4PDRA

Crystal structure of a k+ selective nak mutant in barium and sodium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
molecule keywords Potassium channel protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdrA00
5BZBA 2X6AA 2ZXWC 4R8CA 2BOCC 4R50A 4RAIA 2ITCC 2OCCC 1XL4A 4QE9A 4LBEC 5CBFA 5B1AC 4F4LA 3TCUA 3HPLC 2A0LA 4GX2A 4XDKA 2EIKC 3ABMC 2WLKA 4G28B 2K1EA 4LP8A 2YEVA 2HG5C 2R9RB 3ZRSA 2QTOA 2P7TC 4MW8A 4R6ZA 4MVQA 3SPHA 1OCOC 1ZWIC 2AHYA 3E8GA 3RBZA 3SYQA 4X8AA 1ORQC 3E83A 3TETA 2A79B 2DWEC 4GX5A 5CBHA 3SPIA 1K4DC 5J9PC 3E8BA 3SYPA 5CBGA 4RUEA 4MVRA 2EILC 3LDEA 2W0FC 5KUMA 1OCZC 2WLHA 4WFHA 4TWKA 4MS2A 3SPGA 3E89A 3LDCA 3R65A 2EIMC 3E86A 4JTCB 4MVMA 4QE7A 3FB7C 1K4CC 1R3IC 3ASOC 4GX1A 3T4ZA 4MVOA 5IY5C 4J9ZB 2A9HA 4GX0A 5EBWC 2EINC 3ABLC 3FB8C 4R7CA 4DXWA 1V55C 4BW5A 4H37A 2DYRC 3SYAA 3JYCA 1P7BA 4P2ZA 2X6BA 3PJSK 4MVSA 5EBMC 3SYOA 4RO2A 3K0GA 3SYCA 4I9WA 2NLJC 1OCCC 1M57C 2WLIA 4WFFA 1S5HC 3STZC 2ZD9A 4RUFA 4QNHB 4MTOA 2WLNA 1XL6A 4PDVA 1R3JC 2HFEC 3F5WC 4P9PA 2WLLB 3OUSA 3VOUA 2QKSA 3LNMB 3RW0A 5E1AC 3T2MA 3UM7A 2WLIB 4PA4A 2JK5C 3K03A 1OCRC 2WLMA 4HZ3A 2BOBC 4WFEA 1R3LC 2Q68A 3AG1C 3UKMA 3T1CA 4MTFA 1QLEC 1R3KC 4MSWC 3OR7C 2WLLA 3ZJZA 4ZBMA 5EC1C 4CBCA 2ATKC 3ASNC 4MVUA 2ITDC 2WLJA 2DYSC 3FB5C 4JTAB 5EBLC 4PDLA 3RVYA 4MW3A 3RVZA 2IH1C 2X6CA 3K04A 2HJFC 4UUJC 4PA6A 2EIJC 4XDLA 4PDMA 3SPCA 3FB6C 3IFXA 2Q6AA 3GB7C 5KUKA 5B1BC 3SJQC 1G4YB 4PA7A 4J9YB 3K06A 3ABKC 2IH3C 4PA9A 3E8HA 4X89A 5EC2C 1BL8A 4X88A 1JVMA 3T4DA 2Y69C 3LDDA 4G27B 2KB1A 4P30A 2H8PC 3E8FA 3K0DA 3OGCC 4JTDB 2Q67A 4LCUC 4XDJA 2HVKC 4KFMA 4OXSA 3OR6C 1J95A 1LNQA 3IGAC 3AG4C 3AG3C 4P9OA 1V54C 3OUFA 1KKDA 3F7VC 4WFGA 5EK0A 2DWDC 3K08A 3SPJA 3WG7C 1M56C 3STLC 4EKWA 4PA3A 4PDRA 3BEHA 3F7YC 4HYOA 4MVZA 3X2QC 3KG2A 2HVJC 3EFFK 2Q69A 4MTGA 4H33A 2AHZA 5B3SC 3LUTB 3AG2C
chains in the Genus database with same CATH superfamily
2ZCEA 4LBEC 5LA6B 1N34B 5LGTA 4DW0A 4LP8A 5CMUA 5L3CA 5LGNA 3CJHA 3EHBB 4DR5B 2Q8VA 4DR7O 1Q7YW 2RNBA 3CMAV 3W7SA 2R72A 1WPBA 2RMKB 1IXBA 4X65O 1QR8A 1BGYH 4UCSA 4GX0A 2EINC 3FB8C 3E35A 2E5LB 1SQGA 2YI9A 2P4VA 4JI8B 5B3SB 3B4SA 3B8NA 5A2QN 3STZC 2WPDG 3ETDA 2ZQMA 1SC5B 4X66B 1YZBA 3ETGA 4CH4A 2WLLB 1Y76B 3DGEA 2F93B 2Y0PA 4DK0A 3ZMUA 5H2FZ 2JK5C 3WB2A 3UKMA 3OTOO 4GYCB 2LJ2A 3OR7C 1R6KA 4HNAB 2EIMB 4YY3O 4B08A 3CJHB 5EZYB 5A9GA 2C2AA 4H44B 5BR8O 1CEZA 5JJJB 1BL8A 4JI4B 1H8HG 1WPXA 3H9VA 4IIJA 4G27B 4BR6A 4H13B 5C93A 2RN9A 4O4LA 3CRMA 1IBMO 3L73H 1N0NA 1XMQO 1YEWA 4DV4B 4DUZB 2B9ZA 3K5LA 2UXCB 3KKYA 1F23A 2Q69A 4FLWA 3AG3B 4LF9B 2RJZA 4I7ZB 1EN6A 2Q5ZA 4FFBB 4GKKB 1YVWA 2YXLA 4QJFB 5AG2A 4BIZA 3TK1A 1OCOC 3ZHRA 2DYSB 1H2GA 2CGNA 3FD9A 1M57B 3JD4A 1XHZA 1VMGA 3SGIA 3K59A 4J10A 1H2KA 4DR6O 2W6IG 3J80N 3E89A 4UV9A 3ASOC 1KQSU 4PV1B 4JV5O 5IY5C 5LP6B 3ABLC 1GN3A 3OMNB 3G80A 5KA5A 4LF5B 1EN4A 1XMOB 2X6BA 1XILA 4RO2A 2KG7A 3ZX6A 1QLEB 3RYFB 1H38A 2L35A 2QKSA 2OT5A 4ZI7B 2F1MA 1OCRC 1T5EA 4JPRA 2PUSA 4O2AA 1SF9A 1FFXA 1HNXO 1Q43A 1U97A 3SPCA 3IFXA 5KHKA 2N04A 5KUKA 5LXTA 5F2VO 4X62B 3IC7A 2UUBO 4FFKA 2WA4A 1LR1A 1P7GA 2EX3A 1OV9A 3ETQA 4I4TB 1DGSA 3H1IH 3KZIZ 2XAQA 5K1PA 3HKBA 1VF6C 1Y4MA 3J81N 1VQ8V 2ZR3A 1IX9A 1IDSA 4Z1MG 4GZRB 1HDJA 4YHHO 5ITZB 4NYKA 4X1YA 2F66C 5LP6A 1RFYA 3AG3C 1ZX3A 2Y4TA 1PPJH 1EFRG 4WFGA 4DV3O 1NR1A 3SPJA 2ZDIC 2ARHA 3CCSV 2KG7B 5DN6G 4B3MB 1WA8B 5CBFA 4DUYO 2ZXWC 4G2KA 1L1FA 4R50A 5GTHZ 2QGNA 1S76D 4A5UB 4ZI7A 4DV0B 1I08A 4O4HB 3ZMTA 1KBHA 2A3QA 2BTQA 3C3SA 4OX9B 4UCRA 4MW8A 2UUCB 2V1DA 1ZWIC 1XNQB 1VQMV 3E8GA 2LQTA 4N21A 1SKVA 5CBGA 2PTMA 3OGIB 1FD9A 1QHTA 4WFHA 4UB6Z 3LDCA 4DV7O 2EIMC 1K4CC 3K9SA 1N36O 3UO3A 1GKFA 5FLXN 5FNVB 4LNUB 2QKCA 4DV1O 1HNZB 1FPOA 1D5NA 1P7BA 3P30A 2OWOA 1Z5WA 2E76B 3ML0A 5IJ9A 1AJNA 3O65A 2EULA 1VQ4V 2UUAO 1PNMA 2Q7GA 3BCCH 5KHHA 3RYCB 1WA8A 1AI4A 5DEDA 4JYAO 1ZSPA 4ASUG 4DR5O 2XNDG 1BQZA 2QM8A 4CC6A 4DR7B 2WLJA 3RVYA 4NKGB 3K04A 4NTXA 3PN1A 5EIBC 3RWRD 4YJ3A 4J9YB 4X65B 3CC4V 1GN6A 1J5EO 3FFQA 2LFSA 4PHZA 1YIJV 1MABG 1NH2D 1IXMA 3T1YB 3JASA 4NXMB 1WLEA 2YXYA 3AG4C 5FNVA 1N33B 4D7TA 1JR9A 4TUYB 1AI7A 3D36A 3RYHA 4F6RB 5LOVA 1SETA 4YIOA 4D7SA 4FMTA 5FL7G 3G6EV 3QO5A 3X2QC 1KKCA 3BVOA 3H1HH 2EJ7A 4JYBA 2JDIG 1SESA 3RYCA 3B2EE 4QE9A 1BQ0A 5B1AC 1IZ3A 2QWQB 2GDSA 3A0BZ 2AW9A 4UCTA 1F4NA 2HLDG 3ZRSA 4R6ZA 4LF7O 3SR2C 2BCCH 4LFCO 2CAZC 4FJCC 4NR1A 3CD6V 3JATA 1IURA 2DJVA 2OCHA 5TISZ 3K9AA 3CC7V 3CCVV 1VARA 2P6JA 4I50B 3S3WA 1XMQB 1SQFA 4IYHA 1Q6IA 2DMXA 4JGSA 3MHSC 5JH7A 3E22A 3NR7A 1V55C 4H37A 1WP7A 5L3BA 1BSMA 1OHHG 1K33A 1ENVA 2ODMA 2NNUA 4TUYA 5D5QA 3JALA 3SDLA 2V4DA 5LOVB 1FJGB 1AB3A 4KHPO 3BABA 4HAMA 3BFRA 4O4IA 3ZCCA 4B3TO 4LC1A 2MW2B 1QLEC 2WLLA 4W4LA 1AI6A 2ATKC 3B40A 1R6NA 5JVDA 2IM9A 2Y69B 1N32B 1WAZA 3HKEA 3N2KA 3QVNA 2OTJV 1UPGA 3K06A 4JV5B 4UVAA 5CA3A 1JVMA 4WCEV 1I94B 4JI3B 1K97A 1VQ5V 2FYUH 3HKDB 5IJ0A 2PYLA 1GH6A 1YJNV 3ZRWA 2R9IA 5B1OA 1IBKB 2QA4V 1VF6A 2W6JG 1VQKV 1A32A 1XREA 1ZL8B 4B3SB 1RPOA 3STLC 2DYRB 1EZJA 3F7YC 1VQ7V 4YIPA 2Y0IA 4JASA 2Q4PA 1VQ6V 4I55A 4TT3G 4XDKA 2UUBB 5LHHA 5BXZA 1AI5A 5H9CA 1GM9A 5J2UB 1ORQC 3JD3A 5L3FA 1TGOA 3ZBHA 2BSKB 5IE9A 2JVDA 5C8YA 4IYIA 4MVMA 3E86A 1L0LH 2HEPA 2LGQA 4DRXA 3UQ8A 4CZZA 2JEXA 3SYOA 3OD4A 1H2LA 4DV5B 4DR3O 1P49A 4K35A 2ZD9A 4FLVA 4ZHQA 3MDSA 3RW0A 5E1AC 4CH3A 2LFRA 2CE4A 2ZM6O 2GV9A 1K9MW 5JCOA 4CBCA 3VQVA 1TUBA 5EBLC 2G38A 5B1AB 3CHXA 3RVZA 4DV6O 4UUJC 4ZIBA 5B1NA 2JS3A 1G4YB 2NN4A 4LF8B 4BW9A 5J2UA 3ABKC 3E8HA 1N36B 2LGWA 3WU2Z 1VEWA 3RN4A 3BHPA 3ZHTA 1SZXA 4KL1A 4W4KA 1BS3A 4I4TA 4AQYB 1LUVA 3HKBB 2YS8A 2UUAB 4YJ2B 1R1BA 4P9OA 3OMIB 5EK0A 2RCVA 4RQEA 1L0NH 1N34O 3DC5A 4FLUA 1YJWV 