3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
1BGYH 1NU1H 1SQQH 1SQVH 1SQPH 1PP9H 5KLVH 1BCCH 3BCCH 1L0NH 3H1HH 1SQBH 3CXHF 3H1IH 3L74H 2A06H 1NTZH 1BE3H 3CX5F 4D6TH 1SQXH 1P84F 2IBZH 1PPJH 3H1LH 3CWBH 3L72H 3L71H 3L73H 1EZVH 2FYUH 1L0LH 1NTKH 1KB9F 3L70H 1KYOF 2BCCH 3H1KH 3TGUH 4U3FH 1NTMH 3L75H 4PD4F 3H1JH
chains in the Genus database with same CATH superfamily
2CTPA 2NR5A 3ZRSA 1D5NA 1BS3A 1VMGA 5BR8B 4DR4B 4JZ2A 2BE3A 1L0NH 2PGGA 3A0BZ 3BPZA 2OWOA 1AJQA 4MVMA 1QVGU 2FB5A 4JV5O 2KG7B 2YEVB 4LF8B 1GM9A 1BHBA 4XDKA 1Z5VA 5B5EZ 5LBQA 3CP1A 2ZXWC 4I5SA 3ZHTA 1ZL8B 3SPIA 2WLHA 3AG1B 4DK0A 1XNRO 3QNEA 1VQ4V 2ZR2A 1YF2A 4O4HA 4UCTA 3W7SA 1KUQA 1X59A 4GX0A 4UVCA 4DV2B 1N0JA 1Q8IA 4ZKIA 3MDSA 1E79G 4EEQA 2Y4UA 3ZMVA 1YVWA 4P9OA 5L3CA 4TUYA 1JFFB 4JYCA 3VBBA 2QM4A 4J7KA 3CC2V 1KMIZ 2EIMB 2HVKC 2Q7GA 4FLTA 1HNWO 1K7DA 2HKOA 3T4DA 4HYOA 1M57C 2Q7HA 1RSOB 4CC6A 4CS4A 2QKSA 1T5EA 3QO7A 2XNDG 4LFCB 2EIMC 4I50A 5C8YA 1AROP 2YICA 2ADQB 3G80A 4J80A 4WFFA 3OM3B 1VQ9V 4TOIA 4IT5A 4PA6A 2F1MA 3K0DA 1K97A 2UU9O 1HNXO 2QKAA 4K0KO 3OAAG 2WPDG 2GSMB 2X6AA 4UCSA 3RW0A 2AZ0A 1FYJA 2XOKG 4R50A 1HNZB 2A3QA 3G67A 4RQEA 2ZIMA 4CC5A 3M8AA 5EC1C 3OMAB 4JAAA 4AQYB 1Q86W 4WFAV 3JARB 1E1QG 1KKDA 3UT5A 3B77A 1AI4A 2PF4E 2HLDG 3JARA 1IBKO 5IWAO 1E1RG 5IYDO 4DV1O 4AI8A 5D5PA 3JD2A 3CCSV 1MZFA 3ABMC 3QF7A 1IXMA 1M9NA 4FFBA 4LH6A 1VARA 1GO3F 1SQFA 5EC2C 2HP8A 1KKCA 4U3JB 4QE9A 3JAWA 1IX9A 3EHBB 2EX3A 1G1XB 3HKDB 1JJ2U 5CA1A 4R6ZA 2EIJB 2NLJC 5LYJA 1XL6A 2QTSA 3OR7C 4I9WA 1XHXA 3F5TA 1XL4A 4B3SB 2YIBA 2XHBA 1ENVA 2DQ3A 2EJ7A 3QO8A 5LXTB 1XMOB 3OUSA 3UM7A 1OCCC 3O65A 4FLZA 1DF4A 4K3AA 4X65O 5KA6A 5FNVB 5GTIZ 2A79B 1FKAO 1EZJA 1YCIA 4ZOLA 5FNVA 4PV1B 1GN4A 4BR6A 4PD4F 3C3SA 1QVFU 3D36A 1B06A 1AI5A 4TV9A 1S5HC 2ZT9B 2Z5UA 1PNLA 4JI7O 4I55B 1YIJV 2ZDIC 3ZBHA 5L3FA 3AK2A 3AG2B 2QTOA 1VQLV 4DR2B 1Z5WA 1GM8A 4O2AB 3STZC 1IBMB 1W2BU 3ZRXA 4JTCB 3JAWB 1SQQH 1DF5A 1H2NA 4DRXA 3K3WA 1GN2A 5EBLC 3W7UA 2VQFO 2JGUA 3FKSG 2IW5A 4MVSA 2EZPA 2IH1C 4PHZA 2QEXV 2QM8A 1KB9F 2YI9A 3WB0A 4DV7B 3BA9A 3K58A 3KZIZ 2YUAA 4KL1A 1Y74A 4MSWC 1GH6A 1WAZA 2RCVA 2ITDC 4PI2A 4O4JA 2LFSA 5A9GA 4NXNB 2HEPA 1NH2D 2ZCEA 3ETDA 5H2FZ 4O4JB 2ADPA 3AG1C 1W59A 4I4TB 1YI2V 4E2LA 3U10A 2CTWA 2KB1A 5EYPB 1EN6A 4YJ3A 4CS2A 5ITZA 3SPCA 5J9PC 3SYQA 4GLXA 3GB7C 1MMMA 2HVJC 4JI1B 1YXBA 1ZTEA 3I5DA 4H44B 1VQNV 2IBZH 1IZ3A 2AHZA 4FLWA 3K03A 4H13B 2GTAA 2UXXA 4OX9O 3BRCA 3L70H 1IBLB 4JZGA 1SESA 4QJFB 3RYFA 3JAKB 3LNNA 1KU9A 4NB5A 1NU1H 1Q6UA 3LUTB 1L8DA 2B1GA 4MTXA 3ZHSA 3N2GB 3K59A 3CRCA 4X8AA 4DV2O 4KP4A 4O4IB 1VF7A 1UJWB 4E4EA 3L71H 1YTFD 3JD4A 1KYOF 1YJWV 1IURA 4KHPB 1ZSPA 3P30A 1N33O 2HJFC 4XBFA 4JYYA 2YC0A 1F4MA 5H9CA 4LF7O 5LXTA 4B3MB 1R3KC 1V54C 4RAIA 3CB2A 3RYCA 3HR0A 1URFA 4NYKA 2IJIA 3CX5F 5IYCO 1Y67A 2A7WA 3TXSA 3OT7A 4JI0B 2QDOA 1FXVA 5KX5A 3HKBA 4DR7O 4G27B 4EB6A 1NTMH 1Q5OA 1YHQV 3VQXA 3FFQA 3JASA 2YSUB 3JCUZ 1KP3A 3RWRD 1VQ7V 3SGIA 1K4DC 4PELA 2LW7A 2YIDA 3H1HH 4O2AA 1GM7A 1YEWA 5EIBD 2ZINA 2PYJA 2ZDIA 5KMGA 5B66Z 3M99B 4DV3B 3ASNC 3LSQA 4J7JA 2UU9B 1VQ5V 2NN4A 2LGQA 5GONA 3R65A 3D3IA 1Q6HA 3A0HZ 1ORQC 5B1AB 4P9PA 5FPRA 4CH4A 3QVNA 2DOSA 4GYCB 2JGDB 3JYCA 2CUGA 2BSKA 3DSQA 3FAVB 3FB5C 3E8FA 4I7ZB 3ASOB 5LA6B 2F4VO 3CMAV 1Q43A 5EK0A 4RUEA 4GKKO 1WPXA 4DV6B 2V7QG 2M7WA 3KG2A 1K33A 4BWAA 2ZR3A 3ASOC 3OE7G 4DV1B 3ZMZA 1OCCB 3ABTA 2WLLA 4EB6B 2QR4A 1XBLA 4ASUG 1U97A 1S72V 3CRAA 3W7TA 1PM9A 3HPLC 1YJ9V 2EILB 2CGOA 1Q6IA 4PA3A 3SYPA 4DR3B 2BTQA 4UUJC 3IAYA 4HBNA 1YZBA 5AG2A 1K5SA 1Q82W 3CMEV 1I5YA 4CH5A 1OHHG 1BCCH 4DR1O 1VQ6V 4UCUA 3FB8C 1QQCA 5DEDA 3ZMUA 2X6BA 5GONB 4KUMA 1XEQA 2G38A 1N32O 1GRJA 4FZ0A 3N2GA 2Y0PA 5BZBA 2XUMA 5LMUO 2Q9LA 1XNQO 3F5WC 1XMQB 3LNMB 2H8PC 3UQ8A 1FAFA 2QSAA 3G6BA 4PJ0Z 3D8CA 5EIBC 2DWEC 1WPBA 2F43G 3E8BA 1JMKC 2KQXA 3E8GA 3IC9A 2IU3A 