2QA4V

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qa4V00
4WF9V 3CCMV 3CCUV 2QEXV 1YJWV 3CCVV 1QVGU 4WCEV 1YI2V 3G4SV 3I56V 5DM6V 3CMAV 3CCRV 1N8RW 1M1KW 1YITV 3CCLV 1S72V 1KC8W 1VQ9V 3CCQV 4WFAV 3CD6V 1Q86W 3CCEV 3CCJV 1W2BU 1K73W 1K9MW 2D3OW 1M90W 3CMEV 1VQLV 3CC7V 3CC4V 1VQOV 1K8AW 1YJ9V 2OTJV 1YJNV 1KQSU 1VQPV 1VQ6V 3CXCU 1JJ2U 1QVFU 1Q7YW 1Q82W 1VQ5V 2OTLV 1Q81W 1YHQV 3G71V 3CCSV 1YIJV 3I55V 4WFBV 3CC2V 2QA4V 1VQKV 1VQ8V 3G6EV 3CPWU 1VQMV 1VQ4V 1NJIW 1VQ7V 1R73A 1KD1W 1VQNV 3OW2U
chains in the Genus database with same CATH superfamily
4KFMA 2P7TC 2NLJC 4EEQA 5E79Z 4I55B 3P32A 1MZFA 4LBEC 4JI3O 2DE0X 1BL8A 1GM7A 4NR1A 1YCIA 1F4MA 2QM4A 5LGNA 4EB6A 3W7SA 1BHBA 3E8HA 4DV5B 1L1FA 2H8PC 4J41A 3GB7C 2JJ1G 3OW2U 2ZDIC 2LW1A 4GCZA 2VQEO 4YHHB 4I9QA 2W0FC 4OXSA 4JYAO 5DM6V 1NVPB 2AZ0A 3AK3A 4DUYO 3SJQC 2R9IA 4MTFA 3RWRD 4JAUA 2ARHA 2EBOA 4B3MO 3ZRWB 2OTLV 2L6LA 3CCSV 1YXBA 3OEHG 1AJNA 2DYSB 2DOSA 4PDMA 4LF7B 2Y69C 3TXSA 4OPAA 1LUVA 4GX0A 1VP7A 1UPGA 1R3KC 1M4UA 4UCTA 4TQFA 2XHBA 3CMEV 4FK5C 3ETEA 3LSUA 2WA3A 4DUZB 5JJEB 1IZ3A 1R3IC 2KG7B 1WPXA 4MVQA 3H01A 1BGYH 1XBLA 4X1YB 3CEIA 4UV9A 2BE3A 5H5NA 1AI4A 2UXBO 5J2TA 1YITV 3CD6V 2VQFO 1G6UA 4YIPA 1EZVH 3AG4C 5IE9A 1MG1A 1N0JA 5LHHA 2OTJV 5CB4B 3KG2A 2E76B 4CS4A 2UUCO 1P84F 3B8NA 3ZRWA 3CC2V 3W7XA 4QNHB 4B08A 2PYLA 4DR5O 3VQVA 3T2MA 3L74H 5JCOA 3IJ4A 2IJJA 2QGNA 5A2QN 2PF4E 2F43G 1NU1H 4Q20A 5CA1A 3E8GA 1IBMB 5LA6B 1VQ6V 4JI2O 1HNXB 4MS2A 3RYIA 2Q69A 4DR1B 5LYJA 3AG2C 3T1CA 1KB9F 4NVPA 4RQFA 4UVAA 4DRXA 1T5EA 3ABLC 2XAGA 2CH7B 1QBZA 4ZKIA 1KMIZ 4FFBB 1P7BA 5JVDB 1R6TA 4CC6A 2UU9O 3K03A 3K9AA 5KUKA 5EYPA 1NT2B 2MW2B 1Y4MA 2EX3A 3RT3C 3ICXA 3K9SA 3BY6A 4H44B 1GM8A 3LNMB 2YS8A 1H2KA 3AG7A 5JJJB 5GTHZ 4LH7A 3JARA 3H1KH 1FAFA 3OM3B 5B1OA 2PTMA 3UQ8A 3KKYA 1NI8A 2KKWA 3OGCC 5CA3A 3SYQA 3T4DA 3C3TA 1E1QG 3SPIA 4LFAB 1TGOA 1NBMG 2ODMA 5J2UB 1GRJA 4AHCA 3ABMB 2OIGA 3H1IH 1FXKA 4CH5A 2B1IA 3P3NA 3FB6C 1MSDA 2HLDG 2DMXA 4UXNA 3CC4V 3STLC 1DTOA 1EN5A 3HB3B 1KBHA 2B9ZA 3BA8A 1NH2D 5LP6B 1GMGA 1VF6C 4JI3B 4LF4B 3SGIA 2EILB 1XMOB 3HKDB 2UUBB 1VQ9V 1SS3A 3RGBA 4K3AA 2Q7GA 2EILC 4DV4O 2EIMC 2BOBC 1ZL8A 3JAKA 1Y76B 3OMAB 5LP6C 3R66A 4UV8A 3DXRA 4LP8A 4F6RA 2F1MA 4PA6A 4B3MB 2X7RB 3O9OA 4MSWC 4JI1O 1Q8IA 4O4JB 3OR7C 5B1BC 2YXLA 2KB1A 3JASA 3T1HB 1Q5OA 5KMGA 4LH6A 4WFEA 2K1EA 4DUZO 3JSLA 2ITCC 4TSFG 2W0XA 3DXRB 3CE2A 1EN6A 1QR8A 4DR7B 1AI7A 4O4IA 2GTSA 2X6AA 1ZTEA 4R6ZA 1K4DC 4UCOA 1BMFG 4LNUA 3MHSC 3JD4A 3F5WC 1JPXA 1QNMA 2LFRA 4JF3A 4X65O 1XNQB 2Y48A 1V54B 4FM1A 5GONB 2NNUA 3O65A 2LGWA 4A5UB 1HNXO 1VARA 1US6A 2GUZB 2YI8A 3PN1A 3K59A 2P67A 2JVDA 1IBLO 3QNEA 1EBOA 5H6QA 1U96A 5J2UA 4JYCA 4K8XA 4GX1A 2EIKC 3U10A 1Q6HA 2QWQB 3HKBA 2HVKC 5IYZB 4E2LA 2P06A 3T1YO 2DN9A 4WFFA 3BA9A 1DLBA 1AI6A 3K5OA 1OCZC 3ZRSA 4G2KA 1FFXA 2ZIOA 3M99B 4MW8A 4JAVA 3ZHSA 5KA5A 2MK3A 1FXHA 4R50A 2EZPA 4HNAA 1M9NA 4W4KA 2X0LA 4JYBA 2A79B 1WP7A 1WPBA 3MAQA 5LA6A 2WLIB 5KHGA 1M57B 1WB7A 2QJ1A 3KCXA 4N21A 5BY1A 1FD9A 3I56V 4GT1A 2UXCB 2A06H 4UB8Z 3H9VA 1S5HC 2HG5C 2DQ3A 5B3SC 4WFGA 4IYIA 1BSMA 4Z1MG 3JATA 1P4RA 4PI0A 1QLEB 3JD3A 3JALB 1OCOC 2Y4UA 2H94A 3CCRV 2BSKA 5A9GA 4P30A 5FNVB 4W4LA 1IURA 4DXWA 5LL6Y 3F5TA 1FFTB 2ITDC 2E3CA 2EIJB 5E1AC 4JTDB 4JI0B 4B7EA 1SA0A 2M7WA 2R70A 1SQPH 3P3PA 3B8MA 1I5XA 2WLIA 1J5EB 4FM2A 4ASUG 4J80A 1VF7A 1WAZA 4GKJB 3LDCA 4IL6Z 1XMQB 3IGAC 2CE4A 1L0NH 1K8AW 1Z2GA 4FLVA 1JR9A 4G27B 1KU9A 1YTFB 2EZOA 3UKMA 3OGIB 4NTYA 2Y0IA 5GW7A 2ATKC 4UCVA 1JMKC 3VOUA 3HKBB 2OCHA 3EVKA 2PUSA 3A2FA 2P4KA 4DR5B 2ILMA 3E83A 1Q6UA 3CCEV 2WA4A 1YF2A 4JI8O 2JEXA 2QR4A 3H1HH 4PA7A 4X1KB 3IFXA 3ZMUA 2DYRC 3L73H 3P30A 1K7DA 1N33O 4DR2O 4XBFA 2BTOA 5KUMA 2IH1C 3K0GA 3K5NA 5B66Z 2ZXWC 1M93A 1H8HG 3WG7B 3DGEA 4NTXA 2EJ7A 4LF6O 4JI5B 2DYSC 3CJHB 4X8AA 3PJSK 1DK1A 4LF5B 1Q90D 1R6NA 1QQCA 1FFXB 1LNQA 4YJ3B 3B2EE 3ZS8C 3RFRA 1VMGA 4GLXA 5ITZA 3JAWB 1V54C 1F7YA 1AJQA 2D3OW 5KMGB 4J42A 3EHBB 3MDSA 4WBNA 3OUFA 2N05A 2N74A 4LF8O 4F6EA 3BRCA 3ZHTA 4IYHA 4B3TB 3VBBA 1ZLZA 1XQ8A 1ZX3A 1HW7A 5D5QA 3N2KA 4LFAO 2OIEA 4DV3B 3UCSC 2ZR2A 5K1PA 2QTOA 3G67A 4K0KB 3SJBC 3E86A 4H0LB 4LF9B 4MVSA 4ZBMA 5B1BB 2WLMA 3FB5C 1PM9A 3CXHF 3F7YC 3K06A 3CYOA 1NZ6A 5J9PC 2Q4PA 1SRYA 1GN4A 3VQWA 3WB2A 5KHJA 1VEWA 4IIJA 3QF7A 2O57A 1M56C 2CK3G 2CTPA 3SJCC 5KA6A 2R9RB 3K58A 1THZA 1MABG 1WN7A 3QG5A 3AG3C 2Q0OC 3JASB 1S76D 4WF9V 2QE7G 3JCUZ 2WLKA 3OMNB 2F93B 4FM0A 4AILC 4KHPO 2B5UA 1XDCA 3M7MX 5IJ0A 3A8TA 3KCYA 3CC7V 4QGPA 4TV8B 1GN6A 1K34A 5EZYA 1P49A 2BTQB 2WPDG 2BCCH 3THOA 4RO2A 3C3SA 2WAMA 1JFFB 1Y6XA 1BZKA 4TOIA 1YZBA 2ZD9A 3WU2Z 1S5JA 4CH4A 5EYPB 3OTOO 5L3FA 4X89A 2ZE7A 4Z2WA 4MTXA 4NB5A 1K9MW 1BCCH 1ZL8B 3JAKB 4JI1B 3UO2A 1V55B 3OEEG 2ZT9B 5IWAO 3D36A 2PYJA 4IHJA 4EFBA 2VWJA 2PY5A 4KUMA 2ZINA 2QA4V 1DGSA 4JYYA 2E5LO 3Q4HB 5C8YB 5CMUA 2OCCB 1M56B 2VQEB 2JDIG 1N36O 1RSOA 5KHKA 1Z5WA 1XMQO 5KX5B 3B40A 1E1RG 2FTKA 1OJHA 1FXVA 1SF9A 5JWPA 2BTQA 4TUYB 1V9PA 1SZTA 1ENVA 1XILA 4U7NA 1AR4A 2RJZA 1EM1A 1EN4A 3SPGA 2V1DA 1HNWO 3HKEA 4TWKA 2Q5ZA 1IXMA 2CGOA 2DJVA 3CSXA 1R6KA 1VQPV 5KHIA 3DC5A 4I7ZB 2IJIA 1Q82W 1F51A 1PD3A 1YIJV 1VQKV 4FFBA 2DYRB 2G38A 3RW0A 2UXDO 3TETA 2YUAA 4JASA 1JCHA 2EJRA 2WSSG 4LF4O 2ZKOA 5DEDA 1N34O 2A7WA 1RM1C 2JRIA 5KAFZ 3JD1A 4ABMA 3RYHB 