3OTOO

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3otoO00
5A2QN 3J7AU 4JYAO 4K0KO 1X59A 2ZM6O 5LMUO 4KHPO 4B3SO 2FKXA 2F4VO 1XMOO 4GKJO 5BR8O 2Z0AA 5IT9N 3T1HO 4B3RO 3J81N 1N32O 2DOSA 4LFBO 2DJVA 4LFAO 4LF6O 1N33O 4X66O 4DR5O 4DR7O 3M8AA 4DV0O 1D2DA 4GKKO 4OPHA 1XEQA 2ZKOA 1N34O 5BXZA 2UXBO 5BY1A 1XMQO 4YY3O 1FYJA 4NXMO 4JI7O 3J80N 4X64O 1NS1A 4JI2O 4LF5O 3F5TA 1R1BA 4JI8O 1XNQO 1F7YA 4X62O 4JV5O 1AB3A 4JI6O 1FJGO 3R66A 4LF8O 3SDLA 4DR1O 2UXDO 1HNXO 5FLXN 4A5UB 1J5EO 2UU9O 3RT3C 3T1YO 4DV3O 4B3MO 4DV2O 1I94O 4OX9O 1IBLO 4JI3O 4AQYO 4YHHO 1KUQA 1A32A 4DV7O 1YZBA 2UXCO 2JRIA 4DV6O 4DR2O 4JI4O 1HR0O 4LF9O 4DUYO 4DV5O 1HNWO 2UUBO 4DV1O 1IBKO 4DR4O 4LF4O 4JI0O 4DV4O 1AILA 4OPAA 2UUCO 2LW7A 4LFCO 1R6TA 5H5NA 5IWAO 4NXNO 4LF7O 1G1XB 1XNRO 1IBMO 4JI1O 4DR6O 3O65A 1FKAO 5LMNO 4JI5O 4DR3O 4DUZO 2VQFO 5LL6Y 1HNZO 2HHHO 4B3TO 2VQEO 2AGAA 2N74A 4X65O 3JAMN 2UUAO 2E5LO 1N36O 3OTOO 1DK1A
chains in the Genus database with same CATH superfamily
3CCLV 4QNHB 2OWOA 4LR3A 1ZUQA 5J2TB 2CTRA 3DC5A 1Q6HA 5IYCO 1EN4A 1P7BA 5KLVH 2Q0OC 2DOSA 3ZRSA 4IYHA 4BW5A 4EFEA 3AG4B 4GCZA 5CA1A 1NU1H 1N32B 1HDJA 1P7GA 3DXRB 1SQVH 3EVKA 2AHYA 1N34O 1MA1A 1N4CA 3D36C 1IXMA 4X64O 2QTOA 4R6ZA 4J9ZB 1QLEC 1BHBA 4J7KA 2ODMA 3RYCA 2E75B 3WG7C 4YXWG 4YIPA 5LP6C 4JV5B 2IM9A 4LF8B 2PGGA 2QWPB 1HW7A 4DV1O 4DW0A 4DV4O 3P32A 5DEDA 3NXSA 4LNUA 1SA0A 2JS3A 4I50A 3W7WA 3E8HA 3H1KH 2F95B 3ETDA 4LH6A 3D36A 3E8BA 1KD1W 2P6JA 4DRXA 3E86A 3K04A 1ZSPA 3HKEB 3AG1B 5LMNB 3BCCH 4O4IB 4DR3B 4HZ3A 5LMUO 1S5HC 5CB4A 3JALB 1JFFA 2IU3A 1NTMH 4J11A 2Q69A 4GKJO 1AR1B 2XOKG 3B40A 2K1EA 1SS3A 3JCUZ 1N32O 5CBHA 5JQGB 2VWJA 3TXSA 2Q7EA 3RYHA 1M57B 3H1IH 3GVMA 1QHTA 3RYIB 1JPXA 4CH4A 3PJSK 1B06A 3GWOA 3BY6A 3OMIB 1XEQA 2QR4A 4U7NA 4FIPC 3ZRXA 3U11A 5KMGA 4ZKIA 3HKCA 5L3DA 2WLJA 2GV9A 1AR4A 2X6CA 2MK3A 2P67A 1OZ0A 5JVDA 4JV5O 3ASOB 4LF8O 1SF9A 3BRCA 3S3WA 3L74H 5KHKA 4P2ZA 1CXZB 4GX2A 2UUCB 3G6EV 2XT9A 1VQ9V 3DGEA 1XOUA 1HNXB 3LDEA 1Y67A 1EM1A 2V1DA 5ITZB 4WFEA 1VF7A 1YIJV 2QWQB 3TK1A 4QPJA 4BW9A 5EZYA 1V55B 5H5NA 2Q4PA 1OV9A 1IBKB 1KU9A 1GM8A 1IVSA 3MHSC 5LMNO 4LFCB 3ICXA 2W6JG 3O9OA 4DR3O 2QDOA 3FKSG 2ATKC 1BHAA 1B04A 3F7YC 1YDXA 1H2LA 1WB8A 3W7TA 2GTSA 3OE7G 3SPHA 1JMKC 2YUAA 2F4VO 5C8YA 1KYOF 2CTPA 3FB6C 3HKDA 3RVZA 5KA6A 2Q0AA 5KHHA 3K3WA 1ROPA 2QKAA 3H1LH 1N8RW 3HKBA 4MTXA 3I5DA 2C2AA 3LNMB 4W4LA 5CA1B 3AG3B 2FL4A 4QJFB 3ML0A 2R9IA 4X66B 4UXNA 3JAWA 2F66C 1QLNA 2JGDA 2ZKOA 2P4KA 1YITV 1TVKA 4LBEC 4PA7A 3U0ZA 1DLBA 3TGUH 2ARHA 1DF5A 1DTOA 3F5WC 1HNXO 4JI7B 1F51A 5EYPA 2CGNA 3CD6V 1QVGU 4DV3O 3SR2C 2A3QA 3JD2A 3RYCB 4X62B 2Y0PA 2IW5A 4W4KA 1NI8A 2EZOA 3BPZA 5KAFZ 2QKSA 1M5IA 1R3JC 1IBKO 1HWYA 4KFMA 1ZTEA 4DV2B 4X20A 4LFCO 2HR3A 3QO7A 4DV5B 4LNUB 1SA0B 2EINC 4MVOA 5LYJA 5JWPA 1WB7A 2EIJC 3RN4A 3CC7V 4DRXB 2RQ6A 1VQ6V 2E5LO 1D5AA 2YI9A 3K0DA 2ETNA 3LSUA 3CB2A 5FPOA 3R65A 2N05A 1YHQV 4KP4A 5CB4B 1JFFB 1YXBA 2EULA 2PY5A 3E22A 2WLKA 1Q6UA 4MVQA 2ZXWB 3OT7A 1MSDA 5C93A 3S3XA 4X66O 5IYDO 3JD1A 2FTKA 4B3RB 1VQ8V 1AP5A 1ZX3A 4FLWA 1FXVA 2XAFA 1AJPA 4FZ0A 4KUMA 1P84F 1L0NH 3K9SA 1ZWIC 4IL6Z 2WWWA 3D3QA 1XQ8A 5KMGB 4ASUG 4JI7O 1S76D 4K8ZA 3HKCB 5CN0A 2ADQB 2XAQA 1DF4A 4X62O 4UV8A 3UCSC 5KHGA 2A79B 2PZSA 2Y4TA 3WB2A 2F1MA 4YY3B 4PV1B 3JSNA 2O57A 4CH6A 5DECA 3RFRA 1XL6A 1Q43A 3I55V 2LGQA 1FXKA 4DV2O 1UJWB 1JCHA 1FJGB 3G80A 2KSDA 4FM1A 1GN3A 3CSXA 4DV5O 1WNSA 1I5XA 2HJFC 3FYIB 1PP9H 3N2KA 2UXCB 1AJNA 1EN5A 5EZYB 5J2UA 4DR4B 4LF4B 2DN9A 3AEIA 5B5EZ 1YSCA 2AW9A 4D7TA 3THOA 4BIUA 3OGCC 2E76B 1Y76A 1XILA 1WN7A 2OTLV 2WPDG 1ZAUA 1AROP 3ZMUA 1WPXA 1NVPD 1W0JG 5B3SC 3W7SA 4X65B 1NVPB 3OM3B 5C8YB 3C3SA 4B3RO 2WAMA 3VQWA 4B3SB 3HKBB 4FM2A 3U10A 4PA9A 4WF9V 4LFBB 3QTCA 1I08A 4TT3G 1N33B 4H0LB 2B5UA 1VQ5V 2ZIMA 4PELA 3K06A 3QNEA 3ZHTA 3JAWB 2DW4A 2EJ7A 3E89A 1GH6A 4CS4A 4YY3O 3WB0A 1KBHA 1TVKB 1IXBA 2A0LA 2GSMB 5LHHA 2IH3C 1MABG 2Y69C 3ZBHA 5B1AB 1FJGO 2ZR2A 3APOA 1F23A 4O2AA 5IDJA 1NKDA 1PNMA 4TWKA 4JI8B 3ZHUA 3RWRD 5EYPB 4I7ZB 1K34A 4JI6B 3ABMC 4XDKA 4I55A 1A32A 1YZBA 2UXCO 4O4LA 2GTAA 3OUSA 1Q86W 4DR4O 4LF4O 5KUKA 4DO2A 2IH1C 1OJHA 4FVMA 4NTXA 4TQFA 4X20B 1XHZA 2HJDA 2B1IA 4MVMA 5K1PA 4DR2B 3OFNG 4O4HA 3O65A 3G4SV 5GTHZ 