3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
3H1JH 3L70H 1PP9H 3L75H 3L72H 1NTMH 1SQQH 4U3FH 2FYUH 1EZVH 2BCCH 3H1KH 1SQVH 3H1HH 2IBZH 1PPJH 1NTKH 1NTZH 1BE3H 1SQPH 3H1IH 1P84F 3L73H 3CX5F 1L0NH 3L74H 3TGUH 1NU1H 1KYOF 2A06H 3L71H 4D6TH 1BGYH 1KB9F 5KLVH 3BCCH 3CWBH 3H1LH 1L0LH 3CXHF 1SQXH 4PD4F 1SQBH 1BCCH
chains in the Genus database with same CATH superfamily
2P22C 3VBBA 3T4ZA 3SPGA 1KKDA 1E79G 4DV7O 5H6QA 3STLC 2F4VB 4GKKB 2BE3A 4JYBA 4H44B 3ZCCA 4JI3B 2P6JA 2BSKB 3E8BA 3H1IH 4GT1A 2CTQA 2GTSA 3ABMB 4DW0A 1G8MA 5CMUA 2Q69A 2OTJV 3S3XA 1WN7A 3NR7A 4PA9A 3GVMA 5CN0A 1G1XB 2ZNJA 2CE4A 2HHHB 4K3AA 1BL8A 5EZYB 2Y69C 4WFGA 4UXNA 3G6EV 3Q4HB 3JCUZ 3K5OA 2RCVA 1YCIA 4O4IB 5FNVB 1HWYA 3CCJV 1Y76B 1VQ8V 3JATA 3UKMA 1KP3A 1VQMV 4J9YB 4O2AB 4NXMB 1O9HA 5J2UB 1XNRB 1Y74A 4R7CA 1ZWIC 3OD4A 3K3WA 3E83A 5LHIA 1KECA 3N2KA 1R3JC 4EB6B 1KP2A 2UXCB 2QGNA 3AEIA 3AG1B 1MA1A 1JCHA 1FXKA 1XMQO 2MK3A 3X2QC 3T2MA 3AK3A 3U0ZA 1GM9A 3F7YC 4MTFA 4GYCB 1PD3A 2R9RB 1NTKH 1OZ0A 4LFAB 3LUTB 2YC0A 5LXTB 3CCRV 1FYJA 1L8DA 4RUFA 4CH5A 4IIJB 1FJGO 4DV0B 1WNSA 2YDEA 3M7MX 1IVSA 1BHBA 1G6UA 4PDRA 4I50B 4B7EA 2YUAA 5KMGA 4Z2WA 3CD6V 2PI5A 2WLLB 1XL6A 3DXRB 3K0DA 4R6ZA 3ABLC 4F6RB 3K57A 1YITV 2OCCB 4DV1O 2CTWA 3ZN1A 1SQQH 3E8HA 3M99B 1K4CC 3W7UA 3A0HZ 5BXZA 1QR8A 3GWOA 3KKYA 3F5TA 3S3WA 3H1LH 4XDJA 3CCEV 1D5NA 4X66O 3LDCA 1RSOA 1M9NA 5IJ9B 4FM2A 4F6EA 4QPJA 4GX5A 3FD9A 2R9AA 1ZSPA 3BEHA 1NI8A 2DYRB 4OX9B 1ZAUA 2Q6AA 3SPHA 1QNMA 2OCCC 3KCYA 4DUYO 1PNLA 1Z5VA 2XASA 4UVBA 4NB5A 3JD2A 3SPIA 4JI5B 2XAQA 1CEZA 1H2NA 1JFFA 3E8GA 4JI1B 4YJ2B 2LW1A 3LSSA 4LF6O 4B7KA 1P4RA 2UXDO 1H2MA 1NBMG 3PN1A 5IY5C 2E76B 4WFFA 1URFA 4MW3A 4KFMA 4OPHA 4BIOA 1VQ6V 2LFSA 2V1DA 2DYRC 3E22A 2XAHA 4NXNB 2EBOA 2DWDC 1TUBA 1ENVA 1B06A 3E35A 4DR3O 1J5EO 4NYKA 4F4LA 3CXCU 4LFCO 2DQ3A 4AHCA 2L6LA 2QA4V 1KYOF 4TV9A 2KG7A 1LUWA 5KA6A 3P30A 3WFVA 5IE9A 3CC7V 1NR1A 2EULA 4GKJO 5LMUB 4JI6O 2GSMB 1FPOA 1FXKC 3I55V 2LFRA 2Q68A 4JYAB 4DUZB 1JR9A 4WF9V 1NR7A 3M8AA 4JI2B 1W0JG 1YIJV 1FXVA 1MABG 1MG1A 3JALA 1U97A 4ZHQA 1TVKB 2IU0A 2WLIA 3TETA 2HJDA 2WLMA 5JCOA 1AI5A 3JD3A 5K1XA 1N34B 2DQ0A 5IT9N 1OJHA 3H9VA 2UUCB 1V55C 4LF4B 2ARHA 2JVDA 3CCSV 2BOCC 3C3SA 4CS4A 1VQOV 3CE2A 5KX5A 2EIKC 3HPLC 4CH4A 1K34A 1GO3F 1N0JA 2A3QA 1J95A 2BTOA 3G67A 4DRXA 2JGDA 2UUAB 1JFFB 4NR1A 3L72H 4O4JB 1PKXA 3QO8A 5LA6A 4ASUG 4K0KO 2BTQB 3JASB 3CEIA 2IJKA 1V9PA 5B3SB 4X89A 3ZN0A 4AQYO 2PZSA 3OTFA 5B1NA 4DO2A 4PA7A 4MVOA 2NLJC 3GWKC 4IYHA 1TUBB 2GBOA 3K79A 3G4SV 1IZ3A 1YEWA 3W7SA 3N2GB 4KHPB 3H1HH 4DYLA 1OCRC 4D7SA 1L1FA 2P90A 4J7KA 3UT5B 4DV4B 2DWEC 2H8PC 4MVSA 3LSUA 2AZ0A 1KBHA 2YICA 1KKCA 3SYPA 2XNDG 4X62O 1I5YA 3VQWA 4JI4B 3JAWA 4G27B 4AILC 1RFYA 1ZL8A 2HVKC 4JTCB 3RT3C 4LF9B 1XUQA 3ZRSA 3SJBC 3PJSK 4G28B 2BOBC 4JYYA 1Q90D 1JMKC 1LNQA 1NVPD 4JV5B 2L35A 1IBMO 4DR1O 4DV2O 1YTFB 3B4SA 2DE0X 2GV9A 4JTAB 3T1HB 1YZBA 4HZ3A 4YY3B 4JI0B 2UUBB 3K9SA 1GKFA 1EFRG 1SF9A 2JJ2G 1SZTA 3G80A 3FAVA 3RYIB 3L9DA 3JCZA 4I9WA 3MAQA 2DW4A 1BT8A 4ZIBA 3LNNA 4LP8A 5JQGB 5KUMA 1BQ0A 3DC6A 3AK2A 3VOUA 3E8FA 3QG5A 3CCLV 4X1IA 3QO7A 1SESA 3O65A 2VQEB 1AI4A 4CS2A 1YJNV 5JJJB 5J2TA 3ZJZA 1TUEB 2BSKA 3DC5A 2JGDB 2E74B 4XDLA 4UB8Z 2R9IA 4B3SO 4J10A 2QWPB 1S5LZ 5JCOC 5L3EA 2AHYA 4LF7O 3T4DA 5EZYA 1FFXA 1T5EA 1FKAO 2ODMA 1EBOA 1WP8A 4O4LA 3TCUA 3Q4HA 5IYZB 1EN5A 1S3JA 4FLVA 1FFTB 3OGIB 2ETNA 1FXHA 4YHHO 2GDSA 1K4DC 1HNZO 2ILMA 4O2AA 3K9AA 1PPJH 1NH2B 3OEEG 4JAVA 2GHYA 2DYSB 2ZKOA 1H8EG 2HEPA 3B2EE 2UXDB 2YIDA 3APOA 1GRJA 1WPBA 2ZM6O 1BHAA 2CAZC 4X9QA 1N36O 1Y66A 3STZC 1XHXA 1KMIZ 5CA1B 1QR9A 2X6AA 4EKWA 4LH6A 3D36A 3T1CA 1KUQA 2YS8A 4JI8O 2X7RB 4JZ2A 5FL7G 4EFEA 3UO3A 1DLBA 4I7ZB 3DGEA 4OPAA 4IIJA 3VQYA 3FAVB 2DMXA 1OCCC 2FTKA 1E1QG 2OT5A 3TJTA 4I5SA 1IBKO 1VQPV 4DXWA 2AW9A 4I50A 1P84F 3UO2A 2QEXV 5ITZB 2ZXWB 2OIEA 