4PDRA

Crystal structure of a k+ selective nak mutant in barium and sodium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdrA00
1K4CC 4GX1A 3E86A 4P30A 3RVZA 2DWDC 2X6AA 4WFHA 4H33A 3SJQC 4QE9A 4WFFA 4J9YB 4RO2A 3RBZA 1V55C 4OXSA 2X6CA 2WLIB 4P9OA 4R7CA 5CBHA 2HG5C 3K0GA 3LDDA 3E8BA 2WLHA 4UUJC 2WLIA 1P7BA 4GX5A 5EC2C 5EC1C 3SPGA 4G28B 4X8AA 1S5HC 5E1AC 2H8PC 2AHZA 3ASOC 3JYCA 4JTDB 4PDMA 3FB7C 3PJSK 1XL6A 2BOBC 2NLJC 4MW3A 2A79B 3ZJZA 3T1CA 3WG7C 2DWEC 5CBGA 4LBEC 3T2MA 3AG3C 3AG4C 2JK5C 2IH3C 2EIKC 4XDKA 2EIJC 2BOCC 1KKDA 4MTGA 2EILC 2ZD9A 1R3JC 5IY5C 4MVMA 4RAIA 5B3SC 4WFGA 3OR7C 1ORQC 1R3IC 3LNMB 3E83A 4TWKA 4MVQA 3LDCA 3SPJA 3ABMC 4PA4A 2EIMC 2YEVA 1R3LC 2EINC 2DYRC 4MVUA 3SPIA 4ZBMA 3UKMA 2WLKA 3VOUA 3E89A 3K03A 2ITCC 4H37A 4R50A 3AG2C 2A0LA 4MTOA 4P2ZA 4PA7A 3X2QC 3ABKC 3T4DA 4MVOA 5EBWC 4R6ZA 3FB6C 2HJFC 2Q67A 4HYOA 4I9WA 3IGAC 2WLLA 4MS2A 1M57C 3BEHA 4MSWC 5B1BC 2OCCC 2HFEC 1K4DC 5EK0A 5EBMC 4P9PA 3T4ZA 3K08A 3STLC 3TCUA 2Q6AA 4EKWA 4J9ZB 5BZBA 2WLJA 2A9HA 3AG1C 3F5WC 2R9RB 1M56C 3R65A 2X6BA 4KFMA 1G4YB 1R3KC 2DYSC 2QKSA 1OCCC 2Q68A 3OUSA 4PA6A 3SYPA 3SYOA 5J9PC 3E8GA 2WLNA 5KUKA 4RUEA 1OCRC 4MVZA 3RVYA 3STZC 4R8CA 5CBFA 3KG2A 3FB5C 3K0DA 1LNQA 3FB8C 3SPHA 2IH1C 2AHYA 4LCUC 4PA9A 4JTAB 4QE7A 3RW0A 2WLLB 3E8FA 4X89A 4QNHB 3E8HA 4GX2A 5EBLC 4GX0A 2Q69A 2ITDC 3K04A 3OR6C 4F4LA 1OCOC 3LUTB 3OGCC 4G27B 4PDVA 1QLEC 2Y69C 3F7YC 3SPCA 3SYQA 4PDRA 2QTOA 3LDEA 4PA3A 4MTFA 4BW5A 1V54C 2ZXWC 4RUFA 1J95A 4PDLA 3K06A 2K1EA 3ASNC 3TETA 4HZ3A 3EFFK 3GB7C 3F7VC 2KB1A 1XL4A 4X88A 3ZRSA 2HVJC 2P7TC 3HPLC 4MVSA 4MW8A 3UM7A 1BL8A 3OUFA 1ZWIC 4MVRA 2W0FC 5KUMA 3SYAA 3IFXA 4CBCA 4XDLA 5B1AC 1JVMA 3ABLC 2WLMA 4JTCB 4XDJA 4DXWA 4LP8A 4WFEA 1OCZC 2ATKC 2HVKC 3SYCA
chains in the Genus database with same CATH superfamily
4OPAA 3ABLB 1QU7A 1L8DA 1QCEA 2FB5A 2X6CA 1YVWA 2R72A 1Q3EA 5IYZB 2WLIA 4JI1B 5IYDO 1SQBH 1JJOA 3FB7C 2ZE8A 3A0RA 1FXKC 1DF5A 1R6KA 5BR8O 1ROPA 3P30A 5H2FZ 1AJQA 4GYCB 3RYCA 1H2SB 3APOA 2F4VB 5LA6B 5IY5B 2EILB 2DYRC 4EB6B 1LR1A 2JS3A 5FPRA 3GWKC 1YIJV 4QPJA 3IAYA 4L8JA 1F51A 2A3QA 3RT3C 3X2QB 1VMGA 2LJ2A 3AG2B 1VQ6V 3CEIA 4MT8A 4FFBB 4DRXB 2VQFB 2A9HA 1J5EB 2R9RB 2F93B 4KFMA 3G6EV 1UPGA 1H8EG 3OW2U 1V9PA 4X62B 3STZC 2HEPA 1K9MW 2EJRA 1NTKH 5KAFZ 1FJGB 5E79Z 1Y67A 5LP6A 4DV3B 1HWYA 2QM8A 5KHKA 3A8TA 4X66O 1RPOA 3K06A 2BSKA 5J2TA 3E22A 3GB7C 2E75B 2E5LO 3QVNA 3W7UA 5JJEB 2UXXA 4CBCA 2HP8A 1DLBA 2YICA 3A0HZ 4JTCB 4XDJA 1Y74A 4LP8A 2HVKC 2F23A 1JFFA 1XDCA 2XAJA 2JS5A 4P9OA 2HG5C 4CH4A 1AI4A 2JVDA 3FFQA 4PHZA 5IYZA 4G28B 1S5HC 4FLYA 4N21A 2IU3A 3HKCB 4LH7A 1S5JA 3DXRB 2LFRA 1S76D 1DF4A 1GH6A 5A9GA 2QKCA 2EIJB 3BRCA 1E1QG 2C2AA 1IBKO 1WB8A 5HFLA 5KMGB 4CH3A 2ITCC 4H37A 1FYJA 4K8XA 3D36C 1M57C 1WB7A 4D6TH 4FLVA 5L3DA 3D3QA 3T4ZA 4N23A 2ILMA 4I4TA 3F5WC 4DRXA 2ZR2A 4EFBA 2EBOA 5KAIZ 4LF6O 3UT5A 2Y48A 1MG1A 3K0DA 3OMAB 4YJ3A 2LFSA 5L3CA 1YTFB 3RW0A 2RCVA 3QO7A 1NH2B 3K04A 2P06A 4G27B 4PDVA 3K5LA 5J2UB 3WB2A 1V54C 2UUCO 4ASUG 4TV9A 3G71V 1TVKB 4X66B 4RQEA 1XL4A 1I5XA 2RJZA 2V7QG 1WJZA 3CPWU 5B1OA 2P22C 2E5LB 4XDLA 1MNGA 2CAZC 5IYCO 4B3MO 2ATKC 4O4JB 1V55C 5AG2A 3N27A 4UB8Z 4DR5O 4TUYB 3QTCA 4Q6GA 1L0LH 4GZRB 3SPGA 1VARA 4J42A 4PDMA 4CS4A 4RQFA 2UU9O 2BOBC 4L87A 3CWBH 3BY6A 4MW3A 3ZHUA 2E3CA 4YIPA 2NN4A 4LBEC 1U96A 3HKCA 2EIKC 4FLZA 2ZD9A 3DXRA 4NB5A 4JGSA 3LDCA 5FNVB 3GVMA 4MVUA 3SPIA 2WLKA 4JV5O 1IBKB 1KECA 1PP9H 2ZE5A 3AK3A 3CCEV 2IW5A 3KCXA 1PNMA 5KHIA 2R9AA 4P9PA 4ZKIA 2RDCA 3K59A 2MW2B 3VQYA 3ABTA 5C93A 3TXQA 1R3KC 4JAVA 5ITZA 3QO5A 3RVYA 4WBNB 1PV0A 5H9CA 4LF6B 1G8MA 1QBZA 1YJNV 3MD0A 4X89A 2K9PA 2H3OA 3U0ZA 1OHHG 3L71H 4RWUA 3RYFA 1AI5A 2ZM6O 3C3TA 5J2UA 3JASB 1QVGU 2ZNIA 3ZBHA 3L70H 1PPJH 1K97A 2DQ0A 5L3EA 2UUCB 3T1YO 1TVKA 5LYJB 1XNQO 2XASA 4AILC 2YIBD 1NT2B 1AR1B 4U3JB 3D3IA 4B3MB 4DV0O 4F6RB 1VQ7V 4O4JA 4E4EA 3B40A 2DQ3A 4BIOA 4ZIBA 4YY3O 2WA3A 4UUJC 1QLNA 4DR5B 2HHHO 2X0LA 4HNAA 4A5UB 4X9QA 2N05A 2CGOA 5K1XA 4UVBA 3HKDB 2UU9B 1AVMA 3AG4C 4JAAA 3JD2A 4J10A 5H6RA 3ETQA 5IJ9B 1R3JC 4RAIA 3WG7B 3OR7C 2ZINA 1M9NA 2EIMC 3W7WA 1GM9A 4JYYA 5FNVA 2CUGA 4FFKA 3ZMSA 1K8AW 3E89A 1THZA 1MSDA 4NXMO 4JV5B 2QTSA 3B8NA 4C7UA 1KUQA 4LR3A 2AXTZ 5B1BC 1GKFA 1VQKV 2Q5ZA 1KP3A 3TCUA 5LXTA 4DK1A 2WLJA 3ZHQA 1K34A 2Q73A 4LF7O 1G4YB 2DYSC 4U7OA 3OUSA 1Q6IA 2PTMA 3E8GA 1SZXA 4G2KA 1WNSA 1BSMA 1COWG 2Y0PA 1YITV 4WBNA 3CRQA 2IH1C 1W2BU 4K8ZA 1K92A 4IIJB 1VQPV 1RSOB 5CA1B 2UUAO 1X4TA 2W6JG 3E2EA 1QLEC 1QR9A 3Q4HB 4LWSA 2ZM6B 4GUNA 3OD4A 4UCSA 1Q82W 3O9OA 4UXNA 3ZMVA 2KB1A 1S3JA 3ZRSA 4EEQA 4KUMA 2ZCEA 3UM7A 5L3BA 3ASNB 5KUMA 5LYJA 4O4IB 3T1YB 1XNQB 3ABLC 3DC5A 3M99B 3BPZA 4YIOA 1GRJA 2YS8A 2Y0IA 3RVZA 1XHZA 4WFFA 5EYPA 3LSSA 4ZI7B 3K58A 1TUBB 1Q90D 1XILA 1YF2A 2WAMA 4R7CA 4F6RA 4Z1VA 4LFBO 4K3AA 4DV0B 1Z5VA 4GX5A 3HB3B 4YY3B 4GKJO 2Z5UA 4JTDB 1YZBA 3RWRD 4JI2O 3ZRWB 1MSWD 1R6TA 1KKCA 2HHHB 1RPRA 1BQZA 5FLXN 3ASOB 3HKDA 1KP2A 5IY5C 2EILC 1NU1H 3G80A 5IJ9A 2CE4A 3H1LH 4JF3A 1LUWA 1IVSA 3KZIZ 1Z5WA 3MHSC 4TT3G 1AJNA 1YSCA 2G38A 3X2QC 1XMQO 3AG2C 3W7XA 3JCUZ 3T4DA 1D2DA 1OV9A 5HFMA 3BAAA 5KX5B 4NXMB 3H1KH 2V4DA 3ABKB 1NS1A 1Q43A 3RYCB 5JJJB 1NJIW 2Y4UA 1SA0A 1GMGA 3MAQA 4O4LB 5J9PC 1KC8W 5LGNA 4LF7B 5CN0A 3FB8C 2PI4A 2AHYA 1H2MA 1FFTB 1OCRB 4BAYA 1RP3B 4J41A 4DK0A 1W0KG 1I94O 1CPYA 4IIJA 1RSOA 4GKKO 1VQ5V 2UUAB 1VQ9V 3JSLA 3Q4HA 2IJKA 2K1EA 4LF4O 3TETA 3EFFK 3B77A 2N04A 2EX3A 2AZ2A 1DTOA 1VQMV 4O4IA 3GWOA 3EXAA 5LP6B 2GTSA 3VQVA 4GX1A 2V1DA 4FLUA 5JQGA 2PY5A 5DECA 1P7BA 3HKEB 3W7TA 2FMLA 3QO8A 4DV2O 4LFBB 2AHZA 1NBMG 3PJSK 2NLJC 5D5QA 4GKJB 4JZGA 3S3XA 3ZRWA 5CBGA 4JI2B 2JK5C 1S72V 5GONB 3K5MA 2EIJC 