3UKMA 1K8AW 3CEIA 5H6RA 4ZHQB 3IGAC 5LGTA 1J95A 1O9GA 1RSOA 1Z2GA 2ZE7A 3JASB 1CPYA 3HKBB 4JGSA 4FK5C 5JJJB 2JS3A 1Q3EA 3CCJV 4X64O 4B3RO 1SZTA 5B1BC 4LBEC 3K04A 4UB6Z 2PTMA 4GX1A 5LP6B 1TUEB 4Z1VA 2UXDB 2BOCC 2ITCC 2R9RB 3L73H 1BL8A 5J2TB 3K9AA 1SA0B 2CTRA 2WA3A 4MVUA 4X62O 1K73W 4PDMA 5E1AC 1TUBA 4JV5B 1N8RW 4JAUA 5EZYB 4J7ZA 3ZRWB 1K4CC 4FZ1A 3ZEDA 4TQFA 4IIJA 1H8HG 1R73A 1AR5A 1SQBH 4AHCA 4LF8O 1AB3A 3VQYA 4IIJB 4Q20A 1K34A 1FD9A 3CHXA 4BIZA 3EFFK 1IVSA 3FX7A 4HZ3A 1FS0G 1R6NA 3J81N 3K5NA 1V9PA 4X9QA 4JI3O 2YEVA 3KKYA 3T1HB 4UXNA 4D7TA 5J2UA 5KHGA 2A06H 5L3DA 3RYHA 4FFKA 4X1YA 1NR7A 2WLMA 4MTOA 5J2UB 4X20A 2WLNA 2JEUA 2CE4A 2CTQA 2HJDA 2GTSA 2N05A 2B1IA 2E76B 4UFZA 3JSLA 2P90A 4LFAO 2JDIG 4EFEA 1G4YB 5EBWC 1MNGA 4DR5O 2WLKA 5CA0B 1SQVH 1QCEA 4N21A 4DV4B 4O2BB 4KHPO 4O4HB 2YI8A 3JALB 1XREA 1Y6XA 4BIUA 4O2BA 3I56V 4JYBA 1GKFA 1GAXA 5JVDB 4NTYA 4JTDB 3ZRVA 1F4NA 4DR6B 1KP2A 3JATB 3SR2C 2ZNJA 2EULA 2GHYA 3CE2A 4FFBB 3CCVV 3Q4HA 2Q67A 3DC5A 3CC4V 2QWQB 2ZNIA 4PI0A 4PA7A 4JI2O 1D5AA 1WB8A 3HB3B 2ZKOA 3MHHC 2UXBB 3PN1A 3C3TA 2Y69B 2Y48A 2P22C 3RYHB 3W7WA 1QLEB 3RYIA 4O4IA 4GKJO 1SS3A 2UUCO 2IM9A 4R7CA 2DN9A 4F4LA 4PDVA 4JI6O 5LMNB 2HHHB 1J5EB 4J42A 4DV0O 2O57A 5CBHA 3JAMN 3TJTA 1AJNA 2P4VA 3TGUH 1Y74B 3E22B 2V4DA 2E5LO 1YITV 2AGAA 1IBKB 1RP3B 4UB8Z 1I08A 4IHJA 1EN5A 2HR3A 1MABG 1SQPH 2YDEA 3THOA 2QJ1A 2AW9A 5CB4B 2YIAA 1KD1W 1THZA 3K0GA 2JK5C 1YDXA 4NKGB 4UCRA 1SA0A 2R72A 4GX5A 3ZRWA 4MVQA 2QWNB 5L3EA 1R6TA 3BA8A 4F6RA 4J41A 1O9HA 3KCXA 3SYAA 2CH7B 3BCCH 4H0LB 4AILC 3SYOA 3W7XA 3K79A 4LNUA 2W6JG 3ZHVA 3JD1A 5CBGA 1M56B 3H1LH 5LHHA 4PA9A 3SPHA 4WFHA 5JCOA 3J80N 1Q7YW 4FM2A 4U3FH 4WFGA 4X20B 4DR1B 1BZKA 4WFBV 2Q5ZA 4TT3G 3CXCU 3QG5A 3F7VC 4Z1MG 3MAQA 1OV9A 3E35A 3ETGA 2F66C 2KKWA 2ILMA 5K1XA 1S76D 1AVMA 4D6TH 4NTXA 2FKXA 3B4SA 4CS3A 1N32B 1YSCA 1I94O 3K5LA 4GCZA 4JI7B 4NXMO 2UUBO 5LMUB 1OJHA 4YJ2B 3D36C 3L75H 4LF9B 5LHGA 1BMFG 2DQ0A 4QIWF 5EYPA 2Q68A 4H37A 1OZ0A 4DO2A 3OMIB 5CA3A 5CMUA 4CH6A 1GTOA 1I7FA 4RO2A 2P4KA 2EJRA 4ZOLB 3O9OA 3HKEA 2OCHA 1YJNV 3CJHA 5LHIA 1K3EA 4BW9A 4TV9B 3WG7B 2F23A 2CH7A 2AZ2A 2EIKC 4P30A 2OIGA 2ZE6A 4LNUB 1CP9A 2Q4PA 4K35A 4QGPA 4DUZO 5KUKA 1VEWA 4ZHQA 4LF6B 2WSSG 1R3IC 4WBNA 3RFRA 5JQGB 1NT2B 2ARHA 1H2GA 1HP8A 1QNMA 5IWAB 5B1AC 4PA4A 4DW1A 4DRXB 3QO5A 3SJCC 2AXTZ 4L87A 2UXCO 3ABUA 4NVPA 1V55B 5H6QA 2R9IA 3B40A 4BAYA 2CAZC 4X66B 2ODMA 3S3WA 4TSFG 2HFEC 4B08A 1EZVH 1NTKH 3E8HA 3P3PA 1M4UA 3R66A 3SPGA 3MHSC 4J9YB 3G6EV 5FLXN 1ZAUA 3T2MA 5HFMA 2Z0AA 1NI8A 1US6A 2YXLA 2B5UA 1R6KA 5BY1A 1M1KW 1FPOA 4F6RB 4LFCO 2W0XA 1NR1A 3VQVA 2RMKB 2VRZA 1N36B 5DM6V 5IJ9A 4FM1A 2MW2B 3LSSA 1GN3A 5IE9A 1OCOC 3ZMSA 3F7YC 4YIOA 4A5UB 1BQ0A 4YY3B 4LP8A 3OMNB 3OEEG 3QTCA 1RPOA 4OPHA 4LF4B 3OTFA 1NKDA 5IT9N 1B04A 1HR0B 1DTOA 5IYBO 5IJ0A 1AP5A 1RFYA 1QLEC 2L35A 1H8EG 1A32A 1PP9H 4AQYO 3B8MA 3VOUA 3JD3A 2DE0X 1X4TA 1S0VA 4K8ZA 1Y76B 5LA6A 3RYCB 4UCVA 3AG4C 3APQA 3N2KB 1FXKB 1MA1A 2QE7G 2FYUH 2X0LA 4B3TB 1FFTB 4FJCC 1AJPA 4DV7O 1AILA 2AHYA 2BTQB 3FYIB 3RVZA 5BXZA 3K5MA 2OYQA 3SPJA 4DV3O 1FFXA 2N04A 3RGBA 4JI5O 4JI8O 2UUAB 4NR1A 4MVZA 1NBMG 3ZHRA 1S77D 5KUMA 4ZIBA 4ICGA 3IFXA 4OXSA 2FL4A 2C2AA 2HHHO 2ZM6O 3BABA 3HKDA 5K1PA 3G71V 4JI1O 4JI4B 4JYAB 2RQ6A 4GKKB 5E79Z 1AI6A 2EIKB 2ZQMA 1M5IA 2E5LB 3ABLB 4DW0A 1KC8W 2BSKB 5DN6G 4LC1A 4UCOA 2EBOA 2ETNA 3G4SV 1Y76A 3ABKC 4YHHB 3A8TA 1N0NA 4D7SA 3B8NA 1TA8A 4BIOA 5BMVA 2R70A 1V54B 4NTWA 3CYOA 2LFRA 1I5XA 1N33B 2D3OW 4LF5B 2A9HA 4XDJA 4DV5O 4H33A 3OGIB 5L3BA 4LF7B 3K9SA 5IY5C 3SYCA 1M90W 1W0JG 3BAAA 2F95B 3H01A 1XMQO 4JI0O 3CSXA 4LFBO 3BVOA 1XQ8A 5IJ9B 3RN4A 1R1BA 5LP6A 4JASA 4JPRA 3ETEA 3TCUA 5B3SC 3JALA 2WWWA 5KAFZ 3T1YB 1LR1A 4J10A 3DC6A 3ASNB 5J2TA 1G8MA 4LH7A 3UT5B 1MZEA 3L72H 1VQKV 2XASA 3M7MX 3J7AU 4MS2A 3OD4A 4Z2WA 3FAVA 1K5QA 1JPXA 1JA8A 1BQZA 1WA8B 