3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
1BE3H 2FYUH 3H1LH 3L73H 1SQQH 2IBZH 2BCCH 5KLVH 3CXHF 4D6TH 3H1JH 3H1HH 1NU1H 2A06H 3CX5F 1KB9F 1SQXH 4PD4F 1P84F 3H1IH 1BCCH 1KYOF 1PP9H 3L71H 1BGYH 1NTMH 3L75H 4U3FH 1NTKH 3BCCH 3H1KH 1NTZH 1SQBH 1EZVH 3L70H 3L72H 3CWBH 3L74H 3TGUH 1PPJH 1L0LH 1SQVH 1SQPH 1L0NH
chains in the Genus database with same CATH superfamily
3ETEA 2HEPA 4FM0A 2YI8A 3E83A 3OTOB 2YEVA 1JR9A 3G4SV 1JMKC 4ICGA 4DR3O 1Q6IA 1CEZA 3X2QC 3W7UA 2JK5C 2ZE8A 1U96A 5FLXN 1COWG 4B08A 4A5UB 2A3QA 3ABKB 3F7VC 4H33A 2WA4A 2Q6AA 2QM8A 5CMUA 3IFXA 3ZIAG 3RVZA 3RYCB 1GK9A 1GRJA 4ASUG 2HVKC 1YTFB 4PV1B 3E89A 3AG1C 5J9PC 3AG4B 4X20B 1H2NA 2DYRB 4IYHA 1WJZA 3E8HA 3R66A 5JCOC 1VF7A 2IW5A 2YSUB 1KECA 1D5NA 2RQ6A 4H0LB 3CCSV 3M8AA 2LFRA 1VF5B 1I08A 4DW1A 4DXWA 1TUEB 4JI1B 5BR8B 1R6TA 2QA4V 4YY3B 2VWKA 4O2AA 4YHHB 3K0DA 3QO8A 1VQMV 1SETA 3K08A 4DV3B 1S5LZ 1AJQA 5IJ9A 3SDLA 3BABA 3CC2V 1QVFU 5KHKA 4J7JA 1V55C 4GZRB 4NR1A 4HAMA 3BRCA 1NQTA 2XUMA 1XHXA 5LMNB 4DV2O 1GMGA 4PELA 5CBGA 2ETNA 4JAUA 3U11A 4LF8O 1R3IC 1WAZA 4RAIA 4FPPA 1EN5A 2XASA 4PD4F 3RVYA 4MTXA 4X89A 4F4LA 1I94B 3L75H 2CGNA 1NVPB 2ILMA 3RYIA 2CUGA 3STZC 1AR4A 2F4VO 1SQVH 3N2KA 2X6AA 2EIMB 4NTWA 1EZJA 4JTAB 1QLEC 1J5EB 3OFNG 4PI2A 1YJWV 1N34B 4X62B 4QIWF 4O4IA 1BHBA 5L3GA 1IX9A 3CXCU 4JI6B 2UXCB 4BAYA 3T1YB 2XAJA 1CPYA 1GN3A 4DUYO 3W7XA 3WU2Z 2F43G 4DV0B 5CB4B 2ITDC 5D5PA 3ZHRA 3AG2B 5GTIZ 5L3DA 4DR2O 2XOKG 1QBZA 5DECA 2ZCEA 3HB3B 1Q86W 5J2UA 1D5AA 5KX5A 2CTRA 3A0HZ 2FL4A 2YI9A 3QO5A 1SQGA 3OUFA 3FB5C 4GKKB 5ITZA 3ABMC 1SESA 3D36C 5CBHA 2CTWA 1OZ0A 4DR1O 1XOUA 2E5LB 3D3IA 1WA8A 4K0KB 1FAFA 2FB5A 2UXBB 5IDJA 1WB8A 3EXAA 1M90W 2XAGA 1YJNV 2OCCC 4PJ0Z 2EJ7A 1JPXA 2EILB 1N36B 4DR6O 4Q6GA 1OV9A 1FFXB 3T2MA 1G6UA 1VQ6V 4ZHQA 1NZ6A 1IBMO 5IYBO 4KHPB 2X6BA 1N4CA 2EIJC 1SA0B 4LWSA 3CCLV 1E79G 4X66B 3OAAG 4UCTA 3QTCA 3CE2A 4YXWG 1G8MA 1K5SA 2VWJA 1WP8A 3OT7A 2NR5A 1N33O 4BR6A 2HR3A 1FXKB 4K8XA 5LXTB 1AI7A 3M99B 5IY5B 5LP6A 4X1IA 3RN4A 2A7WA 1XREA 3JASA 2OIGA 4JI0O 1XNRO 1BSMA 1OCRC 3JATB 4Q20A 4Z1VA 3CJHB 4NXNO 4DR7B 1QVGU 1GAXA 1R3JC 1NR7A 1JOYA 1LUWA 3B4SA 2KG7A 1YTFD 2WLLB 2Y4UA 2AW9A 2Q68A 3CS5A 2UU9O 1Q7YW 4TV8B 5B66Z 1H8HG 2WLIB 4FLXA 4I4TB 4H13B 4QNHB 1F4NA 4U3FH 2R72A 1K33A 2P5OA 1S76D 2UXDO 2HHHB 3HKBA 1Q82W 2IJIA 4LC1A 5DM6V 4G28B 1VQPV 3CC4V 3HKCB 4D7TA 1BQZA 2HP8A 2B1IA 1PV0A 3HKEB 2QTSA 4XDJA 1S0VA 2IM9A 1QLNA 1XMQB 4UCSA 2QKSA 3E8FA 3MHSC 3JD1A 4IL6Z 2BSKA 2RMKB 4GCZA 4LF7B 2IU0A 2DN9A 1SZXA 2XAQA 4RUFA 1AI4A 3QVNA 4CH6A 2BOCC 4GKJB 4TUYA 4J41A 3UO2A 1U97A 5GTHZ 4XDKA 2ZXWC 3LDDA 5JJJB 2M6YA 1KB9F 2Q67A 3CRCA 4R7CA 1W0KG 2E75B 5EIBD 3C90A 1PNMA 2YUAA 1FPOA 3JALB 1XMOO 3K0GA 1AR5A 4B3MB 2DW4A 4LF9B 1NVPD 3RYFB 4ZI7A 5F2VO 3L70H 4X1KA 4WCEV 4OX9O 3UO3A 5FPRA 3W7SA 1GN6A 1UFIA 4FFKA 3WG7C 1ZAUA 1EN6A 4I5SA 3H1JH 4UV9A 4OPAA 4LF6O 2KQXA 4I9QA 4LH6A 4J9ZB 5JH7A 3LSUA 5IE9A 3LSQA 3ASOC 5LYJA 3OW2U 1AROP 4JI8B 3WFVA 3SYOA 1YITV 2PUSA 4U3JA 4DV4O 2YS8A 4JYCA 3CCUV 4GX5A 4I7ZB 4AQYO 3JARB 1MSDA 1H2KA 4IHJA 2PI5A 3FX7A 5KLVH 2UUAB 2JGDA 2P90A 4ABMA 4JYAO 1Y4MA 4UUJC 1HNZO 5BZBA 1BCCH 3AG3C 1AB3A 1YDXA 5L3BA 4JI5O 4MVRA 4PDLA 5FNVB 3PJSK 3JAWA 2DWDC 2QM4A 3SGIA 4HNAA 3SPHA 1QNMA 4MW8A 1Z5WA 2QWRB 2YC0A 3LDCA 4YJ3B 1KKCA 3IGAC 3R65A 1N32B 1TUBA 4J9YB 5KX5B 1M5IA 1RM1C 1P7BA 1DGSA 3IC7A 2JEXA 3CWBH 3BHPA 2M7WA 5EYPB 2PI4A 3GVMA 3E22A 4B3TB 2ZT9B 3JAKA 4MTGA 4MVSA 4LH7A 2K1EA 4H37A 3THOA 2EZOA 5LA6A 2Q7EA 1RPRA 1MG1A 3FKSG 1JFFB 4ZBMA 2BTQA 1MZFA 1YZBA 3K04A 4W4LA 4X1YA 5IJ0B 1LNQA 5H6QA 1JJOA 1H2GA 3CRAA 4AI8A 1R1BA 1WP7A 3ZJZA 1ZTEA 1OCCC 3JD2A 2ZDIC 3CRQA 1VARA 3CCEV 5A9GA 5HFMA 1RSOA 4DR5B 2GHYA 4X64O 4FZ0A 2D3OW 5KHIA 2N05A 4HZ3A 4X9QA 1TGOA 1Y6XA 1NH2B 1IURA 1B6QA 1XQ8A 1Y74A 3ZHTA 1HDJA 1AJPA 3WB2A 4YJ2A 2CE4A 3BY6A 1S77D 3ASNB 