1PM9A 2GHYA 1NKDA 3J7AU 5B3SC 3W7TA 4RAIA 1M1KW 2ILMA 1IBLO 4U7OA 3RYIA 2A0LA 2WLKA 1EM1A 4IHJB 3JAWA 2P67A 3FYIB 1EBOA 1TUBB 1Q6HA 5KAFZ 3SYQA 3QG5A 3TETA 2VWKA 5LMNB 3AG1B 1MNGA 1MZFA 1VF5B 4NXMO 5KUMA 2HP8A 1KP2A 1N33O 4MS2A 1N8RW 2P06A 1NI8A 5LHIA 4J7KA 2CTPA 3CC2V 4R7CA 5HFLA 1SQXH 3JARA 4JYYA 1M93A 3ABUA 3OTOB 1SA0A 1XEQA 2XAFA 4CH6A 3EVKA 3CXCU 1MOFA 2HHHO 4YY3B 4O4JB 4I0XB 1KYOF 1Y66A 3LNMB 1VQOV 5KA6A 4LF7B 2WLMA 3AG1C 1D2DA 1NTZH 2CH7A 3A0HZ 3LSQA 1GAXA 3G67A 4L87A 5LA6A 3NXSA 4DR1O 3BA8A 2F43G 2KKWA 4DUZO 3K3WA 2UXCO 2D3OW 5KHGA 4TQFA 2EZPA 5IWAB 4LF9O 3JSLA 1U96A 1FJGO 4JZ2A 2VQFB 1RSOB 1H2NA 3F7VC 2BTOA 3L72H 3QO7A 3WG7C 4GKKO 2Z3YA 2VRZA 5KHIA 1W59A 5DM6V 2FB5A 1N32O 4JI6O 1Q6UA 2YC0A 4FLXA 4G28B 4FVMA 2A06H 4JI7O 2HG5C 2P7TC 4JI0O 1GN2A 3JAMN 1TVKA 5K1XA 1I94O 2WAMA 3SPIA 4H0LB 3E8BA 1PKXA 3CCRV 1OCZC 4HNAA 4BIUA 3K5MA 1IBKO 2E74B 3T4ZA 3MD0A 3SJAC 4GX1A 1QLNA 4DO2A 4B3SO 1ZTEA 2VQEB 4FM1A 1VP7A 1OCOB 3APOA 5KX5A 4J7ZA 4MVSA 1G1XB 3H1LH 3T1HO 2W0XA 2ZNJA 1XI1A 2CGOA 3E22B 1HNXB 3TJTA 2ZIMA 1S0VA 2QWPB 4DW1A 4K3AA 4J11A 4O4LB 3A2FA 3ZMSA 3LSUA 4FK5C 5JCOC 4KUMA 4IGGA 1H2MA 1VQLV 1Q81W 4UVBA 4CS4A 2XAGA 4TSFG 2EZOA 1F4MA 4JI2O 4YHHB 4FFBA 3ZHUA 3L71H 5FPRA 1XOUA 4FLZA 2HJDA 1XBLA 1N0JA 1URFA 4P30A 3OGCC 3M7MX 3CMEV 2YXHA 3THOA 1JCHA 4XDJA 3WG7B 5B66Z 4OXSA 2EBOA 4DUYB 1S5JA 3H1JH 1E79G 2ZE8A 1X59A 4DV0O 5FPOA 1M56C 3ZS8C 3BEHA 4MTGA 2RQ6A 2JJ1G 3KCXA 5CA0A 5LHGA 5GONB 1VQ9V 2X6AA 4FZ1A 4BWAA 4F4LA 3ABMC 2K1EA 4WBNB 1SS3A 1LUWA 1JPXA 1QBZA 2QTOA 2ETNA 2FTKA 4ABMA 3D8CA 2CTQA 2DWEC 3ZRVA 2FKXA 1K4DC 3G6BA 3KCYA 1NZ6A 4AQYO 3N27A 5IYDO 4JYCA 1V9PA 3LDEA 4X64O 1WNSA 4LF6O 1M5IA 1K5QA 1GMGA 3HR0A 1AJPA 2BSKA 2A9HA 5C8YB 1WB8A 1JFFA 1NT2B 2DYRC 4LWSA 4E4EA 1VQNV 3JYCA 2OCCB 4F6EA 4JYAB 5EZYA 1FXHA 5LBQA 3E2EA 2WLIA 1XL6A 2HKOA 2XOKG 4PI0A 3F5WC 5ITZA 3VOUA 3K03A 1R3LC 3C3TA 1Q8IA 3T1CA 4ZHQB 1J5EB 3JD2A 2FL4A 3UCSC 2Z0AA 4N23A 3JCUZ 5B5EZ 2ITDC 4PA6A 5JQGA 1UJWB 1YDXA 5IDJA 4EEQA 4B3RO 2KQXA 4JF3A 5EIBD 2K9PA 4FPPA 1MSDA 5BMVB 1ROPA 4GCZA 4LF4O 4KFMA 2Q73A 2XAHA 3P3PA 1NJIW 4OPAA 2HHHB 1CXZB 1V54C 1K8AW 1Q3EA 5L3GA 4UFZA 3ASNB 2HVJC 2P5OA 2A7WA 4LFCB 4R8CA 4WFBV 2GTAA 1XL4A 1SERA 3U10A 1OJHA 1P4RA 4JZGA 2YEVA 4DR1B 2GTSA 3ZHVA 1HR0O 3OEEG 2GUZA 4MVQA 1TA8A 5JQGB 2AHYA 3E83A 2A79B 4GX5A 4IHJA 1PD3A 2X7RB 3DXRB 1YXBA 3CB2A 3D36C 2VQFO 5IYCO 1I0HA 5KAIZ 3R65A 3WB1A 4JTCB 5BMVA 1S77D 1NH2B 2EILB 3U0ZA 4P2ZA 4B3TB 1DF4A 4TV8B 1S3JA 1QVGU 3W7WA 2PYJA 4LR3A 1S5HC 4JI6B 4PDVA 4FM2A 3JARB 2P4KA 4JI7B 4FIPC 3SJCC 4WF9V 4JI0B 1GO3F 2B1IA 4WFEA 1W0JG 4Q6GA 1B04A 1CP9A 1XNRO 4I0XA 5IYZA 2E3CA 4MVUA 1DTOA 1O9HA 3OFNG 2X6CA 2HJFC 1WN7A 4XDLA 1THZA 2DN9A 5B1BC 5L3EA 3CCJV 4DR2B 2IH3C 5EC2C 2ADPA 3LNNA 3JD1A 4NXNO 4NTYA 4JTDB 2N74A 3R66A 3ZMVA 4OGQB 4KP4A 3ASOB 1US6A 1JQ0A 3K08A 2AZ2A 2Q0AA 3G71V 4K0KB 4WFAV 3EFFK 3ETEA 3CCLV 2AHZA 3LUTB 5JH7B 1GRJA 1F51A 3APQA 2OCCC 3JAKA 1K34A 2DOSA 1RM1C 1Y74B 4GX2A 2ADQB 3EXAA 3I55V 3OEHG 1KUQA 5IYZB 2KSDA 2ZXWB 4MT8A 3QO8A 2M6YA 1NBMG 3FAVA 5CBHA 3ABMB 1S72V 4MTXA 5L3DA 4GUNA 1NU1H 3HB3B 1TUEB 2ZKOA 2F95B 4TWKA 1IVSA 4RQFA 4DV5O 1EZVH 5JVDB 2PY5A 2RDCA 2UXNA 1AR1B 1R6TA 3HKEB 5LGUA 3BA9A 2QJ1A 3LSSA 2Y48A 5H5NA 1COWG 5EYPA 1PV0A 4YJ3B 4ICGA 4E2LA 2NLJC 1OCCC 3AK1A 1AILA 5KX5B 4J41A 3QTCA 2YICA 3ZRWB 3A0RA 3GWKC 2EIJB 4X20B 2ZNIA 1SQPH 1V54B 4RWUA 2BOBC 3JASB 1R3KC 2XUMA 1FAFA 3M99B 1FFTB 3N2GA 1SRYA 2DYSC 3FB5C 1WB7A 3U11A 4BAYA 1BT8A 3RYHB 4X64B 3GB7C 1H8EG 1Q5OA 3RT3C 2ZT9B 3SJQC 2IJKA 1HW7A 3MHHC 4I55B 1BE3H 1K73W 2CUGA 1XUQA 3E8FA 2CDYA 3L74H 1NVPB 2ZDIA 1YSCA 2DE0X 4TV9B 2Q7HA 3IGAC 2LO1A 1KKDA 2YSUB 1EN5A 2DWDC 3TXSA 1IBLB 3JATB 1R73A 1QNMA 2BE3A 2QDOA 1G8MA 3O9OA 4DRXB 2GBOA 1YJ9V 1JJOA 5KMGA 3HPLC 4X9QA 5CA0B 5LMNO 2ZE6A 1M90W 4TOIA 5LL6Y 1AJQA 1D5AA 3JALB 2IU3A 2WA3A 2E75B 3RBZA 3C90A 2ZIOA 2B1GA 2Y4UA 3OAAG 5J9PC 3CRQA 2PI4A 1XDCA 5LYJA 1PL4A 4IT5A 4J9ZB 3CCEV 4FM0A 1AR5A 4BW5A 3SYAA 1NR7A 4Z2WA 4DR4O 1SQVH 3BAAA 5KHJA 2V7QG 1F7YA 3OUSA 3HKDA 3T2MA 5H6RA 1WJZA 2WLIB 4LFBB 5IT9N 2IJIA 3GVMA 4LFAO 1XQ8A 4MTFA 2QWOB 4ZBMA 5EC1C 3ICXA 3L75H 4JTAB 4K8XA 2IH1C 2JS5A 4I5SA 1ZL8A 1HNWB 4PDMA 1YCIA 2EIKB 4FZ0A 3JSNA 5IWAO 4DYLA 2QEXV 4PA9A 4NVPA 3ZN0A 2UXBO 2JRIA 4X88A 3RYFA 3B8MA 4O2BB 1MA1A 2KB1A 2H8PC 2AGAA 3CE2A 3CRRA 3CCUV 2NR5A 4O2AB 2PGGA 4DV2B 3ZRXA 5BY1A 1FKAO 4EKWA 4JI5B 4HYOA 2DQ3A 1W0KG 4JI1B 4Q20A 5DECA 2YDEA 2OYQA 3D3QA 1GM8A 3AG2C 1B6QA 1FS0G 1H2SB 3VQXA 3TCUA 4UV8A 1JX9A 2YIAA 4DR2O 4GKJB 1MG1A 1OCRB 5CN0A 2O57A 2R9RB 1DK1A 5JJEB 2EJRA 3SPHA 3K5NA 3OE7G 4XBFA 3K58A 4J42A 2VQEO 1I5YA 3SYPA 3K57A 4IL6Z 1Z2GA 3M8AA 3T1HB 2JIZG 3SPGA 3VQYA 4CC5A 3I5DA 1R3IC 4UXNA 1QVFU 4MVOA 1ZLZA 4K0KO 4DXWA 3ZEDA 3L9DA 1KB9F 3PJSK 5EBMC 4PI2A 1AP5A 4PJ0Z 1OZ0A 1P84F 4AILC 2OIGA 4I9WA 1M57C 1FXKB 4TQDA 1G6UA 1R3JC 4UCOA 2E5LO 1PNKA 3WFVA 4JI2B 1OCCB 2XT9A 3IJ4A 4JI8O 4YJ2A 1QCEA 2XHBA 3OW2U 5GTIZ 4LNUA 4MW3A 1AP6A 2ZE5A 1FXVA 3B77A 1DF5A 2UXDO 3T4DA 3QNEA 4ZOLA 2M7WA 4UB8Z 4LCUC 2HVKC 1B06A 5E79Z 3JAWB 1I7FA 1K92A 5BR8B 4JI4O 1UFIA 1YTFB 2YI8A 1FFXB 4PDRA 4MVZA 1B3QA 4UVCA 1FXKA 5LXTB 1JA8A 5CA1B 3CCMV 1IBMB 2P22C 1XHXA 2PZSA 1AR4A 2YIDA 3HKCA 3BPZA 1JJ2U 1X4TA 2IU0A 3BY6A 1GK9A 1RPRA 1BHAA 4LF6B 2R70A 4AI8A 3P3NA 2QWNB 1QQCA 3JD0A 3UO2A 3SJBC 4RUEA 3F5TA 4MVRA 3RFRA 2JJ2G 2WLHA 4LH7A 3FAVB 3K79A 4ZOLB 3S3XA 2XAJA 2R9AA 4B7KA 5LMUO 1BZKA 3VQWA 4QPKA 4EFEA 1RM1B 3SYCA 1KD1W 4DR6B 3AG4B 1Q86W 3CRAA 2HFEC 1GTOA 2UU9O 4OPHA 4B3RB 3K5OA 2HR3A 1NTKH 4AHCA 2QKAA 3CSXA 4U3JA 3HKCB 3DC6A 4LF4B 2F23A 2IJJA 3AG2B 5GONA 4PD4F 1VF7A 4C7UA 1YITV 3OM3B 1Q90D 2OIEA 1KMIZ 2IW5A 