4UCOA 2VQFO 1M90W 4HNAA 3FAVB 3L71H 5LYJB 1NTZH 3OAAG 4N23A 2ZE7A 2QGNA 3SJCC 1VQ4V 4ZOLA 4X65O 3RBZA 3JAMN 4JTAB 2D2CB 1DK1A 2P5OA 2HG5C 5A2QN 4GLXA 1LR1A 2YXLA 4B3TB 3H9VA 2BOCC 4B3SO 1GK9A 1U96A 3L73H 2JIZG 3ZCCA 2RMKB 2RNBA 1NQTA 2QEXV 3E22B 2UXNA 3EXAA 4LFBO 3K08A 1PM9A 1N33O 5L3BA 5K1XA 5BR8B 5H2FZ 4NTYA 1GMGA 4CBCA 1D2DA 3OR7C 4TUYA 1TUBA 4U7OA 1KQSU 1YTFD 4BAYA 3AK2A 5GTIZ 2JVDA 3FFQA 2EINB 1YTFB 5JJNB 1BCCH 4FLTA 2PYJA 2EIJB 1OCCC 3SGIA 3I56V 4J42A 4JI8O 4YJ2A 1ZL8A 4FJCC 2K9PA 4JI6O 1AI5A 4GUNA 4TV8A 4LH7A 3JD0A 4H44B 2F23A 3IAYA 1EZVH 3CCJV 3B77A 3FB7C 1SQBH 5KAIZ 1RP3B 1FXKB 4R8CA 4OGQB 2PYLA 3G71V 4DR2O 3ZHQA 4DUYO 1J5EB 4TQDA 3CMEV 2YDEA 5LGTA 3L9DA 2LW7A 5GW7A 3JCZA 1SESA 4UV9A 4Q20A 5IWAO 3N2KB 1HNWB 5LGUA 3TCUA 1K92A 5J2UB 3STLC 1S72V 2WLIA 5LL6Y 3IFXA 2CGOA 4B3TO 1BZKA 1TA8A 1Y76B 4UCTA 4G28B 2PI5A 3SPGA 3CCSV 1GO3F 5JJJB 4R7CA 3A8TA 3OMNB 2OCCC 4PDVA 1UPGA 3P3NA 5BR8O 2Z0AA 2NNUA 3J81N 1TAEA 2ZE8A 4RQFA 2ZT9B 4KHPB 3F7VC 2P06A 1G8MA 3ABKC 2WA4A 3HPLC 1THZA 3ZMVA 3ETGA 4H33A 4MS2A 4RWUA 5CA0B 5LP6A 4H13B 1QR8A 5JCOC 1JOYA 4RAIA 1PNKA 4PA3A 3L72H 1R6KA 4JZ2A 1MMMA 3K03A 4P30A 2YICA 5EIBD 4UFZA 5JH7B 2OIGA 4AQYB 1IX9A 3JSLA 1XMQB 3SDLA 1KP3A 3E83A 4LF5B 1J5EO 4O2AB 4X89A 1KB9F 1AVMA 4PD4F 1KUQA 5EK0A 1WP7A 4LF7B 1L8DA 1HNWO 2UU9B 3AK3A 4O4LB 3RVYA 2YIDA 1H2MA 1OCRC 3A2FA 1GTOA 1XREA 4D7SA 2CUGA 1OCZC 5FL7G 5JCOA 4G27B 4JTDB 4QIWF 1RFYA 1O9GA 1FKAO 4O4HB 1AI6A 4X1YA 2H94A 4GZRB 1SRYA 1Q82W 3RGBA 2DE0X 1F4MA 4HNAB 5B66Z 5KA5A 2AGAA 2EJRA 2BTOA 2G38A 2WLNA 1K33A 2WLHA 4ZOLB 4DK1A 1AP6A 1SQQH 2DYRB 2EIMB 2OTJV 4L8JA 3ZJZA 4O4JA 4KHPO 2ZDIC 3K5LA 3OD4A 3ZIAG 3BVOA 1V54B 1E1RG 3VQVA 3T4DA 2IJHA 5BMVA 3M7MX 2B1GA 4XDJA 1YF2A 3CXCU 4B7EA 3OTFA 4BWAA 1H8HG 2W6IG 3ZMZA 4RQEA 1AI4A 4Z1MG 4TUYB 1SZTA 1TUBB 1OCOB 2YS8A 1W2BU 3ZN0A 2P4VA 4DR5B 2JGUA 1V9PA 3VQXA 1H8EG 1GAXA 1B6QA 1JX9A 2L35A 4WFAV 4XDLA 2ZQMA 5H9CA 1XMQO 2UXDB 1JJ2U 4LF5O 1NS1A 4J7ZA 2NN4A 3H1JH 3VOUA 4YJ2B 4BIZA 1RM1B 1XBLA 2X6BA 3RW0A 3AG2B 1US6A 5JJEB 4TV8B 2UU9O 4J80A 3NR7A 2MW2B 3CMAV 3ABLB 2EILC 1PV0A 4MW3A 2HVJC 3BABA 3K58A 3OEHG 1NR7A 2EIKB 5EBMC 3T1YB 4JF3A 2UUCO 3QF7A 1FS0G 1YEWA 4LF9B 1DGSA 1ENVA 1VMGA 3TETA 2DYSC 2GUZA 1X4TA 5EBLC 2JS5A 5B1NA 1D5NA 4PDLA 3L70H 2DWEC 3CCUV 1H2NA 5B1BC 1RSOA 4WFHA 2YXYA 2RDCA 4UB8Z 3B4SA 1QR9A 3CPWU 3JAKA 2GDSA 4I50B 3KCXA 3KZIZ 1AR5A 1IZ3A 1IDSA 2DJVA 4FFBA 4QE7A 5L3CA 1YCIA 4DR5O 3C90A 1MG1A 1K5QA 1M93A 3HB3B 1JQ0A 2YC0A 1Q3EA 1QLEB 4P9PA 2Y4UA 3N2GA 4ZHQA 1H2KA 5AG2A 1VEWA 3CCVV 1NTKH 3WG7B 1PL4A 2ZNJA 3CC4V 5LP6B 4DV0B 2AZ2A 4UB6Z 1M9NA 2JEXA 2VWKA 3JATA 1QBZA 3CCMV 3AG4C 1WAZA 1WLEA 2IJKA 4JI3B 4X1KA 2H3OA 3RYHB 2Y0IA 3IC9A 3BFRA 3CCEV 3T1YO 4MW8A 1PL0A 2LFRA 3LSQA 3PN1A 1SETA 4LF9O 3LUTB 3SJBC 3W7UA 2W0XA 2EZPA 1FXHA 3DC6A 3AK1A 4JASA 1IBLB 2A7WA 5EC2C 5JVDB 1SQXH 3CRCA 4LWSA 2F43G 2M6YA 1E79G 4X1YB 2OCHA 2VS0A 2X7RB 5LHIA 1IBMB 4K35A 4JI1B 4DR6B 3OUFA 4G2KA 1B3QA 1NT2B 1QQCA 3A0HZ 4DYLA 4O4JB 3MAQA 1VP7A 3K79A 2Q68A 3B2EE 4EEQA 1JA8A 4PA4A 5BMVB 2A06H 4CZZA 3CYOA 1XMOB 2EX3A 1GKFA 1OCRB 1RPOA 3AG1C 4DV0O 3SYQA 4LF6B 4L87A 4MSWC 3LDCA 3ZHRA 2XNDG 1S77D 4E2LA 2Q6AA 3HKDB 1R3IC 2R70A 1G6UA 4DXWA 1R1BA 1VIBA 1M57C 2X6AA 3BA9A 5DM6V 4EKWA 1OHHG 2UXBB 1M1KW 1T5EA 2KG7A 3CCQV 2QSAA 2OYQA 4JYCA 3T1CA 2PI4A 3STZC 1M56C 1IBLO 1R3LC 4UCVA 2CAZC 2GHYA 2JGDB 3A0RA 3OR6C 4RUFA 4ZI7A 1NJIW 4FLZA 4CC6A 3ASOC 1K7DA 4OX9B 3JALA 4BIOA 1NH2D 4EFBA 3CE2A 2QKCA 1GN4A 1R6NA 5CBFA 1IURA 4O2BA 1J95A 1IBMO 5B1OA 4JI1O 1NH2B 4DR6O 1VQ7V 1SKVA 2YSUB 2GUZB 2EBOA 3TJTA 2P90A 1PNLA 4J9YB 1NBMG 4ZBMA 3ZN1A 4CH3A 1E1QG 1NZ6A 1S3JA 4AI8A 2P7TC 1WJZA 2ADPA 1X59A 1V55C 2WLMA 4PI2A 4Q6GA 2VQEB 4MTOA 3MD0A 1XMOO 3SJAC 3JAKB 1VARA 4ICGA 5D5PA 4EB6A 5LHGA 1S5LZ 3CP1A 1AI7A 4LF6O 1WP8A 3OMAB 5A9GA 3T2MA 4FFBB 1ORQC 3BAAA 1Y66A 1H38A 2QM4A 3G6BA 4CS3A 1URFA 3N2GB 4ZHQB 4Z1VA 3GB7C 1MOFA 2NLJC 1Y6XA 4I4TA 5BXZA 2UXBO 4GKKB 2LQTA 1JJOA 4LP8A 3IJ4A 4LC1A 4E4EA 1VQKV 3JATB 1WPBA 3G67A 1FD9A 4J41A 3ABUA 3AG3C 5FLXN 3RT3C 1EFRG 3JD4A 4OX9O 2PF4E 4P9OA 3CRRA 2E74B 4YJ3A 3QO8A 5CA3A 1KP2A 4JZGA 1K8AW 3ASNC 5LOVA 2Q73A 3P30A 3BHPA 1SQPH 3LDDA 5CMUA 2FB5A 1VQPV 2XAGA 