1IXBA 2DN9A 2LGQA 4MVMA 4I0XB 5LBQA 1N36O 3QNEA 2IJIA 2P90A 2L35A 3RGBA 2XAGA 3ABMB 2P5OA 4DR4O 5BMVB 3M8AA 5JCOC 4J80A 5EBWC 2FTKA 1XMQB 4IHJA 3ZMTA 4MSWC 5KX5A 1O9GA 3H1JH 4B3SO 1IURA 1S77D 3OEHG 3BA8A 3K3WA 2QDOA 4O4LA 3AG1B 1M56B 2VRZA 4FJCC 2PI5A 1JR9A 1LNQA 1KBHA 4QNHB 1I0HA 4NTWA 2IBZH 2XAFA 1F23A 4YXWG 4I4TB 1VF6A 3F7YC 1I94B 2B5UA 4GKKB 5LHHA 1WLEA 3UT5B 4X20B 4YJ3B 4LF4B 3H1IH 2JRIA 3CE2A 4IGGA 3OUFA 2W0FC 2B1GA 3RN4A 3ABUA 2Z0AA 2IJHA 1SQGA 4GT1A 2RNBA 4LF5B 5CMUA 2GUZB 3JD1A 5B1AB 4WFHA 3RFRA 5FPOA 4TV9B 1H2LA 1SF9A 4X8AA 1HNXO 3HKEA 1MA1A 2QR4A 4DV2B 3BVOA 4CH6A 3WU2Z 1AP6A 4NTXA 2Q8VA 5GONA 1H38A 4I0XA 3JAWB 5L3GA 5IE9A 1N36B 3ZN0A 3G4SV 1AR4A 5BMVA 4DR4B 4E2LA 1K33A 1JX9A 3LSQA 3OTOB 2BE3A 5EBMC 1JPXA 3OMIB 1VP7A 2OCCB 1JOYA 4B3SB 2BTQB 3G67A 5BXZA 1H2NA 2B9ZA 4PA6A 1RFYA 3CCLV 3THOA 1BE3H 3CP1A 3OT7A 3E8FA 3CCQV 2JEXA 1XQ8A 3OE7G 5LMNO 2ETNA 3CC7V 4IL6Z 5EIBC 4PDRA 3CCVV 5ITZB 1XOUA 4DV4O 3CB2A 4X20A 2ZXWB 2PYJA 2VQEO 4DR6O 1ZWIC 2AGAA 2DJVA 1EN6A 3FAVB 3RYFB 2CTPA 4TQFA 2DWDC 2GUZA 2ZT9B 5EC2C 4JI0O 4DR3O 3SJBC 2ZNJA 1SQXH 1HNXB 4PJ0Z 2DOSA 3WG7C 1WN7A 1BS3A 2M7WA 3SR2C 5A2QN 2QWQB 2XTAA 2Z3YA 4TOIA 1KMIZ 1GK9A 1GN4A 3JALB 1B3QA 2XUMA 3JAWA 2A06H 4LNUB 4ZBMA 2WA4A 3N2GB 3RYIA 1SQVH 4HNAB 2ADPA 1EN5A 2WLLA 3BEHA 3CJHA 4UVAA 3R66A 4I50A 1AR5A 4HAMA 2BTOA 4BW9A 3WB0A 2QKSA 3SYPA 2BTQA 4PV1B 2OCHA 4J7KA 5CA0A 1OCCB 1DK1A 4LCUC 4PA9A 2B1IA 1N8RW 5LOVB 2UXDB 5B66Z 1QR8A 2AZ0A 5LXTB 4ICGA 3OGIB 2R70A 5LMNB 4WCEV 3LDEA 1SC5B 4KL1A 3TGUH 1ZTEA 3A2FA 3ASNC 5JJNB 5H6QA 3L72H 3HPLC 4DV4B 4IYIA 1L1FA 1QVFU 1S0VA 2VQEB 1WPXA 4DR6B 2IU0A 3DGEA 4WFEA 2Q0OC 2JGUA 3FAVA 1PL0A 2ODMA 2YIDA 4LWSB 1E1RG 1OCZB 1PNLA 3HR0A 1E79G 1M1KW 1ZAUA 1MZEA 2H8PC 2W6IG 3ASOC 2ADQB 4JI0B 4DR2O 1VQLV 2DMXA 2ZR3A 4FLXA 4DR3B 4W4KA 5IWAO 2XAQA 2HJDA 4MTGA 3AEIA 2L6LA 5EYPB 1AJPA 4WFGA 3J7AU 4TWKA 2OIEA 2UXBO 2EJ7A 1TUEB 3JALA 1HNZO 5KLVH 2KSDA 1YTFD 1SRYA 1M90W 4LNUA 5EZYA 1KYOF 4MTOA 4YHHO 3ABKC 3N2GA 1NH2D 4KP4A 2HJFC 4XBFA 2GTAA 2Q6AA 1UFIA 4J9ZB 5BZBA 4AI8A 1BCCH 2X6BA 5LMUB 4LH6A 4FLTA 3SYOA 4KXRA 1GM8A 5KUKA 1OCRC 1D5NA 4B7KA 3KG2A 4WFBV 1VF6C 2PGGA 1FXVA 5DN6G 1GN2A 2QM7A 5LOVA 1JJ2U 5EBLC 2E76B 2ITDC 1SS3A 3AK1A 3AG7A 4QJFB 5D5PA 1SA0B 1SKVA 3AK2A 2F43G 2PYLA 1RM1B 1NVPB 1IZ3A 1OCOB 4RUFA 1IBMO 3BCCH 2P4VA 1A32A 4EFEA 1KQSU 4DV5O 2P7TC 2OIGA 1HW7A 5LP6C 2MK3A 2UXCO 5B5EZ 2BCCH 1BZKA 4O2AA 1VIBA 4X65O 3JATA 3CC4V 4DV6O 4TV8B 4OX9B 2R9IA 3ZHRA 1BHBA 3E8BA 1M5IA 1BGYH 2ZE7A 3P3PA 4ZHQB 4CZZA 1XHXA 1M93A 1VQNV 3CRRA 3ZMUA 5IT9N 3ZJZA 3FYEB 1R1BA 4DR2B 2EZPA 2QWNB 2OWOA 1CP9A 2Y4TA 4XDKA 4GLXA 4BWAA 2Q0AA 4NKGB 5IWAB 2YC0A 3LSUA 3J80N 4AQYO 3AG3B 5JQGB 3TJTA 3G6BA 3ABMC 3H01A 1N32O 4JPRA 5B3SB 5KHHA 3ZCCA 2UXBB 3VBBA 5JH7A 3K03A 4P2ZA 1HNZB 3DSQA 2EINB 4MVOA 1W59A 1QHTA 5CB4B 4YHHB 3ZHVA 5BY1A 2QJ1A 2QE7G 1K73W 4YJ2B 3RYHA 1WP7A 2CTWA 4QIWF 3AG1C 3OFNG 1M56C 5EIBD 4ABMA 2YUAA 5LHGA 3SJCC 5LHIA 2Q68A 5DM6V 2KKWA 1EZJA 2WWWA 1F7YA 2X7RB 4JI7O 4R8CA 1OZ0A 1WPBA 4IHJB 4QE7A 3S3WA 4FM1A 3OR6C 1B6QA 2WSSG 3JARA 3JAMN 3J81N 4JYBA 1GTOA 2Y69B 1JMKC 3CRMA 1AI7A 1IBMB 3UCSC 4BIZA 5GTIZ 3UO3A 4DV5B 4FVMA 5B1AC 1GN3A 1Q6HA 2UXCB 4DXWA 1XMOO 1H2GA 4OPHA 4DV1B 3QG5A 4H33A 3K9AA 4J9YB 1BT8A 4Z1MG 3E35A 3IJ4A 3CRCA 4X65B 4TV8A 3LDDA 4DV6B 2WLHA 1NQTA 1ENVA 3CMEV 5E1AC 2ZIMA 4JZ2A 4UCUA 4ZHQA 2IM9A 1WAZA 4X1KB 4FM2A 4LF5O 1NVPD 2QEXV 3APQA 1FXHA 5IJ0A 4NTYA 2GDSA 3CCUV 2XNDG 4AQYB 2FKXA 4NR1A 1N32B 2YXLA 4PA7A 1YCIA 4J11A 3FB6C 4NVPA 5CB4A 1YJ9V 4D7TA 2OCCC 4K35A 3BABA 2QM4A 4EKWA 4YJ2A 4TSFG 4O4HB 2CH7B 3ZHTA 5KHGA 4IT5A 3ML0A 4LFAO 3HKBB 4B08A 3FB5C 4FIPC 4JI7B 2ZDIA 3CCJV 3OTOO 1Y6XA 1HNWO 3ZRVA 4F4LA 2RMKB 3OGCC 1ZX3A 2Q7HA 3JAKB 1S5LZ 4CS3A 4MTFA 1KB9F 2ZXWC 4LFCO 2GV9A 5JVDA 3UO2A 1EFRG 2RN9A 3U10A 1NR1A 3JD4A 4MVRA 3SYAA 1NTMH 1I5YA 5KHJA 1ZL8B 5C8YB 1OJHA 2X6AA 4NYKA 1XMOB 2O57A 4JYAO 1XNRO 4UCRA 4HBNA 1NTZH 1UJWB 3DC6A 1DGSA 3D8CA 3CMAV 3JYCA 2FYUH 3CHXA 3NXSA 3O65A 4X1KA 1AROP 1HR0B 2XOKG 4J7ZA 1H8HG 2IH3C 1KKDA 3C90A 1L0NH 4AHCA 3SPJA 1YXBA 4D7SA 4DR1O 3ICXA 1VQ4V 1WA8A 3MDSA 1N33O 1BQ0A 3JSNA 4X1IB 3VOUA 2OYQA 4R50A 2A0LA 2NR5A 1IBLO 1SESA 4R6ZA 1AILA 2JJ2G 4MS2A 4O2BB 1XREA 2XHBA 1K4DC 1URFA 3KKYA 3CCSV 3B8MA 1MZFA 1PKXA 2YSUB 5IDJA 3OTFA 3R65A 4O4HA 2CH7A 4DV7O 2VWJA 1OCCC 3L75H 1TAEA 3H1HH 1P84F 3RYIB 4MVZA 4LFAB 5CBFA 2QWPB 3HKBA 1TA8A 4OGQB 4K0KO 1IXMA 2WLLB 2F95B 3K57A 3CJHB 4GX2A 4I50B 1X59A 1HNWB 1NKDA 4PELA 1K5SA 3JAKA 1K5QA 4PDLA 4HZ3A 1EBOA 5CA0B 4LFCB 2HVJC 2ZQMA 2LW7A 4MVSA 2UXDO 3L74H 2DE0X 3CRAA 4UVCA 4I5SA 3T1HO 1OCZC 1ZL8A 2H94A 5BR8B 1VQOV 1P4RA 2HR3A 2ZE6A 5C8YA 4OXSA 5LA6A 3PN1A 5CBHA 4JYAB 4B3TO 4PD4F 1XNRB 3WB1A 4EB6A 4UV8A 5EC1C 1FKAO 1AB3A 2JJ1G 3SDLA 2OT5A 4LF9O 2YIAA 2ARHA 3H9VA 2BOCC 1F4NA 2KQXA 3BA9A 1FS0G 1HP8A 3ZIAG 3TK1A 4FFBA 1FXKB 2LQTA 1N4CA 3LNMB 3E83A 1PM9A 1B06A 4DR1B 2CTRA 1N33B 4X1IA 1QQCA 2DYRB 5LL6Y 3OM3B 4JI3O 3IGAC 1D5AA 1K7DA 1IBLB 2DW4A 2HFEC 5GW7A 4O2BA 5DEDA 2EULA 1Q81W 2QWRB 4FMTA 2Q7EA 1ZLZA 4X64O 1LUVA 2VWKA 4DV7B 2QSAA 5EZYB 3I55V 1JCHA 3B2EE 3TXSA 1XUQA 4I9QA 1VF5B 3CXCU 4FLWA 3L9DA 3FYIB 2Q4PA 2YI8A 1P49A 4GX0A 1RM1C 1Y66A 1Y76B 4FZ1A 4K0KB 1OCOC 2CDYA 3LUTB 1SQFA 3K5OA 5LMUO 2PF4E 3CXHF 3SYQA 4B7EA 3CD6V 4JI4O 4PA3A 4MTXA 1M4UA 5L3FA 3QF7A 3CCMV 1F4MA 1TGOA 1G1XB 3ZEDA 3F7VC 4I55B 5CA3A 2FL4A 1Y4MA 2PUSA 4BIUA 3IFXA 1N0JA 4UCVA 1SETA 3L73H 4W4LA 3SYCA 3ETGA 4P30A 1MABG 3T1HB 1YI2V 3RBZA 2YDEA 1FD9A 1W0JG 2LO1A 3ZS8C 4NXNO 1GAXA 2JGDB 5GTHZ 4U7NA 4KHPO 1ZUQA 5LGUA 3JD3A 5KMGA 4CS2A 4B3TB 1CXZB 1KD1W 2QA4V 1N0NA 1WP8A 1NZ6A 5H5NA 3T1CA 2DWEC 4DYLA 