4PDRA

Crystal structure of a k+ selective nak mutant in barium and sodium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdrA00
3FB7C 4MTOA 3ASNC 5CBGA 3E8HA 3RVYA 3TCUA 3E8GA 2WLLB 3BEHA 4X88A 5CBFA 3RVZA 3RW0A 1KKDA 2P7TC 5KUMA 4PDVA 3SYPA 4TWKA 4WFEA 5KUKA 1JVMA 3R65A 3AG2C 4PA9A 1OCOC 5B3SC 5J9PC 2X6AA 1R3LC 3E89A 2AHZA 4MVRA 3SJQC 2X6BA 3E86A 3K0GA 3AG4C 4HZ3A 5B1BC 1K4DC 4UUJC 4CBCA 2ZXWC 4R6ZA 2EIMC 2EILC 4MW3A 4WFGA 4P9PA 2DWDC 3T4ZA 1QLEC 3SPGA 3ZJZA 3AG1C 1M56C 3K06A 4F4LA 2ITCC 4GX5A 4PDRA 2IH1C 4MW8A 3FB8C 4H37A 2IH3C 2NLJC 3EFFK 3LDCA 4GX2A 4JTCB 2EINC 4JTDB 2R9RB 4MVZA 2DYRC 4P30A 2HFEC 3IGAC 4PA6A 2WLJA 3SPJA 5CBHA 4BW5A 4X8AA 3AG3C 5EBWC 3SYCA 2Q69A 3ABKC 3OR6C 3T2MA 5IY5C 5B1AC 3OR7C 2Q6AA 2WLHA 3JYCA 3ABMC 2WLNA 4MS2A 4LCUC 1R3JC 2QTOA 3F7VC 1OCZC 3SPCA 4G27B 1XL6A 2A0LA 3LDDA 3TETA 2EIJC 3SYOA 3T4DA 2BOBC 1P7BA 4QE9A 2HVKC 4RUFA 4LBEC 2WLIA 4MVSA 3ZRSA 4MVMA 2ITDC 3SPIA 2H8PC 2KB1A 4MVQA 4DXWA 2HJFC 4QNHB 3OUSA 3SYAA 3K08A 3K0DA 4GX0A 1V55C 4P2ZA 5E1AC 4QE7A 3E83A 3UKMA 3IFXA 4WFHA 2AHYA 4R50A 4EKWA 3KG2A 5EC2C 4MTGA 4RUEA 4X89A 3FB5C 2W0FC 2WLMA 4MSWC 1OCRC 4XDJA 3UM7A 4RO2A 3RBZA 1R3KC 2ATKC 4HYOA 3E8FA 3LUTB 2A79B 2WLIB 3ASOC 3F5WC 4ZBMA 5BZBA 2DWEC 1K4CC 1R3IC 3VOUA 3LNMB 4OXSA 4PA3A 3STLC 3PJSK 4G28B 4J9ZB 3SYQA 4JTAB 4PA7A 4KFMA 4PA4A 3WG7C 3F7YC 3X2QC 4WFFA 1J95A 4GX1A 2EIKC 2QKSA 3OGCC 4MTFA 1G4YB 1ORQC 2WLKA 4RAIA 5EBLC 1BL8A 2OCCC 3E8BA 3K03A 3FB6C 2ZD9A 1OCCC 2JK5C 3ABLC 2X6CA 3K04A 2HG5C 3STZC 1V54C 4I9WA 4LP8A 4J9YB 4R7CA 1S5HC 2HVJC 4H33A 2WLLA 4XDKA 4XDLA 2Q67A 1XL4A 2A9HA 2Q68A 2Y69C 2YEVA 3LDEA 4PDLA 1M57C 3SPHA 5EC1C 4MVUA 4PDMA 4R8CA 2K1EA 1LNQA 3GB7C 1ZWIC 2BOCC 5EK0A 3T1CA 4MVOA 5EBMC 3HPLC 2DYSC 4P9OA 3OUFA
chains in the Genus database with same CATH superfamily
4JI2O 1Q3EA 3AG4B 3VQVA 4JF3A 1SKVA 2CH7B 4X1YB 4TV8A 2YEVB 3G71V 4PDVA 1VF6A 4WFEA 3R65A 4K0KO 3AG2C 1OV9A 3A0BZ 2RJZA 5KHGA 4WCEV 5CMUA 4AQYB 2AZ0A 1Z2GA 2ZE6A 4YIPA 4JI5O 3G4SV 4DR3O 1HNZO 5B1AB 1M56C 2WSSG 1SETA 2IH1C 5LP6C 1IX9A 4PD4F 2XAQA 3CS5A 1N33B 2EINC 3HKEA 3IC9A 4MVZA 2R9AA 2DJVA 4BW9A 4X8AA 3SYCA 5CA1A 2W6IG 4DV0O 1OJHA 2QM7A 1AJPA 3C90A 4O4HA 1B04A 1HNXB 1J5EB 4EEQA 1MABG 1H2SB 4E4EA 5LOVA 4Z1VA 1BQZA 4GX0A 4P2ZA 3HKBB 2WLMA 3QNEA 3B09A 3RBZA 4OPAA 5H5NA 1YHQV 4OXSA 4JZGA 2IM9A 4LF4O 3CC7V 1M57B 3QO7A 4TOIA 1UFIA 4GX1A 1SQXH 5BMVB 5EBLC 4RQEA 3SDLA 3DGEA 3ABLC 3ASNB 3UCSC 4TSFG 1S5HC 1L0LH 1RM1C 3CRCA 1BS3A 4U3FH 3ML0A 5JQGA 4MVUA 1GM9A 1TUBB 4H13B 2N04A 1OCOB 2GUZA 3HKCB 3RGBA 1QU7A 2PY5A 3J80N 1JX9A 4GT1A 3RVYA 4J41A 1KKDA 2XASA 5LHHA 2DOSA 2UXCB 1AB3A 1NJIW 1M93A 3B8MA 3DXRA 2X6BA 3IJ4A 4I55B 4ZOLB 1S3JA 1VQ7V 5L3FA 1VQ4V 1L1FA 2UUBB 4GX5A 1OCZB 3BA9A 1I94B 5IYDO 5JVDA 3JCZA 2WLJA 1NBMG 4TV9A 3T2MA 4HBNA 5A2QN 2Y4TA 1URFA 5C8YA 2EIJC 3E22A 2W0XA 4DR7O 4YJ2B 1BHBA 2HVKC 2WLIA 2XAGA 3VBBA 4QPJA 3QG5A 1BQ0A 4HNAA 3L74H 1V55C 5KX5B 1EZJA 3N2GA 4WFHA 1Q8IA 3JARB 3Q4HA 4RUEA 4O4LB 3VQWA 1K5QA 1HNXO 2XAHA 3RN4A 4UCVA 3BCCH 4G28B 1K7DA 1IBKB 4I0XA 4JTAB 2PUSA 3JAWA 1FPOA 1PNLA 2WLKA 4DW1A 1FXKA 1Y74B 1AP6A 5LL6Y 4J10A 3AG1B 1XHXA 3UT5B 3LSUA 4A5UB 2A9HA 4CC5A 3ETDA 4J7ZA 2AXTZ 2DYSC 1L0NH 2ZT9B 4FJCC 1QQCA 5DECA 3BEHA 2EIMB 5J2TB 3THOA 2P90A 3ICXA 2OWOA 2X6AA 4ZI7A 5FNVB 3E86A 2R72A 3AG4C 2RNBA 3BFRA 4CBCA 4GUNA 4KHPO 4DV5B 4WBNB 1Q7YW 3ABKB 1JPXA 1WJZA 3CRRA 2KQXA 2VQEB 2F4VO 1B06A 2RDCA 1WPXA 2YUAA 4O2AA 1AJQA 3ZMSA 4EFEA 2ZIOA 3EFFK 3RYHA 4LH6A 2ZNIA 3P32A 4PA6A 2HLDG 2P06A 3B4SA 3H1HH 5EBWC 4LFBB 3QF7A 3ETGA 4FPPA 5B1AC 1GK9A 1FXVA 3JYCA 4BWAA 2UUCB 4X1KA 5LA6A 2Y69B 4EB6B 2JGDB 4JGSA 1I94O 1PL4A 4NTYA 1AI4A 1XMOB 3SGIA 1YF2A 2H8PC 4QNHB 2ZIMA 1YCIA 5BR8B 1WLEA 2XTAA 2HP8A 2AHYA 2IJHA 4X89A 3FB5C 1Z5WA 2DE0X 3OFNG 5BZBA 3DC6A 1MZEA 1YXBA 2Q5ZA 1M1KW 3H1KH 3H1JH 4B3SO 4ZKIA 2PF4E 4WFFA 3OGCC 4KP4A 4MTFA 4DV6B 1Y6XA 3OE7G 4GCZA 4J9YB 2HVJC 2NR5A 1M57C 1Y67A 1GTOA 4DUZB 1ZWIC 3BVOA 3OMIB 4IHJB 2F66C 4GZRB 4DUYB 4X9QA 3OUFA 1K73W 3ASNC 5KHHA 3CWBH 1QHTA 2HKOA 2YXYA 1YITV 4UV9A 2LFRA 1QLEB 5KUKA 5LGTA 2F1MA 1VQLV 1OCOC 3CCSV 2ZR2A 4DV4B 4JI8B 1O9HA 3T1YB 4UUJC 2OYQA 1JFFA 4R6ZA 1KYOF 1B6QA 2ADPA 4O4IA 4X65B 2QDOA 5JH7A 1UJWB 3I56V 4GLXA 3TXSA 1YTFD 1MZFA 4PV1B 2ADQB 5CB4B 1FS0G 2ARHA 2MK3A 3G80A 3VQYA 4PDRA 2NLJC 5IJ9A 1YVWA 4LF6O 4DV5O 4D7TA 4LNUA 4W4KA 3B77A 5IWAB 1WNSA 1QVGU 3RYFB 1OCZC 4G27B 1NTKH 5JWPA 2VQEO 4U3JB 2E5LB 2VQFB 3N2KB 5CA0A 4Q6GA 2ZCEA 1VQ6V 3ASOB 3CCMV 4LFAB 4LWSA 1SQPH 3FKSG 1AR5A 4DR2B 4DR5O 4LF9O 4U7NA 4HYOA 1G6UA 1XMOO 4DRXB 2ZE7A 2IW5A 1XREA 1J95A 3FAVA 2WA3A 1ENVA 2RCVA 2YIBA 5KMGA 2QKAA 1OZ0A 2CTQA 4WFBV 4H33A 1KECA 4PDLA 4PDMA 3E2EA 4J7KA 1HR0O 2UXNA 5IY5B 4I9QA 1TVKA 1N36B 3WU2Z 2ZR3A 4L8JA 3DXRB 1EFRG 1IVSA 3JD0A 4UVAA 2UUAB 3IC7A 4TWKA 2IBZH 1XNRB 1QLNA 4IL6Z 4I5SA 4DUZO 4B3MO 3H1IH 2QEXV 4LC1A 1TGOA 4DUYO 5BY1A 1ROPA 3E89A 2AHZA 4DR6O 3D8CA 3U11A 4K0KB 1X59A 3L70H 2EIMC 4I50B 2IU3A 1D2DA 4FLVA 3ZIAG 2ITCC 3CRQA 4LF8O 1F4NA 3FB8C 1JCHA 4DR3B 1D5NA 1HNZB 1FD9A 4CS2A 4Z1MG 1H2KA 2G38A 2ILMA 1SF9A 4TUYA 2OIGA 2Q69A 3ABKC 4KL1A 3U10A 1WP7A 4IYHA 4X65O 1WB8A 2IJJA 1SA0A 4BAYA 1AP5A 1K92A 4PJ0Z 2A0LA 3GWOA 2CE4A 4X62O 1FFXA 1TA8A 3MHSC 2QKCA 2HJFC 4UVCA 4CC6A 3K0DA 3E83A 5IWAO 2L6LA 1DF5A 5LYJB 4I4TB 1NS1A 2VQFO 3K9AA 3ZHUA 1FXKB 1FFTB 5LXTB 1YJ9V 2ZDIA 3G6BA 3L71H 2NNUA 2JEUA 1N32B 4DO2A 3K03A 2XAJA 4YJ3A 4BIUA 4NR1A 4LF4B 2VWKA 4NTXA 3HKDA 5L3DA 2FYUH 2Y0IA 1LNQA 2Q0AA 1DLBA 5EYPA 1XNQB 3FB7C 4NKGB 2Y0PA 1SERA 1K34A 3CP1A 4KUMA 3SYPA 2P22C 5IJ0B 2PZSA 3WFVA 1HWYA 5KHJA 2K9PA 5E79Z 1I0HA 1QLEC 1AI5A 2UU9B 1XNRO 4FM1A 4LFCO 3G67A 2M6YA 