5KLVH 2EIJC 5BMVB 2WLLB 2WLIB 1XNRB 2ZIOA 4B3RB 4TV8A 4GT1A 2PI4A 1H38A 1F51A 1QR9A 3HKEB 3OTOO 1VF6C 2XAJA 3H1JH 5GW7A 2RNBA 3D3QA 5LYJB 1OCZB 4DK1A 3CD6V 5B1BB 2K9PA 3AK1A 2EILC 1YTFB 1MG1A 2W0FC 2DYSC 1PL0A 1ZUQA 2YS8A 3B09A 1IXBA 5CA0A 3TETA 1HNWB 1PNKA 5JQGA 4B3SO 1N34B 5KHIA 2UXNA 3OR6C 5JH7B 2RN9A 1VP7A 2WA4A 4F6EA 5JH7A 4X65B 2CK3G 4G2KA 3T1HO 3BEHA 3DTUB 1OCRB 3ZHQA 1K92A 1SKVA 1S5LZ 3EXAA 1S3JA 3Q4HB 4HAMA 2M6YA 2PY5A 2LP7A 3ZS8C 4ABMA 1PD3A 2F93B 5CA1B 1OCRC 1VF5B 4FPPA 1NTZH 3WB2A 4DUYB 4X1KA 1ZL8A 4B7KA 2MK3A 4DR2O 2OTJV 1PKXA 1KBHA 1PV0A 5IDJA 1SRYA 1JJOA 2Q69A 3BHPA 5DECA 1RPRA 4IYIA 5C8YB 2LO1A 3GWOA 2Q0OC 1UFIA 1TGOA 1XOUA 1WNSA 2JEXA 5LOVB 2L6LA 4C7UA 4X88A 5HFLA 3FB6C 4LWSB 3UO2A 3ZJZA 2E74B 2XTAA 1HR0O 3E22A 1QU7A 1HWYA 5H5NA 2Y0IA 4EKWA 1ZX3A 4IYHA 1BHAA 3L9DA 2IH3C 2VQEO 1SERA 2EINB 4X64B 1NZ6A 1PNMA 1JFFA 3OW2U 5LP6C 4B3TO 3ABMB 3UCSC 2IJKA 3P3NA 3CS5A 3CJHB 1L1FA 2GUZA 3AK3A 2UXDO 4I0XA 4IL6Z 1SC5B 3RBZA 5FPOA 3S3XA 1EM1A 5IYZB 4JI6B 5LMNO 3JATA 3OEHG 4DR3O 2EINC 2D2CB 4XDLA 3RYFB 4X1KB 3SJQC 2ATKC 4FLYA 3WFVA 2UUAO 2FTKA 3APOA 4MVOA 3X2QB 4WFEA 2P06A 3AG7A 4ZI7A 3UO3A 5KAIZ 2ZM6B 2JJ1G 2DJVA 4U7OA 3JD0A 3MD0A 4I4TA 1VF6A 3ZCCA 3K08A 2KSDA 1JCHA 3E2EA 1XNQB 1FXKA 2A0LA 5L3GA 4EFBA 1SQXH 5LGNA 2X6CA 1MOFA 2DW4A 5IY5B 2P67A 2P6JA 4TUYB 3BFRA 2YXYA 4YHHO 1G6UA 4GX2A 4K8XA 4LFAB 2FMLA 1HNXB 2Z3YA 4RWUA 4K0KB 3CCMV 1EBOA 2CDYA 5B1OA 1P49A 4DV4O 1HNZO 5JCOC 1ROPA 2P7TC 4I55A 1MSDA 4LR3A 3U0ZA 1GK9A 1F7YA 1N4CA 1R3LC 4X89A 2GUZB 1IDSA 3U11A 1JVMA 3OUFA 3DXRA 1BGYH 4J9ZB 3H9VA 1I0HA 3IC7A 4W4KA 4I50B 4L8JA 4YXWG 3AG3B 1XILA 4NXNO 1CEZA 2WAMA 2LW1A 4LF9O 3L74H 1Y4MA 2VWJA 4LFBB 1P4RA 4JTAB 1SETA 3CRMA 3GWKC 4LWSA 2OT5A 3T1YO 4X62B 1JQ0A 2VWKA 2XAHA 3CCQV 4LCUC 1TAEA 1WP8A 1LUVA 4O4LB 5CB4A 1QLNA 4OX9B 4YJ2A 3CWBH 1XHZA 1IBLO 1Q90D 1EFRG 3B2EE 4O4LA 1L0LH 5EZYA 4DUZB 1QHTA 2JRIA 3DGEA 2W6IG 2Y4TA 2PYLA 2R9AA 1XMOO 2P5OA 1FJGO 4GZRB 4FLXA 1HDJA 5IYZA 1P7GA 1RM1B 3FB7C 4JI3B 2VS0A 3H1IH 3K5OA 4W4LA 2QWOB 3ZHUA 2Q73A 3ABLC 3E89A 5JWPA 2LGWA 4X66O 4WBNB 1FXHA 5TISZ 2KG7A 1VIBA 4DR5B 1VQMV 1V55C 1RM1C 1TVKB 1COWG 4X1YB 1OCOB 2LQTA 2JJ2G 1TVKA 1K9MW 2JVDA 4FMTA 3RVYA 2OCCB 1DK1A 3ZMTA 4DYLA 2BCCH 4MW8A 3CCLV 2DMXA 3OGCC 2DYRC 3ZX6A 2XAQA 3E86A 2GBOA 4IGGA 3T4ZA 1B6QA 3A0RA 4PDRA 4UV9A 2JIZG 1H2KA 3ML0A 3WG7C 4MTGA 2GDSA 3CPWU 1JR9A 1FXKC 3BY6A 5BR8O 4DR4O 4MVRA 3CRQA 3N27A 1Q81W 4YY3O 4DUYO 3E83A 3EVKA 3AG3C 3STLC 1AR1B 1XUQA 2QM7A 1DLBA 3ICXA 4YIPA 5D5QA 3GVMA 1PPJH 3HKCB 1KECA 2YIBD 1J5EO 4CZZA 1NVPD 2RDCA 3DXRB 3HKCA 1R3JC 1QR8A 2GV9A 4ZBMA 1ZLZA 2K1EA 4FLUA 4DV6O 3K06A 4QNHB 4U7NA 1S5JA 1M93A 1W0KG 1H2MA 3K57A 3FD9A 3CXHF 2WLJA 1SZXA 3TK1A 4UVAA 2NNUA 2QWPB 4FLVA 2VQEB 3P32A 3AG4B 2HG5C 3NR7A 1SF9A 2OTLV 3SJBC 2E75B 3OFNG 4IHJB 2E3CA 4QE7A 4JI5B 5KHKA 5KHHA 5FL7G 4JI8B 5JJNB 2UXCB 2BOBC 2ZE5A 4R8CA 1NQTA 5KX5B 1BE3H 2Q8VA 5LL6Y 2DYSB 4MT8A 4YJ3B 5ITZB 2PUSA 4B3MO 1NH2B 1MSWD 1FFXB 4JI4O 3WU2Z 3VQWA 4I0XB 4JYAO 4OPAA 2QWRB 5LOVA 3CRRA 4DXWA 2QGNA 3ZIAG 3FYEB 1NS1A 1KQSU 4DR7B 3TXQA 1P84F 3AG2C 1ZWIC 1Y66A 1D2DA 2OCCC 1I94B 4BW5A 1UPGA 2IU0A 4NXMB 5IJ0B 2LJ2A 4X1IB 2DYRB 4ZI7B 1XI1A 1N36O 3ETQA 1M56C 5JVDA 1DGSA 4B7EA 1M57B 1VQ8V 5B1NA 2Y69C 1LNQA 4JAVA 4G28B 3ZN1A 3LSUA 1EN4A 5GTHZ 1F23A 1U96A 2IJJA 2IJHA 4U3JA 4DR6O 2ZE8A 1WJZA 3CCUV 3LDEA 3RYIB 1P7BA 4QPJA 2F4VB 2H94A 2DWDC 1HW7A 3KCYA 4UVBA 4LF6O 4JI2B 1BSMA 4I9QA 2Q7EA 4Q6GA 1AI7A 3T1CA 3CCEV 2YXHA 2N74A 1OCZC 4CBCA 4GKJB 4PDLA 4KXRA 3JAKA 5CBFA 2PZSA 2UUCB 4JF3A 4DV0B 4WCEV 4TWKA 2CGNA 1H2LA 5C93A 3WB1A 4RQFA 3ABKB 1WN7A 4KFMA 4QPKA 2Q6AA 2OIEA 3JCZA 1H2SB 4FIPC 3NXSA 3PJSK 4X1IA 4TQDA 2JGDA 3SJAC 3OTOB 1WB7A 1JX9A 5CN0A 2Q0AA 1QBZA 1WLEA 4CH3A 4HNAB 3X2QC 1FJGB 2H3OA 4GUNA 2B9ZA 2WLIA 1SQGA 1VQPV 4HNAA 1NVPB 4TV8B 1WA8A 3N2KA 3LDCA 1BT8A 4MTFA 2BTOA 2V1DA 4J11A 1WP7A 1IBMO 1B3QA 4P2ZA 3IJ4A 2ZXWB 1GN6A 2ZD9A 4WF9V 2EZOA 5JJEB 1JOYA 2JS5A 3SDLA 1N34O 3I55V 5LGUA 4N23A 5F2VO 2QA4V 2VQFB 2RJZA 4LF4O 1PL4A 5EBMC 4RUFA 2X7RB 4FVMA 5KMGB 3RT3C 2XT9A 5KHJA 3A2FA 2QKCA 1VQOV 4LF5O 1XDCA 1TUBB 3LDDA 2PI5A 4DV5B 4FM0A 1NJIW 1LUWA 3CCRV 4UV8A 3JSNA 3C90A 3ZN0A 3AEIA 5A2QN 2UXBO 1AR4A 5KA5A 2UUBB 1CXZB 4MW3A 5B3SB 3H1KH 1GMGA 3CC7V 2XAGA 2XAFA 1AP6A 4OGQB