3L70H 4WBNA 5IJ9B 2JGDB 4B7EA 1Y6XA 1TAEA 4X62O 4HBNA 1YTFD 3RGBA 3AK2A 1QU7A 3OUFA 4UCUA 1CPYA 4J7JA 1WP8A 3W7UA 1V55B 1HP8A 4LFAB 1HR0B 4H33A 4JAAA 1HNWO 2ITCC 2XASA 5IJ0B 2LW7A 2AXTZ 2YIBD 2Q7EA 2UXBB 4B3MO 5KMGB 1K7DA 5GW7A 4CS2A 5D5PA 4DV2O 4OX9O 2JGDA 1XNQO 2N05A 5EBWC 3FKSG 1W2BU 4QIWF 5IYBO 3CX5F 1KC8W 2F4VO 3ZN1A 1Y76A 1XNRB 4WFFA 2PF4E 2QSAA 1M56B 2JEUA 4GKJO 3QF7A 3CS5A 1HNZO 4PA4A 3CEIA 2Q68A 2QWRB 3ZJZA 1SQQH 3A8TA 4ZKIA 4QNHB 4NXNB 4NTWA 3I56V 2EIJC 4I50A 1SZTA 1FXKC 1K3EA 4IIJB 1S5LZ 4PA7A 1M9NA 2B5UA 4X89A 1MSWD 5KLVH 3ZIAG 2YEVB 3CCQV 1BHBA 2Y69C 3LDDA 1PNLA 1E1QG 3AK3A 2GUZB 3K0DA 4J80A 1Z5VA 1BMFG 2JGUA 2ZR2A 3W7XA 3DSQA 4O2BA 3DXRA 5B1BB 4O4IB 3MAQA 5LP6C 2Q0OC 1MMMA 2Z5UA 4PA3A 4QPJA 2QTSA 1ZUQA 3KG2A 4X1KA 3T1YO 2DW4A 1Y67A 2H94A 3VBBA 4UCVA 3N2KB 2BOCC 3CXHF 2GSMB 5H6QA 2QM7A 3B09A 5JWPA 4X66O 1JFFB 2EIKC 4LWSB 2CTRA 1YHQV 4U7NA 2UXDB 2IJHA 1K5SA 2VS0A 2AZ0A 1AROP 3AG7A 2LP7A 4LH6A 2EILC 1VIBA 4QE7A 2WSSG 4D6TH 5HFMA 3Q4HB 1JMKC 4X1IA 1E1RG 2YUAA 3K0GA 3OTFA 4FLYA 3TXQA 4MTOA 2WLNA 1MZEA 1KP3A 2QE7G 4X1KB 4DV4O 3CWBH 3UM7A 2VWJA 1N4CA 3DTUB 2ZINA 3ABLB 4MSWC 2LW1A 4CS3A 4PDLA 4KHPB 2CTWA 5IY5B 4Z1VA 1NS1A 2H3OA 1GM7A 4X1YB 5LMUB 4DK1A 1O9GA 5CB4B 3FYEB 2Q67A 1QR9A 3ABKB 3UT5B 4CH5A 3CRCA 2PI5A 1VQPV 2OTLV 2UU9B 2XTAA 3Q4HA 4JI3O 1L8DA 4X1IB 3ZMZA 4EB6B 3FX7A 3OMAB 4LF5O 1YF2A 4O4HA 1XMOO 3AEIA 5BZBA 1HWYA 2BTQB 5EYPB 5JJNB 3CP1A 4K8ZA 2CK3G 4KXRA 1NTMH 3ZHQA 1KECA 4EFBA 1PL0A 2IBZH 5CA1A 1Q82W 4TV8A 2QM4A 4PELA 1RSOA 1RP3B 3CPWU 2DQ0A 4X20A 2X0LA 4X8AA 1JOYA 4QGPA 3CYOA 2WWWA 1DLBA 1GN4A 2W0FC 3N2GB 4DR4B 3TGUH 3FB7C 5CB4A 3WB0A 5J2TA 1AVMA 2YIBA 1NVPD 3UT5A 4LFBO 2L6LA 4JAUA 4U3FH 4BIOA 3RYIB 3G4SV 1TVKB 2UXXA 3H1KH 2QR4A 4RUFA 4EB6A 4DV3B 4TV9A 2D2CB 4I9QA 1ZAUA 4HZ3A 3P32A 4DR3B 3ASNC 3H01A 1BCCH 3X2QB 4YXWG 2ZE7A 3ZHSA 1YI2V 3D3IA 3GWOA 2MK3A 3FB6C 2Q6AA 1KU9A 4GT1A 4U3JB 2ZM6B 2UUCO 3IC9A 4GLXA 1SA0B 3JAKB 4DV6B 1M4UA 2F4VB 4JI5O 1Y74A 1PP9H 1SQBH 3IAYA 1FYJA 4F6RA 3JCZA 1I5XA 4JI1O 4O4JA 3BRCA 3OR6C 3OT7A 1J95A 4FLTA 4LF8O 1LNQA 5J2TB 3ABTA 4DV7B 1OCZB 5LYJB 2CH7B 4DV1B 4L8JA 2Q9LA 4JAVA 2FMLA 2P90A 1NQTA 4NB5A 4P9PA 2EINB
chains in the Genus database with same CATH topology
4R8CA 3CCMV 4WFBV 1XL4A 1SERA 4LBEC 5LGTA 1VQ6V 4TT3G 4XDKA 4LP8A 1P4RA 5CMUA 1JJ2U 2YEVA 2IU0A 3BY6A 1GK9A 5L3CA 1RPRA 5LHHA 1BHAA 3OEEG 5LGNA 3EHBB 4MVQA 1AI5A 5H9CA 1GM9A 2AHYA 1ORQC 3E83A 3JD3A 2A79B 4GX5A 5L3FA 3JD0A 1PD3A 2X7RB 1Q7YW 4RUEA 4MVRA 3CMAV 3W7SA 2JJ2G 2WLHA 5IYCO 3R65A 4MVMA 3E86A 4JTCB 3K79A 1QR8A 1S77D 2XAJA 4GX0A 4CZZA 2EINC 1NH2B 3FB8C 2JEXA 2EILB 3E35A 4P2ZA 1DF4A 4QPKA 3SYOA 1S3JA 1RM1B 1QVGU 3SYCA 1KD1W 3W7WA 5B3SB 3AG4B 3B8NA 1Q86W 1S5HC 2WPDG 2ZD9A 3ETDA 2ZQMA 3STZC 4PDVA 3ETGA 2HFEC 1GTOA 2WLLB 3DGEA 3RW0A 5E1AC 3ZMUA 2LFRA 4FIPC 2JK5C 4WF9V 1GO3F 2B1IA 2HR3A 4WFEA 3UKMA 1W0JG 1K9MW 1CP9A 3OR7C 1R6KA 4CBCA 4MVUA 1DTOA 5EBLC 5B1AB 3RVZA 3OFNG 2X6CA 4UUJC 2EIMB 2HJFC 4XDLA 5B1NA 1THZA 2IJJA 3AG2B 5B1BC 1G4YB 2C2AA 5L3EA 3CCJV 1YITV 3ABKC 2IH3C 3E8HA 5EC2C 1CEZA 1BL8A 1H8HG 3OM3B 1WPXA 2IW5A 3JD1A 4G27B 4JTDB 5C93A 3ZMVA 4KP4A 1YTFD 4P9OA 3ASOB 3OMIB 3OUFA 1CPYA 5EK0A 1JQ0A 4RQEA 3W7UA 3K08A 1V55B 3G71V 1YJWV 1F23A 3EFFK 2Q69A 3ETEA 4H33A 4WFAV 2GHYA 1NKDA 3AG3B 3CCLV 2AHZA 5B3SC 3W7TA 3LUTB 1F51A 4RAIA 2ITCC 2OCCC 1M1KW 2XASA 1K34A 4U7OA 1RM1C 2A0LA 4GX2A 2WLKA 3I55V 2P67A 3FYIB 1EBOA 3OEHG 4QJFB 4BIZA 2ZXWB 4MT8A 3TK1A 1K7DA 1OCOC 3QO8A 2DYSB 5GW7A 3SYQA 1NBMG 1H2GA 3TETA 5CBHA 3ABMB 1S72V 4MTXA 5L3DA 3AG1B 1M57B 3JD4A 3HB3B 1TUEB 5KUMA 1KP2A 4TWKA 4MS2A 2W6IG 4RQFA 1N8RW 3E89A 4UV9A 3ASOC 5LHIA 1KQSU 2UXNA 1AR1B 5LGUA 5IY5C 5EBWC 3FKSG 3ABLC 3LSSA 2Y48A 3OMNB 4R7CA 1COWG 3CC2V 5HFLA 1W2BU 4QIWF 5KA5A 5IYBO 1KC8W 2X6BA 3ZN1A 3ABUA 4RO2A 4E2LA 2NLJC 1OCCC 2XAFA 4WFFA 3CXCU 1MOFA 1QLEB 1H38A 1M56B 2JEUA 1Y66A 3ZRWB 3A0RA 2QKSA 3LNMB 1VQOV 2OT5A 2EIJB 4PA4A 5KA6A 1V54B 1OCRC 2WLMA 2BOBC 4JPRA 2Q68A 3AG1C 1R3KC 3M99B 3ZJZA 1FFTB 1SRYA 2DYSC 3FB5C 4ZKIA 4QNHB 4BAYA 3I56V 2EIJC 3SPCA 1SZTA 3IFXA 1FXKC 3LSQA 1K3EA 1H8EG 3GB7C 5KUKA 3SJQC 3IC7A 4PA7A 2IJKA 4L87A 1M9NA 2B5UA 3MHHC 3NXSA 4X89A 1MSWD 2F43G 2XAQA 3ZIAG 2YEVB 1K73W 3CCQV 1BHBA 2Y69C 3LDDA 1Y4MA 1PNLA 3K3WA 1E1QG 2D3OW 1VQ8V 3K0DA 3E8FA 2ZR3A 1NVPB 2EZPA 1BMFG 4Z1MG 2ZDIA 2ZR2A 3W7XA 1YSCA 3IGAC 3AG3C 5B1BB 1KKDA 2YSUB 3F7VC 4WFGA 1EFRG 2DWDC 1NR1A 3SPJA 3QO7A 2Z5UA 3WG7C 2ZDIC 2Z3YA 4PA3A 4QPJA 1R73A 3KG2A 3CCSV 1G8MA 2DW4A 5DN6G 2H94A 3VBBA 5CBFA 5DM6V 1YJ9V 2ZXWC 4G2KA 2BOCC 4R50A 1L1FA 1S76D 2GSMB 5H6QA 2QM7A 3HPLC 2EIKC 3ZMTA 1M90W 4G28B 2HG5C 1YHQV 4U7NA 1AJQA 2P7TC 4MW8A 2IJHA 2V1DA 1ZWIC 1K5SA 2IU3A 1VQMV 3E8GA 3RBZA 2B1GA 3OAAG 2WAMA 4N21A 3SPIA 5J9PC 1AROP 3E8BA 5CBGA 1PKXA 2LP7A 2PI4A 2EILC 3CCRV 1OCZC 4WFHA 4BIUA 3LDCA 2EIMC 4QE7A 2WSSG 3T4ZA 1K4CC 3MD0A 4GX1A 1QLNA 4DO2A 1GKFA 4J9ZB 3CCEV 5HFMA 4BW5A 1OCOB 3SYAA 1NR7A 1P7BA 3P30A 4MVSA 1E1RG 3K0GA 3ML0A 1AJNA 1VQ4V 1PNMA 4MTOA 2V7QG 2WLNA 1S0VA 3OUSA 1KP3A 2QE7G 3T2MA 5H6RA 3UM7A 2WLIB 3ZMSA 1AI4A 2IJIA 3DTUB 4ASUG 4FK5C 2XNDG 3ABLB 4MTFA 4MSWC 4ZBMA 2QM8A 5EC1C 4KUMA 2WLJA 1VQLV 4JTAB 1Q81W 4PDLA 3RVYA 2IH1C 3K04A 4I5SA 4UVBA 4PDMA 2EIKB 2XAGA 5IY5B 4TSFG 2EZOA 1F4MA 4J9YB 3CC4V 2QEXV 4PA9A 1GM7A 3ZN0A 2LFSA 1YIJV 4X88A 3B8MA 1MABG 2KB1A 4P30A 2H8PC 3FYEB 3OGCC 3CMEV 1NH2D 2Q67A 1JCHA 1QR9A 4XDJA 3WG7B 1IXMA 3ABKB 4OXSA 3CCUV 2PI5A 2EBOA 1WLEA 1VQPV 2OTLV 3AG4C 3ZRXA 1E79G 1AI7A 3D36A 1SETA 1M56C 4EKWA 4FMTA 5FL7G 3G6EV 3BEHA 3ZMZA 3QO5A 4HYOA 3X2QC 2DQ3A 1W0KG 3OMAB 4MTGA 4Q20A 2JJ1G 4JYBA 2JDIG 5LHGA 1GM8A 3AG2C 1SESA 3AEIA 5BZBA 1B6QA 2X6AA 