3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
4LUKA 3SCGA 2XLFA 5AVPA 1RUNA 2OYZA 4MZUA 4AQ6A 1QWRA 4F8AA 3ELNA 4QX5A 3SCFA 1O5UA 5KHJA 2VQAA 4WZCA 1UIKA 5BPXA 2MPFA 2FQPA 5E16A 1PM7A 5C8WA 4AVBA 2EVXA 2WC2A 3GBFA 2Q0AA 4D7TA 1DZRA 4XEZA 3H1WA 3RYPA 4KU8A 4OFGA 1IPKA 1O3SA 1I5ZA 4XFBA 5I91A 2UYBA 3E6CC 1UW8A 2PAMA 1LB2A 1SQ4A 5LEKA 1OFNA 2CGPA 2Z69A 3OGJA 3WW2A 4XF1A 2PAKA 3CL1A 4MGYE 5HI0A 4MGKE 2Z2SB 2MNGA 4IEUA 4LEJA 4BHPA 5I8TA 3I59A 3PVBB 1CAVB 4ZU7A 4J1XA 1GQGA 2E9QA 4AQ2A 4XF9A 3E97A 3SHRA 2VPVA 1J3RA 1CAXA 4YARA 1EYBA 4Z82A 3EHKA 4I0BA 3KGLA 4EWDA 4IEWA 5JR7B 4KL1A 4Q0UA 4IEZA 1CAXB 4HVOA 4Q29A 2EA7A 2XKPA 1G6NA 1UIJA 5K8SA 5FCCA 4H7LA 5I93A 1Y9QA 1QXRA 2BNNA 3E5QA 1L3JA 4XFIA 5FDBA 3OCPA 4HVRA 3QOPA 3WW4A 4N9HA 1ZRDA 1VJ2A 1ZZ8A 2XHKA 1NXMA 5J48A 5JAXA 1X82A 2O8QA 4IETA 4YYOA 2IXLA 3CO2A 4AXOA 2PHDA 3ZDSA 1CAUB 4JV4A 5JSRA 3CF6E 1O5LA 1J1LA 2PYTA 4IESA 1CAUA 5D1IA 3SCHA 3ROUA 1FT9A 3LA7A 4HN0A 4XFFA 4Z07A 3CEWA 4UBHA 1V70A 1YUDA 4KWKA 5I0UA 3BPZA 3HT1A 2UYAA 3NKTA 2ATFA 1ZREA 2DCTA 1UPIA 2PQQA 2ETEA 3RNSA 2GC0A 3MZHA 3CJXA 1HW5A 4TLFA 4MV2A 5KHKA 3USSA 3UKVA 5FQ0A 2IXKA 4XFCA 1ZRRA 3H7JA 2QNKA 4AVAA 4HZFA 4R52A 3MYXA 5J7MA 3SXWA 3UKTA 3H1YA 3NJZA 5CADA 4ORFA 3BCWA 3H1MA 2D40A 3H7YA 1VP6A 2WFPA 3HQXA 3D82A 2B5HA 4Q0PA 4DINB 3LA2A 3EQEA 2XGXA 1DZTA 3JZVA 4FAGA 4FAHA 5KBFA 3R6SA 3FJSA 1ZNPA 4P9GA 2H6CA 4KWJA 3U0ZA 2H6BA 1YLLA 5C6CA 3ETQA 3G7DA 4Q0VA 1RUOA 4IEYA 1O7FA 1IPJA 3EJKA 4I2OA 1Y3TA 1X8MA 1ZZBA 3TNPB 3KCCA 3S0MA 4K8FA 1OMIA 4I09A 1O3RA 1EY2A 2D5HA 3E6DA 2IXIA 2QVSB 4JVAA 4IEXA 4JTNA 2FMYA 2N7GA 3ST7A 3E6BA 3D0SA 3E5UA 1LRHA 1WLTA 1I6XA 2KXLA 5JSOA 2GZWA 2ET7A 4F7ZA 2K0GA 1CAVA 3HT2A 3FE5A 2H0VA 1XE7A 3OF1A 4EWEA 2P17A 3KMHA 4XFHA 5T3NA 1SFNA 5E1RA 3H8UA 4QM8A 3LOIA 3OTFA 1WA4A 3C3VA 3IBMA 2PHLA 1RGSA 4X6RB 1U12A 1VR3A 3TNQA 1ZX5A 3H50A 3IDBB 3KGZA 4LLOA 2QJVA 5F1RA 2XL7A 4IEOA 3DV8A 3I7DA 3BALA 2OZJA 4XF3A 1GQHA 1WGPA 5FLJA 4J1WA 2VECA 4I3PA 2EAAA 3ES4A 4EWAA 2UY8A 2C0ZA 1RC6A 2IXHA 1H1MA 4BYYA 1O4TA 3LWCA 4EROA 1YWKA 4LA3A 3M70A 2PFWA 3BU7A 3E5XA 2B8MA 3QACA 1QY4A 4HBNA 4XFAA 5KHGA 2QDRA 2GU9A 3IDCB 1EPZA 2ZCWA 2XKOA 5CU1A 2OA2A 3FX3A 2D5FA 5EFUA 1SEFA 4MUVA 4IERA 4HLTA 4PIYA 5LRSA 3U11A 2BNOA 1RL3A 2IC1A 3WW1A 4ZU4A 3IIAA 4IEQA 3EBRA 2ZKLA 1J3QA 4QGMA 3N4MA 2GC1A 4QXKA 5I8YA 1UD1A 4NVPA 3H3UA 4LTAA 5FPZA 4O9EA 5EZWA 1DGRA 4BH9A 3NVCA 5J3UA 3HIFA 4ONUA 1ZZ7A 2PTMA 2Q1ZB 2BEOA 4ZU5A 2F4PA 4XFGA 3SMHA 4R8HA 1XE8A 5CVRA 1O3TA 1YHFA 4MGIE 5JCTA 2ET1A 4E2SA 5FLIA 4MGZE 2GH2A 1Q43A 2BYVE 2XL9A 4XF4A 5I8SA 2HJIA 1NZCA 4X6QB 3ACLA 2BNMA 4QMAA 3RYRA 5I0TA 3DN7A 4YSFA 1FI2A 2CV6A 3I54A 3FFQA 1OD5A 2XLGA 3RZZA 1OI6A 1Q5OA 1H1IA 5FPXA 2QCSB 4N9IA 2HKXA 4FBFA 4WBBA 1ZZCA 4LUMA 4A2UA 4QGLA 5BXXA 1ZRCA 4IEPA 3D0JA 1CAWB 3LZZA 3UKNA 4PIZA 3DL3A 4BIFA 4O9GA 4WVZA 5BY5A 4E2GA 5I0RA 4MH0E 5BV6A 4IEVA 2OPKA 1J58A 4L11A 1NE6A 2B9UA 3OD0A 4PJYA 5I0SA 3I59B 4QGNA 4KU7A 4YNIA 3M3IA 2GAUA 1LKNA 1J59A 2IXJA 3L2HA 2CAVA 5FLHA 5KHHA 1LR5A 5FQ0B 1YFXA 3PLQA 1CGPA 4Q0QA 2D93A 4FT8A 5LEJA 2Q4SA 2MHFA 2XLAA 1ZZ9A 2BGCA 5JSPA 4KWLA 3WW3A 4I01A 1FXZA 4AVCA 4META 3B02A 1X7NA 1RTVA 4QM9A 3BB6A 1TQ5A 4CYDA 1ZVFA 4E2QA 1O3QA 2GC2A 4B29A 1ZRFA 3NSTA 4XF0A 3FWEA 5KHIA 2GC3A 3MPBA 4UBGA 4UXAA 4MX3A 3NW4A 4HMZA 2IXCA 1PMIA 1J3PA 1CAWA 4YRDA 1XRUA 4HSLA 1EP0A 4OLLA 1YFWA 3FZ3A 4JTOA 3GYDA 3H3ZA 2PA7A 4I02A 1ZZ6A 3CLPA 4D7SA 2UY9A 4LULA 3O14A 3LAGA 3S7EA 3PNAA 4LA2A 5BUVA 1YFYA 3H9AA 4HSJA 2K9ZA 1QXJA 1NYWA 1X8EA 4XETA 3VHRA 2I45A 2OZ6A 1Q3EA 2Y0OA 5LRRA 1NE4A 3KSCA 2Q30A 3DKWA 2O1QA 3MDPA 4Q0SA 3RDIA 3EO6A 3RPQA 4HVQA 4RD7A 3U10A 2PAEA 1DGWA 1YFUA 3RYKA 3LA3A 3IWZA 4PIXA 1UCXA 4GULA 3NL1A 1JUHA 2CAUA 3ES1A 4I0AA 1CX4A 3FHIB 3S7IA 4HN1A 4L2NA 4EV0A 2V09A
chains in the Genus database with same CATH superfamily
1W6MB 2BTQB 3O65A 1FXVA 4BQ4A 1H2MA 1LU2A 3OR7C 1QWRA 5BPXA 2VQAA 1BBT1 4FM2A 4NTYA 4TWKA 1OA3A 2QQUA 3QBQA 5GKAC 4JI8B 3JAWB 4NUBA 4NIIA 5EYXA 4N53B 4K0KO 3KV4A 3J7LA 1IZ3A 2E31A 3CL1A 3KG2A 5LBFA 4CDXC 4EFBA 4HK8A 1MMMA 4MTOA 4IEUA 2XAQA 5EC2C 3BGAA 3I59A 5I8TA 3AG4C 3ZMTA 3X2QC 4O4LB 1M56B 2QJ1A 3M99B 4FLZA 4JI3B 3J7AU 5FYTA 1AJQA 3WY6A 1GP4A 3GF6A 1V9U1 1WLEA 1ASJ1 4UFHA 4E4SA 3M3CA 4CC6A 2JGDB 2ZAAA 2QFEA 1AR93 2RR12 5IY5B 2DUPA 1BCCH 1L3JA 3NNGA 4MSVA 3MD0A 1UL9A 1M57C 5A3OA 3T4VA 1QR8A 5JQGB 3FUQA 2O8QA 3ORJA 3ON7A 4YVSA 3VBOC 1A8DA 1CIWA 3TEXA 4ASKA 3ZHQA 4XCBA 4O4HA 3OR6C 3K51A 2JG8A 2YGMA 2XJRA 2ZX3A 3AK3A 4CP1A 4AQYO 2DCTA 4FO9A 1UNBA 4K1YA 1E57A 4FQ4A 5F8PA 2A6ZA 2QM4A 1DYOA 2WS92 4K8XA 1F15A 4AI8A 5CADA 4G4FA 3BCWA 3H7YA 3HQXA 3DXTA 5L7OB 3OEHG 2EIDA 3I2KA 3ZXFA 2ERFA 2CDPA 2DYSC 4Y26A 5IYBO 2JDZA 3ALQA 1OJHA 3OJBA 4RS5C 4YIOA 2V4DA 2Y6HA 5KC6A 2VQFO 1GR3A 5A33A 4QX3A 1D2SA 4IE6A 3JQXA 4X89A 1BEV2 4QPIA 2VUJA 2ZS6B 1NQTA 3LOBA 1J95A 3GWKC 1NQJA 2E6VA 3LOIA 2YZ4A 1C57A 5LBBA 2R043 4NTXA 1WCSA 1QJX3 1KITA 2HVJC 2YC2A 5FK8A 2OXBA 4LR3A 2R041 4PA6A 3GVMA 4ZOLA 4YWAA 2WSUA 4FPLA 3N2KA 