2FTKA 2A79B 2HJDA 1R3LC 4DUZO 2DJVA 4X65O 3W7WA 3A0RA 2KG7B 3ZEDA 4RQFA 4PA3A 4I50A 3ABKC 2JRIA 4PA4A 2GUZA 4FLWA 2PZSA 1MNGA 3HPLC 1K73W 4JI7B 4JI3O 3AK2A 1PNKA 2OIEA 4LF5O 1PP9H 1IVSA 3DC5A 3UT5B 1K97A 1VQKV 5K1XA 2QWPB 5LOVB 3P3NA 3DXRA 3J80N 4GX2A 4PDMA 3ZHUA 3ZX6A 3AG4C 2DYRC 4R8CA 4DR3B 2V1DA 1FS0G 3UQ8A 3H1IH 3ZHSA 5B1BB 1HP8A 2JS5A 3BPZA 1Q8IA 4ZOLB 4XBFA 3TXSA 2DYSB 2IBZH 1M1KW 1MMMA 2CTQA 1Y76A 4B3SO 2P67A 3KCXA 4EB6A 4F6RB 5CA3A 5IYCO 1VQ5V 4IT5A 2VQFO 4LFCO 2AZ0A 1ROPA 2DOSA 1IBLO 4LNUB 4O2BA 4NXMO 1DLBA 3S3WA 4J80A 3B77A 2O57A 3K79A 3ZHVA 5CA0B 3ZRXA 1LUVA 4HBNA 4K3AA 2YIBA 1ZSPA 2Z0AA 5C8YA 5EIBC 2A06H 4TQDA 2IJHA 1PL0A 3K58A 2R9AA 5GONB 2B5UA 4IIJA 1Q3EA 1G1XB 4JYYA 3SJQC 1V54B 4JI2O 2HKOA 5H6RA 4DK1A 3P30A 2EIMC 1QR9A 1ZL8B 4P9OA 3CSXA 1BE3H 2YIDA 2JS3A 4IYIA 3RBZA 3D36A 3RYHB 5CA1A 4JV5O 3OTOO 3T4ZA 3LSSA 5E1AC 2X7RB 2ZM6O 4UVBA 4DV2B 2RN9A 3B40A 3G6EV 4DO2A 4LF8B 4LF4B 1VQNV 5KUKA 2AHZA 5KMGA 5EK0A 1A32A 3AG2C 3OEEG 3OM3B 3JAMN 1XEQA 2P22C 2Y69B 5H9CA 2HFEC 1MABG 2KSDA 2F4VB 2WLKA 4FJCC 1OCOB 5KHHA 2GTSA 1H38A 5LL6Y 1L8DA 2OT5A 4DV6O 1SQFA 1KP3A 3JD3A 1F4MA 1AI5A 2LJ2A 3G67A 2LFSA 3AK1A 4U7OA 4TV9A 3LUTB 2WSSG 2MK3A 1X59A 1XHZA 1GO3F 1I5XA 4UCOA 3Q4HA 1F7YA 2EILC 2LGQA 1JX9A 4DUYB 3OTFA 3E8GA 1R6NA 2ATKC 1BS3A 3HR0A 4FFBB 1W0JG 3PN1A 4DV3O 2CH7B 2JJ1G 4DR2B 3MAQA 5JQGB 3JD0A 3N2GA 1N0JA 3ABTA 5AG2A 1NT2B 3P32A 3ZMUA 1E1RG 1NI8A 3FB6C 1AR1B 5J2TB 2QEXV 3RWRD 2OTJV 3ZN1A 2QGNA 4DR1B 1FXKC 3FB7C 4B3RB 2WLNA 5IY5C 5LHGA 5HFLA 1B04A 3OE7G 4EFEA 1TAEA 5C93A 4LFBB 5EZYB 2DQ3A 4NTXA 2OWOA 4DR6B 1DF4A 1ORQC 1W2BU 2PYJA 4DV7O 3CC7V 2GUZB 3CEIA 3RW0A 2B9ZA 1IBMB 1Q5OA 3RFRA 2UUBO 2GTAA 3J81N 3TK1A 1YJ9V 4P2ZA 1Q6HA 4O4JB 1KD1W 1N34O 1HR0O 2Z3YA 2EINB 1MA1A 2VRZA 4CS2A 5L3CA 1N33B 2EIKB 4JI6O 3CB2A 4I55B 1HNXB 1I7FA 1M4UA 2Y0IA 2W0FC 3T1YO 4MVUA 3K9SA 1XNRB 3ZRWA 4PDVA 4WFBV 1YEWA 4NXNB 3KZIZ 5EC1C 3SYAA 1MZEA 4DRXA 1T5EA 3HKDA 4UB8Z 2QDOA 4B7EA 4KFMA 1BZKA 3FFQA 1FD9A 2YEVB 1OCZB 1YI2V 1WPXA 3OR7C 2F23A 4MTFA 4DK0A 3UM7A 2UXDB 2E5LO 1XILA 4FZ1A 1YF2A 3LDEA 4JI4B 2UXBO 3F7YC 1THZA 2AGAA 2P06A 5IYZA 1BT8A 1EFRG 1UJWB 3N27A 4O4LA 3SJCC 3A0BZ 1HNWO 5EBLC 1FKAO 4FLZA 4WBNA 2ARHA 2X6CA 1GTOA 2ZNJA 4RUEA 5DEDA 4KHPO 2B1GA 3L9DA 3D8CA 1GM7A 3OGIB 3E86A 4EKWA 3RGBA 5LMUB 3K06A 4BW5A 5CA1B 2ZE7A 4BW9A 5IWAO 4P30A 1NS1A 2JVDA 1SQXH 1AP6A 3CPWU 1XMOB 3CCMV 3CRRA 4OX9B 1WN7A 1WNSA 2H94A 1NKDA 1Z5VA 4O2AB 1F23A 3ICXA 4UVAA 4UV8A 2ODMA 2RJZA 1XDCA 4UFZA 2ZDIA 5IJ9B 2AZ2A 4LFAO 1TVKA 5A2QN 1KKDA 1AP5A 2Q7HA 4G27B 3EVKA 1IBKB 4RQEA 1GKFA 2C2AA 5B3SB 5JJNB 4DV4B 3O65A 5JVDA 3H1KH 5BMVA 4O4HA 1RP3B 4OXSA 4AQYB 3FAVA 2HHHO 4FLVA 3AEIA 3UKMA 4UXNA 2Q5ZA 3MHHC 4KL1A 3C3TA 3J7AU 4JYAB 1HNZB 2ZE6A 2PY5A 5TISZ 4JI5B 4P9PA 5CBFA 1D2DA 1I5YA 1NTMH 3TETA 3RYIB 5LHIA 1KBHA 4LF7O 3N2KB 1VP7A 2Q4PA 4ZKIA 1H2MA 3JSNA 4FMTA 2GBOA 2EBOA 4JF3A 3L73H 1K3EA 3ABLB 3CMAV 1VQLV 2VS0A 2QWOB 5B1NA 3NXSA 3CD6V 3U0ZA 5B1AB 4CS3A 4O4IB 1VQ7V 4R50A 1S5JA 4TSFG 2ZINA 4MTOA 1ENVA 2DQ0A 2EZPA 2R70A 4FM2A 1OHHG 3RYCA 3BEHA 4XDLA 5LBQA 3OMNB 3KCYA 1L1FA 2G38A 2FYUH 2LW7A 3VQVA 1FXVA 2E76B 4X20A 2QWNB 1WPBA 5CN0A 1VQOV 3L71H 4WFHA 1SKVA 2HLDG 3LNMB 5J2UB 3OGCC 3QNEA 4MVOA 1JVMA 3AK3A 4GUNA 5ITZB 2A9HA 4X64B 3APQA 4DV1O 1M56B 3JCUZ 1DF5A 1YVWA 3AG7A 4E2LA 1WA8B 1AVMA 1NU1H 4PA7A 2UUAO 3F5TA 2NLJC 3BFRA 2ZKOA 1M57B 2OTLV 1BL8A 2R9IA 4FLTA 3B8MA 4TOIA 3T1HO 4NKGB 2YXYA 1FYJA 1URFA 1DK1A 3W7TA 4ZHQB 2BCCH 2XTAA 2F93B 3E35A 2E74B 1VF6C 1W59A 4DV5O 2QSAA 1FJGO 4K8ZA 4LWSB 5B1BC 1GM8A 4J42A 2Q0OC 5LHHA 1VMGA 2Q8VA 2ZNIA 3IAYA 4X88A 2LP7A 4YIPA 1ZX3A 1US6A 2DYSC 2Q7GA 1XNQO 1E1QG 2Z5UA 3ABUA 4KUMA 4JI3B 5LP6B 4X1IB 1N8RW 4OPHA 4FM1A 4JYBA 3JASB 1K92A 2XAFA 3ZHQA 2VQEO 2F66C 1RFYA 2XHBA 2YXHA 2ZR3A 2KB1A 4N23A 3L74H 1M9NA 3GWKC 4UCRA 4UCVA 4JGSA 