chains in the Genus database with same CATH topology
1BGYH 1NU1H 1SQQH 1SQVH 1SQPH 1PP9H 5KLVH 1BCCH 3BCCH 1L0NH 3H1HH 1SQBH 3CXHF 3H1IH 3L74H 2A06H 1NTZH 1BE3H 3CX5F 4D6TH 1SQXH 1P84F 2IBZH 1PPJH 3H1LH 3CWBH 3L72H 3L71H 3L73H 1EZVH 2FYUH 1L0LH 1NTKH 1KB9F 3L70H 1KYOF 2BCCH 3H1KH 3TGUH 4U3FH 1NTMH 3L75H 4PD4F 3H1JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  1NU1 H;  1SQQ H;  1SQV H;  1SQP H;  1PP9 H;  5KLV H;  1BCC H;  3BCC H;  1L0N H;  3H1H H;  1SQB H;  3CXH F;  3H1I H;  3L74 H;  2A06 H;  1NTZ H;  1BE3 H;  3CX5 F;  4D6T H;  1SQX H;  1P84 F;  2IBZ H;  1PPJ H;  3H1L H;  3CWB H;  3L72 H;  3L71 H;  3L73 H;  1EZV H;  2FYU H;  1L0L H;  1NTK H;  1KB9 F;  3L70 H;  1KYO F;  2BCC H;  3H1K H;  3TGU H;  4U3F H;  1NTM H;  3L75 H;  4PD4 F;  3H1J H; 
#chains in the Genus database with same CATH topology
 2CTP A;  2NR5 A;  3ZRS A;  1D5N A;  1BS3 A;  1VMG A;  5BR8 B;  4DR4 B;  4JZ2 A;  2BE3 A;  1L0N H;  2PGG A;  3A0B Z;  3BPZ A;  2OWO A;  1AJQ A;  4MVM A;  1QVG U;  2FB5 A;  4JV5 O;  2KG7 B;  2YEV B;  4LF8 B;  1GM9 A;  1BHB A;  4XDK A;  1Z5V A;  5B5E Z;  5LBQ A;  3CP1 A;  2ZXW C;  4I5S A;  3ZHT A;  1ZL8 B;  3SPI A;  2WLH A;  3AG1 B;  4DK0 A;  1XNR O;  3QNE A;  1VQ4 V;  2ZR2 A;  1YF2 A;  4O4H A;  4UCT A;  3W7S A;  1KUQ A;  1X59 A;  4GX0 A;  4UVC A;  4DV2 B;  1N0J A;  1Q8I A;  4ZKI A;  3MDS A;  1E79 G;  4EEQ A;  2Y4U A;  3ZMV A;  1YVW A;  4P9O A;  5L3C A;  4TUY A;  1JFF B;  4JYC A;  3VBB A;  2QM4 A;  4J7K A;  3CC2 V;  1KMI Z;  2EIM B;  2HVK C;  2Q7G A;  4FLT A;  1HNW O;  1K7D A;  2HKO A;  3T4D A;  4HYO A;  1M57 C;  2Q7H A;  1RSO B;  4CC6 A;  4CS4 A;  2QKS A;  1T5E A;  3QO7 A;  2XND G;  4LFC B;  2EIM C;  4I50 A;  5C8Y A;  1ARO P;  2YIC A;  2ADQ B;  3G80 A;  4J80 A;  4WFF A;  3OM3 B;  1VQ9 V;  4TOI A;  4IT5 A;  4PA6 A;  2F1M A;  3K0D A;  1K97 A;  2UU9 O;  1HNX O;  2QKA A;  4K0K O;  3OAA G;  2WPD G;  2GSM B;  2X6A A;  4UCS A;  3RW0 A;  2AZ0 A;  1FYJ A;  2XOK G;  4R50 A;  1HNZ B;  2A3Q A;  3G67 A;  4RQE A;  2ZIM A;  4CC5 A;  3M8A A;  5EC1 C;  3OMA B;  4JAA A;  4AQY B;  1Q86 W;  4WFA V;  3JAR B;  1E1Q G;  1KKD A;  3UT5 A;  3B77 A;  1AI4 A;  2PF4 E;  2HLD G;  3JAR A;  1IBK O;  5IWA O;  1E1R G;  5IYD O;  4DV1 O;  4AI8 A;  5D5P A;  3JD2 A;  3CCS V;  1MZF A;  3ABM C;  3QF7 A;  1IXM A;  1M9N A;  4FFB A;  4LH6 A;  1VAR A;  1GO3 F;  1SQF A;  5EC2 C;  2HP8 A;  1KKC A;  4U3J B;  4QE9 A;  3JAW A;  1IX9 A;  3EHB B;  2EX3 A;  1G1X B;  3HKD B;  1JJ2 U;  5CA1 A;  4R6Z A;  2EIJ B;  2NLJ C;  5LYJ A;  1XL6 A;  2QTS A;  3OR7 C;  4I9W A;  1XHX A;  3F5T A;  1XL4 A;  4B3S B;  2YIB A;  2XHB A;  1ENV A;  2DQ3 A;  2EJ7 A;  3QO8 A;  5LXT B;  1XMO B;  3OUS A;  3UM7 A;  1OCC C;  3O65 A;  4FLZ A;  1DF4 A;  4K3A A;  4X65 O;  5KA6 A;  5FNV B;  5GTI Z;  2A79 B;  1FKA O;  1EZJ A;  1YCI A;  4ZOL A;  5FNV A;  4PV1 B;  1GN4 A;  4BR6 A;  4PD4 F;  3C3S A;  1QVF U;  3D36 A;  1B06 A;  1AI5 A;  4TV9 A;  1S5H C;  2ZT9 B;  2Z5U A;  1PNL A;  4JI7 O;  4I55 B;  1YIJ V;  2ZDI C;  3ZBH A;  5L3F A;  3AK2 A;  3AG2 B;  2QTO A;  1VQL V;  4DR2 B;  1Z5W A;  1GM8 A;  4O2A B;  3STZ C;  1IBM B;  1W2B U;  3ZRX A;  4JTC B;  3JAW B;  1SQQ H;  1DF5 A;  1H2N A;  4DRX A;  3K3W A;  1GN2 A;  5EBL C;  3W7U A;  2VQF O;  2JGU A;  3FKS G;  2IW5 A;  4MVS A;  2EZP A;  2IH1 C;  4PHZ A;  2QEX V;  2QM8 A;  1KB9 F;  2YI9 A;  3WB0 A;  4DV7 B;  3BA9 A;  