3OTOO

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3otoO00
4B3SO 4DR2O 5FLXN 4YY3O 1HR0O 4AQYO 3R66A 5BR8O 4YHHO 1G1XB 2UXCO 4K0KO 4DV4O 4B3TO 2LW7A 4LFCO 3J81N 4NXMO 3F5TA 1XNQO 4GKJO 4DV1O 4DR1O 4DR7O 4LF5O 5BXZA 2ZM6O 3M8AA 2UXDO 1IBLO 4JI8O 4B3RO 1KUQA 1I94O 4DR4O 1IBKO 2DOSA 1A32A 1IBMO 4LF9O 2JRIA 4NXNO 4LF7O 1HNWO 5IWAO 1HNXO 4LFBO 1HNZO 4LFAO 2HHHO 2DJVA 4X65O 4OX9O 5LMNO 4DR5O 1J5EO 3SDLA 1XNRO 4JI1O 4JI0O 4LF4O 2UUAO 5LL6Y 3RT3C 5BY1A 1N36O 4X62O 2FKXA 2UUCO 4DR6O 4X66O 4JI6O 2UUBO 4OPHA 1FYJA 1X59A 4KHPO 4DV5O 4LF8O 1N33O 5LMUO 2AGAA 4DUZO 1DK1A 1FJGO 4DV7O 3T1HO 4JI2O 5IT9N 4JI3O 1FKAO 1YZBA 3T1YO 3J7AU 4JI5O 4A5UB 1D2DA 4JV5O 1R1BA 3JAMN 4DV2O 4LF6O 4JYAO 3OTOO 1NS1A 4X64O 1R6TA 2VQEO 1AB3A 3J80N 4DUYO 1XMQO 1AILA 1F7YA 4DV0O 5A2QN 2UU9O 2VQFO 1XEQA 4JI7O 4DR3O 4B3MO 2F4VO 2N74A 2ZKOA 5H5NA 1N32O 4DV6O 2Z0AA 4DV3O 1N34O 4OPAA 2E5LO 1XMOO 3O65A 4JI4O 4GKKO 2UXBO
chains in the Genus database with same CATH superfamily
5LHIA 3HKDB 4PV1B 2GUZA 1NVPD 1WB7A 2QE7G 4QE7A 4DK0A 4GUNA 4GKJB 3HR0A 4KL1A 5CB4A 4KHPB 1XDCA 3JARB 3A0BZ 3JCZA 4TSFG 3OUFA 1VQ5V 5B5EZ 3OTOB 3ABUA 1IBLO 1D5AA 4I9QA 2MW2B 4PELA 2DOSA 3K04A 4R7CA 3BY6A 1B6QA 4BIUA 2QJ1A 1RSOB 4ZI7A 2VQFB 4JYYA 1VQ8V 5IJ9A 1J5EB 2CTWA 2HHHO 2R72A 1OCRB 4R8CA 3FKSG 2A0LA 4L8JA 3AG1C 4HBNA 2UUAO 2FKXA 4JI4B 3QO5A 4LF5B 2WA4A 4OXSA 3LDDA 3ABMB 2EZPA 3AG2B 3JCUZ 2P90A 3F7VC 3W7SA 4U7OA 5KHHA 4TV9A 1VP7A 3IC7A 1SRYA 1JOYA 2JIZG 4LF6O 1F51A 5DEDA 2G38A 3CCVV 4EEQA 1F7YA 3K5NA 4WFGA 1YSCA 5IY5C 1QR9A 4I7ZB 4UXNA 1FD9A 3LSQA 5FPRA 4BW9A 3AK1A 4YY3B 4UV9A 1NVPB 2ZIOA 1PL4A 2F93B 1NT2B 4DV6B 2RNBA 3ABTA 3H1JH 3KCYA 1GM8A 2ZXWB 1WAZA 4ASUG 3DC6A 4WFEA 3UKMA 1H2SB 3CD6V 1KP3A 4WFHA 5CA0B 3OM3B 2GV9A 4MVZA 1AR4A 4FLUA 2VWKA 1Q7YW 1WPXA 4O2BA 3CWBH 1MOFA 2ZE5A 1L0LH 3K08A 3UCSC 1P4RA 3N2KB 1VQ7V 4U3JB 4LF9O 2JRIA 2OCCC 3CRCA 1OCOC 3TETA 2FB5A 5FNVA 2DJVA 5A9GA 1ZTEA 3RYIB 1R3KC 5DECA 4J10A 1YHQV 4O4IA 4JTAB 2UUBO 4QPKA 4H44B 4DV5O 5J2UB 4RWUA 4ZOLA 1K5SA 4K8XA 4PA6A 4JV5B 3T2MA 1PL0A 3RW0A 3JAWA 3OGIB 3B2EE 2A06H 5KHJA 1BQZA 2VQEB 1VQ4V 5K1PA 4HNAA 5KA6A 1TA8A 1VQ9V 4X64O 1ZSPA 2HR3A 3C3TA 3T4DA 5EYPB 3LDCA 4BWAA 1ZL8A 4IYHA 4DR3O 2N74A 4G2KA 5LMNB 2GSMB 2Q5ZA 4DV3O 4TQDA 1N34O 4LF4B 1H2LA 4F6RB 2E5LO 3BCCH 3G71V 2P7TC 4DR2O 2W0FC 3BEHA 1JJ2U 2XASA 4BW5A 2A3QA 5B1AB 2DMXA 1S76D 4TUYB 5C8YB 2QTSA 4JYAB 1MG1A 4JF3A 4CH4A 4O4JB 1K7DA 3JATA 3EVKA 2ZE6A 1G6UA 4DR1B 3APQA 2KB1A 4MTXA 2AZ2A 1YIJV 1YTFB 2ITCC 4EKWA 4GKJO 4RUEA 1Y67A 3U11A 2QSAA 3AK3A 1FXKA 3QTCA 1IBLB 2JJ1G 2X6CA 3ZN0A 5IE9A 2EBOA 1LUVA 4UCTA 2IU0A 3B40A 1WPBA 4PA9A 2E3CA 1ZX3A 4LFAO 3P3PA 3OR6C 4FFKA 4IL6Z 4IGGA 2YICA 1L8DA 3ETGA 2QM7A 4FLZA 1J5EO 5KMGB 1FAFA 3RVZA 1OCZB 1N36O 2WLLB 3C3SA 3HKCA 1Q6IA 2X6AA 4LCUC 2JS5A 3ZJZA 3AG4C 3JALB 1VQPV 5B66Z 2DQ3A 1NZ6A 5IT9N 2V7QG 1L1FA 1QLEB 2CH7A 1YZBA 2Q8VA 2A7WA 3J7AU 1SC5B 1GK9A 5BMVA 1S5JA 4DUYB 4K0KB 3OTOO 4W4LA 4FJCC 2OT5A 1XILA 5DM6V 1KQSU 2YDEA 1AI4A 2DYSC 3UT5A 1MSWD 4PDRA 1SETA 1YF2A 2V1DA 2YXHA 4GT1A 2ZM6B 3IAYA 1Z5VA 2YIBD 1UPGA 4UV8A 2Q67A 2HHHB 3P3NA 1SA0A 4UVCA 2UUCB 1L0NH 4I0XA 2UXCB 4AI8A 4B7EA 3JD1A 4YY3O 2QA4V 1XL6A 1HR0O 3E8BA 2UUAB 1HNWB 1GTOA 1U97A 4UVAA 1K9MW 4I5SA 3N2GA 1GRJA 2QWPB 4NXMO 4PA7A 4NTWA 2CGOA 2K1EA 2XAGA 1XQ8A 4CS3A 3S3XA 4JI8O 2IU3A 3WB1A 1FPOA 3BRCA 2HLDG 5BR8B 4UB6Z 3P30A 1HNZO 2UXBB 2Q6AA 3B8NA 1GN2A 2YUAA 4I9WA 4Z1MG 5L3DA 5JH7B 3CCQV 4X88A 1PD3A 3K06A 4JAVA 4DV4B 2DE0X 1GN4A 3OR7C 2YSUB 1VF5B 3P32A 4JI7B 3QO8A 4DRXA 5LHGA 1JVMA 2XNDG 3L71H 3AG1B 1BSMA 3LSSA 1VQOV 4YJ3B 1X4TA 1VIBA 3T1HO 3K03A 1MZFA 4JV5O 1H2KA 4DR4B 1SQPH 2Y4UA 3FB8C 2PY5A 3LDEA 3U0ZA 1OCOB 1PNKA 1R6TA 2VQEO 1WJZA 4LFCB 3CRMA 4DV0O 4QGPA 1VMGA 2EILC 4FFBB 1JR9A 4I50B 3ZRSA 3AG3C 3CE2A 3G6BA 4QIWF 1ROPA 3PN1A 5H5NA 1EZVH 1S77D 3K5MA 3RYIA 4U7NA 1I5XA 4WCEV 3R66A 1IXBA 1JFFA 1SQBH 1VQNV 5JJEB 3ZRVA 2XAQA 3JARA 1R3LC 4X65B 2OWOA 3GWOA 2D3OW 1VQMV 2NN4A 5B1BB 4DR1O 3BA9A 4PDMA 1GMGA 5BXZA 1KUQA 1Q90D 3NXSA 2PYLA 2W6IG 5B1NA 1B3QA 1R6NA 1HP8A 1EN6A 4NB5A 2ZINA 4NXNO 2OTLV 3QVNA 1PPJH 4UB8Z 3T4ZA 4FLWA 1Y76A 4FM0A 4CH5A 5CA1B 2YIAA 2PI5A 1VF7A 4OX9O 2XOKG 5LMNO 4D6TH 5LBQA 5B1OA 