3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
1KYOF 3L75H 1SQQH 1PP9H 1PPJH 1P84F 3L70H 3L73H 3L72H 4U3FH 1BE3H 4PD4F 3H1JH 1SQXH 2FYUH 3L74H 3TGUH 3CXHF 2A06H 2BCCH 1SQBH 3H1LH 3H1IH 3CX5F 1BGYH 1NU1H 1NTMH 1KB9F 1SQPH 3BCCH 3CWBH 5KLVH 4D6TH 1EZVH 1SQVH 3H1KH 3L71H 1L0LH 1L0NH 1BCCH 2IBZH 1NTKH 3H1HH 1NTZH
chains in the Genus database with same CATH superfamily
4BAYA 3D36C 1FXKA 2Q8VA 3TETA 4JYCA 5LP6B 3L9DA 3FB7C 2LFSA 2DOSA 4E4EA 1YZBA 1HW7A 3SPIA 1V9PA 2CTRA 2YI8A 1I08A 4DV4O 2EX3A 2OT5A 4X66O 2EIMB 4MTXA 4DK1A 4MSWC 1FAFA 3B09A 5J2UA 1SQQH 2HJDA 1KD1W 3ICXA 1JJOA 2DW4A 3ZHRA 3E8BA 3BA9A 5JWPA 3TGUH 3RVZA 4DV5O 2ARHA 4O4LA 1Y67A 3ABKB 3IC7A 2P90A 3E8GA 2Q7HA 2GTSA 2Y4UA 3N27A 1QR8A 2ZD9A 2H8PC 5B1AC 5JQGA 1A32A 3RT3C 4FZ1A 1IBKO 1DTOA 2Z0AA 3JD0A 4JASA 3SPGA 3BFRA 4QE7A 3JAKA 2VQFO 1THZA 1F51A 2AHYA 2XAJA 2RJZA 3GWOA 4JI2B 1SQVH 1N33B 1YJNV 3KCYA 3EFFK 2W0XA 4LF6B 2X6BA 2W0FC 2RCVA 4EFEA 1NH2B 4JPRA 2KG7A 1PNKA 5KUMA 4B3RB 1JCHA 1G6UA 1Q86W 1I94O 1FYJA 1H8HG 4MW8A 4X62O 1NT2B 2XAHA 4DR7O 1JR9A 3QTCA 5B1OA 2QWRB 1K33A 3DC6A 4TT3G 4FVMA 4GKJB 2BTQB 1ZAUA 4Q20A 1BE3H 1SQXH 5EK0A 3SPCA 5F2VO 2Q67A 4FLTA 1E79G 3J7AU 4MW3A 1PL4A 3H9VA 3DXRA 4WFGA 4QJFB 5IYCO 2YIAA 4YHHB 1KYOF 1AJQA 1YJWV 3D36A 3K08A 3JD3A 2PYJA 4DV0B 2FMLA 3F7YC 3K5MA 1UPGA 5LXTB 4X8AA 3LNNA 4X1IA 2F4VB 2JIZG 3C90A 2BE3A 4QPKA 3CCSV 1HP8A 1XNQB 3THOA 5EYPA 4ZI7B 1VF5B 1VP7A 4DR6B 4JI5O 2A06H 1G4YB 4FLYA 1I0HA 3G80A 2Q7GA 5B3SC 5KLVH 2K1EA 4UCUA 4DYLA 5EZYA 1QVFU 1M9NA 3J81N 2Z5UA 4DW1A 4GX5A 1P7BA 3B77A 4YJ3A 1M4UA 3JATB 3BAAA 4H33A 4FLWA 1Q90D 3CC7V 4YXWG 2NLJC 2OYQA 1Q6HA 1H38A 3H1HH 2L6LA 2QDOA 2JJ1G 5JVDA 4J11A 1TVKA 3ETGA 1AP5A 3FD9A 2UXCO 5LP6C 3ZRVA 1UJWB 1S72V 4LF5B 2XAFA 4FPPA 5J2UB 1YTFD 2ZM6B 2H3OA 1DF4A 1CXZB 4MTOA 2EIMC 2H94A 5JH7B 1SA0A 3CYOA 2RNBA 1WNSA 4JI6O 1K73W 1Q5OA 1YEWA 3VOUA 2IH3C 5EBMC 5D5QA 3CXHF 4LH7A 1H2MA 3H1IH 4JI1B 3I55V 3S3WA 4W4LA 1AROP 4J80A 4AI8A 4B3SB 4LFBB 3P30A 4UCRA 1NR1A 1BL8A 2Q4PA 3OD4A 3JAKB 3CRRA 4DR3B 3L70H 4A5UB 3ETQA 3STZC 1XOUA 3HKEB 1N36O 3I5DA 2OCHA 2RDCA 3BRCA 4K8ZA 3JSNA 1XEQA 2UXDB 4WFAV 4CH3A 3L75H 4I50B 4NVPA 1XQ8A 4EB6A 1P84F 1F23A 2UUCO 4FK5C 3K58A 1AR4A 4O2BA 2X6AA 1SC5B 2YEVA 1RSOA 3ZIAG 1PM9A 1S77D 1K8AW 4WF9V 4P30A 3HR0A 1K9MW 4JYYA 1SQGA 4QPJA 4G28B 4DV1B 1MABG 2EINB 3DXRB 2HKOA 3K59A 1N33O 2X6CA 4UUJC 2JVDA 2QWQB 5LA6B 4LF6O 2CGNA 5C93A 5CB4A 3ABMB 1QNMA 4H13B 2BSKA 4TV8A 4K3AA 2F1MA 4UCOA 3K0DA 1MNGA 4X88A 1HR0B 2DMXA 3E8HA 4QE9A 5FL7G 2LW7A 4KXRA 2Y4TA 4X1IB 4CBCA 2ZNJA 5LP6A 1R6KA 3KZIZ 4PHZA 3QO8A 4D6TH 1YJ9V 3PJSK 2F43G 3ABTA 3M99B 3OE7G 1MA1A 1NTKH 3CCRV 4PA9A 1PP9H 2R70A 1AR1B 2ZDIC 4L87A 2CK3G 4Q6GA 3R66A 3H01A 5BMVA 3K57A 3ZCCA 4YHHO 3ZN1A 4JAAA 1AP6A 3OMAB 5LHIA 4H44B 2R9AA 1YCIA 4OGQB 4WFEA 2YDEA 3SYAA 4DV0O 2WAMA 4UCTA 1IBMB 5LBQA 1P7GA 2Q9LA 1IX9A 3A2FA 3HB3B 4BR6A 5IJ9A 1IBLB 2F4VO 4LH6A 2Y0PA 1SZXA 1R1BA 3CE2A 2VRZA 1NJIW 2YUAA 3CCQV 4DV7B 1XNQO 1ZSPA 3HPLC 4O2AB 4DR6O 3UKMA 3CPWU 5JVDB 1RM1B 2LJ2A 1QLEB 1N0NA 3VQXA 2KSDA 1PPJH 2XASA 3H1JH 3A0BZ 2A0LA 5H6RA 1JMKC 1SQBH 2VWJA 4TQDA 2OIEA 3CMEV 2Q68A 4RQFA 4R7CA 3BABA 4DXWA 4GCZA 1OZ0A 4J9YB 2CTWA 1J5EB 1OCCB 1XNRO 3E89A 3CRMA 5B1BB 2QA4V 3CJHB 1F7YA 1NTMH 4YIPA 2BTQA 3C3TA 1U97A 4ZKIA 4LFAB 2E3CA 4FJCC 2AXTZ 5GTHZ 4LF5O 5KMGB 3FB6C 4F6RA 4BIUA 2R9RB 3JD4A 4X89A 4CS2A 3LDCA 2ITDC 4B3MO 2EZOA 2GTAA 2ZM6O 1W0JG 3QO7A 4CH6A 2DQ0A 3SJQC 1HNZB 2EULA 4U3JB 3KG2A 1MSDA 4WFHA 2N04A 2PF4E 2JEXA 4JI1O 4MVUA 4UCSA 2AZ2A 1QVGU 1RSOB 4B3SO 5LOVB 4NR1A 4LFBO 5H6QA 3W7WA 4BIOA 3D3IA 4YIOA 4ZI7A 2ZIOA 4JF3A 4DR3O 4GKKB 1H2LA 1SZTA 2F95B 1GAXA 4NTWA 3E86A 3TJTA 4JAVA 5KAIZ 1SESA 4U7NA 1HNWB 4UVBA 5IJ0B 2IU0A 3RYHB 2UXDO 2KQXA 1HDJA 4FIPC 2EINC 5GONB 2QTOA 4LWSB 2YICA 1KQSU 2BSKB 2AHZA 3JAWB 2P67A 5HFLA 3VQYA 