1B04A 2WLLA 3W7XA 1Q82W 2PY5A 4DR6O 1XDCA 4X1IB 2EILB 4F6RA 5B5EZ 3K5MA 3GB7C 5A2QN 1GAXA 2WLNA 5KUKA 4MVRA 3ZMZA 3BA9A 1NTZH 2EZPA 4DR4B 1VF6A 2Q73A 5J2TB 2RMKB 4RUEA 2PUSA 1GM7A 3RGBA 5LHHA 3OE7G 1BGYH 1S0VA 3WG7B 4TT3G 1V54B 2YEVB 4CH6A 1HNXB 2YI9A 2CH7B 1FFXB 4X65O 3MDSA 4K8XA 2AZ2A 1HP8A 3UCSC 4O4LB 1B3QA 4A5UB 5IJ9A 2E5LO 4MVZA 2Q4PA 1M5IA 4IYIA 3OFNG 4PD4F 1VMGA 1IDSA 1RPRA 4RO2A 5AG2A 1H8HG 2F93B 2O57A 2PYLA 4MVUA 2BCCH 3K0GA 2QWNB 4PDLA 5HFMA 4QPKA 1M56B 4H33A 3ABMC 4U7OA 5GTIZ 4YJ2A 1WJZA 3ETDA 1M57B 3BPZA 2LJ2A 3K5NA 1JOYA 3HKEB 1OCZB 4CC6A 4CBCA 4X64B 4B3TB 4DK0A 5EIBC 3H1KH 2VQFB 1S76D 4DR5O 2UU9O 3SJQC 3ASNB 5CB4B 3JARB 5GTHZ 1XNQO 1SA0A 4QE7A 3RVZA 2IJHA 4ZOLB 4LNUB 2QJ1A 3RYCA 3B8NA 1Q6IA 4GX2A 4EFBA 1COWG 1M57C 1HR0B 4R8CA 4EEQA 3CJHB 3AG1C 1AVMA 2Z5UA 4H0LB 4BWAA 3SYOA 2CGNA 4B3RO 3W7TA 5JJEB 3AG2B 1LR1A 1PV0A 3OT7A 4J41A 3CRMA 3D36C 1IBMB 3FYEB 5BR8O 5H5NA 1VARA 3KG2A 2ZIOA 2IJJA 1UFIA 4FZ1A 5CA0B 4MT8A 5LBQA 3HKDB 4DV3B 4LC1A 5FPOA 1MSDA 1R6KA 2HR3A 4BAYA 1TVKA 2UXBO 4MTXA 2JK5C 5B1OA 2ZE7A 4PA3A 3ETGA 4L8JA 1K97A 3L70H 4YXWG 1N4CA 3MD0A 2KSDA 2LGQA 1RM1B 2FYUH 1Y6XA 2QKCA 3B77A 3HKBA 5IYCO 4TSFG 2K9PA 4FLTA 3AG2C 4O2BB 3B8MA 2W6IG 4B3MO 2HJFC 2YIBA 2M7WA 5IDJA 1YI2V 2XAJA 2VWJA 2Q7EA 2QM7A 4DV6O 1VF6C 1XHZA 2FL4A 1PP9H 1AJPA 3ZS8C 2JS3A 4ZI7B 4UCVA 3ZMUA 2YSUB 4B3SB 3ZMTA 4B08A 4O4JA 2YXHA 2KB1A 2F66C 3RBZA 2ATKC 2BTQA 3L74H 3JASA 4TWKA 4JAAA 3CCMV 3RVYA 1SQBH 4L87A 1K8AW 2EIMB 1P7GA 1XMOB 3FB8C 4MVMA 3RN4A 3TXQA 4IT5A 2DJVA 2QM8A 2ZIMA 1AJNA 3R65A 1SQVH 1AJQA 3BY6A 4WBNB 3N2GA 1MNGA 3CX5F 2E75B 4NTXA 1IX9A 4LWSA 5LMNO 1SA0B 4H13B 5H6RA 3UT5A 2HFEC 2ZR2A 3T1YB 1SS3A 2RDCA 5LOVB 4J7ZA 3LDDA 3RYCB 2WAMA 4AI8A 2ZE6A 2XAFA 3ZHRA 4UCRA 1N8RW 1JPXA 4FZ0A 4FLXA 3DTUB 3ZRXA 2Q7HA 3JSNA 4JI7B 1SKVA 1W2BU 3K06A 1K92A 5IWAO 1SRYA 5CBHA 1DK1A 1XREA 2EIMC 4N21A 2N74A 1QLEB 1WAZA 2Q8VA 3ZMSA 1DGSA 2QWRB 4U7NA 5FPRA 2F95B 2JIZG 1VEWA 5B66Z 3TK1A 1M90W 1L0NH 4Q20A 5KA5A 3J81N 1MOFA 4PI0A 3RWRD 3RYIA 3WB1A 4XBFA 3HR0A 4ZKIA 3CMEV 1S5JA 5LGNA 3IC9A 4FFBB 5LGTA 2GUZB 2F4VO 3A0BZ 3HKBB 4RQFA 4GKKO 1MSWD 5KHHA 5JQGA 4JI3O 1TA8A 2JJ1G 1VQ5V 3A2FA 3RYFB 3CCUV 3EFFK 2LW7A 4DV7B 4X1KA 1THZA 4UV8A 4RQEA 3K58A 1OHHG 2QTSA 2HG5C 3G71V 2HHHO 3CRCA 1D2DA 4PA6A 3D8CA 2EINB 4PI2A 1AP5A 5DM6V 5JVDB 1M93A 4P9OA 3OGCC 3E2EA 4X65B 4WFAV 1P7BA 4JYCA 1GH6A 2OCHA 5C8YA 4NXMO 2WA3A 1XNRO 4ICGA 3UM7A 2ZE8A 2Q0OC 5IYZA 4PJ0Z 3L75H 1K73W 5BZBA 1PNKA 2ZNIA 1IBLO 2EX3A 4FLZA 1BQZA 4LWSB 1I08A 1I0HA 5L3GA 1K7DA 4FIPC 2QDOA 3H01A 4RWUA 4WFEA 3ZMVA 3SYCA 1R73A 1RPOA 2R70A 2WLJA 1DF4A 2DOSA 5FLXN 4LFAO 1AR4A 5B3SC 5CBGA 3QO5A 1XMQB 3AG7A 4DR5B 1I5XA 2GTAA 3B40A 2LP7A 5CA1A 4DV0O 2KKWA 1N33O 1EN6A 1K3EA 4TOIA 3QF7A 2ZT9B 1US6A 2CDYA 1YXBA 1FJGB 3CSXA 5IYDO 2B5UA 3AG3B 1X59A 3ZHUA 3ASOB 4X20B 2CTRA 5L3DA 3U11A 2K1EA 4TV8A 2P4VA 5IYBO 5F2VO 5KHJA 1X4TA 2OIGA 5ITZA 4YJ3A 4QNHB 2QTOA 2CK3G 4LF5O 1VIBA 5EBLC 3OTOO 4U3FH 1Q81W 4UVAA 3ZIAG 4DV1B 4FM0A 4X1KB 4MS2A 3EXAA 3VQXA 3HKCB 1AI6A 5IJ0A 3R66A 1DTOA 5EIBD 1OCOB 3ICXA 2W0FC 2ITDC 2VS0A 2ITCC 3CXHF 2NR5A 3QNEA 4BW9A 2ZINA 5L3BA 5LYJB 1I7FA 3FX7A 2YI8A 4DR2O 4W4KA 4JZGA 1F4NA 3MHSC 5EBMC 2YEVA 3P3PA 2EIJB 3IFXA 1R3KC 4X66B 5C8YB 4UUJC 2CH7A 3L73H 2PTMA 3OEHG 2PGGA 1AB3A 2XAGA 3OMNB 4JI5O 3BABA 3D3QA 2CTPA 4DUYB 4JI1O 1WA8B 3HB3B 3CC2V 2DN9A 4PV1B 4N23A 4G2KA 1TAEA 1OCOC 4JASA 2B9ZA 1I94O 1F51A 1YF2A 4TQFA 4FPPA 2F23A 1MZEA 4ABMA 2XHBA 5GW7A 5H2FZ 4LF6B 1YJWV 4IHJB 2A7WA 3CS5A 4I0XB 3ZX6A 1Q43A 1L0LH 2A79B 4OXSA 4NXNO 3JAMN 1N32O 2EIJC 5LGUA 1Q6UA 4UCTA 3LSQA 3OM3B 2QKSA 3HKEA 1G4YB 1GN6A 2XOKG 1WB7A 4UCSA 1Q3EA 1S5HC 3A8TA 5BMVA 4DR3B 1J5EB 2P7TC 1GTOA 4P2ZA 4MW8A 4LFCB 5CB4A 4PDMA 4TQDA 1PM9A 4U3JB 2X6BA 4QGPA 5DEDA 3IC7A 5LMUO 1CP9A 3JARA 5JH7A 2DYSC 1W0KG 2JEUA 2ZDIA 2W6JG 4JYAO 2HP8A 4DUZO 4ZOLA 4LNUA 2YIAA 4NTWA 4TV8B 4GKJB 4JI6B 1BSMA 4JI2O 1PL4A 5CBFA 4YJ3B 2QR4A 3CJHA 2D3OW 3K5LA 2LGWA 4W4LA 2ZE5A 2HKOA 1BCCH 3WU2Z 3BHPA 1Q5OA 3OW2U 2A0LA 2VRZA 1YHQV 5IJ0B 3IGAC 5EYPB 2AHZA 1SQPH 3ML0A 4HNAA 4QE9A 1N34O 4JAUA 3F7VC 4NTYA 1NVPB 4FMTA 5CA0A 3HKDA 2UUCO 4LF4O 1FAFA 2XT9A 2RJZA 1AILA 4GX0A 5HFLA 5EBWC 1QCEA 4TUYA 1YDXA 2ZXWC 3ABKB 2H3OA 1BE3H 2Y0PA 4DR7O 4BIZA 3SJAC 5CA3A 3FB5C 4O2BA 1SQGA 2UUAO 3EVKA 4RAIA 4FJCC 2EILC 3BCCH 1R1BA 1GN4A 1N0NA 4WCEV 4O4HA 2Q67A 4HAMA 2PF4E 1S72V 1VQ7V 1M4UA 1IXMA 1CXZB 4ZI7A 2RNBA 3X2QB 4E4EA 3WG7C 5A9GA 3B09A 4K0KB 1V54C 2E3CA 4LF8O 3ZHQA 4YIPA 4R50A 1Q8IA 1E1RG 1JA8A 4AQYB 1NZ6A 1MZFA 4KHPO 3ABKC 1QU7A 5GONB 4DV4O 3N27A 5BMVB 4KP4A 3CCVV 4E2LA 1M1KW 1HDJA 3LNMB 1IBLB 1XL4A 1XBLA 3F5WC 1KU9A 5EC1C 1NKDA 4WBNA 4JI4O 2FB5A 2RN9A 1H2LA 2Y4UA 5JH7B 4CC5A 3LDEA 1M56C 4LF9O 1W59A 1YSCA 4Z1VA 4X62B 3ABLB 5LOVA 1IURA 4OGQB 2X6CA 2XTAA 2LO1A 1S77D 1XQ8A 1HNWO 2IJIA 1BZKA 1XI1A 4JV5O 4BIUA 2YXLA 4UFZA 2IH3C 2JS5A 1Q86W 3AG4B 4FVMA 1OCZC 3BFRA 1KC8W 4X1YB 4I55B 3T1HO 3OUSA 3I56V 4YY3O 4JI0O 2FMLA 2UUBO 3FB7C 1QQCA 2RQ6A 3IJ4A 5C93A 3P3NA 1N33B 3JAKB 4DR1B 4DV2B 3U10A 3BVOA 3ASNC 2ZD9A 5E79Z 4HNAB 4FM1A 2ZQMA 1AR5A 3JYCA 1GN3A 4J7JA 3SJCC 5DECA 3CC4V 4KL1A 2V7QG 1B6QA 2YIBD 2ZDIC 3ZHVA 4J11A 2LQTA 1K5SA 1P49A 1WB8A 3CMAV 4TUYB 4FFBA 2P06A 2JEXA 1WP7A 2VQEO 5E1AC 2GUZA 3AG4C 4LF5B 1SQFA 3OTOB 3CRRA 3CHXA 1QVGU 4UCOA 1SETA 2WA4A 4I4TA 3RYFA 3VQVA 4FFKA 2IH1C 1XILA 1JVMA 5KHGA 5KHKA 4O4HB 5IY5B 4QJFB 1ORQC 4XDKA 1SZXA 2G38A 3CP1A 1XOUA 3RFRA 3RW0A 4DR2B 3ZRVA 4LFBO 5K1PA 1ZX3A 2ZCEA 4LF7B 1ZTEA 3JATB 2Y4TA 5JVDA 2PI4A 3THOA 1RM1C 4CZZA 1UPGA 1Y74B 1SERA 3OUFA 1H2KA 3N2KB 3ZEDA 4PELA 4YHHB 1HNZB 1LUVA 1I94B 3A0RA 1FXKB 5JJNB 5EC2C 4Q6GA 1YTFD 2Q5ZA 1H2SB 5JWPA 1NTMH 1OV9A 2R72A 2ZM6B 1N32B 1EZVH 1N36B 4DK1A 1A32A 3WB0A 3JSLA 3RYHA 3FYIB 1ZLZA 3MHHC 3TGUH 2M6YA 5DN6G 2W0XA 1BMFG 1DF5A 1AROP 2JGUA 4Z1MG 4JF3A 1Y4MA 3NXSA 4J9ZB 4JI8B 1EM1A 5BY1A 5KMGB 1EN4A 2QWOB 2UXXA 2Y48A 2P4KA 1QBZA 2NNUA 3G6BA 1H2GA 3P32A 4GLXA 1NT2B 1V55B 4DV5O 3E89A 1VP7A 2JRIA 1NJIW 1AP6A 1GM8A 4X20A 1IBKB 5J9PC 1NS1A 3K59A 1BS3A 1PNMA 3SYAA 3BAAA 1VQ4V 1WPXA 2EIKB 3H1JH 4P9PA 3CPWU 5TISZ 1SC5B 4WFHA 4DR4O 2QKAA 4DR6B 2Y0IA 2P5OA 1QLEC 4I4TB 3JD4A 1QHTA 3SGIA 1Q6HA 4MTGA 4P30A 4BR6A 2CGOA 3CYOA 1GMGA 4GX1A 3HKCA 3C90A 2QWQB 5KLVH 1PL0A 1JX9A 3WB2A 1HNXO 1RSOB 1R6NA 1R6TA 1O9GA 5KAFZ 4C7UA 5H9CA 5LYJA 3SR2C 4MVQA 3SYQA 2QM4A 3BRCA 1YJ9V 3ZBHA 4GUNA 1NH2D 1OCRB 1Z5WA 4GCZA 3OAAG 2D2CB 2E5LB 4DR7B 3CWBH 5LHGA 4KXRA 2MW2B 3SPCA 2B1GA 2IW5A 3TXSA 2N05A 4X8AA 1WA8A 4H37A 1WLEA 3FFQA 4IGGA 1JJOA 1ZUQA 2UXCO 2EJ7A 4FLUA 4ZBMA 2XUMA 2IU3A 4LH7A 2EINC 3ABUA 3CRAA 3UQ8A 4X64O 4B3TO 2OWOA 1R3IC 4LF8B 3E22B 4IHJA 3ZRWA 5LP6A 4NKGB 2VQFO 4X88A 4MTOA 4I0XA 5EK0A 2NN4A 3JD0A 3RYHB 3BA8A 4TV9B 3CB2A 2CUGA 4I9QA 2KG7B 3O9OA 3SPJA 1NU1H 1MMMA 4PA4A 2UU9B 1Y67A 5D5QA 3L71H 4UB6Z 4JGSA 2X0LA 1KB9F 1GN2A 4PHZA 4PDVA 1R3LC 3J7AU 1VQLV 1K9MW 1GK9A 2Q0AA 2V4DA 1HR0O 4WFBV 2YXYA 4U3JA 1XNQB 2Q9LA 2P67A 1KD1W 1VQ9V 3ZHSA 4J80A 1YVWA 1HNWB 4K8ZA 2N04A 3OMIB 4LBEC 1CPYA 3ZHTA 1F7YA 3JALB 1F4MA 4B3RB 4ZHQB 3K03A 4LCUC 5LL6Y 2VWKA 4DV3O 2IBZH 2WLIB 5BR8B 1NQTA 4NVPA 3E86A 5B1AB 1JQ0A 1VQKV 5EYPA 3OMAB 5D5PA 4HBNA 2C2AA 1VF5B 2AXTZ 1QLNA 1RP3B 4UCUA 2UXBB 3AG3C 3CRQA 3ASOC 2WLKA 1TGOA 2HVJC 1AR1B 4OX9O 5KX5B 4YIOA 4IL6Z 4CH3A 1D5AA 3FKSG 1Z2GA 3JD1A 4HYOA 4DW1A 2PYJA 4DRXB 1IXBA 4D7TA 4KUMA 2KQXA 2OTLV 5LA6B 4B3MB 1VQNV 4DV6B 5B1AC 1K5QA 3EHBB 1XEQA 1ROPA 2FKXA 3KZIZ 2QSAA 1KQSU 3DSQA 1H38A 2OYQA 4LFBB 4MSWC 4JPRA 2EZOA 3C3TA 1XMOO 3ZRWB 4D6TH 1K33A 5LP6B 5B1BB 4FLYA 3FB6C 3OR6C 4QIWF 4O4IA 1SQXH 2WLHA 5FNVA 3ETQA 1Y76A 5L3FA 4FLWA 2HLDG 4UVCA 4BW5A 3D3IA 3K04A 3I5DA 5J2UA 2WWWA 3ETEA 5GONA 3J80N 1QVFU 4J42A 3IAYA 2WSSG 1OCCB 3T1YO 2A06H 3JAWB 4UV9A 4EB6A 1ZL8B 2UXNA 2A9HA 2AGAA 2ADPA 1VF7A 1EZJA 5LMNB 3AK1A 4CS3A 1JJ2U 4JI7O 2B1IA 2QE7G 2JDIG 2IM9A 5KHIA 2Z0AA 1AI7A 5L3CA 5LP6C 1F23A 5B1BC 3W7WA 4LR3A 1HW7A 5KAIZ 2ZR3A 4FK5C 1FS0G 5IWAB 3APQA 2H94A 3SDLA 4K35A 5LXTA 1U96A 4X1YA 4I55A 3QVNA 2F1MA 3KCXA 3K08A 3OR7C 1UJWB 3JAKA 3CCQV 2WPDG 2EJRA 3QTCA 4JTDB 4DV5B 2Y69B 1Q7YW 2F43G 1FD9A 2Q7GA 4GZRB 3ABTA 2Z3YA 3DXRA 2ADQB
