3L73H

Cytochrome bc1 complex from chicken with triazolone inhibitor
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTIREHCEQTEKCVKARERLELCDARVSSRSHTEEQCTEELFDFLHARDHCVAHKLFNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 21
structure length 70
sequence length 70
chains with identical sequence U
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3l73H00
2FYUH 1NTMH 2A06H 3BCCH 2IBZH 3H1IH 1SQVH 1BGYH 3CWBH 1EZVH 3H1KH 1KB9F 3CX5F 4D6TH 1NTKH 2BCCH 1BCCH 1P84F 3L72H 1L0NH 1SQPH 4PD4F 3L73H 1BE3H 1NU1H 3H1JH 5KLVH 1SQXH 4U3FH 1SQBH 3H1HH 1SQQH 3TGUH 3L75H 3CXHF 3L71H 3H1LH 1PPJH 1L0LH 1PP9H 3L74H 3L70H 1KYOF 1NTZH
chains in the Genus database with same CATH superfamily
5CBHA 2W0XA 2VQEO 1XL4A 2ILMA 4WFHA 3W7XA 3CD6V 1NR7A 2CGNA 4CS3A 2VWJA 1BQZA 2QWOB 4X89A 3CCUV 1K33A 3ICXA 1TAEA 2AHZA 2Q7HA 1HW7A 3SDLA 5C8YB 1BMFG 1KMIZ 3U11A 1RSOB 4XBFA 4UCUA 3I55V 3BPZA 4GZRB 5B1AC 4JI6B 5LYJB 3ZIAG 2DOSA 2JVDA 4PJ0Z 4EEQA 1MSDA 1RFYA 2LW1A 3EVKA 1JA8A 3KKYA 4WBNB 4HNAB 4O4LB 1YXBA 2P06A 1JMKC 5BR8O 4I50A 2UXBB 2UUCB 2PZSA 2UXCB 4B7EA 1DF5A 4PA9A 2IW5A 2ZE8A 3S3XA 1M56B 1ZL8B 4U3JA 2EIKC 5CA3A 4DV4B 2RMKB 3R66A 2EINC 1Y67A 1NI8A 3JD1A 1YI2V 4MTFA 5KHKA 1H2SB 1YSCA 2A0LA 2QE7G 2F4VB 1XBLA 3CC4V 1VQLV 2IM9A 3SJAC 5B3SC 3RYIB 3OMAB 2FYUH 2OYQA 2HHHB 4FLVA 1WB8A 4KP4A 2GDSA 4IHJA 3TJTA 3LSUA 4FLTA 4OPAA 1VF5B 3JD2A 3AK3A 1QLEB 3CRQA 3OR6C 1R3KC 2YIBD 3CEIA 4PA6A 4YIOA 1EM1A 1HDJA 1TUBA 4B3SO 4BIZA 2CK3G 4FLYA 2IJJA 5IYZA 1N33B 4F4LA 1FFXB 3AG4B 1H8EG 3W7UA 1SQVH 4GKKO 2ZXWC 2DYRB 4JI4O 1R73A 5E1AC 4YHHO 4LWSB 4WFGA 1YJNV 1W0KG 3TK1A 2KB1A 3DSQA 4PD4F 3L73H 2Z5UA 2LP7A 4NTWA 3I56V 4IT5A 2ZCEA 4JI0O 4DV1O 3BCCH 3FAVB 2R70A 1AILA 3SYOA 1D5AA 2CAZC 1KBHA 4J10A 3ZMSA 1N34O 4X66O 4LF9O 1E1RG 3UCSC 4E2LA 2QR4A 5FNVB 1AJQA 2ZDIC 3ASNC 3B77A 2AW9A 3B8MA 3OFNG 4FK5C 2QTOA 5IY5C 1G1XB 1GAXA 2RDCA 4FFKA 4Z1VA 1BT8A 3ZHQA 1H2NA 4I4TA 4FFBA 4MTXA 4YIPA 4OX9O 3J81N 1AI6A 3ETEA 5J2TA 3UT5B 2BE3A 3EFFK 3WB1A 1MZFA 3AG2C 1WPXA 1JVMA 3APOA 4JPRA 5DN6G 4G27B 5GONA 3J80N 1LR1A 5KUMA 3ABLB 1L1FA 2LO1A 3CMEV 4I9WA 1OJHA 3E8FA 3SYPA 3SR2C 4X1YB 1FKAO 1TVKB 3IFXA 2PY5A 2WLMA 3K5LA 3ABKB 4WFBV 2UXDO 2DQ3A 3QO5A 1RPRA 4OXSA 3G67A 1KD1W 5KX5A 3OD4A 4J11A 4DW0A 5L3FA 3K3WA 5CA0B 2ADPA 1HNWB 4O4HB 2HP8A 2Q68A 2FMLA 4TSFG 4DRXB 4F6EA 1NU1H 2ZIMA 2AZ0A 4EB6A 4EFBA 2B5UA 1Q7YW 4K0KB 5EIBD 4I9QA 2VQFB 4MVOA 4MT8A 4DV2B 5K1XA 1I5XA 2QKSA 3B40A 2EIJC 4ZI7B 3E2EA 2X7RB 3E8GA 3LNMB 4BW9A 1FJGO 1Y74A 2DMXA 1YHQV 1P4RA 1MA1A 1VARA 1BQ0A 5L3CA 4DO2A 5KLVH 4PDLA 4DR7B 4ZOLA 3FX7A 1WA8A 1DF4A 2MK3A 3B8NA 2C2AA 4C7UA 3DXRB 4LF6O 2N04A 1OCOC 2E3CA 3HKEB 3ZRSA 1KC8W 4TV8A 1KP2A 4I5SA 5LBQA 2BOCC 4X64O 1ENVA 1IXBA 3N2KB 3T1HB 3CJHA 3S3WA 2OTJV 3ZBHA 1PKXA 5GTIZ 1IDSA 5KAFZ 4QPKA 1I94O 4LC1A 4X1IA 3TXQA 2F23A 5KMGA 3CRMA 1VP7A 4J7KA 4DV5O 2EZPA 2F95B 2JS5A 1AI5A 4DR3B 2XTAA 4N23A 1P84F 4L87A 1X59A 2R9RB 4JTAB 1NH2D 5EBWC 1AP5A 2UUBO 1Q6HA 2CTRA 3ZHVA 4G28B 4DR1O 3OTFA 4TQFA 4CC5A 1Y66A 3BA9A 4MVUA 1GRJA 5JWPA 1EBOA 1EN4A 4X65B 2ITCC 2UUAO 5EZYA 4AQYB 1OCRC 2P7TC 3O65A 2N05A 3G6BA 4HBNA 4JF3A 4O4JA 2Q7GA 4LNUB 1KECA 2Y0PA 2PF4E 1F4NA 3K58A 1FPOA 1QVFU 3CCMV 1PP9H 3L74H 1R1BA 4IYHA 3WB2A 3J7AU 2AXTZ 3K9SA 2YXHA 2HKOA 1SZTA 3AG1B 1AR1B 4B3MB 3D3IA 5LGUA 2FL4A 2KKWA 4DK1A 2WLLA 3H9VA 1U96A 5C8YA 5LGNA 4P2ZA 1AR5A 4TUYA 5CA1B 1ZSPA 3OT7A 3Q4HA 3JAMN 1AR4A 2IH3C 3MDSA 1Q90D 2NLJC 4YY3B 1VF6A 1DK1A 3VQXA 5LXTB 2Q8VA 3HKBA 4WBNA 3FD9A 2YUAA 1K34A 4HYOA 2HVJC 2GTAA 4X62O 3FB7C 2FB5A 4R50A 2Q7EA 1HR0O 1KYOF 1S0VA 2IJIA 1ZL8A 2V1DA 1LUVA 1ZLZA 1BGYH 1YTFD 2G38A 1Y76B 3ASOB 3ZRWA 4F6RA 3CX5F 2BTQB 4QE7A 3CCJV 1YIJV 4X1KA 4DR2B 2BSKB 2NNUA 3RBZA 1B04A 4I0XB 4DV7O 2P5OA 1VMGA 4DV0B 4LFBO 4FM0A 3E22B 1XL6A 1GN3A 3FKSG 2PYLA 3P32A 2R9AA 4MTOA 1KQSU 1O9GA 1IBKB 3RYHB 3KCXA 1IXMA 1L0NH 3NXSA 4X20A 