3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
4BYYA 3NJZA 1ZREA 3ETQA 3KGLA 4FT8A 3VHRA 4IEOA 3DV8A 2QDRA 4PJYA 4XF4A 4MZUA 3KCCA 2QNKA 1FI2A 4PIYA 4EWEA 1GQHA 3EHKA 2CGPA 3TNQA 3RYRA 1Q5OA 1ZRCA 2PFWA 3RZZA 5JSPA 1ZVFA 4EV0A 2QVSB 1RGSA 2EA7A 4QX5A 5FQ0A 4AVCA 1ZZ8A 3E6BA 5I0UA 1YLLA 1EY2A 4OFGA 4QM8A 1J59A 3MZHA 4PIZA 3S7EA 3BU7A 2HKXA 4JVAA 3C3VA 3H9AA 1YUDA 3SMHA 3NL1A 2ET7A 2Z2SB 3EQEA 3FWEA 4QXKA 5E16A 4YSFA 3EBRA 5BY5A 1J3QA 4WVZA 5FQ0B 5AVPA 1NE6A 5KHGA 1NYWA 1H1MA 3I59A 3TNPB 1X8MA 3NW4A 1EPZA 2GC0A 1YFWA 1IPKA 4L11A 4ONUA 4UBHA 1J58A 4X6QB 4KWJA 4AQ6A 3NVCA 3HQXA 5LRSA 2MNGA 1OD5A 4IETA 1LRHA 3RPQA 2F4PA 4I02A 2KXLA 4MGKE 2K0GA 3ZDSA 3H3ZA 4LUKA 4LULA 3GBFA 2BNOA 1GQGA 1XE7A 3N4MA 3RNSA 4ZU7A 4NVPA 5FPXA 5KBFA 4L2NA 1SEFA 4GULA 3H1WA 4YARA 2DCTA 1TQ5A 4LEJA 3L2HA 5EFUA 3SCFA 4IEWA 4IESA 3KGZA 1LB2A 2QCSB 3ACLA 5K8SA 2PA7A 2GU9A 4HSLA 5BUVA 1EYBA 3PNAA 2XGXA 2XL9A 2IXHA 4IEYA 4Q0SA 4HMZA 1ZRDA 3MYXA 5FPZA 2ZCWA 1U12A 1ZRRA 3ROUA 5I8YA 4KWKA 2D5HA 2Y0OA 4JTNA 5JR7B 1VJ2A 1UD1A 4MH0E 3WW4A 3ES1A 5I0SA 1X8EA 1J3RA 1RC6A 2FMYA 4ORFA 1NXMA 4R52A 5D1IA 1XRUA 2FQPA 2WC2A 5I93A 2ET1A 1V70A 2GC1A 4LUMA 3NSTA 1Y3TA 4IEQA 1HW5A 2CAVA 1QY4A 3G7DA 3IDCB 2GC2A 4JV4A 5EZWA 2B5HA 5I0TA 3OF1A 4O9GA 3CF6E 2Q1ZB 4HLTA 2OZJA 3IWZA 5F1RA 5E1RA 2PYTA 4WZCA 2PAKA 4KU7A 1QWRA 4QGNA 2WFPA 1FT9A 1CGPA 3DL3A 2BNMA 2IXCA 2UYBA 1JUHA 5LEJA 1ZZ6A 5KHJA 3H1YA 3OCPA 3LA7A 2D93A 1OI6A 2EVXA 1ZZ9A 5JSOA 3FZ3A 2I45A 3OD0A 3QACA 4BHPA 3S0MA 2XLGA 2Q4SA 4HVOA 1YHFA 4X6RB 3LOIA 3M70A 2UY8A 1YFYA 5BPXA 4P9GA 4IEVA 5JAXA 1CAXA 4YYOA 1RTVA 1UCXA 4AVAA 4F7ZA 4LLOA 1NZCA 2QJVA 3RYKA 4MGIE 4IERA 2EAAA 3E5UA 4XF1A 3E5QA 4OLLA 4HVQA 1J1LA 2K9ZA 3B02A 3WW2A 2O1QA 2BNNA 1CAUA 3MDPA 3U10A 4J1XA 3PVBB 5I91A 3LA2A 2D40A 3CL1A 3SCHA 2Q0AA 4XFBA 1UIKA 2IXKA 1CAXB 2UY9A 3H3UA 5BXXA 5J48A 2H6CA 1CAWA 2IXJA 4XFCA 3SCGA 4AQ2A 5LRRA 1O4TA 3I59B 2IXIA 4MX3A 3IBMA 4WBBA 2OYZA 1YWKA 4AXOA 2H6BA 4FAHA 2PQQA 3LWCA 1RL3A 4META 3S7IA 4BH9A 3DN7A 5LEKA 1O3TA 3I54A 3PLQA 3IIAA 5KHKA 3U11A 4ZU5A 2XL7A 1DGRA 2ETEA 1LKNA 2IC1A 1CAWB 5FLHA 4N9IA 4D7SA 3CLPA 3LZZA 4Q0QA 4EWAA 1UIJA 3H50A 4XF3A 4I3PA 4XFIA 4HN1A 4F8AA 3FX3A 1O3QA 2BEOA 4CYDA 1WGPA 2ZKLA 4H7LA 4BIFA 4E2SA 4FBFA 1ZNPA 4MGZE 1CAVA 2GZWA 4D7TA 4RD7A 1QXJA 2ATFA 4IEUA 4N9HA 3ST7A 3BCWA 1OFNA 3ELNA 3UKTA 1QXRA 4XFGA 3LA3A 4HVRA 2XKPA 2GAUA 4Q0UA 3E6DA 3WW1A 1ZZBA 2XHKA 4LA3A 2C0ZA 4LTAA 1VR3A 3HT2A 3MPBA 4I01A 2XKOA 1X82A 5FLIA 3H7YA 4QM9A 1ZRFA 3E97A 5FCCA 3RYPA 1VP6A 3H8UA 1CAVB 2B8MA 1UPIA 2PAEA 1I5ZA 4MGYE 2VPVA 4ZU4A 3EJKA 4XEZA 3R6SA 1O3RA 3BALA 2PHDA 4R8HA 4AVBA 2D5FA 4FAGA 1Q3EA 1PMIA 2PTMA 1YFUA 2Q30A 4EROA 1WLTA 5T3NA 1RUNA 3SXWA 4HBNA 3CEWA 4QGMA 4IEPA 3USSA 2MHFA 5C8WA 3CO2A 1SQ4A 1J3PA 1RUOA 3I7DA 4I0BA 4LA2A 2IXLA 3KMHA 4A2UA 1G6NA 1H1IA 4JTOA 1O5LA 2XLFA 4XFHA 4IEZA 4EWDA 2OPKA 2OZ6A 4Q0VA 4DINB 3CJXA 4QMAA 2PAMA 3LAGA 3EO6A 3KSCA 3ES4A 5J7MA 1XE8A 3D0JA 3FFQA 3BPZA 1Q43A 4Q29A 3JZVA 2O8QA 1SFNA 2CV6A 3HT1A 5JSRA 5CADA 5FDBA 2P17A 4TLFA 3OGJA 1UW8A 3BB6A 2VECA 2GC3A 1FXZA 4XETA 1DZTA 4YRDA 2B9UA 3DKWA 1YFXA 2Z69A 3IDBB 5FLJA 1ZZ7A 1EP0A 1DZRA 1I6XA 3D0SA 1O3SA 3FE5A 4QGLA 3GYDA 4XF0A 1X7NA 2H0VA 5J3UA 3O14A 4Q0PA 1CAUB 2UYAA 2BGCA 3HIFA 3SHRA 4I09A 4MUVA 5KHIA 4I0AA 4IEXA 5CVRA 4K8FA 4XFFA 3D82A 1IPJA 4HZFA 2V09A 2HJIA 1WA4A 5C6CA 1L3JA 4I2OA 3NKTA 5KHHA 2VQAA 5HI0A 1ZZCA 2GH2A 4KL1A 3RDIA 5I8TA 5I8SA 1CX4A 1DGWA 4HSJA 3H1MA 4HN0A 4J1WA 4YNIA 1ZX5A 2MPFA 4PIXA 4UXAA 3UKNA 2E9QA 3M3IA 2BYVE 3U0ZA 5CU1A 1PM7A 3QOPA 5JCTA 3OTFA 2PHLA 1O5UA 4UBGA 4XF9A 4Z07A 5I0RA 1LR5A 4KWLA 3E5XA 1O7FA 3FHIB 2CAUA 4Z82A 2XLAA 4MV2A 3UKVA 4B29A 4E2QA 3FJSA 4O9EA 4E2GA 2N7GA 3E6CC 2OA2A 4KU8A 1OMIA 3WW3A 3H7JA 5BV6A 1NE4A 4XFAA 1Y9QA
chains in the Genus database with same CATH superfamily
1JXNA 1YEWA 1BMV2 1EFRG 3JSLA 4JI1O 2WZEA 5HXMA 3DXTA 1PKXA 1EAH2 1RUD1 2VVFA 1AJQA 1SACA 4ICGA 3OBZA 4JASA 3GWOA 4W6YA 2CGPA 2A06H 3TNQA 1D2DA 3A0HZ 1JHJA 2QTSA 2YZ4A 3RZZA 1L7RA 3WQBA 4LF6B 4O4LA 2QVSB 4AAXA 1V55B 5FQ0A 4Y5SA 2DE0X 4JF3A 5FY5A 3WFVA 1OOPB 1J59A 5IYZA 2VNVA 3CZJA 1ENVA 3NL1A 4QE9A 2ET7A 1H8EG 4A6SA 3KKYA 3JAKA 4WVZA 4XBQA 2B39A 5GZGA 2QR4A 1X8MA 2F93B 5DPNA 5IVYA 3JCUZ 1H4GA 1FMD3 4I02A 3I3DA 3H3ZA 2JE8A 2XVLA 3K08A 1DQ5A 5L3DA 1XNRO 1DP0A 4FFGA 5DAPA 1TQ5A 3Q8BA 2A6WA 4N8MA 3WDWA 3B7MA 1BBT2 4CCJA 3LF7A 5CA1B 2ZHKA 4NRPA 2XL9A 5LHIA 3AYCA 3E1F1 4Q0SA 4CCOA 3GB7C 4LMFA 3VBRB 4GJYA 4EN8B 4FOQA 5B5EZ 4FLYA 3VLBB 4MADA 3TEWA 1QJY2 2IM9A 5JQGA 4O4HA 2WO7A 4PBOA 4MXWA 3SPCA 1YJ9V 5J98B 4P02B 4E4DX 2HWE3 3A7QA 4LFAO 1V70A 1PX4A 4BCUA 1HW5A 2CAVA 2RJLA 2Y38A 1QY4A 3S57A 3JB8A 5FZLA 5LGUA 2AZ5A 4JV4A 4D6RA 3LDBA 3CF6E 2BZDA 3HN1A 2RMU1 1YNAA 1FXKA 4UCSA 1O4YA 3PUIA 1L7LA 3LGRA 4TOIA 3MBWA 1FPOA 4CRQA 1F4AA 2XBO3 1XB9A 1R73A 1VBC3 4J25A 4I55A 5FMBA 2HLDG 3KV6A 5ABJB 5L7OC 3ZN6A 2ZR3A 1XMQB 4YM2A 4HL0A 1S0GA 4BJ0A 3IGAC 3DYPA 3I3EA 1UOGA 3AK0A 2ZX2A 4Q4W2 1S0EA 1VF5B 5JI9A 3ASIA 