1B3QA 4FM2A 3JATA 5LGNA 3SJCC 1VQ4V 1SKVA 2OCCB 4LF4B 2X0LA 2B5UA 2XUMA 3G6EV 2ZKOA 3RN4A 3KCXA 1GM8A 2BTOA 5BZBA 4NXNB 5LGTA 4IYIA 4I7ZB 2UXXA 4B7KA 3J80N 3EVKA 3JD2A 4XDKA 4DV1O 2W6JG 1MG1A 2LGQA 1R3LC 5IY5B 1R3IC 3B4SA 1VQLV 1OCOB 5BMVB 4PV1B 1GK9A 3ZHVA 4Z1VA 3QO5A 1KKCA 5JH7A 2PUSA 4QIWF 4HNAB 4RUEA 2GDSA 1HR0O 1M1KW 3SPHA 1VQ6V 4N21A 3D8CA 4JGSA 5IJ9B 2WLLB 1GN3A 3T1YB 3SYPA 4C7UA 4X1KB 3OMIB 5DECA 3RYIB 1YSCA 5FPRA 3GB7C 5DM6V 3CC4V 4JI8B 1Q8IA 1YF2A 4DV2B 1GTOA 3L71H 2ZR2A 1ZUQA 3HKEA 2R72A 2P4VA 4OX9B 5A2QN 2QJ1A 3T1HB 4DR5B 3R65A 4MVMA 4G27B 3SJAC 1RM1C 2N74A 1QLEC 5KA5A 1VQ7V 4I50A 2KB1A 1CEZA 4LP8A 4F4LA 3CS5A 4TWKA 1IBMO 2ILMA 4MVOA 4FFBB 3JCUZ 3CRCA 3CC2V 1NVPB 2Z3YA 3RGBA 3IGAC 1IBLO 3ZJZA 3IAYA 4NKGB 4O4JB 2IU3A 5B66Z 1K97A 4DV7O 4JTAB 2ZQMA 3CRAA 4HAMA 1QR9A 1BHAA 5B1BC 4F6RB 4AQYB 2CTPA 3T2MA 3ZMTA 2BOBC 5LA6A 4HBNA 3W7TA 4I4TB 1XILA 4LC1A 3W7SA 1Y66A 1BSMA 3JCZA 4NB5A 3E83A 1WP7A 2V4DA 3A8TA 1FFTB 3WB1A 1J5EO 4J7KA 2HHHB 1FD9A 5K1XA 4FMTA 4CS3A 2ZT9B 4F6EA 2WSSG 5CA1B 4WCEV 2LW1A 2DWDC 3NR7A 5IYDO 5J2TA 4LFAO 3JARB 2QE7G 1BT8A 4G2KA 4CC6A 5LHGA 1JVMA 4GX1A 1KC8W 3CX5F 5K1PA 2ZE8A 3STLC 2ZE6A 4HYOA 3ZMUA 4UCVA 4KHPB 1L0LH 1S5LZ 1V55C 2D2CB 4DUZO 3AG4B 2A79B 3AK1A 3F5WC 5FLXN 2VQEB 4FM1A 4CZZA 4XBFA 1NQTA 4BW5A 5KA6A 3LUTB 5CA3A 4PA6A 2XHBA 4O4IB 4Z1MG 1AI6A 4QNHB 3MHSC 3DGEA 1F4MA 2VWKA 3A0RA 2UU9B 1BHBA 4O2AA 2C2AA 1AR5A 1Y6XA 4RQEA 2OCCC 5DEDA 3IFXA 3DSQA 4X65B 4GKKO 4J7JA 2UUBB 4OPHA 3ABLB 1NBMG 3AEIA 2IJKA 3BEHA 3H1KH 4YY3B 1VQKV 1HNWO 1AJPA 1YIJV 3CCVV 1PL0A 1ZL8B 2P06A 1SQFA 5IY5C 5CBFA 1OCRB 3BHPA 1O9GA 3ZMSA 5HFMA 3JALB 2D3OW 3FKSG 3E22B 4U7OA 2WLKA 5L3CA 1N34B 4NXMB 1E1QG 4JV5B 4LF4O 1W59A 4JI4B 4J7ZA 4IYHA 5JJEB 5H2FZ 1LR1A 3CJHA 1GM7A 1FPOA 3ABKC 1XL4A 1PV0A 4NXNO 4FLUA 4KFMA 3G67A 3OGIB 5KMGA 3SGIA 1JX9A 3MDSA 1K3EA 3HKDB 1Y76B 1VQPV 2XAQA 4PA3A 4JI3B 1KKDA 1B06A 2PY5A 2Q69A 2JJ2G 1COWG 5DN6G 2BOCC 4U3JA 3SYCA 1AVMA 4U3FH 3LSSA 5EBWC 1YXBA 2A9HA 4I9WA 2AW9A 4PDLA 3TK1A 3T1YO 3AK3A 1I7FA 1GMGA 4LCUC 2B1IA 5LOVA 4GYCB 4GLXA 2QM8A 3OUFA 1KU9A 3RYFB 1XREA 2A3QA 2FL4A 3X2QB 2HVJC 2LP7A 3L72H 3ASNB 4DV2O 2EJRA 4JI2O 2ZE7A 2QR4A 2DYSB 4D7SA 3ZS8C 3T1HO 4DR5O 3N2GB 3UM7A 1H2KA 5ITZB 5IJ0A 4TOIA 5BR8B 3RYHA 4JZGA 2LQTA 5GONA 1ZWIC 4JI7B 4B3RO 4LWSA 1U96A 4JI0B 1E1RG 4WFBV 4NYKA 3EHBB 3JAWA 1D5AA 1K7DA 5LL6Y 1GH6A 3ZBHA 2VS0A 5C8YA 1ZTEA 2Y69B 1ZLZA 1Q43A 4OPAA 5EC2C 1VQ9V 2RQ6A 4P9OA 4ZOLA 4GKJO 4AHCA 5J2TB 2IBZH 2QKCA 3M7MX 3K5OA 3MHHC 3CCJV 1US6A 3FFQA 1EBOA 2Q5ZA 4AQYO 1S5JA 4IIJB 3ZMZA 3CP1A 2W6IG 1JA8A 2B1GA 4RO2A 1FFXB 1OHHG 2ZE5A 4HNAA 2N05A 1SERA 4MVRA 1D2DA 4EKWA 3OGCC 1S76D 4PDMA 3AG4C 4GX0A 2ADQB 2WWWA 2E5LB 2F23A 1JPXA 1W0KG 2WLLA 3RVYA 2HHHO 3OTOB 1QU7A 4B08A 2JGUA 1M5IA 4X1KA 2HR3A 1B04A 1KP2A 2WLMA 2UUAB 4LFCB 2OWOA 3F7VC 3RYIA 1WPXA 3Q4HA 5B1AB 3OAAG 3SYOA 4RUFA 1MZEA 2YIDA 3W7UA 4UFZA 4KL1A 2RMKB 1RFYA 4CS4A 5H5NA 3JD1A 3EXAA 4KHPO 1QCEA 3H1LH 3LSQA 3K9AA 5KHIA 1VQ8V 2AZ0A 1SRYA 4X20A 2EBOA 1P49A 3HKBB 1NTZH 4FFBA 1R73A 2PI5A 1OCRC 4CH5A 4O4JA 1BGYH 2P5OA 2MK3A 2AGAA 3CB2A 5L3BA 2UU9O 3C3SA 2DE0X 4TV9B 4LBEC 3RFRA 1T5EA 3WFVA 3P32A 3B8NA 4X65O 3K5LA 3WU2Z 1BCCH 4XDJA 2YIBA 2UUBO 1WB7A 1VQMV 3PN1A 2QKSA 4IL6Z 3GWKC 1G1XB 3APOA 2WA3A 4YY3O 4D7TA 1YTFB 1XI1A 1TGOA 4I4TA 2CH7B 4XDLA 1Y4MA 4DK0A 3ZHQA 3CD6V 3VQWA 1VEWA 3LSUA 5FNVA 5CA0B 1N34O 4NXMO 2JK5C 3FYIB 1Y74B 5IYBO 5L3EA 2JEUA 5KHKA 2FKXA 4JI4O 1TAEA 1OCZB 1M57B 1PNLA 2IW5A 5CA1A 2UXNA 1IXMA 4RAIA 3UT5B 4W4KA 2HFEC 3JARA 1KB9F 3BY6A 1QBZA 1NR7A 1CP9A 1Q6UA 1N8RW 5KHJA 1EFRG 1X59A 4YJ2A 4B7EA 1F4NA 5IE9A 1GKFA 2ADPA 3X2QC 4JI3O 1K34A 1R3KC 3ZN0A 3ML0A 2E74B 3E2EA 5LMUB 5KHGA 4MTGA 5IWAB 2DYSC 2GHYA 4AILC 1EN5A 3WG7B 1XMOB 2UXCB 1HNXB 2YC0A 2EILB 4RWUA 4ZBMA 2P22C 4O4IA 2XAGA 5C8YB 1Z2GA 3JSLA 3B40A 3ABMC 