2PYLA 1YIJV 3WB1A 4CBCA 4WFGA 4MT8A 5CB4A 1PM9A 4PA6A 1ZWIC 1WLEA 1JQ0A 3HKBB 4W4KA 2XNDG 1XI1A 3ZS8C 2ADQB 1V54C 4MVZA 3IJ4A 3FYEB 3OR6C 4LR3A 2HJFC 1XL6A 1SZTA 4B3SB 4QE7A 1L0NH 1K4DC 3CXHF 1K9MW 2CGOA 2ADPA 2CAZC 1F51A 2BSKB 1OJHA 1ZLZA 4NXMB 1IBLB 4QPJA 2GV9A 2H8PC 4X8AA 2YXLA 4J7KA 1BMFG 2BTOA 1CP9A 4GX1A 1KU9A 3OMIB 2WLHA 4TUYB 3ETDA 4WFAV 1VQ4V 3SPGA 1LR1A 1FFXA 3VBBA 4D6TH 4UB6Z 2L35A 3FB8C 3QG5A 2Y69C 4JI7O 2BOBC 2DE0X 4JI2B 1SA0A 4ZI7B 4X1KB 1B06A 3BVOA 1WB7A 3TXQA 1OCOC 2Y0PA 3DC6A 4JZ2A 1L0LH 4FLUA 1SQQH 4QE9A 5L3EA 2JEUA 4JV5B 1Q43A 4DR4O 1FXKA 5LXTA 2ZM6B 5JH7B 4GT1A 3K5OA 5LYJB 1O9HA 5EC2C 3RT3C 4QPKA 4U3JB 3JATA 4TQFA 3UCSC 1SS3A 2IJJA 4IHJB 3CJHA 4NYKA 3CMEV 4J7ZA 4GLXA 2D2CB 1Q90D 2WLLA 4PDRA 2JGDB 1S72V 2UUCO 4D7SA 4JPRA 4TV8A 1K5QA 1XUQA 2WLIA 4L8JA 1G4YB 4I4TA 4R6ZA 5LGUA 3JD4A 2UXNA 3FD9A 4DV6B 3M7MX 3JAWB 3TGUH 1PKXA 4CZZA 4HNAB 2W6JG 1KC8W 1VQ9V 3HKCA 1MOFA 4OGQB 2XT9A 1KP2A 3HKEA 1BHAA 3H1HH 2RNBA 4FK5C 1TUBB 2WWWA 1PL4A 5D5QA 1SQBH 1ZUQA 2F1MA 3E22B 1IZ3A 5DN6G 3JAKB 2ZE5A 3P3PA 1YHQV 5LA6B 4DYLA 2L6LA 2MW2B 2HVJC 1GM9A 2BTQB 1NJIW 4X1YB 2EINC 1QCEA 4J10A 2HG5C 3JALA 3X2QB 3L72H 4LP8A 3ZMSA 3RYFA 1NH2D 5LGTA 2EIKC 1AI6A 3CCVV 4JI1O 5BR8O 1RSOB 4YY3O 5KUMA 1DTOA 2WAMA 4LF4O 4YHHO 2ITCC 1PNLA 5BY1A 3EHBB 3G80A 1MSWD 4DV7B 1EZVH 1Y74B 2PGGA 3B09A 1S3JA 4G2KA 2UUBB 3SJAC 3BAAA 1KUQA 4WFFA 1SRYA 3AG1B 4MS2A 4YJ2B 3K5LA 2XAHA 3JARA 5LMNO 1OCZC 3APOA 3VQXA 1HR0B 4NVPA 3B2EE 4KXRA 1R6KA 4I9WA 1CXZB 2IJKA 1O9GA 3I5DA 1EBOA 4EFBA 1I94O 4UVCA 4NTYA 5FNVA 4I50B 3I55V 3T1CA 4BWAA 2BE3A 1QU7A 3OUSA 1J5EO 3GWOA 3ML0A 1HW7A 4YJ3A 2LO1A 4UCUA 2Q0AA 2WLMA 1V55B 4X62O 2FMLA 2NN4A 1R3KC 3DXRB 3ZCCA 3C3SA 2P6JA 3SYPA 4PHZA 5EYPA 3BA8A 2GDSA 2PTMA 4MW3A 2UXCO 3KG2A 3G71V 1SF9A 4B3RO 4JI0B 1K4CC 2WLJA 4DV0O 3VOUA 3K03A 1JFFA 4CC5A 4GX0A 2CK3G 4LFBO 5IJ0A 2CDYA 1HNWB 3K9AA 2A0LA 3BA9A 1VIBA 2CTPA 1QLEB 1QR8A 2QTOA 2UU9B 4JAAA 1Y76B 2N74A 4GKKO 4EB6B 3QO7A 2JJ2G 2LGWA 3SPIA 1B3QA 1BGYH 5FPOA 1YCIA 4O2BB 5B3SC 4K0KO 4CH4A 5L3FA 2EX3A 3WB0A 1P7GA 2ZQMA 5IWAB 3NR7A 1HNXO 2Q9LA 4BIOA 5C8YB 1N36O 1YXBA 3K59A 2ZIOA 5KA6A 2NNUA 1GN2A 5BXZA 2DWEC 3IC9A 1KQSU 2YICA 4IIJB 1J95A 3VQYA 3OD4A 4RO2A 1IXBA 3BCCH 4H44B 1NTZH 2DMXA 4X66O 1P49A 3E8BA 4LFAB 5IYDO 3ABMB 4CS4A 3TCUA 3ABLC 5IT9N 3DSQA 4AILC 4U7NA 2JDIG 3TJTA 2QR4A 5B1AC 3I56V 1Z2GA 2JIZG 3SJBC 5KA5A 4GYCB 1HWYA 4F6EA 4RWUA 2P4VA 1N0NA 2X0LA 3UT5A 2OCCB 4JI4O 3U10A 3ZMTA 5LOVA 2Q73A 2QKCA 4DR7O 3A8TA 4B7KA 5KMGB 1M93A 3EFFK 3LNNA 4LF6B 3MDSA 2P7TC 4QGPA 4MVQA 2QE7G 1VF6A 4NB5A 2EIJB 1GN4A 4MSWC 4N21A 2EULA 4I0XA 4Z2WA 2E3CA 3G6BA 1VQ8V 4ZOLA 3H1LH 1M56C 3SR2C 3B8NA 2F95B 5LMUO 3JCZA 2RDCA 4BIZA 4TV9B 4FVMA 4F6RA 4JAVA 1M57C 1XL4A 4HYOA 2QWQB 2H3OA 1XMQO 1OCRB 3Q4HB 5JWPA 1PD3A 1SC5B 2Y4TA 4LNUA 3H01A 2LW1A 4J11A 3K5NA 1R73A 2WPDG 5CA0A 1IDSA 5FL7G 4LBEC 4GKJO 3A2FA 3N2GB 3ZRVA 4ZIBA 2W0XA 1H2LA 5GONA 3ZMVA 1IBKO 2R9RB 3ETQA 2YIAA 3FYIB 4E4EA 4DV1B 4B3MO 4LF9O 2P4KA 3K3WA 4DW0A 1AILA 2IU3A 4CC6A 1ZL8A 3KKYA 1GH6A 1K34A 5LP6C 2WA3A 2QKAA 1XBLA 1P84F 2V4DA 3RYHA 3ASNC 4TWKA 3K5MA 3T1HB 2RCVA 3CCQV 5KAFZ 3S3XA 1BQ0A 1FXHA 4JI8O 4JTDB 4DV5B 1FJGB 5JJEB 2ZXWB 1Y66A 3CHXA 1KMIZ 4L87A 1JA8A 3F5WC 1NTKH 1TA8A 5EBMC 1S5HC 3D3QA 1XNQB 2ZR2A 3JYCA 3SYCA 3STLC 2PF4E 2JGUA 4PA9A 1I0HA 4WF9V 4CH3A 3WG7B 1UPGA 1IXMA 4JASA 1AJNA 2ZIMA 3ZRWB 2VQEB 1V9PA 5H5NA 2ZD9A 5LGNA 4DUZB 1Q6UA 3CCJV 1EM1A 4X65B 1SERA 4K35A 4DRXB 3ASOB 5KHGA 5E79Z 1N32O 4MVMA 3HKDB 3ZMZA 2IH1C 5K1PA 2Q69A 3OEHG 2QM7A 1FFTB 3ETGA 1VEWA 2Y48A 5KAIZ 2YDEA 1JJ2U 2OCHA 4PI0A 1K8AW 4B3TO 2YIBD 3GB7C 2UXXA 3DTUB 4FFBA 4LF5B 4FIPC 3ZRSA 2OYQA 2CH7A 3AG3B 1K7DA 3VQWA 5JQGA 4Z1MG 3H9VA 1Y67A 3SPJA 5IYZB 3ZBHA 4O4LB 4JTCB 5KHJA 2AHYA 4LCUC 4BIUA 5J2TA 4QJFB 4WBNB 4IGGA 1P4RA 1JCHA 1EN4A 1NBMG 3CX5F 4DR5O 2FKXA 3CRMA 3JSLA 5JCOA 5H2FZ 1KYOF 4CH5A 3DGEA 4FLYA 1RM1B 1QQCA 2N04A 3QF7A 5EZYA 1QHTA 4JZGA 4AHCA 1SQPH 4TT3G 2EJRA 3K57A 3SPCA 2IH3C 2QJ1A 4EEQA 3CYOA 1NR1A 2VQFB 5B1OA 4LFCB 4O4JA 3SYQA 3O9OA 2AXTZ 2KKWA 4YIOA 3OMAB 5B5EZ 2GSMB 1RPOA 1OCCB 5GW7A 1Q81W 2K9PA 2V7QG 3CP1A 4DR4B 4I55A 1TVKB 5EBWC 4C7UA 3E2EA 3MD0A 2LQTA 1X4TA 3T4DA 4KP4A 5JVDB 3CCRV 5BMVB 4O4HB 4I0XB 1YSCA 3FAVB 4WFEA 1H2SB 3ZN0A 1PPJH 2W6IG 1H8EG 2UUCB