chains in the Genus database with same CATH topology
3H1JH 3L70H 1PP9H 3L75H 3L72H 1NTMH 1SQQH 4U3FH 2FYUH 1EZVH 2BCCH 3H1KH 1SQVH 3H1HH 2IBZH 1PPJH 1NTKH 1NTZH 1BE3H 1SQPH 3H1IH 1P84F 3L73H 3CX5F 1L0NH 3L74H 3TGUH 1NU1H 1KYOF 2A06H 3L71H 4D6TH 1BGYH 1KB9F 5KLVH 3BCCH 3CWBH 3H1LH 1L0LH 3CXHF 1SQXH 4PD4F 1SQBH 1BCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J H;  3L70 H;  1PP9 H;  3L75 H;  3L72 H;  1NTM H;  1SQQ H;  4U3F H;  2FYU H;  1EZV H;  2BCC H;  3H1K H;  1SQV H;  3H1H H;  2IBZ H;  1PPJ H;  1NTK H;  1NTZ H;  1BE3 H;  1SQP H;  3H1I H;  1P84 F;  3L73 H;  3CX5 F;  1L0N H;  3L74 H;  3TGU H;  1NU1 H;  1KYO F;  2A06 H;  3L71 H;  4D6T H;  1BGY H;  1KB9 F;  5KLV H;  3BCC H;  3CWB H;  3H1L H;  1L0L H;  3CXH F;  1SQX H;  4PD4 F;  1SQB H;  1BCC H; 
#chains in the Genus database with same CATH topology
 2P22 C;  3VBB A;  3T4Z A;  3SPG A;  1KKD A;  1E79 G;  4DV7 O;  5H6Q A;  3STL C;  2F4V B;  4GKK B;  2BE3 A;  4JYB A;  4H44 B;  3ZCC A;  4JI3 B;  2P6J A;  2BSK B;  3E8B A;  3H1I H;  4GT1 A;  2CTQ A;  2GTS A;  3ABM B;  4DW0 A;  1G8M A;  5CMU A;  2Q69 A;  2OTJ V;  3S3X A;  1WN7 A;  3NR7 A;  4PA9 A;  3GVM A;  5CN0 A;  1G1X B;  2ZNJ A;  2CE4 A;  2HHH B;  4K3A A;  1BL8 A;  5EZY B;  2Y69 C;  4WFG A;  4UXN A;  3G6E V;  3Q4H B;  3JCU Z;  3K5O A;  2RCV A;  1YCI A;  4O4I B;  5FNV B;  1HWY A;  3CCJ V;  1Y76 B;  1VQ8 V;  3JAT A;  3UKM A;  1KP3 A;  1VQM V;  4J9Y B;  4O2A B;  4NXM B;  1O9H A;  5J2U B;  1XNR B;  1Y74 A;  4R7C A;  1ZWI C;  3OD4 A;  3K3W A;  3E83 A;  5LHI A;  1KEC A;  3N2K A;  1R3J C;  4EB6 B;  1KP2 A;  2UXC B;  2QGN A;  3AEI A;  3AG1 B;  1MA1 A;  1JCH A;  1FXK A;  1XMQ O;  2MK3 A;  3X2Q C;  3T2M A;  3AK3 A;  3U0Z A;  1GM9 A;  3F7Y C;  4MTF A;  4GYC B;  1PD3 A;  2R9R B;  1NTK H;  1OZ0 A;  4LFA B;  3LUT B;  2YC0 A;  5LXT B;  3CCR V;  1FYJ A;  1L8D A;  4RUF A;  4CH5 A;  4IIJ B;  1FJG O;  4DV0 B;  1WNS A;  2YDE A;  3M7M X;  1IVS A;  1BHB A;  1G6U A;  4PDR A;  4I50 B;  4B7E A;  2YUA A;  5KMG A;  4Z2W A;  3CD6 V;  2PI5 A;  2WLL B;  1XL6 A;  3DXR B;  3K0D A;  4R6Z A;  3ABL C;  4F6R B;  3K57 A;  1YIT V;  2OCC B;  4DV1 O;  2CTW A;  3ZN1 A;  1SQQ H;  3E8H A;  3M99 B;  1K4C C;  3W7U A;  3A0H Z;  5BXZ A;  1QR8 A;  3GWO A;  3KKY A;  3F5T A;  3S3W A;  3H1L H;  4XDJ A;  3CCE V;  1D5N A;  4X66 O;  3LDC A;  1RSO A;  1M9N A;  5IJ9 B;  4FM2 A;  4F6E A;  4QPJ A;  4GX5 A;  3FD9 A;  2R9A A;  1ZSP A;  3BEH A;  1NI8 A;  2DYR B;  4OX9 B;  1ZAU A;  2Q6A A;  3SPH A;  1QNM A;  2OCC C;  3KCY A;  4DUY O;  1PNL A;  1Z5V A;  2XAS A;  4UVB A;  4NB5 A;  3JD2 A;  3SPI A;  4JI5 B;  2XAQ A;  1CEZ A;  1H2N A;  1JFF A;  3E8G A;  4JI1 B;  4YJ2 B;  2LW1 A;  3LSS A;  4LF6 O;  4B7K A;  1P4R A;  2UXD O;  1H2M A;  1NBM G;  3PN1 A;  5IY5 C;  2E76 B;  4WFF A;  1URF A;  4MW3 A;  4KFM A;  4OPH A;  4BIO A;  1VQ6 V;  2LFS A;  2V1D A;  2DYR C;  3E22 A;  2XAH A;  4NXN B;  2EBO A;  2DWD C;  1TUB A;  1ENV A;  1B06 A;  3E35 A;  4DR3 O;  1J5E O;  4NYK A;  4F4L A;  3CXC U;  4LFC O;  2DQ3 A;  4AHC A;  2L6L A;  2QA4 V;  1KYO F;  4TV9 A;  2KG7 A;  1LUW A;  5KA6 A;  3P30 A;  3WFV A;  5IE9 A;  3CC7 V;  1NR1 A;  2EUL A;  4GKJ O;  5LMU B;  4JI6 O;  2GSM B;  1FPO A;  1FXK C;  3I55 V;  2LFR A;  2Q68 A;  4JYA B;  4DUZ B;  1JR9 A;  4WF9 V;  1NR7 A;  3M8A A;  4JI2 B;  1W0J G;  1YIJ V;  1FXV A;  1MAB G;  1MG1 A;  3JAL A;  1U97 A;  4ZHQ A;  