3T2MA 4O2AB 3AG3C 3B4SA 5JCOA 2YXHA 1Q7YW 2GBOA 2YIBA 4LF9B 3JATB 3ZHSA 5B3SC 2P6JA 3A0BZ 4DW1A 1R3IC 4OX9O 3MHHC 4MVQA 1FXKA 3ZMZA 4PA4A 1R3LC 2EINC 1ZSPA 1GM7A 3N2KB 2XT9A 2Q67A 4HYOA 2D3OW 1SQPH 5EK0A 5TISZ 4JI3B 3K08A 3STLC 2CK3G 2F66C 2GHYA 1M57B 1VQ8V 2EZOA 5IYBO 2LGWA 2ZDIC 1PL4A 4RUEA 5JH7B 3SGIA 1Q8IA 2JIZG 4X64B 3B09A 1AI6A 3W7SA 4DUYO 4B3RO 1H2KA 1Q6UA 1N34O 3E8HA 2KG7B 3RYHB 1FFXB 1YDXA 3OMNB 1Y76A 2Y69C 3CYOA 3K79A 2QTOA 4JI4B 4TUYA 2P67A 2XAHA 4JI5O 2Q7GA 4DW0A 2M6YA 5FL7G 2ZIOA 4X88A 1V54B 3P32A 4H0LB 2UUBO 2YI9A 3FX7A 4I55A 2JDIG 1BL8A 2F1MA 4FZ0A 1I7FA 3WFVA 1VEWA 4UCOA 1JVMA 2WLMA 3LNNA 4DO2A 3JARB 1KU9A 2WPDG 4CH5A 2P4KA 4QE9A 4RO2A 5F2VO 4JI6O 4CC6A 3K0GA 1FAFA 3K5NA 4Q20A 1V55B 4NXNB 2JGDA 3CS5A 2YXYA 1NI8A 1GO3F 1XBLA 1XL6A 4GCZA 4LF8O 1Q5OA 4KHPB 3ETEA 1US6A 3FD9A 2CGNA 4DV1O 2LW1A 2PZSA 1ORQC 2YEVB 4H13B 1MOFA 2EIKB 5LGTA 3UQ8A 3UKMA 1QNMA 3M7MX 4U3FH 3N2KA 4WFAV 3F5TA 1YHQV 4DR7O 2CTQA 3VQXA 1JQ0A 4PI2A 5IJ0B 1CEZA 4FPPA 4TQDA 4JI8O 1O9HA 3D36A 5K1PA 3JASA 4Z2WA 2A7WA 1SZTA 3I56V 4PI0A 3BHPA 3K9SA 2GSMB 5JWPA 2ZKOA 4FM0A 2W0XA 4J7JA 4DUYB 4B3RB 5KA6A 2Q69A 1BMFG 1N34B 4X1YB 2KG7A 1FFXA 2D2CB 2OTJV 4UV9A 2JEUA 4U3JA 2RQ6A 3DTUB 3IC9A 4ZOLB 1XEQA 1R6NA 2AW9A 4LC1A 5KA5A 1R73A 4DUZO 3U11A 1YEWA 3CSXA 4MW8A 4JI5B 3JCZA 2UUBB 4I7ZB 4FK5C 2E74B 1MMMA 1U97A 4UFZA 1B04A 4H44B 1K4CC 3E86A 4JASA 3SJQC 4IYHA 1P7GA 4JI1O 2WLIB 3KCYA 1IDSA 1VF7A 4BR6A 2LP7A 4JI6B 3EVKA 1HDJA 5JVDB 1T5EA 3OAAG 3ZX6A 2QWOB 3JD0A 4CC5A 3CX5F 1AP5A 2A79B 2Q9LA 1SQQH 2IJJA 4LF8B 1IX9A 2F4VO 1EZVH 1Z2GA 3AG4B 1Q86W 4UB6Z 2YEVA 1GN6A 2QKAA 1BHAA 2HKOA 4F6EA 2EIMB 3BFRA 4QGPA 3ZRXA 1HR0O 4I9WA 3EHBB 3CCRV 1PNKA 2VQFO 1J5EO 3IC7A 4JAUA 5CA1A 4DR7B 4UCTA 5B1BB 1WA8B 3VQWA 4X62O 2WLNA 2VS0A 3CC2V 4JI8B 3ZN1A 3SJAC 1EM1A 5B1NA 1NR7A 1I08A 1FPOA 1FJGO 2DYSB 4JYCA 2QGNA 1EN4A 3SPHA 3P3NA 4JTAB 2N74A 1YJWV 4DV3O 1G6UA 4WF9V 3ETDA 4X1YA 3SPCA 4BW5A 4ZI7A 2BSKB 1J95A 5J2TB 1TUBA 4ZOLA 3E22B 1QLEB 2HLDG 1XI1A 3FKSG 4QPKA 2UXNA 3C3SA 2OTLV 1K3EA 1SERA 1JA8A 1PD3A 4DUZB 2NNUA 3I5DA 3OEEG 1Y74B 1JFFB 3NR7A
chains in the Genus database with same CATH topology
2H94A 1VQOV 1P4RA 1PL0A 3RVZA 3ABLB 4WFFA 2HR3A 3LSSA 1E1RG 1QCEA 4OXSA 1OCZB 1PNLA 2WAMA 2X6CA 1E79G 4R7CA 5CBHA 1M1KW 2WLIA 4GX5A 3HB3B 5IYDO 4UV8A 5EC1C 2H8PC 2W6IG 2Z5UA 3ASOC 4JTDB 3FB7C 3ZRWB 1VQLV 1MSWD 2JJ1G 2ZR3A 3A0RA 2OT5A 1RPRA 1FXKC 1DF5A 3ASOB 1R6KA 2XAQA 1KP2A 2BOCC 1ROPA 3P30A 1F4NA 1AJQA 2EILC 3AEIA 4MTGA 1FS0G 3ZIAG 5IY5C 3TK1A 4JF3A 1FXKB 1AJPA 4WFGA 3LNMB 4TWKA 3E83A 1TUEB 5IY5B 2EILB 2DYRC 3MHSC 4TT3G 1YTFD 1SRYA 1M90W 1AJNA 1YIJV 1YSCA 3X2QC 3AG2C 4MTOA 3W7XA 3ABKC 2DYRB 4QPJA 1NH2D 3T4DA 4KP4A 2HJFC 3OM3B 3IGAC 5HFMA 1K7DA 1F51A 4XBFA 3X2QB 3AG2B 2DW4A 1VQ6V 3ABKB 2HFEC 5GW7A 4MT8A 1NJIW 2Q6AA 4J9ZB 5BZBA 1Q81W 2A9HA 2R9RB 2X6BA 4KFMA 1GMGA 3SYOA 4FMTA 3G6EV 1GM8A 5J9PC 1KC8W 5KUKA 5LGNA 1H8EG 1OCRC 5CN0A 3I55V 3OW2U 1JCHA 3STZC 3KG2A 4WFBV 1K9MW 2EJRA 3FB8C 2PI4A 3CXCU 2AHYA 1FXVA 1FFTB 1OCRB 4BAYA 5DN6G 3FYIB 2QM7A 1JJ2U 5EBLC 4GX0A 1RM1C 2ITDC 1Y66A 1W0KG 1CPYA 1OCOC 3LUTB 4QJFB 1HWYA 3SYQA 1VQ5V 3CD6V 2F43G 2QM8A 1RM1B 1NVPB 1VQ9V 4PA3A 1OCOB 4MTXA 4RUFA 1RPOA 5L3FA 3K06A 3CCMV 1F4MA 2IJKA 2K1EA 3TETA 3EFFK 3GB7C 3F7VC 1KQSU 5CA3A 3B77A 2P7TC 1Y4MA 3W7UA 2MK3A 2UXXA 3IFXA 4BIUA 4CBCA 1DTOA 1DLBA 4JTCB 1VQMV 1SETA 4XDJA 3GWOA 4LP8A 2HVKC 3SYCA 3ETGA 4GX1A 2XAJA 1MABG 4P30A 2V1DA 1YI2V 3CC4V 3RBZA 1W0JG 2R9IA 4P9OA 2HG5C 1BHBA 1AI4A 3E8BA 1P7BA 3W7TA 3QO8A 4U7NA 4G28B 5LGUA 1S5HC 3JD3A 2AHZA 4CZZA 1NBMG 1KD1W 2QA4V 3PJSK 4N21A 1VQNV 2IU3A 3ZMUA 2NLJC 3ZJZA 3FYEB 3ZRWA 3T1CA 2DWEC 5CBGA 3T2MA 2EZPA 3AG3C 2LFRA 1CP9A 2JK5C 1S72V 4XDKA 2EIJC 1S76D 1Q7YW 1DF4A 4MVMA 5LBQA 5B3SC 2P6JA 1R3IC 3MHHC 3AG3B 3QNEA 1FXKA 4MVQA 2IJIA 3ZMZA 3ABMC 2P90A 2EIJB 3H01A 4PA4A 1E1QG 1R3LC 2C2AA 2EINC 4JPRA 5B3SB 5HFLA 3ZCCA 3VBBA 1GM7A 3K03A 2ITCC 4H37A 2XAGA 3ABMB 4P2ZA 2EINB 4MVOA 5EBWC 2FTKA 2Q67A 4HYOA 2D3OW 3ZMTA 4MSWC 1M57C 2QE7G 5EK0A 1K73W 5L3DA 4QIWF 3T4ZA 3K08A 3STLC 4N23A 2CK3G 2GHYA 1M57B 3AG1C 3F5WC 2EZOA 1M56C 3OFNG 1VQ8V 1S77D 5LHGA 5IYBO 2ZR2A 3OEHG 5LHIA 2Q68A 3K3WA 2EBOA 2ZDIC 5DM6V 4RUEA 3AG1B 1EZJA 1M56B 2WWWA 2X7RB 4FJCC 4R8CA 1OZ0A 2Y48A 2PI5A 1MG1A 2JIZG 3K0DA 3OMAB 1LNQA 1AI6A 3W7SA 2LFSA 5L3CA 1YTFB 4QE7A 3RW0A 4QNHB 3E8HA 3QO7A 1NH2B 3K04A 3OR6C 2XAFA 3OMNB 1F23A 4G27B 1B6QA 2WSSG 4PDVA 4YXWG 2Y69C 3CYOA 3F7YC 3K79A 2B5UA 2QTOA 4JYBA 1V54C 1GTOA 4ASUG 5LHHA 1WLEA 2Y69B 2P67A 2XAHA 3G71V 1AI7A 5FL7G 4RQEA 4X88A 1XL4A 1V54B 1I5XA 3P32A 4BIZA 2JDIG 1BL8A 2V7QG 3OUFA 2W0FC 2B1GA 3CPWU 5B1OA 3WFVA 3ABUA 4XDLA 5B1AC 1JVMA 2IJHA 2WLMA 4GT1A 4DXWA 4DO2A 1H2GA 5IYCO 2ATKC 5CMUA 2WPDG 3JD1A 5B1AB 4WFHA 4H33A 3K9AA 4QE9A 4J9YB 4RO2A 1V55C 4Z1MG 3E35A 3K0GA 3LDDA 2WLHA 1NQTA 1ENVA 4Q20A 3SPGA 3CMEV 4X8AA 1V55B 5E1AC 4PDMA 4RQFA 1GO3F 1XL6A 4GCZA 2BOBC 4L87A 3BY6A 4MW3A 3ETEA 4LBEC 1NVPD 2QEXV 2EIKC 2ZD9A 1FXHA 1H38A 1ORQC 2YEVB 3CCUV 4JGSA 3LDCA 1MOFA 2EIKB 5L3GA 4MVUA 5LGTA 2XNDG 3SPIA 3UKMA 3ZN0A 2WLKA 3G4SV 1KECA 4PA7A 4WFAV 3FB6C 3CCEV 1YHQV 2IW5A 4E2LA 1K33A 1YJ9V 1JX9A 1PNMA 2OCCC 3LSQA 5EBMC 4P9PA 4ZKIA 1JQ0A 1JPXA 3OMIB 4EKWA 1CEZA 4TSFG 4FPPA 2OCCB 3ABTA 1JOYA 3D36A 5C93A 3ML0A 1R3KC 4JAVA 4PA6A 3QO5A 1SZTA 3I56V 3RVYA 3CCLV 3FB5C 5H9CA 2GSMB 3CP1A 4FIPC 1G8MA 1QBZA 1YJNV 3E8FA 3CCQV 3MD0A 2JEXA 2ZDIA 4X89A 3CCJV 3OE7G 5KA6A 2Q69A 1OHHG 3ZRVA 1BMFG 4F4LA 3OGCC 3CC7V 1AI5A 2OTJV 4UV9A 2JEUA 3DTUB 4PDRA 4MTFA 3CCVV 1QVGU 2ZXWC 1R6NA 1K97A 2DQ0A 4LC1A 5KA5A 1R73A 5L3EA 4MW8A 2ZXWB 1EFRG 2XASA 1NR1A 3JD4A 1ZWIC 3JCZA 4MVRA 