chains in the Genus database with same CATH topology
1BE3H 2FYUH 3H1LH 3L73H 1SQQH 2IBZH 2BCCH 5KLVH 3CXHF 4D6TH 3H1JH 3H1HH 1NU1H 2A06H 3CX5F 1KB9F 1SQXH 4PD4F 1P84F 3H1IH 1BCCH 1KYOF 1PP9H 3L71H 1BGYH 1NTMH 3L75H 4U3FH 1NTKH 3BCCH 3H1KH 1NTZH 1SQBH 1EZVH 3L70H 3L72H 3CWBH 3L74H 3TGUH 1PPJH 1L0LH 1SQVH 1SQPH 1L0NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  2FYU H;  3H1L H;  3L73 H;  1SQQ H;  2IBZ H;  2BCC H;  5KLV H;  3CXH F;  4D6T H;  3H1J H;  3H1H H;  1NU1 H;  2A06 H;  3CX5 F;  1KB9 F;  1SQX H;  4PD4 F;  1P84 F;  3H1I H;  1BCC H;  1KYO F;  1PP9 H;  3L71 H;  1BGY H;  1NTM H;  3L75 H;  4U3F H;  1NTK H;  3BCC H;  3H1K H;  1NTZ H;  1SQB H;  1EZV H;  3L70 H;  3L72 H;  3CWB H;  3L74 H;  3TGU H;  1PPJ H;  1L0L H;  1SQV H;  1SQP H;  1L0N H; 
#chains in the Genus database with same CATH topology
 3ETE A;  2HEP A;  4FM0 A;  2YI8 A;  3E83 A;  3OTO B;  2YEV A;  1JR9 A;  3G4S V;  1JMK C;  4ICG A;  4DR3 O;  1Q6I A;  1CEZ A;  3X2Q C;  3W7U A;  2JK5 C;  2ZE8 A;  1U96 A;  5FLX N;  1COW G;  4B08 A;  4A5U B;  2A3Q A;  3ABK B;  3F7V C;  4H33 A;  2WA4 A;  2Q6A A;  2QM8 A;  5CMU A;  3IFX A;  3ZIA G;  3RVZ A;  3RYC B;  1GK9 A;  1GRJ A;  4ASU G;  2HVK C;  1YTF B;  4PV1 B;  3E89 A;  3AG1 C;  5J9P C;  3AG4 B;  4X20 B;  1H2N A;  2DYR B;  4IYH A;  1WJZ A;  3E8H A;  3R66 A;  5JCO C;  1VF7 A;  2IW5 A;  2YSU B;  1KEC A;  1D5N A;  2RQ6 A;  4H0L B;  3CCS V;  3M8A A;  2LFR A;  1VF5 B;  1I08 A;  4DW1 A;  4DXW A;  1TUE B;  4JI1 B;  5BR8 B;  1R6T A;  2QA4 V;  4YY3 B;  2VWK A;  4O2A A;  4YHH B;  3K0D A;  3QO8 A;  1VQM V;  1SET A;  3K08 A;  4DV3 B;  1S5L Z;  1AJQ A;  5IJ9 A;  3SDL A;  3BAB A;  3CC2 V;  1QVF U;  5KHK A;  4J7J A;  1V55 C;  4GZR B;  4NR1 A;  4HAM A;  3BRC A;  1NQT A;  2XUM A;  1XHX A;  5LMN B;  4DV2 O;  1GMG A;  4PEL A;  5CBG A;  2ETN A;  4JAU A;  3U11 A;  4LF8 O;  1R3I C;  1WAZ A;  4RAI A;  4FPP A;  1EN5 A;  2XAS A;  4PD4 F;  3RVY A;  4MTX A;  4X89 A;  4F4L A;  1I94 B;  3L75 H;  2CGN A;  1NVP B;  2ILM A;  3RYI A;  2CUG A;  3STZ C;  1AR4 A;  2F4V O;  1SQV H;  3N2K A;  2X6A A;  2EIM B;  4NTW A;  1EZJ A;  4JTA B;  1QLE C;  1J5E B;  3OFN G;  4PI2 A;  1YJW V;  1N34 B;  4X62 B;  4QIW F;  4O4I A;  1BHB A;  5L3G A;  1IX9 A;  3CXC U;  4JI6 B;  2UXC B;  4BAY A;  3T1Y B;  2XAJ A;  1CPY A;  1GN3 A;  4DUY O;  3W7X A;  3WU2 Z;  2F43 G;  4DV0 B;  5CB4 B;  2ITD C;  5D5P A;  3ZHR A;  3AG2 B;  5GTI Z;  5L3D A;  4DR2 O;  2XOK G;  1QBZ A;  5DEC A;  2ZCE A;  3HB3 B;  1Q86 W;  5J2U A;  1D5A A;  5KX5 A;  2CTR A;  3A0H Z;  2FL4 A;  2YI9 A;  3QO5 A;  1SQG A;  3OUF A;  3FB5 C;  4GKK B;  5ITZ A;  3ABM C;  1SES A;  3D36 C;  5CBH A;  2CTW A;  1OZ0 A;  4DR1 O;  1XOU A;  2E5L B;  3D3I A;  1WA8 A;  4K0K B;  1FAF A;  2FB5 A;  2UXB B;  5IDJ A;  1WB8 A;  3EXA A;  1M90 W;  2XAG A;  1YJN V;  2OCC C;  4PJ0 Z;  2EJ7 A;  1JPX A;  2EIL B;  1N36 B;  4DR6 O;  4Q6G A;  1OV9 A;  1FFX B;  3T2M A;  1G6U A;  1VQ6 V;  4ZHQ A;  1NZ6 A;  1IBM O;  5IYB O;  4KHP B;  2X6B A;  1N4C A;  2EIJ C;  1SA0 B;  4LWS A;  3CCL V;  1E79 G;  4X66 B;  3OAA G;  4UCT A;  3QTC A;  3CE2 A;  4YXW G;  1G8M A;  1K5S A;  2VWJ A;  1WP8 A;  3OT7 A;  2NR5 A;  1N33 O;  4BR6 A;  2HR3 A;  1FXK B;  4K8X A;  5LXT B;  1AI7 A;  3M99 B;  5IY5 B;  5LP6 A;  4X1I A;  3RN4 A;  2A7W A;  1XRE A;  3JAS A;  2OIG A;  4JI0 O;  1XNR O;  1BSM A;  1OCR C;  3JAT B;  4Q20 A;  