3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
3LOIA 1OMIA 1EP0A 1CGPA 3NSTA 2QJVA 2GU9A 4ZU5A 3OF1A 2ATFA 2Q0AA 1SFNA 2GZWA 3CL1A 3H50A 4HN1A 3S7EA 4EWAA 3H7JA 2DCTA 4PJYA 5F1RA 2MHFA 5I0SA 1ZZ7A 4BIFA 4IEZA 4AQ6A 4NVPA 3E6BA 3UKTA 3SCHA 4LLOA 5BV6A 1RUOA 3N4MA 4J1WA 3FWEA 3NVCA 3RYRA 3S7IA 1FT9A 2MNGA 4FT8A 1YFUA 4XFHA 1YUDA 4KU7A 3ST7A 4P9GA 2XLAA 1O3TA 4IEQA 1NXMA 2UY8A 4AQ2A 4XFCA 1ZRRA 4AVBA 4D7SA 2PFWA 4IESA 5J48A 4QGLA 2Q30A 2BEOA 3H3ZA 4IEVA 5D1IA 1OD5A 5BUVA 3CLPA 3IIAA 1ZRCA 3LWCA 4QM8A 2Q1ZB 2B8MA 4HVQA 2ZKLA 1SQ4A 3O14A 4X6QB 5CU1A 1UIJA 1Y3TA 2O1QA 2IXHA 4UBGA 2IXCA 3NW4A 4K8FA 3HQXA 5LEKA 4I02A 1XE8A 2UYBA 5C6CA 2VPVA 3HIFA 5I0TA 2CAUA 2B5HA 2GAUA 4XF4A 2PYTA 3ROUA 5JAXA 3FX3A 3HT2A 3LA2A 4IEXA 4Z07A 4FBFA 1RL3A 4WVZA 5FCCA 4IEOA 1ZZ9A 2PQQA 4MUVA 5J7MA 3FFQA 1CAUA 2C0ZA 3H9AA 4JTNA 1H1MA 5I93A 2Q4SA 2OZ6A 5JSRA 2ET1A 3QACA 2BNNA 4MGKE 4F8AA 3H7YA 1I5ZA 2D5FA 3BPZA 1QWRA 4JV4A 2CV6A 4IEYA 4R8HA 1J3PA 4BYYA 1Q3EA 4YNIA 3FE5A 4FAHA 3OTFA 3KGZA 2IXLA 5KHGA 1FI2A 2H0VA 5AVPA 3LAGA 2XKOA 1J3RA 3QOPA 1RC6A 1RGSA 4QGMA 4WBBA 5E1RA 1NZCA 4HZFA 4B29A 1RUNA 2K9ZA 2XGXA 4ZU7A 2GC2A 1EY2A 5I8YA 2XLFA 2PA7A 3KCCA 2XL7A 1WGPA 4I09A 1YHFA 2P17A 3VHRA 3LA3A 3USSA 1VP6A 2XLGA 3NL1A 1PM7A 3JZVA 1ZZ8A 1IPJA 3D0SA 3MDPA 4MV2A 4LUKA 2GC0A 5JSOA 4BH9A 5J3UA 5FLHA 1CAVA 2D93A 2PAKA 3R6SA 1X8EA 3PLQA 3EO6A 2I45A 1YFYA 4Q29A 1ZRFA 1O5LA 1J59A 1YFXA 4YARA 5BXXA 5E16A 1CAWB 1SEFA 4YYOA 3KSCA 3PVBB 1XRUA 2CGPA 3NKTA 1G6NA 2WC2A 3UKNA 3MPBA 1U12A 3M3IA 4WZCA 4Z82A 2Z69A 3SMHA 4XF3A 3BALA 5I8SA 1RTVA 3RZZA 4JTOA 1Y9QA 2E9QA 2EVXA 3I7DA 4HLTA 3TNPB 4IETA 4LULA 3PNAA 4QXKA 2HKXA 3IDBB 2XL9A 4HBNA 5CVRA 4LUMA 1EYBA 3CF6E 4XF9A 4QM9A 3FJSA 4J1XA 4O9GA 1O3SA 1O3QA 1J1LA 4QMAA 4LA2A 2GH2A 1Q5OA 3NJZA 4HSJA 2PAMA 4AVAA 4TLFA 4UXAA 4E2SA 2UYAA 2QVSB 2PHLA 4Q0VA 1V70A 5CADA 1X8MA 5FDBA 3EJKA 1LB2A 4MZUA 2ZCWA 3IDCB 1DGWA 2O8QA 4ZU4A 5FQ0B 1L3JA 1VJ2A 4I3PA 4H7LA 1YWKA 4XFBA 3HT1A 3IBMA 3DV8A 4HVOA 4RD7A 2HJIA 2IXJA 2WFPA 3OCPA 5FPZA 4LA3A 2BGCA 1EPZA 1J58A 3CJXA 4L2NA 4XFFA 2BYVE 1LKNA 2FQPA 1UIKA 4BHPA 5FQ0A 4EV0A 3ELNA 5T3NA 5JCTA 4F7ZA 5KHHA 4XFGA 3H1MA 1DGRA 2Y0OA 4HN0A 3EHKA 3OD0A 4HVRA 4I01A 3E5UA 1TQ5A 2H6CA 2IXIA 3U0ZA 5LEJA 4FAGA 3UKVA 3RPQA 4OFGA 4LTAA 1LRHA 1ZNPA 1UCXA 4KWKA 1LR5A 3EQEA 4HSLA 1UD1A 1O4TA 4XF0A 3RNSA 2K0GA 4EROA 3BCWA 4MGIE 3S0MA 3B02A 4ONUA 3DL3A 4OLLA 3ZDSA 1VR3A 2H6BA 3SCGA 1GQGA 3MYXA 4KU8A 4KWLA 2D5HA 1PMIA 1CAWA 3I54A 4ORFA 4XF1A 4XFIA 1WLTA 3I59A 4QGNA 4AXOA 1ZREA 5KBFA 3WW2A 2V09A 3EBRA 1I6XA 4I0AA 3E6CC 3KMHA 4MGZE 3FHIB 1DZTA 5FLJA 3CEWA 1O7FA 3RYKA 3I59B 1O3RA 2BNMA 3H3UA 4E2QA 3ES1A 5I0RA 3FZ3A 3WW4A 3TNQA 3ACLA 4CYDA 4Q0QA 4N9HA 2KXLA 3D0JA 1NYWA 1ZX5A 1QXJA 1CAUB 1O5UA 1WA4A 3SHRA 4X6RB 5I91A 1ZZCA 2ETEA 4IEPA 3D82A 2QDRA 4META 2OYZA 3BU7A 5JR7B 5I8TA 1YLLA 4XETA 2BNOA 3E6DA 4DINB 4Q0SA 2IXKA 5KHKA 4QX5A 5I0UA 5K8SA 4I2OA 2D40A 2GC1A 3BB6A 2QCSB 4LEJA 2B9UA 3SXWA 2OA2A 4IEUA 3ES4A 2UY9A 5BY5A 1GQHA 4PIZA 1X7NA 1J3QA 4YSFA 1FXZA 1H1IA 4YRDA 3H1WA 3E5QA 5HI0A 4O9EA 4A2UA 4PIYA 2PTMA 3WW1A 4JVAA 2QNKA 5JSPA 2VECA 3DKWA 3GYDA 3RYPA 2OZJA 5LRSA 5FPXA 2EAAA 1CAVB 1NE6A 3LA7A 4MX3A 1UPIA 2OPKA 3SCFA 4PIXA 4EWEA 1NE4A 2IC1A 1X82A 4AVCA 1ZRDA 3KGLA 4Q0PA 1CX4A 4IERA 3U11A 4XFAA 3RDIA 1Q43A 1IPKA 3CO2A 2MPFA 4XEZA 1XE7A 1CAXA 4KWJA 4N9IA 4IEWA 1ZZBA 2PHDA 1HW5A 3G7DA 1ZZ6A 5C8WA 4GULA 5KHIA 1JUHA 4MGYE 3E5XA 1DZRA 4UBHA 5EFUA 1ZVFA 2PAEA 4HMZA 3H8UA 1YFWA 4L11A 5KHJA 3C3VA 3OGJA 3ETQA 5FLIA 2Z2SB 5BPXA 2N7GA 1CAXB 3H1YA 4EWDA 2F4PA 2FMYA 2CAVA 4Q0UA 3DN7A 2GC3A 4D7TA 3LZZA 4KL1A 3WW3A 1OFNA 1UW8A 4R52A 5LRRA 3MZHA 4E2GA 1QY4A 3IWZA 2VQAA 5EZWA 1QXRA 2XHKA 3U10A 1OI6A 3GBFA 4MH0E 2ET7A 3L2HA 2EA7A 2XKPA 3E97A 4I0BA 3M70A
chains in the Genus database with same CATH superfamily
2HVJC 4UB6Z 1OMIA 1CGPA 3AZZA 4FPGA 2JEUA 1EPWA 4IGOA 3RZKA 4R50A 4GKXA 4BMEA 3AKRA 4XBLA 4A41A 5AFBA 5F8PA 4RS5A 3F7YC 1Z78A 3AP7A 3NVCA 4YJ2A 4FK5C 3ST7A 4CDQC 3N27A 3RS6A 1P7BA 2UY8A 1RUJ2 2RR12 3UKMA 1OCZC 2Q30A 5E89A 3VBFC 5A70A 1TVKA 1TE1B 1I94O 2XJTA 2F1MA 4HANA 2ZEWA 4PD4F 3W5MA 4W4ZA 5LZ6A 3HBKA 4DY3A 3I2KA 5A9GA 3ABKB 2JE7A 2W0XA 3OGVA 4XJWA 1AXZA 5K0UC 4QXBA 1BCCH 4BJ0A 3AXEA 4UCOA 5C6CA 2WZEA 4NPLA 2W6IG 5I0TA 3VKOA 3OR7C 3PIGA 4XF4A 3OBZA 4CCEA 4GIQA 1Q56A 4FBFA 1G1XB 2WKKA 3N35A 1D2DA 1U5ZA 5FCCA 5F2SA 4IEOA 2GSMB 2B45X 5LBQA 5H9PA 2RMU3 2OIIA 3FFQA 4LO6B 5FP9A 4UUJC 2C0ZA 2XUMA 5IT9N 2D6MA 3ASOB 5FLXN 4BIOA 4DR1B 3PDQA 4CEWC 1Y76B 1WW5A 2Q7GA 2XHNA 3R05A 1LJ7A 3ZMOA 2QM7A 3VZLA 2DQ3A 1WBLA 3IGAC 3QOPA 4QX7A 5K7PA 4CH6A 4IV1A 4XABA 3ABLB 2FMDA 2R061 3W7SA 5IVVA 2DJVA 2YC2A 5BNQA 1MVEA 1RIRA 4O4HB 3JB4C 3JBG2 4NXNB 1M56C 1V6MA 4BH9A 2X6AA 2PAKA 3WCSA 4D94A 1ZRFA 1EZVH 4L99A 5C8CA 4YARA 5FBZA 2EF6A 2WC2A 2J1TA 2WNVA 4AAPA 1QHTA 3LGRA 4WZCA 2YPDA 2K1EA 2ZGNA 2W08A 3WF3A 1BK0A 5EJZB 3FN9A 1VQ8V 4JTOA 1R3IC 4LULA 2XL9A 4O65A 2VH9A 1EYBA 4QM9A 1HNXB 2LW1A 3VQWA 2WNUC 1O3QA 4Q1RA 3H1KH 