5LW9A 1YF2A 1OCCC 4YW6A 3WW2A 3MDPA 1PNLA 3RYFA 3ZXKA 4MW8A 2D40A 3H8OA 1DF4A 3CL1A 4D8MA 5CZKA 1W6OB 4IV3A 5LY1A 5EBMC 1ZLZA 3OTOO 1SMVA 1DQ2A 5BXXA 2ZBJA 4OI1A 3K06A 1YRZA 4MTFA 1CAWA 3ZIWA 3I97A 5LRRA 1NY72 1S0JA 2IXIA 1JZ6A 4ASMB 2GNMA 3AKSA 4X8NA 4Z1MG 2ZE8A 3MLKA 4ZZ5A 2ZDIA 2FMLA 3ZPYA 4MXVA 1Y66A 4ZU5A 3I2IA 1W9YA 2IC1A 3FX7A 4GX0A 4AZZA 2YC2A 1POQA 1QNWA 4CTEA 3T1YO 4LHLA 1MQTC 2RCVA 2HBTA 3AP9A 1DLLA 1AHSA 1BVP1 5KMGA 3JAMN 1B35A 1FXHA 1URFA 1C5IA 1G9DA 4BOWA 4CUGA 4XFGA 3LA3A 5C9AC 4GWIA 1YI7A 5K4LA 4BWOA 2P3IA 3MFAA 2HR3A 2P2KA 1EPWA 2QQPA 3ZRSA 1NR1A 4GALA 4JHZA 5A80A 5DAQA 2Y64A 3RYPA 1VP6A 4I50B 2B8MA 3M3OA 1SKVA 4WF9V 1VBA2 4AWDA 3PHMA 3J9SA 3OT7A 4J80A 2RV9A 4LO6B 4ZI7A 5FYIA 2DCZA 4A3ZA 1OUXA 5D21A 3C8XA 4LORA 4E4HA 4PQQA 4FIPC 4UFJA 3OOXA 3CJXA 4E27A 4QU1A 3KSCA 3DPRB 1B09A 5KX5A 1ZL8B 1QDCA 2VQEB 4AGRA 1W0OA 1NA1A 1EP0A 4JDMA 4L87A 1QF3A 4C1XA 1VB4A 3OUSA 4FTBA 4QE7A 4GH4C 5IVCA 4NHKA 4GMP1 4NXMO 1CAUB 5JCOA 2RS13 2ZMLA 4GZ9A 2EXHA 2LP7A 2BFUL 4I0AA 4IEXA 4BR6A 3ZHUA 2CTVA 2ZM6O 2WYSA 1V54B 5JMOA 2R1BA 3PIGA 4UYBA 4QPGA 4R6ZA 4LKEA 4LE4A 3A0KA 1ORQC 4LBNA 3CS5A 3RDIA 3RMXA 4BQ2A 1RJ8A 1NKDA 1RUJ1 1ZX5A 3GHNA 4QXBA 1W8UA 3RJRA 3AYDA 2D98A 3I55V 5JDBA 1OCOC 2YROA 3AMQA 1JJOA 3FUOA 3W21A 1AR73 4COVA 3BN6A 3I8TA 1DU3D 1PHMA 1EAH1 5T52A 3LOBA 5B3SC 4QDQA 3FJSA 3K59A 2TBVA 2PXJA 2RJZA 1MVQA 2VL4A 2XHBA 1VB2A 2EX3A 1IQAA 4Q4X2 4COUA 3AK1A 5IK5A 3QTCA 2UXNA 4AEDC 4FT8A 3WNKA 1FV3A 1ZBE2 2RVAA 2DVDA 2QDRA 2RS51 5GLTA 2BQPA 1ND2B 4GIQA 1UYZA 3ZR5A 3JATA 3CMGA 2Y0IA 4IE5A 1SLBA 3AG1B 2XQRA 1QJFA 2UXBB 4EV0A 2D6PA 4Q4Y2 5EXOA 2D6NA 4YJ2A 5I0UA 4X8AA 3H8RA 3WVJA 4QM8A 1AYM3 3ZN4A 3J80N 4Y5TA 4JGSA 2VZPA 4X9QA 5DZFA 3DYOA 1JYCA 3Q9OA 4R50A 3K4DA 5E16A 1L1FA 5BY5A 3THCA 2R49A 1N34B 2Y6HA 2MEV3 3UT5A 4FQZA 3RPQA 1IBMO 1I5XA 4JI0O 2Q7HA 4WBNB 1ASJ1 2FDGA 5LGTA 4JI4B 2EIJC 1F5JA 1X36A 5L73A 1SEFA 3F5WC 3T4ZA 3L2HA 1LNSA 1QJY1 5M0TA 4W4ZA 5BZBA 4K6BA 1GKBA 5EC2C 4OXSA 2CWMA 1EYBA 2AACA 4F83A 2VUDA 1KB9F 3RI8A 2CDOA 4PI0A 2HYKA 4PDLA 3ACFA 3TK1A 1VJ2A 4X88A 1UD1A 2Z42A 4JC1A 3ES1A 1ACCA 3WU2Z 1PK6B 1J3RA 1W6PA 5CFDA 5F6KA 3H0OA 2WC2A 3PUAA 2QWRB 1RSOA 3Q4HB 3C7GA 1D0GA 1D7PM 3MO4A 4DK1A 5FBZA 1H2GA 1ODNA 3EMRA 4XHBA 1NCRA 1R64A 5E1RA 4YG3A 4LKDA 5FWJA 2V72A 2R041 2X0LA 5JOZA 2ARCA 1MOFA 4W6WA 5K7PA 4W6XA 3PMSA 1G7YA 1XBFA 3PU8A 3VD9A 5LA2A 3T09A 3FZ3A 1C3HA 4Q4W1 1YI9A 2E7QA 2ZNJA 1UOBA 2YU2A 3BVOA 3SYQA 1X9TA 1SZTA 4L8JA 4ZBMA 3H8XA 4F6RB 4UW5A 5EWSA 3RMYA 1COV2 4HVQA 1ODMA 1Q8VA 3VD5A 3B40A 5A2QN 1YIPA 5FPLA 5BY1A 1H2KA 2E75B 4JYCA 2Q8CA 2VQTA 2ZXWC 1W8FA 1Y9GA 3KT1A 4B3TO 3ZSMA 2BUKA 3SCGA 1VQ8V 3ABLC 3ON7A 3MIGA 3MD0A 2WN3A 4GCZA 4AXOA 2Q8VA 4X65O 1DLCA 1WPXA 3LUTB 3I54A 5FYZA 2Y0PA 3ATGA 4DYLA 1XC6A 2PQSA 3ABTA 5IW0A 3O5SA 4Y1YA 4FM1A 4DR4O 4XJAA 1C8M2 4QT6A 5GW7A 4BQ5A 3CDZB 4DS0A 4XFIA 4N23A 1QNMA 4BQ4A 2LO1A 2AH2A 2BEOA 2WT1A 5FYVA 1XILA 1ZNPA 3ABUA 1W06A 1N36O 2WN2A 3ST7A 1G9FA 2VZ3A 1VBA1 2YYOA 2CTRA 4XUPA 4CUBA 4CDQA 2GAUA 4D0QA 1ULEA 1UXZA 4HKLA 3A22A 2RG4A 1P49A 5JJEB 1GP5A 1ZRFA 4PV1B 3ECQA 2VU9A 3GM8A 2FD8A 5H6RA 2RS32 2VZUA 3IIIA 4ZU4A 1R083 3DSQA 3VUOA 3GZAA 2P4VA 5T3NA 1JYVA 1XQ8A 4E4SA 4OI2A 3S6PA 4TXWA 5I0DA 4RUFA 3MV11 4A6OA 4NHYA 1F2NA 1YO8A 3L75H 2A1XA 1O5LA 4UFHA 1XNCA 1V6JA 1MS9A 4PLOA 4KP4A 3D0JA 1K7DA 4Q29A 4J41A 1W9TA 2CV6A 1DTOA 4NO4A 4D6TH 4K1YA 4YZ3A 1K5QA 3DKWA 4L0PA 1M06G 4JKMA 4ATFA 1V00A 3A2FA 1FJGB 2H0VA 3O14A 4FLZA 4P5YA 3HIFA 4DUWA 1EV12 5BNPC 1ENRA 5CKQA 1STMA 4XTPA 1IPJA 2V09A 4QPWA 3HB3B 1WW5A 3OBAA 2DWDC 3B5LB 4I0XA 1ZZCA 3H1LH 4KXRA 3GJAA 2FCVA 4W4KA 2VZRA 5EP9A 4J1WA 4AQYB 4DUZO 4TYSA 3K4AA 4HXCA 1YYNA 5FTTC 4CP1A 2BTQB 3TAYA 2LQTA 1M93A 3JBG1 1ZBA2 4XUTA 5JVVA 3VDDA 3IPVA 2HEPA 3VBFC 3WCRA 3K5LA 4AF9A 4FM2A 1SFPA 3J26N 2WS93 1DFQA 3TXQA 4LWSB 3K3NA 4E2LA 1Y43B 3LIHA 5LP6B 1FKAO 2WLHA 4GJZA 3HKBB 4Q4Y1 4UV8A 5CN0A 2Q69A 1I5PA 3V64A 3J7NA 2JIJA 1AX2A 4TUYB 1AJNA 4B1LA 1AR82 2JG8B 2WLJA 4GKJB 5LK5A 2KSDA 5BNNB 2JG9A 4R4ZA 3J7HA 3WT3A 3M3QA 5JVDA 1IS3A 3R4DB 2PN5A 2OQ6A 1U5IA 3QH7A 4V2VA 5AC92 1VLNA 2ZNIA 2PI4A 5SV8A 3N2GA 3JD2A 3SEEA 3EBRA 5HCAA 1PMHX 5KHGA 1DCSA 4DR5B 3NW4A 2GC0A 1IPKA 3SITA 5LGNA 4KWJA 3AX4A 4S2FA 3ZMOA 2WS91 4XURA 1SFYA 1NLSA 1LODA 2BNOA 4QB6A 3R4UA 2ARAA 5FYBA 1VQOV 5B4NA 3ASOB 5DUWA 2ZZQA 2HLEA 3QO5A 4INDA 4DOUA 3E8GA 3JAWB 3JCZA 4EZHA 3G6JB 5C8YA 1JZ2A 4P9XA 4QKFA 1FYJA 1NLQA 5JOYA 5CFCB 1NXMA 5D1IA 1XYOA 2C26A 2VR4A 2YIDA 3B01A 2N04A 4YXWG 2WJSA 5FZOA 4R9BA 5A7OA 4O2AA 2GBOA 4AR2A 3LDDA 4JAAA 2OZJA 2CWSA 5F1RA 3IMNA 3H3LA 1F35A 2HWF2 1NVPD 1EZVH 2BBAA 5F2SA 1O6UA 3T1HB 2JDKA 2UYBA 1AJKA 4YGEA 5FFOC 3BAAA 4LF5O 3LFMA 1JU4A 1JOPA 2YICA 4TV8B 3OD0A 1COV1 3KLSA 4X6RB 4XXAA 4XCBA 3THTA 2AEYA 1F4HA 2W1UA 1TVKB 2X05A 3WUCA 1URXA 5FUIA 4AVAA 4PA4A 5FZ6A 2QGNA 1FFXB 4PA3A 1RUH2 3E5UA 3ML0A 2VY0A 2B5UA 4TWKA 3MV01 3OEEG 3PVBB 3WNOA 3UK9A 1M1KW 3CQOA 4O65A 5FJHA 2IXKA 2ZDIC 3N3HA 5GZCA 1SHWB 3DGTA 3NRUA 4M01A 4FTSA 5DAXA 