4PDLA 2M6YA 3ZRSA 2P34A 4U3FH 2X8KA 2I07B 1GBGA 4BDVB 1DF0A 5JR2A 5FIXA 3KHBA 2AZ2A 1YWKA 4HETA 4BW5A 3SLIA 4WBNB 5BY1A 4R50A 5C4WB 2GU9A 2XBO2 4DY3A 1QQP3 4BW9A 3OTOB 3IJ4A 2BNOA 4QKBA 4BOWA 4QX2A 1IBKO 1S0IA 3JASA 4FTEA 3ZN1A 1JX9A 2Y6FA 3UGHA 1IQAA 1PNGA 4AK3A 4E8CA 3POWA 3JD0A 4ET7A 2HJDA 2WZR3 3H1IH 2E33A 1AXZA 3INAA 4C1WA 4DV7O 5IYDO 5J3UA 4LO7A 5BR8O 3B09A 5FJHA 4MTFA 5I8SA 3D5OA 1OVPA 5FY9A 2BNMA 1XBFA 3DKQA 2WN2A 4FOVA 5B1AB 3WNLA 3IPVB 1M4WA 1RUJ3 5FPXA 1V6KA 2HKXA 2B4KA 2YI9A 4IIJB 5DG1A 3ECQA 1TNRA 3RYCB 4WVZA 2NMNA 1HRV2 3EMRA 3RJ2X 1MEC2 3WDUA 1S4CA 3JCUZ 1VQ7V 1D4M1 1ND2A 1W6OB 2VQEO 3FX7A 4YVSC 4R7CA 1EN4A 1WMDA 2XHBA 1K5MA 1EV13 4BA6A 5BNOC 5CFCC 4AW7A 3WNXA 4FT8A 3H1JH 4DPNA 2VZUA 1KFUL 1NR7A 1SG3A 4I4TB 5A6ZA 5A32A 2VBDA 3CD6V 2EULA 5SV8A 2OWOA 4RR3B 2HWD2 1IXBA 3NW4A 1GOFA 1MS1A 4J11A 1EBOA 3MGUA 3ML0A 5LA2A 4OLLA 3WQ7A 3GYDA 2F66C 2VMIA 3CLPA 2F1MA 3LAGA 3ZFFB 4P30A 2VD7A 1EN6A 1C4RA 2A3QA 4XETA 2C5DA 3CQOA 1NE4A 4P9PA 3ILRA 1SQGA 2N05A 2BOJA 4Y33A 4S2DA 4IYIA 2ZNJA 3UT5B 5FMCA 3U07A 2WNUC 4CH3A 3C3SA 1JUHA 5JPMB 4I0AA 4EV0A 1SFYA 2RQ6A 5L36A 1RUE2 2X09A 1TZOA 3OY8A 4QPIC 1O5UA 4WZCA 2CSGA 3MICA 5E16A 3B8NA 3M4FA 1ZA7A 5E8AA 3NWKA 2GTAA 4KI5M 5A3PA 5EXOA 1RUD1 1ULFA 3TB0A 4A3ZA 1UW8A 2E63A 5IVFA 5J36A 3SC7X 3SPJA 1KP3A 5IVJA 5JXIA 1N1YA 3ITQA 3SPIA 4BHPA 2X5IB 1BMV2 3ZMVA 4X8PA 5FZ8A 5IK4A 1HXS2 4YJ2B 4I50B 2Q73A 1QU0A 4EWDA 3ZMUA 4A4AA 4HVOA 1UIJA 5FXWA 3WINE 4CU9A 5I93A 4Q4X2 4HVRA 5IVBA 1PV0A 4FFHA 2IVJA 2ADPA 5IUQA 3ZMZA 2RS33 4GALA 2ZX1A 2UXDO 1V6LA 4GH4B 3BABA 3PHMA 3SCHA 4NPMA 3LA7A 2W92A 5JIAA 3TOJA 3C7OA 4A5UB 4XPVA 1V70A 1YUDA 4JI3O 4TXWA 2BUKA 3BVCA 2Q5ZA 2GDSA 1UPIA 1AXYA 3HEIA 3CJXA 4TLFA 5FZCA 1M93A 2YXHA 3MYXA 1Y43B 4CDXA 4QGPA 3F5WC 1Q56A 4TTGA 1PX3A 2Y69C 1WPBA 3T1YB 4BR6A 1WCDJ 2QM8A 1PVC3 4C0HA 4KWJA 1XQNA 3KM5A 3DSQA 1C1LA 4NPLA 3DC6A 1RUI3 2AREA 1JU4A 5H9PA 3E2EA 3WP4A 4Q0VA 4QQPA 4TT3G 1XSRA 4Y22A 1AR61 1W04A 1BQPA 2PGGA 2QKCA 4XBQA 1H8TC 5KAFZ 4CU6A 3UESA 4B08A 2RCVA 3B5LB 1VBC2 2Y4TA 4CH5A 3PVNA 1WMFA 2K0GA 3WHUA 5C9AB 2D3RA 4OPHA 2XG3A 2YFZA 4Q4W2 5JUVA 3GALA 1DZQA 1SFNA 3WP6A 2HEPA 3HKCB 2HEVF 1H2LA 4LF8O 1R1A3 3RVYA 1W03A 2VMFA 2DBNA 1BEV3 5GZEA 1YHQV 1OLQA 2QJVA 3B2EE 3AK2A 1NA1B 2QR4A 2P5BA 4EZ4A 1AJKA 2WT0A 4RUFA 2OZJA 2D6PA 5CA0A 4GT1A 1W9FA 1AX0A 2VECA 5LBQA 3JYCA 2C0ZA 3ZIAG 4OULA 4XE9A 3RVHA 2XTAA 1S0VA 2PHRA 3NV4A 2ORXA 1GZTA 4LA3A 3A0BZ 3QVNA 1TEIA 1TVGA 4LBOA 1QY4A 1SZXA 2XQXA 4JKMA 3WHTA 4JYBA 3VBHA 1AR5A 1QDOA 4XXPA 4KGGA 3IT8A 4GKKB 1SEFA 3WDWA 2R1DA 3RS6A 1GYKA 5KMGB 1EV11 2ETNA 3IIAA 1JZ4A 3EBRA 1HJGA 2ZKLA 2WZPP 5GTHZ 1ACCA 1PGL2 2GC1A 4QXKA 4LC1A 1Z2GA 1N36B 3AMMA 3CHXA 3AG4B 4ZU5A 3OB8A 1WPXA 3HVDA 4FPKA 2B9ZA 2FKXA 4H37A 2J1RA 3ACHA 2XVLA 2Y38A 5C8YB 4Q4W3 3OEEG 2EINB 4QMAA 3GZEA 4OHXA 3HJRA 4NAMA 3SJBC 4AAXA 1OI6A 1WCUA 4N7UA 4N9IA 3MO4A 3WNKA 4Q4V3 2IUWA 4FLTA 3JCIA 1PZ7A 3LKJA 4LF7B 3VZKA 1CIYA 1GQPA 3AJZA 2KD7A 4MH0E 3ZSMA 4NJ4A 4XDLA 1W6QA 4L11A 4PJYA 2NLJC 3JCZA 4YVWA 3MUZ1 2VR4A 1SHWB 1XOYA 2IXJA 3L2HA 5IW0A 3WSOA 2ZGUA 1VB2A 2DUQA 5LEJA 4BIOA 5GLUA 2EIKC 1ZZ9A 5FV3A 2UUBO 1PZ9A 2OS2A 4YJ2A 1WN7A 3HNMA 4FFFA 3AFGA 1ZVFA 4ZS3A 3CCUV 1JODA 5EHDA 4XW3A 3BUCA 3T0BA 4B3TO 4W6XA 3POIA 1CAWA 3L71H 4AGVA 1YFWA 2PA7A 4J42A 1GOHA 4D6RA 3S7EA 4QE7A 3ICXA 2JDPA 3J4UH 1WLDA 3Q4HB 2CTPA 3J8F2 4PF5A 4XUPA 3B4SA 1ENVA 4IYHA 1W6QB 3CDZB 4DRXA 2VOXA 4JASA 2W95A 4NXNO 3I3QA 4AQ6A 1DCSA 1PO21 1H9PA 5CNAA 1MS4A 4YZ2A 3S30A 4Q4X1 1N3PA 1NLQA 2Q1FA 4PV1B 2WYSA 4BQXA 3STZC 2AW9A 2YG0A 3JBG3 2HWF1 1QJU2 1IS4A 1G6UA 2GNTA 5CZKA 5A7WA 3ETDA 1YQ2A 1ZL8A 1R1A1 1HQWA 1PM4A 2DJVA 3N3HA 5A1AA 1P4RA 3WF3A 2ADDA 4LFBB 1ZUQA 1ORQC 2RS32 4M3CE 1AR73 3PU3A 4KHPO 2WPDG 3IM0A 1EYBA 1S77D 4JAVA 4XUTA 2ZGRA 3EHBB 2BTOA 1N1VA 4ZI7B 3SJAC 4JI8O 5CMUA 4GJZA 1VB4A 4YW5A 1IX9A 2BNNA 2YGLA 2ZGPA 3JAWA 3STLC 1WCQA 3D36C 4PBOA 2V5YA 4LORA 1MG1A 1GICA 3TWIA 1JH5A 4XDPA 1EV12 2PYTA 2Z79A 3MFAA 2BGPA 1B35C 1RB8G 1FYJA 4RFT0 1KD1W 2BPA2 2BE3A 2XNDG 1FPOA 5T54A 4OQ9A 4JGZC 4B4QA 3AG2B 2ZGMA 3C7HA 1H4HA 1HW5A 3R0RA 3ZHUA 3AXDA 5IVYA 1NKDA 1DP0A 4MS2A 5JMCA 2YY1A 5KXEA 1QJU3 3FAVA 3TXSA 4X65O 2YPDA 5JOWA 3ZYRA 4CH6A 3BPSA 4URTA 4ZXKA 1FJGO 1HIXA 5ISLA 1VQ5V 3AL6A 2JG9B 2ZZJA 5G04L 1W8NA 5CG9A 1H4GA 1M90W 2NPIA 3ASIA 4HANA 1GUIA 1VMJA 5FZEA 4JGZB 1HR0O 1O7FA 2NQYA 3MW2A 1GO3F 4CEYB 1IS5A 1AB3A 5J2UA 4JZRA 1U5YA 1LCLA 3Q4HA 3TNPB 2R6QA 2WZ8A 1VIWB 4BXFA 2VL4A 4BB3A 4FTBA 1MPXA 3S5AA 2C9AA 2ZT9B 2G9FA 4GX0A 1NAEA 2BW8A 2IH3C 2J1TA 2Q8EA 4QPKA 2Y60A 3HKDA 4ABMA 4HG6B 1RGSA 2ZHMA 5F2WA 4XTPA 4R4ZA 5DAXA 1N32B 1OPMA 2A3WA 1MQTB 5CA0B 2ZM6B 1TMF2 4I30A 4U7NA 3Q8FA 4XF3A 5F32A 4DXSA 3WUCA 4IE4A 3CXHF 5DDJ1 2DWRA 3H9VA 4WFEA 1O4TA 2J1AA 2F4VB 2YIDA 1AR92 4XFAA 1JOBA 1PVC2 2Q69A 2GUZA 5A3TA 4O2AA 1XSQA 4RR3C 1I94O 1BBT3 3A2FA 3UGFA 2D6KA 4BH9A 5FOBB 4XJ8A 1CZTA 4LBMA 1RPRA 1EPWA 5D21A 4XJ9A 2ET1A 2UUCO 3ZPYA 2AHZA 2VU9A 2SLIA 3RYIB 4ZI7A 2IJIA 1HXS1 2NYYA 3V0BB 2IFWA 