2QA4V

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qa4V00
1YJWV 2QEXV 1R73A 1S72V 1YI2V 1Q82W 1Q7YW 1QVGU 3G71V 1VQ5V 1VQ8V 1VQNV 1QVFU 4WF9V 3CMAV 3CD6V 3CCUV 3I55V 3CXCU 3CCQV 1K73W 1VQ7V 1NJIW 1VQ4V 3G6EV 3CCSV 1M90W 3CCLV 1KQSU 2OTJV 1JJ2U 1YHQV 1YITV 3CPWU 2D3OW 1KD1W 3CC2V 1YJNV 1VQKV 4WFAV 1Q81W 3CC7V 1VQMV 1KC8W 3CCMV 3G4SV 3CCEV 1K8AW 3OW2U 1M1KW 3CC4V 1VQOV 2QA4V 2OTLV 1VQ6V 3CCVV 1K9MW 1N8RW 3CCRV 1YJ9V 4WCEV 3I56V 1VQPV 1VQ9V 1Q86W 5DM6V 3CCJV 4WFBV 1VQLV 1YIJV 1W2BU 3CMEV
chains in the Genus database with same CATH superfamily
4JAVA 4NTWA 3OD4A 3M8AA 2DYSB 3L73H 1I5YA 3CE2A 1FJGB 2V4DA 4YJ3B 1JFFB 1XEQA 4YJ2B 4U7NA 2ZQMA 4WFHA 3OM3B 4JPRA 4X66O 2Y69B 3SR2C 2QKAA 2HHHB 4RUFA 2P4KA 4B3TO 3T1HO 1PPJH 1AR4A 5BR8O 4JZGA 2WPDG 3ZIAG 5CMUA 5FPRA 5KHIA 2XAHA 2JEXA 5EC1C 3CC2V 3UQ8A 4X1YA 2PY5A 1V55C 5JQGA 1SQQH 2ZM6O 3H1LH 2H94A 4JYCA 1NH2D 1S72V 3A2FA 5D5PA 3T1YO 4ZIBA 3S3WA 2BTOA 3F7VC 5CA1A 3IGAC 3SYPA 1FXKC 5KHJA 2K1EA 3OEEG 4RQEA 1SESA 1P7BA 2VQFO 2KG7B 2YIBD 2YIBA 2MK3A 3OFNG 3AG3C 2QJ1A 4IT5A 2EIKB 3MAQA 2H3OA 3ASNB 1D5NA 2VRZA 5JH7B 4JV5O 4IIJA 4PA6A 4DV6O 4RAIA 1JR9A 4AHCA 1KKDA 4JI3O 1UJWB 3E83A 1L0LH 1OCZB 5LOVA 4YJ3A 2Y0IA 1URFA 4X65O 2RCVA 1Y74B 2MW2B 5EZYB 4G2KA 1YVWA 1RP3B 2ZKOA 4KP4A 3B4SA 2UXBB 1FXKB 4DV1B 4X66B 5D5QA 3OT7A 2DYRB 4EKWA 5IE9A 1EFRG 4JV5B 4L8JA 3CCJV 4WFBV 2XUMA 3OAAG 3Q4HA 4WBNB 2IJKA 1YJWV 2VQEB 4X62O 2AZ2A 3RVZA 4QIWF 3TXSA 3CXCU 1F4MA 3SDLA 2DQ0A 4F6RA 4X64B 3SPGA 1Q8IA 3JD4A 3C3TA 2OTLV 3CYOA 1ZL8B 2KSDA 1R6NA 2F23A 2JGUA 1XMQO 4QE9A 5KLVH 1WAZA 1OV9A 1BCCH 2WLNA 3CCUV 1XL4A 4XDLA 4PI2A 1Y66A 2QWNB 4TSFG 4GYCB 3FFQA 1BE3H 4FLZA 5KX5A 2R9RB 5KMGA 3GVMA 2F43G 4LFBO 4GT1A 2X7RB 4TUYB 4D7TA 4DV4O 5GONA 1BQ0A 4JI4O 1WJZA 1Q82W 1NBMG 4RO2A 4JF3A 4PA3A 3F7YC 1E1RG 2EIJC 5ITZB 3JSNA 2ZT9B 4MW3A 1GN2A 2YI9A 3R66A 3H1IH 3JAKB 5BY1A 2LFRA 2QKSA 1XBLA 2LW7A 3SYCA 3TGUH 4DK1A 3U0ZA 3APOA 4TUYA 4I50A 2EINB 5IWAO 3EXAA 2GTSA 3QF7A 2FKXA 1YITV 4K8XA 3TCUA 4Q20A 3SJBC 4K3AA 3DC5A 5B1AB 4HZ3A 2VS0A 1YDXA 2AZ0A 4BWAA 4BIUA 3FB6C 5LMNB 2RJZA 1KKCA 2XASA 2KB1A 1HR0O 1TGOA 1QVFU 4IGGA 3E89A 4X65B 4QJFB 4PDLA 5KAIZ 2IJHA 3C3SA 3ETDA 2ADPA 1G6UA 5A9GA 4JI0B 1KP3A 1RFYA 3THOA 2CTPA 3HR0A 1QLEB 4ABMA 1NVPD 1N0NA 2Y4TA 4NR1A 2OYQA 2YIAA 1L0NH 1AR5A 4LWSB 3E8HA 3AG1C 5IDJA 1WNSA 5IYCO 4RUEA 4IYIA 4LCUC 1N32O 4I55B 4DRXA 5AG2A 2OTJV 1JJ2U 2GSMB 3ZRSA 5LP6A 2L6LA 2OIGA 1U97A 3STZC 2HFEC 4BW9A 2FL4A 3RFRA 2QM4A 1W2BU 4B3RO 3ZS8C 2XTAA 4LFBB 2IH3C 1SZTA 2F4VO 2DQ3A 3AK3A 3H1HH 4UCTA 2ZINA 5L3BA 3QG5A 3CS5A 5LMUO 3AG1B 2EIJB 2P6JA 3ETEA 2ZR2A 3OW2U 4DR1B 4OX9O 3VQXA 3ZMSA 2UXDO 5LYJA 4WFEA 5KAFZ 3VBBA 1WN7A 5EC2C 4TT3G 1TVKB 4HYOA 1BSMA 2ZM6B 4YY3O 2P4VA 1KB9F 1O9HA 4LF5O 5J2UB 4W4LA 1Z2GA 5JH7A 3E22A 3FB7C 1BHBA 3TK1A 2F4VB 2HLDG 2CH7A 4DR3B 3X2QC 4LF4O 2OIEA 2V1DA 2PZSA 4LP8A 1EN6A 5LMUB 4DUZO 1SQVH 3IC9A 1Q43A 4B3MB 2RNBA 1WA8B 4DV5O 2P67A 2D3OW 4UV8A 4FIPC 3H9VA 4FM0A 5E1AC 4LF4B 2EILC 4I7ZB 3ABTA 1WPBA 5CB4B 1YCIA 5LGUA 4HNAA 2Q6AA 1GMGA 3ZHQA 5H6QA 1YEWA 1MZEA 1JVMA 1PM9A 2LJ2A 1CXZB 3LDDA 4WFFA 1Y76B 4U3FH 3JAMN 1QLNA 1EZJA 3HKEA 4TQFA 4JAUA 4DUYO 4JI2O 1FFXA 3AG4B 4WBNA 3ZHTA 3ASOC 1L8DA 3OTOO 2ZXWC 1GKFA 1G4YB 1RM1C 4JAAA 1OJHA 1ZL8A 5H9CA 1LNQA 1YXBA 5LHGA 2GBOA 1XOUA 2XAGA 1JPXA 2WLKA 4KUMA 3DXRA 2OT5A 1PL0A 2ZDIC 5LGNA 1DGSA 2V7QG 3CJHA 3CRRA 3R65A 3AG3B 2CGOA 3WB0A 1M57C 5LL6Y 4FLYA 3UO3A 2UXNA 4MS2A 3SJCC 4MVOA 2CTWA 2UXCB 3HKEB 3ZHUA 3T2MA 3BABA 1BMFG 3CCSV 4IHJA 1B6QA 2YEVA 2Q4PA 3E8GA 5DECA 2WA3A 4YY3B 1H8HG 5IJ0A 4PDMA 1F51A 3CRQA 1SQBH 3ABMB 3EVKA 1ZWIC 4NXMO 4FLUA 3CD6V 1XNQB 3L74H 3F5WC 3C90A 4W4KA 4K0KO 2JS5A 4DR7O 1CP9A 1IBLO 4LFCO 2YUAA 1Q5OA 1VQ6V 4DV3B 2YI8A 3JD0A 1RPRA 3K5LA 1RSOB 2PTMA 2DJVA 2QSAA 3SJAC 1B04A 4AQYO 3UT5B 3T4ZA 1VQ5V 1FXHA 4CS2A 2Q7HA 3WFVA 1RPOA 2ZE6A 1VP7A 4JI5B 2UUCB 3BY6A 4EFBA 5FL7G 1EN4A 5C8YA 3WG7C 1R3LC 4DR7B 4B3RB 4FLWA 2IU3A 2LQTA 2W6JG 5IYZA 2JK5C 4G28B 1H2SB 4PHZA 3RW0A 4R7CA 2E74B 3K79A 2Q8VA 2GHYA 4DR2B 4TWKA 3ZHVA 3DSQA 2EINC 3N2KB 4I4TA 1H2GA 3JALB 3BFRA 1Y76A 5LA6B 4GZRB 2JRIA 3G67A 1CEZA 1AI7A 2BSKA 2QWRB 1TUBB 4NB5A 2UUAB 5KMGB 1S5JA 3JASA 3HKCB 1IBKO 3CXHF 1GO3F 4KFMA 1D5AA 5CBGA 1J5EO 2RDCA 1IX9A 2DE0X 5EBWC 4GX0A 2XAFA 2CDYA 2IU0A 1VQ4V 1KMIZ 1L1FA 3E8FA 1IBMO 4MSWC 2HHHO 1FS0G 2R9AA 3IC7A 3GWOA 1IVSA 4U3JB 4LF5B 2WLLA 1KECA 1KUQA 3N2KA 2YIDA 3ZEDA 3L71H 1K73W 1US6A 2WWWA 3RYCB 2YC0A 4MVUA 1Y74A 2ODMA 1NJIW 1P49A 1SS3A 2PF4E 5CB4A 1NTKH 2FB5A 1NQTA 2DOSA 1IBLB 2A3QA 4FK5C 2CGNA 1VF6A 1D2DA 4MTXA 5EBMC 5KUKA 3O65A 2PYLA 3KZIZ 1YIJV 2CE4A 4I4TB 4PJ0Z 2Q0OC 1R3KC 5KUMA 3ABKB 4LFCB 1R3IC 1ZLZA 3EHBB 1NS1A 1H2MA 1AROP 3MHHC 5KHGA 4J7JA 3ZHRA 1QR8A 1WLEA 1HWYA 3AG2C 4YIOA 4LC1A 1B3QA 1S76D 4GX1A 2Q7GA 1G1XB 2DN9A 3W7SA 3QO7A 2ZIMA 2WLLB 5CA1B 5LXTA 4JI8B 4JI0O 4CS3A 1PV0A 2EIMC 3BCCH 4YIPA 1ROPA 2ZE8A 2QR4A 2DWEC 1OZ0A 4CBCA 4KHPO 1HNZB 5FPOA 3UO2A 3A0BZ 5E79Z 3L72H 3K5NA 2PGGA 2UXCO 2YXHA 5ITZA 2QWQB 4X1YB 2GV9A 1LUVA 4PDVA 1FD9A 4DV3O 1F23A 2EIKC 2VWJA 1HNZO 4QGPA 1WPXA 5L3GA 4TV8A 4UUJC 2QEXV 3HKCA 4FZ0A 2JJ2G 1QVGU 4LWSA 1ZAUA 3KCYA 4BR6A 1JOYA 4I0XA 3JAWB 4P2ZA 2E75B 3VOUA 3HKBB 2AGAA 3CCEV 2E3CA 1OCZC 3WB2A 2QDOA 3HKDB 5EK0A 5JCOA 3QVNA 2E5LO 