1HWYA 1VQ9V 1FS0G 4QE9A 3CP1A 5B1AC 4F4LA 3TCUA 2CK3G 1KECA 3ABMC 4UV8A 1JX9A 2K1EA 1PL0A 1MG1A 1OCRB 1Q82W 5CN0A 1F4NA 1JPXA 2HLDG 2R9RB 3ZRSA 1QBZA 2QTOA 2EJRA 2FTKA 4PELA 4R6ZA 3SPHA 3CPWU 2DQ0A 3OE7G 4XBFA 2X0LA 4X8AA 1JOYA 4FJCC 3CD6V 2DWEC 3ZRVA 1K4DC 1I5YA 5IYDO 3CYOA 4JYCA 3SYPA 2WWWA 1DLBA 3K9AA 3LDEA 2W0FC 3CC7V 3CCVV 2P6JA 2JIZG 3SPGA 1K5QA 3FB7C 1R3IC 4UXNA 1QVFU 4MVOA 1GMGA 1AJPA 2A9HA 4JGSA 3MHSC 4DXWA 1V55C 4H37A 2DYRC 1NVPD 5L3BA 1VQNV 3JYCA 2OCCB 1OHHG 1K33A 1ENVA 3PJSK 4JAUA 5EBMC 1OZ0A 1FXHA 2NNUA 5LBQA 3G4SV 4I9WA 3E2EA 1M57C 2WLIA 2UXXA 1FXKB 4RUFA 1XL6A 2HKOA 2XOKG 1R3JC 3F5WC 3VOUA 1PNKA 3WFVA 4HAMA 3ZCCA 1OCCB 3K03A 4HZ3A 1R3LC 4LC1A 3T1CA 3P32A 1QLEC 3JD2A 1QCEA 2WLLA 4N23A 3OW2U 1AI6A 2ATKC 3ASNC 3H01A 3X2QB 2ITDC 1R6NA 4YXWG 4MW3A 1YI2V 3D3IA 4PA6A 3GWOA 1UJWB 2Y69B 2MK3A 3FB6C 2Q6AA 1FXVA 5IDJA 2OTJV 4GT1A 3B77A 4JF3A 3K06A 4UVAA 1DF5A 5CA3A 4FPPA 1JVMA 4WCEV 3T4DA 3QNEA 1K97A 1VQ5V 1ROPA 4GCZA 2M7WA 4LCUC 2HVKC 3JCZA 2XAHA 4KFMA 1I5XA 1YJNV 1NJIW 3OR6C 2R9IA 1J95A 3ZRWA 1LNQA 1K92A 5B1OA 1V54C 3ABTA 2QA4V 2W6JG 1K8AW 1VQKV 5L3GA 1YTFB 1OCZB 1RPOA 3STLC 2DYRB 1EZJA 4PDRA 3ASNB 3F7YC 4MVZA 1VQ7V 4UVCA 2HVJC 4JAVA 1FXKA 2P90A 1NQTA 4JASA 4P9PA 2EINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BZB A;  2X6A A;  2ZXW C;  4R8C A;  2BOC C;  4R50 A;  4RAI A;  2ITC C;  2OCC C;  1XL4 A;  4QE9 A;  4LBE C;  5CBF A;  5B1A C;  4F4L A;  3TCU A;  3HPL C;  2A0L A;  4GX2 A;  4XDK A;  2EIK C;  3ABM C;  2WLK A;  4G28 B;  2K1E A;  4LP8 A;  2YEV A;  2HG5 C;  2R9R B;  3ZRS A;  2QTO A;  2P7T C;  4MW8 A;  4R6Z A;  4MVQ A;  3SPH A;  1OCO C;  1ZWI C;  2AHY A;  3E8G A;  3RBZ A;  3SYQ A;  4X8A A;  1ORQ C;  3E83 A;  3TET A;  2A79 B;  2DWE C;  4GX5 A;  5CBH A;  3SPI A;  1K4D C;  5J9P C;  3E8B A;  3SYP A;  5CBG A;  4RUE A;  4MVR A;  2EIL C;  3LDE A;  2W0F C;  5KUM A;  1OCZ C;  2WLH A;  4WFH A;  4TWK A;  4MS2 A;  3SPG A;  3E89 A;  3LDC A;  3R65 A;  2EIM C;  3E86 A;  4JTC B;  4MVM A;  4QE7 A;  3FB7 C;  1K4C C;  1R3I C;  3ASO C;  4GX1 A;  3T4Z A;  4MVO A;  5IY5 C;  4J9Z B;  2A9H A;  4GX0 A;  5EBW C;  2EIN C;  3ABL C;  3FB8 C;  4R7C A;  4DXW A;  1V55 C;  4BW5 A;  4H37 A;  2DYR C;  3SYA A;  3JYC A;  1P7B A;  4P2Z A;  2X6B A;  3PJS K;  4MVS A;  5EBM C;  3SYO A;  4RO2 A;  3K0G A;  3SYC A;  4I9W A;  2NLJ C;  1OCC C;  1M57 C;  2WLI A;  4WFF A;  1S5H C;  3STZ C;  2ZD9 A;  4RUF A;  4QNH B;  4MTO A;  2WLN A;  1XL6 A;  4PDV A;  1R3J C;  2HFE C;  3F5W C;  4P9P A;  2WLL B;  3OUS A;  3VOU A;  2QKS A;  3LNM B;  3RW0 A;  5E1A C;  3T2M A;  3UM7 A;  2WLI B;  4PA4 A;  2JK5 C;  3K03 A;  1OCR C;  2WLM A;  4HZ3 A;  2BOB C;  4WFE A;  1R3L C;  2Q68 A;  3AG1 C;  3UKM A;  3T1C A;  4MTF A;  1QLE C;  1R3K C;  4MSW C;  3OR7 C;  2WLL A;  3ZJZ A;  4ZBM A;  5EC1 C;  4CBC A;  2ATK C;  3ASN C;  4MVU A;  2ITD C;  2WLJ A;  2DYS C;  3FB5 C;  4JTA B;  5EBL C;  4PDL A;  3RVY A;  4MW3 A;  3RVZ A;  2IH1 C;  2X6C A;  3K04 A;  2HJF C;  4UUJ C;  4PA6 A;  2EIJ C;  4XDL A;  4PDM A;  3SPC A;  3FB6 C;  3IFX A;  2Q6A A;  3GB7 C;  5KUK A;  5B1B C;  3SJQ C;  1G4Y B;  4PA7 A;  4J9Y B;  3K06 A;  3ABK C;  2IH3 C;  4PA9 A;  3E8H A;  4X89 A;  5EC2 C;  1BL8 A;  4X88 A;  1JVM A;  3T4D A;  2Y69 C;  3LDD A;  4G27 B;  2KB1 A;  4P30 A;  2H8P C;  3E8F A;  3K0D A;  3OGC C;  4JTD B;  2Q67 A;  4LCU C;  4XDJ A;  2HVK C;  4KFM A;  4OXS A;  3OR6 C;  1J95 A;  1LNQ A;  3IGA C;  3AG4 C;  3AG3 C;  4P9O A;  1V54 C;  3OUF A;  1KKD A;  3F7V C;  4WFG A;  5EK0 A;  2DWD C;  3K08 A;  3SPJ A;  3WG7 C;  1M56 C;  3STL C;  4EKW A;  4PA3 A;  4PDR A;  3BEH A;  3F7Y C;  4HYO A;  4MVZ A;  3X2Q C;  3KG2 A;  2HVJ C;  3EFF K;  2Q69 A;  4MTG A;  4H33 A;  2AHZ A;  5B3S C;  3LUT B;  3AG2 C; 
#chains in the Genus database with same CATH topology
 2ZCE A;  4LBE C;  5LA6 B;  1N34 B;  5LGT A;  4DW0 A;  4LP8 A;  5CMU A;  5L3C A;  5LGN A;  3CJH A;  3EHB B;  4DR5 B;  2Q8V A;  4DR7 O;  1Q7Y W;  2RNB A;  3CMA V;  3W7S A;  2R72 A;  1WPB A;  2RMK B;  1IXB A;  4X65 O;  1QR8 A;  1BGY H;  4UCS A;  4GX0 A;  2EIN C;  3FB8 C;  3E35 A;  2E5L B;  1SQG A;  2YI9 A;  2P4V A;  4JI8 B;  5B3S B;  3B4S A;  3B8N A;  5A2Q N;  3STZ C;  2WPD G;  3ETD A;  2ZQM A;  1SC5 B;  4X66 B;  1YZB A;  3ETG A;  4CH4 A;  2WLL B;  1Y76 B;  3DGE A;  2F93 B;  2Y0P A;  4DK0 A;  3ZMU A;  5H2F Z;  2JK5 C;  3WB2 A;  3UKM A;  3OTO O;  4GYC B;  2LJ2 A;  3OR7 C;  1R6K A;  4HNA B;  2EIM B;  4YY3 O;  4B08 A;  3CJH B;  5EZY B;  5A9G A;  2C2A A;  4H44 B;  5BR8 O;  1CEZ A;  5JJJ B;  1BL8 A;  4JI4 B;  1H8H G;  1WPX A;  3H9V A;  4IIJ A;  4G27 B;  4BR6 A;  4H13 B;  5C93 A;  2RN9 A;  4O4L A;  3CRM A;  1IBM O;  3L73 H;  1N0N A;  1XMQ O;  1YEW A;  4DV4 B;  4DUZ B;  2B9Z A;  3K5L A;  2UXC B;  3KKY A;  1F23 A;  2Q69 A;  4FLW A;  3AG3 B;  4LF9 B;  2RJZ A;  4I7Z B;  1EN6 A;  2Q5Z A;  4FFB B;  4GKK B;  1YVW A;  2YXL A;  4QJF B;  5AG2 A;  4BIZ A;  3TK1 A;  1OCO C;  3ZHR A;  2DYS B;  1H2G A;  2CGN A;  3FD9 A;  1M57 B;  3JD4 A;  1XHZ A;  1VMG A;  3SGI A;  3K59 A;  4J10 A;  1H2K A;  4DR6 O;  2W6I G;  3J80 N;  3E89 A;  4UV9 A;  3ASO C;  1KQS U;  4PV1 B;  4JV5 O;  5IY5 C;  5LP6 B;  3ABL C;  1GN3 A;  3OMN B;  3G80 A;  5KA5 A;  4LF5 B;  1EN4 A;  1XMO B;  2X6B A;  1XIL A;  4RO2 A;  2KG7 A;  3ZX6 A;  1QLE B;  3RYF B;  1H38 A;  2L35 A;  2QKS A;  2OT5 A;  4ZI7 B;  2F1M A;  1OCR C;  1T5E A;  4JPR A;  2PUS A;  4O2A A;  1SF9 A;  1FFX A;  1HNX O;  1Q43 A;  1U97 A;  3SPC A;  3IFX A;  5KHK A;  2N04 A;  5KUK A;  5LXT A;  5F2V O;  4X62 B;  3IC7 A;  2UUB O;  4FFK A;  2WA4 A;  1LR1 A;  1P7G A;  2EX3 A;  1OV9 A;  3ETQ A;  4I4T B;  1DGS A;  3H1I H;  3KZI Z;  2XAQ A;  