1IKPA 3VBSB 4YSFA 1NCRA 3I54A 3FFQA 5FZ3A 1NS1A 5L3GA 4JTAB 5AC93 1ZZCA 4ZS2A 1G1XB 4QQLA 2VZVA 4CXYA 4LF7O 4LKFA 2EXHA 4AOCA 5DECA 2B45X 3DL3A 4OZXA 2E5LO 4PHZA 4O9GA 1VAMA 1XQ8A 2PYJA 4DV7B 4K35A 4AQTA 5CFDB 1EN5A 4CP2A 2IH1C 2XWBB 2QWPB 2WLHA 4CUCA 3SPCA 5EJZB 5BNOA 4YNIA 5F2SA 1YQ5A 4RQPB 1VAVA 5FLHA 3WDXA 1UX6A 4PA9A 3BFRA 3U37A 2LO1A 3AMHA 1OSGA 3VBBA 3VKOA 3PU8A 4AHXA 2JGDA 1VQNV 4ISRA 1SLLA 4TV8B 1RTVA 1X9PA 4I9QA 3L74H 1SPPA 2FBEA 2GNMA 4DRVA 1QDCA 4YM1A 4D8MA 3AP4A 1ND3C 5FMDA 1I5YA 1QHDA 1QH6A 2HFEC 2F4LA 1OKQA 3B8MA 1STMA 4XTMA 3FLRA 3O1PA 2UY9A 1UY3A 3K5MA 4H44B 5K9YA 1QQP2 1VBD1 3JBG2 4OHVA 2RS11 2UU9O 2DFCA 3EO6A 1YF2A 2DCYA 4RD7A 4DV6B 2RHPA 1RHI3 1UCXA 4PIXA 3NL1A 3ZLIA 2XJTA 1REFA 2ZR2A 4NXNB 4NOTA 4DZGA 3SCGA 5CISA 1RUNA 3ETPA 4QX5A 4OYUA 1AYN2 2MPFA 3E8HA 1RVF2 4NN0A 1MR5A 3LCPA 1ZTEA 5EC1C 2Z5WA 3RZHA 1LU1A 4UVAA 1MOFA 2VCCA 4URAA 1HNZB 1ASJ2 1VBA1 2C6SA 4LBKA 4UW4A 1S72V 1N3OA 3PUSA 4FM1A 4AG4A 1HRV1 3PJQA 1NLSA 3N9MA 1QJX1 5LHGA 4LXLA 2ILMA 4Q1PA 2Z69A 4DR6O 4DS0A 3UO3A 3W58A 3OGRA 4DO0A 4J7JA 4CP9A 1BXHA 1S0EA 3GWOA 2BOCC 4PJ0Z 5FYCA 4LEJA 5FPLA 1AXKA 3OE7G 1L7LA 2JJ1G 2C24A 2YUEA 5CFDA 2LQTA 1GQGA 4DR4O 4AQ2A 1UX7A 1WP8A 1J3RA 4EJRA 4AZZA 1XL6A 1UXZA 5FZ1A 5FXVA 2FMDA 4PLNA 2VMHA 2WJSA 1V54B 4IEZA 2FZ1A 5FP9A 1XNRB 5C3OA 1SZTA 5IYYA 3E86A 2HBTA 2VC9A 1F4NA 1PKXA 1W2UA 4LJHA 4BMBA 4QU2A 5A1LA 2AZ5A 1FFTB 2R9RB 1JN2P 3BYWA 4MW3A 1SPPB 1ULOA 1DGLA 4FXKB 4QB1A 1A3KA 2A3YA 4NRQA 4JYAO 2XBO1 1E79G 2LTNA 3MIGA 3SPGA 1ND2B 4QX8A 3NO8A 1GM7A 2ATFA 3AP6A 4LKDA 4GQ7A 5FY0A 3I2HA 2ZEXA 2H3OA 4MV2A 4YG3A 4A45A 3P5BA 4AVVA 4AVAA 3WG7B 3SXWA 4RYDA 3H1YA 1OPOA 3DXUA 1O8PA 4DINB 2D6MA 3OY8B 1B35B 1F4HA 2WO2A 2GDFA 2H6CA 3RWKX 4FMTA 4NHMA 1Y67A 2WUHA 3ETQA 4E8DA 4CCOA 3MIBA 3JARA 4GA9A 3IIIA 3MHZA 4GH4C 3B00A 1YSCA 1MZEA 1Z5VA 2XJSA 3KCCA 2RS13 3AYDA 3SNMA 4DR1B 4JTNA 2FMLA 2DQ3A 3D0SA 1U5ZA 1QJX2 4F7ZA 1G9FA 1W8HA 1RIRA 1AF9A 1TE1B 2NLRA 2ZGKA 2A5ZA 5HV4A 4W4ZA 2BBAA 2D97A 2Q7GA 3NNMA 4P08A 4LK7A 2Q1MA 3ZFEA 2KG7A 2HR3A 3T1HB 1WWYA 1NTKH 5J2UB 4JGYA 2YSUB 3CCRV 2VS0A 3TBDA 4J1WA 4Q8LA 2WS91 3SR2C 3H3LA 1GKBA 2RMU3 5LYJA 4X9QA 1H1MA 4QDSA 4GH4A 2CY6A 3WCSA 2PFWA 2WFF2 1R082 3AG1B 4HBNA 3CSXA 1XXNA 3OPZA 4TYSA 5GLTA 1G9BA 2DF7A 4MUVA 4UOJA 2W9XA 2CTQA 4N21A 3U11A 4QPIB 1LOFC 4ZU4A 1GFF2 1N8RW 3VL8A 5C93A 4NHKA 2OYQA 3MLKA 3FYIB 5F9TA 4LFAB 2AXTZ 4J7ZA 1HKDA 2DYRC 4I9WA 2HWC2 5B1OA 2YIBA 2F4PA 4J6GA 2BWCA 1FMD2 2YBSA 1US2A 3K03A 5JCTA 5KC5A 5FLIA 1TA8A 5GONB 1CXZB 4GAZA 1TME3 4RA0A 1ZRIA 4Y20B 3ACLA 1UQXA 3CCJV 1PIV2 3C2UA 2X0LA 5KAIZ 2CV6A 4UVBA 1FV2A 4XXAA 3G71V 3AMPA 2VVFA 4TWTA 1OF4A 5IYZA 1CONA 1MZ6A 1QCEA 1F23A 3FFZA 2QQOA 1NCQA 4CA9A 4ISQA 4Q6GA 2LALA 1RM1C 3DECA 2KSDA 3JALB 3M3IA 3K57A 4KG8A 4DV1B 3ZYPA 2KM2A 1SCSA 2ZDIC 5EIBD 2YIAA 3POYA 2ORZA 1FNZA 2ZOEB 4NTWA 1NCQC 4Y5TA 1NT2B 2ZX2A 4YZ4A 3B02A 1Q6HA 4O4IA 4CU7A 1SS3A 3V0BA 2C9KA 2K2SA 4PD4F 2VNGA 1KQSU 5FYVA 3ZN6B 2GC3A 1CEZA 3T0AA 4TV9A 2NMOA 3ZSLA 1OVSA 5IJ0B 4FOWA 2A6YA 3RI8A 2WAOA 5FZHA 4LWSA 4B4RA 5GLWA 3SH5A 4AR2A 3GGLA 1O4ZA 4XC9A 4HYOA 3PNAA 1I1EA 2W47A 4DXZA 2JG8C 2E7TA 1VF5B 4CP0A 2ZPXA 1R093 5LRRA 3T1YO 3LD8A 1CN1A 2I74A 4AFMA 3GZAA 2JEUA 2UUAO 4RQPA 2VQUA 5KWRA 1E1QG 1WJZA 2CK3G 1MQTA 2RMU1 2V09A 1H8TB 4LUKA 1JHNA 1A78A 1VAKA 2ITCC 1JMUB 3ZCCA 1C28A 1H8TA 3WF4A 2FQPA 5JQGA 5IVVA 4PQ9A 4MO3M 1XHZA 1WW5A 1GNHA 1YXWA 3SJQC 2BOIA 3A21A 1N1SA 1SQ4A 1WLCA 4AI1A 2W39A 2CGPA 2VZ1A 3FMGA 4UF0A 1KJLA 4DXRA 2WNEA 4O4LA 2BSKA 3HAGA 2P6JA 1EZVH 4H14A 1Y7BA 2Q8VA 2HH9A 2E9QA 2A7AA 4HKWA 4HNAB 1VP7A 3A0KA 5FWEA 4CDXB 4FP2A 4MXWB 3THDA 1UF2C 4XJUA 2IM9A 4BQ3A 1N1TA 1FXKB 4CUAA 4DK0A 4BQWA 1ZZ8A 5C3PA 1V55C 4AE2A 3QTCA 1X82A 1MS9A 2WO1A 1Y6XA 4O4IB 2CL2A 4JV4A 2YHJA 3CF6E 4FPGA 3CRRA 1APNA 2W68A 4P9JA 1YRZA 2WQ4A 1XMOB 4LITA 4Z2WA 4KHPB 3ILNA 3JSNA 1QNMA 1FOD2 3O5SA 1PP9H 3OUFA 4AYUA 1T2XA 3HT1A 2UYAA 4HOOA 4KP4A 3ZMNA 2RVAA 5LHIA 2PQQA 1SCRA 4R9DA 2XJVA 4GWNA 5EWSA 2DWDC 1UYPA 5CEHA 3UKTA 3NJZA 1UYXA 2QDOA 1VP6A 2WFPA 1CPMA 4Q0PA 5F3GA 2Q8CA 4FPPA 2VO5A 4J9ZB 2YS8A 5LK5A 4MVZA 5B4NA 1YLLA 3L72H 3AG1C 2VOTA 5T52A 2VUAA 4JV5B 4SBVA 1RUOA 1AYM2 1I5PA 1PNLA 1JR9A 1FKAO 5GONA 1SA0B 3KZ4C 1XI1A 3H8RA 1CWPA 3E6DA 1IVSA 4YVWC 3T2QA 3AKTA 5E1AC 2GZWA 2VOKA 1HNXO 3ZBHA 1M06G 1BSMA 3N7MA 4FVVA 2OPWA 3ABKC 2YDEA 1WCKA 2R32A 3UO2A 2J1VA 3ABMC 3IKWA 5JI9A 1VR3A 2G9ZA 2ZKNA 3BN6A 3KGZA 1VQPV 1GN6A 3HOBA 4X66B 3P3NA 2WABA 5HCAA 2RJKA 2PZSA 1RC6A 1RUG2 2D3PA 1JJ2U 5EYYA 5IWAO 1WB8A 2EX3A 2JB4A 3I4IA 3M70A 4FOYA 5FPAA 4RGAA 3DPRC 4O4HB 2VRZA 4HK9A 2QDRA 4DV0B 4DR6B 2Y0PA 2BJSA 4GKKO 1KU9A 1HRV3 3QF7A 4IV3B 1F8VA 4XABA 1F5FA 2D43A 4KQ7A 3UJOA 2XWJB 3AM2A 4LHLA 5EZWA 4ONUA 4JZGA 1Z7S1 4PDRA 3PIJA 5EPAA 5A70A 1LOAA 4MGZE 1KBHA 2B42B 2ZZQA 2BYVE 2D3OW 4WFBV 5BNPC 3AL5A 4Q1RA 4BM8A 1K45A 2YBPA 3T2PA 2G1MA 2VMEA 5I0TA 4QNHB 3AKSA 3RZZA 2OCCB 2J7MA 4AGGA 1S2BA 4XUNA 4WBBA 1QVFU 4IL6Z 4A2UA 1H38A 1F4MA 1I94B 5C3QA 5BXXA 1V9PA 4Q26A 1VQ4V 