3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
3IIAA 4R52A 3FE5A 5LEJA 4XFFA 1O3RA 1WLTA 1UPIA 4LEJA 4QXKA 1QXJA 4I0AA 4Z82A 1DGRA 5LRSA 4YSFA 4TLFA 2QCSB 4IERA 3SMHA 5FLIA 4IETA 4BH9A 2ETEA 3RDIA 2OZJA 3PLQA 2UY9A 4IEUA 1XRUA 4AVAA 4HVOA 1Y9QA 1LB2A 3USSA 1ZZ9A 3S7IA 4META 4AXOA 3UKVA 3M3IA 2H0VA 4IESA 2I45A 4N9IA 1ZX5A 3FWEA 4MGYE 1VR3A 2PHDA 3LA7A 3S0MA 2CAUA 4PIYA 2VQAA 2PHLA 1NYWA 3CF6E 1OMIA 2VPVA 3I59A 1YFWA 4XEZA 3D0SA 1CGPA 5FPXA 3ROUA 4HVRA 1CAVB 5I8SA 4IEZA 1GQHA 1J3PA 4Q0QA 4Q0VA 2UYAA 5I0TA 1SFNA 4N9HA 5CU1A 3HQXA 5KHJA 3H3UA 3E6BA 4BYYA 5FQ0B 3WW3A 4E2QA 1O5LA 4BHPA 3ES4A 5EZWA 4EV0A 1VP6A 1J3RA 2ATFA 2HJIA 5FCCA 4JTOA 4B29A 4YRDA 3D82A 2MNGA 4JVAA 2B8MA 3RYRA 2IC1A 2XLAA 3FFQA 4HBNA 3CL1A 3JZVA 1O4TA 2PYTA 1RC6A 3PVBB 2Z69A 4FAHA 1UCXA 3HIFA 2FMYA 5AVPA 2P17A 2GC2A 1OD5A 2Y0OA 4MV2A 5E1RA 5E16A 2IXJA 4XFIA 4D7SA 4ORFA 2D5FA 3DN7A 4HSLA 1ZVFA 4EWAA 3H1MA 4KU8A 4QM8A 4K8FA 3IDBB 4IEVA 3WW4A 4MZUA 4QMAA 2GC3A 2IXLA 1UD1A 3EBRA 4IEQA 4RD7A 1H1MA 3ES1A 4I02A 4Q0UA 2CGPA 2QDRA 3H3ZA 1O3TA 4HSJA 1O3QA 3LA2A 2XLFA 3MZHA 4I0BA 5JR7B 1ZZ6A 2ZKLA 2ET7A 3H9AA 4JV4A 5I91A 3TNQA 4ZU7A 1EY2A 3H7YA 3U0ZA 4Q0PA 3B02A 3C3VA 4Z07A 1LR5A 3RYKA 2QVSB 2OZ6A 2XKOA 5I0RA 4I3PA 3RZZA 1YHFA 2GC0A 4IEYA 1PM7A 1X8EA 4UBHA 1YUDA 1J58A 2XHKA 5CADA 2K0GA 2O1QA 2XKPA 1CAVA 5I0SA 3DV8A 5FLJA 4LA2A 5CVRA 4X6RB 4XFCA 3EQEA 2XGXA 4MGIE 3RNSA 3ETQA 4KWKA 3NJZA 1O5UA 5FQ0A 3KCCA 1RGSA 3EHKA 4J1XA 1UW8A 4X6QB 1O3SA 3GYDA 4O9EA 5JCTA 3E6DA 4YYOA 4HN1A 2GZWA 1LRHA 4NVPA 4XF3A 2GU9A 4J1WA 2DCTA 3EO6A 1V70A 2IXCA 2WFPA 2UYBA 4QGLA 3S7EA 1GQGA 1UIJA 4EROA 1J1LA 3KSCA 4AQ6A 1RUOA 4LUKA 3NW4A 4R8HA 2PAKA 3BALA 4UBGA 1CAXA 4GULA 5KHIA 4YARA 1IPJA 2BNOA 3KMHA 1ZZ8A 3ELNA 1ZNPA 2WC2A 5K8SA 3LOIA 4D7TA 4F7ZA 2MHFA 2BGCA 2H6CA 4LA3A 5EFUA 5KHKA 2PAEA 1RTVA 4BIFA 4ONUA 5BXXA 1NZCA 1ZZ7A 3CJXA 3H50A 4XF0A 4FAGA 2GAUA 3H1YA 3CLPA 1FXZA 1U12A 1YFYA 1YFXA 5I0UA 4EWDA 4A2UA 1CX4A 4MGKE 3SCFA 2XL9A 1YLLA 5HI0A 3SHRA 3GBFA 4LULA 1QXRA 2IXIA 1LKNA 3HT1A 3OCPA 1WGPA 2Q1ZB 4OLLA 3E5XA 3VHRA 1RUNA 4O9GA 2PAMA 1XE7A 2VECA 5LEKA 1X8MA 5LRRA 3D0JA 2F4PA 5BV6A 1IPKA 3BCWA 4XF4A 4AVCA 2GC1A 1CAUB 2OA2A 5I8YA 3CEWA 3I7DA 3BB6A 3I59B 3WW2A 1DZTA 4P9GA 4KU7A 1FT9A 4WBBA 4JTNA 2D5HA 5J7MA 4OFGA 1J59A 4HMZA 4XFBA 3BU7A 5JAXA 3E97A 4FBFA 2Q0AA 4XFGA 1X82A 3L2HA 2ET1A 4MUVA 1PMIA 2QNKA 2BNNA 2IXKA 2MPFA 5C8WA 1TQ5A 3U10A 4L11A 3DKWA 3E5QA 1WA4A 4I01A 1RL3A 3QOPA 4PIXA 2IXHA 3LZZA 3CO2A 3U11A 2XLGA 4QGMA 2OPKA 2UY8A 1L3JA 3UKNA 3RYPA 4ZU5A 4IEXA 3NL1A 4KWLA 3SXWA 3OGJA 4CYDA 3EJKA 4IEOA 4XETA 1OI6A 4YNIA 2ZCWA 2B5HA 4PIZA 5BUVA 1X7NA 3H8UA 3H7JA 4UXAA 5JSPA 1ZZCA 4ZU4A 2D40A 2B9UA 1J3QA 3OF1A 2PTMA 4XF9A 1QY4A 4LLOA 2BEOA 2D93A 5FPZA 3PNAA 5I93A 1ZZBA 4I09A 4XFAA 2E9QA 3O14A 4QX5A 3IBMA 3FJSA 1XE8A 3DL3A 1NE4A 2EVXA 4LTAA 4L2NA 3MDPA 3OTFA 2C0ZA 2Z2SB 2HKXA 3NKTA 4HN0A 3SCHA 1CAWB 1HW5A 3I54A 3IWZA 1CAUA 2O8QA 4F8AA 1Q5OA 1Q3EA 5J48A 1Q43A 2BYVE 3R6SA 4IEPA 4KL1A 3E6CC 3TNPB 3LWCA 3KGZA 5KHGA 2CV6A 2PQQA 4EWEA 3G7DA 1ZRDA 3UKTA 1FI2A 4HLTA 2PA7A 2Q4SA 1YFUA 3NSTA 5BY5A 2PFWA 2KXLA 1ZRRA 3M70A 1SQ4A 2N7GA 3ST7A 2CAVA 2FQPA 1JUHA 1OFNA 3FHIB 3QACA 4QGNA 4DINB 2QJVA 4AVBA 1EPZA 4HZFA 3KGLA 1DZRA 4MH0E 4AQ2A 1ZREA 5JSOA 2EAAA 3RPQA 4QM9A 1YWKA 5BPXA 4E2SA 1CAXB 1Y3TA 2XL7A 3MYXA 2OYZA 3ZDSA 4IEWA 2K9ZA 2V09A 1EP0A 3IDCB 3LAGA 4XFHA 5F1RA 1EYBA 3MPBA 4LUMA 1G6NA 4FT8A 4MGZE 4Q29A 3E5UA 1NXMA 3H1WA 1DGWA 4H7LA 1I6XA 1VJ2A 2EA7A 1NE6A 2BNMA 3LA3A 2Q30A 4PJYA 5JSRA 5KHHA 5KBFA 4WZCA 5J3UA 1QWRA 1O7FA 5D1IA 5FLHA 4XF1A 1SEFA 3ACLA 4MX3A 3SCGA 4KWJA 1ZRFA 4I2OA 1ZRCA 3BPZA 3WW1A 3FZ3A 4WVZA 5FDBA 5I8TA 1UIKA 3OD0A 4Q0SA 5T3NA 1CAWA 1H1IA 3HT2A 3NVCA 3FX3A 1I5ZA 2H6BA 3N4MA 5C6CA 2GH2A 4E2GA 4HVQA
chains in the Genus database with same CATH superfamily
3QTCA 3ZR6A 5LEJA 4UV8A 4GKJO 3O7OA 3DSQA 2JG9C 3P3PA 1W04A 4BH9A 2JIZG 2RS51 4HVOA 2AZ5A 1XNQO 3I4IA 5FZAA 2A5ZA 5FYTA 2WLKA 5IWAB 2B45X 3ZO0B 1IVSA 1DF0A 1BQ0A 5DUUA 3P1IA 4L9BA 3CEIA 4JI6B 3TEZA 1SC5B 2KA3A 1OQ1A 1FPN2 2WRAA 4IXLA 1J3PA 2UXBB 5DG2A 2OCHA 4NIGA 1XSRA 4C7UA 3ZPOA 1NY71 5CU1A 1VLNA 2RJKA 3AK2A 1SS3A 1SLBA 4FLVA 1HNWB 5J36A 1BVP1 2VMFA 3JU9A 4K8RB 1FFTB 4MADA 4JI7O 2B8MA 4X64B 3PURA 4AHXA 4CDWC 4HBNA 1JYCA 2N04A 3IPVB 1S2EA 1O4TA 3FX7A 3J26N 3FBYA 2D6LX 4FFHA 4FI9A 4UFKA 4ZZ5A 4PA9A 4E4SA 4UFMA 3CCEV 3JD2A 3IKWA 4J80A 4QMAA 3RJ2X 5EV7A 4CH4A 1ZBA2 5IFTA 4JQRA 1W3XA 2WLLB 2ZEWA 1YIFA 3WP5A 3CNAA 5K7PA 3SJCC 1G9DA 3CCVV 3B02A 2VZRA 3N2GB 2YY1A 4IEYA 1S0EA 1KGYA 1VMHA 4RR3B 3WINE 2XHKA 1H2SB 3E2EA 1VBA3 1AYN3 2WNVA 4XVHA 2VAUA 5CVRA 1KECA 2O14A 4Y5SA 5CA3A 4DS0A 3PN1A 1UZ0A 2X10A 3FLTA 1GV9A 1F4AA 1CESA 5EWSA 1YJNV 1UWWA 3ZSEA 4HN1A 2V4AA 5JIUA 2CY6A 4BQYA 1V6MA 4M3CF 2HG5C 3KS7A 5BZBA 1L7QA 4NMIA 5H5NA 4OQ8A 5A3LA 3J7HA 2YFUA 4FLWA 2W08A 1NVPB 4W8JA 4O61A 1CP9A 4IV1B 5FLXN 2Q7GA 4AFCA 1VQ8V 3CJXA 4BQXA 1AR71 2RDRA 5GALA 1H8EG 3VQXA 4EWDA 2GMPA 3JARB 3AYEA 4FPCA 3H0OA 4DR6B 3J81N 