3OTOO

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3otoO00
4LFCO 2VQEO 3SDLA 4LF7O 2DOSA 2DJVA 4DR1O 4NXNO 1N34O 4DR5O 4DR6O 3T1HO 2ZM6O 2JRIA 4X64O 1IBKO 1IBLO 4DR3O 1HR0O 4LF6O 4JI5O 5LMUO 1HNXO 4LFBO 4YY3O 3J81N 1HNZO 1A32A 4LF9O 1FYJA 1NS1A 2UXBO 3F5TA 2AGAA 1XMQO 1D2DA 4OPAA 5LL6Y 4JI0O 4AQYO 2N74A 5BY1A 4JI8O 2ZKOA 4DV5O 2UXCO 1N36O 1X59A 4LF5O 4X62O 1R1BA 3O65A 4LF4O 3J80N 4K0KO 5BR8O 4OPHA 4JI1O 2UUBO 4B3SO 2FKXA 5LMNO 4YHHO 2HHHO 2UXDO 1KUQA 4X65O 3RT3C 1IBMO 2UUCO 1HNWO 4LFAO 4KHPO 1FJGO 4JI7O 4DV0O 4JI4O 3T1YO 4DUYO 5A2QN 2E5LO 1G1XB 5IWAO 4DR7O 4JV5O 4DV7O 3OTOO 4OX9O 4NXMO 1XNRO 5IT9N 5H5NA 2UUAO 3M8AA 3R66A 4DV6O 4JI6O 5FLXN 1DK1A 4JI3O 3JAMN 4B3TO 4LF8O 1F7YA 4DV1O 4DV4O 1AILA 4DV2O 4A5UB 2UU9O 4GKJO 4B3MO 2LW7A 2Z0AA 4DR2O 4JYAO 4DV3O 1N32O 1YZBA 1R6TA 4DUZO 1N33O 2F4VO 4B3RO 1XEQA 1I94O 5BXZA 1AB3A 1J5EO 1FKAO 4JI2O 2VQFO 1XMOO 3J7AU 4GKKO 4DR4O 1XNQO 4X66O
chains in the Genus database with same CATH superfamily
5KHHA 2ZM6B 1K33A 4GX5A 4LC1A 4RAIA 3QNEA 2DYSC 4TQFA 2OYQA 2LFSA 1N4CA 4I4TA 4QNHB 4H44B 4RO2A 1XREA 4XDKA 1URFA 4PDVA 5JJJB 2A9HA 5KMGB 3OEEG 1WAZA 3N2KB 2K9PA 4ZI7A 1V54C 3D36A 4XDJA 4O4IB 1R3KC 4I7ZB 3CC7V 4B08A 4IL6Z 3N2GA 2XNDG 1BGYH 2HVJC 1GK9A 3Q4HA 2R72A 3A8TA 3F7YC 2E5LB 4G27B 1PKXA 4MW8A 3OTOB 2CTRA 4CS3A 3LSSA 3B40A 4X20B 1OV9A 3CCMV 4K0KB 2EIMB 2EIJC 1XBLA 3JYCA 2OCCB 5IJ0A 3OMAB 2QTSA 1VQ4V 4YJ3B 1WB7A 3L72H 4G2KA 4HAMA 4NB5A 1JQ0A 2IU0A 1M57B 2CGOA 1BZKA 2EINC 3K5OA 3ZBHA 5JVDB 4FLXA 2ZDIC 4L8JA 5LYJB 1SQFA 2MW2B 1LUWA 2LO1A 3RGBA 1XEQA 2P5OA 3EXAA 3JARB 1J5EO 2JJ1G 4NKGB 2Q69A 2PYJA 1BHBA 1NVPD 3CCEV 2VQEO 3MAQA 3GB7C 2V1DA 1S77D 1QLEC 3E86A 5CBHA 2HG5C 2ZQMA 2NN4A 4JAAA 1EFRG 1E79G 2DMXA 3CRRA 1OJHA 2LW1A 4BIZA 4DO2A 1VEWA 5B3SC 4LH7A 1ZX3A 1JFFA 4AILC 1VQ6V 3ABLC 1SERA 1H2LA 3OTFA 4OPAA 1CEZA 4UFZA 3AG4B 3CB2A 2LJ2A 5BY1A 4H37A 4YHHB 4DK1A 1DLBA 1QBZA 1Q82W 4TV9B 4NYKA 3K3WA 3VQVA 1K92A 2WLMA 1VQMV 2M6YA 3DXRB 5IWAB 5DN6G 5E79Z 1KECA 5CA3A 2X0LA 1IVSA 3QTCA 4FM0A 3OUSA 1P7BA 3B4SA 2Z3YA 1VQ7V 4H0LB 1P84F 1VQLV 2IM9A 4MVRA 1E1RG 5D5PA 4K8ZA 1DF4A 3U0ZA 1K34A 3UKMA 5GTIZ 2QTOA 4O2BB 1JCHA 5J2TA 1TVKA 3SYOA 4B3MO 2IW5A 2LW7A 4MVUA 3W7UA 4FLWA 1SQPH 1SS3A 1YVWA 4IIJB 3ABUA 1T5EA 3E22A 4B3RO 4EB6B 4B7KA 4LCUC 2UU9B 2EULA 3U11A 2DYRB 1M56C 5H2FZ 1IDSA 1TGOA 5HFMA 5EK0A 5LHIA 1YHQV 3FAVB 2P7TC 4D7SA 2X6CA 1OCCC 3TXSA 2A3QA 2H8PC 2ATKC 3OGIB 1WB8A 3RYHA 2BSKB 3ETEA 4JTDB 5IY5B 4YXWG 3VQXA 4GKKB 1NT2B 3E8BA 2JEUA 4O2AA 2CGNA 3ZX6A 2OTLV 2JGUA 4LF6O 2EJRA 5IJ9A 4Z2WA 4UVCA 3J81N 1PM9A 5L3DA 4CS4A 2YXHA 2GDSA 2X7RB 2KKWA 2DQ3A 1MZEA 1VMGA 3STLC 4LWSA 2ZE5A 4DR3B 1COWG 2R9RB 4UCOA 4DV5O 1HNZB 2X6BA 3P32A 4MTXA 3R65A 4PD4F 1PNKA 5KA5A 5BR8O 3ASNC 2QKSA 2EX3A 1RPOA 4HYOA 2WLJA 2ZR2A 3CJHB 2N05A 3JATB 1XQ8A 4I55A 3HB3B 4L87A 5BZBA 4X1IA 1U97A 2OIEA 4PDMA 1PL4A 5DM6V 2WLIB 4OGQB 3CRAA 5EBWC 1RM1B 5LP6C 1JMKC 5H6QA 1SA0B 1LR1A 2F23A 3JAMN 2WAMA 3AG2B 1PNLA 3WG7C 4U7OA 3F7VC 1GN6A 3HKBB 4R8CA 1J5EB 1QU7A 3BCCH 3CSXA 5LXTA 2ZNIA 3JAWA 5LOVA 3ZRSA 4B3TB 2E76B 4PA7A 2Q8VA 2QWNB 4DV1B 3K57A 5DEDA 3MD0A 4IYIA 2VQEB 3ETGA 5LBQA 4IGGA 1HP8A 1UFIA 4TV8A 4IHJB 4ZOLA 4TUYB 1IXBA 2YI8A 3ZIAG 3CCJV 1N32B 4PI0A 3ETDA 1XDCA 3T4DA 4J11A 5GONA 4G28B 1XNQB 3K03A 1K9MW 3N27A 1KC8W 2PY5A 4ABMA 4NXNB 4GUNA 1KYOF 3CS5A 1Z5VA 1OCOC 3BVOA 4I50A 1XMQO 1WNSA 2BOCC 4Z1MG 1GM9A 3QO7A 5EYPB 2ZXWC 1B6QA 1FXKB 3O65A 2UXBB 1RP3B 5IYDO 2UUBO 5LMNO 1S5HC 3M7MX 4FZ0A 4O4HA 1VQPV 1VQKV 1NTKH 1RSOB 2ILMA 1XILA 2Q0AA 1Z5WA 3JD0A 4E4EA 3FD9A 3SJAC 3BY6A 1NH2B 3RYIA 5LGUA 5EIBD 2H94A 3OR6C 4HNAB 4B3RB 2PGGA 1H2GA 1H2KA 5B1NA 3TGUH 1F51A 4NTXA 3AG3B 1EN4A 4DV3O 5KA6A 4DV6B 3ZRWA 5LA6B 5J2UA 2EIKC 1XHZA 1I7FA 1THZA 3BFRA 5KHGA 2WA4A 3JSLA 4TQDA 1AI4A 2Y69C 4DUZB 2GSMB 1K4CC 3D36C 3B77A 1BS3A 3SDLA 4LF7O 4MVQA 5EZYA 2JS5A 2QE7G 4LF6B 1E1QG 1GN3A 3AG1C 1JJ2U 4RWUA 1XMOB 3IC9A 1FS0G 3APQA 1IBKO 3RN4A 4YIPA 1YJ9V 3JALA 3CCRV 1EBOA 5KAFZ 4CS2A 1MA1A 1MZFA 4LFBO 1SESA 2XASA 4DV5B 3DC6A 4ZIBA 3L9DA 4DR6B 4O4JA 1NR1A 3E83A 3ZMSA 4ASUG 1IBLB 5BR8B 2Q67A 3BEHA 4KFMA 3HKCA 2OIGA 4BR6A 1OZ0A 2YS8A 3IJ4A 2LFRA 4JTCB 4MTOA 5AG2A 2EILC 1JX9A 4NTWA 4W4KA 1H8EG 