3N35A 3UKNA 3FHQA 4Y4YA 4DV3O 4QWNA 2ZGTA 1VBD3 1AL23 2HWF2 4XYXA 4Q2FA 4DV1O 4K3AA 5B1BB 3K04A 3K5NA 4C8DA 4K0KB 3UJQA 5LA9A 5FNVB 1YJNV 3GZUC 4JTDB 1G4YB 5B1NA 2V1DA 3ASNC 1PGW1 1Z7S2 5J9PC 5LOVB 4MG2A 4IHJB 4I55A 4CEWC 3POFA 4AILC 4JQTA 4QKNA 3TN91 4AGRA 4AF9A 2HYKA 2XMLA 4B29A 4X62B 2W0FC 2WLPA 4D94A 2PHFA 2Y64A 2Y0IA 4MVMA 4MX3A 2XJUA 1IBMO 2OIGA 3U4XA 4OXSA 4ZHQB 2QQNA 3VD9A 4OUMA 2E53A 3FZ3A 4JTOA 3RG0A 1U5XA 2EINC 1AVBA 4Q20A 5CA1B 2DVFA 2HEYF 3H9AA 1KEXA 5HXVA 2YROA 1NYWA 4UV9A 2P4KA 1XNAA 2K9PA 3S3WA 5C7GA 2EJ7A 3B77A 3AKPA 3RPQA 1IG3A 2W87A 1W6MA 3W21A 3LA3A 5JMOA 4B4PA 1W99A 3UV9A 2OT5A 5LCWL 4WFGA 3FB8C 3ELNA 3KVAA 4WM7B 1NI8A 3I3BA 1Q8OA 2A79B 4WFHA 4LH7A 2VW2A 1K3IA 2WNVB 4YW1A 5T5OA 4YM3A 5EYPA 1O3SA 4Q4W1 4FQZA 1VRH3 2R072 1XPWA 1W90A 1VARA 1JPXA 4P9WA 1OOPA 1OCRC 4QXCA 1DGSA 3WZ1A 2EXJA 2YEVA 5JH7B 2MNGA 3SYQA 3BA9A 3PVBB 2QQVA 5A9GA 5JH7A 3VDDC 2JEMA 1KKDA 2W08A 5FZ0A 3RW0A 2ZM6O 3WG3A 1QR9A 3LEGA 5JR7B 4JI7B 1YXBA 4LFAO 3MIDA 2LGQA 1Y9QA 4RS5B 1NXD1 5FDBA 1WD4A 1SQBH 1W0PA 2XHKA 3OM3B 1ULCA 3OD4A 1NXMA 5CKMA 1YIJV 4K7JA 1O5LA 1J1LA 4C7UA 2KKWA 5K4LA 4DRRA 3B69A 1OF3A 1NJIW 5FZ9A 5FZMA 2R063 1K3EA 5GZFA 3VHNA 5BNOB 2G4IA 3NJXA 3CCVV 4DRXB 4CCNA 1JUIA 4FTSA 1IS6A 4XDKA 1XNRO 2QNKA 2ZIOA 4RAIA 5CIRA 1K34A 1SLCA 4F6RA 4NO4A 2DFBA 3GBWA 5L3DA 1NLRA 1BE3H 3CMEV 3MV11 1H2GA 1HQNA 2WZR2 4H33A 4H3WA 3CCSV 1NUKA 4R8CA 1YQ8A 4RS5A 1QKQA 1ULGA 4XJWA 4CDUC 4TV9B 4FPCA 3MF6A 1YO8A 1WW4A 1YTFD 3SKJE 2EIMC 4CEYA 5HCFA 2DVAA 1AR82 3T1MA 1I5XA 1OCOB 3JASB 4I09A 2VTFA 4YW3A 2Q4PA 3RYHA 5DN2A 3WLUA 1RUJ2 4PDWB 4NR1A 2R72A 4I0XB 4OHWA 3WQ1A 3ZDVA 3MW3A 1LRHA 4COYA 3GCXA 4PDMA 4QXHA 1FS0G 1B04A 1OHFA 2P6HA 3USUB 1CAVA 1RUG3 3T4HB 4XFHA 5F3IA 1RUD2 3T0DA 1FPN1 5FY7A 3BI3A 2D44A 4Z92B 5E89A 5JLVA 2YYOA 4LBLA 1DGWX 3AP5A 3ZYHA 4BK5A 4GWMA 4JHZA 3IDBB 4UCVA 2VCAA 3OBTA 4X1IA 3MUY1 4CCMA 3PURA 5LMUB 2V73A 4HT1T 1AP5A 2EILC 2GBOA 5C4WA 1Q81W 4PDWC 4XBLA 2EAAA 1W39A 2JE7A 2PHTA 2EIMB 4K6BA 5K1XA 3ZRVA 5KX5A 2OIIA 3TCUA 1XYNA 5LYJB 4IL7A 1F31A 4LPLA 4XURA 1S0CA 1WLWA 5EFUA 3K2OA 5EZYB 2XONA 2Y8KA 1V00A 5LRSA 1XUQA 4DK1A 1RL3A 1FV3A 4DR4B 4KUMA 3VHPA 1H2KA 4GB33 4WZFA 4ZPIA 4QGMA 1CZVA 1UD1A 4HNAA 1D2QA 3NXSA 2ZCEA 4FLVA 4PA3A 4OHYA 1BHAA 4MT8A 4UFMA 1K7DA 4F6RB 3MV01 1XE8A 2KB1A 5H9SA 5C70A 1D0GA 2HEWF 1JZ3A 2EIJC 1JYIA 3ZRWB 5EP9A 4YVSB 2XT9A 4JDOA 5A7WB 5T55A 2VY0A 1W0OA 1LEMA 3M8LA 1FI2A 1TME1 2P90A 1AVMA 2QWRB 4JI0B 1F9KA 2CHHA 4XUOA 2WAMA 2IWGB 2WA4A 2FDJA 4LHKA 1RUH1 1XMOO 3CJHA 3ZN0A 3PVOA 4YJ3B 4JYYA 4XCAA 2MK3A 3LDKA 4IT5A 3H8OA 3FLTA 4IEVA 1I3HA 3BOPA 5J2TB 4HXCA 3OD0A 3WG1A 4Y1UA 4W50A 4X88A 1JCHA 4KU7A 5J2TA 4W6WA 2VWKA 1B35A 3VBOA 2D3SA 1QBZA 2UXXA 4Q0QA 4EN8B 2Q4SA 1K5QA 4XAEA 2JKBA 4JKKA 2HWB1 2JE8A 1N3QA 2X6CA 2P6CA 2JIGA 3VBRC 1AR72 1ZRFA 3NSTA 4Y1VA 3Q8BA 3IDAA 1UZVA 3M7AA 2HHHO 3ZJZA 4YZ5A 5T5PA 1GN3A 3EXUA 2BTQA 3JATA 1EP0A 4MLOA 4C0BA 1ZZ6A 3LF7A 5FTTC 2VCMA 1N0JA 4LHSA 1SBDA 2FYUH 3U75A 5EQUA 3RT3C 2WNUA 3B40A 1YI9A 3A23A 4O2BA 3F7VC 3RWRD 1VRH2 1GZWB 1KS4A 3RYKA 2R0HA 2X7RB 1Q8VA 2RM23 1JZ7A 3P32A 2RS12 3KS7A 2W91A 1LGNA 3WQBA 3BA8A 4MW8A 4AQYB 1JZ6A 3O0WA 1MA1A 4A3XA 5C8WA 4RFRB 4F6EA 2Q0AA 2DU1A 2VZSA 1HXS3 2EALA 1ZBE3 2GUZB 2HWE3 1PIV3 4KGQA 3ZRWA 1MEC1 2P3IA 3K5LA 2QSAA 1RUF3 3IDEA 3UNPA 2QQPA 3G67A 1BEV1 3KKYA 4LF9O 3OGJA 4U3JA 1HN0A 2PAKA 5JIUA 2XH6A 5DZGA 5CB7A 2VNOA 3N9PA 5DAWA 2TUNA 1SDWA 5JCOC 4DW0A 2H8PC 2WO3A 3K58A 1OURA 4NIHA 5FY1A 2RDCA 2I2SA 3APQA 2LW8A 2EICA 1AL21 3CJIC 2YICA 3AP9A 3E1F1 3S3XA 2LUWA 2RN9A 3K4AA 3JD2A 1KD7A 1UZZA 1W2NA 1NX9A 4OX9B 4Y20A 3FLPA 4Q4X3 1Q8QA 4KBBA 5J48A 2OTJV 5JAXA 3F5TA 2IXLA 3CO2A 5I0DA 1GTOA 4ZXEA 1ODNA 3HMYA 1UPGA 1F7YA 4XQDA 5B3SC 2Q8OA 5FP4A 3BPZA 3NKTA 3IMMA 4GX2A 3OAAG 2WL1A 2TBVA 2AUYA 2DURA 3USSA 4JI5B 1BKZA 2UUCB 3C7FA 4JYCA 1ZBA1 2R062 2R073 4PLMA 2Z4FA 2B5HA 2R042 5L3CA 2A6WA 2IBZH 2WSVA 3WV6A 4QPGA 2YXLA 1H2SB 2BRTA 4FAHA 2DBIA 3DGEA 4M3CF 3ZHTA 2VZPA 3ZN6A 3CXCU 2UXDB 3J81N 1Y4MA 2WWJA 4H2AA 1LGBA 1UOFA 2DU0A 2F95B 4N8MA 4YW7A 1YCIA 5J1XA 1IBMB 4TOIA 1JZ8A 3R4UA 3POJA 2QVSB 5DZFA 4XDOA 3HKBA 4J10A 4OMCA 2F17A 1LOEA 3AG2C 5LBCA 1URFA 3LNNA 1S1AA 4AHZA 3OTFA 4ARXA 3KCXA 1HP8A 1PVXA 4AFCA 2P1BA 1R73A 5C33A 4ZZ5A 1OCRB 2PUSA 1BBT2 1N33B 1AYN1 4H13B 5F1RA 3W7UA 2ZAHA 3A7QA 3BALA 2P5OA 3TEWA 4LF5O 4QHBA 3AG3B 1GN4A 4GLXA 2QDNA 4CSWA 5F3EA 4IV1C 1XHXA 1R091 1UMHA 1QQP1 1VQKV 1H6YA 4X8AA 1HW7A 3RMXA 4UAPA 2GALA 4JZ2A 1EM1A 5FXXA 5FR3A 1M56C 2UUAB 2FDHA 1VRH1 3EXAA 5LP6B 3B93A 2K46A 1CPYA 2L9LA 3PUQA 2ZJCA 4UYBA 3AVSA 1EZJA 3J8F3 3RZKA 4UFJA 5BYNA 2X5IC 2ZEZA 4DV2B 4FIPC 1N0NA 2IU3A 1ZZ7A 3CCEV 2BEOA 3SQOA 2HVKC 1B3QA 4WBNA 3S6PA 3I3MA 2GH2A 4PBPA 5IATA 1FAYA 1KDKA 3I2IA 4JGYB 1AR71 3LPGA 3AK0A 4N43A 3ZHSA 2OVUA 1GWMA 4MXVA 4JI0O 2TNFA 2OIEA 3AZVA 1WMEA 4JI1B 2D2CB 1QNYA 4BWOA 4AHCA 4AAPA 4K20A 1V9U3 1JZ2A 2OPKA 1W8ZA 3LIHA 3W9AA 2XQRA 2GAUA 4NHYA 3SYOA 3A22A 4AHWA 2WT1A 2EZOA 4KXRA 3SKVA 4CS3A 3B3QE 3J7HA 1O9GA 