3U0ZA

Tetramerization dynamics of the c-terminus underlies isoform-specific camp-gating in hcn channels
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
199
structure length
199
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Tetramerization dynamics of C-terminal domain underlies isoform-specific cAMP gating in hyperpolarization-activated cyclic nucleotide-gated channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 61
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3u0zA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3u0zA02
4YARA 2PHLA 2K9ZA 4IEZA 1ZRCA 1YFUA 5I0TA 1PM7A 3SCGA 3LWCA 4IEYA 4D7TA 4WVZA 4MGYE 2PA7A 2DCTA 4MGZE 4Q0PA 4AQ6A 5JSPA 4YRDA 3PVBB 4MGIE 2CAUA 4AQ2A 4XFBA 3CO2A 1OI6A 1UD1A 2Q4SA 4META 4F7ZA 4QGNA 4HVOA 4UBHA 4XETA 3SCFA 4A2UA 4O9GA 1QXJA 3KCCA 2P17A 4IEXA 4X6QB 5I0RA 1CAUB 5BPXA 3ST7A 1L3JA 1QY4A 3BU7A 2HKXA 2MHFA 2FQPA 3H8UA 1ZREA 2GU9A 4XF4A 1WGPA 4QM8A 4FT8A 3PNAA 4QGMA 4XF3A 3SXWA 2XLFA 4K8FA 2GC1A 4MV2A 1J3QA 3H1MA 3R6SA 5LRSA 3HT1A 4O9EA 5E16A 2PYTA 4HMZA 2WC2A 1XRUA 3KMHA 2BNNA 4LA3A 3UKNA 4IERA 5I91A 2IC1A 2B9UA 4LULA 4HN0A 3I54A 2XHKA 5F1RA 1UCXA 5KHGA 1RL3A 4I09A 5LRRA 4E2GA 3CF6E 5BUVA 4KWKA 1QXRA 3H1YA 1SEFA 4L2NA 1QWRA 2UYAA 3FHIB 1O7FA 3EBRA 3O14A 4ZU4A 5BY5A 1JUHA 5BV6A 4E2QA 1FXZA 4I0BA 1YFWA 4Q0QA 3FFQA 1VR3A 3FJSA 4Q0UA 1Q43A 1TQ5A 4IEOA 3EO6A 2ATFA 1UIJA 3E5QA 1O3RA 1V70A 1X7NA 2BNMA 1EYBA 2XGXA 1ZNPA 4JTNA 4HSJA 3CLPA 2OA2A 4IEQA 4EROA 2QVSB 5FDBA 2Q30A 3E6CC 2UY9A 5CVRA 3GYDA 1J3PA 4Z82A 3QOPA 2B5HA 3RDIA 1CX4A 1OD5A 1ZRRA 4XFCA 4Q0SA 3NL1A 3NKTA 2Z2SB 2H0VA 4L11A 3H7JA 4HVRA 1DGRA 2EVXA 4H7LA 4JVAA 4QM9A 3RYRA 2Q0AA 4YNIA 2H6BA 3OGJA 1Q5OA 5I8TA 3NJZA 3ACLA 2D5HA 2GAUA 1O3TA 2C0ZA 5EZWA 4KU8A 3WW2A 4CYDA 1RC6A 4IEVA 3OTFA 4MZUA 1EY2A 4E2SA 4FBFA 4IEUA 4HZFA 1XE7A 3RPQA 2D93A 4N9HA 5I0SA 5CADA 5JAXA 4Q0VA 1SQ4A 2XKOA 3M70A 1RUNA 4MX3A 5LEJA 2PAKA 4RD7A 2OPKA 1NZCA 2QDRA 4PJYA 1ZZBA 4FAGA 1DZTA 3N4MA 2ET7A 3UKTA 2KXLA 5LEKA 5KHKA 3MZHA 1YLLA 2D5FA 1VP6A 3IIAA 4LUMA 3DN7A 3LA3A 4LUKA 4AVCA 3L2HA 3H50A 2ETEA 3LAGA 5K8SA 4J1WA 3EQEA 1ZX5A 1I5ZA 4R8HA 4D7SA 2B8MA 2XLAA 3H1WA 1OFNA 3S0MA 2PHDA 3LOIA 4AXOA 2GC2A 3U11A 1ZZ9A 3KSCA 4WBBA 1NYWA 2ET1A 1XE8A 3DKWA 4BH9A 3RZZA 4QGLA 5AVPA 1G6NA 2E9QA 3S7EA 5KHIA 3QACA 3OF1A 4AVBA 4BYYA 1EPZA 1GQHA 4PIYA 1X8MA 4EV0A 3D82A 4N9IA 1CGPA 1YFXA 1ZZ8A 3DV8A 4YSFA 5I93A 5JSRA 4I01A 3FWEA 1J59A 4Q29A 1CAXA 4PIZA 2IXIA 1ZRDA 3NSTA 4MH0E 3LA2A 5JCTA 2O8QA 1O5UA 4XF1A 4FAHA 1U12A 3WW1A 3MPBA 5J7MA 1LR5A 1CAXB 2O1QA 5FLJA 3G7DA 2XL7A 1Q3EA 2ZKLA 2Q1ZB 4R52A 2F4PA 3ETQA 4P9GA 4EWAA 1H1MA 5JR7B 1ZRFA 2OYZA 3SHRA 2PAEA 3I7DA 5I8YA 3UKVA 1FT9A 2PAMA 4HLTA 5FLIA 3C3VA 3EJKA 3FX3A 4XFAA 4X6RB 4KWJA 4DINB 5FPXA 3KGLA 1O5LA 3VHRA 2IXKA 2V09A 4I3PA 2QJVA 2OZ6A 5FQ0A 1X82A 5I0UA 1EP0A 5CU1A 2HJIA 3H7YA 3TNPB 5BXXA 2BEOA 2Z69A 4BIFA 1RGSA 3ELNA 4ORFA 5FQ0B 1OMIA 3PLQA 3EHKA 4TLFA 2FMYA 4QXKA 1H1IA 2EA7A 4KU7A 3NW4A 1UPIA 3E6DA 4XFHA 4ONUA 4EWDA 5C6CA 3H9AA 4LA2A 1WA4A 2PQQA 1ZZ7A 4JV4A 3GBFA 3USSA 5E1RA 4XFGA 1GQGA 3S7IA 4KWLA 2I45A 1YHFA 5JSOA 3MDPA 2D40A 4XEZA 1LRHA 4XF0A 2VECA 3HT2A 4HBNA 4BHPA 1NXMA 4KL1A 3CL1A 4I0AA 4UXAA 1YUDA 2ZCWA 3M3IA 4OFGA 5D1IA 4ZU7A 1CAVA 4WZCA 1NE4A 3OCPA 3FE5A 1O3SA 3SMHA 3D0SA 3ES1A 1CAUA 2EAAA 4HN1A 1Y9QA 3RNSA 2PTMA 1CAVB 1J3RA 3ES4A 4IEPA 1ZZCA 3D0JA 5I8SA 1J1LA 3H3ZA 4JTOA 3E97A 2OZJA 3JZVA 1YFYA 2Y0OA 3I59A 4XFIA 1HW5A 2GZWA 1ZVFA 4IESA 4I2OA 3BCWA 3I59B 2CAVA 4J1XA 2GH2A 4MGKE 3KGZA 1J58A 5T3NA 2MPFA 4LLOA 1SFNA 1LB2A 2IXHA 5J3UA 1YWKA 1Y3TA 1ZZ6A 1IPJA 1UIKA 2IXCA 1RUOA 3IWZA 3SCHA 3HIFA 4QX5A 3BALA 3HQXA 3BPZA 1O4TA 5EFUA 1IPKA 2UY8A 5FLHA 5KHHA 2N7GA 3DL3A 5FCCA 4IETA 2PFWA 2VQAA 2XKPA 3U0ZA 5HI0A 3LZZA 3MYXA 4B29A 1DGWA 3RYPA 3IBMA 2GC0A 1DZRA 1LKNA 1NE6A 1UW8A 2GC3A 3E5XA 4QMAA 3RYKA 1WLTA 2IXLA 3IDCB 5KBFA 2K0GA 4GULA 4EWEA 4XF9A 2QCSB 3NVCA 3ZDSA 5C8WA 2IXJA 3CEWA 2CV6A 4I02A 2BNOA 2WFPA 3CJXA 4LEJA 2VPVA 5KHJA 2UYBA 4UBGA 4NVPA 5FPZA 4ZU5A 2XL9A 3OD0A 4Z07A 1O3QA 4MUVA 3U10A 5J48A 4XFFA 2QNKA 3TNQA 3IDBB 1I6XA 4IEWA 4PIXA 4HVQA 2CGPA 1RTVA 2BYVE 3BB6A 1CAWA 4AVAA 3E6BA 2H6CA 1PMIA 3ROUA 4HSLA 3WW3A 4OLLA 4F8AA 4YYOA 3H3UA 1CAWB 2XLGA 3B02A 3E5UA 1VJ2A 3FZ3A 1X8EA 1FI2A 2MNGA 2BGCA 3LA7A 3WW4A 4LTAA
chains in the Genus database with same CATH superfamily