4O4JB 3G71V 2NLJC 2X0LA 3AK1A 4NVPA 4LF9O 3FB5C 2L35A 3JCZA 1KQSU 1JMKC 1RM1B 1XILA 1VMGA 4P30A 2ZNJA 2UUCO 1P4RA 3ZX6A 4TV9B 4WCEV 3ASNC 4I9QA 1QCEA 2AW9A 2HVJC 2R70A 4DV0O 1R6KA 1Q6UA 1V54C 4B7KA 4UB8Z 3D3IA 2DMXA 3QO5A 2YEVB 4F6EA 1QBZA 3B09A 3A8TA 1AP6A 3CC7V 3P3NA 1G8MA 2JIZG 5C93A 4MTFA 2IW5A 1N0JA 2Q69A 2JJ1G 1PNMA 1BS3A 5LMNO 3VQVA 4O4IA 4ASUG 1VQLV 2F95B 5CA0B 1TVKA 2WLIB 1K5QA 3ZRWB 4X64O 5J2TB 3FYEB 4Q6GA 4CZZA 4FFKA 3QO8A 3OGIB 5IWAB 5B1NA 1SKVA 2UXDB 2FYUH 2PI4A 2HJDA 2HP8A 3AEIA 2Q9LA 3BEHA 4J7ZA 3JD3A 3DTUB 4DR6B 2Q67A 4ZBMA 3SPCA 3X2QB 4FZ1A 1JFFA 5CBHA 3ZMVA 2F66C 4KXRA 3ABKC 2UXXA 4GKKO 3E35A 1I7FA 1YF2A 4LNUA 4U7OA 1SA0A 2QA4V 1KU9A 2BSKB 2QTOA 3D36A 3QTCA 3K9SA 1CPYA 1H8EG 1Z5VA 4X1IA 3JASB 4O4LA 1OCRB 3OR7C 5IJ9B 1Y67A 2QKCA 2JGDA 2P90A 1IXBA 3ABLB 4UB6Z 5BMVB 3LNMB 4U3JA 4ZI7A 5B1OA 1Q86W 1S0VA 2P5OA 3K08A 3BA8A 1K92A 4LNUB 1GAXA 2YSUB 5H6RA 1WB8A 3HPLC 3W7UA 1MMMA 4J9YB 2OCCC 2H8PC 4JASA 1Q3EA 1FJGO 1FXKA 1VQKV 1TA8A 4IL6Z 4JTCB 4DW0A 3SPJA 2B5UA 4IIJB 3RVYA 3CC4V 5B3SC 3K9AA 3CCVV 1SQPH 4X20B 4PD4F 1HNWB 1Q6IA 1PL4A 3ICXA 5B1BB 4L87A 4DUZB 4O2AA 1NU1H 4LH7A 4LBEC 4LF8O 5JQGB 4JI7O 4DYLA 1FKAO 1K33A 2HG5C 4FPPA 1DK1A 1K5SA 3L75H 3E2EA 4GX2A 5CA0A 1ORQC 1NT2B 2QWPB 3OMIB 4FM1A 1COWG 2KQXA 2O57A 5DM6V 2ZDIA 1R6TA 1NZ6A 5IY5B 1BT8A 1U96A 4UCSA 4JI3B 1VQNV 1R3JC 2KKWA 2F1MA 2ZE7A 3ZMUA 3EFFK 3D3QA 4X89A 3JATA 2WLJA 4GKJO 2HEPA 3I5DA 4X1KB 5LYJB 3KG2A 3I56V 4I0XB 1JX9A 3BAAA 4LF6B 4EEQA 4PA7A 1OCOC 2JGDB 1YHQV 3CPWU 2W6IG 3RGBA 1K8AW 1ZX3A 3S3XA 2BE3A 2WLMA 1XUQA 2G38A 2HR3A 3LDCA 1BGYH 2EJRA 1MSDA 4TV8B 5KX5B 2HKOA 3TETA 4E2LA 3IFXA 4OPAA 4MW8A 4DV1O 4MVRA 2JVDA 3T4DA 4J41A 4C7UA 2CUGA 4I50B 4R8CA 2ITDC 1TUBA 1ENVA 1N8RW 3CCRV 2Z3YA 3T1CA 3ZBHA 3JARB 4B3MO 3ZN1A 4JI1O 4LF7B 3LSSA 4GLXA 2ZR3A 3WB1A 2FTKA 4J10A 1H2KA 1GM8A 1SRYA 2OCHA 3KKYA 3B8MA 3CCMV 3AG4C 4X8AA 5LXTB 1SZXA 1KP2A 1SF9A 1K9MW 3FD9A 4JI6O 3ZCCA 2XHBA 4X20A 4O4IB 4LR3A 1SERA 3CX5F 1GRJA 1AJNA 1N33O 1R73A 4JI7B 2WAMA 3JAKA 3U11A 3HB3B 3WG7B 1VARA 4B3SO 1NR7A 1OCRC 3B8NA 5JVDB 4DV0B 1M56B 1WB7A 2LFSA 1GN6A 2UU9O 5J9PC 1EBOA 4Z1VA 4K0KB 5EIBC 5IJ0B 4X9QA 4DV2O 1VF5B 4LF6O 1X4TA 4J42A 2EZPA 1AVMA 1Q7YW 1SC5B 2ATKC 3VQWA 3M7MX 1THZA 4PV1B 4UVAA 1MOFA 3G4SV 4X1IB 5KHKA 5GW7A 4DR6O 1XREA 2Q5ZA 2Q68A 4F4LA 4OGQB 2XOKG 4G27B 4UCVA 1SETA 4TQDA 5B3SB 2XAQA 4PI0A 1Z5WA 3AK2A 3RYFB 1VIBA 3UM7A 3ZJZA 2WSSG 2K9PA 4OXSA 4DV5B 1PD3A 2DWDC 4MVMA 4O4LB 1UPGA 4DR5B 4FVMA 1DF5A 3K04A 4P9PA 4DO2A 4X62B 4AILC 1GN4A 5H5NA 1QHTA 4A5UB 1ZUQA 1K4DC 1YTFB 1V55B 2YXYA 2P22C 4CH3A 4B08A 1SQXH 5FNVB 4ZOLA 4PELA 2EJ7A 2VQEO 1V54B 1AI5A 3LUTB 1W0JG 4MT8A 1E1QG 1XI1A 1SA0B 3ABMC 4I9WA 1HDJA 3H01A 4I5SA 2XT9A 5LOVB 3UT5A 2GUZA 1GM9A 1WA8A 5CN0A 5IYBO 4K8ZA 5LBQA 3IAYA 3DC6A 4UV9A 4HNAB 4PA9A 4FLVA 3GWKC 2WLIA 4JGSA 4NTYA 1AILA 2DW4A 2OCCB 2R72A 5BR8B 2R9IA 1M9NA 3OMNB 3E8BA 5LGTA 4FLTA 1S5LZ 4FM2A 5JVDA 4CC6A 4DV2B 1XL6A 3SYAA 4Z1MG 4XDKA 4P9OA 2ZNIA 2DYSC 1Q81W 5HFLA 1W59A 3J7AU 3OUFA 1OCCB 2Q7EA 5KA5A 4FLXA 4R50A 5JCOC 5J2UA 2BTQB 3RYCA 2EBOA 3N27A 2QWOB 2AXTZ 2Y48A 5KA6A 3NR7A 4ZHQA 4YHHO 2GTAA 4GKJB 5L3DA 1AP5A 1XQ8A 3JCUZ 2Y4UA 3K03A 2F93B 3OTFA 4TV9A 1XMQB 3ZRVA 4DR4B 1AI6A 5LP6B 5BMVA 3K57A 5IT9N 1IZ3A 5A2QN 3HKBA 1VQ8V 3CRAA 3DXRB 1IXMA 1ZSPA 5K1XA 4ZOLB 4DK0A 1FFXB 1FAFA 1KD1W 3ABUA 4WFAV 5IYDO 1IDSA 3PJSK 1AJPA 4MVSA 2A7WA 5CA3A 3L70H 1J95A 2W0FC 3E86A 1JCHA 5LHHA 3SPIA 3BRCA 3P3PA 2QE7G 1N34B 4J11A 4H13B 3H1JH 2CTQA 5L3CA 4EB6A 3G6EV 4E4EA 4DR2O 4UFZA 3Q4HB 1MZFA 2BTQA 1LUWA 4MVQA 4LFAO 1I0HA 4AI8A 3H1KH 3ASOB 2N05A 4HBNA 4GUNA 5FLXN 4QNHB 3CCLV 3K3WA 1ZTEA 1YTFD 1E79G 4KL1A 1K3EA 1VF7A 1Q6HA 2RMKB 1SQGA 1Y6XA 4EFEA 3CB2A 2N74A 1S5HC 1MG1A 4FJCC 3CMEV 2B9ZA 3JSLA 3CRCA 5CBFA 1XHZA 1TAEA 3FAVB 2HJFC 4LFAB 2EIMB 4RQFA 3M99B 1XHXA 3K06A 4UVCA 1IURA 1TUEB 4IYHA 2DYRC 3CWBH 2JS3A 5LHIA 2XAJA 2KG7A 3N2GB 2M6YA 1NVPB 3E22B 5DEDA 2X6BA 3RYIB 2X6CA 3RBZA 1XMOB 4CC5A 1K97A 2W0XA 1FYJA 1GTOA 2YS8A 4H0LB 4ZKIA 1NH2B 4JYAO 4N21A 2LW1A 2BOCC 4LH6A 3UKMA 1M1KW 2AHYA 3ML0A 3SGIA 5IJ9A 1VQOV 1VF6C 4CS4A 3UCSC 3CP1A 2PUSA 4FMTA 2XNDG 2ITCC 3K58A 1HW7A 2OWOA 4O4JA 4BAYA 3RYHB 4JI5O 2ZXWB 1M90W 4BW5A 1S77D 2CTRA 2IH1C 2P7TC 4UXNA 4XDJA 4ICGA 1K34A 5HFMA 1VQ9V 1VQPV 3OR6C 2Q0AA 1Y4MA 4BIZA 1EZVH 5JWPA 3WU2Z 5L3EA 4JYYA 1PP9H 1H2NA 4YXWG 1GH6A 3RYFA 3ZRWA 4TOIA 5TISZ 5FNVA 3D8CA 1XNQO 2NNUA 4JI6B 4J80A 1UFIA 4R6ZA 3FB8C 1BL8A 3LSQA 1DTOA 3RYIA 4H33A 1YJ9V 3ZRXA 1BHAA 4UCRA 5EYPB 3MD0A 2E5LB 2JDIG 4MTGA 2LO1A 1XNRO 1YI2V 3W7WA 1LR1A 4JTDB 1HNXO 2QM7A 4DV7O 5J2TA 2EZOA 5JJNB 1NI8A 3B2EE 2Y69C 4HAMA 3B40A 3APQA 2IM9A 3GB7C 4BIOA 1JQ0A 3K5MA 4DR3O 3W7TA 1DF4A 1EM1A 2B1IA 4K35A 1F4NA 5IYZB 1QU7A 5B66Z 3P32A 3B77A 4NYKA 5K1PA 1RSOA 3W7XA 3NXSA 4WFGA 4CH6A 4GX5A 1V9PA 1W0KG 1AB3A 4EB6B 1MA1A 1K4CC 3ETGA 2Z5UA 4JYAB 4DXWA 2EILB 4JTAB 2BOBC 4D6TH 4KHPB 3BA9A 3RWRD 4WF9V 1M56C 3K0DA 3L9DA 4IHJB 5EYPA 3PN1A 3SPHA 2NR5A 2ZE5A 2LP7A 2VWKA 3HKDA 3P30A 4O2BB 4O2AB 4JZ2A 4JI2B 4N23A 5BXZA 3BHPA 2Y0PA 4XBFA 3ZMTA 3ZMZA 3CMAV 3T1HB 1YZBA 1N36O 4J7KA 4NXNB 2UUBO 4X88A 2Q73A 2YXLA 1MABG 3U10A 1YJNV 3OE7G 2GDSA 3K59A 1QNMA 5EIBD 1GK9A 4JI1B 3JAWA 4LF7O 3ZHSA 2JEUA 4LF9B 1VEWA 2ETNA 2ZIOA 1I08A 1B06A 4H37A 