2JENA 1C8M1 3K9SA 2YGMA 2VO5A 2BP6A 5T50A 4WBBA 3LSSA 5ANNA 3THOA 1W90A 5FAXA 2PQQA 2R9IA 2C24A 2NZ9A 5HXVA 4K8RB 1GOGA 4YPJA 1OHFA 1LAJA 1B35C 1ND3C 2Y69C 5FLHA 1EM1A 2YUAA 4Q0QA 2CGOA 3LKJA 4OZXA 1W0NA 5TSWA 3AP7A 2B7YA 1K3EA 1QVFU 2IZWA 4FSJA 2EZPA 4CEYA 3VL8A 4J7KA 4MVUA 5C8CA 1TME3 1PM9A 1QH6A 1O8PA 3AG4C 3DXRB 3T0BA 2ATFA 3VBOA 5IT9N 2RS31 4SBVA 4NWVA 4ZKTB 1Z0HA 1OXCA 2D3PA 5H9RA 4GQ7A 1Q82W 1YJWV 3MPBA 1V9U3 4NKGB 1Y76B 2LW7A 2XKOA 3BUCA 2ZGNA 4YW2A 1YTFD 1MA1A 2QQWA 2WLLB 5EHDA 1VMFA 1BEV3 3GBGA 3I2FA 2P5OA 4FP2A 1MS1A 2UUBB 1UJWB 3WLUA 1I94B 4DXTA 2ZHNA 2PLV3 3CB2A 4YVSA 1QHDA 2VZSA 4NXNB 4RN5A 4KGGA 5CKMA 3HQUA 1JVMA 2DWEC 1PVC3 1MS8A 1Q43A 3JCIA 5JCOC 3M3EA 1SFNA 2DV9A 4WVMA 2BDRA 1L8DA 1QCEA 2P17A 1ZA7A 1EV11 1DQ6A 1JOJA 1AL23 4YIOA 4YRDA 4QPGC 1U97A 5FLXN 2IVJA 3N7KA 1SZXA 3ZJZA 2Y6LA 3OE7G 2VMCA 4RQPB 1KITA 3ZXJA 2P4KA 3VBHB 4K8FA 3IC9A 2NM1A 4CCEA 5JZGA 5C93A 3HQRA 4XQWA 4Z8BA 1WA4A 4DK0A 2Z5WA 4FLUA 4ZZ8A 1BEV1 3FB7C 1VQ4V 1ZBA1 3JD72 2WWWA 2QQJA 3VQYA 5FRAA 2JKXA 4QD2A 1UAIA 3FLRA 1KECA 4ARXA 4IGGA 3E5XA 4UW4A 5GM0A 3FHIB 1KFXL 1VAVA 5A3LA 3VHOA 2QZ2A 2YIAA 2BGOA 4O9EA 1XYNA 3MLJA 1AR81 3H7JA 5FKBA 4DR3O 1JZ7A 4CUAA 2O14A 1PGW2 1AVMA 3J4UH 3WINE 2B1GA 5ANQA 3AB0A 4IEOA 2MEV2 4CU6A 1OOPA 4AVTA 1XMOB 2W1WA 4PJYA 1XSQA 3URFA 2W52A 2PF4E 2P5BA 2XPJA 3RBZA 2VBPA 5AC91 2PFWA 4UWDA 1BLZA 1C57A 5IWAO 2AZ0A 5DUVA 3VZLA 2PMWB 4MTOA 3L9JT 3LDCA 4OFGA 2WO1A 4AILC 2CSGA 2OXBA 4KI5M 5FMCA 5FUPA 4JVAA 2R16A 4JI7O 3C3VA 5EV7A 3SMHA 5JXGA 4MW3A 4CU9A 2RNBA 4RQEA 5GZDA 1IG3A 4AYUA 2WQ8A 1LRHA 2VZQA 3M3CA 5CA1A 2RR13 1WMFA 5C3RA 3VBRA 1AYN2 1RPRA 3HKCB 2AREA 4GAZA 3N9OA 3ZIAG 3MPPG 4YZ4A 2LW1A 1DIWA 2HWC1 2IWGB 3DCQA 4CXXA 3D4KA 4FPOB 4JGYB 3O1VA 2RDCA 1ENXA 2R0HA 1Q8SA 4YY3O 3WW4A 3SDLA 1JODA 1NCRC 2JDMA 4HK8A 4KFMA 5DEDA 2C5DA 4LR3A 2HWF1 5B1AC 4CE8A 4PI2A 5A1LA 2AENA 5K9YA 1OPOA 2GC2A 4YG0A 4C91A 1RYYA 1ZUQA 4BISA 1JFFB 4O9GA 3MICA 4D6SA 1LULA 4XZPA 1VP7A 3M99B 2PYTA 4WFHA 4N7IA 3PDQA 5ABJA 4XBFA 4X66B 2V4DA 3CCLV 1JUHA 1TEIA 4NTXA 1LOFC 1SBEA 1HNWO 4YVWC 2HJFC 1RUH1 3ZN0A 3K58A 2Q4SA 4QHOA 1IS6A 5G05L 2UXCB 4BQYA 4X1YB 5JI7A 2YHJA 1QKQA 1W6OA 2JICA 4DR2B 4QX7A 3IB3A 2CTWA 4P9PA 4LC1A 3W7XA 3ZHSA 3T3YA 2EAAA 1TMF2 1K5MB 1HJGA 4D7YA 4P9YA 1AUYA 3APBA 2WA3A 5IVFA 1IURA 3CCJV 3AL5A 1W9SA 2W9XA 1U96A 4P14A 3N9QA 2BSKB 4FXKB 2PHWA 3D5OA 5LB6A 4P2ZA 2LTNA 4MX3A 4QPIC 1G9CA 1KGYA 4PJ0Z 5IK7A 2F95B 1KDMA 3S7IA 2EJ7A 4QPYA 1N33O 1QJX1 4HG6B 4TT3G 1JX9A 5D8AA 2VRZA 1LKNA 2YBPA 1R082 3CLPA 5DAVA 1K45A 3B2EE 2PZSA 4M0HA 1LHOA 4XF3A 4PBPA 2HBUA 5F2WA 2LGWA 2ZKLA 3STZC 4D94A 4I50A 1PZ7A 5ISLA 1S0VA 2P6HA 5GLVA 4P9OA 4B3MO 1RUI2 2ZIMA 2X8KA 1Y7BA 1VR3A 4LBLA 1ULFA 3C7EA 5A6ZA 5FYHA 4XEZA 3JU9A 2TEPA 3DPRA 4Q8KA 3NO8A 2PHRA 4WFEA 1ZL8A 1F7YA 4FLXA 1O59A 4MVOA 2XAGA 3I7DA 1Z5WA 4I0BA 2EXIA 2OPKA 1NZ6A 2WBKA 5F3EA 1PZ9A 4QMAA 3TOJA 4IV1B 2DUPA 2YIBD 1JJ2U 1GN2A 3AL6A 2R073 4Q4V2 2W6JG 1MEC2 3AZZA 3GF6A 1O3SA 4RS5C 1ROPA 1DYOA 2VCBA 3ZXAC 3TN92 1BXHA 5FP3A 2ADEA 2PGGA 4KNCA 4LQRA 4Q0PA 3JD71 2YIBA 4V2WA 3K46A 5KHIA 3OFNG 1IXMA 2H8PC 4MGTA 4C1WA 2IU0A 4DV1O 4AI0A 5T54A 1W8NA 5A6XA 3VDDC 1X9PA 4TV9B 2VCMA 1CX4A 1W0PA 1E1QG 5A7WB 3BOPA 3G80A 3M3IA 2Q5TA 2WT0A 1VMGA 1UKRA 4LIVA 1PGW1 2RE9A 4YIPA 4I0WB 3VZOA 3E86A 1LGCA 3H1KH 4AHXA 1ND2A 1XMQO 4G3YC 5H9PA 1VBD2 4JI2B 4XFAA 4PT6A 3K2OA 4XBLA 1PPJH 1K33A 3WR0A 4F6EA 2EIKB 2QKAA 5EYXA 2JXAA 2JD4A 3SJBC 3KCCA 1WLEA 1PGL2 1IKPA 1RJ7A 2JRIA 2A9HA 4CDUC 5FZHA 2DU1A 3U14A 2VOXA 2EA7A 4U7OA 1BHBA 3VOUA 4B8EA 2FKXA 2W87A 3WSOA 1GWKA 5FZGA 1BYHA 4JKKA 3ZKYA 1UN1A 5CEHA 4DZGA 2ZX4A 4WBNA 1RVF1 2E3CA 3EQEA 2JJ1G 3EB7A 4UVCA 4PDWC 3WB1A 1AYN1 2FZ2A 1YQ8A 1QOOA 3STLC 4YW5A 2A73B 4QQLA 3HBKA 1WMXA 4COZA 4OMDA 2KXLA 1U5YA 2YFZA 4MGKE 3ZMVA 2P1BA 4R9AA 4EN0A 3N9LA 5LMUB 3U4SA 4Q2FA 2YXSA 3TXSA 2NR5A 1KD7A 1FPN3 3SJAC 2BGPA 5B1NA 1PK6A 5A6YA 5J1XA 3RG0A 4OUSA 3OBTA 1JPXA 3Q4HA 4Y20B 4ISRA 4W4LA 4IEYA 3KD4A 1ZRDA 2BRTA 1WA6X 3ROUA 1JZ8A 1UZVA 2F43G 1PIV2 4WM7C 3ZCCA 4R7CA 2XOKG 3UYJA 2CY6A 2RM23 1UOJA 4UFMA 1CESA 2A79B 2QTOA 1VBB3 1A6CA 4AW7A 4DY3A 1K92A 1S0BA 4PF5A 5EZWA 4GX5A 2Q6AA 4EE2A 4DV5O 5CBFA 2VQEO 2ZMKA 2VQFB 3CJIC 1L7QA 3WG1A 4AFMA 1FPN1 3MIEA 1UFIA 5L3BA 2DVAA 1VQMV 4F6RA 2EVXA 1IHMA 3KZ4C 1TMF1 5FZ8A 3O1OA 4BHPA 1REFA 3VD3A 3RWKX 3H9VA 1UX6A 2BFUS 4LF9B 1NQTA 2UU9B 5EZYB 2WZ8A 1HRI2 1UWWA 1IOAA 5K0UB 2B9VA 4LOTA 2A7WA 5LA1A 2YSUB 3B94A 1RMU2 3F7YC 5I91A 4QQPA 3L73H 1D0HA 3IFXA 1O8SA 4J11A 2XAQA 1Y6XA 5FK7A 3A0BZ 1KS4A 2IXJA 1I7FA 1VBE2 1XJAA 4DV6B 4P9IA 2VUAA 4TZDA 2G9GA 4H7MA 4XOGA 4PDVA 5FZ4A 3D3QA 2ETEA 2VMHA 3VBOC 2P06A 4X62O 3CMEV 3UQ8A 5C3PA 3NV2A 4D7SA 1LEMA 4DV2O 2UXBO 4Z92B 1RUI1 3ZR6A 2OYQA 3OY8B 2A5ZA 4X20B 1GNYA 1K9MW 2EXJA 3MW2A 4CCNA 4K9SA 1KQRA 3WW1A 3FYEB 4LA3A 1IS5A 4JYAB 2WSSG 2RJ2A 4G27B 4I01A 4DV0B 4YVSC 4NPLA 1HXS3 5FXXA 4JI6B 2WLPA 1UPIA 4QWNA 3DF0A 3OMAB 1PO12 5G04L 3MFCA 5KAIZ 1XHXA 5A3PA 5A9GA 3C7FA 4JI4O 5IUQA 1WLTA 3SXWA 1S4CA 