4PDRA

Crystal structure of a k+ selective nak mutant in barium and sodium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title High Resolution Structural Views of Rubidium, Cesium and Barium Binding within a Potassium Selective Channel Filter
rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4pdrA00
2EILC 4GX2A 2Q67A 4PA3A 3FB7C 3SYPA 2X6BA 3BEHA 2BOCC 3F5WC 4MTFA 3RVYA 1S5HC 3AG1C 3F7VC 3X2QC 3RVZA 3LUTB 4EKWA 3T4ZA 4ZBMA 4QE7A 4XDJA 4XDLA 3T1CA 1M57C 3K0GA 4JTAB 4P9PA 4PA7A 1G4YB 3WG7C 2ITDC 1BL8A 3STZC 2EIKC 1J95A 2H8PC 2HFEC 4G28B 2KB1A 3IGAC 4H33A 5EC1C 3SJQC 5B1BC 3VOUA 4R7CA 4MW8A 5EC2C 1V54C 4MW3A 4MS2A 1K4DC 4G27B 3FB8C 4HZ3A 4PA4A 3SPIA 3TETA 4JTDB 3R65A 2W0FC 4GX0A 3OR6C 2WLLA 4WFFA 3SPHA 1OCOC 3OGCC 3LNMB 1V55C 4MVQA 2EIMC 5EK0A 4P2ZA 4KFMA 4QE9A 4MTGA 4R6ZA 4OXSA 1P7BA 3E83A 4J9ZB 3OUSA 3ABMC 3RW0A 5CBHA 3EFFK 4MSWC 2AHYA 4R50A 4H37A 5EBWC 3ZJZA 3IFXA 1ORQC 4QNHB 1KKDA 1R3IC 1M56C 4F4LA 3E89A 2OCCC 2ZD9A 2WLIB 4X88A 4PA9A 3SPJA 3K06A 3SYOA 1XL6A 2A9HA 3ABLC 3LDEA 2DWDC 4MVZA 4MVRA 5EBLC 3T2MA 4BW5A 4PDLA 1K4CC 3AG2C 3E8FA 4WFEA 1ZWIC 5BZBA 2HVKC 2IH1C 3ASOC 4DXWA 2A0LA 3GB7C 2Q6AA 2IH3C 3JYCA 2HG5C 2WLJA 2HJFC 3OUFA 3SPCA 1XL4A 4MVSA 4RUEA 4GX5A 4MVOA 4HYOA 1R3KC 4LCUC 3K03A 2WLNA 3SYQA 3UKMA 2A79B 3ZRSA 5E1AC 4P30A 4RUFA 2ZXWC 2QTOA 3UM7A 2Q68A 4P9OA 4R8CA 2WLKA 1OCCC 2Y69C 2EINC 3HPLC 3KG2A 2AHZA 3ASNC 1QLEC 5CBFA 1OCRC 3F7YC 4TWKA 3E8HA 3SYAA 3TCUA 4UUJC 4MVMA 2ITCC 2JK5C 3LDCA 4RO2A 3T4DA 4LP8A 2DYSC 3LDDA 2X6CA 2WLHA 2P7TC 2QKSA 4PA6A 3AG4C 3OR7C 4JTCB 4I9WA 4PDRA 2BOBC 4MTOA 4CBCA 2EIJC 4MVUA 5KUKA 5IY5C 3K0DA 4RAIA 3E86A 2WLIA 5J9PC 3FB6C 3FB5C 4WFGA 2ATKC 3E8BA 3STLC 1LNQA 5CBGA 3SYCA 2X6AA 4PDMA 1JVMA 2Q69A 4XDKA 2HVJC 4LBEC 4X89A 1R3LC 4WFHA 3RBZA 5KUMA 3K04A 2YEVA 3AG3C 2DYRC 5B3SC 2WLLB 1OCZC 4X8AA 3SPGA 5B1AC 3PJSK 2DWEC 3K08A 1R3JC 2K1EA 3E8GA 5EBMC 3ABKC 2R9RB 4GX1A 2NLJC 4J9YB 4PDVA 2WLMA
chains in the Genus database with same CATH superfamily
4TV9A 3EVKA 2G38A 4JYAB 1WAZA 2QDOA 1FKAO 1VMGA 3SYPA 2BOCC 4DR3B 4BWAA 3P30A 1H2GA 3CSXA 5LHHA 3CD6V 1O9HA 2XUMA 1ZL8A 1SKVA 3NXSA 3ZN0A 1BL8A 2ZNJA 1CPYA 1EBOA 2EIMB 1YJ9V 1GM9A 2CK3G 1GM8A 1Q5OA 5LYJA 3JAWB 1JPXA 2VQEB 2CTWA 2UUAO 4DRXA 3SPHA 5BR8B 3K79A 2DN9A 4DYLA 3N2GA 2CGNA 2YIBA 1MZFA 4JI7B 1MABG 4JYCA 1M56C 4E4EA 2ZNIA 4PA9A 3GWOA 1UPGA 3T1YB 3KCXA 2CH7B 3ASNB 1OCRB 4DR1B 5FPRA 3OUFA 1U97A 2XAFA 4MVSA 2ZM6B 1FFXB 5LA6B 1K5SA 3JAWA 5IJ0B 5KAIZ 1SRYA 1HW7A 1PNKA 1AB3A 3EHBB 5B66Z 4NYKA 1KBHA 4MT8A 2JK5C 3LDCA 4RO2A 5JQGB 3T4DA 5IYBO 2PTMA 5LXTB 2Q5ZA 5LGNA 3OR7C 3RYCB 5ITZB 1PKXA 4O4IB 4GKJB 5J2UB 3L9DA 5J9PC 5LP6C 1GAXA 1PNMA 1HNXO 1F23A 4PDMA 2HHHB 4ZIBA 4X89A 2CH7A 3APOA 5B3SC 1Q7YW 4NR1A 3D3IA 2P4VA 3B40A 1FFXA 4J9YB 5EZYB 5LA6A 2EILC 2F4VB 5IJ0A 2YXLA 4YJ2B 1S5HC 2ETNA 2Q0AA 5GTIZ 2VQEO 1XNRO 1I94O 3AG2B 1WP8A 2MK3A 5JQGA 5LXTA 1ZUQA 5K1PA 3QO7A 3RYCA 4D6TH 4O4IA 4BIOA 5J2UA 4MW3A 2GDSA 2E74B 4B3MB 4O2BB 4CH4A 3T1YO 3JD4A 2JEXA 4GX0A 2ADQB 4LF7B 3LNMB 2EZOA 2H94A 1YCIA 3E83A 1YIJV 2DMXA 5EZYA 5HFMA 4DR1O 3ASOB 3QVNA 2L6LA 2UXCO 3K3WA 3G67A 4YJ2A 4DR7B 1TUEB 3HR0A 2V7QG 2RMKB 3JD1A 3GWKC 5JJNB 1LUWA 1SQGA 1XOUA 4O2BA 4DW1A 4LH6A 1P49A 2A79B 3ETDA 1XNQO 2HHHO 1B06A 2EINC 2N05A 3L71H 1HDJA 3CCVV 1XMOB 4FLTA 1SF9A 4DV2O 2EJRA 2P67A 4FIPC 4LF5O 2DJVA 4LFBO 3ZHQA 2IJKA 3BA9A 1VEWA 2QTSA 4ZOLB 3OE7G 3OMNB 1Y6XA 1TUBB 3A0RA 3UCSC 2LGQA 3CX5F 3VQXA 1RM1C 5DN6G 2HVJC 4BAYA 4IHJB 2LJ2A 3QO8A 2PYJA 3WG7B 4WCEV 4B3TO 4CH3A 2JDIG 4DV5B 1XUQA 4GZRB 2W6IG 3TJTA 5L3DA 3FYIB 5TISZ 4P9PA 4YY3B 3K9SA 4YHHB 4IYIA 1WJZA 1K8AW 4G28B 3H1HH 5A9GA 4MW8A 4O4JB 3JASB 4IT5A 1TUBA 1K4DC 3ZMUA 4IYHA 1NH2B 3JARB 4HZ3A 1Y74B 4JTDB 4IHJA 1BHBA 4WFFA 3EXAA 3JAKB 3QO5A 3ABUA 4I0XB 1N34B 2DQ0A 4N21A 4JV5O 4LC1A 1F7YA 1NVPD 1ORQC 3CCSV 4LFCO 2PUSA 3L70H 4IGGA 1R3IC 1VQ9V 4EEQA 3ZRWB 4IIJB 4X88A 3SYOA 3K06A 1B04A 5C8YB 3CCEV 3B77A 1XI1A 1URFA 1K4CC 3E8FA 1PL0A 2XHBA 2YS8A 1IBKB 1PV0A 2IM9A 3I5DA 4HAMA 4QGPA 4O4JA 4EB6B 3JASA 4GX5A 2DQ3A 2PY5A 5DEDA 3ZHRA 1EZVH 3JARA 1KQSU 2BTOA 3IJ4A 2JS3A 1Y74A 1YEWA 4RUFA 1AP6A 5LMUB 1IX9A 1IVSA 5CBFA 3JD2A 4JI0B 3JAKA 4DR6O 1QHTA 5KHHA 1XMQB 4I0XA 3AG3B 1S76D 2DYSC 4JI8B 5B1AB 1GTOA 5CA1B 3B8MA 5IY5C 2LFSA 3ZRWA 4IIJA 5C8YA 1GN6A 3E8BA 3OAAG 1R1BA 1R3LC 3AG1B 