2QA4V

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2qa4V00
4WFBV 1VQMV 1YJWV 3CCUV 1QVGU 1KQSU 2QEXV 3CC7V 1Q82W 1N8RW 3CD6V 4WFAV 2OTJV 3G4SV 1VQ4V 1VQ9V 3CCRV 1YI2V 1VQLV 3CXCU 1S72V 1VQ8V 1YJ9V 3CCSV 3CCLV 3G71V 3CCVV 2OTLV 3CC4V 1K73W 3CC2V 1VQOV 1NJIW 1Q81W 1R73A 3CMEV 3G6EV 3CPWU 1VQ7V 3CMAV 1M1KW 1KC8W 1KD1W 1VQNV 1Q86W 1VQ5V 1VQPV 3I55V 3OW2U 2QA4V 1YIJV 1QVFU 1K8AW 3CCEV 1YHQV 1VQKV 1W2BU 3CCJV 3CCMV 4WF9V 4WCEV 1Q7YW 3CCQV 5DM6V 1JJ2U 1VQ6V 2D3OW 1YJNV 1K9MW 3I56V 1M90W 1YITV
chains in the Genus database with same CATH superfamily
2Y0PA 3T1YB 4AILC 4JI2O 5B1NA 4OPHA 1Z5VA 4DRXB 2QM8A 4IT5A 3FKSG 2JIZG 1JCHA 5CA1A 1WA8A 3C90A 3UQ8A 4IL6Z 1QVFU 2CTQA 5EBWC 2IH3C 4BIUA 5FLXN 4JV5O 3HKEA 1Z2GA 2CH7B 4RQEA 1RP3B 3E8BA 3THOA 4JAUA 4L8JA 1ZSPA 4O4IB 1YITV 1YTFB 1NKDA 4KHPO 5CB4B 1GN6A 2OIGA 4DV4B 2GHYA 3CJHB 2D2CB 3FAVB 3ETDA 3RYCB 3EXAA 1QR8A 2K1EA 3SPHA 1M9NA 1H2NA 3TK1A 4GZRB 5LXTA 2NNUA 4G28B 1RPRA 3H1LH 4LC1A 1QQCA 2Y4UA 3J81N 1SZXA 1VF7A 3RT3C 2UXCO 1AR4A 3RGBA 3O65A 5J2TA 2WA4A 3CCLV 4DV3B 3SR2C 5A9GA 1NQTA 3HKEB 3N2KA 4FM0A 2OYQA 3QO7A 4QPKA 1WP7A 4LF9O 2Q6AA 4X9QA 2YEVA 3I5DA 4P30A 1SQBH 1LNQA 1YZBA 2CDYA 2A7WA 4O4LA 4I55A 4DXWA 1K5SA 4LWSB 4BW5A 4I50A 3L70H 4CC6A 1IXBA 2N74A 4YHHB 1SQPH 3L71H 2K9PA 2YIAA 3CHXA 4DR5O 4FFBB 2IJIA 1XHZA 2EJ7A 2YXHA 3N2KB 1AI7A 3P32A 4DV7B 3LUTB 1AVMA 2KG7A 2HKOA 1WB8A 1F4MA 1H2LA 2OCHA 3SJCC 1AROP 1MG1A 2R9IA 5JH7A 5LMUB 2BE3A 2ZIOA 2VWJA 2FYUH 2YEVB 4PA3A 2UXBB 5CBHA 2JGDA 3QVNA 1SQGA 4X66O 3F5WC 1AI6A 4O4LB 5CA0A 1K92A 4I55B 3SYQA 1W59A 4I50B 3RYFB 4XDLA 3CRQA 3ZHSA 1FFXB 3RVZA 2Q5ZA 2IH1C 5LHHA 5CN0A 4FPPA 2MW2B 1H2MA 4B3SB 2YIBA 2D3OW 3I56V 4MT8A 5KX5A 4DR2B 1F4NA 3E83A 4DV2O 2DYSC 1VQ9V 3OFNG 4MVUA 3APQA 2KG7B 3K57A 1VIBA 3K04A 1H2KA 4K8ZA 4GX5A 3ZEDA 5EK0A 4FLYA 3C3TA 3K79A 1XMOO 4JTCB 2CAZC 4FLUA 4LF7B 2JGDB 3RN4A 3SJAC 1QLNA 4RQFA 5CA0B 2DYSB 5EYPA 2QSAA 4DV1O 2QR4A 2LQTA 4BWAA 3HB3B 2IU3A 4JAVA 2JEXA 1G4YB 1D5AA 5KX5B 3RYIA 2Q7GA 1NR1A 3ZMSA 2FMLA 2ZR3A 2AZ2A 5GTHZ 3E8GA 4PJ0Z 1GK9A 5BR8B 3OTFA 4UCSA 4EFEA 1VQ4V 1R6KA 2PGGA 1YJ9V 1M57C 1WN7A 4B3TB 4X64B 1FFTB 3HPLC 1URFA 3UKMA 1TUEB 4NR1A 4D6TH 4EFBA 4DV5B 1SZTA 2JVDA 1NH2B 1JMKC 5EYPB 3ABUA 4JI6B 3DTUB 4JASA 3AG1C 5GW7A 4UUJC 2XAJA 2PF4E 4GX1A 3TXQA 1GM9A 3OMIB 4PHZA 3RFRA 4AQYO 1QR9A 2P06A 3CCJV 1PKXA 2NLJC 1O9HA 1YDXA 2DWEC 1J5EO 1S0VA 1FYJA 3R65A 3WB1A 4J7KA 3CXCU 1BQZA 3M8AA 4B7EA 2OT5A 3WG7B 4F6RA 4YIOA 1R6NA 2GTAA 1YEWA 2LFSA 2JS5A 2UUAO 1BSMA 2JGUA 2Q0OC 1R3JC 4L87A 1K9MW 2JS3A 3WB0A 3D36C 2XHBA 5EC1C 2DQ3A 3OUFA 4B3RO 1US6A 1QU7A 3EVKA 3J80N 2P4KA 4YIPA 5LBQA 5C8YB 3JD3A 3UCSC 5BZBA 3ICXA 3SPIA 1ZL8B 4R50A 2BCCH 1FJGB 2QE7G 1IBKO 4JI4B 1M93A 1Z5WA 2BOCC 3ZIAG 4O4JA 1HR0O 4F6RB 1IBLB 4PA6A 2A0LA 1K34A 4KUMA 5LMNB 4YHHO 2L35A 4PDRA 3AK2A 5LA6B 1I94B 5DM6V 2UUBB 4X20A 4O2BA 3NR7A 3B8MA 5IJ9A 1K7DA 1DTOA 3G71V 1P7BA 3JD1A 1Q81W 3A8TA 4R8CA 4YY3B 4O2AA 4TV9A 3D3IA 5JQGB 1R3KC 4TV8A 4DV6B 4AHCA 3CCMV 1HNXB 4O4JB 1CEZA 3RWRD 1N8RW 1FKAO 1AB3A 5GTIZ 4I0XA 1VQLV 3QF7A 4PA9A 3JAMN 4LFBB 4LF5B 4B7KA 1JJOA 2RNBA 4GKJB 4XDKA 4UB8Z 5H6QA 1KC8W 1Y66A 5H2FZ 1TGOA 2XAFA 4X20B 2W0FC 4O2BB 1KKCA 4Q20A 3VOUA 2HFEC 3SYOA 5KA5A 4DR2O 4QIWF 4MVZA 3SYCA 5IJ9B 4YXWG 4I4TA 1QHTA 4UCUA 1CPYA 4R6ZA 1VF6A 2FB5A 1JPXA 4O2AB 2QKCA 4TV9B 1VQOV 3ZHUA 3L72H 5CA3A 3SPJA 4OX9O 3E86A 2CGOA 2Q68A 4NYKA 2JK5C 3OMNB 3BA9A 4DW1A 2W6IG 2ETNA 4X1IA 1N34B 3EHBB 4GUNA 4I0XB 4LH6A 2WLLA 1XNQO 5KHKA 4WFAV 4I9WA 1VF6C 1ZLZA 3DSQA 1XREA 5JVDA 1IX9A 4Z2WA 2ZM6B 1FD9A 1GN4A 2QA4V 5FPRA 3CCEV 4RWUA 5LHIA 3ZHTA 1VQMV 1PL4A 2X6AA 3O9OA 5EZYB 2E74B 1GH6A 4WFFA 1ZWIC 2P90A 2YIBD 3OGIB 1N33O 4WBNA 4FLTA 1N36B 4FLZA 4DR4B 3ASOC 4DUZB 4LF6B 3ASNC 1I08A 4X1IB 3JD4A 3M99B 2WLLB 1IZ3A 4X62B 4DK0A 1HP8A 5L3EA 4B3MO 4JYAB 1KMIZ 3K0GA 3G67A 2ZNIA 5JVDB 1YI2V 3FD9A 1F7YA 1WPXA 3E8HA 1VQ8V 3ML0A 5H9CA 2HHHB 3J7AU 3B40A 5IYZB 1S5HC 2XOKG 1TAEA 1KD1W 1Q86W 4CC5A 3IC7A 4LFCO 1Y74B 2EIJC 2ZCEA 1G6UA 2WLIA 2DW4A 1VMGA 2QWQB 4XDJA 1GKFA 4WBNB 5TISZ 4FZ0A 4BIZA 4DO2A 1KP2A 2QM4A 4JI0B 3R66A 2QWPB 1LUWA 2JJ2G 4I5SA 3VBBA 2EIJB 2CH7A 3H1KH 3BABA 1DK1A 5L3CA 3CRMA 4DR6O 1I0HA 3MD0A 4MVMA 5B1AB 4D7TA 1YXBA 3ZHVA 1P49A 2WLIB 5CBGA 2HLDG 1NR7A 2E5LO 3TXSA 1L8DA 4P9PA 3ZMTA 1NI8A 4LF8B 1MSDA 3M7MX 4J9ZB 3DGEA 2WPDG 3CCSV 4ZOLA 4K0KO 4DR7O 2X7RB 2EILC 2UUCO 3OUSA 4B08A 2ADPA 3CYOA 4MW8A 1L0LH 2MK3A 4N23A 4YJ2A 1HNWO 4K8XA 2YICA 4DR3O 3HKDA 4JI5B 1KYOF 4DV6O 4LWSA 4J11A 1V9PA 2A3QA 4WFGA 3D8CA 1Q6IA 2F4VO 4JTAB 4DV0O 1N32O 3K9AA 5JWPA 5KAFZ 5IWAB 4ZOLB 1COWG 3ZRVA 4FFBA 1IXMA 1SESA 4MS2A 3C3SA 1JR9A 4WFEA 4NXNB 4ZKIA 2F23A 3CPWU 2EIKC 1OCOC 3CEIA 1SQVH 5HFLA 3K0DA 1NTMH 3FB8C 1JFFB 1THZA 1NT2B 3D3QA 3L73H 2AHZA 3TGUH 4YJ2B 3EFFK 4AI8A 2PYJA 2EJRA 3HKDB 2QKSA 2UXDB 1XNRO 2Q9LA 2B1GA 2F93B 4I9QA 1XMQB 2EIKB 1OCOB 2QJ1A 4LFAB 3OTOO 3RYFA 2X0LA 1YIJV 1H2GA 3RVYA 1K8AW 1FFXA 2EULA 3GB7C 1XHXA 4J80A 4JI1O 3W7TA 1PV0A 2YI8A 1HNZB 5IYDO 1BZKA 2CTWA 1L0NH 3KZIZ 2QM7A 1WAZA 5CBFA 4FM2A 3KCYA 1AR1B 2LP7A 3B09A 4CH4A 3T1HO 4GKKO 3ZRWB 4CH3A 1VEWA 2W0XA 3S3WA 4ZIBA 1GN2A 3ZS8C 2ZD9A 3T4DA 2DN9A 3G6EV 2A9HA 1BCCH 1K4DC 3RW0A 2KSDA 2QWRB 3ZMZA 3SJBC 4JI3B 5LYJB 4JI8O 4KP4A 4DR1O 3KCXA 5JJEB 4LF4B 