2IH3C 4XDLA 4LF4O 1R6KA 2E5LB 5LL6Y 1OCRC 4B7KA 1KU9A 4X66O 1W0JG 4LWSA 4DR2B 3B8MA 1M4UA 4TT3G 2ZIMA 1K4DC 4LF8O 3OMAB 1NKDA 1RFYA 4JI5B 1JJOA 3RFRA 1H2MA 4CS2A 3ABMC 2JS3A 1E1RG 3T1YO 2NLJC 1M56B 1V55C 1NI8A 3CMAV 2A79B 3ASOB 1US6A 1FXKB 2RN9A 4DUYO 5J9PC 1BE3H 2EIKB 3K9SA 4PDVA 3KKYA 5EC2C 4B3MO 4XBFA 3RVYA 2F4VO 3ZMSA 1TVKB 3CEIA 1IURA 4B3SB 2Z0AA 2IJHA 1GN3A 4KXRA 3BAAA 5LOVB 3H01A 1JX9A 1FFTB 1R73A 3O65A 5KX5A 5LYJB 1TGOA 1PP9H 2UXCO 3APOA 3ZMVA 3CRRA 3L74H 5E79Z 4PI0A 1HR0B 4H33A 1BT8A 3ETEA 4F6EA 3D36C 2UU9B 2WPDG 2FTKA 1XI1A 3ZMTA 2L35A 3CMEV 1RP3B 4P9OA 3NR7A 1JA8A 4JGSA 4O2AB 2CUGA 5JVDB 3W7TA 4JI8B 1IBMO 5JQGB 2GDSA 3OE7G 4FPPA 1K4CC 5LP6B 2OCHA 2QR4A 3K0GA 4X1YB 3E8GA 1SA0B 1SQGA 1AP6A 2W0XA 5CBGA 4H13B 1CP9A 4I0XB 4AILC 4JI1O 1WA8B 2BSKB 3RT3C 1DTOA 3SPCA 2WLMA 4O4IB 3FYEB 2UUCO 2B5UA 2IW5A 2QWQB 2Q0OC 2X7RB 3D8CA 2LO1A 3H1KH 2R70A 1F23A 4L87A 4UCRA 4G28B 1DK1A 4QJFB 2KQXA 1DLBA 3LNNA 3CP1A 5B1AC 1HDJA 1IZ3A 1P49A 4CH6A 3CCJV 5GONB 1DGSA 3CJHA 1SQVH 1NH2B 5TISZ 1XMQO 5IWAB 3CCEV 1XHXA 4YIPA 4YJ2B 1M90W 3CCSV 3SYOA 2YI8A 2QM8A 1N32O 1VARA 3BFRA 5H9CA 1QHTA 3I55V 3DGEA 3H1HH 4F6RA 5LXTA 4JASA 3GVMA 3BPZA 4PI2A 4LNUA 1FJGB 2UXBO 1V9PA 3SR2C 2PUSA 5CN0A 4P2ZA 2H94A 2D2CB 2JGDB 5ITZA 1G1XB 5C8YA 4DRXB 4DV4O 3SPHA 1W59A 3ZHSA 5LGUA 1H2NA 1COWG 3FFQA 1AI6A 1JMKC 2VS0A 2VWJA 3OW2U 3CXCU 4DV1O 4BAYA 4JYCA 1GM9A 4FZ1A 4ICGA 1NBMG 4CBCA 3E89A 5BZBA 4FLTA 4P30A 4DR4O 1K34A 3C90A 1KKCA 2B1IA 3CCRV 5CMUA 5JCOC 1KBHA 2YC0A 1Q3EA 1QR8A 1TUBA 4LF7O 3ZN1A 3DC5A 1JCHA 3AG7A 2PTMA 5B3SC 1BS3A 2EINC 4PHZA 4DO2A 4K8ZA 5IYDO 4UUJC 3VQXA 4KFMA 1NH2D 5BY1A 5H2FZ 2LJ2A 1AI5A 2RDCA 1OJHA 1AJNA 5IJ0B 5HFMA 2L6LA 4UVBA 3JALA 5K1XA 1Q5OA 3BA8A 2QDOA 2ZXWC 1KMIZ 3L73H 1K3EA 1HW7A 1PV0A 1YJWV 3BABA 4JI5O 1TUEB 2HVJC 2N05A 2P67A 4NKGB 1MA1A 3ZS8C 3ZMZA 1NU1H 3VQVA 1MNGA 3AEIA 3UT5B 3G80A 5A2QN 4MW8A 1ZAUA 4I55B 1Y76B 3ZCCA 2LGQA 4NXNB 2ZKOA 1YXBA 5IYZB 1KYOF 3A2FA 4B3MB 4AHCA 3JD2A 4EB6A 4O4HA 5IDJA 4B3SO 2F23A 4X1KB 1Z5WA 4YXWG 1N0NA 2DW4A 4AQYO 4JYBA 1QLEC 3RYFA 2RQ6A 3FB5C 4IYIA 2IBZH 4FLYA 1UJWB 4LFAB 2AZ0A 3CC2V 1FFXB 3JD4A 1MSDA 2HVKC 2WLHA 2F43G 1I5YA 2MK3A 3ASOC 1SQXH 4DV2B 3EXAA 1QU7A 4LF5O 1R3IC 1N36B 4F4LA 3JAKA 1M9NA 2ETNA 3L70H 2Y4TA 1DF5A 2OTJV 4JPRA 2OYQA 3ZHUA 4MS2A 3CHXA 1Q8IA 1XNRB 4JAUA 3K59A 2F4VB 3DSQA 4ZKIA 5LOVA 4DR5O 4YIOA 1ZLZA 5C93A 1BMFG 4MW3A 2FYUH 1KECA 3E8FA 2Y0IA 4PA4A 3HPLC 3WG7B 5JCOA 1AR1B 1FS0G 1D5NA 3E86A 3SPIA 1IXMA 3ZEDA 2EIMC 2WLIA 3ZHQA 4D7TA 1EN5A 1VF6A 3QG5A 1S0VA 3CX5F 3CYOA 2YXYA 2EILB 4IHJB 4O2AA 5JVDA 2DYRC 4RQFA 1FXVA 2JVDA 1F4MA 5JJJB 5IYCO 2BTQA 4JTDB 1RM1C 1YJNV 4OGQB 2KSDA 4MVUA 5LP6A 1ZUQA 3W7UA 5LGTA 4GX2A 1H2GA 1N0JA 4O4LA 1N8RW 3ZRXA 4TOIA 3BHPA 4UCSA 1LR1A 3E35A 2EJRA 4MVMA 4LBEC 2BTOA 4FLVA 1HNZB 4DV7B 3AK2A 1XNQO 4J41A 4DR7O 2F95B 3M8AA 2UUBB 4B3RO 4DV1B 4NYKA 4QNHB 4ABMA 4DV5B 3X2QC 1O9GA 1XUQA 4WFBV 2ARHA 2KKWA 4UCVA 2P4VA 3RN4A 5IWAO 3E22A 3I56V 4WFAV 5CA1A 2E75B 1F4NA 3K57A 2Y69C 1N32B 4J11A 1XREA 4CH3A 5EK0A 4LH6A 2Q68A 2JGDA 1GKFA 2GBOA 5LA6B 4D7SA 4LWSB 4QE9A 4DR3B 3SJQC 4U3FH 3OMIB 3FYIB 3CPWU 3I5DA 3Q4HB 1I94B 1EN4A 4DV3B 5EZYA 5D5PA 5LMUO 2X0LA 4DUZO 2HG5C 3TXQA 2JEUA 4LFBB 2Y0PA 4JI3O 3B09A 4BIZA 2CTQA 5J2UA 4JYAO 4MVSA 3JAWB 3VOUA 2Q0AA 3CCLV 4RO2A 4BR6A 4HNAB 4J80A 5B3SB 4CS4A 2LP7A 3CCMV 2LFRA 3A0RA 3BVOA 4CC5A 2CK3G 2H8PC 4JI2B 4IIJB 1XMOO 1W2BU 3AG3B 2CDYA 1Y66A 3RYHA 1W0KG 1H8EG 4GYCB 2PI4A 2Z3YA 1FXKC 4OX9B 4MVOA 4K35A 4TUYA 2W6JG 1OZ0A 1SF9A 3F5WC 2DWEC 2JJ2G 1PNLA 3JATB 4NVPA 2JGUA 3WG7C 2IJJA 1IBKO 4ZI7B 4TV9B 3QF7A 4GKKB 3SPJA 2GTSA 5B1BC 3ZRWA 1K33A 2KG7B 3SJBC 4B08A 2R9IA 1NQTA 3THOA 2H3OA 1WB8A 1Q43A 1Z2GA 4X62B 3E83A 1NTZH 2UXNA 2JDIG 4EB6B 3EFFK 3SPGA 1XNRO 5EBLC 3OEHG 1V54C 4R50A 2YXLA 1CXZB 1ENVA 2ZR3A 4GX5A 3K79A 3FAVA 3OFNG 2XAJA 1M56C 2YEVB 4CC6A 2Q69A 2ZNIA 2K9PA 2NNUA 4X1IA 4HYOA 3JD0A 1YI2V 1DF4A 3ETQA 3K0DA 2QKSA 2EX3A 4J7ZA 5CA0A 4DV2O 3OMNB 5GONA 3DXRA 2JK5C 1RM1B 1NS1A 4J42A 1Y4MA 1KP2A 1K92A 3FD9A 3ZHRA 4NXMB 1AJQA 1G4YB 2N04A 2HJDA 1WP8A 3ASNB 3HKBA 3HKCB 1VQKV 1HWYA 3LSUA 1SQQH 3TXSA 4OPAA 1H8HG 3L72H 3L75H 3TCUA 2Q9LA 4DR5B 1IBMB 1OHHG 2E74B 2EJ7A 1OCCB 4PD4F 