4GB32 1Y9MA 3NJZA 4AVAA 2YEVB 4U36A 4LCUC 2HWF3 1FMD3 2ZKNA 1Z5VA 3SGIA 5EJ3A 1CR7A 2ZCWA 3ZLIA 3UO3A 4FVVA 4ABMA 3GNEA 3KT1A 2D3OW 4Q6GA 5CN0A 4YVWB 3MIDA 4Q4Y1 1N34B 3OCPA 1ODMA 2BGCA 4L2NA 5CFCC 2AHYA 5DN2A 2HFEC 3ACFA 5LK5A 2X5IC 5KHHA 1DGRA 3HR9A 1AR62 2EINC 1VF7A 3E5UA 1MQTB 4JYAB 3C7GA 1OLRA 2PMWB 2DBIA 5CBGA 2SBAA 3E86A 2R0HA 1VBE1 3K3WA 4MVQA 1SRYA 1MOFA 1UCXA 2WIIB 1IBKO 3VBSC 1HWYA 2Y6JA 1KRIA 2WNUB 4BE3A 2XWJB 4UVCA 1EAH1 3HNYM 2E6VA 4IV3B 1GQGA 2D5HA 1PMIA 3I54A 1XILA 1DQ2A 5LA0A 1ZREA 2Y38A 3JAWB 1SBEA 3QD6A 1N32O 1ZBA2 2VUJA 1XREA 3TEWA 5C5TA 5F32A 2JG9C 4QQ2A 3FZ3A 5FMDA 3BPSA 4CDWB 2HJFC 4COWA 3WOGA 3D0JA 4LMFA 3OGIB 1EZJA 5I91A 4O4LA 4IEPA 1HX6A 3D82A 1VLNA 3BU7A 3QH6A 2ZGMA 2P5OA 3E22A 3GGLA 4WBNB 3VQXA 1HJGA 1WA6X 4I2OA 2GC1A 4YIPA 3LFIA 3UCSC 3OBRA 3CCRV 2BSKB 3AZXA 5A7SA 2GP5A 2QM4A 1E57A 3POWA 2PTMA 4AHZA 1NXD1 1W6NB 1VAVA 2EAAA 4S2DA 2Y8KA 1NE6A 1O9GA 3RMXA 4EWEA 1VBE2 1UJWB 4URAA 2WLHA 4Q0PA 4EYUA 3AFKA 3F5WC 2PLV3 1VP7A 1VAKA 1TUBA 3CCMV 1XE7A 1EAH2 1IOAA 3MUY1 2P5BA 2ZGKA 2EALA 2GP3A 3ZIAG 3PN1A 4XUQA 1Z7S1 2Z2SB 5BPXA 2N7GA 1ULDA 1DF5A 1F4AA 2XJVA 4WZFA 2WS93 1NBMG 4GUNA 1N33O 4CCCA 1LR1A 4FLUA 1YXBA 4AEKA 5CBHA 2X6CA 3WNOA 2VZ1A 4LKEA 3K59A 4DUXA 2CYFA 4UFJA 4CDQB 4A5UB 3RWRD 2A1XA 2XBO1 2VW2A 1YWKA 3KF3A 1ZBE2 4FPOB 4XJ8A 3LOIA 2ZMKA 2JX9A 2WWUA 4J80A 5IDJA 3ATGA 2GU9A 1YJWV 3CL1A 1CJDA 1XU2A 4A3XA 4OMCA 2H0BA 1S5HC 5EHDA 3RI9A 2Q73A 3QBQA 5J98B 3GJBA 1UOGA 2FDHA 1FFXB 5FUPA 2Y6LA 1SZXA 4LF9O 4FT8A 1YFUA 1WCSA 2XT9A 1UU6A 1Q8VA 3ZN1A 3D3QA 5IFTA 2BEOA 3VOUA 3OEHG 5C9AB 3RJ2X 2VNGA 3WDTA 4EN6B 2WWJA 5EYYA 4JI8B 4QM8A 1RUG3 1N3QA 5F6LB 2CL2A 5HBAA 2Y0PA 3OPZA 5FZ0A 4H33A 4RQFA 2GMMA 3FMGA 4LF4O 2ZHMA 1G8WA 4XVHA 4RSUA 2O1QA 2YICA 4LH6A 4UBGA 5LOVB 2IXCA 3HPLC 1V6JA 1REEA 3A21A 4FOVA 5BNPC 4QPIB 3AZWA 3ORJA 2VW0A 4B08A 2O14A 3GZAA 1I08A 3ZFEA 3F2ZA 1ZBE3 3HWJA 1U5XA 2UU9O 4MVSA 1VIBA 1WZXA 4YVSA 1NQTA 3SYOA 3QACA 3ZHTA 4Q20A 2OCCC 4TT3G 4F8AA 1AJOA 4YIOA 1MNGA 3BPZA 4FFBA 4IEYA 4X65B 4Y26A 5KA5A 1VIWB 3WNXA 3CS5A 4Y1UA 4Y22B 2H0VA 4UXNA 4LF8B 5AVPA 2RDQA 2IH1C 5L3DA 1OZ0A 4I09A 2HLDG 3VHRA 1ZM1A 2VMDA 3B40A 1ZZ8A 1AR81 3LE0A 4Y1ZA 5A3MA 4Y22A 2DV9A 2YHJA 2X0LA 5E1AC 1GWMA 5C8CC 4NIIA 5BXXA 3ZKUA 4BR6A 4HAMA 4A7ZA 1K97A 1XRUA 3PU8A 5JPNB 2VQFB 3G6EV 4GWMA 1S0CA 2VU9A 3N9LA 2YV8A 1TGOA 3VQVA 5FZGA 3ME2A 2QR4A 5IYBO 1W6PB 2ZE6A 4FP3A 5KXCA 1PD3A 3LD8A 2YI9A 3N9MA 3JALA 5FPVA 4QMAA 4LA2A 1MZEA 2WLLB 1ENXA 1AJNA 1VB2A 1REDA 1VBB2 4GX2A 3LNNA 1S72V 4Q4W1 3FLTA 1Q81W 4CS4A 5CA1B 4OUEA 4B1LA 1H9WA 1SZTA 4RD7A 4HOOA 5D5QA 2F95B 3BCCH 3ZEDA 1J58A 3HPNA 4B7KA 2XJQA 2RN9A 1K7DA 1NCRB 4RA0A 4M4PA 3VBUC 4K8RB 4R4ZA 3EHKA 3FB5C 1UPGA 2NQYA 5FZ8A 1XL4A 3WSOA 2GBOA 1VQ5V 1JW6A 4AFDA 2OTLV 5IHRA 2BWAA 2WLKA 3VL8A 4QE7A 5EBMC 2EX3A 3K48A 2R70A 2XWBB 1VQMV 1LHWA 2E7QA 5CBLA 1WMDA 2OIGA 2E32A 4E4HA 1BMV1 1C5HA 5IVYA 4J10A 2G19A 5ACA3 2A6ZA 5IE9A 4XFIA 1AR63 4JQRA 5IVJA 2JG8C 4L8QA 4LHNA 2JJ2G 2E33A 1UO9A 4FO9A 3WW2A 3N9NA 4LBJA 2FDFA 2VZRA 4P9XA 4K0KB 3ZVXA 2ZR2A 2EIMC 3VBBA 1VMJA 1QEXA 2VQFO 5LP6C 5I0RA 1C8M1 2BJSA 1QVFU 4JGZA 1JQ0A 4P9OA 4OHYA 3CJIC 2VRZA 1ZZCA 3BHPA 4KBBA 2AYHA 3LSQA 4Y4RA 1W0NA 5K1PA 3OOXA 2AH2A 3ZN0A 4JKKA 5DQ0A 1KJLA 2WSVA 1W8WA 2R7EB 1N8RW 4LEJA 3SJBC 5IY5C 5CNAA 2YUAA 3E22B 2EBOA 1OA2A 4QPGB 1FAYA 3EB7A 1FXZA 1LENA 5HI0A 2J1AA 3MAQA 3B09A 1YVWA 4DYLA 4W6YA 3M7MX 3DKWA 2OPWA 4WFAV 3E89A 4YW2A 1LUWA 5LBEA 1JYNA 2XPJA 1WB8A 2DYCA 4Y1YA 4DV7O 3K46A 2A70A 3T0BA 3I3MA 3QG5A 4IEWA 2R30A 1ZZ6A 4AF9A 3AK3A 4L11A 4GAZA 3G71V 3TEYA 1HB4A 2YIBD 4QGPA 2R72A 1A8DA 1JXNA 3ZMNA 2B1IA 1W8UA 4TUYB 1GUIA 4MHRA 3SYCA 4WM8A 4JI0O 5IK8A 4PV1B 3UQ8A 2ZE5A 3MF9A 4Y5SA 4AFAA 3NSTA 4HPKB 4J25A 5KX5B 1MEC1 3VL9A 4RUFA 3S7EA 1H8VA 4EWAA 4NROA 4O4JA 2O8OA 3J7NA 4ZHQA 4AQTA 1UYPA 4YY3O 3T08A 4A3ZA 2D98A 3CCEV 1SMVA 3PVEA 4LE4A 2F93B 5D8AB 1KFUL 2YBKA 1PPJH 1HNWB 3V0BB 1QJU1 4XJAA 2BFUS 3N2GA 3DC6A 4I30A 2W95A 3DF0A 3FAVA 4RR3C 1LUVA 4DEQA 4BW5A 1OCCC 2VJXA 2IJKA 1TMF2 4J7ZA 3TRSB 3HKEB 5EC1C 3ZYFA 4NB5A 2A6VA 2D7FA 1VRH3 3P3NA 1JOBA 2Q5TA 5J96B 5JAXA 1D4M1 3OM3B 5E6HA 4BISA 3HT2A 4KGQA 1RL3A 4BQ3A 4D0QA 1HR0O 2PQQA 3LEIA 3UESA 4DR3O 3FB8C 5CG8A 5HCHA 3JD4A 3OBTA 4FPYA 4X8PA 5ABJC 1B35A 4K8ZA 2RR13 5LY1A 3DYOA 3N7JA 1WD4A 1U5YA 5FZOB 2Y33A 4JI0B 3KCXA 2QZ3A 2Q8DA 4X8NA 2R043 4WFEA 4JI1O 2QQJA 4C0BA 1Y7BA 4IIJB 1BGYH 2UXBB 1M1KW 4QT6A 3LNMB 3D0SA 3CRMA 1R3LC 3MDPA 4MV2A 3AG1B 1W2UA 3SH4A 4FZ1A 4LITA 1XYPA 2P6CA 4RQPC 2WYSA 2PI5A 3INAA 1M57C 4O2BA 4D6SA 3S30A 2GH8A 4YYOA 4OHVA 3HVDA 1G6NA 3OPWA 4IL6Z 1I7FA 3LFMA 3H8OA 5K4LA 3B4SA 4GZRB 1W0PA 3MW4A 1V54B 3BU0A 1VQKV 1NZIA 4XW3A 1LOCA 5CVRA 4LUMA 2R1BA 4QPGC 1G9FA 2RDSA 4B4QA 2K46A 4UF0B 1CXZB 2BGPA 5FYBA 5CYYA 3BUCA 2VMIA 4Q0VA 5GALA 1V70A 3K4DA 1X8MA 4AEJA 4IE7A 4KG8A 5FFOC 1AI6A 2RMKB 3CZUA 4XFBA 4QQPA 4XBFA 3W7TA 1LOBA 2PHUA 4DNYA 1E1RG 4B3NA 2FQPA 1UIKA 2KSDA 2YY1A 4I50A 2WZR3 1IS6A 1KQRA 5F39A 5HV0A 4CDUB 3HB3B 3ZKYA 3WDWA 