2JGDB 1AJNA 2PGGA 1I5XA 5EC1C 1XDCA 1XL6A 1TA8A 4ZOLB 1O9HA 1D5NA 2K9PA 2ITCC 1WP8A 3SYQA 1BMFG 2CUGA 3T4ZA 1SF9A 4GX2A 2EIJB 2QGNA 5LHHA 4J9ZB 2QM4A 5KAFZ 3APQA 4MVSA 3AG1B 3D3QA 3FB5C 5BR8O 5IYZA 1ZL8A 3UQ8A 1N0JA 4JI7O 1M56B 4JI0O 4J42A 4TUYB 3JALA 3E22A 1K5SA 1N36B 1R6TA 2IH1C 3P3NA 1DGSA 3SJBC 2NN4A 2ZCEA 4EFBA 3ASOB 2PYLA 1H2SB 3K9SA 1WN7A 5L3GA 1WAZA 2HEPA 2ZINA 3Q4HB 4BWAA 2DWEC 1FJGB 5KUKA 1FXVA 4IHJB 1K5QA 3K03A 2UUCB 2Q6AA 1SQPH 2DJVA 4I55B 1S5HC 4E2LA 2ODMA 1KMIZ 2WLNA 4PELA 4IT5A 1VARA 4DR1B 5LYJB 3HKDA 1Y76A 1ORQC 3VBBA 3O65A 5BY1A 1WA8B 4O4HA 3OM3B 4PI0A 3CCMV 1LNQA 3ABUA 1Z5WA 2RN9A 3UCSC 4X20B 1NKDA 4X64B 1EN6A 1JFFB 3BCCH 4LR3A 4ASUG 4I5SA 2E5LO 5L3DA 3LNMB 2DYRB 3OTOO 2UXBB 2UUAO 4LFCO 2E76B 1K4CC 1XMQB 1GRJA 4TQFA 3RYFA 5E1AC 2XOKG 2YXLA 4PJ0Z 3ZHUA 1NZ6A 1OCCC 3FAVB 1S3JA 3M8AA 3HKCB 1AI7A 1NI8A 1JJ2U 1L0NH 2CDYA 4DUYB 4FLXA 1Q6IA 3N2GA 2WLHA 5ITZA 1K4DC 4QGPA 3K5NA 3RYCB 3K3WA 3JASA 1EZJA 4X9QA 1LUWA 3G6BA 5LMNB 3E8FA 1YVWA 3BVOA 3QVNA 5FNVB 1RP3B 3U11A 2LGWA 1V54B 4B3TB 2OTJV 3OR6C 2OTLV 2ZIMA 1HWYA 3FYEB 4R50A 4R6ZA 4X1YB 5D5PA 4I0XB 1IZ3A 1JQ0A 3N2KB 3AG3B 1YHQV 2GBOA 2YSUB 1BZKA 1PNMA 1QQCA 4BW9A 1TUEB 2EZPA 1OCZC 4FLZA 1M57C 2EJ7A 4YJ2B 4IIJA 3AG2B 1FFXA 4JYAB 3A0HZ 3B8MA 3NXSA 2V7QG 1H2NA 4DV3B 5AG2A 1HNZO 2FYUH 3RW0A 4Z2WA 3QF7A 3SDLA 4HZ3A 3OTFA 5EIBC 3OFNG 2WLIA 3K79A 5J9PC 3P3PA 1PD3A 1XBLA 1DF5A 4LNUB 4DRXB 5KX5A 3ZRWB 2PI4A 3WG7C 1L8DA 1RPOA 2EILC 1KECA 4J10A 4FM0A 3ETDA 4K0KB 4DR4B 1TUBB 4ZIBA 1N32B 2QTSA 1VIBA 2G38A 2O57A 4MVZA 2OIGA 2GUZA 2XNDG 3WB2A 1AI5A 1FXKB 3OT7A 1XNRB 3UO2A 1AI4A 3F5TA 4PA7A 4MT8A 1DLBA 3OEEG 5IYZB 2EIJC 4MTFA 5LMUO 1ZX3A 3QNEA 2IM9A 3RBZA 5IWAO 1XMOO 1OCOC 1WLEA 4UV8A 1HNXO 3HKBA 2HJFC 3AG1C 4PA4A 3LDDA 1NU1H 2HVKC 3MAQA 3ETEA 4DV6B 4B3MB 1M56C 4BIZA 1EZVH 4WBNA 3CMAV 2JRIA 4ABMA 2ZXWB 5L3FA 3U0ZA 3BPZA 4O4LB 3DTUB 3G71V 1B6QA 4TV9A 3L73H 3CHXA 4JAUA 3ASOC 1AILA 4PD4F 2Q0AA 3ZEDA 3S3XA 2JS3A 4GUNA 5TISZ 4FLVA 5JQGB 2QKAA 4DW0A 2HLDG 3IJ4A 4LF9B 3TCUA 4O4HB 1M90W 1EM1A 2ATKC 2CH7A 5GW7A 4PI2A 2NNUA 2KKWA 2CGOA 3W7XA 2M6YA 4H0LB 1R3JC 1VMGA 2LO1A 1FS0G 1IVSA 5CA0A 1NS1A 3JYCA 4NTXA 1Y74A 4DR2B 4LF8B 2XTAA 2QM7A 2E75B 5EIBD 4DO2A 2Q7EA 3TXQA 1VQNV 2KG7B 3OR7C 3FX7A 1FJGO 4GZRB 3GVMA 3UT5A 1Z5VA 4ZHQA 4JTDB 4H37A 4ICGA 4JI8O 1H8EG 2DYRC 5CBHA 1IURA 2EIKB 4LF7B 2X7RB 1VF7A 2DQ3A 1GM9A 4OX9O 4DR1O 4N23A 1BQ0A 4PDRA 5JCOC 1Q3EA 2MW2B 1VQ5V 4JTCB 1MZFA 4CC5A 3K0GA 2HP8A 1GN2A 3AK2A 4UV9A 3JASB 4DV4B 4X64O 2QWPB 4X66B 4UVAA 3LDEA 3OMNB 5BXZA 2JS5A 3AG7A 1URFA 3DC5A 1AB3A 2JGDA 3K06A 4P9PA 2UXBO 5IT9N 2PZSA 1XMQO 4DV5B 2WA4A 3CRQA 1W2BU 3CCUV 4UB6Z 4FFKA 4NTYA 1V54C 3ZX6A 2F66C 2F93B 4K35A 4UB8Z 1SETA 2P7TC 1IDSA 1S0VA 2DN9A 4DUYO 3AG3C 1IBKB 3BA8A 1L1FA 5EYPB 2VQFB 2YS8A 5E79Z 3AG2C 4TUYA 4CH4A 3UO3A 3WB0A 5LMNO 1MOFA 2NR5A 4PDVA 1BS3A 1MMMA 2WLIB 2A7WA 2YI9A 3L74H 3FB8C 3O9OA 1FXHA 2CAZC 5KX5B 4B3TO 2P4KA 1VF6C 1WPBA 2M7WA 2CE4A 5EZYB 1NH2D 1ENVA 3CWBH 4L8JA 4UXNA 1KUQA 2JDIG 2HG5C 4IHJA 1I94B 4YJ3B 3CXCU 2WPDG 2GUZB 4J41A 1NVPD 4X62B 4I55A 1QLNA 3U10A 5GTIZ 4DR7B 2L35A 5LYJA 4JYAO 3CEIA 2BCCH 1YDXA 1WA8A 4GT1A 4UVCA 1OJHA 2VQEO 4MVQA 3MD0A 1XHXA 3IC9A 4DV3O 1XHZA 4TSFG 2XT9A 1I5YA 3ABLC 5JJNB 1FXKC 1TVKB 1GO3F 3CCEV 2CTQA 2YIBD 3TXSA 3ZHSA 3T4DA 1JFFA 4R8CA 4IGGA 5JJJB 2ZR3A 2ETNA 1DK1A 4WBNB 2IJIA 1R6NA 4I9QA 4K8XA 3OUSA 1ROPA 5B1NA 1GN4A 4OXSA 1SA0B 3KKYA 4K0KO 3SPJA 5KHHA 4DR4O 1LUVA 5JCOA 1N32O 1P4RA 1J95A 2Q0OC 1YITV 3FAVA 1OV9A 3HKCA 4P2ZA 1YI2V 2ZXWC 4MS2A 4JYBA 5EBLC 1MSWD 2IJHA 1JOYA 1KBHA 5FPOA 4EEQA 5CBGA 1Q81W 2ZNIA 1WJZA 2B9ZA 2LFRA 3ZRSA 3ZHTA 3RYCA 1PKXA 4JI5B 3OEHG 1RPRA 5CMUA 1XUQA 2FB5A 4JV5O 2Q73A 2YXYA 4DV6O 2QSAA 1CPYA 4DUZB 2Y0IA 1SS3A 3G4SV 3B2EE 1KP3A 3I56V 4X1YA 3OW2U 2WLJA 4I0XA 1H2GA 4EB6B 3N2KA 1K92A 4ZHQB 1VQOV 1BQZA 3CCLV 5IDJA 5LGUA 1M93A 4O2BB 5LXTA 1WB8A 4FZ0A 1N4CA 1IXBA 2IJJA 2FTKA 1FKAO 2YEVB 1X4TA 1GN6A 2ZDIA 4LF9O 2QEXV 5B3SB 2EIKC 2V1DA 3ASNC 1EN4A 4KP4A 1V55B 5CN0A 1VF6A 2YXHA 2GV9A 3E35A 2R9IA 2GSMB 5B5EZ 1Q7YW 4DR2O 3T1CA 4LF8O 4LNUA 4DRXA 3CSXA 3SR2C 3ZRWA 4WFFA 2QWOB 3JAMN 3QG5A 4JZ2A 5CB4B 2QWNB 3RWRD 3K04A 3VQVA 4JI6B 4TV8B 2Y48A 1TUBA 2PTMA 2P6JA 4KUMA 3ZMVA 2Y69C 1QHTA 1UFIA 5H9CA 1G8MA 4LF7O 1Q82W 3ZRXA 5A9GA