4J7KA 3VOUA 4I9QA 2Q7HA 3C3TA 2QM4A 2OWOA 3DGEA 2MK3A 4KXRA 4DW1A 1FFXB 4B3SB 4U3FH 1NKDA 1OCCB 3JCZA 1XNRO 3N2KA 3OM3B 2D2CB 3R66A 3BRCA 4O4IA 5LGTA 1AILA 3K9SA 4MVSA 3H9VA 1NU1H 3RVYA 2Z0AA 3U10A 3ICXA 1WA8B 4PA9A 1G4YB 4PELA 3JAKB 1VARA 5EBMC 4TWKA 1NBMG 5KLVH 2QDOA 2P67A 1Z2GA 4J7ZA 1WPXA 2ADQB 2XT9A 5IYCO 3UO3A 3ZHSA 3CXCU 1YIJV 2QWQB 3O9OA 2YXLA 2ZE7A 2KG7B 3STZC 5KUMA 3ASNB 2BTQB 1M93A 3VQWA 2PUSA 3TJTA 3IC7A 1OCRC 1JJOA 3IAYA 1NR7A 3LDCA 1R3JC 4X64O 2HVKC 5JVDA 1XMQB 1HR0O 1K4DC 1M1KW 4MTFA 2AXTZ 4R6ZA 4Z1VA 1DTOA 3ABKC 4D7TA 4GX1A 3JARA 2A06H 4AQYO 5LMNB 3B09A 2UXCO 3FB6C 4FFBB 3JD4A 4ZHQB 4LF5O 4LF9B 3G6EV 2PF4E 4X62O 3TXQA 3A0RA 2B5UA 4OPHA 4CZZA 2JEXA 3X2QC 3H1IH 1KUQA 3K06A 3VQYA 4WFAV 1IBMO 1L8DA 2HFEC 3UQ8A 2A7WA 1FPOA 1SKVA 4J10A 4JI4O 2JJ2G 1CXZB 5B1BC 2LQTA 4UB6Z 2BOBC 4MVOA 3LDDA 2WSSG 3ABMC 1QR9A 4NXMO 1CPYA 3BABA 3BHPA 1YDXA 5IT9N 2UUAO 4C7UA 1K5QA 4Q20A 3FYIB 4I0XA 1Q7YW 1F7YA 3T2MA 2KQXA 2AW9A 1VF5B 2IBZH 2RJZA 1Y67A 2C2AA 4TV9A 4EFBA 4DR2O 3QF7A 1KP2A 4JYAO 1L0LH 3QG5A 4P9PA 3HKEB 2YI9A 1QVFU 2QWPB 3G6BA 4LF7B 2BCCH 3CHXA 2XAGA 1TUBB 2D3OW 1ZWIC 2E74B 4U3JB 2YUAA 1D5NA 2EBOA 1Q6IA 1IBKB 3HKDB 1UJWB 1G8MA 1M4UA 2B1IA 4LFBB 3ZJZA 1R73A 2F95B 1YJNV 1SQQH 2JGDB 3OT7A 4FLUA 4FLZA 3T1CA 1QLNA 2R9AA 1V9PA 4EB6A 3AG7A 4WFBV 2AGAA 2B9ZA 1ORQC 3SGIA 2W6JG 3DTUB 4JI5B 4JI8O 2XHBA 4BW9A 2YEVB 1I08A 4FLYA 1IURA 2XTAA 4JI1O 2HHHO 1BQ0A 1MSWD 3RT3C 5K1XA 1AP6A 1HNWO 2EIKB 2IJIA 1GKFA 4IYHA 4KHPO 1FXVA 3SJQC 4PHZA 2RQ6A 3L75H 2IJJA 2ITDC 5C8YA 4AI8A 5A9GA 4FMTA 4JV5O 1NZ6A 4ZI7B 1Y6XA 5JH7A 2GUZB 1OCZB 3WFVA 4MT8A 1IZ3A 1RFYA 3LNMB 3N2GB 1DK1A 3Q4HB 5KUKA 4TSFG 3THOA 3E8GA 4QPKA 1GO3F 3MHHC 5EBLC 3ASOB 3L74H 1Q5OA 3K08A 1ZUQA 4X89A 1W2BU 3CJHA 3G4SV 3E2EA 3ZHVA 4GKJB 3WB1A 2YIAA 2VRZA 1O9GA 2WLIA 5L3CA 3CEIA 5IDJA 1DGSA 1SA0A 3OE7G 1HR0B 3E8HA 2HP8A 1PP9H 4DR1O 4UV8A 1GMGA 4J41A 1N34O 4DR5O 5BMVA 2Y0PA 3BA9A 4O4LB 1NJIW 4FLVA 3ZHQA 4PV1B 1K8AW 4LNUB 3HKBA 4JTAB 1AVMA 4WBNB 3L71H 2ZCEA 4AQYB 1HNXO 4MVMA 1VQ9V 3QVNA 2UXCB 1EN6A 4LF5B 1NTMH 4X62B 2ODMA 2GV9A 3WB0A 4YJ2B 1BE3H 4IHJA 2B1GA 1FFTB 4TUYA 2YICA 3SYCA 3W7TA 3CWBH 3SR2C 3SPHA 1R1BA 1V55C 4JI4B 1N0NA 1VQ8V 4UXNA 5EIBC 4Q6GA 4P30A 2UXDO 4WFFA 4NTYA 1G6UA 1ZSPA 4NXMB 1K3EA 4JI7O 4BW5A 1P4RA 1JPXA 1M9NA 4DUYO 3ZMTA 5A2QN 4GCZA 4DR7O 1JFFB 3B2EE 3FKSG 1AI5A 2EJ7A 2JDIG 3W7XA 4JYBA 4MW3A 4DR2B 1GM8A 5FPRA 2F1MA 4P9OA 4DV2O 2L6LA 3CCVV 1FXKA 1XUQA 3RWRD 1S0VA 3K9AA 3K0DA 1VF6C 5KX5A 2QR4A 5B1AC 3ABKB 1I94O 3W7WA 1F23A 3CE2A 5JCOA 2KB1A 2N04A 2VQFO 4X1KA 2L35A 5CA0A 3ZHTA 5L3EA 1NH2D 4DR4O 5CBFA 4X66O 2DYSB 5B66Z 2RDCA 3AK3A 4WFEA 1XL6A 2NR5A 2IU3A 3ZEDA 5J2TB 5KHIA 2AZ2A 1V54B 4D6TH 2QM7A 4NR1A 3B8NA 1Y76A 4TT3G 1R6KA 1SRYA 1SQGA 1I0HA 2IH3C 3E22B 3S3WA 4DRXA 4JI8B 3C3SA 3RYFB 2FMLA 2P90A 4QIWF 1YJWV 5LA6A 1X4TA 3F5TA 4UB8Z 4UCVA 2NLJC 5JQGA 4JI0O 1F4NA 2HHHB 1N36O 1HNWB 1NQTA 2ZIOA 1L0NH 3P30A 1R3LC 2WA3A 4GYCB 2EIJB 3OFNG 1SC5B 4O2AB 4JV5B 4FLTA 4QE7A 1FJGO 3UT5A 2QA4V 3JD3A 1KB9F 5IJ9B 1FXHA 3RVZA 2Q6AA 5LHGA 2Q0OC 2EINB 5JWPA 4PJ0Z 3WB2A 4UCUA 2ZD9A 1BT8A 2YIBD 4X1YA 4UCTA 1K73W 3G80A 1YTFB 2EIMC 2RNBA 2WLLB 4JPRA 4KP4A 2GHYA 4K8XA 1RPRA 1CP9A 2OCCC 1YEWA 4UUJC 2YDEA 3G67A 3ZN0A 3SPGA 4EEQA 3SYQA 1M57C 3RYCA 4I55B 3M99B 3KCYA 2JS3A 3H1LH 2FYUH 1MMMA 4B3MB 2HEPA 1QLEB 4FJCC 3QO8A 1FFXA 1N34B 1EM1A 4DR5B 2CTQA 3PN1A 4LFCO 3OW2U 2CH7A 5FPOA 2DOSA 3C90A 3ML0A 2DJVA 5ITZB 4F4LA 5B3SB 1HNXB 3FB5C 1AJNA 3T1HO 2JRIA 3ABLB 4H13B 4X9QA 1W0JG 3OD4A 4P2ZA 3K0GA 3FB8C 4ICGA 4QJFB 4TV8B 4ZOLB 5H6RA 4PI2A 4RUFA 3MHSC 2UXDB 1H38A 1VF6A 2X6AA 4F6RB 2YIDA 4ZKIA 2KG7A 2H3OA 1EN5A 1VF7A 4CH3A 2BTQA 3CRQA 4LF4O 4RQEA 1QVGU 4K0KO 5FNVB 5HFLA 4DUYB 1XL4A 1GM7A 4X65O 1HW7A 1QR8A 5TISZ 4JASA 2V7QG 1XI1A 3K79A 3K59A 1O9HA 3K5LA 3GWOA 2F93B 3APOA 3HR0A 4FM1A 1JOYA 1S76D 1GRJA 1OHHG 1VQ5V 2QSAA 4DV2B 2XOKG 2QJ1A 2JK5C 2G38A 3BA8A 1B3QA 5IYZB 4FFBA 4PA3A 4ZHQA 1M56B 4JZ2A 3CD6V 2ZINA 4DR4B 1B06A 4X66B 5BXZA 5KMGA 1P49A 2ZE8A 5CMUA 1FKAO 2W0FC 4B7EA 2PTMA 3H1KH 4LBEC 5L3FA 2W0XA 4I9WA 1N8RW 4RQFA 2DYRC 2R70A 3H1HH 4AHCA 1TUEB 4X20A 4JI0B 1M5IA 2IH1C 5IY5C 1A32A 1FYJA 2ZE6A 4UVAA 5KHKA 3IFXA 3HKEA 1YITV 4YJ3A 