3K58 A;  3KZI Z;  2YUA A;  4KL1 A;  1Y74 A;  4MSW C;  1GH6 A;  1WAZ A;  2RCV A;  2ITD C;  4PI2 A;  4O4J A;  2LFS A;  5A9G A;  4NXN B;  2HEP A;  1NH2 D;  2ZCE A;  3ETD A;  5H2F Z;  4O4J B;  2ADP A;  3AG1 C;  1W59 A;  4I4T B;  1YI2 V;  4E2L A;  3U10 A;  2CTW A;  2KB1 A;  5EYP B;  1EN6 A;  4YJ3 A;  4CS2 A;  5ITZ A;  3SPC A;  5J9P C;  3SYQ A;  4GLX A;  3GB7 C;  1MMM A;  2HVJ C;  4JI1 B;  1YXB A;  1ZTE A;  3I5D A;  4H44 B;  1VQN V;  2IBZ H;  1IZ3 A;  2AHZ A;  4FLW A;  3K03 A;  4H13 B;  2GTA A;  2UXX A;  4OX9 O;  3BRC A;  3L70 H;  1IBL B;  4JZG A;  1SES A;  4QJF B;  3RYF A;  3JAK B;  3LNN A;  1KU9 A;  4NB5 A;  1NU1 H;  1Q6U A;  3LUT B;  1L8D A;  2B1G A;  4MTX A;  3ZHS A;  3N2G B;  3K59 A;  3CRC A;  4X8A A;  4DV2 O;  4KP4 A;  4O4I B;  1VF7 A;  1UJW B;  4E4E A;  3L71 H;  1YTF D;  3JD4 A;  1KYO F;  1YJW V;  1IUR A;  4KHP B;  1ZSP A;  3P30 A;  1N33 O;  2HJF C;  4XBF A;  4JYY A;  2YC0 A;  1F4M A;  5H9C A;  4LF7 O;  5LXT A;  4B3M B;  1R3K C;  1V54 C;  4RAI A;  3CB2 A;  3RYC A;  3HR0 A;  1URF A;  4NYK A;  2IJI A;  3CX5 F;  5IYC O;  1Y67 A;  2A7W A;  3TXS A;  3OT7 A;  4JI0 B;  2QDO A;  1FXV A;  5KX5 A;  3HKB A;  4DR7 O;  4G27 B;  4EB6 A;  1NTM H;  1Q5O A;  1YHQ V;  3VQX A;  3FFQ A;  3JAS A;  2YSU B;  3JCU Z;  1KP3 A;  3RWR D;  1VQ7 V;  3SGI A;  1K4D C;  4PEL A;  2LW7 A;  2YID A;  3H1H H;  4O2A A;  1GM7 A;  1YEW A;  5EIB D;  2ZIN A;  2PYJ A;  2ZDI A;  5KMG A;  5B66 Z;  3M99 B;  4DV3 B;  3ASN C;  3LSQ A;  4J7J A;  2UU9 B;  1VQ5 V;  2NN4 A;  2LGQ A;  5GON A;  3R65 A;  3D3I A;  1Q6H A;  3A0H Z;  1ORQ C;  5B1A B;  4P9P A;  5FPR A;  4CH4 A;  3QVN A;  2DOS A;  4GYC B;  2JGD B;  3JYC A;  2CUG A;  2BSK A;  3DSQ A;  3FAV B;  3FB5 C;  3E8F A;  4I7Z B;  3ASO B;  5LA6 B;  2F4V O;  3CMA V;  1Q43 A;  5EK0 A;  4RUE A;  4GKK O;  1WPX A;  4DV6 B;  2V7Q G;  2M7W A;  3KG2 A;  1K33 A;  4BWA A;  2ZR3 A;  3ASO C;  3OE7 G;  4DV1 B;  3ZMZ A;  1OCC B;  3ABT A;  2WLL A;  4EB6 B;  2QR4 A;  1XBL A;  4ASU G;  1U97 A;  1S72 V;  3CRA A;  3W7T A;  1PM9 A;  3HPL C;  1YJ9 V;  2EIL B;  2CGO A;  1Q6I A;  4PA3 A;  3SYP A;  4DR3 B;  2BTQ A;  4UUJ C;  3IAY A;  4HBN A;  1YZB A;  5AG2 A;  1K5S A;  1Q82 W;  3CME V;  1I5Y A;  4CH5 A;  1OHH G;  1BCC H;  4DR1 O;  1VQ6 V;  4UCU A;  3FB8 C;  1QQC A;  5DED A;  3ZMU A;  2X6B A;  5GON B;  4KUM A;  1XEQ A;  2G38 A;  1N32 O;  1GRJ A;  4FZ0 A;  3N2G A;  2Y0P A;  5BZB A;  2XUM A;  5LMU O;  2Q9L A;  1XNQ O;  3F5W C;  1XMQ B;  3LNM B;  2H8P C;  3UQ8 A;  1FAF A;  2QSA A;  3G6B A;  4PJ0 Z;  3D8C A;  5EIB C;  2DWE C;  1WPB A;  2F43 G;  3E8B A;  1JMK C;  2KQX A;  3E8G A;  3IC9 A;  2IU3 A;  3UKM A;  1K8A W;  3CEI A;  5H6R A;  4ZHQ B;  3IGA C;  5LGT A;  1J95 A;  1O9G A;  1RSO A;  1Z2G A;  2ZE7 A;  3JAS B;  1CPY A;  3HKB B;  4JGS A;  4FK5 C;  5JJJ B;  2JS3 A;  1Q3E A;  3CCJ V;  4X64 O;  4B3R O;  1SZT A;  5B1B C;  4LBE C;  3K04 A;  4UB6 Z;  2PTM A;  4GX1 A;  5LP6 B;  1TUE B;  4Z1V A;  2UXD B;  2BOC C;  2ITC C;  2R9R B;  3L73 H;  1BL8 A;  5J2T B;  3K9A A;  1SA0 B;  2CTR A;  2WA3 A;  4MVU A;  4X62 O;  1K73 W;  4PDM A;  5E1A C;  1TUB A;  4JV5 B;  1N8R W;  4JAU A;  5EZY B;  4J7Z A;  3ZRW B;  1K4C C;  4FZ1 A;  3ZED A;  4TQF A;  4IIJ A;  1H8H G;  1R73 A;  1AR5 A;  1SQB H;  4AHC A;  4LF8 O;  1AB3 A;  3VQY A;  4IIJ B;  4Q20 A;  1K34 A;  1FD9 A;  3CHX A;  4BIZ A;  3EFF K;  1IVS A;  3FX7 A;  4HZ3 A;  1FS0 G;  1R6N A;  3J81 N;  3K5N A;  1V9P A;  4X9Q A;  4JI3 O;  2YEV A;  3KKY A;  3T1H B;  4UXN A;  4D7T A;  5J2U A;  5KHG A;  2A06 H;  5L3D A;  3RYH A;  4FFK A;  4X1Y A;  1NR7 A;  2WLM A;  4MTO A;  5J2U B;  4X20 A;  2WLN A;  2JEU A;  2CE4 A;  2CTQ A;  2HJD A;  2GTS A;  2N05 A;  2B1I A;  2E76 B;  4UFZ A;  3JSL A;  2P90 A;  4LFA O;  2JDI G;  4EFE A;  1G4Y B;  5EBW C;  1MNG A;  4DR5 O;  2WLK A;  5CA0 B;  1SQV H;  1QCE A;  4N21 A;  4DV4 