4JI2B 3CS5A 1H2KA 3FYEB 5LP6A 5IYCO 2OCCB 2Q0OC 2YXYA 3A8TA 4IYIA 1S5LZ 2P4VA 3JAWB 4LF4B 3E8BA 4CH3A 5L3EA 1S3JA 1DLBA 3OTOO 2D3OW 2CGOA 1J5EO 1GN2A 3R65A 2P90A 3L9DA 2OWOA 5D5PA 5JQGB 1FYJA 4AI8A 3QO8A 3MAQA 2DQ0A 1XNQB 4JI3B 3JCZA 1YITV 1BE3H 3JCUZ 3D8CA 5KAIZ 3KG2A 3CCRV 2A7WA 4NB5A 1H8HG 2AHYA 2QEXV 4RWUA 4DYLA 5TISZ 1M56C 2E74B 1IX9A 4J41A 4ZBMA 3E89A 1M90W 1I08A 2QDOA 3CC2V 3CHXA 4JI6O 2MW2B 2FKXA 1RPOA 3EHBB 1DTOA 2QKCA 3BVOA 1M9NA 3P3PA 5J9PC 2IBZH 5KA5A 3UT5A 1X4TA 4Z2WA 3K0DA 4UVCA 1WB7A 3TETA 3BRCA 1K3EA 2UUCO 2UXBO 2UXCO 1K5SA 3HKCB 2PTMA 1U97A 1GKFA 3N27A 2ZNJA 2JS3A 1FXKB 2LQTA 5CN0A 4DV4O 3JARA 1AB3A 1N36B 2PI4A 3JAKA 5F2VO 3HKDB 4QIWF 2EBOA 1RM1B 2F4VO 2EIMB 3VBBA 3AG4C 3P3NA 2DYRC 4CC6A 4WFEA 3C3SA 2YEVB 2JEXA 2P6JA 3F5TA 2HHHO 1MABG 3X2QB 4ZHQB 5HFMA 5BXZA 3STZC 2XAQA 4BIOA 2QWPB 4O4HA 1AVMA 3K08A 5LMNB 2ZM6B 1SKVA 2D2CB 2YI8A 1N33O 2YIAA 1XMQO 5EK0A 4YJ2A 4JI8B 3MHHC 3IGAC 1AI7A 4H0LB 2WLHA 3TXSA 4IIJB 1O9HA 4DV6B 5H6RA 5KA6A 1JOYA 1FXVA 4JI5B 4ZI7A 1ZX3A 3JALB 2P67A 1V9PA 3MD0A 1XHZA 4IL6Z 1IBMO 1GN6A 1XMOB 3H1IH 1SA0B 3H01A 3E35A 3JASB 3LUTB 1KB9F 3K5OA 2BCCH 2AZ2A 3CRCA 2X6AA 4UCRA 3WG7B 4PA3A 1DGSA 1KU9A 4QPJA 3DXRA 1K92A 3ABLC 3K5MA 3HKEA 3ETGA 5JJJB 5BY1A 4P9OA 5JJNB 1HNXB 3BFRA 4LFAB 1HNZB 2ZDIA 5CMUA 3JD3A 5IJ0A 4KFMA 3ABKC 2Z0AA 5IWAB 2HLDG 5LOVA 4GX2A 1XEQA 1S72V 3BA8A 3CCVV 1H2GA 4LCUC 3W7WA 4H37A 1URFA 1ROPA 4UB6Z 2K1EA 1KKCA 1R6TA 4U7OA 4O4IB 4BIUA 3OW2U 1SS3A 1UPGA 1SQPH 5H2FZ 3SYQA 5LMUB 2HR3A 1SQQH 3EXAA 1Q82W 1PM9A 4ZIBA 5BMVA 4BAYA 2QWQB 4PDVA 1R6KA 2ITDC 4A5UB 3B09A 3D3QA 5LA6B 1K97A 1VEWA 3N2GB 4JYBA 2O57A 3JATA 3WU2Z 4WCEV 1Z2GA 2UU9B 2YIBA 4D7TA 1HNWO 4B3TO 4DW1A 2VQEB 2H94A 1IZ3A 5IJ9A 5EBMC 1H38A 3OMNB 1B3QA 1QQCA 3OUSA 1Q86W 4O2AB 4K0KO 3IC7A 2VQFO 4FMTA 4DV2O 1TUEB 3CSXA 4LF8B 5IT9N 2OIGA 1Y6XA 4YXWG 5CA1A 4PI2A 1QLNA 1JR9A 4O2BB 3AEIA 4J9ZB 1WJZA 3RYFB 4DR7O 2A06H 2WSSG 4CZZA 3QVNA 1NJIW 4X9QA 1F4MA 5ITZB 3A0BZ 5BR8B 2YDEA 1NQTA 2A79B 3IJ4A 5A9GA 2OTLV 2GUZA 2ZKOA 4PHZA 1T5EA 1BHBA 1V54B 3H1LH 3WB0A 1XREA 4W4KA 4LF7B 4YJ3A 2GBOA 1Q43A 2JEUA 3T1HO 2ODMA 1SQFA 3BHPA 3SPCA 2Q9LA 1PD3A 3CWBH 3IC9A 4CH4A 2UXNA 5CB4B 1SERA 3RFRA 1EZJA 1SZXA 2BTOA 4B3RB 2DWDC 3T1YO 4I0XA 1K9MW 1M1KW 2DW4A 3LDEA 3HB3B 4GKJB 2Y69C 1RP3B 3A0HZ 4JI1B 3ZHUA 4OGQB 2AGAA 1OCZB 1OZ0A 1E79G 3RYHA 4JYAB 1F23A 3AG1C 4GX5A 1W0JG 1R3IC 2JGDB 4X65O 1XI1A 4UXNA 4AQYO 3JAWA 3U10A 4GUNA 1MMMA 4GYCB 3DC5A 3LDDA 2E76B 2CE4A 1JCHA 3OE7G 4J9YB 1B6QA 4TV9A 4WFAV 5L3GA 1S76D 4W4LA 3ZMTA 3I5DA 1QR9A 2WLIB 1IBLB 2ZNIA 4UB8Z 2DYSC 4BW5A 2VS0A 2EILB 1OCCB 1SQXH 2ZR3A 4B3MO 3K03A 3L75H 3QO7A 1S5JA 1W59A 4R7CA 1N8RW 2X0LA 1N0JA 4Q20A 2LFRA 3ZJZA 3CXCU 3ASOC 4LH7A 5L3BA 3FB5C 1E1QG 2A9HA 4P30A 1SQBH 2IJHA 1Z5WA 4LFCB 1TGOA 4U7NA 2GTSA 5B1BB 1GTOA 4MVRA 5LHGA 1G6UA 1K7DA 4UV9A 2DWEC 3KZIZ 4UVBA 2XAGA 1VQMV 4DUYB 4U3JB 4B7KA 3HKDA 1FXHA 1FS0G 2EULA 2ZT9B 2B1IA 3L71H 3SYAA 4IGGA 2Q67A 1WPBA 4RUEA 4DR2O 3HR0A 3UO2A 2F1MA 4NYKA 1XNRB 1PNLA 4UV8A 1BL8A 1SF9A 4DV0O 3A0RA 1GM7A 3VQWA 3ZHTA 4IHJB 3K57A 3VQYA 5H6QA 4I55B 1QHTA 4JI2O 3BAAA 3G80A 4G2KA 1TUBB 2PYJA 5IYZB 1F51A 1CEZA 4LF4O 1ZUQA 2ZR2A 3HPLC 4IIJA 4K35A 3OM3B 3ZMVA 1WNSA 4KL1A 4K8XA 3F7VC 1XNQO 4JI3O 4MW8A 1RSOA 1BZKA 1PNKA 3RVYA 5LYJA 3ZCCA 2CDYA 3CB2A 4LP8A 3LSSA 4DR6B 2JK5C 1VQ5V 2QTSA 2ATKC 4HNAA 5H5NA 4O4LA 4J7JA 1AJNA 2XAHA 1FXKC 1KUQA 4PDMA 4JYYA 5GTHZ 2HFEC 5KHIA 1RM1C 1P7BA 3LNNA 5DM6V 2EIMC 1EFRG 4E4EA 1VQPV 1NT2B 4I4TB 2QWRB 4RO2A 4AILC 4NXNB 5J2TB 1MNGA 1TA8A 1EN6A 4KXRA 3RYIA 5FLXN 4CBCA 1L0LH 5GONB 3ZN0A 4FZ1A 2DJVA 2X6BA 4D7SA 1QR8A 1JX9A 1NVPB 3OUFA 1N36O 1SETA 2YICA 1N4CA 4XDLA 2JDIG 5JH7B 1LNQA 4JYCA 3AK2A 1OHHG 1I7FA 1GMGA 1FFXA 5JVDB 1NZ6A 3E83A 4OPHA 4JV5B 2NR5A 4LWSA 5KX5B 2IU0A 5A2QN 1QCEA 4RQEA 1D5NA 2CTPA 3KCYA 3RYCB 5LMNO 1Q8IA 2ZM6O 4NXMB 2GHYA 3SPHA 3T4ZA 4UUJC 