3SYAA 4FK5C 1I5YA 1AR1B 1K4CC 3E86A 2DWDC 3D3IA 4JASA 2X6AA 3SJQC 1VQ7V 2DQ3A 2WLIB 4UUJC 1QLNA 2LP7A 5EC2C 1UJWB 3OAAG 3CMAV 3JD0A 3JYCA 2X0LA 2A79B 3NXSA 3WG7C 2IJJA 4UVBA 1AROP 2XOKG 1H8HG 3AG4C 2IH3C 3JD2A 5H6RA 1KKDA 1R3JC 2M7WA 4RAIA 3WG7B 2Z3YA 3OR7C 1GK9A 3AG4B 1Q86W 3SPJA 1M9NA 2YEVA 2EIMC 3W7WA 1VQ4V 1GM9A 4ZBMA 1BHAA 2HKOA 3VOUA 3ZMSA 1K8AW 3E89A 4R50A 1THZA 2A0LA 2EIMB 1SESA 4R6ZA 3ZRXA 3B8NA 4I9WA 3EHBB 2WLLA 2JJ2G 3CCRV 4MS2A 3BEHA 5B1BC 1GKFA 1K4DC 1PNKA 4UVAA 1VQKV 3IC7A 4JAUA 3CCSV 1KP3A 3TCUA 3B8MA 2WLJA 1PKXA 1K34A 2YSUB 4HAMA 5B1BB 5IDJA 3R65A 1G4YB 2DYSC 2QKSA 4U7OA 1OCCC 3OUSA 3SYPA 3E8GA 2WLNA 3CC2V 4G2KA 3ZN1A 4MVZA 5B1NA 1COWG 1NR7A 5CBFA 2DYSB 4JYCA 1YITV 1OCCB 3SPHA 2IH1C 4LCUC 4PA9A 2B1IA 4JTAB 1W2BU 1N8RW 1IXMA 2WLLB 1K92A 1YJWV 1QR8A 4GX2A 1VQPV 4WF9V 3ETDA 2W6JG 3E2EA 1NKDA 1QLEC 3SPCA 4PELA 1K5SA 4WCEV 1QR9A 3LDEA 1K5QA 4BW5A 1J95A 4PDLA 1Q82W 1QLEB 3ASNC 2HLDG 4HZ3A 4UXNA 3ZMVA 1EBOA 3FKSG 4QPKA 2KB1A 2UXNA 1S3JA 5H6QA 3ZRSA 2HVJC 2ZQMA 3HPLC 4KUMA 4MVSA 3UM7A 5L3BA 2OTLV 1K3EA 1SERA 3ASNB 1PD3A 5KUMA 1L1FA 2NNUA 3OEEG 1QVFU 1S0VA 3ABLC 1WPXA 3M99B 4UVCA 2IU0A 4I5SA 4WFEA 1OCZC 3DGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4C C;  4GX1 A;  3E86 A;  4P30 A;  3RVZ A;  2DWD C;  2X6A A;  4WFH A;  4H33 A;  3SJQ C;  4QE9 A;  4WFF A;  4J9Y B;  4RO2 A;  3RBZ A;  1V55 C;  4OXS A;  2X6C A;  2WLI B;  4P9O A;  4R7C A;  5CBH A;  2HG5 C;  3K0G A;  3LDD A;  3E8B A;  2WLH A;  4UUJ C;  2WLI A;  1P7B A;  4GX5 A;  5EC2 C;  5EC1 C;  3SPG A;  4G28 B;  4X8A A;  1S5H C;  5E1A C;  2H8P C;  2AHZ A;  3ASO C;  3JYC A;  4JTD B;  4PDM A;  3FB7 C;  3PJS K;  1XL6 A;  2BOB C;  2NLJ C;  4MW3 A;  2A79 B;  3ZJZ A;  3T1C A;  3WG7 C;  2DWE C;  5CBG A;  4LBE C;  3T2M A;  3AG3 C;  3AG4 C;  2JK5 C;  2IH3 C;  2EIK C;  4XDK A;  2EIJ C;  2BOC C;  1KKD A;  4MTG A;  2EIL C;  2ZD9 A;  1R3J C;  5IY5 C;  4MVM A;  4RAI A;  5B3S C;  4WFG A;  3OR7 C;  1ORQ C;  1R3I C;  3LNM B;  3E83 A;  4TWK A;  4MVQ A;  3LDC A;  3SPJ A;  3ABM C;  4PA4 A;  2EIM C;  2YEV A;  1R3L C;  2EIN C;  2DYR C;  4MVU A;  3SPI A;  4ZBM A;  3UKM A;  2WLK A;  3VOU A;  3E89 A;  3K03 A;  2ITC C;  4H37 A;  4R50 A;  3AG2 C;  2A0L A;  4MTO A;  4P2Z A;  4PA7 A;  3X2Q C;  3ABK C;  3T4D A;  4MVO A;  5EBW C;  4R6Z A;  3FB6 C;  2HJF C;  2Q67 A;  4HYO A;  4I9W A;  3IGA C;  2WLL A;  4MS2 A;  1M57 C;  3BEH A;  4MSW C;  5B1B C;  2OCC C;  2HFE C;  1K4D C;  5EK0 A;  5EBM C;  4P9P A;  3T4Z A;  3K08 A;  3STL C;  3TCU A;  2Q6A A;  4EKW A;  4J9Z B;  5BZB A;  2WLJ A;  2A9H A;  3AG1 C;  3F5W C;  2R9R B;  1M56 C;  3R65 A;  2X6B A;  4KFM A;  1G4Y B;  1R3K C;  2DYS C;  2QKS A;  1OCC C;  2Q68 A;  3OUS A;  4PA6 A;  3SYP A;  3SYO A;  5J9P C;  3E8G A;  2WLN A;  5KUK A;  4RUE A;  1OCR C;  4MVZ A;  3RVY A;  3STZ C;  4R8C A;  5CBF A;  3KG2 A;  3FB5 C;  3K0D A;  1LNQ A;  3FB8 C;  3SPH A;  2IH1 C;  2AHY A;  4LCU C;  4PA9 A;  4JTA B;  4QE7 A;  3RW0 A;  2WLL B;  3E8F A;  4X89 A;  4QNH B;  3E8H A;  4GX2 A;  5EBL C;  4GX0 A;  2Q69 A;  2ITD C;  3K04 A;  3OR6 C;  4F4L A;  1OCO C;  3LUT B;  3OGC C;  4G27 B;  4PDV A;  1QLE C;  2Y69 C;  3F7Y C;  3SPC A;  3SYQ A;  4PDR A;  2QTO A;  3LDE A;  4PA3 A;  4MTF A;  4BW5 A;  1V54 C;  2ZXW C;  4RUF A;  1J95 A;  4PDL A;  3K06 A;  2K1E A;  3ASN C;  3TET A;  4HZ3 A;  3EFF K;  3GB7 C;  3F7V C;  2KB1 A;  1XL4 A;  4X88 A;  3ZRS A;  2HVJ C;  2P7T C;  3HPL C;  4MVS A;  4MW8 A;  3UM7 A;  1BL8 A;  3OUF A;  1ZWI C;  4MVR A;  2W0F C;  5KUM A;  3SYA A;  3IFX A;  4CBC A;  4XDL A;  5B1A C;  1JVM A;  3ABL C;  2WLM A;  4JTC B;  4XDJ A;  4DXW A;  4LP8 A;  4WFE A;  1OCZ C;  2ATK C;  2HVK C;  3SYC A; 
#chains in the Genus database with same CATH topology
 4OPA A;  3ABL B;  1QU7 A;  1L8D A;  1QCE A;  2FB5 A;  2X6C A;  1YVW A;  2R72 A;  1Q3E A;  5IYZ B;  2WLI A;  4JI1 B;  5IYD O;  1SQB H;  1JJO A;  3FB7 C;  2ZE8 A;  3A0R A;  1FXK C;  1DF5 A;  1R6K A;  5BR8 O;  1ROP A;  3P30 A;  5H2F Z;  1AJQ A;  4GYC B;  3RYC A;  1H2S B;  3APO A;  2F4V B;  5LA6 B;  5IY5 B;  2EIL B;  2DYR C;  4EB6 B;  1LR1 A;  2JS3 A;  5FPR A;  3GWK C;  1YIJ V;  4QPJ A;  3IAY A;  4L8J A;  1F51 A;  2A3Q A;  3RT3 C;  3X2Q B;  1VMG A;  2LJ2 A;  3AG2 B;  1VQ6 V;  3CEI A;  4MT8 A;  4FFB B;  4DRX B;  2VQF B;  2A9H A;  1J5E B;  2R9R B;  2F93 B;  4KFM A;  3G6E V;  1UPG A;  1H8E G;  3OW2 U;  1V9P A;  4X62 B;  3STZ C;  2HEP A;  1K9M W;  2EJR A;  1NTK H;  5KAF Z;  1FJG B;  5E79 Z;  1Y67 A;  5LP6 A;  4DV3 B;  1HWY A;  2QM8 A;  5KHK A;  3A8T A;  4X66 O;  1RPO A;  3K06 A;  2BSK A;  5J2T A;  3E22 A;  3GB7 C;  2E75 B;  2E5L O;  3QVN A;  3W7U A;  5JJE B;  2UXX A;  4CBC A;  2HP8 A;  1DLB A;  2YIC A;  3A0H Z;  4JTC B;  4XDJ A;  1Y74 A;  4LP8 A;  2HVK C;  2F23 A;  1JFF A;  1XDC A;  2XAJ A;  2JS5 A;  4P9O A;  2HG5 C;  4CH4 A;  1AI4 A;  2JVD A;  3FFQ A;  4PHZ A;  5IYZ A;  4G28 B;  1S5H C;  4FLY A;  4N21 A;  2IU3 A;  3HKC B;  4LH7 A;  1S5J A;  3DXR B;  2LFR A;  1S76 D;  1DF4 A;  1GH6 A;  5A9G A;  2QKC A;  2EIJ B;  3BRC A;  1E1Q G;  2C2A A;  1IBK O;  1WB8 A;  5HFL A;  5KMG B;  4CH3 A;  2ITC C;  4H37 A;  1FYJ A;  4K8X A;  3D36 C;  1M57 C;  1WB7 A;  4D6T H;  4FLV A;  5L3D A;  3D3Q A;  3T4Z A;  4N23 A;  2ILM A;  4I4T A;  3F5W C;  4DRX A;  2ZR2 A;  4EFB A;  2EBO A;  5KAI Z;  4LF6 O;  3UT5 A;  2Y48 A;  1MG1 A;  3K0D A;  3OMA B;  4YJ3 A;  2LFS A;  5L3C A;  1YTF B;  3RW0 A;  2RCV A;  3QO7 A;  1NH2 B;  3K04 A;  2P06 A;  4G27 B;  4PDV A;  3K5L A;  5J2U B;  3WB2 A;  1V54 C;  2UUC O;  4ASU G;  4TV9 A;  3G71 V;  1TVK B;  4X66 B;  4RQE A;  1XL4 A;  1I5X A;  2RJZ A;  2V7Q G;  1WJZ A;  3CPW U;  5B1O A;  2P22 