3OTOO

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 3otoO00
4KHPO 1HNWO 1XMQO 4AQYO 5BR8O 4OPHA 3SDLA 4B3MO 4LF7O 4OX9O 5H5NA 4DR6O 4DV7O 4DR4O 4YHHO 1FYJA 1XEQA 4JI2O 4LF4O 5FLXN 4OPAA 4DR7O 2HHHO 4LF9O 1R6TA 5LMUO 2UXBO 1A32A 4DUZO 2FKXA 1N36O 2UXDO 4DV6O 4X62O 2ZKOA 4LFCO 4LF8O 1G1XB 1AB3A 1N33O 3M8AA 4X65O 5IWAO 3J81N 2UUAO 4DR2O 4B3RO 2JRIA 3RT3C 2E5LO 1XNRO 4K0KO 4JYAO 1IBKO 1KUQA 1J5EO 3T1HO 4B3SO 5BY1A 4DV5O 2ZM6O 1F7YA 1IBMO 5A2QN 4A5UB 2UXCO 2VQEO 4DUYO 2UUCO 4DV3O 4LF5O 1YZBA 1XNQO 1XMOO 1DK1A 3T1YO 4X64O 4JI3O 3O65A 4JI0O 2DJVA 2Z0AA 2F4VO 3J80N 5LL6Y 3J7AU 4LFAO 4JI1O 1R1BA 5BXZA 4DR3O 4NXNO 1HNZO 1FJGO 2N74A 1N34O 2UU9O 5LMNO 2AGAA 4DV4O 4NXMO 4JV5O 1N32O 3R66A 4GKKO 2VQFO 1AILA 4LF6O 4JI4O 4DV2O 1HR0O 1NS1A 3JAMN 4JI7O 3F5TA 4JI8O 4DR1O 1X59A 2DOSA 2UUBO 4JI6O 2LW7A 4X66O 1IBLO 4DR5O 4GKJO 4B3TO 4YY3O 4DV1O 5IT9N 1HNXO 3OTOO 4JI5O 1FKAO 4DV0O 4LFBO 1I94O 1D2DA
chains in the Genus database with same CATH superfamily
1E79G 4AI8A 2LGWA 4OPHA 3MHHC 1W59A 1NJIW 1VP7A 4EB6B 3SDLA 2VWJA 4LNUA 4DR6O 3K79A 2ODMA 1IX9A 2H94A 3UO3A 2GV9A 4CBCA 3AG3C 4I55B 5DECA 3ASOC 3O9OA 1S72V 1B6QA 5FL7G 1MSWD 2Q6AA 3ETQA 1M1KW 5LOVA 4NKGB 2B1IA 2AHYA 3D36A 5JJJB 3RGBA 3CCMV 2YEVB 1W0JG 1QR9A 2E75B 2W6IG 4P30A 3VQVA 1VQPV 3FYIB 2R9AA 2EILC 1QU7A 2X6BA 5BY1A 1BT8A 3AG2C 4BIUA 5EIBC 1WN7A 4DV3B 1IBMO 1FXVA 1Y6XA 4KP4A 4PELA 1TUBB 4MT8A 3LDCA 2N04A 5K1PA 3N2KA 1XNQO 4IYHA 1XMOO 4YIOA 5L3GA 2BSKB 3SJCC 5BMVA 4YXWG 1YVWA 3HB3B 1Q5OA 2W6JG 3J7AU 4FM2A 1SC5B 4J41A 1VQKV 2B5UA 4FLWA 1B06A 3JD2A 2QWPB 4TV8B 4O2BB 2UUCB 2R72A 1PL4A 3WB1A 2QM4A 5B1NA 1WP8A 4N23A 2KG7B 1NU1H 5F2VO 5CBGA 5E1AC 4PDVA 4X66B 4LFCB 3RVYA 2PY5A 4LFBO 3OR7C 2CGNA 2IU3A 4D7SA 4NTXA 1N34B 1SESA 1YTFB 1KECA 5LXTA 2FTKA 3P30A 1ZLZA 2Q73A 1HW7A 1XMOB 2CDYA 2JGDB 2QJ1A 3JAKB 3T4DA 2UXBO 2ZINA 1G6UA 2FKXA 2CTRA 2QWQB 3SYCA 3ETDA 4K35A 5H6RA 3FX7A 3CC2V 4B3RO 1XNRO 4JYAO 3A8TA 1QVFU 1EM1A 3ZMZA 1M4UA 4X62B 4X9QA 4X1KB 4K8XA 4LF4B 2RN9A 4TWKA 2P06A 4U7OA 1SS3A 4Z2WA 4WFGA 5A2QN 3LUTB 3AEIA 2M6YA 2K1EA 4LFBB 3B77A 4DR5B 1UPGA 1XREA 1NVPB 4YJ3B 5B1BB 3G6BA 1S3JA 1AP5A 1K5SA 1PKXA 3ZRWB 2VRZA 5JCOC 3AG4B 3ABMB 2N74A 1PD3A 5IJ0A 2Q0OC 2YI8A 2UXBB 3R66A 4WF9V 1R3KC 2WA3A 3E8HA 3JD4A 4IHJA 1HR0O 4PHZA 2C2AA 3SJBC 5GONB 2MW2B 2WLLB 3MDSA 2GHYA 4LH7A 1SA0B 2WLIB 2JGDA 1GTOA 3SPIA 4N21A 3TXSA 1HNWB 2D3OW 2Y69B 3ZN0A 5B3SB 4UCVA 5EZYA 1M93A 4D7TA 4WBNB 1H2NA 2EIKB 4DRXB 1OCZC 5GW7A 1GN3A 3CSXA 4JAVA 2QR4A 2BOCC 3A2FA 3G4SV 3EVKA 4L8JA 2WLNA 2W0FC 1E1RG 4DK1A 2UXDO 1AR4A 3IAYA 1BL8A 4FPPA 2ARHA 5KA6A 4GYCB 4JI6B 1QQCA 2EZPA 3RYIA 2QGNA 1FXKC 1COWG 4DUZB 1NR1A 5CA0B 4U3JA 2QEXV 2Z5UA 4JAAA 2ZQMA 3UT5A 2ITCC 3CWBH 1FPOA 2QE7G 2JEUA 1YJNV 3HKCB 1DF4A 1D5AA 1WPXA 1ZL8A 4DV3O 3HKEB 4JI3B 1OCRC 1HP8A 4TUYA 1SQGA 4QPJA 4MW8A 3T1HB 4ZOLA 1OCCC 2PI5A 1K92A 3L9DA 1NZ6A 1XNQB 3QF7A 2P6JA 3CXHF 3OR6C 3L72H 1AJQA 3ML0A 2NR5A 4ZBMA 2IU0A 4TT3G 3JAMN 2BCCH 4MVOA 4JI6O 2LW7A 1YF2A 1IBLO 4CH6A 3TXQA 1YXBA 5DM6V 4OX9B 1VMGA 2BTOA 4AHCA 2F4VB 1FD9A 2XOKG 3D3QA 4CC6A 4O4HA 4O4LA 2HHHB 4G2KA 3JARA 5GTHZ 4HZ3A 2A3QA 4ABMA 5B1OA 3JALB 1KQSU 1JX9A 2P7TC 2W0XA 3GWOA 5CA1B 3C90A 1XL4A 4QNHB 5IYCO 4IGGA 1BHAA 4UB8Z 3ICXA 1M90W 2A7WA 2H3OA 2DYSB 4GLXA 3NR7A 3WB2A 3KG2A 4X1IB 4JYBA 4DV2B 3CS5A 2PYLA 3K59A 4LNUB 2JEXA 2CTQA 5L3EA 3TGUH 1K5QA 2DE0X 4NVPA 3M8AA 3JAWA 4CS4A 4XBFA 1TVKB 1NH2D 3HKDB 3OGIB 4B3RB 4CH3A 3WFVA 1F7YA 1L0NH 3D3IA 2OT5A 4A5UB 1V55B 3GB7C 4QPKA 2OIGA 1VQ9V 5DEDA 2KQXA 1R6NA 1Q90D 2RMKB 1HWYA 2Z0AA 3BABA 1JJOA 1KP2A 2JJ2G 1SQBH 2WWWA 3P32A 3RYFB 3H01A 3E2EA 5FPRA 2ZXWC 1VARA 3K3WA 1YITV 5LP6C 1I94B 4MTFA 3JCUZ 1F4MA 2G38A 4DV2O 4I50B 2R70A 4H13B 4HYOA 4J7ZA 3ZMVA 1M9NA 3ASNB 3KZIZ 4QE7A 1Z2GA 1GN6A 3S3WA 2QKCA 3BRCA 4FM1A 2ZR3A 2FB5A 2ZE5A 5JJEB 5CB4B 4WFAV 2JS3A 4GX0A 4PA7A 1HNWO 2EZOA 4I4TA 4Z1MG 3K58A 1EFRG 2RCVA 3AK1A 3THOA 5D5QA 3AK2A 4PI0A 4JTAB 2IJJA 4B7EA 5KMGB 4UVCA 3WU2Z 4ZI7B 2D2CB 3ABTA 4MVRA 4NTWA 3CCJV 2ZE6A 5BZBA 1YDXA 1OZ0A 4J11A 4WFFA 4MW3A 4NB5A 3OAAG 2Y0PA 5JH7B 2MK3A 4H0LB 4OGQB 3BA9A 5AG2A 5C8YA 1H2LA 4R6ZA 4LP8A 4G28B 1HDJA 3JASA 1AVMA 2DWEC 2F95B 1IURA 1WAZA 3ZJZA 3SYPA 4JI0B 2P90A 