2VQFO 3T1CA 2AXTZ 4JPRA 2F95B 4EKWA 5JCOC 4PI0A 3BRCA 1EN5A 1IBMB 4U3JA 2ZR2A 5IJ0B 2PUSA 3BEHA 5L3DA 5A2QN 3VQYA 4LP8A 1W2BU 2ADQB 2P5OA 4DUYO 4ASUG 1MZEA 4JYAO 2AGAA 3G4SV 5KUKA 4UCTA 2BOBC 3OEEG 4UB6Z 1XI1A 3CC2V 3L75H 3LDEA 4MW3A 1M1KW 1M56C 3BPZA 4JF3A 2WLKA 3A2FA 4KL1A 5B1BC 1FS0G 4IIJA 1EZJA 2UU9B 4UVBA 4NXMB 3CP1A 2PI4A 1DF5A 1EN6A 4U3JB 2QWOB 3P3PA 3P3NA 5D5PA 2RMKB 3ETGA 1M56B 1RPOA 1SC5B 4X65O 5LGUA 4Z1MG 2YSUB 1HDJA 3Q4HB 5B1BB 1DGSA 1B6QA 2HJFC 4BW9A 4TQDA 5FNVA 5EIBD 1AJQA 1P84F 3K5MA 2A79B 1FAFA 3G6BA 2GUZA 1R3LC 2DWDC 3GWKC 4IGGA 4F4LA 4PELA 4MSWC 3LDCA 3N27A 4IIJB 3CCQV 1OHHG 2Z5UA 1BGYH 3T1YO 4LF8O 1WLEA 2Y4TA 1VF5B 1M57B 5LHGA 4NTXA 2HVJC 3OEHG 3A0HZ 1KB9F 5C8YA 1ZL8A 4GX0A 5FNVB 1SA0B 4FIPC 3IJ4A 2HJDA 2BSKA 3D36A 4DV4O 4JI7B 1R1BA 2RQ6A 3AG1B 2XAHA 3OM3B 2F66C 4OPAA 1K3EA 2GUZB 3OT7A 1H2SB 1B3QA 5BMVB 4UFZA 1Q8IA 1YTFD 2ZE5A 1OCCC 4EB6A 2CTPA 1AR5A 2FL4A 1OV9A 3N2GA 2HG5C 4OGQB 1Q43A 3LSUA 3CRAA 3OD4A 5LL6Y 2Q4PA 2DYRC 3ZCCA 3U0ZA 4WFBV 1S76D 5LA6A 3ZN1A 3CCUV 1N0JA 4IHJA 4J7ZA 5E79Z 4DV3O 1MMMA 3ABLC 1ROPA 2PTMA 1QCEA 1OCCB 3CMEV 2VQEB 1AI5A 3B77A 4P9OA 2QTOA 3BY6A 3RYHA 5DEDA 2BSKB 4DK1A 5JQGA 1Q6UA 3OR7C 1YF2A 1SERA 1OZ0A 4UVAA 5KHIA 3ABLB 2E75B 4J7JA 4DW0A 2PY5A 2WSSG 3SGIA 1V54C 1BHAA 4LBEC 4RUFA 1FXKA 4EB6B 3N2GB 1XDCA 4D7SA 2UXNA 2X6BA 5EBMC 3JAKA 4GLXA 2YXLA 4IHJB 4GYCB 2XTAA 1EM1A 1TUBA 1RM1C 2N04A 1L1FA 3LSQA 4X8AA 2DMXA 4JI2B 5KMGA 3BVOA 1V54B 4UV8A 1FXKC 1K73W 3AG2C 4PDLA 4DV7O 3W7XA 1W0JG 2NR5A 4NKGB 3RYHB 2YIDA 3W7UA 4JGSA 1ENVA 5IYCO 4JV5B 4RO2A 5LMUO 2YS8A 4H13B 3AK1A 3K59A 2UXBO 1Y76A 2QKAA 2JDIG 1RM1B 4KHPB 3CRRA 3AEIA 2ZT9B 3K3WA 1FXKB 1PNLA 3AG2B 1XL4A 2HR3A 2O57A 3JSNA 3JCZA 4A5UB 3JAKB 1F51A 4CS2A 1I7FA 4F6EA 2LW1A 1TUBB 1VARA 4TT3G 4B3SO 2HVKC 5KMGB 1B06A 5IY5C 4MTXA 2UXCB 4UV9A 3ABMC 1RFYA 3CXHF 3AG3C 2VS0A 5EZYA 1EFRG 1VQNV 1SKVA 1NBMG 1Q3EA 1Y76B 3F7YC 5KHGA 1H8HG 4LF7O 4LF9B 1JJ2U 3E22A 5K1XA 1BMFG 3ABMB 5GONB 1DF4A 4U3FH 5EC2C 5C93A 1T5EA 2EBOA 4E2LA 4YJ3A 1N0NA 4NTWA 5IYZA 4BIOA 1I5XA 1MABG 4DR5B 2Y0IA 4FVMA 5BR8O 1Y74A 4ZHQA 4QE7A 3MAQA 3A0BZ 4JZ2A 4B3TO 3H9VA 4X64O 3BAAA 4LH7A 2QWNB 3IGAC 3SYAA 2W6JG 4FZ1A 2OCCC 3E22B 4UCVA 2ZXWC 2JJ1G 2XNDG 2ZQMA 3FFQA 4DV5O 4H33A 5KLVH 1XQ8A 5FPOA 4X66B 4JI6O 1NZ6A 1WP8A 5BY1A 1N4CA 2XAQA 4RUEA 4YJ3B 1NJIW 3BA8A 1JQ0A 4PD4F 1R6TA 2OCCB 3ASOB 3ASNB 1NH2D 4P2ZA 3K03A 2ZXWB 3JSLA 2CE4A 4MVOA 1QBZA 2B9ZA 4ZHQB 4KXRA 1YJNV 4N21A 1YJWV 2ITDC 4DV2B 1BS3A 4X88A 4MVSA 1BL8A 3WFVA 1S72V 2E3CA 1VP7A 1LR1A 2WWWA 3B8NA 4XBFA 1MNGA 5DN6G 5FL7G 2E76B 2VRZA 3E35A 1YHQV 3LSSA 1QLEC 2ILMA 3TJTA 4H0LB 4R7CA 1GTOA 3CD6V 2ODMA 4J10A 4JYBA 4DV1B 3B4SA 1YSCA 2KB1A 3WB2A 2F43G 2GV9A 3LDDA 1HWYA 4LNUA 1QLEB 1FJGO 1S5LZ 3AG4C 5LP6A 2XT9A 5B66Z 3QG5A 4JI4O 2B5UA 4EEQA 4FK5C 4MVRA 1UFIA 3T4ZA 1IBLO 4JYCA 3KG2A 2BTQA 4ZI7A 4PDMA 1GO3F 1VQPV 4O4HB 3AG4B 5LMNO 2ZKOA 3E8FA 5LP6C 4MTOA 4QJFB 1SQFA 3FX7A 1I94O 2IJKA 1KBHA 2UUBO 3TCUA 1QVGU 3PN1A 4QNHB 1NVPB 3SJQC 5KHJA 1JFFA 4LNUB 1GMGA 2OTLV 3CC4V 2KQXA 4YY3O 3K5LA 5LP6B 2EILB 1ZX3A 4AQYB 3AK3A 2ZE7A 1HNXO 1J5EB 4FMTA 3CC7V 3IC9A 1J95A 2BTQB 2RJZA 2ZNJA 2LFRA 4ZI7B 2WAMA 2PI5A 1XILA 4W4LA 2IJHA 3X2QC 2VWKA 3MHHC 3SYPA 5IE9A 4LFBO 3APOA 4LF5O 5DECA 5AG2A 5J9PC 3ZRWA 4GKJO 1R73A 2F1MA 3CRCA 4MTFA 2N05A 5KAIZ 2P6JA 3QNEA 2UUAB 1YVWA 2FTKA 4ABMA 1JX9A 4Q6GA 2FKXA 1VQ6V 2CGNA 2GTSA 2IBZH 3LNNA 2Q8VA 3UM7A 1K4CC 1M4UA 5LYJA 1AJNA 3X2QB 4B3RB 3JALA 4MVQA 5CA1B 1WA8B 4WFHA 4ICGA 3ZRSA 1G8MA 3F7VC 3ZX6A 2Q67A 2RDCA 1Q5OA 4CS4A 1JOYA 3FYEB 5BXZA 2P7TC 3ZMVA 3LNMB 1IBKB 5IJ0A 3U11A 4WF9V 3ZMUA 3PJSK 1N34O 4IYIA 4U7NA 3MDSA 4G27B 3K9SA 1HR0B 1PM9A 5B3SC 5IDJA 3CCRV 4QE9A 2DE0X 2AW9A 5LXTB 5JCOA 2ZM6O 4W4KA 2DQ0A 5F2VO 2M7WA 1IVSA 3K08A 4K3AA 3DXRA 4TUYA 4PDVA 5KA6A 1X59A 5J2TB 3JD0A 5LOVA 1Q6HA 3JALB 5B3SB 1GN3A 1OJHA 2LGQA 2NN4A 4E4EA 3ETEA 3CSXA 5L3BA 4HAMA 1N36O 5CMUA 1CXZB 1XUQA 4DR4O 3JD2A 1GAXA 4DUZO 4LF6O 1PD3A 2Z3YA 5E1AC 1EN4A 3S3XA 1S3JA 1PP9H 4X62O 3UT5A 2IJJA 3E2EA 1P7GA 1Y67A 4G2KA 1KECA 3Q4HA 5KHHA 1W0KG 5JJNB 2YC0A 2QTSA 3CWBH 2HHHO 5EBLC 3DXRB 4TUYB 3ZN0A 1BT8A 3QTCA 1S77D 5B5EZ 1LUVA 1VQKV 5LOVB 1AP5A 1WJZA 1NU1H 2EZPA 3SPCA 4HBNA 2HP8A 3OR6C 1Y4MA 2WLJA 1FXHA 3B2EE 1XOUA 2LJ2A 1AP6A 1JA8A 1NTKH 2WA3A 2R72A 1R3IC 5JH7B 2ZE6A 3VQXA 4OX9B 4JI0O 1EBOA 2Q7EA 2Q73A 3BHPA 3UT5B 1U96A 5L3GA 3ZBHA 1WB7A 2M6YA 4FJCC 2XUMA 3JASA 2RCVA 1XNQB 1SQQH 3SDLA 3H01A 1IDSA 1SA0A 3ETQA 4GX2A 4UXNA 2LO1A 1ORQC 1PNMA 3ABTA 3I55V 4CBCA 4X1YA 5BMVA 1MZFA 3FB7C 2L6LA 2CK3G 2LW7A 1KQSU 4J41A 4HZ3A 3H1HH 2H8PC 3GVMA 2ZE8A 2G38A 5K1PA 2X6CA 1N33B 3CCVV 5JJJB 2B1IA 1SRYA 1NTZH 3IFXA 3JASB 2Q0AA 5ITZA 4NTYA 1MOFA 1WNSA 1HW7A 1M90W 4B3MB 1ZAUA 2OWOA 2ZINA 3G80A 1E79G 3WG7C 1UJWB 3ZRXA 1SETA 3RYIB 5H5NA 1ZTEA 4X1YB 2XASA 4JI5O 5D5QA 1NVPD 4LFCB 3OE7G 1XBLA 3UO2A 4IYHA 4X1KA 1X4TA 2EX3A 1DLBA 2AHYA 4NVPA 3HKBA 1PPJH 4FM1A 1KUQA 5IWAO 2ARHA 3H1IH 4TWKA 1MA1A 2ITCC 1UPGA 4PV1B 1O9GA 2Y69C 2P4VA 2IU0A 4NXNO 2V4DA 5ITZB 1M5IA 1VQ5V 5J2UA 1D2DA 4BR6A 4PI2A 2P67A 4NB5A 2DYRB 1OCZC 3H1JH 2QGNA 4UVCA 3ZHRA 4Z1VA 1K5QA 3L74H 4H44B 1OCRC 2ATKC 1D5NA 3QO5A 1IURA 3CE2A 1V55C 2UXDO 1CP9A 4PA4A 2Y69B 4CH6A 2V1DA 4DR6B 3HKCA 4K35A 2UXXA 1XMQO 2KKWA 4LFAO 4HNAA 