1TVK B;  2IU0 A;  2WLI A;  3TET A;  2HJD A;  2WLM A;  5JCO A;  1AI5 A;  3JD3 A;  5K1X A;  1N34 B;  2DQ0 A;  5IT9 N;  1OJH A;  3H9V A;  2UUC B;  1V55 C;  4LF4 B;  2ARH A;  2JVD A;  3CCS V;  2BOC C;  3C3S A;  4CS4 A;  1VQO V;  3CE2 A;  5KX5 A;  2EIK C;  3HPL C;  4CH4 A;  1K34 A;  1GO3 F;  1N0J A;  2A3Q A;  1J95 A;  2BTO A;  3G67 A;  4DRX A;  2JGD A;  2UUA B;  1JFF B;  4NR1 A;  3L72 H;  4O4J B;  1PKX A;  3QO8 A;  5LA6 A;  4ASU G;  4K0K O;  2BTQ B;  3JAS B;  3CEI A;  2IJK A;  1V9P A;  5B3S B;  4X89 A;  3ZN0 A;  4AQY O;  2PZS A;  3OTF A;  5B1N A;  4DO2 A;  4PA7 A;  4MVO A;  2NLJ C;  3GWK C;  4IYH A;  1TUB B;  2GBO A;  3K79 A;  3G4S V;  1IZ3 A;  1YEW A;  3W7S A;  3N2G B;  4KHP B;  3H1H H;  4DYL A;  1OCR C;  4D7S A;  1L1F A;  2P90 A;  4J7K A;  3UT5 B;  4DV4 B;  2DWE C;  2H8P C;  4MVS A;  3LSU A;  2AZ0 A;  1KBH A;  2YIC A;  1KKC A;  3SYP A;  2XND G;  4X62 O;  1I5Y A;  3VQW A;  4JI4 B;  3JAW A;  4G27 B;  4AIL C;  1RFY A;  1ZL8 A;  2HVK C;  4JTC B;  3RT3 C;  4LF9 B;  1XUQ A;  3ZRS A;  3SJB C;  3PJS K;  4G28 B;  2BOB C;  4JYY A;  1Q90 D;  1JMK C;  1LNQ A;  1NVP D;  4JV5 B;  2L35 A;  1IBM O;  4DR1 O;  4DV2 O;  1YTF B;  3B4S A;  2DE0 X;  2GV9 A;  4JTA B;  3T1H B;  1YZB A;  4HZ3 A;  4YY3 B;  4JI0 B;  2UUB B;  3K9S A;  1GKF A;  1EFR G;  1SF9 A;  2JJ2 G;  1SZT A;  3G80 A;  3FAV A;  3RYI B;  3L9D A;  3JCZ A;  4I9W A;  3MAQ A;  2DW4 A;  1BT8 A;  4ZIB A;  3LNN A;  4LP8 A;  5JQG B;  5KUM A;  1BQ0 A;  3DC6 A;  3AK2 A;  3VOU A;  3E8F A;  3QG5 A;  3CCL V;  4X1I A;  3QO7 A;  1SES A;  3O65 A;  2VQE B;  1AI4 A;  4CS2 A;  1YJN V;  5JJJ B;  5J2T A;  3ZJZ A;  1TUE B;  2BSK A;  3DC5 A;  2JGD B;  2E74 B;  4XDL A;  4UB8 Z;  2R9I A;  4B3S O;  4J10 A;  2QWP B;  1S5L Z;  5JCO C;  5L3E A;  2AHY A;  4LF7 O;  3T4D A;  5EZY A;  1FFX A;  1T5E A;  1FKA O;  2ODM A;  1EBO A;  1WP8 A;  4O4L A;  3TCU A;  3Q4H A;  5IYZ B;  1EN5 A;  1S3J A;  4FLV A;  1FFT B;  3OGI B;  2ETN A;  1FXH A;  4YHH O;  2GDS A;  1K4D C;  1HNZ O;  2ILM A;  4O2A A;  3K9A A;  1PPJ H;  1NH2 B;  3OEE G;  4JAV A;  2GHY A;  2DYS B;  2ZKO A;  1H8E G;  2HEP A;  3B2E E;  2UXD B;  2YID A;  3APO A;  1GRJ A;  1WPB A;  2ZM6 O;  1BHA A;  2CAZ C;  4X9Q A;  1N36 O;  1Y66 A;  3STZ C;  1XHX A;  1KMI Z;  5CA1 B;  1QR9 A;  2X6A A;  4EKW A;  4LH6 A;  3D36 A;  3T1C A;  1KUQ A;  2YS8 A;  4JI8 O;  2X7R B;  4JZ2 A;  5FL7 G;  4EFE A;  3UO3 A;  1DLB A;  4I7Z B;  3DGE A;  4OPA A;  4IIJ A;  3VQY A;  3FAV B;  2DMX A;  1OCC C;  2FTK A;  1E1Q G;  2OT5 A;  3TJT A;  4I5S A;  1IBK O;  1VQP V;  4DXW A;  2AW9 A;  4I50 A;  1P84 F;  3UO2 A;  2QEX V;  5ITZ B;  2ZXW B;  2OIE A;  1B04 A;  2WLL A;  3W7X A;  1Q82 W;  2PY5 A;  4DR6 O;  1XDC A;  4X1I B;  2EIL B;  4F6R A;  5B5E Z;  3K5M A;  3GB7 C;  5A2Q N;  1GAX A;  2WLN A;  5KUK A;  4MVR A;  3ZMZ A;  3BA9 A;  1NTZ H;  2EZP A;  4DR4 B;  1VF6 A;  2Q73 A;  5J2T B;  2RMK B;  4RUE A;  2PUS A;  1GM7 A;  3RGB A;  5LHH A;  3OE7 G;  1BGY H;  1S0V A;  3WG7 B;  4TT3 G;  1V54 B;  2YEV B;  4CH6 A;  1HNX B;  2YI9 A;  2CH7 B;  1FFX B;  4X65 O;  3MDS A;  4K8X A;  2AZ2 A;  1HP8 A;  3UCS C;  4O4L B;  1B3Q A;  4A5U B;  5IJ9 A;  2E5L O;  4MVZ A;  2Q4P A;  1M5I A;  4IYI A;  3OFN G;  4PD4 F;  1VMG A;  1IDS A;  1RPR A;  4RO2 A;  5AG2 A;  1H8H G;  2F93 B;  2O57 A;  2PYL A;  4MVU A;  2BCC H;  3K0G A;  2QWN B;  4PDL A;  5HFM A;  4QPK A;  1M56 B;  4H33 A;  3ABM C;  4U7O A;  5GTI Z;  4YJ2 A;  1WJZ A;  3ETD A;  1M57 B;  3BPZ A;  2LJ2 A;  3K5N A;  1JOY A;  3HKE B;  1OCZ B;  4CC6 A;  4CBC A;  4X64 B;  4B3T B;  4DK0 A;  5EIB C;  3H1K H;  2VQF B;  1S76 D;  4DR5 O;  2UU9 O;  3SJQ C;  3ASN B;  5CB4 B;  3JAR B;  5GTH Z;  1XNQ O;  1SA0 A;  4QE7 A;  3RVZ A;  2IJH A;  4ZOL B;  4LNU B;  2QJ1 A;  3RYC A;  3B8N A;  1Q6I A;  4GX2 A;  4EFB A;  1COW G;  1M57 C;  1HR0 B;  4R8C A;  4EEQ A;  3CJH B;  3AG1 