5C8WA 4OHYA 1BK0A 1J3PA 4YW7A 1G6NA 1H1IA 4MVQA 4Q4V1 2DFBA 4X1KB 2FDFA 3CP1A 4CC6A 2W91A 3TN91 3ICXA 4LK7A 4CZZA 3L71H 2Y33A 3D8CA 3N9MA 4XETA 4GB31 4AHCA 4A3XA 4B7EA 3WQ0A 5DN2A 3VN4A 3LDKA 1J5EO 1QLEC 2WZR3 2OQ7A 4YM0A 2E74B 3Q8AA 3MUY1 3HMYA 4JTAB 1WB8A 5L7OB 3AG3C 2VZ1A 2BTQA 3GXUA 3N27A 1UPSA 1U5ZA 1NJIW 5HI0A 4JZ2A 4C0BA 3CRMA 5DMYA 4KL1A 3BPSA 1H6YA 1OCCB 5FZAA 5LWBA 2DMXA 1OCRB 2JB4A 1VBD1 3IT8A 1W28A 5LP6A 3HKBA 2QKSA 4XF9A 3LEGA 2CAUA 2WPDG 4TUYA 2YS8A 2K1EA 4MV2A 2QQLA 1IBLB 5LYJB 1QHTA 1PGL1 2JG8A 1NE4A 2KG7B 3S3WA 2ZXQA 5CYYA 5GONB 5BNNA 1RP3B 2ERFA 1GZCA 4LCUC 3I3QA 5A3TA 1WKYA 4LNVA 3RVYA 1H38A 1ONAA 3Q8EA 3RI9A 5DG2A 2IJHA 2BWCA 4FPPA 1MQTB 1NXD1 1P7BA 1VAMA 1OLMA 4KH9A 1SQBH 2FYUH 5FZKA 4FQ4A 3B4SA 4NN0A 3B9IA 3RZGA 5FO8B 2VZTA 2QWOB 2YY1A 4WFBV 5CBHA 5JIAA 2LFSA 3O1TA 1YUDA 2CDPA 3G6BA 4XYXA 4Y5Z0 2WABA 1J3QA 2FDHA 1PNGA 1QU0A 3TNPB 4FPFA 5LXTB 4DO2A 4LF4O 3BTAA 2Q8DA 1BS3A 5ACA2 2PHTA 4XJ8A 3JAWA 5CA6A 1UPGA 4YZ2A 2D6LX 3H1WA 1D5NA 2JS3A 1W6QB 4YARA 1GANA 3OGVA 1PIV1 2KQXA 2NLRA 1QH7A 5CFCA 1XOUA 3W7UA 1F23A 1R093 2P34A 2EIEA 2VMGA 4GX1A 3PNAA 1HN1A 1JOBA 1VRH3 1Y4MA 2QWPB 2PYJA 4FXGB 2WNEA 1P8JA 5FZ0A 1P4RA 2JEXA 4BIZA 4GH4B 4HYOA 1THZA 1S3JA 3GZUC 4YW4A 2RMKB 5ABJC 3HNMA 3CU7A 5C3QA 2ZGLA 4IEQA 5A1AA 4DR1O 4ES8A 2PUSA 3WXPA 1R1BA 1CEZA 3JASB 4JI3B 1VQPV 5FMOL 1JA8A 3BIWE 1KKDA 3HOBA 4TV8A 1LECA 4B1MA 1J1TA 1BL8A 4NHLA 2R30A 3CCMV 2ZPXA 3MIBA 1QIQA 1TVKA 1KJRA 4GD4A 2BNMA 1HRI1 1CZVA 1FJGO 4Q8LA 1OCOB 1FFXA 3OSDA 5CKNA 4TSFG 2WUHA 4PA9A 1YDXA 1RMU1 2UY8A 1QQP3 1GKFA 5B3SB 3K5MA 2EICA 4QIWF 4GXLA 2JGUA 1E5IA 3OUJA 1N1SA 3W59A 4B4RA 1ULCA 5FYCA 2F4VO 1NS1A 2PHXA 3I2GA 4YYOA 4F7ZA 3K4ZA 1HV0A 3POFA 1AR5A 3AVSA 3BKZA 4UFLA 5GJ6A 3ZYJB 1XBLA 4NIGA 4DW1A 1VBE1 4JYYA 2BNNA 3OD4A 4MVMA 2WLQA 1XYPA 5IE9A 3BOWA 5IK4A 5A7NA 4K0KO 1NT0A 5D8AC 1SQQH 2XAJA 3ACHA 5J48A 3ZFFC 1V6KA 3OYWB 1GP6A 4IIJB 2NQYA 2GNTA 2J1EA 4OI0A 4DV3B 2VAUA 4CC5A 2H6BA 1F5FA 4HKOA 1AJOA 1UOFA 3MHHC 4IUGA 3DXRA 1KD1W 4LO7A 4I4TB 1D2QA 2Y48A 4GKJO 3H50A 1NKGA 4U7NA 5CB4B 2YXHA 4GUNA 5AFBA 1CONA 1Y76A 5DG1A 4CYDA 3NAPC 5GZFA 2MK3A 2WLLA 4GKXA 2DBIA 2XJTA 2W47A 2E76B 1PO11 5GALA 4XW3A 5IYCO 1H2NA 2CDYA 3TEYA 4ASKA 4WFGA 4URAA 2W39A 2GH8A 3GJBA 2W3JA 4DR5O 5FYSA 4KGQA 3AP6A 2XNDG 2R072 4FPKA 1G8MA 1CXZB 1JH5A 3ZVXA 1W2AX 2JGDB 4C0HA 2ARBA 2AYHA 3OG2A 4IEPA 4QKBA 1DYPA 3USSA 3CO2A 4WFFA 3O0VA 2UUCB 3KMHA 2ZEXA 3PL0A 3P3NA 4EWDA 4XFHA 1UL9A 3OEAA 1J83A 3LDEA 4SLIA 3BYWA 5FZ7A 1N3QA 4QX1A 4JI1B 4RL7A 2XAHA 4RQPA 5FREA 5HFMA 5FIXA 5FZFA 3HT1A 3VBHA 4CCDA 4AL9A 3BB6A 1N32O 3I3BA 4XAEA 3K48A 1YFXA 5F39A 2VNGA 4UXNA 2HWB3 1J84A 1SG3A 2K2SA 2ADQB 5J09A 5J3UA 1OH3A 5JLVA 1OQEA 1LOGA 2A7AA 2VULA 3RS6A 1S0IA 4NRQA 3ZHTA 4CBCA 4A7YA 1A3KA 2ENRA 4Z2AA 1TUEB 4FVVA 3ETPA 5LBBA 2JDAA 5LBQA 4HN0A 3WQ1A 3AG1C 5JJNB 3O0WA 2BBVA 4DV7O 1PM7A 3BY6A 4IGQA 4NIIA 1HNZO 4Z07A 2ZXWB 3AMMA 3NJVA 5JH7B 1LTEA 1SDDB 1XNRB 1YQ6A 2W6IG 3BODA 3NNFA 2N7GA 3E6CC 1BZWA 1CIWA 5BV6A 3W7TA 2B9ZA 4LH7A 4XABA 3VHRA 4TQFA 1PL4A 1UU5A 3ZMTA 1Y4WA 2HH9A 4XF4A 4MZUA 3SR2C 4XIOA 1FAYA 4EWEA 4ZKIA 1F51A 1U0AA 4XJZA 2UWBA 1HDJA 2ZD9A 2A6ZA 5E6HA 2W95A 2ZX0A 3W7SA 2ZX1A 1O4ZA 2LS6A 5C4WC 2E53A 1VF7A 4QX5A 4RO2A 4LFAB 1UYYA 5J2UB 1YLLA 2LUWA 3ZIXA 3S7EA 1OZ0A 4RHV2 4RR3C 5HBAA 4FK5C 4UUJC 5ACA1 1M5IA 3IKWA 1US2A 2DYCA 1F4MA 2Q68A 4Y1XA 4YSFA 4H0LB 3HEIA 3HKCA 3JB4C 3UGFA 2J1AA 3FKSG 1H1MA 3QBQA 3KF5A 1EPZA 2WO2A 2DVFA 1W9WA 1BHGA 2DWRA 3SKVA 2DW4A 4JGYA 4YJ3B 1N1YA 1VBB2 3RZMA 3GBFA 2VNRA 5FPXA 1DGRN 4S2GA 3T2PA 3CE2A 3GHMA 4QB2A 2EBOA 3OM3B 1FX5A 4CDWC 1DBNA 2HWD3 4NPMA 1UU4A 1A34A 1RHI2 1AR92 4LBKA 1DF5A 5FPZA 2WQ4A 1XNAA 1AB3A 1JFFA 1V6IA 4CH5A 1UXXX 1I94O 2BW8A 3WF3A 3OTOB 4ORFA 2ET1A 5H6QA 4RSUA 4LUMA 4WVVA 2D3RA 1WW4A 1E1RG 3K9AA 1DHKB 3OF1A 1I0HA 1OBNA 1JQ0A 3K79A 1X33A 3E35A 4X1YA 2HEYF 4FZ1A 1QWRA 1WBFA 4MLOA 2E7TA 5H9QA 2W08A 1QJU3 5IT6A 2R1DA 1IDSA 1K5MA 3OPZA 5JWPA 2VTFA 4MO3M 1RUG3 2XLGA 3F95A 1BQ0A 3LOIA 3VBFB 4Z1VA 2EIDA 2P6JA 4BIOA 4IYIA 4FO9A 2BSKA 3Q8FA 1W2TA 4JV5O 1S55A 1CWPA 1N47A 3ABZA 4XF1A 4FPGA 3DYMA 1NQDA 3N35A 1WB7A 2GSYA 1Z7S3 4CXWA 3OGGA 1PM4A 1W2OA 2NN4A 3NV4A 4FFHA 3ABMC 3BTZA 4D6QA 1AI5A 3VZNA 2DYRC 4XFCA 1RUD3 1YIFA 3GALA 1NCQC 3T1MA 1VF6C 2X6BA 2LGQA 5BNOC 3IIAA 5LASA 4FM0A 4XUNA 2E5LO 1GH6A 3PURA 3O1MA 5L3CA 3VDBA 4LF7B 1R1A2 3AC0A 4A5UB 4DXSA 2I74A 1GP4A 1UIJA 3J8F1 3WG4A 3UNPA 1F31A 1A8DA 1SQXH 5DDJ2 4CH6A 4XDQA 2VC9A 4CS4A 2B1IA 1JCHA 4DR6O 1HRV2 3DECA 4HANA 3S3XA 3ZFEC 4J9YB 1ZTEA 1OFNA 2ZM6B 3AJZA 5KXCA 2R6QA 3JXSA 4JAUA 5DABA 1GAXA 2OKXA 3ZMZA 1POV1 2VOTA 2QM7A 1TZOA 4RGAA 3POIA 4X1IB 1MSWD 2PHDA 4IV1A 1NLRA 5FBJA 2VMEA 3HN3A 2XONA 2YB7A 3FAVB 4DXZA 4MVRA 1CQ9A 4LA2A 2IXLA 4UI9L 5AG2A 4WM8C 4DV4O 1K4CC 4MG2A 4MS2A 3OMIB 1RUF2 1XREA 1WCQA 1G9BA 2E7AA 2WR9A 2JKBA 4PA7A 5CADA 2B42B 3OGJA 3INAA 3T2TA 1ZA4A 2GC3A 3VDAA 5LCWL 4U3JB 4IT5A 1QNYA 3BA9A 3IZOA 3O1RA 4PDMA 4UT5A 1CPYA 1YZBA 3USUB 1BJQA 2ZGMA 4TV9A 2RMU3 