3CB2A 3ZBHA 2CH7A 1ZWIC 2Z3YA 3JAMN 4K0KO 1K92A 3JALA 3ZIAG 4X66B 1Q43A 1M5IA 4J7JA 2CDYA 3OTFA 2QKCA 1TVKB 2QM8A 3BABA 1AJPA 2KQXA 1AR5A 4FLZA 4PELA 2A9HA 4RAIA 2YXYA 1XOUA 1K73W 1SQQH 3U0ZA 1ZUQA 5LBQA 4LFBO 3FFQA 4TQDA 1S77D 5LMNB 1J5EO 3LUTB 5EK0A 3RYCB 1HNZB 3J81N 1HR0O 3I5DA 3CCUV 2R72A 2CTQA 3BAAA 4WCEV 1YI2V 2JEUA 5EIBC 1MMMA 4X1YA 4QPJA 5CB4A 2YIBA 2ZE6A 1BQZA 3RYCA 4X62O 4I55A 3GWOA 2YICA 4JI4B 3CJHA 1QLEC 1XUQA 5JH7B 2YIBD 1N4CA 1B3QA 2CTRA 3N27A 2RCVA 3D3QA 1OV9A 5BR8O 1E79G 2Q67A 1R3JC 4DV5O 1YTFD 2RDCA 3SPCA 4B3RO 4J7ZA 1TAEA 1AROP 2ZQMA 2BSKB 4DR6B 1AB3A 2HHHB 4E4EA 3RYHA 4NTWA 4U3FH 1NJIW 2YIAA 3BEHA 1N0NA 4X88A 4H13B 3T1YB 5HFLA 4UUJC 3GWKC 1H2MA 5L3DA 5IT9N 2RN9A 1JJ2U 5KLVH 4HNAB 3FB7C 2V4DA 4FPPA 1VQ5V 4AI8A 1BE3H 1IX9A 3CCMV 1H38A 5JCOC 2AZ2A 1HR0B 4PJ0Z 1S0VA 1Q6IA 2XT9A 2HJDA 1KP2A 2LJ2A 1HNZO 1ZSPA 2ZE8A 3HKCB 5CN0A 2HP8A 4Q6GA 4C7UA 4BAYA 3ETGA 1OCRB 3CRQA 1COWG 3CRMA 4MVOA 4TUYA 5BZBA 2EINB 3L75H 2V7QG 4I50B 3QVNA 2XAFA 3CMAV 1OCCC 4GKJO 3KZIZ 2LQTA 2IJKA 3BVOA 5B1NA 5KX5A 2P22C 4YJ2A 2YC0A 5IJ9B 4IHJB 4X20A 2Z5UA 1PNMA 5TISZ 2JIZG 3W7TA 3ZMVA 3CX5F 1D2DA 3RN4A 2LO1A 3RYFA 3K04A 3E22A 5L3BA 1A32A 5LHGA 5GONA 3FD9A 4QPKA 1H2GA 3ASNC 3ABUA 3OT7A 2Q7HA 3N2GB 3S3XA 4UVBA 4X64B 2Q9LA 3FB8C 4TV8A 1VQ4V 1K5SA 5LOVA 1NKDA 1FPOA 1FYJA 1NTKH 1R3LC 5LGTA 4DK0A 4J9YB 4I9WA 2XAJA 4UB6Z 2PI4A 4BW9A 4J10A 1PL0A 3SPJA 1QVFU 3DSQA 4X66O 4P9PA 3G6EV 3CPWU 2VRZA 1YHQV 4L87A 5BMVA 3J80N 2JS3A 1RSOB 1JX9A 3ZHUA 1FJGO 3QO8A 3HKDA 1DF5A 2JS5A 4FLYA 5DECA 5C8YA 4FLTA 1OCCB 1Y67A 2QWRB 5LP6A 1Q7YW 4PA9A 1MZEA 3ETQA 5AG2A 5LYJB 2ETNA 2JGDB 4YXWG 1ROPA 2EIMB 5EIBD 2HR3A 5CBGA 4FLWA 4LNUB 1TA8A 2QWOB 2AXTZ 2WWWA 1WNSA 4WFAV 2HKOA 3QTCA 4RUFA 3IC7A 5HFMA 3A0HZ 1XMOO 1XEQA 2CGNA 3OFNG 2W6IG 3X2QB 2AHYA 4OX9O 4JI4O 4JAAA 2Y0PA 1IBKB 4X1IB 2C2AA 3ETDA 1YDXA 2IM9A 2QWNB 2FKXA 3JARB 1UFIA 4B3SO 3MD0A 4D7TA 1N8RW 2UXXA 3S3WA 3ASNB 1Y74A 2PI5A 1QLNA 4DV7B 3BPZA 1HDJA 4IT5A 5CBFA 4JV5O 4YJ3A 4HYOA 2F66C 1XREA 2QEXV 4DV6B 4UCRA 1NQTA 1SQFA 1U97A 4IIJB 2EULA 3FYEB 1WA8B 4O4HA 3ZRVA 2Q68A 2FL4A 2WLNA 3RBZA 3FKSG 1BHAA 4DW1A 1ZAUA 4X1KA 3ABLB 1QU7A 1KC8W 1NR1A 1FXKB 4I50A 4BR6A 3STZC 1Q3EA 4OGQB 4ZHQA 1RP3B 3ZMSA 4BIUA 3W7UA 4JV5B 2R9AA 4J9ZB 1VQ8V 4DV2B 4EFEA 2ZDIA 1GN3A 5EBWC 4DW0A 4FFKA 4DV6O 4DR2B 2M6YA 1H2NA 4UCUA 4D7SA 4LWSA 5K1XA 2QWPB 2A3QA 4H33A 1VQLV 4QJFB 1XI1A 3ML0A 4PA3A 4MW3A 1NR7A 3L9DA 3K0DA 5J2TB 3TJTA 4WFHA 1CPYA 4CH6A 5KAIZ 3B09A 4PDVA 2CUGA 1MNGA 1YSCA 1KECA 2GV9A 2VWKA 4JPRA 4X9QA 1K33A 4PD4F 3M8AA 5EC1C 1JJOA 2XUMA 4ZI7A 1FJGB 4BWAA 1NTZH 2LW7A 1QR9A 1RM1B 3ZRXA 3DTUB 4PHZA 4LWSB 2E5LB 3WB0A 5IYCO 2AHZA 1W0JG 4JTAB 1NS1A 2IU3A 3CCLV 2HEPA 1N32B 3TCUA 4OPHA 2Y69B 4LF9O 1B04A 4JGSA 2EIJC 4DV0O 1SQXH 2QSAA 3K5MA 1G4YB 4Z1VA 4B3SB 4RUEA 4N23A 4GKKO 2RNBA 1SA0B 2AGAA 5IY5C 3ABKC 3A0RA 1VIBA 4BIOA 2PZSA 4UFZA 1KKDA 4ZOLA 5IYZA 4LF7O 4X65B 1XNQO 3LSSA 1H2SB 4KP4A 1Z5VA 4G28B 2FYUH 1Y74B 3ASOC 4JI5O 1PKXA 1AVMA 4JI8B 3LSQA 1TUBA 2GSMB 5EBLC 1IBKO 2JJ2G 4L8JA 3A0BZ 3CRAA 4ZHQB 4RWUA 1FKAO 5LMUO 3BHPA 1IXBA 4DR4B 1PPJH 5FLXN 1PL4A 3CCVV 4DO2A 3RVZA 3E8FA 1MA1A 1N32O 1O9HA 1JVMA 3HR0A 3X2QC 2P90A 3ZMZA 4NYKA 1G1XB 2FB5A 1HP8A 1KD1W 4HAMA 2VS0A 1WA8A 3K3WA 1XNRO 3ZHQA 1FXKC 1QVGU 2E75B 3JCZA 3NR7A 1W2BU 5EZYB 4MT8A 4K35A 4GKKB 2XTAA 2QTSA 1K3EA 3RVYA 1VF6A 1SC5B 4X64O 3AG1C 2H3OA 3FX7A 3MHHC 4DR6O 2JK5C 2GBOA 4LFCB 4NXNO 4I4TA 2Q8VA 2K9PA 2Q73A 4O4LA 2RMKB 2GHYA 1XHZA 4B3RB 2LP7A 4MTOA 2XASA 4DR3O 4GX5A 4CZZA 1V55C 2Y4TA 1N36B 1AR1B 2JGDA 3BCCH 4I5SA 2N04A 3BFRA 4J11A 1AI5A 4NKGB 3ZN1A 5EC2C 4YY3B 3ZMTA 3T1HO 3VQYA 3H1JH 5B1AC 1ORQC 4CS2A 4FJCC 2LFSA 5BXZA 1GM9A 1XNRB 2ADQB 5LHIA 1BS3A 4MTGA 5FL7G 1SKVA 4BIZA 1P7GA 3OR6C 1M90W 4DK1A 2YDEA 5JQGA 1GK9A 4KL1A 4O4IB 5H9CA 4GUNA 2BOCC 2KSDA 1W59A 2LGQA 3JD0A 4O2AB 3D3IA 5FPRA 1JA8A 4U7OA 2PGGA 4MVZA 1N34B 4DR7O 2HVJC 1N33B 3JYCA 5IJ0B 3W7WA 3E35A 4XDLA 4LFBB 1MSWD 1TUBB 1WLEA 4I4TB 1SQGA 3C90A 4PI2A 4DR3B 4O4JA 1SESA 1I94O 4WBNB 1OZ0A 3WG7C 1VQOV 1WB8A 1UJWB 4JZGA 2F4VB 1NTMH 4XDJA 1L0LH 2D2CB 1S3JA 3JAWA 5ITZB 4TT3G 4GYCB 4FIPC 4P9OA 1Y76A 3N2KB 5GTIZ 3K08A 5IYBO 2DWEC 4PV1B 1RFYA 1SZXA 1M1KW 2XAQA 2EINC 4RQEA 1S72V 3ZJZA 1Q86W 1OCRC 5LOVB 3FYIB 4CC5A 2IJHA 4DV1O 3U11A 2GTAA 3CRRA 3J7AU 4DV0B 5IJ9A 4TV9B 1GAXA 3TXQA 1GN2A 1I7FA 4PA4A 1YJ9V 1SERA 1G8MA 5IY5B 3RYFB 1AP6A 3UT5B 2UXCO 2CAZC 1J95A 1WJZA 4QE9A 1JOYA 2UUBO 1PNLA 1URFA 3OUSA 5LXTB 3SR2C 2F23A 3LDDA 5EBMC 5IYDO 3SYPA 4HZ3A 3ABTA 3B77A 4FZ0A 3APOA 3OD4A 2Q6AA 3DC6A 4ZIBA 3D8CA 4U3JB 2IU0A 4DV4B 3NXSA 1SETA 3CRCA 5H6RA 5L3GA 2VQFB 4ZOLB 3CHXA 4FMTA 3OE7G 1TUEB 1KQSU 1X59A 2KG7A 3UM7A 2ZXWB 1IBMO 4JI6O 5JH7A 1H8EG 4BW5A 2UXNA 2UXDB 1PP9H 1QHTA 3SDLA 4DR1O 4O2BB 4DRXB 1IBLB 2RQ6A 4I0XB 3SYCA 4GX2A 1FS0G 1YJNV 1HWYA 3QO5A 2YEVA 4GZRB 1I5YA 2IH3C 1L8DA 4JI7O 3IC9A 5L3EA 1AILA 1KKCA 4XDKA 2B1GA 2Z0AA 3AG4B 4EKWA 3JATB 2ZCEA 2L35A 3E2EA 4LC1A 3K5LA 2NN4A 4B7KA 4DV1B 2AW9A 1NH2B 1DF4A 2FMLA 5DN6G 2QKAA 4PDRA 4R7CA 4KHPB 3ZN0A 3SYAA 1WP8A 3H1LH 3JD2A 3SPHA 2XNDG 2CTWA 1EFRG 1RPRA 1LUWA 2EIKB 2YIDA 1SQVH 1OHHG 3ZCCA 3QO7A 5LMNO 2YEVB 5IWAB 1XL6A 4I0XA 1O9GA 1GO3F 3L70H 1BT8A 3CXCU 4D6TH 3OAAG 2W6JG 1OCOB 4WFBV 2OYQA 2YXHA 4FZ1A 4JI6B 