3OTOO

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3otoO00
1DK1A 3F5TA 4JYAO 1I94O 1D2DA 1NS1A 4DV6O 5LMUO 1XEQA 4LF9O 4DR2O 4DR1O 1YZBA 1HNWO 4DR6O 4K0KO 1IBKO 4DR5O 1HNXO 3SDLA 2HHHO 1XNQO 3R66A 4JI0O 5IWAO 4DR3O 4JI4O 4JV5O 4JI6O 4YHHO 1N34O 5BR8O 4X64O 4OX9O 1A32A 1AB3A 4B3MO 2ZM6O 2Z0AA 1J5EO 4GKJO 1N36O 4JI1O 4LFBO 4JI2O 3J81N 3O65A 1R6TA 1XMQO 4A5UB 2UXDO 4JI7O 4DR7O 1AILA 4LFCO 4B3SO 2DJVA 3M8AA 3JAMN 3J7AU 5BXZA 1HNZO 4JI5O 4DV4O 4OPHA 2UUCO 4DV2O 4GKKO 4LF7O 4X66O 4DV5O 3J80N 1F7YA 2UXCO 1N33O 4LF5O 3T1YO 4JI3O 5LMNO 4LF8O 2AGAA 4X62O 2LW7A 1HR0O 4DV7O 3OTOO 2VQFO 4NXMO 1N32O 4AQYO 3T1HO 2F4VO 4DR4O 4NXNO 1FYJA 1IBLO 1IBMO 2ZKOA 5LL6Y 5IT9N 5A2QN 4JI8O 5H5NA 2FKXA 2N74A 1R1BA 4YY3O 1XMOO 1G1XB 2UXBO 4DUYO 2UUAO 4X65O 4LFAO 1FKAO 4KHPO 1FJGO 5FLXN 2JRIA 1KUQA 2UU9O 1XNRO 4B3TO 2VQEO 4DV3O 2UUBO 2DOSA 4DV1O 4OPAA 4DV0O 4LF4O 4LF6O 1X59A 4DUZO 2E5LO 4B3RO 3RT3C 5BY1A
chains in the Genus database with same CATH superfamily
4HNAB 3AG7A 4QPKA 1FFTB 4BW9A 1CEZA 1KECA 1GM8A 3P3NA 4GCZA 2YI8A 2EILC 1XUQA 4DR2O 4JTCB 1TVKA 2UXNA 4H0LB 2GDSA 1SZXA 5HFLA 1S76D 3VBBA 3GVMA 2DYRC 1P7GA 3RYFA 4DR1B 2XT9A 1FXKC 1WB8A 4JI0O 3H1KH 2KG7B 3CCVV 3E8GA 1M1KW 3A0BZ 1PNMA 2CE4A 1N0NA 4JI4B 1VQLV 1DF4A 3HKBB 2R70A 3L9DA 1NH2D 3RVYA 1XOUA 1GKFA 2AHZA 1H2MA 2DN9A 3ZRWA 4ZHQA 1XMQB 3ZHQA 4TT3G 4QE7A 2RQ6A 4I50A 3TK1A 3ZRVA 3DGEA 3HPLC 2CUGA 2C2AA 2IJIA 5JCOA 1VP7A 5BMVA 2UUCB 1N34B 3ZMZA 2ETNA 4D6TH 3Q4HB 4HZ3A 4LF8B 2DYSB 3ABKC 2LW1A 3P30A 1QR9A 1EZVH 3ABLB 1M57C 2AW9A 4DV7B 1WP8A 5IE9A 3LNMB 4YJ3A 4PDRA 4WF9V 2N74A 4YY3O 1H2KA 3FX7A 3HB3B 2OIGA 5J2UA 1SF9A 2UXBB 3TGUH 2ATKC 1GO3F 3LUTB 4DXWA 1XI1A 2UUBO 4BW5A 4J7ZA 2A9HA 3FB7C 4X1IB 5LHIA 5C8YA 2GBOA 2LJ2A 4LF4B 2O57A 4UCUA 1ZL8A 3FKSG 4FLYA 1BQZA 1ZLZA 1ZAUA 4NTXA 2F93B 4FMTA 4DR2B 1BHAA 4I9QA 1B6QA 1QR8A 4DR5O 2HP8A 2DQ0A 2R9AA 4N21A 2JEUA 4NKGB 1NVPD 2ZE8A 3IGAC 4JI0B 3RYCA 4PDMA 2ZE5A 1R6TA 5FNVB 2P7TC 3AG1B 3E35A 1TGOA 1VQMV 2ZIMA 1VQ7V 4DR7O 1Q3EA 2QSAA 3M8AA 4ICGA 5B1AC 5CA3A 1WAZA 4JYYA 4I5SA 4LH6A 2WWWA 1NU1H 1TVKB 4RQEA 2W0XA 4GLXA 4OPHA 1M90W 2ZE6A 1ZX3A 4KUMA 1EN4A 4JI3O 3RYFB 5LMNO 2CGOA 1GN4A 3ZHVA 1AI5A 4RWUA 4U3FH 4EFEA 3OEHG 3W7WA 1MNGA 5JWPA 4UCVA 5IJ9A 3W7TA 4G2KA 2KQXA 3ZRWB 4ZHQB 3AG4C 3SPIA 3CPWU 4G28B 4GZRB 4I50B 1M56B 4YY3B 1YJ9V 3IC7A 2JRIA 1WPBA 5CBHA 1MSWD 1NT2B 5BMVB 1WLEA 4PA7A 4B3RO 2UUBB 3L75H 2QJ1A 2OWOA 3QVNA 1DK1A 3F5TA 5FL7G 4JYAO 2LFSA 5J2TA 3L73H 2Q73A 4DO2A 4YJ3B 3M7MX 1YZBA 2V4DA 2PYJA 3A0RA 3C90A 5J2UB 3TCUA 1PNKA 2OIEA 3R66A 2RJZA 3AG2C 4CC6A 4DR5B 3JASA 2QA4V 2GV9A 5LXTA 4DW1A 4MVUA 4B3MO 3E22A 4JI2O 4F6EA 2YI9A 5C8YB 3N2GA 3ZN0A 4CS4A 1SC5B 4J9ZB 4DRXA 4LFCO 1ZL8B 3L74H 3OTFA 4U7NA 1JOYA 4IHJA 1R6KA 4DR7B 4XDJA 2JS5A 4PA4A 4DV4O 5B3SC 3APQA 1HW7A 2EJRA 1W2BU 3ZRXA 1IXMA 2AZ0A 1YVWA 4FFBA 3WG7C 4MVOA 2AGAA 3B4SA 1QBZA 4X62O 3G6EV 4F6RA 4JI3B 2VQFO 1S5JA 5LMNB 1FXHA 1Q8IA 2IJKA 3OUSA 3RYCB 2RDCA 2LGWA 1V54C 3CRMA 2Q9LA 5CBFA 4PV1B 4FZ0A 3ASOC 2JEXA 2JGDA 1AI4A 2HEPA 4UCSA 1R3LC 2B1IA 5IYCO 2E75B 3FAVA 1CP9A 4CBCA 1B04A 1Q5OA 2V1DA 1XILA 1K8AW 3ABMB 1YITV 3GB7C 3JSLA 3M99B 4FLZA 1W59A 1LNQA 1FS0G 1MA1A 4PA3A 3SJAC 2BCCH 2CTWA 4B3RB 1NR1A 2HJDA 3X2QC 5IJ9B 1SA0A 2CDYA 2LO1A 2Q6AA 3UM7A 4JYAB 3DTUB 4GYCB 4CH4A 3OR6C 2IU3A 2BOBC 2B9ZA 1FJGB 1YDXA 2HKOA 1F4NA 2OTJV 2F66C 5IWAO 1Q90D 4XDKA 4NVPA 1VARA 1N36O 3CWBH 4MT8A 3ASNC 4B3MB 3K58A 4A5UB 4JI2B 2Y0IA 3E2EA 4B7KA 1KP2A 1YHQV 1KBHA 2VWJA 4CS3A 3QG5A 4LFCB 2HR3A 2BTQA 3K3WA 3K06A 4JI5O 4EFBA 2PUSA 3FB6C 1BHBA 3K5NA 1YI2V 4GKKO 3K5MA 2OCCB 4DV4B 3AG3C 4FLXA 5LGNA 3SYAA 1AR5A 2UXXA 1URFA 1YJNV 3KZIZ 1GH6A 3JASB 5KX5A 4NXMO 4ZI7A 4X62B 5LXTB 1Z5VA 3B2EE 4DK0A 2GUZA 3E22B 1KB9F 2VQFB 3UKMA 2WPDG 3OW2U 5KUKA 3N2GB 3LNNA 2NNUA 1G8MA 4X1KA 4DRXB 4O4HA 1Q81W 1F4MA 1KP3A 4X1YB 3D36A 1V55B 1QLEC 2WLMA 4IHJB 4TWKA 3HKEA 3BY6A 3EXAA 1Y67A 4KP4A 3L72H 4J41A 5EBLC 1AI6A 1I7FA 4H44B 2OCHA 1U97A 1Y74A 3CSXA 4FFBB 5JH7A 1KC8W 2QWPB 2EINC 4TQFA 4NYKA 1D2DA 5L3EA 1QVGU 1KU9A 1GRJA 2ZIOA 1XQ8A 3A8TA 1SERA 2JGDB 4ZOLA 3SPGA 1THZA 4RQFA 3RGBA 5KA6A 2JVDA 4JZGA 2F23A 3FAVB 2IM9A 4JV5O 3ZHSA 1Y76A 1PL0A 3SYCA 5JVDB 5IWAB 2EIMC 5E1AC 