4PDRA

Crystal structure of a k+ selective nak mutant in barium and sodium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdrA00
2DYRC 4WFEA 2JK5C 3T1CA 4J9ZB 1JVMA 4G28B 4MVSA 3ABMC 4PDMA 2EIJC 3ASNC 3LNMB 2NLJC 3SYPA 4MTOA 5CBFA 3LDCA 3KG2A 4PDLA 3X2QC 4GX2A 3BEHA 3SYOA 4PDVA 2AHZA 2R9RB 3RW0A 3JYCA 1P7BA 3E86A 2Y69C 4QE9A 4KFMA 3T2MA 2WLLB 4LCUC 4P9PA 3ABLC 1BL8A 4QNHB 3LDEA 3E8GA 4P2ZA 4DXWA 2A9HA 4MVRA 3VOUA 3OR7C 1LNQA 2DWEC 2QKSA 4GX1A 3K08A 3ZRSA 1R3JC 3SPCA 3K0DA 2EIKC 2WLIA 3UM7A 1KKDA 3FB6C 3K04A 4MVZA 5EBWC 3R65A 3SPHA 3OR6C 4UUJC 5B1AC 2Q69A 3E8BA 1OCZC 3ASOC 4WFFA 1ZWIC 2H8PC 4I9WA 3IFXA 2DYSC 1XL6A 3WG7C 5B3SC 5EC1C 1K4DC 1G4YB 2WLMA 2IH3C 4G27B 3K0GA 4X88A 4PA9A 4QE7A 3SYAA 4PA3A 3LUTB 3K03A 3T4DA 5CBGA 3E8FA 1OCRC 4H33A 2A0LA 4R7CA 5EBLC 3GB7C 4F4LA 5EK0A 4XDJA 2WLKA 4MTGA 2WLLA 2X6BA 1M57C 4JTCB 4P30A 4R8CA 3STZC 3SPJA 4R6ZA 1ORQC 4RUFA 3SYCA 3EFFK 4TWKA 3TCUA 3E8HA 4MSWC 4PA6A 4MW3A 3RVYA 1R3LC 5EBMC 2ITCC 2K1EA 2HVKC 1M56C 2ZXWC 2HVJC 4JTAB 3F5WC 5B1BC 4BW5A 5KUMA 3STLC 3OUSA 4P9OA 3F7YC 1V54C 3PJSK 4ZBMA 2WLHA 3AG4C 4MVQA 4OXSA 1OCOC 4RO2A 2ATKC 1QLEC 3E89A 3ABKC 2ITDC 2X6CA 3FB7C 4WFHA 1R3KC 5J9PC 5IY5C 3K06A 4EKWA 4GX5A 2DWDC 4RUEA 2WLIB 3SPGA 1R3IC 3T4ZA 4H37A 4PA7A 5EC2C 1V55C 2AHYA 4RAIA 3SYQA 2EIMC 3FB5C 1XL4A 2QTOA 4MVOA 1J95A 2EINC 2IH1C 2WLNA 2EILC 2HJFC 2BOCC 3AG3C 3FB8C 2W0FC 3OUFA 4HYOA 2BOBC 4LBEC 3RBZA 2YEVA 4MW8A 3RVZA 5BZBA 4HZ3A 3AG1C 2Q68A 3LDDA 4MVMA 4X8AA 4CBCA 2HFEC 2KB1A 2WLJA 2A79B 2X6AA 3E83A 3HPLC 4XDKA 3UKMA 2HG5C 3AG2C 2ZD9A 2Q6AA 3OGCC 3TETA 4XDLA 4MVUA 4WFGA 4PA4A 5KUKA 2Q67A 3F7VC 4PDRA 2P7TC 1OCCC 1S5HC 1K4CC 4JTDB 4R50A 3SJQC 4MTFA 3SPIA 4GX0A 4J9YB 4LP8A 5CBHA 3IGAC 2OCCC 4MS2A 5E1AC 4X89A 3ZJZA
chains in the Genus database with same CATH superfamily
1I0HA 4J9ZB 1PNLA 3LNMB 2OT5A 3ZS8C 5E79Z 2ZE5A 4LFBO 1XBLA 4DR2O 1P7BA 3WU2Z 4ABMA 4JI1O 4QE9A 1TGOA 2WLLB 3HKEB 5IWAB 3ICXA 4RWUA 1SC5B 3CD6V 4GX1A 4GT1A 1R3JC 4JAVA 1NBMG 2P5OA 4DV7B 2DJVA 3K04A 1SQPH 2XAJA 4U7NA 1SQVH 4WFFA 2CTPA 3HKCB 3JALB 2ODMA 1ZL8A 4L87A 2A06H 1FKAO 4IL6Z 4HAMA 3T1HO 4YJ2A 3D8CA 4AHCA 4JI8B 5EBLC 1SQXH 4F4LA 4K0KB 2P90A 2YXYA 2IM9A 4DK1A 1VQ9V 2HP8A 5C8YB 2QM4A 4TV8B 1X4TA 1R3LC 2K1EA 1EM1A 1KQSU 2C2AA 2WLHA 2CAZC 4O2AB 3W7UA 1JFFB 1CEZA 2CTQA 2F1MA 3JD3A 1FYJA 5LXTA 2E74B 1R3IC 1GM8A 3A8TA 1LR1A 4LH6A 1ZUQA 2UXBB 1XL4A 1HNZO 3UT5A 3OUFA 2PZSA 3HKBA 4B3RO 3LDDA 3H1LH 1N32O 1V54B 2HFEC 4YHHB 4NXMO 2IJKA 3VQWA 3HKCA 3JALA 5B3SB 2ZD9A 4JYAO 1QLEB 2B9ZA 2ZIOA 3JD1A 1Q81W 2RMKB 1XMOB 2YSUB 4Z2WA 4JI6O 5HFLA 2P67A 5FNVA 5C8YA 1QR9A 4YXWG 3CMAV 1JA8A 4FJCC 2BTOA 3B09A 4K8XA 3A2FA 1B3QA 1SKVA 1NJIW 1JFFA 4I4TB 3E22B 2Y69C 1JQ0A 5JVDB 3O9OA 2JJ2G 1N36B 3SPCA 2EIKC 1PPJH 5IYCO 4FLUA 2CE4A 2QA4V 2QM8A 5GONA 3SDLA 4AI8A 3JATA 2RDCA 2UUBO 3AG3B 3IFXA 2HR3A 1XL6A 1HNXB 5ITZA 3SYAA 1N33O 1VQ6V 4ZIBA 2VQEB 2N74A 3CCJV 1EN4A 4BW9A 2F43G 2LGQA 1BQZA 1PM9A 4FMTA 1MZFA 5KMGB 4PA6A 1H2SB 2HVKC 3D3QA 5FLXN 1KBHA 2DYRB 2DE0X 1MSDA 3JSNA 2VRZA 5IDJA 1XQ8A 3C3SA 1VF7A 1HWYA 3CCVV 5LHIA 2GTSA 4K35A 4GX5A 2WA4A 3M7MX 5EZYA 4I4TA 3E22A 1I5XA 4AQYB 4WFBV 1G8MA 1VQOV 4X62O 2QTOA 2XAQA 5BMVB 5JJJB 2XASA 3HKDB 2W0FC 2X7RB 5EIBD 4KHPB 1IVSA 4MVMA 2GV9A 2WLJA 5CMUA 3K59A 3CCUV 2PF4E 2B1IA 1O9GA 2OIGA 1YEWA 2V1DA 2CGOA 3CEIA 2LQTA 2O57A 4JI5O 4FLVA 1U97A 2OCCC 1IBLB 1H2GA 1I94B 1K5SA 1SESA 3RYHB 5KMGA 1XHXA 1NH2D 2UXCO 2EULA 2Q7EA 3RFRA 4KXRA 2AHZA 1M9NA 1YXBA 1JPXA 1NH2B 3NR7A 4QNHB 1WP7A 4DUZO 1Y67A 4YJ3B 4Z1VA 4WF9V 1LNQA 1GKFA 3A0HZ 2NN4A 3R65A 2ADPA 4GKJO 5BMVA 4BIUA 1XOUA 1URFA 1GH6A 1D5AA 1GAXA 1AI5A 3ZHTA 4J7KA 3AG7A 4JI2B 1AJNA 4ZI7A 1QLNA 2M6YA 3BFRA 4KP4A 1WLEA 3CWBH 1L0LH 3SYCA 1KKCA 2H94A 3TGUH 1FXKC 5EBMC 4DV1B 3QF7A 1BE3H 4JTAB 5LMUB 4DYLA 4P9OA 4JV5O 1OCZB 2KQXA 4X9QA 4YIOA 4X64B 1ZLZA 4RO2A 5DM6V 4Z1MG 4KHPO 4LNUB 3K06A 2YXHA 3B8MA 1L1FA 4E4EA 3T4ZA 4CZZA 2GSMB 3K5LA 2AHYA 1BGYH 4RAIA 4LF8B 3FB5C 4FFBA 3CRCA 1XNQB 5IYZA 1M5IA 2HJFC 2UXXA 2H3OA 4LBEC 4UV9A 1VP7A 1RP3B 4I5SA 3LSSA 2QJ1A 5L3EA 2ZINA 4DR4B 3AK1A 3U0ZA 4PDRA 1KUQA 3VQXA 1OCCC 1F23A 4KUMA 5IJ0B 4MS2A 4LF7B 4B7EA 1YF2A 4LFCB 4NVPA 1AVMA 4B3TO 3K9AA 1FXKA 2DW4A 4B3MB 1WPXA 2OWOA 2Q73A 1U96A 2QR4A 5J2TA 1YZBA 4U3JB 1E1QG 3T2MA 4P9PA 4DV0B 4O4HA 1F4MA 2HLDG 2QKAA 1N34B 1NR1A 4ZHQB 3APOA 4UUJC 2WSSG 4X1IA 3OTOB 5KHIA 3NXSA 2H8PC 1IBMO 4MT8A 3QO5A 5EC1C 2GTAA 3K57A 4H44B 4JI0O 4H33A 1DF5A 3GB7C 3SGIA 1AR1B 4DR6O 4NTXA 2X6BA 4JTCB 1K7DA 1Z5VA 3E8HA 1QQCA 1SRYA 3D36C 1YJWV 2DQ3A 5IJ0A 1Q7YW 2RJZA 3OUSA 1J5EO 4LF8O 4CS3A 3QVNA 3C3TA 2EZPA 3WG7B 2DYSB 1VQMV 1NTMH 5J9PC 1GN3A 3H1IH 2GHYA 1OCRB 5H2FZ 1ROPA 3G6BA 4DR4O 1XEQA 4U3JA 2ZNIA 1HR0B 1E79G 1GM7A 2JEXA 2KSDA 1SQFA 2LO1A 4ZHQA 4X8AA 1PV0A 2PI5A 3H1HH 3AG4B 1AJQA 4NKGB 3OMAB 1M93A 2AGAA 1RM1B 1NVPD 3ZCCA 1AR4A 1PKXA 4IHJB 3ZMTA 2B1GA 4X66O 1NU1H 3OT7A 1BHAA 2F23A 2Q67A 3F7VC 2P7TC 2BSKA 1YVWA 2ZM6B 3J81N 4GUNA 2AW9A 1NVPB 1V55B 2F4VB 4DV5O 4HNAB 4PDMA 5CBFA 1P84F 1SERA 3ZX6A 4DW1A 4WFAV 2XOKG 3OTOO 4CS4A 2R9RB 3JYCA 1OJHA 3FAVB 1M4UA 4GCZA 1KP3A 2UU9B 4DXWA 2JDIG 5BR8O 3KCXA 3OR7C 1IBKO 2PYLA 5D5QA 3MD0A 4DR7O 1VF5B 4MVZA 1EFRG 4K3AA 1ZWIC 3OGIB 2YIBD 3OMIB 4I9WA 4FLYA 1NTKH 4FLXA 1XMQO 1YDXA 2KG7B 3CMEV 2A0LA 2P6JA 3AG2B 4LFAB 4TQDA 3PN1A 3A0BZ 3JARB 3A0RA 4RUFA 2NR5A 4FM0A 4JI7B 2YICA 2YEVB 1E1RG 3ML0A 1KECA 3F5WC 3T1YB 4HNAA 3CRRA 2EJ7A 5KLVH 2HHHO 1VIBA 2DWDC 4PELA 3ABLB 1D5NA 3FAVA 5IYDO 2GBOA 4JYYA 3CX5F 1QVFU 1MOFA 4X1YA 2QEXV 4GKKB 4LF9B 1FD9A 1US6A 3GWKC 4JAUA 3H9VA 5JWPA 1MA1A 3CJHA 4WFGA 3MDSA 4BWAA 4NXNB 3R66A 4JTDB 2CGNA 2ZKOA 4MTFA 4DR5B 1XNRO 