4UF0B 1D7PM 4S2HA 2JDHA 3RZGA 4MGYE 1S5JA 4E2LA 1WA8B 1IKQA 3M3QA 2F17A 1TVKB 1Q6HA 3SYCA 4BW5A 1OH4A 2WN3A 5IK4A 4MVQA 3UYJA 4MVTA 4JYCA 3ASOC 1AZDA 2CK3G 2QEXV 1CAUB 3BU7A 1Y76B 4XF4A 3MIBA 2R32A 5FK7A 2CL2A 4WM7B 5LRSA 1K5SA 1NCRA 1W6OA 5IVBA 2FL4A 1VE0A 1IHMA 2WLKA 2QQLA 3U1XA 1H8VA 3VD9A 4ZI7A 3VDCA 4JDNA 2A9HA 4DV7O 1GN4A 5LY2A 4DIQA 4AAPA 3C7EA 3TRSB 2C2AA 1JUHA 5BV6A 3AG2C 2LO1A 3NAPB 2VE1A 5ITZB 1SLLA 1YJKA 1XI1A 2XGXA 4J25A 4Y33A 1GWLA 5FZ1A 3O7OA 1N3QA 1E1RG 4EROA 1S0VA 4EYUA 3QOPA 2HWD3 4N7IA 1RUE3 1OD5A 1UY3A 5F5QA 4LBQB 1DDLA 2Z2SB 2H0VA 5EIYB 1S0GA 4OMCA 3LEGA 5GLVA 1X9TA 3AG1C 4QX8A 3KZIZ 2W3JA 5I8TA 3NJZA 3LDBA 4IV1A 1MEC1 1Y74A 2Y38A 4CUAA 4KU8A 1PVXA 2JG9B 2PLV2 1SQGA 5EZYA 1MACA 3THCA 3T0BA 1Q8SA 2OT7A 3M70A 4B3TB 5L3FA 4IV3B 2YU1A 3UKTA 3POBA 3OFNG 2B5UA 4DQAA 1VMJA 4CXWA 4N8MA 1E5SA 5KXBA 1NX9A 1K12A 1LOCA 2R071 5C3OA 4XDJA 4PJ0Z 3O9OA 4X66O 2VJXA 4ZS3A 4MVZA 4JX0A 5E1AC 2JJ6A 4JV5B 2PHFA 3AZVA 4CVUA 3V0BB 3W5NA 2OIIA 4D6SA 3AFKA 3RJ2X 4EV0A 3ZN0A 2JKXA 5DN2A 1US6A 3O1SA 2DWDC 3CRCA 4NWVA 1HWYA 1PVC1 4PIZA 3WNPA 2QSAA 1KU9A 4YXWG 1G9FA 2R0FA 2FKXA 2BW8A 2O14A 4MH0E 5CKNA 4XTMA 1XNRB 4EN6B 1QOSA 1CAXB 5FLJA 2JDPA 1JOPA 1LOFA 4KWUA 2B9ZA 2F4PA 1H1MA 4ZIBA 4NR1A 4R7CA 3CCJV 2WLHA 1VALA 3JD2A 3DXUA 2VUCA 4GWJA 1WBLA 1NH2D 1GWKA 5HV0A 2PI4A 2WLMA 1V6KA 2VNGA 1VP7A 2K46A 2LFSA 1KYOF 2NM1A 1HIXA 5BXXA 4JTAB 5EHDA 4QDQA 1AP6A 1MSWD 1QLEC 1ZYBA 4BQXA 3RWRD 5JXGA 4XHBA 2XG3A 4JI5O 2XONA 3HJRA 4X20A 1KFUL 2JE7A 5JH7B 4L97A 2NLRA 1UOFA 1I5XA 5EIBC 2E75B 2BGOA 2VOKA 2XAFA 1TVKA 1SCSA 4B3SO 1CEZA 3HKBB 2GN7A 4YGEA 1CAUA 2WNUA 5CN0A 2RS31 2PHUA 3AYAA 4CP1A 4JTOA 3E97A 3IKWA 4WZFA 5ABJB 3HD8B 4KGGA 5CZKA 1MG1A 1LEMA 1GZWA 3O1RA 2YYOA 2YI9A 3J26N 3ZCCA 2PHXA 4U3JB 5FZLA 4Q4W1 4JZ2A 2PHRA 4G3YC 4QX5A 1OOPB 1W8NA 2F95B 3B77A 1SQXH 1LNSA 1JFFA 3VBRC 3OBTA 3IPVB 2DYCA 1OPOA 1NCQC 3MYXA 2VZSA 1DGWA 1YYNA 4JYAO 4P9PA 1AI5A 3MIFA 3NAPA 1OKQA 5ITZA 4ZKTB 3WU2Z 1MEC2 1OCZB 3SPGA 3A0RA 4Z1VA 5JPMB 5KAIZ 3SPJA 3ILNA 3LEMA 3HOBA 1RIRA 2BFUS 3JYCA 3MW4A 4GWMA 4R8CA 2E5LO 4LBQA 5H9QA 4LR4A 5ISLA 3AVRA 1RTVA 2V4VA 2CH7A 1R083 4ZXEA 5B5EZ 2XNDG 3VQWA 4QXHA 1HR0O 2XLGA 2AR6A 4NRMA 4B3NA 2R072 2DOSA 1RUI1 1M57C 4Q1PA 4IEZA 4JI4O 4D7TA 2PA7A 4MGZE 5FZCA 2P3JA 3VBFA 5AC93 1EAH3 3RYIB 2P06A 1W6NA 3VDBA 2D98A 2P90A 2D6MA 3ETDA 4NKGB 1GN6A 3AK3A 2MHFA 1VMGA 1PVC2 4FO9A 4FT8A 1W3VA 1JZ5A 4G4FA 2IUWA 3OUHA 3B00A 4LFCO 3R6SA 3SLIA 3CMEV 2CDYA 5FYUA 4C0HA 5C8CA 4Q5OA 2UXXA 1DK1A 5B4XA 4AYUA 2HLEA 2W92A 5F1RA 1ZTEA 4IHJB 5DDJ1 3HBKA 3ZFEA 1SEFA 5FYSA 3VBSB 4L2NA 3K48A 1QWRA 1APNA 5CKMA 3TCUA 4K40A 4DR5O 2XASA 4NTWA 1XOYA 4TXWA 3OEAA 4PELA 5CFDC 4K8XA 2LROA 3V56A 1QJY1 2VD7A 5IFTA 4DRRA 3LKJA 4GJYA 3BAAA 5FYTA 1ZNPA 2DU0A 1OT5A 4OPHA 4X62O 3J7NA 4QHOA 3RZMA 4CPBD 1V54C 1WB8A 1J5EB 1VQMV 2UY9A 2JEUA 4DS0A 3BIWE 4ZONA 3MFCA 3W7TA 4LBQD 2YBPA 1O4YA 4KGQA 3AXDA 1R6KA 2LQTA 3ZYHA 4YNIA 2B46X 2YXHA 2KD7A 4D0QA 2RS32 5FKCA 5FY7A 2GAUA 4AVTA 1MS1A 2VOVA 1BXHA 2ZGOA 1RC6A 5F5IA 5JVDA 4BR6A 2Y33A 5J09A 1K5MB 5CIRA 2QGNA 5JH7A 2D93A 1UMHA 2C9AA 1Z2GA 5JAXA 4PA7A 1YI7A 2WLJA 3O1VA 4Q4W2 2QWNB 5LEJA 2PAKA 1P8JA 3E35A 4RQPC 5IK8A 1PX3A 5LYJA 5ERLA 1UOBA 1GSLA 5A9GA 4WFBV 5JUVA 4RQFA 4PDLA 3POJA 4B1LA 5LBEA 4PHZA 2W39A 2ZX4A 4RS5A 4CDWB 1KDKA 3VBUA 1UFIA 2W1WA 1ZZ9A 2LFRA 4CC6A 4UAPA 2OVUA 4U3JA 2YG0A 1UYXA 2ADPA 3OF1A 4BYYA 3BY6A 1RVF3 3ZOIA 2M7WA 1LODA 3CCSV 3IPVA 1Q6IA 5L73A 3UGFA 4LBMA 3LA2A 4IL7A 5LZ6A 3MPBA 4AFAA 1VBA1 2F23A 2XL7A 1Q3EA 3T1YO 3ENRA 1VQKV 2IVIB 4DR6O 1HQLA 4QPIB 4JI6O 2OYZA 3LDEA 3ZEDA 4FSJA 3AG3B 1RUI2 5CKQA 2YROA 2YI8A 5GKAC 4C1XA 1O5LA 4M0HA 4CEYB 3L9JT 1GH6A 1ND3C 3THPA 4P9WA 1GMMA 1RGSA 3ELNA 5FQ0B 4H14A 4TLFA 1SLBA 2ZXWC 1TMF3 3IAYA 4R9DA 3NR7A 4UFZA 4E8DA 2R6QA 4ONUA 2R9AA 3JCUZ 2F4VO 4LA2A 3D36A 2BE3A 3IC9A 3AP7A 3NQHA 2FZ2A 1XU1A 2JIZG 4N90A 1QNYA 4WM8C 1E57A 5DDJ2 1X9PA 5FR3A 1OHFA 2JB8A 2VW0A 5LASA 3FE5A 3D0SA 3W5MA 5GTHZ 4L92A 4JQTA 4UV8A 4BMBA 4IE6A 4FQ4A 4GMP1 2BTQB 1U5YA 3I59B 5EWSA 4CU6A 2DCJA 1QJY2 3VZKA 4BOWA 4IHJA 4DW0A 3ETGA 1IBMO 4M0NA 3FFZA 3IB3A 4OZOA 2E76B 4C91A 4PD4F 1LUWA 3L75H 2VQFO 3I56V 1W0KG 3C3TA 5JOYA 3ZXKA 5IT6A 4N7UA 1YSCA 2ZGMA 3ZN4A 3AKQA 4D8MA 3UJOA 3ZFGC 4BMEA 3INAA 1Y67A 4Y4RA 1Y4WA 2WFPA 4LEJA 1CZVA 4LBKA 3FBYA 2VH9A 2UWCA 4N43B 5J48A 5C4WB 2HJDA 1H38A 2PHTA 2WS93 3GJAA 2IJIA 2FBEA 5FPBA 4AVAA 1N34O 1QXPA 4CU8A 4PQQA 4CU9A 5KC5A 4AI9A 2ZIOA 2MW2B 1D2QA 3BTYA 4LTAA 1K5MA 2PHLA 2J1EA 3RRDA 1FMD3 1ZRCA 3H1KH 4UFKA 3HR9A 5JSPA 2XAHA 4NPLA 4XAAA 4XFBA 3NMBA 3WT3A 1JPXA 4B3TO 1LAJA 1SDDB 5L7OC 2FQPA 5BR8O 3POGA 4KP4A 1DGLA 3O0VA 4Z2AA 5FUIA 1VBA2 1XRUA 4LKEA 2X6CA 2IC1A 2B9UA 4OHXA 2QQVA 2XHKA 1N4CA 4BW9A 4JV5O 4DO2A 1C8NA 3VD3A 1OCRC 4FFBB 2YV8A 2E74B 1LHVA 4LJHA 1SLAA 3VKFC 3LQCA 3POFA 3U4XA 2VUDA 3R0RA 2ZT9B 2PQSA 1FXZA 1XNRO 2Q7EA 4IEOA 3B7MA 1M4WA 2UUAB 4CDUB 5K0UB 1HQWA 5JIAA 2EILB 4RR3C 1BVVA 2OYQA 3J8F1 4XTPA 2P3KA 4JAVA 2ES3A 3I2JA 5BNOC 3E6CC 5CVRA 2NPIA 4M3CA 2HWB3 5FP8A 5F5CA 1ZA7A 1ZRRA 4XMIA 2ATKC 4BPZA 3X2QB 3T4VA 1UL9A 5A7OA 2B1IA 4A7ZA 1AXZA 4Q20A 4UB6Z 3FKSG 3W58A 4GD4A 3NNFA 3FYEB 1B3QA 2YFZA 5C33A 3OJBA 3BTAA 4YZ1A 3L9DA 1MQTB 2HG5C 3CHXA 1RITA 3AKSA 4Y1YA 2ZEXA 1Y9GA 4W6XA 3CSXA 3RZJA 4Q8KA 4FFFA 3WNNA 2E26A 4W6WA 1BSMA 1WJZA 1GM9A 3VBBA 4TLGA 5IAVA 3WQ7A 3WF4A 3I2KA 1AR81 5EBLC 3ZN6B 5DXDA 4LIUA 3HQUA 4J11A 2BOIA 4Q4X3 4XJAA 3RMYA 3PJYA 1FPOA 2WABA 1AILA 1FNYA 1RUF1 1LOBA 4FLXA 1SLIA 4YG3A 5HCHA 3JARB 1BCXA 4DRXA 4MYEA 5IW0A 4Q29A 5B1AC 4INDA 2DJVA 4DV2B 2CY6A 3PTRB 3B5LB 1HV1A 4K35A 5JOZA 1RUC3 2NYYA 4DOUA 3SJQC 5DZEA 1I3HA 1M06G 4HLTA 1M56B 4MSVA 1LTEA 2YEVA 2BTVC 4I0XB 2UXDB 3PURA 3JCIA 4ISQA 1SFPA 2UXNA 2UUCB 4XOGA 3JD4A 4GX2A 5A33A 3ZHQA 3CRMA 2HYXA 