5D5PA 4J7KA 2CTRA 1B3QA 4WFFA 1N36B 5H6RA 2QDOA 1PV0A 1OV9A 3UT5A 4GX5A 2QKSA 3J7AU 3UO2A 1PP9H 3K04A 4UFZA 3CE2A 2QGNA 4DK1A 1JJ2U 4JI5B 2Q0AA 3ZIAG 2QWQB 3BA8A 5LP6A 3H1JH 4GKKB 5KLVH 1KKCA 1N32O 4P30A 1FXVA 3OD4A 1K97A 2JJ2G 4WFBV 1XL4A 5KA5A 5IDJA 5JJEB 1SQBH 3HR0A 4PA9A 3T2MA 1G1XB 1KKDA 1AI7A 3MAQA 1VQ8V 3H1HH 5L3FA 1VF6C 3MDSA 4H37A 3JSNA 2BTQB 4X8AA 3B09A 4FJCC 1KUQA 1HWYA 1OCCC 5B1AB 5CN0A 1AR1B 3K0GA 1ZSPA 2XTAA 5A9GA 1H2LA 3BA9A 2OTLV 5KUMA 5KX5B 3G67A 4PHZA 3T4ZA 1GK9A 2ZDIC 4ZI7B 5B1NA 2GUZB 4NTWA 3T4DA 3ZMUA 3H01A 3JYCA 4K3AA 4DV6O 1SKVA 2JK5C 4CC5A 4MS2A 3OFNG 5DECA 3S3WA 2VS0A 4X1KB 4O4HB 4K0KO 2ZNJA 4WFEA 3ZBHA 5B1BC 5EBWC 4J7JA 3ETQA 4JV5B 1Y74B 2WAMA 3CCEV 2BE3A 5L3BA 1NTKH 5JH7B 1R3KC 2AHYA 2QKCA 5EC2C 4JI7O 3JARA 5L3CA 3JATA 4B3SO 2DJVA 3SPHA 1NH2B 3FFQA 1H2NA 4UV9A 2W6IG 4UUJC 3CXHF 4ZOLB 2D2CB 3ZMVA 4DV2O 1XBLA 1R3JC 1AP6A 4TV9A 1V9PA 4DYLA 2Q69A 1P7BA 1Q6UA 1Y76B 4IIJA 1VF5B 3OGIB 3QF7A 1MZEA 2F4VO 3K5OA 1IBLO 1N32B 2LGQA 2YXHA 3AG2B 4JYCA 3RBZA 1JFFA 2F1MA 1HDJA 3CJHA 3F7VC 5IY5C 2L6LA 3UT5B 5B5EZ 2ZQMA 3OUFA 3GWKC 5LBQA 1G4YB 2XASA 3U10A 4J11A 4GX1A 4FVMA 3DC5A 4JPRA 1VMGA 2Z5UA 1VEWA 2X6CA 5LP6B 3A2FA 3CCUV 1L1FA 5B3SB 5KAFZ 3ICXA 1BZKA 5KAIZ 1NS1A 1CPYA 3SPJA 1MZFA 4RAIA 1O9GA 4MSWC 4FM2A 2Y69B 4DV6B 3QO7A 2PY5A 4PELA 2W0FC 4JZ2A 3W7XA 3ZX6A 4MW3A 3ASOB 1XNQO 2IBZH 4K0KB 3RN4A 4JI6O 2YS8A 3CRAA 1L8DA 2QR4A 1AB3A 1EBOA 3JAKA 2JJ1G 1WP7A 3AEIA 1K9MW 1YTFD 4JTDB 5H9CA 1NVPB 1AJPA 3CB2A 2Y48A 3VQVA 3WFVA 3CEIA 1QVFU 1SQPH 4JI7B 1OCOB 4MW8A 4B3SB 4XDLA 4TSFG 4FIPC 4WBNB 2IJJA 2GSMB 3X2QB 1RP3B 3JD0A 2H8PC 1P49A 4O4JA 3WB0A 2EIKB 4DV2B 3NR7A 4ZBMA 3OR7C 1DTOA 3T1HO 4L8JA 4D7SA 3L71H 4K35A 3BPZA 2Q7GA 4P9OA 5IYZA 1S77D 2F4VB 3KCXA 1IBLB 1H8EG 3JARB 3JATB 4O2BA 4Z1MG 3G4SV 3ASNB 4QGPA 2DWEC 5GTHZ 1SQFA 5D5QA 1VF7A 1IXBA 2VQEO 1GMGA 1WNSA 1VF6A 5GTIZ 1US6A 4PJ0Z 4TV9B 1YSCA 4WFGA 4IYHA 1VQ6V 3DSQA 4WFHA 3CXCU 4IIJB 3AG3B 2XAHA 3E8HA 2X6AA 1I94O 1RM1C 2QEXV 2GHYA 3K08A 1COWG 5IJ0B 2EULA 4X20A 1XEQA 2YXLA 1IDSA 1NZ6A 4FLTA 1JFFB 3CJHB 5LGTA 2PZSA 1H8HG 1Z2GA 2M6YA 4DR6O 3LSUA 5KHIA 2JDIG 2WLHA 2B5UA 1K5QA 5F2VO 5BR8O 4K8ZA 1P84F 1XNQB 3OMIB 3ZMSA 3CC7V 2A06H 4JI6B 3F7YC 4LR3A 3T1CA 1SQGA 3CYOA 4BIOA 4J9YB 2GTAA 2LFRA 2QE7G 4C7UA 1AR4A 4WCEV 2WLKA 1S72V 4MVQA 3TJTA 2FTKA 2YIAA 2ADPA 1MG1A 1X4TA 4PDLA 1SZTA 1Q7YW 4QPJA 1I08A 4LF7O 4P9PA 3T1YO 5C93A 4HYOA 1FXKA 1OCRB 2KKWA 3ZS8C 2JGUA 3OTOO 1E79G 3JAKB 3N27A 4GT1A 4X1YA 2ZT9B 3T1HB 2ZKOA 4QE9A 5IT9N 3BFRA 1ZWIC 4F4LA 3HKDA 2D3OW 3HKCA 1PL4A 1BQ0A 1OHHG 2ILMA 3WB2A 5DEDA 3PN1A 3N2KA 4LFAO 5K1XA 4MVRA 2IU0A 4X9QA 4JYBA 3CMAV 2XAFA 3CS5A 2QWNB 3ABLC 3B8MA 4O4JB 4OXSA 2EZOA 3RYIA 2VQEB 1YEWA 5EC1C 1LUWA 1I5XA 3I5DA 2R9IA 3F5WC 1IZ3A 3CCLV 5IYZB 4LF9O 1I94B 2PI5A 3K0DA 1DLBA 4LBEC 2WA3A 2DE0X 4O2BB 1RPRA 5JVDA 2NN4A 3B40A 4MTOA 1HNXO 2ZXWC 3SDLA 3AK2A 2HHHO 4DR6B 1XREA 1BGYH 2L35A 4X64O 4OX9O 1A32A 2FYUH 3CCMV 3RVZA 4NTYA 2ZM6O 1BL8A 3CRCA 4JI1O 5BR8B 3MHHC 2XNDG 3IAYA 1H2GA 1Q86W 2N05A 3EVKA 3JAMN 3LDCA 4MVMA 2RMKB 2R72A 4X20B 1LR1A 4J42A 2XAGA 3KKYA 2P6JA 3E8BA 4LF5O 3STZC 5CB4A 4MTFA 2P4KA 5EBMC 4LF7B 1LUVA 2LW7A 3T1YB 3AG1C 4Z1VA 3OTOB 1IBMO 2CH7A 3A0HZ 4LP8A 2PI4A 2EILB 2RN9A 2BOCC 3KCYA 3DXRA 3H1IH 1S0VA 1Z5WA 1Y4MA 2ZINA 4KHPO 3UQ8A 2DYRB 4B3TO 3LSSA 4LFAB 4DV3O 2MW2B 3C3SA 2YIBD 4CZZA 5E79Z 1FXKB 4FLUA 3W7UA 1Q6HA 2QM8A 5EYPA 1SQQH 1WPXA 2E76B 1M56C 4XBFA 4UCTA 3HKDB 4LF9B 3HKCB 3C3TA 5JCOC 1GAXA 3N2KB 4UCRA 4G27B 1HNXB 1VQ4V 2HHHB 2PTMA 3I56V 2Z0AA 5H6QA 4X64B 4OX9B 3RYIB 2ADQB 2ITDC 2ZM6B 4LWSB 3ABKB 4JI1B 2UXDO 2Q5ZA 1AILA 1M57B 1H2SB 1AJQA 1L0LH 4MTXA 5KHGA 3QTCA 3CC4V 4IL6Z 3ZCCA 1HNZO 1M93A 3W7SA 3BVOA 1F23A 1JCHA 1VQNV 4X88A 5FPOA 4W4LA 2AZ2A 3ML0A 2LP7A 3ZMTA 4LF5B 1QQCA 3D3IA 1GM7A 2A3QA 4JASA 3KG2A 4I4TA 4DR4O 2IH1C 1VQPV 2P4VA 1IBMB 1R1BA 1BS3A 2UUAO 3SJCC 3DC6A 4J80A 4FM1A 1L0NH 4OGQB 4WFAV 1XL6A 1NR7A 1F51A 3JALA 4YIOA 4KHPB 5CB4B 1AVMA 3MHSC 1Q43A 4NXMB 1JQ0A 4B3TB 4DUZO 5LGUA 4MVZA 4DV3B 2HVKC 2HFEC 3SYOA 2ZCEA 2AXTZ 2XAQA 2XUMA 5CA1A 5CA0A 1N4CA 1S5LZ 1S3JA 2CH7B 3FD9A 1M9NA 4Q6GA 3I55V 1RPOA 2A7WA 2QKAA 4X89A 3IFXA 3OMAB 4TUYA 4FZ1A 3ABMC 1HNWO 1EZJA 1YJWV 