chains in the Genus database with same CATH topology
1KYOF 3L75H 1SQQH 1PP9H 1PPJH 1P84F 3L70H 3L73H 3L72H 4U3FH 1BE3H 4PD4F 3H1JH 1SQXH 2FYUH 3L74H 3TGUH 3CXHF 2A06H 2BCCH 1SQBH 3H1LH 3H1IH 3CX5F 1BGYH 1NU1H 1NTMH 1KB9F 1SQPH 3BCCH 3CWBH 5KLVH 4D6TH 1EZVH 1SQVH 3H1KH 3L71H 1L0LH 1L0NH 1BCCH 2IBZH 1NTKH 3H1HH 1NTZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO F;  3L75 H;  1SQQ H;  1PP9 H;  1PPJ H;  1P84 F;  3L70 H;  3L73 H;  3L72 H;  4U3F H;  1BE3 H;  4PD4 F;  3H1J H;  1SQX H;  2FYU H;  3L74 H;  3TGU H;  3CXH F;  2A06 H;  2BCC H;  1SQB H;  3H1L H;  3H1I H;  3CX5 F;  1BGY H;  1NU1 H;  1NTM H;  1KB9 F;  1SQP H;  3BCC H;  3CWB H;  5KLV H;  4D6T H;  1EZV H;  1SQV H;  3H1K H;  3L71 H;  1L0L H;  1L0N H;  1BCC H;  2IBZ H;  1NTK H;  3H1H H;  1NTZ H; 
#chains in the Genus database with same CATH topology
 4BAY A;  3D36 C;  1FXK A;  2Q8V A;  3TET A;  4JYC A;  5LP6 B;  3L9D A;  3FB7 C;  2LFS A;  2DOS A;  4E4E A;  1YZB A;  1HW7 A;  3SPI A;  1V9P A;  2CTR A;  2YI8 A;  1I08 A;  4DV4 O;  2EX3 A;  2OT5 A;  4X66 O;  2EIM B;  4MTX A;  4DK1 A;  4MSW C;  1FAF A;  3B09 A;  5J2U A;  1SQQ H;  2HJD A;  1KD1 W;  3ICX A;  1JJO A;  2DW4 A;  3ZHR A;  3E8B A;  3BA9 A;  5JWP A;  3TGU H;  3RVZ A;  4DV5 O;  2ARH A;  4O4L A;  1Y67 A;  3ABK B;  3IC7 A;  2P90 A;  3E8G A;  2Q7H A;  2GTS A;  2Y4U A;  3N27 A;  1QR8 A;  2ZD9 A;  2H8P C;  5B1A C;  5JQG A;  1A32 A;  3RT3 C;  4FZ1 A;  1IBK O;  1DTO A;  2Z0A A;  3JD0 A;  4JAS A;  3SPG A;  3BFR A;  4QE7 A;  3JAK A;  2VQF O;  1THZ A;  1F51 A;  2AHY A;  2XAJ A;  2RJZ A;  3GWO A;  4JI2 B;  1SQV H;  1N33 B;  1YJN V;  3KCY A;  3EFF K;  2W0X A;  4LF6 B;  2X6B A;  2W0F C;  2RCV A;  4EFE A;  1NH2 B;  4JPR A;  2KG7 A;  1PNK A;  5KUM A;  4B3R B;  1JCH A;  1G6U A;  1Q86 W;  1I94 O;  1FYJ A;  1H8H G;  4MW8 A;  4X62 O;  1NT2 B;  2XAH A;  4DR7 O;  1JR9 A;  3QTC A;  5B1O A;  2QWR B;  1K33 A;  3DC6 A;  4TT3 G;  4FVM A;  4GKJ B;  2BTQ B;  1ZAU A;  4Q20 A;  1BE3 H;  1SQX H;  5EK0 A;  3SPC A;  5F2V O;  2Q67 A;  4FLT A;  1E79 G;  3J7A U;  4MW3 A;  1PL4 A;  3H9V A;  3DXR A;  4WFG A;  4QJF B;  5IYC O;  2YIA A;  4YHH B;  1KYO F;  1AJQ A;  1YJW V;  3D36 A;  3K08 A;  3JD3 A;  2PYJ A;  4DV0 B;  2FML A;  3F7Y C;  3K5M A;  1UPG A;  5LXT B;  4X8A A;  3LNN A;  4X1I A;  2F4V B;  2JIZ G;  3C90 A;  2BE3 A;  4QPK A;  3CCS V;  1HP8 A;  1XNQ B;  3THO A;  5EYP A;  4ZI7 B;  1VF5 B;  1VP7 A;  4DR6 B;  4JI5 O;  2A06 H;  1G4Y B;  4FLY A;  1I0H A;  3G80 A;  2Q7G A;  5B3S C;  5KLV H;  2K1E A;  4UCU A;  4DYL A;  5EZY A;  1QVF U;  1M9N A;  3J81 N;  2Z5U A;  4DW1 A;  4GX5 A;  1P7B A;  3B77 A;  4YJ3 A;  1M4U A;  3JAT B;  3BAA A;  4H33 A;  4FLW A;  1Q90 D;  3CC7 V;  4YXW G;  2NLJ C;  2OYQ A;  1Q6H A;  1H38 A;  3H1H H;  2L6L A;  2QDO A;  2JJ1 G;  5JVD A;  4J11 A;  1TVK A;  3ETG A;  1AP5 A;  3FD9 A;  2UXC O;  5LP6 C;  3ZRV A;  1UJW B;  1S72 V;  4LF5 B;  2XAF A;  4FPP A;  5J2U B;  1YTF D;  2ZM6 B;  2H3O A;  1DF4 A;  1CXZ B;  4MTO A;  2EIM C;  2H94 A;  5JH7 B;  1SA0 A;  3CYO A;  2RNB A;  1WNS A;  4JI6 O;  1K73 W;  1Q5O A;  1YEW A;  3VOU A;  2IH3 C;  5EBM C;  5D5Q A;  3CXH F;  4LH7 A;  1H2M A;  3H1I H;  4JI1 B;  3I55 V;  3S3W A;  4W4L A;  1ARO P;  4J80 A;  4AI8 A;  4B3S B;  4LFB B;  3P30 A;  4UCR A;  1NR1 A;  1BL8 A;  2Q4P A;  3OD4 A;  3JAK B;  3CRR A;  4DR3 B;  3L70 H;  4A5U B;  3ETQ A;  3STZ C;  1XOU A;  