2Q7EA 1F23A 4X1KB 2M7WA 1WP8A 4JAAA 2C2AA 3APQA 3CCVV 3ZHRA 4IIJB 2Y48A 1XBLA 1XOUA 2ZNJA 4O2BA 4FLTA 4JI1O 2BTOA 4F6RB 1CP9A 1Q86W 4G2KA 3D3IA 2EULA 1PNMA 3SR2C 1UPGA 4JAVA 1PPJH 1W59A 2IJKA 4L87A 1IBMO 4DR7B 3DC5A 2QA4V 4XDJA 4FM0A 3AK3A 4H0LB 2EX3A 2E3CA 3ASOC 2Q4PA 4D6TH 3SJCC 1GM8A 3JALA 3OTFA 5C93A 5FL7G 3J81N 3FFQA 2R70A 2V4DA 2LFSA 4QPKA 5L3GA 1WA8A 5EC1C 1RSOB 1Y4MA 1N32O 1F4MA 1IZ3A 5LP6A 1E1QG 2WA4A 2GDSA 5B1BB 2ZXWB 1U97A 1R6TA 2H3OA 4TQDA 3RYCA 1F51A 1ZAUA 4O4IB 1XMQO 2PGGA 1K97A 4O4JB 1G8MA 1XNQO 3CSXA 4MW3A 2VRZA 4X1IB 1VQKV 2XOKG 3ZRVA 4KHPB 4FIPC 1ZL8A 4UCTA 4NXNB 3AEIA 1I5XA 2R9RB 2BSKB 4DV3O 1SQQH 5LMUB 2F4VB 5KAIZ 4E2LA 2UU9O 2HJDA 5ITZB 4GKJO 2ODMA 2BE3A 3SPCA 1N0NA 3VQXA 5GONB 3FYIB 4MVSA 4JYYA 4DXWA 5DM6V 1YJWV 4FFKA 3JASB 4QE7A 3UKMA 2LW7A 4R50A 3OTOO 3W7WA 3KKYA 1W0JG 2QWQB 1R6NA 1OCCB 4NXMO 4C7UA 2Q7GA 3ABTA 1G4YB 1EBOA 5KAFZ 2H94A 3FB6C 2ZD9A 1RP3B 4B3SB 3ETEA 3FX7A 4IT5A 1Q5OA 5CA3A 2WLLA 4XDLA 2JJ2G 5IT9N 5A9GA 4FFBB 2CTRA 5L3EA 5LHIA 4MVOA 3RWRD 1QVFU 4P9OA 1P7GA 5J2UB 2HHHO 2DMXA 5CBFA 5IYZB 2YXHA 2QM8A 2Q0OC 3RYIA 3BAAA 3ZMZA 3BA8A 3M7MX 3TJTA 1S5JA 3SJQC 5LMNB 3TK1A 2YSUB 4JPRA 2UXDB 3QTCA 2BTQB 1VQ9V 5B1NA 3PN1A 4CS4A 3ZRWA 2D2CB 3BRCA 2LGQA 4Q20A 2JVDA 4BR6A 2P4VA 2W6JG 1FFXB 4OPHA 2PI4A 5EZYB 1RFYA 2JEXA 1NTZH 2GTSA 3CXHF 2YXLA 1R3JC 4DV2O 1XL6A 4LF6B 1AI7A 1XI1A 3TETA 3JATA 3W7SA 1HNWB 4J42A 4NXNO 1M90W 2YI9A 3SPIA 4ZHQB 5LMUO 3JD4A 1YJNV 1VQOV 4IYIA 1WB7A 4JI6B 3D36C 3KG2A 4MTGA 2RQ6A 2B9ZA 4B3RO 1H38A 4X66O 2DWEC 4DR1B 4LF9B 4DR5B 1KKCA 3HKDB 2KG7A 3U0ZA 2Z3YA 1P4RA 3CJHB 1AR1B 1VF5B 1ZLZA 2GHYA 4LF7O 5DN6G 1M9NA 4I9WA 1W2BU 2BCCH 3CRMA 4CS3A 2CH7A 4X1YA 2YEVA 4UFZA 3CCUV 1XHZA 3MHHC 1G1XB 3MD0A 2XNDG 4N21A 4YY3B 3ZHQA 2YIDA 1XDCA 4I7ZB 3O65A 4X20B 2PYJA 3A0RA 2LQTA 3RW0A 1NH2B 4UCOA 1HR0B 1GKFA 5KA6A 1KMIZ 5H6RA 1R3LC 4K35A 1PM9A 5B1BC 3GWKC 2ZXWC 3K9SA 5IYCO 4X64O 4B3MB 4TV8B 2QTSA 5JJJB 3JSNA 1O9GA 4U7OA 1NT2B 4DR6B 4B3TO 3CE2A 5L3CA 3ABMB 3K58A 4OX9B 2ZE8A 1IURA 5LMNO 1ZX3A 5CBHA 3SPJA 3IGAC 2OCHA 4UVBA 5DEDA 4JYAO 4LF8B 2UXDO 3HKBA 3AK2A 3O9OA 2QGNA 1Q90D 1OCRB 5K1XA 3W7TA 5F2VO 3KZIZ 4CH5A 2R9IA 3HKEB 1Q6UA 3TGUH 3CCRV 1Q6HA 4YIOA 2X0LA 4F6EA 2YDEA 3C3SA 1VQPV 4UV8A 5CA1B 2O57A 4J11A 4FLWA 1BGYH 3WG7B 4X62B 3X2QB 4LR3A 4EKWA 4YHHO 1SZTA 1DGSA 4O4HB 5FPOA 1U96A 2Q8VA 1HNWO 5LGNA 3LNMB 4PA3A 3STLC 3ZRXA 5LOVB 3RT3C 3I5DA 1JA8A 4KFMA 4PA4A 2QKSA 2JS3A 1N0JA 1ORQC 1TUBA 4JI6O 2QM4A 3K57A 3HKCA 1OCCC 2YC0A 2JK5C 3CEIA 3K04A 3I55V 3STZC 5LP6B 1XL4A 2CAZC 4DR1O 2B5UA 1FAFA 3H1LH 1AR4A 1I7FA 4UCSA 1PNKA 1HW7A 4I55A 1SZXA 1XUQA 4ZOLA 1KP3A 1AROP 2RMKB 5JQGB 1YDXA 4DK1A 2GTAA 2GUZB 3ZMUA 1EN6A 4YY3O 1VQ5V 4JYBA 3N27A 3ETQA 4RQFA 1CXZB 1NVPB 3T4ZA 4K8ZA 2CTPA 5AG2A 3AG1C 1SS3A 1NU1H 3K06A 5D5PA 2IU0A 3ZEDA 1NH2D 1BSMA 3UO2A 3P3PA 2JIZG 3CMAV 4YJ2A 5L3BA 2IH3C 4P30A 4AHCA 2HFEC 2CGOA 4UB8Z 4LFCB 1K9MW 3J7AU 5GTHZ 1NTMH 3ZMTA 3OR7C 3CCEV 5KX5A 2A7WA 1PKXA 3F7VC 3JARA 4O4LA 5HFLA 4JI3O 4JYCA 5JVDB 4OX9O 3OM3B 3OT7A 4AI8A 3LSQA 1YEWA 4MVQA 2KB1A 3OUSA 4TV9B 3JCUZ 3ZHVA 2YI8A 4JI1B 4DV1O 3OEEG 4UCUA 5EC2C 1S76D 5C8YB 2W0FC 1Y74A 3E22B 3BHPA 3AK1A 1IBMB 2ATKC 3LUTB 2WLIB 2JJ1G 3M99B 4HNAB 3UT5A 2Z0AA 4YXWG 3N2GB 5TISZ 3Q4HB 2L35A 3E8BA 2WAMA 2A3QA 1TAEA 2HG5C 1AVMA 4LP8A 1R73A 4I0XB 1D5AA 2Y69C 1NI8A 3JAWB 3SPHA 5J2TA 1K33A 3NXSA 1K5SA 4JI0B 3GB7C 2P6JA 5B3SB 2A06H 2OTJV 2B1GA 5H2FZ 1NKDA 5FNVA 3OD4A 3MAQA 1Z5VA 4BIOA 2EILB 1WN7A 4WBNA 1NR7A 4DV7B 5JCOC 4GKKO 1XILA 4PA9A 2EJRA 4J80A 3IAYA 2QE7G 2DYRB 3CXCU 4WFGA 1XMQB 2ZE5A 2V7QG 5HFMA 3ZJZA 3CD6V 1K3EA 4GYCB 1KUQA 4K8XA 3OMNB 4MW8A 4ZI7B 4EB6A 2JGDA 4H37A 3A2FA 4BW5A 1VF6C 3E35A 3H01A 2PI5A 2ZKOA 3S3XA 1X4TA 3ABMC 2PYLA 2CDYA 4DV3B 1NVPD 5KHKA 4O2AB 4MT8A 3RYHB 1QCEA 2F43G 2ITDC 4GKJB 3W7XA 2JRIA 1QR8A 2EIKB 2GSMB 5LA6B 4WF9V 4MSWC 1OCRC 1MA1A 1PP9H 4ZBMA 3F5WC 3VOUA 3OTOB 2LW1A 2P5OA 4PA7A 2F23A 3WG7C 3X2QC 3ZN0A 3K5MA 2CTWA 4IHJA 2UXBO 5LGUA 5LHGA 1VEWA 4NXMB 2EZPA 3HB3B 3JAKA 3WB2A 2JGUA 3A0HZ 1BE3H 1NQTA 4XDKA 2CGNA 4PELA 5EIBD 1EN5A 1N8RW 2QWPB 2P4KA 2PTMA 1L8DA 3HPLC 3SJAC 4ASUG 5CBGA 1I5YA 5GW7A 1US6A 5KUMA 2XAFA 3AG7A 4CZZA 4JI0O 2HHHB 2Z5UA 1IXMA 3K59A 1Y66A 1Q81W 5CB4A 2ZM6B 4HZ3A 1K4DC 1ZTEA 3B2EE 3AG3B 2Q9LA 1GMGA 3UO3A 4DV7O 2HR3A 3RYFA 3A8TA 2CK3G 4U3JA 3N2KA 4GX2A 4JTCB 5E1AC 1KBHA 1JFFB 1M5IA 5IY5C 5JH7B 2P67A 1NR1A 1WAZA 2YS8A 4LCUC 4B7KA 3FD9A 3ZHTA 5IJ9B 2XUMA 3C3TA 3JAMN 4DV2B 4LNUB 1DF4A 3K08A 4DRXA 1RPOA 2ETNA 1K8AW 4LF5B 4DR4O 1SRYA 2OCCB 3UM7A 3BPZA 5CA0B 2A79B 3CRAA 2LGWA 5KHIA 2DW4A 4LWSB 3SYQA 4B3RB 2E76B 2AGAA 3OEHG 1EM1A 2QWOB 3APOA 4X66B 2F95B 2VS0A 1CPYA 3CYOA 5EIBC 1IBLO 1B3QA 1R1BA 1ZUQA 2OTLV 3EHBB 3SJBC 2YIAA 1Y76A 2Q67A 3K79A 1YIJV 1HDJA 3FAVB 4LF7B 1JOYA 4FK5C 5FLXN 3CCQV 5EK0A 3K3WA 1S5LZ 3CC4V 2X7RB 4CH4A 5KMGB 5IYBO 3RVZA 4AQYO 4I50A 4IGGA 4FM2A 1YSCA 4PI2A 4N23A 1VQ8V 2QSAA 1FXKC 5B3SC 2UXXA 3FYEB 2AZ2A 1THZA 1KP2A 2QJ1A 1TVKB 1LR1A 1Q43A 2EILC 2Q73A 3L9DA 1FYJA 3SPGA 2LO1A 3JD3A 4FZ0A 1N33O 3UQ8A 4X64B 4FVMA 2ZM6O 1QBZA 4B3TB 3LDCA 1SQGA 2DYRC 1XEQA 1JMKC 2WLHA 1JJOA 1J5EO 2WPDG 2QTOA 1E1RG 5LYJA 5LBQA 3G6EV 4JYAB 4I4TA 4D7SA 4KXRA 3CHXA 4TUYB 3ZRSA 5LXTA 1MMMA 1OHHG 2KKWA 1SA0B 2FMLA 4JI4B 2E75B 1W0KG 2QR4A 4RWUA 1R3KC 2EBOA 3T1HB 1V9PA 4J7JA 4MTXA 2GV9A 2D3OW 4PI0A 2DN9A 1KD1W 4YHHB 1V54B 4CH3A 1H2GA 5FPRA 2B1IA 4TT3G 2EIKC 1YTFB 4LF5O 1JR9A 1H2MA 5IDJA 1SQFA 2N74A 4CH6A 3QVNA 4QIWF 2FL4A 2Q68A 3ABUA 5IJ0A 1S0VA 1DTOA 4YJ3B 1KQSU 4JAUA 1AI6A 3W7UA 4JV5B 3ZN1A 2UXCO 3KCXA 1QNMA 4ZIBA 2DQ0A 4MTOA 4NB5A 2OIEA 2EJ7A 1GN3A 5EYPB 1WPBA 2UUBO 2FB5A 4W4LA 2MW2B 