3SYPA 3E2EA 5BR8O 1QVGU 1E1QG 5KAFZ 4WBNB 1OCZC 5H6RA 2EINB 1AR5A 4O2BB 2Q4PA 4P9PA 1U96A 1YTFD 4Q6GA 4TQFA 2WLIB 4JI1B 2CE4A 2P5OA 3LUTB 4KUMA 2M6YA 1WNSA 4B3RB 1MZEA 3JSLA 1M93A 1TUBB 3WU2Z 5KHKA 5KHGA 2O57A 3ML0A 4J7JA 4GKKO 1WN7A 5EYPA 2R9AA 3IJ4A 2A9HA 1LUWA 1NTKH 4NTYA 4X8AA 1QQCA 4O4LB 2Z5UA 4JI0O 2R9RB 5L3FA 4DV0B 1GN6A 2EIJC 3W7WA 1FYJA 2XTAA 3OT7A 2BE3A 4DXWA 2WA3A 5J2TA 3SYCA 3CC4V 5E1AC 5EC1C 4DV7O 2HJFC 5LMUB 5FPOA 3U10A 4BIOA 2ITDC 1XNQB 1Q6UA 4IT5A 3RYCA 1K73W 1LNQA 3CRQA 4FK5C 1QCEA 5F2VO 4J7KA 1YCIA 1V55B 1BCCH 3JSNA 1XL4A 2C2AA 1EZJA 2Q73A 4FMTA 4UFZA 4HAMA 2ZNJA 1M57C 1N33B 4KP4A 3D36A 3UO2A 2EIJB 2PF4E 1QBZA 2BCCH 4I50A 3AG4B 3AG2C 2HEPA 4MTFA 3B4SA 2ADPA 2DQ0A 1XMOB 3RYFB 4RAIA 4FM2A 4LF7B 5KHIA 4MVQA 2WLNA 1T5EA 3J81N 2LQTA 1G8MA 1AJPA 1NTMH 1PM9A 4DUZB 5JJNB 1VEWA 3QNEA 1SZTA 1TAEA 2FL4A 3ZHVA 2UXDO 4JI3B 4FFBA 2OCCB 3UM7A 4LF8B 3O9OA 1EBOA 4CZZA 3JASB 2RJZA 1MMMA 4RQEA 2PZSA 3STZC 4IIJA 1JFFB 4DR6B 2NR5A 2P06A 3KCXA 1RPOA 2ZDIC 2AW9A 3RYHB 4X62O 3R65A 5L3GA 2B1GA 2ZE7A 5DN6G 2CH7B 1I0HA 4DW0A 1Y74A 4TV8B 1B04A 1Q6HA 4I4TB 4MTGA 2IJIA 3JD3A 3OAAG 4IHJA 4AQYB 1SERA 2CTPA 2Q7EA 2X6BA 1IBKB 2BTQB 1Q86W 2UU9O 2XHBA 1XEQA 3A8TA 2ZDIA 2F1MA 2YIBA 1N4CA 1V54B 2PYJA 3M99B 3TK1A 1IDSA 2WWWA 2AHZA 2VRZA 2ILMA 2HFEC 3WB0A 4N23A 3N2GB 4JI6B 2EZOA 2GUZB 1ORQC 4K0KO 2BOBC 4X20B 1PNMA 3D3QA 4EFBA 2AXTZ 4B3TO 2QKAA 3JYCA 1AVMA 3ZX6A 2LW7A 2OIGA 5KX5B 3K3WA 2BOCC 4LH7A 5CB4B 3OTFA 1FXHA 3IFXA 1O9HA 4X1IB 5EBWC 3RBZA 1Y6XA 4N21A 3X2QB 4JZ2A 2IM9A 1XOUA 2ZM6O 4YJ3A 2CGNA 3EHBB 1KD1W 1P7BA 1SS3A 1TVKA 3K5OA 3QO7A 2ATKC 1J95A 2ZD9A 4R6ZA 1KB9F 1S72V 1AI7A 4X89A 4JTCB 5JH7A 1EM1A 1R3JC 1WLEA 3HKEB 4FVMA 4MVRA 4ZHQB 4PDLA 4DYLA 1NR1A 3MD0A 4YHHB 1XMQB 5LA6A 3RWRD 1SKVA 2Q7HA 1YDXA 2Y69B 4X1YA 3OUSA 4QPJA 4WBNA 4H0LB 3ABLC 2LFSA 5EZYB 3SJAC 3L9DA 1Q82W 3S3WA 4DK1A 5CA3A 1K8AW 1FJGO 1EFRG 3G67A 1QLNA 3ZIAG 3IGAC 1R1BA 5GTHZ 4Q20A 1SESA 1KKDA 2V4DA 1AB3A 1S3JA 3SGIA 3WFVA 1JQ0A 2P6JA 4FIPC 1UFIA 4GLXA 2DYRB 2BSKA 1YJ9V 2ZR2A 2P22C 3H9VA 1ZWIC 2IH1C 3D3IA 2IJKA 3ZBHA 4LR3A 2QWNB 2QGNA 4LNUB 5LGNA 5HFLA 3CSXA 3A0HZ 1SZXA 1XBLA 4LFCO 3ETDA 1NR7A 1S5LZ 1THZA 3F5TA 3ZHTA 2E76B 4LC1A 4TWKA 1K5QA 5KUMA 1N34B 3OD4A 3T1CA 1BZKA 1A32A 4X9QA 5L3BA 5KAIZ 2LGWA 3ZRWB 3N2KA 4U3JA 2KG7A 3N27A 3LNMB 4K3AA 1HNXO 4LFBO 2PGGA 4UCOA 2QWRB 2CTRA 2Q7GA 5FNVB 3CC7V 3W7XA 2YS8A 3FB7C 2HKOA 1M1KW 3SYAA 1YVWA 2GHYA 2DWDC 3HKDA 4NTXA 4DR6O 3K5LA 3FAVB 4LP8A 3RGBA 1S5HC 4KHPO 4NR1A 2YEVA 2WLJA 1BL8A 4GX1A 2ZQMA 5LYJA 2AGAA 3G4SV 1GH6A 3CS5A 4JI2O 5IJ0A 3CB2A 2OIEA 1D2DA 1P7GA 1I7FA 1WP7A 4WFFA 1IX9A 3JAMN 3DXRB 1M57B 2UXDB 2Y48A 4ZIBA 3ABKC 4FLXA 1E79G 1AILA 4MT8A 1CEZA 3K9AA 1AROP 2VQFO 1SQFA 4GZRB 1ZL8B 3B77A 4JAAA 1QVFU 1RSOA 5L3CA 5IJ9B 3HKBB 2GTAA 3F7YC 5JQGA 1OCCC 3OGCC 4DW1A 5KUKA 4JI4O 4I55A 1MABG 4MTOA 3VQWA 5GW7A 5D5QA 3T1YB 3SJCC 3ICXA 2WAMA 2EIMB 5EIBD 5KA5A 4O4JA 4GCZA 4MSWC 1BQ0A 5H6QA 4EFEA 1XHZA 4G27B 3UQ8A 4I4TA 4LF6B 3KG2A 2XUMA 2QM4A 1Q81W 1H38A 5IYZA 1NJIW 3KZIZ 2QEXV 1VQ6V 1HNWO 1BGYH 4E2LA 4FZ0A 3STLC 1WA8A 3MAQA 2UXXA 2JEXA 3CXHF 5IY5B 1GM7A 2ZCEA 5CBFA 4WF9V 4ZBMA 1PKXA 2WLLA 3DTUB 3GB7C 5FL7G 4JI6O 4OPHA 4X20A 4E4EA 3G6EV 5J2TB 5L3EA 3IC9A 3H1LH 2XAFA 4W4KA 3K58A 4B3TB 3CJHB 1GO3F 1FKAO 3TGUH 4A5UB 3RYCB 2EIKC 5BMVB 5CBHA 2QKCA 4YJ2A 1BHBA 3HB3B 2DN9A 3ZMUA 3J80N 4J9YB 4FM1A 2RMKB 2ZT9B 5LXTB 4JI7O 5EIBC 1JPXA 4DR7B 3HKEA 3E8HA 4DV6O 2YIDA 5GTIZ 5ITZB 4ZHQA 3T1HB 1OV9A 4GX0A 2B9ZA 3ABLB 2M7WA 5FLXN 1RPRA 2YI9A 3VBBA 3FB6C 4YHHO 2XT9A 1VQLV 1IVSA 2ADQB 2F66C 4ZOLB 4HZ3A 3TJTA 4PJ0Z 4XDJA 4JI0B 2WLKA 5AG2A 3MHSC 4C7UA 2CAZC 4LF9B 1M5IA 1I94O 4H37A 3OEEG 4PA3A 5LHHA 2EULA 3JASA 4Z1VA 1CPYA 1YITV 2XAHA 5JWPA 3CCUV 1URFA 2QWOB 3ABKB 4X65O 1KC8W 3SDLA 3E22B 5IYBO 3ASNC 3PJSK 4Z2WA 2WSSG 1BHAA 2LW1A 2QTOA 5EBMC 3GWKC 1QNMA 1B06A 2FMLA 3SYQA 1X59A 3H1IH 1GAXA 3WB2A 5KLVH 1Y74B 1N33O 1AP5A 4TV8A 1YEWA 2AHYA 3UO3A 1VF6C 2ZE8A 3VQYA 1K97A 4RUFA 3Q4HA 4XDKA 4X64B 1FFXA 2P4KA 4JZGA 3MHHC 2HP8A 1P84F 3JAKB 4X66B 5LP6C 4O4HB 3CRAA 1I08A 4X1KA 1HNXB 3MDSA 2RCVA 3FX7A 2ODMA 2DYSB 4UCUA 3M7MX 5KMGA 4J9ZB
chains in the Genus database with same CATH topology