3LDEA 5LA6B 1PV0A 2LGQA 3IJ4A 2F43G 2ZNIA 4FFKA 1XHZA 2CK3G 3FB7C 3K0GA 1FXKA 2HJFC 4FVMA 1V55C 2HG5C 4JI3O 2FYUH 3ZRVA 5ITZB 4U3JB 2KG7A 1K97A 3CE2A 2XNDG 5LYJB 4DV6B 5J2TB 4NXNO 1Q8IA 2XAQA 1FJGO 4B7KA 1LNQA 1SQVH 4B3SB 1MSDA 4JV5O 2VQFO 4TUYB 3A0BZ 4JI7O 2EILB 2QTSA 4DW0A 3ABKB 4DR1O 2RJZA 4BWAA 1AI5A 1OCOB 2BTQA 4UV9A 4JYCA 2F66C 2UXCB 2HLDG 1HNXO 4FLUA 4KHPO 3AG1C 4PA4A 1YHQV 3MD0A 3F5WC 4F6EA 1NQTA 1VQ6V 5IDJA 2VWKA 1KKCA 4MS2A 2EBOA 3IC9A 4GX5A 5LMUO 1A32A 3OUSA 1DTOA 4DV6O 3TK1A 1EN6A 5CN0A 1AB3A 2BSKA 1GM8A 5JVDA 1H8EG 3K0DA 2GDSA 4JV5B 3KCYA 4P2ZA 3ZRWA 3OE7G 2YUAA 5J2TA 1VIBA 1MABG 3IFXA 1Q7YW 4WFHA 4YJ3A 5LHGA 1OJHA 3RYHB 2UXCO 3OFNG 1NVPD 1VQOV 3JAWB 4HNAB 3EHBB 3M99B 4LF5O 1GN4A 1U97A 3UKMA 3O65A 1K73W 5KHIA 4X89A 5K1XA 4JI5B 5HFLA 3GVMA 1BMFG 4LCUC 1UJWB 4DR3O 1ZTEA 3B4SA 2ZDIC 5H9CA 4CZZA 2Y4TA 3ASNC 1VF6C 1KB9F 1PM9A 5IJ9A 2JIZG 1KMIZ 1YJWV 4DR2B 2VS0A 4JI4O 5LGUA 2YI9A 3Q4HB 1X4TA 1Y67A 1ZSPA 4JGSA 3FB5C 3DC6A 4L87A 5KX5A 1RFYA 2B9ZA 2HJDA 1VQ8V 2Y0IA 3QTCA 4GKJO 1BE3H 5IT9N 4HBNA 5JWPA 2EINB 3CCRV 1SETA 3C3SA 4EFEA 4AQYO 5CBFA 1PL0A 2WAMA 3TCUA 2QWOB 3JATB 3B09A 3RYIB 3LSUA 3UT5B 1VQ5V 2FMLA 1RM1B 5J2UA 3BPZA 5LP6A 1QBZA 1M57C 3A0RA 5FNVA 4HNAA 4DV5B 3CMAV 1Y76A 1H2KA 1SQFA 2XAFA 4FMTA 1CXZB 4DYLA 4DR2O 1WPBA 3K03A 5KHJA 1AI4A 3JSLA 1BGYH 3T1CA 4J7JA 3UM7A 3QVNA 3CXCU 3CC7V 2E76B 1KP3A 1XNRB 1Q81W 3KKYA 3RFRA 5B1AB 4RQEA 4WFEA 1S5JA 1N33B 3ABMC 3F7YC 5B3SC 3SGIA 3UCSC 4XDJA 4X1YB 4ICGA 1YI2V 1JCHA 3CD6V 2B1GA 2UU9O 3EFFK 3G80A 4LC1A 5B1BC 3D36C 3ZN1A 1NKDA 2PYJA 4GKKO 2IH1C 1MA1A 1OHHG 3PN1A 4EB6A 5EYPB 1NBMG 3FB8C 3W7WA 3RYFA 1MOFA 3GWKC 4IL6Z 4YJ2A 4FZ0A 1ZX3A 3ABLC 3N27A 4JI7B 2EJ7A 4X20B 1AROP 3LSQA 2QKAA 5HFMA 2YC0A 1KU9A 2IJHA 1QCEA 3CCVV 2P67A 3NXSA 1RM1C 1NTZH 4DR4B 4U7NA 4J80A 4GCZA 3ZRXA 1R3IC 3BFRA 2FL4A 2YXHA 3RWRD 4NR1A 4IIJB 5FLXN 4FLZA 3ETEA 4C7UA 1H8HG 1SA0A 2WLIA 4CS2A 1US6A 1OV9A 3K9SA 4UVBA 3ZMSA 3K5MA 4UCRA 3ZHUA 2Q0AA 5LMUB 2ZM6B 3DGEA 1G1XB 5IWAO 1Q3EA 1VQMV 3E8FA 1D5NA 2P22C 1JR9A 2EIMC 4K0KO 4HAMA 1QNMA 3VOUA 1RSOA 2H8PC 2XTAA 1T5EA 2AHZA 4X1YA 4JI2B 3OW2U 1RPOA 2QWRB 1P49A 1NT2B 2UUCO 4ZIBA 4LWSB 2ZNJA 3DXRA 2YIDA 4ASUG 1KD1W 4O4IB 3OGCC 3T1YO 3BA8A 4LF5B 5LA6A 1EN4A 4O2BA 5LL6Y 2UUBB 1V9PA 2BOBC 1S76D 2DN9A 1N34O 1MNGA 1S5HC 5CA0A 1IVSA 3L70H 4DV4O 4X65B 4Q20A 2LP7A 1ZL8B 4RO2A 4LF6O 4CH5A 2Z3YA 1AI7A 3OT7A 1OCOC 4QIWF 3SPCA 1AR1B 2P4KA 2DOSA 5CA3A 1SQPH 1M56B 1QLEC 3HKBA 2Q69A 3DTUB 4J10A 3K06A 5DN6G 5KUKA 3C3TA 4R50A 2V7QG 3OTOO 2IJIA 4XDKA 3JAKA 1I0HA 2CTWA 2WPDG 3MHSC 4EFBA 1IBLB 4O4JB 4PA9A 4B3MO 1SZXA 4OX9O 2QKSA 2X7RB 3AG3B 4FK5C 3RYCB 4LF4O 1P84F 4UCOA 2HHHO 3ZMTA 4NXMB 1QLEB 4F6RA 4LF8B 1F51A 3BEHA 3KCXA 4MVUA 4TV9A 4W4KA 2A0LA 3RVZA 5IYZB 1NI8A 3PJSK 4CH4A 4FLVA 5CA1A 4X65O 2CH7A 5KHKA 3CX5F 4FLXA 3JATA 2JS5A 3G6EV 3OMAB 3JALA 2E5LO 3ZIAG 5L3DA 1JFFB 4X8AA 4PI2A 1RPRA 1URFA 5IJ0B 1GK9A 4E2LA 1YSCA 5H2FZ 1JMKC 1Y66A 2DYSC 2WSSG 4I5SA 3UO2A 3SYOA 3ZHRA 1YZBA 4LBEC 1TVKA 4UCUA 4J7KA 1XQ8A 2EX3A 2YSUB 1MZFA 2HVJC 2ZD9A 2HKOA 3BHPA 3E89A 4BIOA 3HKEA 2AGAA 1B3QA 2EIMB 2HP8A 3CRAA 1M56C 4BIZA 3H1IH 4NXMO 1O9GA 3U11A 1UFIA 2YIAA 4PA6A 4WCEV 1P7BA 1H2GA 1AI6A 5KLVH 3VBBA 2BE3A 3E35A 1H38A 4DUYB 3BCCH 5BMVB 1QLNA 3OM3B 1I94O 4W4LA 3CCSV 4P9PA 3CRRA 3HPLC 1RSOB 5CBHA 4J9ZB 2DW4A 1SQXH 2NNUA 4DR4O 3AG2B 2OIEA 2X0LA 3E22A 1FXHA 2CE4A 2K9PA 5B66Z 2ZIMA 2JVDA 4O4IA 3FAVA 2Q7GA 2R9RB 3D8CA 1KKDA 4R8CA 1ZWIC 2VQEB 1IXBA 1GO3F 2RNBA 2P5OA 4I4TB 3APQA 2Q68A 3CJHB 1KYOF 4DV1B 1IBKO 4P9OA 2Y48A 3ASOB 2ZE7A 4FFBA 1GAXA 5EBLC 4IYIA 4DR6B 1GM9A 3JD1A 3N2GB 3SYQA 5BR8B 2JJ1G 5B1AC 4DUYO 5EBWC 2AW9A 1RP3B 3JD3A 4G27B 1U96A 5IJ9B 4RAIA 4JZ2A 3UQ8A 4JI0O 1R6KA 4PDLA 2DJVA 3I55V 2F4VO 5L3BA 2Y4UA 1N8RW 3T1YB 1FFXA 4D6TH 4O4LB 1EZVH 1N4CA 3ABUA 2CAZC 5KHGA 3P3PA 1Z5VA 1J95A 3SJAC 1AR5A 2Q4PA 1IBMB 4DV4B 2IJKA 1FAFA 5KHHA 4FM0A 4J9YB 3I56V 5A9GA 1FJGB 2HEPA 3B40A 4KUMA 2ADQB 3OEHG 1PNKA 3CCQV 4I55A 2ZCEA 1P7GA 4B08A 1XI1A 4MVQA 4DV1O 1IBKB 1XOUA 3CCLV 1K3EA 4MVZA 2F23A 1MZEA 1AJNA 2GUZA 1Y76B 2L6LA 1R3LC 1ROPA 5BR8O 2ETNA 3A0HZ 4DV7B 1XBLA 1JFFA 1M57B 1VF6A 1FYJA 4PJ0Z 1Y74A 1O9HA 1EZJA 2UXNA 1W0KG 4U3FH 4BW9A 