5K1P A;  3HKB A;  1VF6 C;  1Y4M A;  3J81 N;  1VQ8 V;  2ZR3 A;  1IX9 A;  1IDS A;  4Z1M G;  4GZR B;  1HDJ A;  4YHH O;  5ITZ B;  4NYK A;  4X1Y A;  2F66 C;  5LP6 A;  1RFY A;  3AG3 C;  1ZX3 A;  2Y4T A;  1PPJ H;  1EFR G;  4WFG A;  4DV3 O;  1NR1 A;  3SPJ A;  2ZDI C;  2ARH A;  3CCS V;  2KG7 B;  5DN6 G;  4B3M B;  1WA8 B;  5CBF A;  4DUY O;  2ZXW C;  4G2K A;  1L1F A;  4R50 A;  5GTH Z;  2QGN A;  1S76 D;  4A5U B;  4ZI7 A;  4DV0 B;  1I08 A;  4O4H B;  3ZMT A;  1KBH A;  2A3Q A;  2BTQ A;  3C3S A;  4OX9 B;  4UCR A;  4MW8 A;  2UUC B;  2V1D A;  1ZWI C;  1XNQ B;  1VQM V;  3E8G A;  2LQT A;  4N21 A;  1SKV A;  5CBG A;  2PTM A;  3OGI B;  1FD9 A;  1QHT A;  4WFH A;  4UB6 Z;  3LDC A;  4DV7 O;  2EIM C;  1K4C C;  3K9S A;  1N36 O;  3UO3 A;  1GKF A;  5FLX N;  5FNV B;  4LNU B;  2QKC A;  4DV1 O;  1HNZ B;  1FPO A;  1D5N A;  1P7B A;  3P30 A;  2OWO A;  1Z5W A;  2E76 B;  3ML0 A;  5IJ9 A;  1AJN A;  3O65 A;  2EUL A;  1VQ4 V;  2UUA O;  1PNM A;  2Q7G A;  3BCC H;  5KHH A;  3RYC B;  1WA8 A;  1AI4 A;  5DED A;  4JYA O;  1ZSP A;  4ASU G;  4DR5 O;  2XND G;  1BQZ A;  2QM8 A;  4CC6 A;  4DR7 B;  2WLJ A;  3RVY A;  4NKG B;  3K04 A;  4NTX A;  3PN1 A;  5EIB C;  3RWR D;  4YJ3 A;  4J9Y B;  4X65 B;  3CC4 V;  1GN6 A;  1J5E O;  3FFQ A;  2LFS A;  4PHZ A;  1YIJ V;  1MAB G;  1NH2 D;  1IXM A;  3T1Y B;  3JAS A;  4NXM B;  1WLE A;  2YXY A;  3AG4 C;  5FNV A;  1N33 B;  4D7T A;  1JR9 A;  4TUY B;  1AI7 A;  3D36 A;  3RYH A;  4F6R B;  5LOV A;  1SET A;  4YIO A;  4D7S A;  4FMT A;  5FL7 G;  3G6E V;  3QO5 A;  3X2Q C;  1KKC A;  3BVO A;  3H1H H;  2EJ7 A;  4JYB A;  2JDI G;  1SES A;  3RYC A;  3B2E E;  4QE9 A;  1BQ0 A;  5B1A C;  1IZ3 A;  2QWQ B;  2GDS A;  3A0B Z;  2AW9 A;  4UCT A;  1F4N A;  2HLD G;  3ZRS A;  4R6Z A;  4LF7 O;  3SR2 C;  2BCC H;  4LFC O;  2CAZ C;  4FJC C;  4NR1 A;  3CD6 V;  3JAT A;  1IUR A;  2DJV A;  2OCH A;  5TIS Z;  3K9A A;  3CC7 V;  3CCV V;  1VAR A;  2P6J A;  4I50 B;  3S3W A;  1XMQ B;  1SQF A;  4IYH A;  1Q6I A;  2DMX A;  4JGS A;  3MHS C;  5JH7 A;  3E22 A;  3NR7 A;  1V55 C;  4H37 A;  1WP7 A;  5L3B A;  1BSM A;  1OHH G;  1K33 A;  1ENV A;  2ODM A;  2NNU A;  4TUY A;  5D5Q A;  3JAL A;  3SDL A;  2V4D A;  5LOV B;  1FJG B;  1AB3 A;  4KHP O;  3BAB A;  4HAM A;  3BFR A;  4O4I A;  3ZCC A;  4B3T O;  4LC1 A;  2MW2 B;  1QLE C;  2WLL A;  4W4L A;  1AI6 A;  2ATK C;  3B40 A;  1R6N A;  5JVD A;  2IM9 A;  2Y69 B;  1N32 B;  1WAZ A;  3HKE A;  3N2K A;  3QVN A;  2OTJ V;  1UPG A;  3K06 A;  4JV5 B;  4UVA A;  5CA3 A;  1JVM A;  4WCE V;  1I94 B;  4JI3 B;  1K97 A;  1VQ5 V;  2FYU H;  3HKD B;  5IJ0 A;  2PYL A;  1GH6 A;  1YJN V;  3ZRW A;  2R9I A;  5B1O A;  1IBK B;  2QA4 V;  1VF6 A;  2W6J G;  1VQK V;  1A32 A;  1XRE A;  1ZL8 B;  4B3S B;  1RPO A;  3STL C;  2DYR B;  1EZJ A;  3F7Y C;  1VQ7 V;  4YIP A;  2Y0I A;  4JAS A;  2Q4P A;  1VQ6 V;  4I55 A;  4TT3 G;  4XDK A;  2UUB B;  5LHH A;  5BXZ A;  1AI5 A;  5H9C A;  1GM9 A;  5J2U B;  1ORQ C;  3JD3 A;  5L3F A;  1TGO A;  3ZBH A;  2BSK B;  5IE9 A;  2JVD A;  5C8Y A;  4IYI A;  4MVM A;  3E86 A;  1L0L H;  2HEP A;  2LGQ A;  4DRX A;  3UQ8 A;  4CZZ A;  2JEX A;  3SYO A;  3OD4 A;  1H2L A;  4DV5 B;  4DR3 O;  1P49 A;  4K35 A;  2ZD9 A;  4FLV A;  4ZHQ A;  3MDS A;  3RW0 A;  5E1A C;  4CH3 A;  2LFR A;  2CE4 A;  2ZM6 O;  2GV9 A;  1K9M W;  5JCO A;  4CBC A;  3VQV A;  1TUB A;  5EBL C;  2G38 A;  5B1A B;  3CHX A;  3RVZ A;  4DV6 O;  4UUJ C;  4ZIB A;  5B1N A;  2JS3 A;  1G4Y B;  2NN4 A;  4LF8 B;  4BW9 A;  5J2U A;  3ABK C;  3E8H A;  1N36 B;  2LGW A;  3WU2 Z;  1VEW A;  3RN4 A;  3BHP A;  3ZHT A;  1SZX A;  4KL1 A;  4W4K A;  1BS3 A;  4I4T A;  4AQY B;  1LUV A;  3HKB B;  2YS8 A;  2UUA B;  4YJ2 B;  1R1B A;  4P9O A;  3OMI B;  5EK0 A;  2RCV A;  4RQE A;  1L0N H;  1N34 O;  3DC5 A;  4FLU A;  1YJW V;  1PM9 A;  2GHY A;  1NKD A;  3J7A U;  5B3S C;  3W7T A;  4RAI A;  1M1K W;  2ILM A;  1IBL O;  4U7O A;  3RYI A;  2A0L A;  2WLK A;  1EM1 A;  4IHJ B;  3JAW A;  2P67 A;  3FYI B;  1EBO A;  1TUB B;  1Q6H A;  5KAF Z;  3SYQ A;  3QG5 A;  3TET A;  2VWK A;  5LMN B;  3AG1 B;  1MNG A;  1MZF A;  1VF5 B;  4NXM O;  5KUM A;  2HP8 A;  1KP2 A;  1N33 O;  4MS2 A;  1N8R W;  2P06 A;  1NI8 A;  5LHI A;  4J7K A;  2CTP A;  3CC2 V;  4R7C A;  5HFL A;  1SQX H;  3JAR A;  4JYY A;  1M93 A;  3ABU A;  3OTO B;  1SA0 A;  1XEQ A;  2XAF A;  4CH6 A;  3EVK A;  3CXC U;  1MOF A;  2HHH O;  4YY3 B;  4O4J B;  4I0X B;  1KYO F;  1Y66 A;  3LNM B;  1VQO V;  5KA6 A;  4LF7 B;  2WLM A;  3AG1 C;  1D2D A;  1NTZ H;  2CH7 A;  3A0H Z;  3LSQ A;  1GAX A;  3G67 A;  4L87 A;  5LA6 A;  3NXS A;  4DR1 O;  3BA8 A;  2F43 G;  2KKW A;  4DUZ O;  3K3W A;  2UXC O;  2D3O W;  5KHG A;  4TQF A;  2EZP A;  5IWA B;  4LF9 O;  3JSL A;  1U96 A;  1FJG O;  4JZ2 A;  2VQF B;  1RSO B;  1H2N A;  3F7V C;  2BTO A;  3L72 H;  3QO7 A;  3WG7 C;  4GKK O;  2Z3Y A;  2VRZ A;  5KHI A;  1W59 A;  5DM6 V;  2FB5 A;  1N32 O;  4JI6 O;  1Q6U A;  2YC0 A;  4FLX A;  4G28 B;  4FVM A;  2A06 H;  4JI7 O;  2HG5 C;  2P7T C;  4JI0 O;  1GN2 A;  3JAM N;  1TVK A;  5K1X A;  1I94 O;  2WAM A;  3SPI A;  4H0L B;  3E8B A;  1PKX A;  3CCR V;  1OCZ C;  4HNA A;  4BIU A;  3K5M A;  1IBK O;  2E74 B;  3T4Z A;  3MD0 A;  3SJA C;  4GX1 A;  1QLN A;  4DO2 A;  4B3S O;  1ZTE A;  2VQE B;  4FM1 A;  1VP7 A;  1OCO B;  3APO A;  5KX5 A;  4J7Z A;  4MVS A;  1G1X B;  3H1L H;  3T1H O;  2W0X A;  2ZNJ A;  1XI1 A;  2CGO A;  3E22 B;  1HNX B;  3TJT A;  2ZIM A;  1S0V A;  2QWP B;  4DW1 A;  4K3A A;  4J11 A;  4O4L B;  3A2F A;  3ZMS A;  3LSU A;  4FK5 C;  5JCO C;  4KUM A;  4IGG A;  1H2M A;  1VQL V;  1Q81 W;  4UVB A;  4CS4 A;  2XAG A;  4TSF G;  2EZO A;  1F4M A;  4JI2 O;  4YHH B;  4FFB A;  3ZHU A;  3L71 H;  5FPR A;  1XOU A;  4FLZ A;  2HJD A;  1XBL A;  1N0J