1MZFA 2FB5A 1TMF2 1B06A 3AP5A 3CC2V 2QWOB 4JRLA 2XONA 2R041 5KX5A 5B5EZ 4PV1B 1SA0A 2LW1A 1P8JA 4AR2A 4DR3B 2LGWA 3WP6A 4YZ5A 4AVCA 4XZUG 4P02B 4CUBA 1W6NB 4YZ3A 5E88A 4HPKB 3VBSA 2ZHKA 2HWC3 5A6ZA 2GTAA 4FBFA 2EXJA 1SLCA 3L2HA 2JXAA 1PO13 1PNMA 2IZWA 2IXKA 4GKKO 1A78A 1WPBA 3ZIXA 2F17A 2X7RB 5LGUA 4PDWB 4QE9A 1D4M3 1UKRA 3CZJA 3OSDA 3RYPA 1QVFU 1XU2A 4AHZA 4QHOA 3H42B 1VMJA 3RG0A 3TK1A 1XJAA 5KXDA 1R73A 1WBLA 4DEQA 5CFCA 1VMFA 2KM2A 1K5MA 3B01A 4IV1C 1VP7A 4UYBA 3HKDA 3IBMA 2RS32 2BQPA 5LYJA 1PVXA 5FYSA 1G6UA 2DQ3A 4L2NA 3L75H 3QO7A 2HVKC 5DDJ3 3SCHA 3FL7A 1HV0A 4PD4F 3KGZA 3Q4HB 1F4NA 3K75B 1QHTA 1W8NA 2VW1A 5EHDA 1MZ6A 3URFA 1TZOA 5JXIA 2VXRA 5C3QA 4I9WA 4U2AA 4NN0A 2DBNA 5LASA 4YW4A 1BMV1 1JQ0A 3QD6A 2P4KA 4EN9B 4AW7A 5L36A 2Y34A 2J1UA 4AQYB 2EIMC 1GMMA 4DR4O 1RUF1 1IPSA 4XHBA 4PDWC 1JBCA 3TAYA 4K3UA 2VNVA 1AR62 1GU3A 2E51A 1VJ2A 2A6WA 4CDXB 1W6MB 2BSKA 1SDDB 4DK0A 5LGNA 3GWKC 1TVKA 3RQ0A 1JMKC 5AC92 4UF0A 5FP4A 1GP5A 1BEV2 1UIKA 5EYXA 4YJ3A 3EFFK 4H2AA 2XJUA 4DO2A 3BTZA 3S3WA 3ZMUA 5EYPB 4JI1B 2FDFA 4R52A 1KP3A 3B69A 1VMGA 2G4IA 4BIOA 3SGIA 4N53A 4WBNA 1QLEC 1COV1 3I3MA 3ZXLA 2G19A 5K0UB 1OKOA 4DV7O 4XDKA 2OTJV 1ENSA 4YM1A 1KRIA 2P6HA 1M4WA 4META 1XDCA 3VZLA 1XQNA 4RYDA 3C7EA 4BQ2A 2LALA 3PMEA 5FXVA 4BQ1A 2CTRA 2OIIA 4CP0A 2Y4UA 2D2CB 3OOXA 5T52A 2Q8DA 3OTOO 3D0SA 1LEDA 1EUTA 4B3TO 5A7OA 1G7YA 3DYPA 2WNUA 1VQOV 1QR8A 2IM9A 1SFNA 3MHZA 1ENXA 4LOSA 1NKGA 1SERA 4H33A 2O0OA 5LBBA 1C8M1 4I50B 1J3RA 3AL6A 1FMD1 3K3NA 3AX4A 2ZEXA 2IC1A 4G4FA 4JQTA 2XB6C 5C3PA 1NQTA 2J1EA 3LEMA 4MW3A 2LUWA 3FUOA 1NY72 4CDXC 3HIFA 4CC6A 2FMYA 4W6WA 2ZAAA 1AP5A 4DR1O 1FOD3 4K1YA 1K45A 2YHJA 1H2GA 1SACA 5CBHA 1X33A 4RN5A 4MT8A 2BPA2 2XVKA 4PF5A 3HKCB 3RWRD 3OG2A 4JZ2A 4I02A 2ZEZA 3LE0A 3H1IH 4JAAA 4TV8B 4HSJA 2JENA 2UXCO 4I0BA 3CHXA 3TNQA 3TGUH 3O1VA 3H7YA 1M56B 1QEXA 3U0ZA 3ZYPA 3AJYA 3SC7X 2QVSB 3BIWE 5K0UC 1TNRA 4PI2A 2RS12 2W5FA 1YUDA 1IZ3A 1SZBA 3NQHA 3TN92 3WU2Z 3ABKB 4MVSA 3DV8A 3DECA 3W7TA 4CCKA 4LMFA 5JCOA 2YUAA 3DTUB 4KWKA 1UOBA 4Y1YA 1KJRA 4FPOB 2RMU1 5B66Z 5JCTA 2EINB 3MLKA 1NCQA 2GU9A 1BMFG 1GMGA 5FZGA 3DC6A 4QB6A 2DF7A 4MLOA 2FHRA 4GB31 4NJ4A 3MICA 4ZOLA 2QFEA 4Y20A 1CAXA 4PDRA 3ZRWA 4HKOA 1HRI3 1V9U2 2QQVA 4WZFA 1RUJ3 3M7MX 1ASJ1 2WT1A 3TOJA 2XAJA 3SLIA 1OH3A 3BABA 2OQ6A 2R7EB 3V0AA 3D36A 5C3OA 1VQ4V 1NTMH 4NR1A 1RUD1 2QQIA 3NNLA 1YFYA 1HR0B 3P6BA 5E8AA 2AENA 3BIEA 3U14A 5HI0A 1PZ7A 5A3TA 3RVZA 5FZDA 4PELA 5H6QA 3MIGA 3Q8FA 2V4DA 3WY6A 1M56C 2IFWA 4O4LB 4JGYB 4OVEA 1AR72 4I30A 2P67A 1SBEA 1QQP2 2QR4A 4XF4A 5I8YA 3U4SA 2WO2A 1HJFA 1QNMA 4Q4X2 3M7AA 3THDA 3FKSG 1KD7A 4UCSA 1EZVH 1SLIA 4QX1A 2ZNJA 2ZX3A 5C8CC 2DCYA 1YVWA 4QDRA 4H3WA 2EINC 3GNEA 4YVWA 2PYJA 4BM8A 4MTXA 3OM3B 3DKWA 5IJRA 4AEKA 4XW3A 5HPOA 3T2TA 2EIKC 5C5UA 1FFXA 1R091 3B77A 2Y6FA 4MGSA 4TUYA 2HWB1 3AMHA 4KWLA 4G2KA 5T50A 1V6JA 3W58A 2Z3YA 1IS3A 4Q1RA 1XB9A 4CVUA 4GYCB 2Z4FA 3JUUA 3K5OA 1H8TA 3SPJA 4X66B 5T5PA 5A32A 4DV3O 2JDIG 2K1EA 2JG8B 3RMYA 5HV0A 4I09A 1XNRO 3OBZA 2R6QA 5L3FA 1OFSA 3IJ4A 3OBTA 2UUBB 1OZ0A 4PDMA 4W4ZA 1IX9A 2J1TA 4JGZB 2ZE6A 2P4VA 3ZN6B 3E6CC 2KKWA 2ZCEA 4O7XA 1XOUA 4LF6B 3H1HH 1GUIA 3ZMSA 2WO3A 2VVFA 4UAPA 1YFUA 4CUGA 2XOKG 5A1LA 3RYCB 3LFMA 1Q8PA 2GALA 1BE3H 5LA1A 2QWNB 5ABJA 1AVBA 1EPZA 4MH0E 1R082 3E8BA 1M06G 5JSOA 4QPGB 5IYBO 4LF8O 4Y26A 4FK5C 4X1IB 2Q7EA 1JX9A 3VD9A 5C8YA 2SLIA 5IUQA 4XJAA 2XQRA 2R1DA 4IL7A 4FT8A 2UWBA 5DZGA 4E4DX 5FOJB 2CE4A 4Q1PA 3FAVA 2ZPXA 4S2HA 5M0TA 3RZKA 5D8AB 5LK7B 3BEHA 4IYHA 3ZYRA 3V0BB 2JG8C 1QDOA 1LU2A 4TOIA 2EIJB 2WO7A 3R0RA 1LAJA 5LRSA 3SEEA 4JGZC 1L1FA 4GJYA 3MI8A 4FTBA 1TME1 3LF7A 3BUCA 1RIRA 5KC5A 1IBLO 1GICA 1BLZA 1JYWA 2BWCA 3QLQA 4HVRA 3Q9OA 1BCXA 3TWIA 3GBWA 4Q0QA 5I0TA 1HQWA 4MHUA 1GZWB 4J6GA 3HQXA 1T6BX 3F7YC 1EV11 1YI2V 3HQRA 4B3MO 3SR2C 4OHWA 1QMJA 2B7YA 3NJVA 1CZVA 5FYVA 2MNGA 2GNBA 5JVDA 3AB0A 2WINB 2XWBB 1WLCA 3MIFA 3V56A 3PVBB 3RWKX 3I3BA 3FLPA 3JBG2 5E16A 4LFCB 1FYJA 1S0DA 3OD4A 1AYN1 3D3IA 2CH7A 3LSSA 2Z5UA 4XUPA 4GMP3 1QJX1 3AP7A 5LMNO 2C26A 4G28B 1UD1A 3M3OA 2ZHLA 1E57A 1HIXA 5FXXA 3AK0A 3K9AA 5CMUA 1EAH3 3VD7A 3H8XA 1SFPA 5LZ6A 3SH5A 1KJLA 3LCPA 3H9AA 2EIJC 1DYPA 1K42A 5FY4A 3WNNA 5IK8A 2JE9A 5LA2A 1AYM3 5C33A 4QXCA 1SQXH 1X8EA 3OPTA 4HL0A 5FZLA 1CAVA 4XXAA 2YFZA 3B9IA 1B04A 4AGVA 2PMWB 4XJ8A 2W47A 2ZOEB 2BVBA 4H44B 4BLIA 3GYDA 4O9EA 4JI2O 2HYKA 2DCJA 3A0HZ 4NVPA 3N35A 2DCTA 4GWIA 1RUI2 4RA0A 1FYUA 1OUXA 4AF9A 1PZ8A 5HCHA 4MGTA 4XTPA 3AG3C 2RE9A 1NKDA 1GTOA 5IW0A 1BBT2 4AQ6A 3WUDA 3O1TA 1W9WA 2DBIA 2JDKA 4LKSA 1IPJA 4QKDA 2RMU2 4XDOA 1ZNPA 4KQ7A 5EC1C 2WLJA 3JSLA 5EJZB 1LR1A 1XL4A 3G80A 2H6CA 4LA3A 3RFRA 4M4RA 1D7PM 2B39A 1HNZO 5AFEA 5JJEB 1NA1A 2P2KA 3OEAA 3TEXA 2K9PA 2A71A 4XF0A 3H1YA 2UXNA 2NMNA 2HWC1 3ML0A 2Q69A 1KS4A 2W94A 3JD73 1MR5A 2XL9A 1Y76A 1I9RA 2VQTA 1PPJH 4JYCA 4BR6A 1VBE2 4GALA 1PO11 5FPUA 3ZN0A 4LWSA 1W9TA 3C3TA 4ZHQA 4XCAA 1XE7A 4M4PA 4DUVA 5LY1A 4NHMA 2ZX0A 2WLHA 1RHI2 4CH5A 1VAMA 2OA2A 2XXZA 3BB6A 3I59B 5BNNB 2OW4A 5LL6Y 3K4AA 