3HKE B;  1N36 O;  3I5D A;  2OCH A;  2RDC A;  3BRC A;  4K8Z A;  3JSN A;  1XEQ A;  2UXD B;  4WFA V;  4CH3 A;  3L75 H;  4I50 B;  4NVP A;  1XQ8 A;  4EB6 A;  1P84 F;  1F23 A;  2UUC O;  4FK5 C;  3K58 A;  1AR4 A;  4O2B A;  2X6A A;  1SC5 B;  2YEV A;  1RSO A;  3ZIA G;  1PM9 A;  1S77 D;  1K8A W;  4WF9 V;  4P30 A;  3HR0 A;  1K9M W;  4JYY A;  1SQG A;  4QPJ A;  4G28 B;  4DV1 B;  1MAB G;  2EIN B;  3DXR B;  2HKO A;  3K59 A;  1N33 O;  2X6C A;  4UUJ C;  2JVD A;  2QWQ B;  5LA6 B;  4LF6 O;  2CGN A;  5C93 A;  5CB4 A;  3ABM B;  1QNM A;  4H13 B;  2BSK A;  4TV8 A;  4K3A A;  2F1M A;  4UCO A;  3K0D A;  1MNG A;  4X88 A;  1HR0 B;  2DMX A;  3E8H A;  4QE9 A;  5FL7 G;  2LW7 A;  4KXR A;  2Y4T A;  4X1I B;  4CBC A;  2ZNJ A;  5LP6 A;  1R6K A;  3KZI Z;  4PHZ A;  3QO8 A;  4D6T H;  1YJ9 V;  3PJS K;  2F43 G;  3ABT A;  3M99 B;  3OE7 G;  1MA1 A;  1NTK H;  3CCR V;  4PA9 A;  1PP9 H;  2R70 A;  1AR1 B;  2ZDI C;  4L87 A;  2CK3 G;  4Q6G A;  3R66 A;  3H01 A;  5BMV A;  3K57 A;  3ZCC A;  4YHH O;  3ZN1 A;  4JAA A;  1AP6 A;  3OMA B;  5LHI A;  4H44 B;  2R9A A;  1YCI A;  4OGQ B;  4WFE A;  2YDE A;  3SYA A;  4DV0 O;  2WAM A;  4UCT A;  1IBM B;  5LBQ A;  1P7G A;  2Q9L A;  1IX9 A;  3A2F A;  3HB3 B;  4BR6 A;  5IJ9 A;  1IBL B;  2F4V O;  4LH6 A;  2Y0P A;  1SZX A;  1R1B A;  3CE2 A;  2VRZ A;  1NJI W;  2YUA A;  3CCQ V;  4DV7 B;  1XNQ O;  1ZSP A;  3HPL C;  4O2A B;  4DR6 O;  3UKM A;  3CPW U;  5JVD B;  1RM1 B;  2LJ2 A;  1QLE B;  1N0N A;  3VQX A;  2KSD A;  1PPJ H;  2XAS A;  3H1J H;  3A0B Z;  2A0L A;  5H6R A;  1JMK C;  1SQB H;  2VWJ A;  4TQD A;  2OIE A;  3CME V;  2Q68 A;  4RQF A;  4R7C A;  3BAB A;  4DXW A;  4GCZ A;  1OZ0 A;  4J9Y B;  2CTW A;  1J5E B;  1OCC B;  1XNR O;  3E89 A;  3CRM A;  5B1B B;  2QA4 V;  3CJH B;  1F7Y A;  1NTM H;  4YIP A;  2BTQ A;  3C3T A;  1U97 A;  4ZKI A;  4LFA B;  2E3C A;  4FJC C;  2AXT Z;  5GTH Z;  4LF5 O;  5KMG B;  3FB6 C;  4F6R A;  4BIU A;  2R9R B;  3JD4 A;  4X89 A;  4CS2 A;  3LDC A;  2ITD C;  4B3M O;  2EZO A;  2GTA A;  2ZM6 O;  1W0J G;  3QO7 A;  4CH6 A;  2DQ0 A;  3SJQ C;  1HNZ B;  2EUL A;  4U3J B;  3KG2 A;  1MSD A;  4WFH A;  2N04 A;  2PF4 E;  2JEX A;  4JI1 O;  4MVU A;  4UCS A;  2AZ2 A;  1QVG U;  1RSO B;  4B3S O;  5LOV B;  4NR1 A;  4LFB O;  5H6Q A;  3W7W A;  4BIO A;  3D3I A;  4YIO A;  4ZI7 A;  2ZIO A;  4JF3 A;  4DR3 O;  4GKK B;  1H2L A;  1SZT A;  2F95 B;  1GAX A;  4NTW A;  3E86 A;  3TJT A;  4JAV A;  5KAI Z;  1SES A;  4U7N A;  1HNW B;  4UVB A;  5IJ0 B;  2IU0 A;  3RYH B;  2UXD O;  2KQX A;  1HDJ A;  4FIP C;  2EIN C;  5GON B;  2QTO A;  4LWS B;  2YIC A;  1KQS U;  2BSK B;  2AHZ A;  3JAW B;  2P67 A;  5HFL A;  3VQY A;  1B3Q A;  4FM2 A;  3JAT A;  5LGN A;  3SJC C;  1VQ4 V;  1SKV A;  2OCC B;  4LF4 B;  2X0L A;  2B5U A;  2XUM A;  3G6E V;  2ZKO A;  3RN4 A;  3KCX A;  1GM8 A;  2BTO A;  5BZB A;  4NXN B;  5LGT A;  4IYI A;  4I7Z B;  2UXX A;  4B7K A;  3J80 N;  3EVK A;  3JD2 A;  4XDK A;  4DV1 O;  2W6J G;  1MG1 A;  2LGQ A;  1R3L C;  5IY5 B;  1R3I C;  3B4S A;  1VQL V;  1OCO B;  5BMV B;  4PV1 B;  1GK9 A;  3ZHV A;  4Z1V A;  3QO5 A;  1KKC A;  5JH7 A;  2PUS A;  4QIW F;  4HNA B;  4RUE A;  2GDS A;  1HR0 O;  1M1K W;  3SPH A;  1VQ6 V;  4N21 A;  3D8C A;  4JGS A;  5IJ9 B;  2WLL B;  1GN3 A;  3T1Y B;  3SYP A;  4C7U A;  4X1K B;  3OMI B;  5DEC A;  3RYI B;  1YSC A;  5FPR A;  3GB7 C;  5DM6 V;  3CC4 V;  4JI8 B;  1Q8I A;  1YF2 A;  4DV2 B;  1GTO A;  3L71 H;  2ZR2 A;  1ZUQ A;  3HKE A;  2R72 A;  2P4V A;  4OX9 B;  5A2Q N;  2QJ1 A;  3T1H B;  4DR5 B;  3R65 A;  4MVM A;  4G27 B;  3SJA C;  1RM1 C;  2N74 A;  1QLE C;  5KA5 A;  1VQ7 V;  4I50 A;  2KB1 A;  1CEZ A;  4LP8 A;  4F4L A;  3CS5 A;  4TWK A;  1IBM O;  2ILM A;  4MVO A;  4FFB B;  3JCU Z;  3CRC A;  3CC2 V;  1NVP B;  2Z3Y A;  3RGB A;  3IGA C;  1IBL O;  3ZJZ A;  3IAY A;  4NKG B;  4O4J B;  2IU3 A;  5B66 Z;  1K97 A;  4DV7 O;  4JTA B;  2ZQM