4E27A 1DLLA 2J1SA 1ENSA 2ZACA 2BGCA 4M4RA 4BU2A 4EN0A 2UWBA 4L8QA 2EIBA 5JJNB 4I01A 4AVCA 3OEAA 4TUYB 1X7NA 5JZGA 1JYTA 1S5LZ 3KT1A 1O3QA 2P37A 2QWOB 2JX9A 4MVTA 4UXAA 1JQ0A 4FM0A 2JVDA 4ZKTB 1L7QA 4MADA 2JJ6A 3ASOB 2QEXV 3MAQA 2XHNA 3M3QA 3H3ZA 4LWSB 4FLWA 5DG2A 5LGTA 4FZ0A 5BUVA 1YFYA 3THPA 1OA4A 1Q86W 4IE0A 3C90A 4DUXA 2Q30A 3ZXGA 1JS9A 1ZX3A 2QTOA 3U10A 2VTXJ 3CPWU 1QJY1 5CKNA 1RJ8A 2R70A 1W2TA 5FYYA 3T30A 1THZA 3WG4A 4O4JA 3N2GA 4QKFA 4ASUG 4LE3A 5LMUO 2EXIA 3LEKA 3LDEA 3ABLB 2Y6JA 3BRCA 4IIJA 1ZM1A 5C8CC 3WB0A 2Y6KA 2ZTNA 1VF6C 4DO2A 2YI8A 4FVMA 1W28A 4XFBA 1W8UA 3I49A 3JATB 2LW1A 3VBRA 3AEIA 3PDQA 5LEKA 3ZYFA 3KVBA 3OOXA 4IV3C 5LY2A 1CESA 3WOGA 3N7KA 3K77A 4EFEA 3P6BA 2WLLB 3EHKA 2X6BA 2ZINA 4Q4V1 1ZWIC 4L87A 4BPZA 3LIGA 4KL1A 2JGUA 5A7PA 1RUI2 4TSFG 1K97A 4LOTA 4M00A 2KA3A 3O0XA 1VBD2 3L73H 5F3CA 1EAH2 1WAZA 3WW4A 1CP9A 1G86A 5CN0A 4DV0O 3BTAA 1ZL8B 4EKWA 3BCCH 4HKOA 3WF1A 2UWAA 2RDRA 4AFBA 3BHPA 1Z0HA 2EAKA 1IPSA 1W9SA 5K1PA 4XDJA 4XHXA 5JOYA 4H55A 4CZSA 3UKVA 1NT0A 5BR8B 1YJWV 4X8NA 3DEMA 3G4SV 4R52A 5FBZA 4JI6B 1W3XA 5DAVA 5LGUA 1TAEA 1NVPD 3POSA 3LA2A 4YGCA 3ZR5A 4CDQB 5KBFA 2XOKG 4GUNA 5JZGC 3OT7A 1W06A 4TQDA 2RS31 4I2OA 4JPRA 3K75B 1NVPB 3UL2A 2RJLA 3S0MA 3D3IA 2ZGSA 2XJPA 5DAQA 2HKOA 5D2AA 5FO9B 4MVRA 3WR0A 3D8CA 2GHYA 4XHBA 1XREA 3K9SA 5EJ1B 1YI2V 2JJ2G 2PHWA 4F3JA 1XE7A 2Q5TA 5A7QA 1WA4A 1O9HA 1HB2A 3B01A 4NWVA 4JAAA 2LP7A 2VWJA 2VE1A 4DR2B 5JJEB 3Q8AA 3I7DA 4CCJA 5GZCA 2CYFA 4LMFA 3ES4A 2H94A 2IXHA 3C7EA 3LWCA 1AR91 3FL7A 2WIIB 2Q0OC 1AR4A 3VKLA 1JI6A 1OZ0A 1OQDA 2W1WA 5E79Z 2IJKA 2UUBB 3IDCB 5CU1A 1OH3A 1VIBA 5JVDB 1JYXA 2YPJA 2OQ7A 3MW4A 3VBRB 3ILFA 2IU0A 1COV1 1O91A 4IEQA 4RO2A 4ZBMA 2E74B 2B1IA 2X10A 4JI4O 1Y4WA 1J3QA 2YBKA 5FUNA 3UYJA 5FPZA 5C9AC 3OMIB 2WLLA 4LFCO 3E8FA 4LF5B 3ASOC 3KV9A 1BT8A 5L7OC 2VVDA 4COVA 1K4CC 2JDIG 1GLHA 4MGSA 2JE9A 3OMAB 3RYRA 1ASJ3 3VL9A 2FDIA 3MPPG 1Q8IA 5DXDA 2RMKB 2XLGA 2WN3A 4CCKA 3J7NA 3LNMB 4JI2O 3VZOA 2HBUA 1OT5A 2WWUA 2YEVB 3K48A 1YIFA 3NV3A 1PO12 5FP7A 3ZHVA 2JIZG 1RYYA 1U97A 4KWUA 5KXDA 4CCDA 4JI7O 3ZMSA 4FLUA 5T5LA 3KF5A 1XU2A 1QH7A 1GZCA 2C4XA 1YFXA 4X1IB 3X2QB 5FZ4A 2VNVA 4FPOB 1XNBA 3MF9A 4OCTA 3WDTA 3L75H 4KWLA 1X9TA 4N53A 5KLVH 5DUXA 2WA3A 2VGDA 4COZA 5IJ0A 4H0LB 1PGL1 4UCOA 5JVVA 2PLV2 2HWD3 1TUBA 2OUHA 3OSDA 4PDWA 2HWB2 4I02A 3ZFGC 1S76D 4D7SA 4XMAA 3O14A 3PN1A 1C8NA 2CH7A 4BIZA 4ZIBA 5FKCA 2ZIMA 1BJQA 4YGEA 5L3FA 2AGAA 2CH7B 2OZ6A 4KMQA 1RUE1 4V2WA 1YC61 2J22A 1P7GA 1UFIA 5DDJ3 4F4LA 5IK5A 2ZGQA 4QQOA 3OUSA 3IWZA 3Q9OA 2XUMA 1OQEA 5B5EZ 2GMPA 3ZOIA 5JZGB 2BGOA 4NROA 2XB6C 1ROPA 2GP3A 5ACA1 1NY72 5BMVA 1GKFA 1UIKA 3OBZA 4I7ZB 4AVBA 1FAFA 2Y34A 3GBFA 2VQEB 3ZRXA 1DLBA 3H1WA 5FY5A 2TEPA 1EUTA 1ZYBA 2BWAA 2R9IA 4YHHB 3VQYA 4PELA 2PAMA 3QG5A 3L9JT 1VBC1 4XF1A 2B9VA 2YC0A 5HI0A 1HRI1 1W6PB 4O2BB 1HRI2 2B46X 3B9CA 3FUOA 1CAVB 1TNFA 3RSJA 2OCCC 1Q8PA 4DQAA 3ZXAC 4DOUA 2JS3A 3LSSA 1REEA 3K59A 3ZIXA 5LASA 4IV1B 5LP6C 1VMFA 3ACGA 1BCXA 1W9WA 4AVSA 5LB6A 5K8SA 2DTWA 1QXRA 3E5QA 5FZDA 4FPJA 3KZIZ 3VDDA 1O8SA 4JHTA 4CRQA 5LZ6A 2OKXA 2FZ2A 4G3YC 4MTXA 1Z78A 3ZYIB 1RHI1 4Z1MG 4UI9L 2Q8DA 2PHDA 3GXUA 4GMP0 4BZ4A 3WF2A 2CGNA 1J83A 5GZDA 2CWMA 5IFTA 3C3TA 1RSOA 3OUJA 1LULA 3I2DA 1ULPA 5C8CA 1NH2D 3MIFA 2XR4A 4OPAA 5BNNA 3CCLV 1VBA3 3BVOA 1DQ5A 2GC0A 2LRPA 3T09A 5FZ7A 1DHKB 3VKNA 2RJZA 3EB7A 3VBSC 3O0VA 1AJNA 1DQ1A 3HD8B 2D40A 5L73A 5L9VA 2HWC3 2DVBA 5FP8A 1IHMA 3NJVA 1FOD1 1GN2A 1KECA 4FPEA 4AI0A 3TXQA 4N90A 5FZIA 3U78A 1MVEA 5M0TA 3IB3A 3VDDB 5CYYA 5LL6Y 4O61A 3VOUA 3NAPC 4G2KA 1Y3TA 1LTEA 3CX5F 4YXWG 2B39A 2Y6LA 2D6LX 1PK6C 3KB5A 4FPFA 1GU3A 1US6A 4J7KA 4NHLA 1EY2A 1OQ1A 1RITA 2XAGA 1KMIZ 4XJZA 1UKRA 3ME2A 4MGQA 1SLAA 3M2MA 1HLCA 2RJ2A 4RGKA 5F2VO 4FJCC 5DUWA 3HT2A 3I2JA 5A7OA 5DZEA 3WP3A 4QQ2A 3HWJA 2Q68A 1MVQA 3GHMA 5FZFA 4P9YA 1AHSA 1H2NA 1WA8B 3CZJA 4X6RB 2ZE7A 1U12A 4UB6Z 2A6XA 3W59A 4D0QA 4QHOA 2VZ3A 3TK1A 1PL0A 5EJ3A 1R3LC 4FLXA 2LJ2A 5F5IA 2NN4A 2MEV1 4UXNA 1QMJA 1WGPA 3K4DA 4AI9A 4A44A 5D8AB 4QB2A 4DR1O 3CJIA 5IDJA 1SLTA 1Y9MA 4CCCA 5H6QA 3CJIB 3ZKUA 3E5XA 3DC5A 4EYUA 4HPKB 2V4AA 5F39A 2AACA 5KHGA 4N43B 2XOMA 1K33A 2ARXA 3ZIWA 2XKOA 3QO8A 3WUDA 2BFUL 4Q8KA 3ZO0B 1OCCB 1COV2 1NZIA 3K08A 4PIYA 1C3HA 4LF6B 1AR63 3SGIA 5FJKA 4NXMO 3ZMOA 4WVWA 2JG9A 1LGCA 5EBLC 3WFVA 5LP6A 2WKKA 2UXBB 4N53C 2DVGA 5CVRA 1ZSPA 1AL0G 3CP1A 1QOTA 3BEHA 1YJ9V 4B3RB 4DXWA 4HAMA 1UOGA 3AZYA 5D8AC 5A3MA 3AZXA 4DIQA 1B6QA 2BSKB 4Q5OA 4BJ0A 4XAAA 5BNNB 1D4M2 1V6MA 1A6CA 4X1YA 2FDFA 2EZPA 1RJ7A 4QE9A 4TV8A 2JENA 5IK7A 3MLJA 3THTA 2ZHKA 4U3JB 2K1EA 3WNMA 5HCBA 3VBUA 5G05L 1LODA 2P06A 4X64O 3T4ZA 1E5IA 1NE6A 2PQSA 2R9AA 2WO7A 1KKCA 1LKNA 2BTVC 5KHHA 3WNNA 5LA1A 2E76B 1K42A 5IWFA 3JD72 3WW3A 5EYPB 4QXBA 4QM9A 4B3NA 3VN4A 1OV9A 3RN4A 4UFIA 1VE0A 1C8M3 2ZX0A 5CB4B 5T50A 3AFKA 1XC6A 3M3OA 5J98B 5C9AA 1J3PA 5CBGA 1DIWA 1DFQA 1ODMA 4XIKA 1IURA 1KJRA 4CXWA 3A4UA 3LUTB 2QQKA 2YXSA 5A1FA 3CE2A 1FOD3 3WQ0A 2VAUA 3RFRA 1FJGB 2QTWB 4PT6A 1A8MA 5A6YA 2O1QA 3W20A 