4KXRA 1O4ZA 5C71A 1N1VA 1GOHA 4Q4Y3 5T5OA 4YY3B 4KP4A 1H2MA 1UFIA 3RZLA 3ABMB 5IK7A 3IT8A 4YPJA 1WWYA 1IHMA 2WT2A 4X88A 3T1HB 1JTZX 3LIGA 2MPFA 4E27A 4UCOA 4JI4B 3AL5A 5C9AC 2HEWF 3RRDA 2P37A 1I0HA 2H8PC 3OY8B 3FB7C 5JH7A 4JX0A 3ZXJA 3EJKA 1LHUA 1TUBA 3H8UA 4OHVA 1QJU3 3WVJA 3ZXKA 2I2SA 3OF1A 3C7OA 3WF3A 3ZX7A 1KQRA 3CRCA 3VZMA 3UYJA 3P3NA 3NAPA 4HOOA 2R9AA 2ORXA 2PLV2 4IYIA 4P9JA 1QCEA 2C0ZA 1GQPA 3VHOA 2JEXA 4P2ZA 1N47A 3UETA 4LO5B 5ITZB 5J2UB 2YGMA 1SZTA 4EB6B 1ND3A 2ES3A 4LF5O 3T1YB 4HLTA 3OFNG 4BXSV 4JAUA 5BY5A 1W90A 4BU2A 5BNNC 1TGOA 4J7JA 3OYWA 3OB8A 1XL6A 1Q81W 3FHIB 1AR81 3GVMA 3WSOA 4AVBA 1DFQA 3VBBA 3JAKA 2G9GA 3CPWU 1HXS3 4Q4W3 2YYOA 3WNOA 4D6SA 4JI0B 3C7GA 4MGZE 4LKEA 5ERLA 3MW4A 1OCCB 4AILC 1UYPA 1DYOA 3JAWA 1HP8A 1OJHA 5CA0B 2Q30A 1RM1C 2D3PA 1QWRA 1CPMA 5GONB 5BNPC 1SEFA 5KAFZ 3RVHA 2XOMA 5AG2A 3LUTB 1QVGU 2YUEA 3VQWA 4J9ZB 4Y5Z0 5K1PA 3HKEB 2GH2A 4NRQA 3J7LA 1QH6A 3IAPA 1UPIA 4LEJA 3AC0A 2IFRA 1V6NA 1VBB3 1MG1A 4I0AA 3B40A 3ABUA 4IERA 4ZXKA 1U5YA 4IETA 4JYBA 2UU9O 1IXBA 3OR7C 3PLQA 2UY9A 2R063 1VF5B 3IMNA 4OUSA 2BGPA 3VD3A 3CC4V 1JU4A 3PIJA 1RINA 3AMPA 3T1LA 4DV7B 2JDUA 2VZSA 5FY7A 1B09A 4X1YA 2PHDA 2QWQB 4OHZA 2Y6HA 1X9PA 3VBUB 1MSDA 4W50A 3JASB 4XEZA 4RS5C 3SDLA 1AL0G 1IG3A 5FMDA 1CZSA 4ET7A 5LK5A 3GCWA 3JXSA 4YGDA 3VL8A 2XUEA 1CPYA 5LXTA 5EBLC 3TETA 4OGQB 4YGBA 2E32A 4FLZA 4XQWA 2XAFA 1AR5A 3PIGA 2VMDA 2VCBA 5GLUA 1OCCC 2PYTA 1YXBA 3N9LA 1VQMV 4ATEA 3KV9A 1WBFA 4NPRA 3CRAA 4HYOA 4X62B 4BCUA 3H1MA 1NR1A 4M3CB 4CDQB 1DYKA 2XJPA 4K8FA 4B3RO 2R072 5CA1B 1H1MA 3NWKA 2JS3A 4C0BA 1IBMO 4DZGA 1KP2A 1O3TA 2QQLA 4Q6GA 3MW2A 4U7OA 4OXSA 2RM23 2EJ7A 1MEC3 2LROA 1ZZ6A 2ET7A 3SITA 1OF3A 4XAEA 1VBA2 1HKDA 5EP9A 1LOBA 4V2WA 3RZHA 2XKOA 5I0RA 1YNAA 1PM7A 4YHHO 2Y6JA 3ITQA 2UWCA 5F9TA 2K0GA 4LFBB 1HRI1 3I3EA 1H8VA 1RSOB 1RUJ1 3VBHC 2Q7HA 4PA3A 1Z2GA 1EN6A 2VCMA 1PGL1 4IGPA 3DPRB 2I07B 3GZAA 1V70A 3PVEA 4OI4A 1FXKB 1OT5A 3CJIA 3UGFA 2ERFA 4EN6B 4MXWB 1VRH1 4IE6A 1ZA4A 4LBQD 1Q8VA 4NXMO 3BALA 4JCKA 4A7ZA 5CAZA 2LRPA 1UXZA 4R4ZA 5T55A 2AZ2A 4GAZA 2OXBA 2KR2A 3S6PA 4ONUA 5L9RA 5C4WB 5H9QA 4I4TB 4CDQC 1Z7S3 1RMU3 4Q4V3 4YM2A 1XNDA 1JUIA 4NROA 3J8F3 3SCFA 1D4VB 3SHRA 1RXFA 1PNFA 1KFUL 1W6OB 4EEQA 4N43B 3P30A 5JMOA 3POWA 5IDJA 3HNMA 2W68A 2HWC2 2JDNA 1QOTA 3X2QC 4DV6B 1CAUB 1ENVA 2PHXA 4WM7C 3NV3A 2Y60A 3VBOB 2Q5ZA 2ATKC 4FTSA 2G9ZA 5CBLA 2ET1A 4RFT0 5DAWA 1D4M2 3WQ0A 3ASNB 3DPRC 2JS5A 1H2LA 1ULCA 3N2KA 3U10A 1DQ6A 5T5JA 2D6PA 4QNHB 2HWF3 5FP7A 4KGGA 2ZXWC 1EBOA 1ND2B 2X05A 1PO21 2CTQA 5ACA1 4OUMA 3K08A 4TQFA 1N0JA 1RXGA 4PIZA 2XQXA 3K79A 5J2TA 1N1YA 4CEWA 4Q8KA 2WKKA 4FOVA 3GB7C 2ZGOA 1JMUB 4FLYA 2WLPA 3ACHA 5DDJ2 2KB1A 3RZJA 5GLVA 5C4WC 1ZZBA 4Z2WA 2B4KA 4P9OA 2WQ4A 3SISA 4P9LA 5BNOC 1XNRB 1CONA 4IIJA 5L3DA 4JI5O 4N43C 3ZFGB 3AG7A 2R16A 4MOAA 1L7RA 1TEIA 1OHFA 3G7DA 1R1ZA 2IJJA 1K5SA 5A7NA 4DUWA 2TBVA 1ZRDA 1ULEA 4QGPA 4FSJA 3BTYA 4XJ9A 3I56V 1V9PA 1N33O 1GWLA 5IHRA 1OFNA 1J84A 4QAWA 4YJ2A 4O2BB 3PUSA 1YWKA 5DZEA 2JDAA 4K35A 3MAQA 5JZGB 5HBAA 2CTVA 1BVVA 3H3LA 3HKBB 2DFBA 5FO8B 2DWRA 1DGWA 1S76D 4PJYA 4FZ0A 2VWJA 4W4KA 1IBKB 5LOVB 1MS0A 4MX3A 2XR4A 1QJFA 4OHYA 2ZM6B 3IC9A 4K20A 5C6CA 4OHXA 3MIBA 3O9OA 3PHMA 4LLFA 4XFFA 1CIWA 2VBBA 5IJ9B 1TVGA 3UK9A 4PQQA 4LF9B 4JHZA 4JI8B 3OUHA 4LF4O 1YQ5A 1YQ2A 4IESA 2W46A 1ZX5A 4MVTA 4V1PA 2WDBA 4TTGA 1Z0HA 2A73B 1U0AA 2VD7A 2EXKA 1QJY2 3KF3A 4URTA 5BXZA 2A9HA 2X8KA 4GMP1 1UQXA 3ABLB 2JGDA 2P4EA 3VDDA 5DAQA 5FP9A 1B35C 4YW2A 2CU5A 3IM0A 1GWMA 3IDEA 2D3SA 2WBKA 4CH3A 1REDA 4DNYA 1FOD2 4GH4B 4IGOA 3JCZA 2P5OA 1ORQC 5B1OA 4U3JA 4FLTA 2XPJA 2AH2A 5IY5C 3STLC 1AYM1 2VRZA 4UCRA 4RHV1 1OPMA 3LDDA 4OI0A 2DYSB 3JYCA 4NHYA 5JLVA 1AI5A 1GR3A 3ZXDA 5LMNB 5IVFA 4PDLA 1WCKA 4Y1UA 3B8MA 1C57A 2YEVB 1NT0A 5FXZA 2ZKLA 4FM1A 1XHZA 3E1F1 5IVEA 4TT3G 1LECA 4Z07A 1AJKA 1LR5A 1BHAA 1D2SA 2DYRB 2Y26A 4G9SB 1JYNA 1N36O 2OZ6A 1AXKA 2VVDA 1S0IA 5EIBD 4DXTA 3IC7A 5LP6A 2NLJC 3K57A 5FPBA 2ZIMA 1WMDA 4RAIA 2P5BA 3SH4A 2XGXA 2OS2A 1UU6A 3SKVA 5BMVA 5BYNA 2WZ8A 2P90A 2YG0A 4Q20A 5FY9A 3O1MA 5GZEA 3WNMA 4YG3A 1UY3A 1F8VA 2X5IA 5FO9B 2W3JA 1CVNA 1HQLA 2UYBA 2XBO1 1MS1A 2BGOA 3ABLC 1RUJ2 4A42A 2HBUA 3JD71 2F4VB 2NLRA 4PQ9A 3IAQA 2VZTA 4RQPA 3X29B 5EJ3A 3U75A 1W0NA 2PI5A 4LO8A 2MHFA 5IAXA 2VOVA 1URXA 3T09A 4DXSA 1LODA 5B3SB 3B9CA 1VB4A 1WNSA 5IYZA 4X20A 4BQ5A 3UO2A 4CP1A 2FDHA 1W99A 2DFCA 4LULA 3FC0A 5J09A 4WVMB 3VHRA 2XJTA 2PAMA 1HB1A 2MEV3 3DYMA 1BHGA 2GP5A 2DYRC 1VBD1 1IQAA 4QX7A 2W1QA 5BV6A 3RYIB 2WZR2 3LEKA 2P1BA 1D0GA 3W20A 5F2VO 2ADEA 4K1ZA 4P9GA 4J41A 4DY5A 1FT9A 2WQZC 4Z1MG 1QIQA 3T2QA 2FDGA 1XBFA 1K9MW 3RJRA 1QJU1 4DUXA 1QOSA 3POIA 4NUBA 3GM8A 1YRZA 4FOWA 3VKLA 3QOPA 3F5WC 3IIIA 5E1AC 3I2OA 3AP6A 3UKNA 5BR8B 1YQCA 1Y4WA 4ZU5A 2XT9A 4RFRB 4EZ4A 4AEDB 2JWPA 4LBNA 5BUVA 1X7NA 3J9SA 4BB3A 2DVBA 3IPVA 2DE0X 1R6KA 3ZFFB 1ZTEA 2D40A 2YPJA 1BHBA 2D93A 5EIBC 1MVQA 5IWAO 4AEJA 1M5IA 1IS4A 3AM2A 5JPNB 4YFZA 4JI6O 4M3CE 2XWJB 2HLDG 1F4MA 5L7OC 4N90A 4YFWA 2UXBO 3B94A 2QWPB 2WLLA 