4Z1V A;  3CJH B;  4NXN O;  4DR7 B;  1QVG U;  1GAX A;  1R3J C;  1NR7 A;  1JOY A;  1LUW A;  3B4S A;  2KG7 A;  1YTF D;  2WLL B;  2Y4U A;  2AW9 A;  2Q68 A;  3CS5 A;  2UU9 O;  1Q7Y W;  4TV8 B;  5B66 Z;  1H8H G;  2WLI B;  4FLX A;  4I4T B;  4H13 B;  4QNH B;  1F4N A;  4U3F H;  2R72 A;  1K33 A;  2P5O A;  1S76 D;  2UXD O;  2HHH B;  3HKB A;  1Q82 W;  2IJI A;  4LC1 A;  5DM6 V;  4G28 B;  1VQP V;  3CC4 V;  3HKC B;  4D7T A;  1BQZ A;  2HP8 A;  2B1I A;  1PV0 A;  3HKE B;  2QTS A;  4XDJ A;  1S0V A;  2IM9 A;  1QLN A;  1XMQ B;  4UCS A;  2QKS A;  3E8F A;  3MHS C;  3JD1 A;  4IL6 Z;  2BSK A;  2RMK B;  4GCZ A;  4LF7 B;  2IU0 A;  2DN9 A;  1SZX A;  2XAQ A;  4RUF A;  1AI4 A;  3QVN A;  4CH6 A;  2BOC C;  4GKJ B;  4TUY A;  4J41 A;  3UO2 A;  1U97 A;  5GTH Z;  4XDK A;  2ZXW C;  3LDD A;  5JJJ B;  2M6Y A;  1KB9 F;  2Q67 A;  3CRC A;  4R7C A;  1W0K G;  2E75 B;  5EIB D;  3C90 A;  1PNM A;  2YUA A;  1FPO A;  3JAL B;  1XMO O;  3K0G A;  1AR5 A;  4B3M B;  2DW4 A;  4LF9 B;  1NVP D;  3RYF B;  4ZI7 A;  5F2V O;  3L70 H;  4X1K A;  4WCE V;  4OX9 O;  3UO3 A;  5FPR A;  3W7S A;  1GN6 A;  1UFI A;  4FFK A;  3WG7 C;  1ZAU A;  1EN6 A;  4I5S A;  3H1J H;  4UV9 A;  4OPA A;  4LF6 O;  2KQX A;  4I9Q A;  4LH6 A;  4J9Z B;  5JH7 A;  3LSU A;  5IE9 A;  3LSQ A;  3ASO C;  5LYJ A;  3OW2 U;  1ARO P;  4JI8 B;  3WFV A;  3SYO A;  1YIT V;  2PUS A;  4U3J A;  4DV4 O;  2YS8 A;  4JYC A;  3CCU V;  4GX5 A;  4I7Z B;  4AQY O;  3JAR B;  1MSD A;  1H2K A;  4IHJ A;  2PI5 A;  3FX7 A;  5KLV H;  2UUA B;  2JGD A;  2P90 A;  4ABM A;  4JYA O;  1Y4M A;  4UUJ C;  1HNZ O;  5BZB A;  1BCC H;  3AG3 C;  1AB3 A;  1YDX A;  5L3B A;  4JI5 O;  4MVR A;  4PDL A;  5FNV B;  3PJS K;  3JAW A;  2DWD C;  2QM4 A;  3SGI A;  4HNA A;  3SPH A;  1QNM A;  4MW8 A;  1Z5W A;  2QWR B;  2YC0 A;  3LDC A;  4YJ3 B;  1KKC A;  3IGA C;  3R65 A;  1N32 B;  1TUB A;  4J9Y B;  5KX5 B;  1M5I A;  1RM1 C;  1P7B A;  1DGS A;  3IC7 A;  2JEX A;  3CWB H;  3BHP A;  2M7W A;  5EYP B;  2PI4 A;  3GVM A;  3E22 A;  4B3T B;  2ZT9 B;  3JAK A;  4MTG A;  4MVS A;  4LH7 A;  2K1E A;  4H37 A;  3THO A;  2EZO A;  5LA6 A;  2Q7E A;  1RPR A;  1MG1 A;  3FKS G;  1JFF B;  4ZBM A;  2BTQ A;  1MZF A;  1YZB A;  3K04 A;  4W4L A;  4X1Y A;  5IJ0 B;  1LNQ A;  5H6Q A;  1JJO A;  1H2G A;  3CRA A;  4AI8 A;  1R1B A;  1WP7 A;  3ZJZ A;  1ZTE A;  1OCC C;  3JD2 A;  2ZDI C;  3CRQ A;  1VAR A;  3CCE V;  5A9G A;  5HFM A;  1RSO A;  4DR5 B;  2GHY A;  4X64 O;  4FZ0 A;  2D3O W;  5KHI A;  2N05 A;  4HZ3 A;  4X9Q A;  1TGO A;  1Y6X A;  1NH2 B;  1IUR A;  1B6Q A;  1XQ8 A;  1Y74 A;  3ZHT A;  1HDJ A;  1AJP A;  3WB2 A;  4YJ2 A;  2CE4 A;  3BY6 A;  1S77 D;  3ASN B;  2FTK A;  2A79 B;  2HJD A;  1R3L C;  4DUZ O;  2DJV A;  4X65 O;  3W7W A;  3A0R A;  2KG7 B;  3ZED A;  4RQF A;  4PA3 A;  4I50 A;  3ABK C;  2JRI A;  4PA4 A;  2GUZ A;  4FLW A;  2PZS A;  1MNG A;  3HPL C;  1K73 W;  4JI7 B;  4JI3 O;  3AK2 A;  1PNK A;  2OIE A;  4LF5 O;  1PP9 H;  1IVS A;  3DC5 A;  3UT5 B;  1K97 A;  1VQK V;  5K1X A;  2QWP B;  5LOV B;  3P3N A;  3DXR A;  3J80 N;  4GX2 A;  4PDM A;  3ZHU A;  3ZX6 A;  3AG4 C;  2DYR C;  4R8C A;  4DR3 B;  2V1D A;  1FS0 G;  3UQ8 A;  3H1I H;  3ZHS A;  5B1B B;  1HP8 A;  2JS5 A;  3BPZ A;  1Q8I A;  4ZOL B;  4XBF A;  3TXS A;  2DYS B;  2IBZ H;  1M1K W;  1MMM A;  2CTQ A;  1Y76 A;  4B3S O;  2P67 A;  3KCX A;  4EB6 A;  4F6R B;  5CA3 A;  5IYC O;  1VQ5 V;  4IT5 A;  2VQF O;  4LFC O;  2AZ0 A;  1ROP A;  2DOS A;  1IBL O;  4LNU B;  4O2B A;  4NXM O;  1DLB A;  3S3W A;  4J80 A;  3B77 A;  2O57 A;  3K79 A;  3ZHV A;  5CA0 B;  3ZRX A;  1LUV A;  4HBN A;  4K3A A;  2YIB A;  1ZSP A;  2Z0A A;  5C8Y A;  5EIB C;  2A06 H;  4TQD A;  2IJH A;  1PL0 A;  3K58 A;  2R9A A;  5GON B;  2B5U A;  4IIJ A;  1Q3E A;  1G1X B;  4JYY A;  3SJQ C;  1V54 B;  4JI2 O;  2HKO A;  5H6R A;  4DK1 A;  3P30 A;  2EIM C;  1QR9 A;  1ZL8 B;  4P9O A;  3CSX A;  1BE3 