3VQVA 4IT5A 4B3SB 5JCOC 1BMFG 2R9AA 4G28B 1ZL8B 5KX5A 1M56B 4ZKIA 4TT3G 4YJ2B 4GX2A 1GN4A 3BEHA 3EXAA 5DECA 3CC7V 2QWNB 1S0VA 1AROP 1BZKA 3KZIZ 3ZHSA 2BTQA 4BAYA 1MMMA 4ZOLA 3P30A 3ZRSA 1THZA 5CA1A 4DO2A 5LMNO 3EVKA 2ETNA 1KU9A 2XHBA 4X88A 3L9DA 3EHBB 5JJNB 2IBZH 3OFNG 5LXTB 3DTUB 2W0XA 2D2CB 2UUCB 3TCUA 3UT5B 2Q4PA 3HKBB 1YIJV 2Q8VA 4KL1A 1X59A 4FZ0A 4O2BB 3F7YC 4DV4B 1JR9A 3ABMB 4D6TH 5LYJB 1OCOC 3K3WA 2YIDA 3JAWA 3FB7C 1ZAUA 3SPGA 4J10A 1RPRA 2R70A 5FNVB 3L72H 4OPAA 2WLNA 4HYOA 3RBZA 5B1AB 3ASOB 4DR3B 3HPLC 1SETA 2JS3A 2EX3A 4I0XB 1W59A 2AZ0A 1FXHA 1QBZA 4DV3O 2Y48A 2M7WA 3SJQC 2DMXA 5IT9N 4LP8A 5GONB 5B66Z 2UXDO 3JATB 2JK5C 3JD2A 3ASNC 3W7WA 5ITZB 4J80A 1B06A 3DC6A 5LGTA 4O2BA 5B1OA 4O4LA 1P7GA 3QG5A 5LYJA 1FAFA 3ABKB 2ZT9B 3ZRWA 3IC9A 1V9PA 3IC7A 3LDEA 3UO3A 1K8AW 1Q6UA 3W7TA 4CH3A 1K73W 3GWOA 3L71H 5C93A 1D2DA 2W6IG 1PD3A 5IWAO 5IE9A 3OAAG 2FKXA 1DTOA 5GTIZ 2MK3A 2EINB 1FPOA 2EILB 5B3SC 4DV7O 3AG1B 1VQNV 4QE7A 4PA3A 4DR1B 5EZYB 2ZE6A 1TVKA 4GLXA 3BA9A 4I0XA 4EEQA 4R8CA 4R6ZA 4JI8O 4FM1A 4JI4B 4K0KO 2EIKB 1RSOB 1GRJA 3ABTA 3VQYA 4TUYA 5JH7A 3N27A 3J80N 3RT3C 4BW5A 1AP6A 1FFXB 5KUMA 5A2QN 3CCQV 2KKWA 3ZRXA 1NT2B 5LP6C 2IU0A 3W7XA 2ZDIC 3CXHF 3X2QB 1Z2GA 4TV9A 4UCVA 4DR3O 1W0JG 1YITV 1B6QA 1BHBA 1JMKC 3SYQA 2YI9A 1NI8A 1MNGA 1NKDA 3AG3C 3RVZA 5BZBA 3RYCB 4IYIA 2UXBO 4X20A 5KAFZ 4XDKA 1P4RA 3UKMA 3OGCC 1YTFD 1L0NH 3H01A 4YHHO 3ZMVA 4QGPA 1GM9A 1TUBA 1K4CC 4OX9B 2RCVA 4GX0A 3ZRVA 1YCIA 2DYRC 1YTFB 1QHTA 2ZXWB 1XMOO 1RSOA 2E3CA 3Q4HA 3CRAA 1FFXA 2EBOA 3DGEA 3M99B 2WAMA 4ZI7B 2YUAA 2E76B 3G67A 3K79A 2IJIA 4FIPC 4P2ZA 1NTZH 3VOUA 1Q86W 1R73A 3K0DA 4UVBA 2OCCB 3ZN1A 3FB6C 3B2EE 1R6NA 4Q6GA 1N36O 2IH3C 3RYCA 3I56V 3UO2A 2Z5UA 2UXNA 1TAEA 3FD9A 1K92A 3JAMN 1HNXO 3ZHRA 2LW1A 3STZC 4FFBB 2VQEO 5IYZB 3TXQA 4I50A 2QWOB 5AG2A 2ZIMA 2P4KA 1S72V 4JGSA 1JCHA 3E89A 5LGUA 4A5UB 2IJJA 4N23A 3K5NA 4PJ0Z 2IH1C 1FXKB 1IURA 1S5JA 5K1XA 5JJEB 2V7QG 4AQYO 1S5LZ 3SR2C 3CYOA 4G2KA 5J2TB 4DUYB 1XUQA 4RQEA 1Q6IA 3E35A 4O4HB 5KAIZ 3B77A 1OHHG 2Q5ZA 2P22C 4X1KA 4X89A 4X1IB 1K34A 1VQ5V 5KHGA 3DC5A 4EB6B 3CP1A 5LHGA 5IJ9A 1F4NA 1QNMA 3G80A 1IBLO 3K9SA 1I94O 1CXZB 1UPGA 4F6EA 3E86A 3K58A 1GN2A 3BABA 3VBBA 1HP8A 5LBQA 1Y74B 4JASA 4CH5A 1VQ4V 4JI3B 5IY5B 4EFBA 4GZRB 1OCCB 2DWEC 1S3JA 2IJHA 4JYBA 2YIAA 2CK3G 2GUZB 3ETQA 2JGUA 5HFMA 1FXVA 3MHHC 3I55V 3K0GA 1GTOA 1XI1A 3LUTB 1KYOF 5CBGA 2CH7B 2WLKA 4MTGA 2PTMA 1ORQC 1EN5A 2IU3A 3CXCU 4JI2O 4U3FH 2UUAB 3OE7G 1F51A 1F7YA 3PJSK 4EB6A 2FMLA 3QO7A 2EIJB 1FJGB 3JD0A 4F6RB 3P3NA 4DV1O 2E5LB 4WFHA 1WP8A 3OM3B 5LMUO 4YY3B 2BSKB 2WLIB 4J7ZA 4JAAA 4X64O 2R9IA 1T5EA 2HKOA 4PA7A 1Y76B 3BA8A 4W4LA 2N05A 3G6EV 1Y74A 4D7SA 5KA5A 1I5YA 4H13B 1GK9A 1J95A 2CDYA 3CCEV 2GUZA 1VF6C 2Q7HA 2A79B 5L3BA 3WB0A 1XNQO 1SF9A 1H8HG 3U10A 5KUKA 1R1BA 4FLZA 1H2MA 3UQ8A 2WA3A 3AK3A 2LFRA 2CH7A 3QO8A 1M57B 1SA0A 1JVMA 3C90A 4LF7O 3KG2A 4PDLA 4LFCO 1HNWB 5EYPA 1Y6XA 1MABG 3TJTA 4F6RA 4IYHA 4DV6B 4B3MO 4MVRA 3CC4V 1Q90D 2RN9A 3K08A 3TK1A 2QKCA 1K97A 2WLIA 4LF4B 4E2LA 2JGDB 2K9PA 1Y76A 4DV0O 5LL6Y 1WAZA 2MW2B 1AI6A 3D36A 1N34O 1RM1C 2WLMA 3ZHQA 4LC1A 3LNNA 5F2VO 1GMGA 1WNSA 4IIJB 5B1NA 3K03A 2QWPB 5KA6A 4R7CA 1ENVA 1VQLV 1MG1A 4FPPA 3CE2A 3SPJA 4X65B 5H9CA 4TWKA 4NTYA 2VQFB 3W7SA 4QPKA 3DSQA 4X1YB 1IXMA 5B1BC 1DGSA 4ZBMA 3N2GA 4MVQA 4NYKA 2DOSA 3CJHB 3G4SV 1TUEB 2YXLA 1R3KC 4LF6B 1JOYA 5L3CA 4UCTA 1QCEA 2Y0IA 3LSQA 1HW7A 4GYCB 2EIMC 5KX5B 1XHZA 1G1XB 3H1KH 2XAGA 2BOBC 5BXZA 3CCSV 1HR0O 2JGDA 1Q6HA 4CBCA 1VEWA 4J41A 1YSCA 2GDSA 4TQFA 4FFKA 3I5DA 3BCCH 3AG2C 2BTQB 4DV2B 4CH4A 4FVMA 4IIJA 4ZOLB 3ZHUA 1AP5A 1W2BU 3S3WA 3BVOA 3L70H 5CA1B 4LFBB 4WFEA 4LR3A 4DRXB 3T1CA 2HJDA 4UVCA 5LHHA 4MVSA 5KHJA 4DR2B 1VARA 2ZM6O 4JI1B 1K3EA 3HR0A 3S3XA 2F4VO 2Y4UA 2QSAA 3SYOA 4PDVA 1Y4MA 1RFYA 4LCUC 3ABLC 1NR7A 2JJ1G 3F5TA 1ZTEA 5CB4B 2OYQA 1CP9A 4JPRA 5LA6A 5JQGB 2UU9O 5H6RA 3DXRA 2Q69A 1YJ9V 3ZEDA 4UCOA 3ZMUA 2PGGA 3JAWB 1K4DC 1OZ0A 1K9MW 4BR6A 4WCEV 2NNUA 3JCZA 2N04A 1EBOA 2LFSA 2QTSA 5CN0A 5K1PA 3CRQA 1SZTA 2ITCC 1M56C 2XNDG 4LFAO 2HVJC 1PNKA 3CS5A 4PI0A 4DRXA 4JI7O 2Z0AA 3JASA 4B08A 2YC0A 5LOVB 3T1YO 2JIZG 1HNZB 1GN6A 1K5QA 4LWSA 4B3RB 1NZ6A 4WBNB 1N32B 3CB2A 1XILA 2XAHA 4NXMB 5L3DA 3GVMA 3D3IA 5CB4A 1N8RW 4JYAB 1EZJA 5JQGA 2X6AA 4O4LB 5JCOA 3E83A 4U7OA 1HDJA 1IXBA 1OCOB 3ZRWB 4UB6Z 2ZR2A 1WA8B 2AZ2A 4K8ZA 4JI6B 4GKKO 2CTRA 4LF9O 3OEEG 5CBHA 1BQ0A 4EFEA 3RYIA 3ZJZA 1SS3A 2A3QA 4NXNO 3RYFB 3OW2U 3ABMC 4DR5O 2ZE8A 2NLJC 5J2UB 4B3SO 1TVKB 5IYBO 2LW7A 1Q8IA 3FKSG 5LOVA 2FYUH 3JAKB 3ZMZA 3JCUZ 2UUBB 1VMGA 1Q3EA 4TUYB 3UM7A 5JH7B 1FFTB 2W6JG 1N33B 5B1AC 4WBNA 2XTAA 3ASOC 4ICGA 3ASNB 4UB8Z 4TV9B 3L75H 3B8NA 4UXNA 3IJ4A 4I9QA 1VQKV 1WA8A 2WLLA 3HKEA 4OGQB 2DN9A 4PD4F 4MW3A 3RVYA 4LF5B 4X20B 2UUCO 1V54C 3FYEB 1TA8A 3RYFA 2ZE7A 1QLEC 3ABKC 5J2UA 4I55B 5FL7G 1BCCH 4X62B 1TUBB 1W0KG 4DV4O 1YHQV 2Q9LA 3OTFA 2Y69B 3CCRV 1RPOA 5EC2C 3ZBHA 3WB1A 2FB5A 3BHPA 3JAKA 1I08A 4TV8A 2EINC 2EILC 2RNBA 4BIZA 3Q4HB 2XAFA 1N4CA 3AG1C 5LP6B 4JI5B 4O2AA 2HG5C 3B40A 1UJWB 4RQFA 2AXTZ 4MVUA 1QU7A 2OIEA 2UXCB 2JEUA 3BY6A 3N2KB 1B04A 3B4SA 4MTOA 1DK1A 4FLWA 1AJPA 1N0NA 4O4JB 3X2QC 1WN7A 4DUZB 1AR5A 4JYCA 4QJFB 2QWQB 5DEDA 2PUSA 4CC6A 2RQ6A 3K5OA 3JD4A 1S77D 3L73H 4I55A 2A9HA 4GKJB 4I50B 4J11A 3J7AU 5D5PA 1SZXA 4Q20A 4B7KA 4ASUG 4UV8A 4HBNA 5B5EZ 2P06A 4LF5O 3P3PA 3T4DA 3SJBC 3ZN0A 5TISZ 2PY5A 5LP6A 3MAQA 5EK0A 2ZDIA 5JVDA 4BIOA 2ILMA 2IW5A 3OD4A 1WJZA 5FPRA 4DR1O 4JV5B 1IDSA 4MSWC 4O4IB 2EJRA 5H6QA 4UCRA 2ZXWC 1COWG 1NS1A 4OXSA 3N2KA 4JI4O 1LUWA 1XREA 2PI4A 3KKYA 4JZ2A 4O4JA 1R6KA 5EIBC 4X1KB 3ETDA 3RGBA 2QDOA 3LSUA 5IJ9B 3MHSC 1JX9A 2LGWA 4FLTA 