4ZY9A 3KT1A 1TAEA 4JTDB 1HNWO 4NE9A 5ANQA 1D2QA 1FI2A 1N0NA 3L73H 3N2GA 5IJ0B 1YF2A 2YIBD 4UW6A 3H1KH 2RS53 2OUHA 4RR3A 4X64O 3POEA 2EALA 1LNQA 2GTSA 1XPWA 3EVKA 2PUSA 2A6ZA 2QJVA 2RQ6A 1JYIA 4FPKA 1LTEA 4HZ3A 2WYFA 1W8HA 2ENRA 4QM9A 3T08A 5DM6V 2YB7A 3KZIZ 3I2JA 4KMQA 2ZAHA 3MFCA 2XMLA 2V09A 1D5AA 3K58A 1EYBA 1VBB1 4MO3M 3CWBH 4H7LA 1W8UA 3T0DA 1JH5A 3WDWA 3WOGA 2R061 4JYAB 3L9DA 1RVF3 1SPPB 2ZTNA 1US6A 1DTOA 3SPHA 5A7WA 4F4LA 2W95A 2RR13 1M4UA 2GMMA 1VBC3 5HCFA 5FK8A 2K46A 1WLTA 3WB1A 5JWPA 4QKNA 5T54A 4FPPA 3VBRC 4JPRA 3JARA 4TV9B 1MQTB 3U4XA 2ETEA 4QPIA 5H9CA 4AVAA 4UVAA 2YIDA 4DV2B 3FYIB 3UKVA 4GIQA 4TYSA 3HN3A 2E6VA 3HOBA 2QM7A 1VR3A 4OCTA 3K9SA 2EXHA 1W6NA 4GLXA 5FPXA 4DMIA 2ZGKA 4HPKA 2VMHA 2R9RB 4BMBA 1JXNA 2E5LB 4P08A 1O4YA 1GNYA 3ES4A 2A3XA 2CWSA 2H94A 1MEC1 2FD8A 1P84F 3HWJA 2XLAA 1UN1A 4DR6O 4PDWA 4J9YB 2R32A 1E1QG 1UCXA 3DUIA 4QWNA 4AL9A 1EAH2 3ACIA 4QKBA 4DR3O 3NJXA 1UYXA 3AG2C 4K0KB 4YIPA 1W03A 1OCOC 2ZGQA 3AKTA 5C5TA 2QDRA 2KSDA 2R49A 3CIHA 2OVUA 4JV4A 4MS2A 1EY2A 1ONAA 4BW9A 1NH2D 1CJPA 2RN9A 1NCRB 4CDUB 3W7WA 4AHWA 5EC2C 2JDYA 1J5EB 2R043 4CXWA 3Q4HA 5LHGA 3WP3A 3UM7A 1GZCA 2QQNA 3RNSA 2RNBA 1PM9A 2D97A 1RITA 4V2VA 2E7TA 3KWVA 1HJGA 4TQDA 5HFMA 2WNVC 1KXGA 1XMOB 4MG2A 3VDBA 1Q6UA 3ZRXA 3CRMA 1RPOA 3J8F1 5JOYA 4NYKA 3DXRB 4XYXA 1OURA 4Y5TA 3KVBA 4AVVA 1ALYA 5DAVA 4QHZA 5T5LA 2W91A 3G6EV 2D6OX 3JD72 4L92A 4PI0A 1XNCA 2QA4V 3ZXEA 1LHOA 3AG1C 1U12A 1ENQA 1H2KA 3J80N 4B1LA 1GNHA 4ICGA 2JGUA 3GBFA 4AFDA 2ARAA 1QXRA 5EYPA 2Q1ZB 1FJGB 3MGUA 5KLVH 1WW4A 3LFIA 3CCMV 3G6BA 4TZDA 2VUDA 2BRTA 5LRRA 2WLMA 4Q4Y2 4LR3A 5FYYA 4AQYO 2JJ6A 1DHKB 5K0UA 2UUAO 3IB3A 1MOFA 2FBEA 4KU7A 2Y6KA 1C5IA 4WBBA 1VAKA 4O4HA 1SFYA 5FZCA 5IVBA 2F23A 1KYOF 3GHMA 3ZDVA 4E4HA 3GWOA 2ZS6B 3HBZA 2OQ7A 3UQ8A 2R70A 2YBKA 3LIHA 4LNUB 4XZPA 3VBSC 1O9HA 2WL1A 5FMOS 3JALB 1S3JA 4DXZA 4ARXA 5FPRA 4PIXA 4JI1O 2XTAA 1H4GA 4F6RB 2AZ0A 4CZSA 3SXWA 2CAZC 1S5LZ 1RUF3 1VB2A 4XETA 1FXVA 1F23A 3RYHA 5FYZA 2F1MA 5FBJA 5JSPA 2IU0A 1Y74A 2BBAA 4PJ0Z 1GFF2 3JSNA 3DXUA 2IJIA 1Y4MA 3VZOA 5FPZA 2BSKB 2Y4TA 5A80A 3DGEA 1PP9H 1CN1A 5KC6A 4QB1A 4FXKB 1OHHG 1U5ZA 2EVXA 3MDPA 5CFCC 4R6ZA 1K5MC 1IS6A 5F2SA 4TV8A 3FB8C 3OGVA 4ZKTB 3NNFA 3K3OA 4WFEA 4ZI7A 4WBNB 2D6MA 3JD3A 2VMEA 4XBNA 4XXPA 4XBQA 4MTGA 5LY2A 1ULPA 2FQPA 3EHBB 1P49A 2CNAA 2A79B 1LHNA 4JI3B 2Z5WA 1HXS2 4X65B 1GK9A 4Q4W2 2A7WA 4C1WA 5KA5A 3H01A 2ARXA 2ETNA 2WAMA 1PIV1 2WLNA 3NNJA 1XREA 4R8CA 1GANA 4BIZA 1REFA 2XL7A 3MYXA 2OYZA 2K9ZA 3LAGA 4WFGA 1KU9A 1WMFA 3MPBA 4YW6A 2VC9A 4XC9A 4Q29A 3OBRA 3ZHVA 1F15A 1GN4A 4MVOA 5JSRA 1C8M3 4Z2AA 2WABA 2Z79A 5C3RA 3AVRA 4FPEA 4NRPA 2ARHA 1VBB2 4OQ9A 2VZQA 5EIYB 2FDKA 4BW5A 4AWDA 4E2GA 1W3VA 2O57A 3K0DA 4Z82A 5IVCA 3VN4A 2UXDB 1NUKA 2R0FA 3VGIA 3CB2A 4DV4B 4AVSA 1U5IA 5IK4A 3BVOA 4N53C 2M6YA 5EXOA 4JGYA 4X1KB 4DV1B 1H4HA 2L35A 3OPZA 1SRYA 4N9IA 3FWEA 3WNPA 5LGTA 1JZ7A 5CB4B 1CGPA 5F8PA 4FQZA 1FKAO 4F83A 2NN8A 2QBXA 1AX1A 4EN8B 4N9HA 1LOCA 1PGW2 1OXCA 4FCAA 3UCSC 4ITCA 3MHHC 1HB3A 4BHPA 4YXWG 1Q8SA 1HR0O 3DCQA 4EV0A 1I7FA 4DUZB 2WNUC 2VMGA 2XJSA 3M3EA 3Q8AA 5F3GA 1OOPB 4FAHA 4GB33 4OPAA 1IGOA 1PK6B 1CJDA 1S0VA 1OD5A 4Y20B 3BU0A 4XFIA 2LW8A 5F32A 2D5FA 3GGLA 2RM22 3CCRV 4D6RA 2NP0A 3BKZA 1AL23 2HWD3 1CWPA 2JG8A 3LA2A 3LD8A 4DR2O 5CIRA 5DABA 1BZKA 3I49A 2YDEA 3K04A 1DLLA 1UF2C 4UVBA 2HEYF 1JZ3A 3ZN6A 1QU7A 4YM3A 3THOA 1GO3F 2YI9A 5FZKA 1RFYA 2WJSA 3EHKA 2EIDA 4Z8BA 3K4DA 4PDVA 4L99A 4QX2A 4J1WA 3ZRSA 2WFPA 4LK7A 5JCOC 4X66O 3WFVA 1HWYA 4QPGA 4A6SA 3NW4A 4YVWB 1NCQC 4LH7A 4X1IA 2UUBO 1SLLA 1W6PB 2JG9B 4AHYA 3PUHA 1R093 1Z7S2 5LBFA 3M3CA 1PK6C 3VOUA 1RMU2 4Q4V2 2ZKNA 5FYCA 4M00A 3GDBA 2HWB3 3J8F2 1FPN3 1RTVA 2E74B 4LF6O 1LOEA 2TEPA 3RWNA 1H38A 2GAUA 5D8AA 1YJ9V 3RN4A 3LDEA 2WNEA 5FZ8A 1H8TB 2VZPA 2QM8A 3ZYGA 4XMIA 5A32B 3D36C 3V0BA 4O65A 1H6YA 1YI7A 3QF7A 2IXIA 4DRRA 5FRAA 1M93A 2JB8A 1H0BA 5IYYA 1C1LA 1VF6A 2VECA 2JECA 4KI5M 1IPKA 3BCWA 3ZYFA 3UT5A 3UO3A 3GHNA 4NTXA 4AI1A 3O0VA 3PMSA 2RJLA 2XHNA 4K40A 2ODMA 1EFRG 1S0JA 2J1SA 4B7EA 2NMOA 1S0CA 4WFHA 2VUAA 4CDWB 4YZ2A 2HWF2 2PY5A 4QX3A 4OYUA 4OUEA 2A06H 3RMXA 5KMGB 4O4IA 2JEMA 3E5QA 3O65A 1Y6XA 1RL3A 5JMCA 4IGQA 3U11A 2OPKA 5KUKA 4XUTA 1PHMA 5J37A 2WNOA 2WAOA 4YVWC 3I2DA 5EQUA 4CYDA 3ECQA 3ZX6A 3H7JA 2QQUA 4ZU4A 3ZVXA 3NMBA 4XCBA 1J3QA 4FM2A 2WWSA 5A1FA 4C8DA 3DL3A 4Q26A 1W2BU 4D6QA 3MIHA 1H8TC 1S5JA 4UUJC 5F37A 1EN4A 3RYFA 4MVZA 1LNSA 4A41A 4ZXEA 4DY3A 3TCUA 3VKFC 3UKMA 3UKTA 2JDPA 2QZ3A 4Z92B 3W7SA 2ARCA 4B3NA 1TME3 3T0BA 3VKMA 4Y3OA 2WLIB 1RVF1 2P34A 2BVVA 1ROPA 4LFAB 3JB4C 4LFCO 4AQ2A 2Y64A 2CL2A 2YIBA 3MHSC 5FY5A 2RR11 3KT4A 1VBC1 2GDSA 4UFJA 3RS6A 2JJ1G 2Y48A 1L0NH 3IDCB 1KFXL 3P5BA 5ABJC 5A7QA 2NNUA 5JJNB 1VQ9V 2D6NA 1EV13 5KXEA 4KGQA 4UCUA 5FO7B 5IE9A 5A70A 5LHIA 1IURA 1NQDA 3ZMNA 3OD0A 4TXWA 5T3NA 1I5ZA 3O1UA 4HK8A 4YVSA 2VBPA 1JN2P 4GZ9A 4QXKA 4FQ4A 4P9WA 1QJX3 5CBGA 2E53A 3S5QA 4LR4A 2AHYA 1HRV2 3KV6A 2VM9A 3L70H 4JTAB 3SYPA 3HAGA 1Y9QA 1LB2A 2VWKA 1KS5A 2XUMA 3O12A 2LFRA 