3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
3OCPA 3UKVA 3FHIB 5KHIA 2O1QA 2BYVE 2BNOA 1CAWA 3FE5A 4MZUA 1NE4A 2CGPA 4HVOA 2IXJA 1X7NA 2PAMA 5BY5A 5KHGA 3KMHA 4I09A 4E2GA 2QJVA 5HI0A 1VP6A 1J3RA 4PJYA 3RYRA 1UW8A 3NJZA 5J3UA 1Y3TA 2Q0AA 2V09A 3RZZA 2CAUA 3ZDSA 2E9QA 5BV6A 1J59A 1IPKA 2GAUA 4BIFA 3NW4A 4O9GA 3WW4A 2XHKA 4XFGA 4LEJA 2PA7A 2UYBA 3WW3A 3ELNA 3NKTA 1ZREA 1H1IA 4XF3A 3DN7A 3SCFA 4Q0VA 1O5LA 2WFPA 3JZVA 4IEPA 2PFWA 3CO2A 2IXCA 1CAUA 5KHKA 3E5XA 4L2NA 1U12A 3SMHA 4Q0UA 2PHLA 3ROUA 4EWDA 3CL1A 2H6BA 3H50A 4PIYA 3DV8A 2D5FA 4O9EA 1O3RA 4XF4A 3CEWA 4FAGA 2DCTA 4I0AA 4HN0A 3VHRA 5I0SA 3G7DA 3BB6A 3HIFA 1DZRA 4HLTA 4LTAA 3EO6A 4FBFA 1DGRA 3E6BA 4DINB 4WBBA 3PLQA 1ZZ8A 4B29A 4LUKA 2IC1A 3OD0A 4KWKA 4UBGA 3U0ZA 3IDCB 2EVXA 4WZCA 1LRHA 2C0ZA 1J58A 4LA3A 2BNMA 2IXIA 3H3ZA 4META 2UY9A 4MGKE 1Q3EA 4AVCA 1O3SA 1LR5A 4OLLA 1NE6A 1X8MA 3WW2A 4D7TA 3E6DA 3LOIA 1X82A 3KSCA 4FT8A 4Q29A 1HW5A 4K8FA 5LEKA 3IDBB 2ET7A 1CGPA 3U10A 4IEQA 5I0TA 4PIXA 2HKXA 2B8MA 4YRDA 4Z07A 5FQ0B 4BYYA 2ET1A 2HJIA 3I54A 4I2OA 1RGSA 3LAGA 4HVRA 5KHHA 3ACLA 2F4PA 3FZ3A 4KWLA 2IXKA 3OF1A 1O3TA 1CX4A 2BEOA 3IWZA 3IIAA 4IEWA 3I7DA 2Q1ZB 4E2QA 3KGZA 5EZWA 4AVAA 2PAEA 1ZRCA 1YFUA 4WVZA 2GC1A 3ES1A 3BU7A 4XF0A 2OA2A 4N9HA 5I8YA 1CAXB 4I0BA 1WLTA 1X8EA 2ZCWA 4IESA 4QMAA 4HVQA 1DZTA 4KU8A 1GQGA 3LA3A 1CAWB 3USSA 2P17A 4CYDA 1OMIA 1WA4A 2BNNA 2B9UA 3D0SA 2N7GA 3ES4A 1YFYA 3KGLA 3PNAA 3HT1A 2I45A 4ZU7A 5CADA 4EWEA 1DGWA 1YUDA 3DL3A 3M70A 1YWKA 3ETQA 4MV2A 1UIKA 4JTOA 4IETA 3M3IA 3BALA 1FI2A 3E5QA 3NL1A 4LUMA 2Z2SB 4JTNA 3KCCA 3U11A 1RUNA 2MNGA 4R52A 4AXOA 4QM8A 4HSJA 4IEYA 1NZCA 4EROA 2ATFA 2D40A 1RL3A 4I3PA 1J1LA 4F8AA 4ONUA 4AQ6A 2GH2A 1EYBA 1ZZ6A 4XF1A 1O4TA 4ZU4A 5J48A 1RTVA 2FMYA 4MX3A 2WC2A 3H1WA 5BXXA 3SCHA 3H1MA 3FX3A 2MHFA 1OFNA 2BGCA 5JSPA 1CAVA 4L11A 1G6NA 1UCXA 5FLIA 4IEXA 2PHDA 2EAAA 3OTFA 4NVPA 5FLJA 3IBMA 2CV6A 5FCCA 5FDBA 1ZZ7A 1RC6A 3BPZA 4QXKA 4IERA 3NVCA 1UIJA 5D1IA 2O8QA 2GC3A 2XL9A 4Z82A 1NXMA 4FAHA 2B5HA 4XFCA 4R8HA 4HN1A 4EV0A 2PYTA 4QGMA 2VPVA 2XKOA 3TNQA 1YFWA 4J1WA 4IEUA 2K9ZA 1L3JA 1SFNA 3QACA 4QGNA 5EFUA 5I8SA 4KL1A 4A2UA 4N9IA 4Q0QA 4I02A 4UXAA 2UYAA 4P9GA 1O5UA 1ZZCA 3EBRA 5CU1A 1LB2A 2D93A 2ZKLA 2MPFA 4E2SA 2QDRA 2PQQA 2XLFA 3I59B 3HT2A 2CAVA 1EY2A 2PTMA 1YFXA 3B02A 5FQ0A 3H7YA 4H7LA 1Y9QA 2XKPA 4KWJA 3S7EA 1ZVFA 2QCSB 3N4MA 3L2HA 4TLFA 1QXRA 3MZHA 2IXLA 1ZX5A 5BPXA 1YHFA 3CF6E 1IPJA 5AVPA 4YSFA 3QOPA 2FQPA 2OZ6A 3CLPA 2EA7A 5K8SA 5JSOA 4HMZA 2XLAA 3MPBA 2GU9A 2KXLA 3R6SA 2GZWA 1XE7A 5E1RA 4XF9A 3OGJA 1ZZ9A 1CAXA 3UKNA 3H3UA 3SHRA 4YARA 2QNKA 4XFBA 3LWCA 5T3NA 5I93A 5KBFA 4XFFA 5FLHA 1EP0A 5LEJA 4YNIA 2ETEA 1VJ2A 2XLGA 5JR7B 1XRUA 4Q0PA 1JUHA 3S0MA 1J3QA 3WW1A 1ZRFA 1CAUB 2QVSB 3S7IA 1QY4A 3LZZA 1SEFA 3D82A 2VECA 2Q30A 4IEVA 3MDPA 1OI6A 4UBHA 1PMIA 1Q43A 1SQ4A 1VR3A 4MUVA 4ORFA 3BCWA 3TNPB 3O14A 4JVAA 2K0GA 4RD7A 2XGXA 3NSTA 4IEZA 3RPQA 5I0RA 4OFGA 5I8TA 4BH9A 1UD1A 4PIZA 3E97A 5I0UA 1WGPA 3RDIA 1TQ5A 4QM9A 1CAVB 3HQXA 1RUOA 2H6CA 3LA2A 4XFAA 3H1YA 3H8UA 3MYXA 4XETA 4ZU5A 4LA2A 3SCGA 5JAXA 3EQEA 3PVBB 1QWRA 4D7SA 3DKWA 2H0VA 5KHJA 1H1MA 2IXHA 4QGLA 1XE8A 3H7JA 1FT9A 5CVRA 4AQ2A 5FPXA 5J7MA 1ZNPA 2UY8A 4YYOA 1ZZBA 4BHPA 3LA7A 3FWEA 3CJXA 3C3VA 1UPIA 3ST7A 5LRSA 4MGZE 2Z69A 1LKNA 2Y0OA 2OPKA 1V70A 4XFHA 3GYDA 2GC0A 4LLOA 4MH0E 1QXJA 4HZFA 2GC2A 5F1RA 4X6RB 3RYPA 1I6XA 5BUVA 1J3PA 1O3QA 2VQAA 4MGIE 3D0JA 5I91A 4IEOA 5C8WA 1O7FA 2OYZA 3FFQA 5C6CA 3E6CC 1PM7A 4GULA 3RNSA 4HSLA 3SXWA 3FJSA 4J1XA 1OD5A 1I5ZA 4X6QB 5JSRA 4XFIA 3UKTA 1ZRRA 2PAKA 5FPZA 3RYKA 1Q5OA 3EJKA 2Q4SA 4F7ZA 1GQHA 4LULA 4MGYE 3E5UA 1NYWA 4I01A 4JV4A 4Q0SA 3EHKA 1FXZA 4KU7A 1YLLA 4QX5A 3I59A 2OZJA 2XL7A 3GBFA 4EWAA 4XEZA 1ZRDA 1EPZA 4AVBA 4HBNA 5E16A 2D5HA 5LRRA 3H9AA 5JCTA
chains in the Genus database with same CATH superfamily
5BZBA 3UKVA 4N8MA 4O4JB 4BMBA 2BNOA 4COYA 3WF4A 1VBE2 3AMQA 1X7NA 3JQXA 2BTVC 2ZDIC 2GNDA 2A9HA 1VP6A 3SITA 4XPVA 5A3LA 3JCIA 5EC2C 3RYRA 2EXHA 2G9FA 2A1XA 5C9AA 5CZKA 3I2KA 3VQWA 4OYUA 2WT1A 1KXGA 2CNAA 1FYUA 3WV6A 2P2KA 2ZHLA 1QDCA 1SCRA 4Y24A 3SMHA 5JMOA 3TXSA 3CL1A 3WG7B 2B4KA 1YQ2A 4YIOA 3CPWU 4E9KA 4CDXC 2LW7A 2CTQA 1JN2P 1DZRA 3PLQA 2RR12 1M9NA 4ASKA 5DMYA 4G2KA 3SJBC 3ZDVA 4JGYC 1LJ7A 3B8NA 4XHXA 2XDVA 2C0ZA 1HNZB 3K48A 3I5DA 1F51A 2ZIMA 5CBLA 2XJPA 3O12A 4INDA 1YSCA 4K7JA 3ZMUA 1PO21 5J96B 3LOIA 3WP5A 1OURA 4L8JA 2BWAA 1PL0A 5D8AB 2YUEA 3IDBB 5CB7A 5C4WC 3SLIA 2YEVB 5ACA1 3FMGA 4BYYA 3IJ4A 3K4DA 3HJRA 5FY7A 2YV8A 4AAXA 2BV4A 1US6A 4HVRA 2VQEB 5FPOA 2F4PA 4HAMA 2WBKA 5KR7A 2VQFO 3MIGA 4DFSA 1O4YA 3MHHC 3UNPA 3JD72 5CKNA 5IYYA 1L7LA 5A2QN 3SPIA 4V1PA 5A3NA 4AGGA 5FRAA 1K9MW 2V72A 3SH4A 2RDNA 5JOYA 3D0SA 3MICA 2R062 1K4DC 1MPXA 3WNMA 4PA9A 1QCEA 1KS5A 3MUZ1 1GTOA 1SHWB 1JZ8A 1UU6A 4L99A 4WBNA 4JTNA 4AXOA 5FYSA 1H8TB 2F4VB 4FO9A 5IYZA 5A1AA 1V54B 1UKGA 1XREA 2ZM6O 3T2QA 3ZRWA 2TUNA 4GH4C 1JHNA 3WNNA 4CP9B 3ZVXA 3GNEA 3AL5A 1MEC2 3LSUA 4R4ZA 4YG6A 3OTFA 2BTQB 4UB8Z 1BMFG 1B6QA 4X1IB 4GMP1 