4X1KB 4RAIA 1ZUQA 1VQ7V 1BHBA 3HR0A 3HKBB 3JARA 1OCZB 2E5LB 1G1XB 3WU2Z 3K06A 3STZC 1HNZO 3ABKC 2IM9A 3QO8A 3FB5C 3BCCH 1OCRB 1V55B 4GT1A 4GCZA 1E1RG 3RBZA 4K0KB 3BFRA 5J2UB 2R70A 4DR7B 3P30A 4CZZA 2GDSA 3DC6A 1TVKA 2UUCB 3ZJZA 1SS3A 3ABKB 4JI3O 2WLMA 4LF4O 1KP3A 1GM7A 3JCUZ 3CX5F 3K5OA 1NS1A 3HKCB 2YI9A 2Q7HA 1HNWB 4HNAB 3E89A 2Z0AA 1GM8A 2GSMB 1EZVH 1KKDA 1FXVA 4DR3B 1IBMO 5GONA 5LGTA 3JARB 1AILA 2DJVA 2EIMC 3W7WA 2A06H 4FLXA 4FLVA 5H6RA 2GBOA 5HFMA 2Y48A 2F4VB 2H3OA 4DV0B 1N32B 3GWOA 4FFKA 1H38A 3CB2A 4ZBMA 2OIEA 3OGCC 2EIMB 1XL6A 4UCRA 1TVKB 2PZSA 1QNMA 1I5YA 4DYLA 2WLNA 4LCUC 3CS5A 2C2AA 5L3FA 3STLC 2AZ0A 5IY5B 1K97A 2QEXV 2UU9O 2RN9A 3F5TA 4NXMO 3JAWA 4FLWA 1XNRB 3AG3B 4QPJA 3K58A 4KFMA 4TV8B 3JATA 3KKYA 4QGPA 4JAAA 3VQVA 3OTOB 4JZGA 4J9YB 4JI1B 4MTGA 4WCEV 2EINC 1YCIA 3L9DA 2OTJV 1KU9A 3T1HB 4OXSA 4GKKB 2ZIMA 3OMAB 1JVMA 4LR3A 4X89A 2V7QG 4CS3A 2ZDIA 3FYIB 3AG7A 2R9RB 3K5NA 1SQXH 1Q7YW 2EINB 4JI8B 4DR1B 4I4TB 1U97A 4C7UA 2VQFB 1E1QG 3JAWB 1WPBA 1A32A 3W7SA 4TQFA 1Y6XA 2R9AA 5IT9N 1BQ0A 3JATB 4I7ZB 4UCOA 2BTOA 2ZDIC 4JTDB 5B1OA 3TETA 3JYCA 3CMAV 1PL0A 2H94A 1FPOA 5KUMA 2YDEA 1AI4A 1RSOA 1GRJA 1XEQA 4DUYB 4CH5A 2P22C 3UO3A 1SF9A 4JI7O 1TA8A 2DOSA 2CUGA 4H37A 2JEUA 1BE3H 2EZOA 3U10A 3ZHQA 1XMOB 2YXYA 2JRIA 3A0RA 4TSFG 5EIBC 1K33A 2IW5A 3SPGA 2XAGA 2HEPA 2YUAA 4O4HA 1PNKA 2PYLA 2WLHA 3IAYA 2CTRA 2VQEO 4DRXA 3FB6C 4X65B 2Q69A 2QDOA 5B1AC 1RSOB 1MSWD 1AJPA 4U7OA 1B04A 1P4RA 1Q82W 1S5JA 3T2MA 3MHSC 3VQWA 3NXSA 4O4IA 4HYOA 5CB4A 1Q90D 3CJHA 5LGNA 3DC5A 3FAVA 3RYCA 4J42A 1H8EG 2LGWA 4BAYA 4PA7A 3OW2U 3OAAG 4JYYA 1F23A 5IYBO 4TOIA
chains in the Genus database with same CATH topology
2IJJA 3ZCCA 4WFBV 3ZN1A 3CCUV 2WLLA 3E2EA 4G2KA 4WFAV 1KECA 1W0KG 4I9WA 5B1NA 3ABLC 1ROPA 3TETA 5EBLC 2QM8A 3FKSG 2JIZG 1QCEA 1JCHA 1OCCB 3CMEV 3ZN0A 1AI5A 3B77A 1QVFU 2QA4V 5EBWC 2IH3C 4BIUA 1S77D 4P9OA 2QTOA 3CCEV 3BY6A 1VQKV 5LHIA 4RQEA 3E8BA 4JAUA 2EZPA 3SPCA 3OR7C 1YTFB 1YITV 1SERA 1NKDA 1VQMV 1OZ0A 3OR6C 1Y4MA 2WLJA 4UVAA 1FXHA 2X6AA 2GHYA 4WFFA 3ABLB 1ZWIC 2P90A 3ETDA 2WSSG 1QR8A 1V54C 1BHAA 1R3IC 2K1EA 4LBEC 4RUFA 3SPHA 1FXKA 1M9NA 3TK1A 1EBOA 3ASOC 3ASNC 2NNUA 2UXNA 2X6BA 1RPRA 4G28B 5EBMC 3JD4A 3M99B 4LC1A 5L3GA 2WLLB 4FJCC 5L3EA 1RM1C 1L1FA 3LSQA 3H01A 3K0GA 4X8AA 1YI2V 1V54B 1WPXA 3E8HA 4UV8A 3ML0A 1VQ8V 3CCLV 5H9CA 4GX2A 1FXKC 1K73W 3AG2C 4PDLA 3W7XA 1S5HC 1W0JG 1NQTA 2XOKG 4UXNA 1KD1W 3QO7A 3W7UA 1Q86W 1ORQC 1PNMA 3ABTA 1ENVA 3IC7A 4JGSA 4QPKA 5IYCO 3I55V 4RO2A 4CBCA 2Q6AA 2EIJC 3FB7C 2JDIG 1RM1B 2WLIA 2DW4A 2CK3G 4XDJA 2YEVA 1KQSU 1GKFA 4HZ3A 2H8PC 4P30A 1LNQA 3AEIA 3K3WA 2X6CA 1FXKB 1PNLA 3AG2B 1XL4A 2HR3A 3CCVV 4BIZA 4DXWA 1K5SA 3JCZA 4DO2A 4BW5A 1KP2A 1F51A 2B1IA 2JJ2G 1SRYA 3IFXA 4I5SA 3VBBA 2EIJB 4TT3G 1MOFA 2HVKC 1M90W 5IY5C 4MTXA 4UV9A 2IJIA 3ABMC 5L3CA 1E79G 3AG3C 1AI7A 3P32A 3WG7C 1UJWB 3LUTB 3ZRXA 3MD0A 2HKOA 1SETA 4MVMA 1EFRG 1F4MA 1VQNV 2XASA 1AROP 5B1AB 1NVPD 1NBMG 3F7YC 3OE7G 1MG1A 2R9IA 2WLIB 1H8HG 5CBGA 2HLDG 1NR7A 4PA3A 2YEVB 1JJ2U 1DLBA 2AHYA 5CBHA 4P9PA 1BMFG 3ZMTA 3F5WC 1AI6A 3ABMB 4J9ZB 1K92A 3DGEA 4TWKA 2WPDG 3SYQA 3CCSV 2ITCC 1DF4A 4XDLA 5EC2C 5C93A 2Y69C 3RVZA 2EBOA 2IU0A 2IH1C 4E2LA 2X7RB 5LHHA 1VQ5V 5CN0A 4FPPA 2EILC 2P67A 1I5XA 1MABG 2D3OW 2DYRB 3OUSA 1OCZC 3I56V 4MT8A 3CYOA 1F4NA 3E83A 4MW8A 4UVCA 2DYSC 4QE7A 1K5QA 1VQ9V 3OFNG 4MVUA 1OCRC 2ATKC 3QO5A 1V55C 2MK3A 1CP9A 4N23A 4PA4A 2Y69B 3K04A 2V1DA 3IGAC 2UXXA 3SYAA 4GX5A 4RAIA 1VQ7V 2W6JG 5EK0A 1BHBA 2OCCC 3K79A 4JTCB 2ZXWC 1OCZB 2JJ1G 2XNDG 2ZQMA 1QLNA 4RQFA 4WFGA 4H33A 3K06A 3STZC 2DYSB 3ABKC 4JTAB 3QO8A 3FB5C 1OCRB 3K9AA 1V55B 4GT1A 1COWG 3ZRVA 2XAQA 1IXMA 1SESA 4RUEA 4GCZA 1E1RG 3RBZA 4MS2A 1NJIW 1JQ0A 3HB3B 2OCCB 2IU3A 3ASOB 4WFEA 4ZKIA 3ASNB 3CPWU 3P30A 4P2ZA 4CZZA 2EIKC 1OCOC 3K03A 1NH2D 2ZXWB 4JAVA 2JEXA 5HFLA 1G4YB 3K0DA 3FB8C 4MVOA 3ZJZA 1NR1A 1QBZA 3ABKB 3ZMSA 2ZR3A 2WLMA 1YJNV 4N21A 1KP3A 1THZA 1GM7A 2ITDC 1YJWV 3E8GA 2AHZA 1GK9A 4X88A 1VQ4V 4MVSA 1BL8A 1R6KA 3WFVA 1S72V 3EFFK 1YJ9V 2EJRA 1M57C 2QKSA 3E89A 1GM8A 2B1GA 2GSMB 1KKDA 1FXVA 2WWWA 3B8NA 2EIKB 1OCOB 5LGTA 1FFTB 4XBFA 5DN6G 2EIMC 3W7WA 3HPLC 5FL7G 2X0LA 3E35A 1YIJV 1H2GA 3UKMA 3RVYA 1K8AW 1TUEB 1YHQV 5H6RA 3GB7C 1QLEC 3LSSA 3W7TA 1SZTA 5HFMA 2Y48A 5IYDO 1NH2B 3ABUA 2QM7A 4R7CA 1GTOA 5CBFA 3GWOA 3CD6V 3DTUB 1AR1B 2LP7A 1H38A 4JYBA 3ZRWB 4JASA 3AG1C 1YSCA 5GW7A 2KB1A 4UUJC 4ZBMA 2F43G 2XAJA 2ZD9A 2EIMB 1XL6A 3LDDA 1HWYA 3OGCC 3T4DA 4GX1A 3G6EV 1GM9A 2A9HA 3OMIB 1K4DC 1I5YA 1QLEB 3RW0A 2WLNA 1QR9A 3ZMZA 3AG4C 3CCJV 4LCUC 1PKXA 2NLJC 2C2AA 4KP4A 5L3FA 2DWEC 2B5UA 3STLC 3T1CA 5IY5B 1K97A 4FK5C 4MVRA 2QEXV 1S0VA 3T4ZA 4JPRA 3R65A 3CXCU 4EKWA 4JYCA 3AG3B 3KG2A 4QPJA 2OT5A 3WG7B 4PDMA 1R6NA 1GO3F 4KFMA 2ZR2A 3BEHA 1VQPV 3AG4B 4J9YB 2LFSA 3E8FA 4MTOA 5L3DA 4QJFB 4MTGA 4WCEV 2IJKA 1R3JC 4LP8A 4L87A 1K9MW 2EINC 3TCUA 1W2BU 1QVGU 4ASUG 4QNHB 1NVPB 5EC1C 2OTJV 3G4SV 3SJQC 4OXSA 2DQ3A 5KUKA 3OUFA 2BOBC 3OMAB 1JVMA 3OEEG 1GMGA 4X89A 2OTLV 3CC4V 3CC2V 2V7QG 3LDEA 4MW3A 5LBQA 3JD3A 2ZDIA 5BZBA 3FYIB 1M1KW 3SPIA 1M56C 4R50A 2R9RB 2EILB 1Q7YW 4JF3A 2QE7G 2WLKA 2EINB 1E1QG 5B1BC 1FS0G 1EZJA 4FMTA 2BOCC 3ZIAG 3CC7V 4UVBA 1J95A 2LFRA 2WAMA 3CP1A 3W7SA 2PI4A 2PI5A 1DF5A 2IJHA 4PA6A 3X2QC 3MHHC 3SYPA 2A0LA 5J9PC 