3FYIB 4NR1A 3RWRD 2L35A 3FX7A 3WB2A 1S76D 1EZVH 4UVAA 4PA4A 1M90W 1QR8A 4R50A 4J42A 3SPIA 1VQPV 4B3TB 5L3FA 4PHZA 1MZEA 3ZMSA 1YI2V 4FM2A 1O9HA 4OX9O 4O4IA 4JZGA 3HKDA 1A32A 2YS8A 1QVGU 2E75B 3KCYA 2DQ0A 4UFZA 4KFMA 1JJ2U 2X0LA 1BL8A 1GO3F 3CC2V 5BY1A 5L3GA 2QKSA 3IAYA 1VQ8V 1IBMB 2CUGA 5EBWC 4JI0B 3SPHA 2QGNA 1OCZC 4N21A 1BT8A 2B5UA 3RYHA 3CHXA 4DR6B 4G27B 1H8EG 4PA9A 4NTWA 2CTWA 1AB3A 3G71V 1PNMA 4FK5C 4P30A 1J5EB 2G38A 4YJ3A 2Z3YA 3AK2A 4D7TA 1P49A 1EN6A 2F93B 1ZSPA 2XUMA 4C7UA 3BPZA 3QNEA 2ATKC 2BCCH 4UCSA 5H5NA 2A7WA 1SQGA 2ITDC 2X6CA 1JJOA 5IY5C 4RUEA 3ABUA 4TOIA 1SA0B 4IGGA 1KMIZ 1KB9F 3FFQA 2QE7G 2PYJA 3ETEA 2WPDG 4X66B 4HZ3A 3ZHVA 5EYPB 1ZX3A 3H1JH 4DW0A 2Q6AA 4XDLA 4UCUA 4DV5B 4DUYO 4LNUA 1KC8W 2L6LA 1Q82W 4QIWF 3BAAA 5KHKA 3BRCA 5E1AC 1Y66A 4JF3A 3OMNB 4L8JA 3APQA 2ZR3A 2ARHA 2Y4TA 2F66C 2EIJC 2VS0A 1AILA 3LDCA 4H0LB 4QPJA 2EZOA 5BR8B 1IBKB 3RW0A 1DF4A 4DR7B 3P32A 4NB5A 1YJNV 3O65A 1MSWD 4W4KA 1KKDA 4DK0A 4JI3O 3N2GB 1SQBH 1XMQB 4CC5A 1G6UA 2VWKA 3CSXA 3WG7C 2DYSC 3CPWU 5LGNA 1XDCA 3WFVA 3E8FA 1OCRC 1M1KW 4XDJA 2VWJA 1PL0A 1M57C 2ZQMA 2OTLV 3ZIAG 1AI7A 2HHHB 3STLC 2YDEA 3AG4C 2JS5A 2UUAO 1OV9A 5KHHA 2FTKA 1DLBA 3SJCC 4J7JA 1VF6A 1FJGO 2E5LO 1V55C 4PV1B 4YY3O 1UFIA 4MVOA 4AILC 1FS0G 2BOCC 3THOA 3FB8C 5CA0B 3CCLV 1WB8A 2P4VA 4MW8A 4FZ1A 5B1BB 5GTHZ 1XNRB 5A9GA 4LH7A 4CH6A 2ZCEA 3RN4A 1S5HC 3OEHG 4I7ZB 4J9YB 3IGAC 5LA6B 1WB7A 3DXRB 2EIMB 2HEPA 3M8AA 3U11A 1R6TA 3SYPA 1CPYA 1VQ7V 3K5MA 2JVDA 2LP7A 3ETGA 1Q43A 1Z5WA 2QWRB 3JSLA 2BE3A 4IHJA 3E8GA 1HNWO 3CCMV 2YI8A 5LMNB 2Q0OC 2XT9A 4DV6O 1H2KA 3E2EA 3OR6C 2ZNJA 4TSFG 3E8BA 2F95B 3JASB 2QM7A 4LF4O 5CA0A 1IX9A 1G4YB 2Q0AA 4YIPA 5DN6G 2ADQB 4LWSB 2OTJV 1H38A 4MTXA 1H2LA 2V4DA 3EFFK 1H2NA 4OPHA 1LUVA 3T1HB 1AI4A 3HB3B 3TXSA 2R72A 4X65O 2VQFO 2FL4A 3L74H 1N0JA 1BSMA 1PP9H 4CS2A 2OCHA 1IZ3A 3QTCA 4EKWA 3UCSC 1WPBA 2KG7A 3RYIB 1BS3A 1SQQH 4H37A 1I7FA 2YIBA 2Q7GA 4LF6O 5GW7A 2Y0PA 3JARA 3CRMA 2YEVA 5FPOA 2Q68A 2KB1A 3SJAC 4DV3B 1NQTA 4PI2A 5CA3A 3TETA 1Q5OA 1KP2A 2D3OW 1K33A 2LJ2A 1KD1W 2WWWA 2UXDB 3AEIA 1L8DA 1PL4A 4XBFA 4DV2O 2JRIA
chains in the Genus database with same CATH topology
1VQ5V 3CP1A 4J9ZB 5LHGA 2JEUA 3BY6A 4PDMA 1PNLA 1F4NA 3LNMB 2OT5A 4MTOA 5CBFA 1AJPA 3X2QC 1SERA 4JYCA 4WFAV 2XOKG 4QJFB 2R9RB 3JYCA 1P7BA 3E86A 4QE9A 3VBBA 2WLLB 5LBQA 3JD4A 4GCZA 1KP3A 4JASA 1VQ4V 1S77D 5IY5B 4DXWA 2JDIG 2A9HA 1OCCB 3OR7C 2DWEC 3CD6V 4GX1A 1S3JA 2IJHA 1R3JC 3MD0A 1NBMG 4GT1A 4JAVA 2CK3G 4JYBA 3K04A 4MVZA 2XAJA 4Q20A 4U7NA 4ASUG 1EFRG 5HFMA 4WFFA 1ZWIC 4UV8A 3OMIB 4I9WA 1FXVA 3MHHC 4L87A 3I55V 3K0GA 4HAMA 1GTOA 3T4DA 3LUTB 5CBGA 3CMEV 2A0LA 5EBLC 2P6JA 3ZN0A 3AG2B 4F4LA 2P90A 5EK0A 2WLKA 4MTGA 2ZDIA 1VQ9V 2IW5A 1ORQC 3A0RA 4RUFA 4MSWC 2IU3A 3CXCU 1R3LC 2EJRA 2YEVB 2K1EA 5H6QA 2ZXWC 1COWG 1E1RG 3ML0A 1KECA 3F5WC 1KQSU 3OE7G 1F51A 3PJSK 2C2AA 2WLHA 3QO7A 2EIJB 3W7UA 4OXSA 3JD0A 1CEZA 4WFHA 3OM3B 2PI4A 3JD3A 1R6KA 2DWDC 2WLIB 1R3IC 1GM8A 4PELA 2R9IA 3ETDA 3ABLB 2HKOA 4PA7A 3G6EV 5IYDO 5KA5A 1I5YA 1XL4A 3MHSC 1JX9A 1GK9A 1J95A 3OUFA 3CCEV 1QVFU 1MOFA 3LDDA 2QEXV 1V54B 2HFEC 2A79B 5L3BA 3FYIB 2IJKA 4JAUA 5B3SB 1H8HG 2ZD9A 1QLEB 1S76D 4UVAA 4WFGA 4PA4A 5KUKA 1M90W 1QR8A 3JD1A 4JTDB 4R50A 1Q81W 4MTFA 3SPIA 1VQPV 2LFRA 2YSUB 3QO8A 1M57B 5L3FA 5HFLA 2P67A 3ZMSA 1QR9A 1BMFG 4YXWG 1JVMA 4G28B 1YI2V 3CMAV 4FJCC 1M56B 4ZKIA 4TT3G 3KG2A 1QVGU 4PDLA 4GX2A 3BEHA 2DQ0A 1MABG 3CC7V 1NJIW 1S0VA 2Y69C 1JQ0A 1AROP 4KFMA 1JJ2U 2X0LA 1BL8A 1GO3F 3CC2V 4MVRA 3CC4V 5L3GA 2JJ2G 4BAYA 2QKSA 3K08A 1K34A 3P30A 3TK1A 3SPCA 3ZRSA 1K97A 2EIKC 2WLIA 1THZA 1VQ8V 4E2LA 5IYCO 5EBWC 3SPHA 2QA4V 2QM8A 1OCZC 4N21A 4DO2A 3AG3B 1AI6A 2B5UA 3D36A 1RM1C 3IFXA 2HR3A 1XL6A 2WLMA 4LC1A 4G27B 1GMGA 4X88A 1H8EG 4PA9A 3EHBB 3SYAA 5B1NA 3K03A 3OFNG 3DTUB 1VQ6V 3G71V 5KA6A 4R7CA 3CCJV 1ENVA 2F43G 1VQLV 1MG1A 4FMTA 4FPPA 1PNMA 4FK5C 4P30A 3SPJA 3TCUA 5H9CA 4TWKA 4PA6A 2Z3YA 3W7SA 4QPKA 2HVKC 1YIJV 1IXMA 2DYRB 5B1BC 4ZBMA 3F7YC 3ABMB 4MVQA 1NVPB 1OCOC 5IDJA 3K3WA 3QNEA 2ATKC 3G4SV 1HWYA 1TUEB 2ITDC 2X6CA 3FB7C 3CCVV 1R3KC 1JOYA 5LHIA 5IY5C 4GX5A 4RUEA 3SPGA 5L3CA 3ABUA 1QCEA 1I5XA 4WFBV 1RPRA 1G8MA 3LSQA 1VQOV 2EIMC 2QTOA 2XAQA 2XASA 2WLNA 2QE7G 2W0FC 3ETEA 2XAGA 2BOBC 4HYOA 2WPDG 2X7RB 3RBZA 3CCSV 4HZ3A 4CBCA 4MVMA 5B1AB 1YSCA 2WLJA 5CMUA 3ASOB 3CCUV 3HPLC 2B1IA 2V1DA 3AG2C 1SETA 2Q6AA 4XDLA 1FXHA 1QBZA 1KC8W 2Y48A 2M7WA 1Q82W 3SJQC 4QIWF 1W2BU 4LP8A 2OCCC 5E1AC 1Y66A 1H2GA 4JF3A 3OMNB 4WFEA 2JK5C 3T1CA 1K5SA 2ZR3A 3JD2A 4UVCA 5LHHA 4MVSA 1SESA 2EIJC 3ASNC 3W7WA 1NH2D 1K3EA 3LDCA 4QPJA 5LGTA 2EZOA 3SYOA 4PDVA 1Y4MA 5B1OA 2AHZA 3RW0A 1DF4A 1M9NA 3P32A 3ABKB 4LCUC 3ZRWA 1JPXA 3ABLC 3IC7A 1NH2B 1NR7A 4QNHB 3LDEA 1K8AW 2JJ1G 3W7TA 1K73W 3GWOA 1YJNV 4WF9V 1LNQA 1MSWD 1GKFA 5C93A 1KKDA 2W6IG 1PD3A 1CP9A 4JPRA 3R65A 3OAAG 5H6RA 1DTOA 2Q69A 1YJ9V 2MK3A 2EINB 4BIUA 2EILB 3ZMUA 3WG7C 2DYSC 5B3SC 3CPWU 1K4DC 1OZ0A 3AG1B 1K9MW 1VQNV 5LGNA 4QE7A 4PA3A 3WFVA 3E8FA 1OCRC 2NNUA 4WCEV 1M1KW 1AI5A 4XDJA 3JCZA 1AJNA 1QLNA 4KP4A 1EBOA 1PL0A 1WLEA 1M57C 2LFSA 4R8CA 5CN0A 4R6ZA 3SYCA 2H94A 1SZTA 1FXKC 5EBMC 2EIKB 2ZQMA 2ITCC 2OTLV 1M56C 2XNDG 3ABTA 2HVJC 4JTAB 3ZIAG 4BW5A 1AI7A 3CCQV 1PNKA 5KUMA 4P9OA 3STLC 1OCZB 3AG4C 3ZRXA 2IU0A 4RO2A 3W7XA 2ZDIC 3X2QB 2FTKA 1DLBA 5DM6V 4Z1MG 2JIZG 3K06A 1W0JG 3B8MA 1L1FA 3T4ZA 1YITV 1B6QA 4CZZA 2GSMB 1BHBA 1K5QA 1V55C 2AHYA 4RAIA 3SYQA 3FB5C 2XAHA 5L3DA 1NKDA 4MVOA 2HJFC 1FS0G 2BOCC 2UXXA 3AG3C 3D3IA 3FB8C 4LBEC 4UV9A 3RVZA 5BZBA 4MW8A 3CCLV 1N8RW 4I5SA 5B1BB 1EZJA 3LSSA 2X6AA 5L3EA 3E83A 4XDKA 4U7OA 1P4RA 3UKMA 1OCOB 3ZRWB 3OGCC 2ZR2A 1YTFD 3H01A 4PDRA 3ZMVA 1OCCC 