1N3OA 3ZYHA 1JFFA 5FYYA 4RS5B 5IVEA 2DE0X 3AYCA 1I5PA 3ZFFA 1N0NA 2V4AA 1W0JG 5IT9N 1ZM1A 4KL1A 5F3IA 1BMV2 5FAXA 4CDXA 3KWVA 3U37A 4K3UA 2WLJA 1CQ9A 4GB33 2ADQB 2ZJCA 1DZQA 1RUF2 4YG0A 1NCRC 1W2OA 2PQQA 2XLFA 2VBPA 4RHV3 4O2BB 3NNLA 1M4WA 1FPN2 5FMOS 4JGYA 4R9BA 5FZHA 1GUIA 2LGWA 1COV1 1PVXA 1YHFA 4BJ0A 3CF6E 4GIQA 3HKEA 3OY8A 5GLVA 2Q7EA 2FKXA 3HD8B 3CRRA 3ZXJA 3J80N 4QX3A 3SQOA 5F6KA 1UY3A 4X66O 3B94A 3R4UA 1V00A 3C7FA 5FWJA 1QNYA 3H3UA 3CCQV 5DN2A 2QNKA 2OT5A 3CE2A 1I94B 1Z5WA 3HKCB 1D2DA 1HQLA 1PMHX 4QPIB 4OCTA 4O65A 1CAUB 4QPJA 1V6OA 5CBHA 4EFBA 3I3QA 2NN8A 1NTMH 3V0AB 3INAA 4NR1A 3L72H 1MA1A 4MTFA 4JI5O 4XMAA 3P3NA 2UXDB 1UO9A 2JGUA 2PHWA 3H1KH 4QU2A 3GHNA 2WN3A 2OW4A 5I0UA 5T5PA 4XQDA 3N9NA 1FJGO 1S0VA 4UXNA 1GAXA 3EXUA 3AM2A 4XFAA 3H1YA 4LA2A 4YZ3A 4K8ZA 2R1BA 4QGLA 1ORQC 4PI2A 1NCQC 2G19A 5IY5B 3FWEA 1XSQA 1L0LH 2ZA9A 1ZAUA 1UPIA 2YB7A 4NUBA 4URAA 4XDKA 1N4CA 4GX2A 2HYXA 1W6NA 2AHYA 4LHKA 4X65B 4EZ4A 4FP2A 4GH4A 1EV12 5C6CA 3CCJV 1F5JA 2K9PA 1W3VA 3AC0A 1P8JA 3CRAA 4IIJB 4L97A 3A23A 1OSGA 1CESA 3DC5A 2JDZA 1Q5OA 3BABA 4F7ZA 3SJCC 1F15A 5L9BA 1ULEA 4HZ3A 2JDAA 3ETPA 1C4RA 3WD5A 2P4KA 2CYFA 3VBUC 4QE7A 5EJ3A 3SPCA 5E16A 3CC4V 3M8LA 3T0BA 3FHIB 1LOEA 3ZXFA 3ZN5A 3SH5A 4FLWA 1AR1B 5A32B 2XXZA 2ZQMA 4PJYA 4FP3A 2XUEA 2R70A 5IVJA 4GLXA 1PNMA 4MTXA 4LF7B 5M0TA 4F3JA 1XNAA 3PUSA 2GDFA 4QE9A 3K46A 4R7CA 3N7LA 4EWDA 5LHIA 4JDMA 3LEKA 5F37A 3UQ8A 4CP0A 2QTSA 4NIGA 1JYCA 1RXGA 3G7DA 5CMUA 3RFRA 5L3CA 3HVDA 4MSWC 3RYCA 3IAPA 5L3EA 2V73A 1DLBA 4LUKA 3JASB 1GQPA 1SQXH 4LO6B 2MEV1 1VQ8V 1EZJA 4C8DA 1VQ5V 2R071 4GT1A 1QJY3 2AR6A 1NJIW 1OJHA 4XABA 2QM8A 3K04A 2X09A 5KX5A 2BCCH 1Q82W 4DR5B 1UXXX 4XDOA 2VWJA 4LKFA 2LS6A 4WFAV 3JATA 3ZKUA 3KCYA 2FDFA 4NXMB 2ORZA 2DU1A 2W0XA 4K0KO 3IC9A 3GZAA 1ULGA 1RUJ2 3HN3A 4YVSC 2W3JA 1WCQA 2E63A 1W9SA 3AG3C 1NCQA 5EZYB 3OAAG 4RFRB 3CRCA 1ROPA 3K08A 1PZ9A 5C3QA 1RSOA 1NA1C 5FY5A 3IN9A 5IDJA 2VXJA 1D4VB 2DCJA 3E8HA 4I9WA 4IESA 4Z2WA 4OPHA 3O9OA 2EIGA 4IV1B 2ITDC 3WB0A 1DLCA 3MFAA 1MG1A 1UN1A 3MBWA 5G05L 1QJX2 5C3RA 5J36A 3M3IA 2W1WA 3U11A 2MNGA 3VZNA 4GWMA 4LE4A 1UZZA 4LNUA 3D4KA 1K34A 2LALA 3ZMZA 1PZ8A 4IEYA 3SDLA 5JQGA 1PX3A 2QR4A 5JJJB 4QQPA 3SYQA 3I55V 4ICGA 1FD9A 2FMYA 1V55B 2WC2A 3H1WA 5BXXA 5H5NA 5LL6Y 4MO3M 1HNZO 2GNBA 5E1AC 3PVEA 1AILA 4LOSA 2D6PA 2YBSA 3WP3A 1P84F 4X20A 2B5HA 5AFBA 2EIKC 4LHNA 3ZSMA 3OR7C 1W2BU 3FB5C 3RVZA 2QQVA 2AH2A 4J9YB 5DM6V 1LULA 4AI1A 1XOYA 3EVKA 2VQEO 2GMPA 4QU1A 1ND3C 1GO3F 5FZ6A 2B7YA 2DVBA 1JCHA 2JRIA 1V6KA 3HT2A 3H7YA 1U0AA 4V2WA 3E86A 1YNAA 2Y6LA 3L2HA 4TLFA 1VBA3 4LIUA 2IXLA 1IVSA 2ZAAA 5FBZA 2ZGKA 2KXLA 1D0GA 2JG9B 4LF6B 3NNFA 2OCCC 4R9AA 4FLZA 4Y20B 1HQWA 2QTWB 3ZYBA 1M56B 3VBRC 3E1F1 1AL0G 4RGAA 5FL7G 4NROA 3WG2A 1UXZA 1LOFA 1NBMG 1AJNA 3CCEV 4CC6A 2WWJA 5BNNC 5JR7B 4FPPA 5CFCA 3LNNA 1WMFA 3UO3A 4LBKA 2X7RB 4KBZA 2EF6A 3ZXEA 3MDPA 1PMIA 1Y4WA 3LSEA 1NA1A 3FHQA 1F4AA 3BCWA 2R49A 2NMOA 4PA4A 4IEZA 3WZ1A 3VD4A 3FYIB 1UD1A 3UK9A 1W90A 2HWD1 1MS5A 4GUNA 1RPOA 1JOJA 4DEQA 1QWRA 1GV9A 5CA1B 4P9OA 3JBG3 1H1MA 3MIBA 5IATA 2GTAA 2UY8A 5KAIZ 4JHZA 3SPHA 4YW1A 1UPSA 2LTNA 3M3EA 2Y0OA 2OPKA 4WM8B 5A9GA 4HZFA 5FZ9A 1JX9A 3Q8EA 1LOGA 3PDQA 2XAJA 3NNGA 5EPAA 4Q4Y2 3A0BZ 1DG6A 5LXTA 2Q8DA 2WLNA 4HSLA 3QCWA 2GV9A 1PGL1 2Z5UA 4MGYE 5FFOC 1AR82 2CDYA 4OQ9A 5L7OC 1I3HA 1O59A 2QQPA 4B4PA 4Z8BA 1AVMA 5B1AB 2HWC1 4UFKA 3AG1C 1I94O 1JR9A 5LRRA 2N05A 3NXSA 3VBFC 1FFTB 1HIXA 5FYBA 3ML0A 2FDGA 2IXJA 3OUFA 3TYJA 2PAMA 1AR93 4I09A 1DDLA 4JQRA 5HI0A 2RDCA 3AXDA 4HFSA 2DUOA 4TSFG 3A7QA 4QPYA 3WXPA 3N9OA 3PJSK 3FUQA 5GZFA 1RPRA 4L2NA 1CZTA 2OT7A 1MS8A 3LIHA 2CU5A 3WDUA 1DF0A 1LUVA 2JGDA 2NMNA 2P3IA 5I0SA 4HLTA 5H2FZ 1WA6X 2JDIG 3KZ4C 4DUVA 1W99A 1DF5A 2P7TC 1RXFA 5C71A 4TQDA 2XH6A 4FPYA 4X89A 1OVSA 1K12A 4MADA 3ZHUA 3C7OA 4LKEA 3LUTB 1QH6A 4RQPC 2BNMA 1X8MA 1R091 4HPKB 4QPGA 3UGFA 4V2VA 5FOJB 1OBNA 1JZ3A 3RQ0A 1KB9F 4YM1A 3I2DA 2BVBA 1XMOB 4NIDA 1Y76B 4PA7A 1OPOA 2J1RA 4BU2A 2P67A 1RUH2 4LBQA 3K51A 3BAAA 1Y6XA 1WJZA 4AVAA 4TV9A 4WVZA 4Y22A 2L35A 2YC4A 2UUCB 1VMGA 3KB5A 1H2KA 3TRSB 4I0BA 3LFMA 5KXCA 1ENQA 3T1LA 1OCCC 4AGVA 1WMXA 4DV3B 1WMEA 4FVMA 1AI6A 4LF7O 4LH7A 1MMMA 4YXWG 4DUXA 1RUE2 2RNBA 3DL3A 4BLIA 2GH8A 3E5QA 5L7OA 3WFVA 4FTBA 5FZGA 4W8JA 5FWEA 1YIPA 1RUNA 3TB0A 2NN4A 3LQCA 4HNAB 2D40A 4F8AA 5B2GB 1CR7A 5EWSA 4MGQA 1E5HA 1NR1A 1VRH1 3T2PA 2HVJC 3NV4A 3KS7A 1DQ5A 3T2MA 1TVGA 3Q8FA 2C26A 1JOYA 3QO8A 5D21A 2KD7A 2WYFA 3SPJA 5CIRA 4NVPA 5FLJA 4Y4RA 5F2VO 4DR5O 5LHHA 3VZOA 1FOD1 1XNDA 4JI0B 2PI5A 3DF0A 3FB6C 1PNFA 1HNXB 4Z82A 5LBFA 4NXMO 4OZXA 3HPLC 4DMIA 1HJGA 1AR61 3BTXA 1SFNA 3ZHSA 5F3GA 4DB5A 5EFUA 2ZGTA 1YIJV 3MIHA 1NUKA 4Q4X3 1D4M2 5F5CA 3WDWA 3NWKA 1OKQA 1YIFA 5K1XA 4U3JB 4XVHA 4LHSA 4YIPA 3PU3A 4IHJB 4K40A 4KHPB 3I59B 2QBXA 4LH6A 2R16A 2WSSG 3ACFA 4YZ2A 3SR2C 3RZMA 4JI3B 4OVEA 4TTGA 3T4ZA 2JENA 4RQPA 1IPJA 4XDPA 2VR4A 3JAKA 1NQJA 2EA7A 4J25A 1QQP3 3MPBA 3OBAA 3R6SA 4B1MA 3ABKC 3POJA 1ZZ9A 4M0NA 5FPAA 3UKNA 3K0GA 2DYSB 4ZXKA 4K3AA 