2ZDIC 1K34A 1M56B 3ETGA 4JTDB 1RPOA 1R73A 3JYCA 5B1OA 3ZRWA 4MTFA 3CMAV 1PL0A 4KUMA 5LGUA 2H94A 2P6JA 3QNEA 4PDRA 5KUMA 4Z1MG 2FTKA 2YSUB 1JX9A 5DM6V 1VQ6V 5B1BB 1AI4A 1B6QA 3UM7A 1K4CC 2HJFC 1AJNA 3B8MA 3X2QB 1AJQA 1K7DA 4MVQA 1DTOA 4WFHA 3ZRSA 3G71V 1P7BA 3JD1A 1G8MA 2A79B 3F7VC 1Q81W 2Q67A 4H37A 2JEUA 4R8CA 1R3LC 2DWDC 3D3IA 4F4LA 2EZOA 4PELA 3FYEB 1JOYA 4MSWC 3A0RA 4TSFG 2P7TC 1R3KC 3LDCA 3LNMB 3ZMVA 1K33A 2IW5A 4WF9V 3ZMUA 3CCMV 3SPGA 3CCQV 1OHHG 2XAGA 2Z5UA 1CEZA 3PJSK 4U7NA 4G27B 1N8RW 1WLEA 5B3SC 5IDJA 3CCRV 1VQLV 4QE9A 1M57B 1PNKA 4PA9A 5LHGA 2WLHA 2HVJC 4XDKA 2DQ0A 2M7WA 3FB6C 3OEHG 5H6QA 1Y66A 1KC8W 2Q69A 3K08A 2XAFA 5B1AC 1MSWD 2W0FC 1AJPA 4U7OA 4PDVA 4Q20A 3VOUA 5KA6A 1P4RA 2HFEC 3SYOA 5KA5A 4QIWF 4GX0A 3JD0A 4MVZA 3SYCA 4FIPC 4YXWG 1Q82W 5B3SB 3D36A 3T2MA 3MHSC 3NXSA 3AG1B 2XAHA 3OM3B 4HYOA 1CPYA 4R6ZA 1JPXA 1K3EA 3ETEA 5LGNA 1VQOV 5L3BA 4HAMA 5CA3A 3SPJA 5CMUA 3E86A 2Q68A 1H8EG 1YTFD 3JD2A 1OCCC 4PA7A 4BAYA 1PD3A 3OW2U 3OAAG 2Z3YA 2JK5C 5E1AC 3OMNB 1S3JA 2W6IG 2HG5C 1F23A 5IYBO 3EHBB 1S76D 2DYRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  1VQM V;  1YJW V;  3CCU V;  1QVG U;  1KQS U;  2QEX V;  3CC7 V;  1Q82 W;  1N8R W;  3CD6 V;  4WFA V;  2OTJ V;  3G4S V;  1VQ4 V;  1VQ9 V;  3CCR V;  1YI2 V;  1VQL V;  3CXC U;  1S72 V;  1VQ8 V;  1YJ9 V;  3CCS V;  3CCL V;  3G71 V;  3CCV V;  2OTL V;  3CC4 V;  1K73 W;  3CC2 V;  1VQO V;  1NJI W;  1Q81 W;  1R73 A;  3CME V;  3G6E V;  3CPW U;  1VQ7 V;  3CMA V;  1M1K W;  1KC8 W;  1KD1 W;  1VQN V;  1Q86 W;  1VQ5 V;  1VQP V;  3I55 V;  3OW2 U;  2QA4 V;  1YIJ V;  1QVF U;  1K8A W;  3CCE V;  1YHQ V;  1VQK V;  1W2B U;  3CCJ V;  3CCM V;  4WF9 V;  4WCE V;  1Q7Y W;  3CCQ V;  5DM6 V;  1JJ2 U;  1VQ6 V;  2D3O W;  1YJN V;  1K9M W;  3I56 V;  1M90 W;  1YIT V; 
#chains in the Genus database with same CATH topology
 2Y0P A;  3T1Y B;  4AIL C;  4JI2 O;  5B1N A;  4OPH A;  1Z5V A;  4DRX B;  2QM8 A;  4IT5 A;  3FKS G;  2JIZ G;  1JCH A;  5CA1 A;  1WA8 A;  3C90 A;  3UQ8 A;  4IL6 Z;  1QVF U;  2CTQ A;  5EBW C;  2IH3 C;  4BIU A;  5FLX N;  4JV5 O;  3HKE A;  1Z2G A;  2CH7 B;  4RQE A;  1RP3 B;  3E8B A;  3THO A;  4JAU A;  4L8J A;  1ZSP A;  4O4I B;  1YIT V;  1YTF B;  1NKD A;  4KHP O;  5CB4 B;  1GN6 A;  2OIG A;  4DV4 B;  2GHY A;  3CJH B;  2D2C B;  3FAV B;  3ETD A;  3RYC B;  3EXA A;  1QR8 A;  2K1E A;  3SPH A;  1M9N A;  1H2N A;  3TK1 A;  4GZR B;  5LXT A;  2NNU A;  4G28 B;  1RPR A;  3H1L H;  4LC1 A;  1QQC A;  2Y4U A;  3J81 N;  1SZX A;  1VF7 A;  3RT3 C;  2UXC O;  1AR4 A;  3RGB A;  3O65 A;  5J2T A;  2WA4 A;  3CCL V;  4DV3 B;  3SR2 C;  5A9G A;  1NQT A;  3HKE B;  3N2K A;  4FM0 A;  2OYQ A;  3QO7 A;  4QPK A;  1WP7 A;  4LF9 O;  2Q6A A;  4X9Q A;  2YEV A;  3I5D A;  4P30 A;  1SQB H;  1LNQ A;  1YZB A;  2CDY A;  2A7W A;  4O4L A;  4I55 A;  4DXW A;  1K5S A;  4LWS B;  4BW5 A;  4I50 A;  3L70 H;  4CC6 A;  1IXB A;  2N74 A;  4YHH B;  1SQP H;  3L71 H;  2K9P A;  2YIA A;  3CHX A;  4DR5 O;  4FFB B;  2IJI A;  1XHZ A;  2EJ7 A;  2YXH A;  3N2K B;  1AI7 A;  3P32 A;  4DV7 B;  3LUT B;  1AVM A;  2KG7 A;  2HKO A;  1WB8 A;  1F4M A;  1H2L A;  2OCH A;  3SJC C;  1ARO P;  1MG1 A;  2R9I A;  5JH7 A;  5LMU B;  2BE3 A;  2ZIO A;  2VWJ A;  2FYU H;  2YEV B;  4PA3 A;  2UXB B;  5CBH A;  2JGD A;  3QVN A;  1SQG A;  4X66 O;  3F5W C;  1AI6 A;  4O4L B;  5CA0 A;  1K92 A;  4I55 B;  3SYQ A;  1W59 A;  4I50 B;  3RYF B;  4XDL A;  3CRQ A;  3ZHS A;  1FFX B;  3RVZ A;  2Q5Z A;  2IH1 C;  5LHH A;  5CN0 A;  4FPP A;  2MW2 B;  1H2M A;  4B3S B;  2YIB A;  2D3O W;  3I56 V;  4MT8 A;  5KX5 A;  4DR2 B;  1F4N A;  3E83 A;  4DV2 O;  2DYS C;  1VQ9 V;  3OFN G;  4MVU A;  3APQ A;  2KG7 B;  3K57 A;  1VIB A;  3K04 A;  1H2K A;  4K8Z A;  4GX5 A;  3ZED A;  5EK0 A;  4FLY A;  3C3T A;  3K79 A;  1XMO O;  4JTC B;  2CAZ C;  4FLU A;  4LF7 B;  2JGD B;  3RN4 A;  3SJA C;  1QLN A;  4RQF A;  5CA0 B;  2DYS B;  5EYP A;  2QSA A;  4DV1 O;  2QR4 A;  2LQT A;  4BWA A;  3HB3 B;  2IU3 A;  4JAV A;  2JEX A;  1G4Y B;  1D5A A;  5KX5 B;  3RYI A;  2Q7G A;  1NR1 A;  3ZMS A;  2FML A;  2ZR3 A;  2AZ2 A;  5GTH Z;  3E8G A;  4PJ0 Z;  1GK9 A;  5BR8 B;  3OTF A;  4UCS A;  4EFE A;  1VQ4 V;  1R6K A;  2PGG A;  1YJ9 V;  1M57 C;  1WN7 A;  4B3T B;  4X64 B;  1FFT B;  3HPL C;  1URF A;  3UKM A;  1TUE B;  4NR1 A;  4D6T H;  4EFB A;  4DV5 B;  1SZT A;  2JVD A;  1NH2 B;  1JMK C;  5EYP B;  3ABU A;  4JI6 B;  3DTU B;  4JAS A;  3AG1 C;  5GW7 A;  4UUJ C;  2XAJ A;  2PF4 E;  4GX1 A;  3TXQ A;  1GM9 A;  3OMI B;  4PHZ A;  3RFR A;  4AQY O;  1QR9 A;  2P06 A;  3CCJ V;  1PKX A;  2NLJ C;  1O9H A;  1YDX A;  2DWE C;  1J5E O;  1S0V A;  1FYJ A;  3R65 A;  3WB1 A;  4J7K A;  3CXC U;  1BQZ A;  3M8A A;  4B7E A;  2OT5 A;  3WG7 B;  4F6R A;  4YIO A;  1R6N A;  2GTA A;  1YEW A;  2LFS A;  2JS5 A;  2UUA O;  1BSM A;  2JGU A;  2Q0O C;  1R3J C;  4L87 A;  1K9M W;  2JS3 A;  3WB0 A;  3D36 C;  2XHB A;  5EC1 C;  2DQ3 A;  3OUF A;  4B3R O;  1US6 A;  1QU7 A;  3EVK A;  3J80 N;  2P4K A;  4YIP A;  5LBQ A;  5C8Y B;  3JD3 A;  3UCS C;  5BZB A;  3ICX A;  3SPI A;  1ZL8 B;  4R50 A;  2BCC H;  1FJG B;  2QE7 G;  1IBK O;  4JI4 B;  1M93 A;  1Z5W A;  2BOC C;  3ZIA G;  4O4J A;  1HR0 O;  4F6R B;  1IBL B;  4PA6 A;  2A0L A;  1K34 A;  4KUM A;  5LMN B;  4YHH O;  2L35 A;  4PDR A;  3AK2 A;  5LA6 B;  1I94 B;  