A;  1URF A;  4P30 A;  3OGC C;  3M7M X;  3CME V;  2YXH A;  3THO A;  1JCH A;  4XDJ A;  3WG7 B;  5B66 Z;  4OXS A;  2EBO A;  4DUY B;  1S5J A;  3H1J H;  1E79 G;  2ZE8 A;  1X59 A;  4DV0 O;  5FPO A;  1M56 C;  3ZS8 C;  3BEH A;  4MTG A;  2RQ6 A;  2JJ1 G;  3KCX A;  5CA0 A;  5LHG A;  5GON B;  1VQ9 V;  2X6A A;  4FZ1 A;  4BWA A;  4F4L A;  3ABM C;  2K1E A;  4WBN B;  1SS3 A;  1LUW A;  1JPX A;  1QBZ A;  2QTO A;  2ETN A;  2FTK A;  4ABM A;  3D8C A;  2CTQ A;  2DWE C;  3ZRV A;  2FKX A;  1K4D C;  3G6B A;  3KCY A;  1NZ6 A;  4AQY O;  3N27 A;  5IYD O;  4JYC A;  1V9P A;  3LDE A;  4X64 O;  1WNS A;  4LF6 O;  1M5I A;  1K5Q A;  1GMG A;  3HR0 A;  1AJP A;  2BSK A;  2A9H A;  5C8Y B;  1WB8 A;  1JFF A;  1NT2 B;  2DYR C;  4LWS A;  4E4E A;  1VQN V;  3JYC A;  2OCC B;  4F6E A;  4JYA B;  5EZY A;  1FXH A;  5LBQ A;  3E2E A;  2WLI A;  1XL6 A;  2HKO A;  2XOK G;  4PI0 A;  3F5W C;  5ITZ A;  3VOU A;  3K03 A;  1R3L C;  3C3T A;  1Q8I A;  3T1C A;  4ZHQ B;  1J5E B;  3JD2 A;  2FL4 A;  3UCS C;  2Z0A A;  4N23 A;  3JCU Z;  5B5E Z;  2ITD C;  4PA6 A;  5JQG A;  1UJW B;  1YDX A;  5IDJ A;  4EEQ A;  4B3R O;  2KQX A;  4JF3 A;  5EIB D;  2K9P A;  4FPP A;  1MSD A;  5BMV B;  1ROP A;  4GCZ A;  4LF4 O;  4KFM A;  2Q73 A;  2XAH A;  3P3P A;  1NJI W;  4OPA A;  2HHH B;  1CXZ B;  1V54 C;  1K8A W;  1Q3E A;  5L3G A;  4UFZ A;  3ASN B;  2HVJ C;  2P5O A;  2A7W A;  4LFC B;  4R8C A;  4WFB V;  2GTA A;  1XL4 A;  1SER A;  3U10 A;  1OJH A;  1P4R A;  4JZG A;  2YEV A;  4DR1 B;  2GTS A;  3ZHV A;  1HR0 O;  3OEE G;  2GUZ A;  4MVQ A;  1TA8 A;  5JQG B;  2AHY A;  3E83 A;  2A79 B;  4GX5 A;  4IHJ A;  1PD3 A;  2X7R B;  3DXR B;  1YXB A;  3CB2 A;  3D36 C;  2VQF O;  5IYC O;  1I0H A;  5KAI Z;  3R65 A;  3WB1 A;  4JTC B;  5BMV A;  1S77 D;  1NH2 B;  2EIL B;  3U0Z A;  4P2Z A;  4B3T B;  1DF4 A;  4TV8 B;  1S3J A;  1QVG U;  3W7W A;  2PYJ A;  4LR3 A;  1S5H C;  4JI6 B;  4PDV A;  4FM2 A;  3JAR B;  2P4K A;  4JI7 B;  4FIP C;  3SJC C;  4WF9 V;  4JI0 B;  1GO3 F;  2B1I A;  4WFE A;  1W0J G;  4Q6G A;  1B04 A;  1CP9 A;  1XNR O;  4I0X A;  5IYZ A;  2E3C A;  4MVU A;  1DTO A;  1O9H A;  3OFN G;  2X6C A;  2HJF C;  1WN7 A;  4XDL A;  1THZ A;  2DN9 A;  5B1B C;  5L3E A;  3CCJ V;  4DR2 B;  2IH3 C;  5EC2 C;  2ADP A;  3LNN A;  3JD1 A;  4NXN O;  4NTY A;  4JTD B;  2N74 A;  3R66 A;  3ZMV A;  4OGQ B;  4KP4 A;  3ASO B;  1US6 A;  1JQ0 A;  3K08 A;  2AZ2 A;  2Q0A A;  3G71 V;  4K0K B;  4WFA V;  3EFF K;  3ETE A;  3CCL V;  2AHZ A;  3LUT B;  5JH7 B;  1GRJ A;  1F51 A;  3APQ A;  2OCC C;  3JAK A;  1K34 A;  2DOS A;  1RM1 C;  1Y74 B;  4GX2 A;  2ADQ B;  3EXA A;  3I55 V;  3OEH G;  1KUQ A;  5IYZ B;  2KSD A;  2ZXW B;  4MT8 A;  3QO8 A;  2M6Y A;  1NBM G;  3FAV A;  5CBH A;  3ABM B;  1S72 V;  4MTX A;  5L3D A;  4GUN A;  1NU1 H;  3HB3 B;  1TUE B;  2ZKO A;  2F95 B;  4TWK A;  1IVS A;  4RQF A;  4DV5 O;  1EZV H;  5JVD B;  2PY5 A;  2RDC A;  2UXN A;  1AR1 B;  1R6T A;  3HKE B;  5LGU A;  3BA9 A;  2QJ1 A;  3LSS A;  2Y48 A;  5H5N A;  1COW G;  5EYP A;  1PV0 A;  4YJ3 B;  4ICG A;  4E2L A;  2NLJ C;  1OCC C;  3AK1 A;  1AIL A;  5KX5 B;  4J41 A;  3QTC A;  2YIC A;  3ZRW B;  3A0R A;  3GWK C;  2EIJ B;  4X20 B;  2ZNI A;  1SQP H;  1V54 B;  4RWU A;  2BOB C;  3JAS B;  1R3K C;  2XUM A;  1FAF A;  3M99 B;  1FFT B;  3N2G A;  1SRY A;  2DYS C;  3FB5 C;  1WB7 A;  3U11 A;  4BAY A;  1BT8 A;  3RYH B;  4X64 B;  3GB7 C;  1H8E G;  1Q5O A;  3RT3 C;  2ZT9 B;  3SJQ C;  2IJK A;  1HW7 A;  3MHH C;  4I55 B;  1BE3 H;  1K73 W;  2CUG A;  1XUQ A;  3E8F A;  2CDY A;  3L74 H;  1NVP B;  2ZDI A;  1YSC A;  2DE0 X;  4TV9 B;  2Q7H A;  3IGA C;  2LO1 A;  1KKD A;  2YSU B;  1EN5 A;  2DWD C;  3TXS A;  1IBL B;  3JAT B;  1R73 A;  1QNM A;  2BE3 A;  2QDO A;  1G8M A;  3O9O A;  4DRX B;  2GBO A;  1YJ9 V;  1JJO A;  5KMG A;  3HPL C;  4X9Q A;  5CA0 B;  5LMN O;  2ZE6 A;  1M90 W;  4TOI A;  5LL6 Y;  1AJQ A;  1D5A A;  3JAL B;  2IU3 A;  2WA3 A;  2E75 B;  3RBZ A;  3C90 A;  2ZIO A;  2B1G A;  2Y4U A;  3OAA G;  5J9P C;  3CRQ A;  2PI4 A;  1XDC A;  5LYJ A;  1PL4 A;  4IT5 A;  4J9Z B;  3CCE V;  4FM0 A;  1AR5 A;  4BW5 A;  3SYA A;  1NR7 A;  4Z2W A;  4DR4 O;  1SQV H;  3BAA A;  5KHJ A;  2V7Q G;  1F7Y A;  3OUS A;  3HKD A;  3T2M A;  5H6R A;  1WJZ A;  2WLI B;  4LFB B;  5IT9 N;  2IJI A;  3GVM A;  4LFA O;  1XQ8 A;  4MTF A;  2QWO B;  4ZBM A;  5EC1 C;  3ICX A;  3L75 H;  4JTA B;  4K8X A;  2IH1 C;  2JS5 A;  4I5S A;  1ZL8 A;  1HNW B;  4PDM A;  1YCI A;  2EIK B;  4FZ0 A;  3JSN A;  5IWA O;  4DYL A;  2QEX V;  4PA9 A;  4NVP A;  3ZN0 A;  2UXB O;  2JRI A;  4X88 A;  3RYF A;  3B8M A;  4O2B B;  1MA1 A;  2KB1 A;  2H8P C;  2AGA A;  3CE2 A;  3CRR A;  3CCU V;  2NR5 A;  4O2A B;  2PGG A;  4DV2 B;  3ZRX A;  5BY1 A;  1FKA O;  4EKW A;  4JI5 B;  4HYO A;  2DQ3 A;  1W0K G;  4JI1 B;  4Q20 A;  5DEC A;  2YDE A;  2OYQ A;  3D3Q A;  1GM8 A;  3AG2 C;  1B6Q A;  1FS0 G;  1H2S B;  3VQX A;  3TCU A;  4UV8 A;  1JX9 A;  2YIA A;  4DR2 O;  4GKJ B;  1MG1 A;  1OCR B;  5CN0 A;  2O57 A;  2R9R B;  1DK1 A;  5JJE B;  2EJR A;  3SPH A;  3K5N A;  3OE7 G;  4XBF A;  3K58 A;  4J42 A;  2VQE O;  1I5Y A;  3SYP A;  3K57 A;  4IL6 Z;  1Z2G A;  3M8A A;  3T1H B;  2JIZ G;  3SPG A;  3VQY A;  4CC5 A;  3I5D A;  1R3I C;  4UXN A;  1QVF U;  4MVO A;  1ZLZ A;  4K0K O;  4DXW A;  3ZED A;  3L9D A;  1KB9 F;  3PJS K;  5EBM C;  4PI2 A;  1AP5 A;  4PJ0 Z;  1OZ0 A;  1P84 F;  4AIL C;  2OIG A;  4I9W A;  1M57 C;  1FXK B;  4TQD A;  1G6U A;  1R3J C;  4UCO A;  2E5L O;  1PNK A;  3WFV A;  4JI2 B;  1OCC B;  2XT9 A;  3IJ4 A;  4JI8 O;  4YJ2 A;  1QCE A;  2XHB A;  3OW2 U;  5GTI Z;  4LNU A;  4MW3 A;  1AP6 A;  2ZE5 A;  1FXV A;  3B77 A;  1DF5 A;  2UXD O;  3T4D A;  3QNE A;  4ZOL A;  2M7W A;  4UB8 Z;  4LCU C;  2HVK C;  1B06 A;  