4P9XA 4B8EA 3FB6C 1OLRA 1K5JA 4C91A 2P22C 1YYNA 2V72A 4P02B 5JDBA 4FXGB 2J1EA 3CKHA 1JFFA 3ES1A 2NR5A 1O6UA 4NYKA 3B9IA 1KQRA 4DB5A 1PO11 5EK0A 1BMV1 4GYCB 3SCFA 2WFF1 5DQ0A 2Z42A 4MGTA 1W8TA 4QKDA 1DYPA 3Q8EA 2XVKA 1SQQH 1R6TA 2N04A 4YG6A 4CEWA 1KDMA 5KUMA 5H2FZ 3IC7A 3T1LA 1IPKA 3PJYA 3THCA 4LNUB 3VDAA 1AI4A 2PF4E 5H5NA 2H0BA 1MNGA 4KFMA 1D4VB 1JOPA 5GLVA 1OA2A 2Z5UA 1V6OA 5CA1A 5FK7A 2WWSA 3NKGA 3CWBH 5FPBA 3KLSA 1JW6A 4J1XA 4OHZA 1BK0A 3AZWA 4XDQA 4XF9A 4ZKIA 4DUZB 5DUUA 1HB3A 4XQWA 4I0BA 2W6JG 3W7XA 3CEIA 1UJWB 4WM8B 4Q29A 3RZMA 3JU9A 2VZQA 2JWPA 1RHI2 4LO8A 4WM8C 2VNRA 4WM7A 3QOPA 4UCTA 3JXSA 4YVWB 4GKXA 2DYRB 2F6BA 4NE9A 1LOFA 2A73B 3OGIB 1PMJX 5F5CA 1CAUA 2RS53 2DMXA 2HWD1 5FFOC 2YXYA 3TEZA 2W1QA 2CWSA 2YV8A 2JDYA 3P30A 2V7QG 1PZ8A 1E5RA 2SBAA 3MBWA 5C4WC 5IJ9B 4DR3O 4X1KA 3R4SA 4ORFA 2Q9LA 4Y1XA 4Y5SA 4LLFA 4J9YB 4FZ1A 2HJFC 2RR11 3CU7A 3URFA 3R6SA 1DYKA 2W5FA 1V0AA 3VZNA 1T6BX 1Q6IA 4WCEV 1WW6A 3AG7A 1OCOC 2JDHA 1UZ0A 5FUIA 1IPJA 4JI1O 5GZGA 2ZR3A 1NTZH 3NJYA 4B3MO 1IQDC 5B2GB 4B7KA 4LBQD 1S55A 5DDJ2 1O3RA 4K1ZA 3ST7A 2NZ9A 1RINA 2ZX4A 1MEC3 4Q27A 5J09A 2ET7A 1QEXA 1AL22 2HWF3 2Z3YA 2VULA 4P5HA 4NRMA 4I3GA 1NH2B 1ALYA 4AHYA 4EWEA 3WNOA 1I7FA 4PCRA 4QU1A 4GX5A 3VD5A 4BQ5A 3NNFA 1K12A 3T08A 4DNYA 4JQRA 4O4JB 3RGBA 4UWDA 3B7MA 1F35A 2VH9A 1VQ6V 1IXMA 1VBA2 1S0JA 5FYSA 4I3PA 1RMU1 1IBLO 2CDOA 3W7WA 2ITDC 2EJRA 2ZQMA 2J42A 1R1ZA 3K0GA 3BU7A 1RMU3 2XAFA 3M7MX 1UXXX 5FLXN 3G80A 1EPZA 3VBUB 1KRIA 2VZRA 3HKBB 1VPHA 4QPJA 3CIHA 3PTYA 1S2KA 5J37A 1HR0B 2R7EB 3WW1A 4LIVA 4FFBA 2JEXA 3WF0A 3N4MA 1QOOA 3WVJA 4AFAA 4IGPA 4DR5B 3H3UA 1RUC1 2EIJB 4AEMA 1BYHA 3CC4V 3NVCA 4R9CA 3HIFA 1SETA 2Q1ZB 3VQWA 2PY5A 1O3TA 2JIJA 1K73W 1MZFA 1HNZO 3JAMN 1Q43A 3RI9A 3GCWA 1GNYA 2JXAA 4YY3O 2O0OA 3ZFGB 5L9RA 1R6KA 4HZ3A 4FFIA 2EIKB 1VBB1 1RP3B 1IKQA 3E89A 3G6BA 2QWQB 4GMP1 1K9MW 3KQRA 4J41A 1BQZA 4S2FA 4E2GA 5I0RA 3IZOA 1P84F 3I97A 2IW5A 5FBJA 5FWJA 2L35A 3I2FA 3PLQA 4B3RO 4COWA 3CC2V 2CGOA 1W0KG 2BBVA 3POBA 1V6IA 1Q82W 5ITZB 2ATKC 1AUYA 1IOAA 1HN1A 4CYDA 3CRAA 5E88A 3MPBA 2XAJA 4YPJA 4AVTA 4RQEA 2R061 1RPOA 1CR7A 4NRPA 4EB6A 4FCAA 4MSWC 4MVOA 1V6JA 2AEYA 1G7YA 3DCQA 1PK6B 3TETA 3MLLA 1JTZX 1KS5A 3F95A 4JC1A 1TG7A 2OT7A 3QCWA 5FNVA 4Q0SA 2V4VA 4UCUA 1SFPA 3R66A 3ZXKA 3A0NA 1JZ5A 1QJFA 1KC8W 3HPNA 5FYHA 1XNDA 1AZDA 1CX1A 4X62O 4MHRA 3H01A 3J8F1 2OYZA 4MZUA 1XJAA 1MZ5A 4LNVA 1N34O 2QGNA 1FFXA 4DUYO 3MI8A 1HWYA 3AVRA 5ABJB 3OMNB 3VDBA 2VG9A 3LE0A 4XBFA 2GSMB 1AR1B 1REDA 3AG3C 1FMD1 5IFPA 1L1FA 3WW2A 4HFSA 4LOSA 5FZOB 1N32O 1VBC3 4LF6O 4AEDC 2Y33A 3ATGA 1H8EG 1HX6A 4BISA 5L19A 1WB7A 3E97A 4YARA 4DW1A 1HQLA 1I9RA 1G9CA 2KQXA 1CAXB 1J5EB 3LQCA 1OCZB 5FCCA 4MVUA 3AYCA 4OI1A 4K21A 1OFSA 4IE7A 1VJ2A 3ZXLA 4GMP3 4IETA 3HBKA 5TSWA 5B3SB 4AXOA 2QQLA 2JB8A 2OTLV 5JSRA 3HPLC 1CAUB 3OGSA 4IV3A 1X59A 4S2GA 1RUF1 2C26A 4Q4V2 2R16A 5FMBA 1BHBA 1YI7A 3CEWA 3JD3A 4GXLA 1K8AW 2XUEA 1Y76A 3RNSA 1D5AA 5LGNA 2WLNA 4X1KB 4N43C 3VD3A 5KHKA 1QF3A 1ZRRA 2LFRA 2BDRA 5J7MA 5A3LA 2E75B 3MHHC 3H1MA 2AC1A 2XAHA 3JAKA 1ZLZA 2JD9A 5K7PA 1WA8A 4CEYC 1MQTC 3I5DA 1XEQA 5KX5B 4W8JA 4E4ZA 2BU9A 4YM2A 1Q90D 5JXGA 1YNAA 5D5QA 3ZM8A 2ZXWC 4MOAA 4IEYA 1YITV 3L70H 1GOGA 1W2AX 3FKSG 3SPHA 1GSLA 1ZZBA 5GLZA 5LA6B 3AP7A 1FXHA 2WLIA 4JVAA 4NIAA 1PHMA 4DR3B 4IDZA 4QPWA 3BODA 5IT9N 3ABTA 1LHWA 1Y74B 1YIPA 5A3NA 4ZHNA 2IJHA 5LXTB 2P17A 4IE5A 4ES9A 4W65A 5E1RA 1RUH2 4P9LA 4Q4Y3 1JYVA 5IJRA 5IAVA 4LLOA 1GANA 2B1GA 2JG9C 4IEOA 3K79A 4CDWA 4B3MB 1TVKB 3APOA 1XB9A 4EWAA 3W5NA 1PVC1 4DMIA 2FB5A 2AGSA 4UFLA 1HNWO 1DDLA 3ABUA 4TSVA 4OI2A 1X4TA 5AC92 1H0BA 3FX3A 4OI0A 1D5NA 1L0LH 1WP7A 2ZEWA 5FRAA 3IFXA 1ST8A 4W4KA 4JV5O 4GKYA 3BY6A 5F5AA 4V2VA 3ZFFC 3LEMA 4G9SB 1UYZA 1HDKA 1VBB2 4LTAA 2CTWA 4RQPC 2PTMA 3UETA 4QPGB 3SMHA 1LUVA 1YHFA 1BK1A 3OG2A 3VQXA 3AX4A 1XBLA 5GW7A 3OYWB 1HNXB 5FO7B 3KT4A 3KD4A 3AMQA 3WG2A 3TGUH 2VMDA 1RUC2 4FBFA 5C8CB 5FYMA 1FPN2 2YUAA 1ZRCA 4BIFA 5IY5C 5LHHA 2W46A 5EBMC 2VJXA 4YG0A 1CJDA 3DYOA 1I0HA 3K0DA 4L9BA 3FC0A 2GSYA 5FYZA 1LHUA 4PLOA 1NQDA 3NV2A 2B7YA 1CGPA 5KA6A 3QO7A 2DYCA 1RXFA 1VF6A 4X20A 4O65A 5A2QN 1JYCA 4COUA 1OUXA 3AXEA 4CS4A 4UBGA 4OMDA 4L92A 3CCMV 1V6NA 3SEPA 3VB9A 1XRUA 3F2ZA 1WD3A 4XZUG 5FZLA 4JGSA 1GAXA 5LA6A 5C5TA 1BGYH 1LOBA 4LA2A 4HSJA 4ZONA 5DAPA 2F4VO 3VHRA 1POQA 1YQ6A 4K8RB 1AI5A 1QVGU 3J7MA 3LDDA 4HVQA 1XYOA 4UT5A 5C5UA 3WXPA 3POGA 2UXCO 2HP8A 4L2NA 1QIQA 4ZHQA 1S0BA 2P2KA 3CNAA 2WZEA 2ZXWB 2WC2A 1SBFA 4RSUA 1TME2 2P3YA 3RYPA 3USUA 4A42A 3OGVA 4KU8A 1VMGA 4X65B 5CBFA 5B1BC 2UYBA 4P9OA 2VMGA 1YJLA 1QJU1 3UQ8A 1OFNA 1CZSA 4CVUA 3R65A 1MS3A 3VZJA 4MGYE 4P5YA 5ERLA 5AFEA 3WDYA 1ZAUA 2HLEA 3I3DA 5FREA 3SYPA 2ZEYA 3CRMA 3SITA 2R1BA 4G27B 4IEWA 2Q7EA 3IN9A 3R05A 5BNPB 1N34B 3MFCA 3VZMA 3VD7A 2JKXA 4PDVA 4ICGA 3UGGA 5HPOA 3JARB 2RR13 3TRSB 4HKLA 1S3JA 3OCPA 1JVMA 4N9HA 1ZRDA 4NB5A 1AR62 5CFCA 1VQLV 5D8AA 4RHV1 3JD4A 4AL9A 3ZS8C 1NA1C 1W05A 3N2KB 4LF8B 3ZXEA 4LKSA 3O9OA 2CDYA 4IESA 4BCUA 1JA8A 2CTRA 1QJZA 2B5UA 1GH6A 