5DM6 V;  2UUB B;  4X20 A;  4O2B A;  3NR7 A;  3B8M A;  5IJ9 A;  1K7D A;  1DTO A;  3G71 V;  1P7B A;  3JD1 A;  1Q81 W;  3A8T A;  4R8C A;  4YY3 B;  4O2A A;  4TV9 A;  3D3I A;  5JQG B;  1R3K C;  4TV8 A;  4DV6 B;  4AHC A;  3CCM V;  1HNX B;  4O4J B;  1CEZ A;  3RWR D;  1N8R W;  1FKA O;  1AB3 A;  5GTI Z;  4I0X A;  1VQL V;  3QF7 A;  4PA9 A;  3JAM N;  4LFB B;  4LF5 B;  4B7K A;  1JJO A;  2RNB A;  4GKJ B;  4XDK A;  4UB8 Z;  5H6Q A;  1KC8 W;  1Y66 A;  5H2F Z;  1TGO A;  2XAF A;  4X20 B;  2W0F C;  4O2B B;  1KKC A;  4Q20 A;  3VOU A;  2HFE C;  3SYO A;  5KA5 A;  4DR2 O;  4QIW F;  4MVZ A;  3SYC A;  5IJ9 B;  4YXW G;  4I4T A;  1QHT A;  4UCU A;  1CPY A;  4R6Z A;  1VF6 A;  2FB5 A;  1JPX A;  4O2A B;  2QKC A;  4TV9 B;  1VQO V;  3ZHU A;  3L72 H;  5CA3 A;  3SPJ A;  4OX9 O;  3E86 A;  2CGO A;  2Q68 A;  4NYK A;  2JK5 C;  3OMN B;  3BA9 A;  4DW1 A;  2W6I G;  2ETN A;  4X1I A;  1N34 B;  3EHB B;  4GUN A;  4I0X B;  4LH6 A;  2WLL A;  1XNQ O;  5KHK A;  4WFA V;  4I9W A;  1VF6 C;  1ZLZ A;  3DSQ A;  1XRE A;  5JVD A;  1IX9 A;  4Z2W A;  2ZM6 B;  1FD9 A;  1GN4 A;  2QA4 V;  5FPR A;  3CCE V;  4RWU A;  5LHI A;  3ZHT A;  1VQM V;  1PL4 A;  2X6A A;  3O9O A;  5EZY B;  2E74 B;  1GH6 A;  4WFF A;  1ZWI C;  2P90 A;  2YIB D;  3OGI B;  1N33 O;  4WBN A;  4FLT A;  1N36 B;  4FLZ A;  4DR4 B;  3ASO C;  4DUZ B;  4LF6 B;  3ASN C;  1I08 A;  4X1I B;  3JD4 A;  3M99 B;  2WLL B;  1IZ3 A;  4X62 B;  4DK0 A;  1HP8 A;  5L3E A;  4B3M O;  4JYA B;  1KMI Z;  3K0G A;  3G67 A;  2ZNI A;  5JVD B;  1YI2 V;  3FD9 A;  1F7Y A;  1WPX A;  3E8H A;  1VQ8 V;  3ML0 A;  5H9C A;  2HHH B;  3J7A U;  3B40 A;  5IYZ B;  1S5H C;  2XOK G;  1TAE A;  1KD1 W;  1Q86 W;  4CC5 A;  3IC7 A;  4LFC O;  1Y74 B;  2EIJ C;  2ZCE A;  1G6U A;  2WLI A;  2DW4 A;  1VMG A;  2QWQ B;  4XDJ A;  1GKF A;  4WBN B;  5TIS Z;  4FZ0 A;  4BIZ A;  4DO2 A;  1KP2 A;  2QM4 A;  4JI0 B;  3R66 A;  2QWP B;  1LUW A;  2JJ2 G;  4I5S A;  3VBB A;  2EIJ B;  2CH7 A;  3H1K H;  3BAB A;  1DK1 A;  5L3C A;  3CRM A;  4DR6 O;  1I0H A;  3MD0 A;  4MVM A;  5B1A B;  4D7T A;  1YXB A;  3ZHV A;  1P49 A;  2WLI B;  5CBG A;  2HLD G;  1NR7 A;  2E5L O;  3TXS A;  1L8D A;  4P9P A;  3ZMT A;  1NI8 A;  4LF8 B;  1MSD A;  3M7M X;  4J9Z B;  3DGE A;  2WPD G;  3CCS V;  4ZOL A;  4K0K O;  4DR7 O;  2X7R B;  2EIL C;  2UUC O;  3OUS A;  4B08 A;  2ADP A;  3CYO A;  4MW8 A;  1L0L H;  2MK3 A;  4N23 A;  4YJ2 A;  1HNW O;  4K8X A;  2YIC A;  4DR3 O;  3HKD A;  4JI5 B;  1KYO F;  4DV6 O;  4LWS A;  4J11 A;  1V9P A;  2A3Q A;  4WFG A;  3D8C A;  1Q6I A;  2F4V O;  4JTA B;  4DV0 O;  1N32 O;  3K9A A;  5JWP A;  5KAF Z;  5IWA B;  4ZOL B;  1COW G;  3ZRV A;  4FFB A;  1IXM A;  1SES A;  4MS2 A;  3C3S A;  1JR9 A;  4WFE A;  4NXN B;  4ZKI A;  2F23 A;  3CPW U;  2EIK C;  1OCO C;  3CEI A;  1SQV H;  5HFL A;  3K0D A;  1NTM H;  3FB8 C;  1JFF B;  1THZ A;  1NT2 B;  3D3Q A;  3L73 H;  2AHZ A;  3TGU H;  4YJ2 B;  3EFF K;  4AI8 A;  2PYJ A;  2EJR A;  3HKD B;  2QKS A;  2UXD B;  1XNR O;  2Q9L A;  2B1G A;  2F93 B;  4I9Q A;  1XMQ B;  2EIK B;  1OCO B;  2QJ1 A;  4LFA B;  3OTO O;  3RYF A;  2X0L A;  1YIJ V;  1H2G A;  3RVY A;  1K8A W;  1FFX A;  2EUL A;  3GB7 C;  1XHX A;  4J80 A;  4JI1 O;  3W7T A;  1PV0 A;  2YI8 A;  1HNZ B;  5IYD O;  1BZK A;  2CTW A;  1L0N H;  3KZI Z;  2QM7 A;  1WAZ A;  5CBF A;  4FM2 A;  3KCY A;  1AR1 B;  2LP7 A;  3B09 A;  4CH4 A;  3T1H O;  4GKK O;  3ZRW B;  4CH3 A;  1VEW A;  2W0X A;  3S3W A;  4ZIB A;  1GN2 A;  3ZS8 C;  2ZD9 A;  3T4D A;  2DN9 A;  3G6E V;  2A9H A;  1BCC H;  1K4D C;  3RW0 A;  2KSD A;  2QWR B;  3ZMZ A;  3SJB C;  4JI3 B;  5LYJ B;  4JI8 O;  4KP4 A;  4DR1 O;  3KCX A;  5JJE B;  4LF4 B;  2VQF O;  3T1C A;  2AXT Z;  4JPR A;  2F95 B;  4EKW A;  5JCO C;  4PI0 A;  3BRC A;  1EN5 A;  1IBM B;  4U3J A;  2ZR2 A;  5IJ0 B;  2PUS A;  3BEH A;  5L3D A;  5A2Q N;  3VQY A;  4LP8 A;  1W2B U;  2ADQ B;  2P5O A;  4DUY O;  4ASU G;  1MZE A;  4JYA O;  2AGA A;  3G4S V;  5KUK A;  4UCT A;  2BOB C;  3OEE G;  4UB6 Z;  1XI1 A;  3CC2 V;  3L75 H;  3LDE A;  4MW3 A;  1M1K W;  1M56 C;  3BPZ A;  4JF3 A;  2WLK A;  3A2F A;  4KL1 A;  5B1B C;  1FS0 G;  4IIJ A;  1EZJ A;  2UU9 B;  4UVB A;  4NXM B;  3CP1 A;  2PI4 A;  1DF5 A;  1EN6 A;  4U3J B;  2QWO B;  3P3P A;  3P3N A;  5D5P A;  2RMK B;  3ETG A;  1M56 B;  1RPO A;  1SC5 B;  4X65 O;  5LGU A;  4Z1M G;  2YSU B;  1HDJ A;  3Q4H B;  5B1B B;  1DGS A;  1B6Q A;  2HJF C;  4BW9 A;  4TQD A;  5FNV A;  5EIB D;  1AJQ A;  1P84 F;  3K5M A;  2A79 B;  1FAF A;  3G6B A;  2GUZ A;  1R3L C;  2DWD C;  3GWK C;  4IGG A;  4F4L A;  4PEL A;  4MSW C;  3LDC A;  3N27 A;  4IIJ B;  3CCQ V;  1OHH G;  2Z5U A;  1BGY H;  3T1Y O;  4LF8 O;  1WLE A;  2Y4T A;  1VF5 B;  1M57 B;  5LHG A;  4NTX A;  2HVJ C;  3OEH G;  3A0H Z;  1KB9 F;  5C8Y A;  1ZL8 A;  4GX0 A;  5FNV B;  1SA0 B;  4FIP C;  3IJ4 A;  2HJD A;  2BSK A;  3D36 A;  4DV4 O;  4JI7 B;  1R1B A;  2RQ6 A;  3AG1 B;  2XAH A;  3OM3 B;  2F66 C;  4OPA A;  1K3E A;  2GUZ B;  3OT7 A;  1H2S B;  1B3Q A;  5BMV B;  4UFZ A;  1Q8I A;  1YTF D;  2ZE5 A;  1OCC C;  4EB6 A;  2CTP A;  1AR5 A;  2FL4 A;  1OV9 A;  3N2G A;  2HG5 C;  4OGQ B;  1Q43 A;  3LSU A;  3CRA A;  3OD4 A;  5LL6 Y;  2Q4P A;  2DYR C;  3ZCC A;  3U0Z A;  4WFB V;  1S76 D;  5LA6 A;  3ZN1 A;  3CCU V;  1N0J A;  4IHJ A;  4J7Z A;  5E79 Z;  4DV3 O;  1MMM A;  3ABL C;  1ROP A;  2PTM