B;  4O2B B;  4KHP O;  4O4H B;  2YI8 A;  3JAL B;  1XRE A;  1Y6X A;  4BIU A;  4O2B A;  3I56 V;  4JYB A;  1GKF A;  1GAX A;  5JVD B;  4NTY A;  4JTD B;  3ZRV A;  1F4N A;  4DR6 B;  1KP2 A;  3JAT B;  3SR2 C;  2ZNJ A;  2EUL A;  2GHY A;  3CE2 A;  4FFB B;  3CCV V;  3Q4H A;  2Q67 A;  3DC5 A;  3CC4 V;  2QWQ B;  2ZNI A;  4PI0 A;  4PA7 A;  4JI2 O;  1D5A A;  1WB8 A;  3HB3 B;  2ZKO A;  3MHH C;  2UXB B;  3PN1 A;  3C3T A;  2Y69 B;  2Y48 A;  2P22 C;  3RYH B;  3W7W A;  1QLE B;  3RYI A;  4O4I A;  4GKJ O;  1SS3 A;  2UUC O;  2IM9 A;  4R7C A;  2DN9 A;  4F4L A;  4PDV A;  4JI6 O;  5LMN B;  2HHH B;  1J5E B;  4J42 A;  4DV0 O;  2O57 A;  5CBH A;  3JAM N;  3TJT A;  1AJN A;  2P4V A;  3TGU H;  1Y74 B;  3E22 B;  2V4D A;  2E5L O;  1YIT V;  2AGA A;  1IBK B;  1RP3 B;  4UB8 Z;  1I08 A;  4IHJ A;  1EN5 A;  2HR3 A;  1MAB G;  1SQP H;  2YDE A;  3THO A;  2QJ1 A;  2AW9 A;  5CB4 B;  2YIA A;  1KD1 W;  1THZ A;  3K0G A;  2JK5 C;  1YDX A;  4NKG B;  4UCR A;  1SA0 A;  2R72 A;  4GX5 A;  3ZRW A;  4MVQ A;  2QWN B;  5L3E A;  1R6T A;  3BA8 A;  4F6R A;  4J41 A;  1O9H A;  3KCX A;  3SYA A;  2CH7 B;  3BCC H;  4H0L B;  4AIL C;  3SYO A;  3W7X A;  3K79 A;  4LNU A;  2W6J G;  3ZHV A;  3JD1 A;  5CBG A;  1M56 B;  3H1L H;  5LHH A;  4PA9 A;  3SPH A;  4WFH A;  5JCO A;  3J80 N;  1Q7Y W;  4FM2 A;  4U3F H;  4WFG A;  4X20 B;  4DR1 B;  1BZK A;  4WFB V;  2Q5Z A;  4TT3 G;  3CXC U;  3QG5 A;  3F7V C;  4Z1M G;  3MAQ A;  1OV9 A;  3E35 A;  3ETG A;  2F66 C;  2KKW A;  2ILM A;  5K1X A;  1S76 D;  1AVM A;  4D6T H;  4NTX A;  2FKX A;  3B4S A;  4CS3 A;  1N32 B;  1YSC A;  1I94 O;  3K5L A;  4GCZ A;  4JI7 B;  4NXM O;  2UUB O;  5LMU B;  1OJH A;  4YJ2 B;  3D36 C;  3L75 H;  4LF9 B;  5LHG A;  1BMF G;  2DQ0 A;  4QIW F;  5EYP A;  2Q68 A;  4H37 A;  1OZ0 A;  4DO2 A;  3OMI B;  5CA3 A;  5CMU A;  4CH6 A;  1GTO A;  1I7F A;  4RO2 A;  2P4K A;  2EJR A;  4ZOL B;  3O9O A;  3HKE A;  2OCH A;  1YJN V;  3CJH A;  5LHI A;  1K3E A;  4BW9 A;  4TV9 B;  3WG7 B;  2F23 A;  2CH7 A;  2AZ2 A;  2EIK C;  4P30 A;  2OIG A;  2ZE6 A;  4LNU B;  1CP9 A;  2Q4P A;  4K35 A;  4QGP A;  4DUZ O;  5KUK A;  1VEW A;  4ZHQ A;  4LF6 B;  2WSS G;  1R3I C;  4WBN A;  3RFR A;  5JQG B;  1NT2 B;  2ARH A;  1H2G A;  1HP8 A;  1QNM A;  5IWA B;  5B1A C;  4PA4 A;  4DW1 A;  4DRX B;  3QO5 A;  3SJC C;  2AXT Z;  4L87 A;  2UXC O;  3ABU A;  4NVP A;  1V55 B;  5H6Q A;  2R9I A;  3B40 A;  4BAY A;  2CAZ C;  4X66 B;  2ODM A;  3S3W A;  4TSF G;  2HFE C;  4B08 A;  1EZV H;  1NTK H;  3E8H A;  3P3P A;  1M4U A;  3R66 A;  3SPG A;  3MHS C;  4J9Y B;  3G6E V;  5FLX N;  1ZAU A;  3T2M A;  5HFM A;  2Z0A A;  1NI8 A;  1US6 A;  2YXL A;  2B5U A;  1R6K A;  5BY1 A;  1M1K W;  1FPO A;  4F6R B;  4LFC O;  2W0X A;  1NR1 A;  3VQV A;  2RMK B;  2VRZ A;  1N36 B;  5DM6 V;  5IJ9 A;  4FM1 A;  2MW2 B;  3LSS A;  1GN3 A;  5IE9 A;  1OCO C;  3ZMS A;  3F7Y C;  4YIO A;  4A5U B;  1BQ0 A;  4YY3 B;  4LP8 A;  3OMN B;  3OEE G;  3QTC A;  1RPO A;  4OPH A;  4LF4 B;  3OTF A;  1NKD A;  5IT9 N;  1B04 A;  1HR0 B;  1DTO A;  5IYB O;  5IJ0 A;  1AP5 A;  1RFY A;  1QLE C;  2L35 A;  1H8E G;  1A32 A;  1PP9 H;  4AQY O;  3B8M A;  3VOU A;  3JD3 A;  2DE0 X;  1X4T A;  1S0V A;  4K8Z A;  1Y76 B;  5LA6 A;  3RYC B;  4UCV A;  3AG4 C;  3APQ A;  3N2K B;  1FXK B;  1MA1 A;  2QE7 G;  2FYU H;  2X0L A;  4B3T B;  1FFT B;  4FJC C;  1AJP A;  4DV7 O;  1AIL A;  2AHY A;  2BTQ B;  3FYI B;  3RVZ A;  5BXZ A;  3K5M A;  2OYQ A;  3SPJ A;  4DV3 O;  1FFX A;  2N04 A;  3RGB A;  4JI5 O;  4JI8 O;  2UUA B;  4NR1 A;  4MVZ A;  1NBM G;  3ZHR A;  1S77 D;  5KUM A;  4ZIB A;  4ICG A;  3IFX A;  4OXS A;  2FL4 A;  2C2A A;  2HHH O;  2ZM6 O;  3BAB A;  3HKD A;  5K1P A;  3G71 V;  4JI1 O;  4JI4 B;  4JYA B;  2RQ6 A;  4GKK B;  5E79 Z;  1AI6 A;  2EIK B;  2ZQM A;  1M5I A;  2E5L B;  3ABL B;  4DW0 A;  1KC8 W;  2BSK B;  5DN6 G;  4LC1 A;  4UCO A;  2EBO A;  2ETN A;  3G4S V;  