2GV9A 2YICA 1IZ3A 1FXKB 4YHHO 1S72V 3K08A 2PF4E 4YJ3B 3HB3B 4EB6A 4GX1A 2HJDA 3RYIB 3JATB 3D36A 3ZN1A 3CEIA 1VF6A 2B5UA 3SDLA 1RSOB 5AG2A 3WFVA 3AEIA 1PL4A 2Q73A 2Y48A 3DC6A 4CS2A 5CA1A 3P3NA 4JI1B 1GRJA 2WA4A 4NTWA 1Q86W 3PN1A 2CTPA 2OCCB 4UCOA 4AILC 3TXSA 1Z5VA 4CC6A 4I4TB 1HR0B 3IC9A 2ZE7A 1FXKA 2EIMC 4JPRA 4MVQA 1IBKO 4YJ3A 1BMFG 1K33A 3RYIA 3JATA 4J80A 2WAMA 1YJWV 3CRQA 1RSOA 1XL6A 4PELA 4PI0A 5EBLC 4JI0O 2YIAA 4JI8O 1YSCA 4RQFA 1H38A 1S3JA 1KD1W 4MVOA 4ABMA 4HYOA 3SYQA 2EIJB 1ZTEA 4ZI7B 2QTOA 1WP7A 4I4TA 3ASNC 1OCRC 3SGIA 3E8HA 2UXBB 5L3GA 2Y0IA 2DYRB 2Q7HA 4YXWG 3ABKB 3E86A 1R73A 2RCVA 3A0BZ 3FB5C 1J5EB 2UUCB 2ATKC 2YI8A 4FLYA 3SYCA 3KZIZ 4FLUA 3G6EV 2IJJA 1GKFA 3KKYA 4X8AA 5KHJA 3QTCA 4DV1B 2UXDB 3JSNA 2ARHA 1XREA 3TK1A 4PDVA 4DV3B 2ODMA 3FB7C 5B1BB 4K0KB 4ZI7A 1N4CA 1AR4A 1W59A 4EKWA 1TA8A 4FZ0A 4ZBMA 1HR0O 1H2LA 2E3CA 1QQCA 4O4LB 3UO3A 2QEXV 2JIZG 1FPOA 3FB8C 4TSFG 3ZRVA 2QKCA 1RFYA 1AI4A 1FXVA 3OGCC 3ZHTA 3T1HB 3ZRXA 2AHYA 4GKKB 3ZBHA 3OW2U 2GHYA 4NTYA 4E2LA 1RPRA 2H3OA 4JI2B 1NKDA 1N32O 2UXBO 4B7KA 3ASOC 4O4LA 4DV7B 2KQXA 1AROP 2HG5C 2LP7A 2WLJA 4UVBA 2F43G 4UB6Z 4ZHQB 5H6RA 4YIOA 1J5EO 1AP5A 5LHIA 5E1AC 3L75H 1JFFB 2FKXA 5KHIA 4TWKA 4DUZB 3SYAA 3CRRA 4DV1O 4FJCC 2X6CA 4LF9B 3A8TA 3SJAC 4JTCB 1US6A 4GT1A 2F93B 1M5IA 1JJOA 1OV9A 4DV3O 1VQKV 1G1XB 4TOIA 3G6BA 1NTKH 4JAAA 4ZHQA 4UVCA 1EN4A 5B1NA 3K5NA 1JFFA 1GN3A 3SJBC 5LYJB 1E1RG 3T1HO 3WG7C 1OCOB 1V55B 4DRXB 4DR2B 3IGAC 1N33B 5F2VO 4JI3B 1YITV 1K3EA 2RNBA 1L8DA 3BAAA 2KSDA 2WWWA 4EFBA 1MOFA 3BY6A 1T5EA 1IBMO 2W0FC 4JI2O 4X62O 1O9GA 1ROPA 4CS3A 5EK0A 3A0HZ 4KFMA 1FJGB 4RQEA 1G8MA 1GM7A 3BABA 4K35A 3LDEA 4PDLA 4WFAV 1ZWIC 2W0XA 3BPZA 4LF6B 1WB7A 4DW0A 3CCMV 3OTOB 2GSMB 3K03A 2YC0A 1H8EG 4AQYO 4LF4B 3RYFB 1HNWO 3ZMZA 1VQ6V 3DXRB 1OCCC 3OM3B 1H2MA 1N36O 2Q0OC 2JJ2G 3HKDB 1AJNA 4LP8A 1I5XA 1S5LZ 1NI8A 2BOBC 3D36C 4RAIA 1GO3F 1THZA 4IL6Z 1X4TA 2IW5A 2QR4A 2ZIMA 3AG3C 5B1AC 2DWEC 2IU3A 1N33O 2R9RB 2Q7GA 4NXMO 5JJEB 2P06A 2XAHA 3RYFA 3AG1C 1JMKC 1U96A 3DXRA 4JYAO 3HKDA 1FXKC 5H2FZ 2D3OW 4DR3O 2N04A 1FJGO 3K0GA 2V4DA 2XOKG 1YI2V 5L3EA 4LNUB 1XBLA 5EC2C 1NTZH 2ZIOA 3ZHSA 2Q7EA 1FS0G 4G27B 2OTJV 4JI6B 3LNNA 2M6YA 2X0LA 4JF3A 2DW4A 2UXXA 4J41A 1NT2B 3FFQA 3K58A 1Y4MA 3W7TA 3ABLB 4L87A 2GTAA 2GBOA 5BR8O 4MSWC 2DE0X 3E89A 2OCCC 4LF4O 2XNDG 2B1GA 1CXZB 1VQPV 2A9HA 4LR3A 4JI7O 1P4RA 2XAJA 2ZE5A 5LMNB 4H13B 3GB7C 2IH3C 3WB2A 4LNUA 4DK0A 3OMAB 2ZQMA 1NJIW 1M90W 1VARA 4LCUC 3H1LH 1SA0B 3AG4B 4DV0B 2YIDA 5CA3A 2ZM6O 4UV9A 2C2AA 4Z2WA 4K8XA 3U11A 1QCEA 2ZINA 1VQNV 1OCZB 3OD4A 2EIJC 4MVUA 4CH5A 3L74H 3VQYA 3JCUZ 3ZHVA 4LFAB 4UCRA 4FM1A 4GKJO 3RBZA 3MHHC 4NXNB 2Y4TA 1Q43A 4J7KA 1SQFA 2DYRC 4TQFA 1BCCH 1KU9A 1NR7A 1M57B 1KECA 3ABKC 1L1FA 1UJWB 3SJCC 4ZKIA 1SA0A 3OEHG 5IWAB 4JI6O 2CTRA 3ETGA 1P84F 2YDEA 2F4VO 4AHCA 3UQ8A 1SQPH 1JX9A 4QE7A 4XDJA 5LL6Y 3DSQA 3RWRD 1H8HG 1H2SB 1WA8B 5EC1C 5B1BC 3M99B 2JEUA 2W6JG 2NNUA 2E75B 3CC4V 2R9AA 3ETEA 2YIBD 2QSAA 4B3MO 1QR9A 2LQTA 3CJHB 5DECA 5LMNO 3CE2A 4BW9A 2LW1A 4I9QA 1BS3A 4LF7O 5IYCO 3RW0A 5H9CA 5EBWC 4C7UA 3FD9A 3UT5B 3ZHUA 1JJ2U 4DV6B 1XHXA 4UVAA 3GVMA 5L3FA 2ZXWB 4DR7O 4W4KA 1QLEB 3JCZA 4DXWA 1WA8A 5EYPB 1K9MW 1BGYH 1VQ4V 3BVOA 4DR4B 4CH6A 1K34A 2WLNA 3UKMA 1QBZA 4LFAO 1SQBH 4X1YB 3H1KH 1QNMA 3CJHA 1DF4A 4OPAA 2Q4PA 4NXNO 3MAQA 4CC5A 3TCUA 4UUJC 2QKAA 4H0LB 3ICXA 4X64B 4LH7A 4KHPB 2WLHA 1XMOO 2ZE6A 4PDRA 3UT5A 4PD4F 2EZPA 2KKWA 2IJIA 5KLVH 1D5NA 3CCJV 3CCQV 4B3SB 3ZMSA 5IYDO 1YTFB 1JVMA 1MMMA 4XDKA 5L3CA 2ZE8A 1Q90D 5EYPA 1VQ8V 1K7DA 4JAVA 1R3JC 2B9ZA 4DV4B 3UO2A 4ASUG 1TGOA 1M56B 4GX2A 2EX3A 4X1YA 2VWJA 3G80A 4J10A 4DV5O 3VQWA 2UU9B 2DOSA 2OTLV 5FPOA 4JTAB 3VOUA 1I08A 4U7NA 1Q82W 2QM8A 4YY3O 4JI5B 4JYBA 4LF8B 4JAUA 1GK9A 2ZT9B 1M93A 1NR1A 1OCOC 3BFRA 1IDSA 1V55C 4MTGA 5CMUA 1KB9F 2JS5A 4J9ZB 1I5YA 2NR5A 1Y76B 4DR4O 3CP1A 4I55B 4PI2A 4TUYB 1N34O 4F4LA 4B3RB 4EFEA 1QR8A 1HNZB 4FM0A 5GTHZ 3B09A 4NVPA 1K97A 4Z1VA 3B4SA 5D5PA 4KHPO 5DM6V 4FVMA 1KP2A 5K1XA 2WA3A 2B1IA 4DK1A 4B3SO 1AJQA 1Z2GA 3OT7A 5JCOA 1NZ6A 4WFBV 5LMUO 4GYCB 2GTSA 1Y76A 2Q9LA 4FMTA 5LOVB 3W7WA 4DV4O 4I55A 5KUKA 4TUYA 1KKCA 1XMQO 1K73W 2ZCEA 3RYHB 1SS3A 1W2BU 5IE9A 2UU9O 1R6TA 3ZMVA 2M7WA 3W7UA 3X2QB 4OPHA 1Y66A 2QM7A 2OCHA 2EIKB 1SZXA 2A7WA 4LF8O 3E35A 3F5WC 1V54B 2F95B 3H9VA 1Q81W 3LUTB 3T4ZA 2A06H 