4LFCO 2ZE8A 4LF8O 5FPOA 2XASA 4JAUA 1LR1A 1I7FA 5IYBO 3HR0A 2EINC 1TUBA 2IW5A 5JQGB 1CPYA 1ORQC 2YS8A 1XUQA 3X2QC 4BW5A 3K5LA 3RW0A 1E1QG 5LGTA 2OTLV 2OCCC 2XT9A 5GTIZ 2NN4A 5C8YB 3L74H 3CB2A 2ATKC 3L71H 5JH7A 5KA5A 3K08A 3X2QB 3L73H 4UCTA 1VQ4V 2QSAA 4TOIA 1OCZB 4JI8B 4WFBV 1Q82W 4YJ2B 4JYAB 1OCRB 4DXWA 3CCUV 4I9QA 4RUFA 4PA3A 5ITZA 4UB6Z 2LFRA 2DYRC 3QO8A 3G71V 2QTOA 3ZEDA 1JJ2U 1Q6UA 4O2AA 4DR3B 5J2UB 2X6CA 4ZHQB 4DR5O 3AG7A 5FNVB 4K8ZA 5LOVB 4B3TO 4TQDA 1ZAUA 3FB6C 4TSFG 1JVMA 3U10A 1D2DA 3SPHA 5J9PC 2Y69C 2KB1A 3BAAA 1PNMA 3VQWA 3CRMA 4RWUA 1BHBA 2L35A 2JGUA 1IXMA 3U0ZA 2CUGA 2OYQA 4GKJB 3CPWU 1GM7A 4YHHO 4BR6A 5EZYB 1NTMH 2V4DA 2EIKC 1WP7A 4AQYB 4LR3A 4H33A 5D5PA 1XL6A 1BSMA 3ABKC 4JYYA 4LH6A 2KKWA 1Q43A 2ADPA 1NTKH 1TAEA 4MTGA 1GRJA 3T4ZA 2LFSA 2Q7EA 3J81N 2ZT9B 4GUNA 3N2KB 3RT3C 4NXNB 1MG1A 1K33A 1KUQA 2RDCA 3E8GA 3E22B 1JQ0A 4QGPA 3OD4A 4B3SO 4DV5O 2VQFB 3STLC 2AZ2A 4YIPA 2N05A 2ITDC 4MSWC 1K9MW 2PTMA 1VQLV 3OUFA 5GONA 3AG4C 4I9WA 3LNMB 4AILC 2XAJA 2BTQB 4LFAB 4Q6GA 1HNZB 5EBMC 1HNXB 1PNLA 4GX2A 2R9IA 3AK3A 1R1BA 4JTDB 2WLLA 4YHHB 5LMNO 3CC4V 4XDLA 1L8DA 3CHXA 1AILA 3M7MX 1SF9A 3ZHTA 2PI4A 3F5TA 1BZKA 4MVMA 2YIBA 1IDSA 1SQQH 1G4YB 3RBZA 4YY3O 4GKKB 2PUSA 1FKAO 1K4CC 1R3JC 5LGNA 5L3CA 2LW1A 3W7TA 4FLYA 3WG7C 4GX1A 4UUJC 3SYAA 3RN4A 1V54C 2PZSA 3ZHQA 1S5LZ 3QO7A 4DV7O 4X20A 1SKVA 4JZGA 4DR7O 4TQFA 2E74B 2F1MA 2IH3C 3TETA 3B8MA 1R6TA 1N32B 2HFEC 1EBOA 4X62O 2ZKOA 4NYKA 4O4HB 1XILA 2DMXA 2GTAA 2ZDIA 3QNEA 3K57A 5LMNB 3IC7A 5EK0A 1WA8A 3SJQC 4KFMA 3HKCA 1K4DC 2AXTZ 3WB0A 4UFZA 2ZXWB 2E3CA 3CEIA 4KL1A 3ZHVA 2ZM6O 1GKFA 4GZRB 4JI4B 1I5YA 4PD4F 2OCHA 2M7WA 1H2SB 3F7VC 4DW1A 5KMGA 3SPGA 5IWAB 5EC1C 2WLMA 4YY3B 2LQTA 5C93A 4ZHQA 3ZHSA 4NTYA 3WG7B 4IT5A 4JPRA 4X64O 3B8NA 3JASB 5JCOA 3APOA 3FFQA 2XUMA 1N32O 3QO5A 4R7CA 3ETGA 1VF7A 3L75H 2Q8VA 4WBNA 3K9AA 1BQ0A 4UV8A 1J5EB 2UUBO 4H37A 1LUVA 4X1IA 1XMQB 1PPJH 4LF6B 1N0JA 5E79Z 1EN5A 4B3TB 4F4LA 1W2BU 3LNNA 4UVAA 1TA8A 4LF7B 2UXDB 1WA8B 4TV8A 1DLBA 4OPAA 3JD0A 4X64B 5IY5C 2V1DA 2IM9A 1VF5B 4DUZO 3K04A 1N36O 1I5XA 2UUAB 1N33O 1S77D 3CMEV 4MVSA 3FKSG 1VEWA 2JRIA 3K5NA 4DRXA 1G8MA 1YJ9V 2UU9B 5B5EZ 3B2EE 3H1LH 3MAQA 2WA4A 1J5EO 5JJNB 3T1HO 5KAFZ 4ZI7A 3E83A 2YDEA 3RYCA 5KAIZ 3W7XA 2DYRB 1FFXB 2EJRA 4MTOA 1V54B 4ZKIA 2QDOA 4E4EA 2E5LB 4I50A 2JDIG 1R73A 1SRYA 3SPJA 3Q4HA 2A79B 5IYZA 1JA8A 4J42A 5CB4A 4PDMA 5LHIA 4LFAO 1P4RA 3JARB 1HNZO 5L3FA 1OCCB 2YXYA 3W7UA 4I0XA 1QHTA 1L1FA 1CEZA 1Q6HA 2YIBD 4FLTA 1QVGU 1NS1A 3ZMUA 2CGOA 3ABLB 1NR7A 2ZIOA 1CP9A 5LYJA 2HR3A 3BVOA 2OCCB 2Q67A 2ZR2A 3R65A 1TGOA 1S0VA 4DK0A 4QE9A 3CCEV 3FAVB 4UXNA 1TUEB 3FYEB 4IHJB 1B04A 2QM7A 1WNSA 4JF3A 4MTXA 3CJHA 2DQ0A 4K0KB 2EIJB 1F4NA 2QA4V 1AJPA 3OEEG 1ENVA 4JI1B 2P4VA 5H5NA 3P3NA 4GT1A 3LSSA 1XEQA 2YEVA 1AP6A 1FS0G 1XDCA 2GBOA 5EC2C 5IE9A 4JI2O 3E86A 4LF9O 3HKBB 3H1KH 3OTFA 3VQXA 4DR7B 1VQNV 1YCIA 1FXKB 2WLHA 1Z5WA 3ZCCA 2QM8A 4KHPB 1K8AW 4LWSA 3T2MA 4DV0B 2Q9LA 2PGGA 4I0XB 4OXSA 5IYDO 5JVDB 1GN2A 2VQEO 3ZRSA 3SR2C 5IY5B 5LHHA 4FJCC 3ZBHA 3H1HH 5EYPA 1DK1A 1THZA 3CP1A 3STZC 2JK5C 3I5DA 2EIJC 3OTOB 4JI1O 3TJTA 3ZX6A 2DWDC 1F23A 5BXZA 4O2AB 4I7ZB 3HKDA 3AG1B 3BY6A 5CMUA 4LF9B 2CTPA 4RUEA 4UCSA 4B3MB 3IGAC 3N2GA 2XHBA 1KBHA 1M5IA 4KXRA 1NH2B 3H9VA 1BCCH 2LO1A 1WB7A 3JYCA 1WB8A 1DGSA 1ZUQA 4X66O 1DF5A 2A9HA 2YXLA 5EIBD 4JI5O 4DV0O 5H6QA 1FFTB 1H2MA 4FIPC 4TV9B 1Q86W 1Y4MA 2A06H 4PV1B 1XMQO 2PF4E 3JCZA 1N0NA 4F6RB 5TISZ 4EKWA 3JSNA 3ZS8C 4X88A 4CC5A 1XHXA 2HVKC 3OMNB 4LF7O 1Q6IA 4RQFA 1K7DA 3DSQA 2Q5ZA 2UXXA 1GMGA 3H1JH 2X6AA 3RYHA 4EEQA 2GUZB 2RQ6A 4X1KA 1IZ3A 1LUWA 1YTFD 3QG5A 2YICA 1VQ7V 1N36B 1GH6A 2IBZH 1WLEA 2NLJC 1K34A 1KC8W 1MMMA 2UUAO 2KSDA 1BQZA 2OTJV 4K3AA 4IIJA 1Y74B 2EULA 5LXTB 3FD9A 2Q7HA 4ZOLB 2ILMA 1PP9H 1BS3A 4BAYA 2XAHA 3DC5A 3E8BA 1I08A 3LDDA 4JASA 2AZ0A 5KUMA 4FFBB 3VQYA 1SZTA 3CRCA 1L0LH 1SERA 2WLJA 3W7SA 2O57A 1YIJV 3S3XA 3J80N 4DR1B 2QWNB 3EXAA 5JQGA 2DQ3A 2GTSA 1WJZA 4CS3A 5KX5B 4JTCB 1HR0B 2F93B 4DO2A 1YEWA 1JPXA 1QR8A 3CRQA 3CYOA 3DXRB 3G67A 4H44B 1JOYA 2XAGA 2LJ2A 4JI8O 1X59A 4PDRA 4O4JA 4QJFB 4FZ1A 2OWOA 5LP6B 3K5OA 2GSMB 2WLKA 4Z1VA 3OMIB 5LBQA 2CH7B
chains in the Genus database with same CATH topology