1KITA 2PHFA 2X6CA 1UMIA 2OT5A 3OEBA 5FTTC 5D2AA 2A6XA 2B9ZA 3I59A 1YFWA 3N9NA 2RS33 2YC2A 3ROUA 1CAVB 1O8SA 4JHTA 4IEZA 2Q8EA 2WAAA 1R3JC 3ALQA 2VJXA 4I55B 5A6YA 1K34A 2Q8CA 1O5LA 3I2HA 3FYEB 2GUZA 4WF9V 2Q73A 1I94B 2CK3G 2J1VA 2ZR2A 3D82A 1QBZA 2XAGA 4ZS3A 3RYRA 3JB8A 1SETA 1NS1A 5F3CA 4CUAA 2FZ1A 3PU3A 2A70A 2Z69A 1M1KW 1UZZA 2LM3A 3OY8A 3VHNA 3FB6C 1QHDA 4DRXA 4QM8A 4PT6A 5FJKA 4CBCA 4IEVA 2JD4A 1S2BA 2IXLA 3EBRA 3Q8BA 1BQZA 1F31A 3KCYA 4ES8A 4BWOA 1GBGA 4YY3O 2ZE7A 3U37A 1HV1A 1OA3A 1WCUA 2GNTA 2IH1C 2VE1A 3T1HO 2BOBC 4B8EA 3PDQA 4I3PA 2GC0A 2UU8A 2DWEC 4JI4O 2VTXA 1J58A 1XBLA 5LWBA 4C91A 1PD3A 4XE9A 4LWSB 4DPNA 4UWDA 5ITZA 5J2UA 3F2ZA 2EIMB 4ZHQB 2D44A 3KT7A 1QDCA 4LA2A 4XUQA 4QU2A 2ADDA 1UY2A 3KKYA 3K46A 3A23A 1O5UA 2L6LA 2VW2A 2W1WA 5GZDA 3LDRA 3S5AA 5GTHZ 3CE2A 2PHUA 1GOFA 2DV9A 4MXVA 4PLMA 1XEQA 1LOAA 2WLQA 4IHJA 1GM9A 4EE2A 1XNKA 3ACFA 1WN7A 5FZ4A 4FZ1A 3A21A 4XIOA 3PTRB 2C9KA 2BW8A 2XASA 2YSUB 2A3YA 3ELNA 3LOIA 3NNMA 4NO4A 2DOSA 3MFAA 4PCRA 1W2OA 1T2XA 1QLEB 1UXXX 5FZBA 1LUVA 5CA0A 3WCRA 3T2OA 4KH9A 3T1YO 1HB4A 3LPGA 4FAGA 5GONA 5F39A 4KWUA 4X9QA 1TA8A 5FJHA 2MEV2 1NA1C 1VIWB 4DFSA 3HKEA 1UMHA 3G71V 1LKNA 1Q8QA 1GP4A 3D4KA 3ZFEA 2IH3C 2Q5TA 4R9DA 4XPVA 5FZMA 2HWE3 2QZ2A 4YGCA 1W2NA 1VQKV 3UV9A 4JI0O 1GP6A 3H8OA 1PZ9A 5FP3A 2UUAB 4CXYA 1UOGA 2R9IA 5F7UA 3VBUA 1OQEA 3OYWB 1AR83 1K5QA 2VUCA 1RUE1 5FP8A 1YJKA 4CP9A 4W6XA 3CP1A 3IDAA 2HJDA 5CKMA 3AP4A 3TN93 1VQ6V 1AR91 1S0BA 2VQEB 3NV4A 4K6BA 3OE7G 1H1AA 1BL8A 4L87A 3BOWA 4N21A 1N34B 1SQQH 3HMYA 2NM1A 3ATGA 4M3CA 2ZE8A 5JI9A 3UGHA 3THCA 4FFBB 4QPYA 5DAXA 5CA1A 2CHHA 4UOJA 2WS93 1WJZA 3ABTA 2RS52 1COWG 3I5DA 3NAPC 3ZMOA 3TNPB 3OEHG 4UVCA 1WCQA 4ABMA 2QUOA 4EWEA 2VTXJ 1WA8A 4QE7A 3O1OA 5FREA 2W52A 4JAVA 3NSTA 2HJFC 3QACA 1DGLA 1ND3C 3QG5A 1RSOA 3KG2A 2FCTA 3KGLA 3NNGA 1DU3D 4X1YB 2QDOA 4LHLA 4LIVA 5DEDA 4X62O 3QH6A 3RPQA 3FUQA 3QCWA 1Y3TA 3R65A 4FPFA 3KCXA 5F2WA 3JATB 1FXKA 1QQP3 2JDHA 4S2DA 4AFMA 1ACCA 2AW9A 4MXWA 5FYHA 1NE6A 1PMHX 2RDQA 3LGRA 4QPJA 3APBA 1MS5A 3WUCA 1L0LH 2ZMKA 4CCNA 4LFBO 4DR7B 3A4UA 5IK5A 3PJYA 2F43G 3WCSA 1UL9A 2RHPA 1MACA 3N27A 5C4WA 3L72H 4I4TA 3AKQA 2BUKA 1K5JA 2CTPA 3F7VC 4TLGA 1E5HA 2RDNA 3R66A 1SBDA 5FYBA 4TLFA 5A2QN 4Y1ZA 5DG1A 4LH6A 5C8CB 3DXTA 4IEUA 4Q8LA 1W6OA 3WD5A 3O1PA 1Q90D 4LCUC 1S1AA 1QH7A 5FNVA 1H2NA 4FFKA 4DW1A 3VDCA 2H0VA 2DUOA 2Y38A 3ZKUA 1Z5VA 3THPA 4U7NA 2EIKB 4WFBV 3SYAA 4RL7A 3SYOA 4PIYA 2J7MA 3CF6E 4JASA 4FP3A 4HK9A 2AYHA 2A3WA 3R05A 5I8SA 3MV11 5JJJB 3A7QA 4B7KA 3VBOA 1OCZB 3I55V 2DU1A 4PBPA 3SPIA 1D0HA 1K73W 4HG6B 1SF9A 3OMAB 1AL21 2HWD1 1VP6A 2BCCH 4B29A 4FIPC 4MVRA 1DQ2A 1V55C 1PV0A 1NLRA 4CSWA 4Y4RA 2A1XA 1VRH3 1RC6A 1ND2A 1X59A 4BQ3A 1MS3A 4H0LB 4LKDA 2YMZA 3HVDA 3NV1A 4D7SA 2FCVA 3DN7A 4ZBMA 3N3HA 3ZYBA 3ILNA 2ZMNA 4DRVA 4DV6O 1R083 3HBKA 2WA4A 2HHHO 3WW4A 2JEUA 3VQVA 5CEHA 1ZYBA 5FPAA 2GNMA 2B5UA 5JUVA 4GUNA 1HNXB 4ZU7A 2CWMA 4GD4A 2KG7A 2R042 2ZDIA 1O59A 3C3VA 2GP3A 1A34A 4DR2B 5DQ0A 2AGSA 1JHJA 1NAEA 3SPCA 3ZFGA 2XKPA 5F5IA 1VALA 2Q8OA 3RI9A 3K2OA 4A44A 2O8OA 5F5AA 3AMQA 5E79Z 2ZGTA 3G67A 3ETQA 5B1BC 3ZM8A 1FV2A 2VQFB 4LK6A 5LB6A 1FPN1 3ZMZA 3FHAA 3E6DA 4NKGB 3CXHF 4M0NA 1W8WA 2JB4A 3QVNA 2VH9A 1OCZC 3AJZA 4QGLA 3S7EA 1STMA 4O2BA 4NAOA 3K5NA 4TN7A 4BIUA 4UBGA 5JZGA 1OVSA 5HV4A 2PHRA 3CXCU 5K8SA 3CJIC 2E3CA 3HKBA 4QB2A 1ULDA 2Q67A 2BGCA 3AMNA 1KC8W 1PO23 4MW8A 5ACA3 2DMXA 2AGAA 3A0NA 2XDVA 4N8MA 1YC61 5LOVA 2OCCB 4QPKA 2AREA 1ZBA1 1YFXA 1BXHA 2UURA 4EKWA 4LITA 5IJ9A 2AXTZ 3KD4A 2ZZQA 1WMXA 4WFFA 1UMZA 3JQXA 2GC1A 2CGNA 2BBVA 5KXCA 3WW2A 3IMMA 5JXJA 4QXBA 2XJVA 1BGYH 3VDAA 4JC1A 2CTWA 2DUQA 1X9TA 2BFUS 5JQGB 4GQ7A 3E97A 1OLME 1BMV2 1IBKO 4GXLA 1BQPA 3AKSA 4K21A 2ZM6O 1RUF2 2GSYA 1JOPA 2IXHA 4CE8A 4AG4A 4XDPA 5TISZ 3RZMA 3WG3A 4MTFA 1IQDC 4ISRA 2Q9LA 1OI6A 4GH4A 4YNIA 4LF9O 5HXVA 3CCJV 4Y4YA 2RDCA 5FZ3A 2HVJC 4JI8O 5FR3A 1DF5A 4LJHA 2QTOA 2PTMA 1QY4A 5FMOL 5EZYB 3KHBA 4GCZA 4HKLA 2QQOA 4DXWA 5A7SA 1RUI3 2W87A 3TB0A 2OCCC 2CDOA 3BI3A 4CEWC 2E63A 3M8AA 3NKTA 2E26A 1COV2 1DQ1A 3N9MA 1TMF1 2B1IA 1VPHA 2XJRA 2YEVA 1NG0A 4GX2A 1GN6A 4YIOA 2QDNA 1EN5A 2ADPA 3AG3B 1NOVA 5IT9N 1SKVA 3CZUA 3ST7A 2CAVA 5JPMB 1MMMA 3ZSMA 4CP2A 1OKQA 3QH7A 1VQNV 4DW0A 1V6OA 1SLTA 3ZPYA 4HNAA 2EAAA 5FY0A 2PF4E 1O9GA 4YW7A 4ISQA 4IEWA 1ZBE3 1C8M2 2WSVA 5F5QA 1FMD2 4CU6A 1UKGA 1WLDA 4AEMA 3VZJA 1CX1A 3E35A 1RHI3 1UZVA 3BYWA 3VDDB 1W6QB 3ZHUA 3B93A 5AVAA 1AJOA 1WB7A 1GH6A 2BNMA 2ZJCA 1FAYA 1F5JA 3LDCA 4I2OA 3ME2A 3GJAA 4WVZA 3AG4C 1PNKA 1SQVH 4CCCA 2C6SA 3OMIB 4CU9A 1CAWA 1PGSA 3FX3A 3N4MA 4RHV3 1QR9A 3IIAA 2RS31 2UWAA 1WW6A 4NXNB 1DG6A 1GNZA 1NQJA 3HNBM 1LUWA 4BMEA 2QCSB 3SMHA 5FLIA 5FUPA 1N32B 2EXIA 4DO0A 4P9YA 4UFHA 2YZ4A 1XRUA 2RV9A 2PHWA 4WVMA 2F4VO 3V64A 5FPOA 3M3IA 1C8NA 5C9AB 2FMDA 2XJQA 2E7AA 3RYIA 1Y66A 4COVA 5ISLA 1YTFD 4YWAA 2NYYA 2W0XA 1DP0A 5FUNA 1FV3A 4E2LA 3MW3A 4Q0VA 3GJBA 5GTIZ 3E8GA 1JZ4A 3CMGA 3E8FA 5KHJA 4LKFA 2VR4A 4E2QA 5J9PC 1SLAA 4GB32 4LQRA 1MS9A 4JTOA 3C7HA 3KHCA 4EFBA 3TXSA 