5DN6G 1I9RA 5DEDA 3E1F1 4BJ0A 3M4FA 2PZSA 3I55V 2W94A 3RN4A 3NV2A 3USSA 4CUCA 3JATA 4FOYA 4YVSC 4GB31 4QX1A 5C7GA 1RM1B 5FXZA 1AYM3 4KL1A 2RMKB 2ZTNA 3IIIA 3HKEB 3UM7A 4MS2A 1L7LA 2VQ0A 3GNEA 3N9LA 1JYNA 4M01A 1C1LA 1J3RA 2Q73A 5DZFA 1Q86W 3BHPA 5DUWA 2JRIA 5GLZA 3VD7A 2YB7A 1JOJA 4K21A 2EJ7A 5FY0A 5EXOA 2CAVA 4LFAB 2VMEA 1QH7A 1O91A 2GDFA 3M3EA 4ARXA 4UB8Z 2BBAA 1UIKA 1R091 3J8F2 3WUCA 4ITCA 2YIBD 4FFBA 1I94B 5EFUA 1HNXB 5GZDA 4COVA 3D3AA 4JGYC 4DR2B 2W9XA 1BEV1 3RYFA 4H13B 3D3IA 2OCCB 1AR1B 3U0ZA 2ITCC 3G67A 1VRBA 4WVWA 1TNRA 4TT3G 3PMSA 2ZGTA 1S72V 1NR7A 5IVFA 3MD0A 1UW8A 1VQ6V 5K0UA 4CDUA 5KBFA 3WDTA 2HWF3 5EV7A 5C8WA 4I02A 5F5AA 2RR13 3JALB 3ABLC 4OX9B 1SKVA 2FMLA 1VQ5V 3THTA 2WO1A 2YXSA 4UVBA 1J5EO 4CP9A 4LNVA 2ZABA 1Q8VA 1W59A 4AI3A 3ZR6A 5KLVH 1K8AW 5A3MA 4A44A 1S1AA 4X8NA 1AR82 1S55A 4OUEA 3K3WA 1VJ2A 1XQNA 2TUNA 2K9ZA 3OPWA 1MQTA 2W1SA 3SCGA 3LWCA 2P6JA 1T6BX 4MXVA 4ZHNA 4AQ6A 1TVGA 2N74A 4YZ5A 3BRCA 1DFQA 1L1FA 1RUF2 4R9CA 4MT8A 5JMCA 3D4KA 5GZGA 4QB6A 1C8M3 3R05A 4B7EA 1F5FA 1KBHA 1DBNA 5JXHA 3UKNA 3MIEA 4IERA 5F39A 4GH4B 2RG4A 3FHAA 4I09A 4E2GA 2XUMA 5EYYA 1RSOB 3MI8A 1JX9A 1M5IA 3GZTB 3ZR5A 3VHOA 5C9AB 2W2IA 2KSDA 4QPGB 3WF2A 1QQP3 1X33A 3VHNA 3VV1A 2AXTZ 5FMBA 3J7HA 3L73H 1QJX1 1GTOA 4PV1B 4BXSV 4NHXA 2ZAHA 1TQ5A 2ZJCA 2Q6AA 5HFLA 1UZVA 2VZQA 1JVMA 1TME3 3DGEA 3AP4A 1O3RA 2ARXA 4K3UA 5FY5A 1AI6A 1XQ8A 3USUB 4BDVB 4GB32 4NTYA 2FDFA 3OBZA 5K1XA 1W9TA 4I0XA 5FZHA 3KB5A 1N0NA 4A6SA 2Y8KA 1CX4A 4MTXA 2YY1A 3PUHA 4Y22A 1U97A 1URXA 4Q0SA 4L11A 2BSKB 1F15A 4P30A 2YUAA 2EIEA 1QMJA 5JLVA 1ZLZA 4AHYA 5CFCC 4FVVA 1ULDA 2YDEA 1QU0A 1EN4A 3WFVA 2D5HA 5GLUA 5L9BA 2GTAA 4IEVA 4JKLA 4M4RA 2V7QG 3ZIWA 2D6PA 2WNEA 3ABMB 3STZC 2E33A 2FCUA 4HZFA 1XE7A 1FOD1 1NS1A 4BE3A 2E7TA 5IAXA 2GP3A 1YZBA 3O12A 4B3RB 1I5PA 1AXYA 1QLNA 3N4MA 2W91A 3HKEA 3KWVA 4S2DA 2V5DA 4I5SA 4RHV3 4QB1A 3IIAA 5FY4A 2OW4A 1BEV2 4LUKA 3SYPA 4XDKA 1ZX5A 5FMOS 1YJLA 5CISA 2PHDA 2AUYA 4WM7C 4XUNA 2P34A 5E79Z 4CH4A 4Y5SA 1NYWA 3RSJA 3VZNA 3N2GB 4QGLA 1W0NA 4QWNA 4DW1A 1GFF2 4WBNB 1EPZA 5AFBA 1PNLA 4CDQB 1KB9F 4AEMA 1AP5A 4YZ2A 5LATA 3AFGA 2X5IB 3G80A 4J7ZA 3JAWB 3CP1A 4HK9A 4BK4A 2Y6FA 1LNQA 5JR2A 3Q9OA 2DUQA 2RN9A 1V9U3 1SQPH 4HKLA 3WG7B 1FXKC 2JENA 3TBDA 3NAPC 1R1A1 1BK1A 2P6CA 1JHNA 2DVAA 1UU5A 4CH6A 3AYCA 3ETPA 2Z4FA 5DUUA 3JALA 3I7DA 4LF9B 5GTIZ 1W39A 2VVEA 3AG4B 3WP4A 3B4SA 3ZHTA 2EXIA 1S5LZ 4QE9A 3ZKUA 1X82A 3GBGA 3WDWA 3JBG3 2QTWB 3QO8A 3ZIXA 4Q4V3 4Y20B 3AKTA 1NVPB 4DV4O 3OUSA 5CA0B 5FXXA 2PQQA 1QH6A 3SH5A 1EBOA 3S7IA 2JG9C 3N3HA 4XEZA 5BNPA 2RM23 4XF0A 4AEDA 1Y6XA 4XCBA 2IU3A 4XJUA 3ME2A 1ULPA 3PVOA 3T2QA 1AR93 4PI0A 3VBOA 4IV3C 2HWC3 3CCLV 1A32A 3CRAA 1YIFA 5EPAA 1XNKA 4GMP0 5D5PA 1QJX2 1PL0A 1OUXA 4JDMA 3SYAA 3BCWA 2ENRA 4J80A 4Y3OA 2VTXA 3HB3B 1ZZ6A 2OIEA 5FK8A 2IU0A 1IPJA 5IJRA 3APOA 4ZPIA 4MG2A 3BALA 4O4IB 5M0TA 4XQ4A 1K45A 5ACA3 4O4JB 4UCOA 1NJIW 2WSUA 4CDXA 3MHHC 5FCCA 1VBB3 2XKPA 4KFMA 1MZ5A 3ZX7A 2R0HA 3C90A 4P00B 1FPN1 5C8YB 5J98B 5JOXA 4AI0A 1HN1A 4FI9A 4H3WA 2VOWA 3H8OA 4YM2A 5A32A 5FZOA 1Y4MA 3MPPG 5L9RA 3BCCH 1COV1 1GMGA 3I2DA 1HXS3 3UESA 1FOD2 1JJ2U 1F35A 4Z07A 1QJU3 1WP8A 2JE9A 4P02B 1SERA 1PHMA 5A6QA 3RYHB 2V5YA 3OR7C 3E6BA 2HKOA 1N1TA 1UY0A 2HBTA 1ZWIC 2EZOA 2JIGA 5FPUA 3AMNA 1FAFA 3WW4A 3ECQA 3V0AA 4AHWA 1CJDA 3E8FA 1JR9A 4Z1MG 2Z79A 1E1QG 1HP8A 1XNBA 3OUFA 3ZMNA 3B09A 4META 2EIKB 3AJYA 1C1FA 1QXJA 4X1YB 1ZRIA 3DTUB 1W8OA 5LWBA 5H5NA 2JEXA 2CDOA 4RQEA 1WGPA 1JZ4A 5GW7A 4MV2A 4HNAA 4XXAA 5ABJC 3A0HZ 2YC0A 3AMMA 1R1A2 4LO5B 3UNPA 3S57A 3N2GA 1G86A 4BIUA 3T3YA 4Z92B 1RL3A 2VQEO 5BNNC 4QHBA 5FY9A 1OOPC 2HWD1 1ZSPA 1RUE1 4XPVA 3NJYA 3HEIA 4AVVA 1XMQO 4XDPA 1Q43A 2A73B 3CEIA 2QA4V 2HP8A 2JS5A 3KM5A 4DR3B 3ZYBA 1Q56A 3F5TA 4S2FA 5CG9A 3P32A 1ODNA 3TEWA 2GSYA 1JHJA 4O2AB 1VIBA 3RVYA 4CTEA 2AZ2A 2ILMA 1HB4A 5HXVA 1OCOC 3RDIA 1A3KA 2I2SA 3H7JA 2UUCO 3VZLA 4Y20A 2WNVB 1WCDJ 4XURA 2BOCC 2ZEYA 2XJSA 4WV8A 3WW2A 3G71V 1MZ6A 4LBOA 2JG8B 3E8BA 2PUSA 4XBNA 4FVMA 4RWUA 4GA9A 3OSDA 5T54A 1S76D 1IQAA 5JJNB 2KXLA 3AK2A 5IYZB 5F6KA 1WP7A 3AL5A 4JTDB 3DN7A 2QTOA 5FYIA 3JASB 2J1RA 3L2HA 3KS7A 3WY6A 3RGBA 1MS5A 1FPN2 2BWAA 1ND2B 1GK9A 5HXMA 4O4HA 2XLAA 3S0MA 4GALA 2VVDA 5AFEA 3DC6A 5BXZA 2E7QA 4LFAO 3DKWA 4OUMA 2ZX3A 3S7EA 1COV2 1Z7S3 2JDYA 1GQHA 3K0DA 1SBDA 2R9RB 4WFFA 4O4JA 2WZPP 1HNXO 1JU4A 5JSRA 4YW7A 2EIGA 1AF9A 4DR2O 3VBSC 3ZYJB 3ZRSA 1UZWA 5C8YA 2WSSG 1SBEA 2O1QA 4I4TB 3KHCA 4WFEA 2D3RA 4JGZB 4H37A 5FZ3A 2ZINA 4R52A 2UU8A 1WMXA 4LNUB 3UO2A 4A45A 3EFFK 1WCKA 3UKVA 5A6YA 5A3TA 4BXFA 3C3VA 1AVMA 4OX9O 4JC1A 4KWJA 1XC6A 4FK5C 4PDWC 1NUKA 4IIJB 1EP0A 5CU1A 3RYHA 3CCUV 2QUOA 3OG2A 1UPSA 4GXLA 2VO5A 4BIFA 4JRAA 2RS13 1XJAA 2FMYA 2DVGA 1NVPD 4K6BA 2GNBA 2LW7A 1UPIA 2CYFA 5GALA 5C6CA 4RUEA 2EICA 4KG0A 3TWIA 1JZ8A 2ZEWA 4KWLA 2WL1A 1MS8A 2A6VA 2D40A 1GAXA 3AXEA 3MDPA 2V72A 1J83A 2VECA 2RS53 4IGOA 1OURA 3SEPA 3FUQA 2YC4A 4F4LA 1HN0A 3M3IA 1ULEA 2CE4A 1VIWB 4X1YA 2HWD2 3ZO0B 1RUE2 1Y9QA 3MO4A 1MS4A 3Q8CA 1ZZCA 2EBOA 3GCXA 1JA8A 1S3JA 2D3SA 1REDA 4OGQB 4LWSA 3O1UA 4I2OA 4KI5M 