2YIBD 1KU9A 4F4LA 1GN2A 4IIJA 1BT8A 3D36A 3ZS8C 2GBOA 3L73H 4F6RA 1F7YA 1DK1A 3AG3C 3OR6C 3DSQA 1PL0A 3CC2V 2Q6AA 2WLNA 1PV0A 1Q6IA 4UCRA 1H2LA 1ZSPA 3T4DA 1P7BA 4Z2WA 2E74B 3ZHSA 3EVKA 3MDSA 4MVMA 5D5QA 4PHZA 4UB6Z 4JI3B 1BHAA 5JJNB 3OAAG 4WFAV 1SQVH 1IBKO 4O2BB 3H9VA 2N05A 4FMTA 4DV1B 3P30A 3E8FA 1K4CC 5KLVH 2IJIA 1MSWD 2LJ2A 3PJSK 1R6KA 1VF7A 3JAKB 4B08A 1RSOA 3ZBHA 4JI4O 1VQMV 2OCCC 4AILC 4NVPA 3M8AA 2X6CA 4FLXA 3T1HO 1GM7A 5BMVA 3BY6A 3JALB 2OT5A 4XBFA 4BIZA 4K3AA 4H44B 4NTWA 1H8EG 2K1EA 1FKAO 3AG2B 3WB1A 5H6QA 5EBMC 2Y4UA 4O4JA 4FLUA 3E8GA 4X88A 3CPWU 1S72V 3BABA 1WA8B 3NR7A 1HP8A 4X1IA 1SQBH 4DK0A 1JVMA 4LH7A 1M56B 3ZCCA 3F5TA 4JV5O 1AJNA 1QR9A 5BXZA 1MNGA 3K0GA 4GKKB 2EINB 3B40A 2BSKA 2JDIG 3ZMVA 3QO8A 2DWDC 1SC5B 2YICA 2LP7A 1KB9F 3RYCB 3K5NA 1VMGA 5ITZA 5B66Z 4LFBO 3LNNA 1EZVH 2UUCO 1TUEB 5GONA 5IE9A 4FLYA 4FLZA 1VARA 3JASA 1N34B 1GH6A 5H9CA 2NN4A 1MG1A 5BR8O 1ZL8B 2VWJA 3CCJV 4QE9A 1P84F 2DQ3A 3SYAA 1JJ2U 1Q82W 2V1DA 1IDSA 1E79G 2CUGA 1FJGB 1GN4A 2AW9A 3ABLB 1PD3A 4B7EA 1GAXA 2F93B 4ICGA 3EXAA 4DV6O 3K5LA 4JI7B 4J9ZB 5K1PA 3B8NA 3F7YC 1RM1B 1XQ8A 4FFBA 3K5OA 2JS5A 4RAIA 1Y76B 1BL8A 3OW2U 2QWRB 3JD2A 3CB2A 4JI2B 1GN6A 3GVMA 4ABMA 1V54C 5J2UA 2UXBB 3CCLV 4NYKA 5IYZA 4UXNA 2FTKA 1MOFA 3TXQA 2BOCC 5B5EZ 3QO5A 3OGIB 4QGPA 3L75H 2Q7HA 4QJFB 5B1OA 3RFRA 2HEPA 4JI5B 2ZDIC 3E8HA 3TCUA 3DTUB 2WLLB 1BZKA 4DV4O 2P7TC 4JI8O 1A32A 1CEZA 3T1YO 4HAMA 1KC8W 1M4UA 1SESA 1LUWA 4FZ1A 2BTQA 2WWWA 1S77D 4DYLA 1H2NA 4MVRA 3P3NA 4EFBA 3KCYA 1RPRA 4P9PA 4DV0B 1I08A 1VIBA 5EZYA 2ZQMA 3RYIB 3ZX6A 2XHBA 1IXBA 1YZBA 2EIJB 2RN9A 3L72H 4JTDB 3CX5F 1BCCH 3D3QA 4ZHQA 2ZINA 3HR0A 2E5LO 5CN0A 3JD1A 2FKXA 1V55B 4JASA 4MS2A 3R66A 3CMEV 2XT9A 3ZRWB 3LDDA 1LUVA 4LFAO 3SYOA 3JSLA 2BOBC 3OMAB 4RUFA 2QWNB 4LBEC 5J9PC 1N4CA 5KA5A 3WB0A 4TQFA 4DR2O 1FXHA 1BMFG 1T5EA 1N34O 3IFXA 3CJHA 4RO2A 3JATB 1P49A 1R3IC 4DR4B 4DW0A 3S3WA 2EZOA 1VP7A 1AILA 1EN4A 1MSDA 1JQ0A 5JCOA 2DYSB 1FJGO 3LSSA 1NZ6A 4X20A 4R7CA 4JI7O 5JJEB 3LDEA 1IBLB 4R8CA 1N36O 4OGQB 2KG7B 1COWG 2KSDA 1YI2V 1GO3F 1H8HG 1VQNV 3T1CA 2UUAO 1GRJA 4JZ2A 5GTIZ
chains in the Genus database with same CATH topology
5IYBO 3AG4B 3A0RA 2ZR3A 4JF3A 1EFRG 3JD0A 4UVAA 3RVZA 2YEVB 3RW0A 3G71V 1NH2B 4PDVA 3IC7A 4TWKA 4WFEA 1YSCA 1VQ8V 4N23A 1QLNA 3R65A 1GKFA 4I5SA 3AG2C 5KA6A 1FXKC 5H6RA 2UXXA 5B3SC 2QEXV 4LC1A 3FYEB 4WCEV 5CMUA 1R3LC 1ROPA 1THZA 1KP2A 2AHZA 3E89A 5B1BC 2ZXWC 5IYCO 2EIMC 2EILC 3G4SV 3SPGA 2IU3A 4U7OA 3JD3A 5B1AB 1M56C 5L3CA 2WSSG 3ABMB 3ZIAG 2ITCC 1SETA 2IH1C 1F4NA 2XAQA 1JCHA 3FB8C 1QBZA 4Z1MG 3LDCA 2EINC 4MVZA 2DYRC 3SPJA 5CBHA 3IGAC 4UVBA 4X8AA 3SYCA 2W6IG 2Q69A 3ABKC 2QM7A 2WLHA 2IJJA 4BAYA 2WPDG 2QTOA 1E1RG 5LBQA 1AJPA 3G6EV 1K92A 2A0LA 1OCRB 3W7TA 3GWOA 2R9IA 3MHSC 1MABG 3CCRV 3ZRSA 2X0LA 2HJFC 4UVCA 1VQPV 4UV8A 1OHHG 3K0DA 4GX0A 4P2ZA 3E83A 3WG7B 3X2QB 1DF5A 4EKWA 1SZTA 2WLMA 1W0KG 3QNEA 3RBZA 1R3KC 2EBOA 3K9AA 4MTXA 2D3OW 1YHQV 1FXKB 1FFTB 1KD1W 1YJ9V 5LGNA 1V54B 3LNMB 1H2GA 4OXSA 4PA3A 3STLC 3ZRXA 2B1IA 2ZDIA 2NNUA 4TT3G 4KFMA 4PA4A 3CC7V 1M57B 3QO7A 2JEUA 4GX1A 2EIKC 2QKSA 5EBLC 1YTFB 1ORQC 4DO2A 4RQEA 3K03A 2XAJA 4BIUA 5IDJA 1OCCC 3DGEA 2JK5C 3ABLC 3K04A 3I55V 3STZC 3ASNB 4TSFG 1S5HC 4QIWF 1XL4A 2Q68A 2B5UA 3ABUA 1RM1C 5L3DA 3ML0A 1S0VA 4MVUA 1GM9A 1LNQA 1DTOA 1KQSU 1OCOB 4JAUA 1AI6A 3W7UA 1DLBA 1PNKA 3ZN1A 3FB7C 2DQ0A 4MTOA 1JX9A 1SERA 4GT1A 3RVYA 1K34A 1KKDA 2XASA 1KP3A 1AROP 3CP1A 4KUMA 3SYPA 5LHHA 1NJIW 3WFVA 1HWYA 3ZMUA 1VQ5V 3B8MA 4JYBA 2X6BA 4RQFA 1S3JA 1VQ7V 1NVPB 3T4ZA 1QLEC 5L3FA 1AI5A 1VQ4V 3AG1C 1L1FA 3K06A 4F4LA 2IU0A 3CC4V 4GX5A 1NH2D 3D36A 1OCZB 2JIZG 3CMAV 5L3BA 2IH3C 5IYDO 1F23A 4P30A 2M7WA 2HFEC 3JCZA 2WLJA 1K9MW 2C2AA 3AG3C 3OR6C 3ZMTA 1NBMG 3T2MA 3OR7C 3CCVV 1PL0A 3CCEV 3CC2V 2Q6AA 2WLNA 2Y48A 1PKXA 3F7VC 5HFLA 2EIJC 3T4DA 1P7BA 1BHBA 4JYCA 1CP9A 1Q86W 2HVKC 3OM3B 4G2KA 3D3IA 2WLIA 2XAGA 3LSQA 4MVMA 1PNMA 4QPJA 4MVQA 2KB1A 3VBBA 4JAVA 3OUSA 2IJKA 4L87A 1BHAA 1V55C 3OEEG 1EZJA 3OAAG 4WFHA 2QA4V 4WFAV 5EC2C 4RUEA 1S76D 2W0FC 4XDJA 1K5QA 4FMTA 2ATKC 3P30A 3E8FA 3LUTB 2WLIB 2XAHA 3ASOC 2JJ1G 1K4CC 2IJIA 3M99B 1MSWD 3PJSK 1K7DA 4G28B 1GM8A 5C93A 4JTAB 5FL7G 1R6KA 4YXWG 1PNLA 2WLKA 1VQMV 2OCCC 3E8BA 1FXKA 2WAMA 2LFSA 3AG1B 2X6CA 1GM7A 4QPKA 2HG5C 4LP8A 1R73A 3BY6A 5L3GA 2OT5A 4XBFA 4BIZA 2Y69C 2A9HA 3SPHA 3ETDA 5EC1C 1K33A 1H8EG 2K1EA 1Y4MA 3NXSA 1K5SA 3AG2B 3GB7C 2P6JA 1F4MA 5H6QA 5B3SB 5EBMC 2OTJV 2DYSC 2B1GA 1E1QG 1NKDA 4FJCC 5B1BB 2ZXWB 3E8GA 3BEHA 2EIMB 2EILB 4X88A 3CPWU 1S72V 1JVMA 1NR7A 1F51A 1M56B 2P90A 4PA9A 2EJRA 3ZCCA 2X6AA 1AJNA 1K97A 1QR9A 1G8MA 3E86A 2QE7G 3AG4C 3K0GA 4CBCA 2EINB 2DYRB 2JDIG 4MW3A 3CXCU 3ZMVA 3QO8A 4WFGA 2DWDC 1Q7YW 2V7QG 3ABKB 5HFMA 2LP7A 3ZJZA 1VQKV 2XOKG 3CD6V 1K3EA 1JPXA 3ZRVA 3OMNB 1WPXA 4FIPC 4MW8A 1AJQA 3ZMSA 4H37A 3EFFK 3AEIA 1TUEB 1I5XA 2R9RB 3P32A 4PA6A 2HLDG 4BW5A 3E35A 3H01A 5EBWC 2PI5A 3ETGA 4FPPA 5B1AC 4E2LA 1GK9A 1FXVA 3JYCA 3ABMC 5H9CA 1NVPD 3SPCA 1MG1A 2Y69B 4MT8A 3CCJV 4JGSA 4QE9A 3FYIB 4MVSA 1AI4A 1QCEA 2F43G 2ITDC 5DM6V 2H8PC 4DXWA 4QNHB 2DQ3A 1YJWV 3W7XA 3SYAA 1JJ2U 1QR8A 1WLEA 1Q82W 2V1DA 4QE7A 3UKMA 1E79G 2AHYA 2IJHA 2EIKB 4R50A 2GSMB 4X89A 4WF9V 3FB5C 4MSWC 3W7WA 1OCRC 1W0JG 1R6NA 1OCCB 3ABLB 3OFNG 1PD3A 4ZBMA 3F5WC 5BZBA 3VOUA 1M1KW 4J9ZB 3B8NA 4PA7A 3WG7C 3X2QC 3F7YC 4ZKIA 1RM1B 4WFFA 3ABTA 3ZN0A 3OGCC 4KP4A 4MTFA 1G4YB 4RAIA 1BL8A 3OW2U 3JD2A 1EBOA 5LGUA 2H94A 3FB6C 2ZD9A 5LHGA 3ETEA 3OE7G 2EZPA 3HB3B 4GCZA 1V54C 4J9YB 5CA3A 2HVJC 1NQTA 2WLLA 2JJ2G 4XDKA 4XDLA 4PELA 3CCLV 1M57C 4UXNA 2FTKA 1N8RW 1GTOA 5L3EA 1MOFA 1ZWIC 2BOCC 3OMIB 3QO5A 5LHIA 4MVOA 3HPLC 4ASUG 1QVFU 