5E79 Z;  3JAW B;  1I7F A;  1K92 A;  5BR8 B;  4JI4 O;  1UFI A;  1YTF B;  2YI8 A;  1FFX B;  4PDR A;  4MVZ A;  1B3Q A;  4UVC A;  1FXK A;  5LXT B;  1JA8 A;  5CA1 B;  3CCM V;  1IBM B;  2P22 C;  1XHX A;  2PZS A;  1AR4 A;  2YID A;  3HKC A;  3BPZ A;  1JJ2 U;  1X4T A;  2IU0 A;  3BY6 A;  1GK9 A;  1RPR A;  1BHA A;  4LF6 B;  2R70 A;  4AI8 A;  3P3N A;  2QWN B;  1QQC A;  3JD0 A;  3UO2 A;  3SJB C;  4RUE A;  3F5T A;  4MVR A;  3RFR A;  2JJ2 G;  2WLH A;  4LH7 A;  3FAV B;  3K79 A;  4ZOL B;  3S3X A;  2XAJ A;  2R9A A;  4B7K A;  5LMU O;  1BZK A;  3VQW A;  4QPK A;  4EFE A;  1RM1 B;  3SYC A;  1KD1 W;  4DR6 B;  3AG4 B;  1Q86 W;  3CRA A;  2HFE C;  1GTO A;  2UU9 O;  4OPH A;  4B3R B;  3K5O A;  2HR3 A;  1NTK H;  4AHC A;  2QKA A;  3CSX A;  4U3J A;  3HKC B;  3DC6 A;  4LF4 B;  2F23 A;  2IJJ A;  3AG2 B;  5GON A;  4PD4 F;  1VF7 A;  4C7U A;  1YIT V;  3OM3 B;  1Q90 D;  2OIE A;  1KMI Z;  2IW5 A;  3L70 H;  4WBN A;  5IJ9 B;  2JGD B;  4B7E A;  1Y6X A;  1TAE A;  4X62 O;  4HBN A;  1YTF D;  3RGB A;  3AK2 A;  1QU7 A;  3OUF A;  4UCU A;  1CPY A;  4J7J A;  1WP8 A;  3W7U A;  1V55 B;  1HP8 A;  4LFA B;  1HR0 B;  4H33 A;  4JAA A;  1HNW O;  2ITC C;  2XAS A;  5IJ0 B;  2LW7 A;  2AXT Z;  2YIB D;  2Q7E A;  2UXB B;  4B3M O;  5KMG B;  1K7D A;  5GW7 A;  4CS2 A;  5D5P A;  4DV2 O;  4OX9 O;  2JGD A;  1XNQ O;  2N05 A;  5EBW C;  3FKS G;  1W2B U;  4QIW F;  5IYB O;  3CX5 F;  1KC8 W;  2F4V O;  3ZN1 A;  1Y76 A;  1XNR B;  4WFF A;  2PF4 E;  2QSA A;  1M56 B;  2JEU A;  4GKJ O;  3QF7 A;  3CS5 A;  1HNZ O;  4PA4 A;  3CEI A;  2Q68 A;  2QWR B;  3ZJZ A;  1SQQ H;  3A8T A;  4ZKI A;  4QNH B;  4NXN B;  4NTW A;  3I56 V;  2EIJ C;  4I50 A;  1SZT A;  1FXK C;  1K3E A;  4IIJ B;  1S5L Z;  4PA7 A;  1M9N A;  2B5U A;  4X89 A;  1MSW D;  5KLV H;  3ZIA G;  2YEV B;  3CCQ V;  1BHB A;  2Y69 C;  3LDD A;  1PNL A;  1E1Q G;  3AK3 A;  2GUZ B;  3K0D A;  4J80 A;  1Z5V A;  1BMF G;  2JGU A;  2ZR2 A;  3W7X A;  3DSQ A;  4O2B A;  3DXR A;  5B1B B;  4O4I B;  3MAQ A;  5LP6 C;  2Q0O C;  1MMM A;  2Z5U A;  4PA3 A;  4QPJ A;  2QTS A;  1ZUQ A;  3KG2 A;  4X1K A;  3T1Y O;  2DW4 A;  1Y67 A;  2H94 A;  3VBB A;  4UCV A;  3N2K B;  2BOC C;  3CXH F;  2GSM B;  5H6Q A;  2QM7 A;  3B09 A;  5JWP A;  4X66 O;  1JFF B;  2EIK C;  4LWS B;  2CTR A;  1YHQ V;  4U7N A;  2UXD B;  2IJH A;  1K5S A;  2VS0 A;  2AZ0 A;  1ARO P;  3AG7 A;  2LP7 A;  4LH6 A;  2EIL C;  1VIB A;  4QE7 A;  2WSS G;  4D6T H;  5HFM A;  3Q4H B;  1JMK C;  4X1I A;  1E1R G;  2YUA A;  3K0G A;  3OTF A;  4FLY A;  3TXQ A;  4MTO A;  2WLN A;  1MZE A;  1KP3 A;  2QE7 G;  4X1K B;  4DV4 O;  3CWB H;  3UM7 A;  2VWJ A;  1N4C A;  3DTU B;  2ZIN A;  3ABL B;  4MSW C;  2LW1 A;  4CS3 A;  4PDL A;  4KHP B;  2CTW A;  5IY5 B;  4Z1V A;  1NS1 A;  2H3O A;  1GM7 A;  4X1Y B;  5LMU B;  4DK1 A;  1O9G A;  5CB4 B;  3FYE B;  2Q67 A;  1QR9 A;  3ABK B;  3UT5 B;  4CH5 A;  3CRC A;  2PI5 A;  1VQP V;  2OTL V;  2UU9 B;  2XTA A;  3Q4H A;  4JI3 O;  1L8D A;  4X1I B;  3ZMZ A;  4EB6 B;  3FX7 A;  3OMA B;  4LF5 O;  1YF2 A;  4O4H A;  1XMO O;  3AEI A;  5BZB A;  1HWY A;  2BTQ B;  5EYP B;  5JJN B;  3CP1 A;  4K8Z A;  2CK3 G;  4KXR A;  1NTM H;  3ZHQ A;  1KEC A;  4EFB A;  1PL0 A;  2IBZ H;  5CA1 A;  1Q82 W;  4TV8 A;  2QM4 A;  4PEL A;  1RSO A;  1RP3 B;  3CPW U;  2DQ0 A;  4X20 A;  2X0L A;  4X8A A;  1JOY A;  4QGP A;  3CYO A;  2WWW A;  1DLB A;  1GN4 A;  2W0F C;  3N2G B;  4DR4 B;  3TGU H;  3FB7 C;  5CB4 A;  3WB0 A;  5J2T A;  1AVM A;  2YIB A;  1NVP D;  3UT5 A;  4LFB O;  2L6L A;  4JAU A;  4U3F H;  4BIO A;  3RYI B;  3G4S V;  1TVK B;  2UXX A;  3H1K H;  2QR4 A;  4RUF A;  4EB6 A;  4DV3 B;  4TV9 A;  2D2C B;  4I9Q A;  1ZAU A;  4HZ3 A;  3P32 A;  4DR3 B;  3ASN C;  3H01 A;  1BCC H;  3X2Q B;  4YXW G;  2ZE7 A;  3ZHS A;  1YI2 V;  3D3I A;  3GWO A;  2MK3 A;  3FB6 C;  2Q6A A;  1KU9 A;  4GT1 A;  4U3J B;  2ZM6 B;  2UUC O;  3IC9 A;  4GLX A;  1SA0 B;  3JAK B;  4DV6 B;  1M4U A;  2F4V B;  4JI5 O;  1Y74 A;  1PP9 H;  1SQB H;  3IAY A;  1FYJ A;  4F6R A;  3JCZ A;  1I5X A;  4JI1 O;  4O4J A;  3BRC A;  3OR6 C;  3OT7 A;  1J95 A;  4FLT A;  4LF8 O;  1LNQ A;  5J2T B;  3ABT A;  4DV7 B;  1OCZ B;  5LYJ B;  2CH7 B;  4DV1 B;  4L8J A;  2Q9L A;  4JAV A;  2FML A;  2P90 A;  1NQT A;  4NB5 A;  4P9P A;  2EIN B; 
#chains in the Genus database with same CATH homology
 4R8C A;  3CCM V;  4WFB V;  1XL4 A;  1SER A;  4LBE C;  5LGT A;  1VQ6 V;  4TT3 G;  4XDK A;  4LP8 A;  1P4R A;  5CMU A;  1JJ2 U;  2YEV A;  2IU0 A;  3BY6 A;  1GK9 A;  5L3C A;  1RPR A;  5LHH A;  1BHA A;  3OEE G;  5LGN A;  3EHB B;  4MVQ A;  1AI5 A;  5H9C A;  1GM9 A;  2AHY A;  1ORQ C;  3E83 A;  3JD3 A;  2A79 B;  4GX5 A;  5L3F A;  3JD0 A;  1PD3 A;  2X7R B;  1Q7Y W;  4RUE A;  4MVR A;  3CMA V;  3W7S A;  2JJ2 G;  2WLH A;  5IYC O;  3R65 A;  4MVM A;  3E86 A;  4JTC B;  3K79 A;  1QR8 A;  1S77 D;  2XAJ A;  4GX0 A;  4CZZ A;  2EIN C;  1NH2 B;  3FB8 C;  2JEX A;  2EIL B;  3E35 A;  4P2Z A;  1DF4 A;  4QPK A;  3SYO A;  1S3J A;  1RM1 B;  1QVG U;  3SYC A;  1KD1 W;  3W7W A;  5B3S B;  3AG4 B;  3B8N A;  1Q86 W;  1S5H C;  2WPD G;  2ZD9 A;  3ETD A;  2ZQM A;  3STZ C;  4PDV A;  3ETG A;  2HFE C;  1GTO A;  2WLL B;  3DGE A;  3RW0 A;  5E1A C;  3ZMU A;  2LFR A;  4FIP C;  2JK5 C;  4WF9 V;  1GO3 F;  2B1I A;  2HR3 A;  4WFE A;  3UKM A;  1W0J G;  1K9M W;  1CP9 A;  3OR7 C;  1R6K A;  4CBC A;  4MVU A;  1DTO A;  5EBL C;  5B1A B;  3RVZ A;  3OFN G;  2X6C A;  4UUJ C;  2EIM B;  2HJF C;  4XDL A;  5B1N A;  1THZ A;  2IJJ A;  3AG2 B;  5B1B C;  1G4Y B;  2C2A A;  5L3E A;  3CCJ V;  1YIT V;  3ABK C;  2IH3 C;  3E8H A;  5EC2 C;  1CEZ A;  1BL8 A;  1H8H G;  3OM3 B;  1WPX A;  2IW5 A;  3JD1 A;  4G27 B;  4JTD B;  5C93 A;  3ZMV A;  4KP4 A;  1YTF D;  4P9O A;  3ASO B;  