1GM9A 1S5HC 1K4CC 3OEHG 1F23A 4KUMA 3OEEG 4GX0A 4J9YB 5CBHA 3ZRVA 3IGAC 4MS2A 3ZJZA 2DYRC 2EIMB 1YTFB 3OW2U 3ABMC 2NLJC 3SYPA 2ZXWB 3K9AA 1FXKA 1CPYA 2DW4A 1WPXA 1VQ7V 3DGEA 2EBOA 3M99B 5IYBO 2LP7A 3ETGA 2WAMA 1E1QG 3FKSG 3T2MA 3K79A 2IJIA 4P9PA 4FIPC 3E8GA 4P2ZA 3CCMV 3ZMZA 1F4MA 3VOUA 2HLDG 1Q86W 1R73A 3K0DA 3UM7A 4UVBA 1FFTB 2OCCB 1NR1A 2W6JG 3FB6C 3ZN1A 3E2EA 3OR6C 4UUJC 2WSSG 4TSFG 3E8BA 5B1AC 3ASOC 1R6NA 3NXSA 3ASNB 2H8PC 2QM7A 4MT8A 3QO5A 5EC1C 1G4YB 2IH3C 3I56V 3B8NA 4UXNA 4H33A 2Z5UA 5DN6G 1DF5A 3GB7C 2UXNA 1AR1B 1VQKV 1K92A 2OTJV 2WLLA 2X6BA 4JTCB 4MTXA 1H38A 3STZC 1K7DA 3EFFK 3E8HA 1SRYA 4MW3A 3RVYA 2DQ3A 1YJWV 1Q7YW 1AI4A 3HB3B 3OUSA 1V54C 3FYEB 2EZPA 3WG7B 2DYSB 1S72V 1VQMV 4JGSA 1JCHA 1QLEC 3ABKC 3E89A 5FL7G 5J9PC 1W0KG 5LGUA 2GHYA 1OCRB 4EKWA 1YHQV 1ROPA 2IJJA 4N23A 2Y69B 3CCRV 1RPOA 4H37A 1E79G 5EC2C 1GM7A 2JEXA 5GW7A 2EINC 2IH1C 1FXKB 2EILC 2V7QG 4BIZA 2YEVA 2XAFA 3AG1C 2Q68A 3CYOA 4G2KA 4X8AA 2PI5A 2KB1A 3AG4B 1AJQA 1NQTA 3OMAB 5CA3A 2HG5C 1RM1B 1NVPD 3ZCCA 4RQEA 3TETA 1KP2A 1PKXA 3ZMTA 1UJWB 3E35A 2B1GA 4RQFA 4MVUA 1K33A 2D3OW 1KD1W 2WWWA 2Q67A 1BHAA 3F7VC 3B77A 2P7TC 3AEIA 1OHHG 4XBFA 4X89A 1V55B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR C;  4WFE A;  2JK5 C;  3T1C A;  4J9Z B;  1JVM A;  4G28 B;  4MVS A;  3ABM C;  4PDM A;  2EIJ C;  3ASN C;  3LNM B;  2NLJ C;  3SYP A;  4MTO A;  5CBF A;  3LDC A;  3KG2 A;  4PDL A;  3X2Q C;  4GX2 A;  3BEH A;  3SYO A;  4PDV A;  2AHZ A;  2R9R B;  3RW0 A;  3JYC A;  1P7B A;  3E86 A;  2Y69 C;  4QE9 A;  4KFM A;  3T2M A;  2WLL B;  4LCU C;  4P9P A;  3ABL C;  1BL8 A;  4QNH B;  3LDE A;  3E8G A;  4P2Z A;  4DXW A;  2A9H A;  4MVR A;  3VOU A;  3OR7 C;  1LNQ A;  2DWE C;  2QKS A;  4GX1 A;  3K08 A;  3ZRS A;  1R3J C;  3SPC A;  3K0D A;  2EIK C;  2WLI A;  3UM7 A;  1KKD A;  3FB6 C;  3K04 A;  4MVZ A;  5EBW C;  3R65 A;  3SPH A;  3OR6 C;  4UUJ C;  5B1A C;  2Q69 A;  3E8B A;  1OCZ C;  3ASO C;  4WFF A;  1ZWI C;  2H8P C;  4I9W A;  3IFX A;  2DYS C;  1XL6 A;  3WG7 C;  5B3S C;  5EC1 C;  1K4D C;  1G4Y B;  2WLM A;  2IH3 C;  4G27 B;  3K0G A;  4X88 A;  4PA9 A;  4QE7 A;  3SYA A;  4PA3 A;  3LUT B;  3K03 A;  3T4D A;  5CBG A;  3E8F A;  1OCR C;  4H33 A;  2A0L A;  4R7C A;  5EBL C;  3GB7 C;  4F4L A;  5EK0 A;  4XDJ A;  2WLK A;  4MTG A;  2WLL A;  2X6B A;  1M57 C;  4JTC B;  4P30 A;  4R8C A;  3STZ C;  3SPJ A;  4R6Z A;  1ORQ C;  4RUF A;  3SYC A;  3EFF K;  4TWK A;  3TCU A;  3E8H A;  4MSW C;  4PA6 A;  4MW3 A;  3RVY A;  1R3L C;  5EBM C;  2ITC C;  2K1E A;  2HVK C;  1M56 C;  2ZXW C;  2HVJ C;  4JTA B;  3F5W C;  5B1B C;  4BW5 A;  5KUM A;  3STL C;  3OUS A;  4P9O A;  3F7Y C;  1V54 C;  3PJS K;  4ZBM A;  2WLH A;  3AG4 C;  4MVQ A;  4OXS A;  1OCO C;  4RO2 A;  2ATK C;  1QLE C;  3E89 A;  3ABK C;  2ITD C;  2X6C A;  3FB7 C;  4WFH A;  1R3K C;  5J9P C;  5IY5 C;  3K06 A;  4EKW A;  4GX5 A;  2DWD C;  4RUE A;  2WLI B;  3SPG A;  1R3I C;  3T4Z A;  4H37 A;  4PA7 A;  5EC2 C;  1V55 C;  2AHY A;  4RAI A;  3SYQ A;  2EIM C;  3FB5 C;  1XL4 A;  2QTO A;  4MVO A;  1J95 A;  2EIN C;  2IH1 C;  2WLN A;  2EIL C;  2HJF C;  2BOC C;  3AG3 C;  3FB8 C;  2W0F C;  3OUF A;  4HYO A;  2BOB C;  4LBE C;  3RBZ A;  2YEV A;  4MW8 A;  3RVZ A;  5BZB A;  4HZ3 A;  3AG1 C;  2Q68 A;  3LDD A;  4MVM A;  4X8A A;  4CBC A;  2HFE C;  2KB1 A;  2WLJ A;  2A79 B;  2X6A A;  3E83 A;  3HPL C;  4XDK A;  3UKM A;  2HG5 C;  3AG2 C;  2ZD9 A;  2Q6A A;  3OGC C;  3TET A;  4XDL A;  4MVU A;  4WFG A;  4PA4 A;  5KUK A;  2Q67 A;  3F7V C;  4PDR A;  2P7T C;  1OCC C;  1S5H C;  1K4C C;  4JTD B;  4R50 A;  3SJQ C;  4MTF A;  3SPI A;  4GX0 A;  4J9Y B;  4LP8 A;  5CBH A;  3IGA C;  2OCC C;  4MS2 A;  5E1A C;  4X89 A;  3ZJZ A; 
#chains in the Genus database with same CATH topology
 1I0H A;  4J9Z B;  1PNL A;  3LNM B;  2OT5 A;  3ZS8 C;  5E79 Z;  2ZE5 A;  4LFB O;  1XBL A;  4DR2 O;  1P7B A;  3WU2 Z;  4ABM A;  4JI1 O;  4QE9 A;  1TGO A;  2WLL B;  3HKE B;  5IWA B;  3ICX A;  4RWU A;  1SC5 B;  3CD6 V;  4GX1 A;  4GT1 A;  1R3J C;  4JAV A;  1NBM G;  2P5O A;  4DV7 B;  2DJV A;  3K04 A;  1SQP H;  2XAJ A;  4U7N A;  1SQV H;  4WFF A;  2CTP A;  3HKC B;  3JAL B;  2ODM A;  1ZL8 A;  4L87 A;  2A06 H;  1FKA O;  4IL6 Z;  4HAM A;  3T1H O;  4YJ2 A;  3D8C A;  4AHC A;  4JI8 B;  5EBL C;  1SQX H;  4F4L A;  4K0K B;  2P90 A;  2YXY A;  2IM9 A;  4DK1 A;  1VQ9 V;  2HP8 A;  5C8Y B;  2QM4 A;  4TV8 B;  1X4T A;  1R3L C;  2K1E A;  1EM1 A;  1KQS U;  2C2A A;  2WLH A;  2CAZ C;  4O2A B;  3W7U A;  1JFF B;  1CEZ A;  2CTQ A;  2F1M A;  3JD3 A;  1FYJ A;  5LXT A;  2E74 B;  1R3I C;  1GM8 A;  3A8T A;  1LR1 A;  4LH6 A;  1ZUQ A;  2UXB B;  1XL4 A;  1HNZ O;  3UT5 A;  3OUF A;  2PZS A;  3HKB A;  4B3R O;  3LDD A;  3H1L H;  1N32 O;  1V54 B;  2HFE C;  4YHH B;  4NXM O;  2IJK A;  3VQW A;  3HKC A;  3JAL A;  5B3S B;  2ZD9 A;  4JYA O;  1QLE B;  2B9Z A;  2ZIO A;  3JD1 A;  1Q81 W;  2RMK B;  1XMO B;  2YSU B;  4Z2W A;  4JI6 O;  5HFL A;  2P67 A;  5FNV A;  5C8Y A;  1QR9 A;  4YXW G;  3CMA V;  1JA8 A;  4FJC C;  2BTO A;  3B09 A;  4K8X A;  3A2F A;  1B3Q A;  1SKV A;  1NJI W;  1JFF A;  4I4T B;  3E22 B;  2Y69 C;  1JQ0 A;  5JVD B;  3O9O A;  2JJ2 G;  1N36 B;  3SPC A;  2EIK C;  1PPJ H;  5IYC O;  4FLU A;  2CE4 A;  2QA4 V;  2QM8 A;  5GON A;  3SDL A;  4AI8 A;  3JAT A;  2RDC A;  2UUB O;  3AG3 B;  3IFX A;  2HR3 A;  1XL6 A;  1HNX B;  5ITZ A;  3SYA A;  1N33 O;  1VQ6 V;  4ZIB A;  2VQE B;  2N74 A;  3CCJ V;  1EN4 A;  4BW9 A;  2F43 G;  2LGQ A;  1BQZ A;  1PM9 A;  4FMT A;  1MZF A;  5KMG B;  4PA6 A;  1H2S B;  2HVK C;  3D3Q A;  5FLX N;  1KBH A;  2DYR B;  2DE0 X;  1MSD A;  3JSN A;  2VRZ A;  5IDJ A;  1XQ8 A;  3C3S A;  1VF7 A;  1HWY A;  3CCV V;  5LHI A;  2GTS