1VB4A 4CDWC 4TTGA 4MGKE 2OWOA 5T3NA 1YXWA 1O9GA 3QG5A 2IXHA 4ZHQA 3D6EA 4HANA 4FFKA 1GP4A 2XJTA 2JEMA 3BPZA 1GWMA 1LOEA 5LBCA 1Q90D 4LE3A 2C4XA 3H1IH 2I74A 3HKCB 4NHKA 1KMIZ 4P9XA 1R081 4OI0A 1D0HA 3CJIA 1XL4A 1DZRA 2X10A 3CU7A 3WP6A 5FMCA 5L3EA 4WVVA 1WD4A 2IXLA 5IYYA 2H0BA 3N2KB 4CXXA 3OGIB 1NZIA 4Q8LA 3P5BA 4KG8A 1AI4A 2CHHA 4QPIC 3ON7A 4GQ7A 3WD5A 1C3HA 4YW4A 1AL0G 4PBPA 4LKSA 3WNKA 5APAA 2R063 1AI7A 1K33A 3AG3C 4AOCA 5IY5B 3CE2A 1DQ0A 2JDAA 2VW2A 3AL6A 4TV8B 4XFFA 5AC91 1EAH1 2VZ3A 4CEYC 1I6XA 5FZDA 1OV9A 3RBZA 4P5HA 1PNMA 1PX4A 3H3UA 5IFPA 1HRI1 5CYYA 3IJ4A 4CUGA 1RHI3 4IUGA 3OYWB 3PVEA 1NR1A 3AK1A 3T30A 1IVSA 4IEYA 3BA8A 2DCTA 2OPWA 4FPGA 1OZ0A 3OM3B 5GONA 3PVBB 4MGIE 5E8AA 1WN7A 3C3SA 1OKOA 3ZMOA 1FFXB 3JAKA 1EV12 4B3RO 2LS6A 1V55B 2W0FC 3W59A 2NZ9A 5HCBA 1TGOA 3CRQA 4LXLA 3LDCA 1H1AA 2HVKC 4PCRA 3JXSA 1NI8A 3MW3A 2EIJC 3THDA 4O9EA 2YBKA 4YFZA 5LA0A 5F2VO 4U2AA 3KMHA 4CEWB 1CN1A 3UT5B 3LGRA 4HN0A 4MHRA 4DY3A 4I0WB 2VXJA 2IH3C 2ZX1A 2NP0A 5KMGA 3F7VC 1AJOA 5EYPB 3GBWA 1RYYA 1UU4A 3RVHA 2W6IG 4QHZA 2X53S 1V6NA 5CB4A 5LL6Y 2OUHA 2VWKA 2Q8DA 1VMFA 2ATFA 4DB5A 1M90W 1JH5A 4BWOA 1YVWA 5G04L 2VZUA 4ASUG 4LF9O 5FDBA 4YVWB 1E5RA 2FMDA 5F3CA 1ZBE3 1H6YA 3B93A 4N43C 3CRRA 5C4WC 3CXHF 1OQ1A 3SH4A 1R73A 1A8DA 2Y64A 4YW5A 1H9WA 3RYRA 4J6GA 1OVPA 2DU1A 2DN9A 4D69A 4AF9A 2IWGB 3VZMA 5IUQA 1F5JA 1SPPA 4MVOA 3A7QA 3OGSA 4U3FH 3OTFA 5FZ7A 5JPNB 1JYTA 3N35A 1MZEA 4I7ZB 4Q0VA 1G7YA 1H0BA 3I8TA 3A8TA 3IAQA 1NZCA 4FAGA 2H3OA 1RVF1 5T5LA 4OHVA 1HDKA 2VMDA 4UFMA 3EB7A 2CWSA 2GV9A 4AVCA 3J7MA 3CB2A 1NLQA 3H8XA 1I5ZA 1TA8A 1R082 3X29B 3ZMSA 3KSCA 3SDLA 2A5ZA 2J1SA 5FZBA 2ET1A 1XE8A 5E88A 4ASLA 4BH9A 1SDWA 1Q82W 2ZZJA 3KV4A 3THOA 1SCRA 1DGRN 3GALA 3CCEV 4QX7A 4DEQA 3SQOA 1SQFA 1EAH2 5AC92 2ZGSA 2KQXA 1LHOA 4XF1A 4J41A 5LOVB 4YGDA 5D21A 3C7GA 2NNUA 1TMF1 2JDKA 3V64A 2G19A 1HRI2 3N2KA 1POQA 4CDUC 2LP7A 1M4UA 2ZBJA 4NIHA 5F2WA 1A8MA 5C3PA 1U5IA 4X6RB 1AROP 4AFDA 4CCJA 3WQBA 2VM9A 3UT0A 2OQ6A 4UI9L 2LTNA 3RFRA 2B1GA 3PLQA 2FZ1A 1UF2C 1XYOA 3C2UA 2JECA 4UUJC 5TSWA 1RJ7A 2JB4A 5C93A 2TNFA 1IBLB 2JDIG 2I45A 1UZYA 1MQTC 2WYFA 1OVSA 4ISRA 2HVJC 3R4DB 1OLME 1R1ZA 1N33B 5LBFA 5GM0A 1CAVA 1GU3A 4DXTA 2BFUL 3ACHA 3D3QA 2YBSA 3RNSA 4KXRA 2DUPA 3R4UA 1TUBA 3ES4A 5I8SA 1BQZA 5FYHA 4OCTA 1ACCA 1Z5WA 4IESA 1VF6C 3TK1A 3T0AA 3CQOA 3MLKA 4QXCA 3KGZA 4XABA 1PGL1 4PQ9A 1LB2A 3JQXA 2IXCA 2ZAAA 3IWZA 2LRPA 3MV11 4GKXA 3ZRWB 2ZCEA 5EYPA 4L9BA 4C0BA 2N7GA 4ZS2A 2DYRC 1Q8QA 2PFWA 3LZZA 2WS91 4TWKA 3VKMA 1QNMA 3M8LA 2Y48A 1DGWX 3TOJA 3O1TA 1GNYA 3ZHVA 3RYKA 5F37A 1AR63 1YC61 4UW3A 2ZE7A 2A3WA 2HH9A 3KV9A 4DR3O 3IMMA 1W8TA 1FMD1 3TETA 1NY71 2BUKA 1W6PB 4DV3O 5LMUO 3WR0A 4Y24A 4EB6A 1W99A 4N53A 1RVF2 1CAWA 3I5DA 1GO3F 3WB1A 2QQJA 4PDVA 5T52A 1CVNA 3CPWU 4LO4B 1YRZA 3KF3A 3LA7A 1PNKA 3K5NA 4LF7O 1O4ZA 2XBO3 1LR1A 3A23A 4L8JA 5JXJA 1RM1C 3WP5A 5J2UA 1ROPA 5HV4A 1US3A 1N8RW 3ML0A 3STLC 4XETA 4O4LA 1WMEA 5LHGA 5BPXA 1GLHA 3A0BZ 1W3XA 2R7EB 4QM8A 4BQYA 2OCHA 2R043 2Q8OA 1TMF2 4HMZA 1W9SA 1HB2A 1EN6A 1QVGU 2W52A 3VQXA 2VCBA 1NA1C 3RZKA 3R4SA 5EBWC 2W08A 4GCZA 1NCRB 4MGSA 4GUNA 3IZOA 3TYJA 3ZXDA 4DY5A 3WG1A 2XJQA 2YFUA 1JQ0A 4ZI7B 1XNQB 2JX9A 5EJZB 2HWB1 2VBPA 4CRQA 4QKBA 3ZSLA 3POWA 1SMVA 2OCCC 5J9PC 5LOVA 1RMU3 1HKDA 5LXTB 3MIGA 3LE0A 3POYA 2WO3A 3WHUA 3GVMA 1ONAA 4D7YA 3T09A 5JZGA 1DF0A 3UO3A 3T1CA 2SLIA 2QVSB 1W9WA 1HNZB 2WZ8A 2B5HA 4CSWA 2HHHB 4XDQA 3AG1B 2D44A 5JWPA 2LALA 2J22A 4CBCA 1XMOO 4JI7B 4K7JA 1REFA 3NNJA 5GLWA 2BV4A 3OGJA 3FAVA 3P30A 1R3JC 2JKBA 2VC9A 3DPRA 4A3ZA 2ZGRA 5JQGA 4J7KA 4IV1B 2OX0A 3A0NA 1FJGB 3RMXA 4D94A 1Y74B 4Q4X1 5K1PA 4N9HA 1PGL2 2XT9A 4PLMA 5EZYB 4MXWA 2KKWA 4LO6B 5FO9B 3ZHSA 2EIMB 4B3MO 1ORQC 3TEZA 2ZDIA 3SR2C 2ADQB 1ST8A 4NJ4A 2HEPA 4I55A 2NQYA 2WS92 1VARA 2Z5UA 4FP3A 5F3GA 1RUI3 4XQDA 5EK0A 1RFYA 1RUC1 1PO11 2P2KA 3O0WA 2WLPA 5IVEA 1GN2A 4DYLA 3AM2A 2V1DA 3RVZA 1THZA 2ZIMA 2E9QA 4QXBA 1NOVA 4GH4C 1WZXA 1XUQA 1FMD2 2V4DA 3ZDVA 1NY72 1YFXA 1PL4A 1DYPA 1YQ2A 5C9AC 4HYOA 4BQ4A 5CA3A 4QPGC 2XHNA 2P6HA 2WN2A 4BQ2A 2VQUA 3WW1A 4R50A 1LR5A 3C7FA 2QQWA 2DYSB 1S2EA 4XYXA 2DV9A 1RUJ3 1SACA 4K0KB 3SHRA 1KP2A 3PMEA 2Q1MA 3OGVA 3N9NA 2XB6C 1AYM1 1AYN3 5DAVA 4AILC 4QGPA 5FYBA 2EIBA 1SZXA 5H2FZ 1D4M3 4R4XA 1NKDA 4O7XA 5EP9A 1WPBA 2XH6A 3ZFFB 3LDDA 3I97A 4IXLA 4AHZA 1XU2A 1ZZ7A 5CBLA 5B3SB 3GBFA 4J9ZB 3ZXJA 5FRAA 2CTVA 5JSOA 3D8CA 4D6TH 1AVBA 4X20B 5FIXA 1EFRG 1NXMA 1K4CC 1UKRA 3CL1A 1GM8A 4I0AA 2YPDA 1F4AA 2RV9A 2ZCWA 4IW3A 5FBZA 1UZZA 3OCPA 1O3SA 3UCSC 5FTTC 2EAAA 2NMOA 2HWB2 3E22B 1F4NA 1W2UA 2HEYF 1WW5A 1PP9H 4XFIA 2CAZC 2WNUB 1XILA 2EF6A 1ZL8B 2GH2A 2HWF1 4QU1A 1LJ7A 4LLOA 5HCFA 3MEPA 1GZWB 2G4IA 2RR11 1EM1A 3SCHA 1OFSA 3LDKA 4YJ3B 2RVAA 5GZEA 2Y6LA 5A3OA 4M4PA 1YJNV 3I3QA 2WA3A 3N9QA 1DP0A 4CDQC 3DYPA 4IETA 2X5IC 2IW5A 2ZD9A 1JFFB 1NAEA 4M00A 5FAXA 4E9KA 1TZOA 4H0LB 1F51A 4LITA 4LF6O 4JI2B 5FJHA 5LXTA 2VZOA 4FOVA 1XYNA 2JDUA 2Q9LA 2ZHLA 2GC3A 3EXAA 3WG7C 1R6NA 1GP6A 5F3IA 2WBKA 1KS4A 3CCRV 2P1BA 3SEEA 2OKXA 2J1AA 2UYBA 1F23A 1H8TC 4Q4X2 2XAGA 4NOTA 3AG4C 1CPYA 1RUH3 2XL9A 