3OMI B;  3OUF A;  1CPY A;  5EK0 A;  1JQ0 A;  4RQE A;  3W7U A;  3K08 A;  1V55 B;  3G71 V;  1YJW V;  1F23 A;  3EFF K;  2Q69 A;  3ETE A;  4H33 A;  4WFA V;  2GHY A;  1NKD A;  3AG3 B;  3CCL V;  2AHZ A;  5B3S C;  3W7T A;  3LUT B;  1F51 A;  4RAI A;  2ITC C;  2OCC C;  1M1K W;  2XAS A;  1K34 A;  4U7O A;  1RM1 C;  2A0L A;  4GX2 A;  2WLK A;  3I55 V;  2P67 A;  3FYI B;  1EBO A;  3OEH G;  4QJF B;  4BIZ A;  2ZXW B;  4MT8 A;  3TK1 A;  1K7D A;  1OCO C;  3QO8 A;  2DYS B;  5GW7 A;  3SYQ A;  1NBM G;  1H2G A;  3TET A;  5CBH A;  3ABM B;  1S72 V;  4MTX A;  5L3D A;  3AG1 B;  1M57 B;  3JD4 A;  3HB3 B;  1TUE B;  5KUM A;  1KP2 A;  4TWK A;  4MS2 A;  2W6I G;  4RQF A;  1N8R W;  3E89 A;  4UV9 A;  3ASO C;  5LHI A;  1KQS U;  2UXN A;  1AR1 B;  5LGU A;  5IY5 C;  5EBW C;  3FKS G;  3ABL C;  3LSS A;  2Y48 A;  3OMN B;  4R7C A;  1COW G;  3CC2 V;  5HFL A;  1W2B U;  4QIW F;  5KA5 A;  5IYB O;  1KC8 W;  2X6B A;  3ZN1 A;  3ABU A;  4RO2 A;  4E2L A;  2NLJ C;  1OCC C;  2XAF A;  4WFF A;  3CXC U;  1MOF A;  1QLE B;  1H38 A;  1M56 B;  2JEU A;  1Y66 A;  3ZRW B;  3A0R A;  2QKS A;  3LNM B;  1VQO V;  2OT5 A;  2EIJ B;  4PA4 A;  5KA6 A;  1V54 B;  1OCR C;  2WLM A;  2BOB C;  4JPR A;  2Q68 A;  3AG1 C;  1R3K C;  3M99 B;  3ZJZ A;  1FFT B;  1SRY A;  2DYS C;  3FB5 C;  4ZKI A;  4QNH B;  4BAY A;  3I56 V;  2EIJ C;  3SPC A;  1SZT A;  3IFX A;  1FXK C;  3LSQ A;  1K3E A;  1H8E G;  3GB7 C;  5KUK A;  3SJQ C;  3IC7 A;  4PA7 A;  2IJK A;  4L87 A;  1M9N A;  2B5U A;  3MHH C;  3NXS A;  4X89 A;  1MSW D;  2F43 G;  2XAQ A;  3ZIA G;  2YEV B;  1K73 W;  3CCQ V;  1BHB A;  2Y69 C;  3LDD A;  1Y4M A;  1PNL A;  3K3W A;  1E1Q G;  2D3O W;  1VQ8 V;  3K0D A;  3E8F A;  2ZR3 A;  1NVP B;  2EZP A;  1BMF G;  4Z1M G;  2ZDI A;  2ZR2 A;  3W7X A;  1YSC A;  3IGA C;  3AG3 C;  5B1B B;  1KKD A;  2YSU B;  3F7V C;  4WFG A;  1EFR G;  2DWD C;  1NR1 A;  3SPJ A;  3QO7 A;  2Z5U A;  3WG7 C;  2ZDI C;  2Z3Y A;  4PA3 A;  4QPJ A;  1R73 A;  3KG2 A;  3CCS V;  1G8M A;  2DW4 A;  5DN6 G;  2H94 A;  3VBB A;  5CBF A;  5DM6 V;  1YJ9 V;  2ZXW C;  4G2K A;  2BOC C;  4R50 A;  1L1F A;  1S76 D;  2GSM B;  5H6Q A;  2QM7 A;  3HPL C;  2EIK C;  3ZMT A;  1M90 W;  4G28 B;  2HG5 C;  1YHQ V;  4U7N A;  1AJQ A;  2P7T C;  4MW8 A;  2IJH A;  2V1D A;  1ZWI C;  1K5S A;  2IU3 A;  1VQM V;  3E8G A;  3RBZ A;  2B1G A;  3OAA G;  2WAM A;  4N21 A;  3SPI A;  5J9P C;  1ARO P;  3E8B A;  5CBG A;  1PKX A;  2LP7 A;  2PI4 A;  2EIL C;  3CCR V;  1OCZ C;  4WFH A;  4BIU A;  3LDC A;  2EIM C;  4QE7 A;  2WSS G;  3T4Z A;  1K4C C;  3MD0 A;  4GX1 A;  1QLN A;  4DO2 A;  1GKF A;  4J9Z B;  3CCE V;  5HFM A;  4BW5 A;  1OCO B;  3SYA A;  1NR7 A;  1P7B A;  3P30 A;  4MVS A;  1E1R G;  3K0G A;  3ML0 A;  1AJN A;  1VQ4 V;  1PNM A;  4MTO A;  2V7Q G;  2WLN A;  1S0V A;  3OUS A;  1KP3 A;  2QE7 G;  3T2M A;  5H6R A;  3UM7 A;  2WLI B;  3ZMS A;  1AI4 A;  2IJI A;  3DTU B;  4ASU G;  4FK5 C;  2XND G;  3ABL B;  4MTF A;  4MSW C;  4ZBM A;  2QM8 A;  5EC1 C;  4KUM A;  2WLJ A;  1VQL V;  4JTA B;  1Q81 W;  4PDL A;  3RVY A;  2IH1 C;  3K04 A;  4I5S A;  4UVB A;  4PDM A;  2EIK B;  2XAG A;  5IY5 B;  4TSF G;  2EZO A;  1F4M A;  4J9Y B;  3CC4 V;  2QEX V;  4PA9 A;  1GM7 A;  3ZN0 A;  2LFS A;  1YIJ V;  4X88 A;  3B8M A;  1MAB G;  2KB1 A;  4P30 A;  2H8P C;  3FYE B;  3OGC C;  3CME V;  1NH2 D;  2Q67 A;  1JCH A;  1QR9 A;  4XDJ A;  3WG7 B;  1IXM A;  3ABK B;  4OXS A;  3CCU V;  2PI5 A;  2EBO A;  1WLE A;  1VQP V;  2OTL V;  3AG4 C;  3ZRX A;  1E79 G;  1AI7 A;  3D36 A;  1SET A;  1M56 C;  4EKW A;  4FMT A;  5FL7 G;  3G6E V;  3BEH A;  3ZMZ A;  3QO5 A;  4HYO A;  3X2Q C;  2DQ3 A;  1W0K G;  3OMA B;  4MTG A;  4Q20 A;  2JJ1 G;  4JYB A;  2JDI G;  5LHG A;  1GM8 A;  3AG2 C;  1SES A;  3AEI A;  5BZB A;  1B6Q A;  2X6A A;  1HWY A;  1VQ9 V;  1FS0 G;  4QE9 A;  3CP1 A;  5B1A C;  4F4L A;  3TCU A;  2CK3 G;  1KEC A;  3ABM C;  4UV8 A;  1JX9 A;  2K1E A;  1PL0 A;  1MG1 A;  1OCR B;  1Q82 W;  5CN0 A;  1F4N A;  1JPX A;  2HLD G;  2R9R B;  3ZRS A;  1QBZ A;  2QTO A;  2EJR A;  2FTK A;  4PEL A;  4R6Z A;  3SPH A;  3CPW U;  2DQ0 A;  3OE7 G;  4XBF A;  2X0L A;  4X8A A;  1JOY A;  4FJC C;  3CD6 V;  2DWE C;  3ZRV A;  1K4D C;  1I5Y A;  5IYD O;  3CYO A;  4JYC A;  3SYP A;  2WWW A;  1DLB A;  3K9A A;  3LDE A;  2W0F C;  3CC7 V;  3CCV V;  2P6J A;  2JIZ G;  3SPG A;  1K5Q A;  3FB7 C;  1R3I C;  4UXN A;  1QVF U;  4MVO A;  1GMG A;  1AJP A;  2A9H A;  4JGS A;  3MHS C;  4DXW A;  1V55 C;  4H37 A;  2DYR C;  1NVP D;  5L3B A;  1VQN V;  3JYC A;  2OCC B;  1OHH G;  1K33 A;  1ENV A;  3PJS K;  4JAU A;  5EBM C;  1OZ0 A;  1FXH A;  2NNU A;  5LBQ A;  3G4S V;  4I9W A;  3E2E A;  1M57 C;  2WLI A;  2UXX A;  1FXK B;  4RUF A;  1XL6 A;  2HKO A;  2XOK G;  1R3J C;  3F5W C;  3VOU A;  1PNK A;  3WFV A;  4HAM A;  3ZCC A;  1OCC B;  3K03 A;  4HZ3 A;  1R3L C;  4LC1 A;  3T1C A;  3P32 A;  1QLE C;  3JD2 A;  1QCE A;  2WLL A;  4N23 A;  3OW2 U;  1AI6 A;  2ATK C;  3ASN C;  3H01 A;  3X2Q B;  2ITD C;  1R6N A;  4YXW G;  4MW3 A;  1YI2 V;  3D3I A;  4PA6 A;  3GWO A;  1UJW B;  2Y69 B;  2MK3 A;  3FB6 C;  2Q6A A;  1FXV A;  5IDJ A;  2OTJ V;  4GT1 A;  3B77 A;  4JF3 A;  3K06 A;  4UVA A;  1DF5 A;  5CA3 A;  4FPP A;  1JVM A;  4WCE V;  3T4D A;  3QNE A;  1K97 A;  1VQ5 V;  1ROP A;  4GCZ A;  2M7W A;  4LCU C;  2HVK C;  3JCZ A;  2XAH A;  4KFM A;  1I5X A;  1YJN V;  1NJI W;  3OR6 C;  2R9I A;  1J95 A;  3ZRW A;  1LNQ A;  1K92 A;  5B1O A;  1V54 C;  3ABT A;  2QA4 V;  2W6J G;  1K8A W;  1VQK V;  5L3G A;  1YTF B;  1OCZ B;  1RPO A;  3STL C;  2DYR B;  1EZJ A;  4PDR A;  3ASN B;  3F7Y C;  4MVZ A;  1VQ7 V;  4UVC A;  2HVJ C;  4JAV A;  1FXK A;  2P90 A;  1NQT A;  4JAS A;  4P9P A;  2EIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...