A;  4K35 A;  4GX5 A;  2WA4 A;  3M7M X;  5EZY A;  4I4T A;  3E22 A;  1I5X A;  4AQY B;  4WFB V;  1G8M A;  1VQO V;  4X62 O;  2QTO A;  2XAQ A;  5BMV B;  5JJJ B;  2XAS A;  3HKD B;  2W0F C;  2X7R B;  5EIB D;  4KHP B;  1IVS A;  4MVM A;  2GV9 A;  2WLJ A;  5CMU A;  3K59 A;  3CCU V;  2PF4 E;  2B1I A;  1O9G A;  2OIG A;  1YEW A;  2V1D A;  2CGO A;  3CEI A;  2LQT A;  2O57 A;  4JI5 O;  4FLV A;  1U97 A;  2OCC C;  1IBL B;  1H2G A;  1I94 B;  1K5S A;  1SES A;  3RYH B;  5KMG A;  1XHX A;  1NH2 D;  2UXC O;  2EUL A;  2Q7E A;  3RFR A;  4KXR A;  2AHZ A;  1M9N A;  1YXB A;  1JPX A;  1NH2 B;  3NR7 A;  4QNH B;  1WP7 A;  4DUZ O;  1Y67 A;  4YJ3 B;  4Z1V A;  4WF9 V;  1LNQ A;  1GKF A;  3A0H Z;  2NN4 A;  3R65 A;  2ADP A;  4GKJ O;  5BMV A;  4BIU A;  1XOU A;  1URF A;  1GH6 A;  1D5A A;  1GAX A;  1AI5 A;  3ZHT A;  4J7K A;  3AG7 A;  4JI2 B;  1AJN A;  4ZI7 A;  1QLN A;  2M6Y A;  3BFR A;  4KP4 A;  1WLE A;  3CWB H;  1L0L H;  3SYC A;  1KKC A;  2H94 A;  3TGU H;  1FXK C;  5EBM C;  4DV1 B;  3QF7 A;  1BE3 H;  4JTA B;  5LMU B;  4DYL A;  4P9O A;  4JV5 O;  1OCZ B;  2KQX A;  4X9Q A;  4YIO A;  4X64 B;  1ZLZ A;  4RO2 A;  5DM6 V;  4Z1M G;  4KHP O;  4LNU B;  3K06 A;  2YXH A;  3B8M A;  1L1F A;  4E4E A;  3T4Z A;  4CZZ A;  2GSM B;  3K5L A;  2AHY A;  1BGY H;  4RAI A;  4LF8 B;  3FB5 C;  4FFB A;  3CRC A;  1XNQ B;  5IYZ A;  1M5I A;  2HJF C;  2UXX A;  2H3O A;  4LBE C;  4UV9 A;  1VP7 A;  1RP3 B;  4I5S A;  3LSS A;  2QJ1 A;  5L3E A;  2ZIN A;  4DR4 B;  3AK1 A;  3U0Z A;  4PDR A;  1KUQ A;  3VQX A;  1OCC C;  1F23 A;  4KUM A;  5IJ0 B;  4MS2 A;  4LF7 B;  4B7E A;  1YF2 A;  4LFC B;  4NVP A;  1AVM A;  4B3T O;  3K9A A;  1FXK A;  2DW4 A;  4B3M B;  1WPX A;  2OWO A;  2Q73 A;  1U96 A;  2QR4 A;  5J2T A;  1YZB A;  4U3J B;  1E1Q G;  3T2M A;  4P9P A;  4DV0 B;  4O4H A;  1F4M A;  2HLD G;  2QKA A;  1N34 B;  1NR1 A;  4ZHQ B;  3APO A;  4UUJ C;  2WSS G;  4X1I A;  3OTO B;  5KHI A;  3NXS A;  2H8P C;  1IBM O;  4MT8 A;  3QO5 A;  5EC1 C;  2GTA A;  3K57 A;  4H44 B;  4JI0 O;  4H33 A;  1DF5 A;  3GB7 C;  3SGI A;  1AR1 B;  4DR6 O;  4NTX A;  2X6B A;  4JTC B;  1K7D A;  1Z5V A;  3E8H A;  1QQC A;  1SRY A;  3D36 C;  1YJW V;  2DQ3 A;  5IJ0 A;  1Q7Y W;  2RJZ A;  3OUS A;  1J5E O;  4LF8 O;  4CS3 A;  3QVN A;  3C3T A;  2EZP A;  3WG7 B;  2DYS B;  1VQM V;  1NTM H;  5J9P C;  1GN3 A;  3H1I H;  2GHY A;  1OCR B;  5H2F Z;  1ROP A;  3G6B A;  4DR4 O;  1XEQ A;  4U3J A;  2ZNI A;  1HR0 B;  1E79 G;  1GM7 A;  2JEX A;  2KSD A;  1SQF A;  2LO1 A;  4ZHQ A;  4X8A A;  1PV0 A;  2PI5 A;  3H1H H;  3AG4 B;  1AJQ A;  4NKG B;  3OMA B;  1M93 A;  2AGA A;  1RM1 B;  1NVP D;  3ZCC A;  1AR4 A;  1PKX A;  4IHJ B;  3ZMT A;  2B1G A;  4X66 O;  1NU1 H;  3OT7 A;  1BHA A;  2F23 A;  2Q67 A;  3F7V C;  2P7T C;  2BSK A;  1YVW A;  2ZM6 B;  3J81 N;  4GUN A;  2AW9 A;  1NVP B;  1V55 B;  2F4V B;  4DV5 O;  4HNA B;  4PDM A;  5CBF A;  1P84 F;  1SER A;  3ZX6 A;  4DW1 A;  4WFA V;  2XOK G;  3OTO O;  4CS4 A;  2R9R B;  3JYC A;  1OJH A;  3FAV B;  1M4U A;  4GCZ A;  1KP3 A;  2UU9 B;  4DXW A;  2JDI G;  5BR8 O;  3KCX A;  3OR7 C;  1IBK O;  2PYL A;  5D5Q A;  3MD0 A;  4DR7 O;  1VF5 B;  4MVZ A;  1EFR G;  4K3A A;  1ZWI C;  3OGI B;  2YIB D;  3OMI B;  4I9W A;  4FLY A;  1NTK H;  4FLX A;  1XMQ O;  1YDX A;  2KG7 B;  3CME V;  2A0L A;  2P6J A;  3AG2 B;  4LFA B;  4TQD A;  3PN1 A;  3A0B Z;  3JAR B;  3A0R A;  4RUF A;  2NR5 A;  4FM0 A;  4JI7 B;  2YIC A;  2YEV B;  1E1R G;  3ML0 A;  1KEC A;  3F5W C;  3T1Y B;  4HNA A;  3CRR A;  2EJ7 A;  5KLV H;  2HHH O;  1VIB A;  2DWD C;  4PEL A;  3ABL B;  1D5N A;  3FAV A;  5IYD O;  2GBO A;  4JYY A;  3CX5 F;  1QVF U;  1MOF A;  4X1Y A;  2QEX V;  4GKK B;  4LF9 B;  1FD9 A;  1US6 A;  3GWK C;  4JAU A;  3H9V A;  5JWP A;  1MA1 A;  3CJH A;  4WFG A;  3MDS A;  4BWA A;  4NXN B;  3R66 A;  4JTD B;  2CGN A;  2ZKO A;  4MTF A;  4DR5 B;  1XNR O;  3VQV A;  4IT5 A;  4B3S B;  5JCO C;  1BMF G;  2R9A A;  4G28 B;  1ZL8 B;  5KX5 A;  1M56 B;  4ZKI A;  4TT3 G;  4YJ2 B;  4GX2 A;  1GN4 A;  3BEH A;  3EXA A;  5DEC A;  3CC7 V;  2QWN B;  1S0V A;  1ARO P;  1BZK A;  3KZI Z;  3ZHS A;  2BTQ A;  4BAY A;  1MMM A;  4ZOL A;  3P30 A;  3ZRS A;  1THZ A;  5CA1 A;  4DO2 A;  5LMN O;  3EVK A;  2ETN A;  1KU9 A;  2XHB A;  4X88 A;  3L9D A;  3EHB B;  5JJN B;  2IBZ H;  3OFN G;  5LXT B;  3DTU B;  2W0X A;  2D2C B;  2UUC B;  3TCU A;  3UT5 B;  2Q4P A;  3HKB B;  1YIJ V;  2Q8V A;  4KL1 A;  1X59 A;  4FZ0 A;  4O2B B;  3F7Y C;  4DV4 B;  1JR9 A;  3ABM B;  4D6T H;  5LYJ B;  1OCO C;  3K3W A;  2YID A;  3JAW A;  3FB7 C;  1ZAU A;  3SPG A;  4J10 A;  1RPR A;  2R70 A;  5FNV B;  3L72 H;  4OPA A;  2WLN A;  4HYO A;  3RBZ A;  5B1A B;  3ASO B;  4DR3 B;  3HPL C;  1SET A;  2JS3 A;  2EX3 A;  4I0X B;  1W59 A;  2AZ0 A;  1FXH A;  1QBZ A;  4DV3 O;  2Y48 A;  2M7W A;  3SJQ C;  2DMX A;  5IT9 N;  4LP8 A;  5GON B;  5B66 Z;  2UXD O;  3JAT B;  2JK5 C;  3JD2 A;  3ASN C;  3W7W A;  5ITZ B;  4J80 A;  1B06 A;  3DC6 A;  5LGT A;  4O2B A;  5B1O A;  4O4L A;  1P7G A;  3QG5 A;  5LYJ A;  1FAF A;  3ABK B;  2ZT9 B;  3ZRW A;  3IC9 A;  1V9P A;  3IC7 A;  3LDE A;  3UO3 A;  1K8A W;  1Q6U A;  3W7T A;  4CH3 A;  1K73 W;  3GWO A;  3L71 H;  5C93 A;  1D2D A;  2W6I G;  1PD3 A;  5IWA O;  5IE9 A;  3OAA G;  2FKX A;  1DTO A;  5GTI Z;  2MK3 A;  2EIN B;  1FPO A;  2EIL B;  5B3S C;  4DV7 O;  3AG1 B;  1VQN V;  4QE7 A;  4PA3 A;  4DR1 B;  5EZY B;  2ZE6 A;  1TVK A;  4GLX A;  3BA9 A;  4I0X A;  4EEQ A;  4R8C A;  4R6Z A;  4JI8 O;  4FM1 A;  4JI4 B;  4K0K O;  2EIK B;  1RSO B;  1GRJ A;  3ABT A;  3VQY A;  4TUY A;  5JH7 A;  3N27 A;  3J80 N;  3RT3 C;  4BW5 A;  1AP6 A;  1FFX B;  5KUM A;  5A2Q N;  3CCQ V;  2KKW A;  3ZRX A;  1NT2 B;  5LP6 C;  2IU0 A;  3W7X A;  2ZDI