4B3SO 4DR2O 5FLXN 4YY3O 1HR0O 4AQYO 3R66A 5BR8O 4YHHO 1G1XB 2UXCO 4K0KO 4DV4O 4B3TO 2LW7A 4LFCO 3J81N 4NXMO 3F5TA 1XNQO 4GKJO 4DV1O 4DR1O 4DR7O 4LF5O 5BXZA 2ZM6O 3M8AA 2UXDO 1IBLO 4JI8O 4B3RO 1KUQA 1I94O 4DR4O 1IBKO 2DOSA 1A32A 1IBMO 4LF9O 2JRIA 4NXNO 4LF7O 1HNWO 5IWAO 1HNXO 4LFBO 1HNZO 4LFAO 2HHHO 2DJVA 4X65O 4OX9O 5LMNO 4DR5O 1J5EO 3SDLA 1XNRO 4JI1O 4JI0O 4LF4O 2UUAO 5LL6Y 3RT3C 5BY1A 1N36O 4X62O 2FKXA 2UUCO 4DR6O 4X66O 4JI6O 2UUBO 4OPHA 1FYJA 1X59A 4KHPO 4DV5O 4LF8O 1N33O 5LMUO 2AGAA 4DUZO 1DK1A 1FJGO 4DV7O 3T1HO 4JI2O 5IT9N 4JI3O 1FKAO 1YZBA 3T1YO 3J7AU 4JI5O 4A5UB 1D2DA 4JV5O 1R1BA 3JAMN 4DV2O 4LF6O 4JYAO 3OTOO 1NS1A 4X64O 1R6TA 2VQEO 1AB3A 3J80N 4DUYO 1XMQO 1AILA 1F7YA 4DV0O 5A2QN 2UU9O 2VQFO 1XEQA 4JI7O 4DR3O 4B3MO 2F4VO 2N74A 2ZKOA 5H5NA 1N32O 4DV6O 2Z0AA 4DV3O 1N34O 4OPAA 2E5LO 1XMOO 3O65A 4JI4O 4GKKO 2UXBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S O;  4DR2 O;  5FLX N;  4YY3 O;  1HR0 O;  4AQY O;  3R66 A;  5BR8 O;  4YHH O;  1G1X B;  2UXC O;  4K0K O;  4DV4 O;  4B3T O;  2LW7 A;  4LFC O;  3J81 N;  4NXM O;  3F5T A;  1XNQ O;  4GKJ O;  4DV1 O;  4DR1 O;  4DR7 O;  4LF5 O;  5BXZ A;  2ZM6 O;  3M8A A;  2UXD O;  1IBL O;  4JI8 O;  4B3R O;  1KUQ A;  1I94 O;  4DR4 O;  1IBK O;  2DOS A;  1A32 A;  1IBM O;  4LF9 O;  2JRI A;  4NXN O;  4LF7 O;  1HNW O;  5IWA O;  1HNX O;  4LFB O;  1HNZ O;  4LFA O;  2HHH O;  2DJV A;  4X65 O;  4OX9 O;  5LMN O;  4DR5 O;  1J5E O;  3SDL A;  1XNR O;  4JI1 O;  4JI0 O;  4LF4 O;  2UUA O;  5LL6 Y;  3RT3 C;  5BY1 A;  1N36 O;  4X62 O;  2FKX A;  2UUC O;  4DR6 O;  4X66 O;  4JI6 O;  2UUB O;  4OPH A;  1FYJ A;  1X59 A;  4KHP O;  4DV5 O;  4LF8 O;  1N33 O;  5LMU O;  2AGA A;  4DUZ O;  1DK1 A;  1FJG O;  4DV7 O;  3T1H O;  4JI2 O;  5IT9 N;  4JI3 O;  1FKA O;  1YZB A;  3T1Y O;  3J7A U;  4JI5 O;  4A5U B;  1D2D A;  4JV5 O;  1R1B A;  3JAM N;  4DV2 O;  4LF6 O;  4JYA O;  3OTO O;  1NS1 A;  4X64 O;  1R6T A;  2VQE O;  1AB3 A;  3J80 N;  4DUY O;  1XMQ O;  1AIL A;  1F7Y A;  4DV0 O;  5A2Q N;  2UU9 O;  2VQF O;  1XEQ A;  4JI7 O;  4DR3 O;  4B3M O;  2F4V O;  2N74 A;  2ZKO A;  5H5N A;  1N32 O;  4DV6 O;  2Z0A A;  4DV3 O;  1N34 O;  4OPA A;  2E5L O;  1XMO O;  3O65 A;  4JI4 O;  4GKK O;  2UXB O; 
#chains in the Genus database with same CATH topology
 5LHI A;  3HKD B;  4PV1 B;  2GUZ A;  1NVP D;  1WB7 A;  2QE7 G;  4QE7 A;  4DK0 A;  4GUN A;  4GKJ B;  3HR0 A;  4KL1 A;  5CB4 A;  4KHP B;  1XDC A;  3JAR B;  3A0B Z;  3JCZ A;  4TSF G;  3OUF A;  1VQ5 V;  5B5E Z;  3OTO B;  3ABU A;  1IBL O;  1D5A A;  4I9Q A;  2MW2 B;  4PEL A;  2DOS A;  3K04 A;  4R7C A;  3BY6 A;  1B6Q A;  4BIU A;  2QJ1 A;  1RSO B;  4ZI7 A;  2VQF B;  4JYY A;  1VQ8 V;  5IJ9 A;  1J5E B;  2CTW A;  2HHH O;  2R72 A;  1OCR B;  4R8C A;  3FKS G;  2A0L A;  4L8J A;  3AG1 C;  4HBN A;  2UUA O;  2FKX A;  4JI4 B;  3QO5 A;  4LF5 B;  2WA4 A;  4OXS A;  3LDD A;  3ABM B;  2EZP A;  3AG2 B;  3JCU Z;  2P90 A;  3F7V C;  3W7S A;  4U7O A;  5KHH A;  4TV9 A;  1VP7 A;  3IC7 A;  1SRY A;  1JOY A;  2JIZ G;  4LF6 O;  1F51 A;  5DED A;  2G38 A;  3CCV V;  4EEQ A;  1F7Y A;  3K5N A;  4WFG A;  1YSC A;  5IY5 C;  1QR9 A;  4I7Z B;  4UXN A;  1FD9 A;  3LSQ A;  5FPR A;  4BW9 A;  3AK1 A;  4YY3 B;  4UV9 A;  1NVP B;  2ZIO A;  1PL4 A;  2F93 B;  1NT2 B;  4DV6 B;  2RNB A;  3ABT A;  3H1J H;  3KCY A;  1GM8 A;  2ZXW B;  1WAZ A;  4ASU G;  3DC6 A;  4WFE A;  3UKM A;  1H2S B;  3CD6 V;  1KP3 A;  4WFH A;  5CA0 B;  3OM3 B;  2GV9 A;  4MVZ A;  1AR4 A;  4FLU A;  2VWK A;  1Q7Y W;  1WPX A;  4O2B A;  3CWB H;  1MOF A;  2ZE5 A;  1L0L H;  3K08 A;  3UCS C;  1P4R A;  3N2K B;  1VQ7 V;  4U3J B;  4LF9 O;  2JRI A;  2OCC C;  3CRC A;  1OCO C;  3TET A;  2FB5 A;  5FNV A;  2DJV A;  5A9G A;  1ZTE A;  3RYI B;  1R3K C;  5DEC A;  4J10 A;  1YHQ V;  4O4I A;  4JTA B;  2UUB O;  4QPK A;  4H44 B;  4DV5 O;  5J2U B;  4RWU A;  4ZOL A;  1K5S A;  4K8X A;  4PA6 A;  4JV5 B;  3T2M A;  1PL0 A;  3RW0 A;  3JAW A;  3OGI B;  3B2E E;  2A06 H;  5KHJ A;  1BQZ A;  2VQE B;  1VQ4 V;  5K1P A;  4HNA A;  5KA6 A;  1TA8 A;  1VQ9 V;  4X64 O;  1ZSP A;  2HR3 A;  3C3T A;  3T4D A;  5EYP B;  3LDC A;  4BWA A;  1ZL8 A;  4IYH A;  4DR3 O;  2N74 A;  4G2K A;  5LMN B;  2GSM B;  2Q5Z A;  4DV3 O;  4TQD A;  1N34 O;  4LF4 B;  1H2L