4KHPO 1HNWO 1XMQO 4AQYO 5BR8O 4OPHA 3SDLA 4B3MO 4LF7O 4OX9O 5H5NA 4DR6O 4DV7O 4DR4O 4YHHO 1FYJA 1XEQA 4JI2O 4LF4O 5FLXN 4OPAA 4DR7O 2HHHO 4LF9O 1R6TA 5LMUO 2UXBO 1A32A 4DUZO 2FKXA 1N36O 2UXDO 4DV6O 4X62O 2ZKOA 4LFCO 4LF8O 1G1XB 1AB3A 1N33O 3M8AA 4X65O 5IWAO 3J81N 2UUAO 4DR2O 4B3RO 2JRIA 3RT3C 2E5LO 1XNRO 4K0KO 4JYAO 1IBKO 1KUQA 1J5EO 3T1HO 4B3SO 5BY1A 4DV5O 2ZM6O 1F7YA 1IBMO 5A2QN 4A5UB 2UXCO 2VQEO 4DUYO 2UUCO 4DV3O 4LF5O 1YZBA 1XNQO 1XMOO 1DK1A 3T1YO 4X64O 4JI3O 3O65A 4JI0O 2DJVA 2Z0AA 2F4VO 3J80N 5LL6Y 3J7AU 4LFAO 4JI1O 1R1BA 5BXZA 4DR3O 4NXNO 1HNZO 1FJGO 2N74A 1N34O 2UU9O 5LMNO 2AGAA 4DV4O 4NXMO 4JV5O 1N32O 3R66A 4GKKO 2VQFO 1AILA 4LF6O 4JI4O 4DV2O 1HR0O 1NS1A 3JAMN 4JI7O 3F5TA 4JI8O 4DR1O 1X59A 2DOSA 2UUBO 4JI6O 2LW7A 4X66O 1IBLO 4DR5O 4GKJO 4B3TO 4YY3O 4DV1O 5IT9N 1HNXO 3OTOO 4JI5O 1FKAO 4DV0O 4LFBO 1I94O 1D2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP O;  1HNW O;  1XMQ O;  4AQY O;  5BR8 O;  4OPH A;  3SDL A;  4B3M O;  4LF7 O;  4OX9 O;  5H5N A;  4DR6 O;  4DV7 O;  4DR4 O;  4YHH O;  1FYJ A;  1XEQ A;  4JI2 O;  4LF4 O;  5FLX N;  4OPA A;  4DR7 O;  2HHH O;  4LF9 O;  1R6T A;  5LMU O;  2UXB O;  1A32 A;  4DUZ O;  2FKX A;  1N36 O;  2UXD O;  4DV6 O;  4X62 O;  2ZKO A;  4LFC O;  4LF8 O;  1G1X B;  1AB3 A;  1N33 O;  3M8A A;  4X65 O;  5IWA O;  3J81 N;  2UUA O;  4DR2 O;  4B3R O;  2JRI A;  3RT3 C;  2E5L O;  1XNR O;  4K0K O;  4JYA O;  1IBK O;  1KUQ A;  1J5E O;  3T1H O;  4B3S O;  5BY1 A;  4DV5 O;  2ZM6 O;  1F7Y A;  1IBM O;  5A2Q N;  4A5U B;  2UXC O;  2VQE O;  4DUY O;  2UUC O;  4DV3 O;  4LF5 O;  1YZB A;  1XNQ O;  1XMO O;  1DK1 A;  3T1Y O;  4X64 O;  4JI3 O;  3O65 A;  4JI0 O;  2DJV A;  2Z0A A;  2F4V O;  3J80 N;  5LL6 Y;  3J7A U;  4LFA O;  4JI1 O;  1R1B A;  5BXZ A;  4DR3 O;  4NXN O;  1HNZ O;  1FJG O;  2N74 A;  1N34 O;  2UU9 O;  5LMN O;  2AGA A;  4DV4 O;  4NXM O;  4JV5 O;  1N32 O;  3R66 A;  4GKK O;  2VQF O;  1AIL A;  4LF6 O;  4JI4 O;  4DV2 O;  1HR0 O;  1NS1 A;  3JAM N;  4JI7 O;  3F5T A;  4JI8 O;  4DR1 O;  1X59 A;  2DOS A;  2UUB O;  4JI6 O;  2LW7 A;  4X66 O;  1IBL O;  4DR5 O;  4GKJ O;  4B3T O;  4YY3 O;  4DV1 O;  5IT9 N;  1HNX O;  3OTO O;  4JI5 O;  1FKA O;  4DV0 O;  4LFB O;  1I94 O;  1D2D A; 
#chains in the Genus database with same CATH topology
 1E79 G;  4AI8 A;  2LGW A;  4OPH A;  3MHH C;  1W59 A;  1NJI W;  1VP7 A;  4EB6 B;  3SDL A;  2VWJ A;  4LNU A;  4DR6 O;  3K79 A;  2ODM A;  1IX9 A;  2H94 A;  3UO3 A;  2GV9 A;  4CBC A;  3AG3 C;  4I55 B;  5DEC A;  3ASO C;  3O9O A;  1S72 V;  1B6Q A;  5FL7 G;  1MSW D;  2Q6A A;  3ETQ A;  1M1K W;  5LOV A;  4NKG B;  2B1I A;  2AHY A;  3D36 A;  5JJJ B;  3RGB A;  3CCM V;  2YEV B;  1W0J G;  1QR9 A;  2E75 B;  2W6I G;  4P30 A;  3VQV A;  1VQP V;  3FYI B;  2R9A A;  2EIL C;  1QU7 A;  2X6B A;  5BY1 A;  1BT8 A;  3AG2 C;  4BIU A;  5EIB C;  1WN7 A;  4DV3 B;  1IBM O;  1FXV A;  1Y6X A;  4KP4 A;  4PEL A;  1TUB B;  4MT8 A;  3LDC A;  2N04 A;  5K1P A;  3N2K A;  1XNQ O;  4IYH A;  1XMO O;  4YIO A;  5L3G A;  2BSK B;  3SJC C;  5BMV A;  4YXW G;  1YVW A;  3HB3 B;  1Q5O A;  2W6J G;  3J7A U;  4FM2 A;  1SC5 B;  4J41 A;  1VQK V;  2B5U A;  4FLW A;  1B06 A;  3JD2 A;  2QWP B;  4TV8 B;  4O2B B;  2UUC B;  2R72 A;  1PL4 A;  3WB1 A;  2QM4 A;  5B1N A;  1WP8 A;  4N23 A;  2KG7 B;  1NU1 H;  5F2V O;  5CBG A;  5E1A C;  4PDV A;  4X66 B;  4LFC B;  3RVY A;  2PY5 A;  4LFB O;  3OR7 C;  2CGN A;  2IU3 A;  4D7S A;  4NTX A;  1N34 B;  1SES A;  1YTF B;  1KEC A;  5LXT A;  2FTK A;  3P30 A;  1ZLZ A;  2Q73 A;  1HW7 A;  1XMO B;  2CDY A;  2JGD B;  2QJ1 A;  3JAK B;  3T4D A;  2UXB O;  2ZIN A;  1G6U A;  2FKX A;  2CTR A;  2QWQ B;  3SYC A;  3ETD A;  4K35 A;  5H6R A;  3FX7 A;  3CC2 V;  4B3R O;  1XNR O;  4JYA O;  3A8T A;  1QVF U;  1EM1 A;  3ZMZ A;  1M4U A;  4X62 B;  4X9Q A;  4X1K B;  4K8X A;  4LF4 B;  2RN9 A;  4TWK A;  2P06 A;  4U7O A;  1SS3 A;  4Z2W A;  4WFG A;  5A2Q N;  3LUT B;  3AEI A;  2M6Y A;  2K1E A;  4LFB B;  3B77 A;  4DR5 B;  1UPG A;  1XRE A;  1NVP B;  4YJ3 B;  5B1B B;  3G6B A;  1S3J A;  1AP5 A;  1K5S A;  1PKX A;  3ZRW B;  2VRZ A;  5JCO C;  3AG4 B;  3ABM B;  2N74 A;  1PD3 A;  5IJ0 A;  2Q0O C;  2YI8 A;  2UXB B;  3R66 A;  4WF9 V;  1R3K C;  2WA3 A;  3E8H A;  3JD4 A;  4IHJ A;  1HR0 