2XMLA 4UFZA 1NLSA 4JZ2A 1CESA 2JRIA 3I49A 4XC9A 1AR5A 3AL5A 1OCOC 2BE3A 1RFYA 1ZRIA 1ZAUA 3JD73 4JHZA 4TZDA 4UB8Z 4KWLA 4KU8A 2WNVC 3VBRB 1WLTA 3UL2A 2ZR3A 3I59A 4QGNA 5M0TA 4P9YA 4E4SA 3TYJA 1A34A 4X9QA 4MGZE 5DDJ1 1VBC3 5A7WA 4MW3A 1WCKA 4FPHA 2FHRA 1GN2A 2VZUA 2V73A 1HDJA 3F7VC 3KV6A 5DN6G 1UZWA 3TK1A 1CAUB 2BFUL 5HCFA 3WUCA 3WU2Z 2AEYA 3AX4A 1PGL2 1SLCA 1H0BA 1GO3F 4FFIA 4UW3A 3BIEA 4WM7C 1OCZB 2B9UA 2Y6HA 3SEEA 3LF7A 4RR3A 3M1HA 5FBJA 5DABA 1FPN3 1C57A 1NQJA 3BRCA 3NMBA 3Q8AA 5FP3A 2UWAA 5D5PA 1S0FA 2JDNA 3WNPA 5F9TA 1OA4A 5FZAA 5C3RA 1GM7A 4X1KA 5JIAA 4AHCA 3ZXGA 4BQ4A 4ASLA 2X53S 3LSSA 1NY72 4NAOA 1CX4A 1W6OA 1XHZA 5IYZA 5HXMA 1PIV2 3AZYA 4IV1C 3OW2U 3G7DA 4TYSA 1WMFA 1R64A 3AMQA 1YFWA 5A3UA 2JK5C 3H3LA 1COV3 2P67A 3VHPA 1EV12 3RVYA 4BZ4A 4GMP1 4YW5A 2NMNA 2CAVA 2JKXA 4V2VA 2JVDA 4D7TA 4LF5O 1NCRA 1US2A 2IU0A 2YROA 1O8SA 3FHAA 5J1XA 1QXRA 1MS8A 4AHWA 3MHHC 4FIPC 3S3WA 3WG4A 2P4KA 3T1YB 2NP0A 5EIYB 1O59A 5D21A 5EPAA 2VTXA 1DU3D 4DR4O 4IXLA 4IE5A 5I0SA 2Z79A 3WZ1A 1XDCA 4JI4O 3LEGA 2Q4PA 1AVMA 4PF5A 1C8NA 2E74B 3H42B 1K34A 3APQA 1FT9A 3TB0A 1SQVH 1HN0A 4XPVA 3FUOA 1FXVA 2UURA 3VDAA 1E1QG 4BIZA 2O0OA 1L8DA 4DXWA 4ZS2A 1RHI3 3OEAA 3J7LA 3WV6A 5G05L 4KXRA 3VZMA 2F17A 3ZYGA 1I5PA 1NS1A 1BQZA 2VO5A 4YZ3A 4C91A 3VGIA 2ZEZA 3NKGA 2VZPA 4P9PA 2B39A 2ZPXA 4QU1A 4XJ9A 1S0EA 1BHAA 3NW4A 3DXRA 2UYBA 2ZE7A 5FXXA 2D44A 3UNPA 4UWDA 1VMGA 4W4LA 1U5IA 3AJYA 5FY9A 2ORXA 1Q8SA 5J7MA 4JTNA 5I93A 3AC0A 5A7PA 3A22A 3KV5A 4F4LA 3Q8BA 1H2SB 1J3PA 4RGKA 3ZR6A 4V2WA 2C26A 2ZZJA 3ZYHA 2VNOA 4FOQA 5E1RA 4HZFA 2K9ZA 4K8XA 4WM7B 2UXNA 1HW7A 3OGSA 3ECQA 4PA3A 2E63A 5FYSA 2PLV2 3NL1A 3J26N 3OEBA 2WA3A 2GC0A 2EJRA 5J3UA 5FLHA 1TEIA 2V7QG 1NOVA 2JDPA 3J80N 2CDOA 5FY4A 1I1EA 4XURA 4PDLA 3KSCA 1K3EA 2BUKA 2YPJA 2ID4A 2WDBA 1M93A 1JZ7A 1RUF2 3ACHA 2DVDA 4ITCA 3RZZA 3JALB 1ND3B 1KD7A 3I7DA 1W0OA 3PNAA 3QO8A 3IDBB 3CC4V 2VCAA 1UY1A 5CA6A 1Y66A 1D2SA 4ZHQB 3T4HB 2YI8A 1OCOB 2JDMA 4FOYA 5C5UA 3AB0A 1QHDA 1POQA 4I0WB 4DXTA 2FCVA 1GP5A 1GICA 2X8KA 4E2SA 1R093 4W50A 4DR7O 4QDSA 5FDBA 5F5QA 2AW9A 2G9FA 3DPRC 4QXCA 4UVAA 3WQ1A 2RCVA 3OSDA 2QQWA 3DV8A 3CSXA 4IGQA 3AMHA 1YRZA 1GZCA 2YBPA 5FPZA 5C93A 3P3PA 1RVF3 4DPNA 3BTAA 2IJHA 4RS5C 2RS12 4GH4C 1FS0G 3WNLA 2VOWA 2ZAHA 4CH3A 5KA6A 1Q7YW 3DUIA 2Z5UA 4BCUA 4BXSV 3RPQA 3I2GA 4MVOA 1ULFA 4XQ4A 1QJU3 3M3CA 1LR5A 2VBDA 2AGSA 2JDHA 4R6ZA 2WLJA 4UCUA 2JE9A 3H8RA 3LDRA 2ZHKA 4YPJA 2UWBA 4YXWG 4OXSA 5FZCA 1RUF1 1WLEA 4AHYA 1AI4A 2ZABA 3HOBA 2HWE2 4JV5O 4GH4B 3JSLA 4RS5B 3B3QE 3B00A 4ES8A 1MSWD 2DBNA 1X36A 4JYCA 2KXLA 5BNOA 3WF4A 1XB9A 5LHIA 5I8TA 3ABZA 2XONA 1SS3A 4XETA 1BS3A 2XUEA 4KBZA 1P4RA 3EVKA 2IXKA 1AJKA 2YIDA 4GCZA 1HXS2 1JOYA 3M3EA 4PIZA 5IYCO 4QJFB 3OR6C 3USUB 3AYAA 1WCDJ 1T5EA 3APBA 3KT7A 3O9OA 4D6RA 3I3DA 2VNRA 1YJNV 1W9WA 3ZR5A 4PIXA 4Q4X3 1UU5A 2R071 2KG7B 2EIJC 1ND2C 4DV7B 5HCAA 3H9VA 3VBUB 4P02B 2FB5A 2PHFA 5CB4A 5EFUA 1BHGA 2JG8A 3JXSA 4FLTA 3PUSA 4WM8B 5A3LA 1VPHA 3J8F2 1CAXB 1XEQA 2NN8A 4EWDA 3QO7A 4Q0UA 1HN1A 2Z0AA 2YC0A 1UW8A 4ZKIA 4R52A 3O1SA 4H7MA 1AR72 1IX9A 4N7IA 4BAYA 2R32A 4YW4A 4CA9A 3T1CA 2GTSA 1E5RA 2AUYA 3OF1A 3I4IA 2Q0AA 3IB3A 1LOFC 3FLPA 1V55C 2RMU1 3PUQA 4QKDA 3CWBH 2E51A 3I5DA 1YIPA 2MEV2 2IFWA 2MHFA 4I4TB 5L9VA 1LHVA 1N1YA 1SBFA 2GN3A 5E88A 4BDVB 5LGNA 2A73B 1PX4A 2LUWA 1BYHA 5DUVA 2QQIA 3FWEA 1ULGA 1N1TA 5GLVA 5FXZA 3IFXA 5JQGB 1AUYA 4JYBA 1HNWO 4AVBA 3BGAA 3B9CA 4X20B 3G67A 4DR2B 4FQ4A 3ZYJB 4AG4A 4HYOA 1ZL8A 4PI0A 3IIAA 4XZPA 4JCKA 2QWPB 1WPXA 4F83A 4FPPA 1FOD3 3OUJA 1WKYA 1H8HG 4UFLA 4HVQA 1Q90D 5CEHA 1AP5A 4RHV2 4DV2B 4UCTA 1DZQA 2B4KA 4DUYO 1GQPA 3IAQA 3R0RA 2WQZC 1OPMA 1RMU2 3FBYA 5LEKA 4I02A 3I2HA 2RS33 2M7WA 4ZOLB 3CHXA 4JDNA 4KMQA 1SESA 4EB6A 4GT1A 1HNXO 2ZMLA 3K3OA 2ZGOA 2R073 1RXGA 4R4XA 2DUPA 4BPZA 3WQBA 2X09A 2VULA 4K1YA 4U2AA 4JGSA 1WMEA 1RJ7A 2WL1A 3ZXJA 3ZFEB 3CKHA 3OGRA 1RC6A 1Z7S2 4G4FA 5IY5B 3EXUA 2RMU2 1IXMA 1WGPA 1QU0A 2MEV1 3KM5A 4HT1T 2P17A 4XQDA 4XE9A 2X6BA 4FPFA 1PM7A 4XXAA 2WT1A 1MABG 1CN1A 3K5MA 3GBGA 2V1DA 5C4WA 2Q6AA 1OV9A 4F3JA 1N34O 4MGTA 2G1MA 3THDA 5FXWA 2Y34A 3FX7A 5BNNA 1TVKB 3UKNA 3VDDB 4ZXEA 3SMHA 2ARXA 3RBZA 4A6SA 3SEPA 4RHV1 1FYJA 3L73H 1TG7A 2EVXA 3J9SA 2AREA 1RMU1 3J4UH 2F4LA 2J42A 4LBQA 4M0NA 2RDRA 1ND3C 1W8TA 1LODA 4UXAA 2AGAA 3ABTA 3GWKC 5F3CA 1V6KA 3J81N 5AC91 3LKJA 5DAPA 3QO5A 4LBQB 3THOA 4CPBA 3N9PA 3HT1A 1V6IA 3L9JT 2DF7A 1GK9A 5FYYA 1ODNA 4JDMA 1L7RA 2OIEA 4Z2AA 3WFVA 3J7HA 1LKNA 2P22C 3MV11 2P1BA 1NAEA 2V5YA 3MV01 4XFGA 2DYRC 1ONAA 5A3NA 3CCJV 1MZ6A 2B7YA 2BRTA 4EN9B 1AYN2 2F4VO 2HLEA 4XBQA 2RJ2A 2CHHA 2ZA9A 2UU8A 4LTAA 5DG2A 2P3KA 4H0LB 4HSLA 3V0BA 3VN4A 3RNSA 5DZEA 3CXCU 4RUEA 2IZWA 1RMU3 4OLLA 2JDUA 4X89A 1VRH2 2H6BA 3LDCA 1MG1A 1GU3A 1YQCA 2W6JG 4XILA 3ZPOA 1IPSA 3HD8B 3T1MA 4Q26A 1QJY1 1W9FA 1OFSA 2UXCB 5BNPA 1UZZA 5G04L 2VGDA 3ZPYA 4ZONA 3LQCA 4E2QA 2PN5A 1UMIA 5C70A 3K79A 5EZYB 1YC61 3FB7C 1QQP3 4WFBV 2DURA 4YWAA 4CYDA 1HQLA 4FSJA 1O5UA 4N8MA 2GNTA 1PNKA 1VALA 1G6UA 4MS2A 2D43A 1S2KA 