1YXBA 5C93A 5EIBC 4Q6GA 5LOVA 1DK1A 5KX5B 3STZC 1YF2A 1QVGU 1I0HA 3ABMB 3RYHA 2YXYA 1M1KW 2FYUH 5L3BA 4JI1O 1KMIZ 2XTAA 3IAYA 1SZTA 2FB5A 1KKDA 2AXTZ 1RM1B 3AG7A 2RN9A 3ABLC 1NH2D 1QU7A 2Y4UA 3G71V 3AG2C 2Y69B 2VQFB 5KX5A 3K5OA 4CS4A 3WU2Z 4NKGB 2HJFC 1XL4A 4FPPA 4O2AB 1LR1A 3CXCU 1PP9H 3L73H 3L72H 3M8AA 2WLKA 3RT3C 1VQ7V 1PD3A 4MVMA 2WPDG 1K5QA 4QPKA 5KHKA 2CDYA 2CUGA 5JJJB 3AG4C 5IDJA 1KYOF 1DGSA 4DUYB 5LGUA 4OX9B 1GN2A 1W0JG 3STLC 1FXHA 1XEQA 2X6AA 4JI4B 2XAQA 1AILA 1H2NA 2ZR3A 2UUCO 2OWOA 1VQMV 1OCZC 3QNEA 1JA8A 4O2AA 5FLXN 2UXDO 2Q67A 1RP3B 4FLWA 2FMLA 4WF9V 2JJ1G 3JD0A 1Q6HA 4K0KO 1S0VA 4XDLA 4UV8A 1M57C 2Z3YA 3DTUB 4JZGA 4H33A 4R7CA 2Z5UA 2EJ7A 3O9OA 4JYYA 2UUAB 1B6QA 4FLVA 4K8ZA 4FFBB 4PA4A 2RDCA 1Y67A 2HEPA 2LGWA 2BTQB 3CRMA 1NU1H 4R6ZA 5GONB 1M4UA 4FM2A 5IY5B 4FZ1A 2ILMA 4QNHB 2ZR2A 4GKKO 4DR5B 2JGDB 1F51A 3AK3A 3TGUH 1YJNV 2QJ1A 2MW2B 3QF7A 2YEVB 1N0JA 1WN7A 3JALB 5CA0B 3N27A 4DV7O 4FK5C 4OX9O 4FFBA 4F6RB 4P30A 1SESA 2ZXWC 2BTQA 4P9OA 4R8CA 3H1IH 3W7XA 3I55V 3KG2A 4JI4O 3CXHF 1QLEC 3I56V 1ZLZA 5GONA 2E5LB 5JVDB 4DUZO 2P7TC 1PM9A 4PA6A 4RWUA 3ZCCA 1AJPA 3J80N 1HNXB 1Q8IA 5IJ9B 4LF9O 4X1KB 4FLZA 2JGDA 4WFGA 4B08A 1IXMA 3RGBA 2QM4A 2NN4A 1L0NH 3D8CA 2YEVA 5J2TB 5KA5A 1XDCA 3N2KB 3JALA 5CA0A 3VBBA 4X1IB 2IJHA 2WLMA 2QWPB 1XNRB 4PA3A 1I94B 3CCLV 2K9PA 4TV8B 4F6RA 3RVYA 1BSMA 2HR3A 3G4SV 1VF6C 2ADPA 5JVDA 1AR5A 5LGTA 1NVPB 1FYJA 3HKCB 5IJ9A 1I7FA 3K5MA 4X1KA 4DR2O 4Z1MG 2F1MA 4DR5O 2YXHA 3ML0A 4JI3O 3LSUA 3APQA 1ZX3A 2JVDA 5J2TA 3OR6C 1DF5A 4NB5A 3N2KA 2UXCB 4I7ZB 4WBNB 4X1IA 3CMAV 5B1OA 2BE3A 4TV8A 5IYZB 4K3AA 5BXZA 1H2KA 1WNSA 5JCOC 3S3XA 5D5QA 3BRCA 1SQXH 2E5LO 1N0NA 2IH1C 5FL7G 2A0LA 3JYCA 2XT9A 1QVFU 3HKCA 3SPCA 2ZDIA 3ZIAG 1XNQB 1F4MA 3A2FA 4LF6O 1YZBA 4BIUA 3OTOO 1E79G 3UM7A 4DV2B 1S77D 4LF5B 4LFBB 2OIGA 3K59A 2PGGA 4WBNA 1NBMG 1FFTB 2FL4A 4GLXA 1KP3A 5IYZA 4TQDA 2XAGA 1AI6A 1JCHA 1LNQA 2UXNA 5KAFZ 1TVKB 5ITZA 3SR2C 4B3TB 4AI8A 1ZAUA 1A32A 2QWNB 2PI4A 3X2QC 4D7TA 2P5OA 3J81N 1SQVH 3LSSA 1EFRG 3T1CA 2P6JA 4PA7A 1XQ8A 2V1DA 2EIKC 2H8PC 3JSLA 2OYQA 1V54C 5HFLA 2D2CB 2BCCH 4KUMA 1OHHG 3R65A 1TVKA 4UCSA 4JV5B 1SQQH 3O65A 4B7EA 1JR9A 4P2ZA 1HP8A 3CYOA 3C3SA 4N23A 1P7BA 4LFCB 4CZZA 1VQ5V 3OUSA 5CB4B 3ABMC 5CBHA 3EFFK 3FX7A 4F6EA 4HBNA 3HKEB 5KA6A 2UUBB 1S5JA 3KCYA 3OMIB 2ZD9A 3SPJA 2F23A 4X65B 3CS5A 2PZSA 2Q6AA 2O57A 1G6UA 2PI5A 1VQLV 1KC8W 4UCVA 3K5LA 2R72A 4DR6B 4BIZA 2N74A 2Y69C 1FD9A 3OGIB 4DV0O 2AHZA 3Q4HB 3F7YC 1V9PA 5CB4A 3BHPA 1IURA 3CC2V 3HKEA 4CBCA 3E22B 4KL1A 1WPBA 3HKBB 3K0DA 4JASA 2RQ6A 3NR7A 3ABTA 5JWPA 1BE3H 3AK2A 4J42A 2GUZB 1IBLB 4ZOLA 1D5AA 3S3WA 2LO1A 1MA1A 1MSDA 3P32A 3JAMN 1DTOA 3BEHA 1R6NA 2RJZA 2CTQA 3MD0A 4HNAB 3Q4HA 2LFRA 5IWAO 2EULA 4OGQB 1E1QG 1BQ0A 3FAVB 2IBZH 1Q6IA 3RFRA 3SJQC 2HFEC 3E22A 4J7ZA 4DO2A 3HKBA 4QPJA 4U3JB 2X7RB 5EIBD 2UUBO 4X20B 4LWSB 5KHGA 4QJFB 1OCCB 4X65O 2L35A 1BQZA 2JGUA 3CCUV 2KG7B 1JQ0A 4PHZA 2GUZA 3K9AA 1VF5B 3CRAA 5BMVB 1WB8A 1RPOA 2VWKA 2HKOA 3C3TA 1HWYA 1IXBA 5KMGB 1VIBA 3E2EA 4UCUA 3MDSA 2Y0PA 4HNAA 3ZX6A 1MNGA 2DWDC 4ICGA 4MVZA 3T2MA 2YSUB 2JRIA 2CE4A 4WFEA 4YIPA 2Q8VA 5BZBA 4DV6O 3FAVA 4X9QA 2QWOB 3BA8A 2CAZC 4RUEA 4U3JA 4X20A 1R3KC 2QWQB 4LWSA 3CHXA 3ZRSA 1K92A 2KG7A 1YHQV 3OFNG 5LP6B 5BMVA 2R9IA 1IBLO 5KMGA 3CCRV 5B3SB 4UCTA 1PNLA 2PYLA 4FFKA 1M9NA 4I9WA 1AR1B 4QIWF 4GCZA 4X64O 3ZS8C 1DLBA 2CGOA 4PV1B 2EILB 2QA4V 2F66C 2Q69A 1NS1A 5BY1A 4WFHA 3R66A 4J7JA 2P90A 2K1EA 3E8GA 5EBMC 1L0LH 2NLJC 1YDXA 3DC5A 2OIEA 3MHSC 1KUQA 5LP6A 4I50B 3C90A 3D3QA 3RVZA 3B8NA 5GW7A 1G4YB 2ITDC 1ZSPA 1J95A 2KB1A 2EBOA 1EN6A 1BHAA 1MG1A 5FNVB 4MS2A 2ZKOA 1FAFA 3VQVA 3CWBH 4JI5O 4I5SA 3TETA 5IT9N 5A2QN 3FYEB 2VS0A 4QE9A 3IC7A 4OXSA 2ZDIC 1JOYA 2IU0A 4X66B 4JGSA 4H37A 2QE7G 5JH7B 3ZJZA 4GUNA 1AI7A 3CPWU 2AZ0A 5H6QA 4XBFA 2OT5A 3CRCA 3THOA 1VQOV 4I50A 1N32B 3RN4A 5H5NA 2Z0AA 4MVRA 4A5UB 3K57A 2LW7A 4B3RO 2EINB 1HNZO 1Z5WA 2VRZA 3ETQA 3B2EE 3W7SA 1VF7A 1N8RW 5E79Z 2AW9A 4O4HB 4UFZA 5FNVA 1EM1A 1XHZA 2QWRB 3AK1A 1OZ0A 2YUAA 4U3FH 1BT8A 5B5EZ 3CC7V 3CMEV 1BZKA 1WPXA 1VP7A 1PPJH 3TXQA 5JH7A 3FKSG 5LHGA 1NTMH 1CP9A 3J7AU 1F4NA 4UB8Z 3WB1A 3LSQA 5CBGA 1YVWA 4LBEC 5LBQA 1NQTA 3OTFA 2WLLB 4JZ2A 1EN5A 3ZMTA 3PJSK 3H1JH 1P7GA 4O4HA 4KXRA 2QGNA 2AGAA 2X6BA 4MTFA 1XILA 2BSKB 3F7VC 4U7OA 2P4KA 3BCCH 3CB2A 1Q3EA 1YTFD 1AI5A 1SC5B 1Q6UA 3M7MX 4X66O 1CEZA 1UFIA 2R70A 4PJ0Z 4BR6A 1IBMB 1GH6A 4G2KA 1AVMA 1B3QA 4X62B 4TT3G 3H01A 3SPIA 1SETA 1EZJA 2A3QA 1W0KG 2HP8A 1LUVA 2WLLA 3F5TA 2HLDG 4R50A 1OJHA 3IFXA 2AZ2A 2BSKA 1SERA 4FLXA 2WLIB 1WLEA 4Q20A 2YI9A 4KP4A 4H44B 4BW5A 3U10A 1QLNA 2P22C 2HVKC 4MTXA 3U0ZA 2VQFO 4AQYB 2DYSB 1HNWB 1GN4A 4TV9B 1N36B 3OEEG 1MZEA 4NTXA 3JD3A 3ZEDA 2XASA 2Q68A 3HPLC 4W4LA 2ITCC 1D2DA 1R6KA 2E76B 4D7SA 1ZL8B 3LDDA 2WSSG 2QKSA 4MTOA 2WLIA 1ENVA 3DGEA 4L8JA 1GMGA 3FB6C 1X59A 3WB0A 4DUYO 5CN0A 1TAEA 3QG5A 5KUMA 1MSWD 3K04A 2FTKA 3SPGA 4NXMB 4UXNA 1COWG 3P3PA 4J11A 3N2GB