C;  2E5L B;  4XDL A;  1MNG A;  2CAZ C;  5IYC O;  4B3M O;  2ATK C;  4O4J B;  1V55 C;  5AG2 A;  3N27 A;  4UB8 Z;  4DR5 O;  4TUY B;  3QTC A;  4Q6G A;  1L0L H;  4GZR B;  3SPG A;  1VAR A;  4J42 A;  4PDM A;  4CS4 A;  4RQF A;  2UU9 O;  2BOB C;  4L87 A;  3CWB H;  3BY6 A;  4MW3 A;  3ZHU A;  2E3C A;  4YIP A;  2NN4 A;  4LBE C;  1U96 A;  3HKC A;  2EIK C;  4FLZ A;  2ZD9 A;  3DXR A;  4NB5 A;  4JGS A;  3LDC A;  5FNV B;  3GVM A;  4MVU A;  3SPI A;  2WLK A;  4JV5 O;  1IBK B;  1KEC A;  1PP9 H;  2ZE5 A;  3AK3 A;  3CCE V;  2IW5 A;  3KCX A;  1PNM A;  5KHI A;  2R9A A;  4P9P A;  4ZKI A;  2RDC A;  3K59 A;  2MW2 B;  3VQY A;  3ABT A;  5C93 A;  3TXQ A;  1R3K C;  4JAV A;  5ITZ A;  3QO5 A;  3RVY A;  4WBN B;  1PV0 A;  5H9C A;  4LF6 B;  1G8M A;  1QBZ A;  1YJN V;  3MD0 A;  4X89 A;  2K9P A;  2H3O A;  3U0Z A;  1OHH G;  3L71 H;  4RWU A;  3RYF A;  1AI5 A;  2ZM6 O;  3C3T A;  5J2U A;  3JAS B;  1QVG U;  2ZNI A;  3ZBH A;  3L70 H;  1PPJ H;  1K97 A;  2DQ0 A;  5L3E A;  2UUC B;  3T1Y O;  1TVK A;  5LYJ B;  1XNQ O;  2XAS A;  4AIL C;  2YIB D;  1NT2 B;  1AR1 B;  4U3J B;  3D3I A;  4B3M B;  4DV0 O;  4F6R B;  1VQ7 V;  4O4J A;  4E4E A;  3B40 A;  2DQ3 A;  4BIO A;  4ZIB A;  4YY3 O;  2WA3 A;  4UUJ C;  1QLN A;  4DR5 B;  2HHH O;  2X0L A;  4HNA A;  4A5U B;  4X9Q A;  2N05 A;  2CGO A;  5K1X A;  4UVB A;  3HKD B;  2UU9 B;  1AVM A;  3AG4 C;  4JAA A;  3JD2 A;  4J10 A;  5H6R A;  3ETQ A;  5IJ9 B;  1R3J C;  4RAI A;  3WG7 B;  3OR7 C;  2ZIN A;  1M9N A;  2EIM C;  3W7W A;  1GM9 A;  4JYY A;  5FNV A;  2CUG A;  4FFK A;  3ZMS A;  1K8A W;  3E89 A;  1THZ A;  1MSD A;  4NXM O;  4JV5 B;  2QTS A;  3B8N A;  4C7U A;  1KUQ A;  4LR3 A;  2AXT Z;  5B1B C;  1GKF A;  1VQK V;  2Q5Z A;  1KP3 A;  3TCU A;  5LXT A;  4DK1 A;  2WLJ A;  3ZHQ A;  1K34 A;  2Q73 A;  4LF7 O;  1G4Y B;  2DYS C;  4U7O A;  3OUS A;  1Q6I A;  2PTM A;  3E8G A;  1SZX A;  4G2K A;  1WNS A;  1BSM A;  1COW G;  2Y0P A;  1YIT V;  4WBN A;  3CRQ A;  2IH1 C;  1W2B U;  4K8Z A;  1K92 A;  4IIJ B;  1VQP V;  1RSO B;  5CA1 B;  2UUA O;  1X4T A;  2W6J G;  3E2E A;  1QLE C;  1QR9 A;  3Q4H B;  4LWS A;  2ZM6 B;  4GUN A;  3OD4 A;  4UCS A;  1Q82 W;  3O9O A;  4UXN A;  3ZMV A;  2KB1 A;  1S3J A;  3ZRS A;  4EEQ A;  4KUM A;  2ZCE A;  3UM7 A;  5L3B A;  3ASN B;  5KUM A;  5LYJ A;  4O4I B;  3T1Y B;  1XNQ B;  3ABL C;  3DC5 A;  3M99 B;  3BPZ A;  4YIO A;  1GRJ A;  2YS8 A;  2Y0I A;  3RVZ A;  1XHZ A;  4WFF A;  5EYP A;  3LSS A;  4ZI7 B;  3K58 A;  1TUB B;  1Q90 D;  1XIL A;  1YF2 A;  2WAM A;  4R7C A;  4F6R A;  4Z1V A;  4LFB O;  4K3A A;  4DV0 B;  1Z5V A;  4GX5 A;  3HB3 B;  4YY3 B;  4GKJ O;  2Z5U A;  4JTD B;  1YZB A;  3RWR D;  4JI2 O;  3ZRW B;  1MSW D;  1R6T A;  1KKC A;  2HHH B;  1RPR A;  1BQZ A;  5FLX N;  3ASO B;  3HKD A;  1KP2 A;  5IY5 C;  2EIL C;  1NU1 H;  3G80 A;  5IJ9 A;  2CE4 A;  3H1L H;  4JF3 A;  1LUW A;  1IVS A;  3KZI Z;  1Z5W A;  3MHS C;  4TT3 G;  1AJN A;  1YSC A;  2G38 A;  3X2Q C;  1XMQ O;  3AG2 C;  3W7X A;  3JCU Z;  3T4D A;  1D2D A;  1OV9 A;  5HFM A;  3BAA A;  5KX5 B;  4NXM B;  3H1K H;  2V4D A;  3ABK B;  1NS1 A;  1Q43 A;  3RYC B;  5JJJ B;  1NJI W;  2Y4U A;  1SA0 A;  1GMG A;  3MAQ A;  4O4L B;  5J9P C;  1KC8 W;  5LGN A;  4LF7 B;  5CN0 A;  3FB8 C;  2PI4 A;  2AHY A;  1H2M A;  1FFT B;  1OCR B;  4BAY A;  1RP3 B;  4J41 A;  4DK0 A;  1W0K G;  1I94 O;  1CPY A;  4IIJ A;  1RSO A;  4GKK O;  1VQ5 V;  2UUA B;  1VQ9 V;  3JSL A;  3Q4H A;  2IJK A;  2K1E A;  4LF4 O;  3TET A;  3EFF K;  3B77 A;  2N04 A;  2EX3 A;  2AZ2 A;  1DTO A;  1VQM V;  4O4I A;  3GWO A;  3EXA A;  5LP6 B;  2GTS A;  3VQV A;  4GX1 A;  2V1D A;  4FLU A;  5JQG A;  2PY5 A;  5DEC A;  1P7B A;  3HKE B;  3W7T A;  2FML A;  3QO8 A;  4DV2 O;  4LFB B;  2AHZ A;  1NBM G;  3PJS K;  2NLJ C;  5D5Q A;  4GKJ B;  4JZG A;  3S3X A;  3ZRW A;  5CBG A;  4JI2 B;  2JK5 C;  1S72 V;  5GON B;  3K5M A;  2EIJ C;  1IXB A;  2DN9 A;  2LGQ A;  4MVM A;  4I0X B;  5LBQ A;  1N36 O;  3QNE A;  2IJI A;  2P90 A;  2L35 A;  3RGB A;  2XAG A;  3ABM B;  2P5O A;  4DR4 O;  5BMV B;  3M8A A;  5JCO C;  4J80 A;  5EBW C;  2FTK A;  1XMQ B;  4IHJ A;  3ZMT A;  4MSW C;  5KX5 A;  1O9G A;  3H1J H;  4B3S O;  1IUR A;  1S77 D;  3OEH G;  3BA8 A;  3K3W A;  2QDO A;  4O4L A;  3AG1 B;  1M56 B;  2VRZ A;  4FJC C;  2PI5 A;  1JR9 A;  1LNQ A;  1KBH A;  4QNH B;  1I0H A;  4NTW A;  2IBZ H;  2XAF A;  1F23 A;  4YXW G;  4I4T B;  1VF6 A;  3F7Y C;  1I94 B;  2B5U A;  4GKK B;  5LHH A;  1WLE A;  3UT5 B;  4X20 B;  4YJ3 B;  4LF4 B;  3H1I H;  2JRI A;  3CE2 A;  4IGG A;  3OUF A;  2W0F C;  2B1G A;  3RN4 A;  3ABU A;  2Z0A A;  2IJH A;  1SQG A;  4GT1 A;  2RNB A;  4LF5 B;  5CMU A;  2GUZ B;  3JD1 A;  5B1A B;  4WFH A;  3RFR A;  5FPO A;  4TV9 B;  1H2L A;  1SF9 A;  4X8A A;  1HNX O;  3HKE A;  1MA1 A;  2QR4 A;  4DV2 B;  3BVO A;  4CH6 A;  3WU2 Z;  1AP6 A;  4NTX A;  2Q8V A;  5GON A;  1H38 A;  4I0X A;  3JAW B;  5L3G A;  5IE9 A;  1N36 B;  3ZN0 A;  3G4S V;  1AR4 A;  5BMV A;  4DR4 B;  4E2L A;  1K33 A;  1JX9 A;  3LSQ A;  3OTO B;  2BE3 A;  5EBM C;  1JPX A;  3OMI B;  1VP7 A;  2OCC B;  1JOY A;  4B3S B;  2BTQ B;  3G67 A;  5BXZ A;  1H2N A;  2B9Z A;  4PA6 A;  1RFY A;  3CCL V;  3THO A;  1BE3 H;  3CP1 A;  3OT7 A;  3E8F A;  3CCQ V;  2JEX A;  1XQ8 A;  3OE7 G;  5LMN O;  2ETN A;  3CC7 V;  4IL6 Z;  5EIB C;  4PDR A;  3CCV V;  5ITZ B;  1XOU A;  4DV4 O;  3CB2 A;  4X20 A;  2ZXW B;  2PYJ A;  2VQE O;  4DR6 O;  1ZWI C;  2AGA A;  2DJV A;  1EN6 A;  3FAV B;  3RYF B;  2CTP A;  4TQF A;  2DWD C;  2GUZ A;  2ZT9 B;  5EC2 C;  4JI0 O;  4DR3 O;  3SJB C;  2ZNJ A;  1SQX H;  1HNX B;  4PJ0 Z;  2DOS A;  3WG7 C;  1WN7 A;  1BS3 A;  2M7W A;  3SR2 C;  5A2Q N;  2QWQ B;  2XTA A;  2Z3Y A;  4TOI A;  1KMI Z;  1GK9 A;  1GN4 A;  3JAL