1H2GA 4MUVA 3UETA 1UN1A 4UWDA 3IDBB 1D2DA 4LF8B 2XJRA 2CH7B 4CA9A 4FLZA 1C8M1 2XJPA 2DURA 3E2EA 1CIWA 1RUC2 1PO12 4C8DA 3OY8A 1VBD3 2Y60A 4JI3B 4DV6O 1UY4A 5C71A 5J2TA 4UVCA 4LHLA 3LSUA 2CAUA 5IJ0B 2Q4SA 1WW7A 4F7ZA 3VBFB 4UBHA 3NKGA 3MUY1 5B4NA 1S0EA 3FB8C 4XIOA 3H1HH 1W6NB 1QQP1 1QY4A 5FZ9A 2HKXA 4H2AA 3PHMA 2ZHKA 2WLLA 3O0XA 1NQDA 2HWE3 1BJQA 5E16A 2CGOA 4HPKA 1GANA 4Q26A 2BNNA 1CONA 2R9IA 1TME1 3CC2V 3I54A 3CNAA 5C8CB 1AR5A 1LESA 1FS0G 1EZJA 5CBFA 2DFCA 3OEBA 2CWMA 5ANQA 1AYM2 3EXUA 3ZFEB 2DW4A 4ZU4A 1L0NH 1DLBA 1YFWA 1H4GA 3I2OA 1VR3A 4UW4A 3FLRA 4A6OA 3OEHG 3SC7X 1V70A 1GKBA 4FPEA 2RDSA 3OOXA 1T2XA 2AHZA 1LOAA 3W21A 3AZXA 3HNMA 5CNAA 3WG2A 4XILA 4A41A 1AL23 3LSEA 4RHV1 4H7LA 5FXWA 4Q4Y3 2W5FA 1XYPA 2HFEC 3OMAB 1PK6C 4GKJO 2Q0AA 1NXD1 1F31A 3FX7A 1K92A 3ZFFA 3QD6A 5BY1A 4B1MA 1QCEA 3T2PA 4BU2A 5EJ1B 3CWBH 5FP7A 1NT2B 1UU6A 3VD5A 1MABG 4YZ4A 1IBLO 2HWF2 4GKYA 5JVDB 3ZYPA 4XJZA 1NT0A 2VGDA 2A3QA 2RR12 4MTOA 5F2SA 1IGOA 3MF9A 2JJ1G 4YW3A 1DZTA 4QX3A 1KITA 4BK5A 3Q4HA 2EIKC 2RCVA 3FBMA 3E22A 2E31A 1UMZA 4P5YA 3H50A 5LYJB 3T1HB 5A1FA 1XBLA 2BRTA 1V9U1 4EN7B 4YY3B 4QE7A 1ZL8A 3H1WA 1H30A 3VGIA 2GC2A 5CBGA 4RS5B 4PDMA 2F4LA 3VBUB 3VBRA 4PF1A 5AVPA 5FBJA 4DK1A 2WJSA 2BGPA 3QACA 4DPNA 4YJ3A 1NCQA 3T1LA 1PZ9A 2ETNA 1DQ4A 2YUEA 4NE9A 3DXRA 4D6QA 3ZN1A 4AWDA 2IJHA 3JBG1 2HYKA 4FAHA 2ZX0A 3CIHA 3BN6A 4Q4V1 1IURA 5BMVA 3G7DA 4MGQA 4LO7A 1JZ3A 1N47A 2Q69A 3H1LH 2XVKA 1C8M2 3HQRA 5LCWL 4DV0B 1UYPA 3NWKA 1FT9A 1AHSA 4PA3A 2RM21 4AFMA 4DINB 1IS6A 2YHJA 3K4ZA 2QJVA 1AR91 2HJIA 2HWC1 1MS0A 4Y4YA 1DLCA 1SZBA 3ZPYA 1KJLA 2QQOA 3HNYM 2WNVC 1QQP2 5D8AB 2VU9A 1W2BU 3ZMVA 5FNVA 2WA4A 1OXCA 3H9AA 2Y69B 1XSRA 1WA4A 5F3EA 1DYOA 2E53A 3A0KA 3F7YC 2JG8C 1OLQA 4GYCB 3CC4V 1WLEA 1D2SA 1TME2 4OVEA 4HBNA 2RE9A 3PIJA 4XHXA 3LSQA 5IJ0A 4OFGA 5ACA1 3WZ1A 2ZNIA 2DVDA 2W1QA 3ES1A 1VBB1 4HN1A 4AI2A 1OQDA 3OGCC 1OF4A 1SF9A 5DUVA 3WF1A 5FY8A 4RO2A 4UCSA 2NLJC 1ND2C 5A7SA 2R1DA 2Y26A 5KA6A 4J1XA 2OIGA 1J58A 3JD73 1SFNA 2F1MA 4XVHA 1B35B 1YWKA 2NMNA 1FYUA 2GHYA 1JBCA 1GNHA 3HQXA 3OMIB 3WDVA 1HXS1 2AC1A 3T2TA 4CXYA 5L3GA 1GN3A 5CFDA 1Q8IA 1QJU1 4JQRA 5GLTA 2QWRB 3ALQA 3O5SA 3TN93 1KFXL 4NWWA 4RHV2 1OH3A 3ZFGB 1YITV 1JZ7A 1P84F 3CX5F 4PA9A 3IDCB 4JGZC 2DCYA 2FCTA 4GULA 2KM2A 3N27A 2Q0OC 1N32O 2EZPA 1BBT1 4IGPA 4NHYA 1Q8PA 2GBOA 1LGBA 2MEV3 2HEWF 2UXBB 5IYBO 1V6LA 5JDBA 1BZKA 1HNZO 4OXSA 1DHKB 1YIJV 5FO8B 1US2A 3CZJA 4Q2FA 3WF3A 1W0PA 4HSLA 1VAMA 3CJHA 2DE0X 2Y4TA 4FPJA 4GWNA 4FPYA 1LHUA 1FI2A 1V9U2 2JVDA 2E63A 1Q8OA 5KUKA 4E4DX 5FOJB 3K46A 4Y1ZA 1FNZA 1FJGO 2VL4A 2VOTA 2IBZH 2VTFA 2IZWA 4QPWA 3AX4A 1CXZB 3ABKB 2E7AA 4AG4A 2N04A 5IVVA 4F6EA 2IFWA 4QGNA 2YIDA 3WQ1A 3IDAA 1N36B 5AVAA 3TXQA 4AEKA 2P3YA 3ZX6A 2DTYA 3ABZA 3ABTA 2GSMB 3JBG2 2VXRA 1H8HG 1S0FA 4XF3A 2XLFA 4BLIA 4Q4V2 2MK3A 1ENQA 1YF2A 4OQ8A 1QEXA 2Z42A 2QFEA 4J9YB 2GUZB 1G9AA 4LULA 3KQ4B 3G6JB 3VDAA 5KHGA 2RHPA 5LRRA 1WAZA 4ZOLA 1N1YA 1LHWA 4IE5A 2RM22 2BPA2 1DG6A 3HAGA 3LSDA 2WUHA 4DUZB 5ANNA 2VBDA 1O7FA 1AR92 4CS4A 5BY5A 2HWC2 4PI2A 1VQOV 2Y34A 3SPHA 3AP6A 2FB5A 3G4SV 2GP5A 2BDRA 5FMOL 4RGGA 2LM3A 3ZM8A 4NTXA 3PL0A 5H9CA 4DUWA 3M7AA 1G6UA 2Y6JA 1JYVA 5D5QA 2YXYA 3WEZA 1NLRA 1ASJ3 5IY5C 4M3CB 4XFCA 4GWIA 3NKTA 5ACA2 3S5AA 1MR5A 3I3BA 1DGRA 2EVXA 4E27A 3K51A 4JVAA 3K4DA 1VBB2 3MHSC 4UXNA 4URAA 2I07B 4UCRA 5D8AA 5FP4A 2WWJA 5FZIA 2YIAA 3I3MA 4F6RA 1FFTB 2ZNJA 4CCLA 5A1LA 3LPFA 5LB6A 3B9IA 4WM8A 3SH3A 4P9YA 4FBFA 4AL9A 2CTPA 3TAYA 5CADA 3K57A 2WFF3 5KX5A 1SZTA 1Z7S1 1RUNA 2QDRA 3QLQA 1SQQH 1HXS2 1K34A 4AW7A 3R66A 2BP6A 1V6OA 1V55C 1K42A 1QJU2 4DR1B 4DUYB 3L74H 5F8PA 4J1WA 3CKHA 3MIDA 5DECA 3WSOA 2JD4A 5FYMA 1ZBA3 4LKFA 1I7FA 2DCZA 4CEWC 1UJWB 3P3NA 1B35A 1WNSA 4FCAA 3T2MA 1TE1B 1YIPA 2CUGA 2P3IA 4PIYA 1RB8G 1BBT2 3ILRA 1IDSA 2LW8A 1W6QB 1Z78A 4NHMA 3OR6C 3BABA 4YSFA 5J96B 1ENXA 3U4SA 2RDQA 2ORZA 4GLXA 4SBVA 3KT7A 2WT0A 2QQPA 4DRXB 2WLQA 4LHSA 3ZFGA 2RS11 5IJ9B 3CS5A 4JI2O 2HBUA 4NRPA 2QM8A 4PT6A 1N3PA 1UAIA 1ZRFA 1UQXA 2YS8A 1W8WA 3VBHC 4ICGA 3FLTA 4TOIA 2E5LB 1B04A 4NIDA 2IH1C 3ZXGA 1PMHX 2DQ0A 1BQ0A 2RS51 3KGLA 5DG2A 4Z8BA 3O65A 4NAOA 4YVWC 3RWKX 4ABMA 1VQPV 2VZ1A 2YEVB 1BHGA 3DGTA 1CJPA 1HR0B 1RXGA 1ULOA 4RGAA 2WR9A 4RA0A 3I2FA 2ZM6B 4IYHA 3DYOA 5IDJA 4LF8O 2E6VA 5A33B 2ADDA 4EZ4A 3H8RA 3HMYA 4TZDA 4YVSB 1DTOA 3ETEA 4JI4B 1W8FA 4JV4A 4I30A 1IBKB 3MF6A 1XHZA 4AE2A 4KBZA 1GOHA 3JATB 2GMMA 3AYDA 4BHPA 1S0IA 1W8HA 5FPOA 3CZUA 4BB3A 5L7OA 3OEEG 2HEVF 4LFCB 1CWPA 4LBLA 3O1PA 1J1LA 1QQCA 5HBAA 1FOD3 2WINB 2F93B 5IHRA 3PJQA 2GUZA 1BHAA 5F6LB 2G9GA 2BJSA 3ZYRA 3SJAC 2X0LA 1XNDA 5DQ0A 1V0AA 2ZE5A 3RQ0A 3DEMA 2R061 3OPZA 2UY8A 3W20A 5FLHA 4TUYB 4QB2A 2EAKA 3LEKA 5HI0A 3RS6A 4BISA 3ZMZA 1XBFA 4Q27A 4AI1A 2JGDA 1A6CA 3RYFB 3NNGA 1YDXA 2QWOB 3ZYIB 1SLCA 4RR3A 4R9BA 4B4QA 3ILFA 4ES8A 3J4UH 2K0GA 4UCVA 4YLZA 4X65B 1GM7A 3ZDSA 3N7MA 5CA1A 3J81N 2A71A 1RHI1 1L7RA 4XXPA 3APQA 4BZ4A 2ZX2A 3VB9A 3C7OA 2ARHA 4FZ0A 4LFBB 4YW6A 1Z7S2 1GICA 3H01A 4XUTA 3KV6A 5FJKA 2CGPA 4CP9B 1JYIA 5FFOC 1PGSA 4AFCA 4YYOA 1IXBA 3B02A 5IT9N 4ET7A 4QU2A 4OHWA 