1DGWX 5I93A 3N3HA 4Y1VA 5IVVA 2J1EA 2ADEA 4DR3B 1YJLA 2RJZA 2LFRA 3S7IA 2XMLA 2ZR3A 4URTA 3VBHB 2VVEA 1TUBA 4QX1A 1B06A 2VZOA 4LBLA 4MS2A 1C8M3 1FMD1 3AP4A 5FXVA 4GMP0 1SA0B 1LGCA 3C7GA 2A3XA 2WS93 1K45A 4ATFA 1A32A 1YJKA 1SETA 5E88A 2Y4TA 3BI3A 2XAQA 1EAH1 4QDSA 3PVBB 2H0VA 1IDSA 1R1ZA 5A1FA 4NHKA 3N27A 1RUI2 1DYPA 1FT9A 3KV6A 4FFBB 1N32B 3W5NA 2LJ2A 2RE9A 2DTWA 3NJYA 3J8F1 3DXUA 3FD9A 2ZGPA 3FB8C 3AZWA 4LLOA 3KF3A 5F1RA 2RCVA 5L73A 2A06H 2VQAA 2ZE7A 3KF5A 5I91A 1VF7A 5C8WA 2OYZA 1JYIA 3N2KB 1VQOV 3ETEA 1VQLV 4BR6A 4MXWB 1B09A 4QPKA 4XACA 5LOVB 4RUFA 2VBBA 3T4DA 2VZ3A 4XAEA 3MV01 1GZ9A 1YLLA 4LF6O 5ITZB 1XB9A 3GJAA 5IE9A 3QF7A 2B1GA 2TNFA 1V6IA 4S2FA 1SBFA 2PLV3 4N43C 4MVOA 3VZMA 3U4SA 1OD3A 5EYXA 1URFA 1W8OA 2YGMA 5FPBA 4LF5B 4NIIA 2JX9A 4D6TH 4ZZ8A 3OSDA 2VQ0A 4NN0A 4HKWA 5J3UA 2Q0AA 2W87A 4GXLA 2HLEA 3WW4A 2UYBA 4F6RA 3E22B 4QKFA 3VD3A 4MVQA 4AOCA 1D0HA 4JGZB 5C8YB 2ZX3A 4CS3A 2GN3A 2WR9A 1DK1A 3ZYGA 4JAVA 4GAZA 4KGQA 5CBFA 1BKZA 3T1YB 1NQTA 4YGBA 4F6EA 2QE7G 2R0FA 1ZZ8A 4PLOA 5LMUB 5CKMA 3VL8A 4IQPA 2EZPA 4O2AB 1OA3A 4NB5A 5F9TA 3GF6A 3OYWA 5LP6B 4YZ1A 2W5FA 5DEDA 3SYPA 2VCBA 3N7MA 1A78A 4TV8B 4FFHA 1OCOB 4K20A 5JJEB 5LA1A 1RITA 4YG3A 4MHUA 3OPWA 4Y5Z0 1H38A 3IDEA 1Y74A 4YRDA 5FQ0B 4OHXA 4D3WA 3CXCU 3A0KA 4UOJA 1F5FA 4CCJA 3JD4A 1PVC3 1WZXA 2P22C 2IXKA 4ZPIA 4X62B 3HNMA 3VHPA 4ZHQB 3NNJA 2GSMB 4RO2A 3KGZA 4DW0A 4AI8A 2XAHA 5FZAA 3BU7A 4CEYB 2IW5A 3AK3A 1SQVH 2WNUC 2QKAA 1X8EA 3VDDA 4YW6A 1RMU3 3JU9A 4CU6A 2CH7A 3KQ4B 2D97A 1X4TA 5CADA 1YZBA 2D44A 2XJVA 4X1YA 4MV2A 2CDPA 1D5AA 2A6ZA 2P37A 3T1HB 4UFHA 1WBFA 4JDNA 3ZHQA 3VN4A 4AFAA 1RUD3 4I3PA 3LEIA 2PF4E 3ABUA 2ZE5A 1OOPC 4XJWA 1O4TA 3FHAA 2JDYA 4D6RA 2VOTA 4L11A 5JZGC 1VQ4V 4OXSA 2EAAA 3NJXA 2H0BA 5FCCA 3BU0A 3AKPA 1ZZ7A 1RC6A 1S2KA 5KC6A 1TAEA 4OI0A 1Y9MA 2YIDA 2EIBA 5A7OA 2EIDA 1YC61 4LLFA 2W39A 2A75A 3I2FA 1G7YA 4LQRA 3G67A 5I8SA 4QPGB 5KXDA 4JTCB 2JICA 1OKOA 2HWF2 1HXS2 4X8PA 2RS53 5A6XA 2PHTA 1POQA 2UUCO 3ZXAC 3T09A 1HRI3 2XKPA 1HB2A 2OKXA 5FP8A 2XT9A 5AC93 4DV3O 1SF9A 3QO5A 1LEMA 4OUEA 3AG4B 5FYUA 4K1YA 1JXNA 4FI9A 4PQ9A 4BW9A 2ES3A 2M7WA 2A5ZA 1SZXA 5FYMA 1R1A2 3OGGA 5J09A 4HMZA 4LBOA 1AR4A 4UF0A 2W1QA 2VZPA 5E1RA 2R042 1W06A 3GCWA 3CEIA 3RMYA 1PK6A 1UMHA 4YARA 3LWCA 4K1ZA 2P4VA 3LDBA 1RFYA 1ZBE3 1OV9A 3KCXA 4YLZA 5A33B 1WWYA 2WLIA 2WAMA 4QX2A 2JE7A 3CMEV 1Z78A 3AKQA 4C0HA 2JKXA 2WNUA 3UETA 3UJOA 1NKGA 1U97A 3E97A 4X1KB 1HNXO 1O8PA 5IHRA 2XR4A 1KQRA 2X5IC 5BNOB 3OGSA 5JAXA 2QWRB 3DKWA 2RS32 3TEWA 4J10A 4ZY9A 3C7HA 4D6QA 1HRV1 4JPRA 3TN93 3GYDA 1NOVA 4Z92B 4AGRA 4KHPO 2GC2A 4XDJA 1OF3A 2GALA 3RG0A 4AI0A 1YXWA 4W6WA 4YM2A 4JI3O 4PLNA 4E8DA 5JZGA 1OD5A 2HH9A 5DUWA 1R6TA 5DPNA 4CTEA 2HYKA 2VRZA 1TMF1 1KDKA 3C8XA 3RYIB 1NT2B 1AYN2 4JV4A 4Q0SA 2DYRC 4H0LB 4JRLA 1YXBA 5DUUA 1JH5A 3GBFA 5HV4A 3GCXA 3VD9A 3USUB 2X6CA 1CIYA 4QJFB 4W4KA 2HFEC 4DIQA 4TQFA 4Y5SA 4UCVA 2RM21 4CDQB 1QU0A 4XDQA 3OCPA 3N9QA 5KHIA 3AYEA 2YSUB 1VB2A 5HCAA 4IV3C 3BYWA 3N36A 2E76B 1ALYA 1AYM3 4XMIA 1WUVA 1AL21 1UW8A 4EYUA 1QOTA 3NW4A 3OE7G 2E3CA 4BQ5A 3ZYRA 1ZREA 4XF3A 1AXKA 4CCCA 1AI5A 3ORJA 4FXGB 1A3KA 1NVPD 1CONA 1OLME 3H50A 3LDCA 4O9EA 5FMOL 5FUPA 3O1TA 2DCTA 4GMP3 4I0AA 4AK3A 4FMTA 4DR4B 1N32O 1BS3A 3EO6A 5GONB 2HJFC 1TME1 1OH3A 1ZBA1 1W8HA 5JVVA 3SEEA 3OD0A 5A6ZA 3TWIA 3DC6A 5JXHA 2AENA 2YXSA 1VBA2 3FLTA 1LRHA 2J7MA 1BT8A 1AJQA 3N2GB 1SBEA 5J37A 1TEIA 5GKAC 4CU7A 4DR1B 4J9ZB 5FPRA 4WVVA 2ZXQA 3K9AA 1RM1B 3ZFGA 1X9PA 4X8NA 5LY1A 4UUJC 1WKYA 3TBDA 1SBDA 3OMIB 1H4GA 2ZXWB 3LAGA 1WMDA 1F8VA 2VY0A 2RR13 3HMYA 5FUNA 4JI7B 1ENSA 1LU1A 2PAEA 4LF5O 1ZRCA 3SJAC 5DG1A 2HHHB 3ZHRA 4HVQA 3SEPA 1WLTA 2VOKA 5IK8A 4GX5A 1GZCA 3LEGA 4I55B 1GKBA 4LMFA 3GHMA 4PCRA 3JBG2 3CJIB 1NR7A 5B3SB 1DGWA 3W59A 4ZI7A 1UL9A 3M70A 3HQRA 3ACIA 3S3WA 3BPSA 4JZGA 3UT5A 1VQ9V 4GKJB 3N9LA 4F6RB 2WWSA 3WT3A 1GU3A 4AZZA 2F17A 4BA6A 4Y4YA 2X29A 4JGSA 5ABJC 1XNBA 2DUPA 3JD73 3F5TA 4IL6Z 3CC2V 1CJDA 2YU2A 1BYHA 1UY2A 3H1MA 4M4RA 4U3FH 1BHGA 3FC0A 4Y3OA 2ZHMA 1BQPA 1YF2A 5FZDA 4TUYA 3ZR6A 2CV6A 3DPRC 2R063 3P5BA 1SQFA 1Q81W 2VUCA 1PV0A 5H6QA 5GZGA 1UYPA 3OGIB 4MG2A 1NI8A 4FAHA 1FXKA 4YW5A 1H2LA 1L1FA 4QGMA 1YFWA 1BGYH 4IGOA 3ZHTA 4M3CA 1M57C 3TOJA 1L3JA 1R6KA 4WFBV 4QGNA 1WB7A 3GXUA 3VUOA 1PKXA 4N9IA 3OMAB 2VJXA 4X62O 1O5UA 4UB6Z 1YHQV 1ODMA 2ZKLA 4PBPA 3NMBA 1QNMA 5A3WA 3IM0A 3CX5F 1K5SA 3K75B 3Q8BA 1MEC3 2VMEA 2WO3A 1PIV2 2ADPA 1H8EG 5E89A 5C4WB 1AR72 3LDRA 3CLPA 3K3WA 2AZ0A 3U07A 3CCLV 2MK3A 3DYMA 5BNQA 4NHXA 3QLQA 1M06G 1CAXA 1SQPH 3T1HO 2BOCC 1WB8A 3JAWB 2R6QA 4XXPA 5LGUA 2XLGA 2F6BA 2DCYA 3J26N 4W6XA 1ND2A 2ZGRA 1QJU2 2C2AA 2O0OA 1RUF3 3RVHA 1SEFA 1Z7S2 3D82A 5HCFA 2XOKG 3SKVA 3STZC 3JUUA 3ZIWA 2R7EB 4AHYA 1JMKC 4RD7A 3ZMVA 2XQXA 3V65A 4Y5TA 4WFFA 1K5MC 2ZT9B 3ABMC 4QM9A 1LNQA 4GCZA 3CZJA 2P90A 2WAOA 1JOPA 2C6SA 2Z4FA 4DRRA 5E79Z 3OPZA 3N9MA 2Z3YA 1JYVA 4LR4A 1OCZB 1MZ6A 1HB3A 1E79G 4DK1A 3UESA 1NS1A 1S3JA 4P2ZA 4CH5A 1VBC2 4XFHA 5ABJA 3F7VC 4LF4B 2ZABA 3M8AA 3AKTA 3FFQA 4I4TB 2CSGA 