chains in the Genus database with same CATH topology
1M56B 4GX2A 3FB7C 5B1BB 3SYPA 2BOCC 2PI4A 3P30A 3X2QC 1H2GA 4EKWA 5LHHA 2OTLV 3LSSA 4ZBMA 3CD6V 1EFRG 3T1CA 4JTAB 2P6JA 4PA7A 3NXSA 3ZN0A 1BL8A 2V1DA 2EIKC 1CPYA 1EBOA 2EIMB 2H8PC 4U7NA 3VOUA 1Q82W 2QM8A 1YJ9V 1GM9A 2JIZG 2QEXV 1V54C 2CK3G 5HFLA 1GM8A 4JYBA 4JAUA 1GK9A 3FB8C 1JPXA 4TSFG 4KUMA 3ZRVA 1OHHG 3R65A 1NR1A 1AI4A 3SPHA 3K79A 1FXVA 1OCOC 3OGCC 1V55C 4P2ZA 3CYOA 4MTGA 4N23A 5CMUA 1P7BA 1VQ5V 4CZZA 4J9ZB 3OUSA 1I5YA 3ABMC 5CBHA 3EFFK 3ZRXA 2AHYA 3CP1A 3OW2U 2GHYA 4E2LA 5KA6A 1MABG 4JYCA 1M56C 4F4LA 3OMIB 2ZD9A 1RPRA 4PA9A 3GWOA 3SPJA 1QR8A 1NKDA 3ASNB 3ASOC 1OCRB 1K97A 2Q6AA 1AROP 2HG5C 2LP7A 2WLJA 5DM6V 2PI5A 3OUFA 4UVBA 1KP2A 2F43G 2XAFA 4MVSA 1VQLV 1KC8W 5H6RA 1K5SA 2B1IA 5LHIA 5E1AC 1AJQA 1SRYA 4BIZA 1PNKA 2Y69C 3EHBB 2AHZA 3F7YC 4TWKA 3SYAA 4MT8A 4WFBV 2JK5C 3LDCA 4RO2A 3T4DA 5IYBO 4FJCC 2X6CA 4FMTA 3W7WA 3CC2V 5LGNA 3OR7C 4JTCB 4GT1A 5KUKA 4CBCA 1PKXA 4JASA 3K0DA 1K73W 1VQKV 5J9PC 1PNMA 3ABTA 1W2BU 1F23A 4PDMA 4X89A 3ZMVA 2M7WA 3W7UA 3X2QB 5B3SC 1Q7YW 1Y66A 2QM7A 3D3IA 4J9YB 4UVCA 2EILC 3P32A 5B1NA 2EIKB 1DTOA 3E35A 3BEHA 1R6NA 3F5WC 1V54B 1S5HC 3MD0A 2LFRA 1Q81W 3LUTB 3AG2B 3T4ZA 1E1QG 1E1RG 2MK3A 5C93A 3WG7C 3QO7A 1OCOB 1V55B 3STZC 3SJQC 2HFEC 3IGAC 4DO2A 1QVGU 3ABMB 4MW3A 1YITV 4QPJA 2X7RB 1K3EA 4QJFB 1OCCB 1M1KW 3JD4A 3CCUV 2WWWA 5L3BA 2JEXA 1MOFA 3BY6A 1JQ0A 4GX0A 2W0FC 3K9AA 1ROPA 3LNMB 2EZOA 2H94A 5EK0A 1RPOA 2HKOA 4KFMA 1HWYA 3E83A 4RQEA 1YIJV 3E2EA 1SZTA 5HFMA 1G8MA 3ASOB 1KKDA 1GM7A 3K3WA 1RM1B 1TUEB 3ABLC 3LDEA 2DWDC 1NH2D 2V7QG 4MVZA 3T2MA 2YSUB 3G71V 4PDLA 3JD1A 3AG2C 4WFEA 4WFAV 2Y69B 1ZWIC 5BZBA 2HJFC 3CCMV 1XL4A 4RUEA 4FPPA 1R3KC 2GSMB 3K03A 3CXCU 1H8EG 2A79B 3ZRSA 3ETDA 1K92A 3ZMZA 1VQ6V 1YHQV 1OCCC 2WLKA 3OFNG 2EINC 3OM3B 1VQ7V 2JJ2G 2R9IA 3CCVV 1AJNA 1PD3A 4MVMA 2WPDG 1K5QA 2EJRA 4QPKA 2P67A 4FIPC 3CCRV 4LP8A 1I5XA 5B3SB 1PNLA 2IJKA 3AG4C 5IDJA 1M9NA 4I9WA 2BOBC 1AR1B 4QIWF 4GCZA 3OE7G 5LGUA 4RAIA 3OMNB 1GO3F 1DLBA 3A0RA 2EILB 2QA4V 1W0JG 1THZA 3STLC 1FXHA 2IW5A 1RM1C 2X6AA 2Q69A 2XAQA 5DN6G 2HVJC 4WFHA 2ZR3A 4BAYA 3AG3C 3QO8A 1VQMV 1OCZC 5B1AC 2DWEC 3QNEA 2IU3A 2P90A 2K1EA 3E8GA 5EBMC 2R9RB 2NLJC 3WG7B 4WCEV 3MHSC 2Q67A 2JDIG 2XAHA 3AG1C 2W6IG 4WF9V 2JJ1G 3JD0A 3RVZA 5L3DA 3FYIB 1FXKC 2D3OW 1S0VA 3B8NA 5GW7A 4XDLA 4UV8A 1M57C 3K0GA 4P9PA 1G4YB 2Z3YA 1K8AW 2ITDC 3DTUB 1J95A 4H33A 2XOKG 4G28B 2KB1A 1YI2V 5L3EA 4R7CA 4MW8A 2EBOA 2Z5UA 5EC2C 1BHAA 1MG1A 4MS2A 1B6QA 1FS0G 1K4DC 4G27B 3ZMUA 1NH2B 2OTJV 2X0LA 4HZ3A 4PA4A 4I5SA 3TETA 4JF3A 2DW4A 2UXXA 4JTDB 1Y4MA 3W7TA 3ABLB 3FYEB 4WFFA 1BHBA 4L87A 3QO5A 4QE9A 3IC7A 4OXSA 4R6ZA 3ABUA 2ZDIC 2DQ0A 4N21A 1JOYA 2IU0A 4MSWC 4LC1A 4JGSA 4H37A 2QE7G 5IY5B 3ZJZA 1NVPD 1ORQC 4QNHB 3CCSV 1AI7A 2ZR2A 3CPWU 1R3IC 3E89A 1VQ9V 2OCCC 5H6QA 2XNDG 2OT5A 2B1GA 4XBFA 3ZRWB 4X88A 1VQOV 3SYOA 3K06A 1F51A 1VQPV 2A9HA 3CCEV 1P4RA 1YJNV 3B77A 2XAJA 4MVRA 1K4CC 3E8FA 2YEVB 1PL0A 2EINB 3GB7C 2IH3C 3W7SA 1N8RW 4HAMA 4GX5A 2DQ3A 3OMAB 2ZQMA 4FK5C 1NJIW 4LCUC 1M90W 3AG4B 1KQSU 5CA3A 4UV9A 1SESA 1OZ0A 2ZXWC 2C2AA 4P30A 4RUFA 4P9OA 4R8CA 3I55V 3W7XA 3KG2A 1QLEC 5CBFA 3JD2A 3I56V 3CMEV 3CC7V 1QCEA 1WPXA 3AG3B 1VQNV 1S76D 2DYSC 1OCZB 2P7TC 4PA6A 3FKSG 5B1AB 3ZCCA 1AJPA 1GTOA 5LHGA 1CP9A 2EIJC 1F4NA 4MVUA 3B8MA 5IY5C 2LFSA 3ZRWA 3LSQA 4WFGA 3E8BA 1IXMA 5CBGA 3OAAG 4LBEC 3RBZA 1R3LC 3AG1B 3MHHC 2YEVA 2DYRC 5KA5A 1NQTA 5LBQA 2WLLB 3ZMTA 3PJSK 1FXKB 1S72V 3K08A 1NR7A 3HB3B 3VBBA 1M57B 1KECA 3ABKC 4GX1A 1L1FA 1UJWB 2IJHA 4ZKIA 2WLMA 3OEHG 4PA3A 3CCLV 3D36A 2X6BA 4MTFA 3RVYA 3ZN1A 3F7VC 3ETGA 2B5UA 2HR3A 4U7OA 3WFVA 3G4SV 3AEIA 1JX9A 1YTFD 4QE7A 4XDJA 1AI5A 2Y48A 1H8HG 5LGTA 1NVPB 1CEZA 5EC1C 