1R73A 1YEWA 2DW4A 5C93A 5FNVA 4MVRA 5B3SB 1I0HA 2P4VA 1GH6A 4LF5O 4PDLA 4QIWF 3EXAA 3R65A 4KXRA 3E8BA 2WLHA 4DV3O 1H2LA 1I08A 4FLUA 1S5LZ 4DV2O 4IGGA 5H2FZ 4U3JA 1I94B 3G6BA 1F23A 2ADPA 3CS5A 1AP5A 3T4ZA 1M57C 3UT5A 3F7VC 2E74B 5LGUA 2HJFC 2DWDC 3CCQV 4JI7B 4FLXA 5CA0B 1TVKA 4JI2B 2WLJA 2F4VO 1XL4A 3OMIB 3B4SA 2Q7EA 4EB6B 1OCZB 2GUZA 4O4HB 1VQ7V 3Q4HA 4JTCB 3FAVB 3LNNA 1JQ0A 2XOKG 4TV9A 1X4TA 4NXMB 3G4SV 4MVUA 4O2BA 3K57A 1IVSA 4DUYB 4OX9B 1PV0A 3SJAC 2ZNIA 4O4LB 1PNKA 3L71H 5BMVB 3AK2A 1GTOA 1GKFA 3HKEB 1KP3A 3LDEA 2OT5A 4DV7O 3AEIA 4H37A 4UVCA 4F6RB 4CH3A 3WB1A 2QKSA 1CXZB 5JJNB 1D5NA 1MOFA 4JZ2A 3IAYA 1SQBH 2WLLB 5LXTA 5L3CA 1CEZA 4YIOA 3CWBH 3OTOB 4JYAB 3ZHVA 4LFCO 4NXNB 5CBHA 4X1IA 4NXMO 4O2AA 2YSUB 3N2GA 1D5AA 2GDSA 1CP9A 3E89A 2P6JA 2UXBB 1XHXA 5JQGB 4LF6B 5KHHA 4MVMA 4K8ZA 1JFFA 2WLLA 3E22B 2JGUA 2UUCB 2X6BA 4LCUC 5D5PA 3WFVA 4LF8B 4R8CA 5IDJA 2UUAO 2IW5A 4DR4O 4LR3A 1LR1A 1B06A 2OCCC 3K79A 4FVMA 3EFFK 3GVMA 5B1AB 3G80A 4X62B 3D36C 4B3TO 3I55V 5BR8B 4AQYB 1VQNV 2F95B 2QM7A 4QE7A 3AK1A 3HKCA 4DYLA 1KYOF 2YI9A 4P2ZA 2DQ0A 1HNWB 3UO3A 1B6QA 3FAVA 4JI0O 4YHHO 5F2VO 3SYOA 2ZM6B 3AG1B 3G71V 5LMUB 1W0KG 3HPLC 2HHHO 1BQ0A 4HBNA 1VQMV 3ABMC 4UCSA 5CA0A 1YJWV 3ZEDA 1RPOA 3JSNA 2IBZH 1QCEA 2A0LA 1K5QA 3L72H 1F4NA 3TK1A 5JVDA 5FPOA 3APQA 1VF5B 4J7KA 3ASOB 3TGUH 2ZIMA 3AG3B 2X6CA 2UU9B 3ZHRA 1K97A 4X20B 4AQYO 4YJ2B 2P5OA 2ZR3A 1EZJA 3ABKB 4F4LA 5B5EZ 1R1BA 3RYIB 2HFEC 2Q0AA 1NVPD 3CCJV 5CA1B 4ZI7B 3ZX6A 2ZM6O 1Y66A 2OWOA 2QDOA 1KUQA 2UUAB 4CBCA 2ZE5A 2XAHA 4ICGA 1IDSA 1Q81W 3CP1A 1YVWA 2ZNJA 3VQXA 4CS3A 1K4CC 4YY3O 2NR5A 3AG2B
chains in the Genus database with same CATH topology
2HVJC 2JIZG 4KFMA 3VOUA 3W7TA 3JYCA 2P7TC 3ZMVA 2NLJC 3W7WA 3E35A 4XDLA 1MSWD 1WLEA 3K04A 5L3BA 5LHGA 3P32A 3E83A 1SESA 4LBEC 4QPKA 3CCEV 1H2GA 1BL8A 1GM7A 1OZ0A 3WG7C 1VQOV 1F4MA 2JEXA 3ASNC 3ABUA 1UJWB 4XDJA 5LGNA 4PA7A 1S3JA 4UVBA 3W7SA 1BHBA 3E8HA 4TT3G 4FIPC 4P9OA 3IFXA 1L1FA 3ZMUA 2H8PC 3FB8C 1VQ4V 3GB7C 2DYRC 2JJ1G 3K08A 1K5SA 2ZDIC 2DWEC 3P30A 5IYBO 1K7DA 1NKDA 3OW2U 4GCZA 4XBFA 2W0FC 1R3LC 5LGTA 4OXSA 5DM6V 1NVPB 2XAQA 5KUMA 2IH1C 3K0GA 2EINC 4RQEA 1S72V 2ZXWC 3ZJZA 3SJQC 4J9YB 1Q86W 1OCRC 3FYIB 1H8HG 4I9WA 2IJHA 3WG7B 2XAJA 2R9IA 4MTFA 2PI4A 3DGEA 4JAUA 2EBOA 1PL0A 3SPJA 2DYSC 3ZRWB 1QVFU 4X8AA 2OTLV 3PJSK 3CCSV 3OEHG 1AJNA 2DYSB 4P9PA 3G6EV 3CPWU 4PDMA 1R6NA 1YHQV 2Y69C 4PA4A 1YJ9V 1SERA 4L87A 1LNQA 4GX0A 1G8MA 5IY5B 1JX9A 1R3KC 3QO8A 1DF5A 1V54C 1AJQA 2D3OW 1J95A 3CMEV 4FK5C 4QE9A 1JOYA 3EHBB 3ETEA 1PNLA 3OUFA 3OUSA 1OCCB 5IYDO 1R3IC 3LDDA 5EBMC 1Q7YW 3SYPA 1WPXA 4MVQA 4HZ3A 3H01A 3ABTA 4PA9A 3VBBA 3B77A 2Q6AA 4YXWG 1ROPA 2EIMB 2HR3A 5CBGA 4UV9A 2IU0A 2ZR2A 1AI4A 3NXSA 1SETA 1YITV 2QTOA 5H6RA 2WWWA 4WFAV 5L3GA 3CD6V 2HKOA 3AG4C 4RUFA 1MG1A 5LHHA 3IC7A 3OE7G 4FMTA 2OTJV 1TUEB 3E86A 5HFMA 1KQSU 4MVSA 3KG2A 4ZBMA 3UM7A 2ZXWB 3OFNG 2W6IG 3X2QB 2AHYA 5B1BB 2WLMA 3FB5C 3B8NA 3ZRWA 3CC2V 3W7XA 4QNHB 1H8EG 3F7YC 3K06A 4BW5A 2C2AA 3ETDA 3CYOA 2UXNA 5J9PC 1SRYA 3T2MA 2IJJA 3MD0A 1N8RW 2UXXA 1M56C 3ASNB 2F43G 2CK3G 4Q20A 2PI5A 3E8GA 4GX2A 3SYCA 1QLNA 1FS0G 1YJNV 1HWYA 3QO5A 2YEVA 1VQ6V 1I5YA 5KA6A 2R9RB 2IH3C 1THZA 4MS2A 1MABG 5CBFA 5L3EA 2Q69A 4HYOA 3AG3C 4XDKA 2B1GA 1S76D 3AG4B 4EKWA 4WF9V 2QE7G 3AG2C 3E2EA 3T1CA 4LC1A 2QEXV 2WLKA 4RQFA 1NQTA 1NH2B 1DF4A 4UVAA 3OMNB 3ABLC 2XAGA 2B5UA 5DN6G 4PDRA 3FYEB 4R7CA 3ZN0A 3CC7V 1QBZA 4ZKIA 3SYAA 1P7BA 1K34A 3SPHA 3JD2A 2Q68A 2XNDG 3K03A 3K9AA 3ZRVA 2WPDG 4RO2A 1EFRG 5KUKA 2WAMA 2WLNA 1RPRA 3FKSG 3RBZA 1BHAA 1Y4MA 3BY6A 2ZD9A 1GM8A 3LNMB 2EIKB 5L3FA 3ABLB 4X89A 1OHHG 3ZCCA 1KC8W 1NR1A 3QO7A 1FXKB 4MTXA 2YEVB 3OM3B 5B1OA 1K9MW 3STZC 1XL6A 1V55B 3OGCC 3OEEG 1GO3F 5CA3A 3SYQA 3T4DA 3CXCU 3ZMSA 1E1QG 3D36A 4BIUA 3OAAG 3W7UA 3SPIA 2W6JG 4KUMA 1OCOB 4WFBV 4J9ZB 2QA4V 1NBMG 1VQ8V 1R73A 5CMUA 2ZDIA 5EBWC 3ABMB 2DW4A 2OCCB 5C93A 1M56B 1FXKA 2B1IA 4MVRA 5B3SB 2JDIG 3FB6C 2HLDG 4H33A 4PDLA 4UXNA 4QIWF 4QJFB 1VQLV 1E1RG 3R65A 3CC4V 3E8BA 2WLHA 3ML0A 4PA3A 1DTOA 3STLC 2FTKA 4MW3A 1NR7A 3HB3B 3K0DA 1NH2D 1FXVA 1GMGA 1M1KW 1F23A 4WFHA 1CPYA 1SZTA 1ENVA 2EILB 3T4ZA 1M57C 4PDVA 3F7VC 4U7NA 1YSCA 1KECA 5LGUA 2HJFC 4JPRA 1VQ9V 1K33A 2DWDC 3CCQV 5EC1C 2EILC 3SPGA 2V1DA 2EIMC 2WLJA 4TWKA 1QR9A 1RM1B 1IXMA 2BOBC 3ZRXA 3DTUB 1R6KA 1VQPV 1XL4A 3OMAB 1Q82W 2IJIA 3OMIB 4UV8A 5IYCO 1F51A 1PD3A 4LP8A 2AHZA 1YIJV 1OCZB 1W0JG 1VQKV 2DYRB 4PA6A 4JTAB 1VQ7V 4JTCB 1JQ0A 3RW0A 2X7RB 2XOKG 4MSWC 3TETA 4JASA 1JCHA 2EJRA 2WSSG 3OR7C 2IU3A 3G4SV 4MVUA 5B1BC 2KB1A 3CCLV 1RM1C 3JD1A 3TCUA 2Y69B 4WFEA 2K1EA 2ITCC 4TSFG 1ZWIC 2Z3YA 1PNKA 1K92A 4JGSA 1QR8A 2EIJC 1GTOA 3ZIAG 1AI7A 1GKFA 2QM8A 2X6AA 1KP3A 1AJPA 3LDEA 4R6ZA 1K4DC 2OT5A 3AEIA 4H37A 4UVCA 4PELA 1G4YB 2A9HA 4RAIA 1BMFG 2QKSA 3MHSC 1K73W 3JD4A 3F5WC 1JPXA 1MOFA 4RUEA 4N23A 5LBQA 2LFRA 4JF3A 2Y48A 1V54B 2WLLB 1S77D 5IY5C 2NNUA 3LUTB 5EK0A 3ABKC 3A0RA 5L3CA 1CEZA 1KKDA 5CBHA 3CCUV 2P67A 4WCEV 2YSUB 1YI2V 2JEUA 3QNEA 3LSSA 1CP9A 4MVZA 1EBOA 3E89A 4KP4A 4QPJA 4G28B 2P6JA 5H6QA 3ASOC 1PKXA 4JYCA 4MVMA 4GX1A 2WLLA 3LSQA 2EIKC 2GSMB 5EBLC 3GWOA 2JJ2G 2X6BA 1QLEC 4LCUC 2HVKC 3WFVA 4E2LA 4R8CA 5IDJA 4WFFA 2IW5A 1DLBA 1AI6A 3CCVV 1OCZC 4DO2A 3RVZA 3E8FA 3ZRSA 1E79G 2Q67A 4G2KA 1R3JC 2OCCC 1YTFD 3M99B 