3PIJA 3RWNA 1OH4A 4FFBB 5A7WA 3JSNA 2JIGA 1OT5A 5A7PA 3A8TA 5EPAA 2P37A 3WB2A 2BCCH 4YHHB 2XB6C 3K5OA 2YEVB 2Q5ZA 1QVGU 1S5LZ 1H8TC 2YPDA 4MTXA 3SISA 3T2MA 3H1MA 4KWUA 4OGQB 2JG8C 5BNNC 3LPGA 2PHFA 1VEWA 5A1FA 2YMZA 2DU0A 5FYMA 4FPHA 1LOCA 5IJRA 3SC7X 2UXCO 3R05A 1LHUA 1QGLA 5CBGA 3KF3A 1IBMB 4UFIA 1M9NA 5FZEA 1HQNA 1AP5A 2OA2A 1AXKA 5APAA 3RT3C 1R3JC 2ZA9A 2XTAA 3LEKA 1DQ4A 1E5HA 3E8BA 1FXVA 4QAWA 1S0CA 2X29A 1ND3B 1JZ3A 1V6MA 4AVVA 2RQ6A 4GA9A 2XG3A 4EN9B 2L35A 4G4FA 4LHKA 2WFF2 4RHV1 3CJHB 3RYRA 2BV4A 1ZRCA 4UCRA 1T6BX 1GYKA 5JMCA 4EFEA 2H94A 1ZVFA 1L0NH 5FYUA 4JKLA 3NNLA 2XWJB 3HKDB 3VD7A 4DR7O 3AG4B 3UM7A 1MNGA 2R061 3OGCC 2HKXA 3CX5F 4U3FH 1WW7A 2QKDA 4LBQB 1COWG 2Z2SB 2IJKA 3KT7A 1VRBA 4OVEA 1AR62 4XFBA 4X6QB 2D44A 5IVBA 4YFWA 3VB9A 4PF1A 4Y20A 5HCFA 4CEWB 3CCEV 1RHI1 5FZMA 4ZXKA 1AR91 5KBFA 4IE6A 4AI2A 5KR7A 2D3SA 4EEQA 2EAKA 1VARA 4EN6B 2OX0A 5HPOA 5ITZB 2DUOA 1FNZA 3AZVA 4N90A 4EB6B 5LBFA 3THPA 1W0JG 4UOJA 5EJ1B 2FCUA 4JTNA 1Q6HA 2VBDA 2ZGKA 4B3TB 5B4XA 1XRUA 5I93A 1SPPB 3IDCB 5H2FZ 4X65B 1IKQA 3CKHA 1OFSA 2VOVA 4LJHA 4QXHA 4HLTA 4GMP3 4WZCA 1VQKV 4CS3A 4QDRA 1FNYA 3MLLA 2HKOA 5LEJA 2GMEA 1ZZ6A 5K0UA 4YFZA 3BA8A 4L9BA 4BLJA 2D93A 4R9CA 4ZHQB 3TEXA 3S0MA 4NTYA 4ES9A 3QVNA 4MVSA 1ENSA 1R6TA 1OD3A 2QQNA 1N36B 2FHRA 1RUJ3 4NHXA 2L6LA 4NR1A 4IEVA 4G28B 3LEIA 2GP5A 2TUNA 1C28A 4ZS3A 4AEJA 1NZCA 3G71V 3SH3A 1ZAUA 1KC8W 1V6LA 1W8WA 4OLLA 2ITDC 3V0AB 3ZYBA 1EAH3 1NZIA 4J1XA 5IVEA 4GKKO 4B4QA 4LFBO 3ME2A 3CBNA 1CAXB 1GN6A 1GK9A 1W99A 4HKWA 3UL2A 1AROP 4TQDA 4OHVA 1R1A1 2ZT9B 2RS53 3HR0A 4XACA 2E33A 2EILC 3LWCA 2UXXA 4P9LA 5DDJ1 2ZINA 5BMVB 1SQGA 4X20A 2J22A 5FY1A 1OCZC 4A7ZA 1PO21 4JTDB 1HRV1 2A6YA 4HK9A 4MT8A 4L99A 4BQXA 1FFTB 3K3OA 3ZXLA 4AQSA 2ZKNA 2Y8KA 1RFYA 1J95A 5FY4A 2FL4A 4L92A 2Y6FA 1BMV1 1K97A 1SLTA 5A3OA 5LA6B 3UKTA 2XKPA 2QE3A 3PMEA 5EIYB 1Y67A 1WMEA 3L70H 1W2BU 4BK5A 1W8TA 1HIXA 3ZHVA 2B46X 3ZYGA 1ASJ3 5FLIA 5IDJA 4A4AA 3R65A 1HDKA 3N2KB 3IAQA 1HJFA 2VPVA 2F66C 4X1KA 1POV0 1QJY3 4XDLA 1RUF1 1NCRB 3EXUA 4CU7A 4HBNA 3CEWA 2ZEWA 4BB3A 1UMIA 5B1AB 4AI9A 4QXCA 3VBUB 2X10A 2UUAO 2OVUA 4A2UA 4MSVA 1MZEA 2XVGA 3N7MA 2PYLA 1U5XA 3A23A 2VWKA 3E8HA 1QOTA 3N36A 4JGZB 4BW5A 3LAGA 4AGVA 2BVBA 1HX6A 5IFPA 5SV5A 1GTOA 3JZVA 1N4CA 4QQ2A 1Q6UA 1UZ0A 3M8LA 2HVJC 1LOEA 4O4IB 3DTUB 3UJQA 5L7OA 5C3SA 3K3WA 2QA4V 1W05A 4PLMA 4KHPO 3NKGA 3KHCA 2JIZG 4DY5A 3SH5A 4P30A 3W9AA 4YVWB 1BBT1 3CNAA 2Z79A 2R043 1M56C 4UCVA 5CVRA 2C6SA 4S2DA 3KQ4B 1O9GA 2GH2A 5H5NA 4HNAA 5LYJA 4Q4W3 2Q8EA 5LL6Y 4Q27A 3I2JA 5LA9A 2E9QA 4CP9B 4UVAA 1PVXA 3U0ZA 2KG7A 4EJRA 3CCQV 1PMJX 5GZEA 3E89A 4LF9O 3CYOA 5GLZA 4O4JB 4GLXA 2QSAA 2VVEA 1N1TA 1HWYA 5FP4A 4QPIB 2JB8A 3TJTA 4GYCB 4J10A 2WFF1 5FZCA 1MQTA 1Y9QA 2DVBA 1CVNA 2JDZA 3ZEDA 4QPJA 4M3CB 3ETQA 3UESA 5GTIZ 1MZFA 1GZWB 4JDNA 2X5IC 3KHBA 1GQHA 1OVSA 4QKDA 1CJPA 2IH1C 1RUE2 4I3GA 5DXDA 3SPHA 4JQTA 5J36A 1JBCA 3AKPA 2VJXA 3X29B 1AR1B 4DV6O 2PY5A 4AHWA 5FPVA 1AR61 5LXTA 3OJBA 1H0BA 4PIZA 1UKGA 4JGYC 4UW6A 2I07B 2NLJC 4M3CE 2WAMA 3FL7A 5DM6V 3DC5A 4KG8A 1BE3H 2BTVC 1XNQB 2BTOA 4I5SA 3POWA 1CP9A 4QXKA 1UY4A 1FAFA 2JECA 1W6QA 1OLRA 3I59A 3ZSEA 1JOYA 1H2MA 1NY71 4ONUA 4BMEA 1VBA3 4ASLA 3WDTA 3BU0A 1UYPA 1CPMA 3POBA 4LF5B 1W8OA 5IVVA 3O65A 2AR6A 3RNSA 2ZHMA 1WP8A 3VQXA 4C7UA 2GN3A 2ORZA 5EFUA 2ARXA 5JXIA 1C4RA 4MGSA 4GH4A 3WB0A 4DV0O 3X2QC 1FOD2 1Z2GA 4LKSA 4DNYA 3T2OA 1QJU2 4Y1VA 3G6EV 4FCAA 3H1JH 1Q8QA 1GMGA 3MYXA 2V5DA 4P9WA 3JASA 3ZN1A 1JS9A 2WWUA 3B77A 1W6MB 3AEIA 1V9PA 3FYIB 4RS5B 3K03A 2GTSA 2WLNA 2FQPA 1K5SA 1NH2B 2DTYA 1DQ1A 4KBZA 3JYCA 1RUC2 4GWMA 1GV9A 4BPZA 1JYNA 4CP2A 4G9SB 4FFKA 2IFRA 1K5MC 3WHUA 4LNUB 3MHZA 3PJSK 1D4M2 1E57A 3ORJA 1BSMA 1BK1A 2WFPA 3DL3A 1HNXO 4QQOA 5FPAA 4BQ3A 3P1IA 1IPSA 1S2KA 1S77D 4Q5OA 1WZXA 3ETEA 3C90A 4H33A 1OKOA 2JDIG 4TN7A 5CA3A 2BWAA 4K8ZA 1R6KA 3FN9A 1LR1A 3MF9A 4Y33A 2ZIOA 3VBSB 3OUIA 3BRCA 3IJ4A 4JI8O 2XAFA 1UCXA 3RYKA 3WX5A 3OYWA 1W04A 3JBG3 1J1LA 4IIJA 1ZBE3 3JD4A 1FV2A 2K9ZA 2ID4A 3LA2A 2Q0AA 5EIBC 2A6XA 3ZFGC 5T55A 4CDUB 4XTMA 4Q4Y3 2G9ZA 4I4TA 4CCKA 4EQVA 5FKCA 2HEWF 2EINB 3IBMA 3IAYA 4GMP0 2OYZA 1JMKC 4WV8A 5KXDA 5CB4A 4META 1AI4A 1RL3A 3DN7A 5LEKA 3LIGA 3U11A 1KJLA 3HKEB 2WNVC 2H0BA 3QD6A 4PDWB 1LHVA 3GBWA 4W8JA 4HN1A 3KVAA 3WG7C 2DYSC 3A0NA 2YC0A 2C9AA 2Z5UA 4Q4X1 3T1LA 4XJWA 1IXBA 1ZBE1 1AXZA 2JGDA 4N43B 3E6DA 5FV3A 1TUBB 1KS5A 4Y1UA 5A32B 3ZXFA 3H1IH 1CIYA 2KA3A 5EQUA 4MGYE 3ZXDA 3EJKA 2RMU2 3ETDA 4K3UA 1FMD2 1H9WA 4WM7B 3ZYPA 1E5RA 4BZ4A 1PMIA 2K9PA 3DXUA 3FHQA 5IJ0B 1IG0A 2VUCA 1H9PA 4BWAA 3M8AA 3SKJE 1SESA 4JTOA 1VMHA 2GMPA 4DR3B 4FOWA 3ES4A 4H55A 4CS2A 3VGIA 2O8QA 2G1MA 1MZ6A 5FWEA 4WVWA 1QR9A 2EIMC 1FXZA 2YG0A 3AKQA 1DK1A 5KA6A 5GLUA 3CJIB 2DJVA 3ALQA 1W03A 3GYDA 3AVRA 4XF0A 2YXYA 2HWE2 4OUEA 1YSCA 3D36A 4JI3O 3JARB 2BPA2 2JDYA 4D3WA 2NMOA 1SLAA 5FMOS 4YG6A 3LD8A 3LNNA 4JI7B 1TE1B 5JH7A 2KD7A 2VMDA 1COV3 2QQKA 1IBKO 1FD9A 3T0AA 3T30A 4YGCA 3QOPA 3OTFA 3MW4A 1LR5A 2XBO2 4BMBA 2UWAA 2YBKA 5KUKA 2HFEC 1VBC2 1FXKC 