3DXRB 4DR3O 2JS3A 1N34O 2ITCC 2QM4A 4PA6A 4GKJO 3S3XA 1SRYA 4O2AA 3RYHA 5EYPB 2CTQA 2Y4UA 4QJFB 4WBNA 2YDEA 3BRCA 2VWKA 1PKXA 3CRQA 4UB8Z 2UXDB 3IJ4A 1JX9A 3FYEB 3CCSV 1JMKC 1MABG 5LOVB 2PGGA 4LNUA 4KFMA 3AG4B 1HNZB 1VQ5V 4X66O 2UXCO 3ZHUA 4EKWA 1BCCH 1HR0O 3CX5F 3FYIB 1ZTEA 4LH7A 1KQSU 1OCZC 4ABMA 4NXNO 3OM3B 4FLVA 4DR4B 1BSMA 1IVSA 5H5NA 1ROPA 1K5SA 3ZJZA 2HG5C 2OCCC 1TA8A 4B08A 4UVBA 2Q0OC 5L3GA 4HAMA 4Q20A 5LHHA 1R3IC 5EIBD 2UUAB 2DMXA 4N23A 1N0JA 2BTOA 4QIWF 2P90A 1PD3A 5IJ0A 1X59A 1FPOA 3VQYA 2Q68A 3P3PA 1WJZA 2WSSG 3H9VA 1EN6A 4DUZB 1RSOA 4I4TB 2A79B 2PF4E 1V55C 3LDDA 5LMUO 4CH6A 1Y6XA 5EZYB 5JJNB 2P06A 1SETA 4BAYA 4DW0A 1I0HA 4YJ2B 1GN2A 1UFIA 1HNWB 3CCQV 5CBGA 3JALB 3U0ZA 2YIDA 3SYPA 4DR3B 3WG7B 2BSKA 3BEHA 1EM1A 4ZIBA 4GKJB 3JD2A 2F95B 2DW4A 4U7OA 1RFYA 4U3JA 5CA1B 1V54B 5CA0B 3WB1A 1OJHA 5BXZA 1YTFB 1TUEB 2MK3A 1WA8A 1UJWB 4AILC 2ZR3A 3WU2Z 1DF5A 4TUYB 3RFRA 2Q7HA 3EFFK 1YXBA 4GUNA 4R6ZA 1GN6A 2Q4PA 2WA4A 1WB7A 4X66B 3R65A 5GONB 3SJBC 2UXCB 4EB6B 2HLDG 5ITZA 2ZXWB 2QTSA 2V7QG 1HR0B 2YEVA 1FYJA 5KHKA 4EEQA 4O2AB 3RYHB 3K57A 3ZHRA 1NQTA 3VQXA 4NXNB 2CGNA 5A2QN 5B66Z 1K34A 2ZNIA 3G6BA 2HVJC 1NBMG 1XMOO 4UVAA 4JTAB 1GN3A 4K8XA 1VQ9V 3OE7G 4X65O 3ZRSA 3JCUZ 3ETEA 4YIPA 4P2ZA 1QHTA 2X6BA 4LNUB 5DM6V 1VQOV 4BWAA 1D5NA 2ARHA 2DOSA 1IURA 4OPAA 4DV0O 5EK0A 1EFRG 3OGCC 4LF6O 2E5LO 5BY1A 2EIJC 5KHJA 3SGIA 2ZE7A 4PDVA 1SESA 2IW5A 3BABA 5GW7A 3LDEA 5LMUB 2P5OA 1K4CC 3O9OA 1YF2A 5LA6A 4ASUG 3E83A 1QNMA 3CC2V 4R50A 2EZPA 3ETDA 2F43G 1NTMH 4L87A 4RO2A 3K9AA 1YIJV 2M7WA 3SPCA 1NTZH 2ZDIA 1KD1W 3CP1A 1RSOB 2Q7EA 1IX9A 4GX0A 2E74B 3CRRA 3D36C 1M5IA 3E89A 2FB5A 5EIBC 2ZD9A 3P32A 5KHHA 2OT5A 3APOA 4DV5O 1Q82W 1QLEB 1N33O 2JIZG 1JPXA 2N04A 4TV8A 5B1OA 4CH5A 5H2FZ 1QLNA 3BHPA 4I7ZB 3IC9A 2RCVA 2WLNA 2YIBA 1NI8A 3ZEDA 1AROP 1JA8A 2BSKB 4ZKIA 3K59A 4GX2A 2EINB 4IGGA 2K9PA 2H3OA 4JI8O 5AG2A 1TUBA 2KSDA 3MD0A 4U3JB 3G80A 1R6NA 1XMOB 3TXQA 1WA8B 1GM9A 4UCOA 1FJGO 3UCSC 3LSQA 1H38A 4X65B 2G38A 4DV1O 2YXYA 1OZ0A 4TOIA 4UB6Z 2NLJC 1T5EA 1UPGA 4UXNA 4DV0B 4LF6B 5ITZB 3EHBB 2E5LB 2YEVB 2EIMB 3AK1A 1MOFA 3B8NA 1CXZB 3THOA 2DYSC 4RUFA 4FFKA 3NXSA 4O4IA 5LP6C 3TETA 5JJJB 4H33A 5HFMA 4LWSA 1K33A 2CTPA 1J5EO 4HBNA 3O65A 1NJIW 3OMNB 2Y69C 3UO3A 3OT7A 3RWRD 4JGSA 1R73A 2ZR2A 2XOKG 1FD9A 1K7DA 3J80N 5LYJA 5LA6B 1DGSA 4DV5B 3JD1A 2H94A 1N33B 4CS2A 2PYLA 1BE3H 1XHZA 1OCCB 1JR9A 1W0JG 4AQYO 1E1QG 1J95A 5JQGA 1KMIZ 3BCCH 5FPRA 5LL6Y 3SJQC 1OCOC 1SS3A 2FKXA 3FB8C 2EX3A 4CH3A 1P4RA 4BR6A 1AJNA 5KMGA 4JI8B 5K1PA 1E1RG 2EIKC 3VQWA 2UU9O 1ENVA 4QNHB 4E2LA 5B1BB 4Z2WA 4I55A 1XDCA 4TV8B 3OEEG 5IYDO 4B7EA 4BIZA 1HP8A 3K5LA 4DV1B 4JAAA 1S5HC 1WN7A 4R8CA 5DN6G 2QWRB 4PI2A 4AI8A 4PI0A 3G71V 1OCZB 2DWDC 1PNLA 4MVSA 2YC0A 2QWOB 1TUBB 3QO8A 3JD3A 1IBKO 5J2TB 2WLIA 2NR5A 3CHXA 2FMLA 4I0XA 3SR2C 1KYOF 3ABUA 4IYIA 4O4LA 3PJSK 4YHHO 3H1LH 3JAWA 2YUAA 5LHGA 3SYQA 4LFBO 2WLLA 3J81N 4YXWG 2OYQA 1J5EB 5LOVA 4FPPA 4D7TA 2VRZA 2QTOA 1GTOA 4MTGA 1B06A 1SQVH 4I9WA 2Y4TA 5IY5B 2IJHA 1PM9A 1FFXA 1MSDA 1BT8A 4O4IB 4AHCA 1JJOA 4TQDA 3ABTA 4J10A 4HNAA 1ZUQA 2ODMA 4AQYB 1JVMA 4F6RB 1VQKV 2XHBA 2X7RB 1M4UA 4DUYO 4FK5C 4NB5A 3CMEV 1OCRC 1FKAO 2KG7A 2K1EA 3BAAA 1XNRO 5LYJB 2YICA 1K3EA 3HKBA 1I5YA 3VOUA 2UU9B 2Z3YA 3L70H 2RNBA 3RT3C 5EZYA 3K79A 2DQ3A 1SQXH 1G6UA 5CMUA 2Q67A 2CK3G 4YJ2A 5JQGB 3K9SA 3OAAG 1AP5A 4JAVA 1K92A 3TXSA 3QO5A 1PPJH 4DR1O 2Q8VA 3FB5C 4UVCA 3JD4A 1Q6IA 5KMGB 1D5AA 1SA0B 3U11A 2CAZC 1QU7A 5IYBO 2B1GA 3B77A 3Q4HA 1IBKB 4JI4O 3ETGA 5TISZ 2KB1A 1ORQC 2X0LA 4R7CA 4RUEA 4I55B 4YHHB 2IH3C 3D3QA 4LC1A 1FAFA 1EN5A 1XMQO 1TAEA 3CCRV 4LFBB 5J9PC 1K73W 4H13B 2QM7A 1W0KG 1QCEA 1XHXA 3ZHTA 4NR1A 1N8RW 2FL4A 2E3CA 3AK3A 1MMMA 5GONA 4LCUC 2EIJB 3JCZA 4EB6A 2UUCO 2XAJA 4W4KA 1F7YA 3QNEA 2P22C 1YCIA 4E4EA 2WLIB 4LF8O 2P67A 3GWOA 4I0XB 4BIUA 4X1IA 4PD4F 4O4LB 4DV7O 3JAWB 4UV8A 4FM0A 2WLJA 2R9RB 3K03A 4KL1A 4JAUA 5L3DA 2WLLB 2W6JG 3E8FA 2Y0PA 1O9HA 1BMFG 4JF3A 4KXRA 3RW0A 1U96A 3D8CA 2A0LA 1RM1B 2UXBO 3CCJV 3STLC 2YSUB 4IT5A 1Y66A 5BZBA 1VIBA 4FLWA 4DUYB 5FLXN 2HJFC 1K4DC 2GTSA 1NKDA 4LF4O 1FFXB 3ZN1A 1XNRB 2EBOA 5FNVA 3CD6V 3HKEB 2EJ7A 2LQTA 3E86A
chains in the Genus database with same CATH topology