O;  4PHZ A;  2C2A A;  3SJB C;  5GON B;  2MW2 B;  2WLL B;  3MDS A;  2GHY A;  4LH7 A;  1SA0 B;  2WLI B;  2JGD A;  1GTO A;  3SPI A;  4N21 A;  3TXS A;  1HNW B;  2D3O W;  2Y69 B;  3ZN0 A;  5B3S B;  4UCV A;  5EZY A;  1M93 A;  4D7T A;  4WBN B;  1H2N A;  2EIK B;  4DRX B;  1OCZ C;  5GW7 A;  1GN3 A;  3CSX A;  4JAV A;  2QR4 A;  2BOC C;  3A2F A;  3G4S V;  3EVK A;  4L8J A;  2WLN A;  2W0F C;  1E1R G;  4DK1 A;  2UXD O;  1AR4 A;  3IAY A;  1BL8 A;  4FPP A;  2ARH A;  5KA6 A;  4GYC B;  4JI6 B;  1QQC A;  2EZP A;  3RYI A;  2QGN A;  1FXK C;  1COW G;  4DUZ B;  1NR1 A;  5CA0 B;  4U3J A;  2QEX V;  2Z5U A;  4JAA A;  2ZQM A;  3UT5 A;  2ITC C;  3CWB H;  1FPO A;  2QE7 G;  2JEU A;  1YJN V;  3HKC B;  1DF4 A;  1D5A A;  1WPX A;  1ZL8 A;  4DV3 O;  3HKE B;  4JI3 B;  1OCR C;  1HP8 A;  4TUY A;  1SQG A;  4QPJ A;  4MW8 A;  3T1H B;  4ZOL A;  1OCC C;  2PI5 A;  1K92 A;  3L9D A;  1NZ6 A;  1XNQ B;  3QF7 A;  2P6J A;  3CXH F;  3OR6 C;  3L72 H;  1AJQ A;  3ML0 A;  2NR5 A;  4ZBM A;  2IU0 A;  4TT3 G;  3JAM N;  2BCC H;  4MVO A;  4JI6 O;  2LW7 A;  1YF2 A;  1IBL O;  4CH6 A;  3TXQ A;  1YXB A;  5DM6 V;  4OX9 B;  1VMG A;  2BTO A;  4AHC A;  2F4V B;  1FD9 A;  2XOK G;  3D3Q A;  4CC6 A;  4O4H A;  4O4L A;  2HHH B;  4G2K A;  3JAR A;  5GTH Z;  4HZ3 A;  2A3Q A;  4ABM A;  5B1O A;  3JAL B;  1KQS U;  1JX9 A;  2P7T C;  2W0X A;  3GWO A;  5CA1 B;  3C90 A;  1XL4 A;  4QNH B;  5IYC O;  4IGG A;  1BHA A;  4UB8 Z;  3ICX A;  1M90 W;  2A7W A;  2H3O A;  2DYS B;  4GLX A;  3NR7 A;  3WB2 A;  3KG2 A;  4X1I B;  4JYB A;  4DV2 B;  3CS5 A;  2PYL A;  3K59 A;  4LNU B;  2JEX A;  2CTQ A;  5L3E A;  3TGU H;  1K5Q A;  2DE0 X;  4NVP A;  3M8A A;  3JAW A;  4CS4 A;  4XBF A;  1TVK B;  1NH2 D;  3HKD B;  3OGI B;  4B3R B;  4CH3 A;  3WFV A;  1F7Y A;  1L0N H;  3D3I A;  2OT5 A;  4A5U B;  1V55 B;  3GB7 C;  4QPK A;  2OIG A;  1VQ9 V;  5DED A;  2KQX A;  1R6N A;  1Q90 D;  2RMK B;  1HWY A;  2Z0A A;  3BAB A;  1JJO A;  1KP2 A;  2JJ2 G;  1SQB H;  2WWW A;  3P32 A;  3RYF B;  3H01 A;  3E2E A;  5FPR A;  2ZXW C;  1VAR A;  3K3W A;  1YIT V;  5LP6 C;  1I94 B;  4MTF A;  3JCU Z;  1F4M A;  2G38 A;  4DV2 O;  4I50 B;  2R70 A;  4H13 B;  4HYO A;  4J7Z A;  3ZMV A;  1M9N A;  3ASN B;  3KZI Z;  4QE7 A;  1Z2G A;  1GN6 A;  3S3W A;  2QKC A;  3BRC A;  4FM1 A;  2ZR3 A;  2FB5 A;  2ZE5 A;  5JJE B;  5CB4 B;  4WFA V;  2JS3 A;  4GX0 A;  4PA7 A;  1HNW O;  2EZO A;  4I4T A;  4Z1M G;  3K58 A;  1EFR G;  2RCV A;  3AK1 A;  3THO A;  5D5Q A;  3AK2 A;  4PI0 A;  4JTA B;  2IJJ A;  4B7E A;  5KMG B;  4UVC A;  3WU2 Z;  4ZI7 B;  2D2C B;  3ABT A;  4MVR A;  4NTW A;  3CCJ V;  2ZE6 A;  5BZB A;  1YDX A;  1OZ0 A;  4J11 A;  4WFF A;  4MW3 A;  4NB5 A;  3OAA G;  2Y0P A;  5JH7 B;  2MK3 A;  4H0L B;  4OGQ B;  3BA9 A;  5AG2 A;  5C8Y A;  1H2L A;  4R6Z A;  4LP8 A;  4G28 B;  1HDJ A;  3JAS A;  1AVM A;  2DWE C;  2F95 B;  1IUR A;  1WAZ A;  3ZJZ A;  3SYP A;  4JI0 B;  2P90 A;  3LDE A;  5LA6 B;  1PV0 A;  2LGQ A;  3IJ4 A;  2F43 G;  2ZNI A;  4FFK A;  1XHZ A;  2CK3 G;  3FB7 C;  3K0G A;  1FXK A;  2HJF C;  4FVM A;  1V55 C;  2HG5 C;  4JI3 O;  2FYU H;  3ZRV A;  5ITZ B;  4U3J B;  2KG7 A;  1K97 A;  3CE2 A;  2XND G;  5LYJ B;  4DV6 B;  5J2T B;  4NXN O;  1Q8I A;  2XAQ A;  1FJG O;  4B7K A;  1LNQ A;  1SQV H;  4B3S B;  1MSD A;  4JV5 O;  2VQF O;  4TUY B;  3A0B Z;  4JI7 O;  2EIL B;  2QTS A;  4DW0 A;  3ABK B;  4DR1 O;  2RJZ A;  4BWA A;  1AI5 A;  1OCO B;  2BTQ A;  4UV9 A;  4JYC A;  2F66 C;  2UXC B;  2HLD G;  1HNX O;  4FLU A;  4KHP O;  3AG1 C;  4PA4 A;  1YHQ V;  3MD0 A;  3F5W C;  4F6E A;  1NQT A;  1VQ6 V;  5IDJ A;  2VWK A;  1KKC A;  4MS2 A;  2EBO A;  3IC9 A;  4GX5 A;  5LMU O;  1A32 A;  3OUS A;  1DTO A;  4DV6 O;  3TK1 A;  1EN6 A;  5CN0 A;  1AB3 A;  2BSK A;  1GM8 A;  5JVD A;  1H8E G;  3K0D A;  2GDS A;  4JV5 B;  3KCY A;  4P2Z A;  3ZRW A;  3OE7 G;  2YUA A;  5J2T A;  1VIB A;  1MAB G;  3IFX A;  1Q7Y W;  4WFH A;  4YJ3 A;  5LHG A;  1OJH A;  3RYH B;  2UXC O;  3OFN G;  1NVP D;  1VQO V;  3JAW B;  4HNA B;  3EHB B;  3M99 B;  4LF5 O;  1GN4 A;  1U97 A;  3UKM A;  3O65 A;  1K73 W;  5KHI A;  4X89 A;  5K1X A;  4JI5 B;  5HFL A;  3GVM A;  1BMF G;  4LCU C;  1UJW B;  4DR3 O;  1ZTE A;  3B4S A;  2ZDI C;  5H9C A;  4CZZ A;  2Y4T A;  3ASN C;  1VF6 C;  1KB9 F;  1PM9 