1ZLZA 4W6YA 2XBO3 5CZKA 5KXBA 1AR61 1OA2A 2FDIA 1ASJ2 3VDDC 1MABG 1RUG3 4RSUA 1I08A 4DV5B 3N7MA 3THTA 4IE4A 3ZBHA 4MV2A 3B00A 1W05A 4UB6Z 2VCAA 4RQPB 2HWD2 3BAAA 2VL4A 4AEDA 5AC91 4XACA 2ZKOA 4UB8Z 4KBBA 1BEV1 1RUD2 1POV0 5FBZA 4QQHA 3ZFFA 4RD7A 3B3QE 5CKNA 4Q0UA 4EZHA 2NPIA 5A1AA 3ZLIA 3RYKA 5IATA 1XXNA 2E31A 4COYA 1O6UA 2A3QA 3U1XA 1IG0A 3WNLA 5FZOA 5BR8O 1VBD3 2XNDG 5IJ0A 2W92A 1NLSA 1S5HC 3KCCA 1RGSA 2IU3A 4X6QB 5LP6C 5BY1A 1POQA 3W7XA 3T4HB 1RM1B 4XF3A 2HEPA 3AYDA 2HH9A 3AYAA 5BNPB 1W0KG 3ZHTA 4XJUA 4WV8A 4LUKA 1R092 5LBCA 2PAKA 1ZL8B 2ZGNA 2X5IC 2HWB2 3K0GA 5KHIA 2VU9A 2BNOA 1J95A 2WC2A 4CCOA 1DCSA 2LJ2A 4RQEA 1DF4A 2ZGPA 2HWE1 4PBOA 3WG7C 3WZ1A 4H13B 3WF1A 4CC5A 4RQPC 2C5DA 1W9FA 4AI0A 1SPPA 2EIEA 3G4SV 2D7FA 1F35A 3UL2A 4UW3A 1Y9MA 4YW5A 1SBFA 4L8JA 3WX5A 4RS5B 3WQBA 3AFKA 2I74A 1QQCA 4O9GA 1PX4A 1AJPA 2RS11 4TV9A 1MQTA 3I7DA 3TN91 2QKAA 3M8LA 2XAQA 3POFA 1OF4A 2ZXQA 2D5HA 1YO8A 1LOFA 1GKBA 1NXD1 2R073 5JR2A 2DYCA 2PGGA 1Q6IA 2QM4A 1NVPD 1ZWIC 1J1TA 4JYAO 1PMIA 1GOGA 1ZSPA 5A33B 3K5MA 2BJSA 5DUVA 5JIAA 3TXQA 1XMQB 3MPPG 4JV5B 1CEZA 4I3GA 4KHPB 2CGOA 4B4RA 2WS91 4LHSA 1V0AA 1V9U1 3WQ1A 4NHLA 5ANNA 4UCTA 2Y69B 5JI7A 4CS2A 2IBZH 3T4ZA 4K8ZA 4LO7A 3ZIWA 4O4JB 1HN1A 4BOWA 1ZZCA 1AZDA 4DIQA 1HDJA 4DV2O 1Y67A 2YXSA 2LGQA 1G1XB 3DC5A 2XHBA 3USUB 2V4VA 4XFAA 3JAMN 3O14A 4CCEA 5CKQA 1K4CC 1YQ8A 1XE8A 3VBHB 4K7JA 5A7WB 2RMKB 5FUIA 1W8FA 4B4QA 4F8AA 1GKFA 4CPBA 4COUA 4AI8A 4KL1A 2FYUH 1Q82W 1FNZA 2D3OW 1LJ7A 1TME2 2E5LO 1K7DA 1QQP1 1W28A 1WD3A 4FJCC 1NCRA 5A3PA 4CEYB 4CDUA 5L3EA 3QBQA 5FZ0A 2JKXA 2Q4SA 5FMCA 4QPIB 4YZ1A 2P3IA 2A6VA 3OGSA 4LF7B 4Q4X1 1QJEA 2YV8A 2VTFA 4JKLA 1NZ6A 3K48A 3T1CA 5DUWA 5B1AB 4OZXA 3POGA 4JZGA 1O91A 4P9PA 2QEXV 4DR5B 4RWUA 4RR3C 1EV12 3HB3B 5LA0A 1F2NA 1N3PA 4IV3A 1VQ5V 3U78A 5FZEA 4HAMA 4I0XB 4K0KO 3VKNA 2AEZA 2VGDA 5E6HA 3MO4A 4G3YC 2P3KA 1I6XA 2Q0OC 2EA7A 3DXRA 5EBMC 4L8QA 5APAA 2P3JA 2Y69C 2J42A 3K3WA 5D1IA 1O7FA 2DTWA 3H9VA 3ACLA 3SEPA 1AYN2 3WW1A 4JTCB 3GXUA 1QJX2 1ZM1A 1J5EO 2P6JA 4FP2A 1PNGA 4COWA 3HT2A 3X2QB 2EAKA 5IFPA 3E89A 4WM7B 3I3DA 4DOUA 1UU5A 4O2AB 4WFAV 5GLTA 1OVPA 1TUEB 5E89A 1RPRA 3BFRA 1XMOO 3F95A 2OPWA 3IGAC 2VY0A 4AXOA 4AI2A 2LFSA 1KDMA 3JD0A 2Y0IA 4CEYC 3M2MA 4MGYE 3LA7A 2ZXWB 4QPIC 2WSUA 2VQAA 1AXYA 3ETPA 1DQ4A 4XILA 5B1AC 4Y1XA 4UFLA 5LMUB 1NTZH 1R081 4UI9L 4ARYA 2PI4A 1HN0A 4TSVA 4CS3A 1KKDA 4XJZA 1L8DA 4FLXA 1JFFA 4LNUA 1AJNA 2ZHMA 4YRDA 3JALA 1KD1W 2JD9A 3FFQA 3CL1A 2AC1A 5BNOB 3LKJA 5IVVA 4F6RA 1FJGO 1XC6A 4JDNA 5E1RA 3KV4A 2VS0A 3CRQA 3LNNA 3KQRA 1LHWA 1ZVFA 1FD9A 4KU8A 1BT8A 2P06A 4J10A 2HHHB 4LBQB 1MNGA 4A3XA 1PO12 2VG9A 3QO8A 1JODA 4QX8A 1JPXA 5CYYA 1URFA 3K5LA 3OGGA 2HEVF 4UBHA 5KWRA 2HYXA 3LEGA 3J7NA 1AX2A 3V65A 4BLJA 4P5YA 4LPLA 5L73A 1Q86W 3CJHB 2VNRA 2ZABA 5FQ0A 2ADQB 4J1XA 3VB9A 3O0XA 3C90A 2F6BA 2GHYA 4P9XA 1ZUQA 3K77A 4DUYB 2GZWA 3B5LB 4O4HB 4WCEV 3W5MA 4GJZA 4N7UA 1KQSU 1KBHA 2DQ0A 2FL4A 2YROA 3I2GA 1J1LA 1A3KA 5BNQA 1E79G 3BODA 1X4TA 5DN6G 5JXGA 3ILRA 5A3UA 4Y22B 5J96B 2Y8KA 4DEVA 4D7YA 3WDXA 1I5XA 2WT0A 3JBG1 2VOTA 1XILA 3VBFA 5IYDO 1NZCA 1QJY3 2FTKA 3RYHB 2VBDA 3FFZA 1Y74B 3OUFA 3ZR5A 2HWE2 4JI3O 2XVLA 3ICXA 4X65O 1UJWB 3M99B 2ARBA 3GALA 2G38A 4MSVA 4G27B 1WP8A 1B35B 1JVMA 2EF6A 3H1LH 4OI2A 1AR82 4OFGA 3PU8A 4HMZA 4X1KA 5F3EA 4ZI7B 1P4RA 1THZA 3KVAA 2YI8A 2W6IG 5C93A 5IY5B 1G9FA 1AROP 3CSXA 5CB4A 3CBNA 2OIGA 4WVVA 2QE7G 1R3LC 1RUI1 4L11A 2E76B 4BA6A 1WA4A 3LPFA 3WXPA 1BBT1 1PIV3 4XHXA 2R72A 2XLGA 4A45A 2ZGMA 2BTVC 2FMLA 4QQ2A 5FFOC 5F5CA 5FZ1A 2QQWA 2VMIA 4P30A 1WW5A 4IEOA 2ZBJA 2ZCWA 1P7GA 2BOCC 2UXDO 3ABZA 3WG4A 4MVQA 2ZNIA 5A9GA 2QQMA 4DV4O 4OPHA 2C24A 1X36A 5LA6B 1GSLA 3WQ7A 4JF3A 1OOPA 1PK6A 4DV1O 4ASUG 1XNTA 2WS92 1AUYA 1NI8A 1JOYA 1JU3A 1Q8IA 3P32A 3I2KA 1APNA 4B3SB 3OTFA 3ZHRA 1QGLA 2HKXA 4HN0A 5L3CA 1FS0G 1UZWA 3IWZA 3ZSKA 1SQBH 1VBE1 4F3JA 2BYVE 3DYOA 5KHGA 2PQSA 1ZBE1 3ZIAG 2J1AA 1M9NA 4AAPA 4QU1A 4S2GA 1RHI1 1GYKA 4DUZO 4ZPIA 3R4DB 5CNAA 2RVAA 1P7BA 5LATA 3PUAA 3H1JH 3WV6A 5GZGA 3M4FA 3C2UA 2JK5C 3ZJZA 4RGAA 5G04L 4WM8B 2NN4A 3ABKC 3ORJA 1H9PA 2EIBA 1EP0A 4EQVA 5F1RA 1PVC3 3TYJA 1DQ0A 2WZR3 1NT2B 1R6TA 1V00A 4LBOA 1WPXA 1WW7A 2XVGA 3OUSA 2W1SA 1LESA 3WG2A 4LBLA 1UOJA 4U36A 1K8AW 2VNOA 5KHHA 1MA1A 3JCIA 1W6PA 2JG9A 4D0QA 4C1XA 1AB3A 4Q0SA 3B8NA 1S4CA 1I1EA 2WWWA 1Q6HA 2PLV1 3PJSK 4XBLA 3RZGA 3POSA 4YSFA 3STZC 4EN7B 4GX1A 2LQTA 3RDIA 1JYTA 5CFDB 5I0DA 4XQ4A 2BTOA 5F6LB 3SYQA 4KBZA 1MPXA 1HRI2 2WWUA 4DYLA 3D3AA 2F95B 1N1SA 4DB5A 1RUG1 3S0MA 3CQOA 4FFFA 1UY0A 1POV1 1OMIA 2VVEA 1QF3A 4A7KA 3EMRA 4JGYC 1PGL2 2IVIB 1C28A 4CDWA 1JHNA 3E22A 1MVEA 3WW3A 1VRH2 4DK1A 4WM8C 3BGAA 5FCCA 2HJIA 5KMGA 3KF5A 1WUVA 4QXHA 2EJRA 2BV4A 2D6KA 4FLUA 2UUCB 2P17A 4AVTA 4QQLA 2XAHA 5L7OB 1ULOA 4BK4A 3NKGA 5FY8A 2VQ0A 2BTQB 3CCUV 4A6OA 3HJRA 2CYFA 2H3OA 4XDQA 4PA4A 4DV0O 1LGCA 3MZHA 5JR7B 4GWMA 3VKOA 5FYUA 2WZPP 1NLQA 1WCDJ 1YHFA 1I3HA 5CFDC 1SQFA 4EJRA 5H9RA 4QDSA 5I0SA 2N05A 1YYNA 3JD1A 5FIXA 1AXZA 2VOKA 4GKJB 3ZN5A 3UT5B 