1DK1A 3F5TA 4JYAO 1I94O 1D2DA 1NS1A 4DV6O 5LMUO 1XEQA 4LF9O 4DR2O 4DR1O 1YZBA 1HNWO 4DR6O 4K0KO 1IBKO 4DR5O 1HNXO 3SDLA 2HHHO 1XNQO 3R66A 4JI0O 5IWAO 4DR3O 4JI4O 4JV5O 4JI6O 4YHHO 1N34O 5BR8O 4X64O 4OX9O 1A32A 1AB3A 4B3MO 2ZM6O 2Z0AA 1J5EO 4GKJO 1N36O 4JI1O 4LFBO 4JI2O 3J81N 3O65A 1R6TA 1XMQO 4A5UB 2UXDO 4JI7O 4DR7O 1AILA 4LFCO 4B3SO 2DJVA 3M8AA 3JAMN 3J7AU 5BXZA 1HNZO 4JI5O 4DV4O 4OPHA 2UUCO 4DV2O 4GKKO 4LF7O 4X66O 4DV5O 3J80N 1F7YA 2UXCO 1N33O 4LF5O 3T1YO 4JI3O 5LMNO 4LF8O 2AGAA 4X62O 2LW7A 1HR0O 4DV7O 3OTOO 2VQFO 4NXMO 1N32O 4AQYO 3T1HO 2F4VO 4DR4O 4NXNO 1FYJA 1IBLO 1IBMO 2ZKOA 5LL6Y 5IT9N 5A2QN 4JI8O 5H5NA 2FKXA 2N74A 1R1BA 4YY3O 1XMOO 1G1XB 2UXBO 4DUYO 2UUAO 4X65O 4LFAO 1FKAO 4KHPO 1FJGO 5FLXN 2JRIA 1KUQA 2UU9O 1XNRO 4B3TO 2VQEO 4DV3O 2UUBO 2DOSA 4DV1O 4OPAA 4DV0O 4LF4O 4LF6O 1X59A 4DUZO 2E5LO 4B3RO 3RT3C 5BY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DK1 A;  3F5T A;  4JYA O;  1I94 O;  1D2D A;  1NS1 A;  4DV6 O;  5LMU O;  1XEQ A;  4LF9 O;  4DR2 O;  4DR1 O;  1YZB A;  1HNW O;  4DR6 O;  4K0K O;  1IBK O;  4DR5 O;  1HNX O;  3SDL A;  2HHH O;  1XNQ O;  3R66 A;  4JI0 O;  5IWA O;  4DR3 O;  4JI4 O;  4JV5 O;  4JI6 O;  4YHH O;  1N34 O;  5BR8 O;  4X64 O;  4OX9 O;  1A32 A;  1AB3 A;  4B3M O;  2ZM6 O;  2Z0A A;  1J5E O;  4GKJ O;  1N36 O;  4JI1 O;  4LFB O;  4JI2 O;  3J81 N;  3O65 A;  1R6T A;  1XMQ O;  4A5U B;  2UXD O;  4JI7 O;  4DR7 O;  1AIL A;  4LFC O;  4B3S O;  2DJV A;  3M8A A;  3JAM N;  3J7A U;  5BXZ A;  1HNZ O;  4JI5 O;  4DV4 O;  4OPH A;  2UUC O;  4DV2 O;  4GKK O;  4LF7 O;  4X66 O;  4DV5 O;  3J80 N;  1F7Y A;  2UXC O;  1N33 O;  4LF5 O;  3T1Y O;  4JI3 O;  5LMN O;  4LF8 O;  2AGA A;  4X62 O;  2LW7 A;  1HR0 O;  4DV7 O;  3OTO O;  2VQF O;  4NXM O;  1N32 O;  4AQY O;  3T1H O;  2F4V O;  4DR4 O;  4NXN O;  1FYJ A;  1IBL O;  1IBM O;  2ZKO A;  5LL6 Y;  5IT9 N;  5A2Q N;  4JI8 O;  5H5N A;  2FKX A;  2N74 A;  1R1B A;  4YY3 O;  1XMO O;  1G1X B;  2UXB O;  4DUY O;  2UUA O;  4X65 O;  4LFA O;  1FKA O;  4KHP O;  1FJG O;  5FLX N;  2JRI A;  1KUQ A;  2UU9 O;  1XNR O;  4B3T O;  2VQE O;  4DV3 O;  2UUB O;  2DOS A;  4DV1 O;  4OPA A;  4DV0 O;  4LF4 O;  4LF6 O;  1X59 A;  4DUZ O;  2E5L O;  4B3R O;  3RT3 C;  5BY1 A; 
#chains in the Genus database with same CATH topology
 4HNA B;  3AG7 A;  4QPK A;  1FFT B;  4BW9 A;  1CEZ A;  1KEC A;  1GM8 A;  3P3N A;  4GCZ A;  2YI8 A;  2EIL C;  1XUQ A;  4DR2 O;  4JTC B;  1TVK A;  2UXN A;  4H0L B;  2GDS A;  1SZX A;  5HFL A;  1S76 D;  3VBB A;  3GVM A;  2DYR C;  1P7G A;  3RYF A;  4DR1 B;  2XT9 A;  1FXK C;  1WB8 A;  4JI0 O;  3H1K H;  2KG7 B;  3CCV V;  3E8G A;  1M1K W;  3A0B Z;  1PNM A;  2CE4 A;  1N0N A;  4JI4 B;  1VQL V;  1DF4 A;  3HKB B;  2R70 A;  3L9D A;  1NH2 D;  3RVY A;  1XOU A;  1GKF A;  2AHZ A;  1H2M A;  2DN9 A;  3ZRW A;  4ZHQ A;  1XMQ B;  3ZHQ A;  4TT3 G;  4QE7 A;  2RQ6 A;  4I50 A;  3TK1 A;  3ZRV A;  3DGE A;  3HPL C;  2CUG A;  2C2A A;  2IJI A;  5JCO A;  1VP7 A;  5BMV A;  2UUC B;  1N34 B;  3ZMZ A;  2ETN A;  4D6T H;  3Q4H B;  4HZ3 A;  4LF8 B;  2DYS B;  3ABK C;  2LW1 A;  3P30 A;  1QR9 A;  1EZV H;  3ABL B;  1M57 C;  2AW9 A;  4DV7 B;  1WP8 A;  5IE9 A;  3LNM B;  4YJ3 A;  4PDR A;  4WF9 V;  2N74 A;  4YY3 O;  1H2K A;  3FX7 A;  3HB3 B;  2OIG A;  5J2U A;  1SF9 A;  2UXB B;  3TGU H;  2ATK C;  1GO3 F;  3LUT B;  4DXW A;  1XI1 A;  2UUB O;  4BW5 A;  4J7Z A;  2A9H A;  3FB7 C;  4X1I B;  5LHI A;  5C8Y A;  2GBO A;  2LJ2 A;  4LF4 B;  2O57 A;  4UCU A;  1ZL8 A;  3FKS G;  4FLY A;  1BQZ A;  1ZLZ A;  1ZAU A;  4NTX A;  2F93 B;  4FMT A;  4DR2 B;  1BHA A;  4I9Q A;  1B6Q A;  1QR8 A;  4DR5 O;  2HP8 A;  2DQ0 A;  2R9A A;  4N21 A;  2JEU A;  4NKG B;  1NVP D;  2ZE8 A;  3IGA C;  4JI0 B;  3RYC A;  4PDM A;  2ZE5 A;  1R6T A;  5FNV B;  2P7T C;  3AG1 B;  3E35 A;  1TGO A;  1VQM V;  2ZIM A;  1VQ7 V;  4DR7 O;  1Q3E A;  2QSA A;  3M8A A;  4ICG A;  5B1A C;  5CA3 A;  1WAZ A;  4JYY A;  4I5S A;  4LH6 A;  2WWW A;  1NU1 H;  1TVK B;  4RQE A;  2W0X A;  4GLX A;  4OPH A;  1M90 W;  2ZE6 A;  1ZX3 A;  4KUM A;  1EN4 A;  4JI3 O;  3RYF B;  5LMN O;  2CGO A;  1GN4 A;  3ZHV A;  1AI5 A;  4RWU A;  4U3F H;  4EFE A;  3OEH G;  3W7W A;  1MNG A;  5JWP A;  4UCV A;  5IJ9 A;  3W7T A;  4G2K A;  2KQX A;  3ZRW B;  4ZHQ B;  3AG4 C;  3SPI A;  3CPW U;  4G28 B;  4GZR B;  4I50 B;  1M56 B;  4YY3 B;  1YJ9 V;  3IC7 A;  2JRI A;  1WPB A;  5CBH A;  1MSW D;  1NT2 B;  5BMV B;  1WLE A;  4PA7 A;  4B3R O;  2UUB B;  3L75 H;  2QJ1 A;  2OWO A;  3QVN A;  1DK1 A;  3F5T A;  5FL7 G;  4JYA O;  2LFS A;  5J2T A;  3L73 H;  2Q73 A;  4DO2 A;  4YJ3 B;  3M7M X;  1YZB A;  2V4D A;  2PYJ A;  3A0R A;  3C90 A;  5J2U B;  3TCU A;  1PNK A;  2OIE A;  3R66 A;  2RJZ A;  3AG2 C;  4CC6 A;  4DR5 B;  3JAS A;  2QA4 V;  2GV9 A;  5LXT A;  4DW1 A;  4MVU A;  4B3M O;  3E22 A;  4JI2 O;  4F6E A;  2YI9 A;  5C8Y B;  3N2G A;  3ZN0 A;  4CS4 A;  1SC5 B;  4J9Z B;  4DRX A;  4LFC O;  1ZL8 B;  3L74 H;  3OTF A;  4U7N A;  1JOY A;  4IHJ A;  1R6K A;  4DR7 B;  4XDJ A;  2JS5 A;  4PA4 A;  4DV4 O;  5B3S C;  3APQ A;  1HW7 A;  2EJR A;  1W2B U;  3ZRX A;  1IXM A;  2AZ0 A;  1YVW A;  4FFB A;  3WG7 C;  4MVO A;  2AGA A;  3B4S A;  1QBZ A;  4X62 O;  3G6E V;  4F6R A;  4JI3 B;  2VQF O;  1S5J A;  5LMN B;  1FXH A;  1Q8I A;  2IJK A;  3OUS A;  3RYC B;  2RDC A;  2LGW A;  1V54 C;  3CRM A;  2Q9L A;  5CBF A;  4PV1 B;  4FZ0 A;  3ASO C;  2JEX A;  2JGD A;  1AI4 A;  2HEP A;  4UCS A;  1R3L C;  2B1I A;  5IYC O;  2E75 B;  3FAV A;  1CP9 A;  4CBC A;  1B04 A;  1Q5O A;  2V1D A;  1XIL A;  1K8A W;  3ABM B;  1YIT V;  3GB7 C;  3JSL A;  3M99 B;  4FLZ A;  1W59 A;  1LNQ A;  1FS0 G;  1MA1 A;  4PA3 A;  3SJA C;  2BCC H;  2CTW A;  4B3R B;  1NR1 A;  2HJD A;  3X2Q C;  5IJ9 B;  1SA0 A;  2CDY A;  2LO1 A;  2Q6A A;  3UM7 A;  4JYA B;  3DTU B;  4GYC B;  4CH4 A;  3OR6 C;  2IU3 A;  2BOB C;  2B9Z A;  1FJG B;  1YDX A;  2HKO A;  1F4N A;  2OTJ V;  2F66 C;  5IWA O;  1Q90 D;  4XDK A;  4NVP A;  1VAR A;  1N36 O;  3CWB H;  4MT8 A;  3ASN C;  4B3M B;  3K58 A;  4A5U B;  4JI2 B;  2Y0I A;  3E2E A;  4B7K A;  1KP2 A;  1YHQ V;  1KBH A;  2VWJ A;  4CS3 A;  3QG5 A;  4LFC B;  2HR3 A;  2BTQ A;  3K3W A;  3K06 A;  4JI5 O;  4EFB A;  2PUS A;  3FB6 C;  1BHB A;  3K5N A;  1YI2 V;  4GKK O;  3K5M A;  2OCC B;  4DV4 B;  3AG3 C;  4FLX A;  5LGN A;  3SYA A;  1AR5 A;  2UXX A;  1URF A;  1YJN V;  3KZI Z;  1GH6 A;  3JAS B;  5KX5 A;  4NXM O;  4ZI7 A;  4X62 B;  5LXT B;  1Z5V A;  3B2E E;  4DK0 A;  2GUZ A;  3E22 B;  1KB9 F;  2VQF B;  3UKM A;  2WPD G;  3OW2 U;  5KUK A;  3N2G B;  3LNN A;  2NNU A;  1G8M A;  4X1K A;  4DRX B;  4O4H A;  1Q81 W;  1F4M A;  1KP3 A;  4X1Y B;  3D36 A;  1V55 B;  1QLE C;  2WLM A;  4IHJ B;  4TWK A;  3HKE A;  3BY6 A;  3EXA A;  1Y67 A;  4KP4 A;  3L72 H;  4J41 A;  5EBL C;  1AI6 A;  1I7F A;  4H44 B;  2OCH A;  1U97 A;  1Y74 A;  3CSX A;  4FFB B;  5JH7 A;  1KC8 W;  2QWP B;  2EIN C;  4TQF A;  4NYK A;  1D2D A;  5L3E A;  1QVG U;  1KU9 A;  1GRJ A;  2ZIO A;  1XQ8 A;  3A8T A;  1SER A;  2JGD B;  4ZOL A;  3SPG A;  1THZ A;  4RQF A;  3RGB A;  5KA6 A;  2JVD A;  4JZG A;  2F23 A;  3FAV B;  2IM9 A;  4JV5 O;  3ZHS A;  1Y76 A;  1PL0 A;  3SYC A;  5JVD B;  5IWA B;  2EIM C;  5E1A C;  5D5P A;  4J7K A;  2CTR A;  1B3Q A;  4WFF A;  1N36 B;  5H6R A;  2QDO A;  1PV0 A;  1OV9 A;  3UT5 A;  4GX5 A;  2QKS A;  3J7A U;  3UO2 A;  1PP9 H;  3K04 A;  4UFZ A;  3CE2 A;  2QGN A;  4DK1 A;  1JJ2 U;  4JI5 B;  2Q0A A;  3ZIA G;  2QWQ B;  3BA8 A;  5LP6 A;  3H1J H;  4GKK B;  5KLV H;  1KKC A;  1N32 O;  4P30 A;  1FXV A;  3OD4 A;  1K97 A;  2JJ2 G;  4WFB V;  1XL4 A;  5KA5 A;  5IDJ A;  5JJE B;  1SQB H;  3HR0 A;  4PA9 A;  3T2M A;  1G1X B;  1KKD A;  1AI7 A;  3MAQ A;  1VQ8 V;  3H1H H;  5L3F A;  1VF6 C;  3MDS A;  4H37 A;  3JSN A;  2BTQ B;  4X8A A;  3B09 A;  4FJC C;  1KUQ A;  1HWY A;  1OCC C;  5B1A B;  5CN0 A;  1AR1 B;  3K0G A;  1ZSP A;  2XTA A;  5A9G A;  1H2L A;  3BA9 A;  2OTL V;  5KUM A;  5KX5 B;  3G67 A;  4PHZ A;  3T4Z A;  1GK9 A;  2ZDI C;  4ZI7 B;  5B1N A;  2GUZ B;  4NTW A;  3T4D A;  3ZMU A;  3H01 A;  3JYC A;  4K3A A;  4DV6 O;  1SKV A;  2JK5 C;  4CC5 A;  4MS2 A;  3OFN G;  5DEC A;  3S3W A;  2VS0 A;  4X1K B;  4O4H B;  4K0K O;  2ZNJ A;  4WFE A;  3ZBH A;  5B1B C;  5EBW C;  4J7J A;  3ETQ A;  4JV5 B;  1Y74 B;  2WAM A;  3CCE V;  2BE3 A;  5L3B A;  1NTK H;  5JH7 B;  1R3K C;  2AHY A;  2QKC A;  5EC2 C;  4JI7 O;  3JAR A;  5L3C A;  3JAT A;  4B3S O;  2DJV A;  3SPH A;  1NH2 B;  3FFQ A;  1H2N A;  4UV9 A;  2W6I G;  4UUJ C;  3CXH F;  4ZOL B;  2D2C B;  3ZMV A;  4DV2 O;  1XBL