4GULA 4HANA 1I08A 3MHZA 2XHBA 5H9RA 4FPLA 4TWKA 5JOZA 1C5IA 5J9PC 2YXYA 3FJSA 2DWRA 3VBSB 1PM4A 3DPRA 3UKTA 4IGPA 1VE0A 1WA8B 3E5UA 1S5LZ 5APAA 1Y7BA 2AYHA 2IJIA 2XL7A 2AXTZ 1NKDA 4EZHA 4FPKA 3BIWE 5IVCA 3LE0A 5FMDA 4FIPC 4AVBA 3HBZA 3AVSA 3H1JH 2ADDA 4ES9A 1UYZA 1XE0A 2XBO1 4UF0B 1NCRB 4UW5A 5BMVA 1JYNA 1W39A 2VUAA 1LR1A 2VMFA 3WG7C 2EULA 1LODA 4FM2A 4XBFA 1R73A 1GZWB 3KV4A 1AP6A 3VKLA 1EV13 1UY4A 2LW8A 3B00A 2BE3A 3VBOC 4BQYA 4QQOA 5F2WA 4DO2A 1DF4A 1BEV1 4CCKA 4LWSA 3RZZA 2E9QA 1PO11 3KD4A 4BIFA 1OA2A 4JYYA 3H9VA 2GBOA 4XDLA 2Y34A 1O5LA 4R50A 2JECA 2G38A 3ASOB 3G6EV 1PZ7A 4P9JA 3CCUV 4P9YA 1BBT1 1PGW2 3P3PA 2H3OA 4CXYA 1RVF2 3BB6A 1XUQA 2BDRA 1POV0 2KG7B 2IZWA 2P1BA 1G9FA 1OPMA 3E6BA 5D8AC 4DINB 4JI4B 4GZ9A 5CA0A 2VL4A 4RGKA 1B35B 4G9SB 5CKQA 3RYHA 5HCBA 3ZFEB 4UFIA 3CQOA 4LHLA 2PUSA 4META 4QX8A 3WP6A 2HJDA 1NE6A 1UY1A 4LBQD 4B4RA 3R0RA 2WLQA 2VW1A 4MTGA 3JD3A 1LESA 1ACCA 1TZOA 1RHI2 5AFEA 2QEXV 2M6YA 4E2LA 5EYPA 4B3MB 3JAMN 1C28A 1S1AA 5CISA 2A6XA 4YW2A 5KC5A 4PDWA 2UXXA 2D3PA 3LOBA 3OBRA 2QA4V 1VBD2 3N9PA 2DUQA 2BERA 3ES1A 4FFGA 4QQLA 5I8YA 1H8TC 2BOIA 1V54C 2N7GA 5FP4A 3KGLA 1TG7A 4O4JA 1M5IA 1YUDA 3AMHA 3VBUB 2HLDG 4BE3A 4FFKA 3JALB 3Q4HB 2BQPA 1SESA 1W8FA 1BQZA 5E8AA 1W6MB 2YBPA 1GM9A 2FL4A 1W9WA 4MW3A 4COUA 1EN5A 1XSRA 4RS5C 4PDRA 2ATFA 5IWAB 1J1LA 1PGSA 1ZZ6A 1M4UA 4YY3B 2VULA 4EB6B 3AK0A 4OZOA 1RINA 1R081 3BOWA 3H0OA 2WA3A 5FLIA 4C91A 3AK2A 5C70A 4OHZA 2ARBA 4JI1B 4DR1O 4IE0A 4Q4W1 4YVWC 2WFF2 2O8QA 5FZKA 1VMFA 1QJX3 2PLV2 4FXKB 1HDKA 4DZGA 2JEMA 5FNVB 1TVKB 4TXWA 4W50A 3LPGA 2E33A 3ZFGB 4BK5A 3T1MA 3OUSA 4JI7O 3OOXA 2QDRA 2MW2B 1H2SB 2HWC3 2HHHO 1Y9QA 4SBVA 2XASA 3RWRD 3K79A 1FYJA 3AL6A 1WLDA 5H9CA 4P9IA 3H1LH 4QHZA 2W46A 3ZX7A 2XJUA 4LXLA 5JSOA 2NYYA 4TWTA 1GANA 5BXZA 1RUG1 2D3OW 4GKJO 4XBLA 5T54A 5FO7B 3AG3B 2VMDA 5DZEA 5E6HA 2BWCA 4KUMA 4BWAA 1YJ9V 3K5NA 1W8NA 1QF3A 1S4CA 4K8XA 3WW1A 1WW7A 1UQXA 3WOGA 5FMBA 4NRMA 4PDVA 5C3SA 5IAXA 5EV7A 2HBTA 1YJNV 1LOCA 1SKVA 3JB4C 4I0WB 2YPJA 1FATA 1H8TA 3ILFA 2ZCEA 2IVJA 1WW4A 1FV3A 4J41A 1IGOA 1ZYBA 3THOA 1JU4A 4CP9A 4R6ZA 5EYYA 2RMU1 4CUCA 4DR6B 3ZSKA 4S2GA 2BTQA 4HOOA 5J7MA 1GP6A 1R093 4X1IA 2JS3A 3LA7A 3UT0A 2XAFA 1FXKB 4CDUB 1G4YB 3V0BB 5EQUA 3PURA 4RS5A 2B9ZA 1F2NA 3RZKA 5A7WB 4E27A 1XU1A 3GJBA 1J3PA 5FP3A 4A4AA 3D0JA 4PELA 2E32A 2XOMA 2FCUA 5L3DA 1CJPA 3RNSA 2YC2A 1NY72 1KP2A 4EEQA 1ULCA 3AZVA 1U5YA 3ITQA 3BGAA 4RL7A 3OW2U 3ZXKA 4QX5A 4O2BA 2BP6A 1GBGA 3I2JA 3I4IA 1GLHA 1O9HA 1EPZA 1PP9H 2LM3A 2CY6A 1ND3B 4HBNA 2VZUA 3J7NA 1OF4A 4BWOA 3EXAA 4PA6A 2TEPA 2Q5TA 4ISRA 1N0JA 3CCMV 2PHUA 4ATEA 3KMHA 4JC1A 4XTMA 2J42A 5JOWA 3NJZA 3KHBA 4Q4Y3 2AZ2A 1S5HC 3Q8AA 5GZDA 3RN4A 5LMNB 1H1IA 3SCFA 3E83A 4QPIA 2YI8A 1CAUA 3L71H 3K5OA 5KHKA 3THDA 2EJRA 1UJWB 2CTVA 3VBRB 3TEYA 3V0AA 4D94A 3O1SA 5IJ9B 1PNGA 5KMGB 3CEWA 5BNNB 4TZDA 1K97A 3CBNA 4QAWA 1OVPA 2RS52 3LIGA 1BLZA 1K5JA 5FKCA 2ZEYA 4PLMA 1HRI2 5FK7A 1QR9A 2OUJA 2WKKA 4LF4O 1S0DA 2LUWA 3HBKA 3CJHB 2W6JG 1VQNV 2Y26A 1GKFA 3W21A 2C24A 2XVKA 4BIOA 1XNCA 1DGSA 1VALA 1W05A 4LA3A 3WY6A 2J1SA 1HJFA 4PDMA 1BZWA 1LR5A 1IQDC 1W3XA 3DTUB 1LHNA 2IFRA 5FZ4A 2A71A 4FT8A 3TEZA 4LBNA 3B7MA 4NKGB 3QH6A 1QGLA 2VMHA 3U10A 4OHVA 3SNMA 2EXJA 3WG4A 2AW9A 2JIGA 2LGQA 3L9JT 2QQKA 3VGIA 4IV1C 4YPJA 4GB31 4IIJA 3W20A 3B9CA 1RGSA 5FPVA 4W6YA 3OF1A 3H3LA 4RHV1 3MUY1 5C9AC 3IWZA 2VOVA 1W2NA 3O1PA 4DPNA 5EZWA 1YYNA 4DOUA 5D5QA 4LCUC 2X6BA 2PELA 2GC1A 2LFSA 1HKDA 2F1MA 2XJQA 2PGGA 3HR0A 3PUAA 3TJTA 2WZR1 2GMEA 2P17A 4BQ2A 1WA4A 4A3ZA 1YFYA 4DXTA 4H13B 2WIIB 1BVP1 2I45A 3OPTA 3UJQA 4ITCA 5DUXA 3OD4A 4JASA 2OTLV 1LOAA 4DYLA 1PO22 5A32A 1E5SA 2AHZA 3JD1A 2V4VA 1XL6A 3VBFB 1GWLA 1XNTA 4FLUA 1LNSA 2FZ1A 1M90W 3AKSA 3LNMB 5ACA2 5FOBB 1HX6A 3ACGA 1APNA 2VOXA 4DUYB 1EAH3 1NH2D 1RUH3 2GH2A 2GTSA 2BSKB 2J1VA 1PX4A 4GX0A 4BOWA 2P5OA 1E5IA 2C9KA 2VCAA 3FX3A 1CAVA 1KITA 2D6LX 1POV3 3IZOA 1Q8IA 2ILMA 2WUHA 2ORXA 4IERA 3BTYA 4LITA 3RYHB 2K46A 3JASA 1G86A 3ECQA 4DV1O 3AP9A 4MTOA 4R8HA 4JHTA 4ASMB 1IS5A 2RS11 4DV5B 5DAPA 2Y69C 4IEUA 3CC7V 3EMRA 1N34B 1IKQA 3CCRV 4B3MO 1MSWD 4LT5A 1GR3A 4TLGA 4DV0O 4L9BA 2D93A 5H6RA 1EUUA 3ZN0A 5EYPB 3N35A 1KGYA 5F3CA 3BOPA 1M56C 5CB4B 5DG2A 2ITCC 2WQZC 5CNAA 3MZHA 1MZFA 3I2OA 1ZX5A 5EZYA 2VZTA 4EN7B 3ILNA 1XL4A 2FQPA 2DMXA 3PVNA 1ZLZA 4FLYA 3VHOA 1R64A 1UAIA 3AYAA 2EILC 1S0BA 3J81N 5BNPB 1NTZH 4AFCA 1D4M3 4XFFA 4CU8A 5J2TB 4LFAO 4IV1A 1FS0G 1UZYA 4AI9A 1R6NA 1NU1H 1H4HA 3DCQA 1F9KA 3C7EA 4YY3O 3E89A 3LZZA 4LO4B 2JXAA 3PTYA 3N7JA 3WR0A 1VF5B 3RPQA 4AHXA 4B1LA 3MEPA 4WM8C 5JCOA 3B4SA 5G04L 3ZFFC 5A1LA 4GWJA 2CTRA 3ZPYA 1COV2 3QBQA 3K58A 3AJYA 4YGDA 3QO7A 4W4LA 4WFHA 4CDWB 1N33B 2EIEA 3OEEG 4ZU5A 3ZX6A 1SQBH 4WM7B 4BB3A 4BQWA 3IT8A 1G6UA 3NV2A 1MZ5A 3C3VA 4AQSA 2VOWA 4FTSA 1S0JA 1QJY1 3H8RA 3BRCA 3WQ1A 4W4ZA 4TT3G 1I6XA 4N23A 1O7FA 4AHWA 1WCUA 2ZKOA 5FPUA 2WQ8A 2BOJA 2XNDG 3M2MA 2PZSA 2Q1FA 4LFCB 1YTFD 4P9LA 4XOGA 1FPOA 3B93A 1RUI3 3GZTB 3M4FA 1AF9A 4NXNB 4YGEA 2HWE1 3FN9A 2WT0A 3H1HH 4M3CF 2YIBA 