2VQUA 2Z0AA 3W5NA 5D21A 5CBFA 2JDZA 4AFAA 3FD9A 3BPSA 2DJVA 3EYPA 1N3OA 5H6RA 2WLIA 2X29A 1EUUA 1ZRIA 1XNQB 1HX6A 3ETDA 1W8ZA 1PO22 1GN2A 4X89A 1KB9F 1LGBA 2V72A 3RVYA 3SJBC 5ACA2 2GN7A 2ZGUA 4O4IB 3KMHA 3MIDA 2X6BA 3OGRA 5KUMA 2K2SA 4QPGC 3D6EA 4ATFA 5EFUA 3VBRB 1SZXA 4BIFA 1G86A 4D69A 1J83A 3CCLV 2R071 1GZ9A 1S0FA 3J7MA 3O5SA 5I0UA 1QXPA 5IT6A 4FM0A 4JI7B 3N9OA 4BZ4A 1YLLA 3LSQA 1K12A 1WLEA 1HW7A 2QTSA 4AGGA 4LFAO 5D8AC 2DTYA 4CUCA 4X8AA 1VBA1 2TNFA 1UX6A 3UJQA 2SBAA 4OX9O 4P5HA 3RYFB 4FPJA 4PA7A 1DZTA 3IN9A 4GMP0 3L74H 1VF6C 1J59A 4OULA 4FOQA 4JKKA 3BU7A 1OLMA 1D5NA 2X6AA 4EN0A 4MUVA 4AAXA 1OD3A 1LULA 4B08A 5F3IA 4ASKA 3FHQA 3W59A 3U07A 4HFSA 5C70A 1D2DA 3AG2B 4I55A 4UT5A 1OCOB 1AF9A 2BFUL 4IEXA 4IV1A 3A22A 2LS6A 3R4SA 4UXAA 1BK1A 1OCRB 1NU1H 4SLIA 4XF9A 2ILMA 1EM1A 2WWJA 1JZ6A 4RO2A 5H9PA 3C3SA 5JOZA 4QX5A 5K1XA 5TSWA 5C3SA 3MLLA 1RUH3 1JS9A 1HW5A 3I54A 3HR9A 1WD4A 5DAPA 4KFMA 4YVSB 3ZSJA 2WNVB 2CV6A 2PQQA 3AZWA 1G4YB 2WFF3 1I94O 3M3QA 2PA7A 4FXGB 3B09A 2N7GA 2W2IA 2ZINA 4Q27A 1LCLA 3PVNA 2WPDG 1ZBE2 2EILB 4INDA 4P00B 1D4M1 2JIJA 5IYCO 3POJA 3UJOA 4C90A 5CB7A 3AKPA 3ZDSA 3AKRA 4BQ4A 3BRCA 3K51A 3AG1B 3E5UA 2DVAA 4CXXA 2GUZB 3KM5A 3LA3A 4NOTA 3TEWA 1AYM2 5A3MA 4WZCA 5A6XA 4RHV2 4AK3A 4XF1A 2PN5A 3SCGA 2QE3A 1ZRCA 1OCRC 4GKKB 3FZ3A 4XABA 1V6LA 3ETGA 2P3YA 3CDZB 2ZE5A 4PA6A 3OBAA 5DDJ1 1H1IA 2LW7A 3OGCC 4AI9A 5B1NA 3RBZA 1V6IA 5IAVA 5H2FZ 5FPLA 1O3RA 3K59A 5KX5B 3GF6A 3TRSB 2YXLA 4DRXB 1SA0B 1V54B 4A5UB 3N7JA 4CZZA 2QTWB 5D5PA 1W2UA 4Q2FA 1G9BA 5A7PA 4IDZA 1TG7A 3QNEA 3I8TA 3CS5A 1REEA 4YVSC 3L2YA 2HLEA 2GSMB 3USSA 1GZTA 1ZZ9A 3ZXGA 3VBSB 3B2EE 3WB2A 2BDRA 3AMMA 5KR7A 1YDXA 1KUQA 3ZN1A 1VE0A 3ZN4A 2JX9A 2ZT9B 2CAUA 3VQYA 3T2MA 4D6TH 2PHLA 1NYWA 2VUJA 3LB9A 3AEIA 3APOA 1YSCA 3ASIA 4UW5A 1E5IA 3IFXA 3E86A 3CMAV 4QX0A 2EILC 4N23A 4NHXA 1NH2B 2XBO2 1R1A3 4MYEA 1GRJA 1RUG2 1NTKH 4CDXA 4AE2A 1W6MA 3VZNA 4LHNA 5LBQA 1AX0A 2GN3A 3WNKA 4IHJB 3OUIA 3ABMC 1JCHA 4YW1A 5CFCB 4ZKIA 5JOWA 2XH6A 4URAA 1Q7YW 4QDQA 1K5MB 2Y0OA 2RCVA 4LE3A 4YM0A 3HKDB 3CKHA 3N7KA 1CZTA 1YXWA 4UV9A 5LYJB 2LTNA 4OMCA 4DR4B 3ZHQA 4D8MA 1N4CA 1O3QA 2XLFA 4J25A 2EICA 1V54C 1RUC3 3IZOA 4XOGA 4FFBA 3MDSA 1XOYA 1VBD2 3RZZA 3ZMTA 4NHKA 5CADA 5KA6A 2KD7A 1R3KC 3ZFEB 2UXXA 1PX3A 3WF0A 3ACGA 4FPGA 2VQEO 4YG6A 3NJZA 1QJU2 5KAIZ 1OSGA 1O3SA 2B9VA 4COZA 4YYOA 4I50A 1QJY1 2PYLA 2JE8A 5FZHA 3F5TA 2A0LA 1N34O 3FN9A 4EROA 5FYIA 3ENRA 3MEPA 4TWTA 1RUOA 2GBOA 2QKCA 3LEIA 4X8NA 2VW0A 4IE7A 4LBJA 5LCWL 1FOD1 4GZRB 4YARA 1RUE3 4R9AA 1JR9A 4I0WB 3BTXA 1TVKB 2ZACA 4HXCA 3JATA 1B6QA 4D7TA 4CP9B 4UF0B 3OTOB 3H8RA 4B3TB 4BXFA 3HKCA 3B7MA 4YJ3B 4HT1T 1AR93 1W59A 5D5QA 2V5DA 1XYOA 3PUQA 1WAZA 1ODNA 4N53B 4EFEA 1QKQA 4BJ0A 4FPLA 3R4UA 1LOGA 4MGKE 5EK0A 4KG8A 3KV5A 3ZYHA 2QKDA 1YITV 1V6KA 3HT1A 3OCPA 3T0AA 4OLLA 3E5XA 4DR1B 1RUNA 3WDVA 3D5OA 1AILA 1W9YA 4KUMA 5LA9A 4HKWA 4XURA 5C8CA 1DZQA 1JZ2A 3OAAG 3ZFEC 3WEZA 2VZVA 2WNUB 4BAYA 1WA8B 4FTEA 4Y24A 4LP8A 2UXCB 2P6CA 1CD3G 1N3QA 3JD4A 2HR3A 2BNNA 4XUNA 1W39A 2FKXA 3I2IA 1US2A 1FPOA 4DR7O 2W9XA 5EPAA 3SNMA 5FAXA 2IJKA 3VBUC 1US3A 3CC7V 2GNDA 1H9WA 1JYXA 3SYCA 1QJZA 1DGSA 4HONA 2R062 2BOIA 4RQFA 4XMAA 4E8DA 2B9UA 5F6KA 4QPWA 3EB7A 3PNAA 5IWFA 5I93A 5CISA 3D3QA 2Z42A 3OEEG 2BE3A 2W39A 5FZIA 4O4LA 4LTAA 1IS5A 5SV8A 2BZDA 1DK1A 1KMIZ 2X0LA 1Q56A 1RP3B 4LBEC 1Q3EA 2OUJA 4IUGA 3R6SA 2C4XA 2IUWA 1U97A 3TBDA 4NPMA 1PVC1 1F7YA 4QJFB 4MVUA 2Q68A 2WZR1 1XSQA 2JICA 1XNAA 2JVDA 1R6NA 4MGQA 1YJLA 2AHZA 2PFWA 4PLOA 1XI1A 1HQNA 3A8TA 1NCQB 4CU7A 1I5PA 5FNVB 2YC0A 2WZEA 4XDJA 5HFLA 3L9JT 1ZREA 3AP9A 1XQ8A 4ZOLB 1OPOA 2P7TC 4H55A 1CAXB 2JIGA 2WO1A 3ZRWB 2VMCA 4IQPA 4CTEA 1MEC2 1OV9A 1G6NA 4LT5A 2HBTA 3H1WA 5IVJA 4GX0A 1HNXO 1G9AA 1RYYA 2OT7A 4IT5A 2OKXA 3V0AB 4W4LA 1F4HA 2AEYA 4UW4A 4M0HA 2MW2B 2R30A 1XUQA 2WUHA 4PLNA 3RW0A 1FXKC 3AZYA 4XJWA 4QT6A 1SCSA 5I8TA 3BCCH 3NVCA 3S57A 3VD4A 3GZEA 4JGZA 2YS8A 3HPLC 4HVQA 2W1UA 3INAA 4FFIA 3FE5A 4MTOA 1BJQA 1W9SA 2VQFO 1G8MA 4QQPA 5EYYA 2OZJA 4ZIBA 3AFGA 3RYCA 4DV3B 5AFBA 3POBA 3BTAA 1GWKA 2KG7B 2I45A 3I3QA 1U5XA 1L7LA 4KG0A 1AJQA 4DXRA 2DCKA 1BK0A 2FZ2A 2DVFA 3S3XA 1FFXB 1K3IA 5JQGA 4LE4A 4L97A 3H3UA 4BYYA 1CR7A 1JZ5A 4TUYB 2ZIOA 1SESA 4OI1A 1K33A 3BHPA 4SBVA 4EYUA 1ST8A 3E8HA 2ZEYA 3VBOC 3W21A 2WIIB 2Q4PA 4XUOA 4PF1A 1WP7A 2A75A 5AVPA 3ASNC 4IW3A 1LENA 1S72V 3AZVA 3DF0A 1SCRA 4X8PA 1Z78A 1CPNA 3MLJA 1DQ5A 4LF8B 4A7YA 4BDVB 3IDBB 4MZUA 3CU7A 1ND2C 2JDMA 2EZPA 3HD8B 2GH8A 3J4UH 3ES1A 4RUEA 1MS8A 1TE1B 5EZYA 5K4LA 2QWRB 5G05L 1JJ2U 5A3OA 3T3YA 4K9SA 4JKMA 5I91A 1OC1A 2H0BA 4CCJA 5J98B 1VQ7V 1BS3A 4NIDA 1ZBA3 3ZCCA 4DV0B 3FMGA 1Q8OA 4LO6B 2KQXA 1DBNA 2OTLV 4LIUA 2JRIA 2O1QA 1R3IC 3LSUA 5FLJA 2VOXA 5LBEA 1ODMA 2ZDIC 4XFCA 1XYNA 4UFIA 5ABJB 2V73A 1GZWA 1UYYA 3SKJE 5CG9A 1W8OA 3D8CA 1OUSA 3DGTA 2BOJA 2R1BA 1UW8A 3S30A 3ZFGC 5EJ1B 2EULA 2D43A 5GJ6A 5C8YB 1HRV3 1M90W 1QNWA 1GQGA 4IE0A 3W9AA 5B4XA 4BWAA 2BU9A 3HEIA 3FAVB 1R64A 3ZYIB 5LW9A 1IBLB 2TUNA 3PVOA 5CG8A 4AQTA 3K03A 3NO8A 