A;  1R3J C;  1AP6 A;  4TV9 A;  1V9P A;  4DYL A;  2Q69 A;  1P7B A;  1Q6U A;  1Y76 B;  4IIJ A;  1VF5 B;  3OGI B;  3QF7 A;  1MZE A;  2F4V O;  3K5O A;  1IBL O;  1N32 B;  2LGQ A;  2YXH A;  3AG2 B;  4JYC A;  3RBZ A;  1JFF A;  2F1M A;  1HDJ A;  3CJH A;  3F7V C;  5IY5 C;  2L6L A;  3UT5 B;  5B5E Z;  2ZQM A;  3OUF A;  3GWK C;  5LBQ A;  1G4Y B;  2XAS A;  3U10 A;  4J11 A;  4GX1 A;  4FVM A;  3DC5 A;  4JPR A;  1VMG A;  2Z5U A;  1VEW A;  2X6C A;  5LP6 B;  3A2F A;  3CCU V;  1L1F A;  5B3S B;  5KAF Z;  3ICX A;  1BZK A;  5KAI Z;  1NS1 A;  1CPY A;  3SPJ A;  1MZF A;  4RAI A;  1O9G A;  4MSW C;  4FM2 A;  2Y69 B;  4DV6 B;  3QO7 A;  2PY5 A;  4PEL A;  2W0F C;  4JZ2 A;  3W7X A;  3ZX6 A;  4MW3 A;  3ASO B;  1XNQ O;  2IBZ H;  4K0K B;  3RN4 A;  4JI6 O;  2YS8 A;  3CRA A;  1L8D A;  2QR4 A;  1AB3 A;  1EBO A;  3JAK A;  2JJ1 G;  1WP7 A;  3AEI A;  1K9M W;  1YTF D;  4JTD B;  5H9C A;  1NVP B;  1AJP A;  3CB2 A;  2Y48 A;  3VQV A;  3WFV A;  3CEI A;  1QVF U;  1SQP H;  4JI7 B;  1OCO B;  4MW8 A;  4B3S B;  4XDL A;  4TSF G;  4FIP C;  4WBN B;  2IJJ A;  2GSM B;  3X2Q B;  1RP3 B;  3JD0 A;  2H8P C;  1P49 A;  4O4J A;  3WB0 A;  2EIK B;  4DV2 B;  3NR7 A;  4ZBM A;  3OR7 C;  1DTO A;  3T1H O;  4L8J A;  4D7S A;  3L71 H;  4K35 A;  3BPZ A;  2Q7G A;  4P9O A;  5IYZ A;  1S77 D;  2F4V B;  3KCX A;  1IBL B;  1H8E G;  3JAR B;  3JAT B;  4O2B A;  4Z1M G;  3G4S V;  3ASN B;  4QGP A;  2DWE C;  5GTH Z;  1SQF A;  5D5Q A;  1VF7 A;  1IXB A;  2VQE O;  1GMG A;  1WNS A;  1VF6 A;  5GTI Z;  1US6 A;  4PJ0 Z;  4TV9 B;  1YSC A;  4WFG A;  4IYH A;  1VQ6 V;  3DSQ A;  4WFH A;  3CXC U;  4IIJ B;  3AG3 B;  2XAH A;  3E8H A;  2X6A A;  1I94 O;  1RM1 C;  2QEX V;  2GHY A;  3K08 A;  1COW G;  5IJ0 B;  2EUL A;  4X20 A;  1XEQ A;  2YXL A;  1IDS A;  1NZ6 A;  4FLT A;  1JFF B;  3CJH B;  5LGT A;  2PZS A;  1H8H G;  1Z2G A;  2M6Y A;  4DR6 O;  3LSU A;  5KHI A;  2JDI G;  2WLH A;  2B5U A;  1K5Q A;  5F2V O;  5BR8 O;  4K8Z A;  1P84 F;  1XNQ B;  3OMI B;  3ZMS A;  3CC7 V;  2A06 H;  4JI6 B;  3F7Y C;  4LR3 A;  3T1C A;  1SQG A;  3CYO A;  4BIO A;  4J9Y B;  2GTA A;  2LFR A;  2QE7 G;  4C7U A;  1AR4 A;  4WCE V;  2WLK A;  1S72 V;  4MVQ A;  3TJT A;  2FTK A;  2YIA A;  2ADP A;  1MG1 A;  1X4T A;  4PDL A;  1SZT A;  1Q7Y W;  4QPJ A;  1I08 A;  4LF7 O;  4P9P A;  3T1Y O;  5C93 A;  4HYO A;  1FXK A;  1OCR B;  2KKW A;  3ZS8 C;  2JGU A;  3OTO O;  1E79 G;  3JAK B;  3N27 A;  4GT1 A;  4X1Y A;  2ZT9 B;  3T1H B;  2ZKO A;  4QE9 A;  5IT9 N;  3BFR A;  1ZWI C;  4F4L A;  3HKD A;  2D3O W;  3HKC A;  1PL4 A;  1BQ0 A;  1OHH G;  2ILM A;  3WB2 A;  5DED A;  3PN1 A;  3N2K A;  4LFA O;  5K1X A;  4MVR A;  2IU0 A;  4X9Q A;  4JYB A;  3CMA V;  2XAF A;  3CS5 A;  2QWN B;  3ABL C;  3B8M A;  4O4J B;  4OXS A;  2EZO A;  3RYI A;  2VQE B;  1YEW A;  5EC1 C;  1LUW A;  1I5X A;  3I5D A;  2R9I A;  3F5W C;  1IZ3 A;  3CCL V;  5IYZ B;  4LF9 O;  1I94 B;  2PI5 A;  3K0D A;  1DLB A;  4LBE C;  2WA3 A;  2DE0 X;  4O2B B;  1RPR A;  5JVD A;  2NN4 A;  3B40 A;  4MTO A;  1HNX O;  2ZXW C;  3SDL A;  3AK2 A;  2HHH O;  4DR6 B;  1XRE A;  1BGY H;  2L35 A;  4X64 O;  4OX9 O;  1A32 A;  2FYU H;  3CCM V;  3RVZ A;  4NTY A;  2ZM6 O;  1BL8 A;  3CRC A;  4JI1 O;  5BR8 B;  3MHH C;  2XND G;  3IAY A;  1H2G A;  1Q86 W;  2N05 A;  3EVK A;  3JAM N;  3LDC A;  4MVM A;  2RMK B;  2R72 A;  4X20 B;  1LR1 A;  4J42 A;  2XAG A;  3KKY A;  2P6J A;  3E8B A;  4LF5 O;  3STZ C;  5CB4 A;  4MTF A;  2P4K A;  5EBM C;  4LF7 B;  1LUV A;  2LW7 A;  3T1Y B;  3AG1 C;  4Z1V A;  3OTO B;  1IBM O;  2CH7 A;  3A0H Z;  4LP8 A;  2PI4 A;  2EIL B;  2RN9 A;  2BOC C;  3KCY A;  3DXR A;  3H1I H;  1S0V A;  1Z5W A;  1Y4M A;  2ZIN A;  4KHP O;  3UQ8 A;  2DYR B;  4B3T O;  3LSS A;  4LFA B;  4DV3 O;  2MW2 B;  3C3S A;  2YIB D;  4CZZ A;  5E79 Z;  1FXK B;  4FLU A;  3W7U A;  1Q6H A;  2QM8 A;  5EYP A;  1SQQ H;  1WPX A;  2E76 B;  1M56 C;  4XBF A;  4UCT A;  3HKD B;  4LF9 B;  3HKC B;  3C3T A;  5JCO C;  1GAX A;  3N2K B;  4UCR A;  4G27 B;  1HNX B;  1VQ4 V;  2HHH B;  2PTM A;  3I56 V;  2Z0A A;  5H6Q A;  4X64 B;  4OX9 B;  3RYI B;  2ADQ B;  2ITD C;  2ZM6 B;  4LWS B;  3ABK B;  4JI1 B;  2UXD O;  2Q5Z A;  1AIL A;  1M57 B;  1H2S B;  1AJQ A;  1L0L H;  4MTX A;  5KHG A;  3QTC A;  3CC4 V;  4IL6 Z;  3ZCC A;  