3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
1EZVH 1SQVH 3CX5F 2FYUH 2BCCH 1NTZH 1SQXH 2A06H 1KB9F 1NTMH 1BCCH 1L0LH 4U3FH 1SQPH 3H1IH 3H1HH 1BGYH 3L72H 1KYOF 4D6TH 3BCCH 3H1KH 3L75H 1NTKH 1NU1H 1PP9H 3CXHF 2IBZH 3H1JH 1P84F 3TGUH 1SQBH 1PPJH 3L70H 3L73H 1BE3H 1SQQH 3L74H 5KLVH 3L71H 3H1LH 4PD4F 3CWBH 1L0NH
chains in the Genus database with same CATH superfamily
1N36O 1P49A 4O4LB 4X1IA 3JAMN 1KB9F 1NR7A 3DXRA 2V1DA 2E5LO 1AP6A 3OMAB 2UXCB 2WLLB 4LF6B 1V55C 2OTJV 4QE9A 1M90W 1MMMA 3SYQA 3CMAV 1JJ2U 1N33O 1EZVH 4MTXA 1BMFG 2KG7B 3AEIA 5GTIZ 4PA9A 2F43G 1O9GA 2ZCEA 1QNMA 3QF7A 1M1KW 1IBLB 4DXWA 3CCVV 3DC6A 4TWKA 3D36C 1A32A 4GCZA 1NTKH 1ENVA 3FYEB 1MZEA 2KG7A 3F5WC 3ZJZA 2M6YA 1F51A 1SQBH 3W7UA 2XHBA 4DV1B 1JX9A 3C90A 2QA4V 4JYAO 3K79A 1H38A 2LW7A 4B08A 3ZMSA 1Q43A 1B06A 2W6IG 5LHGA 1QCEA 2DYSB 1MA1A 2JEXA 3T1HO 1US6A 2Q0OC 3QO8A 1BQZA 1COWG 4PA4A 5LBQA 4XDJA 5B5EZ 3ETQA 5DEDA 2DWEC 3W7XA 5A9GA 2EZPA 2UUBB 4LF9O 4LFAB 2ZIOA 2E74B 3ABKB 1V9PA 1BHBA 1OCRC 1SETA 3JD1A 4W4LA 3SPGA 5LP6C 1R6TA 3D8CA 5B1AB 2KKWA 1L0NH 4PDLA 2CTQA 1Q8IA 1XEQA 1BQ0A 2QKSA 1AJPA 3AG3C 4W4KA 3ZMZA 4PA7A 1AI4A 2B1GA 1IVSA 4DR3O 5A2QN 4PDVA 4MVUA 2EIMC 1Z2GA 1NU1H 1Z5VA 3K5MA 4X1IB 3VQYA 3LSQA 1WB8A 5L3DA 2G38A 4JYYA 4DR6B 1KECA 5EC1C 1WJZA 2Y69B 4HYOA 4LFBO 4BIZA 1V55B 1MSDA 4EFBA 1J5EO 1IBKB 2QWRB 3E8FA 4YHHB 2H8PC 4DV4O 3ZBHA 4I7ZB 2DE0X 4B3SO 4GKJO 1Q6HA 1HDJA 1K92A 4X9QA 4FK5C 4OGQB 2QKAA 1JOYA 1OCCB 2WLLA 5CBFA 2PI4A 4RWUA 4O4HA 4KP4A 2P67A 4DV0B 1DF5A 4EEQA 4JI7O 2BOBC 3N2GA 1QBZA 4I5SA 2ADQB 4B3RB 3AG1B 5EYPA 1NR1A 2R70A 5KUKA 3OEEG 2BSKA 2P5OA 2A06H 3I56V 1FXHA 2GV9A 4PHZA 3ZRSA 2UU9O 3N27A 4ZBMA 4LFCB 3BY6A 3G80A 3ZMUA 4D7TA 3WB2A 4JI2O 2LP7A 2Q67A 2EJRA 3ABKC 4YJ2B 3HR0A 3C3SA 4LWSB 3ZRVA 1YSCA 1SZTA 1RPOA 1Y66A 1GM8A 3FB5C 1H2NA 4YXWG 4NTXA 5IYBO 2ZNIA 2YXHA 1K9MW 1SESA 3SPHA 4DR1O 1S0VA 2N74A 4FFBA 2HJDA 3OEHG 1BL8A 4G2KA 2B1IA 1MZFA 2ZR3A 2WLIA 4LBEC 3JARB 3AG3B 2P90A 2OCHA 3JAKB 3K3WA 1N0JA 2BCCH 3A0BZ 1EBOA 4DK1A 4LF5B 2F23A 2FMLA 2P4VA 3CRMA 4NKGB 2UUCO 2BE3A 4J7ZA 1JA8A 1VQLV 3BAAA 4K0KB 2KSDA 1R3IC 2YIDA 5IY5C 1EFRG 1S5LZ 1KP3A 3BA8A 3AG2C 2JVDA 5K1PA 3OM3B 2FTKA 2GUZA 5JQGA 4RUFA 2B9ZA 2DW4A 3OW2U 2LGWA 2ZQMA 1N32O 1FFTB 1AR1B 3SPIA 4CZZA 5J2UA 5KHHA 3DGEA 4GT1A 1SA0B 2EZOA 2CGNA 5JH7A 1HNZB 1SF9A 5GONB 3L70H 1OCCC 2XT9A 3ZRWA 5IE9A 1K8AW 5LOVA 4WFGA 3CX5F 4P2ZA 2VS0A 3MHHC 4L8JA 3CCJV 3H1HH 1FFXA 1BT8A 2LGQA 3AG1C 1Q81W 3TK1A 1NS1A 1VQ8V 5LP6A 4H37A 5CA0B 5EZYA 4JI5O 2Q5ZA 3D3IA 5LA6B 1AR5A 4LF4O 3OMIB 5LXTA 3CCMV 1FJGO 5IT9N 3CD6V 5GW7A 2K9PA 2EILB 4X88A 1IBKO 4X66O 5CA1A 1AVMA 1OHHG 4LWSA 5LGNA 2ITCC 1PP9H 3OR7C 1Q6UA 3ABLC 4B7KA 3B4SA 2AHYA 1X4TA 2Y48A 3CC7V 5LYJB 3ZEDA 4UV8A 4JI0O 4X64O 1KUQA 3SYOA 1THZA 2AXTZ 5KX5B 2QKCA 2YIBA 3T1CA 3H1IH 2V7QG 1LUWA 4X1YB 4BAYA 4TV8A 3BFRA 4UB8Z 3H1KH 1PL0A 5JCOC 4CC5A 5B1BB 2JGDA 1QQCA 1Y76B 3E86A 3K59A 3OTOO 4YY3B 3LSSA 2PGGA 2HHHO 4GYCB 1AI5A 3CCLV 5CA1B 4PI2A 3THOA 3N2KA 2UU9B 4O4JA 4J7KA 3ZN1A 1SERA 3OE7G 1P7BA 5IY5B 2ILMA 5EBMC 5IYZA 4E4EA 5LGUA 4JI2B 2GHYA 5ITZA 3ASOB 4I9WA 3IGAC 4DR7O 3RYFA 2RNBA 3FAVA 5BR8O 4ZIBA 4DUYO 2F4VO 2LFSA 4TV8B 1VQOV 4QPJA 2YSUB 2WPDG 4MS2A 3CCQV 3RYCA 3CC4V 1TUEB 4UCUA 1ROPA 2DOSA 3ETEA 1PKXA 1XMQB 1M5IA 1D5AA 3DSQA 3L74H 3O9OA 4FIPC 2N05A 2PTMA 1SQFA 5LMUO 4KHPO 3AG7A 3A2FA 2GBOA 2YUAA 1HNXO 3CC2V 2QE7G 1VP7A 1OCOC 1XDCA 3CCEV 1H2GA 3K9AA 4LF7O 5DM6V 1YJ9V 4J9YB 2IH3C 2UXBO 4QPKA 4XDKA 4Z1MG 1N34B 4O2AB 1JR9A 2BTOA 1XOUA 1I94O 2FYUH 2QWQB 2F93B 2ARHA 1XQ8A 4GX0A 4FVMA 1Q86W 1NTMH 1N32B 5FPRA 1TUBA 4X62B 2E76B 3ABLB 2Y0IA 3TCUA 2K1EA 2Q68A 4ZOLA 1P7GA 2PI5A 3ASNB 3JASA 3U11A 4IT5A 3SPJA 3WG7B 1WPBA 2O57A 1XI1A 1HNWO 1QVGU 2VQEO 3E2EA 1VF6A 3JD4A 2UXDO 3BEHA 1E1RG 1KMIZ 1XNRO 2VQFB 3UM7A 2OTLV 4TUYA 4E2LA 3NR7A 4AQYB 