3WG7C 2ZD9A 4JI8O 4EB6B 3ABUA 1JJOA 4K8ZA 3FAVA 4MVZA 5D5QA 4UVAA 1YVWA 4DV6O 2PUSA 4RAIA 3WFVA 1VQ7V 4JI5O 4PI0A 3D36C 4AHCA 5FNVA 3TCUA 5DEDA 3ML0A 1GK9A 1K4CC 1PL4A 1Y74B 2WLKA 5GW7A 3K9AA 4LF5B 3H1HH 4GCZA 3APQA 3AG7A 3ABMB 2WWWA 4DR4B 4NR1A 1Y4MA 4ZOLB 1UJWB 4RQFA 5IYDO 4RUFA 5ITZA 1XDCA 4X62B 4GT1A 4TV8B 2CTWA 2ZQMA 1HNXO 1M93A 1QLEC 4LFAO 3THOA 3SJQC 1HNZO 3PJSK 1Q81W 1VQNV 1M57B 3QNEA 5EYPB 5EC1C 3CJHB 2DN9A 1I5YA 5CB4A 4X1YA 2F66C 1TVKA 4H13B 3ZMUA 4X1IB 2WA3A 5J2UB 1XILA 2F43G 4CS4A 3FYIB 1GO3F 1YJWV 1W2BU 2F93B 3AK1A 4KHPB 4N21A 5CA0A 1SRYA 3CCSV 2H8PC 4UCTA 1ZWIC 5LMUO 3BABA 3OEHG 4DR5B 2IH1C 2R9IA 1N32B 2YI9A 4DRXA 4PA4A 4UFZA 5EBLC 2OT5A 2HEPA 1MOFA 3SYCA 2Y4UA 3K59A 5CBGA 4DV3B 1VQ6V 3K06A 2UU9O 1FFTB 2W0FC 3CXHF 4O4JB 3P30A 1R3JC 4JI7B 1S77D 2WLIA 3LSQA 3JSNA 2JRIA 4DK0A 4H33A 2JJ1G 3AG3B 2JGUA 2ZE5A 2P4KA 5AG2A 4LF8O 2WAMA 2Y0IA 5C93A 2WLLB 3CCEV 3CRAA 1V55B 1V54C 4GX0A 1PL0A 2ZE6A 4ZKIA 2HVKC 4JZGA 4TUYB 5CBFA 3Q4HB 3CCLV 1M4UA 2LJ2A 3N2KA 4R8CA 1BCCH 3HKBB 4DUZB 2KQXA 4UCSA 3GWOA 4UCVA 5B1NA 1XQ8A 3M8AA 2LFSA 4QGPA 1WAZA 2XUMA 3JD4A 3OGCC 4GLXA 5K1PA 5KHJA 2M6YA 5EC2C 1OCZC 1K5QA 2VRZA 4LF7O 4I7ZB 2OCHA 5JCOA 3JYCA 2CH7B 1HWYA 2W6JG 3ZRWB 2KG7B 4WFFA 4KUMA 4F6RB 1BSMA 2RCVA 4X1KB 4MTGA 4PDRA 4DXWA 4B3RO 4TWKA 4BWAA 4PV1B 2E5LB 1YTFB 4GKJO 4FZ0A 4JI1O 1WP8A 1COWG 4FJCC 3FFQA 4LNUA 4I55A 2QJ1A 2EILC 3K5NA 1OCCC 4JYAO 4X20B 1JPXA 3RW0A 4CH5A 5LP6B 4J80A 3ZEDA 2K9PA 1XMQB 1VIBA 3RVZA 3FB6C 3T4DA 3ABTA 1AROP 3T1CA 2N74A 3CP1A 4MS2A 1WLEA 3K04A 4JAAA 1Z5VA 1H2MA 4U3FH 1IBMB 1IBLO 3NR7A 3CE2A 2EJRA 3L70H 2EZOA 2RNBA 2QWNB 1VF7A 5LXTA 3QG5A 5B1BC 3GWKC 3JSLA 2QGNA 3H1KH 2Q4PA 4ABMA 2QA4V 4B08A 2V4DA 1YDXA 2L35A 5JCOC 1SQGA 3LDCA 3ZHRA 1BS3A 1GM8A 1Y76A 5B1AB 3CC7V 3F7YC 1NVPD 4LFCO 1HP8A 2BTQA 1QNMA 3M99B 5E79Z 4CS2A 4JZ2A 2BSKA 4J42A 2GV9A 4HZ3A 5DECA 2WLNA 1CPYA 1M5IA 1N0NA 1VQOV 3TGUH 4DR3O 5KHHA 3E22A 4DUYO 1Q6UA 4PA7A 3JARB 4L8JA 1YF2A 2QM8A 1JFFB 3JAKB 2IJKA 1NTMH 1P49A 1G4YB 5JH7A 3UO3A 2EIKB 3SPGA 2A3QA 2EINB 2XHBA 1VQ9V 1ZAUA 4B3SB 1XNRO 2EJ7A 1MZEA 3G71V 1FD9A 5JJEB 1B06A 5JVDA 4GKKB 5B1OA 1WN7A 4WF9V 5B3SB 4JI4B 3UM7A 1WP7A 4YHHB 1IURA 3U0ZA 2Q69A 5JQGA 1XOUA 2HJDA 2XAJA 3RYCA 4B3TB 1EZVH 5BZBA 4FPPA 2YIDA 4EFEA 1CP9A 4YJ2B 1VQ8V 5FPRA 4JI0B 2V7QG 2CTQA 4DV1B 1YEWA 4PELA 3BY6A 3C3TA 2BOBC 4QE9A 3SPJA 3O9OA 3RT3C 1N34B 4X66B 4LF9B 2X6CA 5IDJA 1K4DC 3CYOA 2ZXWB 1YZBA 3G4SV 1KP3A 2R72A 3ZN1A 2P22C 3W7TA 4X88A 4YY3O 4DR6O 1NS1A 4UCOA 3IAYA 2GSMB 1XHXA 4X8AA 1A32A 4JASA 4OX9B 1ORQC 2RQ6A 4ASUG 2OIEA 1NBMG 3W7SA 2YXLA 1QBZA 3HKCA 4I50B 4TQDA 3E86A 2Q5ZA 2B1GA 4CH6A 1FXKA 3UKMA 3OGIB 5EYPA 3ASNB 5IJ0B 2JJ2G 1Q5OA 3B4SA 4JAVA 3ETQA 1QU7A 5IY5B 3T2MA 2OCCC 2ADQB 5LOVB 4NXNO 4H44B 4LH6A 5J2UA 1SESA 3T1YB 2YEVA 1EN5A 2UXDB 1NKDA 2PGGA 1YCIA 4ICGA 3AG2B 3ETDA 4ZHQA 3MHSC 3SJCC 5LHIA 2QSAA 1IBKO 3CPWU 2UXXA 1PPJH 4EKWA 2WLJA 2ZIOA 1US6A 5BMVB 1THZA 4QJFB 5IE9A 2PI5A 1AI4A 2Q6AA 4MVSA 4TT3G 2NN4A 4NTXA 3FB8C 4MW3A 4JV5O 4JTDB 2YC0A 3JATB 3DC6A 3ZRXA 4FM2A 1LUWA 2Y69B 3JALA 5L3DA 5H9CA 5EIBC 1G8MA 2KSDA 3UQ8A 4Q6GA 3ABMC 4R6ZA 4NXMO 1SA0A 1CXZB 1FJGB 1NTZH 1Q6IA 3DGEA 5IJ9B 3ZHSA 1J95A 1PNMA 3JASA 4NKGB 1R6NA 3ZMZA 2Y4TA 1L8DA 1VQKV 3L72H 2ZE7A 2LGQA 2WPDG 4JAUA 1K8AW 4FLWA 3SGIA 4LF6B 2QKAA 1M57C 1JJ2U 5KHGA 1YJ9V 3D36A 4LF5O 2EIJB 4XDKA 4X64B 2Y48A 3VOUA 2DYSB 3B2EE 1VQ4V 4DR4O 2ARHA 2RN9A 4P9PA 1H2LA 4FFBB 4FIPC 1I94B 5KUKA 2B9ZA 1D2DA 4FLUA 4QNHB 2YSUB 1JQ0A 3X2QC 2JIZG 3ZX6A 3RN4A 3OR7C 2GUZB 4DV5B 5B66Z 2Q73A 3OMIB 4O4IA 4YJ3B 1OCOB 2CH7A 3PN1A 5LHHA 3E8HA 4BR6A 1MSWD 2KG7A 2UUBB 4LR3A 1SC5B 2QM7A 4DR1B 3VQVA 2ETNA 5FPOA 3A2FA 2Q0AA 3C90A 1AJPA 4GX1A 3SPIA 4TOIA 2UUAB 5LA6A 4J7ZA 3STLC 1GH6A 2W6IG 3N2GA 2XT9A 4KHPO 4D6TH 1NTKH 3AG3C 3CMAV 4DR5O 2RJZA 1N32O 3CCQV 2LW7A 1UFIA 2H3OA 4FM1A 1ZTEA 2ZINA 1P7GA 1V55C 2WA4A 