1HNZ O;  1M93 A;  3W7S A;  3BVO A;  1F23 A;  1JCH A;  1VQN V;  4X88 A;  5FPO A;  4W4L A;  2AZ2 A;  3ML0 A;  2LP7 A;  3ZMT A;  4LF5 B;  1QQC A;  3D3I A;  1GM7 A;  2A3Q A;  4JAS A;  3KG2 A;  4I4T A;  4DR4 O;  2IH1 C;  1VQP V;  2P4V A;  1IBM B;  1R1B A;  1BS3 A;  2UUA O;  3SJC C;  3DC6 A;  4J80 A;  4FM1 A;  1L0N H;  4OGQ B;  4WFA V;  1XL6 A;  1NR7 A;  1F51 A;  3JAL A;  4YIO A;  4KHP B;  5CB4 B;  1AVM A;  3MHS C;  1Q43 A;  4NXM B;  1JQ0 A;  4B3T B;  4DUZ O;  5LGU A;  4MVZ A;  4DV3 B;  2HVK C;  2HFE C;  3SYO A;  2ZCE A;  2AXT Z;  2XAQ A;  2XUM A;  5CA1 A;  5CA0 A;  1N4C A;  1S5L Z;  1S3J A;  2CH7 B;  3FD9 A;  1M9N A;  4Q6G A;  3I55 V;  1RPO A;  2A7W A;  2QKA A;  4X89 A;  3IFX A;  3OMA B;  4TUY A;  4FZ1 A;  3ABM C;  1HNW O;  1EZJ A;  1YJW V;  3DXR B;  4DR3 O;  2JS3 A;  1N34 O;  2ITC C;  2QM4 A;  4PA6 A;  4GKJ O;  3S3X A;  1SRY A;  4O2A A;  3RYH A;  5EYP B;  2CTQ A;  2Y4U A;  4QJF B;  4WBN A;  2YDE A;  3BRC A;  2VWK A;  1PKX A;  3CRQ A;  4UB8 Z;  2UXD B;  3IJ4 A;  1JX9 A;  3FYE B;  3CCS V;  1JMK C;  1MAB G;  5LOV B;  2PGG A;  4LNU A;  4KFM A;  3AG4 B;  1HNZ B;  1VQ5 V;  4X66 O;  2UXC O;  3ZHU A;  4EKW A;  1BCC H;  1HR0 O;  3CX5 F;  3FYI B;  1ZTE A;  4LH7 A;  1KQS U;  1OCZ C;  4ABM A;  4NXN O;  3OM3 B;  4FLV A;  4DR4 B;  1BSM A;  1IVS A;  5H5N A;  1ROP A;  1K5S A;  3ZJZ A;  2HG5 C;  2OCC C;  1TA8 A;  4B08 A;  4UVB A;  2Q0O C;  5L3G A;  4HAM A;  4Q20 A;  5LHH A;  1R3I C;  5EIB D;  2UUA B;  2DMX A;  4N23 A;  1N0J A;  2BTO A;  4QIW F;  2P90 A;  1PD3 A;  5IJ0 A;  1X59 A;  1FPO A;  3VQY A;  2Q68 A;  3P3P A;  1WJZ A;  2WSS G;  3H9V A;  1EN6 A;  4DUZ B;  1RSO A;  4I4T B;  2A79 B;  2PF4 E;  1V55 C;  3LDD A;  5LMU O;  4CH6 A;  1Y6X A;  5EZY B;  5JJN B;  2P06 A;  1SET A;  4BAY A;  4DW0 A;  1I0H A;  4YJ2 B;  1GN2 A;  1UFI A;  1HNW B;  3CCQ V;  5CBG A;  3JAL B;  3U0Z A;  2YID A;  3SYP A;  4DR3 B;  3WG7 B;  2BSK A;  3BEH A;  1EM1 A;  4ZIB A;  4GKJ B;  3JD2 A;  2F95 B;  2DW4 A;  4U7O A;  1RFY A;  4U3J A;  5CA1 B;  1V54 B;  5CA0 B;  3WB1 A;  1OJH A;  5BXZ A;  1YTF B;  1TUE B;  2MK3 A;  1WA8 A;  1UJW B;  4AIL C;  2ZR3 A;  3WU2 Z;  1DF5 A;  4TUY B;  3RFR A;  2Q7H A;  3EFF K;  1YXB A;  4GUN A;  4R6Z A;  1GN6 A;  2Q4P A;  2WA4 A;  1WB7 A;  4X66 B;  3R65 A;  5GON B;  3SJB C;  2UXC B;  4EB6 B;  2HLD G;  5ITZ A;  2ZXW B;  2QTS A;  2V7Q G;  1HR0 B;  2YEV A;  1FYJ A;  5KHK A;  4EEQ A;  4O2A B;  3RYH B;  3K57 A;  3ZHR A;  1NQT A;  3VQX A;  4NXN B;  2CGN A;  5A2Q N;  5B66 Z;  1K34 A;  2ZNI A;  3G6B A;  2HVJ C;  1NBM G;  1XMO O;  4UVA A;  4JTA B;  1GN3 A;  4K8X A;  1VQ9 V;  3OE7 G;  4X65 O;  3ZRS A;  3JCU Z;  3ETE A;  4YIP A;  4P2Z A;  1QHT A;  2X6B A;  4LNU B;  5DM6 V;  1VQO V;  4BWA A;  1D5N A;  2ARH A;  2DOS A;  1IUR A;  4OPA A;  4DV0 O;  5EK0 A;  1EFR G;  3OGC C;  4LF6 O;  2E5L O;  5BY1 A;  2EIJ C;  5KHJ A;  3SGI A;  2ZE7 A;  4PDV A;  1SES A;  2IW5 A;  3BAB A;  5GW7 A;  3LDE A;  5LMU B;  2P5O A;  1K4C C;  3O9O A;  1YF2 A;  5LA6 A;  4ASU G;  3E83 A;  1QNM A;  3CC2 V;  4R50 A;  2EZP A;  3ETD A;  2F43 G;  1NTM H;  4L87 A;  4RO2 A;  3K9A A;  1YIJ V;  2M7W A;  3SPC A;  1NTZ H;  2ZDI A;  1KD1 W;  3CP1 A;  1RSO B;  2Q7E A;  1IX9 A;  4GX0 A;  2E74 B;  3CRR A;  3D36 C;  1M5I A;  3E89 A;  2FB5 A;  5EIB C;  2ZD9 A;  3P32 A;  5KHH A;  2OT5 A;  3APO A;  4DV5 O;  1Q82 W;  1QLE B;  1N33 O;  2JIZ G;  1JPX A;  2N04 A;  4TV8 A;  5B1O A;  4CH5 A;  5H2F Z;  1QLN A;  3BHP A;  4I7Z B;  3IC9 A;  2RCV A;  2WLN A;  2YIB A;  1NI8 A;  3ZED A;  1ARO P;  1JA8 A;  2BSK B;  4ZKI A;  3K59 A;  4GX2 A;  2EIN B;  4IGG A;  2K9P A;  2H3O A;  4JI8 O;  5AG2 A;  1TUB A;  2KSD A;  3MD0 A;  4U3J B;  3G80 A;  1R6N A;  1XMO B;  3TXQ A;  1WA8 B;  1GM9 A;  4UCO A;  1FJG O;  3UCS C;  3LSQ A;  1H38 A;  4X65 B;  2G38 A;  4DV1 O;  2YXY A;  1OZ0 A;  4TOI A;  4UB6 Z;  2NLJ C;  1T5E A;  1UPG A;  4UXN A;  4DV0 B;  4LF6 B;  5ITZ B;  3EHB B;  2E5L B;  2YEV B;  2EIM B;  3AK1 A;  1MOF A;  3B8N A;  1CXZ B;  3THO A;  2DYS C;  4RUF A;  4FFK A;  3NXS A;  4O4I A;  5LP6 C;  3TET A;  5JJJ B;  4H33 A;  5HFM A;  4LWS A;  1K33 A;  2CTP A;  1J5E O;  4HBN A;  3O65 A;  1NJI W;  3OMN B;  2Y69 C;  3UO3 A;  3OT7 A;  3RWR D;  4JGS A;  1R73 A;  