3IC7A 4UCRA 2QM4A 4CH4A 3CJHB 5IWAO 1YIJV 2XAFA 4WFFA 1QR9A 4MW8A 4DR4B 2DYRC 1JFFB 2Y0PA 4O4IA 3RGBA 4EB6B 1G1XB 1KBHA 2L35A 5JJJB 3I55V 2W0FC 2QEXV 4XDLA 2P22C 1PL4A 2IJHA 3JARA 4MTGA 4JI0B 3BVOA 1Q5OA 5KMGB 4DV6O 5IYZB 4ZHQA 1BS3A 5J2UB 4JYCA 3CP1A 1QHTA 4O2BA 3DTUB 5EBWC 3AG4B 1EN4A 2C2AA 1NH2B 5JWPA 1XL6A 2XOKG 3B8NA 1X59A 4HBNA 1VQ6V 4FPPA 3BRCA 3BHPA 2ZE8A 5H5NA 2ZINA 1TGOA 3EHBB 2QDOA 4PA6A 1EM1A 3ZHRA 1OZ0A 3K5NA 2B5UA 4KFMA 2AZ2A 1GN3A 1N8RW 5JCOA 2ZM6B 3JAWA 4DV5O 5KUMA 4J7JA 2E5LB 5AG2A 2UXCO 4H0LB 4FMTA 5H2FZ 2A7WA 2HG5C 1SQGA 1MOFA 3Q4HA 2F66C 2F4VB 4UCTA 1XNQB 1L0LH 4CH3A 4PI0A 3K04A 1DF4A 5F2VO 3ASNC 4NTYA 3J81N 2W0XA 1DK1A 5EIBC 1FD9A 3WG7C 2CGOA 3Q4HB 1S72V 3H1JH 2GUZB 3S3XA 4DRXB 5JQGB 5LA6A 5IYDO 1ZWIC 2IJJA 3L71H 4BW5A 3AK2A 1QLEB 3W7SA 1F23A 2A9HA 2EIJB 1EN6A 5KHKA 4NR1A 2WLHA 4LF7B 5K1XA 1Q6IA 1OCZB 4JAVA 4LF8B 1PNKA 2P6JA 3N2GB 3OGCC 2DYRB 3RYIB 3JALA 5LHIA 3RFRA 3OT7A 1FYJA 4WCEV 4R7CA 2X6BA 4TOIA 4FM1A 1GM7A 2M7WA 1GK9A 4OPAA 2Z3YA 4IIJA 3JD2A 3CSXA 3NXSA 3IC9A 2ZR2A 3HKEB 4X1KB 3JAWB 1SQXH 1QVFU 4WFHA 1Q90D 5E1AC 5J2TB 4J9ZB 4MSWC 3CRRA 3FB6C 1YTFD 2Q7HA 2D3OW 5C8YB 1NJIW 1VARA 1GO3F 2LFRA 4UVAA 4AQYO 1AI7A 1D5NA 4JASA 2Q69A 2CE4A 4LF9B 4TUYB 1IURA 4LFAO 4DR2O 4D7SA 1GN4A 5L3EA 4DR6O 2E3CA 2JDIG 2KB1A 4U7OA 2ZNJA 5BMVB 3HKDA 2Z5UA 3TJTA 2ZDIC 4O4LA 2JK5C 3K08A 1PD3A 1J5EB 1ZUQA 2DYSC 3RYHB 3D3QA 4X89A 3LDDA 5D5PA 3IFXA 4GKJB 4NYKA 4DR3B 1AILA 3FFQA 4TQFA 1XHXA 4KUMA 4B7EA 3CS5A 2CH7A 1R6KA 3PN1A 4UUJC 1OCRB 4DV7O 1XILA 2ADPA 4J10A 4JYBA 1GKFA 3E8BA 5IJ0B 3JATB 4ZI7B 2HEPA 5B1AC 1H2KA 5EIBD 1O9HA 4YHHO 1VF5B 1OCZC 1XBLA 4CH5A 3ML0A 2HVJC 1I08A 4ASUG 1FXKC 3CE2A 3VQWA 2LJ2A 4I4TB 3LUTB 4MVRA 4F6RB 4MW3A 2JJ1G 2UXNA 1ZSPA 2V4DA 4TSFG 5EZYB 1URFA 1SC5B 4PA3A 2CDYA 1XNQO 3A8TA 4DR5B 2JJ2G 3IJ4A 1FFXB 2RQ6A 1YI2V 1TVKA 3HPLC 3HKBB 2FKXA 5D5QA 5JJNB 2WA3A 5LGTA 4RQEA 2XAHA 4JI7B 2MK3A 1VQMV 4JV5B 1R3LC 3KKYA 1GN6A 4YJ3B 3IAYA 3OUSA 1GM9A 4I55A 4NB5A 4CH6A 2YIBD 3T1YO 3UCSC 5FL7G 5CBHA 5EC2C 3OFNG 1AJNA 2AZ0A 3VQXA 1SQPH 2OCCC 4K3AA 4DYLA 1QU7A 4TV9B 1P4RA 3LDCA 3CPWU 4BIOA 3QO5A 2RCVA 3U10A 4GLXA 1DGSA 4JI4B 3FB7C 4CS3A 2ZKOA 1RP3B 2CK3G 2Z0AA 4B3TB 1I0HA 4LH6A 5JVDB 2FL4A 2YXYA 1BCCH 4FZ0A 1TA8A 2WLNA 2YC0A 2YDEA 2H94A 3TXQA 4Z1VA 2WA4A 5CB4A 1BE3H 3K5LA 4HNAB 2A0LA 2PZSA 1J95A 3CWBH 3CRAA 2RDCA 3ABMB 5GONA 3VQVA 1I5XA 3P30A 4IIJB 4JTDB 1DLBA 4FFKA 2DQ3A 2XNDG 1YEWA 3E8HA 2UUAB 4B3SB 2QR4A 2OIEA 4I50A 1OJHA 2QM8A 3JD3A 3STLC 4CC6A 3SGIA 1KC8W 4LNUB 1IBMO 3JALB 3RYIA 3EFFK 2YXLA 4IGGA 1WA8A 4IYHA 1ORQC 1ZL8B 3QTCA 4DV0O 3P32A 5C8YA 5BY1A 4DR2B 5L3CA 1JJOA 4JTCB 2Y4TA 1HWYA 4HAMA 1NH2D 1JQ0A 2NN4A 3KCYA 1JCHA 1TUBB 2WLMA 4HZ3A 5KAIZ 5KAFZ 4FLVA 1SQQH 4X66B 4OX9O 4GUNA 4B3MO 2YI8A 4CBCA 4LFCO 1BSMA 3CEIA 1LUVA 3MDSA 2ZT9B 2EIKB 4RO2A 3HKDB 3SPCA 3ZHVA 2R9AA 2YEVA 3ZMTA 4DW0A 4FLUA 3L72H 1PNLA 4DW1A 4WBNB 5FPOA 3GWOA 3H01A 1CPYA 3CYOA 1R3KC 3F5TA 4JAAA 3BA9A 3RVZA 4JI5B 1NKDA 5LL6Y 2HJFC 3ZHUA 4AILC 2OCCB 3RVYA 1NTZH 4TQDA 1VMGA 2QGNA 5DECA 3W7WA 4FM0A 1S76D 1FS0G 3SJCC 1XMOB 3APQA 3K58A 3B8MA 4WF9V 3SJBC 2IW5A 4GKKO 1RPRA 2AGAA 2UUCB 4QE7A 1H8HG 4H44B 3SJAC 1Q3EA 4JI1O 4X64B 1RM1B 4MTFA 4DR5O 4LNUA 4N21A 3G4SV 3E83A 3T4ZA 4ZHQB 4OPHA 3CHXA 2QSAA 4PJ0Z 4U3JA 3JATA 3D36A 4I55B 4R8CA 1XUQA 2UXXA 3E89A 3T1YB 2ZDIA 4PD4F 1RSOA 4YIPA 4JI8O 1K4CC 1WAZA 2ITDC 3T4DA 3JSLA 4Z2WA 1VF7A 3B09A 4PELA 4IHJB 5IJ9B 5LMUB 4KHPB 3OD4A 5DN6G 1NZ6A 1RSOB 4DUZO 1WP7A 2P7TC 3ICXA 3MHSC 1M9NA 3LNMB 3FX7A 4X8AA 5JH7B 2EULA 2F95B 4FFBB 5B1BC 4B3TO 5B3SB 3E8GA 4LR3A 1K34A 1HR0O 1YZBA 2Q73A 2PY5A 1NBMG 4OXSA 1WN7A 4DV3O 3N2KB 2NR5A 1E79G 1WB7A 4C7UA 2A3QA 1L1FA 5LXTB 3CRCA 4JTAB 5KHIA 1AROP 3AK1A 1MNGA 1PPJH 2NLJC 5IYCO 3H1LH 3WB1A 3ZIAG 1WNSA 4G27B 3A0RA 3DC5A 1Y74B 5TISZ 4DV1O 4X65O 1BGYH 1BHAA 