3SYQA 4NXNO 1VQ7V 1QQCA 3CSXA 3ETQA 2QGNA 1XDCA 3SYOA 1N32B 1XNRB 1BQZA 1KBHA 4DW1A 2Z0AA 2LGWA 4X1KA 4UVBA 3SJQC 4NKGB 1NKDA 1N36B 1N33B 5GTHZ 2LGQA 3JD1A 3OMAB 2IJJA 4PA4A 3JD2A 3LSUA 4YHHB 3G80A 2M7WA 2RQ6A 4DUYB 3LDEA 1NTMH 3JATB 4GCZA 4PDRA 3OTOB 4CH4A 4MVZA 4DR4O 4JI4B 1IBKB 4DR5O 3FKSG 3D36C 1MSWD 5GTIZ 3KCXA 5JJJB 1PKXA 3A0RA 2WLHA 1PNLA 2EX3A 4FFBB 4MTOA 1NTZH 3N2GA 1P7GA 2N04A 1QLEC 4ZI7B 2UXBO 2PI5A 4NXMB 3VQYA 3OUSA 3J81N 2A0LA 3ZN0A 1J5EB 2B1GA 1OCOB 2E76B 1BZKA 1GM7A 3FAVA 5DN6G 3G6BA 3K0GA 2ILMA 1GN3A 2PYJA 2CK3G 4LF8B 1A32A 1VQMV 3FX7A 5JJEB 3O9OA 3RN4A 1XMOO 2ZD9A 3LNNA 3RYHA 4B7EA 2A9HA 1N34O 1DLBA 1WP8A 1FXVA 3CEIA 5B5EZ 4DV7B 3MDSA 3AG2B 1OHHG 4UCOA 3QNEA 5KHHA 1NR1A 1Q90D 1K7DA 1WP7A 3CRMA 3I55V 5EZYA 4F6RB 3K5OA 4QPKA 4I55A 4DRXB 2UUBB 1FFTB 1P84F 1FPOA 1IBMB 1T5EA 2IBZH 4QPJA 5BZBA 3CHXA 1YSCA 2YICA 1HP8A 4B3SB 1KC8W 1N4CA 2X6AA 3DGEA 3TXQA 1O9GA 3JALA 4YJ2A 5LA6A 1S3JA 1EN5A 2A79B 4JI8O 1HR0B 1PNKA 3OGCC 3ABLC 3OEHG 5B1AC 3RT3C 2YDEA 4ZHQB 2ADQB 5C8YB 3JYCA 3FYIB 2A06H 4Z2WA 2CAZC 4B3TB 2WA4A 3BPZA 5F2VO 5IY5C 1M5IA 4CH5A 2QM8A 4O4HB 4NTXA 3J80N 1HNWO 3TJTA 2QTSA 4RWUA 4GKKB 2VQFB 4QE7A 4FFBA 2C2AA 3AG7A 2D2CB 1OCCC 2IJIA 1SQFA 1AR1B 1R1BA 2CH7B 5B1BC 5GONB 1M4UA 2HVKC 2RN9A 2NN4A 1JA8A 1I5XA 4H44B 1HNXB 1H2LA 3IJ4A 1M93A 3F5TA 1AJQA 1AI4A 3CCQV 4D7SA 4UCUA 4DV6B 3STLC 3T1YB 4AQYB 1F7YA 1X59A 4DV4B 1I94O 5LP6C 2AHZA 5EBLC 4DR1O 4OX9B 1KYOF 2ZCEA 3A0HZ 1MNGA 5L3FA 2GUZB 2ARHA 3JARA 3BVOA 2FMLA 1H38A 3MHSC 4JYBA 1I94B 4O4HA 2EULA 4J9ZB 2P06A 1M57B 2UUAO 4OPHA 1QR9A 3CJHB 2UU9B 1JJOA 4O2BA 2BCCH 5H2FZ
chains in the Genus database with same CATH topology
4JAVA 2UXNA 4MS2A 1NVPB 4MVOA 2X6BA 2DYSB 2X6CA 4LBEC 3RBZA 1K97A 3T2MA 1BMFG 3CCSV 1B6QA 1GTOA 1I5YA 1K33A 2HG5C 2YEVA 4FPPA 4ZKIA 3E8GA 1NH2B 1K5SA 4N21A 3E2EA 4GX2A 2BOCC 4U7NA 1ORQC 3UKMA 3OMIB 1M1KW 1H8HG 2AHYA 2ZQMA 3ML0A 1VQOV 1COWG 4PDMA 4WFHA 1F51A 3OM3B 4JPRA 2Y69B 5DM6V 4RUFA 2ZDIA 3CP1A 3ABMB 5IY5B 4FMTA 1ZWIC 2XNDG 2ITCC 1VQNV 4BAYA 1R3JC 3CD6V 2WPDG 3ZIAG 2ZXWB 5CMUA 1M90W 3ZMUA 3EFFK 2XAHA 2JEXA 3F5WC 5EC1C 3CC2V 4BW5A 1S77D 2IH1C 4X89A 2WLJA 2P7TC 4UXNA 4XDJA 1CP9A 1V55C 1K34A 1VQ6V 5HFMA 1VQ9V 3I56V 3KG2A 1VQPV 3JD0A 3OR6C 1RPRA 1JX9A 1Y4MA 4BIZA 2H94A 4JYCA 1NH2D 5L3EA 1S72V 3T4ZA 4PA7A 1VQ5V 4YXWG 1FXHA 3F7VC 3IGAC 3ZRWA 3SYPA 1OCOC 1FXKC 3WFVA 1RPOA 2NNUA 2K1EA 3OEEG 3BY6A 4RQEA 1YHQV 3CPWU 1SESA 5FL7G 3WG7C 1P7BA 4R6ZA 2W6IG 1R3LC 2MK3A 2IU3A 3FB8C 3OFNG 1BL8A 3AG3C 2W6JG 1DTOA 2WLMA 3LSQA 1K8AW 4H33A 2HR3A 2JK5C 4G28B 1YJ9V 3LDCA 3ZRXA 2EJRA 1BHAA 3MD0A 2EIKB 2JDIG 4MTGA 3RW0A 4R7CA 3ASNB 2HKOA 3K79A 3TETA 1YI2V 3W7WA 4E2LA 2GHYA 3IFXA 4JTDB 2QM7A 4TWKA 4PA6A 4MW8A 2EZOA 4MVRA 2EINC 4RAIA 3T4DA 1H2GA 2Y69C 4HAMA 1CEZA 4R8CA 1AI7A 1KKDA 2ITDC 1ENVA 3GB7C 1N8RW 3CCRV 1JQ0A 2Z3YA 1UJWB 3T1CA 3W7TA 1DF4A 3E83A 3ZN1A 2B1IA 1OCZB 3LSSA 1F4NA 2ZR3A 5CBGA 1GO3F 4KFMA 2FTKA 5EBWC 4G2KA 4GX0A 2XAFA 3P32A 2IU0A 1VQ4V 1L1FA 3B77A 3E8FA 4KP4A 1GM8A 1SRYA 1FXKB 4MSWC 1FS0G 3W7XA 3B8MA 3CCMV 3IC7A 3NXSA 3AG4C 4X8AA 2DYRB 4WFGA 4EKWA 3GWOA 2WLLA 1KP2A 1EFRG 4GX5A 1KECA 1W0KG 1K9MW 1K4CC 3ETGA 3ZCCA 2Z5UA 3CCJV 4WFBV 1K73W 4DXWA 3OAAG 1YJWV 1SERA 2IJKA 2EILB 1AJNA 2BOBC 1R73A 4JTAB 2WAMA 3HB3B 2WWWA 3WG7B 4MVUA 3RVZA 4WF9V 1M56C 4QIWF 1NR7A 3CXCU 1NJIW 3K0DA 1OCRC 1F4MA 3B8NA 2DQ0A 1NQTA 1M56B 3SPHA 4FK5C 2LFSA 5J9PC 3SPGA 1EBOA 3JD4A 2LP7A 4MTXA 5EBMC 3P30A 5KUKA 2OTLV 3CYOA 1YIJV 1R6NA 4N23A 2EZPA 4QE9A 1R3KC 5KUMA 3ABKB 1Q7YW 2WLNA 4XBFA 3ZMTA 3ZMZA 3CMAV 2ATKC 1R3IC 1XL4A 3EHBB 4XDLA 3CCUV 1THZA 1Y66A 4TSFG 4X88A 1AROP 3MHHC 1MABG 1YJNV 2R9RB 1QR8A 4UVAA 1MOFA 3OE7G 3G4SV 2F43G 5GW7A 1WLEA 1HWYA 4GT1A 2X7RB 3AG2C 4LC1A 2Q68A 4F4LA 1GK9A 1S76D 2JEUA 2XOKG 4G27B 4GX1A 1SETA 5B3SB 2XAQA 4H37A 3W7SA 1Q82W 3QO7A 3SYQA 1NBMG 2WLLB 4JF3A 4RO2A 4PA3A 3F7YC 1E1RG 2EIJC 1VQ7V 3UM7A 2WSSG 4OXSA 3ZJZA 4MW3A 3SYOA 2EIMC 1PD3A 2DWDC 1ROPA 4MVMA 2DWEC 2LFRA 2QKSA 1OZ0A 1DF5A 3K04A 4P9PA 4CBCA 4DO2A 4UVBA 3SJQC 1NKDA 3SYCA 1K4DC 3JD1A 3OMAB 1YTFB 1V55B 2IJJA 4PA4A 3JD2A 2EINB 2M7WA 4PELA 1YITV 1V54B 3TCUA 3LDEA 1AI5A 4Q20A 3LUTB 1W0JG 4MT8A 4PDVA 1E1QG 4GCZA 5B1AB 4HZ3A 4PDRA 1F23A 2EIKC 3ABMC 4MVZA 4I9WA 4BIUA 1WPXA 5L3GA 3H01A 3FB6C 4I5SA 3FKSG 4UUJC 2QEXV 1MSWD 2JJ2G 2XASA 2KB1A 1QVGU 1GM9A 1PKXA 1QVFU 5CN0A 3E89A 5IYBO 3A0RA 2WLHA 4QJFB 4PDLA 1JOYA 1PNLA 5LBQA 4P2ZA 4MTOA 4UV9A 4PA9A 3VOUA 2IJHA 2WLIA 3ETDA 4JGSA 1QLEC 2DW4A 2OCCB 3CCEV 1OCZC 2PI5A 1KP3A 2R9IA 3OUSA 5EK0A 1M9NA 3OMNB 3E8BA 5LGTA 1QLEB 2A0LA 3ZN0A 1NVPD 2B1GA 1OCOB 3G71V 2NLJC 2X0LA 1GM7A 1XL6A 3E8HA 3SYAA 3AG1C 5DN6G 5IDJA 3FB5C 3K0GA 4RUEA 4XDKA 4Z1MG 4LCUC 5IYCO 1KQSU 3JCZA 4P9OA 2OTJV 1JJ2U 2DYSC 2GSMB 3ZRSA 1RM1B 2CK3G 1Q81W 1VQMV 4P30A 1P4RA 3STZC 2ZD9A 5HFLA 2HFEC 2A9HA 1DLBA 3OUFA 4WCEV 3ASNC 1OCCB 1FXVA 5KA5A 1W2BU 3AG2B 4R50A 1OHHG 1QCEA 2HVJC 2IH3C 1SZTA 1R6KA 2EBOA 2DQ3A 3QNEA 2Y48A 1V54C 1NR1A 1K7DA 3I55V 5KA6A 5L3BA 4QPKA 5L3DA 3D3IA 1FFTB 3AG1B 2YEVB 3QO5A 2EIJB 1QBZA 2P6JA 3CC7V 3ETEA 1G8MA 2JIZG 3K03A 5C93A 4MTFA 2ZR2A 3OW2U 2IW5A 4QPJA 5BZBA 2Q69A 2JJ1G 1PNMA 1YSCA 3ZMSA 4ASUG 3ZRVA 1VQLV 1KC8W 2X6AA 1AI6A 4WFEA 3DGEA 3VBBA 5EC2C 4TT3G 1S3JA 2WLIB 1K5QA 1VQ8V 2A79B 3ZRWB 