4O2AA 4DV3O 5B5EZ 3ZS8C 1Q3EA 1OCRB 2HG5C 4NTYA 4TV9B 4FLXA 1QVGU 3K0GA 1FAFA 2XOKG 4JI7O 1F7YA 1VF6C 4MSWC 1IVSA 1XMOO 3RWRD 3H1JH 3OAAG 3BEHA 4O2BA 3RGBA 3RYFA 1PV0A 2HJFC 3GB7C 3QTCA 5HFLA 4XDJA 3CRRA 3SJBC 3G6EV 1WA8B 3OEEG 2XAFA 3DTUB 1BHAA 2Z3YA 2YS8A 4LBEC 1XUQA 1HR0B 4Z1MG 2XASA 3ZRVA 1GN4A 4DUZO 2VWKA 5IWAO 5LL6Y 4NVPA 4MVQA 4JTCB 2E75B 2FTKA 3M7MX 1MG1A 5KMGB 4FLZA 5LGTA 4DV7B 4LFBB 1R3LC 5FL7G 1JFFA 3K79A 2IU3A 5LP6C 2DE0X 4MVMA 2M7WA 2QM4A 2L6LA 4JGSA 1GM9A 1I0HA 1S5HC 2XNDG 2JGDA 1NR1A 2CUGA 3JD0A 2EX3A 2E5LO 5EZYB 1AP6A 1NH2B 4K3AA 4HAMA 3OTOB 1J5EB 3F5WC 3GVMA 1OV9A 4FVMA 3QF7A 1K73W 2LGWA 5IYBO 1KKDA
chains in the Genus database with same CATH topology
2FYUH 1NTMH 2A06H 3BCCH 2IBZH 3H1IH 1SQVH 1BGYH 3CWBH 1EZVH 3H1KH 1KB9F 3CX5F 4D6TH 1NTKH 2BCCH 1BCCH 1P84F 3L72H 1L0NH 1SQPH 4PD4F 3L73H 1BE3H 1NU1H 3H1JH 5KLVH 1SQXH 4U3FH 1SQBH 3H1HH 1SQQH 3TGUH 3L75H 3CXHF 3L71H 3H1LH 1PPJH 1L0LH 1PP9H 3L74H 3L70H 1KYOF 1NTZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU H;  1NTM H;  2A06 H;  3BCC H;  2IBZ H;  3H1I H;  1SQV H;  1BGY H;  3CWB H;  1EZV H;  3H1K H;  1KB9 F;  3CX5 F;  4D6T H;  1NTK H;  2BCC H;  1BCC H;  1P84 F;  3L72 H;  1L0N H;  1SQP H;  4PD4 F;  3L73 H;  1BE3 H;  1NU1 H;  3H1J H;  5KLV H;  1SQX H;  4U3F H;  1SQB H;  3H1H H;  1SQQ H;  3TGU H;  3L75 H;  3CXH F;  3L71 H;  3H1L H;  1PPJ H;  1L0L H;  1PP9 H;  3L74 H;  3L70 H;  1KYO F;  1NTZ H; 
#chains in the Genus database with same CATH topology
 5CBH A;  2W0X A;  2VQE O;  1XL4 A;  2ILM A;  4WFH A;  3W7X A;  3CD6 V;  1NR7 A;  2CGN A;  4CS3 A;  2VWJ A;  1BQZ A;  2QWO B;  4X89 A;  3CCU V;  1K33 A;  3ICX A;  1TAE A;  2AHZ A;  2Q7H A;  1HW7 A;  3SDL A;  5C8Y B;  1BMF G;  1KMI Z;  3U11 A;  1RSO B;  4XBF A;  4UCU A;  3I55 V;  3BPZ A;  4GZR B;  5B1A C;  4JI6 B;  5LYJ B;  3ZIA G;  2DOS A;  2JVD A;  4PJ0 Z;  4EEQ A;  1MSD A;  1RFY A;  2LW1 A;  3EVK A;  1JA8 A;  3KKY A;  4WBN B;  4HNA B;  4O4L B;  1YXB A;  2P06 A;  1JMK C;  5BR8 O;  4I50 A;  2UXB B;  2UUC B;  2PZS A;  2UXC B;  4B7E A;  1DF5 A;  4PA9 A;  2IW5 A;  2ZE8 A;  3S3X A;  1M56 B;  1ZL8 B;  4U3J A;  2EIK C;  5CA3 A;  4DV4 B;  2RMK B;  3R66 A;  2EIN C;  1Y67 A;  1NI8 A;  3JD1 A;  1YI2 V;  4MTF A;  5KHK A;  1H2S B;  1YSC A;  2A0L A;  2QE7 G;  2F4V B;  1XBL A;  3CC4 V;  1VQL V;  2IM9 A;  3SJA C;  5B3S C;  3RYI B;  3OMA B;  2FYU H;  2OYQ A;  2HHH B;  4FLV A;  1WB8 A;  4KP4 A;  2GDS A;  4IHJ A;  3TJT A;  3LSU A;  4FLT A;  4OPA A;  1VF5 B;  3JD2 A;  3AK3 A;  1QLE B;  3CRQ A;  3OR6 C;  1R3K C;  2YIB D;  3CEI A;  4PA6 A;  4YIO A;  1EM1 A;  1HDJ A;  1TUB A;  4B3S O;  4BIZ A;  2CK3 G;  4FLY A;  2IJJ A;  5IYZ A;  1N33 B;  4F4L A;  1FFX B;  3AG4 B;  1H8E G;  3W7U A;  1SQV H;  4GKK O;  2ZXW C;  2DYR B;  4JI4 O;  1R73 A;  5E1A C;  4YHH O;  4LWS B;  4WFG A;  1YJN V;  1W0K G;  3TK1 A;  2KB1 A;  3DSQ A;  4PD4 F;  3L73 H;  2Z5U A;  2LP7 A;  4NTW A;  3I56 V;  4IT5 A;  2ZCE A;  4JI0 O;  4DV1 O;  3BCC H;  3FAV B;  2R70 A;  1AIL A;  3SYO A;  1D5A A;  2CAZ C;  1KBH A;  4J10 A;  3ZMS A;  1N34 O;  4X66 O;  4LF9 O;  1E1R G;  3UCS C;  4E2L A;  2QR4 A;  5FNV B;  1AJQ A;  2ZDI C;  3ASN C;  3B77 A;  2AW9 A;  3B8M A;  3OFN G;  4FK5 C;  2QTO A;  5IY5 C;  1G1X B;  1GAX A;  2RDC A;  4FFK A;  4Z1V A;  1BT8 A;  3ZHQ A;  1H2N A;  4I4T A;  4FFB A;  4MTX A;  4YIP A;  4OX9 O;  3J81 N;  1AI6 A;  3ETE A;  5J2T A;  3UT5 B;  2BE3 A;  3EFF K;  3WB1 A;  1MZF A;  3AG2 C;  1WPX A;  1JVM A;  3APO A;  4JPR A;  5DN6 G;  4G27 B;  5GON A;  3J80 N;  1LR1 A;  5KUM A;  3ABL B;  1L1F A;  2LO1 A;  3CME V;  4I9W A;  1OJH A;  3E8F A;  3SYP A;  3SR2 C;  4X1Y B;  1FKA O;  1TVK B;  3IFX A;  2PY5 A;  2WLM A;  3K5L A;  3ABK B;  4WFB V;  2UXD O;  2DQ3 A;  3QO5 A;  1RPR A;  4OXS A;  3G67 A;  1KD1 W;  5KX5 A;  3OD4 A;  4J11 A;  4DW0 A;  5L3F A;  3K3W A;  5CA0 B;  2ADP A;  1HNW B;  4O4H B;  2HP8 A;  2Q68 A;  2FML A;  4TSF G;  4DRX B;  4F6E A;  1NU1 H;  2ZIM A;  2AZ0 A;  4EB6 A;  4EFB A;  2B5U A;  1Q7Y W;  4K0K B;  5EIB D;  4I9Q A;  2VQF B;  4MVO A;  4MT8 A;  4DV2 B;  5K1X A;  1I5X A;  2QKS A;  3B40 A;  2EIJ C;  4ZI7 B;  3E2E A;  2X7R B;  3E8G A;  3LNM B;  4BW9 A;  1FJG O;  1Y74 A;  2DMX A;  1YHQ V;  1P4R A;  1MA1 A;  1VAR A;  1BQ0 A;  5L3C A;  4DO2 A;  5KLV H;  4PDL A;  4DR7 B;  4ZOL A;  3FX7 A;  1WA8 A;  1DF4 A;  2MK3 A;  3B8N A;  2C2A A;  4C7U A;  3DXR B;  4LF6 O;  2N04 A;  1OCO C;  2E3C A;  3HKE B;  3ZRS A;  1KC8 W;  4TV8 A;  1KP2 A;  4I5S A;  5LBQ A;  2BOC C;  4X64 O;  1ENV A;  1IXB A;  3N2K B;  3T1H B;  3CJH A;  3S3W A;  2OTJ V;  3ZBH A;  1PKX A;  5GTI Z;  1IDS A;  5KAF Z;  4QPK A;  1I94 O;  4LC1 A;  4X1I A;  3TXQ A;  2F23 A;  5KMG A;  3CRM A;  1VP7 A;  4J7K A;  4DV5 O;  2EZP A;  2F95 B;  2JS5 A;  1AI5 A;  4DR3 B;  2XTA A;  4N23 A;  1P84 F;  4L87 A;  1X59 A;  2R9R B;  4JTA B;  1NH2 D;  5EBW C;  1AP5 A;  2UUB O;  1Q6H A;  2CTR A;  3ZHV A;  4G28 B;  4DR1 O;  3OTF A;  4TQF A;  4CC5 A;  1Y66 A;  3BA9 A;  4MVU A;  1GRJ A;  5JWP A;  1EBO A;  1EN4 A;  4X65 B;  2ITC C;  2UUA O;  5EZY A;  4AQY B;  1OCR C;  2P7T C;  3O65 A;  2N05 A;  3G6B A;  4HBN A;  4JF3 A;  4O4J A;  2Q7G A;  4LNU B;  1KEC A;  2Y0P A;  2PF4 E;  1F4N A;  3K58 A;  1FPO A;  1QVF U;  3CCM V;  1PP9 H;  3L74 H;  1R1B A;  4IYH A;  3WB2 A;  3J7A U;  2AXT Z;  3K9S A;  2YXH A;  2HKO A;  1SZT A;  3AG1 B;  1AR1 B;  4B3M B;  3D3I A;  5LGU A;  2FL4 A;  2KKW A;  4DK1 A;  2WLL A;  3H9V A;  1U96 A;  5C8Y A;  5LGN A;  4P2Z A;  1AR5 A;  4TUY A;  5CA1 B;  1ZSP A;  3OT7 A;  3Q4H A;  3JAM N;  1AR4 A;  2IH3 C;  3MDS A;  1Q90 D;  2NLJ C;  4YY3 B;  1VF6 A;  1DK1 A;  3VQX A;  5LXT B;  2Q8V A;  3HKB A;  4WBN A;  3FD9 A;  2YUA A;  1K34 A;  4HYO A;  2HVJ C;  2GTA A;  4X62 O;  3FB7 C;  2FB5 A;  4R50 A;  2Q7E A;  1HR0 O;  1KYO F;  1S0V A;  2IJI A;  1ZL8 A;  2V1D A;  1LUV A;  1ZLZ A;  1BGY H;  1YTF D;  2G38 A;  1Y76 B;  3ASO B;  3ZRW A;  4F6R A;  3CX5 F;  2BTQ B;  4QE7 A;  3CCJ V;  1YIJ V;  4X1K A;  4DR2 B;  2BSK B;  2NNU A;  3RBZ A;  1B04 A;  4I0X B;  4DV7 O;  2P5O A;  1VMG A;  4DV0 B;  4LFB O;  4FM0 A;  3E22 B;  1XL6 A;  1GN3 A;  3FKS G;  2PYL A;  3P32 A;  2R9A A;  4MTO A;  1KQS U;  1O9G A;  1IBK B;  3RYH B;  3KCX A;  1IXM A;  1L0N H;  3NXS A;  4X20 A;  4JI2 B;  3CS5 A;  1H2K A;  3FYE B;  5LP6 A;  5IYC O;  2OCC B;  2Q0O C;  2YXY A;  3A8T A;  4IYI A;  1S5L Z;  2P4V A;  3JAW B;  4LF4 B;  3E8B A;  4CH3 A;  5L3E A;  1S3J A;  1DLB A;  3OTO O;  2D3O W;  2CGO A;  1J5E O;  1GN2 A;  3R65 A;  2P90 A;  3L9D A;  2OWO A;  5D5P A;  5JQG B;  1FYJ A;  4AI8 A;  3QO8 A;  3MAQ A;  2DQ0 A;  1XNQ B;  4JI3 B;  3JCZ A;  1YIT V;  1BE3 H;  3JCU Z;  3D8C A;  5KAI Z;  3KG2 A;  3CCR V;  2A7W A;  4NB5 A;  1H8H G;  2AHY A;  2QEX V;  4RWU A;  4DYL A;  5TIS Z;  1M56 C;  2E74 B;  1IX9 A;  4J41 A;  4ZBM A;  3E89 A;  1M90 W;  1I08 A;  2QDO A;  3CC2 V;  3CHX A;  4JI6 O;  2MW2 B;  2FKX A;  1RPO A;  3EHB B;  1DTO A;  2QKC A;  3BVO A;  1M9N A;  3P3P A;  5J9P C;  2IBZ H;  5KA5 A;  3UT5 A;  1X4T A;  4Z2W A;  3K0D A;  4UVC A;  1WB7 A;  3TET A;  3BRC A;  1K3E A;  2UUC O;  2UXB O;  2UXC O;  1K5S A;  3HKC B;  2PTM A;  1U97 A;  1GKF A;  3N27 A;  2ZNJ A;  2JS3 A;  1FXK B;  2LQT A;  5CN0 A;  4DV4 O;  3JAR A;  1AB3 A;  1N36 B;  2PI4 A;  3JAK A;  5F2V O;  3HKD B;  4QIW F;  2EBO A;  1RM1 B;  2F4V O;  2EIM B;  3VBB A;  3AG4 C;  3P3N A;  2DYR C;  4CC6 A;  4WFE A;  3C3S A;  2YEV B;  2JEX A;  2P6J A;  3F5T A;  2HHH O;  1MAB G;  3X2Q B;  4ZHQ B;  5HFM A;  5BXZ A;  3STZ C;  2XAQ A;  4BIO A;  2QWP B;  4O4H A;  1AVM A;  3K08 A;  5LMN B;  2ZM6 B;  1SKV A;  2D2C B;  2YI8 A;  1N33 O;  2YIA A;  1XMQ O;  5EK0 A;  4YJ2 A;  4JI8 B;  3MHH C;  3IGA C;  1AI7 A;  4H0L B;  2WLH A;  3TXS A;  4IIJ B;  1O9H A;  4DV6 B;  5H6R A;  5KA6 A;  1JOY