C;  3CXH F;  3X2Q B;  1Z2G A;  4TV9 A;  4UCV A;  4DR3 O;  1W0J G;  1YIT V;  1B6Q A;  1BHB A;  1JMK C;  3SYQ A;  2YI9 A;  1NI8 A;  1MNG A;  1NKD A;  3AG3 C;  3RVZ A;  5BZB A;  3RYC B;  4IYI A;  2UXB O;  4X20 A;  5KAF Z;  4XDK A;  1P4R A;  3UKM A;  3OGC C;  1YTF D;  1L0N H;  3H01 A;  4YHH O;  3ZMV A;  4QGP A;  1GM9 A;  1TUB A;  1K4C C;  4OX9 B;  2RCV A;  4GX0 A;  3ZRV A;  1YCI A;  2DYR C;  1YTF B;  1QHT A;  2ZXW B;  1XMO O;  1RSO A;  2E3C A;  3Q4H A;  3CRA A;  1FFX A;  2EBO A;  3DGE A;  3M99 B;  2WAM A;  4ZI7 B;  2YUA A;  2E76 B;  3G67 A;  3K79 A;  2IJI A;  4FIP C;  4P2Z A;  1NTZ H;  3VOU A;  1Q86 W;  1R73 A;  3K0D A;  4UVB A;  2OCC B;  3ZN1 A;  3FB6 C;  3B2E E;  1R6N A;  4Q6G A;  1N36 O;  2IH3 C;  3RYC A;  3I56 V;  3UO2 A;  2Z5U A;  2UXN A;  1TAE A;  3FD9 A;  1K92 A;  3JAM N;  1HNX O;  3ZHR A;  2LW1 A;  3STZ C;  4FFB B;  2VQE O;  5IYZ B;  3TXQ A;  4I50 A;  2QWO B;  5AG2 A;  2ZIM A;  2P4K A;  1S72 V;  4JGS A;  1JCH A;  3E89 A;  5LGU A;  4A5U B;  2IJJ A;  4N23 A;  3K5N A;  4PJ0 Z;  2IH1 C;  1FXK B;  1IUR A;  1S5J A;  5K1X A;  5JJE B;  2V7Q G;  4AQY O;  1S5L Z;  3SR2 C;  3CYO A;  4G2K A;  5J2T B;  4DUY B;  1XUQ A;  4RQE A;  1Q6I A;  3E35 A;  4O4H B;  5KAI Z;  3B77 A;  1OHH G;  2Q5Z A;  2P22 C;  4X1K A;  4X89 A;  4X1I B;  1K34 A;  1VQ5 V;  5KHG A;  3DC5 A;  4EB6 B;  3CP1 A;  5LHG A;  5IJ9 A;  1F4N A;  1QNM A;  3G80 A;  1IBL O;  3K9S A;  1I94 O;  1CXZ B;  1UPG A;  4F6E A;  3E86 A;  3K58 A;  1GN2 A;  3BAB A;  3VBB A;  1HP8 A;  5LBQ A;  1Y74 B;  4JAS A;  4CH5 A;  1VQ4 V;  4JI3 B;  5IY5 B;  4EFB A;  4GZR B;  1OCC B;  2DWE C;  1S3J A;  2IJH A;  4JYB A;  2YIA A;  2CK3 G;  2GUZ B;  3ETQ A;  2JGU A;  5HFM A;  1FXV A;  3MHH C;  3I55 V;  3K0G A;  1GTO A;  1XI1 A;  3LUT B;  1KYO F;  5CBG A;  2CH7 B;  2WLK A;  4MTG A;  2PTM A;  1ORQ C;  1EN5 A;  2IU3 A;  3CXC U;  4JI2 O;  4U3F H;  2UUA B;  3OE7 G;  1F51 A;  1F7Y A;  3PJS K;  4EB6 A;  2FML A;  3QO7 A;  2EIJ B;  1FJG B;  3JD0 A;  4F6R B;  3P3N A;  4DV1 O;  2E5L B;  4WFH A;  1WP8 A;  3OM3 B;  5LMU O;  4YY3 B;  2BSK B;  2WLI B;  4J7Z A;  4JAA A;  4X64 O;  2R9I A;  1T5E A;  2HKO A;  4PA7 A;  1Y76 B;  3BA8 A;  4W4L A;  2N05 A;  3G6E V;  1Y74 A;  4D7S A;  5KA5 A;  1I5Y A;  4H13 B;  1GK9 A;  1J95 A;  2CDY A;  3CCE V;  2GUZ A;  1VF6 C;  2Q7H A;  2A79 B;  5L3B A;  3WB0 A;  1XNQ O;  1SF9 A;  1H8H G;  3U10 A;  5KUK A;  1R1B A;  4FLZ A;  1H2M A;  3UQ8 A;  2WA3 A;  3AK3 A;  2LFR A;  2CH7 A;  3QO8 A;  1M57 B;  1SA0 A;  1JVM A;  3C90 A;  4LF7 O;  3KG2 A;  4PDL A;  4LFC O;  1HNW B;  5EYP A;  1Y6X A;  1MAB G;  3TJT A;  4F6R A;  4IYH A;  4DV6 B;  4B3M O;  4MVR A;  3CC4 V;  1Q90 D;  2RN9 A;  3K08 A;  3TK1 A;  2QKC A;  1K97 A;  2WLI A;  4LF4 B;  4E2L A;  2JGD B;  2K9P A;  1Y76 A;  4DV0 O;  5LL6 Y;  1WAZ A;  2MW2 B;  1AI6 A;  3D36 A;  1N34 O;  1RM1 C;  2WLM A;  3ZHQ A;  4LC1 A;  3LNN A;  5F2V O;  1GMG A;  1WNS A;  4IIJ B;  5B1N A;  3K03 A;  2QWP B;  5KA6 A;  4R7C A;  1ENV A;  1VQL V;  1MG1 A;  4FPP A;  3CE2 A;  3SPJ A;  4X65 B;  5H9C A;  4TWK A;  4NTY A;  2VQF B;  3W7S A;  4QPK A;  3DSQ A;  4X1Y B;  1IXM A;  5B1B C;  1DGS A;  4ZBM A;  3N2G A;  4MVQ A;  4NYK A;  2DOS A;  3CJH B;  3G4S V;  1TUE B;  2YXL A;  1R3K C;  4LF6 B;  1JOY A;  5L3C A;  4UCT A;  1QCE A;  2Y0I A;  3LSQ A;  1HW7 A;  4GYC B;  2EIM C;  5KX5 B;  1XHZ A;  1G1X B;  3H1K H;  2XAG A;  2BOB C;  5BXZ A;  3CCS V;  1HR0 O;  2JGD A;  1Q6H A;  4CBC A;  1VEW A;  4J41 A;  1YSC A;  2GDS A;  4TQF A;  4FFK A;  3I5D A;  3BCC H;  3AG2 C;  2BTQ B;  4DV2 B;  4CH4 A;  4FVM A;  4IIJ A;  4ZOL B;  3ZHU A;  1AP5 A;  1W2B U;  3S3W A;  3BVO A;  3L70 H;  5CA1 B;  4LFB B;  4WFE A;  4LR3 A;  4DRX B;  3T1C A;  2HJD A;  4UVC A;  5LHH A;  4MVS A;  5KHJ A;  4DR2 B;  1VAR A;  2ZM6 O;  4JI1 B;  1K3E A;  3HR0 A;  3S3X A;  2F4V O;  2Y4U A;  2QSA A;  3SYO A;  4PDV A;  1Y4M A;  1RFY A;  4LCU C;  3ABL C;  1NR7 A;  2JJ1 G;  3F5T A;  1ZTE A;  5CB4 B;  2OYQ A;  1CP9 A;  4JPR A;  5LA6 A;  5JQG B;  2UU9 O;  5H6R A;  3DXR A;  2Q69 A;  1YJ9 V;  3ZED A;  4UCO A;  3ZMU A;  2PGG A;  3JAW B;  1K4D C;  1OZ0 A;  1K9M W;  4BR6 A;  4WCE V;  2NNU A;  3JCZ A;  2N04 A;  1EBO A;  2LFS A;  2QTS A;  5CN0 A;  5K1P A;  3CRQ A;  1SZT A;  2ITC C;  1M56 C;  2XND G;  4LFA O;  2HVJ C;  1PNK A;  3CS5 A;  4PI0 A;  4DRX A;  4JI7 O;  2Z0A A;  3JAS A;  4B08 A;  2YC0 A;  5LOV B;  3T1Y O;  2JIZ G;  1HNZ B;  1GN6 A;  1K5Q A;  4LWS A;  4B3R B;  1NZ6 A;  4WBN B;  1N32 B;  3CB2 A;  1XIL A;  2XAH A;  4NXM B;  5L3D A;  3GVM A;  3D3I A;  5CB4 A;  1N8R W;  4JYA B;  1EZJ A;  5JQG A;  2X6A A;  4O4L B;  5JCO A;  3E83 A;  4U7O A;  1HDJ A;  1IXB A;  1OCO B;  3ZRW B;  4UB6 Z;  2ZR2 A;  1WA8 B;  2AZ2 A;  4K8Z A;  4JI6 B;  4GKK O;  2CTR A;  4LF9 O;  3OEE G;  5CBH A;  1BQ0 A;  4EFE A;  3RYI A;  3ZJZ A;  1SS3 A;  2A3Q A;  4NXN O;  3RYF B;  3OW2 U;  3ABM C;  4DR5 O;  2ZE8 A;  2NLJ C;  5J2U B;  4B3S O;  1TVK B;  5IYB O;  2LW7 A;  1Q8I A;  3FKS G;  5LOV A;  2FYU H;  3JAK B;  3ZMZ A;  3JCU Z;  2UUB B;  1VMG A;  1Q3E A;  4TUY B;  3UM7 A;  5JH7 B;  1FFT B;  2W6J G;  1N33 B;  5B1A C;  4WBN A;  2XTA A;  3ASO C;  4ICG A;  3ASN B;  4UB8 Z;  4TV9 B;  3L75 H;  3B8N A;  4UXN A;  3IJ4 A;  4I9Q A;  1VQK V;  1WA8 A;  2WLL A;  3HKE A;  4OGQ B;  2DN9 A;  4PD4 F;  4MW3 A;  3RVY A;  4LF5 B;  4X20 B;  2UUC O;  1V54 C;  3FYE B;  1TA8 A;  3RYF A;  2ZE7 A;  1QLE C;  3ABK C;  5J2U A;  4I55 B;  5FL7 G;  1BCC H;  4X62 B;  1TUB B;  1W0K G;  4DV4 O;  1YHQ V;  2Q9L A;  3OTF A;  2Y69 B;  3CCR V;  1RPO A;  5EC2 C;  3ZBH A;  3WB1 A;  2FB5 A;  3BHP A;  3JAK A;  1I08 A;  4TV8 A;  2EIN C;  2EIL C;  2RNB A;  4BIZ A;  3Q4H