1IXMA 4HYOA 1PNKA 3OGCC 3ABLC 3OEHG 5B1AC 3FYEB 4CZZA 1KD1W 3QO8A 3ABUA 3JYCA 5B1NA 4WFAV 5IYDO 3FYIB 3PJSK 2PI4A 1AJPA 3FB7C 1BHBA 3AEIA 3BEHA 3TK1A 2HLDG 5IY5C 3X2QC 4MVSA 5CA3A 3JD3A 1J95A 3DTUB 2V1DA 2W0FC 3E86A 1JCHA 2QM8A 4LP8A 5LHHA 2Q67A 4ZBMA 3SPIA 3SPCA 3X2QB 2QE7G 5CBHA 3ZMVA 5L3CA 3G6EV 2P67A 3ABKC 2D3OW 4QE7A 2UXXA 2C2AA 4UV8A 3E35A 1OCCC 4FIPC 2IJIA 4MVQA 4U7OA 5E1AC 2EILC 1AR1B 5B1BC 2QTOA 2QA4V 3D36A 3ASOB 2HVKC 3ABTA 1I5XA 1CPYA 1H8EG 5LGUA 2Q6AA 1GMGA 1AJQA 1OCRB 3OR7C 1AI4A 5H6QA 4QNHB 3CCQV 1JVMA 3CCLV 2P90A 3K3WA 3STLC 3LDDA 1YTFD 1E79G 3ABLB 1K3EA 4WFFA 3LNMB 1QLNA 1EZJA 5B1OA 2AHZA 4JAUA 5EBLC 1Q86W 1S0VA 1S5HC 1MG1A 3AG4B 3K08A 4FJCC 3CMEV 1K92A 5L3FA 3ASOC 2ZXWC 1GKFA 5CBFA 2YSUB 5H6RA 1G4YB 3HPLC 2HJFC 3W7UA 1RM1C 2EIMB 4J9YB 5H9CA 2OCCC 1LNQA 4RQFA 2H8PC 3M99B 4JASA 1FXKA 5LHGA 1H38A 1VQKV 3MHSC 4JYBA 4UVCA 3K06A 4JTCB 2XAGA 1JPXA 3SPJA 4J9ZB 1TUEB 2B5UA 2WLKA 4KUMA 1M57B 3RVYA 3CC4V 1QR9A 2OT5A 5B3SC 1PL0A 3K9AA 2ZDIC 5LGNA 3CCVV 2DYRC 2V7QG 5LHIA 3R65A 2XAJA 5B1BB 4L87A 3AG3B 1M57C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW V;  2QEX V;  1R73 A;  1S72 V;  1YI2 V;  1Q82 W;  1Q7Y W;  1QVG U;  3G71 V;  1VQ5 V;  1VQ8 V;  1VQN V;  1QVF U;  4WF9 V;  3CMA V;  3CD6 V;  3CCU V;  3I55 V;  3CXC U;  3CCQ V;  1K73 W;  1VQ7 V;  1NJI W;  1VQ4 V;  3G6E V;  3CCS V;  1M90 W;  3CCL V;  1KQS U;  2OTJ V;  1JJ2 U;  1YHQ V;  1YIT V;  3CPW U;  2D3O W;  1KD1 W;  3CC2 V;  1YJN V;  1VQK V;  4WFA V;  1Q81 W;  3CC7 V;  1VQM V;  1KC8 W;  3CCM V;  3G4S V;  3CCE V;  1K8A W;  3OW2 U;  1M1K W;  3CC4 V;  1VQO V;  2QA4 V;  2OTL V;  1VQ6 V;  3CCV V;  1K9M W;  1N8R W;  3CCR V;  1YJ9 V;  4WCE V;  3I56 V;  1VQP V;  1VQ9 V;  1Q86 W;  5DM6 V;  3CCJ V;  4WFB V;  1VQL V;  1YIJ V;  1W2B U;  3CME V; 
#chains in the Genus database with same CATH topology
 4JAV A;  4NTW A;  3OD4 A;  3M8A A;  2DYS B;  3L73 H;  1I5Y A;  3CE2 A;  1FJG B;  2V4D A;  4YJ3 B;  1JFF B;  1XEQ A;  4YJ2 B;  4U7N A;  2ZQM A;  4WFH A;  3OM3 B;  4JPR A;  4X66 O;  2Y69 B;  3SR2 C;  2QKA A;  2HHH B;  4RUF A;  2P4K A;  4B3T O;  3T1H O;  1PPJ H;  1AR4 A;  5BR8 O;  4JZG A;  2WPD G;  3ZIA G;  5CMU A;  5FPR A;  5KHI A;  2XAH A;  2JEX A;  5EC1 C;  3CC2 V;  3UQ8 A;  4X1Y A;  2PY5 A;  1V55 C;  5JQG A;  1SQQ H;  2ZM6 O;  3H1L H;  2H94 A;  4JYC A;  1NH2 D;  1S72 V;  3A2F A;  5D5P A;  3T1Y O;  4ZIB A;  3S3W A;  2BTO A;  3F7V C;  5CA1 A;  3IGA C;  3SYP A;  1FXK C;  5KHJ A;  2K1E A;  3OEE G;  4RQE A;  1SES A;  1P7B A;  2VQF O;  2KG7 B;  2YIB D;  2YIB A;  2MK3 A;  3OFN G;  3AG3 C;  2QJ1 A;  4IT5 A;  2EIK B;  3MAQ A;  2H3O A;  3ASN B;  1D5N A;  2VRZ A;  5JH7 B;  4JV5 O;  4IIJ A;  4PA6 A;  4DV6 O;  4RAI A;  1JR9 A;  4AHC A;  1KKD A;  4JI3 O;  1UJW B;  3E83 A;  1L0L H;  1OCZ B;  5LOV A;  4YJ3 A;  2Y0I A;  1URF A;  4X65 O;  2RCV A;  1Y74 B;  2MW2 B;  5EZY B;  4G2K A;  1YVW A;  1RP3 B;  2ZKO A;  4KP4 A;  3B4S A;  2UXB B;  1FXK B;  4DV1 B;  4X66 B;  5D5Q A;  3OT7 A;  2DYR B;  4EKW A;  5IE9 A;  1EFR G;  4JV5 B;  4L8J A;  3CCJ V;  4WFB V;  2XUM A;  3OAA G;  3Q4H A;  4WBN B;  2IJK A;  1YJW V;  2VQE B;  4X62 O;  2AZ2 A;  3RVZ A;  4QIW F;  3TXS A;  3CXC U;  1F4M A;  3SDL A;  2DQ0 A;  4F6R A;  4X64 B;  3SPG A;  1Q8I A;  3JD4 A;  3C3T A;  2OTL V;  3CYO A;  1ZL8 B;  2KSD A;  1R6N A;  2F23 A;  2JGU A;  1XMQ O;  4QE9 A;  5KLV H;  1WAZ A;  1OV9 A;  1BCC H;  2WLN A;  3CCU V;  1XL4 A;  4XDL A;  4PI2 A;  1Y66 A;  2QWN B;  4TSF G;  4GYC B;  3FFQ A;  1BE3 H;  4FLZ A;  5KX5 A;  2R9R B;  5KMG A;  3GVM A;  2F43 G;  4LFB O;  4GT1 A;  2X7R B;  4TUY B;  4D7T A;  4DV4 O;  5GON A;  1BQ0 A;  4JI4 O;  1WJZ A;  1Q82 W;  1NBM G;  4RO2 A;  4JF3 A;  4PA3 A;  3F7Y C;  1E1R G;  2EIJ C;  5ITZ B;  3JSN A;  2ZT9 B;  4MW3 A;  1GN2 A;  2YI9 A;  3R66 A;  3H1I H;  3JAK B;  5BY1 A;  2LFR A;  2QKS A;  1XBL A;  2LW7 A;  3SYC A;  3TGU H;  4DK1 A;  3U0Z A;  3APO A;  4TUY A;  4I50 A;  2EIN B;  5IWA O;  3EXA A;  2GTS A;  3QF7 A;  2FKX A;  1YIT V;  4K8X A;  3TCU A;  4Q20 A;  3SJB C;  4K3A A;  3DC5 A;  5B1A B;  4HZ3 A;  2VS0 A;  1YDX A;  2AZ0 A;  4BWA A;  4BIU A;  3FB6 C;  5LMN B;  2RJZ A;  1KKC A;  2XAS A;  2KB1 A;  1HR0 O;  1TGO A;  1QVF U;  4IGG A;  3E89 A;  4X65 B;  4QJF B;  4PDL A;  5KAI Z;  2IJH A;  3C3S A;  3ETD A;  2ADP A;  1G6U A;  5A9G A;  4JI0 B;  1KP3 A;  1RFY A;  3THO A;  2CTP A;  3HR0 A;  1QLE B;  4ABM A;  1NVP D;  1N0N A;  2Y4T A;  4NR1 A;  2OYQ A;  2YIA A;  1L0N H;  1AR5 A;  4LWS B;  3E8H A;  3AG1 C;  5IDJ A;  1WNS A;  5IYC O;  4RUE A;  4IYI A;  4LCU C;  1N32 O;  4I55 B;  4DRX A;  5AG2 A;  2OTJ V;  1JJ2 U;  2GSM B;  3ZRS A;  5LP6 A;  2L6L A;  2OIG A;  1U97 A;  3STZ C;  2HFE C;  4BW9 A;  2FL4 A;  3RFR A;  2QM4 A;  1W2B U;  4B3R O;  3ZS8 C;  2XTA A;  4LFB B;  2IH3 C;  1SZT A;  2F4V O;  2DQ3 A;  3AK3 A;  3H1H H;  4UCT A;  2ZIN A;  5L3B A;  3QG5 A;  3CS5 A;  5LMU O;  3AG1 B;  2EIJ B;  2P6J A;  3ETE A;  2ZR2 A;  3OW2 U;  4DR1 B;  4OX9 O;  3VQX A;  3ZMS A;  2UXD O;  5LYJ A;  4WFE A;  5KAF Z;  3VBB A;  1WN7 A;  5EC2 C;  4TT3 G;  1TVK B;  4HYO A;  1BSM A;  2ZM6 B;  4YY3 O;  2P4V A;  1KB9 F;  1O9H A;  4LF5 O;  5J2U B;  4W4L A;  1Z2G A;  5JH7 A;  3E22 A;  3FB7 C;  1BHB A;  3TK1 A;  2F4V B;  2HLD G;  2CH7 A;  4DR3 B;  3X2Q C;  