3WG1A 4AILC 4FFFA 1TNFA 4KG0A 3CHXA 1REEA 2JG9A 3A4UA 2W9XA 4DXWA 4NTWA 1QHTA 4Y20A 1WLCA 3I2IA 1WPBA 4E4ZA 1IPKA 2GAUA 1WLEA 3POGA 1STMA 2E51A 3LEMA 3U4XA 3ELNA 3GM8A 3ABKB 2Q73A 4QQHA 2YG0A 5EBLC 2A6YA 1ZA4A 1MQTA 1U12A 3ROUA 4AE2A 4NAOA 2QZ3A 4XIOA 3PU8A 4DR6O 4RR3B 3DV8A 4H55A 2Q6AA 4EJRA 4NOTA 4A42A 3CCVV 1YQCA 1WCSA 2C5DA 5A3OA 4FBFA 2RJKA 3LDEA 5GZCA 4BZ4A 3UM7A 5IYCO 3NV1A 2UU9B 5CA1A 5BR8B 2W6IG 1V6MA 3DYOA 4GZRB 1J58A 4YZ5A 2CTPA 1GWMA 1BSMA 2JB4A 3THPA 3ASNB 4B3NA 5HFLA 5CYYA 1O6UA 1W9YA 1XJAA 5DXDA 2V5DA 3HN1A 4WM8A 4C90A 4HK9A 4K8FA 3W58A 2OUHA 4YW4A 4GA9A 2WZEA 4JV5O 1PPJH 3ABTA 4F4LA 3POSA 3H8XA 4DRXA 3ACLA 2OVUA 2QSAA 4CUBA 3T08A 5HXMA 4LJHA 1JMUB 5LBBA 1SZTA 4A6OA 4KFMA 2VZVA 2ERFA 3TGUH 2IU3A 1YFUA 2DQ0A 2XUMA 3ZYJB 3PL0A 2B1IA 2MEV2 3CB2A 1V6JA 5FZ1A 2JG8A 2R072 2TBVA 4CYDA 1A6CA 5LMNO 4P00B 1AB3A 4NE9A 4ZONA 3AZYA 3AP7A 1SFPA 2AEYA 2XB6C 3MW3A 3IMMA 3OMNB 1A8DA 2VW2A 4N43B 2WN2A 2ZGNA 5IJ0B 3PN1A 3ZN1A 1LHVA 1CVNA 1NTKH 4QM8A 1N1VA 2W95A 1XMQB 4BK4A 3H8OA 4D0QA 5L3GA 4AQ6A 4XF1A 5JIUA 1LEDA 1QXPA 4QXCA 3AG7A 3SCHA 1OLMA 2BGCA 2QQOA 1K3IA 3ZN6B 2VE1A 2Y33A 4EE2A 2JVDA 4IE7A 4FPHA 4OHWA 4AWDA 3MW4A 4FOQA 4RWUA 5J2UB 3AMMA 4HN1A 4EV0A 4CS2A 2WNOA 4OUMA 3QH7A 3DUIA 3D3QA 1TMF3 4A41A 2AC1A 4GALA 4HPKA 1J5EB 4P9GA 1LGBA 5CU1A 2X0LA 1F31A 1CZVA 2DYSC 5I0DA 2D6NA 1XYPA 2Q8CA 4EFEA 3O1UA 3LF7A 4NRQA 2D2CB 1Y76A 1EBOA 1COWG 4NWVA 3B3QE 5AVPA 3QOPA 1ZWIC 1JI6A 3VBHC 1VPHA 4AEMA 1AXZA 2WT2A 2ZMLA 4RQFA 1NLSA 4DUZB 1O91A 1F35A 1EP0A 1W6OB 4Q20A 1AR91 2HWF3 2P3KA 1HXS3 3WDVA 1E1QG 1ZRFA 1L7QA 3H42B 1SQ4A 1K5QA 1E5RA 1VR3A 3J7MA 3T30A 3B77A 4MUVA 2O57A 4NJ4A 4DV7O 5IJRA 1I5XA 2PMWB 3ZIAG 3APOA 4HT1T 2QWNB 4HNAA 5F6LB 3POYA 1CAVB 4BQ3A 3HQXA 1RUOA 1R1A3 1RJ8A 2H6CA 1PHMA 2R043 3ZR5A 4NIHA 2Y6HA 1W0PA 1R3KC 5IVYA 5LA6B 4FQZA 4HG6B 4BHPA 1GM8A 2D3SA 3ASIA 1N3QA 3THCA 4MGZE 1SLCA 3GBGA 2GNTA 5FJHA 5TSWA 2HWB1 4LOTA 3RYPA 1IXBA 4LPLA 1QEXA 1O8SA 5HBAA 1J83A 1QMJA 3VKFC 1OCRB 1QHDA 4ZS3A 3F95A 1YEWA 3FBYA 4UVAA 1DGRN 4K21A 4X6QB 4U3JA 3THTA 3LFIA 5GALA 4GKKB 4LULA 4IHJA 4PF5A 1L0NH 4J7ZA 1LOFC 3J7LA 3I59A 3WNKA 2HWD2 5CFCC 2RS33 3A8TA 1HLCA 3A22A 3I8TA 1HP8A 5DAQA 3OGCC 3D5OA 1S55A 3DYPA 3AKRA 1HN0A 3R4DB 1XXNA 4JGZC 1WLWA 1CAWA 3FE5A 4Q2FA 4AFBA 2B39A 4JYAB 2VBDA 1WD4A 5GLZA 5FZOB 2DBIA 5T52A 1GMGA 3T2OA 1H0BA 4FCAA 4RYDA 3RJ2X 4MT8A 1S76D 2CAUA 4DO0A 4BQ4A 4G3YC 3ZHVA 2P6CA 4TN7A 3RGBA 4LEJA 1OUXA 3ZYIB 4UFZA 3DN7A 2WFPA 1LCLA 2PFWA 3CO2A 1AYN3 2KKWA 4JF3A 1PGL2 3LKJA 4XZUG 4R8CA 1W8ZA 2E26A 3VBHA 4ARXA 3VD5A 2IJHA 3TETA 1G8MA 2VAUA 1ULPA 3I2GA 1ZSPA 1SA0A 2HWC2 2PHRA 4AR2A 3BUCA 4LFBB 1X59A 1OZ0A 3O0WA 4LO5B 4AQTA 3U0ZA 2D43A 4BIZA 4KBBA 5TISZ 4YGCA 3LSSA 2KR2A 1SLTA 4FFBA 4KWUA 1VIWB 1Q3EA 4AVCA 4HYOA 2RDSA 2X5IB 4LFCO 4GQ7A 3OGVA 2NP0A 4IYIA 4Q4X1 4IE4A 4Z07A 2E7AA 3I2HA 3N2KA 1CN1A 4NXNO 4MXWA 2BTOA 2JS5A 1UOBA 1NLRA 5LOVA 5LCWL 2ZX1A 4Q4V1 2L9LA 1GOFA 1CX4A 3WHUA 2Z42A 1I1EA 5ITZA 4MXVA 4UW6A 3RT3C 1NAEA 3ACHA 2B9UA 3BTAA 1QQP1 2HP8A 1LHWA 2Y6FA 3ON7A 5JH7B 2R0HA 2Y4UA 4LBMA 1R092 2F4VO 4JZRA 2QQJA 2ENRA 4DNYA 1K42A 1K3EA 1MQTB 3E22A 4IV3B 5C5TA 3R66A 1VQ7V 1RL3A 3IPVA 4ZU4A 4AFDA 1RTVA 3DECA 4LBJA 4JGZA 5C8YA 2UU9O 5GJ6A 2Y6GA 5F39A 5BR8O 1C8M1 3J7AU 3HNYM 4QPGC 1G6NA 4Q8LA 4LE3A 3SYOA 5LYJB 3ZSEA 4GWIA 1WN7A 2WS91 3P1IA 4YJ2B 3ZOIA 1HWYA 4PI0A 2Y0IA 4QXKA 1U5ZA 4CSWA 2XWJB 3WSOA 1QJZA 4OQ8A 2GC3A 3S57A 4J11A 4CU9A 4O2AA 4CRQA 3H01A 5LP6A 1NLQA 3E2EA 5IVBA 2VZRA 4DXZA 3AG4C 4YHHB 4TV8A 3QACA 2D6KA 1SS3A 4CCEA 4DR2B 5FYTA 2LP7A 4ISQA 4FPEA 2VVFA 1KUQA 3ZMTA 3EHBB 3BA9A 2Y48A 5FQ0A 4RUEA 3MO4A 4KWJA 4DRXB 3VLBB 4OUSA 4DV6B 2HKOA 1VRH2 4YZ4A 3N4MA 3A0RA 3O5SA 5JI7A 3WF3A 3DXRB 5JJNB 5BPXA 2ZIOA 1H9WA 1X33A 4ZHQA 4LC1A 4FPCA 1FOD2 5K8SA 2JG8B 1A34A 4CEYA 3AJZA 3OGJA 1W8UA 3AEIA 1XMQO 3TEXA 1G9AA 3DGTA 1AR62 1XDCA 1XRUA 2FZ2A 1GOHA 3T4HB 3MW2A 4ZKTB 2UXDO 4DQAA 1IQAA 3WU2Z 3AXEA 1GK9A 1N8RW 1PIV3 1A8MA 4QDRA 1IKPA 2E31A 2K0GA 1XI1A 1QIQA 1W6PB 2EBOA 4XHBA 5I0RA 3RBZA 1PNLA 3ZSLA 1AR73 5DABA 1ZL8B 3GDBA 1S5JA 5LASA 4NRPA 4DXRA 3MYXA 2D7FA 2ZEWA 1RUC1 1G9DA 4KGGA 1H8HG 4X64B 5KHJA 3ZPOA 4IE5A 5LA9A 4X65O 1BZKA 3ZRSA 1J5EO 1IS6A 1DFQA 1Q86W 1QJU3 1Z7S3 3V64A 1SLBA 3HR9A 1BE3H 3K9SA 4CEWB 3I3MA 2WNVB 2A70A 3D8CA 3ZIXA 3SXWA 2A6WA 1QLEB 3F2ZA 5FK8A 1T5EA 2PAKA 4ZIBA 1FMD2 2IWGB 2ZKNA 2EIMB 1PVC1 1C8NA 3UO2A 4DUZO 1EAH2 4GWNA 1AP5A 4AG4A 5FYVA 1S0EA 3M3OA 1QU7A 2IH3C 1GP4A 2EXKA 4XE9A 3D3AA 2F23A 2J1TA 4XCAA 1GYKA 3EB7A 2OPWA 1AHSA 1VBC3 2OQ7A 2DVAA 1KC8W 3J8F2 1DQ2A 3X2QC 1RMU1 3M7MX 4S2DA 2DJVA 2OCHA 2YHJA 2BRTA 3ZDSA 3ICXA 5FYHA 3WW3A 3MV11 3NR7A 1ZRIA 5A33A 1ODNA 4CUAA 4UT5A 5IFTA 1DIWA 4H37A 3U75A 3BY6A 4QKNA 1RUD1 5A6YA 3ETDA 3VD7A 3JARB 2DURA 4XQWA 1MSDA 3ZSJA 4BM8A 2HBUA 4X1KA 3O1MA 2Q9LA 1RM1C 4F83A 4MVTA 3HKBB 4FZ1A 3SJQC 4O4LA 2WL1A 3AX4A 5BNOA 5GTIZ 1W0OA 2VD7A 3IDCB 2QJ1A 2ZXWC 4FSJA 1K5MB 4EKWA 2IXIA 1VB4A 5CG9A 2UY9A 1O3SA 1D7PM 2X10A 1LECA 4JX0A 4AHCA 2F66C 1XQNA 