3FZ3A 3DKQA 2BGCA 2G1MA 5LK5A 3ZSJA 4I3GA 1OHHG 3U78A 4BWAA 2WZR3 1GYKA 2CDPA 4CC5A 4HZ3A 5H6QA 1SHWB 4DXRA 4X6QB 2BBVA 5FZAA 4ZZ5A 5C5UA 5A3UA 2VZRA 3PNAA 3SXWA 4JZGA 4FXKB 3T1HO 2GC1A 3FB6C 1VRH3 5JCOC 2RS12 1PPJH 4YY3O 1AJQA 3NJVA 5A7QA 1XPWA 5IWAB 1Y9MA 2WAMA 4NPMA 2VAUA 1W9YA 3GZAA 5A7WA 3NV3A 1W6QA 3BU0A 5I0DA 2CTQA 1YXBA 5LA6B 2RS52 1ZBE1 2DWEC 4YGCA 4FTEA 1DCSA 4LKDA 2UYAA 1COWG 4LHNA 3EBRA 1VAVA 4DR6B 4E4ZA 4IT5A 4E2QA 1FV3A 5IJ9A 3MLLA 5IK7A 3HR0A 5FUNA 4M3CE 3SPCA 2A6WA 1SETA 1XREA 1K5QA 1DIWA 1Y7BA 2BNMA 3L71H 3GXUA 4NAMA 1D4VB 1FXVA 3FD9A 3CLPA 4EQVA 4DV0O 5J1XA 4PA6A 1HNWB 3BTXA 3JU9A 4OULA 4QDSA 4UT5A 1WCSA 3CDZB 3B01A 3NXSA 2XQXA 3S3WA 4M3CF 4A4AA 4Y5Z0 3M7MX 1WA6X 2F4VB 2JICA 4Y22B 4XUOA 5LP6C 4QPJA 4XUPA 2JK5C 4MVSA 1F2NA 4YIOA 4YVSA 3DCQA 1O3TA 1LGNA 1SRYA 1VAKA 2AHYA 3EMRA 4HKWA 4Y26A 4LE4A 1HX6A 4CZSA 1QJFA 2G38A 3OGRA 4HFSA 2YSUB 2OPKA 4X9QA 4ARYA 1W90A 2R062 5KHKA 2D5FA 4JPRA 3UJQA 2JJ2G 1SQVH 4LH7A 3HBZA 3LA3A 1PO23 2W6JG 4TYSA 3LF7A 2WO7A 5KXDA 4MSWC 4D7SA 1LHNA 3WNXA 1ENRA 2DQ3A 1CZSA 4CH3A 3CC7V 1IBMB 4GT1A 3RJRA 4JGYA 5DABA 2UXCB 1RHI2 1NCRC 2WQZC 1SC5B 3D82A 2VQFB 4TUYA 1CGPA 3OTOB 3W9AA 2PXJA 2F43G 1DF5A 1FXKB 3FWEA 3E8HA 2IXIA 1ZRDA 2E3CA 2CGNA 1I08A 1O5UA 2EJRA 4JHZA 3KG2A 4AR2A 1ODMA 5GZFA 5DUXA 1M9NA 3AYEA 4IDZA 3ETQA 4XZUG 4IGQA 3K9SA 2P5OA 3VDDB 1KRIA 4XZPA 3FB7C 4BLJA 4AFBA 1E5IA 3TEXA 5FPXA 5FOBB 3BI3A 1N34B 2UXBO 3B69A 2W47A 1W2NA 2NR5A 2ZEZA 1KKDA 2X29A 3J80N 4ATEA 4U36A 4ASKA 3K5LA 1LECA 1H1IA 2AEYA 1MZFA 4GX0A 5FZKA 2EIDA 3S6PA 1GQGA 3ZXEA 4IE0A 1WW4A 4IV1C 4AAXA 3S3XA 1OCCB 1CP9A 2K2SA 5BNPB 4AEDB 4FFIA 3ZKYA 5D1IA 2DTWA 5BR8B 3SMHA 2EIMC 3JSLA 2K9PA 1ZBE2 3VBOB 1N36O 1UX6A 2OZJA 4MLOA 2OXBA 4JI1B 2Y0OA 1O8SA 1SA0A 1DZQA 3QH6A 3M8AA 2PYJA 1AR61 4EN9B 1X50A 1BMFG 2GDSA 3MICA 4HK8A 4EKWA 4PF5A 3AK0A 2QBXA 5SV8A 3KCYA 5LA6A 1T5EA 3PIGA 3A2FA 2KG7A 4NB5A 4JYYA 2VQAA 3M3CA 4FTSA 4X1IA 4DUZO 4CDXB 2OTLV 4UV9A 1HJFA 2VR4A 2L35A 1JUIA 3N7KA 3JD0A 2QDNA 3E5XA 2DYSC 3CEWA 1EV13 1LOFC 2VPVA 2XBO1 5A32B 5FZOB 4F3JA 2KB1A 4NVPA 1WUVA 2A1XA 2ID4A 3TGUH 3K3NA 3U10A 2AH2A 5A3PA 3TNQA 5CFCA 1POV1 3PN1A 2QQMA 4DNYA 2WYSA 5LA1A 4NN0A 2BYVE 1UYYA 1S2KA 1IX9A 2W68A 2H6CA 3AZYA 5GZCA 3IC7A 4JF3A 3OD4A 4OMDA 4C1WA 3ZFFC 1QU7A 1X8EA 4UF0A 2FDJA 2R041 2DVBA 3GM8A 4YARA 2R49A 5B3SC 2ZA9A 1WA8A 5I0TA 5FMDA 3FL7A 4SLIA 1DF4A 3V0AB 4Q0PA 5JMOA 3UGHA 1KECA 1MSDA 4PLOA 1P7BA 3LD8A 1B06A 1R092 4A2UA 1Y76A 5C70A 1L3JA 2VZTA 1JCHA 4WM7A 1ZREA 1UKGA 4DMIA 1K9MW 3WNMA 4DR1O 4J42A 4DUYO 1RMU1 4HAMA 3J9SA 1IS4A 2OTJV 2YU2A 2ZGPA 2WNUC 1IPSA 5B1NA 1GKFA 4HNAB 1W03A 1QIQA 3UKMA 5BNNB 2CU5A 4FM1A 1KUQA 3ORJA 2XAQA 1C5IA 1UNBA 3BYWA 4EN8B 4XBFA 5LY1A 1FXKA 2ZMNA 1LUVA 1V9PA 4FQZA 3VN4A 3T2OA 5LGNA 3JD3A 4FM0A 3LPGA 4FPPA 2C1FA 2PF4E 3CCVV 3VKNA 3W7XA 4QPYA 4YW2A 3FLPA 2UUBB 4P9LA 3JD1A 3E5QA 1X7NA 1EYBA 1CPMA 4CPBA 1SS3A 4I9QA 1C5HA 4W4LA 3VDDA 3NNMA 1OCOB 1Y43B 4NROA 4HL0A 4JGSA 1SBFA 1Q6UA 3OGGA 2P7TC 4YG6A 1G8MA 3ZJZA 3SKJE 2RNBA 1XDCA 1W0OA 4FM2A 1AR4A 2ZM6O 2JG9A 1U96A 2WWSA 4Y1UA 4CYDA 3WCRA 2PMWB 3POSA 3WB0A 2R70A 1EY2A 5EJ3A 5IWFA 4IEUA 1IBKO 2VOXA 3HN1A 1AR62 4U7OA 4X8PA 1IXMA 4IV3A 4KQ7A 4ZY9A 2GMEA 4RD7A 4A3XA 1ZZBA 4BQ3A 1RUD1 1TG7A 4FP2A 4HETA 1YNAA 4OI2A 1HRI3 2C9KA 3VBFC 1E79G 4FFGA 4FPKA 1W05A 2FDGA 2B8MA 3BVCA 4W65A 4WCEV 1OFNA 1RUG3 2AACA 1Z5VA 3V0BA 1VBC3 4DV5B 4IE7A 4O4HB 1RUJ1 1UOGA 2OS2A 3KV5A 1JODA 2VMHA 3UL2A 2XBO2 5C8CC 4HONA 2A6ZA 2VQTA 4JCKA 4W4KA 1AYN1 4K1ZA 1J59A 3ZFEC 1CAXA 1D4M1 3WDUA 1VBE3 4NUBA 2Z3YA 3WDXA 1PIV3 2XOMA 3WQ0A 3N36A 1D5NA 2ZKLA 3E8GA 4CCOA 1VLNA 3CBNA 1EN5A 4LT5A 3ZYFA 3BPSA 4CCKA 1BYHA 3K4AA 5I8YA 4X65O 2R042 2Q8CA 2PAMA 2ZMLA 2RMU3 2UUAO 4CS3A 4PDWB 4XUQA 2WIIB 1H9PA 2XDVA 3MV01 3QH7A 4LFBO 2XQRA 1H2MA 2ZHMA 3WX5A 4OQ9A 4YZ3A 4AI8A 1BQPA 2ERFA 4X89A 1QHTA 5B1BB 3MAQA 3A22A 5C3QA 1RMU2 3UV9A 1V6IA 5E1RA 3S30A 1K4DC 1E5HA 1H2NA 2Q8VA 2N05A 1SQBH 1WLDA 5EC1C 3HKBA 1PNGA 2VVFA 5ABJA 2WAOA 1AJNA 4BQWA 1OA2A 3NNLA 5A6XA 1R1BA 1OQEA 4JTCB 2EX3A 4LWSB 5BNNA 4RS5C 1OOPA 2LGWA 3IFXA 1GOGA 3WB2A 3VBUC 3P3PA 5IWAO 3K2OA 3KLSA 4ZHQB 1RUH1 1MVQA 2FYUH 3TXSA 1IS3A 5KHHA 3HVDA 2VG9A 1K3EA 1AR73 1HRV3 4IGGA 1I5YA 4QQHA 1QJZA 2PHWA 4LORA 2BU9A 3HNBM 4L0PA 2QQKA 1W8ZA 2XAJA 2JS3A 1FYJA 3CJIB 4DV2O 4Y1VA 3B8NA 5IE9A 4V1PA 2RDCA 1UYZA 1YQ5A 4UBGA 4TN7A 1VBD1 2JWPA 1OCZC 1XXNA 4LBNA 5HPOA 1XNTA 3MLJA 4RGKA 1HNWO 1OSGA 3VHPA 1UXZA 2YXLA 4DV1B 1BVP1 1A78A 5FZ0A 1RUD2 4QKFA 3K06A 2UXDO 3ZIAG 3BODA 3ROUA 5JI7A 5LA9A 4F8AA 2XMLA 4NO4A 1BK0A 4LF4B 4JI0B 4KHPB 5D8AC 1B09A 3FHQA 2HWE1 1NZ6A 4URTA 2Y69C 3QVNA 2G9FA 3AKPA 4GZ9A 4HG6B 2P67A 4JKKA 1K5JA 1RUJ2 3RYIA 3D36C 1KGYA 4CCMA 4RFRB 2YC2A 3F5WC 2JXAA 2WDBA 4FPLA 3CO2A 5JI9A 3GWOA 1UD1A 2RJKA 2DFBA 4RFT0 4CZZA 4FLUA 5GONB 1AYN2 2P17A 3JAKB 1VEWA 2EIJB 5HCAA 3M3OA 3ST7A 3K77A 1P7GA 1VQ7V 1D4M2 2VZVA 2VW1A 1TEIA 4AQYB 3HT1A 5EC2C 3BEHA 1KKCA 1AX2A 2CTWA 4NIAA 4RSUA 4XDLA 3A21A 1ZX3A 3AP9A 1B35C 1OJHA 3CF6E 4Y1XA 2UXCO 3VBSA 3H9VA 5FKBA 5KMGB 5FZMA 3SPIA 2ZE6A 3OTOO 1SESA 