A;  5IJ9 A;  2JIZ G;  1KMI Z;  1YJW V;  4DR2 B;  2VS0 A;  4JI4 O;  5LGU A;  2YI9 A;  3Q4H B;  1X4T A;  1Y67 A;  1ZSP A;  4JGS A;  3FB5 C;  3DC6 A;  4L87 A;  5KX5 A;  1RFY A;  2B9Z A;  2HJD A;  1VQ8 V;  2Y0I A;  3QTC A;  4GKJ O;  1BE3 H;  5IT9 N;  4HBN A;  5JWP A;  2EIN B;  3CCR V;  1SET A;  3C3S A;  4EFE A;  4AQY O;  5CBF A;  1PL0 A;  2WAM A;  3TCU A;  2QWO B;  3JAT B;  3B09 A;  3RYI B;  3LSU A;  3UT5 B;  1VQ5 V;  2FML A;  1RM1 B;  5J2U A;  3BPZ A;  5LP6 A;  1QBZ A;  1M57 C;  3A0R A;  5FNV A;  4HNA A;  4DV5 B;  3CMA V;  1Y76 A;  1H2K A;  1SQF A;  2XAF A;  4FMT A;  1CXZ B;  4DYL A;  4DR2 O;  1WPB A;  3K03 A;  5KHJ A;  1AI4 A;  3JSL A;  1BGY H;  3T1C A;  4J7J A;  3UM7 A;  3QVN A;  3CXC U;  3CC7 V;  2E76 B;  1KP3 A;  1XNR B;  1Q81 W;  3KKY A;  3RFR A;  5B1A B;  4RQE A;  4WFE A;  1S5J A;  1N33 B;  3ABM C;  3F7Y C;  5B3S C;  3SGI A;  3UCS C;  4XDJ A;  4X1Y B;  4ICG A;  1YI2 V;  1JCH A;  3CD6 V;  2B1G A;  2UU9 O;  3EFF K;  3G80 A;  4LC1 A;  5B1B C;  3D36 C;  3ZN1 A;  1NKD A;  2PYJ A;  4GKK O;  2IH1 C;  1MA1 A;  1OHH G;  3PN1 A;  4EB6 A;  5EYP B;  1NBM G;  3FB8 C;  3W7W A;  3RYF A;  1MOF A;  3GWK C;  4IL6 Z;  4YJ2 A;  4FZ0 A;  1ZX3 A;  3ABL C;  3N27 A;  4JI7 B;  2EJ7 A;  4X20 B;  1ARO P;  3LSQ A;  2QKA A;  5HFM A;  2YC0 A;  1KU9 A;  2IJH A;  1QCE A;  3CCV V;  2P67 A;  3NXS A;  1RM1 C;  1NTZ H;  4DR4 B;  4U7N A;  4J80 A;  4GCZ A;  3ZRX A;  1R3I C;  3BFR A;  2FL4 A;  2YXH A;  3RWR D;  4NR1 A;  4IIJ B;  5FLX N;  4FLZ A;  3ETE A;  4C7U A;  1H8H G;  1SA0 A;  2WLI A;  4CS2 A;  1US6 A;  1OV9 A;  3K9S A;  4UVB A;  3ZMS A;  3K5M A;  4UCR A;  3ZHU A;  2Q0A A;  5LMU B;  2ZM6 B;  3DGE A;  1G1X B;  5IWA O;  1Q3E A;  1VQM V;  3E8F A;  1D5N A;  2P22 C;  1JR9 A;  2EIM C;  4K0K O;  4HAM A;  1QNM A;  3VOU A;  1RSO A;  2H8P C;  2XTA A;  1T5E A;  2AHZ A;  4X1Y A;  4JI2 B;  3OW2 U;  1RPO A;  2QWR B;  1P49 A;  1NT2 B;  2UUC O;  4ZIB A;  4LWS B;  2ZNJ A;  3DXR A;  2YID A;  4ASU G;  1KD1 W;  4O4I B;  3OGC C;  3T1Y O;  3BA8 A;  4LF5 B;  5LA6 A;  1EN4 A;  4O2B A;  5LL6 Y;  2UUB B;  1V9P A;  2BOB C;  1S76 D;  2DN9 A;  1N34 O;  1MNG A;  1S5H C;  5CA0 A;  1IVS A;  3L70 H;  4DV4 O;  4X65 B;  4Q20 A;  2LP7 A;  1ZL8 B;  4RO2 A;  4LF6 O;  4CH5 A;  2Z3Y A;  1AI7 A;  3OT7 A;  1OCO C;  4QIW F;  3SPC A;  1AR1 B;  2P4K A;  2DOS A;  5CA3 A;  1SQP H;  1M56 B;  1QLE C;  3HKB A;  2Q69 A;  3DTU B;  4J10 A;  3K06 A;  5DN6 G;  5KUK A;  3C3T A;  4R50 A;  2V7Q G;  3OTO O;  2IJI A;  4XDK A;  3JAK A;  1I0H A;  2CTW A;  2WPD G;  3MHS C;  4EFB A;  1IBL B;  4O4J B;  4PA9 A;  4B3M O;  1SZX A;  4OX9 O;  2QKS A;  2X7R B;  3AG3 B;  4FK5 C;  3RYC B;  4LF4 O;  1P84 F;  4UCO A;  2HHH O;  3ZMT A;  4NXM B;  1QLE B;  4F6R A;  4LF8 B;  1F51 A;  3BEH A;  3KCX A;  4MVU A;  4TV9 A;  4W4K A;  2A0L A;  3RVZ A;  5IYZ B;  1NI8 A;  3PJS K;  4CH4 A;  4FLV A;  5CA1 A;  4X65 O;  2CH7 A;  5KHK A;  3CX5 F;  4FLX A;  3JAT A;  2JS5 A;  3G6E V;  3OMA B;  3JAL A;  2E5L O;  3ZIA G;  5L3D A;  1JFF B;  4X8A A;  4PI2 A;  1RPR A;  1URF A;  5IJ0 B;  1GK9 A;  4E2L A;  1YSC A;  5H2F Z;  1JMK C;  1Y66 A;  2DYS C;  2WSS G;  4I5S A;  3UO2 A;  3SYO A;  3ZHR A;  1YZB A;  4LBE C;  1TVK A;  4UCU A;  4J7K A;  1XQ8 A;  2EX3 A;  2YSU B;  1MZF A;  2HVJ C;  2ZD9 A;  2HKO A;  3BHP A;  3E89 A;  4BIO A;  3HKE A;  2AGA A;  1B3Q A;  2EIM B;  2HP8 A;  3CRA A;  1M56 C;  4BIZ A;  3H1I H;  4NXM O;  1O9G A;  3U11 A;  1UFI A;  2YIA A;  4PA6 A;  4WCE V;  1P7B A;  1H2G A;  1AI6 A;  5KLV H;  3VBB A;  2BE3 A;  3E35 A;  1H38 A;  4DUY B;  3BCC H;  5BMV B;  1QLN A;  3OM3 B;  1I94 O;  4W4L A;  3CCS V;  4P9P A;  3CRR A;  3HPL C;  1RSO B;  5CBH A;  4J9Z B;  2DW4 A;  1SQX H;  2NNU A;  4DR4 O;  3AG2 B;  2OIE A;  2X0L A;  3E22 A;  1FXH A;  2CE4 A;  2K9P A;  5B66 Z;  2ZIM A;  2JVD A;  4O4I A;  3FAV A;  2Q7G A;  2R9R B;  3D8C A;  1KKD A;  4R8C A;  1ZWI C;  2VQE B;  1IXB A;  1GO3 F;  2RNB A;  2P5O A;  4I4T B;  3APQ A;  2Q68 A;  3CJH B;  1KYO F;  4DV1 B;  1IBK O;  4P9O A;  2Y48 A;  3ASO B;  2ZE7 A;  4FFB A;  1GAX A;  5EBL C;  4IYI A;  4DR6 B;  1GM9 A;  3JD1 A;  3N2G B;  3SYQ A;  5BR8 B;  2JJ1 G;  5B1A C;  4DUY O;  5EBW C;  2AW9 A;  1RP3 B;  3JD3 A;  4G27 B;  1U96 A;  