1L1FA 1YJ9V 1HR0B 1COWG 2UUBB 4NVPA 3FYEB 4LWSB 4UCRA 4TV9A 3D8CA 5LMUB 2LP7A 2VQEO 4MVSA 3SPCA 4GKJB 2R9AA 4CH5A 3B8NA 4GX5A 3JARA 5EBWC 1P49A 3LNNA 3X2QC 2Y48A 4AHCA 4IIJA 5GONA 4Z2WA 3JASA 3Q4HA 2ZM6B 5H6RA 3CS5A 4J10A 1CPYA 2QJ1A 2BTQA 1LUVA 2HKOA 2WA3A 4X1IA 2Q7GA 4PJ0Z 4UVAA 5LA6A 4GKKO 3FB8C 1H2SB 3UM7A 4F6RA 4PA6A 4ABMA 1SERA 2KKWA 3UQ8A 1S5JA 3P3PA 5FNVA 1VQMV 2RJZA 2ZXWC 5BY1A 4XBFA 3J80N 1BQ0A 1Z2GA 2QE7G 1XHXA 5IJ0A 2XHBA 4WFFA 3CEIA 4JAVA 2ZINA 2KG7B 2QWRB 4WCEV 3CXHF 3OGIB 1YJWV 1PD3A 3M99B 4QPKA 2LFSA 2DWDC 4MTFA 4IT5A 1HR0O 1L0LH 3E2EA 2YIBA 2UUBO 4MVZA 4ZI7B 5LGNA 4IGGA 3QO5A 1Q5OA 2QTSA 2HVKC 3KKYA 1I94B 1K3EA 4YHHB 5B3SB 2ITCC 3IGAC 1NR1A 4JI0B 4O2BB 2RCVA 2ZR3A 1Y74A 4KXRA 3CRQA 4RUEA 4I55B 2F4VB 1FAFA 4PDRA 3UKMA 3K57A 3FX7A 1JR9A 4I9QA 1PPJH 2ZNIA 3L75H 1Z5WA 1FFXA 2CTWA 2YEVA 3TXQA 3K5OA 2ZM6O 4KL1A 1BS3A 4ZIBA 2V4DA 4U3JA 2HFEC 2Q9LA 4I0XA 2FKXA 3GWKC 4UCSA 1K4DC 1N36B 3OTOB 1M56B 4FK5C 2BSKA 1G4YB 2FYUH 4EB6B 4K0KB 2DQ0A 1GM7A 1XUQA 4GX1A 3B09A 5LXTA 2XAJA 3E35A 4DK0A 2Y69B 1VF6C 3IC7A 3T4ZA 2ZE6A 3DSQA 5KHJA 1YVWA 1K5SA 3CJHA 4DR7B 2V7QG 4FPPA 3CHXA 4OPHA 1Q8IA 3ABMB 2XUMA 3UT5A 2CTQA 4I4TB 3JYCA 4JPRA 3ZHSA 1PKXA 4DV3B 5IY5C 3ZS8C 1AB3A 3WB1A 2IJJA 3R66A 1CEZA 3W7XA 1SQFA 2D3OW 2ZD9A 2YI8A 4JI2B 4A5UB 5BZBA 1XNQB 3BA8A 1I94O 1VQNV 4AQYO 1EZJA 4YHHO 4WBNA 3SJQC 1GN6A 1LNQA 1K4CC 3SYPA 2YXHA 3ZMSA 1EBOA 4YJ3B 1VF6A 3ZEDA 4JI0O 3SPIA 2M7WA 5B1AC 2LJ2A 5LOVB 1ZL8B 5IYBO 2ZDIA 5IYZA 4DV7B 4IHJA 4DV6B 2BOBC 3OEEG 4JI4B 4LF7O 1BSMA 4N21A 2E5LB 3VQYA 4TV9B 3ZRVA 2F93B 3MDSA 2H8PC 1XNRB 5LBQA 1N36O 3OTOO 3K5NA 2KB1A 4DW1A 2DMXA 4JI5B 4K0KO 2PTMA 2HHHB 3CX5F 3WFVA 4UCUA 2FMLA 2OT5A 5IT9N 3JARB 3EHBB 1R3KC 4YIOA 2WLLA 2PUSA 1WA8A 4F6EA 4IIJB 4TOIA 5GONB 4AILC 2Q67A 3JASB 3Q4HB 1OCCB 2WLIB 2JDIG 4NYKA 3ASNB 4DR7O 3CC2V 2BTQB 5E1AC 1GN2A 4FLVA 4X1IB 1XL4A 3T1HB 3ABTA 1BQZA 2LW1A 5LA6B 5IE9A 4LFAB 2BCCH 5E79Z 1YJNV 4QGPA 4F6RB 4FZ1A 1W59A 1I5YA 3MHHC 3OW2U 5FNVB 4X8AA 3ZMTA 4JI2O 5L3FA 1XNQO 3SYOA 1F7YA 1Q90D 1N0JA 3ZRWA 4X88A 2QM7A 1VF5B 1CP9A 5IJ0B 4R50A 1Q6IA 3E8FA 2AHZA 2UXDO 3B8MA 4JYYA 2A9HA 4CS2A 5KX5A 5HFLA 2Z5UA 3X2QB 3ZHVA 2LO1A 2QA4V 2CH7A 3FAVA 2WSSG 4WFBV 1TGOA 4RO2A 4DV7O 2YIBD 1AJQA 4DR1B 1O9HA 2JRIA 4DV6O 1MSWD 4JI4O 1KKCA 5IJ9A 4C7UA 4NKGB 1AILA 4B7KA 4OPAA 2QWOB 3E8GA 2CE4A 3HR0A 1KKDA 2KQXA 2XTAA 3RYFA 2OCCB 1I0HA 1XNRO 1BMFG 3DTUB 4JI5O 1FXKC 1Y74B 1YI2V 5EC1C 2YIAA 4NR1A 1MZEA 2HHHO 2B9ZA 5L3GA 1SC5B 2CK3G 2XASA 5JH7A 2VRZA 5HFMA 4JAUA 2ZE5A 4MVRA 2HLDG 5KUMA 4UVCA 3ABKB 4DUZB 3LSSA 5J2TA 1HNZB 1FFXB 2YEVB 4U3JB 4J7JA 4I0XB 2UUAB 1LUWA 3APQA 3T1HO 1RPRA 2CDYA 4JYAB 2BSKB 1FPOA 4LFAO 1TUEB 4GT1A 3SYAA 2LGWA 4HYOA 2W0FC 3K59A 5LXTB 3SYCA 2IJIA 4CC5A 4NB5A 3DXRA 1S0VA 2ILMA 2IU0A 4LCUC 1EN6A 3QG5A 1KECA 4H37A 1GRJA 4JAAA 3CJHB 4I5SA 4HAMA 3FD9A 2N04A 1FYJA 2OIEA 3UT5B 3EFFK 3CRMA 1KMIZ 2GBOA 1BGYH 1GM9A 4K3AA 3C3TA 3K5MA 5F2VO 1P4RA 1BE3H 4DR1O 4NXMB 2BE3A 3VBBA 1BT8A 1OCZB 2Q8VA 4D6TH 2IBZH 4HBNA 5TISZ 3UO3A 1Z5VA 2ITDC 1F4NA 1QNMA 4JI3O 3AG7A 4PI0A 1VQOV 3K0GA 4WBNB 2HEPA 3FB5C 3H1HH 1XDCA 4B3MB 1R73A 2AZ0A 2VQFB 2X0LA 1VQLV 1U97A 3KCYA 4I9WA 5EIBC 4MVUA 4FLYA 2QWNB 5IYZB 1Y4MA 4IHJB 1G1XB 3ZX6A 3H01A 5KHIA 1W0KG 3QVNA 4DUZO 4JGSA 1HNZO 4NXNB 1XI1A 2N74A 3HKEA 5IY5B 2HP8A 4FLUA 2UUAO 3WU2Z 2JK5C 4O4IA 1QVFU 3CRAA 1M4UA 3J7AU 1MNGA 4JYAO 2JEUA 1I7FA 3SPJA 1H2GA 2JJ1G 1UFIA 5CA0A 3UO2A 3CWBH 4U3FH 5J9PC 4PDMA 2JJ2G 2Q5ZA 5JQGA 2ZIOA 4UUJC 4TSFG 2WLLB 3D3IA 2QM8A 1WA8B 1QCEA 3KG2A 3K9AA 3N27A 4GX0A 4UVBA 2Z3YA 3M8AA 5H6QA 3RYIA 2P22C 2DYRC 2EIMC 1RSOB 5L3EA 3A0BZ 1V54C 1MZFA 3ETEA 1K9MW 3JD3A 2EILB 2AXTZ 1HP8A 4NXMO 4IYIA 3F5TA 4JTCB 4B08A 5DN6G 4NTWA 4GYCB 1ZLZA 1FFTB 4BR6A 1N34B 3ZRWB 1Q7YW 3BEHA 4QE9A 1OCOC 4DUYB 4FFKA 4X64B 4OXSA 4MTGA 4B3MO 4X9QA 2DYSB 4JYBA 5KX5B 2R9RB 1SZXA 2Q7HA 4K8XA 2XAHA 2CH7B 5FPRA 5IWAB 1QU7A 4MT8A 4FMTA 4F4LA 2UXXA 5ITZA 2E3CA 1K73W 5B1BB 5IJ9B 2ZCEA 2RN9A 4FLXA 2DQ3A 3CCRV 1RM1C 1R6TA 5CBGA 4X1KB 2R72A 4NXNO 3AG2C 4PHZA 1Q81W 1JVMA 4DV1B 3RYFB 4DV4B 3ABLC 1KC8W 2NR5A 1N0NA 1SQGA 1BL8A 1K97A 3ETQA 4FM0A 2EIKC 4WFGA 5D5QA 2L6LA
chains in the Genus database with same CATH topology