A;  3CRA A;  4HAM A;  1QR9 A;  1BHA A;  5B1B C;  4F6R B;  4AQY B;  2CTP A;  3T2M A;  3ZMT A;  2BOB C;  5LA6 A;  4HBN A;  3W7T A;  4I4T B;  1XIL A;  4LC1 A;  3W7S A;  1Y66 A;  1BSM A;  3JCZ A;  4NB5 A;  3E83 A;  1WP7 A;  2V4D A;  3A8T A;  1FFT B;  3WB1 A;  1J5E O;  4J7K A;  2HHH B;  1FD9 A;  5K1X A;  4FMT A;  4CS3 A;  2ZT9 B;  4F6E A;  2WSS G;  5CA1 B;  4WCE V;  2LW1 A;  2DWD C;  3NR7 A;  5IYD O;  5J2T A;  4LFA O;  3JAR B;  2QE7 G;  1BT8 A;  4G2K A;  4CC6 A;  5LHG A;  1JVM A;  4GX1 A;  1KC8 W;  3CX5 F;  5K1P A;  2ZE8 A;  3STL C;  2ZE6 A;  4HYO A;  3ZMU A;  4UCV A;  4KHP B;  1L0L H;  1S5L Z;  1V55 C;  2D2C B;  4DUZ O;  3AG4 B;  2A79 B;  3AK1 A;  3F5W C;  5FLX N;  2VQE B;  4FM1 A;  4CZZ A;  4XBF A;  1NQT A;  4BW5 A;  5KA6 A;  3LUT B;  5CA3 A;  4PA6 A;  2XHB A;  4O4I B;  4Z1M G;  1AI6 A;  4QNH B;  3MHS C;  3DGE A;  1F4M A;  2VWK A;  3A0R A;  2UU9 B;  1BHB A;  4O2A A;  2C2A A;  1AR5 A;  1Y6X A;  4RQE A;  2OCC C;  5DED A;  3IFX A;  3DSQ A;  4X65 B;  4GKK O;  4J7J A;  2UUB B;  4OPH A;  3ABL B;  1NBM G;  3AEI A;  2IJK A;  3BEH A;  3H1K H;  4YY3 B;  1VQK V;  1HNW O;  1AJP A;  1YIJ V;  3CCV V;  1PL0 A;  1ZL8 B;  2P06 A;  1SQF A;  5IY5 C;  5CBF A;  1OCR B;  3BHP A;  1O9G A;  3ZMS A;  5HFM A;  3JAL B;  2D3O W;  3FKS G;  3E22 B;  4U7O A;  2WLK A;  5L3C A;  1N34 B;  4NXM B;  1E1Q G;  4JV5 B;  4LF4 O;  1W59 A;  4JI4 B;  4J7Z A;  4IYH A;  5JJE B;  5H2F Z;  1LR1 A;  3CJH A;  1GM7 A;  1FPO A;  3ABK C;  1XL4 A;  1PV0 A;  4NXN O;  4FLU A;  4KFM A;  3G67 A;  3OGI B;  5KMG A;  3SGI A;  1JX9 A;  3MDS A;  1K3E A;  3HKD B;  1Y76 B;  1VQP V;  2XAQ A;  4PA3 A;  4JI3 B;  1KKD A;  1B06 A;  2PY5 A;  2Q69 A;  2JJ2 G;  1COW G;  5DN6 G;  2BOC C;  4U3J A;  3SYC A;  1AVM A;  4U3F H;  3LSS A;  5EBW C;  1YXB A;  2A9H A;  4I9W A;  2AW9 A;  4PDL A;  3TK1 A;  3T1Y O;  3AK3 A;  1I7F A;  1GMG A;  4LCU C;  2B1I A;  5LOV A;  4GYC B;  4GLX A;  2QM8 A;  3OUF A;  1KU9 A;  3RYF B;  1XRE A;  2A3Q A;  2FL4 A;  3X2Q B;  2HVJ C;  2LP7 A;  3L72 H;  3ASN B;  4DV2 O;  2EJR A;  4JI2 O;  2ZE7 A;  2QR4 A;  2DYS B;  4D7S A;  3ZS8 C;  3T1H O;  4DR5 O;  3N2G B;  3UM7 A;  1H2K A;  5ITZ B;  5IJ0 A;  4TOI A;  5BR8 B;  3RYH A;  4JZG A;  2LQT A;  5GON A;  1ZWI C;  4JI7 B;  4B3R O;  4LWS A;  1U96 A;  4JI0 B;  1E1R G;  4WFB V;  4NYK A;  3EHB B;  3JAW A;  1D5A A;  1K7D A;  5LL6 Y;  1GH6 A;  3ZBH A;  2VS0 A;  5C8Y A;  1ZTE A;  2Y69 B;  1ZLZ A;  1Q43 A;  4OPA A;  5EC2 C;  1VQ9 V;  2RQ6 A;  4P9O A;  4ZOL A;  4GKJ O;  4AHC A;  5J2T B;  2IBZ H;  2QKC A;  3M7M X;  3K5O A;  3MHH C;  3CCJ V;  1US6 A;  3FFQ A;  1EBO A;  2Q5Z A;  4AQY O;  1S5J A;  4IIJ B;  3ZMZ A;  3CP1 A;  2W6I G;  1JA8 A;  2B1G A;  4RO2 A;  1FFX B;  1OHH G;  2ZE5 A;  4HNA A;  2N05 A;  1SER A;  4MVR A;  1D2D A;  4EKW A;  3OGC C;  1S76 D;  4PDM A;  3AG4 C;  4GX0 A;  2ADQ B;  2WWW A;  2E5L B;  2F23 A;  1JPX A;  1W0K G;  2WLL A;  3RVY A;  2HHH O;  3OTO B;  1QU7 A;  4B08 A;  2JGU A;  1M5I A;  4X1K A;  2HR3 A;  1B04 A;  1KP2 A;  2WLM A;  2UUA B;  4LFC B;  2OWO A;  3F7V C;  3RYI A;  1WPX A;  3Q4H A;  5B1A B;  3OAA G;  3SYO A;  4RUF A;  1MZE A;  2YID A;  3W7U A;  4UFZ A;  4KL1 A;  2RMK B;  1RFY A;  4CS4 A;  5H5N A;  3JD1 A;  3EXA A;  4KHP O;  1QCE A;  3H1L H;  3LSQ A;  3K9A A;  5KHI A;  1VQ8 V;  2AZ0 A;  1SRY A;  4X20 A;  2EBO A;  1P49 A;  3HKB B;  1NTZ H;  4FFB A;  1R73 A;  2PI5 A;  1OCR C;  4CH5 A;  4O4J A;  1BGY H;  2P5O A;  2MK3 A;  2AGA A;  3CB2 A;  5L3B A;  2UU9 O;  3C3S A;  2DE0 X;  4TV9 B;  4LBE C;  3RFR A;  1T5E A;  3WFV A;  3P32 A;  3B8N A;  4X65 O;  3K5L A;  3WU2 Z;  1BCC H;  4XDJ A;  2YIB A;  2UUB O;  1WB7 A;  1VQM V;  3PN1 A;  2QKS A;  4IL6 Z;  3GWK C;  1G1X B;  3APO A;  2WA3 A;  4YY3 O;  4D7T A;  1YTF B;  1XI1 A;  1TGO A;  4I4T A;  2CH7 B;  4XDL A;  1Y4M A;  4DK0 A;  3ZHQ A;  3CD6 V;  3VQW A;  