4LF4 O;  2OIE A;  2V1D A;  2PZS A;  4LP8 A;  1EN6 A;  5LMU B;  4DUZ O;  1SQV H;  3IC9 A;  1Q43 A;  4B3M B;  2RNB A;  1WA8 B;  4DV5 O;  2P67 A;  2D3O W;  4UV8 A;  4FIP C;  3H9V A;  4FM0 A;  5E1A C;  4LF4 B;  2EIL C;  4I7Z B;  3ABT A;  1WPB A;  5CB4 B;  1YCI A;  5LGU A;  4HNA A;  2Q6A A;  1GMG A;  3ZHQ A;  5H6Q A;  1YEW A;  1MZE A;  1JVM A;  1PM9 A;  2LJ2 A;  1CXZ B;  3LDD A;  4WFF A;  1Y76 B;  4U3F H;  3JAM N;  1QLN A;  1EZJ A;  3HKE A;  4TQF A;  4JAU A;  4DUY O;  4JI2 O;  1FFX A;  3AG4 B;  4WBN A;  3ZHT A;  3ASO C;  1L8D A;  3OTO O;  2ZXW C;  1GKF A;  1G4Y B;  1RM1 C;  4JAA A;  1OJH A;  1ZL8 A;  5H9C A;  1LNQ A;  1YXB A;  5LHG A;  2GBO A;  1XOU A;  2XAG A;  1JPX A;  2WLK A;  4KUM A;  3DXR A;  2OT5 A;  1PL0 A;  2ZDI C;  5LGN A;  1DGS A;  2V7Q G;  3CJH A;  3CRR A;  3R65 A;  3AG3 B;  2CGO A;  3WB0 A;  1M57 C;  5LL6 Y;  4FLY A;  3UO3 A;  2UXN A;  4MS2 A;  3SJC C;  4MVO A;  2CTW A;  2UXC B;  3HKE B;  3ZHU A;  3T2M A;  3BAB A;  1BMF G;  3CCS V;  4IHJ A;  1B6Q A;  2YEV A;  2Q4P A;  3E8G A;  5DEC A;  2WA3 A;  4YY3 B;  1H8H G;  5IJ0 A;  4PDM A;  1F51 A;  3CRQ A;  1SQB H;  3ABM B;  3EVK A;  1ZWI C;  4NXM O;  4FLU A;  3CD6 V;  1XNQ B;  3L74 H;  3F5W C;  3C90 A;  4W4K A;  4K0K O;  2JS5 A;  4DR7 O;  1CP9 A;  1IBL O;  4LFC O;  2YUA A;  1Q5O A;  1VQ6 V;  4DV3 B;  2YI8 A;  3JD0 A;  1RPR A;  3K5L A;  1RSO B;  2PTM A;  2DJV A;  2QSA A;  3SJA C;  1B04 A;  4AQY O;  3UT5 B;  3T4Z A;  1VQ5 V;  1FXH A;  4CS2 A;  2Q7H A;  3WFV A;  1RPO A;  2ZE6 A;  1VP7 A;  4JI5 B;  2UUC B;  3BY6 A;  4EFB A;  5FL7 G;  1EN4 A;  5C8Y A;  3WG7 C;  1R3L C;  4DR7 B;  4B3R B;  4FLW A;  2IU3 A;  2LQT A;  2W6J G;  5IYZ A;  2JK5 C;  4G28 B;  1H2S B;  4PHZ A;  3RW0 A;  4R7C A;  2E74 B;  3K79 A;  2Q8V A;  2GHY A;  4DR2 B;  4TWK A;  3ZHV A;  3DSQ A;  2EIN C;  3N2K B;  4I4T A;  1H2G A;  3JAL B;  3BFR A;  1Y76 A;  5LA6 B;  4GZR B;  2JRI A;  3G67 A;  1CEZ A;  1AI7 A;  2BSK A;  2QWR B;  1TUB B;  4NB5 A;  2UUA B;  5KMG B;  1S5J A;  3JAS A;  3HKC B;  1IBK O;  3CXH F;  1GO3 F;  4KFM A;  1D5A A;  5CBG A;  1J5E O;  2RDC A;  1IX9 A;  2DE0 X;  5EBW C;  4GX0 A;  2XAF A;  2CDY A;  2IU0 A;  1VQ4 V;  1KMI Z;  1L1F A;  3E8F A;  1IBM O;  4MSW C;  2HHH O;  1FS0 G;  2R9A A;  3IC7 A;  3GWO A;  1IVS A;  4U3J B;  4LF5 B;  2WLL A;  1KEC A;  1KUQ A;  3N2K A;  2YID A;  3ZED A;  3L71 H;  1K73 W;  1US6 A;  2WWW A;  3RYC B;  2YC0 A;  4MVU A;  1Y74 A;  2ODM A;  1NJI W;  1P49 A;  1SS3 A;  2PF4 E;  5CB4 A;  1NTK H;  2FB5 A;  1NQT A;  2DOS A;  1IBL B;  2A3Q A;  4FK5 C;  2CGN A;  1VF6 A;  1D2D A;  4MTX A;  5EBM C;  5KUK A;  3O65 A;  2PYL A;  3KZI Z;  1YIJ V;  2CE4 A;  4I4T B;  4PJ0 Z;  2Q0O C;  1R3K C;  5KUM A;  3ABK B;  4LFC B;  1R3I C;  1ZLZ A;  3EHB B;  1NS1 A;  1H2M A;  1ARO P;  3MHH C;  5KHG A;  4J7J A;  3ZHR A;  1QR8 A;  1WLE A;  1HWY A;  3AG2 C;  4YIO A;  4LC1 A;  1B3Q A;  1S76 D;  4GX1 A;  2Q7G A;  1G1X B;  2DN9 A;  3W7S A;  3QO7 A;  2ZIM A;  2WLL B;  5CA1 B;  5LXT A;  4JI8 B;  4JI0 O;  4CS3 A;  1PV0 A;  2EIM C;  3BCC H;  4YIP A;  1ROP A;  2ZE8 A;  2QR4 A;  2DWE C;  1OZ0 A;  4CBC A;  4KHP O;  1HNZ B;  5FPO A;  3UO2 A;  3A0B Z;  5E79 Z;  3L72 H;  3K5N A;  2PGG A;  2UXC O;  2YXH A;  5ITZ A;  2QWQ B;  4X1Y B;  2GV9 A;  1LUV A;  4PDV A;  1FD9 A;  4DV3 O;  1F23 A;  2EIK C;  2VWJ A;  1HNZ O;  4QGP A;  1WPX A;  5L3G A;  4TV8 A;  4UUJ C;  2QEX V;  3HKC A;  4FZ0 A;  2JJ2 G;  1QVG U;  4LWS A;  1ZAU A;  3KCY A;  4BR6 A;  1JOY A;  4I0X A;  3JAW B;  4P2Z A;  2E75 B;  3VOU A;  3HKB B;  2AGA A;  3CCE V;  2E3C A;  1OCZ C;  3WB2 A;  2QDO A;  3HKD B;  5EK0 A;  5JCO A;  3QVN A;  2E5L O;  4O4J B;  3G71 V;  2NLJ C;  2X0L A;  3AK1 A;  4NVP A;  4LF9 O;  3FB5 C;  2L35 A;  3JCZ A;  1KQS U;  1JMK C;  1RM1 B;  1XIL A;  1VMG A;  4P30 A;  2ZNJ A;  2UUC O;  1P4R A;  3ZX6 A;  4TV9 B;  4WCE V;  3ASN C;  4I9Q A;  1QCE A;  2AW9 A;  2HVJ C;  2R70 A;  4DV0 O;  1R6K A;  1Q6U A;  1V54 C;  4B7K A;  4UB8 Z;  3D3I A;  2DMX A;  3QO5 A;  2YEV B;  4F6E A;  1QBZ A;  3B09 A;  3A8T A;  1AP6 A;  3CC7 V;  3P3N A;  1G8M A;  2JIZ G;  5C93 A;  4MTF A;  2IW5 A;  1N0J A;  2Q69 A;  2JJ1 G;  1PNM A;  1BS3 A;  5LMN O;  3VQV A;  4O4I A;  4ASU G;  1VQL V;  2F95 B;  5CA0 B;  1TVK A;  2WLI B;  1K5Q A;  3ZRW B;  4X64 O;  5J2T B;  3FYE B;  4Q6G A;  4CZZ A;  4FFK A;  3QO8 A;  3OGI B;  5IWA B;  5B1N A;  1SKV A;  2UXD B;  2FYU H;  2PI4 A;  2HJD A;  2HP8 A;  3AEI A;  2Q9L A;  3BEH A;  4J7Z A;  3JD3 A;  3DTU B;  4DR6 B;  2Q67 A;  4ZBM A;  3SPC A;  3X2Q B;  4FZ1 A;  1JFF A;  5CBH A;  3ZMV A;  2F66 C;  4KXR A;  3ABK C;  2UXX A;  4GKK O;  3E35 A;  1I7F A;  1YF2 A;  4LNU A;  4U7O A;  1SA0 A;  2QA4 V;  1KU9 A;  2BSK B;  2QTO A;  3D36 A;  3QTC A;  3K9S A;  1CPY A;  1H8E G;  1Z5V A;  4X1I A;  3JAS B;  4O4L A;  1OCR B;  3OR7 C;  5IJ9 B;  1Y67 A;  2QKC A;  2JGD A;  2P90 A;  1IXB A;  3ABL B;  4UB6 Z;  5BMV B;  3LNM B;  4U3J A;  4ZI7 A;  5B1O A;  1Q86 W;  1S0V A;  2P5O A;  3K08 A;  3BA8 A;  1K92 A;  4LNU B;  1GAX A;  2YSU B;  5H6R A;  1WB8 A;  3HPL C;  3W7U A;  1MMM A;  4J9Y B;  2OCC C;  2H8P C;  4JAS A;  1Q3E A;  1FJG O;  1FXK A;  1VQK V;  1TA8 A;  4IL6 Z;  4JTC B;  4DW0 A;  3SPJ A;  2B5U A;  4IIJ B;  3RVY A;  3CC4 V;  5B3S C;  3K9A A;  3CCV V;  1SQP H;  4X20 B;  4PD4 F;  1HNW