2A6XA 3D3AA 1YI7A 2XAJA 2NPIA 5K8SA 1SLIA 5SV8A 5CA1A 4GD4A 2YIBA 3BVCA 2WT0A 4YRDA 1OOPC 4FFGA 3K0GA 1AR73 5H9SA 5CA0A 5A33B 4JI7O 3JQWA 3NRUA 1ND2A 5GJ6A 3OD4A 3UM7A 4N90A 1ALYA 4CS3A 4MW8A 1AX2A 3LDKA 4MO3M 1IXBA 5T5JA 4LFBO 1MZ5A 2Z42A 4A4AA 5CFCB 1GOFA 5L3BA 1TME2 1OA3A 4I55A 3ETQA 1U96A 1TUEB 1YJKA 1H2NA 3ON7A 5FZ1A 2F4PA 2C6SA 3LCPA 4Q4X2 1OQ1A 2RS32 3DGTA 1L7LA 3B69A 1BZWA 5F3IA 1IS4A 5JZGA 2EIKB 3QLQA 2H94A 3ML0A 4FFBB 4OI0A 1WW4A 4YY3B 2QEXV 1BMV2 4BU2A 1GWLA 1CIYA 1JX9A 4GKJB 3ZMSA 2QJVA 2HJDA 1L1FA 3A4UA 1AR4A 2AENA 3O1MA 2KKWA 1Y4MA 2BWCA 3OGGA 3NJVA 3H7JA 3RZJA 2IW5A 2YC4A 2YYOA 4BQYA 2QWNB 2A3XA 3SCHA 3E8HA 4J1WA 1KMIZ 5ITZA 3IM0A 3K9AA 1F5JA 1C8M2 1N3PA 2Q1FA 4QDQA 1NXMA 4JTDB 2OT5A 5J48A 5A1FA 2ARCA 2BERA 4G3YC 1XOUA 4MSWC 4PELA 3CLPA 3HKEA 4IE6A 4X62O 3THPA 4LF7B 4YW3A 5D2AA 4XIOA 5A7OA 4OULA 1RM1C 1MACA 1AHSA 2RJKA 1UIJA 3A2FA 4JV5B 5BZBA 2Q8VA 3GWOA 1AI5A 5J2TA 2ZGTA 4BQ1A 1HP8A 3Q8EA 5GKAC 5FJHA 2D6KA 1XBFA 3U78A 5DDJ3 2WAMA 2CAUA 1AR61 5L3FA 4BLIA 1FPOA 3J8F3 1PGW1 4QDRA 4Q4X1 4Z07A 2WLIA 2PUSA 1ZZ9A 1QJY3 4JGYB 4NN0A 4W6XA 3MEPA 3LB9A 2Q8OA 3CRAA 4XDPA 5IAXA 4YNIA 2R063 4WFHA 1FPN1 1K8AW 4QKNA 1JJOA 4B29A 1JYTA 2IU3A 1AP6A 2JS3A 1IG0A 2PA7A 3KCCA 2YFUA 4YG0A 1XHXA 1UX7A 3OY8A 3VBUA 1YITV 2LS6A 1W04A 5EYPA 1WD3A 3OE7G 4N53A 3JZVA 1IPJA 4NO4A 2X29A 1HRV2 2Y0IA 1UKGA 4FFKA 1GFF2 3P6BA 5GZGA 1UZVA 2OWOA 4YVWA 4CC5A 1UXXX 4NYKA 3WX5A 4JI2B 2CGOA 4NJ4A 1J59A 4P00B 1OC1A 5BR8B 3OBAA 3NAPC 5FY0A 1JODA 1SEFA 2ZAAA 3KQRA 1XSRA 1RPOA 2J7MA 1BEV2 1ASJ2 3D6EA 2CTQA 3CCSV 4CCJA 2VOTA 5B1BB 3SKVA 1FJGB 5JVDB 2QQPA 1XNKA 4H14A 1BBT3 2WA4A 4WVVA 1PL0A 2NNUA 2ZNIA 1JYVA 4MXWB 4FI9A 2VZOA 4B3TB 5L9RA 1F8VA 3ZN6A 2WN2A 5JQGA 1VARA 2GNBA 1X50A 2XVGA 3T2OA 2CU5A 4GKKB 4PI2A 1GH6A 1POV1 1W05A 1UNBA 5KMGA 3ZS8C 5FQ0A 4MTXA 1PVC1 4YG6A 4LKDA 4F7ZA 2G9GA 2EIEA 2ZJCA 1OUXA 1G9DA 2YMZA 1NH2D 5CIRA 1XOYA 1K92A 1QKQA 1NCQA 1IVSA 2ZS6B 1HRV1 4I3GA 1UYXA 1K73W 4CVUA 2GDSA 2LP7A 1MPXA 2QGNA 4H2AA 1UXZA 2ARAA 2VMHA 3VUOA 4COVA 1PNGA 4COYA 4LKFA 1N1SA 2VMCA 1VBE3 4Y20B 3ZDSA 3SCGA 3AP6A 4L9BA 2P7TC 2P6HA 4CDXB 2UUAO 4NE9A 4LT5A 2SLIA 2V09A 2LW7A 1KKDA 2GALA 3RI8A 5LATA 1DLCA 4XCAA 5CFDA 1GV9A 1X9TA 4C8DA 3WY6A 5ITZB 4HKOA 4CEYC 1POV3 3GHNA 3KT4A 3FYEB 5H2FZ 4Q0QA 4A7YA 2VM9A 4RR3B 4OMDA 2RJZA 1UY3A 2CTVA 1LHOA 3ZYRA 1AVBA 1XBLA 5FUIA 3TN93 5TISZ 4EEQA 3CCQV 5JWPA 5JOXA 2KD7A 1W3VA 3UJOA 1HRV3 3ETDA 3E35A 3A0NA 4UFHA 3SNMA 3RYFA 2WQ4A 3H1WA 1PVC2 3ZXKA 4LFAO 1B6QA 4FJCC 3JASA 2QNKA 2GTAA 1R1A2 3PUAA 2A5ZA 1BMFG 3VBSA 4YJ3A 3RSJA 4AI9A 3RT3C 3CXHF 3T2MA 2XR4A 5IW0A 3J7MA 4J7KA 3CO2A 4ZHNA 3OGCC 1J84A 5A6ZA 3I2IA 5KHIA 3PVOA 4P9IA 2JS5A 4YJ3B 1OQEA 1ZVFA 3IDEA 1O4YA 1G8MA 3C3VA 1W6OB 1EAH3 2QWRB 5T5LA 3ACIA 1PNLA 3H1LH 3WG2A 2P4EA 4EQVA 1DQ0A 1BVVA 3WW3A 1QH7A 3Q4HA 1RUC1 4XDOA 4FLWA 1IGOA 1OI6A 1B04A 2XKPA 3AM2A 4KWUA 4X1YB 3M4FA 4Z8BA 5C3OA 4AVSA 2OCCB 1DF0A 3AG4B 1SFNA 4Q4V1 1YTFB 1ZYBA 2EIGA 3RZHA 1BEV3 1IG3A 2IWGB 4U7OA 2A06H 3ZRVA 2A9HA 5FZDA 1HR0B 4GWIA 2WO7A 1GM9A 4MVMA 1H38A 1NJIW 1BJQA 4U7NA 1IBKB 5C3SA 3ZFFA 4LOTA 2WZR1 4O2BB 1R1A1 3WDUA 1J1TA 4D7SA 2JD4A 3KCYA 4LF5B 2PELA 1IHMA 4EN8B 4JX0A 1X33A 2XHBA 1GLHA 1PMHX 1JFFA 4JI1B 4KHPB 5FMOL 1ZBA3 3NV2A 2ZKLA 2GUZA 4CTEA 2ZX2A 5GONB 1Y3TA 2VQUA 1X9PA 1DTOA 2IXHA 5FPBA 1OPOA 2OS2A 1YIJV 5A3TA 2X7RB 4DY5A 3T1HO 4KNCA 3ROUA 2PI4A 1T6BX 2WFF3 1PNMA 4TUYA 1JHNA 1CAUA 2ZGUA 1W6PA 3N9OA 1OCRC 2BOBC 1G4YB 1I5ZA 4DRVA 1GN4A 1W59A 2R9AA 4FZ0A 4K7JA 3MLKA 4AGVA 1LOFA 4NHYA 2WLLA 4D69A 3ASNB 1KJRA 4A44A 3CIHA 5FYZA 3CJHA 3CC2V 3K08A 3VV1A 4BW9A 4AEMA 4N7UA 2DCJA 4FM1A 3M3QA 1W6QB 1AXYA 1EN6A 1FMD2 3DKQA 3T4VA 2I45A 2YU1A 4U3FH 1O5LA 2N05A 4FPCA 1YFXA 5ANQA 3HQRA 2ZIMA 2JGUA 1GAXA 4FPLA 2VCMA 4E4ZA 2ZMNA 3A0KA 3M3IA 5FPAA 2YXHA 1QNWA 4JASA 1RTVA 5FYIA 4BQXA 4IETA 3WVJA 3VBOB 2HKXA 2B42B 2XVKA 1C1FA 1NLRA 2DVBA 3OAAG 1UY4A 1VBC2 2DYSB 1IS5A 1VE0A 3WF0A 5DXDA 2BTOA 4H3WA 1ND3A 3OUSA 4CU6A 5KAIZ 1V9PA 1SACA 3L70H 1S4CA 5FWJA 5GLUA 3JBG3 4H7LA 2YSUB 5JIUA 3HNMA 1S76D 1YIFA 3ZXFA 1OXCA 1XXNA 2EICA 1OHFA 4AAXA 1I3HA 5C8YB 4BWOA 3CPWU 5KUKA 3H1MA 2C4XA 4HN0A 2OQ7A 3U37A 1W6NA 1LCLA 5LA1A 4X64O 2QKCA 1LHUA 4KQ7A 4E8DA 4AI1A 1O8PA 1Y43B 1CZTA 1W2OA 3K03A 3N9QA 4YVSB 1UY0A 1SQGA 1FKAO 4NR1A 2ZKOA 2FDGA 4R9BA 4AGGA 5FMBA 3RG0A 4OPAA 2XAHA 1QMJA 1QOTA 3IIIA 3PU3A 4MVRA 1W8ZA 3D8CA 3T2QA 1NH2B 1MEC2 3FB6C 5EIBC 4SBVA 2ZOEB 1EM1A 2R9RB 1NI8A 1BQPA 2FZ1A 2QBXA 3HBZA 3WD5A 1OD3A 2PLV1 1E5SA 2LW8A 3FHIB 3OMNB 4F6EA 2ZX3A 1XMOB 1SCSA 5C4WB 3SH3A 2VQEB 1N33B 1RUJ3 3AG3C 3SHRA 5CMUA 3USUA 1UMZA 3SJQC 3OUIA 1L0NH 4NTWA 3OYWB 2JDYA 4JAVA 5FYHA 1DLBA 2AEZA 4DXZA 4R7CA 3VD9A 3P1IA 5JR2A 1JZ3A 1YI9A 3LSUA 3ES4A 4YM0A 4UW6A 1J3QA 1UKRA 3X2QB 3T0DA 1AF9A 1OOPA 3DXRB 5JSPA 4CDXA 1D4M2 4Q1PA 2R042 4YVSC 1JYXA 3TGUH 4TV8A 1A78A 3ZX7A 4B3RB 3ABMB 2V4AA 5JMOA 2D97A 1OLME 4EFEA 1LNQA 4EE2A 1HLCA 5KXEA 4ARXA 1RUI3 5K9YA 1I9RA 2D6NA 2LQTA 2Y69C 1S1AA 1QH6A 1PX3A 4AHXA 4HKWA 1RUE1 