1AP5A 3P3NA 3BPZA 3EXAA 3L75H 1F7YA 1YXBA 1SRYA 2IH1C 3LDEA 3RW0A 3ZHTA 4MT8A 1I94B 2Q9LA 4U3JB 4MVOA 4YIOA 3FYIB 4P9PA 4JAUA 2QM7A 4GX2A 3X2QB 5FNVA 4DV2O 1AR4A 1IZ3A 2ETNA 1VQPV 4JPRA 4CS2A 3BABA 4JGSA 3ABTA 4WFAV 1L8DA 1OCOB 1RM1C 3HKCB 4K8ZA 2QTSA 4TT3G 1VQ5V 3B2EE 4FJCC 2UXDB 1Y76A 2P06A 1E1QG 5H6QA 3GVMA 1EZJA 3CCUV 2IU3A 4DR7B 4X20B 2CUGA 5J2TA 1GTOA 4J41A 4DV6B 5KX5A 2YICA 5BR8B 3FD9A 1ZL8A 2QTOA 1M57C 1S5HC 1I7FA 1YDXA 1N33B 1VQ7V 1S77D 2GTAA 1PNMA 4I50B 2AW9A 1VQ4V 4WBNA 3VOUA 2Q6AA 4CS4A 4O4JB 2AHZA 4FLXA 1IXBA 2GDSA 1IBLO 2DJVA 4GX1A 1H2SB 1KYOF 4LFBB 2XAJA 5B3SC 1U97A 2JS5A 1V54B 4R6ZA 4J80A 4RUEA 2DWDC 4UXNA 4JI1B 2JGUA 2HR3A 2JGDB 2XAGA 4DV4B 1SQVH 4JYAB 2JRIA 4BIUA 4LF6O 2OIGA 3G6BA 4ICGA 5KA5A 2UXBB 3OAAG 2WSSG 3I5DA 3R66A 2Q7EA 4P30A 4UV9A 1JFFA 4O4IB 4EB6A 3W7TA 2GTSA 3T1HB 1WA8B 1H2LA 3ZHSA 4UB6Z 3K9SA 1VIBA 3HKCA 2EIMB 3G6EV 1K33A 4NXMB 4TV9A 3QO7A 3GWKC 3LNNA 2VQEB 4UVBA 4DUZB 1S3JA 3WU2Z 4H33A 2A79B 3SR2C 2YS8A 1P84F 2Y69C 2JIZG 2CH7B 3JASB 2IU0A 1H8EG 3K06A 1D2DA 3OTFA 3X2QC 2RN9A 3FKSG 1PM9A 3K0DA 1YHQV 4DV3B 3WFVA 1VQKV 1YJNV 3OMNB 2ZXWC 4FLZA 2ZE6A 2BOCC 2RJZA 1FAFA 4FZ1A 1NT2B 3SDLA 2HLDG 1PV0A 3APOA 4I4TA 3RYHA 1Z5WA 1Y4MA 2CTRA 4DR1B 4K35A 2X7RB 4LP8A 1LNQA 2DMXA 4H13B 1FXVA 2D2CB 1SKVA 3U0ZA 1KKDA 4LCUC 3M99B 1M57B 2N04A 3K0GA 1WP8A 4LF8O 2OT5A 5C93A 3P3PA 2EINB 2PUSA 4AI8A 2MW2B 3CMEV 4MVQA 5IJ9A 4P9OA 2JS3A 2XTAA 3HKBA 2X6AA 5BXZA 3RT3C 3C3TA 1B04A 3ZCCA 2EIJC 1V54C 3EVKA 1B6QA 4G28B 3K57A 3JAKA 1M56C 1UFIA 3RBZA 3QG5A 1VQ9V 1G4YB 4F6RA 4MVMA 4B3RO 3JD0A 1KP2A 4LH7A 2VRZA 1YJWV 2ZIMA 1YTFB 4KL1A 2VWJA 1LR1A 4L87A 4DV5B 3JSNA 4AHCA 3MD0A 3B40A 3HB3B 1N0NA 4MVSA 2XAQA 3KCXA 2LW1A 3E22B 5HFMA 2ZE5A 5CB4B 3MAQA 2QJ1A 1GMGA 5B1NA 4BWAA 2OWOA 2QWNB 1CP9A 3ETDA 1F4NA 4DV7B 2W6JG 1HW7A 1UPGA 2IJIA 3AG2B 2HKOA 4K8XA 3SYCA 5LYJA 3FAVB 1SZXA 5GTHZ 1G8MA 1YCIA 3M7MX 4UFZA 4F6EA 4EKWA 3R65A 5B66Z 2EBOA 4DRXA 5CN0A 2ZXWB 2E75B 4O4HB 3CRQA 1I5YA 4LF5O 3ZX6A 1XL4A 3ZN0A 3ZMVA 5FNVB 5BZBA 2YEVB 1K5QA 3KZIZ 4YJ2A 4IYIA 2KQXA 5LMNB 4HNAA 1GH6A 3UKMA 4X20A 4NXMO 1N4CA 5E79Z 1R73A 2XUMA 4UCSA 4X1KA 2EINC 3G67A 3L73H 4BW9A 3SYAA 5EYPB 2EILC 4K0KO 4BR6A 5EBLC 5ITZB 4O2BB 2X0LA 4JZ2A 1KD1W 1M56B 1T5EA 2WLKA 2Q4PA 3L9DA 4DUYB 3ABUA 1R3JC 4JI6O 1W2BU 1NVPD 3A0HZ 4NVPA 3OGIB 4U7NA 3RWRD 2WLJA 2YI9A 1ZAUA 1FXKB 4XBFA 4ZOLB 1VF6C 5LHHA 1XMQO 1FJGB 1HNZO 1K73W 4I0XA 2ODMA 1KQSU 2R9RB 3JCZA 3J7AU 4NXNB 1CXZB 2WAMA 4EFEA 1YF2A 4JI4O 1GRJA 4PV1B 1JMKC 3E35A 3M8AA 2F1MA 4JZGA 3T2MA 1NQTA 1Y67A 3CXCU 4U3FH 1SA0A 1N34O 3ASOC 4FLTA 3SYPA 1R1BA 3B77A 2JEUA 4FLWA 3OR6C 3DXRB 4LF4B 1KKCA 4J11A 3TXSA 5IJ0A 1WPXA 3O65A 2CTPA 3OTOB 4I9QA 4YY3O 4R50A 4PDMA 3WB0A 3AK3A 4DK0A 4OX9B 2UUAO 4IHJA 1MABG 5KA6A 1XHZA 1WLEA 5L3GA 3UO2A 3QVNA 1W0KG 2XASA 1IBMB 3E22A 4WFEA 2Q7GA 2GSMB 2ATKC 2QWPB 3F7VC 3PJSK 4JV5O 2R72A 3ABMC 4UCOA 2NNUA 3OUFA 1FPOA 3BCCH 2HHHB 2R9IA 5HFLA 2LQTA 4RAIA 1KU9A 5B1OA 5CA0A 4JI3O 4B3MB 5KLVH 1IXMA 4GX5A 3FB8C 2RMKB 4YJ3A 2P4KA 1G6UA 1N36B 5H9CA 4DO2A 4GKKB 2PF4E 4X1YA 4QJFB 5IDJA 4QIWF 1TVKB 2H3OA 4PDRA 4RQFA 1Q7YW 3K5OA 4D6TH 1VEWA 2QWOB 5LMNO 3ZRWB 4UVCA 3RN4A 1ZLZA 1K3EA 1K4DC 1MG1A 5BMVA 1K7DA 3CCSV 2EX3A 3UQ8A 2IJKA 1XMOO 5KHGA 3TETA 2EIKC 4X62O 2DQ0A 1NI8A 2CAZC 1IX9A 4IL6Z 2FB5A 3LSUA 2PYLA 4ZI7A 2IBZH 1F4MA 1DTOA 2EJ7A 3QNEA 1HNXB 3ZS8C 1M93A 1VQNV 4GZRB 2HVKC 5L3FA 4UCVA 1W59A 2IM9A 5EK0A 2L6LA 2BTQA 3UT5B 1CEZA 1ZX3A 1Y6XA 5CMUA 2ZD9A 3UO3A 1XNRB 3RYCB 1TAEA 1XREA 3VBBA 5JVDA 1SS3A 4JI6B 4ABMA 3K03A 1HR0B 1EN5A 1R6NA 5CBGA 4N23A 4FLYA 1FXKA 2CTWA 5LOVB 1RFYA 1NVPB 2X6CA 5IWAB 4ZKIA 4JI8B 2YIAA 2UUBO 3G71V 3JYCA 2Y4UA 1IDSA 3AG4C 4MVZA 1HNWB 3CB2A 2Q0AA 3J80N 3ZHQA 3STZC 4NXNO 1W0JG 2ZE7A 3KG2A 1YVWA 3CXHF 5KHJA 1QR8A 1Q82W 1BZKA 1H2MA 2VQFO 1FKAO 1HP8A 1ZTEA 3CCRV 5H6RA 4LC1A 5CA3A 4WFBV 4MTOA 4Q6GA 2LO1A 2WWWA 4Q20A 5L3BA 4F4LA 4DR4O 1AB3A 1QLNA 4DV2B 2WLIB 4QGPA 2HP8A 1U96A 5J9PC 4X65B 4FM2A 4JF3A 1M4UA 3SJQC 3GB7C 1OV9A 3H9VA 4A5UB 1AJQA 2Q8VA 5FLXN 2DN9A 1QLEC 1JPXA 2HFEC 3JCUZ 5KMGA 2ZM6O 1S5JA 1K97A 1K5SA 4J42A 1B3QA 5LP6B 2VWKA 5JJEB 4QNHB 1GAXA 4I0XB 3ZRXA 1Y74A 1MSWD 2OYQA 2PYJA 2BSKB 3F7YC 1YITV 2BTQB 3UT5A 1UJWB 3HKEA 4KXRA 3TGUH 4JI3B 3ETGA 4O2AA 4NTWA 3S3WA 1GN2A 3RYFB 1AI6A 3CJHA 1JVMA