5B1BC 3M99B 2JEUA 2W6JG 2NNUA 4Z1MG 3CC4V 3ETEA 4G2KA 4TT3G 3ML0A 3H01A 3SPIA 1SETA 1Q86W 1EZJA 2OCCB 1QR9A 1W0KG 3OR6C 2WLLA 1DF5A 1FXKA 2EIMC 4JPRA 4MVQA 5IYCO 3RW0A 3CMAV 2HLDG 4R50A 5H9CA 1BMFG 5B1OA 1K33A 5EBWC 3IFXA 2WAMA 1YJWV 1SERA 2WLIB 1WLEA 4Q20A 1JJ2U 1XL6A 4KP4A 4PELA 4UVAA 5EBLC 4BW5A 5L3FA 2ZXWB 1QLNA 2HVKC 1QLEB 2IH1C 3JCZA 5FL7G 4DXWA 2A0LA 1K9MW 3JYCA 1QVFU 4MTXA 1YSCA 1VQ4V 4RQFA 3SPCA 1S3JA 1KD1W 1H38A 2ZDIA 2DYSB 4MVOA 3ZIAG 4HYOA 1F4MA 1K34A 3OEEG 2WLNA 3SYQA 1QBZA 3JD3A 3UKMA 2EIJB 4BIUA 1E79G 2QTOA 2XASA 2Q68A 3UM7A 1DF4A 3HPLC 1S77D 3ASNC 1OCRC 3E8HA 3TCUA 4UUJC 2ITCC 5L3GA 1R6KA 1NBMG 2DYRB 3LDDA 2WLHA 1FFTB 2WSSG 2QKSA 4YXWG 4PDRA 4MTOA 2EZPA 1KP3A 2IJIA 3ABKB 3E86A 2WLIA 1ENVA 3DGEA 1R73A 1GMGA 3FB6C 3FB5C 2XAGA 3CCJV 3CCQV 1AI6A 2ATKC 1JCHA 1LNQA 3ZMSA 5IYDO 3SYCA 1YTFB 2UXNA 1JVMA 4XDKA 5CN0A 5KUMA 5L3CA 3K04A 2IJJA 1GKFA 3G6EV 2FTKA 1MSWD 4X8AA 3SPGA 1VQ8V 1K7DA 4JAVA 1R3JC 4UXNA 1COWG 3TK1A 4PDVA 4ASUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIL C;  4GX2 A;  2Q67 A;  4PA3 A;  3FB7 C;  3SYP A;  2X6B A;  3BEH A;  2BOC C;  3F5W C;  4MTF A;  3RVY A;  1S5H C;  3AG1 C;  3F7V C;  3X2Q C;  3RVZ A;  3LUT B;  4EKW A;  3T4Z A;  4ZBM A;  4QE7 A;  4XDJ A;  4XDL A;  3T1C A;  1M57 C;  3K0G A;  4JTA B;  4P9P A;  4PA7 A;  1G4Y B;  3WG7 C;  2ITD C;  1BL8 A;  3STZ C;  2EIK C;  1J95 A;  2H8P C;  2HFE C;  4G28 B;  2KB1 A;  3IGA C;  4H33 A;  5EC1 C;  3SJQ C;  5B1B C;  3VOU A;  4R7C A;  4MW8 A;  5EC2 C;  1V54 C;  4MW3 A;  4MS2 A;  1K4D C;  4G27 B;  3FB8 C;  4HZ3 A;  4PA4 A;  3SPI A;  3TET A;  4JTD B;  3R65 A;  2W0F C;  4GX0 A;  3OR6 C;  2WLL A;  4WFF A;  3SPH A;  1OCO C;  3OGC C;  3LNM B;  1V55 C;  4MVQ A;  2EIM C;  5EK0 A;  4P2Z A;  4KFM A;  4QE9 A;  4MTG A;  4R6Z A;  4OXS A;  1P7B A;  3E83 A;  4J9Z B;  3OUS A;  3ABM C;  3RW0 A;  5CBH A;  3EFF K;  4MSW C;  2AHY A;  4R50 A;  4H37 A;  5EBW C;  3ZJZ A;  3IFX A;  1ORQ C;  4QNH B;  1KKD A;  1R3I C;  1M56 C;  4F4L A;  3E89 A;  2OCC C;  2ZD9 A;  2WLI B;  4X88 A;  4PA9 A;  3SPJ A;  3K06 A;  3SYO A;  1XL6 A;  2A9H A;  3ABL C;  3LDE A;  2DWD C;  4MVZ A;  4MVR A;  5EBL C;  3T2M A;  4BW5 A;  4PDL A;  1K4C C;  3AG2 C;  3E8F A;  4WFE A;  1ZWI C;  5BZB A;  2HVK C;  2IH1 C;  3ASO C;  4DXW A;  2A0L A;  3GB7 C;  2Q6A A;  2IH3 C;  3JYC A;  2HG5 C;  2WLJ A;  2HJF C;  3OUF A;  3SPC A;  1XL4 A;  4MVS A;  4RUE A;  4GX5 A;  4MVO A;  4HYO A;  1R3K C;  4LCU C;  3K03 A;  2WLN A;  3SYQ A;  3UKM A;  2A79 B;  3ZRS A;  5E1A C;  4P30 A;  4RUF A;  2ZXW C;  2QTO A;  3UM7 A;  2Q68 A;  4P9O A;  4R8C A;  2WLK A;  1OCC C;  2Y69 C;  2EIN C;  3HPL C;  3KG2 A;  2AHZ A;  3ASN C;  1QLE C;  5CBF A;  1OCR C;  3F7Y C;  4TWK A;  3E8H A;  3SYA A;  3TCU A;  4UUJ C;  4MVM A;  2ITC C;  2JK5 C;  3LDC A;  4RO2 A;  3T4D A;  4LP8 A;  2DYS C;  3LDD A;  2X6C A;  2WLH A;  2P7T C;  2QKS A;  4PA6 A;  3AG4 C;  3OR7 C;  4JTC B;  4I9W A;  4PDR A;  2BOB C;  4MTO A;  4CBC A;  2EIJ C;  4MVU A;  5KUK A;  5IY5 C;  3K0D A;  4RAI A;  3E86 A;  2WLI A;  5J9P C;  3FB6 C;  3FB5 C;  4WFG A;  2ATK C;  3E8B A;  3STL C;  1LNQ A;  5CBG A;  3SYC A;  2X6A A;  4PDM A;  1JVM A;  2Q69 A;  4XDK A;  2HVJ C;  4LBE C;  4X89 A;  1R3L C;  4WFH A;  3RBZ A;  5KUM A;  3K04 A;  2YEV A;  3AG3 C;  2DYR C;  5B3S C;  2WLL B;  1OCZ C;  4X8A A;  3SPG A;  5B1A C;  3PJS K;  2DWE C;  3K08 A;  1R3J C;  2K1E A;  3E8G A;  5EBM C;  3ABK C;  2R9R B;  4GX1 A;  2NLJ C;  4J9Y B;  4PDV A;  2WLM A; 
#chains in the Genus database with same CATH topology
 4TV9 A;  3EVK A;  2G38 A;  4JYA B;  1WAZ A;  2QDO A;  1FKA O;  1VMG A;  3SYP A;  2BOC C;  4DR3 B;  4BWA A;  3P30 A;  1H2G A;  3CSX A;  5LHH A;  3CD6 V;  1O9H A;  2XUM A;  1ZL8 A;  1SKV A;  3NXS A;  3ZN0 A;  1BL8 A;  2ZNJ A;  1CPY A;  1EBO A;  2EIM B;  1YJ9 V;  1GM9 A;  2CK3 G;  1GM8 A;  1Q5O A;  5LYJ A;  3JAW B;  1JPX A;  2VQE B;  2CTW A;  2UUA O;  4DRX A;  3SPH A;  5BR8 B;  3K79 A;  2DN9 A;  4DYL A;  3N2G A;  2CGN A;  2YIB A;  1MZF A;  4JI7 B;  1MAB G;  4JYC A;  1M56 C;  4E4E A;  2ZNI A;  4PA9 A;  3GWO A;  1UPG A;  3T1Y B;  3KCX A;  2CH7 B;  3ASN B;  1OCR B;  4DR1 B;  5FPR A;  3OUF A;  1U97 A;  2XAF A;  4MVS A;  2ZM6 B;  1FFX B;  5LA6 B;  1K5S A;  3JAW A;  5IJ0 B;  5KAI Z;  1SRY A;  1HW7 A;  1PNK A;  1AB3 A;  3EHB B;  5B66 Z;  4NYK A;  