C;  1AVM A;  2Z5U A;  4H0L B;  4BWA A;  3SYO A;  2CGN A;  4B3R O;  3W7T A;  5JJE B;  3AG2 B;  1LR1 A;  1PV0 A;  3OT7 A;  4J41 A;  3CRM A;  3D36 C;  1IBM B;  3FYE B;  5BR8 O;  5H5N A;  1VAR A;  3KG2 A;  2ZIO A;  2IJJ A;  1UFI A;  4FZ1 A;  5CA0 B;  4MT8 A;  5LBQ A;  3HKD B;  4DV3 B;  4LC1 A;  5FPO A;  1MSD A;  1R6K A;  2HR3 A;  4BAY A;  1TVK A;  2UXB O;  4MTX A;  2JK5 C;  5B1O A;  2ZE7 A;  4PA3 A;  3ETG A;  4L8J A;  1K97 A;  3L70 H;  4YXW G;  1N4C A;  3MD0 A;  2KSD A;  2LGQ A;  1RM1 B;  2FYU H;  1Y6X A;  2QKC A;  3B77 A;  3HKB A;  5IYC O;  4TSF G;  2K9P A;  4FLT A;  3AG2 C;  4O2B B;  3B8M A;  2W6I G;  4B3M O;  2HJF C;  2YIB A;  2M7W A;  5IDJ A;  1YI2 V;  2XAJ A;  2VWJ A;  2Q7E A;  2QM7 A;  4DV6 O;  1VF6 C;  1XHZ A;  2FL4 A;  1PP9 H;  1AJP A;  3ZS8 C;  2JS3 A;  4ZI7 B;  4UCV A;  3ZMU A;  2YSU B;  4B3S B;  3ZMT A;  4B08 A;  4O4J A;  2YXH A;  2KB1 A;  2F66 C;  3RBZ A;  2ATK C;  2BTQ A;  3L74 H;  3JAS A;  4TWK A;  4JAA A;  3CCM V;  3RVY A;  1SQB H;  4L87 A;  1K8A W;  2EIM B;  1P7G A;  1XMO B;  3FB8 C;  4MVM A;  3RN4 A;  3TXQ A;  4IT5 A;  2DJV A;  2QM8 A;  2ZIM A;  1AJN A;  3R65 A;  1SQV H;  1AJQ A;  3BY6 A;  4WBN B;  3N2G A;  1MNG A;  3CX5 F;  2E75 B;  4NTX A;  1IX9 A;  4LWS A;  5LMN O;  1SA0 B;  4H13 B;  5H6R A;  3UT5 A;  2HFE C;  2ZR2 A;  3T1Y B;  1SS3 A;  2RDC A;  5LOV B;  4J7Z A;  3LDD A;  3RYC B;  2WAM A;  4AI8 A;  2ZE6 A;  2XAF A;  3ZHR A;  4UCR A;  1N8R W;  1JPX A;  4FZ0 A;  4FLX A;  3DTU B;  3ZRX A;  2Q7H A;  3JSN A;  4JI7 B;  1SKV A;  1W2B U;  3K06 A;  1K92 A;  5IWA O;  1SRY A;  5CBH A;  1DK1 A;  1XRE A;  2EIM C;  4N21 A;  2N74 A;  1QLE B;  1WAZ A;  2Q8V A;  3ZMS A;  1DGS A;  2QWR B;  4U7N A;  5FPR A;  2F95 B;  2JIZ G;  1VEW A;  5B66 Z;  3TK1 A;  1M90 W;  1L0N H;  4Q20 A;  5KA5 A;  3J81 N;  1MOF A;  4PI0 A;  3RWR D;  3RYI A;  3WB1 A;  4XBF A;  3HR0 A;  4ZKI A;  3CME V;  1S5J A;  5LGN A;  3IC9 A;  4FFB B;  5LGT A;  2GUZ B;  2F4V O;  3A0B Z;  3HKB B;  4RQF A;  4GKK O;  1MSW D;  5KHH A;  5JQG A;  4JI3 O;  1TA8 A;  2JJ1 G;  1VQ5 V;  3A2F A;  3RYF B;  3CCU V;  3EFF K;  2LW7 A;  4DV7 B;  4X1K A;  1THZ A;  4UV8 A;  4RQE A;  3K58 A;  1OHH G;  2QTS A;  2HG5 C;  3G71 V;  2HHH O;  3CRC A;  1D2D A;  4PA6 A;  3D8C A;  2EIN B;  4PI2 A;  1AP5 A;  5DM6 V;  5JVD B;  1M93 A;  4P9O A;  3OGC C;  3E2E A;  4X65 B;  4WFA V;  1P7B A;  4JYC A;  1GH6 A;  2OCH A;  5C8Y A;  4NXM O;  2WA3 A;  1XNR O;  4ICG A;  3UM7 A;  2ZE8 A;  2Q0O C;  5IYZ A;  4PJ0 Z;  3L75 H;  1K73 W;  5BZB A;  1PNK A;  2ZNI A;  1IBL O;  2EX3 A;  4FLZ A;  1BQZ A;  4LWS B;  1I08 A;  1I0H A;  5L3G A;  1K7D A;  4FIP C;  2QDO A;  3H01 A;  4RWU A;  4WFE A;  3ZMV A;  3SYC A;  1R73 A;  1RPO A;  2R70 A;  2WLJ A;  1DF4 A;  2DOS A;  5FLX N;  4LFA O;  1AR4 A;  5B3S C;  5CBG A;  3QO5 A;  1XMQ B;  3AG7 A;  4DR5 B;  1I5X A;  2GTA A;  3B40 A;  2LP7 A;  5CA1 A;  4DV0 O;  2KKW A;  1N33 O;  1EN6 A;  1K3E A;  4TOI A;  3QF7 A;  2ZT9 B;  1US6 A;  2CDY A;  1YXB A;  1FJG B;  3CSX A;  5IYD O;  2B5U A;  3AG3 B;  1X59 A;  3ZHU A;  3ASO B;  4X20 B;  2CTR A;  5L3D A;  3U11 A;  2K1E A;  4TV8 A;  2P4V A;  5IYB O;  5F2V O;  5KHJ A;  1X4T A;  2OIG A;  5ITZ A;  4YJ3 A;  4QNH B;  2QTO A;  2CK3 G;  4LF5 O;  1VIB A;  5EBL C;  3OTO O;  4U3F H;  1Q81 W;  4UVA A;  3ZIA G;  4DV1 B;  4FM0 A;  4X1K B;  4MS2 A;  3EXA A;  3VQX A;  3HKC B;  1AI6 A;  5IJ0 A;  3R66 A;  1DTO A;  5EIB D;  1OCO B;  3ICX A;  2W0F C;  2ITD C;  2VS0 A;  2ITC C;  3CXH F;  2NR5 A;  3QNE A;  4BW9 A;  2ZIN A;  5L3B A;  5LYJ B;  1I7F A;  3FX7 A;  2YI8 A;  4DR2 O;  4W4K A;  4JZG A;  1F4N A;  3MHS C;  5EBM C;  2YEV A;  3P3P A;  2EIJ B;  3IFX A;  1R3K C;  4X66 B;  5C8Y B;  4UUJ C;  2CH7 A;  3L73 H;  2PTM A;  3OEH G;  2PGG A;  1AB3 A;  2XAG A;  3OMN B;  4JI5 O;  3BAB A;  3D3Q A;  2CTP A;  4DUY B;  4JI1 O;  1WA8 B;  3HB3 B;  