3K79A 4JAVA 4MW8A 1JVMA 3SPCA 5KA5A 2MK3A 1FXHA 3EFFK 5B1AB 4R50A 2EZPA 1AROP 1M9NA 2P90A 2ZQMA 3X2QC 3ZMZA 2X0LA 4JYBA 3I55V 2A79B 2WLIB 1NJIW 1KD1W 1M57B 4HAMA 1VQNV 3K3WA 3BEHA 4N21A 2QM7A 1FXKC 4QE7A 4X88A 1QVGU 5HFLA 3I56V 4GT1A 4P2ZA 2DQ0A 4UUJC 3JCZA 1W2BU 1B6QA 4MT8A 5L3DA 1S5HC 3SYOA 1JJ2U 3AG1B 1K3EA 3G71V 2HG5C 2DQ3A 1W0KG 3HPLC 3RVYA 5B3SC 4WFGA 3AG1C 3FB7C 1VQMV 4FPPA 4Z1MG 1VQ5V 3ABMC 3MHHC 1P4RA 2JK5C 1QLEB 3JD3A 3CCMV 1H38A 1YJWV 1RPOA 1OCOC 1QCEA 2A0LA 1K5QA 2H94A 1S0VA 2GHYA 3CCRV 2LP7A 1F4NA 4P30A 3TK1A 4MTOA 2XASA 1KP2A 4DXWA 4GX5A 3ASOB 4CZZA 1V55C 1AR1B 4I5SA 1FFTB 3AG3B 2ITDC 2EIJB 1AI5A 2X6CA 5E1AC 3ZN1A 1K97A 5EC2C 4JTDB 2M7WA 3ZMTA 5CN0A 5B1AC 1ORQC 2ZR3A 3B8MA 1I5XA 2WLIA 4BAYA 3ETGA 1OCRB 1EZJA 1COWG 3ABKB 4FJCC 4MVOA 4ASUG 4F4LA 2LFSA 1GM9A 2EINB 5BZBA 2V7QG 5LHIA 2HFEC 2XAFA 3CMAV 1OCCC 4MTGA 1NVPD 5FL7G 3LDCA 4BIZA 3CCJV 3IGAC 3OR6C 1M90W 2IJKA 1Y66A 1K8AW 1GK9A 5B1NA 5H9CA 4G27B 4CBCA 2BOCC 2XAHA 1Q81W 1YTFB 2EZOA 3CP1A 3JD0A 3UKMA 3D3IA 2Z5UA 1PNMA 4U7OA 1K4CC 5GW7A 2ATKC 3AG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF9 V;  3CCM V;  3CCU V;  2QEX V;  1YJW V;  3CCV V;  1QVG U;  4WCE V;  1YI2 V;  3G4S V;  3I56 V;  5DM6 V;  3CMA V;  3CCR V;  1N8R W;  1M1K W;  1YIT V;  3CCL V;  1S72 V;  1KC8 W;  1VQ9 V;  3CCQ V;  4WFA V;  3CD6 V;  1Q86 W;  3CCE V;  3CCJ V;  1W2B U;  1K73 W;  1K9M W;  2D3O W;  1M90 W;  3CME V;  1VQL V;  3CC7 V;  3CC4 V;  1VQO V;  1K8A W;  1YJ9 V;  2OTJ V;  1YJN V;  1KQS U;  1VQP V;  1VQ6 V;  3CXC U;  1JJ2 U;  1QVF U;  1Q7Y W;  1Q82 W;  1VQ5 V;  2OTL V;  1Q81 W;  1YHQ V;  3G71 V;  3CCS V;  1YIJ V;  3I55 V;  4WFB V;  3CC2 V;  2QA4 V;  1VQK V;  1VQ8 V;  3G6E V;  3CPW U;  1VQM V;  1VQ4 V;  1NJI W;  1VQ7 V;  1R73 A;  1KD1 W;  1VQN V;  3OW2 U; 
#chains in the Genus database with same CATH topology
 4KFM A;  2P7T C;  2NLJ C;  4EEQ A;  5E79 Z;  4I55 B;  3P32 A;  1MZF A;  4LBE C;  4JI3 O;  2DE0 X;  1BL8 A;  1GM7 A;  4NR1 A;  1YCI A;  1F4M A;  2QM4 A;  5LGN A;  4EB6 A;  3W7S A;  1BHB A;  3E8H A;  4DV5 B;  1L1F A;  2H8P C;  4J41 A;  3GB7 C;  2JJ1 G;  3OW2 U;  2ZDI C;  2LW1 A;  4GCZ A;  2VQE O;  4YHH B;  4I9Q A;  2W0F C;  4OXS A;  4JYA O;  5DM6 V;  1NVP B;  2AZ0 A;  3AK3 A;  4DUY O;  3SJQ C;  2R9I A;  4MTF A;  3RWR D;  4JAU A;  2ARH A;  2EBO A;  4B3M O;  3ZRW B;  2OTL V;  2L6L A;  3CCS V;  1YXB A;  3OEH G;  1AJN A;  2DYS B;  2DOS A;  4PDM A;  4LF7 B;  2Y69 C;  3TXS A;  4OPA A;  1LUV A;  4GX0 A;  1VP7 A;  1UPG A;  1R3K C;  1M4U A;  4UCT A;  4TQF A;  2XHB A;  3CME V;  4FK5 C;  3ETE A;  3LSU A;  2WA3 A;  4DUZ B;  5JJE B;  1IZ3 A;  1R3I C;  2KG7 B;  1WPX A;  4MVQ A;  3H01 A;  1BGY H;  1XBL A;  4X1Y B;  3CEI A;  4UV9 A;  2BE3 A;  5H5N A;  1AI4 A;  2UXB O;  5J2T A;  1YIT V;  3CD6 V;  2VQF O;  1G6U A;  4YIP A;  1EZV H;  3AG4 C;  5IE9 A;  1MG1 A;  1N0J A;  5LHH A;  2OTJ V;  5CB4 B;  3KG2 A;  2E76 B;  4CS4 A;  2UUC O;  1P84 F;  3B8N A;  3ZRW A;  3CC2 V;  3W7X A;  4QNH B;  4B08 A;  2PYL A;  4DR5 O;  3VQV A;  3T2M A;  3L74 H;  5JCO A;  3IJ4 A;  2IJJ A;  2QGN A;  5A2Q N;  2PF4 E;  2F43 G;  1NU1 H;  4Q20 A;  5CA1 A;  3E8G A;  1IBM B;  5LA6 B;  1VQ6 V;  4JI2 O;  1HNX B;  4MS2 A;  3RYI A;  2Q69 A;  4DR1 B;  5LYJ A;  3AG2 C;  3T1C A;  1KB9 F;  4NVP A;  4RQF A;  4UVA A;  4DRX A;  1T5E A;  3ABL C;  2XAG A;  2CH7 B;  1QBZ A;  4ZKI A;  1KMI Z;  4FFB B;  1P7B A;  5JVD B;  1R6T A;  4CC6 A;  2UU9 O;  3K03 A;  3K9A A;  5KUK A;  5EYP A;  1NT2 B;  2MW2 B;  1Y4M A;  2EX3 A;  3RT3 C;  3ICX A;  3K9S A;  3BY6 A;  4H44 B;  1GM8 A;  3LNM B;  2YS8 A;  1H2K A;  3AG7 A;  5JJJ B;  5GTH Z;  4LH7 A;  3JAR A;  3H1K H;  1FAF A;  3OM3 B;  5B1O A;  2PTM A;  3UQ8 A;  3KKY A;  1NI8 A;  2KKW A;  3OGC C;  5CA3 A;  3SYQ A;  3T4D A;  3C3T A;  1E1Q G;  3SPI A;  4LFA B;  1TGO A;  1NBM G;  2ODM A;  5J2U B;  1GRJ A;  4AHC A;  3ABM B;  2OIG A;  3H1I H;  1FXK A;  4CH5 A;  2B1I A;  3P3N A;  3FB6 C;  1MSD A;  2HLD G;  2DMX A;  4UXN A;  3CC4 V;  3STL C;  1DTO A;  1EN5 A;  3HB3 B;  1KBH A;  2B9Z A;  3BA8 A;  1NH2 D;  5LP6 B;  1GMG A;  1VF6 C;  4JI3 B;  4LF4 B;  3SGI A;  2EIL B;  1XMO B;  3HKD B;  2UUB B;  1VQ9 V;  1SS3 A;  3RGB A;  4K3A A;  2Q7G A;  2EIL C;  4DV4 O;  2EIM C;  2BOB C;  1ZL8 A;  3JAK A;  1Y76 B;  3OMA B;  5LP6 C;  3R66 A;  4UV8 A;  3DXR A;  4LP8 A;  4F6R A;  2F1M A;  4PA6 A;  4B3M B;  2X7R B;  3O9O A;  4MSW C;  4JI1 O;  1Q8I A;  4O4J B;  3OR7 C;  5B1B C;  2YXL A;  2KB1 A;  3JAS A;  3T1H B;  1Q5O A;  5KMG A;  4LH6 A;  4WFE A;  2K1E A;  4DUZ O;  3JSL A;  2ITC C;  4TSF G;  2W0X A;  3DXR B;  3CE2 A;  1EN6 A;  1QR8 A;  4DR7 B;  1AI7 A;  4O4I A;  2GTS A;  2X6A A;  1ZTE A;  4R6Z A;  1K4D C;  4UCO A;  1BMF G;  4LNU A;  3MHS C;  3JD4 A;  3F5W C;  1JPX A;  1QNM A;  2LFR A;  4JF3 A;  4X65 O;  1XNQ B;  2Y48 A;  1V54 B;  4FM1 A;  5GON B;  2NNU A;  3O65 A;  2LGW A;  4A5U B;  1HNX O;  1VAR A;  1US6 A;  2GUZ B;  2YI8 A;  3PN1 A;  3K59 A;  2P67 A;  2JVD A;  1IBL O;  3QNE A;  1EBO A;  5H6Q A;  1U96 A;  5J2U A;  4JYC A;  4K8X A;  4GX1 A;  2EIK C;  3U10 A;  1Q6H A;  2QWQ B;  3HKB A;  2HVK C;  5IYZ B;  4E2L A;  2P06 A;  3T1Y O;  2DN9 A;  4WFF A;  3BA9 A;  1DLB A;  1AI6 A;  3K5O A;  1OCZ C;  3ZRS A;  4G2K A;  1FFX A;  2ZIO A;  3M99 B;  4MW8 A;  