5A2QN 3J7AU 4JYAO 4K0KO 1X59A 2ZM6O 5LMUO 4KHPO 4B3SO 2FKXA 2F4VO 1XMOO 4GKJO 5BR8O 2Z0AA 5IT9N 3T1HO 4B3RO 3J81N 1N32O 2DOSA 4LFBO 2DJVA 4LFAO 4LF6O 1N33O 4X66O 4DR5O 4DR7O 3M8AA 4DV0O 1D2DA 4GKKO 4OPHA 1XEQA 2ZKOA 1N34O 5BXZA 2UXBO 5BY1A 1XMQO 4YY3O 1FYJA 4NXMO 4JI7O 3J80N 4X64O 1NS1A 4JI2O 4LF5O 3F5TA 1R1BA 4JI8O 1XNQO 1F7YA 4X62O 4JV5O 1AB3A 4JI6O 1FJGO 3R66A 4LF8O 3SDLA 4DR1O 2UXDO 1HNXO 5FLXN 4A5UB 1J5EO 2UU9O 3RT3C 3T1YO 4DV3O 4B3MO 4DV2O 1I94O 4OX9O 1IBLO 4JI3O 4AQYO 4YHHO 1KUQA 1A32A 4DV7O 1YZBA 2UXCO 2JRIA 4DV6O 4DR2O 4JI4O 1HR0O 4LF9O 4DUYO 4DV5O 1HNWO 2UUBO 4DV1O 1IBKO 4DR4O 4LF4O 4JI0O 4DV4O 1AILA 4OPAA 2UUCO 2LW7A 4LFCO 1R6TA 5H5NA 5IWAO 4NXNO 4LF7O 1G1XB 1XNRO 1IBMO 4JI1O 4DR6O 3O65A 1FKAO 5LMNO 4JI5O 4DR3O 4DUZO 2VQFO 5LL6Y 1HNZO 2HHHO 4B3TO 2VQEO 2AGAA 2N74A 4X65O 3JAMN 2UUAO 2E5LO 1N36O 3OTOO 1DK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  3J7A U;  4JYA O;  4K0K O;  1X59 A;  2ZM6 O;  5LMU O;  4KHP O;  4B3S O;  2FKX A;  2F4V O;  1XMO O;  4GKJ O;  5BR8 O;  2Z0A A;  5IT9 N;  3T1H O;  4B3R O;  3J81 N;  1N32 O;  2DOS A;  4LFB O;  2DJV A;  4LFA O;  4LF6 O;  1N33 O;  4X66 O;  4DR5 O;  4DR7 O;  3M8A A;  4DV0 O;  1D2D A;  4GKK O;  4OPH A;  1XEQ A;  2ZKO A;  1N34 O;  5BXZ A;  2UXB O;  5BY1 A;  1XMQ O;  4YY3 O;  1FYJ A;  4NXM O;  4JI7 O;  3J80 N;  4X64 O;  1NS1 A;  4JI2 O;  4LF5 O;  3F5T A;  1R1B A;  4JI8 O;  1XNQ O;  1F7Y A;  4X62 O;  4JV5 O;  1AB3 A;  4JI6 O;  1FJG O;  3R66 A;  4LF8 O;  3SDL A;  4DR1 O;  2UXD O;  1HNX O;  5FLX N;  4A5U B;  1J5E O;  2UU9 O;  3RT3 C;  3T1Y O;  4DV3 O;  4B3M O;  4DV2 O;  1I94 O;  4OX9 O;  1IBL O;  4JI3 O;  4AQY O;  4YHH O;  1KUQ A;  1A32 A;  4DV7 O;  1YZB A;  2UXC O;  2JRI A;  4DV6 O;  4DR2 O;  4JI4 O;  1HR0 O;  4LF9 O;  4DUY O;  4DV5 O;  1HNW O;  2UUB O;  4DV1 O;  1IBK O;  4DR4 O;  4LF4 O;  4JI0 O;  4DV4 O;  1AIL A;  4OPA A;  2UUC O;  2LW7 A;  4LFC O;  1R6T A;  5H5N A;  5IWA O;  4NXN O;  4LF7 O;  1G1X B;  1XNR O;  1IBM O;  4JI1 O;  4DR6 O;  3O65 A;  1FKA O;  5LMN O;  4JI5 O;  4DR3 O;  4DUZ O;  2VQF O;  5LL6 Y;  1HNZ O;  2HHH O;  4B3T O;  2VQE O;  2AGA A;  2N74 A;  4X65 O;  3JAM N;  2UUA O;  2E5L O;  1N36 O;  3OTO O;  1DK1 A; 
#chains in the Genus database with same CATH topology
 3CCL V;  4QNH B;  2OWO A;  4LR3 A;  1ZUQ A;  5J2T B;  2CTR A;  3DC5 A;  1Q6H A;  5IYC O;  1EN4 A;  1P7B A;  5KLV H;  2Q0O C;  2DOS A;  3ZRS A;  4IYH A;  4BW5 A;  4EFE A;  3AG4 B;  4GCZ A;  5CA1 A;  1NU1 H;  1N32 B;  1HDJ A;  1P7G A;  3DXR B;  1SQV H;  3EVK A;  2AHY A;  1N34 O;  1MA1 A;  1N4C A;  3D36 C;  1IXM A;  4X64 O;  2QTO A;  4R6Z A;  4J9Z B;  1QLE C;  1BHB A;  4J7K A;  2ODM A;  3RYC A;  2E75 B;  3WG7 C;  4YXW G;  4YIP A;  5LP6 C;  4JV5 B;  2IM9 A;  4LF8 B;  2PGG A;  2QWP B;  1HW7 A;  4DV1 O;  4DW0 A;  4DV4 O;  3P32 A;  5DED A;  3NXS A;  4LNU A;  1SA0 A;  2JS3 A;  4I50 A;  3W7W A;  3E8H A;  3H1K H;  2F95 B;  3ETD A;  4LH6 A;  3D36 A;  3E8B A;  1KD1 W;  2P6J A;  4DRX A;  3E86 A;  3K04 A;  1ZSP A;  3HKE B;  3AG1 B;  5LMN B;  3BCC H;  4O4I B;  4DR3 B;  4HZ3 A;  5LMU O;  1S5H C;  5CB4 A;  3JAL B;  1JFF A;  2IU3 A;  1NTM H;  4J11 A;  2Q69 A;  4GKJ O;  1AR1 B;  2XOK G;  3B40 A;  2K1E A;  1SS3 A;  3JCU Z;  1N32 O;  5CBH A;  5JQG B;  2VWJ A;  3TXS A;  2Q7E A;  3RYH A;  1M57 B;  3H1I H;  3GVM A;  1QHT A;  3RYI B;  1JPX A;  4CH4 A;  3PJS K;  1B06 A;  3GWO A;  3BY6 A;  3OMI B;  1XEQ A;  2QR4 A;  4U7N A;  4FIP C;  3ZRX A;  3U11 A;  5KMG A;  4ZKI A;  3HKC A;  5L3D A;  2WLJ A;  2GV9 A;  1AR4 A;  2X6C A;  2MK3 A;  2P67 A;  1OZ0 A;  5JVD A;  4JV5 O;  3ASO B;  4LF8 O;  1SF9 A;  3BRC A;  3S3W A;  3L74 H;  5KHK A;  4P2Z A;  1CXZ B;  4GX2 A;  2UUC B;  3G6E V;  2XT9 A;  1VQ9 V;  3DGE A;  1XOU A;  1HNX B;  3LDE A;  1Y67 A;  1EM1 A;  2V1D A;  5ITZ B;  4WFE A;  1VF7 A;  1YIJ V;  2QWQ B;  3TK1 A;  4QPJ A;  4BW9 A;  5EZY A;  1V55 B;  5H5N A;  2Q4P A;  1OV9 A;  1IBK B;  1KU9 A;  1GM8 A;  1IVS A;  3MHS C;  5LMN O;  4LFC B;  3ICX A;  2W6J G;  3O9O A;  4DR3 O;  2QDO A;  3FKS G;  2ATK C;  1BHA A;  1B04 A;  3F7Y C;  1YDX A;  1H2L A;  1WB8 A;  3W7T A;  2GTS A;  3OE7 G;  3SPH A;  1JMK C;  2YUA A;  2F4V O;  5C8Y A;  1KYO F;  2CTP A;  3FB6 C;  