1R3KC 3DPRB 3C3TA 1RYYA 4AFCA 4EZHA 4WM8C 1XL6A 3WF2A 1QY4A 2CAZC 5EZWA 4LBMA 1SQXH 5T52A 5A3WA 5A3OA 3ZOIA 4AFMA 4QHBA 4LO4B 5CKNA 2B5HA 1C5IA 1FNYA 2ZNJA 2JDIG 1ULEA 5FAXA 4TOIA 4LHKA 3ASOC 3ZFGA 4GJYA 1PGSA 4INDA 3JAKA 2HWE1 1BZKA 2VBBA 4P5YA 3T30A 1V6OA 4E9KA 3TEZA 3AKPA 2NLRA 4RQEA 5FIXA 4FLYA 2XXZA 5L73A 2E76B 2EZPA 3DECA 1NVPD 1IQDC 5CKQA 1RM1B 1WA8A 5IK5A 3IPVB 3AMMA 1K4DC 1JZ2A 1JA8A 4PA9A 1W28A 2FTKA 4JI2O 3NXSA 4CP0A 5FPUA 4AYUA 3LWCA 1HXS1 4JRLA 4GALA 3K9SA 1NTMH 1KD1W 4DEVA 4L8JA 4OYUA 4LQRA 2LGQA 1AX0A 3B93A 3PTYA 2VY0A 5DAXA 1HB1A 4H37A 1LOGA 1WBFA 4LHLA 3KV4A 3N7MA 4W4KA 2PYTA 1QBZA 3ABMC 1S5JA 4IEXA 4WVZA 3W7UA 2R072 4WVMB 1QLEC 2G9ZA 2VUAA 4GMP3 2ZBJA 4MVZA 3JATA 1Z0HA 4JV4A 2CV6A 4BYYA 3X2QC 2CWSA 3FE5A 4UFKA 5EYPB 4AQYO 4QE9A 1J95A 3Q9OA 3A7QA 2IJJA 4Y24A 5B4XA 2WWSA 4ZU7A 4TQDA 3OTOO 5A2QN 1TNRA 5F2WA 1FOD2 2JG9A 1VP6A 1NLQA 1VRBA 2OUHA 5BNNB 5JXIA 2P34A 4LUKA 3MPPG 5JSOA 1HXS3 2VCCA 1AR71 1X8EA 4FMTA 1FFXA 2HH9A 2RS53 2YS8A 5CB7A 1KITA 2JEXA 4YM1A 2Y26A 2B5UA 4JPRA 2WO2A 2QSAA 2RDCA 3B01A 1URXA 3HR0A 4IYIA 4O7XA 4QKBA 3PJQA 4PDRA 4PQ9A 2VOVA 2RS13 2JG8B 1TNFA 4HFSA 2GUZB 2QKSA 5FUNA 2E5LB 1N47A 2ZACA 4QXKA 4AQYB 3SPGA 2Q67A 5DAQA 1PM4A 1R1A3 1HNZB 2YBSA 3FJSA 2CDYA 4JKMA 1Q5OA 5L3CA 2ZGQA 4P14A 3LEMA 2AZ5A 5LGTA 5CADA 1RUG1 1B35C 4QB6A 5FNVA 1PO11 1UOFA 2A7AA 4UFIA 4YFWA 5FO7B 4CRQA 2WFPA 3I3QA 3CJXA 3V65A 1FXKB 4O4JB 3POFA 4IV1B 2QQOA 4I01A 4GWJA 5LB6A 5FZ9A 2H6CA 4NRQA 5LXTA 4FVMA 5IYYA 5FO9B 1OLQA 2FYUH 4HK9A 5B3SB 1W6QA 5FREA 2QQVA 1GZ9A 3SPHA 3BA8A 3BOWA 1W8OA 1CPNA 1SQQH 3VBOC 3WHUA 5DUUA 3BAAA 5CFDB 2K2SA 1VBB3 2AACA 3SYPA 5BY1A 4IE4A 4XAEA 5HFLA 2DVFA 1NZ6A 2R6QA 4DR5O 1W6MA 3JAKB 1NVPB 1DDLA 3IN9A 4GKJO 3NWKA 4IGGA 2JIGA 2LM3A 4BK5A 4CCNA 1VB4A 2HHHO 1M4UA 4CEYA 2ADDA 1YQ5A 1NT2B 4AW7A 4N9HA 1COWG 3K4ZA 4DRXA 4IGPA 2NYYA 3WR0A 3JD2A 2QKDA 5LASA 4QD2A 1URFA 3O5SA 1KB9F 2P3JA 1XQNA 1A3KA 4QX5A 4Z92B 2DCYA 1CX1A 2QCSB 3PURA 5B1OA 3OYWA 2WNVB 2VMFA 3KB5A 1GYKA 2QTSA 1IDSA 3K3NA 1JS9A 4Y5TA 2LTNA 4JDOA 3VD7A 1AYM3 2JJ1G 3JSNA 2ZM6B 2XJSA 1JMKC 4LNUA 3CMGA 3ZN6B 4QPJA 5AC92 4AVCA 3RRDA 3VDDC 4H44B 2DOSA 1R73A 1I94B 3WXPA 2MPFA 2BTVC 1XC6A 1O6UA 4TTGA 5EP9A 5KC6A 3E5XA 3L9DA 4AEDA 4W6WA 4IT5A 4KHPO 1LTEA 4N53C 1XNBA 3LSDA 2I2SA 5JI7A 5LBFA 4N43C 4LIUA 3AL6A 4DK0A 2GC3A 2WYFA 1YXWA 1CJPA 5SV5A 3LZZA 5APAA 1NU1H 2RJLA 3U10A 2PYJA 4QB1A 3L2HA 3E97A 1V9U3 3I3BA 1VRH1 3S3XA 4DUYB 5A7QA 3H50A 4OI2A 1D5NA 1QLEB 5FZHA 4DB5A 3KLSA 3NV3A 1IKQA 4WBNA 3RVZA 1N36O 3POBA 3H1HH 1QJY2 3NNLA 2IVIB 1PVXA 3U14A 2Z3YA 2W2IA 4LF7O 4B7EA 1H4GA 2H3OA 1ZSPA 1P7GA 2VVDA 4XDKA 4XYXA 1ZRRA 3AK1A 3UT5B 1STMA 5FY1A 1O9HA 5ISLA 5J2TB 3AG1C 2CE4A 1DGWX 3ETGA 1APNA 3K75B 3FHQA 1SLBA 5AG2A 1SQ4A 3OG2A 2A71A 1J5EO 3SQOA 3HQUA 4JKLA 2Y64A 4UT5A 3MUZ1 4GB31 2DFBA 4C1WA 1DFQA 4BOWA 3DCQA 1VMFA 3EMRA 1NTKH 2XOMA 1PIV3 3N7LA 3UJQA 4MUVA 1PL4A 1V00A 1C28A 2EXIA 2NZ9A 1W06A 2J1SA 3OY8B 2W39A 1HRI1 3OB8A 2ZCEA 5GZDA 1K4CC 4FAHA 3K2OA 3K57A 3UV9A 2OVUA 1VBD3 2ZX4A 4CXYA 1FI2A 1UZ0A 3ZHUA 5EWSA 3WNMA 1OCCB 3I2OA 2GC2A 4W8JA 3DXUA 3LA3A 1KQSU 1JR9A 3C7HA 4ZS3A 4JYYA 4YZ5A 3STLC 3R6SA 1HV1A 4JI5B 2C9KA 3VBFA 2JG9B 4CEYB 2DDUA 1YSCA 4NIHA 5E16A 3B5LB 1CAWB 1AL0G 1R083 1VF6C 1KGYA 3RZGA 4DV3B 4Z82A 2Z69A 5FYMA 1K5MC 4I55B 1VBA2 1Q8OA 4AEDC 5KC5A 2VZQA 2ES3A 4TWTA 5JJEB 1D5AA 4RO2A 3P5BA 4P5HA 1KDMA 1VQ6V 2V4VA 3HN3A 3RVHA 4Q4W3 1ENSA 2GH2A 4CZSA 1YJ9V 4BWAA 3RWNA 2EIKC 1J5EB 3ILNA 4PJ0Z 1QNMA 1M5IA 4UCVA 2QVSB 3HKCA 4RQPA 1FD9A 4FM0A 4LIVA 3IBMA 5EBWC 1S0BA 1RITA 3AJZA 1SBDA 4YHHO 1RP3B 1PMJX 3UT0A 4M01A 3LDBA 2VE1A 5HFMA 2WR9A 4OCTA 1LAJA 1WJZA 4FLZA 2J1EA 1VQLV 2ITCC 3WCRA 4X64B 1IZ3A 4HONA 1XNTA 3U0ZA 5DPNA 1RXFA 3L72H 3RZMA 3UKVA 2VCBA 4AWDA 3O1RA 1LRHA 1ZNPA 1ENQA 2J1UA 2N74A 2IVJA 4E27A 1OOPB 5DM6V 2R49A 3OJBA 1FPN2 5ABJB 5FZIA 3VZKA 4EZ4A 3QVNA 2PHRA 2HWF2 4RWUA 3BTYA 1F15A 3ZFGC 1Z2GA 1WUVA 1C8M3 3I2DA 3AEIA 2BOCC 3SKJE 2W47A 1GN3A 1B06A 3AG7A 1AYN3 1O7FA 4PLNA 2IFRA 1THZA 1NX9A 1DQ5A 3U75A 2XBO2 1DCSA 4DO0A 3U4SA 3ZX6A 3NNMA 3TBDA 4META 2EIMB 4BIUA 2WNEA 3DPRA 1YTFD 1HNZO 1ASJ1 5GZFA 5A6QA 2QDOA 2J1RA 2VQTA 1PO22 4M3CF 4DOUA 3SXWA 4FCAA 2V5DA 1VMHA 1Q6UA 5JH7A 2DYSC 5LYJB 3AZVA 3CNAA 4JYAO 3MBWA 3E5QA 4PIYA 1B3QA 2ZM6O 2ETNA 2RVAA 2F43G 5FPXA 4M4RA 2CY6A 1DLLA 4J6GA 3AG2B 4DXRA 5JH7B 2IC1A 3ZXDA 4FXKB 4XJUA 1AR83 2HWB2 3CBNA 3BKZA 5BMVB 4XFAA 1Q43A 4PA6A 1OT5A 1I5XA 1IPKA 5B1AC 1Q8IA 2KB1A 3GM8A 4CBCA 3K5LA 2HEVF 1JCHA 1CAXA 2Q1MA 2LJ2A 3DYMA 1G7YA 1JUHA 1DZRA 4PDMA 4EFBA 3BOPA 2XOKG 3LPFA 5KHJA 4URTA 5B1NA 4DUZO 3ZYIB 4GX1A 1YO8A 1CZSA 1G9BA 2FD8A 1EUUA 1EBOA 5IJ9B 3FL7A 5H6QA 1MSDA 2RE9A 1VQNV 3LPGA 3BTXA 1CVNA 1TAEA 4LBEC 2EA7A 4JGZB 3M70A 4B3SB 1PK6A 3V0AB 4DRXB 3K77A 3UYJA 2YZ4A 4DR2O 1AX1A 4HN1A 1YDXA 1PO13 2Q69A 3DXTA 3A0RA 4PJYA 3PMSA 4DV6O 3N3HA 2O57A 3TEXA 2ZX0A 4E8CA 3LUTB 4L92A 4LF4B 1H9PA 2Z4FA 5C3QA 1RINA 2ORZA 3HAGA 1NCQC 2VXJA 1YUDA 5JXJA 3JAMN 1XSQA 5J9PC 4IEQA 2NM1A 5CA0B 