A;  4F6R B;  2E5L O;  3BCC H;  3G71 V;  2P7T C;  4DR2 O;  2W0F C;  3BEH A;  1JJ2 U;  2XAS A;  4BW5 A;  2A3Q A;  5B1A B;  2DMX A;  1S76 D;  4TUY B;  5C8Y B;  2QTS A;  4JYA B;  1MG1 A;  4JF3 A;  4CH4 A;  4O4J B;  1K7D A;  3JAT A;  3EVK A;  2ZE6 A;  1G6U A;  4DR1 B;  3APQ A;  2KB1 A;  4MTX A;  2AZ2 A;  1YIJ V;  1YTF B;  2ITC C;  4EKW A;  4GKJ O;  4RUE A;  1Y67 A;  3U11 A;  2QSA A;  3AK3 A;  1FXK A;  3QTC A;  1IBL B;  2JJ1 G;  2X6C A;  3ZN0 A;  5IE9 A;  2EBO A;  1LUV A;  4UCT A;  2IU0 A;  3B40 A;  1WPB A;  4PA9 A;  2E3C A;  1ZX3 A;  4LFA O;  3P3P A;  3OR6 C;  4FFK A;  4IL6 Z;  4IGG A;  2YIC A;  1L8D A;  3ETG A;  2QM7 A;  4FLZ A;  1J5E O;  5KMG B;  1FAF A;  3RVZ A;  1OCZ B;  1N36 O;  2WLL B;  3C3S A;  3HKC A;  1Q6I A;  2X6A A;  4LCU C;  2JS5 A;  3ZJZ A;  3AG4 C;  3JAL B;  1VQP V;  5B66 Z;  2DQ3 A;  1NZ6 A;  5IT9 N;  2V7Q G;  1L1F A;  1QLE B;  2CH7 A;  1YZB A;  2Q8V A;  2A7W A;  3J7A U;  1SC5 B;  1GK9 A;  5BMV A;  1S5J A;  4DUY B;  4K0K B;  3OTO O;  4W4L A;  4FJC C;  2OT5 A;  1XIL A;  5DM6 V;  1KQS U;  2YDE A;  1AI4 A;  2DYS C;  3UT5 A;  1MSW D;  4PDR A;  1SET A;  1YF2 A;  2V1D A;  2YXH A;  4GT1 A;  2ZM6 B;  3IAY A;  1Z5V A;  2YIB D;  1UPG A;  4UV8 A;  2Q67 A;  2HHH B;  3P3N A;  1SA0 A;  4UVC A;  2UUC B;  1L0N H;  4I0X A;  2UXC B;  4AI8 A;  4B7E A;  3JD1 A;  4YY3 O;  2QA4 V;  1XL6 A;  1HR0 O;  3E8B A;  2UUA B;  1HNW B;  1GTO A;  1U97 A;  4UVA A;  1K9M W;  4I5S A;  3N2G A;  1GRJ A;  2QWP B;  4NXM O;  4PA7 A;  4NTW A;  2CGO A;  2K1E A;  2XAG A;  1XQ8 A;  4CS3 A;  3S3X A;  4JI8 O;  2IU3 A;  3WB1 A;  1FPO A;  3BRC A;  2HLD G;  5BR8 B;  4UB6 Z;  3P30 A;  1HNZ O;  2UXB B;  2Q6A A;  3B8N A;  1GN2 A;  2YUA A;  4I9W A;  4Z1M G;  5L3D A;  5JH7 B;  3CCQ V;  4X88 A;  1PD3 A;  3K06 A;  4JAV A;  4DV4 B;  2DE0 X;  1GN4 A;  3OR7 C;  2YSU B;  1VF5 B;  3P32 A;  4JI7 B;  3QO8 A;  4DRX A;  5LHG A;  1JVM A;  2XND G;  3L71 H;  3AG1 B;  1BSM A;  3LSS A;  1VQO V;  4YJ3 B;  1X4T A;  1VIB A;  3T1H O;  3K03 A;  1MZF A;  4JV5 O;  1H2K A;  4DR4 B;  1SQP H;  2Y4U A;  3FB8 C;  2PY5 A;  3LDE A;  3U0Z A;  1OCO B;  1PNK A;  1R6T A;  2VQE O;  1WJZ A;  4LFC B;  3CRM A;  4DV0 O;  4QGP A;  1VMG A;  2EIL C;  4FFB B;  1JR9 A;  4I50 B;  3ZRS A;  3AG3 C;  3CE2 A;  3G6B A;  4QIW F;  1ROP A;  3PN1 A;  5H5N A;  1EZV H;  1S77 D;  3K5M A;  3RYI A;  4U7N A;  1I5X A;  4WCE V;  3R66 A;  1IXB A;  1JFF A;  1SQB H;  1VQN V;  5JJE B;  3ZRV A;  2XAQ A;  3JAR A;  1R3L C;  4X65 B;  2OWO A;  3GWO A;  2D3O W;  1VQM V;  2NN4 A;  5B1B B;  4DR1 O;  3BA9 A;  4PDM A;  1GMG A;  5BXZ A;  1KUQ A;  1Q90 D;  3NXS A;  2PYL A;  2W6I G;  5B1N A;  1B3Q A;  1R6N A;  1HP8 A;  1EN6 A;  4NB5 A;  2ZIN A;  4NXN O;  2OTL V;  3QVN A;  1PPJ H;  4UB8 Z;  3T4Z A;  4FLW A;  1Y76 A;  4FM0 A;  4CH5 A;  5CA1 B;  2YIA A;  2PI5 A;  1VF7 A;  4OX9 O;  2XOK G;  5LMN O;  4D6T H;  5LBQ A;  5B1O A;  2IH3 C;  4XDL A;  4LF4 O;  1R6K A;  2E5L B;  5LL6 Y;  1OCR C;  4B7K A;  1KU9 A;  4X66 O;  1W0J G;  4LWS A;  4DR2 B;  3B8M A;  1M4U A;  4TT3 G;  2ZIM A;  1K4D C;  4LF8 O;  3OMA B;  1NKD A;  1RFY A;  4JI5 B;  1JJO A;  3RFR A;  1H2M A;  4CS2 A;  3ABM C;  2JS3 A;  1E1R G;  3T1Y O;  2NLJ C;  1M56 B;  1V55 C;  1NI8 A;  3CMA V;  2A79 B;  3ASO B;  1US6 A;  1FXK B;  2RN9 A;  4DUY O;  5J9P C;  1BE3 H;  2EIK B;  3K9S A;  4PDV A;  3KKY A;  5EC2 C;  4B3M O;  4XBF A;  3RVY A;  2F4V O;  3ZMS A;  1TVK B;  3CEI A;  1IUR A;  4B3S B;  2Z0A A;  2IJH A;  1GN3 A;  4KXR A;  3BAA A;  5LOV B;  3H01 A;  1JX9 A;  1FFT B;  1R73 A;  3O65 A;  5KX5 A;  5LYJ B;  1TGO A;  1PP9 H;  2UXC O;  3APO A;  3ZMV A;  3CRR A;  3L74 H;  5E79 Z;  4PI0 A;  1HR0 B;  4H33 A;  1BT8 A;  3ETE A;  4F6E A;  3D36 C;  2UU9 B;  2WPD G;  2FTK A;  1XI1 A;  3ZMT A;  2L35 A;  3CME V;  1RP3 B;  4P9O A;  3NR7 A;  1JA8 A;  4JGS A;  4O2A B;  2CUG A;  5JVD B;  3W7T A;  4JI8 B;  1IBM O;  5JQG B;  2GDS A;  3OE7 G;  4FPP A;  1K4C C;  5LP6 B;  2OCH A;  2QR4 A;  3K0G A;  4X1Y B;  3E8G A;  1SA0 B;  1SQG A;  1AP6 A;  2W0X A;  5CBG A;  4H13 B;  1CP9 A;  4I0X B;  4AIL C;  4JI1 O;  1WA8 B;  2BSK B;  3RT3 C;  1DTO A;  3SPC A;  2WLM A;  4O4I B;  3FYE B;  2UUC O;  2B5U A;  2IW5 A;  2QWQ B;  2Q0O C;  2X7R B;  3D8C A;  2LO1 