A;  1QCE A;  1OCC B;  3CME V;  2VQE B;  1AI5 A;  3B77 A;  4P9O A;  2QTO A;  3BY6 A;  3RYH A;  5DED A;  2BSK B;  4DK1 A;  5JQG A;  1Q6U A;  3OR7 C;  1YF2 A;  1SER A;  1OZ0 A;  4UVA A;  5KHI A;  3ABL B;  2E75 B;  4J7J A;  4DW0 A;  2PY5 A;  2WSS G;  3SGI A;  1V54 C;  1BHA A;  4LBE C;  4RUF A;  1FXK A;  4EB6 B;  3N2G B;  1XDC A;  4D7S A;  2UXN A;  2X6B A;  5EBM C;  3JAK A;  4GLX A;  2YXL A;  4IHJ B;  4GYC B;  2XTA A;  1EM1 A;  1TUB A;  1RM1 C;  2N04 A;  1L1F A;  3LSQ A;  4X8A A;  2DMX A;  4JI2 B;  5KMG A;  3BVO A;  1V54 B;  4UV8 A;  1FXK C;  1K73 W;  3AG2 C;  4PDL A;  4DV7 O;  3W7X A;  1W0J G;  2NR5 A;  4NKG B;  3RYH B;  2YID A;  3W7U A;  4JGS A;  1ENV A;  5IYC O;  4JV5 B;  4RO2 A;  5LMU O;  2YS8 A;  4H13 B;  3AK1 A;  3K59 A;  2UXB O;  1Y76 A;  2QKA A;  2JDI G;  1RM1 B;  4KHP B;  3CRR A;  3AEI A;  2ZT9 B;  3K3W A;  1FXK B;  1PNL A;  3AG2 B;  1XL4 A;  2HR3 A;  2O57 A;  3JSN A;  3JCZ A;  4A5U B;  3JAK B;  1F51 A;  4CS2 A;  1I7F A;  4F6E A;  2LW1 A;  1TUB B;  1VAR A;  4TT3 G;  4B3S O;  2HVK C;  5KMG B;  1B06 A;  5IY5 C;  4MTX A;  2UXC B;  4UV9 A;  3ABM C;  1RFY A;  3CXH F;  3AG3 C;  2VS0 A;  5EZY A;  1EFR G;  1VQN V;  1SKV A;  1NBM G;  1Q3E A;  1Y76 B;  3F7Y C;  5KHG A;  1H8H G;  4LF7 O;  4LF9 B;  1JJ2 U;  3E22 A;  5K1X A;  1BMF G;  3ABM B;  5GON B;  1DF4 A;  4U3F H;  5EC2 C;  5C93 A;  1T5E A;  2EBO A;  4E2L A;  4YJ3 A;  1N0N A;  4NTW A;  5IYZ A;  4BIO A;  1I5X A;  1MAB G;  4DR5 B;  2Y0I A;  4FVM A;  5BR8 O;  1Y74 A;  4ZHQ A;  4QE7 A;  3MAQ A;  3A0B Z;  4JZ2 A;  4B3T O;  3H9V A;  4X64 O;  3BAA A;  4LH7 A;  2QWN B;  3IGA C;  3SYA A;  2W6J G;  4FZ1 A;  2OCC C;  3E22 B;  4UCV A;  2ZXW C;  2JJ1 G;  2XND G;  2ZQM A;  3FFQ A;  4DV5 O;  4H33 A;  5KLV H;  1XQ8 A;  5FPO A;  4X66 B;  4JI6 O;  1NZ6 A;  1WP8 A;  5BY1 A;  1N4C A;  2XAQ A;  4RUE A;  4YJ3 B;  1NJI W;  3BA8 A;  1JQ0 A;  4PD4 F;  1R6T A;  2OCC B;  3ASO B;  3ASN B;  1NH2 D;  4P2Z A;  3K03 A;  2ZXW B;  3JSL A;  2CE4 A;  4MVO A;  1QBZ A;  2B9Z A;  4ZHQ B;  4KXR A;  1YJN V;  4N21 A;  1YJW V;  2ITD C;  4DV2 B;  1BS3 A;  4X88 A;  4MVS A;  1BL8 A;  3WFV A;  1S72 V;  2E3C A;  1VP7 A;  1LR1 A;  2WWW A;  3B8N A;  4XBF A;  1MNG A;  5DN6 G;  5FL7 G;  2E76 B;  2VRZ A;  3E35 A;  1YHQ V;  3LSS A;  1QLE C;  2ILM A;  3TJT A;  4H0L B;  4R7C A;  1GTO A;  3CD6 V;  2ODM A;  4J10 A;  4JYB A;  4DV1 B;  3B4S A;  1YSC A;  2KB1 A;  3WB2 A;  2F43 G;  2GV9 A;  3LDD A;  1HWY A;  4LNU A;  1QLE B;  1FJG O;  1S5L Z;  3AG4 C;  5LP6 A;  2XT9 A;  5B66 Z;  3QG5 A;  4JI4 O;  2B5U A;  4EEQ A;  4FK5 C;  4MVR A;  1UFI A;  3T4Z A;  1IBL O;  4JYC A;  3KG2 A;  2BTQ A;  4ZI7 A;  4PDM A;  1GO3 F;  1VQP V;  4O4H B;  3AG4 B;  5LMN O;  2ZKO A;  3E8F A;  5LP6 C;  4MTO A;  4QJF B;  1SQF A;  3FX7 A;  1I94 O;  2IJK A;  1KBH A;  2UUB O;  3TCU A;  1QVG U;  3PN1 A;  4QNH B;  1NVP B;  3SJQ C;  5KHJ A;  1JFF A;  4LNU B;  1GMG A;  2OTL V;  3CC4 V;  2KQX A;  4YY3 O;  3K5L A;  5LP6 B;  2EIL B;  1ZX3 A;  4AQY B;  3AK3 A;  2ZE7 A;  1HNX O;  1J5E B;  4FMT A;  3CC7 V;  3IC9 A;  1J95 A;  2BTQ B;  2RJZ A;  2ZNJ A;  2LFR A;  4ZI7 B;  2WAM A;  2PI5 A;  1XIL A;  4W4L A;  2IJH A;  3X2Q C;  2VWK A;  3MHH C;  3SYP A;  5IE9 A;  4LFB O;  3APO A;  4LF5 O;  5DEC A;  5AG2 A;  5J9P C;  3ZRW A;  4GKJ O;  1R73 A;  2F1M A;  3CRC A;  4MTF A;  2N05 A;  5KAI Z;  2P6J A;  3QNE A;  2UUA B;  1YVW A;  2FTK A;  4ABM A;  1JX9 A;  4Q6G A;  2FKX A;  1VQ6 V;  2CGN A;  2GTS A;  2IBZ H;  3LNN A;  2Q8V A;  3UM7 A;  1K4C C;  1M4U A;  5LYJ A;  1AJN A;  3X2Q B;  4B3R B;  3JAL A;  4MVQ A;  5CA1 B;  1WA8 B;  4WFH A;  4ICG A;  3ZRS A;  1G8M A;  3F7V C;  3ZX6 A;  2Q67 A;  2RDC A;  1Q5O A;  4CS4 A;  1JOY A;  3FYE B;  5BXZ A;  2P7T C;  3ZMV A;  3LNM B;  1IBK B;  5IJ0 A;  3U11 A;  4WF9 V;  3ZMU A;  3PJS K;  1N34 O;  4IYI A;  4U7N A;  3MDS A;  4G27 B;  3K9S A;  1HR0 B;  1PM9 A;  5B3S C;  5IDJ A;  3CCR V;  4QE9 A;  2DE0 X;  2AW9 A;  5LXT B;  5JCO A;  2ZM6 O;  4W4K A;  2DQ0 A;  5F2V O;  2M7W A;  1IVS A;  3K08 A;  4K3A A;  3DXR A;  4TUY A;  4PDV A;  5KA6 A;  1X59 A;  5J2T B;  3JD0 A;  5LOV A;  1Q6H A;  3JAL B;  5B3S B;  1GN3 A;  1OJH A;  2LGQ A;  2NN4 A;  4E4E A;  3ETE A;  3CSX A;  5L3B A;  4HAM A;  1N36 O;  5CMU A;  1CXZ B;  1XUQ A;  4DR4 O;  3JD2 A;  1GAX A;  4DUZ O;  4LF6 O;  1PD3 A;  2Z3Y A;  5E1A C;  1EN4 A;  3S3X A;  1S3J A;  1PP9 H;  4X62 O;  3UT5 A;  2IJJ A;  3E2E A;  1P7G A;  1Y67 A;  4G2K A;  1KEC A;  3Q4H A;  5KHH A;  1W0K G;  5JJN B;  2YC0 A;  2QTS A;  3CWB H;  2HHH O;  5EBL C;  3DXR B;  4TUY B;  3ZN0 A;  1BT8 A;  3QTC A;  1S77 D;  5B5E Z;  1LUV A;  1VQK V;  5LOV B;  1AP5 A;  1WJZ A;  1NU1 H;  2EZP A;  3SPC A;  4HBN A;  2HP8 A;  3OR6 C;  1Y4M A;  2WLJ A;  1FXH A;  3B2E E;  1XOU A;  2LJ2 A;  1AP6 A;  1JA8 A;  1NTK H;  2WA3 A;  2R72 A;  1R3I C;  5JH7 B;  2ZE6 A;  3VQX A;  4OX9 B;  4JI0 O;  1EBO A;  2Q7E A;  2Q73 A;  3BHP A;  3UT5 B;  1U96 A;  5L3G A;  3ZBH A;  1WB7 A;  2M6Y A;  4FJC C;  2XUM A;  3JAS A;  2RCV A;  1XNQ B;  1SQQ H;  3SDL A;  3H01 A;  1IDS A;  1SA0 A;  3ETQ A;  4GX2 A;  4UXN A;  2LO1 A;  1ORQ C;  1PNM A;  3ABT A;  3I55 V;  4CBC A;  4X1Y A;  5BMV A;  1MZF A;  3FB7 C;  2L6L A;  2CK3 G;  2LW7 A;  1KQS U;  4J41 A;  4HZ3 A;  3H1H H;  2H8P C;  3GVM A;  2ZE8 A;  2G38 A;  