H;  2YID A;  2JS3 A;  4IYI A;  3RBZ A;  3D36 A;  3RYH B;  5CA1 A;  4JV5 O;  3OTO O;  3T4Z A;  3LSS A;  5E1A C;  2X7R B;  2ZM6 O;  4UVB A;  4DV2 B;  2RN9 A;  3B40 A;  3G6E V;  4DO2 A;  4LF8 B;  4LF4 B;  1VQN V;  5KUK A;  2AHZ A;  5KMG A;  5EK0 A;  1A32 A;  3AG2 C;  3OEE G;  3OM3 B;  3JAM N;  1XEQ A;  2P22 C;  2Y69 B;  5H9C A;  2HFE C;  1MAB G;  2KSD A;  2F4V B;  2WLK A;  4FJC C;  1OCO B;  5KHH A;  2GTS A;  1H38 A;  5LL6 Y;  1L8D A;  2OT5 A;  4DV6 O;  1SQF A;  1KP3 A;  3JD3 A;  1F4M A;  1AI5 A;  2LJ2 A;  3G67 A;  2LFS A;  3AK1 A;  4U7O A;  4TV9 A;  3LUT B;  2WSS G;  2MK3 A;  1X59 A;  1XHZ A;  1GO3 F;  1I5X A;  4UCO A;  3Q4H A;  1F7Y A;  2EIL C;  2LGQ A;  1JX9 A;  4DUY B;  3OTF A;  3E8G A;  1R6N A;  2ATK C;  1BS3 A;  3HR0 A;  4FFB B;  1W0J G;  3PN1 A;  4DV3 O;  2CH7 B;  2JJ1 G;  4DR2 B;  3MAQ A;  5JQG B;  3JD0 A;  3N2G A;  1N0J A;  3ABT A;  5AG2 A;  1NT2 B;  3P32 A;  3ZMU A;  1E1R G;  1NI8 A;  3FB6 C;  1AR1 B;  5J2T B;  2QEX V;  3RWR D;  2OTJ V;  3ZN1 A;  2QGN A;  4DR1 B;  1FXK C;  3FB7 C;  4B3R B;  2WLN A;  5IY5 C;  5LHG A;  5HFL A;  1B04 A;  3OE7 G;  4EFE A;  1TAE A;  5C93 A;  4LFB B;  5EZY B;  2DQ3 A;  4NTX A;  2OWO A;  4DR6 B;  1DF4 A;  1ORQ C;  1W2B U;  2PYJ A;  4DV7 O;  3CC7 V;  2GUZ B;  3CEI A;  3RW0 A;  2B9Z A;  1IBM B;  1Q5O A;  3RFR A;  2UUB O;  2GTA A;  3J81 N;  3TK1 A;  1YJ9 V;  4P2Z A;  1Q6H A;  4O4J B;  1KD1 W;  1N34 O;  1HR0 O;  2Z3Y A;  2EIN B;  1MA1 A;  2VRZ A;  4CS2 A;  5L3C A;  1N33 B;  2EIK B;  4JI6 O;  3CB2 A;  4I55 B;  1HNX B;  1I7F A;  1M4U A;  2Y0I A;  2W0F C;  3T1Y O;  4MVU A;  3K9S A;  1XNR B;  3ZRW A;  4PDV A;  4WFB V;  1YEW A;  4NXN B;  3KZI Z;  5EC1 C;  3SYA A;  1MZE A;  4DRX A;  1T5E A;  3HKD A;  4UB8 Z;  2QDO A;  4B7E A;  4KFM A;  1BZK A;  3FFQ A;  1FD9 A;  2YEV B;  1OCZ B;  1YI2 V;  1WPX A;  3OR7 C;  2F23 A;  4MTF A;  4DK0 A;  3UM7 A;  2UXD B;  2E5L O;  1XIL A;  4FZ1 A;  1YF2 A;  3LDE A;  4JI4 B;  2UXB O;  3F7Y C;  1THZ A;  2AGA A;  2P06 A;  5IYZ A;  1BT8 A;  1EFR G;  1UJW B;  3N27 A;  4O4L A;  3SJC C;  3A0B Z;  1HNW O;  5EBL C;  1FKA O;  4FLZ A;  4WBN A;  2ARH A;  2X6C A;  1GTO A;  2ZNJ A;  4RUE A;  5DED A;  4KHP O;  2B1G A;  3L9D A;  3D8C A;  1GM7 A;  3OGI B;  3E86 A;  4EKW A;  3RGB A;  5LMU B;  3K06 A;  4BW5 A;  5CA1 B;  2ZE7 A;  4BW9 A;  5IWA O;  4P30 A;  1NS1 A;  2JVD A;  1SQX H;  1AP6 A;  3CPW U;  1XMO B;  3CCM V;  3CRR A;  4OX9 B;  1WN7 A;  1WNS A;  2H94 A;  1NKD A;  1Z5V A;  4O2A B;  1F23 A;  3ICX A;  4UVA A;  4UV8 A;  2ODM A;  2RJZ A;  1XDC A;  4UFZ A;  2ZDI A;  5IJ9 B;  2AZ2 A;  4LFA O;  1TVK A;  5A2Q N;  1KKD A;  1AP5 A;  2Q7H A;  4G27 B;  3EVK A;  1IBK B;  4RQE A;  1GKF A;  2C2A A;  5B3S B;  5JJN B;  4DV4 B;  3O65 A;  5JVD A;  3H1K H;  5BMV A;  4O4H A;  1RP3 B;  4OXS A;  4AQY B;  3FAV A;  2HHH O;  4FLV A;  3AEI A;  3UKM A;  4UXN A;  2Q5Z A;  3MHH C;  4KL1 A;  3C3T A;  3J7A U;  4JYA B;  1HNZ B;  2ZE6 A;  2PY5 A;  5TIS Z;  4JI5 B;  4P9P A;  5CBF A;  1D2D A;  1I5Y A;  1NTM H;  3TET A;  3RYI B;  5LHI A;  1KBH A;  4LF7 O;  3N2K B;  1VP7 A;  2Q4P A;  4ZKI A;  1H2M A;  3JSN A;  4FMT A;  2GBO A;  2EBO A;  4JF3 A;  3L73 H;  1K3E A;  3ABL B;  3CMA V;  1VQL V;  2VS0 A;  2QWO B;  5B1N A;  3NXS A;  3CD6 V;  3U0Z A;  5B1A B;  4CS3 A;  4O4I B;  1VQ7 V;  4R50 A;  1S5J A;  4TSF G;  2ZIN A;  4MTO A;  1ENV A;  2DQ0 A;  2EZP A;  2R70 A;  4FM2 A;  1OHH G;  3RYC A;  3BEH A;  4XDL A;  5LBQ A;  3OMN B;  3KCY A;  1L1F A;  2G38 A;  2FYU H;  2LW7 A;  3VQV A;  1FXV A;  2E76 B;  4X20 A;  2QWN B;  1WPB A;  5CN0 A;  1VQO V;  3L71 H;  4WFH A;  1SKV A;  2HLD G;  3LNM B;  5J2U B;  3OGC C;  3QNE A;  4MVO A;  1JVM A;  3AK3 A;  4GUN A;  5ITZ B;  2A9H A;  4X64 B;  3APQ A;  4DV1 O;  1M56 B;  3JCU Z;  1DF5 A;  1YVW A;  3AG7 A;  4E2L A;  1WA8 B;  1AVM A;  1NU1 H;  4PA7 A;  2UUA O;  3F5T A;  