chains in the Genus database with same CATH topology
1EZVH 1SQVH 3CX5F 2FYUH 2BCCH 1NTZH 1SQXH 2A06H 1KB9F 1NTMH 1BCCH 1L0LH 4U3FH 1SQPH 3H1IH 3H1HH 1BGYH 3L72H 1KYOF 4D6TH 3BCCH 3H1KH 3L75H 1NTKH 1NU1H 1PP9H 3CXHF 2IBZH 3H1JH 1P84F 3TGUH 1SQBH 1PPJH 3L70H 3L73H 1BE3H 1SQQH 3L74H 5KLVH 3L71H 3H1LH 4PD4F 3CWBH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV H;  1SQV H;  3CX5 F;  2FYU H;  2BCC H;  1NTZ H;  1SQX H;  2A06 H;  1KB9 F;  1NTM H;  1BCC H;  1L0L H;  4U3F H;  1SQP H;  3H1I H;  3H1H H;  1BGY H;  3L72 H;  1KYO F;  4D6T H;  3BCC H;  3H1K H;  3L75 H;  1NTK H;  1NU1 H;  1PP9 H;  3CXH F;  2IBZ H;  3H1J H;  1P84 F;  3TGU H;  1SQB H;  1PPJ H;  3L70 H;  3L73 H;  1BE3 H;  1SQQ H;  3L74 H;  5KLV H;  3L71 H;  3H1L H;  4PD4 F;  3CWB H;  1L0N H; 
#chains in the Genus database with same CATH topology
 1N36 O;  1P49 A;  4O4L B;  4X1I A;  3JAM N;  1KB9 F;  1NR7 A;  3DXR A;  2V1D A;  2E5L O;  1AP6 A;  3OMA B;  2UXC B;  2WLL B;  4LF6 B;  1V55 C;  2OTJ V;  4QE9 A;  1M90 W;  1MMM A;  3SYQ A;  3CMA V;  1JJ2 U;  1N33 O;  1EZV H;  4MTX A;  1BMF G;  2KG7 B;  3AEI A;  5GTI Z;  4PA9 A;  2F43 G;  1O9G A;  2ZCE A;  1QNM A;  3QF7 A;  1M1K W;  1IBL B;  4DXW A;  3CCV V;  3DC6 A;  4TWK A;  3D36 C;  1A32 A;  4GCZ A;  1NTK H;  1ENV A;  3FYE B;  1MZE A;  2KG7 A;  3F5W C;  3ZJZ A;  2M6Y A;  1F51 A;  1SQB H;  3W7U A;  2XHB A;  4DV1 B;  1JX9 A;  3C90 A;  2QA4 V;  4JYA O;  3K79 A;  1H38 A;  2LW7 A;  4B08 A;  3ZMS A;  1Q43 A;  1B06 A;  2W6I G;  5LHG A;  1QCE A;  2DYS B;  1MA1 A;  2JEX A;  3T1H O;  1US6 A;  2Q0O C;  3QO8 A;  1BQZ A;  1COW G;  4PA4 A;  5LBQ A;  4XDJ A;  5B5E Z;  3ETQ A;  5DED A;  2DWE C;  3W7X A;  5A9G A;  2EZP A;  2UUB B;  4LF9 O;  4LFA B;  2ZIO A;  2E74 B;  3ABK B;  1V9P A;  1BHB A;  1OCR C;  1SET A;  3JD1 A;  4W4L A;  3SPG A;  5LP6 C;  1R6T A;  3D8C A;  5B1A B;  2KKW A;  1L0N H;  4PDL A;  2CTQ A;  1Q8I A;  1XEQ A;  1BQ0 A;  2QKS A;  1AJP A;  3AG3 C;  4W4K A;  3ZMZ A;  4PA7 A;  1AI4 A;  2B1G A;  1IVS A;  4DR3 O;  5A2Q N;  4PDV A;  4MVU A;  2EIM C;  1Z2G A;  1NU1 H;  1Z5V A;  3K5M A;  4X1I B;  3VQY A;  3LSQ A;  1WB8 A;  5L3D A;  2G38 A;  4JYY A;  4DR6 B;  1KEC A;  5EC1 C;  1WJZ A;  2Y69 B;  4HYO A;  4LFB O;  4BIZ A;  1V55 B;  1MSD A;  4EFB A;  1J5E O;  1IBK B;  2QWR B;  3E8F A;  4YHH B;  2H8P C;  4DV4 O;  3ZBH A;  4I7Z B;  2DE0 X;  4B3S O;  4GKJ O;  1Q6H A;  1HDJ A;  1K92 A;  4X9Q A;  4FK5 C;  4OGQ B;  2QKA A;  1JOY A;  1OCC B;  2WLL A;  5CBF A;  2PI4 A;  4RWU A;  4O4H A;  4KP4 A;  2P67 A;  4DV0 B;  1DF5 A;  4EEQ A;  4JI7 O;  2BOB C;  3N2G A;  1QBZ A;  4I5S A;  2ADQ B;  4B3R B;  3AG1 B;  5EYP A;  1NR1 A;  2R70 A;  5KUK A;  3OEE G;  2BSK A;  2P5O A;  2A06 H;  3I56 V;  1FXH A;  2GV9 A;  4PHZ A;  3ZRS A;  2UU9 O;  3N27 A;  4ZBM A;  4LFC B;  3BY6 A;  3G80 A;  3ZMU A;  4D7T A;  3WB2 A;  4JI2 O;  2LP7 A;  2Q67 A;  2EJR A;  3ABK C;  4YJ2 B;  3HR0 A;  3C3S A;  4LWS B;  3ZRV A;  1YSC A;  1SZT A;  1RPO A;  1Y66 A;  1GM8 A;  3FB5 C;  1H2N A;  4YXW G;  4NTX A;  5IYB O;  2ZNI A;  2YXH A;  1K9M W;  1SES A;  3SPH A;  4DR1 O;  1S0V A;  2N74 A;  4FFB A;  2HJD A;  3OEH G;  1BL8 A;  4G2K A;  2B1I A;  1MZF A;  2ZR3 A;  2WLI A;  4LBE C;  3JAR B;  3AG3 B;  2P90 A;  2OCH A;  3JAK B;  3K3W A;  1N0J A;  2BCC H;  3A0B Z;  1EBO A;  4DK1 A;  4LF5 B;  2F23 A;  2FML A;  2P4V A;  3CRM A;  4NKG B;  2UUC O;  