B;  1B3Q A;  2XUM A;  3JAW A;  2A06 H;  4LNU B;  4ZBM A;  2WA4 A;  3N2G B;  3RYI A;  1SQV H;  4HNA B;  2ADP A;  1EN5 A;  2WLL A;  3BEH A;  3CJH A;  4UVA A;  3R66 A;  4I50 A;  1AR5 A;  4HAM A;  2BTO A;  4BW9 A;  3WB0 A;  2QKS A;  3SYP A;  2BTQ A;  4PV1 B;  2OCH A;  4J7K A;  5CA0 A;  1OCC B;  1DK1 A;  4LCU C;  4PA9 A;  2B1I A;  1N8R W;  5LOV B;  2UXD B;  5B66 Z;  1QR8 A;  2AZ0 A;  5LXT B;  4ICG A;  3OGI B;  2R70 A;  5LMN B;  4WCE V;  3LDE A;  1SC5 B;  4KL1 A;  3TGU H;  1ZTE A;  3A2F A;  3ASN C;  5JJN B;  5H6Q A;  3L72 H;  3HPL C;  4DV4 B;  4IYI A;  1L1F A;  1QVF U;  1S0V A;  2VQE B;  1WPX A;  4DR6 B;  2IU0 A;  3DGE A;  4WFE A;  2Q0O C;  2JGU A;  3FAV A;  1PL0 A;  2ODM A;  2YID A;  4LWS B;  1E1R G;  1OCZ B;  1PNL A;  3HR0 A;  1E79 G;  1M1K W;  1ZAU A;  1MZE A;  2H8P C;  2W6I G;  3ASO C;  2ADQ B;  4JI0 B;  4DR2 O;  1VQL V;  2DMX A;  2ZR3 A;  4FLX A;  4DR3 B;  4W4K A;  5IWA O;  2XAQ A;  2HJD A;  4MTG A;  3AEI A;  2L6L A;  5EYP B;  1AJP A;  4WFG A;  3J7A U;  4TWK A;  2OIE A;  2UXB O;  2EJ7 A;  1TUE B;  3JAL A;  1HNZ O;  5KLV H;  2KSD A;  1YTF D;  1SRY A;  1M90 W;  4LNU A;  5EZY A;  1KYO F;  4MTO A;  4YHH O;  3ABK C;  3N2G A;  1NH2 D;  4KP4 A;  2HJF C;  4XBF A;  2GTA A;  2Q6A A;  1UFI A;  4J9Z B;  5BZB A;  4AI8 A;  1BCC H;  2X6B A;  5LMU B;  4LH6 A;  4FLT A;  3SYO A;  4KXR A;  1GM8 A;  5KUK A;  1OCR C;  1D5N A;  4B7K A;  3KG2 A;  4WFB V;  1VF6 C;  2PGG A;  1FXV A;  5DN6 G;  1GN2 A;  2QM7 A;  5LOV A;  1JJ2 U;  5EBL C;  2E76 B;  2ITD C;  1SS3 A;  3AK1 A;  3AG7 A;  4QJF B;  5D5P A;  1SA0 B;  1SKV A;  3AK2 A;  2F43 G;  2PYL A;  1RM1 B;  1NVP B;  1IZ3 A;  1OCO B;  4RUF A;  1IBM O;  3BCC H;  2P4V A;  1A32 A;  4EFE A;  1KQS U;  4DV5 O;  2P7T C;  2OIG A;  1HW7 A;  5LP6 C;  2MK3 A;  2UXC O;  5B5E Z;  2BCC H;  1BZK A;  4O2A A;  1VIB A;  4X65 O;  3JAT A;  3CC4 V;  4DV6 O;  4TV8 B;  4OX9 B;  2R9I A;  3ZHR A;  1BHB A;  3E8B A;  1M5I A;  1BGY H;  2ZE7 A;  3P3P A;  4ZHQ B;  4CZZ A;  1XHX A;  1M93 A;  1VQN V;  3CRR A;  3ZMU A;  5IT9 N;  3ZJZ A;  3FYE B;  1R1B A;  4DR2 B;  2EZP A;  2QWN B;  2OWO A;  1CP9 A;  2Y4T A;  4XDK A;  4GLX A;  4BWA A;  2Q0A A;  4NKG B;  5IWA B;  2YC0 A;  3LSU A;  3J80 N;  4AQY O;  3AG3 B;  5JQG B;  3TJT A;  3G6B A;  3ABM C;  3H01 A;  1N32 O;  4JPR A;  5B3S B;  5KHH A;  3ZCC A;  2UXB B;  3VBB A;  5JH7 A;  3K03 A;  4P2Z A;  1HNZ B;  3DSQ A;  2EIN B;  4MVO A;  1W59 A;  1QHT A;  5CB4 B;  4YHH B;  3ZHV A;  5BY1 A;  2QJ1 A;  2QE7 G;  1K73 W;  4YJ2 B;  3RYH A;  1WP7 A;  2CTW A;  4QIW F;  3AG1 C;  3OFN G;  1M56 C;  5EIB D;  4ABM A;  2YUA A;  5LHG A;  3SJC C;  5LHI A;  2Q68 A;  5DM6 V;  2KKW A;  1EZJ A;  2WWW A;  1F7Y A;  2X7R B;  4JI7 O;  4R8C A;  1OZ0 A;  1WPB A;  4IHJ B;  4QE7 A;  3S3W A;  4FM1 A;  3OR6 C;  1B6Q A;  2WSS G;  3JAR A;  3JAM N;  3J81 N;  4JYB A;  1GTO A;  2Y69 B;  1JMK C;  3CRM A;  1AI7 A;  1IBM B;  3UCS C;  4BIZ A;  5GTI Z;  3UO3 A;  4DV5 B;  4FVM A;  5B1A C;  1GN3 A;  1Q6H A;  2UXC B;  4DXW A;  1XMO O;  1H2G A;  4OPH A;  4DV1 B;  3QG5 A;  4H33 A;  3K9A A;  4J9Y B;  1BT8 A;  4Z1M G;  3E35 A;  3IJ4 A;  3CRC A;  4X65 B;  4TV8 A;  3LDD A;  4DV6 B;  2WLH A;  1NQT A;  1ENV A;  3CME V;  5E1A C;  2ZIM A;  4JZ2 A;  4UCU A;  4ZHQ A;  2IM9 A;  1WAZ A;  4X1K B;  4FM2 A;  4LF5 O;  1NVP D;  2QEX V;  3APQ A;  1FXH A;  5IJ0 A;  4NTY A;  2GDS A;  3CCU V;  2XND G;  4AQY B;  2FKX A;  4NR1 A;  1N32 B;  2YXL A;  4PA7 A;  1YCI A;  4J11 A;  3FB6 C;  4NVP A;  5CB4 A;  1YJ9 V;  4D7T A;  2OCC C;  4K35 A;  3BAB A;  2QM4 A;  4EKW A;  4YJ2 A;  4TSF G;  4O4H B;  2CH7 B;  3ZHT A;  5KHG A;  4IT5 A;  3ML0 A;  4LFA O;  3HKB B;  4B08 A;  3FB5 C;  4FIP C;  4JI7 B;  2ZDI A;  3CCJ V;  3OTO O;  1Y6X A;  1HNW O;  3ZRV A;  4F4L A;  2RMK B;  3OGC C;  1ZX3 A;  2Q7H A;  3JAK B;  1S5L Z;  4CS3 A;  4MTF A;  1KB9 F;  2ZXW C;  4LFC O;  2GV9 A;  5JVD A;  3UO2 A;  1EFR G;  2RN9 A;  3U10 A;  1NR1 A;  3JD4 A;  4MVR A;  3SYA A;  1NTM H;  1I5Y A;  5KHJ A;  1ZL8 B;  5C8Y B;  1OJH A;  2X6A A;  4NYK A;  1XMO B;  2O57 A;  4JYA O;  1XNR O;  4UCR A;  4HBN A;  1NTZ H;  1UJW B;  3DC6 A;  1DGS A;  3D8C A;  3CMA V;  3JYC A;  2FYU H;  3CHX A;  3NXS A;  3O65 A;  4X1K A;  1ARO P;  1HR0 B;  2XOK G;  4J7Z A;  1H8H G;  2IH3 C;  1KKD A;  3C90 A;  1L0N H;  4AHC A;  3SPJ A;  1YXB A;  4D7S A;  4DR1 O;  3ICX A;  1VQ4 V;  1WA8 A;  3MDS A;  1N33 O;  1BQ0 A;  3JSN A;  4X1I B;  3VOU A;  2OYQ A;  4R50 A;  2A0L A;  2NR5 A;  1IBL O;  1SES A;  4R6Z A;  1AIL A;  2JJ2 G;  4MS2 A;  4O2B B;  1XRE A;  2XHB A;  1K4D C;  1URF A;  3KKY A;  3CCS V;  3B8M A;  1MZF A;  1PKX A;  2YSU B;  5IDJ A;  3OTF A;  3R65 A;  4O4H A;  2CH7 A;  4DV7 O;  2VWJ A;  1OCC C;  3L75 H;  1TAE A;  3H1H H;  1P84 F;  3RYI B;  4MVZ A;  4LFA B;  5CBF A;  2QWP B;  3HKB A;  1TA8 A;  4OGQ B;  4K0K O;  1IXM A;  2WLL B;  2F95 B;  3K57 A;  3CJH B;  4GX2 A;  4I50 B;  1X59 A;  1HNW B;  1NKD A;  4PEL A;  1K5S A;  3JAK A;  1K5Q A;  4PDL A;  4HZ3 A;  1EBO A;  5CA0 B;  4LFC B;  2HVJ C;  2ZQM A;  2LW7 A;  4MVS A;  2UXD O;  3L74 H;  2DE0 X;  3CRA A;  4UVC A;  4I5S A;  3T1H O;  1OCZ C;  1ZL8 A;  2H94 A;  5BR8 B;  1VQO V;  1P4R A;  2HR3 A;  2ZE6 A;  5C8Y A;  4OXS A;  5LA6 A;  3PN1 A;  5CBH A;  4JYA B;  4B3T O;  4PD4 F;  1XNR B;  3WB1 A;  4EB6 A;  4UV8 A;  5EC1 C;  1FKA O;  1AB3 A;  2JJ1 G;  3SDL A;  2OT5 A;  4LF9 O;  2YIA A;  2ARH A;  3H9V A;  2BOC C;  1F4N A;  2KQX A;  3BA9 A;  1FS0 G;  1HP8 A;  3ZIA G;  3TK1 A;  4FFB A;  1FXK B;  2LQT A;  1N4C A;  3LNM B;  3E83 A;  1PM9 A;  1B06 A;  4DR1 B;  2CTR A;  1N33 B;  4X1I A;  1QQC A;  2DYR B;  5LL6 Y;  3OM3 B;  4JI3 O;  3IGA C;  1D5A A;  1K7D A;  1IBL