4QJFB 4P9OA 3OUFA 5B1OA 1K73W 3ASNC 5CBGA 1I5YA 2ZDIC 3E8HA 5GW7A 3DTUB 3TCUA 5CBFA 2WLLB 2HKOA 1YITV 2P7TC 5KUMA 2XAFA 4UV9A 2LFRA 1QLEB 5KUKA 2QM8A 1CEZA 4CZZA 1KC8W 4HAMA 1SESA 5LGTA 1VQLV 3ZMZA 1OCOC 2Z5UA 1IXMA 3CCSV 2WWWA 2ZR2A 1Y66A 1S77D 1Q81W 4MVRA 3SJQC 4HZ3A 3TK1A 1K4DC 4UUJC 2YSUB 4R6ZA 4JPRA 1RPRA 1B6QA 4P9PA 3AG3B 1UJWB 3I56V 1GMGA 2ZQMA 2HR3A 1VQ9V 1YTFD 5B1NA 2CK3G 3ZRWA 1FS0G 2EIJB 2MK3A 4GX2A 2NLJC 4PDRA 4JTCB 4Q20A 5E1AC 4JTDB 2W6JG 5IY5C 3B77A 5CN0A 3JD1A 2PI4A 1V55B 2JEXA 2P67A 1NR1A 1QVGU 4JASA 4MS2A 4LCUC 3CMEV 1R3JC 1OCZC 4G27B 3ZRWB 1XL6A 1AI7A 3LDDA 3TETA 3SYOA 2BOBC 3W7SA 3OMAB 4RUFA 1VQ6V 4LBEC 5J9PC 1M90W 3ASOB 3SPIA 5KA5A 3CCMV 3JD4A 1YJNV 1DF4A 3K08A 1VQOV 1FXHA 1BMFG 1RPOA 3IFXA 1K8AW 3FKSG 3KG2A 4MTGA 1SRYA 2OCCB 3UM7A 4RO2A 1H38A 4U7NA 4HYOA 2A79B 2DWEC 1R3IC 2DW4A 3SYQA 2IW5A 2EZOA 3OEHG 1J95A 1JQ0A 2Z3YA 1P4RA 1AR1B 1CPYA 1ENVA 3CYOA 2DYSB 3LSSA 2GHYA 5DN6G 1M9NA 4I9WA 1OZ0A 4R7CA 1W2BU 3EHBB 2OTLV 4WFBV 4H33A 1KECA 2Q67A 2YEVA 3LDEA 4PDLA 3K79A 3CCUV 1YIJV 4R8CA 3MHHC 4PDMA 3E2EA 1JOYA 1COWG 3MD0A 1YI2V 1GO3F 2XNDG 4FK5C 4N21A 3CCQV 1H8HG 5EK0A 3T1CA 1VQNV 2UXNA 3K3WA 5IY5B 2X7RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB7 C;  4MTO A;  3ASN C;  5CBG A;  3E8H A;  3RVY A;  3TCU A;  3E8G A;  2WLL B;  3BEH A;  4X88 A;  5CBF A;  3RVZ A;  3RW0 A;  1KKD A;  2P7T C;  5KUM A;  4PDV A;  3SYP A;  4TWK A;  4WFE A;  5KUK A;  1JVM A;  3R65 A;  3AG2 C;  4PA9 A;  1OCO C;  5B3S C;  5J9P C;  2X6A A;  1R3L C;  3E89 A;  2AHZ A;  4MVR A;  3SJQ C;  2X6B A;  3E86 A;  3K0G A;  3AG4 C;  4HZ3 A;  5B1B C;  1K4D C;  4UUJ C;  4CBC A;  2ZXW C;  4R6Z A;  2EIM C;  2EIL C;  4MW3 A;  4WFG A;  4P9P A;  2DWD C;  3T4Z A;  1QLE C;  3SPG A;  3ZJZ A;  3AG1 C;  1M56 C;  3K06 A;  4F4L A;  2ITC C;  4GX5 A;  4PDR A;  2IH1 C;  4MW8 A;  3FB8 C;  4H37 A;  2IH3 C;  2NLJ C;  3EFF K;  3LDC A;  4GX2 A;  4JTC B;  2EIN C;  4JTD B;  2R9R B;  4MVZ A;  2DYR C;  4P30 A;  2HFE C;  3IGA C;  4PA6 A;  2WLJ A;  3SPJ A;  5CBH A;  4BW5 A;  4X8A A;  3AG3 C;  5EBW C;  3SYC A;  2Q69 A;  3ABK C;  3OR6 C;  3T2M A;  5IY5 C;  5B1A C;  3OR7 C;  2Q6A A;  2WLH A;  3JYC A;  3ABM C;  2WLN A;  4MS2 A;  4LCU C;  1R3J C;  2QTO A;  3F7V C;  1OCZ C;  3SPC A;  4G27 B;  1XL6 A;  2A0L A;  3LDD A;  3TET A;  2EIJ C;  3SYO A;  3T4D A;  2BOB C;  1P7B A;  4QE9 A;  2HVK C;  4RUF A;  4LBE C;  2WLI A;  4MVS A;  3ZRS A;  4MVM A;  2ITD C;  3SPI A;  2H8P C;  2KB1 A;  4MVQ A;  4DXW A;  2HJF C;  4QNH B;  3OUS A;  3SYA A;  3K08 A;  3K0D A;  4GX0 A;  1V55 C;  4P2Z A;  5E1A C;  4QE7 A;  3E83 A;  3UKM A;  3IFX A;  4WFH A;  2AHY A;  4R50 A;  4EKW A;  3KG2 A;  5EC2 C;  4MTG A;  4RUE A;  4X89 A;  3FB5 C;  2W0F C;  2WLM A;  4MSW C;  1OCR C;  4XDJ A;  3UM7 A;  4RO2 A;  3RBZ A;  1R3K C;  2ATK C;  4HYO A;  3E8F A;  3LUT B;  2A79 B;  2WLI B;  3ASO C;  3F5W C;  4ZBM A;  5BZB A;  2DWE C;  1K4C C;  1R3I C;  3VOU A;  3LNM B;  4OXS A;  4PA3 A;  3STL C;  3PJS K;  4G28 B;  4J9Z B;  3SYQ A;  4JTA B;  4PA7 A;  4KFM A;  4PA4 A;  3WG7 C;  3F7Y C;  3X2Q C;  4WFF A;  1J95 A;  4GX1 A;  2EIK C;  2QKS A;  3OGC C;  4MTF A;  1G4Y B;  1ORQ C;  2WLK A;  4RAI A;  5EBL C;  1BL8 A;  2OCC C;  3E8B A;  3K03 A;  3FB6 C;  2ZD9 A;  1OCC C;  2JK5 C;  3ABL C;  2X6C A;  3K04 A;  2HG5 C;  3STZ C;  1V54 C;  4I9W A;  4LP8 A;  4J9Y B;  4R7C A;  1S5H C;  2HVJ C;  4H33 A;  2WLL A;  4XDK A;  4XDL A;  2Q67 A;  1XL4 A;  2A9H A;  2Q68 A;  2Y69 C;  2YEV A;  3LDE A;  4PDL A;  1M57 C;  3SPH A;  5EC1 C;  4MVU A;  4PDM A;  4R8C A;  2K1E A;  1LNQ A;  3GB7 C;  1ZWI C;  2BOC C;  5EK0 A;  3T1C A;  4MVO A;  5EBM C;  3HPL C;  2DYS C;  4P9O A;  3OUF A; 
#chains in the Genus database with same CATH topology
 4JI2 O;  1Q3E A;  3AG4 B;  3VQV A;  4JF3 A;  1SKV A;  2CH7 B;  4X1Y B;  4TV8 A;  2YEV B;  3G71 V;  4PDV A;  1VF6 A;  4WFE A;  3R65 A;  4K0K O;  3AG2 C;  1OV9 A;  3A0B Z;  2RJZ A;  5KHG A;  4WCE V;  5CMU A;  4AQY B;  2AZ0 A;  1Z2G A;  2ZE6 A;  4YIP A;  4JI5 O;  3G4S V;  4DR3 O;  1HNZ O;  5B1A B;  1M56 C;  2WSS G;  1SET A;  2IH1 C;  5LP6 C;  1IX9 A;  4PD4 F;  2XAQ A;  3CS5 A;  1N33 B;  2EIN C;  3HKE A;  3IC9 A;  4MVZ A;  2R9A A;  2DJV A;  4BW9 A;  4X8A A;  3SYC A;  5CA1 A;  2W6I G;  4DV0 O;  1OJH A;  2QM7 A;  1AJP A;  3C90 A;  4O4H A;  1B04 A;  1HNX B;  1J5E B;  4EEQ A;  1MAB G;  1H2S B;  4E4E A;  5LOV A;  4Z1V A;  1BQZ A;  4GX0 A;  4P2Z A;  3HKB B;  2WLM A;  3QNE A;  3B09 A;  3RBZ A;  4OPA A;  5H5N A;  1YHQ V;  4OXS A;  4JZG A;  2IM9 A;  4LF4 O;  3CC7 V;  1M57 B;  3QO7 A;  4TOI A;  1UFI A;  4GX1 A;  1SQX H;  5BMV B;  5EBL C;  4RQE A;  3SDL A;  3DGE A;  3ABL C;  3ASN B;  3UCS C;  4TSF G;  1S5H C;  1L0L H;  1RM1 C;  3CRC A;  1BS3 A;  4U3F H;  3ML0 A;  5JQG A;  4MVU A;  1GM9 A;  1TUB B;  4H13 B;  2N04 A;  1OCO B;  2GUZ A;  3HKC B;  3RGB A;  1QU7 A;  2PY5 A;  3J80 N;  1JX9 A;  4GT1 A;  3RVY A;  4J41 A;  1KKD A;  2XAS A;  5LHH A;  2DOS A;  2UXC B;  1AB3 A;  1NJI W;  1M93 A;  3B8M A;  3DXR A;  2X6B A;  3IJ4 A;  4I55 B;  4ZOL B;  1S3J A;  1VQ7 V;  5L3F A;  1VQ4 V;  1L1F A;  2UUB B;  4GX5 A;  1OCZ B;  3BA9 A;  1I94 B;  5IYD O;  5JVD A;  3JCZ A;  2WLJ A;  1NBM G;  4TV9 A;  3T2M A;  4HBN A;  5A2Q N;  2Y4T A;  1URF A;  5C8Y A;  2EIJ C;  3E22 A;  2W0X A;  4DR7 O;  4YJ2 B;  1BHB A;  2HVK C;  2WLI A;  2XAG A;  3VBB A;  4QPJ A;  3QG5 A;  1BQ0 A;  4HNA A;  3L74 H;  1V55 C;  5KX5 B;  1EZJ A;  3N2G A;  4WFH A;  1Q8I A;  3JAR B;  3Q4H A;  4RUE A;  4O4L B;  3VQW A;  1K5Q A;  1HNX O;  2XAH A;  3RN4 A;  4UCV A;  3BCC H;  4G28 B;  1K7D A;  1IBK B;  4I0X A;  4JTA B;  2PUS A;  3JAW A;  1FPO A;  1PNL A;  2WLK