A;  1FXV A;  4JI5 B;  4ZI7 A;  1ZX3 A;  3JAL B;  2P67 A;  1V9P A;  3MD0 A;  1XHZ A;  4IL6 Z;  1IBM O;  1GN6 A;  1XMO B;  3H1I H;  1SA0 B;  3H01 A;  3E35 A;  3JAS B;  3LUT B;  1KB9 F;  3K5O A;  2BCC H;  2AZ2 A;  3CRC A;  2X6A A;  4UCR A;  3WG7 B;  4PA3 A;  1DGS A;  1KU9 A;  4QPJ A;  3DXR A;  1K92 A;  3ABL C;  3K5M A;  3HKE A;  3ETG A;  5JJJ B;  5BY1 A;  4P9O A;  5JJN B;  1HNX B;  3BFR A;  4LFA B;  1HNZ B;  2ZDI A;  5CMU A;  3JD3 A;  5IJ0 A;  4KFM A;  3ABK C;  2Z0A A;  5IWA B;  2HLD G;  5LOV A;  4GX2 A;  1XEQ A;  1S72 V;  3BA8 A;  3CCV V;  1H2G A;  4LCU C;  3W7W A;  4H37 A;  1URF A;  1ROP A;  4UB6 Z;  2K1E A;  1KKC A;  1R6T A;  4U7O A;  4O4I B;  4BIU A;  3OW2 U;  1SS3 A;  1UPG A;  1SQP H;  5H2F Z;  3SYQ A;  5LMU B;  2HR3 A;  1SQQ H;  3EXA A;  1Q82 W;  1PM9 A;  4ZIB A;  5BMV A;  4BAY A;  2QWQ B;  4PDV A;  1R6K A;  2ITD C;  4A5U B;  3B09 A;  3D3Q A;  5LA6 B;  1K97 A;  1VEW A;  3N2G B;  4JYB A;  2O57 A;  3JAT A;  3WU2 Z;  4WCE V;  1Z2G A;  2UU9 B;  2YIB A;  4D7T A;  1HNW O;  4B3T O;  4DW1 A;  2VQE B;  2H94 A;  1IZ3 A;  5IJ9 A;  5EBM C;  1H38 A;  3OMN B;  1B3Q A;  1QQC A;  3OUS A;  1Q86 W;  4O2A B;  4K0K O;  3IC7 A;  2VQF O;  4FMT A;  4DV2 O;  1TUE B;  3CSX A;  4LF8 B;  5IT9 N;  2OIG A;  1Y6X A;  4YXW G;  5CA1 A;  4PI2 A;  1QLN A;  1JR9 A;  4O2B B;  3AEI A;  4J9Z B;  1WJZ A;  3RYF B;  4DR7 O;  2A06 H;  2WSS G;  4CZZ A;  3QVN A;  1NJI W;  4X9Q A;  1F4M A;  5ITZ B;  3A0B Z;  5BR8 B;  2YDE A;  1NQT A;  2A79 B;  3IJ4 A;  5A9G A;  2OTL V;  2GUZ A;  2ZKO A;  4PHZ A;  1T5E A;  1BHB A;  1V54 B;  3H1L H;  3WB0 A;  1XRE A;  4W4K A;  4LF7 B;  4YJ3 A;  2GBO A;  1Q43 A;  2JEU A;  3T1H O;  2ODM A;  1SQF A;  3BHP A;  3SPC A;  2Q9L A;  1PD3 A;  3CWB H;  3IC9 A;  4CH4 A;  2UXN A;  5CB4 B;  1SER A;  3RFR A;  1EZJ A;  1SZX A;  2BTO A;  4B3R B;  2DWD C;  3T1Y O;  4I0X A;  1K9M W;  1M1K W;  2DW4 A;  3LDE A;  3HB3 B;  4GKJ B;  2Y69 C;  1RP3 B;  3A0H Z;  4JI1 B;  3ZHU A;  4OGQ B;  2AGA A;  1OCZ B;  1OZ0 A;  1E79 G;  3RYH A;  4JYA B;  1F23 A;  3AG1 C;  4GX5 A;  1W0J G;  1R3I C;  2JGD B;  4X65 O;  1XI1 A;  4UXN A;  4AQY O;  3JAW A;  3U10 A;  4GUN A;  1MMM A;  4GYC B;  3DC5 A;  3LDD A;  2E76 B;  2CE4 A;  1JCH A;  3OE7 G;  4J9Y B;  1B6Q A;  4TV9 A;  4WFA V;  5L3G A;  1S76 D;  4W4L A;  3ZMT A;  3I5D A;  1QR9 A;  2WLI B;  1IBL B;  2ZNI A;  4UB8 Z;  2DYS C;  4BW5 A;  2VS0 A;  2EIL B;  1OCC B;  1SQX H;  2ZR3 A;  4B3M O;  3K03 A;  3L75 H;  3QO7 A;  1S5J A;  1W59 A;  4R7C A;  1N8R W;  2X0L A;  1N0J A;  4Q20 A;  2LFR A;  3ZJZ A;  3CXC U;  3ASO C;  4LH7 A;  5L3B A;  3FB5 C;  1E1Q G;  2A9H A;  4P30 A;  1SQB H;  2IJH A;  1Z5W A;  4LFC B;  1TGO A;  4U7N A;  2GTS A;  5B1B B;  1GTO A;  4MVR A;  5LHG A;  1G6U A;  1K7D A;  4UV9 A;  2DWE C;  3KZI Z;  4UVB A;  2XAG A;  1VQM V;  4DUY B;  4U3J B;  4B7K A;  3HKD A;  1FXH A;  1FS0 G;  2EUL A;  2ZT9 B;  2B1I A;  3L71 H;  3SYA A;  4IGG A;  2Q67 A;  1WPB A;  4RUE A;  4DR2 O;  3HR0 A;  3UO2 A;  2F1M A;  4NYK A;  1XNR B;  1PNL A;  4UV8 A;  1BL8 A;  1SF9 A;  4DV0 O;  3A0R A;  1GM7 A;  3VQW A;  3ZHT A;  4IHJ B;  3K57 A;  3VQY A;  5H6Q A;  4I55 B;  1QHT A;  4JI2 O;  3BAA A;  3G80 A;  4G2K A;  1TUB B;  2PYJ A;  5IYZ B;  1F51 A;  1CEZ A;  4LF4 O;  1ZUQ A;  2ZR2 A;  3HPL C;  4IIJ A;  4K35 A;  3OM3 B;  3ZMV A;  1WNS A;  4KL1 A;  4K8X A;  3F7V C;  1XNQ O;  4JI3 O;  4MW8 A;  1RSO A;  1BZK A;  1PNK A;  3RVY A;  5LYJ A;  3ZCC A;  2CDY A;  3CB2 A;  4LP8 A;  3LSS A;  4DR6 B;  2JK5 C;  1VQ5 V;  2QTS A;  2ATK C;  4HNA A;  5H5N A;  4O4L A;  4J7J A;  1AJN A;  2XAH A;  1FXK C;  1KUQ A;  4PDM A;  4JYY A;  5GTH Z;  2HFE C;  5KHI A;  1RM1 C;  1P7B A;  3LNN A;  5DM6 V;  2EIM C;  1EFR G;  4E4E A;  1VQP V;  1NT2 B;  4I4T B;  2QWR B;  4RO2 A;  4AIL C;  4NXN B;  5J2T B;  1MNG A;  1TA8 A;  1EN6 A;  4KXR A;  3RYI A;  5FLX N;  4CBC A;  1L0L H;  5GON B;  3ZN0 A;  