B;  1Q6I A;  1PL4 A;  3ICX A;  5B1B B;  4L87 A;  4DUZ B;  4O2A A;  1NU1 H;  4LH7 A;  4LBE C;  4LF8 O;  5JQG B;  4JI7 O;  4DYL A;  1FKA O;  1K33 A;  2HG5 C;  4FPP A;  1DK1 A;  1K5S A;  3L75 H;  3E2E A;  4GX2 A;  5CA0 A;  1ORQ C;  1NT2 B;  2QWP B;  3OMI B;  4FM1 A;  1COW G;  2KQX A;  2O57 A;  5DM6 V;  2ZDI A;  1R6T A;  1NZ6 A;  5IY5 B;  1BT8 A;  1U96 A;  4UCS A;  4JI3 B;  1VQN V;  1R3J C;  2KKW A;  2F1M A;  2ZE7 A;  3ZMU A;  3EFF K;  3D3Q A;  4X89 A;  3JAT A;  2WLJ A;  4GKJ O;  2HEP A;  3I5D A;  4X1K B;  5LYJ B;  3KG2 A;  3I56 V;  4I0X B;  1JX9 A;  3BAA A;  4LF6 B;  4EEQ A;  4PA7 A;  1OCO C;  2JGD B;  1YHQ V;  3CPW U;  2W6I G;  3RGB A;  1K8A W;  1ZX3 A;  3S3X A;  2BE3 A;  2WLM A;  1XUQ A;  2G38 A;  2HR3 A;  3LDC A;  1BGY H;  2EJR A;  1MSD A;  4TV8 B;  5KX5 B;  2HKO A;  3TET A;  4E2L A;  3IFX A;  4OPA A;  4MW8 A;  4DV1 O;  4MVR A;  2JVD A;  3T4D A;  4J41 A;  4C7U A;  2CUG A;  4I50 B;  4R8C A;  2ITD C;  1TUB A;  1ENV A;  1N8R W;  3CCR V;  2Z3Y A;  3T1C A;  3ZBH A;  3JAR B;  4B3M O;  3ZN1 A;  4JI1 O;  4LF7 B;  3LSS A;  4GLX A;  2ZR3 A;  3WB1 A;  2FTK A;  4J10 A;  1H2K A;  1GM8 A;  1SRY A;  2OCH A;  3KKY A;  3B8M A;  3CCM V;  3AG4 C;  4X8A A;  5LXT B;  1SZX A;  1KP2 A;  1SF9 A;  1K9M W;  3FD9 A;  4JI6 O;  3ZCC A;  2XHB A;  4X20 A;  4O4I B;  4LR3 A;  1SER A;  3CX5 F;  1GRJ A;  1AJN A;  1N33 O;  1R73 A;  4JI7 B;  2WAM A;  3JAK A;  3U11 A;  3HB3 B;  3WG7 B;  1VAR A;  4B3S O;  1NR7 A;  1OCR C;  3B8N A;  5JVD B;  4DV0 B;  1M56 B;  1WB7 A;  2LFS A;  1GN6 A;  2UU9 O;  5J9P C;  1EBO A;  4Z1V A;  4K0K B;  5EIB C;  5IJ0 B;  4X9Q A;  4DV2 O;  1VF5 B;  4LF6 O;  1X4T A;  4J42 A;  2EZP A;  1AVM A;  1Q7Y W;  1SC5 B;  2ATK C;  3VQW A;  3M7M X;  1THZ A;  4PV1 B;  4UVA A;  1MOF A;  3G4S V;  4X1I B;  5KHK A;  5GW7 A;  4DR6 O;  1XRE A;  2Q5Z A;  2Q68 A;  4F4L A;  4OGQ B;  2XOK G;  4G27 B;  4UCV A;  1SET A;  4TQD A;  5B3S B;  2XAQ A;  4PI0 A;  1Z5W A;  3AK2 A;  3RYF B;  1VIB A;  3UM7 A;  3ZJZ A;  2WSS G;  2K9P A;  4OXS A;  4DV5 B;  1PD3 A;  2DWD C;  4MVM A;  4O4L B;  1UPG A;  4DR5 B;  4FVM A;  1DF5 A;  3K04 A;  4P9P A;  4DO2 A;  4X62 B;  4AIL C;  1GN4 A;  5H5N A;  1QHT A;  4A5U B;  1ZUQ A;  1K4D C;  1YTF B;  1V55 B;  2YXY A;  2P22 C;  4CH3 A;  4B08 A;  1SQX H;  5FNV B;  4ZOL A;  4PEL A;  2EJ7 A;  2VQE O;  1V54 B;  1AI5 A;  3LUT B;  1W0J G;  4MT8 A;  1E1Q G;  1XI1 A;  1SA0 B;  3ABM C;  4I9W A;  1HDJ A;  3H01 A;  4I5S A;  2XT9 A;  5LOV B;  3UT5 A;  2GUZ A;  1GM9 A;  1WA8 A;  5CN0 A;  5IYB O;  4K8Z A;  5LBQ A;  3IAY A;  3DC6 A;  4UV9 A;  4HNA B;  4PA9 A;  4FLV A;  3GWK C;  2WLI A;  4JGS A;  4NTY A;  1AIL A;  2DW4 A;  2OCC B;  2R72 A;  5BR8 B;  2R9I A;  1M9N A;  3OMN B;  3E8B A;  5LGT A;  4FLT A;  1S5L Z;  4FM2 A;  5JVD A;  4CC6 A;  4DV2 B;  1XL6 A;  3SYA A;  4Z1M G;  4XDK A;  4P9O A;  2ZNI A;  2DYS C;  1Q81 W;  5HFL A;  1W59 A;  3J7A U;  3OUF A;  1OCC B;  2Q7E A;  5KA5 A;  4FLX A;  4R50 A;  5JCO C;  5J2U A;  2BTQ B;  3RYC A;  2EBO A;  3N27 A;  2QWO B;  2AXT Z;  2Y48 A;  5KA6 A;  3NR7 A;  4ZHQ A;  4YHH O;  2GTA A;  4GKJ B;  5L3D A;  1AP5 A;  1XQ8 A;  3JCU Z;  2Y4U A;  3K03 A;  2F93 B;  3OTF A;  4TV9 A;  1XMQ B;  3ZRV A;  4DR4 B;  1AI6 A;  5LP6 B;  5BMV A;  3K57 A;  5IT9 N;  1IZ3 A;  5A2Q N;  3HKB A;  1VQ8 V;  3CRA A;  3DXR B;  1IXM A;  1ZSP A;  5K1X A;  4ZOL B;  4DK0 A;  1FFX B;  1FAF A;  1KD1 W;  3ABU A;  4WFA V;  5IYD O;  1IDS A;  3PJS K;  1AJP A;  4MVS A;  2A7W A;  5CA3 A;  3L70 H;  1J95 A;  2W0F C;  3E86 A;  1JCH A;  5LHH A;  3SPI A;  3BRC A;  3P3P A;  2QE7 G;  1N34 B;  4J11 A;  4H13 B;  3H1J H;  2CTQ A;  5L3C A;  4EB6 A;  3G6E V;  4E4E A;  4DR2 O;  4UFZ A;  3Q4H B;  1MZF A;  2BTQ A;  1LUW A;  4MVQ A;  4LFA O;  1I0H A;  4AI8 A;  3H1K H;  3ASO B;  2N05 A;  4HBN A;  4GUN A;  5FLX N;  4QNH B;  3CCL V;  3K3W A;  1ZTE A;  1YTF D;  1E79 G;  4KL1 A;  1K3E A;  1VF7 A;  1Q6H A;  2RMK B;  1SQG A;  1Y6X A;  4EFE A;  3CB2 A;  2N74 A;  1S5H C;  1MG1 A;  4FJC C;  3CME V;  2B9Z A;  3JSL A;  3CRC A;  5CBF A;  1XHZ A;  1TAE A;  3FAV B;  2HJF C;  4LFA B;  2EIM B;  4RQF A;  3M99 B;  1XHX A;  3K06 A;  4UVC A;  1IUR A;  1TUE B;  4IYH A;  2DYR C;  3CWB H;  2JS3 A;  5LHI A;  2XAJ A;  2KG7 A;  3N2G B;  2M6Y A;  1NVP B;  3E22 B;  5DED A;  2X6B A;  3RYI B;  2X6C A;  3RBZ A;  1XMO B;  4CC5 A;  1K97 A;  2W0X A;  1FYJ A;  1GTO A;  2YS8 A;  4H0L B;  4ZKI A;  1NH2 B;  4JYA O;  4N21 A;  2LW1 A;  2BOC C;  4LH6 A;  3UKM A;  1M1K W;  2AHY A;  3ML0 A;  3SGI A;  5IJ9 A;  1VQO V;  1VF6 C;  4CS4 A;  3UCS C;  3CP1 A;  2PUS A;  4FMT A;  2XND G;  2ITC C;  3K58 A;  1HW7 A;  2OWO A;  4O4J A;  4BAY A;  3RYH B;  4JI5 O;  2ZXW B;  1M90 W;  4BW5 A;  1S77 D;  2CTR A;  2IH1 C;  2P7T C;  4UXN A;  4XDJ A;  4ICG A;  1K34 A;  5HFM A;  1VQ9 V;  1VQP V;  3OR6 C;  2Q0A A;  1Y4M A;  4BIZ A;  1EZV H;  5JWP A;  3WU2 Z;  5L3E A;  4JYY A;  1PP9 H;  1H2N A;  4YXW G;  1GH6 A;  3RYF A;  3ZRW A;  4TOI A;  5TIS Z;  5FNV A;  3D8C A;  1XNQ O;  2NNU A;  4JI6 B;  4J80 A;  1UFI A;  4R6Z A;  3FB8 C;  1BL8 A;  3LSQ A;  1DTO A;  3RYI A;  4H33 A;  1YJ9 V;  3ZRX A;  1BHA A;  4UCR A;  5EYP B;  3MD0 A;  2E5L B;  2JDI G;  4MTG A;  2LO1 A;  1XNR O;  1YI2 V;  3W7W A;  1LR1 A;  4JTD B;  1HNX O;  2QM7 A;  4DV7 O;  5J2T A;  2EZO A;  