A;  3H1K H;  2R70 A;  1F23 A;  4L87 A;  4UCR A;  4G28 B;  1DK1 A;  4QJF B;  2KQX A;  1DLB A;  3LNN A;  3CP1 A;  5B1A C;  1HDJ A;  1IZ3 A;  1P49 A;  4CH6 A;  3CCJ V;  5GON B;  1DGS A;  3CJH A;  1SQV H;  1NH2 B;  5TIS Z;  1XMQ O;  5IWA B;  3CCE V;  1XHX A;  4YIP A;  4YJ2 B;  1M90 W;  3CCS V;  3SYO A;  2YI8 A;  2QM8 A;  1N32 O;  1VAR A;  3BFR A;  5H9C A;  1QHT A;  3I55 V;  3DGE A;  3H1H H;  4F6R A;  5LXT A;  4JAS A;  3GVM A;  3BPZ A;  4PI2 A;  4LNU A;  1FJG B;  2UXB O;  1V9P A;  3SR2 C;  2PUS A;  5CN0 A;  4P2Z A;  2H94 A;  2D2C B;  2JGD B;  5ITZ A;  1G1X B;  5C8Y A;  4DRX B;  4DV4 O;  3SPH A;  1W59 A;  3ZHS A;  5LGU A;  1H2N A;  1COW G;  3FFQ A;  1AI6 A;  1JMK C;  2VS0 A;  2VWJ A;  3OW2 U;  3CXC U;  4DV1 O;  4BAY A;  4JYC A;  1GM9 A;  4FZ1 A;  4ICG A;  1NBM G;  4CBC A;  3E89 A;  5BZB A;  4FLT A;  4P30 A;  4DR4 O;  1K34 A;  3C90 A;  1KKC A;  2B1I A;  3CCR V;  5CMU A;  5JCO C;  1KBH A;  2YC0 A;  1Q3E A;  1QR8 A;  1TUB A;  4LF7 O;  3ZN1 A;  3DC5 A;  1JCH A;  3AG7 A;  2PTM A;  5B3S C;  1BS3 A;  2EIN C;  4PHZ A;  4DO2 A;  4K8Z A;  5IYD O;  4UUJ C;  3VQX A;  4KFM A;  1NH2 D;  5BY1 A;  5H2F Z;  2LJ2 A;  1AI5 A;  2RDC A;  1OJH A;  1AJN A;  5IJ0 B;  5HFM A;  2L6L A;  4UVB A;  3JAL A;  5K1X A;  1Q5O A;  3BA8 A;  2QDO A;  2ZXW C;  1KMI Z;  3L73 H;  1K3E A;  1HW7 A;  1PV0 A;  1YJW V;  3BAB A;  4JI5 O;  1TUE B;  2HVJ C;  2N05 A;  2P67 A;  4NKG B;  1MA1 A;  3ZS8 C;  3ZMZ A;  1NU1 H;  3VQV A;  1MNG A;  3AEI A;  3UT5 B;  3G80 A;  5A2Q N;  4MW8 A;  1ZAU A;  4I55 B;  1Y76 B;  3ZCC A;  2LGQ A;  4NXN B;  2ZKO A;  1YXB A;  5IYZ B;  1KYO F;  3A2F A;  4B3M B;  4AHC A;  3JD2 A;  4EB6 A;  4O4H A;  5IDJ A;  4B3S O;  2F23 A;  4X1K B;  1Z5W A;  4YXW G;  1N0N A;  2DW4 A;  4AQY O;  4JYB A;  1QLE C;  3RYF A;  2RQ6 A;  3FB5 C;  4IYI A;  2IBZ H;  4FLY A;  1UJW B;  4LFA B;  2AZ0 A;  3CC2 V;  1FFX B;  3JD4 A;  1MSD A;  2HVK C;  2WLH A;  2F43 G;  1I5Y A;  2MK3 A;  3ASO C;  1SQX H;  4DV2 B;  3EXA A;  1QU7 A;  4LF5 O;  1R3I C;  1N36 B;  4F4L A;  3JAK A;  1M9N A;  2ETN A;  3L70 H;  2Y4T A;  1DF5 A;  2OTJ V;  4JPR A;  2OYQ A;  3ZHU A;  4MS2 A;  3CHX A;  1Q8I A;  1XNR B;  4JAU A;  3K59 A;  2F4V B;  3DSQ A;  4ZKI A;  5LOV A;  4DR5 O;  4YIO A;  1ZLZ A;  5C93 A;  1BMF G;  4MW3 A;  2FYU H;  1KEC A;  3E8F A;  2Y0I A;  4PA4 A;  3HPL C;  3WG7 B;  5JCO A;  1AR1 B;  1FS0 G;  1D5N A;  3E86 A;  3SPI A;  1IXM A;  3ZED A;  2EIM C;  2WLI A;  3ZHQ A;  4D7T A;  1EN5 A;  1VF6 A;  3QG5 A;  1S0V A;  3CX5 F;  3CYO A;  2YXY A;  2EIL B;  4IHJ B;  4O2A A;  5JVD A;  2DYR C;  4RQF A;  1FXV A;  2JVD A;  1F4M A;  5JJJ B;  5IYC O;  2BTQ A;  4JTD B;  1RM1 C;  1YJN V;  4OGQ B;  2KSD A;  4MVU A;  5LP6 A;  1ZUQ A;  3W7U A;  5LGT A;  4GX2 A;  1H2G A;  1N0J A;  4O4L A;  1N8R W;  3ZRX A;  4TOI A;  3BHP A;  4UCS A;  1LR1 A;  3E35 A;  2EJR A;  4MVM A;  4LBE C;  2BTO A;  4FLV A;  1HNZ B;  4DV7 B;  3AK2 A;  1XNQ O;  4J41 A;  4DR7 O;  2F95 B;  3M8A A;  2UUB B;  4B3R O;  4DV1 B;  4NYK A;  4QNH B;  4ABM A;  4DV5 B;  3X2Q C;  1O9G A;  1XUQ A;  4WFB V;  2ARH A;  2KKW A;  4UCV A;  2P4V A;  3RN4 A;  5IWA O;  3E22 A;  3I56 V;  4WFA V;  5CA1 A;  2E75 B;  1F4N A;  3K57 A;  2Y69 C;  1N32 B;  4J11 A;  1XRE A;  4CH3 A;  5EK0 A;  4LH6 A;  2Q68 A;  2JGD A;  1GKF A;  2GBO A;  5LA6 B;  4D7S A;  4LWS B;  4QE9 A;  4DR3 B;  3SJQ C;  4U3F H;  3OMI B;  3FYI B;  3CPW U;  3I5D A;  3Q4H B;  1I94 B;  1EN4 A;  4DV3 B;  5EZY A;  5D5P A;  5LMU O;  2X0L A;  4DUZ O;  2HG5 C;  3TXQ A;  2JEU A;  4LFB B;  2Y0P A;  4JI3 O;  3B09 A;  4BIZ A;  2CTQ A;  5J2U A;  4JYA O;  4MVS A;  3JAW B;  3VOU A;  2Q0A A;  3CCL V;  4RO2 A;  4BR6 A;  4HNA B;  4J80 A;  5B3S B;  4CS4 A;  2LP7 A;  3CCM V;  2LFR A;  3A0R A;  3BVO A;  4CC5 A;  2CK3 G;  2H8P C;  4JI2 B;  4IIJ B;  1XMO O;  1W2B U;  3AG3 B;  2CDY A;  1Y66 A;  3RYH A;  1W0K G;  1H8E G;  4GYC B;  2PI4 A;  2Z3Y A;  1FXK C;  4OX9 B;  4MVO A;  4K35 A;  4TUY A;  2W6J G;  1OZ0 A;  1SF9 A;  3F5W C;  2DWE C;  2JJ2 G;  1PNL A;  3JAT B;  4NVP A;  2JGU A;  3WG7 C;  2IJJ A;  1IBK O;  4ZI7 B;  4TV9 B;  3QF7 A;  4GKK B;  3SPJ A;  2GTS A;  5B1B C;  3ZRW A;  1K33 A;  2KG7 B;  3SJB C;  4B08 A;  2R9I A;  1NQT A;  3THO A;  2H3O A;  