4E2QA 5F2VO 1AL0G 4B3RO 1RUE1 1K3IA 2WKKA 4Y4RA 5FNVB 3O1UA 3O0XA 2P4EA 5J2UA 3VBOB 4EFBA 2GTAA 1C8M3 3I2KA 1VQ9V 4NE9A 4PD4F 4MHUA 2ITCC 4YY3B 3U1XA 1TG7A 1TGOA 2GHYA 2W0XA 3UJOA 2E31A 4DV3O 4AVCA 2JJ6A 1HB4A 3ZDVA 1EY2A 3GZTB 4PLNA 4LBOA 4LBEC 3PJYA 2K46A 1PX3A 4IV3C 4JZRA 5CB7A 4YJ3A 3ZHQA 3H9AA 3GCXA 1BCCH 3FB8C 4JTCB 1CJDA 1MABG 3U07A 4O2BB 4U2AA 2QE7G 4NIAA 4WCEV 3ZYRA 2RS33 5LRSA 4AQ6A 4IL6Z 1YJKA 2DVGA 2E32A 2QWNB 2MNGA 3AJYA 1OD5A 2AC1A 1HNWB 1WP7A 1FOD1 3ZDSA 1SCRA 4OQ8A 4ZU7A 4HFSA 1GSLA 1A78A 4A41A 1PNMA 5C7GA 4XXPA 3SCFA 5FOBB 5K8SA 5LMNO 2XGXA 4UCOA 2ZGQA 4HMZA 4AAPA 3TB0A 2ZCWA 1GO3F 1ZRRA 1RUC1 3MHSC 5I8YA 4KWKA 1W0KG 2D5HA 4FFIA 5JJJB 1XXNA 3CXCU 1QLEB 3HNBM 2BOJA 1D4M1 1ST8A 4XVHA 2QQMA 4U36A 4OCTA 1YJLA 1EV13 3AMPA 4XBNA 4OX9B 3ZLIA 4B4PA 2XASA 5I0TA 3AG3B 2B5HA 2LALA 2F17A 2WWJA 1N33B 2Q1ZB 3POGA 1KU9A 4XC9A 5KWRA 1VALA 4UCUA 3VBFA 4DB5A 2YPJA 4YGDA 2NYYA 4R9DA 2ARHA 3LCPA 1M57C 3NR7A 4IW3A 2J1SA 4LO4B 2ZGRA 3N9NA 3WF2A 2CTPA 3LA7A 1LESA 5FY0A 4DPNA 5FUNA 5JSOA 3FC0A 2RS52 4S2HA 1ZBA3 2RS12 4RUEA 1RINA 4P9GA 5T5OA 4B3MB 1NA1C 4LLOA 4JHTA 3ZSJA 1HB3A 4NYKA 1D4VB 3B02A 1CD3G 2O1QA 1NUKA 3GWKC 1ZYBA 4EYUA 1AR83 3FLPA 4A7KA 2VNOA 1AR72 2XJVA 2ETNA 2YXLA 5B66Z 3LSDA 4AQ2A 3ACGA 3MAQA 5D5QA 1W39A 5L3GA 1YWKA 2J1UA 5EJZB 2DDUA 4LBMA 1ASJ2 4DIQA 1HB2A 5AC93 3VKOA 1XPWA 4N53B 5HCHA 2D7FA 2XL7A 2SLIA 5GKAC 1DGRA 4PQ9A 3AKTA 2ZJCA 2GNBA 5FXVA 5EBWC 4QX2A 3TEZA 2OWOA 2WRAA 1SLLA 3CCSV 3HNYM 3CSXA 1HR0O 4I30A 1MACA 2ZCEA 3ENRA 2F6BA 1DGLA 4XDKA 1BHAA 1AYM2 4X1IA 1YIJV 1W2UA 1FMD1 4COWA 4FMTA 4DV1B 3FAVA 3JD1A 1SLIA 2R32A 3WDYA 2WNUB 1Y74B 4IGOA 1I5ZA 3LFIA 4XDPA 1O3RA 1E5SA 2XOMA 1JHNA 4R8HA 4UF0B 3AYAA 5FXZA 4NPRA 3K5NA 2HWC3 3QO8A 2G38A 2HG5C 3WF4A 5CBLA 1YFUA 2R042 3WNXA 2Q30A 5CISA 2LFRA 3AKRA 1G6UA 4U3JA 1WCKA 3H42B 3ABKB 4COYA 4N21A 2BOBC 4IEZA 3ZXEA 2OZ6A 1DGSA 1WW6A 3DEMA 3USUA 5LA0A 5FZDA 3WP3A 3OPTA 2UU8A 1JR9A 3SQOA 4FFBA 2HWE1 5IYBO 3VHNA 4X64O 1OCRC 2C9KA 4DUYB 2HWF3 2HYXA 2LM3A 4FLTA 3GCWA 2V1DA 2YEVA 2O0OA 4QGLA 2XJSA 4CDXB 1GZTA 4DRRA 4ZXEA 3RJ2X 3SLIA 2OCCB 1Q7YW 5FPRA 3VQVA 3TGUH 2XBO1 2UXDO 2ZMNA 1RUH3 2QQIA 5CFDC 1VBC1 2VH9A 4ET7A 2MPFA 3B93A 1XUQA 2O57A 3WEZA 1T5EA 2G4IA 3VKNA 5I0RA 3UCSC 1RM1C 5D8AB 1ND3A 2R7EB 4Y22B 4XJUA 1K34A 4EZ4A 3ZFFB 3ILFA 3J7MA 4X8PA 4J6GA 1WLWA 1QDOA 3CJHA 1RXFA 4DUVA 3E8FA 5IAXA 3BCCH 4ZHNA 1GN4A 4LBQD 1TA8A 1LOBA 3HKDA 2AHZA 5A3MA 1Q5OA 2OIGA 4LBQA 1H8VA 2LJ2A 1EN5A 1QJX3 3ZBHA 3MIHA 4AEKA 3NAPB 3B09A 1MS3A 2YI8A 2KR2A 3KM5A 5E89A 2VE1A 4CEWA 4NAOA 4LF7O 4DV5B 3ZRWB 1JTZX 4IXLA 2FCTA 3RSJA 5FZIA 1NE6A 1VQ5V 4FI9A 5B1BC 4LF8O 3LE0A 5JIUA 3NVCA 1UMHA 3BFRA 5ITZA 4AGGA 4RFT0 1LNQA 1Q56A 4Y1ZA 4A42A 4EB6A 1GQGA 2XXZA 5FZ3A 5C5TA 3N4MA 4YM1A 3VZJA 2DCTA 2VMFA 2W68A 2WNOA 1AI6A 4IESA 2V73A 1LB2A 1RB8G 1RIRA 2GU9A 4WFAV 1TNFA 1OURA 3VZMA 2ZQMA 1SPPA 1Q8IA 2VOKA 4EN7B 3RW0A 4CCCA 1KKCA 2Y0OA 4PELA 4CDQC 4CCLA 2AW9A 3ZRVA 4LF6O 5F37A 5KC6A 2VXJA 4B3SB 3C2UA 2F1MA 2RHPA 5C70A 5KC5A 4DXWA 3PUQA 3APQA 4GX2A 1M4UA 3JBG2 4ZHQA 2FDKA 2VW1A 4XE9A 1HB1A 3IWZA 4XUQA 4QGPA 2RS11 4X62B 3JD73 4QPKA 4KU7A 3SPJA 1CGPA 4DV2B 4NMIA 2IUWA 1WCDJ 2HEVF 5FXWA 1OLQA 1SRYA 3OEBA 3V56A 3V0AA 4BU2A 1VE0A 1M90W 3PUHA 4FZ0A 4YM3A 4YHHO 2ATKC 2JDHA 5JAXA 1CAXA 5H9SA 1RTVA 3T0DA 3BVCA 2QJVA 2QTWB 1NQJA 1AR71 2XJQA 4RGKA 4ITCA 3LEMA 1CAUA 2ZGTA 1K8AW 1BQZA 2ZTNA 4ISQA 3VBBA 1R6NA 1UIKA 5KA5A 3L2YA 5BMVA 2GP3A 4AI8A 2XJUA 1MR5A 3H3UA 1GWMA 1TNRA 1OHHG 5C4WB 3V65A 2AXTZ 1TAEA 2P6CA 3R4SA 5EYPB 2WS92 3W20A 1DF0A 2HHHB 4FAHA 3P32A 4LH6A 1XOYA 4RR3B 1BVVA 1NG0A 2Z0AA 4HZ3A 1NR7A 2AZ2A 4QX3A 1G4YB 5FP8A 5LA6A 1AYM1 1YXBA 4Y26A 3RVHA 2DTWA 4LO5B 4K8XA 1J5EB 2DCYA 1X59A 1YVWA 3GGLA 3O1SA 1RVF3 4Z2WA 4RGGA 4LFCB 3N2KA 4IEUA 1AYN3 2MEV1 1JZ5A 3BCWA 3ELNA 1GICA 1GLHA 4CDWB 4DRXB 1BGYH 5J37A 2JG9C 3VBUA 3H7YA 1QLNA 1R1ZA 1UY3A 1PNKA 1CAVB 1H4HA 2PAEA 3ACIA 1DLBA 1OSGA 4JGZA 2Q1FA 1ZX3A 1MPXA 2Q8OA 3WY6A 4JI5B 1QXPA 3ETGA 2EALA 1Q3EA 2VW2A 3ZO0B 2A71A 3CHXA 2V5YA 4O4IA 5DN6G 1KUQA 2MHFA 4H13B 2JEMA 2WDBA 4NWWA 2AGSA 2OCHA 2XT9A 2X09A 2XLFA 1LOFA 3J81N 1S5JA 4YVWA 3EO6A 5J7MA 2ZS6B 4NOTA 1VQ7V 3ZKUA 2Q9LA 3D36C 4DUXA 4ZIBA 4QJFB 2QQOA 1VIWB 1F8VA 2OT5A 2B9UA 4NTWA 3RYHB 1M4WA 2QDNA 4XQDA 2WYFA 1Q6IA 5IVJA 1MS5A 2QZ3A 4XAAA 4CUCA 5F3IA 4AHZA 3ASNB 5BR8B 4CP9A 3WG3A 5F5AA 2CNAA 2QEXV 1V0AA 2W46A 5FP7A 2CK3G 3VKMA 4IE4A 1OA2A 5DUXA 4O4JA 1NBMG 2GN7A 1TMF3 5I8TA 5I8SA 4QPIA 1DGWA 2C1FA 4HSJA 1GM7A 4UXAA 3BIEA 2QFEA 2BOCC 3N7JA 3N7LA 3N9PA 3OUFA 5L3FA 5JCTA 1AP6A 4LF4B 4UW3A 4M0NA 4M3CA 3ABMB 4JQRA 4NHMA 2FZ1A 2Q7GA 4V1PA 4NB5A 1GZWA 2DYRB 2XJRA 2GSMB 2VZOA 3UKVA 2DQ0A 4E2GA 1NCQB 2E51A 4IE0A 1DG6A 3CRRA 5BNOB 4FPLA 4CH3A 3E22B 2XHNA 3P30A 1NU1H 1JYTA 4BE3A 1YC61 3VZKA 3WHTA 1CZTA 2IW5A 1NTKH 3EHKA 5CNAA 3HVDA 2D6MA 2OIIA 5HFLA 2I2SA 3IDEA 4ZOLB 1ZZ8A 3WQ7A 1T2XA 3ZFEB 4KG0A 4DR1B 1SA0B 3PVNA 4Y3OA 4HETA 3K04A 1RUI3 2GUZB 5DECA 4AHYA 1MSDA 4FJCC 4CXYA 1KP3A 1XNKA 5E79Z 3K57A 