A;  4DW1 A;  1FXK A;  1Y74 B;  1AP6 A;  5LL6 Y;  4J10 A;  3AG1 B;  1XHX A;  3UT5 B;  3LSU A;  4A5U B;  2A9H A;  4CC5 A;  3ETD A;  4J7Z A;  2AXT Z;  2DYS C;  1L0N H;  2ZT9 B;  4FJC C;  1QQC A;  5DEC A;  3BEH A;  2EIM B;  5J2T B;  3THO A;  2P90 A;  3ICX A;  2OWO A;  2X6A A;  4ZI7 A;  5FNV B;  3E86 A;  2R72 A;  3AG4 C;  2RNB A;  3BFR A;  4CBC A;  4GUN A;  4KHP O;  4DV5 B;  4WBN B;  1Q7Y W;  3ABK B;  1JPX A;  1WJZ A;  3CRR A;  2KQX A;  2VQE B;  2F4V O;  1B06 A;  2RDC A;  1WPX A;  2YUA A;  4O2A A;  1AJQ A;  3ZMS A;  4EFE A;  2ZIO A;  3EFF K;  3RYH A;  4LH6 A;  2ZNI A;  3P32 A;  4PA6 A;  2HLD G;  2P06 A;  3B4S A;  3H1H H;  5EBW C;  4LFB B;  3QF7 A;  3ETG A;  4FPP A;  5B1A C;  1GK9 A;  1FXV A;  3JYC A;  4BWA A;  2UUC B;  4X1K A;  5LA6 A;  2Y69 B;  4EB6 B;  2JGD B;  4JGS A;  1I94 O;  1PL4 A;  4NTY A;  1AI4 A;  1XMO B;  3SGI A;  1YF2 A;  2H8P C;  4QNH B;  2ZIM A;  1YCI A;  5BR8 B;  1WLE A;  2XTA A;  2HP8 A;  2AHY A;  2IJH A;  4X89 A;  3FB5 C;  1Z5W A;  2DE0 X;  3OFN G;  5BZB A;  3DC6 A;  1MZE A;  1YXB A;  2Q5Z A;  1M1K W;  3H1K H;  3H1J H;  4B3S O;  4ZKI A;  2PF4 E;  4WFF A;  3OGC C;  4KP4 A;  4MTF A;  4DV6 B;  1Y6X A;  3OE7 G;  4GCZ A;  4J9Y B;  2HVJ C;  2NR5 A;  1M57 C;  1Y67 A;  1GTO A;  4DUZ B;  1ZWI C;  3BVO A;  3OMI B;  4IHJ B;  2F66 C;  4GZR B;  4DUY B;  4X9Q A;  3OUF A;  1K73 W;  3ASN C;  5KHH A;  3CWB H;  1QHT A;  2HKO A;  2YXY A;  1YIT V;  4UV9 A;  2LFR A;  1QLE B;  5KUK A;  5LGT A;  2F1M A;  1VQL V;  1OCO C;  3CCS V;  2ZR2 A;  4DV4 B;  4JI8 B;  1O9H A;  3T1Y B;  4UUJ C;  2OYQ A;  1JFF A;  4R6Z A;  1KYO F;  1B6Q A;  2ADP A;  4O4I A;  4X65 B;  2QDO A;  5JH7 A;  1UJW B;  3I56 V;  4GLX A;  3TXS A;  1YTF D;  1MZF A;  4PV1 B;  2ADQ B;  5CB4 B;  1FS0 G;  2ARH A;  2MK3 A;  3G80 A;  3VQY A;  4PDR A;  2NLJ C;  5IJ9 A;  1YVW A;  4LF6 O;  4DV5 O;  4D7T A;  4LNU A;  4W4K A;  3B77 A;  5IWA B;  1WNS A;  1QVG U;  3RYF B;  1OCZ C;  4G27 B;  1NTK H;  5JWP A;  2VQE O;  4U3J B;  2E5L B;  2VQF B;  3N2K B;  5CA0 A;  4Q6G A;  2ZCE A;  1VQ6 V;  3ASO B;  3CCM V;  4LFA B;  4LWS A;  1SQP H;  3FKS G;  1AR5 A;  4DR2 B;  4DR5 O;  4LF9 O;  4U7N A;  4HYO A;  1G6U A;  1XMO O;  4DRX B;  2ZE7 A;  2IW5 A;  1XRE A;  1J95 A;  3FAV A;  2WA3 A;  1ENV A;  2RCV A;  2YIB A;  5KMG A;  2QKA A;  1OZ0 A;  2CTQ A;  4WFB V;  4H33 A;  1KEC A;  4PDL A;  4PDM A;  3E2E A;  4J7K A;  1HR0 O;  2UXN A;  5IY5 B;  4I9Q A;  1TVK A;  1N36 B;  3WU2 Z;  2ZR3 A;  4L8J A;  3DXR B;  1EFR G;  1IVS A;  3JD0 A;  4UVA A;  2UUA B;  3IC7 A;  4TWK A;  2IBZ H;  1XNR B;  1QLN A;  4IL6 Z;  4I5S A;  4DUZ O;  4B3M O;  3H1I H;  2QEX V;  4LC1 A;  1TGO A;  4DUY O;  5BY1 A;  1ROP A;  3E89 A;  2AHZ A;  4DR6 O;  3D8C A;  3U11 A;  4K0K B;  1X59 A;  3L70 H;  2EIM C;  4I50 B;  2IU3 A;  1D2D A;  4FLV A;  3ZIA G;  2ITC C;  3CRQ A;  4LF8 O;  1F4N A;  3FB8 C;  1JCH A;  4DR3 B;  1D5N A;  1HNZ B;  1FD9 A;  4CS2 A;  4Z1M G;  1H2K A;  2G38 A;  2ILM A;  1SF9 A;  4TUY A;  2OIG A;  2Q69 A;  3ABK C;  4KL1 A;  3U10 A;  1WP7 A;  4IYH A;  4X65 O;  1WB8 A;  2IJJ A;  1SA0 A;  4BAY A;  1AP5 A;  1K92 A;  4PJ0 Z;  2A0L A;  3GWO A;  2CE4 A;  4X62 O;  1FFX A;  1TA8 A;  3MHS C;  2QKC A;  2HJF C;  4UVC A;  4CC6 A;  3K0D A;  3E83 A;  5IWA O;  2L6L A;  1DF5 A;  5LYJ B;  4I4T B;  1NS1 A;  2VQF O;  3K9A A;  3ZHU A;  1FXK B;  1FFT B;  5LXT B;  1YJ9 V;  2ZDI A;  3G6B A;  3L71 H;  2NNU A;  2JEU A;  1N32 B;  4DO2 A;  3K03 A;  2XAJ A;  4YJ3 A;  4BIU A;  4NR1 A;  4LF4 B;  2VWK A;  4NTX A;  3HKD A;  5L3D A;  2FYU H;  2Y0I A;  1LNQ A;  2Q0A A;  1DLB A;  5EYP A;  1XNQ B;  3FB7 C;  4NKG B;  2Y0P A;  1SER A;  1K34 A;  3CP1 A;  4KUM A;  3SYP A;  2P22 C;  5IJ0 B;  2PZS A;  3WFV A;  1HWY A;  5KHJ A;  2K9P A;  5E79 Z;  1I0H A;  1QLE C;  1AI5 A;  2UU9 B;  1XNR O;  4FM1 A;  4LFC O;  3G67 A;  2M6Y A;  2Q7E A;  1F23 A;  4X1K B;  2M7W A;  1WP8 A;  4JAA A;  2C2A A;  3APQ A;  3CCV V;  3ZHR A;  4IIJ B;  2Y48 A;  1XBL A;  1XOU A;  2ZNJ A;  4O2B A;  4FLT A;  4JI1 O;  2BTO A;  4F6R B;  1CP9 A;  1Q86 W;  4G2K A;  3D3I A;  2EUL A;  1PNM A;  3SR2 C;  1UPG A;  4JAV A;  1PPJ H;  1W59 A;  2IJK A;  4L87 A;  1IBM O;  4DR7 B;  3DC5 A;  2QA4 V;  4XDJ A;  4FM0 A;  3AK3 A;  4H0L B;  2EX3 A;  2E3C A;  3ASO C;  2Q4P A;  4D6T H;  3SJC C;  1GM8 A;  3JAL A;  3OTF A;  5C93 A;  5FL7 G;  3J81 N;  3FFQ A;  2R70 A;  2V4D A;  2LFS A;  4QPK A;  5L3G A;  1WA8 A;  5EC1 C;  1RSO B;  1Y4M A;  1N32 O;  1F4M A;  1IZ3 A;  5LP6 A;  1E1Q G;  2WA4 A;  2GDS A;  5B1B B;  2ZXW B;  1U97 A;  1R6T A;  2H3O A;  4TQD A;  3RYC A;  1F51 A;  1ZAU A;  4O4I B;  1XMQ O;  2PGG A;  1K97 A;  4O4J B;  1G8M A;  1XNQ O;  3CSX A;  4MW3 A;  2VRZ A;  4X1I B;  1VQK V;  2XOK G;  3ZRV A;  4KHP B;  4FIP C;  1ZL8 A;  4UCT A;  4NXN B;  3AEI A;  1I5X A;  2R9R B;  2BSK B;  4DV3 O;  1SQQ H;  5LMU B;  2F4V B;  5KAI Z;  4E2L A;  2UU9 O;  2HJD A;  5ITZ B;  4GKJ O;  2ODM A;  2BE3 A;  3SPC A;  1N0N A;  3VQX A;  5GON B;  3FYI B;  4MVS A;  4JYY A;  4DXW A;  5DM6 V;  1YJW V;  4FFK A;  3JAS B;  4QE7 A;  3UKM A;  2LW7 A;  4R50 A;  3OTO O;  3W7W A;  3KKY A;  1W0J G;  2QWQ B;  1R6N A;  1OCC B;  4NXM O;  4C7U A;  2Q7G A;  3ABT A;  1G4Y B;  1EBO A;  5KAF Z;  2H94 A;  3FB6 C;  2ZD9 A;  1RP3 B;  4B3S B;  3ETE A;  3FX7 A;  4IT5 A;  1Q5O A;  5CA3 A;  2WLL A;  4XDL A;  2JJ2 G;  5IT9 N;  5A9G A;  4FFB B;  2CTR A;  5L3E A;  5LHI A;  4MVO A;  3RWR D;  1QVF U;  4P9O A;  1P7G A;  5J2U B;  2HHH O;  2DMX A;  5CBF A;  5IYZ B;  2YXH A;  2QM8 A;  2Q0O C;  3RYI A;  3BAA A;  3ZMZ A;  3BA8 A;  3M7M X;  3TJT A;  1S5J A;  3SJQ C;  5LMN B;  3TK1 A;  2YSU B;  4JPR A;  2UXD B;  3QTC A;  2BTQ B;  1VQ9 V;  5B1N