5IJ9 B;  4RAI A;  4JZ2 A;  3UQ8 A;  4JI0 O;  1R6K A;  4PDL A;  2DJV A;  3I55 V;  2F4V O;  5L3B A;  2Y4U A;  1N8R W;  3T1Y B;  1FFX A;  4D6T H;  4O4L B;  1EZV H;  1N4C A;  3ABU A;  2CAZ C;  5KHG A;  3P3P A;  1Z5V A;  1J95 A;  3SJA C;  1AR5 A;  2Q4P A;  1IBM B;  4DV4 B;  2IJK A;  1FAF A;  5KHH A;  4FM0 A;  4J9Y B;  3I56 V;  5A9G A;  1FJG B;  2HEP A;  3B40 A;  4KUM A;  2ADQ B;  3OEH G;  1PNK A;  3CCQ V;  4I55 A;  2ZCE A;  1P7G A;  4B08 A;  1XI1 A;  4MVQ A;  4DV1 O;  1IBK B;  1XOU A;  3CCL V;  1K3E A;  4MVZ A;  2F23 A;  1MZE A;  1AJN A;  2GUZ A;  1Y76 B;  2L6L A;  1R3L C;  1ROP A;  5BR8 O;  2ETN A;  3A0H Z;  4DV7 B;  1XBL A;  1JFF A;  1M57 B;  1VF6 A;  1FYJ A;  4PJ0 Z;  1Y74 A;  1O9H A;  1EZJ A;  2UXN A;  1W0K G;  4U3F H;  4BW9 A;  4LFC O;  2ZE8 A;  4LF8 O;  5FPO A;  2XAS A;  4JAU A;  1LR1 A;  1I7F A;  5IYB O;  3HR0 A;  2EIN C;  1TUB A;  2IW5 A;  5JQG B;  1CPY A;  1ORQ C;  2YS8 A;  1XUQ A;  3X2Q C;  4BW5 A;  3K5L A;  3RW0 A;  1E1Q G;  5LGT A;  2OTL V;  2OCC C;  2XT9 A;  5GTI Z;  2NN4 A;  5C8Y B;  3L74 H;  3CB2 A;  2ATK C;  3L71 H;  5JH7 A;  5KA5 A;  3K08 A;  3X2Q B;  3L73 H;  4UCT A;  1VQ4 V;  2QSA A;  4TOI A;  1OCZ B;  4JI8 B;  4WFB V;  1Q82 W;  4YJ2 B;  4JYA B;  1OCR B;  4DXW A;  3CCU V;  4I9Q A;  4RUF A;  4PA3 A;  5ITZ A;  4UB6 Z;  2LFR A;  2DYR C;  3QO8 A;  3G71 V;  2QTO A;  3ZED A;  1JJ2 U;  1Q6U A;  4O2A A;  4DR3 B;  5J2U B;  2X6C A;  4ZHQ B;  4DR5 O;  3AG7 A;  5FNV B;  4K8Z A;  5LOV B;  4B3T O;  4TQD A;  1ZAU A;  3FB6 C;  4TSF G;  1JVM A;  3U10 A;  1D2D A;  3SPH A;  5J9P C;  2Y69 C;  2KB1 A;  3BAA A;  1PNM A;  3VQW A;  3CRM A;  4RWU A;  1BHB A;  2L35 A;  2JGU A;  1IXM A;  3U0Z A;  2CUG A;  2OYQ A;  4GKJ B;  3CPW U;  1GM7 A;  4YHH O;  4BR6 A;  5EZY B;  1NTM H;  2V4D A;  2EIK C;  1WP7 A;  4AQY B;  4LR3 A;  4H33 A;  5D5P A;  1XL6 A;  1BSM A;  3ABK C;  4JYY A;  4LH6 A;  2KKW A;  1Q43 A;  2ADP A;  1NTK H;  1TAE A;  4MTG A;  1GRJ A;  3T4Z A;  2LFS A;  2Q7E A;  3J81 N;  2ZT9 B;  4GUN A;  3N2K B;  3RT3 C;  4NXN B;  1MG1 A;  1K33 A;  1KUQ A;  2RDC A;  3E8G A;  3E22 B;  1JQ0 A;  4QGP A;  3OD4 A;  4B3S O;  4DV5 O;  2VQF B;  3STL C;  2AZ2 A;  4YIP A;  2N05 A;  2ITD C;  4MSW C;  1K9M W;  2PTM A;  1VQL V;  3OUF A;  5GON A;  3AG4 C;  4I9W A;  3LNM B;  4AIL C;  2XAJ A;  2BTQ B;  4LFA B;  4Q6G A;  1HNZ B;  5EBM C;  1HNX B;  1PNL A;  4GX2 A;  2R9I A;  3AK3 A;  1R1B A;  4JTD B;  2WLL A;  4YHH B;  5LMN O;  3CC4 V;  4XDL A;  1L8D A;  3CHX A;  1AIL A;  3M7M X;  1SF9 A;  3ZHT A;  2PI4 A;  3F5T A;  1BZK A;  4MVM A;  2YIB A;  1IDS A;  1SQQ H;  1G4Y B;  3RBZ A;  4YY3 O;  4GKK B;  2PUS A;  1FKA O;  1K4C C;  1R3J C;  5LGN A;  5L3C A;  2LW1 A;  3W7T A;  4FLY A;  3WG7 C;  4GX1 A;  4UUJ C;  3SYA A;  3RN4 A;  1V54 C;  2PZS A;  3ZHQ A;  1S5L Z;  3QO7 A;  4DV7 O;  4X20 A;  1SKV A;  4JZG A;  4DR7 O;  4TQF A;  2E74 B;  2F1M A;  2IH3 C;  3TET A;  3B8M A;  1R6T A;  1N32 B;  2HFE C;  1EBO A;  4X62 O;  2ZKO A;  4NYK A;  4O4H B;  1XIL A;  2DMX A;  2GTA A;  2ZDI A;  3QNE A;  3K57 A;  5LMN B;  3IC7 A;  5EK0 A;  1WA8 A;  3SJQ C;  4KFM A;  3HKC A;  1K4D C;  2AXT Z;  3WB0 A;  4UFZ A;  2ZXW B;  2E3C A;  3CEI A;  4KL1 A;  3ZHV A;  2ZM6 O;  1GKF A;  4GZR B;  4JI4 B;  1I5Y A;  4PD4 F;  2OCH A;  2M7W A;  1H2S B;  3F7V C;  4DW1 A;  5KMG A;  3SPG A;  5IWA B;  5EC1 C;  2WLM A;  4YY3 B;  2LQT A;  5C93 A;  4ZHQ A;  3ZHS A;  4NTY A;  3WG7 B;  4IT5 A;  4JPR A;  4X64 O;  3B8N A;  3JAS B;  5JCO A;  3APO A;  3FFQ A;  2XUM A;  1N32 O;  3QO5 A;  4R7C A;  3ETG A;  1VF7 A;  3L75 H;  2Q8V A;  4WBN A;  3K9A A;  1BQ0 A;  4UV8 A;  1J5E B;  2UUB O;  4H37 A;  1LUV A;  4X1I A;  1XMQ B;  1PPJ H;  4LF6 B;  1N0J A;  5E79 Z;  1EN5 A;  4B3T B;  4F4L A;  1W2B U;  3LNN A;  4UVA A;  1TA8 A;  4LF7 B;  2UXD B;  1WA8 B;  4TV8 A;  1DLB A;  4OPA A;  3JD0 A;  4X64 B;  5IY5 C;  2V1D A;  2IM9 A;  1VF5 B;  4DUZ O;  3K04 A;  1N36 O;  1I5X A;  2UUA B;  1N33 O;  1S77 D;  3CME V;  4MVS A;  3FKS G;  1VEW A;  2JRI A;  3K5N A;  4DRX A;  1G8M A;  1YJ9 V;  2UU9 B;  5B5E Z;  3B2E E;  3H1L H;  3MAQ A;  2WA4 A;  1J5E O;  5JJN B;  3T1H O;  5KAF Z;  4ZI7 A;  3E83 A;  2YDE A;  3RYC A;  5KAI Z;  3W7X A;  2DYR B;  1FFX B;  2EJR A;  4MTO A;  