2NLJ C;  3BFR A;  2ZKO A;  1M57 B;  2OTL V;  1BL8 A;  2R9I A;  4FLT A;  3B8M A;  4TOI A;  3T1H O;  4NKG B;  2YXY A;  1FYJ A;  1URF A;  1DK1 A;  3W7T A;  4ZHQ B;  2BCC H;  2XTA A;  2F93 B;  3E35 A;  2E74 B;  1VF6 C;  1W59 A;  4DV5 O;  2QSA A;  1FJG O;  4K8Z A;  4LWS B;  5B1B C;  1GM8 A;  4J42 A;  2Q0O C;  5LHH A;  1VMG A;  2Q8V A;  2ZNI A;  3IAY A;  4X88 A;  2LP7 A;  4YIP A;  1ZX3 A;  1US6 A;  2DYS C;  2Q7G A;  1XNQ O;  1E1Q G;  2Z5U A;  3ABU A;  4KUM A;  4JI3 B;  5LP6 B;  4X1I B;  1N8R W;  4OPH A;  4FM1 A;  4JYB A;  3JAS B;  1K92 A;  2XAF A;  3ZHQ A;  2VQE O;  2F66 C;  1RFY A;  2XHB A;  2YXH A;  2ZR3 A;  2KB1 A;  4N23 A;  3L74 H;  1M9N A;  3GWK C;  4UCR A;  4UCV A;  4JGS A;  2PYL A;  1YIJ V;  3WB1 A;  4CBC A;  4WFG A;  4MT8 A;  5CB4 A;  1PM9 A;  4PA6 A;  1ZWI C;  1WLE A;  1JQ0 A;  3HKB B;  4W4K A;  2XND G;  1XI1 A;  3ZS8 C;  2ADQ B;  1V54 C;  4MVZ A;  3IJ4 A;  3FYE B;  3OR6 C;  4LR3 A;  2HJF C;  1XL6 A;  1SZT A;  4B3S B;  4QE7 A;  1L0N H;  1K4D C;  3CXH F;  1K9M W;  2CGO A;  2ADP A;  2CAZ C;  1F51 A;  2BSK B;  1OJH A;  1ZLZ A;  4NXM B;  1IBL B;  4QPJ A;  2GV9 A;  2H8P C;  4X8A A;  2YXL A;  4J7K A;  1BMF G;  2BTO A;  1CP9 A;  4GX1 A;  1KU9 A;  3OMI B;  2WLH A;  4TUY B;  3ETD A;  4WFA V;  1VQ4 V;  3SPG A;  1LR1 A;  1FFX A;  3VBB A;  4D6T H;  4UB6 Z;  2L35 A;  3FB8 C;  3QG5 A;  2Y69 C;  4JI7 O;  2BOB C;  2DE0 X;  4JI2 B;  1SA0 A;  4ZI7 B;  4X1K B;  1B06 A;  3BVO A;  1WB7 A;  3TXQ A;  1OCO C;  2Y0P A;  3DC6 A;  4JZ2 A;  1L0L H;  4FLU A;  1SQQ H;  4QE9 A;  5L3E A;  2JEU A;  4JV5 B;  1Q43 A;  4DR4 O;  1FXK A;  5LXT A;  2ZM6 B;  5JH7 B;  4GT1 A;  3K5O A;  5LYJ B;  1O9H A;  5EC2 C;  3RT3 C;  4QPK A;  4U3J B;  3JAT A;  4TQF A;  3UCS C;  1SS3 A;  2IJJ A;  4IHJ B;  3CJH A;  4NYK A;  3CME V;  4J7Z A;  4GLX A;  2D2C B;  1Q90 D;  2WLL A;  4PDR A;  2JGD B;  1S72 V;  2UUC O;  4D7S A;  4JPR A;  4TV8 A;  1K5Q A;  1XUQ A;  2WLI A;  4L8J A;  1G4Y B;  4I4T A;  4R6Z A;  5LGU A;  3JD4 A;  2UXN A;  3FD9 A;  4DV6 B;  3M7M X;  3JAW B;  3TGU H;  1PKX A;  4CZZ A;  4HNA B;  2W6J G;  1KC8 W;  1VQ9 V;  3HKC A;  1MOF A;  4OGQ B;  2XT9 A;  1KP2 A;  3HKE A;  1BHA A;  3H1H H;  2RNB A;  4FK5 C;  1TUB B;  2WWW A;  1PL4 A;  5D5Q A;  1SQB H;  1ZUQ A;  2F1M A;  3E22 B;  1IZ3 A;  5DN6 G;  3JAK B;  2ZE5 A;  3P3P A;  1YHQ V;  5LA6 B;  4DYL A;  2L6L A;  2MW2 B;  2HVJ C;  1GM9 A;  2BTQ B;  1NJI W;  4X1Y B;  2EIN C;  1QCE A;  4J10 A;  2HG5 C;  3JAL A;  3X2Q B;  3L72 H;  4LP8 A;  3ZMS A;  3RYF A;  1NH2 D;  5LGT A;  2EIK C;  1AI6 A;  3CCV V;  4JI1 O;  5BR8 O;  1RSO B;  4YY3 O;  5KUM A;  1DTO A;  2WAM A;  4LF4 O;  4YHH O;  2ITC C;  1PNL A;  5BY1 A;  3EHB B;  3G80 A;  1MSW D;  4DV7 B;  1EZV H;  1Y74 B;  2PGG A;  3B09 A;  1S3J A;  4G2K A;  2UUB B;  3SJA C;  3BAA A;  1KUQ A;  4WFF A;  1SRY A;  3AG1 B;  4MS2 A;  4YJ2 B;  3K5L A;  2XAH A;  3JAR A;  5LMN O;  1OCZ C;  3APO A;  3VQX A;  1HR0 B;  4NVP A;  3B2E E;  4KXR A;  1R6K A;  4I9W A;  1CXZ B;  2IJK A;  1O9G A;  3I5D A;  1EBO A;  4EFB A;  1I94 O;  4UVC A;  4NTY A;  5FNV A;  4I50 B;  3I55 V;  3T1C A;  4BWA A;  2BE3 A;  1QU7 A;  3OUS A;  1J5E O;  3GWO A;  3ML0 A;  1HW7 A;  4YJ3 A;  2LO1 A;  4UCU A;  2Q0A A;  2WLM A;  1V55 B;  4X62 O;  2FML A;  2NN4 A;  1R3K C;  3DXR B;  3ZCC A;  3C3S A;  2P6J A;  3SYP A;  4PHZ A;  5EYP A;  3BA8 A;  2GDS A;  2PTM A;  4MW3 A;  2UXC O;  3KG2 A;  3G71 V;  1SF9 A;  4B3R O;  4JI0 B;  1K4C C;  2WLJ A;  4DV0 O;  3VOU A;  3K03 A;  1JFF A;  4CC5 A;  4GX0 A;  2CK3 G;  4LFB O;  5IJ0 A;  2CDY A;  1HNW B;  3K9A A;  2A0L A;  3BA9 A;  1VIB A;  2CTP A;  1QLE B;  1QR8 A;  2QTO A;  2UU9 B;  4JAA A;  1Y76 B;  2N74 A;  4GKK O;  4EB6 B;  3QO7 A;  2JJ2 G;  2LGW A;  3SPI A;  1B3Q A;  1BGY H;  5FPO A;  1YCI A;  4O2B B;  5B3S C;  4K0K O;  4CH4 A;  5L3F A;  2EX3 A;  3WB0 A;  1P7G A;  2ZQM