1SBEA 1XMQB 1ZREA 4X64B 5C71A 1DQ2A 1PMHX 5FPRA 5FPVA 4XFCA 1WZXA 4LK6A 5L9BA 1SESA 1DK1A 2MEV2 4FK5C 4HL0A 3WG7C 4WFAV 3D82A 2WT2A 4LQRA 4OUSA 2PLV1 3AK1A 4FAGA 5BNPA 1RUJ1 3HKEA 1ZNPA 4XJAA 4AEJA 3DPRA 4DV4O 3U0ZA 4GZ9A 1UMZA 2H6BA 1RFYA 1CPNA 3ETEA 3O1TA 1SERA 3V65A 1LENA 2JD4A 4D3WA 3E22A 4JAUA 2EXKA 5CBHA 3E8GA 3AYAA 3OYWA 4LBQB 4XZPA 4DV3B 5LWBA 5CA6A 5IAXA 2JDAA 1JYWA 1WLTA 1UZWA 3CBNA 5JSOA 1W8FA 4Y22B 3BTYA 4PQQA 2O57A 2WQ8A 3FE5A 3UCSC 2PYLA 3CRCA 1VRBA 1S2EA 4MVQA 1C8M1 1TGOA 3CCQV 4LO6B 2LFSA 2PHLA 4O7XA 1LOCA 5LMNB 1NOVA 3TNQA 3WCRA 1SC5B 5ANNA 4KG0A 2GNDA 3ENRA 2XL7A 4NIDA 4GKJO 2M7WA 2ARAA 5TISZ 1NCRC 4YFZA 1UYYA 3OGGA 1G9AA 1W0JG 4R4XA 1LECA 5IT6A 4R9BA 1COWG 2BFUS 2JS5A 5A3UA 5KA5A 3BKZA 3WB1A 5A7NA 3T2TA 2ZCWA 1PPJH 4JF3A 2DUOA 5JOXA 1PO13 2PN5A 4ATEA 5FUPA 3ZXDA 2QZ2A 4IERA 5KXBA 5FPOA 2IC1A 4MXWA 3BTZA 5LXTA 5HBAA 3P3PA 4UW3A 4RHV2 1NTMH 1U0AA 3S57A 2J1UA 2GV9A 3R4DB 3HB3B 2ES3A 3CC7V 1SF9A 3HR9A 4Z2AA 2WLMA 3S5QA 3QH6A 4FP3A 2E26A 2OX0A 2X6AA 5L3EA 4QX1A 4L99A 2YB7A 4XFGA 1R1A2 3CMGA 2DVDA 3PMSA 2FTKA 4UVCA 1HDJA 1NZ6A 3VBHB 4XF4A 5BZBA 5FMOS 2HJIA 4FFKA 4Y4RA 3K5OA 3LPFA 3IAQA 1LHVA 2DCJA 1M1KW 1AYN3 1RUH3 4TZDA 4OGQB 1OD5A 4W6YA 2KG7B 1UU5A 4ZY9A 2QCSB 3FBYA 2WLKA 4P00B 3AB0A 5E6HA 3TJTA 3NV1A 4PIZA 1Y74A 1AX1A 4FPHA 1M4UA 1L8DA 4DEQA 4LH6A 2A9HA 2B9UA 2ZHLA 3JD1A 2RNBA 1JXNA 3GJAA 1DTOA 4Y1ZA 4X20B 5ACA2 1GV9A 1HJFA 2MHFA 4IW3A 5JSPA 3UT5A 2ZABA 2ZMLA 3CJHB 3FB5C 1EAH3 3ZN5A 1LAJA 4C90A 3ZVXA 4BK4A 2WSSG 1B09A 2VQTA 1S0FA 5H9CA 4GZRB 2CAZC 4XF0A 2AHYA 4XMIA 3N36A 2XVGA 3H0OA 2IXCA 1R6NA 2RG4A 3T1HO 5FKBA 1SQVH 5KR7A 1O4YA 2P3JA 1R3JC 4INDA 5AC91 4OI4A 1XL4A 3K9AA 4FFBB 3SYCA 2X29A 3LSDA 4IV1A 1X8EA 2Q7HA 1C5IA 3DKWA 2LM3A 3MDPA 3L9DA 4D6TH 4EN7B 1LUWA 1PNMA 4GULA 1G8MA 3FN9A 4JTCB 2XJQA 1SLIA 4TLGA 2HWB3 2ZGOA 1FFXB 2O8OA 3O1SA 4F8AA 4RL7A 4PA7A 3ZN4A 2ID4A 4D7TA 1DZRA 4LO5B 4M3CB 1W2BU 2FD8A 3JQWA 2AZ0A 2WZR1 4DUVA 4CUBA 1I5ZA 5I91A 4JI6O 4A6OA 2E51A 4AWDA 2P7TC 3WDVA 3KF3A 3ZFEC 3OEBA 3NR7A 4D6QA 2EILB 4ZU7A 2Y26A 3A8TA 4XQ4A 2UXCB 4CDQA 1TVKA 4XUQA 2Y4UA 4UW6A 1F2NA 2IFRA 1XNCA 2C1FA 5H6RA 3O1UA 5GTIZ 4DUZO 3D36A 2X5IA 3OW2U 3KGLA 2RM21 5SV5A 1P7BA 3D3QA 1YZBA 3J80N 2XKPA 3I2OA 1QQCA 4UCSA 1GMMA 4H7LA 3I55V 1XU1A 4XFIA 3QH7A 1XE0A 5FZKA 3SJCC 3MIEA 1NR1A 4BWAA 4EQVA 1N47A 3I3EA 3ZDSA 1AYM3 1R083 4WM7C 2A3XA 4A7YA 4MVSA 3OBRA 1ND3A 1T6GC 4XFFA 1H9WA 1KUQA 2ZNIA 1UOJA 4JCKA 1E5HA 3H8XA 4DR5O 4YIPA 2JRIA 3MZHA 5LOVA 1K5SA 1SDDB 5FQ0A 5LATA 3V0AA 3O7OA 3H7JA 3K4ZA 4HZFA 1QNWA 3NQHA 3PJSK 1X33A 1BLZA 3RYFB 4JDMA 3ACFA 1OCZC 4WVMA 2Y6GA 5IYZB 3FJSA 1T5EA 2RE9A 1ULEA 3K46A 2QBXA 3UK9A 1K92A 1NY71 5A80A 2DWEC 3HKDB 2QQWA 2ODMA 5JJJB 1BVVA 1H8HG 4ASMB 1GP5A 2WLIB 3BIWE 4AEKA 5JPNB 3TYJA 5DM6V 5APAA 1OMIA 4P14A 2CUGA 5A32B 2CE4A 3TN93 1NCRB 3DTUB 5FZGA 2KXLA 2BVBA 4XOGA 4ES8A 3IGAC 1EFRG 1GWLA 2EF6A 2YU2A 2H0VA 1RUD3 2N74A 3IBMA 3RYHB 3RMYA 4FOQA 2JICA 1XNQB 1ENXA 3DYPA 5LW9A 1JBCA 3GNEA 2OUJA 3N9NA 1PIV1 5JXJA 3DV8A 5HFLA 2HHHB 2VW1A 1PNFA 1DG6A 1U96A 1UOBA 4JDNA 2UY8A 3VBFB 1G9DA 4IUGA 1FATA 3VGIA 2PI4A 1Y76B 3QACA 4FI9A 1H8VA 4LBJA 1F51A 4CDUB 1POV3 2AEZA 4YM0A 3VLBB 1SA0A 1QLEC 1J84A 1PK6A 1JOYA 5A6XA 1K5MC 1POV1 2YFUA 4QIWF 1L7RA 2PHUA 3JBG1 4DR2O 4GKJB 1EAH1 1R092 4NVPA 3M3EA 1M57B 1L0NH 1DQ6A 1Q6UA 1DGRA 4LF4B 3IC9A 4CE8A 4LO4B 1E1RG 1FMD3 2VQ0A 3DPRB 1X36A 4MGIE 4XBNA 4LE4A 3NNLA 2FCUA 2JK5C 5JOZA 3T2MA 2HLDG 3AYEA 5K0UA 1NZCA 4X6QB 4UV8A 5H9RA 2CU5A 2BCCH 4JRLA 1NBMG 3KQ4B 4FLYA 5HXMA 3IPVA 3AC0A 2ZA9A 3O1VA 1N33O 3CZUA 5BNQA 1VQOV 1WBFA 4IEPA 1CAWB 1GWKA 3ZPOA 3F7YC 1XMQO 1S0DA 1JMKC 4LR4A 1AJPA 3J26N 1UMIA 1J58A 2JDKA 1PO23 4LFCB 4ATFA 4QGNA 1J5EO 2FCTA 1OBNA 4WFFA 1SQFA 3NNJA 2QTSA 4DY5A 3VHOA 2NN8A 5FQ0B 4DFSA 2FDKA 3RJRA 1H30A 5A3WA 3K3WA 4Y1YA 1UWWA 2VZTA 1FXZA 4META 4PF1A 1SKVA 1LESA 3GDBA 4UW5A 3BB6A 5CG8A 4CEWB 2AENA 2XPJA 2QE7G 2IVIB 3ASNB 4Q4Y2 4JGZA 2PLV3 2XXZA 1VLNA 2ZBJA 4CTEA 2QM7A 4EEQA 2EIGA 2P67A 5HCHA 4YRDA 4K40A 3HNYM 4P2ZA 2ZE6A 2A75A 5F7UA 3WT3A 4YZ3A 3H1LH 2QKAA 1BS3A 1AJOA 1FNYA 3EVKA 2OCHA 5HFMA 3OPWA 2I45A 3ABZA 2Y0OA 3KSCA 3I2GA 4K3UA 3RDIA 1UN1A 2PMWB 1DGWA 1YFUA 3OPTA 2QZ3A 2ENRA 3S7IA 2CAUA 4JYAB 1CX4A 5DUVA 4D7YA 3V0AB 1WW7A 4CZZA 2ARBA 4R9AA 2GH8A 2VZOA 2WNUB 3ZYJB 1Y9GA 2EVXA 5IVEA 3ZYGA 5CB4A 4DUYB 2W94A 5JI7A 1W9YA 4U36A 4QX0A 3ZR6A 1TMF1 2PELA 3E6CC 4LT5A 5CFDC 2DW4A 4NKGB 5JVDA 2VXRA 1CJPA 5CAZA 3V56A 5C8YA 2ZXQA 2UWCA 3TEYA 3OBAA 5B66Z 2ZHNA 4QPYA 2WINB 4M4PA 4F83A 2ZGLA 3HQUA 3LGRA 5AG2A 1LOGA 1DLCA 4GB32 2ZDIA 4WV8A 4CUGA 3GB7C 3SYAA 3DF0A 5CBLA 3C7GA 2EA7A 1G6NA 5CKQA 5FY8A 2GMEA 2O14A 3CYOA 1X50A 5T5JA 2WWWA 3RYIA 4M3CA 4NAOA 4CPBD 5GM0A 3BIEA 2ADEA 4A7ZA 5LBEA 3KCYA 3THOA 1OOPC 3VV1A 1UPSA 1ZBE1 3ABKB 2HWE1 4Q4Y1 3KWVA 2G19A 3MDSA 4UBHA 5I0UA 4KWKA 3T3YA 2DYSB 4PI0A 4L97A 5FO8B 4AQSA 3X29B 1UKGA 4KH9A 3RYCA 1BHGA 1FYUA 2W0XA 4DV2O 4AI2A 3RZJA 2Y69B 3ZHRA 4YW2A 3TAYA 5JXHA 1W6OA 1GP6A 1R3IC 4YFWA 2IJJA 3RBZA 