B;  2XAF A;  1N4C A;  3AG1 C;  5LP6 B;  4JI5 B;  4O2A A;  2HG5 C;  3B40 A;  1UJW B;  4RQF A;  2AXT Z;  4MVU A;  1QU7 A;  2OIE A;  2UXC B;  2JEU A;  3BY6 A;  3N2K B;  1B04 A;  3B4S A;  4MTO A;  1DK1 A;  4FLW A;  1AJP A;  1N0N A;  4O4J B;  3X2Q C;  1WN7 A;  4DUZ B;  1AR5 A;  4JYC A;  4QJF B;  2QWQ B;  5DED A;  2PUS A;  4CC6 A;  2RQ6 A;  3K5O A;  3JD4 A;  1S77 D;  3L73 H;  4I55 A;  2A9H A;  4GKJ B;  4I50 B;  4J11 A;  3J7A U;  5D5P A;  1SZX A;  4Q20 A;  4B7K A;  4ASU G;  4UV8 A;  4HBN A;  5B5E Z;  2P06 A;  4LF5 O;  3P3P A;  3T4D A;  3SJB C;  3ZN0 A;  5TIS Z;  2PY5 A;  5LP6 A;  3MAQ A;  5EK0 A;  2ZDI A;  5JVD A;  4BIO A;  2ILM A;  2IW5 A;  3OD4 A;  1WJZ A;  5FPR A;  4DR1 O;  4JV5 B;  1IDS A;  4MSW C;  4O4I B;  2EJR A;  5H6Q A;  4UCR A;  2ZXW C;  1COW G;  1NS1 A;  4OXS A;  3N2K A;  4JI4 O;  1LUW A;  1XRE A;  2PI4 A;  3KKY A;  4JZ2 A;  4O4J A;  1R6K A;  5EIB C;  4X1K B;  3ETD A;  3RGB A;  2QDO A;  3LSU A;  5IJ9 B;  3MHS C;  1JX9 A;  2LGW A;  4FLT A;  3FYI B;  4NR1 A;  3RWR D;  2L35 A;  3FX7 A;  3WB2 A;  1S76 D;  1EZV H;  4UVA A;  4PA4 A;  1M90 W;  1QR8 A;  4R50 A;  4J42 A;  3SPI A;  1VQP V;  4B3T B;  5L3F A;  4PHZ A;  1MZE A;  3ZMS A;  1YI2 V;  4FM2 A;  1O9H A;  4OX9 O;  4O4I A;  4JZG A;  3HKD A;  1A32 A;  2YS8 A;  1QVG U;  2E75 B;  3KCY A;  2DQ0 A;  4UFZ A;  4KFM A;  1JJ2 U;  2X0L A;  1BL8 A;  1GO3 F;  3CC2 V;  5BY1 A;  5L3G A;  2QKS A;  3IAY A;  1VQ8 V;  1IBM B;  2CUG A;  5EBW C;  4JI0 B;  3SPH A;  2QGN A;  1OCZ C;  4N21 A;  1BT8 A;  2B5U A;  3RYH A;  3CHX A;  4DR6 B;  4G27 B;  1H8E G;  4PA9 A;  4NTW A;  2CTW A;  1AB3 A;  3G71 V;  1PNM A;  4FK5 C;  4P30 A;  1J5E B;  2G38 A;  4YJ3 A;  2Z3Y A;  3AK2 A;  4D7T A;  1P49 A;  1EN6 A;  2F93 B;  1ZSP A;  2XUM A;  4C7U A;  3BPZ A;  3QNE A;  2ATK C;  2BCC H;  4UCS A;  5H5N A;  2A7W A;  1SQG A;  2ITD C;  2X6C A;  1JJO A;  5IY5 C;  4RUE A;  3ABU A;  4TOI A;  1SA0 B;  4IGG A;  1KMI Z;  1KB9 F;  3FFQ A;  2QE7 G;  2PYJ A;  3ETE A;  2WPD G;  4X66 B;  4HZ3 A;  3ZHV A;  5EYP B;  1ZX3 A;  3H1J H;  4DW0 A;  2Q6A A;  4XDL A;  4UCU A;  4DV5 B;  4DUY O;  4LNU A;  1KC8 W;  2L6L A;  1Q82 W;  4QIW F;  3BAA A;  5KHK A;  3BRC A;  5E1A C;  1Y66 A;  4JF3 A;  3OMN B;  4L8J A;  3APQ A;  2ZR3 A;  2ARH A;  2Y4T A;  2F66 C;  2EIJ C;  2VS0 A;  1AIL A;  3LDC A;  4H0L B;  4QPJ A;  2EZO A;  5BR8 B;  1IBK B;  3RW0 A;  1DF4 A;  4DR7 B;  3P32 A;  4NB5 A;  1YJN V;  3O65 A;  1MSW D;  4W4K A;  1KKD A;  4DK0 A;  4JI3 O;  3N2G B;  1SQB H;  1XMQ B;  4CC5 A;  1G6U A;  2VWK A;  3CSX A;  3WG7 C;  2DYS C;  3CPW U;  5LGN A;  1XDC A;  3WFV A;  3E8F A;  1OCR C;  1M1K W;  4XDJ A;  2VWJ A;  1PL0 A;  1M57 C;  2ZQM A;  2OTL V;  3ZIA G;  1AI7 A;  2HHH B;  3STL C;  2YDE A;  3AG4 C;  2JS5 A;  2UUA O;  1OV9 A;  5KHH A;  2FTK A;  1DLB A;  3SJC C;  4J7J A;  1VF6 A;  1FJG O;  2E5L O;  1V55 C;  4PV1 B;  4YY3 O;  1UFI A;  4MVO A;  4AIL C;  1FS0 G;  2BOC C;  3THO A;  3FB8 C;  5CA0 B;  3CCL V;  1WB8 A;  2P4V A;  4MW8 A;  4FZ1 A;  5B1B B;  5GTH Z;  1XNR B;  5A9G A;  4LH7 A;  4CH6 A;  2ZCE A;  3RN4 A;  1S5H C;  3OEH G;  4I7Z B;  4J9Y B;  3IGA C;  5LA6 B;  1WB7 A;  3DXR B;  2EIM B;  2HEP A;  3M8A A;  3U11 A;  1R6T A;  3SYP A;  1CPY A;  1VQ7 V;  3K5M A;  2JVD A;  2LP7 A;  3ETG A;  1Q43 A;  1Z5W A;  2QWR B;  3JSL A;  2BE3 A;  4IHJ A;  3E8G A;  1HNW O;  3CCM V;  2YI8 A;  5LMN B;  2Q0O C;  2XT9 A;  4DV6 O;  1H2K A;  3E2E A;  3OR6 C;  2ZNJ A;  4TSF G;  3E8B A;  2F95 B;  3JAS B;  2QM7 A;  4LF4 O;  5CA0 A;  1IX9 A;  1G4Y B;  2Q0A A;  4YIP A;  5DN6 G;  2ADQ B;  4LWS B;  2OTJ V;  1H38 A;  4MTX A;  1H2L A;  2V4D A;  3EFF K;  1H2N A;  4OPH A;  1LUV A;  3T1H B;  1AI4 A;  3HB3 B;  3TXS A;  2R72 A;  4X65 O;  2VQF O;  2FL4 A;  3L74 H;  1N0J A;  1BSM A;  1PP9 H;  4CS2 A;  2OCH A;  1IZ3 A;  3QTC A;  4EKW A;  3UCS C;  1WPB A;  2KG7 A;  3RYI B;  1BS3 A;  1SQQ H;  4H37 A;  1I7F A;  2YIB A;  2Q7G A;  4LF6 O;  5GW7 A;  2Y0P A;  3JAR A;  3CRM A;  2YEV A;  5FPO A;  2Q68 A;  2KB1 A;  3SJA C;  4DV3 B;  1NQT A;  4PI2 A;  5CA3 A;  3TET A;  1Q5O A;  1KP2 A;  2D3O W;  1K33 A;  2LJ2 A;  1KD1 W;  2WWW A;  2UXD B;  3AEI A;  1L8D A;  1PL4 A;  4XBF A;  4DV2 O;  2JRI A; 
#chains in the Genus database with same CATH homology
 1VQ5 V;  3CP1 A;  4J9Z B;  5LHG A;  2JEU A;  3BY6 A;  4PDM A;  1PNL A;  1F4N A;  3LNM B;  2OT5 A;  4MTO A;  5CBF A;  1AJP A;  3X2Q C;  1SER A;  4JYC A;  4WFA V;  2XOK G;  4QJF B;  2R9R B;  3JYC A;  1P7B A;  3E86 A;  4QE9 A;  3VBB A;  2WLL B;  5LBQ A;  3JD4 A;  4GCZ A;  1KP3 A;  4JAS A;  1VQ4 V;  1S77 D;  5IY5 B;  4DXW A;  2JDI G;  2A9H A;  1OCC B;  3OR7 C;  2DWE C;  3CD6 V;  4GX1 A;  1S3J A;  2IJH A;  1R3J C;  3MD0 A;  1NBM G;  4GT1 A;  4JAV A;  2CK3 G;  4JYB A;  3K04 A;  4MVZ A;  2XAJ A;  4Q20 A;  4U7N A;  4ASU G;  1EFR G;  5HFM A;  4WFF A;  1ZWI C;  4UV8 A;  3OMI B;  4I9W A;  1FXV A;  3MHH C;  4L87 A;  3I55 V;  3K0G A;  4HAM A;  1GTO A;  3T4D A;  3LUT B;  5CBG A;  3CME V;  2A0L A;  5EBL C;  2P6J A;  3ZN0 A;  3AG2 B;  4F4L A;  2P90 A;  5EK0 A;  2WLK A;  4MTG A;  2ZDI A;  1VQ9 V;  2IW5 A;  1ORQ C;  3A0R A;  4RUF A;  4MSW C;  2IU3 A;  3CXC U;  1R3L C;  2EJR A;  2YEV B;  2K1E A;  5H6Q A;  2ZXW C;  1COW G;  1E1R G;  3ML0 A;  1KEC A;  3F5W C;  1KQS U;  3OE7 G;  1F51 A;  3PJS K;  2C2A A;  2WLH A;  3QO7 A;  2EIJ B;  3W7U A;  4OXS A;  3JD0 A;  1CEZ A;  4WFH A;  3OM3 B;  2PI4 A;  3JD3 A;  1R6K A;  2DWD C;  2WLI B;  1R3I C;  1GM8 A;  4PEL A;  2R9I A;  3ETD A;  3ABL B;  2HKO A;  4PA7 A;  3G6E V;  5IYD O;  5KA5 A;  1I5Y A;  1XL4 A;  3MHS C;  1JX9 A;  1GK9 A;  1J95 A;  3OUF A;  3CCE V;  1QVF U;  1MOF A;  3LDD A;  2QEX V;  1V54 