2BE3 A;  4J7Z A;  1JA8 A;  1VQL V;  3BAA A;  4K0K B;  2KSD A;  1R3I C;  2YID A;  5IY5 C;  1EFR G;  1S5L Z;  1KP3 A;  3BA8 A;  3AG2 C;  2JVD A;  5K1P A;  3OM3 B;  2FTK A;  2GUZ A;  5JQG A;  4RUF A;  2B9Z A;  2DW4 A;  3OW2 U;  2LGW A;  2ZQM A;  1N32 O;  1FFT B;  1AR1 B;  3SPI A;  4CZZ A;  5J2U A;  5KHH A;  3DGE A;  4GT1 A;  1SA0 B;  2EZO A;  2CGN A;  5JH7 A;  1HNZ B;  1SF9 A;  5GON B;  3L70 H;  1OCC C;  2XT9 A;  3ZRW A;  5IE9 A;  1K8A W;  5LOV A;  4WFG A;  3CX5 F;  4P2Z A;  2VS0 A;  3MHH C;  4L8J A;  3CCJ V;  3H1H H;  1FFX A;  1BT8 A;  2LGQ A;  3AG1 C;  1Q81 W;  3TK1 A;  1NS1 A;  1VQ8 V;  5LP6 A;  4H37 A;  5CA0 B;  5EZY A;  4JI5 O;  2Q5Z A;  3D3I A;  5LA6 B;  1AR5 A;  4LF4 O;  3OMI B;  5LXT A;  3CCM V;  1FJG O;  5IT9 N;  3CD6 V;  5GW7 A;  2K9P A;  2EIL B;  4X88 A;  1IBK O;  4X66 O;  5CA1 A;  1AVM A;  1OHH G;  4LWS A;  5LGN A;  2ITC C;  1PP9 H;  3OR7 C;  1Q6U A;  3ABL C;  4B7K A;  3B4S A;  2AHY A;  1X4T A;  2Y48 A;  3CC7 V;  5LYJ B;  3ZED A;  4UV8 A;  4JI0 O;  4X64 O;  1KUQ A;  3SYO A;  1THZ A;  2AXT Z;  5KX5 B;  2QKC A;  2YIB A;  3T1C A;  3H1I H;  2V7Q G;  1LUW A;  4X1Y B;  4BAY A;  4TV8 A;  3BFR A;  4UB8 Z;  3H1K H;  1PL0 A;  5JCO C;  4CC5 A;  5B1B B;  2JGD A;  1QQC A;  1Y76 B;  3E86 A;  3K59 A;  3OTO O;  4YY3 B;  3LSS A;  2PGG A;  2HHH O;  4GYC B;  1AI5 A;  3CCL V;  5CA1 B;  4PI2 A;  3THO A;  3N2K A;  2UU9 B;  4O4J A;  4J7K A;  3ZN1 A;  1SER A;  3OE7 G;  1P7B A;  5IY5 B;  2ILM A;  5EBM C;  5IYZ A;  4E4E A;  5LGU A;  4JI2 B;  2GHY A;  5ITZ A;  3ASO B;  4I9W A;  3IGA C;  4DR7 O;  3RYF A;  2RNB A;  3FAV A;  5BR8 O;  4ZIB A;  4DUY O;  2F4V O;  2LFS A;  4TV8 B;  1VQO V;  4QPJ A;  2YSU B;  2WPD G;  4MS2 A;  3CCQ V;  3RYC A;  3CC4 V;  1TUE B;  4UCU A;  1ROP A;  2DOS A;  3ETE A;  1PKX A;  1XMQ B;  1M5I A;  1D5A A;  3DSQ A;  3L74 H;  3O9O A;  4FIP C;  2N05 A;  2PTM A;  1SQF A;  5LMU O;  4KHP O;  3AG7 A;  3A2F A;  2GBO A;  2YUA A;  1HNX O;  3CC2 V;  2QE7 G;  1VP7 A;  1OCO C;  1XDC A;  3CCE V;  1H2G A;  3K9A A;  4LF7 O;  5DM6 V;  1YJ9 V;  4J9Y B;  2IH3 C;  2UXB O;  4QPK A;  4XDK A;  4Z1M G;  1N34 B;  4O2A B;  1JR9 A;  2BTO A;  1XOU A;  1I94 O;  2FYU H;  2QWQ B;  2F93 B;  2ARH A;  1XQ8 A;  4GX0 A;  4FVM A;  1Q86 W;  1NTM H;  1N32 B;  5FPR A;  1TUB A;  4X62 B;  2E76 B;  3ABL B;  2Y0I A;  3TCU A;  2K1E A;  2Q68 A;  4ZOL A;  1P7G A;  2PI5 A;  3ASN B;  3JAS A;  3U11 A;  4IT5 A;  3SPJ A;  3WG7 B;  1WPB A;  2O57 A;  1XI1 A;  1HNW O;  1QVG U;  2VQE O;  3E2E A;  1VF6 A;  3JD4 A;  2UXD O;  3BEH A;  1E1R G;  1KMI Z;  1XNR O;  2VQF B;  3UM7 A;  2OTL V;  4TUY A;  4E2L A;  3NR7 A;  4AQY B;  3IC7 A;  4UCR A;  2QM4 A;  4CH4 A;  3CJH B;  5IWA O;  1YIJ V;  2XAF A;  4WFF A;  1QR9 A;  4MW8 A;  4DR4 B;  2DYR C;  1JFF B;  2Y0P A;  4O4I A;  3RGB A;  4EB6 B;  1G1X B;  1KBH A;  2L35 A;  5JJJ B;  3I55 V;  2W0F C;  2QEX V;  4XDL A;  2P22 C;  1PL4 A;  2IJH A;  3JAR A;  4MTG A;  4JI0 B;  3BVO A;  1Q5O A;  5KMG B;  4DV6 O;  5IYZ B;  4ZHQ A;  1BS3 A;  5J2U B;  4JYC A;  3CP1 A;  1QHT A;  4O2B A;  3DTU B;  5EBW C;  3AG4 B;  1EN4 A;  2C2A A;  1NH2 B;  5JWP A;  1XL6 A;  2XOK G;  3B8N A;  1X59 A;  4HBN A;  1VQ6 V;  4FPP A;  3BRC A;  3BHP A;  2ZE8 A;  5H5N A;  2ZIN A;  1TGO A;  3EHB B;  2QDO A;  4PA6 A;  1EM1 A;  3ZHR A;  1OZ0 A;  3K5N A;  2B5U A;  4KFM A;  2AZ2 A;  1GN3 A;  1N8R W;  5JCO A;  2ZM6 B;  3JAW A;  4DV5 O;  5KUM A;  4J7J A;  2E5L B;  5AG2 A;  2UXC O;  4H0L B;  4FMT A;  5H2F Z;  2A7W A;  2HG5 C;  1SQG A;  1MOF A;  3Q4H A;  2F66 C;  2F4V B;  4UCT A;  1XNQ B;  1L0L H;  4CH3 A;  4PI0 A;  3K04 A;  1DF4 A;  5F2V O;  3ASN C;  4NTY A;  3J81 N;  2W0X A;  1DK1 A;  5EIB C;  1FD9 A;  3WG7 C;  2CGO A;  3Q4H B;  1S72 V;  3H1J H;  2GUZ B;  3S3X A;  4DRX B;  5JQG B;  5LA6 A;  5IYD O;  1ZWI C;  2IJJ A;  3L71 H;  4BW5 A;  3AK2 A;  1QLE B;  