4FZ1 A;  2DJV A;  2X6B A;  4D7S A;  1QR8 A;  1JX9 A;  1NVP B;  3OUF A;  1N36 O;  1SET A;  2YIC A;  1N4C A;  4XDL A;  2JDI G;  5JH7 B;  1LNQ A;  4JYC A;  3AK2 A;  1OHH G;  1I7F A;  1GMG A;  1FFX A;  5JVD B;  1NZ6 A;  3E83 A;  4OPH A;  4JV5 B;  2NR5 A;  4LWS A;  5KX5 B;  2IU0 A;  5A2Q N;  1QCE A;  4RQE A;  1D5N A;  2CTP A;  3KCY A;  3RYC B;  5LMN O;  1Q8I A;  2ZM6 O;  4NXM B;  2GHY A;  3SPH A;  3T4Z A;  4UUJ C;  3WG7 C;  2ZD9 A;  4JI8 O;  4EB6 B;  3ABU A;  1JJO A;  4K8Z A;  3FAV A;  4MVZ A;  5D5Q A;  4UVA A;  1YVW A;  4DV6 O;  2PUS A;  4RAI A;  3WFV A;  1VQ7 V;  4JI5 O;  4PI0 A;  3D36 C;  4AHC A;  5FNV A;  3TCU A;  5DED A;  3ML0 A;  1GK9 A;  1K4C C;  1PL4 A;  1Y74 B;  2WLK A;  5GW7 A;  3K9A A;  4LF5 B;  3H1H H;  4GCZ A;  3APQ A;  3AG7 A;  3ABM B;  2WWW A;  4DR4 B;  4NR1 A;  1Y4M A;  4ZOL B;  1UJW B;  4RQF A;  5IYD O;  4RUF A;  5ITZ A;  1XDC A;  4X62 B;  4GT1 A;  4TV8 B;  2CTW A;  2ZQM A;  1HNX O;  1M93 A;  1QLE C;  4LFA O;  3THO A;  3SJQ C;  1HNZ O;  3PJS K;  1Q81 W;  1VQN V;  1M57 B;  3QNE A;  5EYP B;  5EC1 C;  3CJH B;  2DN9 A;  1I5Y A;  5CB4 A;  4X1Y A;  2F66 C;  1TVK A;  4H13 B;  3ZMU A;  4X1I B;  2WA3 A;  5J2U B;  1XIL A;  2F43 G;  4CS4 A;  3FYI B;  1GO3 F;  1YJW V;  1W2B U;  2F93 B;  3AK1 A;  4KHP B;  4N21 A;  5CA0 A;  1SRY A;  3CCS V;  2H8P C;  4UCT A;  1ZWI C;  5LMU O;  3BAB A;  3OEH G;  4DR5 B;  2IH1 C;  2R9I A;  1N32 B;  2YI9 A;  4DRX A;  4PA4 A;  4UFZ A;  5EBL C;  2OT5 A;  2HEP A;  1MOF A;  3SYC A;  2Y4U A;  3K59 A;  5CBG A;  4DV3 B;  1VQ6 V;  3K06 A;  2UU9 O;  1FFT B;  2W0F C;  3CXH F;  4O4J B;  3P30 A;  1R3J C;  4JI7 B;  1S77 D;  2WLI A;  3LSQ A;  3JSN A;  2JRI A;  4DK0 A;  4H33 A;  2JJ1 G;  3AG3 B;  2JGU A;  2ZE5 A;  2P4K A;  5AG2 A;  4LF8 O;  2WAM A;  2Y0I A;  5C93 A;  2WLL B;  3CCE V;  3CRA A;  1V55 B;  1V54 C;  4GX0 A;  1PL0 A;  2ZE6 A;  4ZKI A;  2HVK C;  4JZG A;  4TUY B;  5CBF A;  3Q4H B;  3CCL V;  1M4U A;  2LJ2 A;  3N2K A;  4R8C A;  1BCC H;  3HKB B;  4DUZ B;  2KQX A;  4UCS A;  3GWO A;  4UCV A;  5B1N A;  1XQ8 A;  3M8A A;  2LFS A;  4QGP A;  1WAZ A;  2XUM A;  3JD4 A;  3OGC C;  4GLX A;  5K1P A;  5KHJ A;  2M6Y A;  5EC2 C;  1OCZ C;  1K5Q A;  2VRZ A;  4LF7 O;  4I7Z B;  2OCH A;  5JCO A;  3JYC A;  2CH7 B;  1HWY A;  2W6J G;  3ZRW B;  2KG7 B;  4WFF A;  4KUM A;  4F6R B;  1BSM A;  2RCV A;  4X1K B;  4MTG A;  4PDR A;  4DXW A;  4B3R O;  4TWK A;  4BWA A;  4PV1 B;  2E5L B;  1YTF B;  4GKJ O;  4FZ0 A;  4JI1 O;  1WP8 A;  1COW G;  4FJC C;  3FFQ A;  4LNU A;  4I55 A;  2QJ1 A;  2EIL C;  3K5N A;  1OCC C;  4JYA O;  4X20 B;  1JPX A;  3RW0 A;  4CH5 A;  5LP6 B;  4J80 A;  3ZED A;  2K9P A;  1XMQ B;  1VIB A;  3RVZ A;  3FB6 C;  3T4D A;  3ABT A;  1ARO P;  3T1C A;  2N74 A;  3CP1 A;  4MS2 A;  1WLE A;  3K04 A;  4JAA A;  1Z5V A;  1H2M A;  4U3F H;  1IBM B;  1IBL O;  3NR7 A;  3CE2 A;  2EJR A;  3L70 H;  2EZO A;  2RNB A;  2QWN B;  1VF7 A;  5LXT A;  3QG5 A;  5B1B C;  3GWK C;  3JSL A;  2QGN A;  3H1K H;  2Q4P A;  4ABM A;  2QA4 V;  4B08 A;  2V4D A;  1YDX A;  2L35 A;  5JCO C;  1SQG A;  3LDC A;  3ZHR A;  1BS3 A;  1GM8 A;  1Y76 A;  5B1A B;  3CC7 V;  3F7Y C;  1NVP D;  4LFC O;  1HP8 A;  2BTQ A;  1QNM A;  3M99 B;  5E79 Z;  4CS2 A;  4JZ2 A;  2BSK A;  4J42 A;  2GV9 A;  4HZ3 A;  5DEC A;  2WLN A;  1CPY A;  1M5I A;  1N0N A;  1VQO V;  3TGU H;  4DR3 O;  5KHH A;  3E22 A;  4DUY O;  1Q6U A;  4PA7 A;  3JAR B;  4L8J A;  1YF2 A;  2QM8 A;  1JFF B;  3JAK B;  2IJK A;  1NTM H;  1P49 A;  1G4Y B;  5JH7 A;  3UO3 A;  2EIK B;  3SPG A;  2A3Q A;  2EIN B;  2XHB A;  1VQ9 V;  1ZAU A;  4B3S B;  1XNR O;  2EJ7 A;  1MZE A;  3G71 V;  1FD9 A;  5JJE B;  1B06 A;  5JVD A;  4GKK B;  5B1O A;  1WN7 A;  4WF9 V;  5B3S B;  4JI4 B;  3UM7 A;  1WP7 A;  4YHH B;  1IUR A;  3U0Z A;  2Q69 A;  5JQG A;  1XOU A;  2HJD A;  2XAJ A;  3RYC A;  4B3T B;  1EZV H;  5BZB A;  4FPP A;  2YID A;  4EFE A;  1CP9 A;  4YJ2 B;  1VQ8 V;  