3HKD A;  3RVZ A;  5KA6 A;  2Q0A A;  5KHH A;  3K3W A;  1ROP A;  2QKA A;  3H1L H;  1N8R W;  3HKB A;  4MTX A;  3I5D A;  2C2A A;  3LNM B;  4W4L A;  5CA1 B;  3AG3 B;  2FL4 A;  4QJF B;  3ML0 A;  2R9I A;  4X66 B;  4UXN A;  3JAW A;  2F66 C;  1QLN A;  2JGD A;  2ZKO A;  2P4K A;  1YIT V;  1TVK A;  4LBE C;  4PA7 A;  3U0Z A;  1DLB A;  3TGU H;  2ARH A;  1DF5 A;  1DTO A;  3F5W C;  1HNX O;  4JI7 B;  1F51 A;  5EYP A;  2CGN A;  3CD6 V;  1QVG U;  4DV3 O;  3SR2 C;  2A3Q A;  3JD2 A;  3RYC B;  4X62 B;  2Y0P A;  2IW5 A;  4W4K A;  1NI8 A;  2EZO A;  3BPZ A;  5KAF Z;  2QKS A;  1M5I A;  1R3J C;  1IBK O;  1HWY A;  4KFM A;  1ZTE A;  4DV2 B;  4X20 A;  4LFC O;  2HR3 A;  3QO7 A;  4DV5 B;  4LNU B;  1SA0 B;  2EIN C;  4MVO A;  5LYJ A;  5JWP A;  1WB7 A;  2EIJ C;  3RN4 A;  3CC7 V;  4DRX B;  2RQ6 A;  1VQ6 V;  2E5L O;  1D5A A;  2YI9 A;  3K0D A;  2ETN A;  3LSU A;  3CB2 A;  5FPO A;  3R65 A;  2N05 A;  1YHQ V;  4KP4 A;  5CB4 B;  1JFF B;  1YXB A;  2EUL A;  2PY5 A;  3E22 A;  2WLK A;  1Q6U A;  4MVQ A;  2ZXW B;  3OT7 A;  1MSD A;  5C93 A;  3S3X A;  4X66 O;  5IYD O;  3JD1 A;  2FTK A;  4B3R B;  1VQ8 V;  1AP5 A;  1ZX3 A;  4FLW A;  1FXV A;  2XAF A;  1AJP A;  4FZ0 A;  4KUM A;  1P84 F;  1L0N H;  3K9S A;  1ZWI C;  4IL6 Z;  2WWW A;  3D3Q A;  1XQ8 A;  5KMG B;  4ASU G;  4JI7 O;  1S76 D;  4K8Z A;  3HKC B;  5CN0 A;  2ADQ B;  2XAQ A;  1DF4 A;  4X62 O;  4UV8 A;  3UCS C;  5KHG A;  2A79 B;  2PZS A;  2Y4T A;  3WB2 A;  2F1M A;  4YY3 B;  4PV1 B;  3JSN A;  2O57 A;  4CH6 A;  5DEC A;  3RFR A;  1XL6 A;  1Q43 A;  3I55 V;  2LGQ A;  1FXK A;  4DV2 O;  1UJW B;  1JCH A;  1FJG B;  3G80 A;  2KSD A;  4FM1 A;  1GN3 A;  3CSX A;  4DV5 O;  1WNS A;  1I5X A;  2HJF C;  3FYI B;  1PP9 H;  3N2K A;  2UXC B;  1AJN A;  1EN5 A;  5EZY B;  5J2U A;  4DR4 B;  4LF4 B;  2DN9 A;  3AEI A;  5B5E Z;  1YSC A;  2AW9 A;  4D7T A;  3THO A;  4BIU A;  3OGC C;  2E76 B;  1Y76 A;  1XIL A;  1WN7 A;  2OTL V;  2WPD G;  1ZAU A;  1ARO P;  3ZMU A;  1WPX A;  1NVP D;  1W0J G;  5B3S C;  3W7S A;  4X65 B;  1NVP B;  3OM3 B;  5C8Y B;  3C3S A;  4B3R O;  2WAM A;  3VQW A;  4B3S B;  3HKB B;  4FM2 A;  3U10 A;  4PA9 A;  4WF9 V;  4LFB B;  3QTC A;  1I08 A;  4TT3 G;  1N33 B;  4H0L B;  2B5U A;  1VQ5 V;  2ZIM A;  4PEL A;  3K06 A;  3QNE A;  3ZHT A;  3JAW B;  2DW4 A;  2EJ7 A;  3E89 A;  1GH6 A;  4CS4 A;  4YY3 O;  3WB0 A;  1KBH A;  1TVK B;  1IXB A;  2A0L A;  2GSM B;  5LHH A;  2IH3 C;  1MAB G;  2Y69 C;  3ZBH A;  5B1A B;  1FJG O;  2ZR2 A;  3APO A;  1F23 A;  4O2A A;  5IDJ A;  1NKD A;  1PNM A;  4TWK A;  4JI8 B;  3ZHU A;  3RWR D;  5EYP B;  4I7Z B;  1K34 A;  4JI6 B;  3ABM C;  4XDK A;  4I55 A;  1A32 A;  1YZB A;  2UXC O;  4O4L A;  2GTA A;  3OUS A;  1Q86 W;  4DR4 O;  4LF4 O;  5KUK A;  4DO2 A;  2IH1 C;  1OJH A;  4FVM A;  4NTX A;  4TQF A;  4X20 B;  1XHZ A;  2HJD A;  2B1I A;  4MVM A;  5K1P A;  4DR2 B;  3OFN G;  4O4H A;  3O65 A;  3G4S V;  5GTH Z;  4UCO A;  2VQF O;  1M90 W;  4HNA A;  3FAV B;  3L71 H;  5LYJ B;  1NTZ H;  3OAA G;  4N23 A;  2ZE7 A;  2QGN A;  3SJC C;  1VQ4 V;  4ZOL A;  4X65 O;  3RBZ A;  3JAM N;  4JTA B;  2D2C B;  1DK1 A;  2P5O A;  2HG5 C;  5A2Q N;  4GLX A;  1LR1 A;  2YXL A;  4B3T B;  3H9V A;  2BOC C;  4B3S O;  1GK9 A;  1U96 A;  3L73 H;  2JIZ G;  3ZCC A;  2RMK B;  2RNB A;  1NQT A;  2QEX V;  3E22 B;  2UXN A;  3EXA A;  4LFB O;  3K08 A;  1PM9 A;  1N33 O;  5L3B A;  5K1X A;  5BR8 B;  5H2F Z;  4NTY A;  1GMG A;  4CBC A;  1D2D A;  3OR7 C;  4TUY A;  1TUB A;  4U7O A;  1KQS U;  1YTF D;  4BAY A;  3AK2 A;  5GTI Z;  2JVD A;  3FFQ A;  2EIN B;  1YTF B;  5JJN B;  1BCC H;  4FLT A;  2PYJ A;  2EIJ B;  1OCC C;  3SGI A;  3I56 V;  4J42 A;  4JI8 O;  4YJ2 A;  1ZL8 A;  4FJC C;  2K9P A;  4JI6 O;  1AI5 A;  4GUN A;  4TV8 A;  4LH7 A;  3JD0 A;  4H44 B;  2F23 A;  3IAY A;  1EZV H;  3CCJ V;  3B77 A;  3FB7 C;  1SQB H;  5KAI Z;  1RP3 B;  1FXK B;  4R8C A;  4OGQ B;  2PYL A;  3G71 V;  4DR2 O;  3ZHQ A;  4DUY O;  1J5E B;  4TQD A;  3CME V;  2YDE A;  5LGT A;  3L9D A;  2LW7 A;  5GW7 A;  3JCZ A;  1SES A;  4UV9 A;  4Q20 A;  5IWA O;  3N2K B;  1HNW B;  5LGU A;  3TCU A;  1K92 A;  5J2U B;  3STL C;  1S72 V;  2WLI A;  5LL6 Y;  3IFX A;  2CGO A;  4B3T O;  1BZK A;  1TA8 A;  1Y76 B;  4UCT A;  4G28 B;  2PI5 A;  3SPG A;  3CCS V;  1GO3 