1Y76 A;  3ABK C;  4YHH B;  3A8T A;  1N0N A;  4D7S A;  3B8N A;  1TA8 A;  4BIO A;  5BMV A;  2R70 A;  1V54 B;  4NTW A;  3CYO A;  2LFR A;  1I5X A;  1N33 B;  2D3O W;  4LF5 B;  2A9H A;  4XDJ A;  4DV5 O;  4H33 A;  3OGI B;  5L3B A;  4LF7 B;  3K9S A;  5IY5 C;  3SYC A;  1M90 W;  1W0J G;  3BAA A;  2F95 B;  3H01 A;  1XMQ O;  4JI0 O;  3CSX A;  4LFB O;  3BVO A;  1XQ8 A;  5IJ9 B;  3RN4 A;  1R1B A;  5LP6 A;  4JAS A;  4JPR A;  3ETE A;  3TCU A;  5B3S C;  3JAL A;  2WWW A;  5KAF Z;  3T1Y B;  1LR1 A;  4J10 A;  3DC6 A;  3ASN B;  5J2T A;  1G8M A;  4LH7 A;  3UT5 B;  1MZE A;  3L72 H;  1VQK V;  2XAS A;  3M7M X;  3J7A U;  4MS2 A;  3OD4 A;  4Z2W A;  3FAV A;  1K5Q A;  1JPX A;  1JA8 A;  1BQZ A;  1WA8 B;  5KLV H;  2EIJ C;  5BMV B;  2WLL B;  2WLI B;  1XNR B;  2ZIO A;  4B3R B;  4TV8 A;  4GT1 A;  2PI4 A;  1H38 A;  1F51 A;  1QR9 A;  3HKE B;  3OTO O;  1VF6 C;  2XAJ A;  3H1J H;  5GW7 A;  2RNB A;  3D3Q A;  5LYJ B;  1OCZ B;  4DK1 A;  3CD6 V;  5B1B B;  2K9P A;  3AK1 A;  2EIL C;  1YTF B;  1MG1 A;  2W0F C;  2DYS C;  1PL0 A;  1ZUQ A;  2YS8 A;  3B09 A;  1IXB A;  5CA0 A;  3TET A;  1HNW B;  1PNK A;  5JQG A;  4B3S O;  1N34 B;  5KHI A;  2UXN A;  3OR6 C;  5JH7 B;  2RN9 A;  1VP7 A;  2WA4 A;  4F6E A;  5JH7 A;  4X65 B;  2CK3 G;  4G2K A;  3T1H O;  3BEH A;  3DTU B;  1OCR B;  3ZHQ A;  1K92 A;  1SKV A;  1S5L Z;  3EXA A;  1S3J A;  3Q4H B;  4HAM A;  2M6Y A;  2PY5 A;  2LP7 A;  3ZS8 C;  4ABM A;  1PD3 A;  2F93 B;  5CA1 B;  1OCR C;  1VF5 B;  4FPP A;  1NTZ H;  3WB2 A;  4DUY B;  4X1K A;  1ZL8 A;  4B7K A;  2MK3 A;  4DR2 O;  2OTJ V;  1PKX A;  1KBH A;  1PV0 A;  5IDJ A;  1SRY A;  1JJO A;  2Q69 A;  3BHP A;  5DEC A;  1RPR A;  4IYI A;  5C8Y B;  2LO1 A;  3GWO A;  2Q0O C;  1UFI A;  1TGO A;  1XOU A;  1WNS A;  2JEX A;  5LOV B;  2L6L A;  4C7U A;  4X88 A;  5HFL A;  3FB6 C;  4LWS B;  3UO2 A;  3ZJZ A;  2E74 B;  2XTA A;  1HR0 O;  3E22 A;  1QU7 A;  1HWY A;  5H5N A;  2Y0I A;  4EKW A;  1ZX3 A;  4IYH A;  1BHA A;  3L9D A;  2IH3 C;  2VQE O;  1SER A;  2EIN B;  4X64 B;  1NZ6 A;  1PNM A;  1JFF A;  3OW2 U;  5LP6 C;  4B3T O;  3ABM B;  3UCS C;  2IJK A;  3P3N A;  3CS5 A;  3CJH B;  1L1F A;  2GUZ A;  3AK3 A;  2UXD O;  4I0X A;  4IL6 Z;  1SC5 B;  3RBZ A;  5FPO A;  3S3X A;  1EM1 A;  5IYZ B;  4JI6 B;  5LMN O;  3JAT A;  3OEH G;  4DR3 O;  2EIN C;  2D2C B;  4XDL A;  3RYF B;  4X1K B;  3SJQ C;  2ATK C;  4FLY A;  3WFV A;  2UUA O;  2FTK A;  3APO A;  4MVO A;  3X2Q B;  4WFE A;  2P06 A;  3AG7 A;  4ZI7 A;  3UO3 A;  5KAI Z;  2ZM6 B;  2JJ1 G;  2DJV A;  4U7O A;  3JD0 A;  3MD0 A;  4I4T A;  1VF6 A;  3ZCC A;  3K08 A;  2KSD A;  1JCH A;  3E2E A;  1XNQ B;  1FXK A;  2A0L A;  5L3G A;  4EFB A;  1SQX H;  5LGN A;  2X6C A;  1MOF A;  2DW4 A;  5IY5 B;  2P67 A;  2P6J A;  4TUY B;  3BFR A;  2YXY A;  4YHH O;  1G6U A;  4GX2 A;  4K8X A;  4LFA B;  2FML A;  1HNX B;  2Z3Y A;  4RWU A;  4K0K B;  3CCM V;  1EBO A;  2CDY A;  5B1O A;  1P49 A;  4DV4 O;  1HNZ O;  5JCO C;  1ROP A;  2P7T C;  4I55 A;  1MSD A;  4LR3 A;  3U0Z A;  1GK9 A;  1F7Y A;  1N4C A;  1R3L C;  4X89 A;  2GUZ B;  1IDS A;  3U11 A;  1JVM A;  3OUF A;  3DXR A;  1BGY H;  4J9Z B;  3H9V A;  1I0H A;  3IC7 A;  4W4K A;  4I50 B;  4L8J A;  4YXW G;  3AG3 B;  1XIL A;  4NXN O;  1CEZ A;  2WAM A;  2LW1 A;  4LF9 O;  3L74 H;  1Y4M A;  2VWJ A;  4LFB B;  1P4R A;  4JTA B;  1SET A;  3CRM A;  3GWK C;  4LWS A;  2OT5 A;  3T1Y O;  4X62 B;  1JQ0 A;  2VWK A;  2XAH A;  3CCQ V;  4LCU C;  1TAE A;  1WP8 A;  1LUV A;  4O4L B;  5CB4 A;  1QLN A;  4OX9 B;  4YJ2 A;  3CWB H;  1XHZ A;  1IBL O;  1Q90 D;  1EFR G;  3B2E E;  4O4L A;  1L0L H;  5EZY A;  4DUZ B;  1QHT A;  2JRI A;  3DGE A;  2W6I G;  2Y4T A;  2PYL A;  2R9A A;  1XMO O;  2P5O A;  1FJG O;  4GZR B;  4FLX A;  1HDJ A;  5IYZ A;  1P7G A;  1RM1 B;  3FB7 C;  4JI3 B;  2VS0 A;  3H1I H;  3K5O A;  4W4L A;  2QWO B;  3ZHU A;  2Q73 A;  3ABL C;  3E89 A;  5JWP A;  2LGW