5FXXA 3T3YA 4GKKO 1NX9A 3ENRA 1H6XA 5I0TA 5BY1A 1GP5A 4TSVA 2R72A 1H30A 3JSNA 1RVF3 4QB1A 3ABLB 4DV4B 3CJIC 5DZGA 4CH6A 2BEOA 2VO5A 3RYIA 4FLVA 2B45X 5JVDB 1YCIA 4JYAO 4QX7A 2Q1ZB 4C1WA 2E75B 5A3UA 4LF9B 4Y26A 5AC91 4AHZA 4XF0A 1PM9A 1WP7A 3PMSA 1UMIA 3USUA 5K7PA 1D5NA 1CAWB 2QDOA 2YROA 4CDQA 3HT1A 4U2AA 3BKZA 2DVFA 4EWEA 4CZZA 1W6QB 1QOSA 3PMEA 1V9U1 3R4SA 1KKDA 3PIJA 1V0AA 4A44A 1ZBE1 1RHI3 2Z2SB 3KCCA 2YC0A 3VDAA 2ZINA 5CFDA 4UCTA 1OFSA 4YM0A 4LFBO 2RMU3 3OT7A 3K4AA 3B69A 5FZ3A 3BIEA 1VBD3 3VBOB 1HDJA 3GB7C 2O8OA 4MX3A 4OMCA 5GLWA 2ZBJA 5EC1C 5C8CA 5EP9A 4CXWA 3RZJA 1ASJ1 2Y60A 2CUGA 2KB1A 5GONA 4AEDB 4D8MA 5DDJ1 3RRDA 2ARCA 5A7NA 1KJRA 3AZZA 2XONA 1C1LA 3K03A 4XUNA 4JQTA 4OHYA 5FYCA 3N2GA 4UCUA 3TN91 5FZCA 1OHHG 2UUAB 3FAVB 4FPJA 4E4EA 4H7MA 4LKDA 5CEHA 3VDDC 4QX0A 1ZX3A 1RP3B 2QQUA 3KZIZ 2ZS6B 1YFXA 2DW4A 3NKGA 3GWKC 2DTYA 2JB8A 3S5AA 2ZGLA 3NO8A 4YSFA 1C57A 3ZEDA 2WFF3 3AZXA 1BHBA 2XAGA 3J7HA 1U5IA 3OTOB 5HCHA 4I50B 1YO8A 3WCRA 5K0UB 4BISA 1SC5B 2VQUA 5T3NA 4FM1A 1S0GA 4P9XA 4I55A 3AFGA 3PTRB 4RGGA 4O4IB 3CJIA 4IGQA 1VBB1 1AYM1 1YDXA 4QHOA 2QVSB 5IT6A 4LF8B 1OLRA 2VECA 4NIAA 3NRUA 1K4CC 2F95B 3HKDB 1AJPA 3DKQA 3TNPB 4JVAA 1OCZC 4NHMA 2F93B 3IPVB 2QQMA 3AG2C 3FL7A 2EALA 2ZDIA 4K6BA 2VWKA 2OQ6A 4U7OA 3FLRA 5L36A 2ARAA 4XETA 3SCGA 3EQEA 1UOJA 5LZ6A 4YHHO 2IXHA 3VBSC 4OMDA 4DR2O 1VBE1 2WINB 4RQEA 4O4HB 3L73H 1LUWA 2ZZQA 3WQBA 2VUJA 2BVVA 4MH0E 4AVVA 3MF9A 4YJ3B 1IXMA 2WO2A 3RI8A 1JZ2A 4DV6O 2DVGA 5DECA 3T4VA 3PUHA 4NAMA 3AVRA 5DAWA 2Q5ZA 3JQWA 4YVWB 3HNBM 1I9RA 2RHPA 2YIBD 4MGSA 4U36A 4RN5A 1PK6C 1VRBA 2Q4SA 2RQ6A 1ZUQA 2F4LA 4KU7A 4UCSA 4HONA 4H44B 2WZR3 2WWWA 4PDLA 5ISLA 2A0LA 1AJKA 2RR11 4R9DA 2D5HA 2PQSA 3H9AA 2W1SA 2NM1A 3ASOC 5C4WA 2O14A 2C9AA 4MZUA 2JDUA 2W47A 4I7ZB 3WDXA 5EHDA 1LHOA 1HRV2 4WVMB 4BQ1A 4XBNA 4Z1VA 1Y3TA 1V9PA 5FMCA 1ULFA 3B8MA 3JAWA 4P9WA 4NPRA 4JKKA 4DEVA 1B35C 2XHKA 2D6OX 4N7UA 2PA7A 4Y1YA 2FDHA 4PJ0Z 2FB5A 4IEPA 2R9IA 2ZX0A 4FJCC 3ZFEC 1XHXA 1VAKA 3ZN4A 5F5IA 1JVMA 3RZHA 4X64O 1TMF2 1JJOA 4M01A 2D5FA 1O3RA 4XF4A 3OEHG 4GJYA 3P30A 3JD71 3V56A 4LTAA 1D2SA 1US2A 2ZMNA 2QE3A 5LHGA 1OC1A 1QR8A 5A7QA 2UU8A 2WLLB 1QH7A 3CYOA 5B1BB 2RS13 1H9PA 3PIGA 2BW8A 2RM22 3G71V 2CWSA 3K57A 4UBGA 2LROA 3AK1A 2YPDA 3CCSV 2R061 2C4XA 2CK3G 1AL22 4OLLA 4D7TA 2EINB 4MSVA 1J1TA 1W0NA 1X82A 4XCBA 1OUSA 1MVEA 4DY3A 4AVSA 1LENA 2D98A 2J1AA 1XMOO 4UYBA 2ZGSA 4I4TA 1CZSA 2OTJV 2UXBB 5LWBA 1SPPB 5JPMB 3VBSA 4EQVA 3ZLIA 4KWLA 3JD2A 2RJ2A 1WA8A 3IIAA 1MEC1 4PV1B 3QVNA 1RYYA 1TME2 3P6BA 3NAPB 1ZBA2 3R05A 3WEZA 3KT1A 3RZGA 3HOBA 1QLNA 2BNNA 3NQHA 1NCRA 3STLC 1B3QA 4UFLA 4XJAA 3FKSG 1WNSA 4M0HA 4CVUA 1FFXB 1Q90D 1GZWA 3DSQA 1FNYA 4N53B 4UFMA 1JZ7A 3O1VA 1UIKA 3OGRA 3GZUC 1BMV1 1M1KW 1FI2A 3VQYA 3CRMA 4P14A 1BCXA 4KH9A 3K77A 2ZZJA 4X8AA 4KNCA 1M93A 1RUF1 2OXBA 2DVDA 2JD9A 2CL2A 5GLTA 1FPN1 3ZS8C 1TE1B 2UWBA 1FV2A 4LO8A 2QGNA 2XPJA 4JI0O 1UX6A 2YXHA 2WDBA 4BXFA 3IC7A 2KG7A 3ZFGC 5FZMA 4O4LB 3BPZA 2Q7GA 4M3CE 5JIAA 1B35A 2Q8EA 1LAJA 2IM9A 1NXMA 1PO23 4NO4A 3I3DA 4XFCA 4FPOB 3ZFEA 2VPVA 3B09A 2DN9A 3CS5A 4WF9V 1SMVA 5ACA3 3RYFB 4DV4O 1GM7A 1UOGA 2QKCA 4WCEV 4Q0QA 2UYAA 3ZYPA 1WPXA 3ZXDA 2QUOA 4C1XA 3EBRA 1CPYA 4E2SA 4LF9O 2GHYA 1DTOA 3KLSA 2JKBA 1UY0A 3EFFK 2VCCA 3POIA 2HWE3 3ME2A 4I0XB 3VOUA 3SH3A 3RWKX 4K8RB 4HKLA 2P6HA 1B04A 1IPSA 2XLAA 1QBZA 1N1SA 3ZMNA 4QPWA 4EN8B 4DR3O 2X53S 2W2IA 5C9AB 3IB3A 4YNIA 2YIAA 2VMCA 2YUAA 1SDDB 2N74A 3WQ7A 1UWWA 1EV11 1E57A 1JUHA 2A79B 3VBUA 4UWDA 3UL2A 3JALA 3Q4HA 3I56V 5JXJA 3JB8A 3GWOA 2GUZA 1OI6A 3VZJA 3VZLA 2BZDA 1W6MA 5CFDB 3B9IA 1CWPA 3Q9OA 1FXKC 4CDUC 2AZ5A 4XUPA 3WF1A 4OFGA 5I8TA 2JEXA 4CCMA 1TQ5A 1UYXA 4WZFA 4LNVA 4EB6A 1N47A 5C8CB 1F4MA 1Y67A 1K8AW 3A2FA 1XEQA 2VG9A 2UUAO 1ZNPA 1S0FA 4N90A 1H8VA 2YBKA 5FZ0A 4D69A 1QVGU 5EJZB 3ST7A 4GD4A 4HXCA 1V70A 3FBMA 1QXJA 5JOXA 3U78A 5BUVA 4MGIE 1KKCA 4I5SA 2WA4A 3BODA 5FNVA 2KSDA 1TVKA 2EIJC 5K4LA 2VCMA 2VU9A 4IE6A 5F7UA 1JHJA 3KQRA 1I5ZA 1KBHA 3EJKA 1COV3 2Y69B 3OTOO 3I3BA 3LDKA 4FPGA 3UKMA 3BTZA 1ND2C 1W2AX 1AZDA 5FBJA 2BFUS 1EZVH 4ZOLA 4L0PA 3WLUA 3WCSA 3DGEA 3RVYA 3BVCA 3POFA 1SACA 2VZSA 4MVUA 4LF8O 3ZXGA 3B2EE 4YVSA 2OIEA 3UCSC 2QJVA 4P5HA 5KLVH 2V09A 4UI9L 4WBNB 1UYYA 1DLLA 4MVSA 1AR5A 4GJZA 3OEBA 5FZLA 5IYZB 3S30A 4COWA 2PI4A 2EILB 3VV1A 3E8FA 3ZRWB 4A7ZA 2PHLA 1RUJ1 2NLRA 3T1YO 4H14A 1ONAA 5FLXN 1AI7A 3BVOA 5ERLA 5LMUO 1MACA 3GBWA 5EIBC 5FJKA 3J9SA 1RB8G 2WZ8A 4ASLA 3CMAV 4OULA 1JFFB 1BCCH 4XUTA 3FYEB 1G9CA 2XBO2 5LGTA 2E74B 1VQKV 2VZ1A 4FQ4A 3OBZA 1LOBA 4JRAA 1DQ0A 4CPBA 4J7JA 5C93A 3ZFFB 2QZ2A 4E4DX 1IURA 3FFZA 1S72V 5JMCA 4FLTA 3M7AA 2JJ1G 2E5LB 4CDUA 4CDXB 3V0BA 1BEV2 2FYUH 1W9TA 1QJX1 2EXIA 1PO12 4BCUA 4R4XA 3WB1A 1LHUA 5A7WA 1FAYA 3O65A 4C7UA 1MZEA 1Y9GA 2HKXA 1N36B 1IS3A 1CPMA 4HKOA 1HNWB 1VIBA 4JGYB 3NJVA 2G9GA 1VMJA 1QVFU 2AUYA 2GMMA 1BBT2 2W91A 3O1OA 2ZAHA 2ZX4A 4IXLA 5B5EZ 3A0NA 1N1YA 3HKEB 3OY8B 5D2AA 4LK7A 4ZXEA 4R9CA 3RWNA 3WF2A 3T0DA 2EJ7A 1ND3A 1HR0B 4LBEC 1DZTA 4KU8A 4XJ9A 3WQ0A 