5JJN B;  1NI8 A;  3B2E E;  2Y69 C;  4HAM A;  3B40 A;  3APQ A;  2IM9 A;  3GB7 C;  4BIO A;  1JQ0 A;  3K5M A;  4DR3 O;  3W7T A;  1DF4 A;  1EM1 A;  2B1I A;  4K35 A;  1F4N A;  5IYZ B;  1QU7 A;  5B66 Z;  3P32 A;  3B77 A;  4NYK A;  5K1P A;  1RSO A;  3W7X A;  3NXS A;  4WFG A;  4CH6 A;  4GX5 A;  1V9P A;  1W0K G;  1AB3 A;  4EB6 B;  1MA1 A;  1K4C C;  3ETG A;  2Z5U A;  4JYA B;  4DXW A;  2EIL B;  4JTA B;  2BOB C;  4D6T H;  4KHP B;  3BA9 A;  3RWR D;  4WF9 V;  1M56 C;  3K0D A;  3L9D A;  4IHJ B;  5EYP A;  3PN1 A;  3SPH A;  2NR5 A;  2ZE5 A;  2LP7 A;  2VWK A;  3HKD A;  3P30 A;  4O2B B;  4O2A B;  4JZ2 A;  4JI2 B;  4N23 A;  5BXZ A;  3BHP A;  2Y0P A;  4XBF A;  3ZMT A;  3ZMZ A;  3CMA V;  3T1H B;  1YZB A;  1N36 O;  4J7K A;  4NXN B;  2UUB O;  4X88 A;  2Q73 A;  2YXL A;  1MAB G;  3U10 A;  1YJN V;  3OE7 G;  2GDS A;  3K59 A;  1QNM A;  5EIB D;  1GK9 A;  4JI1 B;  3JAW A;  4LF7 O;  3ZHS A;  2JEU A;  4LF9 B;  1VEW A;  2ETN A;  2ZIO A;  1I08 A;  1B06 A;  4H37 A;  3SYQ A;  4NXN O;  1VQ7 V;  1QQC A;  3CSX A;  3ETQ A;  2QGN A;  1XDC A;  3SYO A;  1N32 B;  1XNR B;  1BQZ A;  1KBH A;  4DW1 A;  2Z0A A;  2LGW A;  4X1K A;  4UVB A;  3SJQ C;  4NKG B;  1NKD A;  1N36 B;  1N33 B;  5GTH Z;  2LGQ A;  3JD1 A;  3OMA B;  2IJJ A;  4PA4 A;  3JD2 A;  3LSU A;  4YHH B;  3G80 A;  2M7W A;  2RQ6 A;  4DUY B;  3LDE A;  1NTM H;  3JAT B;  4GCZ A;  4PDR A;  3OTO B;  4CH4 A;  4MVZ A;  4DR4 O;  4JI4 B;  1IBK B;  4DR5 O;  3FKS G;  3D36 C;  1MSW D;  5GTI Z;  3KCX A;  5JJJ B;  1PKX A;  3A0R A;  2WLH A;  1PNL A;  2EX3 A;  4FFB B;  4MTO A;  1NTZ H;  3N2G A;  1P7G A;  2N04 A;  1QLE C;  4ZI7 B;  2UXB O;  2PI5 A;  4NXM B;  3VQY A;  3OUS A;  3J81 N;  2A0L A;  3ZN0 A;  1J5E B;  2B1G A;  1OCO B;  2E76 B;  1BZK A;  1GM7 A;  3FAV A;  5DN6 G;  3G6B A;  3K0G A;  2ILM A;  1GN3 A;  2PYJ A;  2CK3 G;  4LF8 B;  1A32 A;  1VQM V;  3FX7 A;  5JJE B;  3O9O A;  3RN4 A;  1XMO O;  2ZD9 A;  3LNN A;  3RYH A;  4B7E A;  2A9H A;  1N34 O;  1DLB A;  1WP8 A;  1FXV A;  3CEI A;  5B5E Z;  4DV7 B;  3MDS A;  3AG2 B;  1OHH G;  4UCO A;  3QNE A;  5KHH A;  1NR1 A;  1Q90 D;  1K7D A;  1WP7 A;  3CRM A;  3I55 V;  5EZY A;  4F6R B;  3K5O A;  4QPK A;  4I55 A;  4DRX B;  2UUB B;  1FFT B;  1P84 F;  1FPO A;  1IBM B;  1T5E A;  2IBZ H;  4QPJ A;  5BZB A;  3CHX A;  1YSC A;  2YIC A;  1HP8 A;  4B3S B;  1KC8 W;  1N4C A;  2X6A A;  3DGE A;  3TXQ A;  1O9G A;  3JAL A;  4YJ2 A;  5LA6 A;  1S3J A;  1EN5 A;  2A79 B;  4JI8 O;  1HR0 B;  1PNK A;  3OGC C;  3ABL C;  3OEH G;  5B1A C;  3RT3 C;  2YDE A;  4ZHQ B;  2ADQ B;  5C8Y B;  3JYC A;  3FYI B;  2A06 H;  4Z2W A;  2CAZ C;  4B3T B;  2WA4 A;  3BPZ A;  5F2V O;  5IY5 C;  1M5I A;  4CH5 A;  2QM8 A;  4O4H B;  4NTX A;  3J80 N;  1HNW O;  3TJT A;  2QTS A;  4RWU A;  4GKK B;  2VQF B;  4QE7 A;  4FFB A;  2C2A A;  3AG7 A;  2D2C B;  1OCC C;  2IJI A;  1SQF A;  1AR1 B;  1R1B A;  2CH7 B;  5B1B C;  5GON B;  1M4U A;  2HVK C;  2RN9 A;  2NN4 A;  1JA8 A;  1I5X A;  4H44 B;  1HNX B;  1H2L A;  3IJ4 A;  1M93 A;  3F5T A;  1AJQ A;  1AI4 A;  3CCQ V;  4D7S A;  4UCU A;  4DV6 B;  3STL C;  3T1Y B;  4AQY B;  1F7Y A;  1X59 A;  4DV4 B;  1I94 O;  5LP6 C;  2AHZ A;  5EBL C;  4DR1 O;  4OX9 B;  1KYO F;  2ZCE A;  3A0H Z;  1MNG A;  5L3F A;  2GUZ B;  2ARH A;  3JAR A;  3BVO A;  2FML A;  1H38 A;  3MHS C;  4JYB A;  1I94 B;  4O4H A;  2EUL A;  4J9Z B;  2P06 A;  1M57 B;  2UUA O;  4OPH A;  1QR9 A;  3CJH B;  2UU9 B;  1JJO A;  4O2B A;  2BCC H;  5H2F Z; 
#chains in the Genus database with same CATH homology
 4JAV A;  2UXN A;  4MS2 A;  1NVP B;  4MVO A;  2X6B A;  2DYS B;  2X6C A;  4LBE C;  3RBZ A;  1K97 A;  3T2M A;  1BMF G;  3CCS V;  1B6Q A;  1GTO A;  1I5Y A;  1K33 A;  2HG5 C;  2YEV A;  4FPP A;  4ZKI A;  3E8G A;  1NH2 B;  1K5S A;  4N21 A;  3E2E A;  4GX2 A;  2BOC C;  4U7N A;  1ORQ C;  3UKM A;  3OMI B;  1M1K W;  1H8H G;  2AHY A;  2ZQM A;  3ML0 A;  1VQO V;  1COW G;  4PDM A;  4WFH A;  1F51 A;  3OM3 B;  4JPR A;  2Y69 B;  5DM6 V;  4RUF A;  2ZDI A;  3CP1 A;  3ABM B;  5IY5 B;  4FMT A;  1ZWI C;  2XND G;  2ITC C;  1VQN V;  4BAY A;  1R3J C;  3CD6 V;  2WPD G;  3ZIA G;  2ZXW B;  5CMU A;  1M90 W;  3ZMU A;  3EFF K;  2XAH A;  2JEX A;  3F5W C;  5EC1 C;  3CC2 V;  4BW5 A;  1S77 D;  2IH1 C;  4X89 A;  2WLJ A;  2P7T C;  4UXN A;  4XDJ A;  1CP9 A;  1V55 C;  1K34 A;  1VQ6 V;  5HFM A;  1VQ9 V;  3I56 V;  3KG2 A;  1VQP V;  3JD0 A;  3OR6 C;  1RPR A;  1JX9 A;  1Y4M A;  4BIZ A;  2H94 A;  4JYC A;  1NH2 D;  5L3E A;  1S72 V;  3T4Z A;  4PA7 A;  1VQ5 V;  4YXW G;  1FXH A;  3F7V C;  3IGA C;  3ZRW A;  3SYP A;  1OCO C;  1FXK C;  3WFV A;  1RPO A;  2NNU A;  2K1E A;  3OEE G;  3BY6 A;  4RQE A;  1YHQ V;  3CPW U;  1SES A;  5FL7 G;  3WG7 C;  1P7B A;  4R6Z A;  2W6I G;  1R3L C;  2MK3 A;  2IU3 A;  3FB8 C;  3OFN G;  1BL8 A;  3AG3 C;  2W6J G;  1DTO A;  2WLM A;  3LSQ A;  1K8A W;  4H33 A;  2HR3 A;  2JK5 C;  4G28 B;  1YJ9 V;  3LDC A;  3ZRX A;  2EJR A;  1BHA A;  3MD0 A;  2EIK B;  2JDI G;  4MTG A;  3RW0 A;  4R7C A;  3ASN B;  2HKO A;  3K79 A;  3TET A;  1YI2 V;  3W7W A;  4E2L A;  2GHY A;  3IFX A;  4JTD B;  2QM7 A;  4TWK A;  4PA6 A;  4MW8 A;  2EZO A;  4MVR A;  2EIN C;  4RAI A;  3T4D A;  1H2G A;  2Y69 C;  4HAM A;  1CEZ A;  4R8C A;  1AI7 A;  1KKD A;  2ITD C;  1ENV A;  3GB7 C;  1N8R W;  3CCR V;  1JQ0 A;  2Z3Y A;  1UJW B;  3T1C A;  3W7T