1I94O 1AL21 4P08A 4Q4Y1 3E83A 2ARBA 2EINB 5CB4B 1JU3A 4AHCA 4Q0UA 2JDMA 2EXJA 4COWA 3VZJA 4QJFB 1S5HC 1JOYA 2ODMA 4JTNA 1FAYA 5G05L 4BQ1A 4PDWA 4NIIA 3KVAA 3LEIA 3GCWA 3WVJA 1SFYA 3RW0A 2QE3A 5A1AA 4DV4B 3NL1A 3J7AU 1NG0A 3AMPA 1ULFA 4XE9A 3W7WA 2FD8A 3KQRA 5FYVA 3AC0A 3W7SA 1Y66A 3KCXA 3ZXFA 3Q8AA 4OHYA 1RJ8A 3CMGA 5A7NA 3C8XA 1SPPB 3AKRA 1QOOA 1HW7A 3RPQA 5I0SA 3BGAA 2JE8A 1J84A 1WLWA 2QM4A 2IM9A 4DR4B 1K5MC 3KT1A 3ABKC 4QIWF 1WMDA 3LFMA 5KUMA 2DCKA 4UFLA 2AZ5A 5LEKA 1RUH2 1YLLA 3S5QA 4CDWA 4JI8B 2YGLA 1AX0A 3ZMUA 4NIGA 2EALA 4JI1O 1W04A 3F95A 3HN3A 4LIVA 3LOIA 2WQ8A 4COZA 2SBAA 3RZZA 5EYXA 3AB0A 1G6NA 4OYUA 3K04A 5KHIA 1T6GC 4XBLA 4AVBA 1O59A 1BL8A 1VBD2 4N9IA 4ATFA 5I93A 4I01A 4K8RB 3DC5A 5JCTA 1UOJA 2BTOA 1F7YA 1MMMA 4QPIA 3PU3A 1RPRA 2HWE2 2PAEA 2LW1A 4CEYA 4XFAA 3FX3A 1BMV1 4D6RA 2BERA 1XL6A 2V09A 3WNLA 5FQ0A 3BVOA 3T4ZA 5FXVA 1R3KC 1NKGA 2Z69A 1OMIA 3MBWA 5IVYA 2GNMA 3A4UA 3ZSEA 5A3NA 4UW5A 4EE2A 2VZPA 3RI9A 4BM8A 3JD71 3HWJA 5T5PA 3N9MA 1XSQA 1W2TA 3L2YA 5FYYA 4MOAA 4A7YA 3ZHRA 4TQDA 4C7UA 2RJLA 1YUDA 2A3XA 4BQ5A 1AX1A 3VKLA 4OI1A 1KD7A 4WZCA 3LUTB 1YI2V 2Q5TA 3QTCA 4GAZA 5A3LA 1O9HA 2PTMA 1CAVB 3K9AA 4YM3A 3H3ZA 1AL22 3TN91 2BTQA 3I59A 1TUBB 4Q4Y2 2XWJB 5H9RA 1EUTA 1EUUA 2MPFA 2DBNA 5LMNB 2VQEB 1FX5A 1JS9A 5T5OA 4FPCA 2YIBA 5JXIA 1KQRA 4J7JA 2DYRB 2LGQA 3VL9A 2MEV1 1CR7A 1N1VA 3LNMB 1XMQB 2UWAA 3ZYGA 3KHBA 5FY1A 5L3CA 1PO13 5SV5A 2PLV3 4IQPA 4G2KA 2BCCH 2D7FA 1NE6A 3VZOA 4LLFA 5FPVA 2UUBO 4GZRB 3CJXA 4KNCA 5DG1A 4YGBA 4CE8A 2FDKA 5KHJA 3OMNB 3SGIA 4MTGA 4N43A 3HKDB 5C4WA 1R3LC 5FPZA 3IMNA 1POV0 2A7AA 4FLWA 1HB3A 3P6BA 4H33A 3ZBHA 1S0DA 3H42B 3PVNA 4EB6B 5IATA 2A79B 4N53B 5B1OA 1LENA 3IT8A 3QCWA 2GTSA 2ZZQA 1CAWB 5AG2A 3E5UA 2IVJA 4X88A 3KD4A 2MNGA 2Y6GA 1DLLA 2W46A 4LQRA 5A2QN 3CCQV 2JDZA 2XWBB 1QHDA 4OUSA 5K7PA 5CG8A 3CMAV 2A06H 4R9AA 1CPNA 1WD3A 1IG0A 1YJ9V 1GZCA 1QOTA 3OUIA 1OI6A 5J2UB 4HVOA 2Y6KA 2B4KA 3SCFA 4O9GA 3ZHUA 3KCCA 5L9VA 2XR4A 4O4LB 3H8UA 1W2AX 1K3IA 2WQ4A 1NA1B 2EXHA 1G8WA 4YIPA 3SKVA 5IYCO 1D0GA 2ZXQA 3SJBC 3OBRA 4DV5O 4AGVA 4YHHB 5J37A 3FMGA 4JYBA 2HLDG 3WDYA 5BUVA 1UMIA 3H1YA 1DU3D 3DYMA 1BMV2 5LHIA 4UW6A 1ASJ1 2VS0A 2P22C 3K03A 4FPFA 3LFIA 2A7WA 4K1YA 3UK9A 4K20A 1AJPA 3GHNA 1XEQA 4I0BA 4Q0QA 1NU1H 3FJSA 5F7UA 3I4IA 4K8ZA 3HPNA 1PGW1 2PY5A 5IVJA 4LF5B 1J95A 4IEQA 5K0UC 5JZGB 1OLRA 2ZGLA 1S77D 3JD72 4MVUA 3M2MA 3GYDA 2WFF1 2EILC 1H2KA 2R30A 4NXMB 5TISZ 4IL6Z 1GP5A 4HVRA 4I50B 4E8CA 2ZE8A 1NBMG 4GJZA 3X2QC 3ACLA 2BOJA 1OUSA 3TN92 2C0ZA 4WF9V 3WCSA 1KC8W 3FAVB 3WLUA 4C90A 1ZBA1 3DPRB 4MZUA 3IAPA 1PV0A 2AREA 1YJWV 3PJSK 5JQGB 3O1OA 4FLTA 2FCVA 3Q8FA 3AZWA 1SQ4A 3WHTA 1KXGA 2B39A 1NTMH 1ZUQA 4UCUA 4PJYA 4QQ2A 4MXWB 1FXHA 2MEV2 1YQCA 3MZHA 5IVCA 4GX1A 1L7QA 1VF6A 1VF7A 2PELA 3RWNA 3ZN6A 1BKZA 3LAGA 2DDUA 3M99B 1MEC3 3EQEA 1GNZA 4I55B 2QZ3A 2FDHA 4R6ZA 3E86A 2GALA 1B6QA 3FC0A 4UFHA 2ZMKA 1G9BA 3JARA 3FYIB 1JMUB 2ZOEB 3W7UA 1VQLV 5FWJA 5KA5A 2VCCA 3G6EV 1CX1A 3PUAA 1GOFA 2F66C 1YHQV 2O8QA 1BGYH 4V2VA 4YJ2B 1C57A 3WXPA 2X09A 1A34A 2H8PC 4JASA 2R073 2AZ0A 3B40A 1OA4A 4UOJA 3GGLA 3IM0A 2JGUA 3VD4A 4B8EA 5JR7B 1QNWA 2RJZA 1L0LH 4O2BB 3QO5A 2ADEA 3PUIA 2XJUA 5FLIA 3HKDA 3ASNB 1OPMA 3OT7A 2Z5WA 1M56C 4S2GA 1PVC3 3ABUA 2AENA 4QQLA 4F83A 3H7YA 2IJJA 4DV1O 3P1IA 4LBJA 4Q1RA 2WWUA 2LUWA 2PN5A 1WWYA 1MPXA 2OQ7A 2P37A 2BVBA 4XW3A 2YMZA 4OI4A 3J7LA 4LF4O 4XFGA 4JI0O 4KHPO 5J36A 1MS9A 2Y0IA 4DO0A 2C24A 4RL7A 5KR7A 4MTFA 3QF7A 3NV1A 2WSVA 2XHBA 3MW2A 2QWQB 2GH8A 3ASOB 3PTYA 1ASJ2 3M1HA 3B94A 2DF7A 4LO8A 3GF6A 1NA1A 5L36A 1S4CA 2BZDA 1ZVFA 4FOWA 4CU7A 4AQSA 1YI9A 2OT5A 4AQYO 4JDOA 1H2SB 2CSGA 4P14A 3ZN5A 4Z2WA 2A6YA 1PGW2 1Y3TA 3ZLIA 2Z0AA 3HIFA 4CCNA 1MS3A 1QKQA 5CB7A 1BT8A 2Q1FA 2ZR2A 2WFF2 1UY2A 3UQ8A 5F9TA 4E4SA 2RS33 4B29A 3AG2B 2VCMA 3IBMA 2C5DA 4Y5TA 4QMAA 3UGGA 3WF0A 4CCDA 1H8TB 1YTFB 2QCSB 3NVCA 3U14A 1X59A 3ZMTA 3G6BA 2CV6A 3ZSMA 3AMQA 4Q4W3 3QBQA 1ZBA2 4MADA 4NRQA 4JAUA 3VDDC 2WZR1 2BVVA 3QO7A 1O3QA 4DXZA 5EQUA 5IK5A 3EVKA 2ZR3A 4IYIA 5LGUA 3K5OA 3CYOA 4COUA 4I50A 2IJKA 1PMIA 3RZHA 1JTZX 3WW3A 4OLLA 4RYDA 1PMJX 2WZEA 1LGCA 1R64A 1W0JG 1KS5A 1VRH1 2AEZA 3GJBA 2D3OW 1YFUA 5DMYA 4AZZA 3ACFA 1EZVH 5H6RA 5LBBA 3OY8B 2FTKA 1OCCC 5J2TB 4DR4O 5BNPC 1RINA 2J42A 4AEDC 4PLNA 1KD1W 5B2GB 4IEXA 4E4EA 2GN3A 4XDOA 3ASIA 1XNCA 4AQTA 3WG3A 3VBOC 5K9YA 4JI8O 3VQVA 2ZACA 5K4LA 4X1KB 3H1MA 2WWWA 2WLLB 2G9ZA 4GH4A 5JJEB 2EXKA 4HPKB 1URFA 3KZ4C 4E4HA 4BAYA 1RSOA 2VUAA 2VNRA 5C9AA 3MIHA 3JUUA 1Z0HA 4QPGA 1QXRA 3D5OA 2Q8EA 3URFA 4TSFG 1IKPA 1W28A 4QDRA 2TBVA 4YJ2A 4JRLA 3VLBB 4NXNB 4NMIA 4CDXC 1MNGA 1Q7YW 3FFQA 1XB9A 2B45X 1QJEA 3USUA 2DBIA 4O2BA 1S2BA 4HSJA 1Q81W 5DDJ3 3GWKC 1DQ1A 5KXCA 4RAIA 4G9SB 2Q30A 4Q6GA 3NJXA 1LOGA 1N0JA 2BSKA 3T4HB 3VUOA 3GHMA 1PK6B 3BFRA 3ZS8C 1C28A 1BE3H 4QD2A 4FIPC 1JN2P 1DQ6A 1PO21 1NTKH 2H6BA 1QLEB 1Q5OA 1DGSA 1N3OA 1RXFA 1NTZH 1QJY3 3B2EE 5EZWA 2Q7GA 1BBT3 3MHZA 4DZGA 4XQWA 1JJOA 3OB8A 5FYZA 3WOGA 3BKZA 4OZXA 1F4HA 4QX2A 2JDNA 3ABMC 1WMFA 5L19A 4R4ZA 1V6JA 2QZ2A 4GKKB 2P4EA 2ET7A 1LCLA 2XTAA 4P9JA 5T50A 4B08A 