1GNYA 1UZVA 2IFWA 5LBEA 4FK5C 4B3RB 3X29B 1VEWA 1PD3A 3CWBH 4HETA 2Q4PA 4C0BA 2ZR2A 5IYDO 3G6JB 2J1UA 4OI2A 2Y6JA 4J80A 4GKXA 2JD4A 2CHHA 5FREA 2DU0A 1NZCA 1UMZA 1UX7A 3IKWA 1YI2V 1SLAA 4QB2A 4O61A 5J48A 1XOUA 4BAYA 1REDA 3VBRA 4B7KA 1OFNA 3CZUA 4NMIA 1UCXA 5IJ9A 2MEV3 5F5QA 2DWDC 5KMGA 5BNNA 4ASUG 2R073 1FXVA 1WCKA 3KM5A 2AREA 1S0IA 5FDBA 2PHFA 5FO8B 2HWB3 4LORA 2W1UA 1W6NB 2G4IA 4ZS2A 3GZEA 3S6PA 2X8KA 4PDWC 3CJHA 3MDSA 2WLPA 4GH4B 4J1WA 1J95A 2UXBO 2ZACA 1W2UA 2IJKA 4E8CA 1WD3A 5EXOA 4I02A 4CCNA 4Q1PA 4UXAA 1WW6A 3RJRA 2MPFA 2XJRA 3VB9A 3S3XA 5BNPC 4WFGA 4IW3A 1IX9A 3S7EA 3LSQA 1N1TA 1R082 4XUOA 4AVTA 1CPNA 4Q27A 5T55A 3VBBA 3J4UH 3UYJA 4CCOA 2WSVA 2QWQB 4Q4W2 1XE7A 4WVWA 2VS0A 1P7GA 2WZPP 1MS0A 1GRJA 5LB6A 1W59A 2QWPB 1XNKA 3VZKA 5LEJA 2BPA2 5CA3A 4CDWC 1GN3A 4WM7C 4Q4Y1 1YITV 4UBHA 2BOBC 3VBFA 1U96A 2WLHA 4UCOA 4N7IA 2ZEZA 3O14A 4QNHB 1AR81 1IG3A 3KHCA 5DAXA 4BH9A 4B3TB 3RYCB 3CMGA 2P06A 5A6QA 2JE9A 2BSKA 2GNMA 2XJTA 2ZPXA 2PYLA 3H8UA 1Z5VA 5FZFA 1C3HA 1HV1A 4KXRA 2YFUA 1UFIA 1NVPB 3ILRA 4CZSA 1ENXA 2QKDA 4JDOA 3D36C 1P49A 1RUG2 2GN7A 5KX5B 4YWAA 5LRSA 4CBCA 3JATB 5DN6G 1AJOA 1MS9A 3QNEA 2CE4A 1TA8A 3HQUA 2ZMKA 3E6CC 1IHMA 2L6LA 4YW3A 4N21A 4Q4V3 1JOBA 1SQGA 5A7SA 3WUCA 3L70H 5A80A 3BEHA 2YICA 5JSRA 1NCQB 3C3TA 3WNPA 5FPZA 3JSLA 1OHFA 1NYWA 3EHKA 3LGRA 1RSOB 1MVQA 5CB4A 1EM1A 5IW0A 1E1RG 1MS1A 2RMU2 3KV5A 4AW7A 2ODMA 4UV8A 2O1QA 4HVOA 4RR3C 3L2YA 3OEAA 2JEUA 1UNBA 4OGQB 5CBGA 1J3RA 5FYZA 3P32A 5FXZA 5BNPA 3ZRXA 2YGLA 5BV6A 1PNKA 5T5JA 4LNUB 2DF7A 2DYCA 5J2TA 4XFGA 2VTFA 5JQGB 3AP6A 3NKTA 1TUEB 1GWKA 5HFMA 2GUZB 4Q0VA 2ZTNA 3VKNA 1FKAO 1X36A 4DR4O 3N7KA 4AYUA 4Q0UA 4MYEA 2FMLA 1GICA 2HWD3 1GMMA 4PD4F 3ASNC 4FTEA 3IAQA 2P6JA 1RUH1 2W94A 3ALQA 1F4NA 1DGRA 3AMNA 4QDQA 2XVGA 5B66Z 1BK1A 3SYAA 4UAPA 1KFXL 3QTCA 1POV1 4CDWA 1Z2GA 4X20B 3KVAA 4J42A 1T6BX 5CA6A 2K1EA 4WZCA 4WM7A 4I9QA 4NHYA 2XJSA 2CTWA 1ENRA 1R1BA 1RUE1 2VNGA 2V7QG 1XU2A 4DR7B 2A73B 4H3WA 1JPXA 1AX0A 4EN6B 4XYXA 3LPFA 3KSCA 2ZX2A 2DCKA 2KA3A 1CGPA 3POWA 4Z2AA 5F2SA 2VNRA 1QDOA 1AX2A 1UU5A 5IUQA 1Q8OA 2DWEC 5JXIA 2HJIA 3UGHA 4I2OA 3D36A 5KHHA 3MF6A 5IK5A 3BN6A 3E35A 4P9PA 3URFA 1OQDA 1O3TA 1UZ0A 4NTXA 4XJUA 4ZOLB 4JZ2A 2LW1A 4QPIC 3C2UA 5H9PA 3K5LA 1GQGA 5CN0A 1JYWA 2CWMA 1QKQA 2SLIA 2ZE6A 3VL9A 4YVSB 3GVMA 4ZU7A 5CFCB 1VAMA 1W8WA 2NZ9A 4X88A 3T1CA 5K1PA 2DOSA 3HAGA 3SPGA 1D4M1 4Q1RA 2ZGOA 1S2BA 4H2AA 1XNRB 3G6BA 1C5HA 1NA1B 3PUQA 3LB9A 5FY1A 1C1FA 4XIKA 2YMZA 4A6SA 3WVJA 3C90A 4CE8A 1OQEA 4GB32 4CP1A 1RUC3 5IY5C 1EYBA 5FZ8A 4DW1A 2RDQA 3KG2A 4Q8KA 2VGDA 4RHV2 4ZHNA 4RR3A 4BXSV 3PHMA 2QKSA 2QQLA 2XQRA 3K06A 2E5LO 4LK6A 3WG3A 1ULDA 2NPIA 2ZEXA 3MPPG 1BQ0A 1JYXA 2WZR2 2P5BA 5D1IA 3OUJA 4Q26A 4XJ8A 2W0FC 2XTAA 1K92A 1N36O 4PT6A 2OIGA 2C1FA 4FPFA 1HNWO 2R9RB 1XBLA 5F8PA 1EFRG 5LXTB 3MLKA 3BHPA 1EPWA 4ZBMA 5FYIA 4Y1ZA 4A2UA 4AI2A 1Q6UA 3HPNA 3MIDA 4IT5A 2JDNA 1URXA 5B1NA 1X9TA 1OA4A 1R3LC 3FB7C 1T2XA 4WFEA 3LSDA 2FCTA 4XTPA 3ZMSA 2H8PC 2K2SA 4H7LA 1V6LA 2VH9A 1G9BA 1HR0O 2EIKB 4AEKA 1W03A 1XQ8A 1QXRA 5HV0A 3ZCCA 1R3JC 5C5UA 3F5WC 4B3RO 2W92A 4IUGA 4AFMA 1RUI1 2QQWA 5FR3A 2CGOA 4FLXA 2P34A 1KDMA 1DYOA 1I0HA 4JI2B 5FY8A 4NPLA 5LA0A 2RS12 4ABMA 4NYKA 3MIEA 1JU3A 4CCDA 1KQSU 1QY4A 1MNGA 4X9QA 5FV3A 3F7YC 3R65A 1Q8QA 3PVOA 4IEVA 2Q7HA 2VC9A 1H2GA 1Q43A 4N43A 2IH1C 5FY9A 5IJ0A 1JBCA 2WPDG 1VRH3 2G9ZA 4IYHA 2JGDB 2OCCB 4B3SB 1IOAA 3ZKYA 4COVA 2Q68A 1XC6A 1FOD3 4BW5A 2CDOA 2UWCA 1AUYA 2ZHNA 2UXCB 2WRAA 2Q1MA 1SFYA 2E7TA 5JWPA 3WP4A 1OCRC 3M99B 4FOVA 1UU4A 3WNOA 3ZN6A 2UXNA 1KRIA 1H2NA 1S0CA 2ATKC 4UW3A 1G1XB 1CEZA 4U7NA 1AR63 1EN6A 2I2SA 2BU9A 5FTTC 2DCZA 4QKDA 2IU0A 5J2UA 2GC0A 4I3GA 4BMEA 1AX1A 1DQ4A 4DV2B 4PBOA 1W9FA 4Q5OA 5LK5A 5FZ7A 4CA9A 1ZTEA 1GQHA 4I01A 4LBQB 1CIWA 4ZZ5A 4TV9B 1MS4A 4Y22B 5D5PA 3T0AA 3W7SA 2VZQA 3U14A 4KP4A 2BJSA 2HEVF 1DBNA 3ETGA 5CG8A 2A7WA 1SDWA 4UW4A 1UF2C 4OX9B 1V9U3 2ARXA 3JCUZ 5JCOC 1K73W 1L8DA 5KHGA 2Y6KA 2DDUA 1QJY2 1GN2A 4A45A 2VTXJ 1JUIA 5L7OB 5CAZA 2CGNA 1V55C 1FXHA 1L7RA 3I49A 1W6OA 4B3TO 3AG1B 2FHRA 4Y1UA 2HEWF 1FMD3 2IXCA 1DQ6A 3HB3B 4A5UB 1I5YA 4JI4O 4UFJA 1ASJ3 2P3YA 2AACA 3HEIA 1KS4A 2IVIB 4HN0A 3VHRA 4BPZA 3HIFA 1IBMB 3KT7A 5DDJ3 2NLJC 1YRZA 2FBEA 5LY2A 5FIXA 3D3IA 4WBBA 5KA6A 2IC1A 2HWE2 2PN5A 3CXHF 4CH4A 1BJQA 5J98B 4M00A 3J8F3 1XYOA 2OX0A 3WX5A 4XUQA 5GW7A 2NQYA 5LA6A 1OOPA 2WYSA 4DXSA 5C33A 4I30A 3K3NA 3WW2A 3E6DA 3A21A 3TXQA 2FD8A 5F3EA 3KKYA 4XQ4A 5L3BA 3Q8CA 2H94A 2EZOA 2VNVA 2QTOA 5F5AA 3VQVA 3JCZA 4L92A 4H33A 2JG9C 1IG0A 3K59A 4AQYB 1LTEA 4AI3A 3FX7A 4RQPB 3I7DA 2GSYA 1ULOA 3OUIA 2YDEA 3JAKB 3CP1A 5EJ1B 5LBCA 1MQTC 1KJLA 4BLJA 2FDKA 1VBB3 5B4XA 3ES4A 3RW0A 1QQCA 4NPMA 2Y8KA 4IGGA 5FY4A 1JJ2U 5ANNA 2YXLA 1NXD1 5FP7A 5DAVA 5DQ0A 1O4ZA 5FZOA 4IETA 1QNWA 2JDKA 3NL1A 3B5LB 1XPWA 4J7KA 5IWAO 4CS4A 4ZKIA 2HWF1 1HXS1 1TUBB 4P5YA 4MVRA 1OCCB 4GX1A 4B4QA 1BVVA 4NHLA 3X2QB 4ARYA 4G27B 1QOOA 4JI1O 5KA5A 5JSPA 1VBE3 1W04A 1VQ6V 1S77D 1R1A1 4DR7O 1UOFA 2UURA 2B5UA 1RJ7A 1UIJA 3VDCA 2R041 