5A33A 3JASB 4GLXA 5FYCA 4BMBA 2BCCH 4DMIA 1GSLA 1PO23 1GANA 1RHI1 2HWD2 3ZN4A 3TWIA 4HZ3A 3VHOA 1ZRCA 4DV5O 1PZ9A 5C9AA 4COUA 1SG3A 2VXRA 5CU1A 3KQ4B 4ASUG 2UWCA 1RUI2 5FYVA 4MT8A 4WCEV 1WP7A 3WG3A 4UAPA 1SETA 3D5OA 4ZI7B 2GAUA 4CUGA 1QR8A 3NR7A 2PZSA 3JARA 1OURA 1SFYA 1KDKA 2GDFA 3W9AA 1XMQO 3TN91 1AR91 2W94A 3PUIA 4XOGA 1FATA 2VW1A 2BNNA 3VDBA 4MGKE 3H7YA 5ERLA 1RSOB 2ZGPA 1ZBE1 4R8HA 5I0DA 5TSWA 3HKBB 4HL0A 4DUWA 1H2GA 1RGSA 3K58A 1RUNA 4KP4A 2BOJA 2VVFA 5I8YA 2XLFA 4G28B 5FPLA 2GNDA 4FTSA 5CA3A 5JXGA 3IC9A 3USSA 3NNJA 5FNVB 4OX9B 2UXXA 4X88A 4U3JB 1F23A 1AYM1 3KWVA 3PLQA 4CCKA 3RN4A 3EO6A 2RNBA 4LBNA 3W5NA 1S0GA 1DK1A 5JXHA 2R9IA 5BMVA 1JU4A 4FFFA 3UGGA 4P30A 5IUQA 1WNSA 3POGA 1W99A 2HWD1 4U3JA 5H9CA 3MPBA 2FBEA 2RG4A 2IH3C 5I8SA 3WNKA 3S6PA 1KU9A 1JOJA 3ZRWA 4IQPA 4Z1MG 2E9QA 1VQ9V 5H5NA 2J22A 2WS91 3Q8FA 3CP1A 4I7ZB 1G9CA 2OW4A 1JPXA 1E5IA 2K9PA 5LGUA 4ZBMA 4AL9A 4AQSA 3VKMA 2DUQA 5GTHZ 3EJKA 4PDWC 4Z2WA 3G4SV 4ZU4A 3WDXA 5F5IA 1DYPA 4M3CB 4E4EA 4DO2A 1R091 2CK3G 1W0JG 2IXJA 1F31A 1JYIA 1BE3H 5LXTB 4EV0A 4DR7B 2EULA 3FAVB 3CX5F 1A8MA 2RHPA 2RM22 2F4VB 3MIEA 4AI3A 1E79G 2IBZH 2EZOA 2Y4TA 3ASNC 3MW3A 5F3GA 1DQ4A 3VBRC 4CP2A 1O4TA 4R9DA 5LHGA 4AGRA 1JU3A 2ITDC 1FAFA 1S77D 2DMXA 5C3PA 2XBO3 3ICXA 4ATEA 4XUOA 4QHOA 2OT7A 3L2YA 4XUPA 1ZA7A 1RUD2 4K3UA 2JDZA 5H6RA 4FLXA 2BGOA 5EZYA 4D6TH 4CDUC 3KMHA 2WT2A 3PVNA 5FLJA 1XNQO 2B46X 4OHZA 4OVEA 2A79B 3H1JH 3EYPA 3H3UA 3EXAA 2HWC2 4QX8A 1M90W 1QXJA 2YDEA 4X6RB 3M8LA 3HKCB 3HKDA 3P30A 4Q4W2 1TA8A 4LFCO 5KHKA 4UV8A 1Q86W 5I0UA 1ZTEA 4TV9A 1L7QA 1O4ZA 4YW1A 1QJX2 4IEUA 5ACA2 1R092 1K33A 2UUBO 4B3TO 2VZSA 3GF6A 2BTQA 1H1IA 4F6RA 4JVAA 2Q9LA 1AL21 5KXDA 4HPKA 3BODA 5EIBD 4JI3O 4X20A 4CH4A 4P08A 2M6YA 3SCFA 2QFEA 5CZKA 3MGUA 4X1IA 3CCLV 1NE4A 4JF3A 1HV0A 4PA4A 5F3EA 3VZOA 3THCA 2WUHA 5FZKA 4JI5O 4UF0A 5IYDO 3JB8A 4FP2A 4ASMB 1V9U2 2DTWA 1TMF1 4KWJA 1SC5B 1RJ8A 4UFMA 1HW5A 3MIBA 1Q82W 4RQPB 4ES9A 5LMUO 2R0FA 1OBNA 3N2KB 4FPJA 3T2PA 4LP8A 2UXDO 5FP8A 1S0IA 2DN9A 2GN7A 5FP4A 1LESA 3T1HB 4KH9A 2ZD9A 1SQBH 2MK3A 2D3RA 1BVP1 5LRRA 2JE8A 3IJ4A 1QDOA 3CJIA 4CCOA 2HWC1 5JOWA 4PDWA 4LF9B 4B3MO 4I0BA 2A0LA 1WW6A 2HVKC 1XYNA 1D4VB 1IBMB 4DV6B 3WB0A 3CQOA 3F5TA 2G4IA 3PJYA 1GR3A 5IVEA 4X62B 1H8TA 4OPHA 1K42A 1BEV1 4BLJA 2Y6KA 4NVPA 4AQ6A 3E6BA 1QJX1 2YGLA 4MGSA 3K4AA 2PY5A 5GZEA 4B1MA 1ZL8B 2VWKA 2EIBA 4XACA 1A32A 1QR9A 5F7UA 5BXZA 3K06A 3VDCA 1KS4A 4P9GA 5B5EZ 1F7YA 3UGHA 4GX0A 1W2NA 3VLBB 2JXAA 4XBNA 2VL4A 1QJZA 3H3ZA 2W0FC 4X1KB 2L6LA 4XDQA 1PP9H 2W91A 4RN5A 5IJ9A 5BNOC 3WG7B 1QQCA 2B8MA 4LE3A 3N7KA 4HXCA 3ABLC 4LK7A 4DQAA 3NO8A 3T4DA 2NR5A 4CU9A 4MOAA 2Y69B 4L97A 3VKNA 5JJJB 1V0AA 3D36C 5D8AC 1MVQA 2WLPA 2ADQB 2DCKA 5GTIZ 5C8YA 4NMIA 4HNAB 5IJ0A 3VQYA 3UETA 4Q8LA 1RVF2 3FX3A 3LA2A 4S2GA 4CPBD 1SERA 4MTFA 3UO2A 2C2AA 3I3EA 5JI9A 1CP9A 1ACCA 1AR93 3ZXLA 1MS4A 1F4HA 1PVC3 3LIHA 4AK3A 1LU1A 2ADPA 2C1FA 2VZ3A 5F37A 2LFSA 1XI1A 1P8JA 2QWOB 3VBSB 1F9KA 3BY6A 4FM2A 3OTFA 3O12A 4LBQD 3AKTA 2QJ1A 4TWKA 3LAGA 3ABKC 2QWQB 2X5IA 1N3OA 3JCIA 2XL7A 1YHFA 3JATB 4ISRA 4DK1A 3NJXA 4JI7B 2XLGA 4QPWA 1I0HA 4YM3A 3ZHVA 5JZGB 5L7OC 3HJRA 1CAVA 4MXVA 2GMEA 4TV8B 3CYOA 4PA7A 5AC93 5T50A 1Y6XA 1SDDB 4K40A 1WCUA 1VAMA 1KECA 5JOZA 2ERFA 1AB3A 4K35A 1PKXA 4Y4YA 4DV1B 4MYEA 1F2NA 1OSGA 1W8FA 2DWRA 4B4PA 3BALA 4Q5OA 4PCRA 4QWNA 5C71A 1JUIA 1SCRA 5KWRA 3A8TA 4JTAB 2NLJC 4XF9A 3A0HZ 1QOSA 1ULCA 4ZPIA 1J1LA 5FZLA 1YZBA 4V1PA 3VBRA 4DS0A 2XB6C 3F95A 1RUE3 2PAMA 4DR3B 2JDKA 4EB6B 1K3IA 1FXKA 2QDNA 2XNDG 3AFGA 4JRAA 3E2EA 4MZUA 4XMAA 3B2EE 3GHMA 1NKDA 4GB33 4LHSA 5FQ0B 1OVPA 2LRPA 2XG3A 4B3SO 2ATKC 4OUMA 3KKYA 1DGLA 4LA3A 2QQMA 3FUQA 3ELNA 2ZXWB 4GJZA 1D0HA 2Q0OC 2WSUA 1BCXA 4LWSA 3MLLA 3BVOA 2Y6GA 4I5SA 1FV3A 3G6JB 2E5LO 2YXSA 1W90A 4LPLA 5J37A 1LULA 2W87A 1NY71 1LGNA 3BEHA 4ZI7A 4D8MA 1BXHA 1Q8PA 4EROA 4IE0A 5FP7A 3K5OA 4KI5M 3JARB 3B02A 3DL3A 4RL7A 3E83A 3ZCCA 3MYXA 3OEEG 5A7WB 4RAIA 4JGYC 4XF1A 1FOD1 2W68A 4CSWA 1ZX3A 3H01A 3WINE 4HNAA 3THTA 2LO1A 4H55A 4PLMA 1PNFA 1IS3A 3N2GB 3SYAA 4KUMA 3CC7V 1JTZX 1KKCA 3AMNA 2WZR2 3KG2A 3ZMTA 2DW4A 4I50B 1ZX5A 3T2TA 1WA4A 2IUWA 2ETEA 4YFZA 2DU0A 3RQ0A 3IPVA 3POYA 5A1AA 3CDZB 4SLIA 2HEYF 1AJQA 2D6PA 2I07B 5IK7A 3MI8A 1W39A 5JVDA 3KS7A 1GQHA 3IMMA 1GWKA 4YSFA 1SLLA 4BB3A 3V0AA 3CE2A 5D8AA 3WW1A 3BN6A 5JOYA 2VC9A 3LIGA 3K04A 2Q5ZA 2OCHA 5FYUA 3LA7A 2C9AA 1X82A 4NHKA 3AP4A 3HMYA 3FC0A 3RDIA 4YM2A 3JYCA 5JCOA 4YZ4A 4XEZA 3ILFA 4J11A 2CUGA 2YEVA 1FJGO 1H8TC 3UK9A 2VMEA 4COZA 3L74H 2ZINA 2KA3A 4QX0A 2WRAA 5EQUA 2QA4V 2LROA 2AHZA 2JGDB 4NOTA 2I74A 4ZZ8A 4JQTA 3N2KA 4KL1A 1H6YA 3NQHA 1X59A 1R6NA 1ROPA 2WWWA 3JCUZ 4OZOA 1YCIA 3M7AA 4J7JA 1FMD1 5JMCA 4DV4B 4MH0E 2ZHLA 5FY5A 3X29B 3K51A 4LO8A 4O4LB 1BQ0A 1V6LA 1NR1A 1GMGA 1XMQB 1IBMO 2OYQA 4GWNA 4K3AA 5KUMA 1K45A 3DEMA 2BW8A 1DYKA 5F1RA 2ZGRA 5FZ6A 4BIFA 4ATFA 3AG4C 4TSVA 1RUH2 3MW2A 1JZ6A 2EXJA 2FCUA 4L0PA 2HWD3 4CU8A 1N0JA 2G38A 2BOIA 4XFHA 2DFCA 4LBKA 2YXLA 3JD71 4A6OA 3C3SA 4P9WA 2E31A 3PHMA 2PFWA 