B;  2HFE C;  2A79 B;  5L3B A;  3FYI B;  2IJK A;  4JAU A;  5B3S B;  1H8H G;  2ZD9 A;  1QLE B;  1S76 D;  4UVA A;  4WFG A;  4PA4 A;  5KUK A;  1M90 W;  1QR8 A;  3JD1 A;  4JTD B;  4R50 A;  1Q81 W;  4MTF A;  3SPI A;  1VQP V;  2LFR A;  2YSU B;  3QO8 A;  1M57 B;  5L3F A;  5HFL A;  2P67 A;  3ZMS A;  1QR9 A;  1BMF G;  4YXW G;  1JVM A;  4G28 B;  1YI2 V;  3CMA V;  4FJC C;  1M56 B;  4ZKI A;  4TT3 G;  3KG2 A;  1QVG U;  4PDL A;  4GX2 A;  3BEH A;  2DQ0 A;  1MAB G;  3CC7 V;  1NJI W;  1S0V A;  2Y69 C;  1JQ0 A;  1ARO P;  4KFM A;  1JJ2 U;  2X0L A;  1BL8 A;  1GO3 F;  3CC2 V;  4MVR A;  3CC4 V;  5L3G A;  2JJ2 G;  4BAY A;  2QKS A;  3K08 A;  1K34 A;  3P30 A;  3TK1 A;  3SPC A;  3ZRS A;  1K97 A;  2EIK C;  2WLI A;  1THZ A;  1VQ8 V;  4E2L A;  5IYC O;  5EBW C;  3SPH A;  2QA4 V;  2QM8 A;  1OCZ C;  4N21 A;  4DO2 A;  3AG3 B;  1AI6 A;  2B5U A;  3D36 A;  1RM1 C;  3IFX A;  2HR3 A;  1XL6 A;  2WLM A;  4LC1 A;  4G27 B;  1GMG A;  4X88 A;  1H8E G;  4PA9 A;  3EHB B;  3SYA A;  5B1N A;  3K03 A;  3OFN G;  3DTU B;  1VQ6 V;  3G71 V;  5KA6 A;  4R7C A;  3CCJ V;  1ENV A;  2F43 G;  1VQL V;  1MG1 A;  4FMT A;  4FPP A;  1PNM A;  4FK5 C;  4P30 A;  3SPJ A;  3TCU A;  5H9C A;  4TWK A;  4PA6 A;  2Z3Y A;  3W7S A;  4QPK A;  2HVK C;  1YIJ V;  1IXM A;  2DYR B;  5B1B C;  4ZBM A;  3F7Y C;  3ABM B;  4MVQ A;  1NVP B;  1OCO C;  5IDJ A;  3K3W A;  3QNE A;  2ATK C;  3G4S V;  1HWY A;  1TUE B;  2ITD C;  2X6C A;  3FB7 C;  3CCV V;  1R3K C;  1JOY A;  5LHI A;  5IY5 C;  4GX5 A;  4RUE A;  3SPG A;  5L3C A;  3ABU A;  1QCE A;  1I5X A;  4WFB V;  1RPR A;  1G8M A;  3LSQ A;  1VQO V;  2EIM C;  2QTO A;  2XAQ A;  2XAS A;  2WLN A;  2QE7 G;  2W0F C;  3ETE A;  2XAG A;  2BOB C;  4HYO A;  2WPD G;  2X7R B;  3RBZ A;  3CCS V;  4HZ3 A;  4CBC A;  4MVM A;  5B1A B;  1YSC A;  2WLJ A;  5CMU A;  3ASO B;  3CCU V;  3HPL C;  2B1I A;  2V1D A;  3AG2 C;  1SET A;  2Q6A A;  4XDL A;  1FXH A;  1QBZ A;  1KC8 W;  2Y48 A;  2M7W A;  1Q82 W;  3SJQ C;  4QIW F;  1W2B U;  4LP8 A;  2OCC C;  5E1A C;  1Y66 A;  1H2G A;  4JF3 A;  3OMN B;  4WFE A;  2JK5 C;  3T1C A;  1K5S A;  2ZR3 A;  3JD2 A;  4UVC A;  5LHH A;  4MVS A;  1SES A;  2EIJ C;  3ASN C;  3W7W A;  1NH2 D;  1K3E A;  3LDC A;  4QPJ A;  5LGT A;  2EZO A;  3SYO A;  4PDV A;  1Y4M A;  5B1O A;  2AHZ A;  3RW0 A;  1DF4 A;  1M9N A;  3P32 A;  3ABK B;  4LCU C;  3ZRW A;  1JPX A;  3ABL C;  3IC7 A;  1NH2 B;  1NR7 A;  4QNH B;  3LDE A;  1K8A W;  2JJ1 G;  3W7T A;  1K73 W;  3GWO A;  1YJN V;  4WF9 V;  1LNQ A;  1MSW D;  1GKF A;  5C93 A;  1KKD A;  2W6I G;  1PD3 A;  1CP9 A;  4JPR A;  3R65 A;  3OAA G;  5H6R A;  1DTO A;  2Q69 A;  1YJ9 V;  2MK3 A;  2EIN B;  4BIU A;  2EIL B;  3ZMU A;  3WG7 C;  2DYS C;  5B3S C;  3CPW U;  1K4D C;  1OZ0 A;  3AG1 B;  1K9M W;  1VQN V;  5LGN A;  4QE7 A;  4PA3 A;  3WFV A;  3E8F A;  1OCR C;  2NNU A;  4WCE V;  1M1K W;  1AI5 A;  4XDJ A;  3JCZ A;  1AJN A;  1QLN A;  4KP4 A;  1EBO A;  1PL0 A;  1WLE A;  1M57 C;  2LFS A;  4R8C A;  5CN0 A;  4R6Z A;  3SYC A;  2H94 A;  1SZT A;  1FXK C;  5EBM C;  2EIK B;  2ZQM A;  2ITC C;  2OTL V;  1M56 C;  2XND G;  3ABT A;  2HVJ C;  4JTA B;  3ZIA G;  4BW5 A;  1AI7 A;  3CCQ V;  1PNK A;  5KUM A;  4P9O A;  3STL C;  1OCZ B;  3AG4 C;  3ZRX A;  2IU0 A;  4RO2 A;  3W7X A;  2ZDI C;  3X2Q B;  2FTK A;  1DLB A;  5DM6 V;  4Z1M G;  2JIZ G;  3K06 A;  1W0J G;  3B8M A;  1L1F A;  3T4Z A;  1YIT V;  1B6Q A;  4CZZ A;  2GSM B;  1BHB A;  1K5Q A;  1V55 C;  2AHY A;  4RAI A;  3SYQ A;  3FB5 C;  2XAH A;  5L3D A;  1NKD A;  4MVO A;  2HJF C;  1FS0 G;  2BOC C;  2UXX A;  3AG3 C;  3D3I A;  3FB8 C;  4LBE C;  4UV9 A;  3RVZ A;  5BZB A;  4MW8 A;  3CCL V;  1N8R W;  4I5S A;  5B1B B;  1EZJ A;  3LSS A;  2X6A A;  5L3E A;  3E83 A;  4XDK A;  4U7O A;  1P4R A;  3UKM A;  1OCO B;  3ZRW B;  3OGC C;  2ZR2 A;  1YTF D;  3H01 A;  4PDR A;  3ZMV A;  1OCC C;  1GM9 A;  1S5H C;  1K4C C;  3OEH G;  1F23 A;  4KUM A;  3OEE G;  4GX0 A;  4J9Y B;  5CBH A;  3ZRV A;  3IGA C;  4MS2 A;  3ZJZ A;  2DYR C;  2EIM B;  1YTF B;  3OW2 U;  3ABM C;  2NLJ C;  3SYP A;  2ZXW B;  3K9A A;  1FXK A;  1CPY A;  2DW4 A;  1WPX A;  1VQ7 V;  3DGE A;  2EBO A;  3M99 B;  5IYB O;  2LP7 A;  3ETG A;  2WAM A;  1E1Q G;  3FKS G;  3T2M A;  3K79 A;  2IJI A;  4P9P A;  4FIP C;  3E8G A;  4P2Z A;  3CCM V;  3ZMZ A;  1F4M A;  3VOU A;  2HLD G;  1Q86 W;  1R73 A;  3K0D A;  3UM7 A;  4UVB A;  1FFT B;  2OCC B;  1NR1 A;  2W6J G;  3FB6 C;  3ZN1 A;  3E2E A;  3OR6 C;  4UUJ C;  2WSS G;  4TSF G;  3E8B A;  5B1A C;  3ASO C;  1R6N A;  3NXS A;  3ASN B;  2H8P C;  2QM7 A;  4MT8 A;  3QO5 A;  5EC1 C;  1G4Y B;  2IH3 C;  3I56 V;  3B8N A;  4UXN A;  4H33 A;  2Z5U A;  5DN6 G;  1DF5 A;  3GB7 C;  2UXN A;  1AR1 B;  1VQK V;  1K92 A;  2OTJ V;  2WLL A;  2X6B A;  4JTC B;  4MTX A;  1H38 A;  3STZ C;  1K7D A;  3EFF K;  3E8H A;  1SRY A;  4MW3 A;  3RVY A;  2DQ3 A;  1YJW V;  1Q7Y W;  1AI4 A;  3HB3 B;  3OUS A;  1V54 C;  3FYE B;  2EZP A;  3WG7 B;  2DYS B;  1S72 V;  1VQM V;  4JGS A;  1JCH A;  1QLE C;  3ABK C;  3E89 A;  5FL7 G;  5J9P C;  1W0K G;  5LGU A;  2GHY A;  1OCR B;  4EKW A;  1YHQ V;  1ROP A;  2IJJ A;  4N23 A;  2Y69 B;  3CCR V;  1RPO A;  4H37 A;  1E79 G;  5EC2 C;  1GM7 A;  2JEX A;  5GW7 A;  2EIN C;  2IH1 C;  1FXK B;  2EIL C;  2V7Q G;  4BIZ A;  2YEV A;  2XAF A;  3AG1 C;  2Q68 A;  3CYO A;  4G2K A;  4X8A A;  2PI5 A;  2KB1 A;  3AG4 B;  1AJQ A;  1NQT A;  3OMA B;  5CA3 A;  2HG5 C;  1RM1 B;  1NVP D;  3ZCC A;  4RQE A;  3TET A;  1KP2 A;  1PKX A;  3ZMT A;  1UJW B;  3E35 A;  2B1G A;  4RQF A;  4MVU A;  1K33 A;  2D3O W;  1KD1 W;  2WWW A;  2Q67 A;  1BHA A;  3F7V C;  3B77 A;  2P7T C;  3AEI A;  1OHH G;  4XBF A;  4X89 A;  1V55 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...