1V54 B;  4ZKI A;  2QDO A;  4E4E A;  2E5L B;  4I50 A;  2JDI G;  1R73 A;  1SRY A;  3SPJ A;  3Q4H A;  2A79 B;  5IYZ A;  1JA8 A;  4J42 A;  5CB4 A;  4PDM A;  5LHI A;  4LFA O;  1P4R A;  3JAR B;  1HNZ O;  5L3F A;  1OCC B;  2YXY A;  3W7U A;  4I0X A;  1QHT A;  1L1F A;  1CEZ A;  1Q6H A;  2YIB D;  4FLT A;  1QVG U;  1NS1 A;  3ZMU A;  2CGO A;  3ABL B;  1NR7 A;  2ZIO A;  1CP9 A;  5LYJ A;  2HR3 A;  3BVO A;  2OCC B;  2Q67 A;  2ZR2 A;  3R65 A;  1TGO A;  1S0V A;  4DK0 A;  4QE9 A;  3CCE V;  3FAV B;  4UXN A;  1TUE B;  3FYE B;  4IHJ B;  1B04 A;  2QM7 A;  1WNS A;  4JF3 A;  4MTX A;  3CJH A;  2DQ0 A;  4K0K B;  2EIJ B;  1F4N A;  2QA4 V;  1AJP A;  3OEE G;  1ENV A;  4JI1 B;  2P4V A;  5H5N A;  3P3N A;  4GT1 A;  3LSS A;  1XEQ A;  2YEV A;  1AP6 A;  1FS0 G;  1XDC A;  2GBO A;  5EC2 C;  5IE9 A;  4JI2 O;  3E86 A;  4LF9 O;  3HKB B;  3H1K H;  3OTF A;  3VQX A;  4DR7 B;  1VQN V;  1YCI A;  1FXK B;  2WLH A;  1Z5W A;  3ZCC A;  2QM8 A;  4KHP B;  1K8A W;  4LWS A;  3T2M A;  4DV0 B;  2Q9L A;  2PGG A;  4I0X B;  4OXS A;  5IYD O;  5JVD B;  1GN2 A;  2VQE O;  3ZRS A;  3SR2 C;  5IY5 B;  5LHH A;  4FJC C;  3ZBH A;  3H1H H;  5EYP A;  1DK1 A;  1THZ A;  3CP1 A;  3STZ C;  2JK5 C;  3I5D A;  2EIJ C;  3OTO B;  4JI1 O;  3TJT A;  3ZX6 A;  2DWD C;  1F23 A;  5BXZ A;  4O2A B;  4I7Z B;  3HKD A;  3AG1 B;  3BY6 A;  5CMU A;  4LF9 B;  2CTP A;  4RUE A;  4UCS A;  4B3M B;  3IGA C;  3N2G A;  2XHB A;  1KBH A;  1M5I A;  4KXR A;  1NH2 B;  3H9V A;  1BCC H;  2LO1 A;  1WB7 A;  3JYC A;  1WB8 A;  1DGS A;  1ZUQ A;  4X66 O;  1DF5 A;  2A9H A;  2YXL A;  5EIB D;  4JI5 O;  4DV0 O;  5H6Q A;  1FFT B;  1H2M A;  4FIP C;  4TV9 B;  1Q86 W;  1Y4M A;  2A06 H;  4PV1 B;  1XMQ O;  2PF4 E;  3JCZ A;  1N0N A;  4F6R B;  5TIS Z;  4EKW A;  3JSN A;  3ZS8 C;  4X88 A;  4CC5 A;  1XHX A;  2HVK C;  3OMN B;  4LF7 O;  1Q6I A;  4RQF A;  1K7D A;  3DSQ A;  2Q5Z A;  2UXX A;  1GMG A;  3H1J H;  2X6A A;  3RYH A;  4EEQ A;  2GUZ B;  2RQ6 A;  4X1K A;  1IZ3 A;  1LUW A;  1YTF D;  3QG5 A;  2YIC A;  1VQ7 V;  1N36 B;  1GH6 A;  2IBZ H;  1WLE A;  2NLJ C;  1K34 A;  1KC8 W;  1MMM A;  2UUA O;  2KSD A;  1BQZ A;  2OTJ V;  4K3A A;  4IIJ A;  1Y74 B;  2EUL A;  5LXT B;  3FD9 A;  2Q7H A;  4ZOL B;  2ILM A;  1PP9 H;  1BS3 A;  4BAY A;  2XAH A;  3DC5 A;  3E8B A;  1I08 A;  3LDD A;  4JAS A;  2AZ0 A;  5KUM A;  4FFB B;  3VQY A;  1SZT A;  3CRC A;  1L0L H;  1SER A;  2WLJ A;  3W7S A;  2O57 A;  1YIJ V;  3S3X A;  3J80 N;  4DR1 B;  2QWN B;  3EXA A;  5JQG A;  2DQ3 A;  2GTS A;  1WJZ A;  4CS3 A;  5KX5 B;  4JTC B;  1HR0 B;  2F93 B;  4DO2 A;  1YEW A;  1JPX A;  1QR8 A;  3CRQ A;  3CYO A;  3DXR B;  3G67 A;  4H44 B;  1JOY A;  2XAG A;  2LJ2 A;  4JI8 O;  1X59 A;  4PDR A;  4O4J A;  4QJF B;  4FZ1 A;  2OWO A;  5LP6 B;  3K5O A;  2GSM B;  2WLK A;  4Z1V A;  3OMI B;  5LBQ A;  2CH7 B; 
#chains in the Genus database with same CATH homology
 4KHP O;  1HNW O;  1XMQ O;  4AQY O;  5BR8 O;  4OPH A;  3SDL A;  4B3M O;  4LF7 O;  4OX9 O;  5H5N A;  4DR6 O;  4DV7 O;  4DR4 O;  4YHH O;  1FYJ A;  1XEQ A;  4JI2 O;  4LF4 O;  5FLX N;  4OPA A;  4DR7 O;  2HHH O;  4LF9 O;  1R6T A;  5LMU O;  2UXB O;  1A32 A;  4DUZ O;  2FKX A;  1N36 O;  2UXD O;  4DV6 O;  4X62 O;  2ZKO A;  4LFC O;  4LF8 O;  1G1X B;  1AB3 A;  1N33 O;  3M8A A;  4X65 O;  5IWA O;  3J81 N;  2UUA O;  4DR2 O;  4B3R O;  2JRI A;  3RT3 C;  2E5L O;  1XNR O;  4K0K O;  4JYA O;  1IBK O;  1KUQ A;  1J5E O;  3T1H O;  4B3S O;  5BY1 A;  4DV5 O;  2ZM6 O;  1F7Y A;  1IBM O;  5A2Q N;  4A5U B;  2UXC O;  2VQE O;  4DUY O;  2UUC O;  4DV3 O;  4LF5 O;  1YZB A;  1XNQ O;  1XMO O;  1DK1 A;  3T1Y O;  4X64 O;  4JI3 O;  3O65 A;  4JI0 O;  2DJV A;  2Z0A A;  2F4V O;  3J80 N;  5LL6 Y;  3J7A U;  4LFA O;  4JI1 O;  1R1B A;  5BXZ A;  4DR3 O;  4NXN O;  1HNZ O;  1FJG O;  2N74 A;  1N34 O;  2UU9 O;  5LMN O;  2AGA A;  4DV4 O;  4NXM O;  4JV5 O;  1N32 O;  3R66 A;  4GKK O;  2VQF O;  1AIL A;  4LF6 O;  4JI4 O;  4DV2 O;  1HR0 O;  1NS1 A;  3JAM N;  4JI7 O;  3F5T A;  4JI8 O;  4DR1 O;  1X59 A;  2DOS A;  2UUB O;  4JI6 O;  2LW7 A;  4X66 O;  1IBL O;  4DR5 O;  4GKJ O;  4B3T O;  4YY3 O;  4DV1 O;  5IT9 N;  1HNX O;  3OTO O;  4JI5 O;  1FKA O;  4DV0 O;  4LFB O;  1I94 O;  1D2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...