1S2BA 4OMCA 4LXLA 2K0GA 1TME2 2XDVA 4AFBA 3W5NA 1NH2D 4MSWC 4B3NA 2GMMA 2TNFA 1Q8OA 4HONA 2RDRA 1WN7A 1W6MA 5IY5C 2JDNA 4WM8B 3AG2C 5E8AA 4RS5A 1R081 2F4VB 3B8NA 4CEYC 2QCSB 1V9U2 3KCXA 3PU3A 5C8CC 3GDBA 1AILA 1DGWX 3IN9A 1BEV2 2N74A 4LNUA 4Q4V3 1S0FA 1R3KC 1S5HC 2GDFA 1X8EA 1MEC3 3WNMA 5I0SA 3BTYA 4K0KB 4GWJA 3TN93 3L9DA 4B7KA 2PLV2 1NTZH 4PHZA 2NPIA 1G8WA 2YUEA 4DMIA 5A70A 4GB33 1Y9MA 2E26A 2NMNA 1GNZA 1PVC2 4GKYA 3KG2A 1H8TB 4XPVA 2VXRA 3VBSA 3FBMA 1AL22 1SBFA 1JU3A 1N34O 3AG7A 2QKCA 5CA0B 1VQLV 2IH3C 5F6LB 1XSRA 1KYOF 3FFZA 5LHHA 3S5AA 2ZKOA 3T1CA 5D5PA 5BPXA 4MVTA 2QQVA 4FPYA 1VBD3 3B69A 3VHPA 4ASUG 4CDUA 3I56V 4YZ5A 1MEC1 4LO8A 5FJKA 1H2SB 4H14A 2VCAA 5LOVB 1YXWA 5J9PC 1SERA 3T2QA 3ZMUA 5JZGC 4MGQA 2WIIB 3MEPA 1KDKA 5JPNB 3HKEA 4QU2A 3ZPOA 2F23A 1HP8A 4PDWA 2DCJA 1REDA 5DAWA 1O4TA 1WA8B 2XH6A 1BQPA 3KT4A 3OR6C 1HKDA 2QWQB 1OLME 4KUMA 3QG5A 5CG9A 5KHKA 4H37A 3W58A 3LSQA 3NXSA 2Y60A 4N43A 1CZSA 1KEXA 4NAMA 1N32B 2HWC2 2XJPA 4K20A 1SQVH 2P3JA 1TUBA 2VG9A 4LWSA 4PDRA 5A32A 4F8AA 4BLIA 4F3JA 1WGPA 1V55C 2W1SA 4H7LA 4E2SA 3O7OA 5L9BA 3UV9A 4FBFA 4RD7A 5CG8A 4D7TA 4N9HA 1OOPC 3WF1A 4OPAA 2DBNA 5JOXA 2ZE5A 1XNQO 4E8CA 4WM7A 2CE4A 4GZRB 5BXZA 2ZABA 3FLTA 5IJ0A 2FMDA 2OUHA 1OF3A 1K73W 1WCSA 4DV7B 3BALA 2A0LA 4LK6A 2D5FA 4FAGA 1G86A 1PIV3 5C3OA 1HNZB 1WLCA 1UZYA 4EROA 2RR12 2GV9A 2JE7A 2D3OW 2W0FC 3CJIA 4C8DA 5JUVA 3RYCB 2WLIB 4BK4A 3QO7A 3WUDA 3BHPA 4PA6A 3U78A 4LE3A 5C9AB 2EXKA 3JARA 1QBZA 2WQZC 5JSRA 5FOJB 1HQLA 1UW8A 3VBRC 2XVKA 2JS5A 2CL2A 4URTA 4CA9A 3ZMSA 2YU1A 1W8HA 5GTHZ 1I6XA 5LBEA 3WNLA 5ERLA 5KLVH 1H2LA 2DQ3A 1WD3A 4HPKB 4JAVA 3FMGA 4XFFA 5F9TA 3D82A 4CSWA 2YC4A 1HRI3 3POJA 1T6GC 1L3JA 2P67A 2RN9A 2VTXJ 3MIFA 4TSVA 2CU5A 1EUUA 1GQPA 1RMU3 1XNTA 2X53S 3RYIB 1QJX2 5KXBA 1FS0G 5F32A 2PHLA 1QJEA 2KM2A 5FNVA 1AR4A 4KWLA 1SC5B 1C5HA 1O7FA 4Z82A 2XLAA 3WP4A 3JQXA 2Y6GA 1Q86W 4KBBA 4B29A 1VBE3 1KBHA 1RPOA 2VS0A 2A3WA 5IJ9B 1OMIA 2CH7B 3TETA 4J7ZA 1YHQV 2EILB 4BYYA 3NJZA 1WAZA 2OW4A 3S30A 3SJCC 1OCZB 3KGLA 2Z3YA 1K5JA 1B6QA 4PIYA 1LJ7A 4CEWC 4OYUA 5IK8A 3AK3A 2E6VA 1IGOA 5FZBA 3O9OA 3RRDA 2ZAHA 4O2BA 3O1PA 2VZVA 3E6BA 2GDSA 1OVPA 2VTXA 4AEMA 3U75A 1P7GA 4OI4A 3S5QA 1APNA 3D6EA 1TME1 2D6KA 1JMUB 4AQYO 4AEDB 3C7OA 3CD6V 4FPJA 4BAYA 4RYDA 1PO13 4OZOA 3JALB 4K35A 1YQ5A 3SYPA 1V9U1 2OTLV 4LULA 3C7HA 5L9VA 1SZBA 3V0BB 4WZFA 2JJ2G 1R3IC 2XMLA 4MHRA 2VOWA 4JV5B 1F15A 1XU2A 4L97A 3I2OA 3CCRV 5BUVA 4LKFA 2VM9A 2PLV1 1FYUA 2V4VA 4FLVA 3HR9A 1W59A 2FDIA 1XI1A 3WP5A 1PVC1 4R52A 4W65A 2JEUA 1OQ1A 3K77A 5KAFZ 4AOCA 3TWIA 4B08A 1AL21 2PI5A 1M56B 3G7DA 2EIJB 1WLDA 2P7TC 1GFF2 3DPRC 2H3OA 3WV6A 2E5LB 5EC1C 4AE2A 1N3PA 1I3HA 1FT9A 1OJHA 3L72H 4GT1A 3H1YA 3G4SV 2X6AA 1JYXA 2P3YA 1SS3A 3CRQA 2RDNA 5JOWA 5F5QA 3QACA 4DR6B 4AQTA 1YHFA 3DGEA 4AK3A 3M70A 3WCSA 1LU2A 2KKWA 1V54C 5IFTA 3RZKA 2EF6A 1KXGA 3ZX7A 4BA6A 5B1OA 1HV1A 1V6NA 1W2NA 1AI7A 2X5IB 3SCHA 1RVF2 3CEIA 5C5UA 4N53A 1YCIA 4L8QA 2H6CA 3PTYA 3ZXGA 4OPHA 5IYDO 1XL6A 4IGPA 4DV4B 1W6NB 4BH9A 1UF2C 3MI8A 4BW9A 3VQWA 3FD9A 5A6QA 1SF9A 1ND2C 3T1HO 5CAZA 5E88A 1WUVA 1LENA 3FX3A 3VBUC 5ACA3 1S76D 5JR2A 5J2TB 2WNUA 4YZ1A 4JCKA 4MGZE 1Y74A 2ZEYA 1D2SA 4JGZC 3IDAA 1AVBA 4UF0A 3ABLB 3I4IA 3BABA 2N05A 2ZOEB 3X2QB 2RR11 1YQCA 5IAVA 3DKQA 3KCYA 1X4TA 4RA0A 4NROA 3M7AA 1N1VA 4IHJB 1LGBA 3T08A 4OHWA 2V7QG 3OPWA 1ULPA 2KB1A 2AEZA 1FPN2 1KMIZ 1SQ4A 3SH4A 4DINB 3JD0A 4O61A 2QDOA 2ZEZA 1MS0A 4D69A 4CDXA 1XE8A 1JW6A 3ZHRA 3W5MA 1CR7A 1ZRIA 3KQRA 3M1HA 5FMDA 1Z78A 1WWYA 4NRMA 2HVKC 4XDJA 3A4UA 3MGUA 5C33A 1I5YA 4OUMA 1EN6A 4HOOA 4CH4A 1PK6C 3EFFK 2JX9A 2D43A 3FHAA 2ADPA 2RM22 4OX9O 2UYAA 5A33B 4J42A 4DR7B 3RWRD 5EYYA 1UU6A 1W3VA 5LK7B 3IC7A 2BVVA 2JD9A 4Y22A 5FK8A 3UGGA 5L19A 2A6VA 3ZFFA 2Y34A 3MW3A 3UKNA 3I3MA 1KQSU 5F3CA 4RWUA 5FZ1A 4K1ZA 3TRSB 3ZFGB 4OHXA 4LIUA 4H44B 2UUBO 2EIGA 1W3XA 1PP9H 4YW3A 3SGIA 4NXNO 2QBXA 3WW3A 5DZEA 1JUIA 4H3WA 4K40A 5BNPB 1REEA 1IZ3A 1ZREA 3NAPA 3CRCA 2WNVB 2EZOA 3SYOA 2FTKA 2IU3A 3MF6A 1UX7A 4MYEA 4RFRB 3WG7B 5JSPA 5L36A 2DYSB 3ZRWA 4OHZA 3T1YB 3AMNA 1VQNV 4RAIA 3H1HH 2J1VA 3I2HA 3MZHA 4TLGA 1H8HG 3J8F3 5F5CA 2HP8A 1S2EA 3WDUA 4OQ9A 4E9KA 3RZLA 1MG1A 2WA4A 4O4LB 1QJZA 1VPHA 3M4FA 3NV3A 1GU3A 3TBDA 4CPBD 1HLCA 5FQ0B 3TCUA 2VVDA 4L11A 2A70A 3B9CA 3KZIZ 1NT2B 2JDUA 4IETA 4NUBA 5FYTA 4XHXA 5IYZB 5IHRA 1N3OA 4CPBA 3ZSLA 2BERA 4GB32 2R0FA 4XMAA 2LRPA 4L2NA 4GULA 3JAKB 1WMDA 1MS4A 2Q0OC 1POV3 2YDEA 5L9RA 4RQFA 5EBLC 4IEWA 1UO9A 2BOIA 2WAAA 1D5AA 1N0NA 5EJ3A 1HXS2 1XMOO 3EXAA 4E4ZA 1PGSA 2EIMB 2VCCA 1C1LA 4GKKB 3ZX6A 4LFBB 1I9RA 1UQXA 4MH0E 1S0DA 2M7WA 1WCUA 4E4EA 3VBSC 4G2KA 2DCKA 1XE0A 3CC4V 4LR4A 4QNHB 2BU9A 4NJ4A 4NXMB 2R071 3K0GA 1GOHA 4O7XA 1NI8A 5JQGB 4O4HB 3BTXA 4DUYO 4M3CF 1LGNA 4FVMA 4CVUA 1YJNV 4MXWB 3WF0A 4XILA 2PAKA 3FBYA 2WSUA 4BIUA 4QGNA 1YITV 3WDXA 1GR3A 3CIHA 2WZR2 1B04A 5CIRA 2EINC 4LLFA 2A75A 3UO3A 3HJRA 4HVOA 1FXKB 1UYXA 1K12A 2QM8A 5J96B 2R70A 4UV9A 1PD3A 3T4DA 5C4WA 1XL4A 2OT7A 4AI3A 2ZACA 5EYPA 1HQWA 1ZSPA 3RZHA 2GNDA 