1HWYA 2EZOA 1S5LZ 1TUBA 3I55V 1VIBA 1QHTA 4JYYA 4U3JA 3GVMA 3L70H 1EZJA 3JD1A 2Y0IA 3HKDA 3EHBB 4HBNA 3TCUA 5LYJA 1KQSU 2JVDA 4WFGA 5LP6B 4FM2A 1K7DA 4K3AA 1WP7A 1S72V 2JGDA 1AR4A 3CMEV 3SYPA 2QM8A 1PL0A 2XAJA 2UUBB 3WG7B 2PI4A 4DV7O 4OX9O 3LSQA 3HKCB 1AI6A 3S3XA 3ZN1A 2M7WA 1Y74B 2P6JA 3CCLV 3OEHG 1RM1C 2UU9O 2YEVA 2Q68A 4MSWC 3KG2A 1MG1A 3FB7C 4QPJA 4FIPC 2QWOB 1YZBA 2CTPA 5CB4B 3AG2C 1SQVH 4LFCB 2LP7A 3CMAV 4PDRA 2BTOA 4GKKO 1SETA 4DV3B 2Q5ZA 3ZCCA 1N0JA 3T1HB 1PV0A 1P7GA 2GUZA 3CP1A 2ITCC 1ZL8B 1ROPA 3JASB 1SQXH 4N23A 3DXRA 1OCOB 5B5EZ 2CUGA 4DR3O 2ZR3A 1Q6HA 5LMUO 3E89A 4ZBMA 4YY3O 1HNZO 3RFRA 3OUFA 2ZXWB 4CH5A 5L3GA 1WP8A 4FK5C 2ARHA 4LF4B 5LL6Y 1J95A 3FX7A 5FL7G 4MVZA 1X59A 4X65B 3ZMZA 4O2BA 1H2MA 4J9YB 1GH6A 3OMNB 4UVBA 2VWKA 3J80N 4GT1A 1JA8A 1AJQA 1FAFA 4CH4A 2FL4A 1KKDA 2CDYA 1GTOA 4IIJA 4O4LA 1SZXA 1AR1B 2NNUA 1FXKC 4MTGA 3ZRVA 4LNUA 5KHJA 5CA1B 2WLKA 2PI5A 4WBNA 2ADPA 4EKWA 2ETNA 2AZ0A 3IGAC 5JCOC 3FAVA 3GWKC 3HPLC 2Q9LA 1TAEA 4B3TO 1R3IC 4YJ2A 2BSKA 1Q43A 4DV1O 3OMIB 4I4TB 1XNRB 1W59A 5CBGA 2R9IA 3A0HZ 4F6EA 3D8CA 4UV9A 1BL8A 1N32O 1BHAA 2Y69B 1N33O 2F4VO 3D3QA 3CYOA 2P22C 1AB3A 3SPCA 2UXNA 1WN7A 4DXWA 3SYAA 3AG1B 3J7AU 2W6IG 3AG3C 1XNQO 5EC2C 3JSNA 1SQBH 2N74A 4JYCA 4I0XB 2Q73A 4BIUA 5KAIZ 3NR7A 4CC5A 4NXNO 5B1OA 3CC4V 3CCSV 2PYLA 5E1AC 3JATA 1H2NA 3CC2V 1YSCA 2FTKA 1BQZA 2IJHA 1ENVA 4LH6A 1Q8IA 5IJ0B 4JGSA 1VQOV 2EILB 4X64B 2UXBO 2P4VA 2ZKOA 3A0BZ 1IX9A 3W7SA 1ZLZA 3UM7A 1Q81W 2EZPA 1U96A 5CN0A 3DSQA 3FYEB 2FKXA 4WF9V 3H01A 4DV7B 2UUCO 4OX9B 1S5JA 2RN9A 4IT5A 1W0KG 4DV0O 4TOIA 3K58A 2AHYA 2BE3A 2Q7GA 1IBMB 3RYFA 3L73H 2YC0A 2Q7EA 1VQNV 5H5NA 1NVPB 4GX0A 4JAUA 4DV6O 4JI6O 3RW0A 4GLXA 4LF8O 3OR7C 2CTWA 2ZNJA 3RBZA 5GW7A 1YF2A 3LUTB 1DF5A 3E35A 2XAFA 2UUAB 4X88A 2Y4TA 3JD2A 1Y66A 1YXBA 3ABTA 4DUZO 2DE0X 4R7CA 1KBHA 2RMKB 5C8YB 4JI2O 4J7JA 1QCEA 1KU9A 2XAQA 1XMOO 1OCRB 4FFKA 5JH7B 3CRMA 4JYAB 5EYPA 3BPZA 1H2SB 2HJFC 3CXHF 2ZDIA 1YTFD 4LP8A 5LMUB 4YY3B 4DR6O 3P3NA 3D3IA 3K5NA 2WLLA 1KKCA 2E75B 3PJSK 3CCQV 1IBLO 4WCEV 1H8HG 3AK2A 1RSOA 4FPPA 5JJNB 3FFQA 3AEIA 4J42A 2P06A 1PPJH 2QWRB 3X2QB 3VBBA 4J80A 2Y48A 3T4ZA 3LNNA 4HNAA 1TVKB 4W4LA 4I5SA 2DWEC 3B8MA 2DN9A 3SJCC 3CRCA 1SF9A 1MNGA 5B1BB 1ZTEA 3TK1A 5BMVB 2AHZA 4B3SO 5ITZA 4RUEA 3ABMB 4PA4A 4PDLA 4LFAO 4EFEA 1YCIA 3T1YO 1M90W 1AP5A 5LGNA 2PZSA 3EVKA 5IE9A 4JI1B 4DW0A 1I5XA 5H9CA 2Q4PA 4JZGA 4KHPB 3RYHB 2WLNA 5IYBO 3SPJA 1S3JA 3OGCC 3LDEA 4JI3O 5J9PC 4BAYA 2XUMA 2CE4A 4DV4O 1N33B 2F4VB 4F6RA 1Q90D 1BCCH 3LSUA 2UXXA 1TA8A 5FNVA 2YXYA 1YI2V 3DC5A 3WU2Z 4N21A 4MS2A 4LWSB 3I56V 2YIBA 1MOFA 2DW4A 3ZMVA 2KSDA 4GZRB 4DK0A 1XHXA 3E8FA 2ZM6O 2A0LA 5IYZA 4XDLA 3BAAA 3QO5A 4X1IB 3OAAG 1AJPA 3ZRXA 5KX5B 4E2LA 1K97A 1XOUA 4DR1B 4LF9O 3KKYA 5LHHA 4H33A 2QKAA 1NS1A 1BSMA 3A2FA 1I5YA 1D2DA 2ZT9B 4X1KB 1PD3A 2Y4UA 5CA0B 1L1FA 2WPDG 2DQ0A 3KZIZ 4BWAA 2UUCB 4J9ZB 2CK3G 4DV0B 1IXMA 5LXTB 3G71V 3JAWB 5DECA 5LOVB 1LUVA 1KMIZ 1WA8A 3JAKA 4K35A 5F2VO 1JVMA 1Y76B 4CH6A 1NI8A 2FB5A 3F5WC 4DRXB 4PA6A 4JI6B 2F43G 2E5LO 1G1XB 4LF8B 3I5DA 3OTOO 3K5MA 1Q86W 2HJDA 5JQGB 4JI7B 1K5SA 3M8AA 5GONB 1WPBA 2QEXV 1UPGA 5JJEB 3AG4C 1Y4MA 2F66C 1F4MA 1FD9A 1KP3A 3H1JH 4DR7B 3ZS8C 3ZHRA 3CCUV 1BMFG 1OCZC 1R6NA 1AI7A 2GTSA 4FVMA 1MSDA 2VWJA 4JI2B 2RCVA 5C93A 2IJKA 4HZ3A 4KUMA 4FZ1A 4QGPA 1R6TA 2ZIMA 2O57A 3UT5B 5LP6A 4I50B 2E3CA 1VP7A 3CX5F 3ETQA 1D5AA 2QKCA 3ZHUA 3ASOC 1I94B 4X1YB 2CAZC 1US6A 3P3PA 4CC6A 2VQFB 4O4HB 1Y74A 2DWDC 2WWWA 3SPIA 4DYLA 2GTAA 4KL1A 4WFHA 2K1EA 3UO2A 1QQCA 4JI5O 3RYCB 1GN2A 1GAXA 2OTJV 3EFFK 3RYIB 5CB4A 1V55B 3MDSA 4R50A 3K04A 1AROP 1Q6UA 4UCRA 2A79B 2OT5A 1JR9A 3ZMUA 2HLDG 2CH7B 1AR5A 4LFAB 2VS0A 3NXSA 2V4DA 1GN4A 3AK1A 4JAVA 1HDJA 3T1YB 1ZL8A 4YHHO 3ZRWB 2LGQA 2WLHA 3JASA 1QNMA 1N36B 5J2UB 2QGNA 5EC1C 1PNMA 2HR3A 5K1PA 3SJBC 4JI3B 3UCSC 5IWAO 1EZVH 1LNQA 5L3BA 4DV4B 2P4KA 1KD1W 5EZYB 2Z5UA 4BIOA 1FJGB 1ZAUA 5FLXN 1WLEA 5GTHZ 5B1AB 1SZTA 1Q3EA 2GBOA 1MABG 4QE9A 3JALB 4A5UB 4GKJO 4UCSA 5D5QA 2YSUB 3CPWU 1NTZH 4YIOA 3JCUZ 3TETA 2XAHA 2HKOA 4NVPA 4CBCA 4O4JB 4X8AA 2OCHA 4LR3A 2LGWA 1B04A 4XBFA 4U7NA 4OXSA 2JIZG 4GX2A 5CA1A 4JF3A 1WJZA 3KCXA
chains in the Genus database with same CATH topology