A;  3PN1 A;  4CS4 A;  3ZRW A;  2D2C B;  3BRC A;  2LGQ A;  4Q20 A;  2JVD A;  4BR6 A;  2P4V A;  2W6J G;  1FFX B;  4OPH A;  2PI4 A;  5EZY B;  1RFY A;  2JEX A;  1NTZ H;  2GTS A;  3CXH F;  2YXL A;  1R3J C;  4DV2 O;  1XL6 A;  4LF6 B;  1AI7 A;  1XI1 A;  3TET A;  3JAT A;  3W7S A;  1HNW B;  4J42 A;  4NXN O;  1M90 W;  2YI9 A;  3SPI A;  4ZHQ B;  5LMU O;  3JD4 A;  1YJN V;  1VQO V;  4IYI A;  1WB7 A;  4JI6 B;  3D36 C;  3KG2 A;  4MTG A;  2RQ6 A;  2B9Z A;  4B3R O;  1H38 A;  4X66 O;  2DWE C;  4DR1 B;  4LF9 B;  4DR5 B;  1KKC A;  3HKD B;  2KG7 A;  3U0Z A;  2Z3Y A;  1P4R A;  3CJH B;  1AR1 B;  1VF5 B;  1ZLZ A;  2GHY A;  4LF7 O;  5DN6 G;  1M9N A;  4I9W A;  1W2B U;  2BCC H;  3CRM A;  4CS3 A;  2CH7 A;  4X1Y A;  2YEV A;  4UFZ A;  3CCU V;  1XHZ A;  3MHH C;  1G1X B;  3MD0 A;  2XND G;  4N21 A;  4YY3 B;  3ZHQ A;  2YID A;  1XDC A;  4I7Z B;  3O65 A;  4X20 B;  2PYJ A;  3A0R A;  2LQT A;  3RW0 A;  1NH2 B;  4UCO A;  1HR0 B;  1GKF A;  5KA6 A;  1KMI Z;  5H6R A;  1R3L C;  4K35 A;  1PM9 A;  5B1B C;  3GWK C;  2ZXW C;  3K9S A;  5IYC O;  4X64 O;  4B3M B;  4TV8 B;  2QTS A;  5JJJ B;  3JSN A;  1O9G A;  4U7O A;  1NT2 B;  4DR6 B;  4B3T O;  3CE2 A;  5L3C A;  3ABM B;  3K58 A;  4OX9 B;  2ZE8 A;  1IUR A;  5LMN O;  1ZX3 A;  5CBH A;  3SPJ A;  3IGA C;  2OCH A;  4UVB A;  5DED A;  4JYA O;  4LF8 B;  2UXD O;  3HKB A;  3AK2 A;  3O9O A;  2QGN A;  1Q90 D;  1OCR B;  5K1X A;  3W7T A;  5F2V O;  3KZI Z;  4CH5 A;  2R9I A;  3HKE B;  1Q6U A;  3TGU H;  3CCR V;  1Q6H A;  4YIO A;  2X0L A;  4F6E A;  2YDE A;  3C3S A;  1VQP V;  4UV8 A;  5CA1 B;  2O57 A;  4J11 A;  4FLW A;  1BGY H;  3WG7 B;  4X62 B;  3X2Q B;  4LR3 A;  4EKW A;  4YHH O;  1SZT A;  1DGS A;  4O4H B;  5FPO A;  1U96 A;  2Q8V A;  1HNW O;  5LGN A;  3LNM B;  4PA3 A;  3STL C;  3ZRX A;  5LOV B;  3RT3 C;  3I5D A;  1JA8 A;  4KFM A;  4PA4 A;  2QKS A;  2JS3 A;  1N0J A;  1ORQ C;  1TUB A;  4JI6 O;  2QM4 A;  3K57 A;  3HKC A;  1OCC C;  2YC0 A;  2JK5 C;  3CEI A;  3K04 A;  3I55 V;  3STZ C;  5LP6 B;  1XL4 A;  2CAZ C;  4DR1 O;  2B5U A;  1FAF A;  3H1L H;  1AR4 A;  1I7F A;  4UCS A;  1PNK A;  1HW7 A;  4I55 A;  1SZX A;  1XUQ A;  4ZOL A;  1KP3 A;  1ARO P;  2RMK B;  5JQG B;  1YDX A;  4DK1 A;  2GTA A;  2GUZ B;  3ZMU A;  1EN6 A;  4YY3 O;  1VQ5 V;  4JYB A;  3N27 A;  3ETQ A;  4RQF A;  1CXZ B;  1NVP B;  3T4Z A;  4K8Z A;  2CTP A;  5AG2 A;  3AG1 C;  1SS3 A;  1NU1 H;  3K06 A;  5D5P A;  2IU0 A;  3ZED A;  1NH2 D;  1BSM A;  3UO2 A;  3P3P A;  2JIZ G;  3CMA V;  4YJ2 A;  5L3B A;  2IH3 C;  4P30 A;  4AHC A;  2HFE C;  2CGO A;  4UB8 Z;  4LFC B;  1K9M W;  3J7A U;  5GTH Z;  1NTM H;  3ZMT A;  3OR7 C;  3CCE V;  5KX5 A;  2A7W A;  1PKX A;  3F7V C;  3JAR A;  4O4L A;  5HFL A;  4JI3 O;  4JYC A;  5JVD B;  4OX9 O;  3OM3 B;  3OT7 A;  4AI8 A;  3LSQ A;  1YEW A;  4MVQ A;  2KB1 A;  3OUS A;  4TV9 B;  3JCU Z;  3ZHV A;  2YI8 A;  4JI1 B;  4DV1 O;  3OEE G;  4UCU A;  5EC2 C;  1S76 D;  5C8Y B;  2W0F C;  1Y74 A;  3E22 B;  3BHP A;  3AK1 A;  1IBM B;  2ATK C;  3LUT B;  2WLI B;  2JJ1 G;  3M99 B;  4HNA B;  3UT5 A;  2Z0A A;  4YXW G;  3N2G B;  5TIS Z;  3Q4H B;  2L35 A;  3E8B A;  2WAM A;  2A3Q A;  1TAE A;  2HG5 C;  1AVM A;  4LP8 A;  1R73 A;  4I0X B;  1D5A A;  2Y69 C;  1NI8 A;  3JAW B;  3SPH A;  5J2T A;  1K33 A;  3NXS A;  1K5S A;  4JI0 B;  3GB7 C;  2P6J A;  5B3S B;  2A06 H;  2OTJ V;  2B1G A;  5H2F Z;  1NKD A;  5FNV A;  3OD4 A;  3MAQ A;  1Z5V A;  4BIO A;  2EIL B;  1WN7 A;  4WBN A;  1NR7 A;  4DV7 B;  5JCO C;  4GKK O;  1XIL A;  4PA9 A;  2EJR A;  4J80 A;  3IAY A;  2QE7 G;  2DYR B;  3CXC U;  4WFG A;  1XMQ B;  2ZE5 A;  2V7Q G;  5HFM A;  3ZJZ A;  3CD6 V;  1K3E A;  4GYC B;  1KUQ A;  4K8X A;  3OMN B;  4MW8 A;  4ZI7 B;  4EB6 A;  2JGD A;  4H37 A;  3A2F A;  4BW5 A;  1VF6 C;  3E35 A;  3H01 A;  2PI5 A;  2ZKO A;  3S3X A;  1X4T A;  3ABM C;  2PYL A;  2CDY A;  4DV3 B;  1NVP D;  5KHK A;  4O2A B;  4MT8 A;  3RYH B;  1QCE A;  2F43 G;  2ITD C;  4GKJ B;  3W7X A;  2JRI A;  1QR8 A;  2EIK B;  2GSM B;  5LA6 B;  4WF9 V;  4MSW C;  1OCR C;  1MA1 A;  1PP9 H;  4ZBM A;  3F5W C;  3VOU A;  3OTO B;  2LW1 A;  2P5O A;  4PA7 A;  2F23 A;  3WG7 C;  3X2Q C;  3ZN0 A;  3K5M A;  2CTW A;  4IHJ A;  2UXB O;  5LGU A;  5LHG A;  1VEW A;  4NXM B;  2EZP A;  3HB3 B;  3JAK A;  3WB2 A;  2JGU A;  3A0H Z;  1BE3 H;  1NQT A;  4XDK A;  2CGN A;  4PEL A;  5EIB D;  1EN5 A;  1N8R W;  2QWP B;  2P4K A;  2PTM A;  1L8D A;  3HPL C;  3SJA C;  4ASU G;  5CBG A;  1I5Y A;  5GW7 A;  1US6 A;  5KUM A;  2XAF A;  3AG7 A;  4CZZ A;  4JI0 O;  2HHH B;  2Z5U A;  1IXM A;  3K59 A;  1Y66 A;  1Q81 W;  5CB4 A;  2ZM6 B;  4HZ3 A;  1K4D C;  1ZTE A;  3B2E E;  3AG3 B;  2Q9L A;  1GMG A;  3UO3 A;  4DV7 O;  2HR3 A;  3RYF A;  3A8T A;  2CK3 G;  4U3J A;  3N2K A;  4GX2 A;  4JTC B;  5E1A C;  1KBH A;  1JFF B;  1M5I A;  5IY5 C;  5JH7 B;  2P67 A;  1NR1 A;  1WAZ A;  2YS8 A;  4LCU C;  4B7K A;  3FD9 A;  3ZHT A;  5IJ9 B;  2XUM A;  3C3T A;  3JAM N;  4DV2 B;  4LNU B;  1DF4 A;  3K08 A;  4DRX A;  1RPO A;  2ETN A;  1K8A W;  4LF5 B;  4DR4 O;  1SRY A;  2OCC B;  3UM7 A;  3BPZ A;  5CA0 B;  2A79 B;  3CRA A;  2LGW A;  5KHI A;  2DW4 A;  4LWS B;  3SYQ A;  4B3R B;  2E76 B;  2AGA A;  3OEH G;  1EM1 A;  2QWO B;  3APO A;  4X66 B;  2F95 B;  2VS0 A;  1CPY A;  3CYO A;  5EIB C;  1IBL O;  1B3Q A;  1R1B A;  1ZUQ A;  2OTL V;  3EHB B;  3SJB C;  2YIA A;  1Y76 A;  2Q67 A;  3K79 A;  1YIJ V;  1HDJ A;  3FAV B;  4LF7 B;  1JOY A;  4FK5 C;  5FLX N;  3CCQ V;  5EK0 A;  3K3W A;  1S5L Z;  3CC4 V;  2X7R B;  4CH4 A;  5KMG B;  5IYB O;  3RVZ A;  4AQY O;  4I50 A;  4IGG A;  4FM2 A;  1YSC A;  4PI2 A;  4N23 A;  1VQ8 V;  2QSA A;  1FXK C;  5B3S C;  2UXX A;  3FYE B;  2AZ2 A;  1THZ A;  1KP2 A;  2QJ1 A;  1TVK B;  1LR1 