5K1P A;  2X6C A;  1N33 B;  3CCV V;  5JJJ B;  2B1I A;  1SRY A;  1NTZ H;  3IFX A;  3JAS B;  2Q0A A;  5ITZ A;  4NTY A;  1MOF A;  1WNS A;  1HW7 A;  1M90 W;  4B3M B;  1ZAU A;  2OWO A;  2ZIN A;  3G80 A;  1E79 G;  3WG7 C;  1UJW B;  3ZRX A;  1SET A;  3RYI B;  5H5N A;  1ZTE A;  4X1Y B;  2XAS A;  4JI5 O;  5D5Q A;  1NVP D;  4LFC B;  3OE7 G;  1XBL A;  3UO2 A;  4IYH A;  4X1K A;  1X4T A;  2EX3 A;  1DLB A;  2AHY A;  4NVP A;  3HKB A;  1PPJ H;  4FM1 A;  1KUQ A;  5IWA O;  2ARH A;  3H1I H;  4TWK A;  1MA1 A;  2ITC C;  1UPG A;  4PV1 B;  1O9G A;  2Y69 C;  2P4V A;  2IU0 A;  4NXN O;  2V4D A;  5ITZ B;  1M5I A;  1VQ5 V;  5J2U A;  1D2D A;  4BR6 A;  4PI2 A;  2P67 A;  4NB5 A;  2DYR B;  1OCZ C;  3H1J H;  2QGN A;  4UVC A;  3ZHR A;  4Z1V A;  1K5Q A;  3L74 H;  4H44 B;  1OCR C;  2ATK C;  1D5N A;  3QO5 A;  1IUR A;  3CE2 A;  1V55 C;  2UXD O;  1CP9 A;  4PA4 A;  2Y69 B;  4CH6 A;  2V1D A;  4DR6 B;  3HKC A;  4K35 A;  2UXX A;  1XMQ O;  2KKW A;  4LFA O;  4HNA A;  4X1K B;  4RAI A;  1ZUQ A;  1VQ7 V;  1BHB A;  3HR0 A;  3HKB B;  3JAR A;  1OCZ B;  2E5L B;  1G1X B;  3WU2 Z;  3K06 A;  3STZ C;  1HNZ O;  3ABK C;  2IM9 A;  3QO8 A;  3FB5 C;  3BCC H;  1OCR B;  1V55 B;  4GT1 A;  4GCZ A;  1E1R G;  3RBZ A;  4K0K B;  3BFR A;  5J2U B;  2R70 A;  4DR7 B;  3P30 A;  4CZZ A;  2GDS A;  3DC6 A;  1TVK A;  2UUC B;  3ZJZ A;  1SS3 A;  3ABK B;  4JI3 O;  2WLM A;  4LF4 O;  1KP3 A;  1GM7 A;  3JCU Z;  3CX5 F;  3K5O A;  1NS1 A;  3HKC B;  2YI9 A;  2Q7H A;  1HNW B;  4HNA B;  3E89 A;  2Z0A A;  1GM8 A;  2GSM B;  1EZV H;  1KKD A;  1FXV A;  4DR3 B;  1IBM O;  5GON A;  5LGT A;  3JAR B;  1AIL A;  2DJV A;  2EIM C;  3W7W A;  2A06 H;  4FLX A;  4FLV A;  5H6R A;  2GBO A;  5HFM A;  2Y48 A;  2F4V B;  2H3O A;  4DV0 B;  1N32 B;  3GWO A;  4FFK A;  1H38 A;  3CB2 A;  4ZBM A;  2OIE A;  3OGC C;  2EIM B;  1XL6 A;  4UCR A;  1TVK B;  2PZS A;  1QNM A;  1I5Y A;  4DYL A;  2WLN A;  4LCU C;  3CS5 A;  2C2A A;  5L3F A;  3STL C;  2AZ0 A;  5IY5 B;  1K97 A;  2QEX V;  2UU9 O;  2RN9 A;  3F5T A;  4NXM O;  3JAW A;  4FLW A;  1XNR B;  3AG3 B;  4QPJ A;  3K58 A;  4KFM A;  4TV8 B;  3JAT A;  3KKY A;  4QGP A;  4JAA A;  3VQV A;  3OTO B;  4JZG A;  4J9Y B;  4JI1 B;  4MTG A;  4WCE V;  2EIN C;  1YCI A;  3L9D A;  2OTJ V;  1KU9 A;  3T1H B;  4OXS A;  4GKK B;  2ZIM A;  3OMA B;  1JVM A;  4LR3 A;  4X89 A;  2V7Q G;  4CS3 A;  2ZDI A;  3FYI B;  3AG7 A;  2R9R B;  3K5N A;  1SQX H;  1Q7Y W;  2EIN B;  4JI8 B;  4DR1 B;  4I4T B;  1U97 A;  4C7U A;  2VQF B;  1E1Q G;  3JAW B;  1WPB A;  1A32 A;  3W7S A;  4TQF A;  1Y6X A;  2R9A A;  5IT9 N;  1BQ0 A;  3JAT B;  4I7Z B;  4UCO A;  2BTO A;  2ZDI C;  4JTD B;  5B1O A;  3TET A;  3JYC A;  3CMA V;  1PL0 A;  2H94 A;  1FPO A;  5KUM A;  2YDE A;  1AI4 A;  1RSO A;  1GRJ A;  1XEQ A;  4DUY B;  4CH5 A;  2P22 C;  3UO3 A;  1SF9 A;  4JI7 O;  1TA8 A;  2DOS A;  2CUG A;  4H37 A;  2JEU A;  1BE3 H;  2EZO A;  3U10 A;  3ZHQ A;  1XMO B;  2YXY A;  2JRI A;  3A0R A;  4TSF G;  5EIB C;  1K33 A;  2IW5 A;  3SPG A;  2XAG A;  2HEP A;  2YUA A;  4O4H A;  1PNK A;  2PYL A;  2WLH A;  3IAY A;  2CTR A;  2VQE O;  4DRX A;  3FB6 C;  4X65 B;  2Q69 A;  2QDO A;  5B1A C;  1RSO B;  1MSW D;  1AJP A;  4U7O A;  1B04 A;  1P4R A;  1Q82 W;  1S5J A;  3T2M A;  3MHS C;  3VQW A;  3NXS A;  4O4I A;  4HYO A;  5CB4 A;  1Q90 D;  3CJH A;  5LGN A;  3DC5 A;  3FAV A;  3RYC A;  4J42 A;  1H8E G;  2LGW A;  4BAY A;  4PA7 A;  3OW2 U;  3OAA G;  4JYY A;  1F23 A;  5IYB O;  4TOI A; 
#chains in the Genus database with same CATH homology
 2IJJ A;  3ZCC A;  4WFB V;  3ZN1 A;  3CCU V;  2WLL A;  3E2E A;  4G2K A;  4WFA V;  1KEC A;  1W0K G;  4I9W A;  5B1N A;  3ABL C;  1ROP A;  3TET A;  5EBL C;  2QM8 A;  3FKS G;  2JIZ G;  1QCE A;  1JCH A;  1OCC B;  3CME V;  3ZN0 A;  1AI5 A;  3B77 A;  1QVF U;  2QA4 V;  5EBW C;  2IH3 C;  4BIU A;  1S77 D;  4P9O A;  2QTO A;  3CCE V;  3BY6 A;  1VQK V;  5LHI A;  4RQE A;  3E8B A;  4JAU A;  2EZP A;  3SPC A;  3OR7 C;  1YTF B;  1YIT V;  1SER A;  1NKD A;  1VQM V;  1OZ0 A;  3OR6 C;  1Y4M A;  2WLJ A;  4UVA A;  1FXH A;  2X6A A;  2GHY A;  4WFF A;  3ABL B;  1ZWI C;  2P90 A;  3ETD A;  2WSS G;  1QR8 A;  1V54 C;  1BHA A;  1R3I C;  2K1E A;  4LBE C;  4RUF A;  3SPH A;  1FXK A;  1M9N A;  3TK1 A;  1EBO A;  3ASO C;  3ASN C;  2NNU A;  2UXN A;  2X6B A;  1RPR A;  4G28 B;  5EBM C;  3JD4 A;  3M99 B;  4LC1 A;  5L3G A;  2WLL B;  4FJC C;  5L3E A;  1RM1 C;  1L1F A;  3LSQ A;  3H01 A;  3K0G A;  4X8A A;  1YI2 V;  1V54 B;  1WPX A;  3E8H A;  4UV8 A;  3ML0 A;  1VQ8 V;  3CCL V;  5H9C A;  4GX2 A;  1FXK C;  1K73 W;  3AG2 C;  4PDL A;  3W7X A;  1S5H C;  1W0J G;  1NQT A;  2XOK G;  4UXN A;  1KD1 W;  3QO7 A;  3W7U A;  1Q86 W;  1ORQ C;  1PNM A;  3ABT A;  1ENV A;  3IC7 A;  4JGS A;  4QPK A;  5IYC O;  3I55 V;  4RO2 A;  4CBC A;  2Q6A A;  2EIJ C;  3FB7 C;  2JDI G;  1RM1 B;  2WLI A;  2DW4 A;  2CK3 G;  4XDJ A;  2YEV A;  1KQS U;  1GKF A;  4HZ3 A;  2H8P C;  4P30 A;  1LNQ A;  3AEI A;  3K3W A;  2X6C A;  1FXK B;  1PNL A;  3AG2 B;  1XL4 A;  2HR3 A;  3CCV V;  4BIZ A;  4DXW A;  1K5S A;  3JCZ A;  4DO2 A;  4BW5 A;  1KP2 A;  1F51 A;  2B1I A;  2JJ2 G;  1SRY A;  3IFX A;  4I5S A;  3VBB A;  2EIJ B;  4TT3 G;  1MOF A;  2HVK C;  1M90 W;  5IY5 C;  4MTX A;  4UV9 A;  2IJI A;  3ABM C;  5L3C A;  1E79 G;  3AG3 C;  1AI7 A;  3P32 A;  3WG7 C;  1UJW B;  