2ZR2 A;  2XOK G;  1FD9 A;  1K7D A;  3J80 N;  5LYJ A;  5LA6 B;  1DGS A;  4DV5 B;  3JD1 A;  2H94 A;  1N33 B;  4CS2 A;  2PYL A;  1BE3 H;  1XHZ A;  1OCC B;  1JR9 A;  1W0J G;  4AQY O;  1E1Q G;  1J95 A;  5JQG A;  1KMI Z;  3BCC H;  5FPR A;  5LL6 Y;  3SJQ C;  1OCO C;  1SS3 A;  2FKX A;  3FB8 C;  2EX3 A;  4CH3 A;  1P4R A;  4BR6 A;  1AJN A;  5KMG A;  4JI8 B;  5K1P A;  1E1R G;  2EIK C;  3VQW A;  2UU9 O;  1ENV A;  4QNH B;  4E2L A;  5B1B B;  4Z2W A;  4I55 A;  1XDC A;  4TV8 B;  3OEE G;  5IYD O;  4B7E A;  4BIZ A;  1HP8 A;  3K5L A;  4DV1 B;  4JAA A;  1S5H C;  1WN7 A;  4R8C A;  5DN6 G;  2QWR B;  4PI2 A;  4AI8 A;  4PI0 A;  3G71 V;  1OCZ B;  2DWD C;  1PNL A;  4MVS A;  2YC0 A;  2QWO B;  1TUB B;  3QO8 A;  3JD3 A;  1IBK O;  5J2T B;  2WLI A;  2NR5 A;  3CHX A;  2FML A;  4I0X A;  3SR2 C;  1KYO F;  3ABU A;  4IYI A;  4O4L A;  3PJS K;  4YHH O;  3H1L H;  3JAW A;  2YUA A;  5LHG A;  3SYQ A;  4LFB O;  2WLL A;  3J81 N;  4YXW G;  2OYQ A;  1J5E B;  5LOV A;  4FPP A;  4D7T A;  2VRZ A;  2QTO A;  1GTO A;  4MTG A;  1B06 A;  1SQV H;  4I9W A;  2Y4T A;  5IY5 B;  2IJH A;  1PM9 A;  1FFX A;  1MSD A;  1BT8 A;  4O4I B;  4AHC A;  1JJO A;  4TQD A;  3ABT A;  4J10 A;  4HNA A;  1ZUQ A;  2ODM A;  4AQY B;  1JVM A;  4F6R B;  1VQK V;  2XHB A;  2X7R B;  1M4U A;  4DUY O;  4FK5 C;  4NB5 A;  3CME V;  1OCR C;  1FKA O;  2KG7 A;  2K1E A;  3BAA A;  1XNR O;  5LYJ B;  2YIC A;  1K3E A;  3HKB A;  1I5Y A;  3VOU A;  2UU9 B;  2Z3Y A;  3L70 H;  2RNB A;  3RT3 C;  5EZY A;  3K79 A;  2DQ3 A;  1SQX H;  1G6U A;  5CMU A;  2Q67 A;  2CK3 G;  4YJ2 A;  5JQG B;  3K9S A;  3OAA G;  1AP5 A;  4JAV A;  1K92 A;  3TXS A;  3QO5 A;  1PPJ H;  4DR1 O;  2Q8V A;  3FB5 C;  4UVC A;  3JD4 A;  1Q6I A;  5KMG B;  1D5A A;  1SA0 B;  3U11 A;  2CAZ C;  1QU7 A;  5IYB O;  2B1G A;  3B77 A;  3Q4H A;  1IBK B;  4JI4 O;  3ETG A;  5TIS Z;  2KB1 A;  1ORQ C;  2X0L A;  4R7C A;  4RUE A;  4I55 B;  4YHH B;  2IH3 C;  3D3Q A;  4LC1 A;  1FAF A;  1EN5 A;  1XMQ O;  1TAE A;  3CCR V;  4LFB B;  5J9P C;  1K73 W;  4H13 B;  2QM7 A;  1W0K G;  1QCE A;  1XHX A;  3ZHT A;  4NR1 A;  1N8R W;  2FL4 A;  2E3C A;  3AK3 A;  1MMM A;  5GON A;  4LCU C;  2EIJ B;  3JCZ A;  4EB6 A;  2UUC O;  2XAJ A;  4W4K A;  1F7Y A;  3QNE A;  2P22 C;  1YCI A;  4E4E A;  2WLI B;  4LF8 O;  2P67 A;  3GWO A;  4I0X B;  4BIU A;  4X1I A;  4PD4 F;  4O4L B;  4DV7 O;  3JAW B;  4UV8 A;  4FM0 A;  2WLJ A;  2R9R B;  3K03 A;  4KL1 A;  4JAU A;  5L3D A;  2WLL B;  2W6J G;  3E8F A;  2Y0P A;  1O9H A;  1BMF G;  4JF3 A;  4KXR A;  3RW0 A;  1U96 A;  3D8C A;  2A0L A;  1RM1 B;  2UXB O;  3CCJ V;  3STL C;  2YSU B;  4IT5 A;  1Y66 A;  5BZB A;  1VIB A;  4FLW A;  4DUY B;  5FLX N;  2HJF C;  1K4D C;  2GTS A;  1NKD A;  4LF4 O;  1FFX B;  3ZN1 A;  1XNR B;  2EBO A;  5FNV A;  3CD6 V;  3HKE B;  2EJ7 A;  2LQT A;  3E86 A; 
#chains in the Genus database with same CATH homology
 1DK1 A;  3F5T A;  4JYA O;  1I94 O;  1D2D A;  1NS1 A;  4DV6 O;  5LMU O;  1XEQ A;  4LF9 O;  4DR2 O;  4DR1 O;  1YZB A;  1HNW O;  4DR6 O;  4K0K O;  1IBK O;  4DR5 O;  1HNX O;  3SDL A;  2HHH O;  1XNQ O;  3R66 A;  4JI0 O;  5IWA O;  4DR3 O;  4JI4 O;  4JV5 O;  4JI6 O;  4YHH O;  1N34 O;  5BR8 O;  4X64 O;  4OX9 O;  1A32 A;  1AB3 A;  4B3M O;  2ZM6 O;  2Z0A A;  1J5E O;  4GKJ O;  1N36 O;  4JI1 O;  4LFB O;  4JI2 O;  3J81 N;  3O65 A;  1R6T A;  1XMQ O;  4A5U B;  2UXD O;  4JI7 O;  4DR7 O;  1AIL A;  4LFC O;  4B3S O;  2DJV A;  3M8A A;  3JAM N;  3J7A U;  5BXZ A;  1HNZ O;  4JI5 O;  4DV4 O;  4OPH A;  2UUC O;  4DV2 O;  4GKK O;  4LF7 O;  4X66 O;  4DV5 O;  3J80 N;  1F7Y A;  2UXC O;  1N33 O;  4LF5 O;  3T1Y O;  4JI3 O;  5LMN O;  4LF8 O;  2AGA A;  4X62 O;  2LW7 A;  1HR0 O;  4DV7 O;  3OTO O;  2VQF O;  4NXM O;  1N32 O;  4AQY O;  3T1H O;  2F4V O;  4DR4 O;  4NXN O;  1FYJ A;  1IBL O;  1IBM O;  2ZKO A;  5LL6 Y;  5IT9 N;  5A2Q N;  4JI8 O;  5H5N A;  2FKX A;  2N74 A;  1R1B A;  4YY3 O;  1XMO O;  1G1X B;  2UXB O;  4DUY O;  2UUA O;  4X65 O;  4LFA O;  1FKA O;  4KHP O;  1FJG O;  5FLX N;  2JRI A;  1KUQ A;  2UU9 O;  1XNR O;  4B3T O;  2VQE O;  4DV3 O;  2UUB O;  2DOS A;  4DV1 O;  4OPA A;  4DV0 O;  4LF4 O;  4LF6 O;  1X59 A;  4DUZ O;  2E5L O;  4B3R O;  3RT3 C;  5BY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...