B;  2DW4 A;  2HFE C;  5GW7 A;  4O2B A;  5DED A;  2EUL A;  1Q81 W;  2QWR B;  4FMT A;  2Q7E A;  1ZLZ A;  4X64 O;  1LUV A;  2VWK A;  4DV7 B;  2QSA A;  5EZY B;  3I55 V;  1JCH A;  3B2E E;  3TXS A;  1XUQ A;  4I9Q A;  1VF5 B;  3CXC U;  4FLW A;  3L9D A;  3FYI B;  2Q4P A;  2YI8 A;  1P49 A;  4GX0 A;  1RM1 C;  1Y66 A;  1Y76 B;  4FZ1 A;  4K0K B;  1OCO C;  2CDY A;  3LUT B;  1SQF A;  3K5O A;  5LMU O;  2PF4 E;  3CXH F;  3SYQ A;  4B7E A;  3CD6 V;  4JI4 O;  4PA3 A;  4MTX A;  1M4U A;  5L3F A;  3QF7 A;  3CCM V;  1F4M A;  1TGO A;  1G1X B;  3ZED A;  3F7V C;  4I55 B;  5CA3 A;  2FL4 A;  1Y4M A;  2PUS A;  4BIU A;  3IFX A;  1N0J A;  4UCV A;  1SET A;  3L73 H;  4W4L A;  3SYC A;  3ETG A;  4P30 A;  1MAB G;  3T1H B;  1YI2 V;  3RBZ A;  2YDE A;  1FD9 A;  1W0J G;  2LO1 A;  3ZS8 C;  4NXN O;  1GAX A;  2JGD B;  5GTH Z;  4U7N A;  4KHP O;  1ZUQ A;  5LGU A;  3JD3 A;  5KMG A;  4CS2 A;  4B3T B;  1CXZ B;  1KD1 W;  2QA4 V;  1N0N A;  1WP8 A;  1NZ6 A;  5H5N A;  3T1C A;  2DWE C;  4DYL A;  3T2M A;  4O2A B;  3AG3 C;  3B4S A;  5JCO A;  2YXH A;  1Q7Y W;  2GBO A;  2YIB A;  4LF9 B;  3JAT B;  3ZHS A;  5B3S C;  2P6J A;  3A0B Z;  4DW1 A;  1R3I C;  4OX9 O;  3MHH C;  4MVQ A;  1FXK A;  3ZMZ A;  4PA4 A;  1R3L C;  2EIN C;  1ZSP A;  1GM7 A;  3N2K B;  2XT9 A;  2Q67 A;  4HYO A;  2D3O W;  1SQP H;  5EK0 A;  5TIS Z;  4JI3 B;  3K08 A;  3STL C;  2CK3 G;  2F66 C;  2GHY A;  1M57 B;  1VQ8 V;  2EZO A;  5IYB O;  2LGW A;  2ZDI C;  1PL4 A;  4RUE A;  5JH7 B;  3SGI A;  1Q8I A;  2JIZ G;  4X64 B;  3B09 A;  1AI6 A;  3W7S A;  4DUY O;  4B3R O;  1H2K A;  1Q6U A;  1N34 O;  3E8H A;  2KG7 B;  3RYH B;  1FFX B;  1YDX A;  3OMN B;  1Y76 A;  2Y69 C;  3CYO A;  3K79 A;  2QTO A;  4JI4 B;  4TUY A;  2P67 A;  2XAH A;  4JI5 O;  2Q7G A;  4DW0 A;  2M6Y A;  5FL7 G;  2ZIO A;  4X88 A;  1V54 B;  3P32 A;  4H0L B;  2UUB O;  2YI9 A;  3FX7 A;  4I55 A;  2JDI G;  1BL8 A;  2F1M A;  4FZ0 A;  1I7F A;  3WFV A;  1VEW A;  4UCO A;  1JVM A;  2WLM A;  3LNN A;  4DO2 A;  3JAR B;  1KU9 A;  2WPD G;  4CH5 A;  2P4K A;  4QE9 A;  4RO2 A;  5F2V O;  4JI6 O;  4CC6 A;  3K0G A;  1FAF A;  3K5N A;  4Q20 A;  1V55 B;  4NXN B;  2JGD A;  3CS5 A;  2YXY A;  1NI8 A;  1GO3 F;  1XBL A;  1XL6 A;  4GCZ A;  4LF8 O;  1Q5O A;  4KHP B;  3ETE A;  1US6 A;  3FD9 A;  2CGN A;  4DV1 O;  2LW1 A;  2PZS A;  1ORQ C;  2YEV B;  4H13 B;  1MOF A;  2EIK B;  5LGT A;  3UQ8 A;  3UKM A;  1QNM A;  3M7M X;  4U3F H;  3N2K A;  4WFA V;  3F5T A;  1YHQ V;  4DR7 O;  2CTQ A;  3VQX A;  1JQ0 A;  4PI2 A;  5IJ0 B;  1CEZ A;  4FPP A;  4TQD A;  4JI8 O;  1O9H A;  3D36 A;  5K1P A;  3JAS A;  4Z2W A;  2A7W A;  1SZT A;  3I56 V;  4PI0 A;  3BHP A;  3K9S A;  2GSM B;  5JWP A;  2ZKO A;  4FM0 A;  2W0X A;  4J7J A;  4DUY B;  4B3R B;  5KA6 A;  2Q69 A;  1BMF G;  1N34 B;  4X1Y B;  2KG7 A;  1FFX A;  2D2C B;  2OTJ V;  4UV9 A;  2JEU A;  4U3J A;  2RQ6 A;  3DTU B;  3IC9 A;  4ZOL B;  1XEQ A;  1R6N A;  2AW9 A;  4LC1 A;  5KA5 A;  1R73 A;  4DUZ O;  3U11 A;  1YEW A;  3CSX A;  4MW8 A;  4JI5 B;  3JCZ A;  2UUB B;  4I7Z B;  4FK5 C;  2E74 B;  1MMM A;  1U97 A;  4UFZ A;  1B04 A;  4H44 B;  1K4C C;  3E86 A;  4JAS A;  3SJQ C;  4IYH A;  1P7G A;  4JI1 O;  2WLI B;  3KCY A;  1IDS A;  1VF7 A;  4BR6 A;  2LP7 A;  4JI6 B;  3EVK A;  1HDJ A;  5JVD B;  1T5E A;  3OAA G;  3ZX6 A;  2QWO B;  3JD0 A;  4CC5 A;  3CX5 F;  1AP5 A;  2A79 B;  2Q9L A;  1SQQ H;  2IJJ A;  4LF8 B;  1IX9 A;  2F4V O;  1EZV H;  1Z2G A;  3AG4 B;  1Q86 W;  4UB6 Z;  2YEV A;  1GN6 A;  2QKA A;  1BHA A;  2HKO A;  4F6E A;  2EIM B;  3BFR A;  4QGP A;  3ZRX A;  1HR0 O;  4I9W A;  3EHB B;  3CCR V;  1PNK A;  2VQF O;  1J5E O;  3IC7 A;  4JAU A;  5CA1 A;  4DR7 B;  4UCT A;  5B1B B;  1WA8 B;  3VQW A;  4X62 O;  2WLN A;  2VS0 A;  3CC2 V;  4JI8 B;  3ZN1 A;  3SJA C;  1EM1 A;  5B1N A;  1NR7 A;  1I08 A;  1FPO A;  1FJG O;  2DYS B;  4JYC A;  2QGN A;  1EN4 A;  3SPH A;  3P3N A;  4JTA B;  2N74 A;  1YJW V;  4DV3 O;  1G6U A;  4WF9 V;  3ETD A;  4X1Y A;  3SPC A;  4BW5 A;  4ZI7 A;  2BSK B;  1J95 A;  5J2T B;  1TUB A;  4ZOL A;  3E22 B;  1QLE B;  2HLD G;  1XI1 A;  3FKS G;  4QPK A;  2UXN A;  3C3S A;  2OTL V;  1K3E A;  1SER A;  1JA8 A;  1PD3 A;  4DUZ B;  2NNU A;  3I5D A;  3OEE G;  1Y74 B;  1JFF B;  3NR7 A; 
#chains in the Genus database with same CATH homology
 2H94 A;  1VQO V;  1P4R A;  1PL0 A;  3RVZ A;  3ABL B;  4WFF A;  2HR3 A;  3LSS A;  1E1R G;  1QCE A;  4OXS A;  1OCZ B;  1PNL A;  2WAM A;  2X6C A;  1E79 G;  4R7C A;  5CBH A;  1M1K W;  2WLI A;  4GX5 A;  3HB3 B;  5IYD O;  4UV8 A;  5EC1 C;  2H8P C;  2W6I G;  2Z5U A;  3ASO C;  4JTD B;  3FB7 C;  3ZRW B;  1VQL V;  1MSW D;  2JJ1 G;  2ZR3 A;  3A0R A;  2OT5 A;  1RPR A;  1FXK C;  1DF5 A;  3ASO B;  1R6K A;  2XAQ A;  1KP2 A;  2BOC C;  1ROP A;  3P30 A;  1F4N A;  1AJQ A;  2EIL C;  3AEI A;  4MTG A;  1FS0 G;  3ZIA G;  5IY5 C;  3TK1 A;  4JF3 A;  1FXK B;  1AJP A;  4WFG A;  3LNM B;  4TWK A;  3E83 A;  1TUE B;  5IY5 B;  2EIL B;  2DYR C;  3MHS C;  4TT3 G;  1YTF D;  1SRY A;  1M90 W;  1AJN A;  1YIJ V;  1YSC A;  3X2Q C;  3AG2 C;  4MTO A;  3W7X A;  3ABK C;  2DYR B;  4QPJ A;  1NH2 D;  3T4D A;  4KP4 A;  2HJF C;  3OM3 B;  3IGA C;  5HFM A;  1K7D A;  1F51 A;  4XBF A;  3X2Q B;  3AG2 B;  2DW4 A;  1VQ6 V;  3ABK B;  2HFE C;  5GW7 A;  4MT8 A;  1NJI W;  2Q6A A;  4J9Z B;  5BZB A;  1Q81 W;  2A9H A;  2R9R B;  2X6B A;  4KFM A;  1GMG A;  3SYO A;  4FMT A;  3G6E V;  1GM8 A;  5J9P C;  1KC8 W;  5KUK A;  5LGN A;  1H8E G;  1OCR C;  5CN0 A;  3I55 V;  3OW2 U;  1JCH A;  3STZ C;  3KG2 A;  4WFB V;  1K9M W;  2EJR A;  3FB8 C;  2PI4 A;  3CXC U;  2AHY A;  1FXV A;  1FFT B;  1OCR B;  4BAY A;  5DN6 G;  3FYI B;  2QM7 A;  1JJ2 U;  5EBL C;  4GX0 A;  1RM1 C;  2ITD C;  1Y66 A;  1W0K