1WB8 A;  1Q43 A;  1Z2G A;  4X62 B;  3E83 A;  1NTZ H;  2UXN A;  2JDI G;  4EB6 B;  3EFF K;  3SPG A;  1XNR O;  5EBL C;  3OEH G;  1V54 C;  4R50 A;  2YXL A;  1CXZ B;  1ENV A;  2ZR3 A;  4GX5 A;  3K79 A;  3FAV A;  3OFN G;  2XAJ A;  1M56 C;  2YEV B;  4CC6 A;  2Q69 A;  2ZNI A;  2K9P A;  2NNU A;  4X1I A;  4HYO A;  3JD0 A;  1YI2 V;  1DF4 A;  3ETQ A;  3K0D A;  2QKS A;  2EX3 A;  4J7Z A;  5CA0 A;  4DV2 O;  3OMN B;  5GON A;  3DXR A;  2JK5 C;  1RM1 B;  1NS1 A;  4J42 A;  1Y4M A;  1KP2 A;  1K92 A;  3FD9 A;  3ZHR A;  4NXM B;  1AJQ A;  1G4Y B;  2N04 A;  2HJD A;  1WP8 A;  3ASN B;  3HKB A;  3HKC B;  1VQK V;  1HWY A;  3LSU A;  1SQQ H;  3TXS A;  4OPA A;  1H8H G;  3L72 H;  3L75 H;  3TCU A;  2Q9L A;  4DR5 B;  1IBM B;  1OHH G;  2E74 B;  2EJ7 A;  1OCC B;  4PD4 F;  3SYP A;  3E2E A;  5BR8 O;  1QVG U;  1E1Q G;  5KAF Z;  4WBN B;  1OCZ C;  5H6R A;  2EIN B;  1AR5 A;  4O2B B;  2Q4P A;  4P9P A;  1U96 A;  1YTF D;  4Q6G A;  4TQF A;  2WLI B;  4JI1 B;  2CE4 A;  2P5O A;  3LUT B;  4KUM A;  2M6Y A;  1WNS A;  4B3R B;  1MZE A;  3JSL A;  1M93 A;  1TUB B;  3WU2 Z;  5KHK A;  5KHG A;  2O57 A;  3ML0 A;  4J7J A;  4GKK O;  1WN7 A;  5EYP A;  2R9A A;  3IJ4 A;  2A9H A;  1LUW A;  1NTK H;  4NTY A;  4X8A A;  1QQC A;  4O4L B;  2Z5U A;  4JI0 O;  2R9R B;  5L3F A;  4DV0 B;  1GN6 A;  2EIJ C;  3W7W A;  1FYJ A;  2XTA A;  3OT7 A;  2BE3 A;  4DXW A;  2WA3 A;  5J2T A;  3SYC A;  3CC4 V;  5E1A C;  5EC1 C;  4DV7 O;  2HJF C;  5LMU B;  5FPO A;  3U10 A;  4BIO A;  2ITD C;  1XNQ B;  1Q6U A;  4IT5 A;  3RYC A;  1K73 W;  1LNQ A;  3CRQ A;  4FK5 C;  1QCE A;  5F2V O;  4J7K A;  1YCI A;  1V55 B;  1BCC H;  3JSN A;  1XL4 A;  2C2A A;  1EZJ A;  2Q73 A;  4FMT A;  4UFZ A;  4HAM A;  2ZNJ A;  1M57 C;  1N33 B;  4KP4 A;  3D36 A;  3UO2 A;  2EIJ B;  2PF4 E;  1QBZ A;  2BCC H;  4I50 A;  3AG4 B;  3AG2 C;  2HEP A;  4MTF A;  3B4S A;  2ADP A;  2DQ0 A;  1XMO B;  3RYF B;  4RAI A;  4FM2 A;  4LF7 B;  5KHI A;  4MVQ A;  2WLN A;  1T5E A;  3J81 N;  2LQT A;  1G8M A;  1AJP A;  1NTM H;  1PM9 A;  4DUZ B;  5JJN B;  1VEW A;  3QNE A;  1SZT A;  1TAE A;  2FL4 A;  3ZHV A;  2UXD O;  4JI3 B;  4FFB A;  2OCC B;  3UM7 A;  4LF8 B;  3O9O A;  1EBO A;  4CZZ A;  3JAS B;  2RJZ A;  1MMM A;  4RQE A;  2PZS A;  3STZ C;  4IIJ A;  1JFF B;  4DR6 B;  2NR5 A;  2P06 A;  3KCX A;  1RPO A;  2ZDI C;  2AW9 A;  3RYH B;  4X62 O;  3R65 A;  5L3G A;  2B1G A;  2ZE7 A;  5DN6 G;  2CH7 B;  1I0H A;  4DW0 A;  1Y74 A;  4TV8 B;  1B04 A;  1Q6H A;  4I4T B;  4MTG A;  2IJI A;  3JD3 A;  3OAA G;  4IHJ A;  4AQY B;  1SER A;  2CTP A;  2Q7E A;  2X6B A;  1IBK B;  2BTQ B;  1Q86 W;  2UU9 O;  2XHB A;  1XEQ A;  3A8T A;  2ZDI A;  2F1M A;  2YIB A;  1N4C A;  1V54 B;  2PYJ A;  3M99 B;  3TK1 A;  1IDS A;  2WWW A;  2AHZ A;  2VRZ A;  2ILM A;  2HFE C;  3WB0 A;  4N23 A;  3N2G B;  4JI6 B;  2EZO A;  2GUZ B;  1ORQ C;  4K0K O;  2BOB C;  4X20 B;  1PNM A;  3D3Q A;  4EFB A;  2AXT Z;  4B3T O;  2QKA A;  3JYC A;  1AVM A;  3ZX6 A;  2LW7 A;  2OIG A;  5KX5 B;  3K3W A;  2BOC C;  4LH7 A;  5CB4 B;  3OTF A;  1FXH A;  3IFX A;  1O9H A;  4X1I B;  5EBW C;  3RBZ A;  1Y6X A;  4N21 A;  3X2Q B;  4JZ2 A;  2IM9 A;  1XOU A;  2ZM6 O;  4YJ3 A;  2CGN A;  3EHB B;  1KD1 W;  1P7B A;  1SS3 A;  1TVK A;  3K5O A;  3QO7 A;  2ATK C;  1J95 A;  2ZD9 A;  4R6Z A;  1KB9 F;  1S72 V;  1AI7 A;  4X89 A;  4JTC B;  5JH7 A;  1EM1 A;  1R3J C;  1WLE A;  3HKE B;  4FVM A;  4MVR A;  4ZHQ B;  4PDL A;  4DYL A;  1NR1 A;  3MD0 A;  4YHH B;  1XMQ B;  5LA6 A;  3RWR D;  1SKV A;  2Q7H A;  1YDX A;  2Y69 B;  4X1Y A;  3OUS A;  4QPJ A;  4WBN A;  4H0L B;  3ABL C;  2LFS A;  5EZY B;  3SJA C;  3L9D A;  1Q82 W;  3S3W A;  4DK1 A;  5CA3 A;  1K8A W;  1FJG O;  1EFR G;  3G67 A;  1QLN A;  3ZIA G;  3IGA C;  1R1B A;  5GTH Z;  4Q20 A;  1SES A;  1KKD A;  2V4D A;  1AB3 A;  1S3J A;  3SGI A;  3WFV A;  1JQ0 A;  2P6J A;  4FIP C;  1UFI A;  4GLX A;  2DYR B;  2BSK A;  1YJ9 V;  2ZR2 A;  2P22 C;  3H9V A;  1ZWI C;  2IH1 C;  3D3I A;  2IJK A;  3ZBH A;  4LR3 A;  2QWN B;  2QGN A;  4LNU B;  5LGN A;  5HFL A;  3CSX A;  3A0H Z;  1SZX A;  1XBL A;  4LFC O;  3ETD A;  1NR7 A;  1S5L Z;  1THZ A;  3F5T A;  3ZHT A;  2E76 B;  4LC1 A;  4TWK A;  1K5Q A;  5KUM A;  1N34 B;  3OD4 A;  3T1C A;  1BZK A;  1A32 A;  4X9Q A;  5L3B A;  5KAI Z;  