F;  5JJJ B;  4R7C A;  3A8T A;  3OMN B;  2OCC C;  4PDV A;  1UPG A;  3P3N A;  5BR8 O;  2Z0A A;  2NNU A;  3J81 N;  1TAE A;  2ZE8 A;  4RQF A;  2ZT9 B;  4KHP B;  3F7V C;  2P06 A;  1G8M A;  3ABK C;  2WA4 A;  3HPL C;  1THZ A;  3ZMV A;  3ETG A;  4H33 A;  4MS2 A;  4RWU A;  5CA0 B;  5LP6 A;  4H13 B;  1QR8 A;  5JCO C;  1JOY A;  4RAI A;  1PNK A;  4PA3 A;  3L72 H;  1R6K A;  4JZ2 A;  1MMM A;  3K03 A;  4P30 A;  2YIC A;  5EIB D;  4UFZ A;  5JH7 B;  2OIG A;  4AQY B;  1IX9 A;  3JSL A;  1XMQ B;  3SDL A;  1KP3 A;  3E83 A;  4LF5 B;  1J5E O;  4O2A B;  4X89 A;  1KB9 F;  1AVM A;  4PD4 F;  1KUQ A;  5EK0 A;  1WP7 A;  4LF7 B;  1L8D A;  1HNW O;  2UU9 B;  3AK3 A;  4O4L B;  3RVY A;  2YID A;  1H2M A;  1OCR C;  3A2F A;  1GTO A;  1XRE A;  4D7S A;  2CUG A;  1OCZ C;  5FL7 G;  5JCO A;  4G27 B;  4JTD B;  4QIW F;  1RFY A;  1O9G A;  1FKA O;  4O4H B;  1AI6 A;  4X1Y A;  2H94 A;  4GZR B;  1SRY A;  1Q82 W;  3RGB A;  2DE0 X;  1F4M A;  4HNA B;  5B66 Z;  5KA5 A;  2AGA A;  2EJR A;  2BTO A;  2G38 A;  2WLN A;  1K33 A;  2WLH A;  4ZOL B;  4DK1 A;  1AP6 A;  1SQQ H;  2DYR B;  2EIM B;  2OTJ V;  4L8J A;  3ZJZ A;  4O4J A;  4KHP O;  2ZDI C;  3K5L A;  3OD4 A;  3ZIA G;  3BVO A;  1V54 B;  1E1R G;  3VQV A;  3T4D A;  2IJH A;  5BMV A;  3M7M X;  2B1G A;  4XDJ A;  1YF2 A;  3CXC U;  4B7E A;  3OTF A;  4BWA A;  1H8H G;  2W6I G;  3ZMZ A;  4RQE A;  1AI4 A;  4Z1M G;  4TUY B;  1SZT A;  1TUB B;  1OCO B;  2YS8 A;  1W2B U;  3ZN0 A;  2P4V A;  4DR5 B;  2JGU A;  1V9P A;  3VQX A;  1H8E G;  1GAX A;  1B6Q A;  1JX9 A;  2L35 A;  4WFA V;  4XDL A;  2ZQM A;  5H9C A;  1XMQ O;  2UXD B;  1JJ2 U;  4LF5 O;  1NS1 A;  4J7Z A;  2NN4 A;  3H1J H;  3VOU A;  4YJ2 B;  4BIZ A;  1RM1 B;  1XBL A;  2X6B A;  3RW0 A;  3AG2 B;  1US6 A;  5JJE B;  4TV8 B;  2UU9 O;  4J80 A;  3NR7 A;  2MW2 B;  3CMA V;  3ABL B;  2EIL C;  1PV0 A;  4MW3 A;  2HVJ C;  3BAB A;  3K58 A;  3OEH G;  1NR7 A;  2EIK B;  5EBM C;  3T1Y B;  4JF3 A;  2UUC O;  3QF7 A;  1FS0 G;  1YEW A;  4LF9 B;  1DGS A;  1ENV A;  1VMG A;  3TET A;  2DYS C;  2GUZ A;  1X4T A;  5EBL C;  2JS5 A;  5B1N A;  1D5N A;  4PDL A;  3L70 H;  2DWE C;  3CCU V;  1H2N A;  5B1B C;  1RSO A;  4WFH A;  2YXY A;  2RDC A;  4UB8 Z;  3B4S A;  1QR9 A;  3CPW U;  3JAK A;  2GDS A;  4I50 B;  3KCX A;  3KZI Z;  1AR5 A;  1IZ3 A;  1IDS A;  2DJV A;  4FFB A;  4QE7 A;  5L3C A;  1YCI A;  4DR5 O;  3C90 A;  1MG1 A;  1K5Q A;  1M93 A;  3HB3 B;  1JQ0 A;  2YC0 A;  1Q3E A;  1QLE B;  4P9P A;  2Y4U A;  3N2G A;  4ZHQ A;  1H2K A;  5AG2 A;  1VEW A;  3CCV V;  1NTK H;  3WG7 B;  1PL4 A;  2ZNJ A;  3CC4 V;  5LP6 B;  4DV0 B;  2AZ2 A;  4UB6 Z;  1M9N A;  2JEX A;  2VWK A;  3JAT A;  1QBZ A;  3CCM V;  3AG4 C;  1WAZ A;  1WLE A;  2IJK A;  4JI3 B;  4X1K A;  2H3O A;  3RYH B;  2Y0I A;  3IC9 A;  3BFR A;  3CCE V;  3T1Y O;  4MW8 A;  1PL0 A;  2LFR A;  3LSQ A;  3PN1 A;  1SET A;  4LF9 O;  3LUT B;  3SJB C;  3W7U A;  2W0X A;  2EZP A;  1FXH A;  3DC6 A;  3AK1 A;  4JAS A;  1IBL B;  2A7W A;  5EC2 C;  5JVD B;  1SQX H;  3CRC A;  4LWS A;  2F43 G;  2M6Y A;  1E79 G;  4X1Y B;  2OCH A;  2VS0 A;  2X7R B;  5LHI A;  1IBM B;  4K35 A;  4JI1 B;  4DR6 B;  3OUF A;  4G2K A;  1B3Q A;  1NT2 B;  1QQC A;  3A0H Z;  4DYL A;  4O4J B;  3MAQ A;  1VP7 A;  3K79 A;  2Q68 A;  3B2E E;  4EEQ A;  1JA8 A;  4PA4 A;  5BMV B;  2A06 H;  4CZZ A;  3CYO A;  1XMO B;  2EX3 A;  1GKF A;  1OCR B;  1RPO A;  3AG1 C;  4DV0 O;  3SYQ A;  4LF6 B;  4L87 A;  4MSW C;  3LDC A;  3ZHR A;  2XND G;  1S77 D;  4E2L A;  2Q6A A;  3HKD B;  1R3I C;  2R70 A;  1G6U A;  4DXW A;  1R1B A;  1VIB A;  1M57 C;  2X6A A;  3BA9 A;  5DM6 V;  4EKW A;  1OHH G;  2UXB B;  1M1K W;  1T5E A;  2KG7 A;  3CCQ V;  2QSA A;  2OYQ A;  4JYC A;  3T1C A;  2PI4 A;  3STZ C;  1M56 C;  1IBL O;  1R3L C;  4UCV A;  2CAZ C;  2GHY A;  2JGD B;  3A0R A;  3OR6 C;  4RUF A;  4ZI7 A;  1NJI W;  4FLZ A;  4CC6 A;  3ASO C;  1K7D A;  4OX9 B;  3JAL A;  4BIO A;  1NH2 D;  4EFB A;  3CE2 A;  2QKC A;  1GN4 A;  1R6N A;  5CBF A;  1IUR A;  4O2B A;  1J95 A;  1IBM O;  5B1O A;  4JI1 O;  1NH2 B;  4DR6 O;  1VQ7 V;  1SKV A;  2YSU B;  2GUZ B;  2EBO A;  3TJT A;  2P90 A;  1PNL A;  4J9Y B;  1NBM G;  4ZBM A;  3ZN1 A;  4CH3 A;  1E1Q G;  1NZ6 A;  1S3J A;  4AI8 A;  2P7T C;  1WJZ A;  2ADP A;  1X59 A;  1V55 C;  