A;  1DF4 A;  3E83 A;  3ZN1 A;  2B1I A;  1OCZ B;  3LSS A;  1F4N A;  2ZR3 A;  5CBG A;  1GO3 F;  4KFM A;  2FTK A;  5EBW C;  4G2K A;  4GX0 A;  2XAF A;  3P32 A;  2IU0 A;  1VQ4 V;  1L1F A;  3B77 A;  3E8F A;  4KP4 A;  1GM8 A;  1SRY A;  1FXK B;  4MSW C;  1FS0 G;  3W7X A;  3B8M A;  3CCM V;  3IC7 A;  3NXS A;  3AG4 C;  4X8A A;  2DYR B;  4WFG A;  4EKW A;  3GWO A;  2WLL A;  1KP2 A;  1EFR G;  4GX5 A;  1KEC A;  1W0K G;  1K9M W;  1K4C C;  3ETG A;  3ZCC A;  2Z5U A;  3CCJ V;  4WFB V;  1K73 W;  4DXW A;  3OAA G;  1YJW V;  1SER A;  2IJK A;  2EIL B;  1AJN A;  2BOB C;  1R73 A;  4JTA B;  2WAM A;  3HB3 B;  2WWW A;  3WG7 B;  4MVU A;  3RVZ A;  4WF9 V;  1M56 C;  4QIW F;  1NR7 A;  3CXC U;  1NJI W;  3K0D A;  1OCR C;  1F4M A;  3B8N A;  2DQ0 A;  1NQT A;  1M56 B;  3SPH A;  4FK5 C;  2LFS A;  5J9P C;  3SPG A;  1EBO A;  3JD4 A;  2LP7 A;  4MTX A;  5EBM C;  3P30 A;  5KUK A;  2OTL V;  3CYO A;  1YIJ V;  1R6N A;  4N23 A;  2EZP A;  4QE9 A;  1R3K C;  5KUM A;  3ABK B;  1Q7Y W;  2WLN A;  4XBF A;  3ZMT A;  3ZMZ A;  3CMA V;  2ATK C;  1R3I C;  1XL4 A;  3EHB B;  4XDL A;  3CCU V;  1THZ A;  1Y66 A;  4TSF G;  4X88 A;  1ARO P;  3MHH C;  1MAB G;  1YJN V;  2R9R B;  1QR8 A;  4UVA A;  1MOF A;  3OE7 G;  3G4S V;  2F43 G;  5GW7 A;  1WLE A;  1HWY A;  4GT1 A;  2X7R B;  3AG2 C;  4LC1 A;  2Q68 A;  4F4L A;  1GK9 A;  1S76 D;  2JEU A;  2XOK G;  4G27 B;  4GX1 A;  1SET A;  5B3S B;  2XAQ A;  4H37 A;  3W7S A;  1Q82 W;  3QO7 A;  3SYQ A;  1NBM G;  2WLL B;  4JF3 A;  4RO2 A;  4PA3 A;  3F7Y C;  1E1R G;  2EIJ C;  1VQ7 V;  3UM7 A;  2WSS G;  4OXS A;  3ZJZ A;  4MW3 A;  3SYO A;  2EIM C;  1PD3 A;  2DWD C;  1ROP A;  4MVM A;  2DWE C;  2LFR A;  2QKS A;  1OZ0 A;  1DF5 A;  3K04 A;  4P9P A;  4CBC A;  4DO2 A;  4UVB A;  3SJQ C;  1NKD A;  3SYC A;  1K4D C;  3JD1 A;  3OMA B;  1YTF B;  1V55 B;  2IJJ A;  4PA4 A;  3JD2 A;  2EIN B;  2M7W A;  4PEL A;  1YIT V;  1V54 B;  3TCU A;  3LDE A;  1AI5 A;  4Q20 A;  3LUT B;  1W0J G;  4MT8 A;  4PDV A;  1E1Q G;  4GCZ A;  5B1A B;  4HZ3 A;  4PDR A;  1F23 A;  2EIK C;  3ABM C;  4MVZ A;  4I9W A;  4BIU A;  1WPX A;  5L3G A;  3H01 A;  3FB6 C;  4I5S A;  3FKS G;  4UUJ C;  2QEX V;  1MSW D;  2JJ2 G;  2XAS A;  2KB1 A;  1QVG U;  1GM9 A;  1PKX A;  1QVF U;  5CN0 A;  3E89 A;  5IYB O;  3A0R A;  2WLH A;  4QJF B;  4PDL A;  1JOY A;  1PNL A;  5LBQ A;  4P2Z A;  4MTO A;  4UV9 A;  4PA9 A;  3VOU A;  2IJH A;  2WLI A;  3ETD A;  4JGS A;  1QLE C;  2DW4 A;  2OCC B;  3CCE V;  1OCZ C;  2PI5 A;  1KP3 A;  2R9I A;  3OUS A;  5EK0 A;  1M9N A;  3OMN B;  3E8B A;  5LGT A;  1QLE B;  2A0L A;  3ZN0 A;  1NVP D;  2B1G A;  1OCO B;  3G71 V;  2NLJ C;  2X0L A;  1GM7 A;  1XL6 A;  3E8H A;  3SYA A;  3AG1 C;  5DN6 G;  5IDJ A;  3FB5 C;  3K0G A;  4RUE A;  4XDK A;  4Z1M G;  4LCU C;  5IYC O;  1KQS U;  3JCZ A;  4P9O A;  2OTJ V;  1JJ2 U;  2DYS C;  2GSM B;  3ZRS A;  1RM1 B;  2CK3 G;  1Q81 W;  1VQM V;  4P30 A;  1P4R A;  3STZ C;  2ZD9 A;  5HFL A;  2HFE C;  2A9H A;  1DLB A;  3OUF A;  4WCE V;  3ASN C;  1OCC B;  1FXV A;  5KA5 A;  1W2B U;  3AG2 B;  4R50 A;  1OHH G;  1QCE A;  2HVJ C;  2IH3 C;  1SZT A;  1R6K A;  2EBO A;  2DQ3 A;  3QNE A;  2Y48 A;  1V54 C;  1NR1 A;  1K7D A;  3I55 V;  5KA6 A;  5L3B A;  4QPK A;  5L3D A;  3D3I A;  1FFT B;  3AG1 B;  2YEV B;  3QO5 A;  2EIJ B;  1QBZ A;  2P6J A;  3CC7 V;  3ETE A;  1G8M A;  2JIZ G;  3K03 A;  5C93 A;  4MTF A;  2ZR2 A;  3OW2 U;  2IW5 A;  4QPJ A;  5BZB A;  2Q69 A;  2JJ1 G;  1PNM A;  1YSC A;  3ZMS A;  4ASU G;  3ZRV A;  1VQL V;  1KC8 W;  2X6A A;  1AI6 A;  4WFE A;  3DGE A;  3VBB A;  5EC2 C;  4TT3 G;  1S3J A;  2WLI B;  1K5Q A;  1VQ8 V;  2A79 B;  3ZRW B;  1IXM A;  4HYO A;  1PNK A;  3OGC C;  3ABL C;  3OEH G;  5B1A C;  3FYE B;  4CZZ A;  1KD1 W;  3QO8 A;  3ABU A;  3JYC A;  5B1N A;  4WFA V;  5IYD O;  3FYI B;  3PJS K;  2PI4 A;  1AJP A;  3FB7 C;  1BHB A;  3AEI A;  3BEH A;  3TK1 A;  2HLD G;  5IY5 C;  3X2Q C;  4MVS A;  5CA3 A;  3JD3 A;  1J95 A;  3DTU B;  2V1D A;  2W0F C;  3E86 A;  1JCH A;  2QM8 A;  4LP8 A;  5LHH A;  2Q67 A;  4ZBM A;  3SPI A;  3SPC A;  3X2Q B;  2QE7 G;  5CBH A;  3ZMV A;  5L3C A;  3G6E V;  2P67 A;  3ABK C;  2D3O W;  4QE7 A;  2UXX A;  2C2A A;  4UV8 A;  3E35 A;  1OCC C;  4FIP C;  2IJI A;  4MVQ A;  4U7O A;  5E1A C;  2EIL C;  1AR1 B;  5B1B C;  2QTO A;  2QA4 V;  3D36 A;  3ASO B;  2HVK C;  3ABT A;  1I5X A;  1CPY A;  1H8E G;  5LGU A;  2Q6A A;  1GMG A;  1AJQ A;  1OCR B;  3OR7 C;  1AI4 A;  5H6Q A;  4QNH B;  3CCQ V;  1JVM A;  3CCL V;  2P90 A;  3K3W A;  3STL C;  3LDD A;  1YTF D;  1E79 G;  3ABL B;  1K3E A;  4WFF A;  3LNM B;  1QLN A;  1EZJ A;  5B1O A;  2AHZ A;  4JAU A;  5EBL C;  1Q86 W;  1S0V A;  1S5H C;  1MG1 A;  3AG4 B;  3K08 A;  4FJC C;  3CME V;  1K92 A;  5L3F A;  3ASO C;  2ZXW C;  1GKF A;  5CBF A;  2YSU B;  5H6R A;  1G4Y B;  3HPL C;  2HJF C;  3W7U A;  1RM1 C;  2EIM B;  4J9Y B;  5H9C A;  2OCC C;  1LNQ A;  4RQF A;  2H8P C;  3M99 B;  4JAS A;  1FXK A;  5LHG A;  1H38 A;  1VQK V;  3MHS C;  4JYB A;  4UVC A;  3K06 A;  4JTC B;  2XAG A;  1JPX A;  3SPJ A;  4J9Z B;  1TUE B;  2B5U A;  2WLK A;  4KUM A;  1M57 B;  3RVY A;  3CC4 V;  1QR9 A;  2OT5 A;  5B3S C;  1PL0 A;  3K9A A;  2ZDI C;  5LGN A;  3CCV V;  2DYR C;  2V7Q G;  5LHI A;  3R65 A;  2XAJ A;  5B1B B;  4L87 A;  3AG3 B;  1M57 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...