G;  1CPY A;  1OCO C;  3LUT B;  4QJF B;  1HWY A;  3SYQ A;  1VQ5 V;  3CD6 V;  2F43 G;  2QM8 A;  1RM1 B;  1NVP B;  1VQ9 V;  4PA3 A;  1OCO B;  4MTX A;  4RUF A;  1RPO A;  5L3F A;  3K06 A;  3CCM V;  1F4M A;  2IJK A;  2K1E A;  3TET A;  3EFF K;  3GB7 C;  3F7V C;  1KQS U;  5CA3 A;  3B77 A;  2P7T C;  1Y4M A;  3W7U A;  2MK3 A;  2UXX A;  3IFX A;  4BIU A;  4CBC A;  1DTO A;  1DLB A;  4JTC B;  1VQM V;  1SET A;  4XDJ A;  3GWO A;  4LP8 A;  2HVK C;  3SYC A;  3ETG A;  4GX1 A;  2XAJ A;  1MAB G;  4P30 A;  2V1D A;  1YI2 V;  3CC4 V;  3RBZ A;  1W0J G;  2R9I A;  4P9O A;  2HG5 C;  1BHB A;  1AI4 A;  3E8B A;  1P7B A;  3W7T A;  3QO8 A;  4U7N A;  4G28 B;  5LGU A;  1S5H C;  3JD3 A;  2AHZ A;  4CZZ A;  1NBM G;  1KD1 W;  2QA4 V;  3PJS K;  4N21 A;  1VQN V;  2IU3 A;  3ZMU A;  2NLJ C;  3ZJZ A;  3FYE B;  3ZRW A;  3T1C A;  2DWE C;  5CBG A;  3T2M A;  2EZP A;  3AG3 C;  2LFR A;  1CP9 A;  2JK5 C;  1S72 V;  4XDK A;  2EIJ C;  1S76 D;  1Q7Y W;  1DF4 A;  4MVM A;  5LBQ A;  5B3S C;  2P6J A;  1R3I C;  3MHH C;  3AG3 B;  3QNE A;  1FXK A;  4MVQ A;  2IJI A;  3ZMZ A;  3ABM C;  2P90 A;  2EIJ B;  3H01 A;  4PA4 A;  1E1Q G;  1R3L C;  2C2A A;  2EIN C;  4JPR A;  5B3S B;  5HFL A;  3ZCC A;  3VBB A;  1GM7 A;  3K03 A;  2ITC C;  4H37 A;  2XAG A;  3ABM B;  4P2Z A;  2EIN B;  4MVO A;  5EBW C;  2FTK A;  2Q67 A;  4HYO A;  2D3O W;  3ZMT A;  4MSW C;  1M57 C;  2QE7 G;  5EK0 A;  1K73 W;  5L3D A;  4QIW F;  3T4Z A;  3K08 A;  3STL C;  4N23 A;  2CK3 G;  2GHY A;  1M57 B;  3AG1 C;  3F5W C;  2EZO A;  1M56 C;  3OFN G;  1VQ8 V;  1S77 D;  5LHG A;  5IYB O;  2ZR2 A;  3OEH G;  5LHI A;  2Q68 A;  3K3W A;  2EBO A;  2ZDI C;  5DM6 V;  4RUE A;  3AG1 B;  1EZJ A;  1M56 B;  2WWW A;  2X7R B;  4FJC C;  4R8C A;  1OZ0 A;  2Y48 A;  2PI5 A;  1MG1 A;  2JIZ G;  3K0D A;  3OMA B;  1LNQ A;  1AI6 A;  3W7S A;  2LFS A;  5L3C A;  1YTF B;  4QE7 A;  3RW0 A;  4QNH B;  3E8H A;  3QO7 A;  1NH2 B;  3K04 A;  3OR6 C;  2XAF A;  3OMN B;  1F23 A;  4G27 B;  1B6Q A;  2WSS G;  4PDV A;  4YXW G;  2Y69 C;  3CYO A;  3F7Y C;  3K79 A;  2B5U A;  2QTO A;  4JYB A;  1V54 C;  1GTO A;  4ASU G;  5LHH A;  1WLE A;  2Y69 B;  2P67 A;  2XAH A;  3G71 V;  1AI7 A;  5FL7 G;  4RQE A;  4X88 A;  1XL4 A;  1V54 B;  1I5X A;  3P32 A;  4BIZ A;  2JDI G;  1BL8 A;  2V7Q G;  3OUF A;  2W0F C;  2B1G A;  3CPW U;  5B1O A;  3WFV A;  3ABU A;  4XDL A;  5B1A C;  1JVM A;  2IJH A;  2WLM A;  4GT1 A;  4DXW A;  4DO2 A;  1H2G A;  5IYC O;  2ATK C;  5CMU A;  2WPD G;  3JD1 A;  5B1A B;  4WFH A;  4H33 A;  3K9A A;  4QE9 A;  4J9Y B;  4RO2 A;  1V55 C;  4Z1M G;  3E35 A;  3K0G A;  3LDD A;  2WLH A;  1NQT A;  1ENV A;  4Q20 A;  3SPG A;  3CME V;  4X8A A;  1V55 B;  5E1A C;  4PDM A;  4RQF A;  1GO3 F;  1XL6 A;  4GCZ A;  2BOB C;  4L87 A;  3BY6 A;  4MW3 A;  3ETE A;  4LBE C;  1NVP D;  2QEX V;  2EIK C;  2ZD9 A;  1FXH A;  1H38 A;  1ORQ C;  2YEV B;  3CCU V;  4JGS A;  3LDC A;  1MOF A;  2EIK B;  5L3G A;  4MVU A;  5LGT A;  2XND G;  3SPI A;  3UKM A;  3ZN0 A;  2WLK A;  3G4S V;  1KEC A;  4PA7 A;  4WFA V;  3FB6 C;  3CCE V;  1YHQ V;  2IW5 A;  4E2L A;  1K33 A;  1YJ9 V;  1JX9 A;  1PNM A;  2OCC C;  3LSQ A;  5EBM C;  4P9P A;  4ZKI A;  1JQ0 A;  1JPX A;  3OMI B;  4EKW A;  1CEZ A;  4TSF G;  4FPP A;  2OCC B;  3ABT A;  1JOY A;  3D36 A;  5C93 A;  3ML0 A;  1R3K C;  4JAV A;  4PA6 A;  3QO5 A;  1SZT A;  3I56 V;  3RVY A;  3CCL V;  3FB5 C;  5H9C A;  2GSM B;  3CP1 A;  4FIP C;  1G8M A;  1QBZ A;  1YJN V;  3E8F A;  3CCQ V;  3MD0 A;  2JEX A;  2ZDI A;  4X89 A;  3CCJ V;  3OE7 G;  5KA6 A;  2Q69 A;  1OHH G;  3ZRV A;  1BMF G;  4F4L A;  3OGC C;  3CC7 V;  1AI5 A;  2OTJ V;  4UV9 A;  2JEU A;  3DTU B;  4PDR A;  4MTF A;  3CCV V;  1QVG U;  2ZXW C;  1R6N A;  1K97 A;  2DQ0 A;  4LC1 A;  5KA5 A;  1R73 A;  5L3E A;  4MW8 A;  2ZXW B;  1EFR G;  2XAS A;  1NR1 A;  3JD4 A;  1ZWI C;  3JCZ A;  4MVR A;  3SYA A;  4FK5 C;  1I5Y A;  1AR1 B;  1K4C C;  3E86 A;  2DWD C;  3D3I A;  4JAS A;  2X6A A;  3SJQ C;  1VQ7 V;  2DQ3 A;  2WLI B;  4UUJ C;  1QLN A;  2LP7 A;  5EC2 C;  1UJW B;  3OAA G;  3CMA V;  3JD0 A;  3JYC A;  2X0L A;  2A79 B;  3NXS A;  3WG7 C;  2IJJ A;  4UVB A;  1ARO P;  2XOK G;  1H8H G;  3AG4 C;  2IH3 C;  3JD2 A;  5H6R A;  1KKD A;  1R3J C;  2M7W A;  4RAI A;  3WG7 B;  2Z3Y A;  3OR7 C;  1GK9 A;  3AG4 B;  1Q86 W;  3SPJ A;  1M9N A;  2YEV A;  2EIM C;  3W7W A;  1VQ4 V;  1GM9 A;  4ZBM A;  1BHA A;  2HKO A;  3VOU A;  3ZMS A;  1K8A W;  3E89 A;  4R50 A;  1THZ A;  2A0L A;  2EIM B;  1SES A;  4R6Z A;  3ZRX A;  3B8N A;  4I9W A;  3EHB B;  2WLL A;  2JJ2 G;  3CCR V;  4MS2 A;  3BEH A;  5B1B C;  1GKF A;  1K4D C;  1PNK A;  4UVA A;  1VQK V;  3IC7 A;  4JAU A;  3CCS V;  1KP3 A;  3TCU A;  3B8M A;  2WLJ A;  1PKX A;  1K34 A;  2YSU B;  4HAM A;  5B1B B;  5IDJ A;  3R65 A;  1G4Y B;  2DYS C;  2QKS A;  4U7O A;  1OCC C;  3OUS A;  3SYP A;  3E8G A;  2WLN A;  3CC2 V;  4G2K A;  3ZN1 A;  4MVZ A;  5B1N A;  1COW G;  1NR7 A;  5CBF A;  2DYS B;  4JYC A;  1YIT V;  1OCC B;  3SPH A;  2IH1 C;  4LCU C;  4PA9 A;  2B1I A;  4JTA B;  1W2B U;  1N8R W;  1IXM A;  2WLL B;  1K92 A;  1YJW V;  1QR8 A;  4GX2 A;  1VQP V;  4WF9 V;  3ETD A;  2W6J G;  3E2E A;  1NKD A;  1QLE C;  3SPC A;  4PEL A;  1K5S A;  4WCE V;  1QR9 A;  3LDE A;  1K5Q A;  4BW5 A;  1J95 A;  4PDL A;  1Q82 W;  1QLE B;  3ASN C;  2HLD G;  4HZ3 A;  4UXN A;  3ZMV A;  1EBO A;  3FKS G;  4QPK A;  2KB1 A;  2UXN A;  1S3J A;  5H6Q A;  3ZRS A;  2HVJ C;  2ZQM A;  3HPL C;  4KUM A;  4MVS A;  3UM7 A;  5L3B A;  2OTL V;  1K3E A;  1SER A;  3ASN B;  1PD3 A;  5KUM A;  1L1F A;  2NNU A;  3OEE G;  1QVF U;  1S0V A;  3ABL C;  1WPX A;  3M99 B;  4UVC A;  2IU0 A;  4I5S A;  4WFE A;  1OCZ C;  3DGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...