4LFCO 2VQEO 3SDLA 4LF7O 2DOSA 2DJVA 4DR1O 4NXNO 1N34O 4DR5O 4DR6O 3T1HO 2ZM6O 2JRIA 4X64O 1IBKO 1IBLO 4DR3O 1HR0O 4LF6O 4JI5O 5LMUO 1HNXO 4LFBO 4YY3O 3J81N 1HNZO 1A32A 4LF9O 1FYJA 1NS1A 2UXBO 3F5TA 2AGAA 1XMQO 1D2DA 4OPAA 5LL6Y 4JI0O 4AQYO 2N74A 5BY1A 4JI8O 2ZKOA 4DV5O 2UXCO 1N36O 1X59A 4LF5O 4X62O 1R1BA 3O65A 4LF4O 3J80N 4K0KO 5BR8O 4OPHA 4JI1O 2UUBO 4B3SO 2FKXA 5LMNO 4YHHO 2HHHO 2UXDO 1KUQA 4X65O 3RT3C 1IBMO 2UUCO 1HNWO 4LFAO 4KHPO 1FJGO 4JI7O 4DV0O 4JI4O 3T1YO 4DUYO 5A2QN 2E5LO 1G1XB 5IWAO 4DR7O 4JV5O 4DV7O 3OTOO 4OX9O 4NXMO 1XNRO 5IT9N 5H5NA 2UUAO 3M8AA 3R66A 4DV6O 4JI6O 5FLXN 1DK1A 4JI3O 3JAMN 4B3TO 4LF8O 1F7YA 4DV1O 4DV4O 1AILA 4DV2O 4A5UB 2UU9O 4GKJO 4B3MO 2LW7A 2Z0AA 4DR2O 4JYAO 4DV3O 1N32O 1YZBA 1R6TA 4DUZO 1N33O 2F4VO 4B3RO 1XEQA 1I94O 5BXZA 1AB3A 1J5EO 1FKAO 4JI2O 2VQFO 1XMOO 3J7AU 4GKKO 4DR4O 1XNQO 4X66O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC O;  2VQE O;  3SDL A;  4LF7 O;  2DOS A;  2DJV A;  4DR1 O;  4NXN O;  1N34 O;  4DR5 O;  4DR6 O;  3T1H O;  2ZM6 O;  2JRI A;  4X64 O;  1IBK O;  1IBL O;  4DR3 O;  1HR0 O;  4LF6 O;  4JI5 O;  5LMU O;  1HNX O;  4LFB O;  4YY3 O;  3J81 N;  1HNZ O;  1A32 A;  4LF9 O;  1FYJ A;  1NS1 A;  2UXB O;  3F5T A;  2AGA A;  1XMQ O;  1D2D A;  4OPA A;  5LL6 Y;  4JI0 O;  4AQY O;  2N74 A;  5BY1 A;  4JI8 O;  2ZKO A;  4DV5 O;  2UXC O;  1N36 O;  1X59 A;  4LF5 O;  4X62 O;  1R1B A;  3O65 A;  4LF4 O;  3J80 N;  4K0K O;  5BR8 O;  4OPH A;  4JI1 O;  2UUB O;  4B3S O;  2FKX A;  5LMN O;  4YHH O;  2HHH O;  2UXD O;  1KUQ A;  4X65 O;  3RT3 C;  1IBM O;  2UUC O;  1HNW O;  4LFA O;  4KHP O;  1FJG O;  4JI7 O;  4DV0 O;  4JI4 O;  3T1Y O;  4DUY O;  5A2Q N;  2E5L O;  1G1X B;  5IWA O;  4DR7 O;  4JV5 O;  4DV7 O;  3OTO O;  4OX9 O;  4NXM O;  1XNR O;  5IT9 N;  5H5N A;  2UUA O;  3M8A A;  3R66 A;  4DV6 O;  4JI6 O;  5FLX N;  1DK1 A;  4JI3 O;  3JAM N;  4B3T O;  4LF8 O;  1F7Y A;  4DV1 O;  4DV4 O;  1AIL A;  4DV2 O;  4A5U B;  2UU9 O;  4GKJ O;  4B3M O;  2LW7 A;  2Z0A A;  4DR2 O;  4JYA O;  4DV3 O;  1N32 O;  1YZB A;  1R6T A;  4DUZ O;  1N33 O;  2F4V O;  4B3R O;  1XEQ A;  1I94 O;  5BXZ A;  1AB3 A;  1J5E O;  1FKA O;  4JI2 O;  2VQF O;  1XMO O;  3J7A U;  4GKK O;  4DR4 O;  1XNQ O;  4X66 O; 
#chains in the Genus database with same CATH topology
 5KHH A;  2ZM6 B;  1K33 A;  4GX5 A;  4LC1 A;  4RAI A;  3QNE A;  2DYS C;  4TQF A;  2OYQ A;  2LFS A;  1N4C A;  4I4T A;  4QNH B;  4H44 B;  4RO2 A;  1XRE A;  4XDK A;  1URF A;  4PDV A;  5JJJ B;  2A9H A;  5KMG B;  3OEE G;  1WAZ A;  3N2K B;  2K9P A;  4ZI7 A;  1V54 C;  3D36 A;  4XDJ A;  4O4I B;  1R3K C;  4I7Z B;  3CC7 V;  4B08 A;  4IL6 Z;  3N2G A;  2XND G;  1BGY H;  2HVJ C;  1GK9 A;  3Q4H A;  2R72 A;  3A8T A;  3F7Y C;  2E5L B;  4G27 B;  1PKX A;  4MW8 A;  3OTO B;  2CTR A;  4CS3 A;  3LSS A;  3B40 A;  4X20 B;  1OV9 A;  3CCM V;  4K0K B;  2EIM B;  2EIJ C;  1XBL A;  3JYC A;  2OCC B;  5IJ0 A;  3OMA B;  2QTS A;  1VQ4 V;  4YJ3 B;  1WB7 A;  3L72 H;  4G2K A;  4HAM A;  4NB5 A;  1JQ0 A;  2IU0 A;  1M57 B;  2CGO A;  1BZK A;  2EIN C;  3K5O A;  3ZBH A;  5JVD B;  4FLX A;  2ZDI C;  4L8J A;  5LYJ B;  1SQF A;  2MW2 B;  1LUW A;  2LO1 A;  3RGB A;  1XEQ A;  2P5O A;  3EXA A;  3JAR B;  1J5E O;  2JJ1 G;  4NKG B;  2Q69 A;  2PYJ A;  1BHB A;  1NVP D;  3CCE V;  2VQE O;  3MAQ A;  3GB7 C;  2V1D A;  1S77 D;  1QLE C;  3E86 A;  5CBH A;  2HG5 C;  2ZQM A;  2NN4 A;  4JAA A;  1EFR G;  1E79 G;  2DMX A;  3CRR A;  1OJH A;  2LW1 A;  4BIZ A;  4DO2 A;  1VEW A;  5B3S C;  4LH7 A;  1ZX3 A;  1JFF A;  4AIL C;  1VQ6 V;  3ABL C;  1SER A;  1H2L A;  3OTF A;  4OPA A;  1CEZ A;  4UFZ A;  3AG4 B;  3CB2 A;  2LJ2 A;  5BY1 A;  4H37 A;  4YHH B;  4DK1 A;  1DLB A;  1QBZ A;  1Q82 W;  4TV9 B;  4NYK A;  3K3W A;  3VQV A;  1K92 A;  2WLM A;  1VQM V;  2M6Y A;  3DXR B;  5IWA B;  5DN6 G;  5E79 Z;  1KEC A;  5CA3 A;  2X0L A;  1IVS A;  3QTC A;  4FM0 A;  3OUS A;  1P7B A;  3B4S A;  2Z3Y A;  1VQ7 V;  4H0L B;  1P84 F;  1VQL V;  2IM9 A;  4MVR A;  1E1R G;  5D5P A;  4K8Z A;  1DF4 A;  3U0Z A;  1K34 A;  3UKM A;  5GTI Z;  2QTO A;  4O2B B;  1JCH A;  5J2T A;  1TVK A;  3SYO A;  4B3M O;  2IW5 A;  2LW7 A;  4MVU A;  3W7U A;  4FLW A;  1SQP H;  1SS3 A;  1YVW A;  4IIJ B;  3ABU A;  1T5E A;  3E22 A;  4B3R O;  4EB6 