1KBH A;  4MT8 A;  2JK5 C;  3LDC A;  4RO2 A;  5JQG B;  3T4D A;  5IYB O;  2PTM A;  5LXT B;  2Q5Z A;  5LGN A;  3OR7 C;  3RYC B;  5ITZ B;  1PKX A;  4O4I B;  4GKJ B;  5J2U B;  3L9D A;  5J9P C;  5LP6 C;  1GAX A;  1PNM A;  1HNX O;  1F23 A;  4PDM A;  2HHH B;  4ZIB A;  4X89 A;  2CH7 A;  3APO A;  5B3S C;  1Q7Y W;  4NR1 A;  3D3I A;  2P4V A;  3B40 A;  1FFX A;  4J9Y B;  5EZY B;  5LA6 A;  2EIL C;  2F4V B;  5IJ0 A;  2YXL A;  4YJ2 B;  1S5H C;  2ETN A;  2Q0A A;  5GTI Z;  2VQE O;  1XNR O;  1I94 O;  3AG2 B;  1WP8 A;  2MK3 A;  5JQG A;  5LXT A;  1ZUQ A;  5K1P A;  3QO7 A;  3RYC A;  4D6T H;  4O4I A;  4BIO A;  5J2U A;  4MW3 A;  2GDS A;  2E74 B;  4B3M B;  4O2B B;  4CH4 A;  3T1Y O;  3JD4 A;  2JEX A;  4GX0 A;  2ADQ B;  4LF7 B;  3LNM B;  2EZO A;  2H94 A;  1YCI A;  3E83 A;  1YIJ V;  2DMX A;  5EZY A;  5HFM A;  4DR1 O;  3ASO B;  3QVN A;  2L6L A;  2UXC O;  3K3W A;  3G67 A;  4YJ2 A;  4DR7 B;  1TUE B;  3HR0 A;  2V7Q G;  2RMK B;  3JD1 A;  3GWK C;  5JJN B;  1LUW A;  1SQG A;  1XOU A;  4O2B A;  4DW1 A;  4LH6 A;  1P49 A;  2A79 B;  3ETD A;  1XNQ O;  2HHH O;  1B06 A;  2EIN C;  2N05 A;  3L71 H;  1HDJ A;  3CCV V;  1XMO B;  4FLT A;  1SF9 A;  4DV2 O;  2EJR A;  2P67 A;  4FIP C;  4LF5 O;  2DJV A;  4LFB O;  3ZHQ A;  2IJK A;  3BA9 A;  1VEW A;  2QTS A;  4ZOL B;  3OE7 G;  3OMN B;  1Y6X A;  1TUB B;  3A0R A;  3UCS C;  2LGQ A;  3CX5 F;  3VQX A;  1RM1 C;  5DN6 G;  2HVJ C;  4BAY A;  4IHJ B;  2LJ2 A;  3QO8 A;  2PYJ A;  3WG7 B;  4WCE V;  4B3T O;  4CH3 A;  2JDI G;  4DV5 B;  1XUQ A;  4GZR B;  2W6I G;  3TJT A;  5L3D A;  3FYI B;  5TIS Z;  4P9P A;  4YY3 B;  3K9S A;  4YHH B;  4IYI A;  1WJZ A;  1K8A W;  4G28 B;  3H1H H;  5A9G A;  4MW8 A;  4O4J B;  3JAS B;  4IT5 A;  1TUB A;  1K4D C;  3ZMU A;  4IYH A;  1NH2 B;  3JAR B;  4HZ3 A;  1Y74 B;  4JTD B;  4IHJ A;  1BHB A;  4WFF A;  3EXA A;  3JAK B;  3QO5 A;  3ABU A;  4I0X B;  1N34 B;  2DQ0 A;  4N21 A;  4JV5 O;  4LC1 A;  1F7Y A;  1NVP D;  1ORQ C;  3CCS V;  4LFC O;  2PUS A;  3L70 H;  4IGG A;  1R3I C;  1VQ9 V;  4EEQ A;  3ZRW B;  4IIJ B;  4X88 A;  3SYO A;  3K06 A;  1B04 A;  5C8Y B;  3CCE V;  3B77 A;  1XI1 A;  1URF A;  1K4C C;  3E8F A;  1PL0 A;  2XHB A;  2YS8 A;  1IBK B;  1PV0 A;  2IM9 A;  3I5D A;  4HAM A;  4QGP A;  4O4J A;  4EB6 B;  3JAS A;  4GX5 A;  2DQ3 A;  2PY5 A;  5DED A;  3ZHR A;  1EZV H;  3JAR A;  1KQS U;  2BTO A;  3IJ4 A;  2JS3 A;  1Y74 A;  1YEW A;  4RUF A;  1AP6 A;  5LMU B;  1IX9 A;  1IVS A;  5CBF A;  3JD2 A;  4JI0 B;  3JAK A;  4DR6 O;  1QHT A;  5KHH A;  1XMQ B;  4I0X A;  3AG3 B;  1S76 D;  2DYS C;  4JI8 B;  5B1A B;  1GTO A;  5CA1 B;  3B8M A;  5IY5 C;  2LFS A;  3ZRW A;  4IIJ A;  5C8Y A;  1GN6 A;  3E8B A;  3OAA G;  1R1B A;  1R3L C;  3AG1 B;  2GV9 A;  2YIC A;  1IZ3 A;  1FXK B;  4YHH O;  1S72 V;  3K08 A;  2PF4 E;  4YJ3 B;  3HB3 B;  4EB6 A;  4GX1 A;  2HJD A;  3RYI B;  3JAT B;  3D36 A;  3ZN1 A;  3CEI A;  1VF6 A;  2B5U A;  3SDL A;  1RSO B;  5AG2 A;  3WFV A;  3AEI A;  1PL4 A;  2Q73 A;  2Y48 A;  3DC6 A;  4CS2 A;  5CA1 A;  3P3N A;  4JI1 B;  1GRJ A;  2WA4 A;  4NTW A;  1Q86 W;  3PN1 A;  2CTP A;  2OCC B;  4UCO A;  4AIL C;  3TXS A;  1Z5V A;  4CC6 A;  4I4T B;  1HR0 B;  3IC9 A;  2ZE7 A;  1FXK A;  2EIM C;  4JPR A;  4MVQ A;  1IBK O;  4YJ3 A;  1BMF G;  1K33 A;  3RYI A;  3JAT A;  4J80 A;  2WAM A;  1YJW V;  3CRQ A;  1RSO A;  1XL6 A;  4PEL A;  4PI0 A;  5EBL C;  4JI0 O;  2YIA A;  4JI8 O;  1YSC A;  4RQF A;  1H38 A;  1S3J A;  1KD1 W;  4MVO A;  4ABM A;  4HYO A;  3SYQ A;  2EIJ B;  1ZTE A;  4ZI7 B;  2QTO A;  1WP7 A;  4I4T A;  3ASN C;  1OCR C;  3SGI A;  3E8H A;  2UXB B;  5L3G A;  2Y0I A;  2DYR B;  2Q7H A;  4YXW G;  3ABK B;  3E86 A;  1R73 A;  2RCV A;  3A0B Z;  3FB5 C;  1J5E B;  2UUC B;  2ATK C;  2YI8 A;  4FLY A;  3SYC A;  3KZI Z;  4FLU A;  3G6E V;  2IJJ A;  1GKF A;  3KKY A;  4X8A A;  5KHJ A;  3QTC A;  4DV1 B;  2UXD B;  3JSN A;  2ARH A;  1XRE A;  3TK1 A;  4PDV A;  4DV3 B;  2ODM A;  3FB7 C;  5B1B B;  4K0K B;  4ZI7 A;  1N4C A;  1AR4 A;  1W59 A;  4EKW A;  1TA8 A;  4FZ0 A;  4ZBM A;  1HR0 O;  1H2L A;  2E3C A;  1QQC A;  4O4L B;  3UO3 A;  2QEX V;  2JIZ G;  1FPO A;  3FB8 C;  4TSF G;  3ZRV A;  2QKC A;  1RFY A;  1AI4 A;  1FXV A;  3OGC C;  3ZHT A;  3T1H B;  3ZRX A;  2AHY A;  4GKK B;  3ZBH A;  3OW2 U;  2GHY A;  4NTY A;  4E2L A;  1RPR A;  2H3O A;  4JI2 B;  1NKD A;  1N32 O;  2UXB O;  4B7K A;  3ASO C;  4O4L A;  