5JOWA 4XC9A 3IN9A 3Q4HB 3K59A 2O0OA 4B4RA 4R8HA 4QKNA 1S0CA 1BLZA 2XUEA 1P4RA 1CD3G 2QKSA 3BOWA 4XJWA 4HT1T 4WBNA 1K73W 2ZPXA 3DF0A 3FUOA 4CDQA 5LMNO 4CCCA 1UO9A 2X5IA 4QT6A 1I1EA 2QDOA 3VBRB 3JAWA 3MGUA 2VY0A 2V4AA 2QQIA 2B7YA 2WRAA 3KT4A 1WBFA 4QKDA 2WZR2 3SYOA 1ZZ8A 1NCQB 3DV8A 3SISA 2ZHNA 3BUCA 4XMAA 1GQPA 2Q68A 3DXRB 4I9WA 1GZ9A 3MDSA 4MVRA 1AXKA 1VQ9V 1MVEA 2UURA 4N23A 3ZXAC 1WLCA 4K9SA 4PBOA 5BMVB 4GIQA 5LA2A 4EWAA 5CEHA 1H8TA 1OBNA 4DV3B 4MVMA 1REEA 4KMQA 1VRH2 3ACGA 4MW8A 5LMUB 5FZGA 1IQDC 4A42A 1VQ4V 4FLVA 1HV0A 1VF5B 5A6ZA 4CH5A 1CQ9A 2WLIB 2UU9B 4OPAA 5I0UA 1IZ3A 2JD9A 1UXXX 2O8OA 2AW9A 1S0BA 1VBA3 5CA0A 1C4RA 4LF7B 1X4TA 4EWDA 3WUDA 1M57B 5FNVB 1N1SA 1DYKA 2Q4PA 4YFWA 2VNOA 3T4DA 4DR7B 1GV9A 1PD3A 4P2ZA 4BIOA 3TB0A 1TUEB 4BCUA 2KA3A 3I3EA 2ITDC 4ZU7A 4UCTA 1YCIA 2VNVA 3D0JA 3OAAG 2QTSA 1WB7A 3JZVA 1YFYA 5CA6A 1HW5A 4RN5A 4X1KA 4AVSA 4XJ8A 4O61A 3B3QE 1EV11 5J3UA 4O4IA 3SJCC 1RUOA 1CESA 3JAMN 4YHHO 2OUJA 2W95A 1L8DA 5H9PA 3ACIA 1PM4A 3DECA 3TJTA 5CFDB 3BOPA 4CUBA 5FP9A 1JYXA 1CIYA 1PO22 4GMP3 4TSVA 3OBAA 1WLTA 1YTFD 4XACA 2P5BA 3JCZA 1V54B 4LF5O 5FYCA 1BS3A 4ZKIA 2C6SA 1XMOB 4W6YA 4JHTA 5FZFA 1PK6A 1QDOA 4L99A 2QNKA 1VQNV 1ZM1A 3TEYA 5JIUA 4IEWA 2ZKOA 4PIXA 2R72A 3RG0A 4HVQA 1HLCA 4NXMO 4DXSA 4LH6A 4FPOB 4JAAA 4FTBA 4EN0A 1AUYA 5B1BC 3H1JH 3DXTA 3CJHB 2ZGKA 5FO7B 4X8AA 3AG7A 3LCPA 1VMHA 3ZRXA 1H8EG 1QR9A 3APBA 4WVZA 4X64B 1JYCA 5FLXN 4B3MB 4WFGA 4YRDA 4QPKA 3N7LA 5EBMC 4COYA 5LBQA 4RQPB 1KP3A 5D2AA 3IDEA 1W8UA 4UFJA 4OHZA 1OC1A 3AMHA 5I0RA 2YICA 4YPJA 1OA3A 2ARCA 1JW6A 1N33O 2GU9A 1ENVA 5LHHA 4QGMA 5IYDO 1J3QA 3CD6V 3NV4A 5LW9A 2PYTA 2WC2A 4LA3A 1ENSA 2J1TA 4MGTA 3ZPOA 3EHBB 1UCXA 3PUSA 4NPRA 2J1VA 1VQ8V 5DZGA 1GRJA 4UFIA 2Y0PA 4KWKA 4ZOLB 4DK0A 2RDNA 4YM0A 2ZKNA 4YWAA 3O14A 5H9SA 1UWWA 3I2GA 1RPOA 1V6MA 1X36A 1ZA4A 4JKMA 4H7MA 4HKOA 1AJKA 3WNOA 1SLTA 1YO8A 4BIZA 3EO6A 1NLSA 3NRUA 4MO3M 1HJGA 1UIJA 4AEJA 2A0LA 4EEQA 3CJIC 1NQJA 1OD3A 1AB3A 4TQFA 4O2AA 1U5ZA 1BZWA 2VMFA 2OA2A 2QE7G 2C26A 5LGTA 1J3PA 2R1BA 4QQOA 1QVFU 2XXZA 2GNTA 2D6NA 2WLIA 1ND3B 3T0DA 5E6HA 2WNVA 2WNOA 3KF5A 2CTRA 2ZXWB 4KUMA 3EYPA 4CP0A 1O8PA 2WLNA 1YQ6A 2JG8A 1XHXA 3ATGA 1STMA 1LEDA 2KR2A 3LDRA 1RUG1 3J8F3 4ZBMA 4F6RB 4E2SA 5EIBD 1MA1A 1VBC1 4LK7A 2QQUA 3LOBA 4WM8B 3SYQA 1PZ8A 2VMCA 2VUJA 2ZGQA 2AGAA 3IGAC 4MX3A 2PYLA 5DM6V 5IYZA 1G4YB 3JASA 5KX5B 2D97A 3QNEA 1VP6A 1QF3A 4FXGB 3POIA 3MUZ1 5T5JA 1ND2A 2ETEA 1VBE1 4NHLA 1PIV1 2AYHA 3ITQA 4AXOA 2CNAA 3U11A 4WBBA 2X8KA 3NO8A 3L70H 2DUOA 4GX5A 3I2IA 2RMU1 2QKDA 4DV7B 3GZEA 2E51A 5DAXA 4W50A 3U75A 1OF3A 4V2WA 3JB4C 3VOUA 4PDRA 1LU2A 4NYKA 4LF6B 4P9OA 4DUVA 3U37A 1W6MB 1WPXA 4XIKA 3LNNA 1AR83 4I4TA 3NSTA 2Q5ZA 4JGZA 1XNQO 4L87A 5J7MA 4ASMB 4LNUA 4LPLA 2Q1ZB 3VBHB 1R3IC 2EINC 4YM1A 1XOUA 4P9GA 5C5TA 5BNQA 3I49A 1BHBA 2VMGA 3N9PA 4LK6A 5DAQA 3OUJA 1RUF3 2Q7HA 3LIGA 1KDMA 2DMXA 3K79A 1EPWA 4IIJA 3VHRA 4BA6A 2IXKA 4G28B 2K1EA 4I3PA 1IS5A 3ICXA 1LU1A 3TNPB 5FL7G 3R65A 2B9VA 5JVVA 4ORFA 2HHHO 4FZ1A 1XE0A 2ZS6B 2X05A 4QXKA 3I2HA 1VPHA 2EA7A 1H4HA 1FATA 4JZRA 4JI7O 1J1TA 4DV6B 3GZUC 4ES9A 2QKAA 1YHFA 4TV9B 1GR3A 3HPLC 4XJ9A 3HT2A 1QGLA 1WW6A 4DUXA 2WT2A 4AGGA 2IFRA 4RQPA 5LK7B 2TEPA 3WINE 2JIJA 4ZZ8A 1NE4A 1FV2A 4G27B 2QWPB 1AR71 5L7OB 1HRV1 4B7KA 2WO2A 4IEPA 2P4KA 1OLMA 5KAFZ 2H94A 4XCAA 1DQ2A 5FREA 5A70A 2GZWA 5FP3A 4A7KA 3RYCB 2X6BA 2YPJA 4X66B 3GB7C 1PZ7A 4GB33 5L3BA 2E32A 1PKXA 4AHXA 1OCRB 2WKKA 1S0JA 3WV6A 1GBGA 1O4TA 2BWCA 3HKCA 1GZTA 4KH9A 1TAEA 1KJRA 3DL3A 2RDRA 2YGMA 3RYPA 1UY1A 2GC0A 1M93A 1HDJA 5CAZA 3MFAA 4NXNO 1QBZA 1LKNA 2JGDB 4U7NA 5T55A 5KXEA 3WG4A 3F2ZA 5JJJB 3LSSA 5CBHA 4K3AA 4RR3B 3BTZA 2VCAA 2IXJA 4XAEA 2BNOA 2LJ2A 2AGSA 1R093 1RUG2 5BNOB 2WT1A 5C3SA 4O65A 5CA1B 1VBC2 4TV8A 2QKCA 3PDQA 4LC1A 4K0KO 2D43A 2ZGUA 2FDIA 1ND3A 1BEV3 4D3WA 4GKJB 2M6YA 2RJ2A 1JI6A 5A3WA 3BB6A 2R16A 4QNHB 4CP2A 4JI5B 1VBE2 4AGRA 1DQ5A 2PGGA 3AP5A 3OYWA 1PIV2 5FZ6A 1YQ8A 1MOFA 3B9CA 5FPAA 1PM7A 1FFXA 1NQTA 2ZQMA 1XNAA 2RMU2 4B3SB 4AQ2A 1W9FA 2XPJA 3U07A 1HB1A 4GKKO 2VULA 2NN4A 2UWBA 4EZHA 3AZZA 3DSQA 4CEWA 2A3YA 4K8FA 3UT5A 2F6BA 5FV3A 1VB2A 5I91A 1PM9A 5B66Z 2W0XA 3OPTA 3OW2U 2Q67A 5BYNA 2QR4A 1K97A 1F9KA 2HJFC 2XVLA 5A7WB 5B1AB 3B8MA 1W6MA 3VKOA 2V73A 3FHIB 4JYAB 4J10A 4DRVA 1H2LA 1F8VA 3AVSA 2D2CB 1W06A 2XJVA 1W2OA 3Q8EA 3VBHA 3ZXLA 1JXNA 4IE4A 4FFHA 1V00A 1WCQA 4QAWA 1JZ6A 1O6UA 2YZ4A 2J7MA 1BCCH 4YVWA 3GDBA 2GMPA 3RI8A 4Z82A 2XVGA 5FPLA 4FPHA 3ZVXA 5LP6B 2VBBA 2UU9O 4MW3A 1QJX3 5DAWA 4LP8A 4ZXKA 5A7PA 1IOAA 1AR72 4QM9A 4WVMB 2D3PA 1HRV2 1UPGA 4N53C 1UZ0A 1QR8A 4CS2A 5DPNA 4LHKA 4EFEA 4TV9A 1ALYA 1HQNA 2D6LX 3V65A 1WCUA 4HOOA 3CCMV 4DR7O 1POV3 3AEIA 2XKOA 1G1XB 2WAAA 3LB9A 1ZAUA 3O1MA 4JI3O 4XBQA 5FUPA 4LUMA 2W87A 4QQPA 2DVFA 3K3OA 4EJRA 2Y4UA 5K8SA 5A80A 1WKYA 2QM7A 3RYCA 1JZ2A 3WP3A 1W6OB 2D6OX 4HXCA 5CMUA 3VL8A 5BZBA 1UX7A 4P9IA 1K7DA 3PU8A 5C3RA 4FOQA 3SNMA 2P4VA 2PI5A 1X8MA 4JGYB 1F4MA 5L3DA 2D6KA 5KWRA 3N7JA 4DR5B 3T1MA 3E89A 2QJ1A 3C7HA 2EULA 1KQSU 1U12A 2ZGNA 5FZEA 5F32A 1N32B 2HR3A 3FN9A 1P49A 4FLYA 4RUFA 2NN8A 1R6T<