A;  1Q43 A;  2EIL C;  2Q73 A;  3L9D A;  1FYJ A;  3SPG A;  2LO1 A;  3JD3 A;  4FZ0 A;  1N33 O;  3UQ8 A;  4X64 B;  4FVM A;  2ZM6 O;  1QBZ A;  4B3T B;  3LDC A;  1SQG A;  2DYR C;  1XEQ A;  1JMK C;  2WLH A;  1JJO A;  1J5E O;  2WPD G;  2QTO A;  1E1R G;  5LYJ A;  5LBQ A;  3G6E V;  4JYA B;  4I4T A;  4D7S A;  4KXR A;  3CHX A;  4TUY B;  3ZRS A;  5LXT A;  1MMM A;  1OHH G;  2KKW A;  1SA0 B;  2FML A;  4JI4 B;  2E75 B;  1W0K G;  2QR4 A;  4RWU A;  1R3K C;  2EBO A;  3T1H B;  1V9P A;  4J7J A;  4MTX A;  2GV9 A;  2D3O W;  4PI0 A;  2DN9 A;  1KD1 W;  4YHH B;  1V54 B;  4CH3 A;  1H2G A;  5FPR A;  2B1I A;  4TT3 G;  2EIK C;  1YTF B;  4LF5 O;  1JR9 A;  1H2M A;  5IDJ A;  1SQF A;  2N74 A;  4CH6 A;  3QVN A;  4QIW F;  2FL4 A;  2Q68 A;  3ABU A;  5IJ0 A;  1S0V A;  1DTO A;  4YJ3 B;  1KQS U;  4JAU A;  1AI6 A;  3W7U A;  4JV5 B;  3ZN1 A;  2UXC O;  3KCX A;  1QNM A;  4ZIB A;  2DQ0 A;  4MTO A;  4NB5 A;  2OIE A;  2EJ7 A;  1GN3 A;  5EYP B;  1WPB A;  2UUB O;  2FB5 A;  4W4L A;  2MW2 B;  2YIB D;  1KU9 A;  4F4L A;  1GN2 A;  4IIJ A;  1BT8 A;  3D36 A;  3ZS8 C;  2GBO A;  3L73 H;  4F6R A;  1F7Y A;  1DK1 A;  3AG3 C;  3OR6 C;  3DSQ A;  1PL0 A;  3CC2 V;  2Q6A A;  2WLN A;  1PV0 A;  1Q6I A;  4UCR A;  1H2L A;  1ZSP A;  3T4D A;  1P7B A;  4Z2W A;  2E74 B;  3ZHS A;  3EVK A;  3MDS A;  4MVM A;  5D5Q A;  4PHZ A;  4UB6 Z;  4JI3 B;  1BHA A;  5JJN B;  3OAA G;  4WFA V;  1SQV H;  1IBK O;  4O2B B;  3H9V A;  2N05 A;  4FMT A;  4DV1 B;  3P30 A;  3E8F A;  1K4C C;  5KLV H;  2IJI A;  1MSW D;  2LJ2 A;  3PJS K;  1R6K A;  1VF7 A;  3JAK B;  4B08 A;  1RSO A;  3ZBH A;  4JI4 O;  1VQM V;  2OCC C;  4AIL C;  4NVP A;  3M8A A;  2X6C A;  4FLX A;  3T1H O;  1GM7 A;  5BMV A;  3BY6 A;  3JAL B;  2OT5 A;  4XBF A;  4BIZ A;  4K3A A;  4H44 B;  4NTW A;  1H8E G;  2K1E A;  1FKA O;  3AG2 B;  3WB1 A;  5H6Q A;  5EBM C;  2Y4U A;  4O4J A;  4FLU A;  3E8G A;  4X88 A;  3CPW U;  1S72 V;  3BAB A;  1WA8 B;  3NR7 A;  1HP8 A;  4X1I A;  1SQB H;  4DK0 A;  1JVM A;  4LH7 A;  1M56 B;  3ZCC A;  3F5T A;  4JV5 O;  1AJN A;  1QR9 A;  5BXZ A;  1MNG A;  3K0G A;  4GKK B;  2EIN B;  3B40 A;  2BSK A;  2JDI G;  3ZMV A;  3QO8 A;  2DWD C;  1SC5 B;  2YIC A;  2LP7 A;  1KB9 F;  3RYC B;  3K5N A;  1VMG A;  5ITZ A;  5B66 Z;  4LFB O;  3LNN A;  1EZV H;  2UUC O;  1TUE B;  5GON A;  5IE9 A;  4FLY A;  4FLZ A;  1VAR A;  3JAS A;  1N34 B;  1GH6 A;  5H9C A;  2NN4 A;  1MG1 A;  5BR8 O;  1ZL8 B;  2VWJ A;  3CCJ V;  4QE9 A;  1P84 F;  2DQ3 A;  3SYA A;  1JJ2 U;  1Q82 W;  2V1D A;  1IDS A;  1E79 G;  2CUG A;  1FJG B;  1GN4 A;  2AW9 A;  3ABL B;  1PD3 A;  4B7E A;  1GAX A;  2F93 B;  4ICG A;  3EXA A;  4DV6 O;  3K5L A;  4JI7 B;  4J9Z B;  5K1P A;  3B8N A;  3F7Y C;  1RM1 B;  1XQ8 A;  4FFB A;  3K5O A;  2JS5 A;  4RAI A;  1Y76 B;  1BL8 A;  3OW2 U;  2QWR B;  3JD2 A;  3CB2 A;  4JI2 B;  1GN6 A;  3GVM A;  4ABM A;  1V54 C;  5J2U A;  2UXB B;  3CCL V;  4NYK A;  5IYZ A;  4UXN A;  2FTK A;  1MOF A;  3TXQ A;  2BOC C;  5B5E Z;  3QO5 A;  3OGI B;  4QGP A;  3L75 H;  2Q7H A;  4QJF B;  5B1O A;  3RFR A;  2HEP A;  4JI5 B;  2ZDI C;  3E8H A;  3TCU A;  3DTU B;  2WLL B;  1BZK A;  4DV4 O;  2P7T C;  4JI8 O;  1A32 A;  1CEZ A;  3T1Y O;  4HAM A;  1KC8 W;  1M4U A;  1SES A;  1LUW A;  4FZ1 A;  2BTQ A;  2WWW A;  1S77 D;  4DYL A;  1H2N A;  4MVR A;  3P3N A;  4EFB A;  3KCY A;  1RPR A;  4P9P A;  4DV0 B;  1I08 A;  1VIB A;  5EZY A;  2ZQM A;  3RYI B;  3ZX6 A;  2XHB A;  1IXB A;  1YZB A;  2EIJ B;  2RN9 A;  3L72 H;  4JTD B;  3CX5 F;  1BCC H;  3D3Q A;  4ZHQ A;  2ZIN A;  3HR0 A;  2E5L O;  5CN0 A;  3JD1 A;  2FKX A;  1V55 B;  4JAS A;  4MS2 A;  3R66 A;  3CME V;  2XT9 A;  3ZRW B;  3LDD A;  1LUV A;  4LFA O;  3SYO A;  3JSL A;  2BOB C;  3OMA B;  4RUF A;  2QWN B;  4LBE C;  5J9P C;  1N4C A;  5KA5 A;  3WB0 A;  4TQF A;  4DR2 O;  1FXH A;  1BMF G;  1T5E A;  1N34 O;  3IFX A;  3CJH A;  4RO2 A;  3JAT B;  1P49 A;  1R3I C;  4DR4 B;  4DW0 A;  3S3W A;  2EZO A;  1VP7 A;  1AIL A;  1EN4 A;  1MSD A;  1JQ0 A;  5JCO A;  2DYS B;  1FJG O;  3LSS A;  1NZ6 A;  4X20 A;  4R7C A;  4JI7 O;  5JJE B;  3LDE A;  1IBL B;  4R8C A;  1N36 O;  4OGQ B;  2KG7 B;  1COW G;  2KSD A;  1YI2 V;  1GO3 F;  1H8H G;  1VQN V;  3T1C A;  2UUA O;  1GRJ A;  4JZ2 A;  5GTI Z; 
#chains in the Genus database with same CATH homology
 5IYB O;  3AG4 B;  3A0R A;  2ZR3 A;  4JF3 A;  1EFR G;  3JD0 A;  4UVA A;  3RVZ A;  2YEV B;  3RW0 A;  3G71 V;  1NH2 B;  4PDV A;  3IC7 A;  4TWK A;  4WFE A;  1YSC A;  1VQ8 V;  4N23 A;  1QLN A;  3R65 A;  1GKF A;  4I5S A;  3AG2 C;  5KA6 A;  1FXK C;  5H6R A;  2UXX A;  5B3S C;  2QEX V;  4LC1 A;  3FYE B;  4WCE V;  5CMU A;  1R3L C;  1ROP A;  1THZ A;  1KP2 A;  2AHZ A;  3E89 A;  5B1B C;  2ZXW C;  5IYC O;  2EIM C;  2EIL C;  3G4S V;  3SPG A;  2IU3 A;  4U7O A;  3JD3 A;  5B1A B;  1M56 C;  5L3C A;  2WSS G;  3ABM B;  3ZIA G;  2ITC C;  1SET A;  2IH1 C;  1F4N A;  2XAQ A;  1JCH A;  3FB8 C;  1QBZ A;  4Z1M G;  3LDC A;  2EIN C;  4MVZ A;  2DYR C;  3SPJ A;  5CBH A;  3IGA C;  4UVB A;  4X8A A;  3SYC A;  2W6I G;  2Q69 A;  3ABK C;  2QM7 A;  2WLH A;  2IJJ A;  4BAY A;  2WPD G;  2QTO A;  1E1R G;  5LBQ A;  1AJP A;  3G6E V;  1K92 A;  2A0L A;  1OCR B;  3W7T A;  3GWO A;  2R9I A;  3MHS C;  1MAB G;  3CCR V;  3ZRS A;  2X0L A;  2HJF C;  4UVC A;  1VQP V;  4UV8 A;  1OHH G;  3K0D A;  4GX0 A;  4P2Z A;  3E83 A;  3WG7 B;  3X2Q B;  1DF5 A;  4EKW A;  1SZT A;  2WLM A;  1W0K G;  3QNE A;  3RBZ A;  1R3K C;  2EBO A;  3K9A A;  4MTX A;  2D3O W;  1YHQ V;  1FXK B;  1FFT B;  1KD1 W;  1YJ9 V;  5LGN A;  1V54 B;  3LNM B;  1H2G A;  4OXS A;  4PA3 A;  3STL C;  3ZRX A;  2B1I A;  2ZDI A;  2NNU A;  4TT3 G;  4KFM A;  4PA4 A;  3CC7 V;  1M57 B;  3QO7 A;  2JEU A;  4GX1 A;  2EIK C;  2QKS