2ZGMA 4GYCB 3OUHA 4QHBA 3WHTA 5FP9A 2PYTA 3IMNA 5C3PA 3ZM8A 3IDAA 3AYDA 5SV8A 4A7YA 1KECA 1MS3A 4UV9A 5LBQA 2AEZA 3JD0A 3TCUA 3IFXA 5B1AC 2PY5A 1V6NA 2X5IA 2WJSA 2IUWA 2JG8C 2Q69A 4QGPA 2QDNA 4PA3A 2HR3A 1HW7A 2ZGQA 2CAVA 3K0DA 1VQMV 4QKBA 2PTMA 3B02A 3APBA 4FVVA 3MIFA 1ZVFA 2YI9A 1OQ1A 2QCSB 5J1XA 1BXHA 2WNEA 3ABZA 1Q6IA 5H9QA 2J22A 3KVBA 3I97A 3W9AA 2RS31 5H9SA 1ENVA 3M3QA 2GU9A 2GZWA 2SBAA 4XF9A 1XNRO 4MGTA 3NNMA 4FZ0A 1JZ6A 4B08A 3LCPA 1UKRA 1NG0A 1N3PA 5FLHA 5IAVA 1CX1A 3SISA 3ZO0B 1VJ2A 4MVMA 5F32A 5JH7A 1J84A 2P3JA 3OM3B 2A3WA 1QJFA 1KFUL 3TK1A 1JQ0A 1F4HA 4K35A 2XGXA 1MOFA 1AYN1 3VQXA 4IV3A 4PIZA 3W7UA 1VF6C 3CRQA 2VMGA 3LA2A 1IZ3A 3CD6V 4CEWC 3OYWB 2WNVC 5B4NA 1DU3D 5LYJA 1QLEC 4TOIA 2WQ4A 4YJ2A 5CVRA 4AQ2A 5EBMC 4IDZA 4BDVB 1GN4A 1S2EA 1SERA 2JK5C 2Z69A 1LKNA 1IBLB 2EIMC 4XJZA 2R1DA 1AR92 4X6RB 1Y74B 1O3QA 1XNQB 3I3EA 2Q8VA 1PM7A 1Q7YW 1GOGA 5GM0A 2UUBB 4QWNA 2ZGUA 1Q6HA 2DBNA 1SLIA 2XG3A 2VNOA 1T6GC 1GH6A 3L9DA 2OWOA 4W65A 2X6AA 4LP8A 4JI2O 1YJWV 2GDSA 4JI6B 2KM2A 3ZJZA 3DXRA 2RV9A 3VDDB 1IS4A 2X05A 5JCTA 2CH7B 1VBA1 4CCLA 2ETNA 2CGPA 3SYCA 3O7OA 4X1YB 5JDBA 1W8TA 2HWB2 3MI8A 2B46X 1Q8VA 3IGAC 4B3SO 2ZNIA 5KXEA 5C3OA 1F23A 1FPN3 4J6GA 4ES8A 3JZVA 2BGOA 1PL4A 4UVBA 2UXCO 3E5XA 1DCSA 1WAZA 4JKMA 2H6BA 3G4SV 2ZE8A 4PIYA 4CPBD 1JZ4A 4K9SA 1Y4MA 1BK0A 2A3QA 4FAGA 1W6PA 3E8BA 4IL7A 2VQTA 2BGPA 3W7TA 1JS9A 1ZL8A 4JI8B 1Q8SA 1UZWA 3M1HA 1CD3G 2NR5A 5IVFA 4LIVA 5KUKA 2DFCA 5HPOA 3BFRA 1D2QA 3WINE 3RZLA 1NH2B 1HRV3 1Q8PA 1NT0A 2EVXA 1P7BA 3AG2B 3ABLC 2DQ3A 5AVAA 4DV2O 5FZEA 3JBG1 1US3A 3O0XA 3TAYA 4BIUA 2RMKB 4LO7A 4PF1A 5L9VA 4UVCA 1IBKB 5T5LA 2RDRA 4EN9B 5LEKA 2N04A 4MVZA 5FKBA 1VF6A 2B8MA 2RVAA 2Y38A 3VDBA 1X50A 4QQ2A 4CEWA 3AP5A 1Y66A 2ET1A 2W68A 2WNVA 5KXBA 3I54A 2Y0PA 2WLMA 4KMQA 5FPLA 4XURA 1FAFA 5T50A 1ST8A 5GTHZ 3OBTA 3FZ3A 4QXBA 4OX9O 2RM23 4E2QA 3MHSC 3S5QA 3MLLA 2OA2A 4N9HA 1Y43B 5FUIA 1PK6B 1YVWA 5T5OA 1AL23 3PNAA 1XILA 2WLIB 2HVKC 3ETQA 3EYPA 3AB0A 2ZHKA 5LW9A 1OH4A 1VARA 4DUYO 3APQA 1IBMO 4AEDC 2W52A 2WNUB 2QQIA 3W7WA 4Q4X2 2JJ2G 1GSLA 4B8EA 4HSJA 3VKOA 3ZRVA 5EIYB 1W28A 4EROA 2JDPA 1WP8A 3UV9A 1PIV1 1TME3 4Q4V2 1ZBA3 3W7XA 2XHNA 3WB2A 4S2HA 1TGOA 4IEXA 2ZD9A 2CAZC 3JARA 1AR71 2BFUL 2JIJA 2V1DA 3HWJA 5EIBD 4AEJA 2IJJA 3NVCA 4DV5O 1KP3A 2YFZA 1JW6A 3HKBA 1N34O 1SQQH 4XW3A 1UPGA 1QQP2 3NV3A 1HB1A 1OOPB 5FY0A 5JPNB 5L3FA 2K9ZA 4DV1B 3M3CA 4G28B 4KG8A 1K5MA 2VW0A 4AQYO 1QJU1 3ZMOA 5JZGB 1EN4A 1H2MA 1SZBA 1Z7S1 2A6VA 5LATA 1FNZA 1WW5A 1ZZCA 1AXYA 5K0UC 3GALA 4OI4A 3MAQA 2ZOEB 5EK0A 1GZTA 4DV0B 4XAAA 5DZFA 2QM4A 2Q8OA 3MFCA 3L74H 2R9AA 4PHZA 1C8M2 2AGSA 4LR3A 1REFA 5FZBA 2WS92 5JVDA 2GP3A 5A70A 3VKMA 3CKHA 1YTFB 2JWPA 1VAVA 5JI9A 1TNRA 3FUOA 1MABG 3T2TA 1VBC1 1VLNA 4CXXA 4D7YA 3BA8A 1XBFA 1RUJ3 4Q0PA 3IIIA 1W6QA 5JLVA 4RAIA 3CNAA 3S0MA 4JAUA 2Y64A 4JAAA 4LFAB 1P4RA 5JR2A 4UCRA 2V5YA 3LD8A 1O9GA 2Z5WA 5LP6C 2FDJA 1I7FA 1N33O 4XILA 4YW7A 1K7DA 1OCOC 5IFPA 2LQTA 3GGLA 2QM7A 2Z0AA 3VBOA 3QG5A 1YI7A 2NNUA 2PXJA 4COZA 2GP5A 2YS8A 5K9YA 2QQNA 2VMIA 1KEXA 1Q56A 1ZZBA 4JKLA 4AEDA 2WO7A 3LDDA 4YFWA 1OXCA 1YQ6A 4WV8A 1LU2A 1H1AA 4Q6GA 4FM0A 4IEOA 1K33A 4JTAB 5D8AA 4XZPA 4Y1XA 3RSJA 2YEVA 3FAVA 5FO9B 4CEYC 4CC5A 4J1XA 1KD1W 4JTDB 4XFIA 4L8QA 4RFT0 2QFEA 2A3YA 1PGW1 4L87A 3H1IH 2YZ4A 1RVF1 1AI4A 2OZJA 1WCDJ 4EWAA 4XEZA 1ZRDA 4KI5M 3VHNA 4Z1MG 2PYJA 2OYQA 3K4ZA 4A3XA 1RUC2 4DK0A 5JXGA 1DQ1A 2BYVE 5IWFA 2Q67A 2VQFB 1NE4A 2YYOA 4ZI7B 2WLKA 1XYNA 5IK7A 5BY5A 5L19A 1GN6A 4I50A 1SRYA 4E2GA 5K0UA 3UGGA 2DYRB 3UT5B 2D6MA 4DRVA 1J59A 2RJLA 2D3RA 4O9GA 4KQ7A 5B1BC 2BBAA 1KU9A 4B7EA 4O4IA 2I07B 3L75H 1RHI1 2P4EA 5HXVA 5L9RA 4YM3A 3CSXA 2WABA 3FLPA 4E4SA 3AMPA 3HKDA 3C3SA 2LRPA 1MR5A 2XVLA 1BHAA 1NZIA 4RA0A 2EINC 4TUYB 1VBD1 1PVC2 1LGNA 4B29A 2R30A 1IBLO 2ZM6B 2V4DA 5B1OA 4KWKA 4E4HA 1XNQO 2JE8A 5DUVA 5IK4A 4QB6A 4M3CB 3B40A 2JIZG 2UUBO 3K5MA 3H3ZA 3SC7X 3SKJE 4MGKE 1RMU2 1FX5A 4O4HA 3KT4A 1W0KG 4DUWA 1PMJX 4Q29A 3NAPC 2YY1A 1HW5A 2JDHA 3MLJA 2ET7A 3O0VA 4IEQA 4YJ3A 4PIXA 4D6SA 4AF9A 4JI6O 1SG3A 2EAKA 4XBQA 4YVWA 4HL0A 1CXZB 2E6VA 2IBZH 4CUGA 3B01A 2QWOB 1RUD2 4JYBA 4JV5B 4N53C 4PQQA 1AROP 5AG2A 4IEWA 5A3PA 2B42B 2XBO3 1OLQA 3OJBA 1R3IC 2EIJB 3RI9A 3CIHA 3MD0A 1Z0HA 3O1RA 1CAXB 2ZCWA 4QMAA 3LA3A 4HK8A 4MLOA 3USSA 1KMIZ 1F7YA 2WFF1 1OMIA 2RG4A 1JZ5A 1CP9A 2R32A 2FCVA 2HG5C 1BEV3 1VMHA 4AAPA 2PLV1 5KAFZ 1PO13 2WWUA 2EICA 1ND2B 4XXAA 1AVBA 1VP7A 4JCKA 1YWKA 1RIRA 2WSUA 1VQPV 2WAAA 4JTOA 4WVMA 2AGAA 3HKCA 3BALA 4X66B 3U1XA 1AR83 4LUMA 3WDYA 5BNOC 4CP2A 1BBT3 4R52A 2KQXA 4QIWF 2XWBB 4JI8O 2W08A 1JYTA 3OFNG 4ONUA 1SCSA 5A7PA 3KV9A 3G80A 2FMDA 2MHFA 5FXWA 3POBA 2DV9A 2ARHA 2PHDA 4YFZA 2BUKA 3OR6C 3IBMA 5AC92 1ZA7A 1BL8A 4JI5B 3D6EA 1XHZA 3ZYFA 3ZBHA 2WLLA 1JTZX 1IBKO 4EN0A 1KYOF 1FJGB 4NTYA 2XL9A 1HB4A 4JYCA 5ABJB 2VVDA 5IYBO 3TNQA 2XKOA 1HQNA 4QD2A 3ATGA 3JXSA 4P30A 1YQ5A 1V9U2 5KUMA 3RMXA 1DP0A 2VXRA 3PJQA 1ZBE2 1NZ6A 1JA8A 2LO1A 3DPRB 2FTKA 1U5XA 1NQDA 5LGNA 5ANQA 2JJ6A 1LB2A 1SLLA 2RN9A 4CDQC