2LGW A;  3ZRW B;  3N2K A;  4U3J A;  2KG7 A;  3N27 A;  3LNM B;  4K3A A;  1HNX O;  4LFB O;  2PGG A;  4UCO A;  2QWR B;  2CTR A;  2Q7G A;  5FNV B;  3CC7 V;  3W7X A;  2YS8 A;  3FB7 C;  2HKO A;  1M1K W;  3SYA A;  1YVW A;  2GHY A;  2DWD C;  3HKD A;  4NTX A;  4DR6 O;  3K5L A;  3FAV B;  4LP8 A;  3RGB A;  1S5H C;  4KHP O;  4NR1 A;  2YEV A;  2WLJ A;  1BL8 A;  4GX1 A;  2ZQM A;  5LYJ A;  2AGA A;  3G4S V;  1GH6 A;  3CS5 A;  4JI2 O;  5IJ0 A;  3CB2 A;  2OIE A;  1D2D A;  1P7G A;  1I7F A;  1WP7 A;  4WFF A;  1IX9 A;  3JAM N;  3DXR B;  1M57 B;  2UXD B;  2Y48 A;  4ZIB A;  3ABK C;  4FLX A;  1E79 G;  1AIL A;  4MT8 A;  1CEZ A;  3K9A A;  1ARO P;  2VQF O;  1SQF A;  4GZR B;  1ZL8 B;  3B77 A;  4JAA A;  1QVF U;  1RSO A;  5L3C A;  5IJ9 B;  3HKB B;  2GTA A;  3F7Y C;  5JQG A;  1OCC C;  3OGC C;  4DW1 A;  5KUK A;  4JI4 O;  4I55 A;  1MAB G;  4MTO A;  3VQW A;  5GW7 A;  5D5Q A;  3T1Y B;  3SJC C;  3ICX A;  2WAM A;  2EIM B;  5EIB D;  5KA5 A;  4O4J A;  4GCZ A;  4MSW C;  1BQ0 A;  5H6Q A;  4EFE A;  1XHZ A;  4G27 B;  3UQ8 A;  4I4T A;  4LF6 B;  3KG2 A;  2XUM A;  2QM4 A;  1Q81 W;  1H38 A;  5IYZ A;  1NJI W;  3KZI Z;  2QEX V;  1VQ6 V;  1HNW O;  1BGY H;  4E2L A;  4FZ0 A;  3STL C;  1WA8 A;  3MAQ A;  2UXX A;  2JEX A;  3CXH F;  5IY5 B;  1GM7 A;  2ZCE A;  5CBF A;  4WF9 V;  4ZBM A;  1PKX A;  2WLL A;  3DTU B;  3GB7 C;  5FL7 G;  4JI6 O;  4OPH A;  4X20 A;  4E4E A;  3G6E V;  5J2T B;  5L3E A;  3IC9 A;  3H1L H;  2XAF A;  4W4K A;  3K58 A;  4B3T B;  3CJH B;  1GO3 F;  1FKA O;  3TGU H;  4A5U B;  3RYC B;  2EIK C;  5BMV B;  5CBH A;  2QKC A;  4YJ2 A;  1BHB A;  3HB3 B;  2DN9 A;  3ZMU A;  3J80 N;  4J9Y B;  4FM1 A;  2RMK B;  2ZT9 B;  5LXT B;  4JI7 O;  5EIB C;  1JPX A;  4DR7 B;  3HKE A;  3E8H A;  4DV6 O;  2YID A;  5GTI Z;  5ITZ B;  4ZHQ A;  3T1H B;  1OV9 A;  4GX0 A;  2B9Z A;  3ABL B;  2M7W A;  5FLX N;  1RPR A;  2YI9 A;  3VBB A;  3FB6 C;  4YHH O;  2XT9 A;  1VQL V;  1IVS A;  2ADQ B;  2F66 C;  4ZOL B;  4HZ3 A;  3TJT A;  4PJ0 Z;  4XDJ A;  4JI0 B;  2WLK A;  5AG2 A;  3MHS C;  4C7U A;  2CAZ C;  4LF9 B;  1M5I A;  1I94 O;  4H37 A;  3OEE G;  4PA3 A;  5LHH A;  2EUL A;  3JAS A;  4Z1V A;  1CPY A;  1YIT V;  2XAH A;  5JWP A;  3CCU V;  1URF A;  2QWO B;  3ABK B;  4X65 O;  1KC8 W;  3SDL A;  3E22 B;  5IYB O;  3ASN C;  3PJS K;  4Z2W A;  2WSS G;  1BHA A;  2LW1 A;  2QTO A;  5EBM C;  3GWK C;  1QNM A;  1B06 A;  2FML A;  3SYQ A;  1X59 A;  3H1I H;  1GAX A;  3WB2 A;  5KLV H;  1Y74 B;  1N33 O;  1AP5 A;  4TV8 A;  1YEW A;  2AHY A;  3UO3 A;  1VF6 C;  2ZE8 A;  3VQY A;  1K97 A;  4RUF A;  3Q4H A;  4XDK A;  4X64 B;  1FFX A;  2P4K A;  4JZG A;  3MHH C;  2HP8 A;  1P84 F;  3JAK B;  4X66 B;  5LP6 C;  4O4H B;  3CRA A;  1I08 A;  4X1K A;  1HNX B;  3MDS A;  2RCV A;  3FX7 A;  2ODM A;  2DYS B;  4UCU A;  3M7M X;  5KMG A;  4J9Z B; 
#chains in the Genus database with same CATH homology
 4B3S O;  4DR2 O;  5FLX N;  4YY3 O;  1HR0 O;  4AQY O;  3R66 A;  5BR8 O;  4YHH O;  1G1X B;  2UXC O;  4K0K O;  4DV4 O;  4B3T O;  2LW7 A;  4LFC O;  3J81 N;  4NXM O;  3F5T A;  1XNQ O;  4GKJ O;  4DV1 O;  4DR1 O;  4DR7 O;  4LF5 O;  5BXZ A;  2ZM6 O;  3M8A A;  2UXD O;  1IBL O;  4JI8 O;  4B3R O;  1KUQ A;  1I94 O;  4DR4 O;  1IBK O;  2DOS A;  1A32 A;  1IBM O;  4LF9 O;  2JRI A;  4NXN O;  4LF7 O;  1HNW O;  5IWA O;  1HNX O;  4LFB O;  1HNZ O;  4LFA O;  2HHH O;  2DJV A;  4X65 O;  4OX9 O;  5LMN O;  4DR5 O;  1J5E O;  3SDL A;  1XNR O;  4JI1 O;  4JI0 O;  4LF4 O;  2UUA O;  5LL6 Y;  3RT3 C;  5BY1 A;  1N36 O;  4X62 O;  2FKX A;  2UUC O;  4DR6 O;  4X66 O;  4JI6 O;  2UUB O;  4OPH A;  1FYJ A;  1X59 A;  4KHP O;  4DV5 O;  4LF8 O;  1N33 O;  5LMU O;  2AGA A;  4DUZ O;  1DK1 A;  1FJG O;  4DV7 O;  3T1H O;  4JI2 O;  5IT9 N;  4JI3 O;  1FKA O;  1YZB A;  3T1Y O;  3J7A U;  4JI5 O;  4A5U B;  1D2D A;  4JV5 O;  1R1B A;  3JAM N;  4DV2 O;  4LF6 O;  4JYA O;  3OTO O;  1NS1 A;  4X64 O;  1R6T A;  2VQE O;  1AB3 A;  3J80 N;  4DUY O;  1XMQ O;  1AIL A;  1F7Y A;  4DV0 O;  5A2Q N;  2UU9 O;  2VQF O;  1XEQ A;  4JI7 O;  4DR3 O;  4B3M O;  2F4V O;  2N74 A;  2ZKO A;  5H5N A;  1N32 O;  4DV6 O;  2Z0A A;  4DV3 O;  1N34 O;  4OPA A;  2E5L O;  1XMO O;  3O65 A;  4JI4 O;  4GKK O;  2UXB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...