90 A;  4JI6 O;  2NN4 A;  4ICG A;  4LF5 B;  2HHH B;  3CHX A;  3MHH C;  3SJB C;  2YID A;  3WG7 B;  4MVQ A;  4IHJ B;  5BR8 B;  2ATK C;  2QWO B;  2WPD G;  4WBN A;  3T2M A;  2M6Y A;  1SQF A;  4E2L A;  3J81 N;  1R3L C;  1D5A A;  2R9A A;  3RYH A;  1LUW A;  4CZZ A;  2PTM A;  1K33 A;  2ZE8 A;  3IGA C;  4GUN A;  3RYI A;  1B04 A;  4ZOL A;  3P32 A;  2OIE A;  3OFN G;  2HJF C;  2B5U A;  5E1A C;  3QNE A;  3DC6 A;  1O9G A;  5J2U A;  1WAZ A;  1HNW O;  4D6T H;  1K34 A;  5FPR A;  4GT1 A;  4X64 O;  1KB9 F;  4RO2 A;  1P7B A;  3E8B A;  3AEI A;  1JJ2 U;  2VWJ A;  1Q86 W;  5B66 Z;  2WA3 A;  2ZDI A;  3HB3 B;  4I9Q A;  3CEI A;  2HFE C;  4FFB B;  3TJT A;  2VWK A;  3L9D A;  1FKA O;  2UXC B;  2A06 H;  1R3J C;  2R70 A;  3UM7 A;  4PA6 A;  3CP1 A;  2YUA A;  3O65 A;  2WLI B;  4LH6 A;  2HP8 A;  5LA6 B;  5CA0 A;  3E8H A;  3FYI B;  4PA7 A;  4PHZ A;  4LWS B;  3K57 A;  1SES A;  4JTA B;  5LOV B;  1KP3 A;  1Y67 A;  3E89 A;  3QF7 A;  3H1I H;  1YJ9 V;  2F66 C;  3ABM C;  1VQ4 V;  4BIZ A;  2WLM A;  3CCV V;  1GO3 F;  1TUB A;  1SQX H;  3HR0 A;  5B1A C;  5ITZ A;  3APO A;  2VRZ A;  3RBZ A;  1N34 B;  3CCU V;  3OM3 B;  2F4V B;  3QVN A;  5E79 Z;  3VOU A;  3OW2 U;  4YJ3 B;  1AJP A;  5KAI Z;  1VQL V;  5KUM A;  2E75 B;  3F5W C;  4MVR A;  4FPP A;  3NXS A;  2HJD A;  2XND G;  4MTX A;  2EIL B;  4EB6 A;  1YEW A;  2ADP A;  3W7W A;  4NVP A;  1Q7Y W;  4ASU G;  1XHX A;  4TWK A;  2WLL B;  3E22 B;  3SPJ A;  3K3W A;  3SYC A;  1YSC A;  3Q4H A;  3RYF A;  3ASO B;  4BAY A;  3IC9 A;  4I4T B;  3W7U A;  4DV0 O;  2P22 C;  1GN2 A;  2X7R B;  2N74 A;  4B7K A;  2L35 A;  1FXH A;  1NBM G;  4W4L A;  4IT5 A;  3P3N A;  1K4D C;  2RNB A;  3FX7 A;  1HNZ O;  4U3J B;  2OCC C;  2Q0A A;  4X64 B;  4JV5 O;  3AK1 A;  3VQY A;  1ENV A;  4OX9 O; 
#chains in the Genus database with same CATH homology
 4NKG B;  2HJD A;  2RMK B;  1URF A;  1US6 A;  4IGG A;  2Q0O C;  1UPG A;  1CXZ B;  1RFY A;  4NB5 A;  4DYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...