5FPR A;  4JI0 B;  2V7Q G;  2CTQ A;  4DV1 B;  1YEW A;  4PEL A;  3BY6 A;  3C3T A;  2BOB C;  4QE9 A;  3SPJ A;  3O9O A;  3RT3 C;  1N34 B;  4X66 B;  4LF9 B;  2X6C A;  5IDJ A;  1K4D C;  3CYO A;  2ZXW B;  1YZB A;  3G4S V;  1KP3 A;  2R72 A;  3ZN1 A;  2P22 C;  3W7T A;  4X88 A;  4YY3 O;  4DR6 O;  1NS1 A;  4UCO A;  3IAY A;  2GSM B;  1XHX A;  4X8A A;  1A32 A;  4JAS A;  4OX9 B;  1ORQ C;  2RQ6 A;  4ASU G;  2OIE A;  1NBM G;  3W7S A;  2YXL A;  1QBZ A;  3HKC A;  4I50 B;  4TQD A;  3E86 A;  2Q5Z A;  2B1G A;  4CH6 A;  1FXK A;  3UKM A;  3OGI B;  5EYP A;  3ASN B;  5IJ0 B;  2JJ2 G;  1Q5O A;  3B4S A;  4JAV A;  3ETQ A;  1QU7 A;  5IY5 B;  3T2M A;  2OCC C;  2ADQ B;  5LOV B;  4NXN O;  4H44 B;  4LH6 A;  5J2U A;  1SES A;  3T1Y B;  2YEV A;  1EN5 A;  2UXD B;  1NKD A;  2PGG A;  1YCI A;  4ICG A;  3AG2 B;  3ETD A;  4ZHQ A;  3MHS C;  3SJC C;  5LHI A;  2QSA A;  1IBK O;  3CPW U;  2UXX A;  1PPJ H;  4EKW A;  2WLJ A;  2ZIO A;  1US6 A;  5BMV B;  1THZ A;  4QJF B;  5IE9 A;  2PI5 A;  1AI4 A;  2Q6A A;  4MVS A;  4TT3 G;  2NN4 A;  4NTX A;  3FB8 C;  4MW3 A;  4JV5 O;  4JTD B;  2YC0 A;  3JAT B;  3DC6 A;  3ZRX A;  4FM2 A;  1LUW A;  2Y69 B;  3JAL A;  5L3D A;  5H9C A;  5EIB C;  1G8M A;  2KSD A;  3UQ8 A;  4Q6G A;  3ABM C;  4R6Z A;  4NXM O;  1SA0 A;  1CXZ B;  1FJG B;  1NTZ H;  1Q6I A;  3DGE A;  5IJ9 B;  3ZHS A;  1J95 A;  1PNM A;  3JAS A;  4NKG B;  1R6N A;  3ZMZ A;  2Y4T A;  1L8D A;  1VQK V;  3L72 H;  2ZE7 A;  2LGQ A;  2WPD G;  4JAU A;  1K8A W;  4FLW A;  3SGI A;  4LF6 B;  2QKA A;  1M57 C;  1JJ2 U;  5KHG A;  1YJ9 V;  3D36 A;  4LF5 O;  2EIJ B;  4XDK A;  4X64 B;  2Y48 A;  3VOU A;  2DYS B;  3B2E E;  1VQ4 V;  4DR4 O;  2ARH A;  2RN9 A;  4P9P A;  1H2L A;  4FFB B;  4FIP C;  1I94 B;  5KUK A;  2B9Z A;  1D2D A;  4FLU A;  4QNH B;  2YSU B;  1JQ0 A;  3X2Q C;  2JIZ G;  3ZX6 A;  3RN4 A;  3OR7 C;  2GUZ B;  4DV5 B;  5B66 Z;  2Q73 A;  3OMI B;  4O4I A;  4YJ3 B;  1OCO B;  2CH7 A;  3PN1 A;  5LHH A;  3E8H A;  4BR6 A;  1MSW D;  2KG7 A;  2UUB B;  4LR3 A;  1SC5 B;  2QM7 A;  4DR1 B;  3VQV A;  2ETN A;  5FPO A;  3A2F A;  2Q0A A;  3C90 A;  1AJP A;  4GX1 A;  3SPI A;  4TOI A;  2UUA B;  5LA6 A;  4J7Z A;  3STL C;  1GH6 A;  2W6I G;  3N2G A;  2XT9 A;  4KHP O;  4D6T H;  1NTK H;  3AG3 C;  3CMA V;  4DR5 O;  2RJZ A;  1N32 O;  3CCQ V;  2LW7 A;  1UFI A;  2H3O A;  4FM1 A;  1ZTE A;  2ZIN A;  1P7G A;  1V55 C;  2WA4 A;  4O2A A;  4DV3 O;  5B5E Z;  3ZS8 C;  1Q3E A;  1OCR B;  2HG5 C;  4NTY A;  4TV9 B;  4FLX A;  1QVG U;  3K0G A;  1FAF A;  2XOK G;  4JI7 O;  1F7Y A;  1VF6 C;  4MSW C;  1IVS A;  1XMO O;  3RWR D;  3H1J H;  3OAA G;  3BEH A;  4O2B A;  3RGB A;  3RYF A;  1PV0 A;  2HJF C;  3GB7 C;  3QTC A;  5HFL A;  4XDJ A;  3CRR A;  3SJB C;  3G6E V;  1WA8 B;  3OEE G;  2XAF A;  3DTU B;  1BHA A;  2Z3Y A;  2YS8 A;  4LBE C;  1XUQ A;  1HR0 B;  4Z1M G;  2XAS A;  3ZRV A;  1GN4 A;  4DUZ O;  2VWK A;  5IWA O;  5LL6 Y;  4NVP A;  4MVQ A;  4JTC B;  2E75 B;  2FTK A;  3M7M X;  1MG1 A;  5KMG B;  4FLZ A;  5LGT A;  4DV7 B;  4LFB B;  1R3L C;  5FL7 G;  1JFF A;  3K79 A;  2IU3 A;  5LP6 C;  2DE0 X;  4MVM A;  2M7W A;  2QM4 A;  2L6L A;  4JGS A;  1GM9 A;  1I0H A;  1S5H C;  2XND G;  2JGD A;  1NR1 A;  2CUG A;  3JD0 A;  2EX3 A;  2E5L O;  5EZY B;  1AP6 A;  1NH2 B;  4K3A A;  4HAM A;  3OTO B;  1J5E B;  3F5W C;  3GVM A;  1OV9 A;  4FVM A;  3QF7 A;  1K73 W;  2LGW A;  5IYB O;  1KKD A; 
#chains in the Genus database with same CATH homology
 2FYU H;  1NTM H;  2A06 H;  3BCC H;  2IBZ H;  3H1I H;  1SQV H;  1BGY H;  3CWB H;  1EZV H;  3H1K H;  1KB9 F;  3CX5 F;  4D6T H;  1NTK H;  2BCC H;  1BCC H;  1P84 F;  3L72 H;  1L0N H;  1SQP H;  4PD4 F;  3L73 H;  1BE3 H;  1NU1 H;  3H1J H;  5KLV H;  1SQX H;  4U3F H;  1SQB H;  3H1H H;  1SQQ H;  3TGU H;  3L75 H;  3CXH F;  3L71 H;  3H1L H;  1PPJ H;  1L0L H;  1PP9 H;  3L74 H;  3L70 H;  1KYO F;  1NTZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...