3W7S A;  1F23 A;  2A9H A;  2EIJ B;  1EN6 A;  5KHK A;  4NR1 A;  2WLH A;  4LF7 B;  5K1X A;  1Q6I A;  1OCZ B;  4JAV A;  4LF8 B;  1PNK A;  2P6J A;  3N2G B;  3OGC C;  2DYR B;  3RYI B;  3JAL A;  5LHI A;  3RFR A;  3OT7 A;  1FYJ A;  4WCE V;  4R7C A;  2X6B A;  4TOI A;  4FM1 A;  1GM7 A;  2M7W A;  1GK9 A;  4OPA A;  2Z3Y A;  4IIJ A;  3JD2 A;  3CSX A;  3NXS A;  3IC9 A;  2ZR2 A;  3HKE B;  4X1K B;  3JAW B;  1SQX H;  1QVF U;  4WFH A;  1Q90 D;  5E1A C;  5J2T B;  4J9Z B;  4MSW C;  3CRR A;  3FB6 C;  1YTF D;  2Q7H A;  2D3O W;  5C8Y B;  1NJI W;  1VAR A;  1GO3 F;  2LFR A;  4UVA A;  4AQY O;  1AI7 A;  1D5N A;  4JAS A;  2Q69 A;  2CE4 A;  4LF9 B;  4TUY B;  1IUR A;  4LFA O;  4DR2 O;  4D7S A;  1GN4 A;  5L3E A;  4DR6 O;  2E3C A;  2JDI G;  2KB1 A;  4U7O A;  2ZNJ A;  5BMV B;  3HKD A;  2Z5U A;  3TJT A;  2ZDI C;  4O4L A;  2JK5 C;  3K08 A;  1PD3 A;  1J5E B;  1ZUQ A;  2DYS C;  3RYH B;  3D3Q A;  4X89 A;  3LDD A;  5D5P A;  3IFX A;  4GKJ B;  4NYK A;  4DR3 B;  1AIL A;  3FFQ A;  4TQF A;  1XHX A;  4KUM A;  4B7E A;  3CS5 A;  2CH7 A;  1R6K A;  3PN1 A;  4UUJ C;  1OCR B;  4DV7 O;  1XIL A;  2ADP A;  4J10 A;  4JYB A;  1GKF A;  3E8B A;  5IJ0 B;  3JAT B;  4ZI7 B;  2HEP A;  5B1A C;  1H2K A;  5EIB D;  1O9H A;  4YHH O;  1VF5 B;  1OCZ C;  1XBL A;  4CH5 A;  3ML0 A;  2HVJ C;  1I08 A;  4ASU G;  1FXK C;  3CE2 A;  3VQW A;  2LJ2 A;  4I4T B;  3LUT B;  4MVR A;  4F6R B;  4MW3 A;  2JJ1 G;  2UXN A;  1ZSP A;  2V4D A;  4TSF G;  5EZY B;  1URF A;  1SC5 B;  4PA3 A;  2CDY A;  1XNQ O;  3A8T A;  4DR5 B;  2JJ2 G;  3IJ4 A;  1FFX B;  2RQ6 A;  1YI2 V;  1TVK A;  3HPL C;  3HKB B;  2FKX A;  5D5Q A;  5JJN B;  2WA3 A;  5LGT A;  4RQE A;  2XAH A;  4JI7 B;  2MK3 A;  1VQM V;  4JV5 B;  1R3L C;  3KKY A;  1GN6 A;  4YJ3 B;  3IAY A;  3OUS A;  1GM9 A;  4I55 A;  4NB5 A;  4CH6 A;  2YIB D;  3T1Y O;  3UCS C;  5FL7 G;  5CBH A;  5EC2 C;  3OFN G;  1AJN A;  2AZ0 A;  3VQX A;  1SQP H;  2OCC C;  4K3A A;  4DYL A;  1QU7 A;  4TV9 B;  1P4R A;  3LDC A;  3CPW U;  4BIO A;  3QO5 A;  2RCV A;  3U10 A;  4GLX A;  1DGS A;  4JI4 B;  3FB7 C;  4CS3 A;  2ZKO A;  1RP3 B;  2CK3 G;  2Z0A A;  4B3T B;  1I0H A;  4LH6 A;  5JVD B;  2FL4 A;  2YXY A;  1BCC H;  4FZ0 A;  1TA8 A;  2WLN A;  2YC0 A;  2YDE A;  2H94 A;  3TXQ A;  4Z1V A;  2WA4 A;  5CB4 A;  1BE3 H;  3K5L A;  4HNA B;  2A0L A;  2PZS A;  1J95 A;  3CWB H;  3CRA A;  2RDC A;  3ABM B;  5GON A;  3VQV A;  1I5X A;  3P30 A;  4IIJ B;  4JTD B;  1DLB A;  4FFK A;  2DQ3 A;  2XND G;  1YEW A;  3E8H A;  2UUA B;  4B3S B;  2QR4 A;  2OIE A;  4I50 A;  1OJH A;  2QM8 A;  3JD3 A;  3STL C;  4CC6 A;  3SGI A;  1KC8 W;  4LNU B;  1IBM O;  3JAL B;  3RYI A;  3EFF K;  2YXL A;  4IGG A;  1WA8 A;  4IYH A;  1ORQ C;  1ZL8 B;  3QTC A;  4DV0 O;  3P32 A;  5C8Y A;  5BY1 A;  4DR2 B;  5L3C A;  1JJO A;  4JTC B;  2Y4T A;  1HWY A;  4HAM A;  1NH2 D;  1JQ0 A;  2NN4 A;  3KCY A;  1JCH A;  1TUB B;  2WLM A;  4HZ3 A;  5KAI Z;  5KAF Z;  4FLV A;  1SQQ H;  4X66 B;  4OX9 O;  4GUN A;  4B3M O;  2YI8 A;  4CBC A;  4LFC O;  1BSM A;  3CEI A;  1LUV A;  3MDS A;  2ZT9 B;  2EIK B;  4RO2 A;  3HKD B;  3SPC A;  3ZHV A;  2R9A A;  2YEV A;  3ZMT A;  4DW0 A;  4FLU A;  3L72 H;  1PNL A;  4DW1 A;  4WBN B;  5FPO A;  3GWO A;  3H01 A;  1CPY A;  3CYO A;  1R3K C;  3F5T A;  4JAA A;  3BA9 A;  3RVZ A;  4JI5 B;  1NKD A;  5LL6 Y;  2HJF C;  3ZHU A;  4AIL C;  2OCC B;  3RVY A;  1NTZ H;  4TQD A;  1VMG A;  2QGN A;  5DEC A;  3W7W A;  4FM0 A;  1S76 D;  1FS0 G;  3SJC C;  1XMO B;  3APQ A;  3K58 A;  3B8M A;  4WF9 V;  3SJB C;  2IW5 A;  4GKK O;  1RPR A;  2AGA A;  2UUC B;  4QE7 A;  1H8H G;  4H44 B;  3SJA C;  1Q3E A;  4JI1 O;  4X64 B;  1RM1 B;  4MTF A;  4DR5 O;  4LNU A;  4N21 A;  3G4S V;  3E83 A;  3T4Z A;  4ZHQ B;  4OPH A;  3CHX A;  2QSA A;  4PJ0 Z;  4U3J A;  3JAT A;  3D36 A;  4I55 B;  4R8C A;  1XUQ A;  2UXX A;  3E89 A;  3T1Y B;  2ZDI A;  4PD4 F;  1RSO A;  4YIP