A;  4X66 O;  4WBN B;  1FXH A;  5TIS Z;  2KG7 A;  1VIB A;  4DR5 B;  1VQM V;  1V55 C;  1RM1 C;  1TVK B;  1COW G;  4X1Y B;  1OCO B;  2LQT A;  2JJ2 G;  1TVK A;  1K9M W;  2JVD A;  4FMT A;  3RVY A;  2OCC B;  1DK1 A;  3ZMT A;  4DYL A;  2BCC H;  4MW8 A;  3CCL V;  2DMX A;  3OGC C;  2DYR C;  3ZX6 A;  2XAQ A;  3E86 A;  2GBO A;  4IGG A;  3T4Z A;  1B6Q A;  3A0R A;  4PDR A;  4UV9 A;  2JIZ G;  1H2K A;  3ML0 A;  3WG7 C;  4MTG A;  2GDS A;  3CPW U;  1JR9 A;  1FXK C;  3BY6 A;  5BR8 O;  4DR4 O;  4MVR A;  3CRQ A;  3N27 A;  1Q81 W;  4YY3 O;  4DUY O;  3E83 A;  3EVK A;  3AG3 C;  3STL C;  1AR1 B;  1XUQ A;  2QM7 A;  1DLB A;  3ICX A;  4YIP A;  5D5Q A;  3GVM A;  1PPJ H;  3HKC B;  1KEC A;  2YIB D;  1J5E O;  4CZZ A;  1NVP D;  2RDC A;  3DXR B;  3HKC A;  1R3J C;  1QR8 A;  2GV9 A;  4ZBM A;  1ZLZ A;  2K1E A;  4FLU A;  4DV6 O;  3K06 A;  4QNH B;  4U7N A;  1S5J A;  1M93 A;  1W0K G;  1H2M A;  3K57 A;  3FD9 A;  3CXH F;  2WLJ A;  1SZX A;  3TK1 A;  4UVA A;  2NNU A;  2QWP B;  4FLV A;  2VQE B;  3P32 A;  3AG4 B;  2HG5 C;  3NR7 A;  1SF9 A;  2OTL V;  3SJB C;  2E75 B;  3OFN G;  4IHJ B;  2E3C A;  4QE7 A;  4JI5 B;  5KHK A;  5KHH A;  5FL7 G;  4JI8 B;  5JJN B;  2UXC B;  2BOB C;  2ZE5 A;  4R8C A;  1NQT A;  5KX5 B;  1BE3 H;  2Q8V A;  5LL6 Y;  2DYS B;  4MT8 A;  4YJ3 B;  5ITZ B;  2PUS A;  4B3M O;  1NH2 B;  1MSW D;  1FFX B;  4JI4 O;  3WU2 Z;  3VQW A;  4I0X B;  4JYA O;  4OPA A;  2QWR B;  5LOV A;  3CRR A;  4DXW A;  2QGN A;  3ZIA G;  3FYE B;  1NS1 A;  1KQS U;  4DR7 B;  3TXQ A;  1P84 F;  3AG2 C;  1ZWI C;  1Y66 A;  1D2D A;  2OCC C;  1I94 B;  4BW5 A;  1UPG A;  2IU0 A;  4NXM B;  5IJ0 B;  2LJ2 A;  4X1I B;  2DYR B;  4ZI7 B;  1XI1 A;  1N36 O;  3ETQ A;  1M56 C;  5JVD A;  1DGS A;  4B7E A;  1M57 B;  1VQ8 V;  5B1N A;  2Y69 C;  1LNQ A;  4JAV A;  4G28 B;  3ZN1 A;  3LSU A;  1EN4 A;  5GTH Z;  1F23 A;  1U96 A;  2IJJ A;  2IJH A;  4U3J A;  4DR6 O;  2ZE8 A;  1WJZ A;  3CCU V;  3LDE A;  3RYI B;  1P7B A;  4QPJ A;  2F4V B;  2H94 A;  2DWD C;  1HW7 A;  3KCY A;  4UVB A;  4LF6 O;  4JI2 B;  1BSM A;  4I9Q A;  2Q7E A;  4Q6G A;  1AI7 A;  3T1C A;  3CCE V;  2YXH A;  2N74 A;  1OCZ C;  4CBC A;  4GKJ B;  4PDL A;  4KXR A;  3JAK A;  5CBF A;  2PZS A;  2UUC B;  4JF3 A;  4DV0 B;  4WCE V;  4TWK A;  2CGN A;  1H2L A;  5C93 A;  3WB1 A;  4RQF A;  3ABK B;  1WN7 A;  4KFM A;  4QPK A;  2Q6A A;  2OIE A;  3JCZ A;  1H2S B;  4FIP C;  3NXS A;  3PJS K;  4X1I A;  4TQD A;  2JGD A;  3SJA C;  3OTO B;  1WB7 A;  1JX9 A;  5CN0 A;  2Q0A A;  1QBZ A;  1WLE A;  4CH3 A;  4HNA B;  3X2Q C;  1FJG B;  2H3O A;  4GUN A;  2B9Z A;  2WLI A;  1SQG A;  1VQP V;  4HNA A;  1NVP B;  4TV8 B;  1WA8 A;  3N2K A;  3LDC A;  1BT8 A;  4MTF A;  2BTO A;  2V1D A;  4J11 A;  1WP7 A;  1IBM O;  1B3Q A;  4P2Z A;  3IJ4 A;  2ZXW B;  1GN6 A;  2ZD9 A;  4WF9 V;  2EZO A;  5JJE B;  1JOY A;  2JS5 A;  3SDL A;  1N34 O;  3I55 V;  5LGU A;  4N23 A;  5F2V O;  2QA4 V;  2VQF B;  2RJZ A;  4LF4 O;  1PL4 A;  5EBM C;  4RUF A;  2X7R B;  4FVM A;  5KMG B;  3RT3 C;  2XT9 A;  5KHJ A;  3A2F A;  2QKC A;  1VQO V;  4LF5 O;  1XDC A;  1TUB B;  3LDD A;  2PI5 A;  4DV5 B;  4FM0 A;  1NJI W;  1LUW A;  3CCR V;  4UV8 A;  3JSN A;  3C90 A;  3ZN0 A;  3AEI A;  5A2Q N;  2UXB O;  1AR4 A;  5KA5 A;  2UUB B;  1CXZ B;  4MW3 A;  5B3S B;  3H1K H;  1GMG A;  3CC7 V;  2XAG A;  2XAF A;  1AP6 A;  4OGQ B; 
#chains in the Genus database with same CATH homology
 1BGY H;  1NU1 H;  1SQQ H;  1SQV H;  1SQP H;  1PP9 H;  5KLV H;  1BCC H;  3BCC H;  1L0N H;  3H1H H;  1SQB H;  3CXH F;  3H1I H;  3L74 H;  2A06 H;  1NTZ H;  1BE3 H;  3CX5 F;  4D6T H;  1SQX H;  1P84 F;  2IBZ H;  1PPJ H;  3H1L H;  3CWB H;  3L72 H;  3L71 H;  3L73 H;  1EZV H;  2FYU H;  1L0L H;  1NTK H;  1KB9 F;  3L70 H;  1KYO F;  2BCC H;  3H1K H;  3TGU H;  4U3F H;  1NTM H;  3L75 H;  4PD4 F;  3H1J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...