4JAV A;  3ZHS A;  5KA5 A;  2MK3 A;  1FXH A;  4R50 A;  2EZP A;  4HNA A;  1M9N A;  4W4K A;  2X0L A;  4JYB A;  2A79 B;  1WP7 A;  1WPB A;  3MAQ A;  5LA6 A;  2WLI B;  5KHG A;  1M57 B;  1WB7 A;  2QJ1 A;  3KCX A;  4N21 A;  5BY1 A;  1FD9 A;  3I56 V;  4GT1 A;  2UXC B;  2A06 H;  4UB8 Z;  3H9V A;  1S5H C;  2HG5 C;  2DQ3 A;  5B3S C;  4WFG A;  4IYI A;  1BSM A;  4Z1M G;  3JAT A;  1P4R A;  4PI0 A;  1QLE B;  3JD3 A;  3JAL B;  1OCO C;  2Y4U A;  2H94 A;  3CCR V;  2BSK A;  5A9G A;  4P30 A;  5FNV B;  4W4L A;  1IUR A;  4DXW A;  5LL6 Y;  3F5T A;  1FFT B;  2ITD C;  2E3C A;  2EIJ B;  5E1A C;  4JTD B;  4JI0 B;  4B7E A;  1SA0 A;  2M7W A;  2R70 A;  1SQP H;  3P3P A;  3B8M A;  1I5X A;  2WLI A;  1J5E B;  4FM2 A;  4ASU G;  4J80 A;  1VF7 A;  1WAZ A;  4GKJ B;  3LDC A;  4IL6 Z;  1XMQ B;  3IGA C;  2CE4 A;  1L0N H;  1K8A W;  1Z2G A;  4FLV A;  1JR9 A;  4G27 B;  1KU9 A;  1YTF B;  2EZO A;  3UKM A;  3OGI B;  4NTY A;  2Y0I A;  5GW7 A;  2ATK C;  4UCV A;  1JMK C;  3VOU A;  3HKB B;  2OCH A;  3EVK A;  2PUS A;  3A2F A;  2P4K A;  4DR5 B;  2ILM A;  3E83 A;  1Q6U A;  3CCE V;  2WA4 A;  1YF2 A;  4JI8 O;  2JEX A;  2QR4 A;  3H1H H;  4PA7 A;  4X1K B;  3IFX A;  3ZMU A;  2DYR C;  3L73 H;  3P30 A;  1K7D A;  1N33 O;  4DR2 O;  4XBF A;  2BTO A;  5KUM A;  2IH1 C;  3K0G A;  3K5N A;  5B66 Z;  2ZXW C;  1M93 A;  1H8H G;  3WG7 B;  3DGE A;  4NTX A;  2EJ7 A;  4LF6 O;  4JI5 B;  2DYS C;  3CJH B;  4X8A A;  3PJS K;  1DK1 A;  4LF5 B;  1Q90 D;  1R6N A;  1QQC A;  1FFX B;  1LNQ A;  4YJ3 B;  3B2E E;  3ZS8 C;  3RFR A;  1VMG A;  4GLX A;  5ITZ A;  3JAW B;  1V54 C;  1F7Y A;  1AJQ A;  2D3O W;  5KMG B;  4J42 A;  3EHB B;  3MDS A;  4WBN A;  3OUF A;  2N05 A;  2N74 A;  4LF8 O;  4F6E A;  3BRC A;  3ZHT A;  4IYH A;  4B3T B;  3VBB A;  1ZLZ A;  1XQ8 A;  1ZX3 A;  1HW7 A;  5D5Q A;  3N2K A;  4LFA O;  2OIE A;  4DV3 B;  3UCS C;  2ZR2 A;  5K1P A;  2QTO A;  3G67 A;  4K0K B;  3SJB C;  3E86 A;  4H0L B;  4LF9 B;  4MVS A;  4ZBM A;  5B1B B;  2WLM A;  3FB5 C;  1PM9 A;  3CXH F;  3F7Y C;  3K06 A;  3CYO A;  1NZ6 A;  5J9P C;  2Q4P A;  1SRY A;  1GN4 A;  3VQW A;  3WB2 A;  5KHJ A;  1VEW A;  4IIJ A;  3QF7 A;  2O57 A;  1M56 C;  2CK3 G;  2CTP A;  3SJC C;  5KA6 A;  2R9R B;  3K58 A;  1THZ A;  1MAB G;  1WN7 A;  3QG5 A;  3AG3 C;  2Q0O C;  3JAS B;  1S76 D;  4WF9 V;  2QE7 G;  3JCU Z;  2WLK A;  3OMN B;  2F93 B;  4FM0 A;  4AIL C;  4KHP O;  2B5U A;  1XDC A;  3M7M X;  5IJ0 A;  3A8T A;  3KCY A;  3CC7 V;  4QGP A;  4TV8 B;  1GN6 A;  1K34 A;  5EZY A;  1P49 A;  2BTQ B;  2WPD G;  2BCC H;  3THO A;  4RO2 A;  3C3S A;  2WAM A;  1JFF B;  1Y6X A;  1BZK A;  4TOI A;  1YZB A;  2ZD9 A;  3WU2 Z;  1S5J A;  4CH4 A;  5EYP B;  3OTO O;  5L3F A;  4X89 A;  2ZE7 A;  4Z2W A;  4MTX A;  4NB5 A;  1K9M W;  1BCC H;  1ZL8 B;  3JAK B;  4JI1 B;  3UO2 A;  1V55 B;  3OEE G;  2ZT9 B;  5IWA O;  3D36 A;  2PYJ A;  4IHJ A;  4EFB A;  2VWJ A;  2PY5 A;  4KUM A;  2ZIN A;  2QA4 V;  1DGS A;  4JYY A;  2E5L O;  3Q4H B;  5C8Y B;  5CMU A;  2OCC B;  1M56 B;  2VQE B;  2JDI G;  1N36 O;  1RSO A;  5KHK A;  1Z5W A;  1XMQ O;  5KX5 B;  3B40 A;  1E1R G;  2FTK A;  1OJH A;  1FXV A;  1SF9 A;  5JWP A;  2BTQ A;  4TUY B;  1V9P A;  1SZT A;  1ENV A;  1XIL A;  4U7N A;  1AR4 A;  2RJZ A;  1EM1 A;  1EN4 A;  3SPG A;  2V1D A;  1HNW O;  3HKE A;  4TWK A;  2Q5Z A;  1IXM A;  2CGO A;  2DJV A;  3CSX A;  1R6K A;  1VQP V;  5KHI A;  3DC5 A;  4I7Z B;  2IJI A;  1Q82 W;  1F51 A;  1PD3 A;  1YIJ V;  1VQK V;  4FFB A;  2DYR B;  2G38 A;  3RW0 A;  2UXD O;  3TET A;  2YUA A;  4JAS A;  1JCH A;  2EJR A;  2WSS G;  4LF4 O;  2ZKO A;  5DED A;  1N34 O;  2A7W A;  1RM1 C;  2JRI A;  5KAF Z;  3JD1 A;  4ABM A;  3RYH B;  3CB2 A;  3ZBH A;  2CH7 A;  1ZWI C;  2Z3Y A;  3JAM N;  4K0K O;  1K92 A;  3JAL A;  3ZIA G;  4X66 B;  1Q43 A;  1M5I A;  4J7J A;  2CDY A;  3OTF A;  2QKC A;  1TVK B;  2QM8 A;  3BAB A;  1AJP A;  2KQX A;  1AR5 A;  4FLZ A;  4PEL A;  2A9H A;  4RAI A;  2YXY A;  1XOU A;  1K73 W;  1SQQ H;  3U0Z A;  1ZUQ A;  5LBQ A;  4LFB O;  3FFQ A;  4TQD A;  1S77 D;  5LMN B;  1J5E O;  3LUT B;  5EK0 A;  3RYC B;  1HNZ B;  3J81 N;  1HR0 O;  3I5D A;  3CCU V;  2R72 A;  2CTQ A;  3BAA A;  4WCE V;  1YI2 V;  2JEU A;  5EIB C;  1MMM A;  4X1Y A;  4QPJ A;  5CB4 A;  2YIB A;  2ZE6 A;  1BQZ A;  3RYC A;  4X62 O;  4I55 A;  3GWO A;  2YIC A;  4JI4 B;  3CJH A;  1QLE C;  1XUQ A;  5JH7 B;  2YIB D;  1N4C A;  1B3Q A;  2CTR A;  3N27 A;  2RCV A;  3D3Q A;  1OV9 A;  5BR8 O;  1E79 G;  2Q67 A;  1R3J C;  4DV5 O;  1YTF D;  2RDC A;  3SPC A;  4B3R O;  4J7Z A;  1TAE A;  1ARO P;  2ZQM A;  2BSK B;  4DR6 B;  1AB3 A;  2HHH B;  4E4E A;  3RYH A;  4NTW A;  4U3F H;  1NJI W;  2YIA A;  3BEH A;  1N0N A;  4X88 A;  4H13 B;  3T1Y B;  5HFL A;  4UUJ C;  3GWK C;  1H2M A;  5L3D A;  5IT9 N;  2RN9 A;  1JJ2 U;  5KLV H;  4HNA B;  3FB7 C;  2V4D A;  4FPP A;  1VQ5 V;  4AI8 A;  1BE3 H;  1IX9 A;  3CCM V;  1H38 A;  5JCO C;  2AZ2 A;  1HR0 B;  4PJ0 Z;  1S0V A;  1Q6I A;  2XT9 A;  2HJD A;  1KP2 A;  2LJ2 A;  1HNZ O;  1ZSP A;  2ZE8 A;  3HKC B;  5CN0 A;  2HP8 A;  4Q6G A;  4C7U A;  4BAY A;  3ETG A;  1OCR B;  3CRQ A;  1COW G;  3CRM A;  4MVO A;  4TUY A;  5BZB A;  2EIN B;  3L75 H;  2V7Q G;  4I50 B;  3QVN A;  2XAF A;  3CMA V;  1OCC C;  4GKJ O;  3KZI Z;  2LQT A;  2IJK A;  3BVO A;  5B1N A;  5KX5 A;  2P22 C;  4YJ2 A;  2YC0 A;  5IJ9 B;  4IHJ B;  4X20 A;  2Z5U A;  1PNM A;  5TIS Z;  2JIZ G;  3W7T A;  3ZMV A;  3CX5 F;  1D2D A;  3RN4 A;  2LO1 A;  3RYF A;  3K04 A;  3E22 A;  5L3B A;  1A32 A;  5LHG A;  5GON A;  3FD9 A;  4QPK A;  1H2G A;  3ASN C;  3ABU A;  3OT7 A;  2Q7H A;  3N2G B;  3S3X A;  4UVB A;  4X64 B;  2Q9L A;  3FB8 C;  4TV8 A;  1VQ4 V;  1K5S A;  5LOV A;  1NKD A;  1FPO A;  1FYJ A;  1NTK H;  1R3L C;  5LGT A;  4DK0 A;  4J9Y B;  4I9W A;  2XAJ A;  4UB6 Z;  2PI4 A;  4BW9 A;  4J10 A;  1PL0 A;  3SPJ A;  1QVF U;  3DSQ A;  4X66 O;  4P9P A;  3G6E V;  3CPW U;  2VRZ A;  1YHQ V;  4L87 A;  5BMV A;  3J80 N;  2JS3 A;  1RSO B;  1JX9 A;  3ZHU A;  1FJG O;  3QO8 A;  3HKD A;  1DF5 A;  2JS5 A;  4FLY A;  5DEC A;  5C8Y A;  4FLT A;  1OCC B;  1Y67 A;  2QWR B;  5LP6 A;  1Q7Y W;  4PA9 A;  1MZE A;  3ETQ A;  5AG2 A;  5LYJ B;  2ETN A;  2JGD B;  4YXW G;  1ROP A;  2EIM B;  5EIB D;  2HR3 A;  5CBG A;  4FLW A;  4LNU B;  1TA8 A;  2QWO B;  2AXT Z;  2WWW A;  1WNS A;  4WFA V;  2HKO A;  3QTC A;  4RUF A;  3IC7 A;  5HFM A;  3A0H Z;  1XMO O;  1XEQ A;  2CGN A;  3OFN G;  2W6I G;  3X2Q B;  2AHY A;  4OX9 O;  4JI4 O;  4JAA A;  2Y0P A;  1IBK B;  4X1I B;  2C2A A;  3ETD A;  1YDX A;  2IM9 A;  2QWN B;  2FKX A;  3JAR B;  1UFI A;  4B3S O;  3MD0 A;  4D7T A;  1N8R W;  2UXX A;  3S3W A;  3ASN B;  1Y74 A;  2PI5 A;  1QLN A;  4DV7 B;  3BPZ A;  1HDJ A;  4IT5 A;  5CBF A;  4JV5 O;  4YJ3 A;  4HYO A;  2F66 C;  1XRE A;  2QEX V;  4DV6 B;  4UCR A;  1NQT A;  1SQF A;  1U97 A;  4IIJ B;  2EUL A;  3FYE B;  1WA8 B;  4O4H A;  3ZRV A;  2Q68 A;  2FL4 A;  2WLN A;  3RBZ A;  3FKS G;  1BHA A;  4DW1 A;  1ZAU A;  4X1K A;  3ABL B;  1QU7 A;  1KC8 W;  1NR1 A;  1FXK B;  4I50 A;  4BR6 A;  3STZ C;  1Q3E A;  4OGQ B;  4ZHQ A;  1RP3 B;  3ZMS A;  4BIU A;  3W7U A;  4JV5 B;  2R9A A;  4J9Z B;  1VQ8 V;  4DV2 B;  4EFE A;  2ZDI A;  1GN3 A;  5EBW C;  4DW0 A;  4FFK A;  4DV6 O;  4DR2 B;  2M6Y A;  1H2N A;  4UCU A;  4D7S A;  4LWS A;  5K1X A;  2QWP B;  2A3Q A;  4H33 A;  1VQL V;  4QJF B;  1XI1 A;  3ML0 A;  4PA3 A;  4MW3 A;  1NR7 A;  3L9D A;  3K0D A;  5J2T B;  3TJT A;  4WFH A;  1CPY A;  4CH6 A;  5KAI Z;  3B09 A;  4PDV A;  2CUG A;  1MNG A;  1YSC A;  1KEC A;  2GV9 A;  2VWK A;  4JPR A;  4X9Q A;  1K33 A;  4PD4 F;  3M8A A;  5EC1 C;  1JJO A;  2XUM A;  4ZI7 A;  1FJG B;  4BWA A;  1NTZ H;  2LW7 A;  1QR9 A;  1RM1 B;  3ZRX A;  3DTU B;  4PHZ A;  4LWS B;  2E5L B;  3WB0 A;  5IYC O;  2AHZ A;  1W0J G;  4JTA B;  1NS1 A;  2IU3 A;  3CCL V;  2HEP A;  1N32 B;  3TCU A;  4OPH A;  2Y69 B;  4LF9 O;  1B04 A;  4JGS A;  2EIJ C;  4DV0 O;  1SQX H;  2QSA A;  3K5M A;  1G4Y B;  4Z1V A;  4B3S B;  4RUE A;  4N23 A;  4GKK O;  2RNB A;  1SA0 B;  2AGA A;  5IY5 C;  3ABK C;  3A0R A;  1VIB A;  4BIO A;  2PZS A;  4UFZ A;  1KKD A;  4ZOL A;  5IYZ A;  4LF7 O;  4X65 B;  1XNQ O;  3LSS A;  1H2S B;  4KP4 A;  1Z5V A;  4G28 B;  2FYU H;  1Y74 B;  3ASO C;  4JI5 O;  1PKX A;  1AVM A;  4JI8 B;  3LSQ A;  1TUB A;  2GSM B;  5EBL C;  1IBK O;  2JJ2 G;  4L8J A;  3A0B Z;  3CRA A;  4ZHQ B;  4RWU A;  1FKA O;  5LMU O;  3BHP A;  1IXB A;  4DR4 B;  1PPJ H;  5FLX N;  1PL4 A;  3CCV V;  4DO2 A;  3RVZ A;  3E8F A;  1MA1 A;  1N32 O;  1O9H A;  1JVM A;  3HR0 A;  3X2Q C;  2P90 A;  3ZMZ A;  4NYK A;  1G1X B;  2FB5 A;  1HP8 A;  1KD1 W;  4HAM A;  2VS0 A;  1WA8 A;  3K3W A;  1XNR O;  3ZHQ A;  1FXK C;  1QVG U;  2E75 B;  3JCZ A;  3NR7 A;  1W2B U;  5EZY B;  4MT8 A;  4K35 A;  4GKK B;  2XTA A;  2QTS A;  1K3E A;  3RVY A;  1VF6 A;  1SC5 B;  4X64 O;  3AG1 C;  2H3O A;  3FX7 A;  3MHH C;  4DR6 O;  2JK5 C;  2GBO A;  4LFC B;  4NXN O;  4I4T A;  2Q8V A;  2K9P A;  2Q73 A;  4O4L A;  2RMK B;  2GHY A;  1XHZ A;  4B3R B;  2LP7 A;  4MTO A;  2XAS A;  4DR3 O;  4GX5 A;  4CZZ A;  1V55 C;  2Y4T A;  1N36 B;  1AR1 B;  2JGD A;  3BCC H;  4I5S A;  2N04 A;  3BFR A;  4J11 A;  1AI5 A;  4NKG B;  3ZN1 A;  5EC2 C;  4YY3 B;  3ZMT A;  3T1H O;  3VQY A;  3H1J H;  5B1A C;  1ORQ C;  4CS2 A;  4FJC C;  2LFS A;  5BXZ A;  1GM9 A;  1XNR B;  2ADQ B;  5LHI A;  1BS3 A;  4MTG A;  5FL7 G;  1SKV A;  4BIZ A;  1P7G A;  3OR6 C;  1M90 W;  4DK1 A;  2YDE A;  5JQG A;  1GK9 A;  4KL1 A;  4O4I B;  5H9C A;  4GUN A;  2BOC C;  2KSD A;  1W59 A;  2LGQ A;  3JD0 A;  4O2A B;  3D3I A;  5FPR A;  1JA8 A;  4U7O A;  2PGG A;  4MVZ A;  1N34 B;  4DR7 O;  2HVJ C;  1N33 B;  3JYC A;  5IJ0 B;  3W7W A;  3E35 A;  4XDL A;  4LFB B;  1MSW D;  1TUB B;  1WLE A;  4I4T B;  1SQG A;  3C90 A;  4PI2 A;  4DR3 B;  4O4J A;  1SES A;  1I94 O;  4WBN B;  1OZ0 A;  3WG7 C;  1VQO V;  1WB8 A;  1UJW B;  4JZG A;  2F4V B;  1NTM H;  4XDJ A;  1L0L H;  2D2C B;  1S3J A;  3JAW A;  5ITZ B;  4TT3 G;  4GYC B;  4FIP C;  4P9O A;  1Y76 A;  3N2K B;  5GTI Z;  3K08 A;  5IYB O;  2DWE C;  4PV1 B;  1RFY A;  1SZX A;  1M1K W;  2XAQ A;  2EIN C;  4RQE A;  1S72 V;  3ZJZ A;  1Q86 W;  1OCR C;  5LOV B;  3FYI B;  4CC5 A;  2IJH A;  4DV1 O;  3U11 A;  2GTA A;  3CRR A;  3J7A U;  4DV0 B;  5IJ9 A;  4TV9 B;  1GAX A;  3TXQ A;  1GN2 A;  1I7F A;  4PA4 A;  1YJ9 V;  1SER A;  1G8M A;  5IY5 B;  3RYF B;  1AP6 A;  3UT5 B;  2UXC O;  2CAZ C;  1J95 A;  1WJZ A;  4QE9 A;  1JOY A;  2UUB O;  1PNL A;  1URF A;  3OUS A;  5LXT B;  3SR2 C;  2F23 A;  3LDD A;  5EBM C;  5IYD O;  3SYP A;  4HZ3 A;  3ABT A;  3B77 A;  4FZ0 A;  3APO A;  3OD4 A;  2Q6A A;  3DC6 A;  4ZIB A;  3D8C A;  4U3J B;  2IU0 A;  4DV4 B;  3NXS A;  1SET A;  