3ZSLA 1KDKA 1XYPA 1Y9GA 4FVMA 2WR9A 5KHKA 1W6QA 2V1DA 2X53S 1EAH1 5JZGC 1PM4A 1ZA7A 1BKZA 3OPWA 1ZZ7A 4B3MB 3H50A 1AHSA 2Y33A 1DIWA 2ZHNA 4IGGA 4BQWA 1YZBA 2JKBA 2F66C 1YCIA 4CCDA 4XTMA 1CIYA 1AR4A 2RDSA 5FWEA 1WA6X 2VZOA 4P9IA 5GLZA 2EIGA 1EZJA 5JVVA 3RGBA 3N9QA 3D0JA 2F4PA 2CUGA 4IL6Z 5DXDA 2CDYA 5DPNA 1TMF3 3CEWA 3NRUA 4OX9B 3AXDA 5DN2A 4JTNA 2FCUA 1QU0A 1UY1A 4XFBA 3VZKA 2N74A 5JAXA 1B3QA 5C9AA 2Q0AA 3NJYA 1JW6A 2QNKA 1PIV2 5C8WA 1PKXA 1TQ5A 3N9PA 5JVDB 1GLHA 1W2TA 2GV9A 2Q1MA 1BCCH 4J7KA 1RUH1 3CO2A 4HNAB 3KLSA 4E8CA 3C8XA 1L3JA 4FO9A 4NXNO 2QQPA 3SJQC 4Z1VA 4BE3A 3OGJA 1W0OA 2HP8A 4ZS2A 4S2FA 1SDWA 2CH7B 1N32O 4JI2B 3VL9A 3CMEV 1S77D 4CH6A 2WFF1 3CRRA 1N1TA 4LLOA 2E7QA 3WR0A 1DLCA 4GT1A 5FKCA 4AGRA 1Z5WA 2DW4A 4NPLA 2J22A 1AR1B 4GH4C 4GKXA 4A3ZA 2E33A 3ASOB 4I5SA 3OGIB 2ZD9A 5JOXA 5GZCA 1K3EA 3MV01 4D3WA 4ASMB 3O1RA 3WP4A 1CAWB 4XAAA 4BISA 2O8QA 1GM8A 1C1FA 3FBMA 2WQ8A 5BNNA 1Q5OA 4FFGA 2NQYA 3TJTA 1HNZB 2FDJA 4B4PA 2DYSC 4D94A 4E4EA 4Q4Y1 5L3GA 4R7CA 2BERA 4RGGA 1JOBA 4KNCA 1QOOA 1SQ4A 2QSAA 5CN0A 4WVWA 4NIAA 5K9YA 4DV5O 4RGKA 3HR0A 1UU4A 1PVC2 1VQLV 1PL4A 2B46X 2IVJA 4OMDA 2DUPA 1RB8G 4NRMA 3IAYA 5BPXA 3C7FA 3PUIA 1SMVA 4QQOA 4JDMA 1DDLA 2IW5A 1S0GA 1OA4A 5BNPA 1F51A 1H8HG 1YJWV 2Y0PA 4NIIA 1ZL8A 4LO4B 1NA1B 5IVYA 4L0PA 4CCLA 5FLHA 1ZRFA 5A3WA 1AR63 5FOBB 5FDBA 4GX5A 5FK7A 2ZX4A 2D98A 4JRAA 1Y76B 3GZTB 1YI9A 1KEXA 3KB5A 2ZGRA 3BVCA 3ASOC 5AC93 4TSFG 4EB6A 2PHTA 4NTYA 1BEV3 4N7IA 4MHRA 3LNMB 3MUY1 3I2FA 1R1A1 4FPYA 4LNVA 5B3SC 4RS5A 5GLWA 3S7IA 2GDFA 1YHQV 4JDOA 2GMEA 1XU1A 4YZ4A 3T30A 1BYHA 1E5RA 2G9FA 2VULA 3B4SA 4GKYA 4RUFA 3OR6C 1CXZB 2YIAA 1HXS1 4E4ZA 1GQHA 4Q4W1 5FZ6A 4YGEA 1GAXA 2UYAA 5FZOB 3APQA 3E6BA 3HNYM 4H7MA 2WYSA 4LF5B 1ULGA 1WCSA 2NR5A 5JH7B 3SPGA 3O0WA 2WSSG 3SH3A 5A33A 1AI4A 4MSWC 1FATA 2IJHA 4JVAA 1TUBB 1RUC1 2XG3A 4BPZA 1PL0A 3POYA 2C9AA 1VQPV 3NV2A 4CU8A 3RSJA 3FLRA 3ZMVA 4QIWF 2GC2A 4GA9A 1SQGA 5A6QA 2EBOA 2AUYA 2IXJA 4E9KA 5FKBA 4ORFA 3OW2U 3NAPB 1K92A 4HSLA 2VNGA 3VHPA 1UPSA 4O4JA 3MF6A 2GC3A 4LC1A 4NTWA 2RJZA 2PELA 2CGPA 3H3ZA 3USUA 5HXMA 5FZ9A 4AEDC 4NAMA 2Q8VA 1NX9A 3RI8A 4XDLA 2YXHA 1ND3B 2J1RA 3ZFFC 3VBHA 4LORA 5LHHA 5L3BA 5FL7G 1NJIW 3JASA 4XIKA 1XMQO 4YLZA 1QNYA 1X50A 2A6YA 5FPVA 4TWKA 4JV5O 2OYQA 4X6RB 4MGIE 4KHPO 5GKAC 3WLUA 2RS13 3JAKB 1UO9A 4CEYA 1MSWD 3BA9A 1QLNA 1IKPA 4I7ZB 2UU9B 2ZR3A 2AACA 1UYZA 2IXCA 2R0HA 2YXYA 1PGW1 3G6JB 1ULFA 3DKQA 3JAWB 5A3NA 4CPBD 2P22C 2ZA9A 4I0XA 1G8WA 3CX5F 2LP7A 1ZZ8A 4C0HA 3PL0A 3WF2A 2QGNA 4CDQA 3LOBA 1A6CA 4UXNA 1WLWA 3OJBA 2WN2A 1DGRN 2OX0A 1VAVA 2VO5A 2ZGSA 2PAEA 4CRQA 3UESA 1V9U3 1F9KA 1YQ6A 5BXXA 2RM21 1WMEA 1SQPH 4A2UA 4LF7O 1CX4A 2QJ1A 4CA9A 4YG0A 3MBWA 4WM7A 3AYCA 2L9LA 5FY1A 3T4VA 1ZX3A 4DR5O 3AK3A 3UNPA 1JA8A 3KZ4C 1X8MA 3JCUZ 4O2AA 1OLQA 2BWAA 1K97A 3GZUC 2YICA 2C1FA 5CA6A 4B3RB 1Y43B 1JOJA 3I97A 3QO5A 4HETA 1NR7A 1YIJV 3DPRA 2YU1A 1IBMB 1AR73 1OH4A 2M7WA 1V55B 2QKSA 2BP6A 4AYUA 1XNBA 1RVF2 5LXTB 2DURA 1MQTC 5HCAA 1SG3A 1X82A 5DUXA 4Q4X3 1UZYA 2RR12 1LOFC 1VBC2 3WHTA 4YHHB 3AK1A 4I01A 4M01A 4YW3A 3LZZA 2ID4A 4QGMA 1FNYA 4IV3B 1LEMA 2DVDA 4NWVA 1H6XA 3PTYA 1Z7S1 3ILFA 1GM7A 1XHXA 1RMU1 4Q4V1 3SJAC 5BNOA 1A8MA 1RUH2 1BSMA 2WN3A 2BEOA 2G1MA 4P14A 4N43A 5EBWC 2CDPA 2PXJA 1GN3A 4NXMB 1UAIA 4AOCA 1WZXA 2YU2A 5B1BB 2WFF2 1UX7A 1CAUA 1W06A 3OT7A 4K3AA 4LBQA 2VZ1A 5LMUO 1UY4A 1Q43A 3LWCA 1EPWA 3MD0A 1ENRA 1AI6A 1HLCA 2DDUA 1W0PA 1W8TA 5L19A 3FB5C 1OBNA 1Y7BA 2KXLA 3M70A 3MIEA 3WHUA 5JDBA 3AZXA 1KKCA 4F6EA 1HDKA 1JUHA 3CCSV 2ZZJA 3OUJA 4QGNA 3CJIB 1I5YA 2HWF1 1NCRC 1DZRA 4CDUC 4B1MA 3CJHA 1FXHA 3ZS8C 4E2SA 3N7LA 2QQKA 3HPNA 3J7AU 5L9BA 1AP6A 4XFHA 3JQWA 4LUMA 2OIEA 2VCCA 3WF4A 1NXMA 3E83A 4IV3C 4Q5OA 1A32A 1JFFB 3LDBA 1W0JG 3HN1A 2DWDC 2B1GA 5DMYA 3WG1A 5KBFA 3BA8A 5J3UA 2W6JG 4J42A 4I9QA 3T4DA 3BPZA 1FAFA 4Y22A 1YIPA 3SQOA 3BN6A 3AXEA 2H6BA 1T6GC 4QHBA 1RJ8A 4AHCA 2AR6A 4FVVA 2HKOA 1QXJA 1MZ5A 5B2GB 1DGRA 2ZX2A 4R9CA 4QKFA 1PNLA 3UGGA 5B4NA 1MZEA 1S2KA 4NIHA 4DUYO 3K4ZA 4W65A 4JGSA 1UNBA 2JJ2G 4MVMA 3OMNB 1JYVA 4U3FH 2DVGA 1B35A 3T1MA 2VPVA 1R1A2 4DQAA 2WA3A 3N2KB 4JI5B 4ZZ8A 3A0RA 4ZHNA 1HB2A 3GCXA 1S55A 1COV3 2ORZA 3NR7A 3VLBB 1SHWB 2ZGLA 3GBGA 1MS4A 1VIBA 1TNFA 5FQ0B 2ZX1A 5J1XA 2X09A 4OZOA 5EZWA 1K4DC 1ZAUA 3RT3C 4Y33A 2ATFA 4K8XA 3ZEDA 1W2AX 1N33B 2EX3A 1JJOA 5J2TB 4XBFA 3ZRVA 4CEWB 3JZVA 1UPGA 3A2FA 3ON7A 3VV1A 4AQSA 3T2PA 3HQUA 3A0KA 5FYMA 2YBPA 4EWAA 3VUOA 2YC4A 3MUZ1 3K06A 1RUC2 2HFEC 4LOTA 4IIJB 4IEQA 5LA6A 3JBG3 5GM0A 5GZFA 2VOWA 3VBFB 1FMD3 1E1RG 5FZ7A 2ITCC 1N8RW 1HRV1 4Q0PA 2VZUA 3ZYJB 3L71H 3A0BZ 3O1SA 1CQ9A 1A8DA 4NB5A 2YGLA 4H14A 3TEYA 3EQEA 4YJ2B 5SV5A 3BY6A 3LDKA 3CYOA 5FMBA 1C5HA 3LSEA 1U96A 1C3HA 1JZ8A 3WB0A 1LRHA 3EO6A 2C2AA 1RUE2 2NZ9A 3EXUA 4XQDA 1UIJA 3AG4B 3ZXAC 3WNXA 3KSCA 4LF4B 4R50A 1BZWA 4R8HA 3BOPA 5FXWA 4GULA 4WM8A 1AR92 4B3SO 5C7GA 1T5EA 4F7ZA 1BBT3 4BK5A 3ZKYA 2F93B 3Q8CA 2DCZA 1C4RA 1OQDA 1M57B 2RMU3 1WB8A 2Q6AA 4ZONA 1R1BA 3CLPA 1FXZA 1RJ7A 1AI7A 2DN9A 1H30A 2QQJA