B;  4B7K A;  4LCU C;  2UU9 B;  2EUL A;  3U11 A;  2DYR B;  1M56 C;  5H2F Z;  1IDS A;  1TGO A;  5HFM A;  5EK0 A;  5LHI A;  1YHQ V;  3FAV B;  2P7T C;  4D7S A;  2X6C A;  1OCC C;  3TXS A;  2A3Q A;  2H8P C;  2ATK C;  3OGI B;  1WB8 A;  3RYH A;  2BSK B;  3ETE A;  4JTD B;  5IY5 B;  4YXW G;  3VQX A;  4GKK B;  1NT2 B;  3E8B A;  2JEU A;  4O2A A;  2CGN A;  3ZX6 A;  2OTL V;  2JGU A;  4LF6 O;  2EJR A;  5IJ9 A;  4Z2W A;  4UVC A;  3J81 N;  1PM9 A;  5L3D A;  4CS4 A;  2YXH A;  2GDS A;  2X7R B;  2KKW A;  2DQ3 A;  1MZE A;  1VMG A;  3STL C;  4LWS A;  2ZE5 A;  4DR3 B;  1COW G;  2R9R B;  4UCO A;  4DV5 O;  1HNZ B;  2X6B A;  3P32 A;  4MTX A;  3R65 A;  4PD4 F;  1PNK A;  5KA5 A;  5BR8 O;  3ASN C;  2QKS A;  2EX3 A;  1RPO A;  4HYO A;  2WLJ A;  2ZR2 A;  3CJH B;  2N05 A;  3JAT B;  1XQ8 A;  4I55 A;  3HB3 B;  4L87 A;  5BZB A;  4X1I A;  1U97 A;  2OIE A;  4PDM A;  1PL4 A;  5DM6 V;  2WLI B;  4OGQ B;  3CRA A;  5EBW C;  1RM1 B;  5LP6 C;  1JMK C;  5H6Q A;  1SA0 B;  1LR1 A;  2F23 A;  3JAM N;  2WAM A;  3AG2 B;  1PNL A;  3WG7 C;  4U7O A;  3F7V C;  1GN6 A;  3HKB B;  4R8C A;  1J5E B;  1QU7 A;  3BCC H;  3CSX A;  5LXT A;  2ZNI A;  3JAW A;  5LOV A;  3ZRS A;  4B3T B;  2E76 B;  4PA7 A;  2Q8V A;  2QWN B;  4DV1 B;  3K57 A;  5DED A;  3MD0 A;  4IYI A;  2VQE B;  3ETG A;  5LBQ A;  4IGG A;  1HP8 A;  1UFI A;  4TV8 A;  4IHJ B;  4ZOL A;  4TUY B;  1IXB A;  2YI8 A;  3ZIA G;  3CCJ V;  1N32 B;  4PI0 A;  3ETD A;  1XDC A;  3T4D A;  4J11 A;  5GON A;  4G28 B;  1XNQ B;  3K03 A;  1K9M W;  3N27 A;  1KC8 W;  2PY5 A;  4ABM A;  4NXN B;  4GUN A;  1KYO F;  3CS5 A;  1Z5V A;  1OCO C;  3BVO A;  4I50 A;  1XMQ O;  1WNS A;  2BOC C;  4Z1M G;  1GM9 A;  3QO7 A;  5EYP B;  2ZXW C;  1B6Q A;  1FXK B;  3O65 A;  2UXB B;  1RP3 B;  5IYD O;  2UUB O;  5LMN O;  1S5H C;  3M7M X;  4FZ0 A;  4O4H A;  1VQP V;  1VQK V;  1NTK H;  1RSO B;  2ILM A;  1XIL A;  2Q0A A;  1Z5W A;  3JD0 A;  4E4E A;  3FD9 A;  3SJA C;  3BY6 A;  1NH2 B;  3RYI A;  5LGU A;  5EIB D;  2H94 A;  3OR6 C;  4HNA B;  4B3R B;  2PGG A;  1H2G A;  1H2K A;  5B1N A;  3TGU H;  1F51 A;  4NTX A;  3AG3 B;  1EN4 A;  4DV3 O;  5KA6 A;  4DV6 B;  3ZRW A;  5LA6 B;  5J2U A;  2EIK C;  1XHZ A;  1I7F A;  1THZ A;  3BFR A;  5KHG A;  2WA4 A;  3JSL A;  4TQD A;  1AI4 A;  2Y69 C;  4DUZ B;  2GSM B;  1K4C C;  3D36 C;  3B77 A;  1BS3 A;  3SDL A;  4LF7 O;  4MVQ A;  5EZY A;  2JS5 A;  2QE7 G;  4LF6 B;  1E1Q G;  1GN3 A;  3AG1 C;  1JJ2 U;  4RWU A;  1XMO B;  3IC9 A;  1FS0 G;  3APQ A;  1IBK O;  3RN4 A;  4YIP A;  1YJ9 V;  3JAL A;  3CCR V;  1EBO A;  5KAF Z;  4CS2 A;  1MA1 A;  1MZF A;  4LFB O;  1SES A;  2XAS A;  4DV5 B;  3DC6 A;  4ZIB A;  3L9D A;  4DR6 B;  4O4J A;  1NR1 A;  3E83 A;  3ZMS A;  4ASU G;  1IBL B;  5BR8 B;  2Q67 A;  3BEH A;  4KFM A;  3HKC A;  2OIG A;  4BR6 A;  1OZ0 A;  2YS8 A;  3IJ4 A;  2LFR A;  4JTC B;  4MTO A;  5AG2 A;  2EIL C;  1JX9 A;  4NTW A;  4W4K A;  1H8E G;  4J7K A;  3VOU A;  4I9Q A;  2Q7H A;  3C3T A;  2QM4 A;  2OWO A;  3DGE A;  2MK3 A;  4KXR A;  4DW1 A;  1FFX B;  4B3S B;  4U3F H;  1NKD A;  1OCC B;  3JCZ A;  1XNR O;  3N2K A;  3OM3 B;  2D2C B;  3R66 A;  3BRC A;  4O4I A;  5LGT A;  1AIL A;  3K9S A;  4MVS A;  3H9V A;  1NU1 H;  3RVY A;  2Z0A A;  3U10 A;  3ICX A;  1WA8 B;  4PA9 A;  1G4Y B;  4PEL A;  3JAK B;  1VAR A;  5EBM C;  4TWK A;  1NBM G;  5KLV H;  2QDO A;  2P67 A;  1Z2G A;  4J7Z A;  1WPX A;  2ADQ B;  2XT9 A;  5IYC O;  3UO3 A;  3ZHS A;  3CXC U;  1YIJ V;  2QWQ B;  3O9O A;  2YXL A;  2ZE7 A;  2KG7 B;  3STZ C;  5KUM A;  3ASN B;  2BTQ B;  1M93 A;  3VQW A;  2PUS A;  3TJT A;  3IC7 A;  1OCR C;  1JJO A;  3IAY A;  1NR7 A;  3LDC A;  1R3J C;  4X64 O;  2HVK C;  5JVD A;  1XMQ B;  1HR0 O;  1K4D C;  1M1K W;  4MTF A;  2AXT Z;  4R6Z A;  4Z1V A;  1DTO A;  3ABK C;  4D7T A;  4GX1 A;  3JAR A;  2A06 H;  4AQY O;  5LMN B;  3B09 A;  2UXC O;  3FB6 C;  4FFB B;  3JD4 A;  4ZHQ B;  4LF5 O;  4LF9 B;  3G6E V;  2PF4 E;  4X62 O;  3TXQ A;  3A0R A;  2B5U A;  4OPH A;  4CZZ A;  2JEX A;  3X2Q C;  3H1I H;  1KUQ A;  3K06 A;  3VQY A;  4WFA V;  1IBM O;  1L8D A;  2HFE C;  3UQ8 A;  2A7W A;  1FPO A;  1SKV A;  4J10 A;  4JI4 O;  2JJ2 G;  1CXZ B;  5B1B C;  2LQT A;  4UB6 Z;  2BOB C;  4MVO A;  3LDD A;  2WSS G;  3ABM C;  1QR9 A;  4NXM O;  1CPY A;  3BAB