2WLM A;  4PI2 A;  4Q6G A;  2VQE B;  4MTO A;  3MD0 A;  1XMO O;  3SJA C;  3JAK B;  1VAR A;  4ICG A;  5D5P A;  4EB6 A;  5LHG A;  1S5L Z;  3CP1 A;  1AI7 A;  4LF6 O;  1WP8 A;  3OMA B;  5A9G A;  3T2M A;  4FFB B;  1ORQ C;  3BAA A;  1Y66 A;  1H38 A;  2QM4 A;  3G6B A;  4CS3 A;  1URF A;  3N2G B;  4ZHQ B;  4Z1V A;  3GB7 C;  1MOF A;  2NLJ C;  1Y6X A;  4I4T A;  5BXZ A;  2UXB O;  4GKK B;  2LQT A;  1JJO A;  4LP8 A;  3IJ4 A;  4LC1 A;  4E4E A;  1VQK V;  3JAT B;  1WPB A;  3G67 A;  1FD9 A;  4J41 A;  3ABU A;  3AG3 C;  5FLX N;  3RT3 C;  1EFR G;  3JD4 A;  4OX9 O;  2PF4 E;  4P9O A;  3CRR A;  2E74 B;  4YJ3 A;  3QO8 A;  5CA3 A;  1KP2 A;  4JZG A;  1K8A W;  3ASN C;  5LOV A;  2Q73 A;  3P30 A;  3BHP A;  1SQP H;  3LDD A;  5CMU A;  2FB5 A;  1VQP V;  2XAG A;  1L1F A;  1YJ9 V;  1HR0 B;  1COW G;  2UUB B;  4NVP A;  3FYE B;  4LWS B;  4UCR A;  4TV9 A;  3D8C A;  5LMU B;  2LP7 A;  2VQE O;  4MVS A;  3SPC A;  4GKJ B;  2R9A A;  4CH5 A;  3B8N A;  4GX5 A;  3JAR A;  5EBW C;  1P49 A;  3LNN A;  3X2Q C;  2Y48 A;  4AHC A;  4IIJ A;  5GON A;  4Z2W A;  3JAS A;  3Q4H A;  2ZM6 B;  5H6R A;  3CS5 A;  4J10 A;  1CPY A;  2QJ1 A;  2BTQ A;  1LUV A;  2HKO A;  2WA3 A;  4X1I A;  2Q7G A;  4PJ0 Z;  4UVA A;  5LA6 A;  4GKK O;  3FB8 C;  1H2S B;  3UM7 A;  4F6R A;  4PA6 A;  4ABM A;  1SER A;  2KKW A;  3UQ8 A;  1S5J A;  3P3P A;  5FNV A;  1VQM V;  2RJZ A;  2ZXW C;  5BY1 A;  4XBF A;  3J80 N;  1BQ0 A;  1Z2G A;  2QE7 G;  1XHX A;  5IJ0 A;  2XHB A;  4WFF A;  3CEI A;  4JAV A;  2ZIN A;  2KG7 B;  2QWR B;  4WCE V;  3CXH F;  3OGI B;  1YJW V;  1PD3 A;  3M99 B;  4QPK A;  2LFS A;  2DWD C;  4MTF A;  4IT5 A;  1HR0 O;  1L0L H;  3E2E A;  2YIB A;  2UUB O;  4MVZ A;  4ZI7 B;  5LGN A;  4IGG A;  3QO5 A;  1Q5O A;  2QTS A;  2HVK C;  3KKY A;  1I94 B;  1K3E A;  4YHH B;  5B3S B;  2ITC C;  3IGA C;  1NR1 A;  4JI0 B;  4O2B B;  2RCV A;  2ZR3 A;  1Y74 A;  4KXR A;  3CRQ A;  4RUE A;  4I55 B;  2F4V B;  1FAF A;  4PDR A;  3UKM A;  3K57 A;  3FX7 A;  1JR9 A;  4I9Q A;  1PPJ H;  2ZNI A;  3L75 H;  1Z5W A;  1FFX A;  2CTW A;  2YEV A;  3TXQ A;  3K5O A;  2ZM6 O;  4KL1 A;  1BS3 A;  4ZIB A;  2V4D A;  4U3J A;  2HFE C;  2Q9L A;  4I0X A;  2FKX A;  3GWK C;  4UCS A;  1K4D C;  1N36 B;  3OTO B;  1M56 B;  4FK5 C;  2BSK A;  1G4Y B;  2FYU H;  4EB6 B;  4K0K B;  2DQ0 A;  1GM7 A;  1XUQ A;  4GX1 A;  3B09 A;  5LXT A;  2XAJ A;  3E35 A;  4DK0 A;  2Y69 B;  1VF6 C;  3IC7 A;  3T4Z A;  2ZE6 A;  3DSQ A;  5KHJ A;  1YVW A;  1K5S A;  3CJH A;  4DR7 B;  2V7Q G;  4FPP A;  3CHX A;  4OPH A;  1Q8I A;  3ABM B;  2XUM A;  3UT5 A;  2CTQ A;  4I4T B;  3JYC A;  4JPR A;  3ZHS A;  1PKX A;  4DV3 B;  5IY5 C;  3ZS8 C;  1AB3 A;  3WB1 A;  2IJJ A;  3R66 A;  1CEZ A;  3W7X A;  1SQF A;  2D3O W;  2ZD9 A;  2YI8 A;  4JI2 B;  4A5U B;  5BZB A;  1XNQ B;  3BA8 A;  1I94 O;  1VQN V;  4AQY O;  1EZJ A;  4YHH O;  4WBN A;  3SJQ C;  1GN6 A;  1LNQ A;  1K4C C;  3SYP A;  2YXH A;  3ZMS A;  1EBO A;  4YJ3 B;  1VF6 A;  3ZED A;  4JI0 O;  3SPI A;  2M7W A;  5B1A C;  2LJ2 A;  5LOV B;  1ZL8 B;  5IYB O;  2ZDI A;  5IYZ A;  4DV7 B;  4IHJ A;  4DV6 B;  2BOB C;  3OEE G;  4JI4 B;  4LF7 O;  1BSM A;  4N21 A;  2E5L B;  3VQY A;  4TV9 B;  3ZRV A;  2F93 B;  3MDS A;  2H8P C;  1XNR B;  5LBQ A;  1N36 O;  3OTO O;  3K5N A;  2KB1 A;  4DW1 A;  2DMX A;  4JI5 B;  4K0K O;  2PTM A;  2HHH B;  3CX5 F;  3WFV A;  4UCU A;  2FML A;  2OT5 A;  5IT9 N;  3JAR B;  3EHB B;  1R3K C;  4YIO A;  2WLL A;  2PUS A;  1WA8 A;  4F6E A;  4IIJ B;  4TOI A;  5GON B;  4AIL C;  2Q67 A;  3JAS B;  3Q4H B;  1OCC B;  2WLI B;  2JDI G;  4NYK A;  3ASN B;  4DR7 O;  3CC2 V;  2BTQ B;  5E1A C;  1GN2 A;  4FLV A;  4X1I B;  1XL4 A;  3T1H B;  3ABT A;  1BQZ A;  2LW1 A;  5LA6 B;  5IE9 A;  4LFA B;  2BCC H;  5E79 Z;  1YJN V;  4QGP A;  4F6R B;  4FZ1 A;  1W59 A;  1I5Y A;  3MHH C;  3OW2 U;  5FNV B;  4X8A A;  3ZMT A;  4JI2 O;  5L3F A;  1XNQ O;  3SYO A;  1F7Y A;  1Q90 D;  1N0J A;  3ZRW A;  4X88 A;  2QM7 A;  1VF5 B;  1CP9 A;  5IJ0 B;  4R50 A;  1Q6I A;  3E8F A;  2AHZ A;  2UXD O;  3B8M A;  4JYY A;  2A9H A;  4CS2 A;  5KX5 A;  5HFL A;  2Z5U A;  3X2Q B;  3ZHV A;  2LO1 A;  2QA4 V;  2CH7 A;  3FAV A;  2WSS G;  4WFB V;  1TGO A;  4RO2 A;  4DV7 O;  2YIB D;  1AJQ A;  4DR1 B;  1O9H A;  2JRI A;  4DV6 O;  1MSW D;  4JI4 O;  