2YG0A 1SF9A 3VB9A 5JZGC 5L7OB 4GXLA 5BNNC 3ZSJA 1S0VA 4DV5B 3IMNA 4HETA 2DU1A 2E53A 4IL7A 1TME3 1ENVA 1WWYA 3B77A 4NXMB 2WO3A 5FOJB 5AFEA 5T55A 2VPVA 1GZTA 1AI7A 3VKLA 2ZIOA 4X65O 2VUCA 4A7KA 4DR6B 2TEPA 1NA1A 1MS9A 2GMPA 1OJHA 3WHTA 3KV9A 2UUCB 2W1QA 2OZ6A 4LFCB 2ET1A 4PBPA 2XDVA 4CU7A 3HN1A 4YJ2B 1GNZA 1UX6A 1W9YA 1Q3EA 3B8NA 2ZEXA 1YEWA 2RDNA 4CCLA 3PMEA 3RMYA 2XKOA 1JN2P 4K1ZA 2XGXA 1EY2A 3SPCA 4C7UA 2BQPA 4QPKA 4OZXA 4K20A 3RYFB 4GZ9A 4LKSA 1HQWA 4J9ZB 4YGCA 2UUBB 4MVTA 2D3SA 3SR2C 2WO1A 1FXKC 2MW2B 3RJRA 5L3GA 3OFNG 4IW3A 1US3A 3APOA 4TQFA 5FL7G 3GCWA 1FXHA 5IJ0B 4R9CA 5FWEA 1IBLB 2CSGA 4XF3A 4CCMA 2W1WA 4PF1A 3Q8CA 3JUUA 1RUC3 4FTEA 2VZTA 1Y4WA 5EBLC 1OH3A 2RR11 2WLQA 3TAYA 3ZMUA 4CUCA 2FCTA 2PHWA 1PV0A 2R041 2JIJA 4J41A 1DGWA 4JGYA 3E8GA 3SH5A 5DAVA 1AZDA 1H2KA 1P49A 5FZ3A 5A6YA 4LORA 2XASA 3G6BA 4YGDA 4O4IB 1YF2A 2BYVE 4OQ8A 4BHPA 1OLMA 4UW4A 4H13B 1MEC3 3R4DB 4HVRA 4Q2FA 4QB2A 3D4KA 5T5OA 5LEJA 4FAGA 3LSEA 3TXSA 1TMF3 1SLAA 4OFGA 1K5QA 1PK6C 2WSSG 1UYZA 1X4TA 5IAVA 4JI6B 1RSOA 2D3PA 2XQXA 4EN0A 1T6GC 4Y33A 3ZMZA 2VVEA 2E75B 4CCDA 3IDAA 2YFZA 2HWB3 4TLGA 4OHWA 1H8EG 4LK6A 3GVMA 3J8F1 1W2TA 1W9TA 4EKWA 3R65A 1B09A 2BV4A 1WLDA 3ZSKA 4LLFA 2X5IB 1BLZA 4OI4A 4WVWA 4J42A 1WP8A 5JCOC 3LDDA 3I8TA 2P06A 1G86A 3O0XA 4BQ5A 3EFFK 5FV3A 3DTUB 2BTQB 1RUH3 3BFRA 3S57A 3STZC 2UY9A 3ZYBA 4OX9O 1SLTA 5F5CA 1UWWA 2R1DA 1U97A 4LF6B 2WZPP 2JECA 2EILC 1R6TA 3ABUA 5JJNB 1UZYA 1N0NA 4GKYA 1AJPA 1QGLA 3GYDA 5LRSA 2OZJA 1GMMA 4MX3A 1K5MB 1V55B 4XAAA 3VD3A 4OUSA 4DFSA 1DBNA 3CB2A 2VOKA 1GZWB 2WFF1 2PYLA 4LOSA 4XZUG 3WP4A 1XNRB 5LW9A 4Q4Y2 3BIWE 2P2KA 3CCUV 2HWE3 4N9IA 5LA2A 2EXKA 2EIDA 4UVBA 1UU4A 1QCEA 1SA0B 4FFHA 3AXDA 5LMNO 5BNOB 4N23A 1GN6A 4MVUA 4PDWB 2WQ8A 2IJIA 5IVCA 1QU7A 2PQSA 1EUTA 3IWZA 1JMUB 1FX5A 4Y1XA 4B3MB 2D2CB 3GBFA 3FFZA 5FJKA 3CCVV 1IURA 1LNSA 1EP0A 4NRMA 3BA9A 4CEWB 1BHBA 2CTWA 1T2XA 1XU1A 1VQOV 4WM7A 5CKMA 2E7AA 1IQAA 4IEZA 2W3JA 5BV6A 5DUXA 4AVTA 3MIHA 3R4SA 4QPGA 4NAMA 5FKCA 4NHXA 3P32A 4FPKA 5K0UA 3S7IA 4I4TA 1O3TA 1W6MB 1JH5A 4ZY9A 4M3CE 3W7WA 4QGLA 1JZ4A 4IEVA 3ZYPA 5J36A 3O1PA 4UYBA 3U07A 1RUG2 2PF4E 3C7OA 4M00A 2WFF2 1CONA 1F35A 5LWBA 4DV3O 4BA6A 3NV1A 2XAQA 3RYCB 4OI1A 3ILRA 5KAFZ 4K8FA 3HQXA 2OXBA 2KR2A 4F6RB 3AYCA 1XE8A 2Q7HA 2P37A 4XTPA 1R3JC 2D6LX 3ZIXA 4NWWA 1FFTB 1ZLZA 3TOJA 4RFT0 2PHTA 1SQFA 2Q4SA 4X8AA 2B9VA 3RYHA 1D7PM 1DYOA 2QE7G 3HKDB 1QOOA 1PK6B 4FOWA 1UAIA 1SQPH 4QGMA 4WBBA 4ASKA 5JUVA 2CTPA 1GNHA 1QF3A 1XE0A 3VBHC 1GTOA 3L71H 5FZOA 2D93A 3CJIB 4NRPA 3RFRA 4K21A 1GNYA 5L9BA 1ZA4A 2WNUA 5A80A 5ANNA 2JGDA 1QVGU 4AILC 1YJLA 4DV0B 4CS2A 4YHHB 3BTZA 4XJZA 2VG9A 4RYDA 4QPIA 1DIWA 4QQOA 4QPYA 4NIDA 1COV1 5EXOA 1CZVA 4RGAA 5FZ7A 2VWJA 4EN7B 3JD3A 3OMAB 5LL6Y 3O1OA 1YQ2A 4CZZA 5FZMA 5E79Z 1KP3A 2ZDIA 4ZZ5A 3CF6E 2F23A 4O9GA 2LALA 4YZ2A 2JIZG 1L0LH 1RHI2 4DR1O 1UF2C 4QU2A 4S2HA 2N04A 2CNAA 1KEXA 3PJSK 5HXVA 1XMOO 3VD5A 2JICA 1MMMA 5DAWA 2F6BA 1LB2A 3DGEA 4E4DX 1VJ2A 3M8AA 3K5NA 3FYIB 1F4NA 1C3HA 3C2UA 1RUI1 4LO5B 4CUBA 1NKGA 3RYIB 4MSVA 4Y5Z0 5FO8B 1CWPA 3OD0A 3GZTB 4CDQA 4O4IA 5BR8O 3AVRA 4FTBA 4DR5B 3TN92 1AR92 2A7WA 2WABA 5LMUB 3AG2C 3H1IH 3EQEA 2XAGA 3BCWA 2HKOA 5A3PA 1JOPA 4BK4A 4ARYA 1ENRA 2VBPA 3V56A 1HJFA 1COV2 2ARHA 2OQ6A 3TJTA 4QNHB 4HK8A 1VQ4V 2ZGSA 3QTCA 1I6XA 3S5AA 2RS31 2DWEC 3GXUA 1AYM2 3G80A 5CBFA 3NNGA 2DCZA 2W9XA 1U0AA 3RYKA 1IKPA 3HEIA 3ZDVA 3GDBA 1S0JA 4CDWC 3TNQA 3ZN5A 1RUJ1 2GHYA 3RW0A 2QDRA 2QTWB 3J7AU 2ZGLA 5JR7B 3CMEV 4O2AB 2CH7A 4Z1VA 1B35B 3C8XA 4DIQA 4UI9L 3KVBA 3K0DA 2OA2A 1UN1A 2HWC3 1X7NA 2WS92 4WFGA 2W1UA 3OT7A 5LA9A 4A2UA 4O4HA 2QQKA 4Q4V3 2WAOA 2VECA 4TN7A 1RUD3 3S5QA 1NQDA 2UXBO 5FMCA 3ZFFC 1AYN1 3ZJZA 5DECA 2TBVA 1WW7A 4TXWA 4QIWF 1H4HA 1NA1C 3KGLA 4G27B 3KHBA 4QPIC 3TCUA 4AZZA 3DSQA 2A3QA 3A0BZ 2E26A 5BNPB 2NN4A 1WLCA 3WQ0A 1M57B 3NV4A 1HRI2 4GULA 3C7FA 4MGYE 4LO7A 4UBHA 3U4XA 4IV3A 3URFA 4JHTA 3CD6V 2XAFA 1YQ6A 2RM21 3ZHRA 1N4CA 4NXMO 1R1BA 4KFMA 1ORQC 2DWDC 4MADA 2FMYA 5LK7B 3E1F1 2R062 1F4MA 2BPA2 1OFNA 3JBG1 2ADEA 3MZHA 2P3IA 4NIGA 3QNEA 4IHJB 5GM0A 1LU2A 4OQ9A 4IYHA 2Y4UA 4DV4O 3C7EA 4DR6O 4RFRB 5FZ4A 3E8FA 2GZWA 3GJAA 4C0HA 3JQXA 4DXSA 3VKFC 1RUD1 4IHJA 2EJ7A 4CH5A 1WPBA 3B8MA 5IWAO 2DCTA 5EYXA 4LR3A 1QJX3 2FZ2A 4Y20A 4HG6B 4AVVA 1VBA1 1NG0A 1OF3A 4G9SB 1YNAA 4XCBA 3RYRA 1BT8A 4OHXA 4JGZC 2MNGA 1CPYA 5FZFA 2XLAA 2TNFA 1OUSA 5FZEA 2ZZQA 2FDIA 1XNAA 1LECA 1M56B 5D1IA 3WG7C 5BUVA 1QIQA 4P9JA 3VDDA 4YW6A 4YZ1A 5JLVA 3ZXAC 2E3CA 5ACA1 3MF6A 4X6QB 3KF5A 5FZBA 4BXFA 4ICGA 1AXKA 3WQ7A 5C7GA 2Q68A 3AKSA 5GZCA 3KZIZ 1RPRA 1TME1 4XIKA 2ZT9B 4JZRA 2XTAA 4LF8O 2W46A 4CE8A 2ZEYA 2R16A 2ZX1A 1BK1A 3GALA 5LYJA 2HYXA 2C24A 2BZDA 4CDWA 1UMHA 4Y3OA 2A3WA 5LMNB 1S2EA 2CH7B 4I0XB 1JYWA 1OH4A 1QWRA 2V72A 1UL9A 5K0UB 4XHXA 2QUOA 3ETPA 3WUDA 2VQ0A 2IXLA 4JZGA 3H0OA 3CU7A 2HWF1 1MZFA 3E8BA 3ZRSA 4I0XA 2NMOA 3IC7A 1SPPA 2YB7A 4B4RA 3NNFA 4XTMA 1ZBA1 1DQ6A 2ZXWC 3MDSA 1XNCA 4LF6O 2VD7A 4FXGB 4ZXKA 3L75H 1OKOA 2YGMA 1D4M3 3RYCA 3AYEA 3JCZA 3WP3A 