1SQPH 1BQ0A 3OUIA 3VBFC 3EQEA 3D4KA 2RS52 2XGXA 1UU6A 4MTGA 4QAWA 2JDMA 4DV5O 2WNOA 1IDSA 5FZ6A 3G7DA 4M01A 3HN3A 2NP0A 2RMU2 5JWPA 1X8MA 4KBZA 1BVP1 1QJY2 4YZ1A 4K8FA 2D5HA 1S0GA 1G8WA 4IEXA 1D4M3 2FMYA 1WBLA 4P9IA 1W59A 4RUEA 2XASA 3H42B 2BOBC 4QHZA 3FB7C 2PXJA 5ANQA 3U14A 4N7IA 4CH4A 4E4EA 1PL4A 4QM8A 1HV1A 1UY0A 3C3VA 2PHXA 5FYUA 3ZX6A 4U2AA 1OUSA 4TUYA 3DGTA 2Y48A 1SZBA 4ZOLB 1P8JA 1OC1A 4WVVA 3SH4A 4AFDA 2Q67A 4I50A 1SQXH 1TMF3 1N4CA 2ZMKA 3A0HZ 1AP6A 4UB8Z 3ZFGA 3AZZA 4QJFB 4JI5O 4Z8BA 2RDNA 1PM9A 4N23A 4EROA 1BZKA 3N7JA 1VBE2 1HNWB 2B8MA 2BVVA 3D3AA 3BOWA 1H6XA 1LHOA 1C5HA 2YC4A 4XACA 1JU3A 3AKQA 3G6EV 3CB2A 1OXCA 2BZDA 4EN6B 4C1XA 3ZFEB 1LJ7A 2R0FA 4HONA 1W6NA 1WUVA 3WP5A 3WU2Z 2VW0A 4NIGA 4O9EA 4S2HA 2QQMA 4AEDB 4QX7A 4QQHA 5EIYB 5K0UB 3HKCA 4R8HA 5LA0A 1VF7A 2UXNA 3VQVA 2VUCA 1W8WA 1MS0A 1WMXA 2ZGNA 2LROA 5FXZA 2XL9A 4YGDA 5GALA 4XIOA 3LDRA 2WAAA 4OZOA 4LF9B 3L2YA 2JECA 2VBBA 4NWWA 3JB8A 2QA4V 1ND2C 2A1XA 2QKSA 1LNQA 1ENQA 3D0JA 2WLQA 3LZZA 3JB4C 1QOSA 4A6SA 1POV0 3HNBM 2ZE8A 2E7QA 4ASLA 3MHSC 4RR3A 3O1OA 2LS6A 3LB9A 4QDQA 2AR6A 3ZYBA 3KT7A 3I59B 4R6ZA 2V5DA 1XOUA 1M9NA 2RV9A 1VBE3 4ARYA 2D93A 5CA3A 4K8ZA 4I5SA 2Z0AA 1RSOB 2EBOA 1OD3A 1TQ5A 1GMGA 3E22B 2VCBA 4E2QA 2GC2A 4YGBA 1H1AA 3N9LA 3JUUA 4LBQA 3N27A 1PMIA 1UU4A 2MEV3 2DN9A 3RYFA 4IGGA 2RDQA 4JGYC 3ZKYA 4CPBA 3O1MA 4NHXA 1ZA4A 1QXJA 1W9TA 3E35A 5ABJC 5FOJB 3HN1A 3VKFC 1Q3EA 1QXPA 2QE3A 2VUDA 4CDWB 3AMNA 2WRAA 2G9GA 1B06A 3JD71 1UY2A 4HN1A 2DOSA 2WYFA 2ZE5A 2XLFA 5AVPA 1OHHG 4FPYA 1J1TA 4BE3A 5KHJA 3N7LA 2XBO3 5C3SA 2WQZC 2DV9A 1FX5A 4OFGA 1TUEB 1OKOA 4I0WB 2VTXA 4BQ1A 3OUHA 5FZAA 1ZBA2 4GJYA 2D6NA 2GMMA 2FL4A 4D69A 3DXRB 1WA6X 2BERA 4MGKE 3ETGA 2Z2SB 3DXRA 1OCCC 3FD9A 4E4DX 1XNTA 1GM9A 2CTVA 1YTFB 4WM8A 4A7KA 4M0NA 1IGOA 3AKRA 4UF0B 3QO5A 1RM1B 3PUAA 5EZYA 2E3CA 5KMGA 2E7AA 5ACA3 4PA4A 3RQ0A 1LNSA 1TUBB 4GX1A 3U4SA 1D2DA 2DCKA 4KNCA 4WVMB 1PO22 2AYHA 5DPNA 2NM1A 4LNUA 5FY4A 4Z1VA 3APBA 2WDBA 2E32A 3VZLA 3T2OA 3SH3A 4DV6O 3NRUA 2EIEA 4AI3A 3K06A 1RUC3 3NAPB 5D1IA 1UAIA 1FPN3 3W7SA 1XNKA 3ROUA 1FT9A 2D98A 5D5PA 4XILA 1VQMV 3WD5A 1GK9A 5F6KA 1HRI3 1NKGA 1PNKA 3A0RA 3C8XA 5B4XA 1R3KC 4L0PA 2A06H 2IXKA 2UURA 2FHRA 1DF5A 1XYPA 5H9QA 2FDGA 4EE2A 1JFFB 5AVAA 1K5MB 5IVCA 1RVF3 4CC5A 1UZYA 1YQCA 4P9GA 2JDNA 3JSLA 3M8AA 4DV4B 2AH2A 5L7OA 1RVF1 1S5HC 4Y3OA 3LDBA 3GJBA 3ABLC 4NXMB 3EJKA 2ZD9A 2JG8B 2A0LA 2F93B 3LFIA 1RUE3 3AJYA 2IXIA 3VBOB 2W1SA 1I6XA 1VQ8V 1AR81 5A33B 3HKEB 5FZOA 1Y66A 3HQRA 1YEWA 4OVEA 2A6VA 4BXSV 3N2GB 3OF1A 3KMHA 1R64A 2QWNB 2P4VA 2OQ6A 4OUEA 1WKYA 2IZWA 5FAXA 3KV6A 1AI7A 3PVEA 3N9OA 4DV5B 5LMNO 5FPUA 1ZX5A 3BTXA 2HG5C 3O12A 2ARHA 3RZLA 5F37A 2P4EA 3CS5A 4LP8A 4MHUA 5BNNC 1JYNA 3FHAA 2W3JA 2ZMNA 5LK7B 5FLJA 3DUIA 2GNBA 1PD3A 3VBSA 1U5IA 1PX4A 1V54C 4H7MA 2WNVC 4Y5Z0 2GN3A 3VBFA 4DYLA 4NMIA 1W6PA 2FCVA 4FFGA 4DR7B 3H1HH 4RN5A 4LBEC 2OA2A 2D5FA 3LSQA 3CMAV 1US3A 2OW4A 3RZGA 1XNQO 2QUOA 5IJ9A 1W2OA 1AX2A 2RS51 4LCUC 5L3BA 5FP3A 3VD4A 2D6OX 2R49A 1VMHA 4CP9B 3LFMA 3PMEA 3I8TA 4ITCA 1YDXA 1NG0A 4DUWA 4U7OA 1QJEA 1C8M2 3K3OA 3U1XA 2WR9A 4E2SA 4GIQA 3LDCA 5IK8A 1Z7S3 4QB6A 1ZBE2 2HWE2 5A7SA 3KHCA 1RUF2 3D6EA 5HV0A 1CQ9A 1ND3B 1AROP 4LUMA 4UFKA 3IAPA 2LGWA 3SISA 5EV7A 1KFXL 2BQPA 1YJKA 1CVNA 2R071 4X66O 4LF4O 1WNSA 5BV6A 4I0XA 4GCZA 5GJ6A 4TN7A 1BL8A 3VKMA 4Y24A 5F6LB 1J59A 5IWAB 2VBPA 3PIGA 4FSJA 1LR5A 2BP6A 3NMBA 4GB31 2XLAA 1AYM1 4CS2A 3GZTB 3GBGA 2DE0X 1DF4A 1KGYA 4B3SO 3RRDA 4JKLA 1DU3D 4CCEA 3CRQA 1GZWA 3FWEA 5KHIA 1KB9F 1JHJA 2GP5A 2WS93 3H1KH 5DABA 4LHNA 3SEEA 4I55B 5EIBC 3LSEA 4GWJA 2UXBO 3BAAA 1S5JA 1O59A 4LULA 1KYOF 4BMEA 1A32A 2KR2A 1MACA 2R30A 2VOWA 3J9SA 3TN92 2DTYA 2HYXA 5DEDA 1OH4A 3EFFK 1YVWA 1LEDA 3FHIB 5FYBA 1COV3 4LBNA 5B1AC 3E83A 1DQ0A 1MS8A 1QLEB 1VBE1 1NA1A 5CFCB 1PM7A 4MYEA 4E9KA 3NAPA 1Z5WA 4XEZA 1HB1A 5A6QA 5KXCA 3ZEDA 3MEPA 1QGLA 2XDVA 4B7EA 1GNZA 3WNPA 2VVEA 1LB2A 1QHTA 3PL0A 3HR0A 4QD2A 4EZHA 1FD9A 3WB2A 1W3VA 1CD3G 1VQ9V 1SLBA 3OGCC 3W7TA 3WX5A 2W1UA 3VBUC 3IAYA 2RDSA 4DXTA 3SHRA 2VPVA 1CAXA 2DCZA 4Z82A 4O2AB 2Q6AA 2E5LB 3VUOA 1N36O 1DBNA 2WNVA 4Q0UA 4BAYA 3PTRB 4IQPA 2W6IG 4I4TA 3UM7A 4G28B 3MIHA 1EUUA 4IGOA 3OFNG 4IXLA 1A34A 3LSUA 3JD73 5ABJA 3IMNA 5K0UC 1GRJA 3JALA 4HPKA 1AR83 2QQJA 3GM8A 4YYOA 3BU0A 1F4AA 2VXJA 1URXA 4EN9B 1ULDA 3UT0A 3ACIA 4JI4B 4IHJA 4HN0A 3ZSKA 4Z07A 3JAKB 2A70A 2DQ0A 3ZX7A 2VQFB 2ETEA 1AI6A 3B94A 1FXKC 1IBLB 1RUG1 4CDQC 1V55B 4BLIA 4UUJC 1ONAA 1JOJA 2VOVA 2ZKOA 2YU1A 3P1IA 4QDRA 1W0NA 1E5SA 1P49A 2GN7A 1DZTA 3JZVA 1RUI1 2P3KA 5JCOA 3VDCA 2W52A 1MS5A 4JI2B 4RWUA 2PI5A 1W8OA 4UCRA 1Q8SA 3RVZA 5DMYA 5C6CA 3ZXJA 1Q7YW 1QU7A 4BQ2A 4RHV3 3T4DA 1HV0A 4DEVA 4OQ8A 2JDUA 3PUHA 4EB6B 3DYMA 5DN6G 4B3TB 5BXZA 5IE9A 2YIBD 3HBZA 2ARCA 1D7PM 1MABG 3ZSEA 4K9SA 5BMVB 1MSDA 2N7GA 3E6BA 3GHNA 4UFZA 4W4LA 3E5UA 1GM8A 1R1BA 5KUKA 1IG0A 1V9U2 1NU1H 2A71A 5ITZA 4NPRA 1BZWA 5AFBA 5T3NA 3H8UA 1LR1A 2F23A 3OTOO 1QLNA 2WFF3 4E4HA 3FAVB 3V64A 3I56V 3LEIA 4B1MA 1M5IA 3H50A 4CDWC 4GWIA