A;  3BHP A;  1YDX A;  5IT9 N;  2UUA O;  4C7U A;  1K5Q A;  4Q20 A;  3FYI B;  4I0X A;  1Q7Y W;  1F7Y A;  3T2M A;  2KQX A;  2AW9 A;  1VF5 B;  2IBZ H;  2RJZ A;  1Y67 A;  2C2A A;  4TV9 A;  4EFB A;  4DR2 O;  3QF7 A;  1KP2 A;  4JYA O;  1L0L H;  3QG5 A;  4P9P A;  3HKE B;  2YI9 A;  1QVF U;  2QWP B;  3G6B A;  4LF7 B;  2BCC H;  3CHX A;  2XAG A;  1TUB B;  2D3O W;  1ZWI C;  2E74 B;  4U3J B;  2YUA A;  1D5N A;  2EBO A;  1Q6I A;  1IBK B;  3HKD B;  1UJW B;  1G8M A;  1M4U A;  2B1I A;  4LFB B;  3ZJZ A;  1R73 A;  2F95 B;  1YJN V;  1SQQ H;  2JGD B;  3OT7 A;  4FLU A;  4FLZ A;  3T1C A;  1QLN A;  2R9A A;  1V9P A;  4EB6 A;  3AG7 A;  4WFB V;  2AGA A;  2B9Z A;  1ORQ C;  3SGI A;  2W6J G;  3DTU B;  4JI5 B;  4JI8 O;  2XHB A;  4BW9 A;  2YEV B;  1I08 A;  4FLY A;  1IUR A;  2XTA A;  4JI1 O;  2HHH O;  1BQ0 A;  1MSW D;  3RT3 C;  5K1X A;  1AP6 A;  1HNW O;  2EIK B;  2IJI A;  1GKF A;  4IYH A;  4KHP O;  1FXV A;  3SJQ C;  4PHZ A;  2RQ6 A;  3L75 H;  2IJJ A;  2ITD C;  5C8Y A;  4AI8 A;  5A9G A;  4FMT A;  4JV5 O;  1NZ6 A;  4ZI7 B;  1Y6X A;  5JH7 A;  2GUZ B;  1OCZ B;  3WFV A;  4MT8 A;  1IZ3 A;  1RFY A;  3LNM B;  3N2G B;  1DK1 A;  3Q4H B;  5KUK A;  4TSF G;  3THO A;  3E8G A;  4QPK A;  1GO3 F;  3MHH C;  5EBL C;  3ASO B;  3L74 H;  1Q5O A;  3K08 A;  1ZUQ A;  4X89 A;  1W2B U;  3CJH A;  3G4S V;  3E2E A;  3ZHV A;  4GKJ B;  3WB1 A;  2YIA A;  2VRZ A;  1O9G A;  2WLI A;  5L3C A;  3CEI A;  5IDJ A;  1DGS A;  1SA0 A;  3OE7 G;  1HR0 B;  3E8H A;  2HP8 A;  1PP9 H;  4DR1 O;  4UV8 A;  1GMG A;  4J41 A;  1N34 O;  4DR5 O;  5BMV A;  2Y0P A;  3BA9 A;  4O4L B;  1NJI W;  4FLV A;  3ZHQ A;  4PV1 B;  1K8A W;  4LNU B;  3HKB A;  4JTA B;  1AVM A;  4WBN B;  3L71 H;  2ZCE A;  4AQY B;  1HNX O;  4MVM A;  1VQ9 V;  3QVN A;  2UXC B;  1EN6 A;  4LF5 B;  1NTM H;  4X62 B;  2ODM A;  2GV9 A;  3WB0 A;  4YJ2 B;  1BE3 H;  4IHJ A;  2B1G A;  1FFT B;  4TUY A;  2YIC A;  3SYC A;  3W7T A;  3CWB H;  3SR2 C;  3SPH A;  1R1B A;  1V55 C;  4JI4 B;  1N0N A;  1VQ8 V;  4UXN A;  5EIB C;  4Q6G A;  4P30 A;  2UXD O;  4WFF A;  4NTY A;  1G6U A;  1ZSP A;  4NXM B;  1K3E A;  4JI7 O;  4BW5 A;  1P4R A;  1JPX A;  1M9N A;  4DUY O;  3ZMT A;  5A2Q N;  4GCZ A;  4DR7 O;  1JFF B;  3B2E E;  3FKS G;  1AI5 A;  2EJ7 A;  2JDI G;  3W7X A;  4JYB A;  4MW3 A;  4DR2 B;  1GM8 A;  5FPR A;  2F1M A;  4P9O A;  4DV2 O;  2L6L A;  3CCV V;  1FXK A;  1XUQ A;  3RWR D;  1S0V A;  3K9A A;  3K0D A;  1VF6 C;  5KX5 A;  2QR4 A;  5B1A C;  3ABK B;  1I94 O;  3W7W A;  1F23 A;  3CE2 A;  5JCO A;  2KB1 A;  2N04 A;  2VQF O;  4X1K A;  2L35 A;  5CA0 A;  3ZHT A;  5L3E A;  1NH2 D;  4DR4 O;  5CBF A;  4X66 O;  2DYS B;  5B66 Z;  2RDC A;  3AK3 A;  4WFE A;  1XL6 A;  2NR5 A;  2IU3 A;  3ZED A;  5J2T B;  5KHI A;  2AZ2 A;  1V54 B;  4D6T H;  2QM7 A;  4NR1 A;  3B8N A;  1Y76 A;  4TT3 G;  1R6K A;  1SRY A;  1SQG A;  1I0H A;  2IH3 C;  3E22 B;  3S3W A;  4DRX A;  4JI8 B;  3C3S A;  3RYF B;  2FML A;  2P90 A;  4QIW F;  1YJW V;  5LA6 A;  1X4T A;  3F5T A;  4UB8 Z;  4UCV A;  2NLJ C;  5JQG A;  4JI0 O;  1F4N A;  2HHH B;  1N36 O;  1HNW B;  1NQT A;  2ZIO A;  1L0N H;  3P30 A;  1R3L C;  2WA3 A;  4GYC B;  2EIJ B;  3OFN G;  1SC5 B;  4O2A B;  4JV5 B;  4FLT A;  4QE7 A;  1FJG O;  3UT5 A;  2QA4 V;  3JD3 A;  1KB9 F;  5IJ9 B;  1FXH A;  3RVZ A;  2Q6A A;  5LHG A;  2Q0O C;  2EIN B;  5JWP A;  4PJ0 Z;  3WB2 A;  4UCU A;  2ZD9 A;  1BT8 A;  2YIB D;  4X1Y A;  4UCT A;  1K73 W;  3G80 A;  1YTF B;  2EIM C;  2RNB A;  2WLL B;  4JPR A;  4KP4 A;  2GHY A;  4K8X A;  1RPR A;  1CP9 A;  2OCC C;  1YEW A;  4UUJ C;  2YDE A;  3G67 A;  3ZN0 A;  3SPG A;  4EEQ A;  3SYQ A;  1M57 C;  3RYC A;  4I55 B;  3M99 B;  3KCY A;  2JS3 A;  3H1L H;  2FYU H;  1MMM A;  4B3M B;  2HEP A;  1QLE B;  4FJC C;  3QO8 A;  1FFX A;  1N34 B;  1EM1 A;  4DR5 B;  2CTQ A;  3PN1 A;  4LFC O;  3OW2 U;  2CH7 A;  5FPO A;  2DOS A;  3C90 A;  3ML0 A;  2DJV A;  5ITZ B;  4F4L A;  5B3S B;  1HNX B;  3FB5 C;  1AJN A;  3T1H O;  2JRI A;  3ABL B;  4H13 B;  4X9Q A;  1W0J G;  3OD4 A;  4P2Z A;  3K0G A;  3FB8 C;  4ICG A;  4QJF B;  4TV8 B;  4ZOL B;  5H6R A;  4PI2 A;  4RUF A;  3MHS C;  2UXD B;  1H38 A;  1VF6 A;  2X6A A;  4F6R B;  2YID A;  4ZKI A;  2KG7 A;  2H3O A;  1EN5 A;  1VF7 A;  4CH3 A;  2BTQ A;  3CRQ A;  4LF4 O;  