4DV7 B;  2KQX A;  1ARO P;  2HG5 C;  2LP7 A;  2WLJ A;  4UVB A;  2F43 G;  4UB6 Z;  4ZHQ B;  5H6R A;  4YIO A;  1J5E O;  1AP5 A;  5LHI A;  5E1A C;  3L75 H;  1JFF B;  2FKX A;  5KHI A;  4TWK A;  4DUZ B;  3SYA A;  3CRR A;  4DV1 O;  4FJC C;  2X6C A;  4LF9 B;  3A8T A;  3SJA C;  4JTC B;  1US6 A;  4GT1 A;  2F93 B;  1M5I A;  1JJO A;  1OV9 A;  4DV3 O;  1VQK V;  1G1X B;  4TOI A;  3G6B A;  1NTK H;  4JAA A;  4ZHQ A;  4UVC A;  1EN4 A;  5B1N A;  3K5N A;  1JFF A;  1GN3 A;  3SJB C;  5LYJ B;  1E1R G;  3T1H O;  3WG7 C;  1OCO B;  1V55 B;  4DRX B;  4DR2 B;  3IGA C;  1N33 B;  5F2V O;  4JI3 B;  1YIT V;  1K3E A;  2RNB A;  1L8D A;  3BAA A;  2KSD A;  2WWW A;  4EFB A;  1MOF A;  3BY6 A;  1T5E A;  1IBM O;  2W0F C;  4JI2 O;  4X62 O;  1O9G A;  1ROP A;  4CS3 A;  5EK0 A;  3A0H Z;  4KFM A;  1FJG B;  4RQE A;  1G8M A;  1GM7 A;  3BAB A;  4K35 A;  3LDE A;  4PDL A;  4WFA V;  1ZWI C;  2W0X A;  3BPZ A;  4LF6 B;  1WB7 A;  4DW0 A;  3CCM V;  3OTO B;  2GSM B;  3K03 A;  2YC0 A;  1H8E G;  4AQY O;  4LF4 B;  3RYF B;  1HNW O;  3ZMZ A;  1VQ6 V;  3DXR B;  1OCC C;  3OM3 B;  1H2M A;  1N36 O;  2Q0O C;  2JJ2 G;  3HKD B;  1AJN A;  4LP8 A;  1I5X A;  1S5L Z;  1NI8 A;  2BOB C;  3D36 C;  4RAI A;  1GO3 F;  1THZ A;  4IL6 Z;  1X4T A;  2IW5 A;  2QR4 A;  2ZIM A;  3AG3 C;  5B1A C;  2DWE C;  2IU3 A;  1N33 O;  2R9R B;  2Q7G A;  4NXM O;  5JJE B;  2P06 A;  2XAH A;  3RYF A;  3AG1 C;  1JMK C;  1U96 A;  3DXR A;  4JYA O;  3HKD A;  1FXK C;  5H2F Z;  2D3O W;  4DR3 O;  2N04 A;  1FJG O;  3K0G A;  2V4D A;  2XOK G;  1YI2 V;  5L3E A;  4LNU B;  1XBL A;  5EC2 C;  1NTZ H;  2ZIO A;  3ZHS A;  2Q7E A;  1FS0 G;  4G27 B;  2OTJ V;  4JI6 B;  3LNN A;  2M6Y A;  2X0L A;  4JF3 A;  2DW4 A;  2UXX A;  4J41 A;  1NT2 B;  3FFQ A;  3K58 A;  1Y4M A;  3W7T A;  3ABL B;  4L87 A;  2GTA A;  2GBO A;  5BR8 O;  4MSW C;  2DE0 X;  3E89 A;  2OCC C;  4LF4 O;  2XND G;  2B1G A;  1CXZ B;  1VQP V;  2A9H A;  4LR3 A;  4JI7 O;  1P4R A;  2XAJ A;  2ZE5 A;  5LMN B;  4H13 B;  3GB7 C;  2IH3 C;  3WB2 A;  4LNU A;  4DK0 A;  3OMA B;  2ZQM A;  1NJI W;  1M90 W;  1VAR A;  4LCU C;  3H1L H;  1SA0 B;  3AG4 B;  4DV0 B;  2YID A;  5CA3 A;  2ZM6 O;  4UV9 A;  2C2A A;  4Z2W A;  4K8X A;  3U11 A;  1QCE A;  2ZIN A;  1VQN V;  1OCZ B;  3OD4 A;  2EIJ C;  4MVU A;  4CH5 A;  3L74 H;  3VQY A;  3JCU Z;  3ZHV A;  4LFA B;  4UCR A;  4FM1 A;  4GKJ O;  3RBZ A;  3MHH C;  4NXN B;  2Y4T A;  1Q43 A;  4J7K A;  1SQF A;  2DYR C;  4TQF A;  1BCC H;  1KU9 A;  1NR7 A;  1M57 B;  1KEC A;  3ABK C;  1L1F A;  1UJW B;  3SJC C;  4ZKI A;  1SA0 A;  3OEH G;  5IWA B;  4JI6 O;  2CTR A;  3ETG A;  1P84 F;  2YDE A;  2F4V O;  4AHC A;  3UQ8 A;  1SQP H;  1JX9 A;  4QE7 A;  4XDJ A;  5LL6 Y;  3DSQ A;  3RWR D;  1H8H G;  1H2S B;  1WA8 B;  5EC1 C;  5B1B C;  3M99 B;  2JEU A;  2W6J G;  2NNU A;  2E75 B;  3CC4 V;  2R9A A;  3ETE A;  2YIB D;  2QSA A;  4B3M O;  1QR9 A;  2LQT A;  3CJH B;  5DEC A;  5LMN O;  3CE2 A;  4BW9 A;  2LW1 A;  4I9Q A;  1BS3 A;  4LF7 O;  5IYC O;  3RW0 A;  5H9C A;  5EBW C;  4C7U A;  3FD9 A;  3UT5 B;  3ZHU A;  1JJ2 U;  4DV6 B;  1XHX A;  4UVA A;  3GVM A;  5L3F A;  2ZXW B;  4DR7 O;  4W4K A;  1QLE B;  3JCZ A;  4DXW A;  1WA8 A;  5EYP B;  1K9M W;  1BGY H;  1VQ4 V;  3BVO A;  4DR4 B;  4CH6 A;  1K34 A;  2WLN A;  3UKM A;  1QBZ A;  4LFA O;  1SQB H;  4X1Y B;  3H1K H;  1QNM A;  3CJH A;  1DF4 A;  4OPA A;  2Q4P A;  4NXN O;  3MAQ A;  4CC5 A;  3TCU A;  4UUJ C;  2QKA A;  4H0L B;  3ICX A;  4X64 B;  4LH7 A;  4KHP B;  2WLH A;  1XMO O;  2ZE6 A;  4PDR A;  3UT5 A;  4PD4 F;  2EZP A;  2KKW A;  2IJI A;  5KLV H;  1D5N A;  3CCJ V;  3CCQ V;  4B3S B;  3ZMS A;  5IYD O;  1YTF B;  1JVM A;  1MMM A;  4XDK A;  5L3C A;  2ZE8 A;  1Q90 D;  5EYP A;  1VQ8 V;  1K7D A;  4JAV A;  1R3J C;  2B9Z A;  4DV4 B;  3UO2 A;  4ASU G;  1TGO A;  1M56 B;  4GX2 A;  2EX3 A;  4X1Y A;  2VWJ A;  3G80 A;  4J10 A;  4DV5 O;  3VQW A;  2UU9 B;  2DOS A;  2OTL V;  5FPO A;  4JTA B;  3VOU A;  1I08 A;  4U7N A;  1Q82 W;  2QM8 A;  4YY3 O;  4JI5 B;  4JYB A;  4LF8 B;  4JAU A;  1GK9 A;  2ZT9 B;  1M93 A;  1NR1 A;  1OCO C;  3BFR A;  1IDS A;  1V55 C;  4MTG A;  5CMU A;  1KB9 F;  2JS5 A;  4J9Z B;  1I5Y A;  2NR5 A;  1Y76 B;  4DR4 O;  3CP1 A;  4I55 B;  4PI2 A;  4TUY B;  1N34 O;  4F4L A;  4B3R B;  4EFE A;  1QR8 A;  1HNZ B;  4FM0 A;  5GTH Z;  3B09 A;  4NVP A;  1K97 A;  4Z1V A;  3B4S A;  5D5P A;  4KHP O;  5DM6 V;  