1VEW A;  3LSU A;  5FNV A;  5CA0 B;  1N34 O;  4NXM O;  2JK5 C;  3FYI B;  1Y74 B;  5IYB O;  5L3E A;  2JEU A;  5KHK A;  2FKX A;  4JI4 O;  1TAE A;  1OCZ B;  1M57 B;  1PNL A;  2IW5 A;  5CA1 A;  2UXN A;  1IXM A;  4RAI A;  3UT5 B;  4W4K A;  2HFE C;  3JAR A;  1KB9 F;  3BY6 A;  1QBZ A;  1NR7 A;  1CP9 A;  1Q6U A;  1N8R W;  5KHJ A;  1EFR G;  1X59 A;  4YJ2 A;  4B7E A;  1F4N A;  5IE9 A;  1GKF A;  2ADP A;  3X2Q C;  4JI3 O;  1K34 A;  1R3K C;  3ZN0 A;  3ML0 A;  2E74 B;  3E2E A;  5LMU B;  5KHG A;  4MTG A;  5IWA B;  2DYS C;  2GHY A;  4AIL C;  1EN5 A;  3WG7 B;  1XMO B;  2UXC B;  1HNX B;  2YC0 A;  2EIL B;  4RWU A;  4ZBM A;  2P22 C;  4O4I A;  2XAG A;  5C8Y B;  1Z2G A;  3JSL A;  3B40 A;  3ABM C;  2JGD B;  1AJN A;  2PGG A;  1I5X A;  5EC1 C;  1XDC A;  1XL6 A;  1TA8 A;  4ZOL B;  1O9H A;  1D5N A;  2K9P A;  2ITC C;  1WP8 A;  3SYQ A;  1BMF G;  2CUG A;  3T4Z A;  1SF9 A;  4GX2 A;  2EIJ B;  2QGN A;  5LHH A;  4J9Z B;  2QM4 A;  5KAF Z;  3APQ A;  4MVS A;  3AG1 B;  3D3Q A;  3FB5 C;  5BR8 O;  5IYZ A;  1ZL8 A;  3UQ8 A;  1N0J A;  4JI7 O;  1M56 B;  4JI0 O;  4J42 A;  4TUY B;  3JAL A;  3E22 A;  1K5S A;  1N36 B;  1R6T A;  2IH1 C;  3P3N A;  1DGS A;  3SJB C;  2NN4 A;  2ZCE A;  4EFB A;  3ASO B;  2PYL A;  1H2S B;  3K9S A;  1WN7 A;  5L3G A;  1WAZ A;  2HEP A;  2ZIN A;  3Q4H B;  4BWA A;  2DWE C;  1FJG B;  5KUK A;  1FXV A;  4IHJ B;  1K5Q A;  3K03 A;  2UUC B;  2Q6A A;  1SQP H;  2DJV A;  4I55 B;  1S5H C;  4E2L A;  2ODM A;  1KMI Z;  2WLN A;  4PEL A;  4IT5 A;  1VAR A;  4DR1 B;  5LYJ B;  3HKD A;  1Y76 A;  1ORQ C;  3VBB A;  3O65 A;  5BY1 A;  1WA8 B;  4O4H A;  3OM3 B;  4PI0 A;  3CCM V;  1LNQ A;  3ABU A;  1Z5W A;  2RN9 A;  3UCS C;  4X20 B;  1NKD A;  4X64 B;  1EN6 A;  1JFF B;  3BCC H;  4LR3 A;  4ASU G;  4I5S A;  2E5L O;  5L3D A;  3LNM B;  2DYR B;  3OTO O;  2UXB B;  2UUA O;  4LFC O;  2E76 B;  1K4C C;  1XMQ B;  1GRJ A;  4TQF A;  3RYF A;  5E1A C;  2XOK G;  2YXL A;  4PJ0 Z;  3ZHU A;  1NZ6 A;  1OCC C;  3FAV B;  1S3J A;  3M8A A;  3HKC B;  1AI7 A;  1NI8 A;  1JJ2 U;  1L0N H;  2CDY A;  4DUY B;  4FLX A;  1Q6I A;  3N2G A;  2WLH A;  5ITZ A;  1K4D C;  4QGP A;  3K5N A;  3RYC B;  3K3W A;  3JAS A;  1EZJ A;  4X9Q A;  1LUW A;  3G6B A;  5LMN B;  3E8F A;  1YVW A;  3BVO A;  3QVN A;  5FNV B;  1RP3 B;  3U11 A;  2LGW A;  1V54 B;  4B3T B;  2OTJ V;  3OR6 C;  2OTL V;  2ZIM A;  1HWY A;  3FYE B;  4R50 A;  4R6Z A;  4X1Y B;  5D5P A;  4I0X B;  1IZ3 A;  1JQ0 A;  3N2K B;  3AG3 B;  1YHQ V;  2GBO A;  2YSU B;  1BZK A;  1PNM A;  1QQC A;  4BW9 A;  1TUE B;  2EZP A;  1OCZ C;  4FLZ A;  1M57 C;  2EJ7 A;  4YJ2 B;  4IIJ A;  3AG2 B;  1FFX A;  4JYA B;  3A0H Z;  3B8M A;  3NXS A;  2V7Q G;  1H2N A;  4DV3 B;  5AG2 A;  1HNZ O;  2FYU H;  3RW0 A;  4Z2W A;  3QF7 A;  3SDL A;  4HZ3 A;  3OTF A;  5EIB C;  3OFN G;  2WLI A;  3K79 A;  5J9P C;  3P3P A;  1PD3 A;  1XBL A;  1DF5 A;  4LNU B;  4DRX B;  5KX5 A;  3ZRW B;  2PI4 A;  3WG7 C;  1L8D A;  1RPO A;  2EIL C;  1KEC A;  4J10 A;  4FM0 A;  3ETD A;  4K0K B;  4DR4 B;  1TUB B;  4ZIB A;  1N32 B;  2QTS A;  1VIB A;  2G38 A;  2O57 A;  4MVZ A;  2OIG A;  2GUZ A;  2XND G;  3WB2 A;  1AI5 A;  1FXK B;  3OT7 A;  1XNR B;  3UO2 A;  1AI4 A;  3F5T A;  4PA7 A;  4MT8 A;  1DLB A;  3OEE G;  5IYZ B;  2EIJ C;  4MTF A;  5LMU O;  1ZX3 A;  3QNE A;  2IM9 A;  3RBZ A;  5IWA O;  1XMO O;  1OCO C;  1WLE A;  4UV8 A;  1HNX O;  3HKB A;  2HJF C;  3AG1 C;  4PA4 A;  3LDD A;  1NU1 H;  2HVK C;  3MAQ A;  3ETE A;  4DV6 B;  4B3M B;  1M56 C;  4BIZ A;  1EZV H;  4WBN A;  3CMA V;  2JRI A;  4ABM A;  2ZXW B;  5L3F A;  3U0Z A;  3BPZ A;  4O4L B;  3DTU B;  3G71 V;  1B6Q A;  4TV9 A;  3L73 H;  3CHX A;  4JAU A;  3ASO C;  1AIL A;  4PD4 F;  2Q0A A;  3ZED A;  3S3X A;  2JS3 A;  4GUN A;  5TIS Z;  4FLV A;  5JQG B;  2QKA A;  4DW0 A;  2HLD G;  3IJ4 A;  4LF9 B;  3TCU A;  4O4H B;  1M90 W;  1EM1 A;  2ATK C;  2CH7 A;  5GW7 A;  4PI2 