4RQE A;  1QVG U;  4K0K O;  5FNV B;  5HFL A;  4DUY B;  1XL4 A;  1GM7 A;  4X65 O;  1HW7 A;  1QR8 A;  5TIS Z;  4JAS A;  2V7Q G;  1XI1 A;  3K79 A;  3K59 A;  1O9H A;  3K5L A;  3GWO A;  2F93 B;  3APO A;  3HR0 A;  4FM1 A;  1JOY A;  1S76 D;  1GRJ A;  1OHH G;  1VQ5 V;  2QSA A;  4DV2 B;  2XOK G;  2QJ1 A;  2JK5 C;  2G38 A;  3BA8 A;  1B3Q A;  5IYZ B;  4FFB A;  4PA3 A;  4ZHQ A;  1M56 B;  4JZ2 A;  3CD6 V;  2ZIN A;  4DR4 B;  1B06 A;  4X66 B;  5BXZ A;  5KMG A;  1P49 A;  2ZE8 A;  5CMU A;  1FKA O;  2W0F C;  4B7E A;  2PTM A;  3H1K H;  4LBE C;  5L3F A;  2W0X A;  4I9W A;  1N8R W;  4RQF A;  2DYR C;  2R70 A;  3H1H H;  4AHC A;  1TUE B;  4X20 A;  4JI0 B;  1M5I A;  2IH1 C;  5IY5 C;  1A32 A;  1FYJ A;  2ZE6 A;  4UVA A;  5KHK A;  3IFX A;  3HKE A;  1YIT V;  4YJ3 A;  1HWY A;  2EZO A;  1S5L Z;  1TUB A;  3I55 V;  1VIB A;  1QHT A;  4JYY A;  4U3J A;  3GVM A;  3L70 H;  1EZJ A;  3JD1 A;  2Y0I A;  3HKD A;  3EHB B;  4HBN A;  3TCU A;  5LYJ A;  1KQS U;  2JVD A;  4WFG A;  5LP6 B;  4FM2 A;  1K7D A;  4K3A A;  1WP7 A;  1S72 V;  2JGD A;  1AR4 A;  3CME V;  3SYP A;  2QM8 A;  1PL0 A;  2XAJ A;  2UUB B;  3WG7 B;  2PI4 A;  4DV7 O;  4OX9 O;  3LSQ A;  3HKC B;  1AI6 A;  3S3X A;  3ZN1 A;  2M7W A;  1Y74 B;  2P6J A;  3CCL V;  3OEH G;  1RM1 C;  2UU9 O;  2YEV A;  2Q68 A;  4MSW C;  3KG2 A;  1MG1 A;  3FB7 C;  4QPJ A;  4FIP C;  2QWO B;  1YZB A;  2CTP A;  5CB4 B;  3AG2 C;  1SQV H;  4LFC B;  2LP7 A;  3CMA V;  4PDR A;  2BTO A;  4GKK O;  1SET A;  4DV3 B;  2Q5Z A;  3ZCC A;  1N0J A;  3T1H B;  1PV0 A;  1P7G A;  2GUZ A;  3CP1 A;  2ITC C;  1ZL8 B;  1ROP A;  3JAS B;  1SQX H;  4N23 A;  3DXR A;  1OCO B;  5B5E Z;  2CUG A;  4DR3 O;  2ZR3 A;  1Q6H A;  5LMU O;  3E89 A;  4ZBM A;  4YY3 O;  1HNZ O;  3RFR A;  3OUF A;  2ZXW B;  4CH5 A;  5L3G A;  1WP8 A;  4FK5 C;  2ARH A;  4LF4 B;  5LL6 Y;  1J95 A;  3FX7 A;  5FL7 G;  4MVZ A;  1X59 A;  4X65 B;  3ZMZ A;  4O2B A;  1H2M A;  4J9Y B;  1GH6 A;  3OMN B;  4UVB A;  2VWK A;  3J80 N;  4GT1 A;  1JA8 A;  1AJQ A;  1FAF A;  4CH4 A;  2FL4 A;  1KKD A;  2CDY A;  1GTO A;  4IIJ A;  4O4L A;  1SZX A;  1AR1 B;  2NNU A;  1FXK C;  4MTG A;  3ZRV A;  4LNU A;  5KHJ A;  5CA1 B;  2WLK A;  2PI5 A;  4WBN A;  2ADP A;  4EKW A;  2ETN A;  2AZ0 A;  3IGA C;  5JCO C;  3FAV A;  3GWK C;  3HPL C;  2Q9L A;  1TAE A;  4B3T O;  1R3I C;  4YJ2 A;  2BSK A;  1Q43 A;  4DV1 O;  3OMI B;  4I4T B;  1XNR B;  1W59 A;  5CBG A;  2R9I A;  3A0H Z;  4F6E A;  3D8C A;  4UV9 A;  1BL8 A;  1N32 O;  1BHA A;  2Y69 B;  1N33 O;  2F4V O;  3D3Q A;  3CYO A;  2P22 C;  1AB3 A;  3SPC A;  2UXN A;  1WN7 A;  4DXW A;  3SYA A;  3AG1 B;  3J7A U;  2W6I G;  3AG3 C;  1XNQ O;  5EC2 C;  3JSN A;  1SQB H;  2N74 A;  4JYC A;  4I0X B;  2Q73 A;  4BIU A;  5KAI Z;  3NR7 A;  4CC5 A;  4NXN O;  5B1O A;  3CC4 V;  3CCS V;  2PYL A;  5E1A C;  3JAT A;  1H2N A;  3CC2 V;  1YSC A;  2FTK A;  1BQZ A;  2IJH A;  1ENV A;  4LH6 A;  1Q8I A;  5IJ0 B;  4JGS A;  1VQO V;  2EIL B;  4X64 B;  2UXB O;  2P4V A;  2ZKO A;  3A0B Z;  1IX9 A;  3W7S A;  1ZLZ A;  3UM7 A;  1Q81 W;  2EZP A;  1U96 A;  5CN0 A;  3DSQ A;  3FYE B;  2FKX A;  4WF9 V;  3H01 A;  4DV7 B;  2UUC O;  4OX9 B;  1S5J A;  2RN9 A;  4IT5 A;  1W0K G;  4DV0 O;  4TOI A;  3K58 A;  2AHY A;  2BE3 A;  2Q7G A;  1IBM B;  3RYF A;  3L73 H;  2YC0 A;  2Q7E A;  1VQN V;  5H5N A;  1NVP B;  4GX0 A;  4JAU A;  4DV6 O;  4JI6 O;  3RW0 A;  4GLX A;  4LF8 O;  3OR7 C;  2CTW A;  2ZNJ A;  3RBZ A;  5GW7 A;  1YF2 A;  3LUT B;  1DF5 A;  3E35 A;  2XAF A;  2UUA B;  4X88 A;  2Y4T A;  3JD2 A;  1Y66 A;  1YXB A;  3ABT A;  4DUZ O;  2DE0 X;  4R7C A;  1KBH A;  2RMK B;  5C8Y B;  4JI2 O;  4J7J A;  1QCE A;  1KU9 A;  2XAQ A;  1XMO O;  1OCR B;  4FFK A;  5JH7 B;  3CRM A;  4JYA B;  5EYP A;  3BPZ A;  1H2S B;  2HJF C;  3CXH F;  2ZDI A;  1YTF D;  4LP8 A;  5LMU B;  4YY3 B;  4DR6 O;  3P3N A;  3D3I A;  3K5N A;  2WLL A;  1KKC A;  2E75 B;  3PJS K;  3CCQ V;  1IBL O;  4WCE V;  1H8H G;  3AK2 A;  1RSO A;  4FPP A;  5JJN B;  3FFQ A;  3AEI A;  4J42 A;  2P06 A;  1PPJ H;  2QWR B;  3X2Q B;  3VBB A;  4J80 A;  2Y48 A;  3T4Z A;  3LNN A;  4HNA A;  1TVK B;  4W4L A;  4I5S A;  2DWE C;  3B8M A;  2DN9 A;  3SJC C;  3CRC A;  1SF9 A;  1MNG A;  5B1B B;  1ZTE A;  3TK1 A;  5BMV B;  2AHZ A;  4B3S O;  5ITZ A;  4RUE A;  