3LUT B;  3ZRX A;  3MD0 A;  2HKO A;  1SET A;  4MVM A;  1EFR G;  1F4M A;  1VQN V;  2XAS A;  1ARO P;  5B1A B;  1NVP D;  1NBM G;  3F7Y C;  3OE7 G;  1MG1 A;  2R9I A;  2WLI B;  1H8H G;  5CBG A;  2HLD G;  1NR7 A;  4PA3 A;  2YEV B;  1JJ2 U;  1DLB A;  2AHY A;  5CBH A;  4P9P A;  1BMF G;  3ZMT A;  3F5W C;  1AI6 A;  3ABM B;  4J9Z B;  1K92 A;  3DGE A;  4TWK A;  2WPD G;  3SYQ A;  3CCS V;  2ITC C;  1DF4 A;  4XDL A;  5EC2 C;  5C93 A;  2Y69 C;  3RVZ A;  2EBO A;  2IU0 A;  2IH1 C;  4E2L A;  2X7R B;  5LHH A;  1VQ5 V;  5CN0 A;  4FPP A;  2EIL C;  2P67 A;  1I5X A;  1MAB G;  2D3O W;  2DYR B;  3OUS A;  1OCZ C;  3I56 V;  4MT8 A;  3CYO A;  1F4N A;  3E83 A;  4MW8 A;  4UVC A;  2DYS C;  4QE7 A;  1K5Q A;  1VQ9 V;  3OFN G;  4MVU A;  1OCR C;  2ATK C;  3QO5 A;  1V55 C;  2MK3 A;  1CP9 A;  4N23 A;  4PA4 A;  2Y69 B;  3K04 A;  2V1D A;  3IGA C;  2UXX A;  3SYA A;  4GX5 A;  4RAI A;  1VQ7 V;  2W6J G;  5EK0 A;  1BHB A;  2OCC C;  3K79 A;  4JTC B;  2ZXW C;  1OCZ B;  2JJ1 G;  2XND G;  2ZQM A;  1QLN A;  4RQF A;  4WFG A;  4H33 A;  3K06 A;  3STZ C;  2DYS B;  3ABK C;  4JTA B;  3QO8 A;  3FB5 C;  1OCR B;  3K9A A;  1V55 B;  4GT1 A;  1COW G;  3ZRV A;  2XAQ A;  1IXM A;  1SES A;  4RUE A;  4GCZ A;  1E1R G;  3RBZ A;  4MS2 A;  1NJI W;  1JQ0 A;  3HB3 B;  2OCC B;  2IU3 A;  3ASO B;  4WFE A;  4ZKI A;  3ASN B;  3CPW U;  3P30 A;  4P2Z A;  4CZZ A;  2EIK C;  1OCO C;  3K03 A;  1NH2 D;  2ZXW B;  4JAV A;  2JEX A;  5HFL A;  1G4Y B;  3K0D A;  3FB8 C;  4MVO A;  3ZJZ A;  1NR1 A;  1QBZ A;  3ABK B;  3ZMS A;  2ZR3 A;  2WLM A;  1YJN V;  4N21 A;  1KP3 A;  1THZ A;  1GM7 A;  2ITD C;  1YJW V;  3E8G A;  2AHZ A;  1GK9 A;  4X88 A;  1VQ4 V;  4MVS A;  1BL8 A;  1R6K A;  3WFV A;  1S72 V;  3EFF K;  1YJ9 V;  2EJR A;  1M57 C;  2QKS A;  3E89 A;  1GM8 A;  2B1G A;  2GSM B;  1KKD A;  1FXV A;  2WWW A;  3B8N A;  2EIK B;  1OCO B;  5LGT A;  1FFT B;  4XBF A;  5DN6 G;  2EIM C;  3W7W A;  3HPL C;  5FL7 G;  2X0L A;  3E35 A;  1YIJ V;  1H2G A;  3UKM A;  3RVY A;  1K8A W;  1TUE B;  1YHQ V;  5H6R A;  3GB7 C;  1QLE C;  3LSS A;  3W7T A;  1SZT A;  5HFM A;  2Y48 A;  5IYD O;  1NH2 B;  3ABU A;  2QM7 A;  4R7C A;  1GTO A;  5CBF A;  3GWO A;  3CD6 V;  3DTU B;  1AR1 B;  2LP7 A;  1H38 A;  4JYB A;  3ZRW B;  4JAS A;  3AG1 C;  1YSC A;  5GW7 A;  2KB1 A;  4UUJ C;  4ZBM A;  2F43 G;  2XAJ A;  2ZD9 A;  2EIM B;  1XL6 A;  3LDD A;  1HWY A;  3OGC C;  3T4D A;  4GX1 A;  3G6E V;  1GM9 A;  2A9H A;  3OMI B;  1K4D C;  1I5Y A;  1QLE B;  3RW0 A;  2WLN A;  1QR9 A;  3ZMZ A;  3AG4 C;  3CCJ V;  4LCU C;  1PKX A;  2NLJ C;  2C2A A;  4KP4 A;  5L3F A;  2DWE C;  2B5U A;  3STL C;  3T1C A;  5IY5 B;  1K97 A;  4FK5 C;  4MVR A;  2QEX V;  1S0V A;  3T4Z A;  4JPR A;  3R65 A;  3CXC U;  4EKW A;  4JYC A;  3AG3 B;  3KG2 A;  4QPJ A;  2OT5 A;  3WG7 B;  4PDM A;  1R6N A;  1GO3 F;  4KFM A;  2ZR2 A;  3BEH A;  1VQP V;  3AG4 B;  4J9Y B;  2LFS A;  3E8F A;  4MTO A;  5L3D A;  4QJF B;  4MTG A;  4WCE V;  2IJK A;  1R3J C;  4LP8 A;  4L87 A;  1K9M W;  2EIN C;  3TCU A;  1W2B U;  1QVG U;  4ASU G;  4QNH B;  1NVP B;  5EC1 C;  2OTJ V;  3G4S V;  3SJQ C;  4OXS A;  2DQ3 A;  5KUK A;  3OUF A;  2BOB C;  3OMA B;  1JVM A;  3OEE G;  1GMG A;  4X89 A;  2OTL V;  3CC4 V;  3CC2 V;  2V7Q G;  3LDE A;  4MW3 A;  5LBQ A;  3JD3 A;  2ZDI A;  5BZB A;  3FYI B;  1M1K W;  3SPI A;  1M56 C;  4R50 A;  2R9R B;  2EIL B;  1Q7Y W;  4JF3 A;  2QE7 G;  2WLK A;  2EIN B;  1E1Q G;  5B1B C;  1FS0 G;  1EZJ A;  4FMT A;  2BOC C;  3ZIA G;  3CC7 V;  4UVB A;  1J95 A;  2LFR A;  2WAM A;  3CP1 A;  3W7S A;  2PI4 A;  2PI5 A;  1DF5 A;  2IJH A;  4PA6 A;  3X2Q C;  3MHH C;  3SYP A;  2A0L A;  5J9P C;  2ZDI C;  1K34 A;  1M56 B;  3ETG A;  4JTD B;  1RPO A;  1R73 A;  3JYC A;  5B1O A;  3ZRW A;  4MTF A;  3CMA V;  1PL0 A;  4KUM A;  5LGU A;  2H94 A;  2P6J A;  3QNE A;  4PDR A;  5KUM A;  4Z1M G;  2FTK A;  2YSU B;  1JX9 A;  5DM6 V;  1VQ6 V;  5B1B B;  1AI4 A;  1B6Q A;  3UM7 A;  1K4C C;  2HJF C;  1AJN A;  3B8M A;  3X2Q B;  1AJQ A;  1K7D A;  4MVQ A;  1DTO A;  4WFH A;  3ZRS A;  3G71 V;  1P7B A;  3JD1 A;  1G8M A;  2A79 B;  3F7V C;  1Q81 W;  2Q67 A;  4H37 A;  2JEU A;  4R8C A;  1R3L C;  2DWD C;  3D3I A;  4F4L A;  2EZO A;  4PEL A;  3FYE B;  1JOY A;  4MSW C;  3A0R A;  4TSF G;  2P7T C;  1R3K C;  3LDC A;  3LNM B;  3ZMV A;  1K33 A;  2IW5 A;  4WF9 V;  3ZMU A;  3CCM V;  3SPG A;  3CCQ V;  1OHH G;  2XAG A;  2Z5U A;  1CEZ A;  3PJS K;  4U7N A;  4G27 B;  1N8R W;  1WLE A;  5B3S C;  5IDJ A;  3CCR V;  1VQL V;  4QE9 A;  1M57 B;  1PNK A;  4PA9 A;  5LHG A;  2WLH A;  2HVJ C;  4XDK A;  2DQ0 A;  2M7W A;  3FB6 C;  3OEH G;  5H6Q A;  1Y66 A;  1KC8 W;  2Q69 A;  3K08 A;  2XAF A;  5B1A C;  1MSW D;  2W0F C;  1AJP A;  4U7O A;  4PDV A;  4Q20 A;  3VOU A;  5KA6 A;  1P4R A;  2HFE C;  3SYO A;  5KA5 A;  4QIW F;  4GX0 A;  3JD0 A;  4MVZ A;  3SYC A;  4FIP C;  4YXW G;  1Q82 W;  5B3S B;  3D36 A;  3T2M A;  3MHS C;  3NXS A;  3AG1 B;  2XAH A;  3OM3 B;  4HYO A;  1CPY A;  4R6Z A;  1JPX A;  1K3E A;  3ETE A;  5LGN A;  1VQO V;  5L3B A;  4HAM A;  5CA3 A;  3SPJ A;  5CMU A;  3E86 A;  2Q68 A;  1H8E G;  1YTF D;  3JD2 A;  1OCC C;  4PA7 A;  4BAY A;  1PD3 A;  3OW2 U;  3OAA G;  2Z3Y A;  2JK5 C;  5E1A C;  3OMN B;  1S3J A;  2W6I G;  2HG5 C;  1F23 A;  5IYB O;  3EHB B;  1S76 D;  2DYR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...