A;  5IWA B;  3NR7 A;  1HNX O;  2Q9L A;  4BIO A;  5C8Y B;  1N36 O;  1YXB A;  3K59 A;  2ZIO A;  5KA6 A;  2NNU A;  1GN2 A;  5BXZ A;  2DWE C;  3IC9 A;  1KQS U;  2YIC A;  4IIJ B;  1J95 A;  3VQY A;  3OD4 A;  4RO2 A;  1IXB A;  3BCC H;  4H44 B;  1NTZ H;  2DMX A;  4X66 O;  1P49 A;  3E8B A;  4LFA B;  5IYD O;  3ABM B;  4CS4 A;  3TCU A;  3ABL C;  5IT9 N;  3DSQ A;  4AIL C;  4U7N A;  2JDI G;  3TJT A;  2QR4 A;  5B1A C;  3I56 V;  1Z2G A;  2JIZ G;  3SJB C;  5KA5 A;  4GYC B;  1HWY A;  4F6E A;  4RWU A;  2P4V A;  1N0N A;  2X0L A;  3UT5 A;  2OCC B;  4JI4 O;  3U10 A;  3ZMT A;  5LOV A;  2Q73 A;  2QKC A;  4DR7 O;  3A8T A;  4B7K A;  5KMG B;  1M93 A;  3EFF K;  3LNN A;  4LF6 B;  3MDS A;  2P7T C;  4QGP A;  4MVQ A;  2QE7 G;  1VF6 A;  4NB5 A;  2EIJ B;  1GN4 A;  4MSW C;  4N21 A;  2EUL A;  4I0X A;  4Z2W A;  2E3C A;  3G6B A;  1VQ8 V;  4ZOL A;  3H1L H;  1M56 C;  3SR2 C;  3B8N A;  2F95 B;  5LMU O;  3JCZ A;  2RDC A;  4BIZ A;  4TV9 B;  4FVM A;  4F6R A;  4JAV A;  1M57 C;  1XL4 A;  4HYO A;  2QWQ B;  2H3O A;  1XMQ O;  1OCR B;  3Q4H B;  5JWP A;  1PD3 A;  1SC5 B;  2Y4T A;  4LNU A;  3H01 A;  2LW1 A;  4J11 A;  3K5N A;  1R73 A;  2WPD G;  5CA0 A;  1IDS A;  5FL7 G;  4LBE C;  4GKJ O;  3A2F A;  3N2G B;  3ZRV A;  4ZIB A;  2W0X A;  1H2L A;  5GON A;  3ZMV A;  1IBK O;  2R9R B;  3ETQ A;  2YIA A;  3FYI B;  4E4E A;  4DV1 B;  4B3M O;  4LF9 O;  2P4K A;  3K3W A;  4DW0 A;  1AIL A;  2IU3 A;  4CC6 A;  1ZL8 A;  3KKY A;  1GH6 A;  1K34 A;  5LP6 C;  2WA3 A;  2QKA A;  1XBL A;  1P84 F;  2V4D A;  3RYH A;  3ASN C;  4TWK A;  3K5M A;  3T1H B;  2RCV A;  3CCQ V;  5KAF Z;  3S3X A;  1BQ0 A;  1FXH A;  4JI8 O;  4JTD B;  4DV5 B;  1FJG B;  5JJE B;  2ZXW B;  1Y66 A;  3CHX A;  1KMI Z;  4L87 A;  1JA8 A;  3F5W C;  1NTK H;  1TA8 A;  5EBM C;  1S5H C;  3D3Q A;  1XNQ B;  2ZR2 A;  3JYC A;  3SYC A;  3STL C;  2PF4 E;  2JGU A;  4PA9 A;  1I0H A;  4WF9 V;  4CH3 A;  3WG7 B;  1UPG A;  1IXM A;  4JAS A;  1AJN A;  2ZIM A;  3ZRW B;  2VQE B;  1V9P A;  5H5N A;  2ZD9 A;  5LGN A;  4DUZ B;  1Q6U A;  3CCJ V;  1EM1 A;  4X65 B;  1SER A;  4K35 A;  4DRX B;  3ASO B;  5KHG A;  5E79 Z;  1N32 O;  4MVM A;  3HKD B;  3ZMZ A;  2IH1 C;  5K1P A;  2Q69 A;  3OEH G;  2QM7 A;  1FFT B;  3ETG A;  1VEW A;  2Y48 A;  5KAI Z;  2YDE A;  1JJ2 U;  2OCH A;  4PI0 A;  1K8A W;  4B3T O;  2YIB D;  3GB7 C;  2UXX A;  3DTU B;  4FFB A;  4LF5 B;  4FIP C;  3ZRS A;  2OYQ A;  2CH7 A;  3AG3 B;  1K7D A;  3VQW A;  5JQG A;  4Z1M G;  3H9V A;  1Y67 A;  3SPJ A;  5IYZ B;  3ZBH A;  4O4L B;  4JTC B;  5KHJ A;  2AHY A;  4LCU C;  4BIU A;  5J2T A;  4QJF B;  4WBN B;  4IGG A;  1P4R A;  1JCH A;  1EN4 A;  1NBM G;  3CX5 F;  4DR5 O;  2FKX A;  3CRM A;  3JSL A;  5JCO A;  5H2F Z;  1KYO F;  4CH5 A;  3DGE A;  4FLY A;  1RM1 B;  1QQC A;  2N04 A;  3QF7 A;  5EZY A;  1QHT A;  4JZG A;  4AHC A;  1SQP H;  4TT3 G;  2EJR A;  3K57 A;  3SPC A;  2IH3 C;  2QJ1 A;  4EEQ A;  3CYO A;  1NR1 A;  2VQF B;  5B1O A;  4LFC B;  4O4J A;  3SYQ A;  3O9O A;  2AXT Z;  2KKW A;  4YIO A;  3OMA B;  5B5E Z;  2GSM B;  1RPO A;  1OCC B;  5GW7 A;  1Q81 W;  2K9P A;  2V7Q G;  3CP1 A;  4DR4 B;  4I55 A;  1TVK B;  5EBW C;  4C7U A;  3E2E A;  3MD0 A;  2LQT A;  1X4T A;  3T4D A;  4KP4 A;  5JVD B;  3CCR V;  5BMV B;  4O4H B;  4I0X B;  1YSC A;  3FAV B;  4WFE A;  1H2S B;  3ZN0 A;  1PPJ H;  2W6I G;  1H8E G;  2UUC B; 
#chains in the Genus database with same CATH homology
 1BE3 H;  2FYU H;  3H1L H;  3L73 H;  1SQQ H;  2IBZ H;  2BCC H;  5KLV H;  3CXH F;  4D6T H;  3H1J H;  3H1H H;  1NU1 H;  2A06 H;  3CX5 F;  1KB9 F;  1SQX H;  4PD4 F;  1P84 F;  3H1I H;  1BCC H;  1KYO F;  1PP9 H;  3L71 H;  1BGY H;  1NTM H;  3L75 H;  4U3F H;  1NTK H;  3BCC H;  3H1K H;  1NTZ H;  1SQB H;  1EZV H;  3L70 H;  3L72 H;  3CWB H;  3L74 H;  3TGU H;  1PPJ H;  1L0L H;  1SQV H;  1SQP H;  1L0N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...