3CC2 V;  2DN9 A;  4PV1 B;  4N23 A;  4G2K A;  1TAE A;  1OCO C;  4JAS A;  2B9Z A;  1I94 O;  1F51 A;  1YF2 A;  4TQF A;  4FPP A;  2F23 A;  1MZE A;  4ABM A;  2XHB A;  5GW7 A;  5H2F Z;  4LF6 B;  1YJW V;  4IHJ B;  2A7W A;  3CS5 A;  4I0X B;  3ZX6 A;  1Q43 A;  1L0L H;  2A79 B;  4OXS A;  4NXN O;  3JAM N;  1N32 O;  2EIJ C;  5LGU A;  1Q6U A;  4UCT A;  3LSQ A;  3OM3 B;  2QKS A;  3HKE A;  1G4Y B;  1GN6 A;  2XOK G;  1WB7 A;  4UCS A;  1Q3E A;  1S5H C;  3A8T A;  5BMV A;  4DR3 B;  1J5E B;  2P7T C;  1GTO A;  4P2Z A;  4MW8 A;  4LFC B;  5CB4 A;  4PDM A;  4TQD A;  1PM9 A;  4U3J B;  2X6B A;  4QGP A;  5DED A;  3IC7 A;  5LMU O;  1CP9 A;  3JAR A;  5JH7 A;  2DYS C;  1W0K G;  2JEU A;  2ZDI A;  2W6J G;  4JYA O;  2HP8 A;  4DUZ O;  4ZOL A;  4LNU A;  2YIA A;  4NTW A;  4TV8 B;  4GKJ B;  4JI6 B;  1BSM A;  4JI2 O;  1PL4 A;  5CBF A;  4YJ3 B;  2QR4 A;  3CJH A;  2D3O W;  3K5L A;  2LGW A;  4W4L A;  2ZE5 A;  2HKO A;  1BCC H;  3WU2 Z;  3BHP A;  1Q5O A;  3OW2 U;  2A0L A;  2VRZ A;  1YHQ V;  5IJ0 B;  3IGA C;  5EYP B;  2AHZ A;  1SQP H;  3ML0 A;  4HNA A;  4QE9 A;  1N34 O;  4JAU A;  3F7V C;  4NTY A;  1NVP B;  4FMT A;  5CA0 A;  3HKD A;  2UUC O;  4LF4 O;  1FAF A;  2XT9 A;  2RJZ A;  1AIL A;  4GX0 A;  5HFL A;  5EBW C;  1QCE A;  4TUY A;  1YDX A;  2ZXW C;  3ABK B;  2H3O A;  1BE3 H;  2Y0P A;  4DR7 O;  4BIZ A;  3SJA C;  5CA3 A;  3FB5 C;  4O2B A;  1SQG A;  2UUA O;  3EVK A;  4RAI A;  4FJC C;  2EIL C;  3BCC H;  1R1B A;  1GN4 A;  1N0N A;  4WCE V;  4O4H A;  2Q67 A;  4HAM A;  2PF4 E;  1S72 V;  1VQ7 V;  1M4U A;  1IXM A;  1CXZ B;  4ZI7 A;  2RNB A;  3X2Q B;  4E4E A;  3WG7 C;  5A9G A;  3B09 A;  4K0K B;  1V54 C;  2E3C A;  4LF8 O;  3ZHQ A;  4YIP A;  4R50 A;  1Q8I A;  1E1R G;  1JA8 A;  4AQY B;  1NZ6 A;  1MZF A;  4KHP O;  3ABK C;  1QU7 A;  5GON B;  4DV4 O;  3N27 A;  5BMV B;  4KP4 A;  3CCV V;  4E2L A;  1M1K W;  1HDJ A;  3LNM B;  1IBL B;  1XL4 A;  1XBL A;  3F5W C;  1KU9 A;  5EC1 C;  1NKD A;  4WBN A;  4JI4 O;  2FB5 A;  2RN9 A;  1H2L A;  2Y4U A;  5JH7 B;  4CC5 A;  3LDE A;  1M56 C;  4LF9 O;  1W59 A;  1YSC A;  4Z1V A;  4X62 B;  3ABL B;  5LOV A;  1IUR A;  4OGQ B;  2X6C A;  2XTA A;  2LO1 A;  1S77 D;  1XQ8 A;  1HNW O;  2IJI A;  1BZK A;  1XI1 A;  4JV5 O;  4BIU A;  2YXL A;  4UFZ A;  2IH3 C;  2JS5 A;  1Q86 W;  3AG4 B;  4FVM A;  1OCZ C;  3BFR A;  1KC8 W;  4X1Y B;  4I55 B;  3T1H O;  3OUS A;  3I56 V;  4YY3 O;  4JI0 O;  2FML A;  2UUB O;  3FB7 C;  1QQC A;  2RQ6 A;  3IJ4 A;  5C93 A;  3P3N A;  1N33 B;  3JAK B;  4DR1 B;  4DV2 B;  3U10 A;  3BVO A;  3ASN C;  2ZD9 A;  5E79 Z;  4HNA B;  4FM1 A;  2ZQM A;  1AR5 A;  3JYC A;  1GN3 A;  4J7J A;  3SJC C;  5DEC A;  3CC4 V;  4KL1 A;  2V7Q G;  1B6Q A;  2YIB D;  2ZDI C;  3ZHV A;  4J11 A;  2LQT A;  1K5S A;  1P49 A;  1WB8 A;  3CMA V;  4TUY B;  4FFB A;  2P06 A;  2JEX A;  1WP7 A;  2VQE O;  5E1A C;  2GUZ A;  3AG4 C;  4LF5 B;  1SQF A;  3OTO B;  3CRR A;  3CHX A;  1QVG U;  4UCO A;  1SET A;  2WA4 A;  4I4T A;  3RYF A;  3VQV A;  4FFK A;  2IH1 C;  1XIL A;  1JVM A;  5KHG A;  5KHK A;  4O4H B;  5IY5 B;  4QJF B;  1ORQ C;  4XDK A;  1SZX A;  2G38 A;  3CP1 A;  1XOU A;  3RFR A;  3RW0 A;  4DR2 B;  3ZRV A;  4LFB O;  5K1P A;  1ZX3 A;  2ZCE A;  4LF7 B;  1ZTE A;  3JAT B;  2Y4T A;  5JVD A;  2PI4 A;  3THO A;  1RM1 C;  4CZZ A;  1UPG A;  1Y74 B;  1SER A;  3OUF A;  1H2K A;  3N2K B;  3ZED A;  4PEL A;  4YHH B;  1HNZ B;  1LUV A;  1I94 B;  3A0R A;  1FXK B;  5JJN B;  5EC2 C;  4Q6G A;  1YTF D;  2Q5Z A;  1H2S B;  5JWP A;  1NTM H;  1OV9 A;  2R72 A;  2ZM6 B;  1N32 B;  1EZV H;  1N36 B;  4DK1 A;  1A32 A;  3WB0 A;  3JSL A;  3RYH A;  3FYI B;  1ZLZ A;  3MHH C;  3TGU H;  2M6Y A;  5DN6 G;  2W0X A;  1BMF G;  1DF5 A;  1ARO P;  2JGU A;  4Z1M G;  4JF3 A;  1Y4M A;  3NXS A;  4J9Z B;  4JI8 B;  1EM1 A;  5BY1 A;  5KMG B;  1EN4 A;  2QWO B;  2UXX A;  2Y48 A;  2P4K A;  1QBZ A;  2NNU A;  3G6B A;  