A;  4JI8 O;  1K4C C;  1WAZ A;  2ITD C;  3T4D A;  3JSL A;  4Z2W A;  1VF7 A;  3B09 A;  4PEL A;  4IHJ B;  5IJ9 B;  5LMU B;  4KHP B;  3OD4 A;  5DN6 G;  1NZ6 A;  1RSO B;  4DUZ O;  1WP7 A;  2P7T C;  3ICX A;  3MHS C;  1M9N A;  3LNM B;  3FX7 A;  4X8A A;  5JH7 B;  2EUL A;  2F95 B;  4FFB B;  5B1B C;  4B3T O;  5B3S B;  3E8G A;  4LR3 A;  1K34 A;  1HR0 O;  1YZB A;  2Q73 A;  2PY5 A;  1NBM G;  4OXS A;  1WN7 A;  4DV3 O;  3N2K B;  2NR5 A;  1E79 G;  1WB7 A;  4C7U A;  2A3Q A;  1L1F A;  5LXT B;  3CRC A;  4JTA B;  5KHI A;  1ARO P;  3AK1 A;  1MNG A;  1PPJ H;  2NLJ C;  5IYC O;  3H1L H;  3WB1 A;  3ZIA G;  1WNS A;  4G27 B;  3A0R A;  3DC5 A;  1Y74 B;  5TIS Z;  4DV1 O;  4X65 O;  1BGY H;  1BHA A;  1AP5 A;  3P3N A;  3BPZ A;  3EXA A;  3L75 H;  1F7Y A;  1YXB A;  1SRY A;  2IH1 C;  3LDE A;  3RW0 A;  3ZHT A;  4MT8 A;  1I94 B;  2Q9L A;  4U3J B;  4MVO A;  4YIO A;  3FYI B;  4P9P A;  4JAU A;  2QM7 A;  4GX2 A;  3X2Q B;  5FNV A;  4DV2 O;  1AR4 A;  1IZ3 A;  2ETN A;  1VQP V;  4JPR A;  4CS2 A;  3BAB A;  4JGS A;  3ABT A;  4WFA V;  1L8D A;  1OCO B;  1RM1 C;  3HKC B;  4K8Z A;  2QTS A;  4TT3 G;  1VQ5 V;  3B2E E;  4FJC C;  2UXD B;  1Y76 A;  2P06 A;  1E1Q G;  5H6Q A;  3GVM A;  1EZJ A;  3CCU V;  2IU3 A;  4DR7 B;  4X20 B;  2CUG A;  5J2T A;  1GTO A;  4J41 A;  4DV6 B;  5KX5 A;  2YIC A;  5BR8 B;  3FD9 A;  1ZL8 A;  2QTO A;  1M57 C;  1S5H C;  1I7F A;  1YDX A;  1N33 B;  1VQ7 V;  1S77 D;  2GTA A;  1PNM A;  4I50 B;  2AW9 A;  1VQ4 V;  4WBN A;  3VOU A;  2Q6A A;  4CS4 A;  4O4J B;  2AHZ A;  4FLX A;  1IXB A;  2GDS A;  1IBL O;  2DJV A;  4GX1 A;  1H2S B;  1KYO F;  4LFB B;  2XAJ A;  5B3S C;  1U97 A;  2JS5 A;  1V54 B;  4R6Z A;  4J80 A;  4RUE A;  2DWD C;  4UXN A;  4JI1 B;  2JGU A;  2HR3 A;  2JGD B;  2XAG A;  4DV4 B;  1SQV H;  4JYA B;  2JRI A;  4BIU A;  4LF6 O;  2OIG A;  3G6B A;  4ICG A;  5KA5 A;  2UXB B;  3OAA G;  2WSS G;  3I5D A;  3R66 A;  2Q7E A;  4P30 A;  4UV9 A;  1JFF A;  4O4I B;  4EB6 A;  3W7T A;  2GTS A;  3T1H B;  1WA8 B;  1H2L A;  3ZHS A;  4UB6 Z;  3K9S A;  1VIB A;  3HKC A;  2EIM B;  3G6E V;  1K33 A;  4NXM B;  4TV9 A;  3QO7 A;  3GWK C;  3LNN A;  2VQE B;  4UVB A;  4DUZ B;  1S3J A;  3WU2 Z;  4H33 A;  2A79 B;  3SR2 C;  2YS8 A;  1P84 F;  2Y69 C;  2JIZ G;  2CH7 B;  3JAS B;  2IU0 A;  1H8E G;  3K06 A;  1D2D A;  3OTF A;  3X2Q C;  2RN9 A;  3FKS G;  1PM9 A;  3K0D A;  1YHQ V;  4DV3 B;  3WFV A;  1VQK V;  1YJN V;  3OMN B;  2ZXW C;  4FLZ A;  2ZE6 A;  2BOC C;  2RJZ A;  1FAF A;  4FZ1 A;  1NT2 B;  3SDL A;  2HLD G;  1PV0 A;  3APO A;  4I4T A;  3RYH A;  1Z5W A;  1Y4M A;  2CTR A;  4DR1 B;  4K35 A;  2X7R B;  4LP8 A;  1LNQ A;  2DMX A;  4H13 B;  1FXV A;  2D2C B;  1SKV A;  3U0Z A;  1KKD A;  4LCU C;  3M99 B;  1M57 B;  2N04 A;  3K0G A;  1WP8 A;  4LF8 O;  2OT5 A;  5C93 A;  3P3P A;  2EIN B;  2PUS A;  4AI8 A;  2MW2 B;  3CME V;  4MVQ A;  5IJ9 A;  4P9O A;  2JS3 A;  2XTA A;  3HKB A;  2X6A A;  5BXZ A;  3RT3 C;  3C3T A;  1B04 A;  3ZCC A;  2EIJ C;  1V54 C;  3EVK A;  1B6Q A;  4G28 B;  3K57 A;  3JAK A;  1M56 C;  1UFI A;  3RBZ A;  3QG5 A;  1VQ9 V;  1G4Y B;  4F6R A;  4MVM A;  4B3R O;  3JD0 A;  1KP2 A;  4LH7 A;  2VRZ A;  1YJW V;  2ZIM A;  1YTF B;  4KL1 A;  2VWJ A;  1LR1 A;  4L87 A;  4DV5 B;  3JSN A;  4AHC A;  3MD0 A;  3B40 A;  3HB3 B;  1N0N A;  4MVS A;  2XAQ A;  3KCX A;  2LW1 A;  3E22 B;  5HFM A;  2ZE5 A;  5CB4 B;  3MAQ A;  2QJ1 A;  1GMG A;  5B1N A;  4BWA A;  2OWO A;  2QWN B;  1CP9 A;  3ETD A;  1F4N A;  4DV7 B;  2W6J G;  1HW7 A;  1UPG A;  2IJI A;  3AG2 B;  2HKO A;  4K8X A;  3SYC A;  5LYJ A;  3FAV B;  1SZX A;  5GTH Z;  1G8M A;  1YCI A;  3M7M X;  4UFZ A;  4F6E A;  4EKW A;  3R65 A;  5B66 Z;  2EBO A;  4DRX A;  5CN0 A;  2ZXW B;  2E75 B;  4O4H B;  3CRQ A;  1I5Y A;  4LF5 O;  3ZX6 A;  1XL4 A;  3ZN0 A;  3ZMV A;  5FNV B;  5BZB A;  2YEV B;  1K5Q A;  3KZI Z;  4YJ2 A;  4IYI A;  2KQX A;  5LMN B;  4HNA