A;  2NNU A;  2KKW A;  2CGO A;  3W7X A;  2M6Y A;  4H0L B;  1R3J C;  1VMG A;  2LO1 A;  1FS0 G;  1IVS A;  5CA0 A;  1NS1 A;  3JYC A;  4NTX A;  1Y74 A;  4DR2 B;  4LF8 B;  2XTA A;  2QM7 A;  2E75 B;  5EIB D;  4DO2 A;  2Q7E A;  3TXQ A;  1VQN V;  2KG7 B;  3OR7 C;  3FX7 A;  1FJG O;  4GZR B;  3GVM A;  3UT5 A;  1Z5V A;  4ZHQ A;  4JTD B;  4H37 A;  4ICG A;  4JI8 O;  1H8E G;  2DYR C;  5CBH A;  1IUR A;  2EIK B;  4LF7 B;  2X7R B;  1VF7 A;  2DQ3 A;  1GM9 A;  4OX9 O;  4DR1 O;  4N23 A;  1BQ0 A;  4PDR A;  5JCO C;  1Q3E A;  2MW2 B;  1VQ5 V;  4JTC B;  1MZF A;  4CC5 A;  3K0G A;  2HP8 A;  1GN2 A;  3AK2 A;  4UV9 A;  3JAS B;  4DV4 B;  4X64 O;  2QWP B;  4X66 B;  4UVA A;  3LDE A;  3OMN B;  5BXZ A;  2JS5 A;  3AG7 A;  1URF A;  3DC5 A;  1AB3 A;  2JGD A;  3K06 A;  4P9P A;  2UXB O;  5IT9 N;  2PZS A;  1XMQ O;  4DV5 B;  2WA4 A;  3CRQ A;  1W2B U;  3CCU V;  4UB6 Z;  4FFK A;  4NTY A;  1V54 C;  3ZX6 A;  2F66 C;  2F93 B;  4K35 A;  4UB8 Z;  1SET A;  2P7T C;  1IDS A;  1S0V A;  2DN9 A;  4DUY O;  3AG3 C;  1IBK B;  3BA8 A;  1L1F A;  5EYP B;  2VQF B;  2YS8 A;  5E79 Z;  3AG2 C;  4TUY A;  4CH4 A;  3UO3 A;  3WB0 A;  5LMN O;  1MOF A;  2NR5 A;  4PDV A;  1BS3 A;  1MMM A;  2WLI B;  2A7W A;  2YI9 A;  3L74 H;  3FB8 C;  3O9O A;  1FXH A;  2CAZ C;  5KX5 B;  4B3T O;  2P4K A;  1VF6 C;  1WPB A;  2M7W A;  2CE4 A;  5EZY B;  1NH2 D;  1ENV A;  3CWB H;  4L8J A;  4UXN A;  1KUQ A;  2JDI G;  2HG5 C;  4IHJ A;  1I94 B;  4YJ3 B;  3CXC U;  2WPD G;  2GUZ B;  4J41 A;  1NVP D;  4X62 B;  4I55 A;  1QLN A;  3U10 A;  5GTI Z;  4DR7 B;  2L35 A;  5LYJ A;  4JYA O;  3CEI A;  2BCC H;  1YDX A;  1WA8 A;  4GT1 A;  4UVC A;  1OJH A;  2VQE O;  4MVQ A;  3MD0 A;  1XHX A;  3IC9 A;  4DV3 O;  1XHZ A;  4TSF G;  2XT9 A;  1I5Y A;  3ABL C;  5JJN B;  1FXK C;  1TVK B;  1GO3 F;  3CCE V;  2CTQ A;  2YIB D;  3TXS A;  3ZHS A;  3T4D A;  1JFF A;  4R8C A;  4IGG A;  5JJJ B;  2ZR3 A;  2ETN A;  1DK1 A;  4WBN B;  2IJI A;  1R6N A;  4I9Q A;  4K8X A;  3OUS A;  1ROP A;  5B1N A;  1GN4 A;  4OXS A;  1SA0 B;  3KKY A;  4K0K O;  3SPJ A;  5KHH A;  4DR4 O;  1LUV A;  5JCO A;  1N32 O;  1P4R A;  1J95 A;  2Q0O C;  1YIT V;  3FAV A;  1OV9 A;  3HKC A;  4P2Z A;  1YI2 V;  2ZXW C;  4MS2 A;  4JYB A;  5EBL C;  1MSW D;  2IJH A;  1JOY A;  1KBH A;  5FPO A;  4EEQ A;  5CBG A;  1Q81 W;  2ZNI A;  1WJZ A;  2B9Z A;  2LFR A;  3ZRS A;  3ZHT A;  3RYC A;  1PKX A;  4JI5 B;  3OEH G;  1RPR A;  5CMU A;  1XUQ A;  2FB5 A;  4JV5 O;  2Q73 A;  2YXY A;  4DV6 O;  2QSA A;  1CPY A;  4DUZ B;  2Y0I A;  1SS3 A;  3G4S V;  3B2E E;  1KP3 A;  3I56 V;  4X1Y A;  3OW2 U;  2WLJ A;  4I0X A;  1H2G A;  4EB6 B;  3N2K A;  1K92 A;  4ZHQ B;  1VQO V;  1BQZ A;  3CCL V;  5IDJ A;  5LGU A;  1M93 A;  4O2B B;  5LXT A;  1WB8 A;  4FZ0 A;  1N4C A;  1IXB A;  2IJJ A;  2FTK A;  1FKA O;  2YEV B;  1X4T A;  1GN6 A;  2ZDI A;  4LF9 O;  2QEX V;  5B3S B;  2EIK C;  2V1D A;  3ASN C;  1EN4 A;  4KP4 A;  1V55 B;  5CN0 A;  1VF6 A;  2YXH A;  2GV9 A;  3E35 A;  2R9I A;  2GSM B;  5B5E Z;  1Q7Y W;  4DR2 O;  3T1C A;  4LF8 O;  4LNU A;  4DRX A;  3CSX A;  3SR2 C;  3ZRW A;  4WFF A;  2QWO B;  3JAM N;  3QG5 A;  4JZ2 A;  5CB4 B;  2QWN B;  3RWR D;  3K04 A;  3VQV A;  4JI6 B;  4TV8 B;  2Y48 A;  1TUB A;  2PTM A;  2P6J A;  4KUM A;  3ZMV A;  2Y69 C;  1QHT A;  1UFI A;  5H9C A;  1G8M A;  4LF7 O;  1Q82 W;  3ZRX A;  5A9G A; 
#chains in the Genus database with same CATH homology
 1KYO F;  3L75 H;  1SQQ H;  1PP9 H;  1PPJ H;  1P84 F;  3L70 H;  3L73 H;  3L72 H;  4U3F H;  1BE3 H;  4PD4 F;  3H1J H;  1SQX H;  2FYU H;  3L74 H;  3TGU H;  3CXH F;  2A06 H;  2BCC H;  1SQB H;  3H1L H;  3H1I H;  3CX5 F;  1BGY H;  1NU1 H;  1NTM H;  1KB9 F;  1SQP H;  3BCC H;  3CWB H;  5KLV H;  4D6T H;  1EZV H;  1SQV H;  3H1K H;  3L71 H;  1L0L H;  1L0N H;  1BCC H;  2IBZ H;  1NTK H;  3H1H H;  1NTZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...