A;  5EBL C;  1YTF B;  1ORQ C;  4DO2 A;  4RQE A;  3K03 A;  2XAJ A;  4BIU A;  5IDJ A;  1OCC C;  3DGE A;  2JK5 C;  3ABL C;  3K04 A;  3I55 V;  3STZ C;  3ASN B;  4TSF G;  1S5H C;  4QIW F;  1XL4 A;  2Q68 A;  2B5U A;  3ABU A;  1RM1 C;  5L3D A;  3ML0 A;  1S0V A;  4MVU A;  1GM9 A;  1LNQ A;  1DTO A;  1KQS U;  1OCO B;  4JAU A;  1AI6 A;  3W7U A;  1DLB A;  1PNK A;  3ZN1 A;  3FB7 C;  2DQ0 A;  4MTO A;  1JX9 A;  1SER A;  4GT1 A;  3RVY A;  1K34 A;  1KKD A;  2XAS A;  1KP3 A;  1ARO P;  3CP1 A;  4KUM A;  3SYP A;  5LHH A;  1NJI W;  3WFV A;  1HWY A;  3ZMU A;  1VQ5 V;  3B8M A;  4JYB A;  2X6B A;  4RQF A;  1S3J A;  1VQ7 V;  1NVP B;  3T4Z A;  1QLE C;  5L3F A;  1AI5 A;  1VQ4 V;  3AG1 C;  1L1F A;  3K06 A;  4F4L A;  2IU0 A;  3CC4 V;  4GX5 A;  1NH2 D;  3D36 A;  1OCZ B;  2JIZ G;  3CMA V;  5L3B A;  2IH3 C;  5IYD O;  1F23 A;  4P30 A;  2M7W A;  2HFE C;  3JCZ A;  2WLJ A;  1K9M W;  2C2A A;  3AG3 C;  3OR6 C;  3ZMT A;  1NBM G;  3T2M A;  3OR7 C;  3CCV V;  1PL0 A;  3CCE V;  3CC2 V;  2Q6A A;  2WLN A;  2Y48 A;  1PKX A;  3F7V C;  5HFL A;  2EIJ C;  3T4D A;  1P7B A;  1BHB A;  4JYC A;  1CP9 A;  1Q86 W;  2HVK C;  3OM3 B;  4G2K A;  3D3I A;  2WLI A;  2XAG A;  3LSQ A;  4MVM A;  1PNM A;  4QPJ A;  4MVQ A;  2KB1 A;  3VBB A;  4JAV A;  3OUS A;  2IJK A;  4L87 A;  1BHA A;  1V55 C;  3OEE G;  1EZJ A;  3OAA G;  4WFH A;  2QA4 V;  4WFA V;  5EC2 C;  4RUE A;  1S76 D;  2W0F C;  4XDJ A;  1K5Q A;  4FMT A;  2ATK C;  3P30 A;  3E8F A;  3LUT B;  2WLI B;  2XAH A;  3ASO C;  2JJ1 G;  1K4C C;  2IJI A;  3M99 B;  1MSW D;  3PJS K;  1K7D A;  4G28 B;  1GM8 A;  5C93 A;  4JTA B;  5FL7 G;  1R6K A;  4YXW G;  1PNL A;  2WLK A;  1VQM V;  2OCC C;  3E8B A;  1FXK A;  2WAM A;  2LFS A;  3AG1 B;  2X6C A;  1GM7 A;  4QPK A;  2HG5 C;  4LP8 A;  1R73 A;  3BY6 A;  5L3G A;  2OT5 A;  4XBF A;  4BIZ A;  2Y69 C;  2A9H A;  3SPH A;  3ETD A;  5EC1 C;  1K33 A;  1H8E G;  2K1E A;  1Y4M A;  3NXS A;  1K5S A;  3AG2 B;  3GB7 C;  2P6J A;  1F4M A;  5H6Q A;  5B3S B;  5EBM C;  2OTJ V;  2DYS C;  2B1G A;  1E1Q G;  1NKD A;  4FJC C;  5B1B B;  2ZXW B;  3E8G A;  3BEH A;  2EIM B;  2EIL B;  4X88 A;  3CPW U;  1S72 V;  1JVM A;  1NR7 A;  1F51 A;  1M56 B;  2P90 A;  4PA9 A;  2EJR A;  3ZCC A;  2X6A A;  1AJN A;  1K97 A;  1QR9 A;  1G8M A;  3E86 A;  2QE7 G;  3AG4 C;  3K0G A;  4CBC A;  2EIN B;  2DYR B;  2JDI G;  4MW3 A;  3CXC U;  3ZMV A;  3QO8 A;  4WFG A;  2DWD C;  1Q7Y W;  2V7Q G;  3ABK B;  5HFM A;  2LP7 A;  3ZJZ A;  1VQK V;  2XOK G;  3CD6 V;  1K3E A;  1JPX A;  3ZRV A;  3OMN B;  1WPX A;  4FIP C;  4MW8 A;  1AJQ A;  3ZMS A;  4H37 A;  3EFF K;  3AEI A;  1TUE B;  1I5X A;  2R9R B;  3P32 A;  4PA6 A;  2HLD G;  4BW5 A;  3E35 A;  3H01 A;  5EBW C;  2PI5 A;  3ETG A;  4FPP A;  5B1A C;  4E2L A;  1GK9 A;  1FXV A;  3JYC A;  3ABM C;  5H9C A;  1NVP D;  3SPC A;  1MG1 A;  2Y69 B;  4MT8 A;  3CCJ V;  4JGS A;  4QE9 A;  3FYI B;  4MVS A;  1AI4 A;  1QCE A;  2F43 G;  2ITD C;  5DM6 V;  2H8P C;  4DXW A;  4QNH B;  2DQ3 A;  1YJW V;  3W7X A;  3SYA A;  1JJ2 U;  1QR8 A;  1WLE A;  1Q82 W;  2V1D A;  4QE7 A;  3UKM A;  1E79 G;  2AHY A;  2IJH A;  2EIK B;  4R50 A;  2GSM B;  4X89 A;  4WF9 V;  3FB5 C;  4MSW C;  3W7W A;  1OCR C;  1W0J G;  1R6N A;  1OCC B;  3ABL B;  3OFN G;  1PD3 A;  4ZBM A;  3F5W C;  5BZB A;  3VOU A;  1M1K W;  4J9Z B;  3B8N A;  4PA7 A;  3WG7 C;  3X2Q C;  3F7Y C;  4ZKI A;  1RM1 B;  4WFF A;  3ABT A;  3ZN0 A;  3OGC C;  4KP4 A;  4MTF A;  1G4Y B;  4RAI A;  1BL8 A;  3OW2 U;  3JD2 A;  1EBO A;  5LGU A;  2H94 A;  3FB6 C;  2ZD9 A;  5LHG A;  3ETE A;  3OE7 G;  2EZP A;  3HB3 B;  4GCZ A;  1V54 C;  4J9Y B;  5CA3 A;  2HVJ C;  1NQT A;  2WLL A;  2JJ2 G;  4XDK A;  4XDL A;  4PEL A;  3CCL V;  1M57 C;  4UXN A;  2FTK A;  1N8R W;  1GTO A;  5L3E A;  1MOF A;  1ZWI C;  2BOC C;  3OMI B;  3QO5 A;  5LHI A;  4MVO A;  3HPL C;  4ASU G;  1QVF U;  4QJF B;  4P9O A;  3OUF A;  5B1O A;  1K73 W;  3ASN C;  5CBG A;  1I5Y A;  2ZDI C;  3E8H A;  5GW7 A;  3DTU B;  3TCU A;  5CBF A;  2WLL B;  2HKO A;  1YIT V;  2P7T C;  5KUM A;  2XAF A;  4UV9 A;  2LFR A;  1QLE B;  5KUK A;  2QM8 A;  1CEZ A;  4CZZ A;  1KC8 W;  4HAM A;  1SES A;  5LGT A;  1VQL V;  3ZMZ A;  1OCO C;  2Z5U A;  1IXM A;  3CCS V;  2WWW A;  2ZR2 A;  1Y66 A;  1S77 D;  1Q81 W;  4MVR A;  3SJQ C;  4HZ3 A;  3TK1 A;  1K4D C;  4UUJ C;  2YSU B;  4R6Z A;  4JPR A;  1RPR A;  1B6Q A;  4P9P A;  3AG3 B;  1UJW B;  3I56 V;  1GMG A;  2ZQM A;  2HR3 A;  1VQ9 V;  1YTF D;  5B1N A;  2CK3 G;  3ZRW A;  1FS0 G;  2EIJ B;  2MK3 A;  4GX2 A;  2NLJ C;  4PDR A;  4JTC B;  4Q20 A;  5E1A C;  4JTD B;  2W6J G;  5IY5 C;  3B77 A;  5CN0 A;  3JD1 A;  2PI4 A;  1V55 B;  2JEX A;  2P67 A;  1NR1 A;  1QVG U;  4JAS A;  4MS2 A;  4LCU C;  3CME V;  1R3J C;  1OCZ C;  4G27 B;  3ZRW B;  1XL6 A;  1AI7 A;  3LDD A;  3TET A;  3SYO A;  2BOB C;  3W7S A;  3OMA B;  4RUF A;  1VQ6 V;  4LBE C;  5J9P C;  1M90 W;  3ASO B;  3SPI A;  5KA5 A;  3CCM V;  3JD4 A;  1YJN V;  1DF4 A;  3K08 A;  1VQO V;  1FXH A;  1BMF G;  1RPO A;  3IFX A;  1K8A W;  3FKS G;  3KG2 A;  4MTG A;  1SRY A;  2OCC B;  3UM7 A;  4RO2 A;  1H38 A;  4U7N A;  4HYO A;  2A79 B;  2DWE C;  1R3I C;  2DW4 A;  3SYQ A;  2IW5 A;  2EZO A;  3OEH G;  1J95 A;  1JQ0 A;  2Z3Y A;  1P4R A;  1AR1 B;  1CPY A;  1ENV A;  3CYO A;  2DYS B;  3LSS A;  2GHY A;  5DN6 G;  1M9N A;  4I9W A;  1OZ0 A;  4R7C A;  1W2B U;  3EHB B;  2OTL V;  4WFB V;  4H33 A;  1KEC A;  2Q67 A;  2YEV A;  3LDE A;  4PDL A;  3K79 A;  3CCU V;  1YIJ V;  4R8C A;  3MHH C;  4PDM A;  3E2E A;  1JOY A;  1COW G;  3MD0 A;  1YI2 V;  1GO3 F;  2XND G;  4FK5 C;  4N21 A;  3CCQ V;  1H8H G;  5EK0 A;  3T1C A;  1VQN V;  2UXN A;  3K3W A;  5IY5 B;  2X7R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...