1H2G A;  3P32 A;  4GLX A;  1NT2 B;  1V55 B;  4DV5 O;  3E89 A;  1VP7 A;  2JRI A;  1NJI W;  1AP6 A;  1GM8 A;  4X20 A;  1IBK B;  5J9P C;  1NS1 A;  3K59 A;  1BS3 A;  1PNM A;  3SYA A;  3BAA A;  1VQ4 V;  1WPX A;  2EIK B;  3H1J H;  4P9P A;  3CPW U;  5TIS Z;  1SC5 B;  4WFH A;  4DR4 O;  2QKA A;  4DR6 B;  2Y0I A;  2P5O A;  1QLE C;  4I4T B;  3JD4 A;  1QHT A;  3SGI A;  1Q6H A;  4MTG A;  4P30 A;  4BR6 A;  2CGO A;  3CYO A;  1GMG A;  4GX1 A;  3HKC A;  3C90 A;  2QWQ B;  5KLV H;  1PL0 A;  1JX9 A;  3WB2 A;  1HNX O;  1RSO B;  1R6N A;  1R6T A;  1O9G A;  5KAF Z;  4C7U A;  5H9C A;  5LYJ A;  3SR2 C;  4MVQ A;  3SYQ A;  2QM4 A;  3BRC A;  1YJ9 V;  3ZBH A;  4GUN A;  1NH2 D;  1OCR B;  1Z5W A;  4GCZ A;  3OAA G;  2D2C B;  2E5L B;  4DR7 B;  3CWB H;  5LHG A;  4KXR A;  2MW2 B;  3SPC A;  2B1G A;  2IW5 A;  3TXS A;  2N05 A;  4X8A A;  1WA8 A;  4H37 A;  1WLE A;  3FFQ A;  4IGG A;  1JJO A;  1ZUQ A;  2UXC O;  2EJ7 A;  4FLU A;  4ZBM A;  2XUM A;  2IU3 A;  4LH7 A;  2EIN C;  3ABU A;  3CRA A;  3UQ8 A;  4X64 O;  4B3T O;  2OWO A;  1R3I C;  4LF8 B;  3E22 B;  4IHJ A;  3ZRW A;  5LP6 A;  4NKG B;  2VQF O;  4X88 A;  4MTO A;  4I0X A;  5EK0 A;  2NN4 A;  3JD0 A;  3RYH B;  3BA8 A;  4TV9 B;  3CB2 A;  2CUG A;  4I9Q A;  2KG7 B;  3O9O A;  3SPJ A;  1NU1 H;  1MMM A;  4PA4 A;  2UU9 B;  1Y67 A;  5D5Q A;  3L71 H;  4UB6 Z;  4JGS A;  2X0L A;  1KB9 F;  1GN2 A;  4PHZ A;  4PDV A;  1R3L C;  3J7A U;  1VQL V;  1K9M W;  1GK9 A;  2Q0A A;  2V4D A;  1HR0 O;  4WFB V;  2YXY A;  4U3J A;  1XNQ B;  2Q9L A;  2P67 A;  1KD1 W;  1VQ9 V;  3ZHS A;  4J80 A;  1YVW A;  1HNW B;  4K8Z A;  2N04 A;  3OMI B;  4LBE C;  1CPY A;  3ZHT A;  1F7Y A;  3JAL B;  1F4M A;  4B3R B;  4ZHQ B;  3K03 A;  4LCU C;  5LL6 Y;  2VWK A;  4DV3 O;  2IBZ H;  2WLI B;  5BR8 B;  1NQT A;  4NVP A;  3E86 A;  5B1A B;  1JQ0 A;  1VQK V;  5EYP A;  3OMA B;  5D5P A;  4HBN A;  2C2A A;  1VF5 B;  2AXT Z;  1QLN A;  1RP3 B;  4UCU A;  2UXB B;  3AG3 C;  3CRQ A;  3ASO C;  2WLK A;  1TGO A;  2HVJ C;  1AR1 B;  4OX9 O;  5KX5 B;  4YIO A;  4IL6 Z;  4CH3 A;  1D5A A;  3FKS G;  1Z2G A;  3JD1 A;  4HYO A;  4DW1 A;  2PYJ A;  4DRX B;  1IXB A;  4D7T A;  4KUM A;  2KQX A;  2OTL V;  5LA6 B;  4B3M B;  1VQN V;  4DV6 B;  5B1A C;  1K5Q A;  3EHB B;  1XEQ A;  1ROP A;  2FKX A;  3KZI Z;  2QSA A;  1KQS U;  3DSQ A;  1H38 A;  2OYQ A;  4LFB B;  4MSW C;  4JPR A;  2EZO A;  3C3T A;  1XMO O;  3ZRW B;  4D6T H;  1K33 A;  5LP6 B;  5B1B B;  4FLY A;  3FB6 C;  3OR6 C;  4QIW F;  4O4I A;  1SQX H;  2WLH A;  5FNV A;  3ETQ A;  1Y76 A;  5L3F A;  4FLW A;  2HLD G;  4UVC A;  4BW5 A;  3D3I A;  3K04 A;  3I5D A;  5J2U A;  2WWW A;  3ETE A;  5GON A;  3J80 N;  1QVF U;  4J42 A;  3IAY A;  2WSS G;  1OCC B;  3T1Y O;  2A06 H;  3JAW B;  4UV9 A;  4EB6 A;  1ZL8 B;  2UXN A;  2A9H A;  2AGA A;  2ADP A;  1VF7 A;  1EZJ A;  5LMN B;  3AK1 A;  4CS3 A;  1JJ2 U;  4JI7 O;  2B1I A;  2QE7 G;  2JDI G;  2IM9 A;  5KHI A;  2Z0A A;  1AI7 A;  5L3C A;  5LP6 C;  1F23 A;  5B1B C;  3W7W A;  4LR3 A;  1HW7 A;  5KAI Z;  2ZR3 A;  4FK5 C;  1FS0 G;  5IWA B;  3APQ A;  2H94 A;  3SDL A;  4K35 A;  5LXT A;  1U96 A;  4X1Y A;  4I55 A;  3QVN A;  2F1M A;  3KCX A;  3K08 A;  3OR7 C;  1UJW B;  3JAK A;  3CCQ V;  2WPD G;  2EJR A;  3QTC A;  4JTD B;  4DV5 B;  2Y69 B;  1Q7Y W;  2F43 G;  1FD9 A;  2Q7G A;  4GZR B;  3ABT A;  2Z3Y A;  3DXR A;  2ADQ B; 
#chains in the Genus database with same CATH homology
 3H1J H;  3L70 H;  1PP9 H;  3L75 H;  3L72 H;  1NTM H;  1SQQ H;  4U3F H;  2FYU H;  1EZV H;  2BCC H;  3H1K H;  1SQV H;  3H1H H;  2IBZ H;  1PPJ H;  1NTK H;  1NTZ H;  1BE3 H;  1SQP H;  3H1I H;  1P84 F;  3L73 H;  3CX5 F;  1L0N H;  3L74 H;  3TGU H;  1NU1 H;  1KYO F;  2A06 H;  3L71 H;  4D6T H;  1BGY H;  1KB9 F;  5KLV H;  3BCC H;  3CWB H;  3H1L H;  1L0L H;  3CXH F;  1SQX H;  4PD4 F;  1SQB H;  1BCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...