3CRC A;  5H6R A;  5L3G A;  2VQF B;  4ZOL B;  3CHX A;  4FMT A;  3OE7 G;  1TUE B;  1KQS U;  1X59 A;  2KG7 A;  3UM7 A;  2ZXW B;  1IBM O;  4JI6 O;  5JH7 A;  1H8E G;  4BW5 A;  2UXN A;  2UXD B;  1PP9 H;  1QHT A;  3SDL A;  4DR1 O;  4O2B B;  4DRX B;  1IBL B;  2RQ6 A;  4I0X B;  3SYC A;  4GX2 A;  1FS0 G;  1YJN V;  1HWY A;  3QO5 A;  2YEV A;  4GZR B;  1I5Y A;  2IH3 C;  1L8D A;  4JI7 O;  3IC9 A;  5L3E A;  1AIL A;  1KKC A;  4XDK A;  2B1G A;  2Z0A A;  3AG4 B;  4EKW A;  3JAT B;  2ZCE A;  2L35 A;  3E2E A;  4LC1 A;  3K5L A;  2NN4 A;  4B7K A;  4DV1 B;  2AW9 A;  1NH2 B;  1DF4 A;  2FML A;  5DN6 G;  2QKA A;  4PDR A;  4R7C A;  4KHP B;  3ZN0 A;  3SYA A;  1WP8 A;  3H1L H;  3JD2 A;  3SPH A;  2XND G;  2CTW A;  1EFR G;  1RPR A;  1LUW A;  2EIK B;  2YID A;  1SQV H;  1OHH G;  3ZCC A;  3QO7 A;  5LMN O;  2YEV B;  5IWA B;  1XL6 A;  4I0X A;  1O9G A;  1GO3 F;  3L70 H;  1BT8 A;  3CXC U;  4D6T H;  3OAA G;  2W6J G;  1OCO B;  4WFB V;  2OYQ A;  2YXH A;  4FZ1 A;  4JI6 B;  1R73 A;  1YEW A;  2DW4 A;  5C93 A;  5FNV A;  4MVR A;  5B3S B;  1I0H A;  2P4V A;  1GH6 A;  4LF5 O;  4PDL A;  4QIW F;  3EXA A;  3R65 A;  4KXR A;  3E8B A;  2WLH A;  4DV3 O;  1H2L A;  1I08 A;  4FLU A;  1S5L Z;  4DV2 O;  4IGG A;  5H2F Z;  4U3J A;  1I94 B;  3G6B A;  1F23 A;  2ADP A;  3CS5 A;  1AP5 A;  3T4Z A;  1M57 C;  3UT5 A;  3F7V C;  2E74 B;  5LGU A;  2HJF C;  2DWD C;  3CCQ V;  4JI7 B;  4FLX A;  5CA0 B;  1TVK A;  4JI2 B;  2WLJ A;  2F4V O;  1XL4 A;  3OMI B;  3B4S A;  2Q7E A;  4EB6 B;  1OCZ B;  2GUZ A;  4O4H B;  1VQ7 V;  3Q4H A;  4JTC B;  3FAV B;  3LNN A;  1JQ0 A;  2XOK G;  4TV9 A;  1X4T A;  4NXM B;  3G4S V;  4MVU A;  4O2B A;  3K57 A;  1IVS A;  4DUY B;  4OX9 B;  1PV0 A;  3SJA C;  2ZNI A;  4O4L B;  1PNK A;  3L71 H;  5BMV B;  3AK2 A;  1GTO A;  1GKF A;  3HKE B;  1KP3 A;  3LDE A;  2OT5 A;  4DV7 O;  3AEI A;  4H37 A;  4UVC A;  4F6R B;  4CH3 A;  3WB1 A;  2QKS A;  1CXZ B;  5JJN B;  1D5N A;  1MOF A;  4JZ2 A;  3IAY A;  1SQB H;  2WLL B;  5LXT A;  5L3C A;  1CEZ A;  4YIO A;  3CWB H;  3OTO B;  4JYA B;  3ZHV A;  4LFC O;  4NXN B;  5CBH A;  4X1I A;  4NXM O;  4O2A A;  2YSU B;  3N2G A;  1D5A A;  2GDS A;  1CP9 A;  3E89 A;  2P6J A;  2UXB B;  1XHX A;  5JQG B;  4LF6 B;  5KHH A;  4MVM A;  4K8Z A;  1JFF A;  2WLL A;  3E22 B;  2JGU A;  2UUC B;  2X6B A;  4LCU C;  5D5P A;  3WFV A;  4LF8 B;  4R8C A;  5IDJ A;  2UUA O;  2IW5 A;  4DR4 O;  4LR3 A;  1LR1 A;  1B06 A;  2OCC C;  3K79 A;  4FVM A;  3EFF K;  3GVM A;  5B1A B;  3G80 A;  4X62 B;  3D36 C;  4B3T O;  3I55 V;  5BR8 B;  4AQY B;  1VQN V;  2F95 B;  2QM7 A;  4QE7 A;  3AK1 A;  3HKC A;  4DYL A;  1KYO F;  2YI9 A;  4P2Z A;  2DQ0 A;  1HNW B;  3UO3 A;  1B6Q A;  3FAV A;  4JI0 O;  4YHH O;  5F2V O;  3SYO A;  2ZM6 B;  3AG1 B;  3G71 V;  5LMU B;  1W0K G;  3HPL C;  2HHH O;  1BQ0 A;  4HBN A;  1VQM V;  3ABM C;  4UCS A;  5CA0 A;  1YJW V;  3ZED A;  1RPO A;  3JSN A;  2IBZ H;  1QCE A;  2A0L A;  1K5Q A;  3L72 H;  1F4N A;  3TK1 A;  5JVD A;  5FPO A;  3APQ A;  1VF5 B;  4J7K A;  3ASO B;  3TGU H;  2ZIM A;  3AG3 B;  2X6C A;  2UU9 B;  3ZHR A;  1K97 A;  4X20 B;  4AQY O;  4YJ2 B;  2P5O A;  2ZR3 A;  1EZJ A;  3ABK B;  4F4L A;  5B5E Z;  1R1B A;  3RYI B;  2HFE C;  2Q0A A;  1NVP D;  3CCJ V;  5CA1 B;  4ZI7 B;  3ZX6 A;  2ZM6 O;  1Y66 A;  2OWO A;  2QDO A;  1KUQ A;  2UUA B;  4CBC A;  2ZE5 A;  2XAH A;  4ICG A;  1IDS A;  1Q81 W;  3CP1 A;  1YVW A;  2ZNJ A;  3VQX A;  4CS3 A;  1K4C C;  4YY3 O;  2NR5 A;  3AG2 B; 
#chains in the Genus database with same CATH homology
 2HVJ C;  2JIZ G;  4KFM A;  3VOU A;  3W7T A;  3JYC A;  2P7T C;  3ZMV A;  2NLJ C;  3W7W A;  3E35 A;  4XDL A;  1MSW D;  1WLE A;  3K04 A;  5L3B A;  5LHG A;  3P32 A;  3E83 A;  1SES A;  4LBE C;  4QPK A;  3CCE V;  1H2G A;  1BL8 A;  1GM7 A;  1OZ0 A;  3WG7 C;  1VQO V;  1F4M A;  2JEX A;  3ASN C;  3ABU A;  1UJW B;  4XDJ A;  5LGN A;  4PA7 A;  1S3J A;  4UVB A;  3W7S A;  1BHB A;  3E8H A;  4TT3 G;  4FIP C;  4P9O A;  3IFX A;  1L1F A;  3ZMU A;  2H8P C;  3FB8 C;  1VQ4 V;  3GB7 C;  2DYR C;  2JJ1 G;  3K08 A;  1K5S A;  2ZDI C;  2DWE C;  3P30 A;  5IYB O;  1K7D A;  1NKD A;  3OW2 U;  4GCZ A;  4XBF A;  2W0F C;  1R3L C;  5LGT A;  4OXS A;  5DM6 V;  1NVP B;  2XAQ A;  5KUM A;  2IH1 C;  3K0G A;  2EIN C;  4RQE A;  1S72 V;  2ZXW C;  3ZJZ A;  3SJQ C;  4J9Y B;  1Q86 W;  1OCR C;  3FYI B;  1H8H G;  4I9W A;  2IJH A;  3WG7 B;  2XAJ A;  2R9I A;  4MTF A;  2PI4 A;  3DGE A;  4JAU A;  2EBO A;  1PL0 A;  3SPJ A;  2DYS C;  3ZRW B;  1QVF U;  4X8A A;  2OTL V;  3PJS K;  3CCS V;  3OEH G;  1AJN A;  2DYS B;  4P9P A;  3G6E V;  3CPW U;  4PDM A;  1R6N A;  1YHQ V;  2Y69 C;  4PA4 A;  1YJ9 V;  1SER A;  4L87 A;  1LNQ A;  4GX0 A;  1G8M A;  5IY5 B;  1JX9 A;  1R3K C;  3QO8 A;  1DF5 A;  1V54 C;  1AJQ A;  2D3O W;  1J95 A;  3CME V;  4FK5 C;  4QE9 A;  1JOY A;  3EHB B;  3ETE A;  1PNL A;  3OUF A;  3OUS A;  1OCC B;  5IYD O;  1R3I C;  3LDD A;  5EBM C;  1Q7Y W;  3SYP A;  1WPX A;  4MVQ A;  4HZ3 A;  3H01 A;  3ABT A;  4PA9 A;  3VBB A;  3B77 A;  2Q6A A;  4YXW G;  1ROP A;  2EIM B;  2HR3 A;  5CBG A;  4UV9 A;  2IU0 A;  2ZR2 A;  1AI4 A;  3NXS A;  1SET A;  1YIT V;  2QTO A;  5H6R A;  2WWW A;  4WFA V;  5L3G A;  3CD6 V;  2HKO A;  3AG4 C;  4RUF A;  1MG1 A;  5LHH A;  3IC7 A;  3OE7 G;  4FMT A;  2OTJ V;  1TUE B;  3E86 A;  5HFM A;  1KQS U;  4MVS A;  