3HD8B 3U10A 3ZS8C 2LW8A 4OULA 4I55B 4RR3A 2OS2A 1N8RW 2QM4A 4Q26A 3CC7V 4ARYA 3ZN6B 2ZR2A 3PJQA 2UY9A 3A21A 3IM0A 3ILNA 3UGHA 1P84F 3I49A 4N43C 3T4HB 1RITA 5JXHA 2UUAB 3EHBB 1A8MA 1Q81W 2YI9A 2XQXA 3RYFB 3ZYIB 4RHV3 2ORXA 5LP6C 4IV3B 1O3TA 1LOAA 4FOYA 5IYYA 3G67A 1DDLA 1AX1A 5DQ0A 1CAWB 4X66O 1QQCA 2R063 4EWAA 3ZMNA 1NOVA 4KHPB 4I3PA 4DEVA 4CDWA 5BNQA 1X50A 4DRXA 5FYYA 3SPIA 1IQDC 4BIFA 3MUZ1 3P6BA 2R72A 1CAVA 3LQCA 4JI0B 2CUGA 3SYAA 4DR2O 4HVRA 3JD3A 3NNJA 4Q0UA 3HPLC 1TVGA 1ZZBA 3H01A 4DXRA 4LTAA 2ZGOA 1RHI3 5F3GA 3CMAV 1AR93 4QM9A 3E97A 4XQ4A 5KMGB 5FCCA 1B35B 2IJIA 3H8UA 1XNBA 3K75B 4E8DA 4YW1A 1NX9A 2Y69B 4K7JA 3PTRB 3MIDA 3PN1A 1IS4A 4QGMA 4KMQA 5BYNA 3NJXA 4BXFA 3KS7A 4UCTA 4LHSA 3ASOC 2A3YA 4MTGA 3RYHA 4Q0VA 3JUUA 3SPGA 3HWJA 1R092 4AFCA 2PAMA 3BPZA 4EKWA 2XUEA 1OQDA 2R9RB 2RM21 1SETA 1VRH2 4ZI7B 1GM8A 1GOFA 3AP5A 3LDRA 1VBB1 2V4AA 1F9KA 2W92A 1EN4A 1DZTA 1YQ2A 1M57B 3W7WA 4BQ1A 3D0SA 1O9HA 4B3SO 3FE5A 4IL7A 5CFCC 4CU8A 5CMUA 1OV9A 1CPNA 4J7JA 1JZ4A 5JPMB 3SYCA 2BGCA 5KXEA 2DN9A 3SHRA 5KX5B 4I09A 4QKNA 2DURA 3OB8A 1JYWA 4HZFA 1LUWA 2HJIA 1NA1B 4I2OA 5LATA 5KHHA 3DUIA 1XEQA 1XQNA 5FY9A 5D2AA 4QX0A 1NCQA 2LROA 3I2DA 1VF6A 1C8NA 5CU1A 2XR4A 3OGRA 5BNOA 1O5UA 3E22A 1S1AA 2IJJA 3R66A 4QPGB 4I7ZB 3KV4A 5T5LA 1QQP2 1KP2A 3IMMA 3LSEA 1LHNA 4Q6GA 3CXHF 1MMMA 4F4LA 5HCBA 2YV8A 4DRVA 2J1RA 1UZWA 2VUJA 4ZOLA 2DF7A 4LHNA 3ZFEA 2DFCA 1SA0A 4BXSV 3JQWA 1R1A3 2AHYA 2QNKA 3ITQA 4DR4B 1OUSA 2GUZA 1OA4A 1WBLA 2CYFA 3VDCA 5EZYA 3CC2V 3QH6A 2Y4UA 1B3QA 3P5BA 5DDJ3 2WZPP 4UAPA 3U37A 1FATA 1HN0A 1PO23 1HRV3 2IVIB 2HHHO 1AF9A 1BCXA 3GVMA 5FP9A 2ZZJA 4QX8A 4DO0A 1W9FA 1SCSA 3C3TA 1DZQA 3BU7A 1XU1A 3HPNA 3JATB 4CP0A 4KQ7A 1QMJA 1LHWA 1ZWIC 2W1QA 4WM8A 4YJ2B 1NYWA 1VMJA 1XDCA 1HNXB 4FP3A 1YFWA 4UBHA 3QNEA 3HAGA 4AI1A 4IDZA 5A3NA 1O91A 2SBAA 1BMFG 4LFCO 3KWVA 1E79G 4HT1T 4TTGA 1HXS1 3AK2A 2F4LA 5GLWA 1UZZA 4LEJA 4XZUG 4JI2O 4JI8B 1EBOA 3UT5B 3KGZA 1RUF3 4FOVA 4R8CA 2PA7A 5FO7B 2EULA 2CTQA 3OMNB 3OY8A 2ZAAA 3DC6A 1U12A 3D3IA 2EIBA 5T5PA 4JI5O 5FPOA 2ZGPA 1WD4A 1AXYA 5JR7B 4DFSA 3HBZA 3LPFA 1H8TA 1RC6A 2FMYA 4HNAB 1GNHA 5F7UA 2CGNA 5IWFA 3WP6A 2GC1A 3NSTA 3MDSA 5LY2A 3OR7C 4UB8Z 1Y3TA 4W50A 4ZY9A 2VBBA 2RDQA 5CA0A 1YI2V 2NP0A 3AMHA 1MZ5A 3WNNA 2WZR1 1OKQA 4XUOA 2WAOA 1W6PB 2G9FA 3POYA 2ZGUA 5CFDB 1BBT3 2JVDA 3EYPA 4H2AA 3ZYFA 2JE9A 1RSOB 5LHGA 2IXCA 1GRJA 5KHJA 3OCPA 2HWB2 3Q8CA 3L74H 4DUZB 3VKLA 1WJZA 1OI6A 2Q67A 5BR8O 1RM1B 5LMUO 1F4NA 4RQPC 5LOVA 1YFYA 3J7LA 4QDSA 3VBHC 1QOSA 1UY0A 2CAZC 3FUQA 1SQPH 2QQUA 4N53C 3CCVV 4AVSA 3WOGA 5LBCA 4MGIE 4IERA 5EK0A 1WA8A 4XMIA 1WNSA 1SQFA 5FL7G 2WFF3 3KV9A 3T4VA 1G1XB 4P5HA 2B45X 3THDA 3I59B 3OEHG 2Y6JA 3AYEA 3PVOA 3ZYHA 2M6YA 2WNUC 2VGDA 1Q8PA 2VQFO 1I1EA 1AR63 4N9IA 1UY2A 3LZZA 1OPMA 5B1BB 5A7QA 5FR3A 2W5FA 1LCLA 2P3KA 4DQAA 1S72V 2WL1A 1DQ0A 2HJDA 1BKZA 5GONA 1SLCA 1JN2P 3ABKC 3OGSA 3SNMA 3VL9A 1W8ZA 3NNGA 4LITA 4LP8A 1I08A 1QXJA 4X89A 2FB5A 1H30A 1GM9A 2UU9O 5JXJA 1PL0A 1UMZA 1QXRA 4MOAA 3NWKA 2C0ZA 3HT2A 1LEDA 2RDSA 1X82A 4FPCA 3UO2A 3AM2A 1IBKB 2GALA 5A3WA 1QU7A 3RYCA 2WLIA 4JRAA 4QB1A 2G19A 1JYIA 4Y4YA 1R091 4CDXC 4AVBA 5KUMA 1LU1A 4CDQB 5C9AA 4QQHA 2PTMA 2L9LA 4Q20A 4HAMA 2D6OX 2Q73A 1VRH1 1NTMH 2UURA 3QLQA 2OCCC 1CN1A 4B3RB 2A3QA 1KFUL 2ZE6A 4C90A 2VD7A 3RVZA 1DYKA 3GZEA 2HWD2 3E83A 4HPKA 3NV1A 2Q1MA 4ATEA 4AFDA 4LOSA 5FDBA 4TLFA 2P22C 2VECA 1Z5VA 3AXEA 2OIEA 2Z69A 5FLJA 5T5JA 3GNEA 4QHBA 2Y6KA 2ES3A 3SEPA 1X7NA 4R4XA 3CPWU 1AZDA 4GWNA 3RYIA 4MUVA 3IAPA 2XWBB 2Y4TA 4P9JA 3CZUA 4XIKA 4AG4A 4QHZA 4JYAO 5AFEA 2WO3A 4M00A 3P3PA 2WWSA 2ILMA 1QQP1 2JK5C 3B8MA 3NQHA 4YNIA 5IJ9A 3A0RA 4JI6O 2CH7A 2BYVE 3I5DA 4JX0A 4UBGA 3WZ1A 2IBZH 3PVEA 4BDVB 2OPWA 5H9CA 1RUG2 4I0XB 1K4DC 3F7VC 3J8F2 3FB5C 3WDVA 4LT5A 5K1PA 3NMBA 2VQ0A 4UFKA 3C3SA 3AZXA 2C2AA 4DW0A 5LMNB 4N7UA 3DV8A 4A45A 3QCWA 3UKMA 1H1AA 1BT8A 4UVBA 3VDDB 3IPVB 1Z7S2 1K42A 1FI2A 5A7SA 4TWTA 2WLMA 2O8OA 5FY7A 3POEA 5L3EA 3RN4A 3OW2U 3O12A 1UNBA 3AXDA 1VIBA 1RGSA 4MVZA 1RUD2 4AEDA 3BEHA 1CX1A 3ZRXA 4CCMA 4YGBA 1GN3A 4JPRA 3U4XA 3JALA 3BGAA 3ZSKA 1HW7A 3KB5A 4CZSA 3V0BA 2JG9B 3FWEA 2MW2B 2BJSA 4Q4X3 3ILRA 3OGIB 5AVPA 4FTEA 5JVDB 3RQ0A 1J58A 3HQXA 2JWPA 3APOA 4J9ZB 2F4PA 4JDOA 3NJYA 1GWLA 4LUKA 1A32A 2QJ1A 3KV5A 4P00B 1ALYA 1BZKA 1KRIA 1XE7A 1OC1A 3N2GB 4NVPA 1IBLO 2D97A 2ZGSA 2A3XA 4UB6Z 4PCRA 2ZHLA 2YBSA 2PHUA 3BI3A 1H6XA 1ULGA 3F2ZA 3ACLA 2VMIA 2E63A 4I9WA 3AFGA 4HSLA 1NAEA 2IXHA 3B3QE 1SBDA 5LZ6A 3LSUA 4ZS2A 1XNDA 3AFKA 2DOSA 2WLKA 1JI6A 2X7RB 2Z4FA 2HWB1 1QR8A 4IE7A 4BQWA 5C8YB 4IV1C 3VD4A 1PNFA 2CHHA 3QF7A 2OUJA 2Y26A 2QUOA 5E1AC 3RZJA 2WSVA 4JYBA 2OTJV 2ZE7A 5FZOB 1G9AA 2AGAA 2ODMA 2FBEA 4YLZA 4O2AB 1US3A 1V6OA 2WINB 3SJQC 4IQPA 4A44A 4K21A 5IATA 1HR0B 1ZZ9A 4AFAA 2I45A 5AVAA 2DUQA 2J42A 2X5IA 3RFRA 3F5TA 1XHZA 2R062 3E5QA 5F8PA 5FZ9A 1NVPB 4Y24A 1W6NA 3OBRA 3PUSA 1ZM1A 2YGLA 2NN8A 3LB9A 1RUE3 2J1TA 5C71A 1C1FA 3B00A 3EVKA 3ZM8A 3VV1A 3E2EA 2XUMA 5IWAB 1EZJA 5FY8A 1OF4A 4BM8A 4LPLA 3M7MX 3TYJA 3CWBH