1QQP1 3OUFA 5IT6A 4GMP0 1JZ5A 2YXYA 1IBLO 5B66Z 1POV0 2Y48A 1XPWA 1GKFA 2VS0A 2P90A 3WNNA 3ZXEA 5CISA 3POSA 1PO21 4GH4A 2B9ZA 1Y9QA 2JD9A 2P4VA 4IV3C 3RWKX 4LNUB 1W8NA 2AZ0A 3IZOA 4I9WA 3ZM8A 3W58A 3ALQA 2TUNA 1XNQB 1FNZA 2WLNA 1WCQA 4UCRA 4NUBA 5GLZA 4ZOLA 2YIAA 2PHXA 4HSJA 1PGW2 3NAPA 5L7OA 2Z5WA 1JYCA 1VF6A 1SDWA 3IDCB 3WLUA 1TVGA 1N36B 4JAUA 2HWB1 2DUOA 3SJCC 3SISA 2VUDA 2L35A 3AG3B 4CC6A 2HJIA 1N32B 2JJ6A 5IK4A 5FKBA 4AR2A 5FPOA 1MR5A 4XFFA 5HPOA 5FXVA 1JFFB 3TETA 3UGFA 5BYNA 2XH6A 5EK0A 5L3EA 5LP6B 2QKAA 5DZFA 1EN5A 5A6XA 4EJRA 3I2FA 1NA1B 3O1TA 3R66A 2WJSA 2XJUA 3RZLA 3EHBB 1NT0A 4I9QA 4QAWA 4KWKA 2K0GA 1WAZA 4N21A 1AROP 1S5LZ 2OTJV 2HEPA 4NPMA 4MGIE 4ONUA 1ZUQA 1CPMA 2WLMA 1QQP2 3ZIWA 2PGGA 4AEDB 2J1VA 4GA9A 1K5JA 4ORFA 5T54A 1GM8A 1BSMA 1PM9A 1K5MA 3I2JA 4LH7A 2QM8A 5KBFA 4JTCB 1YHQV 3I59B 2ZXQA 4QQHA 1RUC2 3AVSA 4QXHA 4E2LA 3ES1A 1NCRC 1K9MW 4PT6A 1K12A 4DRRA 4LFAB 3IAPA 5EC2C 1LGCA 4LXLA 2A6YA 2F66C 1W3XA 5KX5A 3RGBA 2BNOA 1UFIA 3WDYA 2HR3A 4DINB 1P84F 4ZKTB 1K5SA 4TSFG 2RV9A 2HG5C 2A75A 2P3YA 1DF4A 3BB6A 3ACGA 1H2LA 2OX0A 5CFDC 2WLIB 4OGQB 1CEZA 3NJYA 2EXHA 4Q8KA 4BM8A 4BQ2A 4LR4A 2VTXJ 1W03A 1QDCA 1GOHA 3DYPA 1KYOF 3UT5A 2MEV3 1GBGA 4NXNO 3AP9A 1ZRDA 5KXBA 3U11A 4NTXA 5LBBA 1CD3G 2DYRB 1CQ9A 3CRQA 5LOVA 4DV0O 3POIA 4DZGA 1O91A 5C8WA 5KLVH 2PAEA 3ETEA 3H8UA 1WLWA 5IYZB 5F2VO 3CRCA 2HEWF 4WV8A 3VZNA 5FLIA 1Z7S3 1H2MA 1YYNA 4QX1A 4NPRA 3GZEA 5FK8A 4ET7A 5DUWA 2VR4A 5CB4B 3ZMVA 2BBVA 5HCBA 1AR82 2VQAA 4JI8O 5LBCA 4CEWA 3SDLA 1C4RA 4DW1A 5LY2A 1F5FA 3GCXA 2WNOA 2FDJA 3MO4A 5F5AA 1RB8G 3I97A 2PXJA 2BVBA 2ATFA 3BI3A 4GQ7A 4QX2A 4AOCA 2CWMA 1REFA 3ZFFB 1ZZ7A 5IWFA 3UKTA 4LLOA 3SYQA 3A23A 2Q8CA 4C90A 2JKBA 3WP6A 4RHV3 4DUVA 1HRI3 1J83A 4NHMA 3SJAC 4MG2A 4N43A 4KU7A 1XQ8A 1MS3A 3TXQA 1XJAA 4DV2O 4BQWA 4XFCA 5C33A 4IESA 5K1XA 5H9RA 2YU2A 3SITA 1PGL1 3ZBHA 1OQDA 1MS5A 4MGQA 4DR4B 1VBB1 1OD5A 4ISQA 1LOAA 3MHSC 4WF9V 4UV9A 4N43B 2Q1ZB 4JI3B 5C9AC 3VZJA 1DQ1A 3Q4HB 2Y60A 3GBWA 3C90A 1NCQB 4P2ZA 1VBC1 1R081 5CFCA 1M9NA 3HIFA 5LP6A 1MQTA 2L9LA 2W5FA 3SPJA 2ZTNA 5JSRA 3M3OA 2DTYA 2AC1A 1PZ7A 5DEDA 1WMXA 3SPIA 3OPTA 3IT8A 4PBOA 4X1IB 3KGZA 3VD4A 5KHGA 3KZ4C 5KR7A 1VBD1 4Q4V2 1NZCA 2QZ2A 2BSKA 1SZBA 5CG9A 1Q6IA 5L19A 4FQZA 1GKBA 4NIAA 3D3IA 4O61A 3ZSMA 2ODMA 4A45A 4FPEA 5GONA 1YFYA 2BVVA 5IWAB 1Q8QA 1VQ7V 1XNRO 3AK2A 4C1XA 1A6CA 4J9YB 1GRJA 5FY8A 3ZO0B 1WA8B 5GW7A 2A3YA 3CRRA 5DZGA 3AYDA 5FK7A 5LHHA 3VBOA 3MFCA 1SKVA 3FKSG 3ZHSA 4AI2A 1VBA3 1RUH1 1H6XA 2FDKA 5IVBA 2LGWA 5LCWL 1R082 1US6A 5CAZA 3BABA 5GLWA 1AL22 3QH7A 4NHLA 2H8PC 4R9AA 4M3CA 1HDKA 3AP5A 1BBT1 2PHLA 4L87A 3ZSLA 1Q6HA 1JBCA 3I56V 1L3JA 5J09A 4I3PA 3RYIA 4FLVA 4HVOA 3T0AA 3OTOB 1VQPV 1OKQA 1V9U1 1JI6A 5T3NA 2QQNA 1HQNA 1VBD2 4MLOA 1MS1A 1W0KG 4PDVA 1H1AA 2EIJB 1ND2B 3MIFA 4TV9B 2ZDIC 4KGGA 2JB4A 5T5PA 1KC8W 4CDXC 5FRAA 2QTOA 4MTGA 1UOBA 1PHMA 3ZFEC 1FV2A 2XJRA 3MIGA 4XF0A 1TZOA 3S0MA 4LBOA 2EILB 3B7MA 1R6KA 4LNVA 1S0DA 4Q27A 1CAWA 1V54C 5A32B 4IIJA 1RUE2 2BBAA 1XNDA 3OUHA 5J2UA 3FBMA 3T09A 3VBHA 3T4ZA 1H30A 4CXXA 4I0AA 2GNMA 4CXWA 2FL4A 4DV1O 2EINB 2W1SA 2VZVA 4GYCB 1D0GA 5FYTA 1QJFA 4XXPA 4O2AA 3KD4A 1JHJA 2D6OX 3ACLA 4QQLA 1E5HA 2Q8EA 1NYWA 4YVWC 1MA1A 4W65A 2BU9A 2DVGA 2OYZA 2JEMA 1BBT2 1YLLA 1QJU2 4K0KO 3E6DA 5JVVA 4P9LA 2D40A 4ZIBA 2HYKA 3T1LA 3ENRA 2HHHB 2VNVA 1DG6A 2ZQMA 3ZRXA 1RUF3 4O9EA 1GZWA 4AI8A 1ST8A 2X05A 3WF1A 1UYYA 5EJ1B 3RYPA 2KM2A 1ZWIC 5B1BC 2UXDB 1RVF1 1F51A 3LDEA 2OPKA 4PQQA 2JENA 2ARBA 1QJEA 3MFAA 4QHZA 2BDRA 2WN3A 3WG1A 3T3YA 2XVLA 3AK0A 2RQ6A 5FOBB 3B94A 3NAPB 1ZZBA 1AILA 5EV7A 4D3WA 1W2AX 1S55A 3MD0A 4XMIA 2W52A 2RS11 4XDLA 2LFRA 3OGJA 2ILMA 5IFPA 3H1YA 3JU9A 1YI2V 3VHNA 1KXGA 3POJA 1ULOA 1UPSA 3DN7A 2HBTA 2Q7EA 1SHWB 3BYWA 2W92A 4JI4B 1XYOA 1CIWA 3IAYA 1LEDA 2ET7A 5B1AB 3MHZA 4ZU5A 4A42A 2WINB 2JB8A 1V6NA 5IJRA 4MHUA 2DE0X 1GOGA 1M4WA 1RUOA 3O65A 3N4MA 4X66O 3PTRB 3V64A 1NUKA 3O1VA 2AR6A 3POEA 1KUQA 5FPRA 4NTYA 4IUGA 1DGRN 3H8XA 2OUJA 4YGBA 2AXTZ 4AQ2A 2HP8A 5IVFA 2JWPA 1ASJ3 2V4DA 4LFBB 1DHKB 3N36A 4Y1VA 2RS52 3KVAA 3WP5A 3PIJA 3O14A 2GV9A 1Y9GA 4CP1A 1HB3A 1UQXA 1ULPA 1Y67A 2XJPA 1JJ2U 3U1XA 4B8EA 1OCRB 1Y76A 1KFXL 3QF7A 3DC5A 4XUTA 3ZFGB 3ASIA 2UU9B 1W8HA 1QNYA 4Q4Y3 4X66B 1HB2A 3H9AA 1H1MA 1C1LA 4YW7A 2RM23 4RGGA 4K9SA 1W9SA 3T1YO 1GP4A 4MTOA 2D5FA 2QQUA 1KBHA 2FKXA 3W20A 5FR3A 1M06G 2ZE8A 3JD1A 4G2KA 4X1YA 2CTRA 1J3RA 1AL23 4CDUA 4YLZA 2DVAA 2QE3A 5A32A 4YG3A 3FLRA 4IDZA 3B9IA 1MQTC 3LEKA 4CUAA 3PUHA 5DDJ2 5FMOS 1PZ8A 3CMAV 3FD9A 1Z5WA 2WBKA 4CP9B 1VEWA 4Q29A 2VOXA 1EFRG 5A1LA 2C5DA 5C4WC 3R4UA 5HV4A 3SC7X 3PL0A 5A7NA 3PVBB 5IATA 2CGPA 3NKTA 4LWSB 5E8AA 5B4NA 1UY2A 1U12A 3WT3A 2RS51 2ZHNA 3JAWA 4PHZA 1DP0A 4QX3A 1SA0A 4WVMA 3MICA 1LHNA 1SFPA 3GZUC 1NTZH 4AI0A 2A6WA 3JD0A 1EV13 4JAAA 4HLTA 3TNPB 4YGEA 1VF5B 4HBNA 5DMYA 1XUQA 3QCWA 3GB7C 4JI6O 4J1XA 1O3SA 2OKXA 5JDBA 4DW0A 1BL8A 5JPMB 1TUBB 4TLFA 5LA6B 1KP2A 2UYAA 2ENRA 2CGNA 2VQEO 2O8QA 1FYUA 1KS5A 1YQ8A 2WPDG 3HNBM 4D7YA 2Y6FA 3O0WA 1DGSA