1KKC A;  5IJ9 A;  4C7U A;  4NKG B;  1AIL A;  4B7K A;  4OPA A;  2QWO B;  3E8G A;  2CE4 A;  3HR0 A;  1KKD A;  2KQX A;  2XTA A;  3RYF A;  2OCC B;  1I0H A;  1XNR O;  1BMF G;  3DTU B;  4JI5 O;  1FXK C;  1Y74 B;  1YI2 V;  5EC1 C;  2YIA A;  4NR1 A;  1MZE A;  2HHH O;  2B9Z A;  5L3G A;  1SC5 B;  2CK3 G;  2XAS A;  5JH7 A;  2VRZ A;  5HFM A;  4JAU A;  2ZE5 A;  4MVR A;  2HLD G;  5KUM A;  4UVC A;  3ABK B;  4DUZ B;  3LSS A;  5J2T A;  1HNZ B;  1FFX B;  2YEV B;  4U3J B;  4J7J A;  4I0X B;  2UUA B;  1LUW A;  3APQ A;  3T1H O;  1RPR A;  2CDY A;  4JYA B;  2BSK B;  1FPO A;  4LFA O;  1TUE B;  4GT1 A;  3SYA A;  2LGW A;  4HYO A;  2W0F C;  3K59 A;  5LXT B;  3SYC A;  2IJI A;  4CC5 A;  4NB5 A;  3DXR A;  1S0V A;  2ILM A;  2IU0 A;  4LCU C;  1EN6 A;  3QG5 A;  1KEC A;  4H37 A;  1GRJ A;  4JAA A;  3CJH B;  4I5S A;  4HAM A;  3FD9 A;  2N04 A;  1FYJ A;  2OIE A;  3UT5 B;  3EFF K;  3CRM A;  1KMI Z;  2GBO A;  1BGY H;  1GM9 A;  4K3A A;  3C3T A;  3K5M A;  5F2V O;  1P4R A;  1BE3 H;  4DR1 O;  4NXM B;  2BE3 A;  3VBB A;  1BT8 A;  1OCZ B;  2Q8V A;  4D6T H;  2IBZ H;  4HBN A;  5TIS Z;  3UO3 A;  1Z5V A;  2ITD C;  1F4N A;  1QNM A;  4JI3 O;  3AG7 A;  4PI0 A;  1VQO V;  3K0G A;  4WBN B;  2HEP A;  3FB5 C;  3H1H H;  1XDC A;  4B3M B;  1R73 A;  2AZ0 A;  2VQF B;  2X0L A;  1VQL V;  1U97 A;  3KCY A;  4I9W A;  5EIB C;  4MVU A;  4FLY A;  2QWN B;  5IYZ B;  1Y4M A;  4IHJ B;  1G1X B;  3ZX6 A;  3H01 A;  5KHI A;  1W0K G;  3QVN A;  4DUZ O;  4JGS A;  1HNZ O;  4NXN B;  1XI1 A;  2N74 A;  3HKE A;  5IY5 B;  2HP8 A;  4FLU A;  2UUA O;  3WU2 Z;  2JK5 C;  4O4I A;  1QVF U;  3CRA A;  1M4U A;  3J7A U;  1MNG A;  4JYA O;  2JEU A;  1I7F A;  3SPJ A;  1H2G A;  2JJ1 G;  1UFI A;  5CA0 A;  3UO2 A;  3CWB H;  4U3F H;  5J9P C;  4PDM A;  2JJ2 G;  2Q5Z A;  5JQG A;  2ZIO A;  4UUJ C;  4TSF G;  2WLL B;  3D3I A;  2QM8 A;  1WA8 B;  1QCE A;  3KG2 A;  3K9A A;  3N27 A;  4GX0 A;  4UVB A;  2Z3Y A;  3M8A A;  5H6Q A;  3RYI A;  2P22 C;  2DYR C;  2EIM C;  1RSO B;  5L3E A;  3A0B Z;  1V54 C;  1MZF A;  3ETE A;  1K9M W;  3JD3 A;  2EIL B;  2AXT Z;  1HP8 A;  4NXM O;  4IYI A;  3F5T A;  4JTC B;  4B08 A;  5DN6 G;  4NTW A;  4GYC B;  1ZLZ A;  1FFT B;  4BR6 A;  1N34 B;  3ZRW B;  1Q7Y W;  3BEH A;  4QE9 A;  1OCO C;  4DUY B;  4FFK A;  4X64 B;  4OXS A;  4MTG A;  4B3M O;  4X9Q A;  2DYS B;  4JYB A;  5KX5 B;  2R9R B;  1SZX A;  2Q7H A;  4K8X A;  2XAH A;  2CH7 B;  5FPR A;  5IWA B;  1QU7 A;  4MT8 A;  4FMT A;  4F4L A;  2UXX A;  5ITZ A;  2E3C A;  1K73 W;  5B1B B;  5IJ9 B;  2ZCE A;  2RN9 A;  4FLX A;  2DQ3 A;  3CCR V;  1RM1 C;  1R6T A;  5CBG A;  4X1K B;  2R72 A;  4NXN O;  3AG2 C;  4PHZ A;  1Q81 W;  1JVM A;  4DV1 B;  3RYF B;  4DV4 B;  3ABL C;  1KC8 W;  2NR5 A;  1N0N A;  1SQG A;  1BL8 A;  1K97 A;  3ETQ A;  4FM0 A;  2EIK C;  4WFG A;  5D5Q A;  2L6L A; 
#chains in the Genus database with same CATH homology
 5A2Q N;  3J7A U;  4JYA O;  4K0K O;  1X59 A;  2ZM6 O;  5LMU O;  4KHP O;  4B3S O;  2FKX A;  2F4V O;  1XMO O;  4GKJ O;  5BR8 O;  2Z0A A;  5IT9 N;  3T1H O;  4B3R O;  3J81 N;  1N32 O;  2DOS A;  4LFB O;  2DJV A;  4LFA O;  4LF6 O;  1N33 O;  4X66 O;  4DR5 O;  4DR7 O;  3M8A A;  4DV0 O;  1D2D A;  4GKK O;  4OPH A;  1XEQ A;  2ZKO A;  1N34 O;  5BXZ A;  2UXB O;  5BY1 A;  1XMQ O;  4YY3 O;  1FYJ A;  4NXM O;  4JI7 O;  3J80 N;  4X64 O;  1NS1 A;  4JI2 O;  4LF5 O;  3F5T A;  1R1B A;  4JI8 O;  1XNQ O;  1F7Y A;  4X62 O;  4JV5 O;  1AB3 A;  4JI6 O;  1FJG O;  3R66 A;  4LF8 O;  3SDL A;  4DR1 O;  2UXD O;  1HNX O;  5FLX N;  4A5U B;  1J5E O;  2UU9 O;  3RT3 C;  3T1Y O;  4DV3 O;  4B3M O;  4DV2 O;  1I94 O;  4OX9 O;  1IBL O;  4JI3 O;  4AQY O;  4YHH O;  1KUQ A;  1A32 A;  4DV7 O;  1YZB A;  2UXC O;  2JRI A;  4DV6 O;  4DR2 O;  4JI4 O;  1HR0 O;  4LF9 O;  4DUY O;  4DV5 O;  1HNW O;  2UUB O;  4DV1 O;  1IBK O;  4DR4 O;  4LF4 O;  4JI0 O;  4DV4 O;  1AIL A;  4OPA A;  2UUC O;  2LW7 A;  4LFC O;  1R6T A;  5H5N A;  5IWA O;  4NXN O;  4LF7 O;  1G1X B;  1XNR O;  1IBM O;  4JI1 O;  4DR6 O;  3O65 A;  1FKA O;  5LMN O;  4JI5 O;  4DR3 O;  4DUZ O;  2VQF O;  5LL6 Y;  1HNZ O;  2HHH O;  4B3T O;  2VQE O;  2AGA A;  2N74 A;  4X65 O;  3JAM N;  2UUA O;  2E5L O;  1N36 O;  3OTO O;  1DK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...