A;  1GH6 A;  3UKM A;  4X20 A;  4NXM O;  1N4C A;  5E79 Z;  1R73 A;  2XUM A;  4UCS A;  4X1K A;  2EIN C;  3G67 A;  3L73 H;  4BW9 A;  3SYA A;  5EYP B;  2EIL C;  4K0K O;  4BR6 A;  5EBL C;  5ITZ B;  4O2B B;  2X0L A;  4JZ2 A;  1KD1 W;  1M56 B;  1T5E A;  2WLK A;  2Q4P A;  3L9D A;  4DUY B;  3ABU A;  1R3J C;  4JI6 O;  1W2B U;  1NVP D;  3A0H Z;  4NVP A;  3OGI B;  4U7N A;  3RWR D;  2WLJ A;  2YI9 A;  1ZAU A;  1FXK B;  4XBF A;  4ZOL B;  1VF6 C;  5LHH A;  1XMQ O;  1FJG B;  1HNZ O;  1K73 W;  4I0X A;  2ODM A;  1KQS U;  2R9R B;  3JCZ A;  3J7A U;  4NXN B;  1CXZ B;  2WAM A;  4EFE A;  1YF2 A;  4JI4 O;  1GRJ A;  4PV1 B;  1JMK C;  3E35 A;  3M8A A;  2F1M A;  4JZG A;  3T2M A;  1NQT A;  1Y67 A;  3CXC U;  4U3F H;  1SA0 A;  1N34 O;  3ASO C;  4FLT A;  3SYP A;  1R1B A;  3B77 A;  2JEU A;  4FLW A;  3OR6 C;  3DXR B;  4LF4 B;  1KKC A;  4J11 A;  3TXS A;  5IJ0 A;  1WPX A;  3O65 A;  2CTP A;  3OTO B;  4I9Q A;  4YY3 O;  4R50 A;  4PDM A;  3WB0 A;  3AK3 A;  4DK0 A;  4OX9 B;  2UUA O;  4IHJ A;  1MAB G;  5KA6 A;  1XHZ A;  1WLE A;  5L3G A;  3UO2 A;  3QVN A;  1W0K G;  2XAS A;  1IBM B;  3E22 A;  4WFE A;  2Q7G A;  2GSM B;  2ATK C;  2QWP B;  3F7V C;  3PJS K;  4JV5 O;  2R72 A;  3ABM C;  4UCO A;  2NNU A;  3OUF A;  1FPO A;  3BCC H;  2HHH B;  2R9I A;  5HFL A;  2LQT A;  4RAI A;  1KU9 A;  5B1O A;  5CA0 A;  4JI3 O;  4B3M B;  5KLV H;  1IXM A;  4GX5 A;  3FB8 C;  2RMK B;  4YJ3 A;  2P4K A;  1G6U A;  1N36 B;  5H9C A;  4DO2 A;  4GKK B;  2PF4 E;  4X1Y A;  4QJF B;  5IDJ A;  4QIW F;  1TVK B;  2H3O A;  4PDR A;  4RQF A;  1Q7Y W;  3K5O A;  4D6T H;  1VEW A;  2QWO B;  5LMN O;  3ZRW B;  4UVC A;  3RN4 A;  1ZLZ A;  1K3E A;  1K4D C;  1MG1 A;  5BMV A;  1K7D A;  3CCS V;  2EX3 A;  3UQ8 A;  2IJK A;  1XMO O;  5KHG A;  3TET A;  2EIK C;  4X62 O;  2DQ0 A;  1NI8 A;  2CAZ C;  1IX9 A;  4IL6 Z;  2FB5 A;  3LSU A;  2PYL A;  4ZI7 A;  2IBZ H;  1F4M A;  1DTO A;  2EJ7 A;  3QNE A;  1HNX B;  3ZS8 C;  1M93 A;  1VQN V;  4GZR B;  2HVK C;  5L3F A;  4UCV A;  1W59 A;  2IM9 A;  5EK0 A;  2L6L A;  2BTQ A;  3UT5 B;  1CEZ A;  1ZX3 A;  1Y6X A;  5CMU A;  2ZD9 A;  3UO3 A;  1XNR B;  3RYC B;  1TAE A;  1XRE A;  3VBB A;  5JVD A;  1SS3 A;  4JI6 B;  4ABM A;  3K03 A;  1HR0 B;  1EN5 A;  1R6N A;  5CBG A;  4N23 A;  4FLY A;  1FXK A;  2CTW A;  5LOV B;  1RFY A;  1NVP B;  2X6C A;  5IWA B;  4ZKI A;  4JI8 B;  2YIA A;  2UUB O;  3G71 V;  3JYC A;  2Y4U A;  1IDS A;  3AG4 C;  4MVZ A;  1HNW B;  3CB2 A;  2Q0A A;  3J80 N;  3ZHQ A;  3STZ C;  4NXN O;  1W0J G;  2ZE7 A;  3KG2 A;  1YVW A;  3CXH F;  5KHJ A;  1QR8 A;  1Q82 W;  1BZK A;  1H2M A;  2VQF O;  1FKA O;  1HP8 A;  1ZTE A;  3CCR V;  5H6R A;  4LC1 A;  5CA3 A;  4WFB V;  4MTO A;  4Q6G A;  2LO1 A;  2WWW A;  4Q20 A;  5L3B A;  4F4L A;  4DR4 O;  1AB3 A;  1QLN A;  4DV2 B;  2WLI B;  4QGP A;  2HP8 A;  1U96 A;  5J9P C;  4X65 B;  4FM2 A;  4JF3 A;  1M4U A;  3SJQ C;  3GB7 C;  1OV9 A;  3H9V A;  4A5U B;  1AJQ A;  2Q8V A;  5FLX N;  2DN9 A;  1QLE C;  1JPX A;  2HFE C;  3JCU Z;  5KMG A;  2ZM6 O;  1S5J A;  1K97 A;  1K5S A;  4J42 A;  1B3Q A;  5LP6 B;  2VWK A;  5JJE B;  4QNH B;  1GAX A;  4I0X B;  3ZRX A;  1Y74 A;  1MSW D;  2OYQ A;  2PYJ A;  2BSK B;  3F7Y C;  1YIT V;  2BTQ B;  3UT5 A;  1UJW B;  3HKE A;  4KXR A;  3TGU H;  4JI3 B;  3ETG A;  4O2A A;  4NTW A;  3S3W A;  1GN2 A;  3RYF B;  1AI6 A;  3CJH A;  1JVM A; 
#chains in the Genus database with same CATH homology
 1EZV H;  1SQV H;  3CX5 F;  2FYU H;  2BCC H;  1NTZ H;  1SQX H;  2A06 H;  1KB9 F;  1NTM H;  1BCC H;  1L0L H;  4U3F H;  1SQP H;  3H1I H;  3H1H H;  1BGY H;  3L72 H;  1KYO F;  4D6T H;  3BCC H;  3H1K H;  3L75 H;  1NTK H;  1NU1 H;  1PP9 H;  3CXH F;  2IBZ H;  3H1J H;  1P84 F;  3TGU H;  1SQB H;  1PPJ H;  3L70 H;  3L73 H;  1BE3 H;  1SQQ H;  3L74 H;  5KLV H;  3L71 H;  3H1L H;  4PD4 F;  3CWB H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...