3KG2 A;  4ZBM A;  3UM7 A;  2ZXW B;  3OFN G;  2W6I G;  3X2Q B;  2AHY A;  5B1B B;  2WLM A;  3FB5 C;  3B8N A;  3ZRW A;  3CC2 V;  3W7X A;  4QNH B;  1H8E G;  3F7Y C;  3K06 A;  4BW5 A;  2C2A A;  3ETD A;  3CYO A;  2UXN A;  5J9P C;  1SRY A;  3T2M A;  2IJJ A;  3MD0 A;  1N8R W;  2UXX A;  1M56 C;  3ASN B;  2F43 G;  2CK3 G;  4Q20 A;  2PI5 A;  3E8G A;  4GX2 A;  3SYC A;  1QLN A;  1FS0 G;  1YJN V;  1HWY A;  3QO5 A;  2YEV A;  1VQ6 V;  1I5Y A;  5KA6 A;  2R9R B;  2IH3 C;  1THZ A;  4MS2 A;  1MAB G;  5CBF A;  5L3E A;  2Q69 A;  4HYO A;  3AG3 C;  4XDK A;  2B1G A;  1S76 D;  3AG4 B;  4EKW A;  4WF9 V;  2QE7 G;  3AG2 C;  3E2E A;  3T1C A;  4LC1 A;  2QEX V;  2WLK A;  4RQF A;  1NQT A;  1NH2 B;  1DF4 A;  4UVA A;  3OMN B;  3ABL C;  2XAG A;  2B5U A;  5DN6 G;  4PDR A;  3FYE B;  4R7C A;  3ZN0 A;  3CC7 V;  1QBZ A;  4ZKI A;  3SYA A;  1P7B A;  1K34 A;  3SPH A;  3JD2 A;  2Q68 A;  2XND G;  3K03 A;  3K9A A;  3ZRV A;  2WPD G;  4RO2 A;  1EFR G;  5KUK A;  2WAM A;  2WLN A;  1RPR A;  3FKS G;  3RBZ A;  1BHA A;  1Y4M A;  3BY6 A;  2ZD9 A;  1GM8 A;  3LNM B;  2EIK B;  5L3F A;  3ABL B;  4X89 A;  1OHH G;  3ZCC A;  1KC8 W;  1NR1 A;  3QO7 A;  1FXK B;  4MTX A;  2YEV B;  3OM3 B;  5B1O A;  1K9M W;  3STZ C;  1XL6 A;  1V55 B;  3OGC C;  3OEE G;  1GO3 F;  5CA3 A;  3SYQ A;  3T4D A;  3CXC U;  3ZMS A;  1E1Q G;  3D36 A;  4BIU A;  3OAA G;  3W7U A;  3SPI A;  2W6J G;  4KUM A;  1OCO B;  4WFB V;  4J9Z B;  2QA4 V;  1NBM G;  1VQ8 V;  1R73 A;  5CMU A;  2ZDI A;  5EBW C;  3ABM B;  2DW4 A;  2OCC B;  5C93 A;  1M56 B;  1FXK A;  2B1I A;  4MVR A;  5B3S B;  2JDI G;  3FB6 C;  2HLD G;  4H33 A;  4PDL A;  4UXN A;  4QIW F;  4QJF B;  1VQL V;  1E1R G;  3R65 A;  3CC4 V;  3E8B A;  2WLH A;  3ML0 A;  4PA3 A;  1DTO A;  3STL C;  2FTK A;  4MW3 A;  1NR7 A;  3HB3 B;  3K0D A;  1NH2 D;  1FXV A;  1GMG A;  1M1K W;  1F23 A;  4WFH A;  1CPY A;  1SZT A;  1ENV A;  2EIL B;  3T4Z A;  1M57 C;  4PDV A;  3F7V C;  4U7N A;  1YSC A;  1KEC A;  5LGU A;  2HJF C;  4JPR A;  1VQ9 V;  1K33 A;  2DWD C;  3CCQ V;  5EC1 C;  2EIL C;  3SPG A;  2V1D A;  2EIM C;  2WLJ A;  4TWK A;  1QR9 A;  1RM1 B;  1IXM A;  2BOB C;  3ZRX A;  3DTU B;  1R6K A;  1VQP V;  1XL4 A;  3OMA B;  1Q82 W;  2IJI A;  3OMI B;  4UV8 A;  5IYC O;  1F51 A;  1PD3 A;  4LP8 A;  2AHZ A;  1YIJ V;  1OCZ B;  1W0J G;  1VQK V;  2DYR B;  4PA6 A;  4JTA B;  1VQ7 V;  4JTC B;  1JQ0 A;  3RW0 A;  2X7R B;  2XOK G;  4MSW C;  3TET A;  4JAS A;  1JCH A;  2EJR A;  2WSS G;  3OR7 C;  2IU3 A;  3G4S V;  4MVU A;  5B1B C;  2KB1 A;  3CCL V;  1RM1 C;  3JD1 A;  3TCU A;  2Y69 B;  4WFE A;  2K1E A;  2ITC C;  4TSF G;  1ZWI C;  2Z3Y A;  1PNK A;  1K92 A;  4JGS A;  1QR8 A;  2EIJ C;  1GTO A;  3ZIA G;  1AI7 A;  1GKF A;  2QM8 A;  2X6A A;  1KP3 A;  1AJP A;  3LDE A;  4R6Z A;  1K4D C;  2OT5 A;  3AEI A;  4H37 A;  4UVC A;  4PEL A;  1G4Y B;  2A9H A;  4RAI A;  1BMF G;  2QKS A;  3MHS C;  1K73 W;  3JD4 A;  3F5W C;  1JPX A;  1MOF A;  4RUE A;  4N23 A;  5LBQ A;  2LFR A;  4JF3 A;  2Y48 A;  1V54 B;  2WLL B;  1S77 D;  5IY5 C;  2NNU A;  3LUT B;  5EK0 A;  3ABK C;  3A0R A;  5L3C A;  1CEZ A;  1KKD A;  5CBH A;  3CCU V;  2P67 A;  4WCE V;  2YSU B;  1YI2 V;  2JEU A;  3QNE A;  3LSS A;  1CP9 A;  4MVZ A;  1EBO A;  3E89 A;  4KP4 A;  4QPJ A;  4G28 B;  2P6J A;  5H6Q A;  3ASO C;  1PKX A;  4JYC A;  4MVM A;  4GX1 A;  2WLL A;  3LSQ A;  2EIK C;  2GSM B;  5EBL C;  3GWO A;  2JJ2 G;  2X6B A;  1QLE C;  4LCU C;  2HVK C;  3WFV A;  4E2L A;  4R8C A;  5IDJ A;  4WFF A;  2IW5 A;  1DLB A;  1AI6 A;  3CCV V;  1OCZ C;  4DO2 A;  3RVZ A;  3E8F A;  3ZRS A;  1E79 G;  2Q67 A;  4G2K A;  1R3J C;  2OCC C;  1YTF D;  3M99 B;  3K79 A;  4JAV A;  4MW8 A;  1JVM A;  3SPC A;  5KA5 A;  2MK3 A;  1FXH A;  3EFF K;  5B1A B;  4R50 A;  2EZP A;  1ARO P;  1M9N A;  2P90 A;  2ZQM A;  3X2Q C;  3ZMZ A;  2X0L A;  4JYB A;  3I55 V;  2A79 B;  2WLI B;  1NJI W;  1KD1 W;  1M57 B;  4HAM A;  1VQN V;  3K3W A;  3BEH A;  4N21 A;  2QM7 A;  1FXK C;  4QE7 A;  4X88 A;  1QVG U;  5HFL A;  3I56 V;  4GT1 A;  4P2Z A;  2DQ0 A;  4UUJ C;  3JCZ A;  1W2B U;  1B6Q A;  4MT8 A;  5L3D A;  1S5H C;  3SYO A;  1JJ2 U;  3AG1 B;  1K3E A;  3G71 V;  2HG5 C;  2DQ3 A;  1W0K G;  3HPL C;  3RVY A;  5B3S C;  4WFG A;  3AG1 C;  3FB7 C;  1VQM V;  4FPP A;  4Z1M G;  1VQ5 V;  3ABM C;  3MHH C;  1P4R A;  2JK5 C;  1QLE B;  3JD3 A;  3CCM V;  1H38 A;  1YJW V;  1RPO A;  1OCO C;  1QCE A;  2A0L A;  1K5Q A;  2H94 A;  1S0V A;  2GHY A;  3CCR V;  2LP7 A;  1F4N A;  4P30 A;  3TK1 A;  4MTO A;  2XAS A;  1KP2 A;  4DXW A;  4GX5 A;  3ASO B;  4CZZ A;  1V55 C;  1AR1 B;  4I5S A;  1FFT B;  3AG3 B;  2ITD C;  2EIJ B;  1AI5 A;  2X6C A;  5E1A C;  3ZN1 A;  1K97 A;  5EC2 C;  4JTD B;  2M7W A;  3ZMT A;  5CN0 A;  5B1A C;  1ORQ C;  2ZR3 A;  3B8M A;  1I5X A;  2WLI A;  4BAY A;  3ETG A;  1OCR B;  1EZJ A;  1COW G;  3ABK B;  4FJC C;  4MVO A;  4ASU G;  4F4L A;  2LFS A;  1GM9 A;  2EIN B;  5BZB A;  2V7Q G;  5LHI A;  2HFE C;  2XAF A;  3CMA V;  1OCC C;  4MTG A;  1NVP D;  5FL7 G;  3LDC A;  4BIZ A;  3CCJ V;  3IGA C;  3OR6 C;  1M90 W;  2IJK A;  1Y66 A;  1K8A W;  1GK9 A;  5B1N A;  5H9C A;  4G27 B;  4CBC A;  2BOC C;  2XAH A;  1Q81 W;  1YTF B;  2EZO A;  3CP1 A;  3JD0 A;  3UKM A;  3D3I A;  2Z5U A;  1PNM A;  4U7O A;  1K4C C;  5GW7 A;  2ATK C;  3AG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...