3ABM B;  4PA4 A;  4PDL A;  4LFA O;  4EFE A;  1YCI A;  3T1Y O;  1M90 W;  1AP5 A;  5LGN A;  2PZS A;  3EVK A;  5IE9 A;  4JI1 B;  4DW0 A;  1I5X A;  5H9C A;  2Q4P A;  4JZG A;  4KHP B;  3RYH B;  2WLN A;  5IYB O;  3SPJ A;  1S3J A;  3OGC C;  3LDE A;  4JI3 O;  5J9P C;  4BAY A;  2XUM A;  2CE4 A;  4DV4 O;  1N33 B;  2F4V B;  4F6R A;  1Q90 D;  1BCC H;  3LSU A;  2UXX A;  1TA8 A;  5FNV A;  2YXY A;  1YI2 V;  3DC5 A;  3WU2 Z;  4N21 A;  4MS2 A;  4LWS B;  3I56 V;  2YIB A;  1MOF A;  2DW4 A;  3ZMV A;  2KSD A;  4GZR B;  4DK0 A;  1XHX A;  3E8F A;  2ZM6 O;  2A0L A;  5IYZ A;  4XDL A;  3BAA A;  3QO5 A;  4X1I B;  3OAA G;  1AJP A;  3ZRX A;  5KX5 B;  4E2L A;  1K97 A;  1XOU A;  4DR1 B;  4LF9 O;  3KKY A;  5LHH A;  4H33 A;  2QKA A;  1NS1 A;  1BSM A;  3A2F A;  1I5Y A;  1D2D A;  2ZT9 B;  4X1K B;  1PD3 A;  2Y4U A;  5CA0 B;  1L1F A;  2WPD G;  2DQ0 A;  3KZI Z;  4BWA A;  2UUC B;  4J9Z B;  2CK3 G;  4DV0 B;  1IXM A;  5LXT B;  3G71 V;  3JAW B;  5DEC A;  5LOV B;  1LUV A;  1KMI Z;  1WA8 A;  3JAK A;  4K35 A;  5F2V O;  1JVM A;  1Y76 B;  4CH6 A;  1NI8 A;  2FB5 A;  3F5W C;  4DRX B;  4PA6 A;  4JI6 B;  2F43 G;  2E5L O;  1G1X B;  4LF8 B;  3I5D A;  3OTO O;  3K5M A;  1Q86 W;  2HJD A;  5JQG B;  4JI7 B;  1K5S A;  3M8A A;  5GON B;  1WPB A;  2QEX V;  1UPG A;  5JJE B;  3AG4 C;  1Y4M A;  2F66 C;  1F4M A;  1FD9 A;  1KP3 A;  3H1J H;  4DR7 B;  3ZS8 C;  3ZHR A;  3CCU V;  1BMF G;  1OCZ C;  1R6N A;  1AI7 A;  2GTS A;  4FVM A;  1MSD A;  2VWJ A;  4JI2 B;  2RCV A;  5C93 A;  2IJK A;  4HZ3 A;  4KUM A;  4FZ1 A;  4QGP A;  1R6T A;  2ZIM A;  2O57 A;  3UT5 B;  5LP6 A;  4I50 B;  2E3C A;  1VP7 A;  3CX5 F;  3ETQ A;  1D5A A;  2QKC A;  3ZHU A;  3ASO C;  1I94 B;  4X1Y B;  2CAZ C;  1US6 A;  3P3P A;  4CC6 A;  2VQF B;  4O4H B;  1Y74 A;  2DWD C;  2WWW A;  3SPI A;  4DYL A;  2GTA A;  4KL1 A;  4WFH A;  2K1E A;  3UO2 A;  1QQC A;  4JI5 O;  3RYC B;  1GN2 A;  1GAX A;  2OTJ V;  3EFF K;  3RYI B;  5CB4 A;  1V55 B;  3MDS A;  4R50 A;  3K04 A;  1ARO P;  1Q6U A;  4UCR A;  2A79 B;  2OT5 A;  1JR9 A;  3ZMU A;  2HLD G;  2CH7 B;  1AR5 A;  4LFA B;  2VS0 A;  3NXS A;  2V4D A;  1GN4 A;  3AK1 A;  4JAV A;  1HDJ A;  3T1Y B;  1ZL8 A;  4YHH O;  3ZRW B;  2LGQ A;  2WLH A;  3JAS A;  1QNM A;  1N36 B;  5J2U B;  2QGN A;  5EC1 C;  1PNM A;  2HR3 A;  5K1P A;  3SJB C;  4JI3 B;  3UCS C;  5IWA O;  1EZV H;  1LNQ A;  5L3B A;  4DV4 B;  2P4K A;  1KD1 W;  5EZY B;  2Z5U A;  4BIO A;  1FJG B;  1ZAU A;  5FLX N;  1WLE A;  5GTH Z;  5B1A B;  1SZT A;  1Q3E A;  2GBO A;  1MAB G;  4QE9 A;  3JAL B;  4A5U B;  4GKJ O;  4UCS A;  5D5Q A;  2YSU B;  3CPW U;  1NTZ H;  4YIO A;  3JCU Z;  3TET A;  2XAH A;  2HKO A;  4NVP A;  4CBC A;  4O4J B;  4X8A A;  2OCH A;  4LR3 A;  2LGW A;  1B04 A;  4XBF A;  4U7N A;  4OXS A;  2JIZ G;  4GX2 A;  5CA1 A;  4JF3 A;  1WJZ A;  3KCX A; 
#chains in the Genus database with same CATH homology
 4LFC O;  2VQE O;  3SDL A;  4LF7 O;  2DOS A;  2DJV A;  4DR1 O;  4NXN O;  1N34 O;  4DR5 O;  4DR6 O;  3T1H O;  2ZM6 O;  2JRI A;  4X64 O;  1IBK O;  1IBL O;  4DR3 O;  1HR0 O;  4LF6 O;  4JI5 O;  5LMU O;  1HNX O;  4LFB O;  4YY3 O;  3J81 N;  1HNZ O;  1A32 A;  4LF9 O;  1FYJ A;  1NS1 A;  2UXB O;  3F5T A;  2AGA A;  1XMQ O;  1D2D A;  4OPA A;  5LL6 Y;  4JI0 O;  4AQY O;  2N74 A;  5BY1 A;  4JI8 O;  2ZKO A;  4DV5 O;  2UXC O;  1N36 O;  1X59 A;  4LF5 O;  4X62 O;  1R1B A;  3O65 A;  4LF4 O;  3J80 N;  4K0K O;  5BR8 O;  4OPH A;  4JI1 O;  2UUB O;  4B3S O;  2FKX A;  5LMN O;  4YHH O;  2HHH O;  2UXD O;  1KUQ A;  4X65 O;  3RT3 C;  1IBM O;  2UUC O;  1HNW O;  4LFA O;  4KHP O;  1FJG O;  4JI7 O;  4DV0 O;  4JI4 O;  3T1Y O;  4DUY O;  5A2Q N;  2E5L O;  1G1X B;  5IWA O;  4DR7 O;  4JV5 O;  4DV7 O;  3OTO O;  4OX9 O;  4NXM O;  1XNR O;  5IT9 N;  5H5N A;  2UUA O;  3M8A A;  3R66 A;  4DV6 O;  4JI6 O;  5FLX N;  1DK1 A;  4JI3 O;  3JAM N;  4B3T O;  4LF8 O;  1F7Y A;  4DV1 O;  4DV4 O;  1AIL A;  4DV2 O;  4A5U B;  2UU9 O;  4GKJ O;  4B3M O;  2LW7 A;  2Z0A A;  4DR2 O;  4JYA O;  4DV3 O;  1N32 O;  1YZB A;  1R6T A;  4DUZ O;  1N33 O;  2F4V O;  4B3R O;  1XEQ A;  1I94 O;  5BXZ A;  1AB3 A;  1J5E O;  1FKA O;  4JI2 O;  2VQF O;  1XMO O;  3J7A U;  4GKK O;  4DR4 O;  1XNQ O;  4X66 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...