4FVM A;  1KP2 A;  5K1X A;  2WA3 A;  2B1I A;  4DK1 A;  4B3S O;  1AJQ A;  1Z2G A;  3OT7 A;  5JCO A;  1NZ6 A;  4WFB V;  5LMU O;  4GYC B;  2GTS A;  1Y76 A;  2Q9L A;  4FMT A;  5LOV B;  3W7W A;  4DV4 O;  4I55 A;  5KUK A;  4TUY A;  1KKC A;  1XMQ O;  1K73 W;  2ZCE A;  3RYH B;  1SS3 A;  1W2B U;  5IE9 A;  2UU9 O;  1R6T A;  3ZMV A;  2M7W A;  3W7U A;  3X2Q B;  4OPH A;  1Y66 A;  2QM7 A;  2OCH A;  2EIK B;  1SZX A;  2A7W A;  4LF8 O;  3E35 A;  3F5W C;  1V54 B;  2F95 B;  3H9V A;  1Q81 W;  3LUT B;  3T4Z A;  2A06 H;  1YXB A;  5C93 A;  5EIB C;  4Q6G A;  5LOV A;  1DK1 A;  5KX5 B;  3STZ C;  1YF2 A;  1QVG U;  1I0H A;  3ABM B;  3RYH A;  2YXY A;  1M1K W;  2FYU H;  5L3B A;  4JI1 O;  1KMI Z;  2XTA A;  3IAY A;  1SZT A;  2FB5 A;  1KKD A;  2AXT Z;  1RM1 B;  3AG7 A;  2RN9 A;  3ABL C;  1NH2 D;  1QU7 A;  2Y4U A;  3G71 V;  3AG2 C;  2Y69 B;  2VQF B;  5KX5 A;  3K5O A;  4CS4 A;  3WU2 Z;  4NKG B;  2HJF C;  1XL4 A;  4FPP A;  4O2A B;  1LR1 A;  3CXC U;  1PP9 H;  3L73 H;  3L72 H;  3M8A A;  2WLK A;  3RT3 C;  1VQ7 V;  1PD3 A;  4MVM A;  2WPD G;  1K5Q A;  4QPK A;  5KHK A;  2CDY A;  2CUG A;  5JJJ B;  3AG4 C;  5IDJ A;  1KYO F;  1DGS A;  4DUY B;  5LGU A;  4OX9 B;  1GN2 A;  1W0J G;  3STL C;  1FXH A;  1XEQ A;  2X6A A;  4JI4 B;  2XAQ A;  1AIL A;  1H2N A;  2ZR3 A;  2UUC O;  2OWO A;  1VQM V;  1OCZ C;  3QNE A;  1JA8 A;  4O2A A;  5FLX N;  2UXD O;  2Q67 A;  1RP3 B;  4FLW A;  2FML A;  4WF9 V;  2JJ1 G;  3JD0 A;  1Q6H A;  4K0K O;  1S0V A;  4XDL A;  4UV8 A;  1M57 C;  2Z3Y A;  3DTU B;  4JZG A;  4H33 A;  4R7C A;  2Z5U A;  2EJ7 A;  3O9O A;  4JYY A;  2UUA B;  1B6Q A;  4FLV A;  4K8Z A;  4FFB B;  4PA4 A;  2RDC A;  1Y67 A;  2HEP A;  2LGW A;  2BTQ B;  3CRM A;  1NU1 H;  4R6Z A;  5GON B;  1M4U A;  4FM2 A;  5IY5 B;  4FZ1 A;  2ILM A;  4QNH B;  2ZR2 A;  4GKK O;  4DR5 B;  2JGD B;  1F51 A;  3AK3 A;  3TGU H;  1YJN V;  2QJ1 A;  2MW2 B;  3QF7 A;  2YEV B;  1N0J A;  1WN7 A;  3JAL B;  5CA0 B;  3N27 A;  4DV7 O;  4FK5 C;  4OX9 O;  4FFB A;  4F6R B;  4P30 A;  1SES A;  2ZXW C;  2BTQ A;  4P9O A;  4R8C A;  3H1I H;  3W7X A;  3I55 V;  3KG2 A;  4JI4 O;  3CXH F;  1QLE C;  3I56 V;  1ZLZ A;  5GON A;  2E5L B;  5JVD B;  4DUZ O;  2P7T C;  1PM9 A;  4PA6 A;  4RWU A;  3ZCC A;  1AJP A;  3J80 N;  1HNX B;  1Q8I A;  5IJ9 B;  4LF9 O;  4X1K B;  4FLZ A;  2JGD A;  4WFG A;  4B08 A;  1IXM A;  3RGB A;  2QM4 A;  2NN4 A;  1L0N H;  3D8C A;  2YEV A;  5J2T B;  5KA5 A;  1XDC A;  3N2K B;  3JAL A;  5CA0 A;  3VBB A;  4X1I B;  2IJH A;  2WLM A;  2QWP B;  1XNR B;  4PA3 A;  1I94 B;  3CCL V;  2K9P A;  4TV8 B;  4F6R A;  3RVY A;  1BSM A;  2HR3 A;  3G4S V;  1VF6 C;  2ADP A;  5JVD A;  1AR5 A;  5LGT A;  1NVP B;  1FYJ A;  3HKC B;  5IJ9 A;  1I7F A;  3K5M A;  4X1K A;  4DR2 O;  4Z1M G;  2F1M A;  4DR5 O;  2YXH A;  3ML0 A;  4JI3 O;  3LSU A;  3APQ A;  1ZX3 A;  2JVD A;  5J2T A;  3OR6 C;  1DF5 A;  4NB5 A;  3N2K A;  2UXC B;  4I7Z B;  4WBN B;  4X1I A;  3CMA V;  5B1O A;  2BE3 A;  4TV8 A;  5IYZ B;  4K3A A;  5BXZ A;  1H2K A;  1WNS A;  5JCO C;  3S3X A;  5D5Q A;  3BRC A;  1SQX H;  2E5L O;  1N0N A;  2IH1 C;  5FL7 G;  2A0L A;  3JYC A;  2XT9 A;  1QVF U;  3HKC A;  3SPC A;  2ZDI A;  3ZIA G;  1XNQ B;  1F4M A;  3A2F A;  4LF6 O;  1YZB A;  4BIU A;  3OTO O;  1E79 G;  3UM7 A;  4DV2 B;  1S77 D;  4LF5 B;  4LFB B;  2OIG A;  3K59 A;  2PGG A;  4WBN A;  1NBM G;  1FFT B;  2FL4 A;  4GLX A;  1KP3 A;  5IYZ A;  4TQD A;  2XAG A;  1AI6 A;  1JCH A;  1LNQ A;  2UXN A;  5KAF Z;  1TVK B;  5ITZ A;  3SR2 C;  4B3T B;  4AI8 A;  1ZAU A;  1A32 A;  2QWN B;  2PI4 A;  3X2Q C;  4D7T A;  2P5O A;  3J81 N;  1SQV H;  3LSS A;  1EFR G;  3T1C A;  2P6J A;  4PA7 A;  1XQ8 A;  2V1D A;  2EIK C;  2H8P C;  3JSL A;  2OYQ A;  1V54 C;  5HFL A;  2D2C B;  2BCC H;  4KUM A;  1OHH G;  3R65 A;  1TVK A;  4UCS A;  4JV5 B;  1SQQ H;  3O65 A;  4B7E A;  1JR9 A;  4P2Z A;  1HP8 A;  3CYO A;  3C3S A;  4N23 A;  1P7B A;  4LFC B;  4CZZ A;  1VQ5 V;  3OUS A;  5CB4 B;  3ABM C;  5CBH A;  3EFF K;  3FX7 A;  4F6E A;  4HBN A;  3HKE B;  5KA6 A;  2UUB B;  1S5J A;  3KCY A;  3OMI B;  2ZD9 A;  3SPJ A;  2F23 A;  4X65 B;  3CS5 A;  2PZS A;  2Q6A A;  2O57 A;  1G6U A;  2PI5 A;  1VQL V;  1KC8 W;  4UCV A;  3K5L A;  2R72 A;  4DR6 B;  4BIZ A;  2N74 A;  2Y69 C;  1FD9 A;  3OGI B;  4DV0 O;  2AHZ A;  3Q4H B;  3F7Y C;  1V9P A;  5CB4 A;  3BHP A;  1IUR A;  3CC2 V;  3HKE A;  4CBC A;  3E22 B;  4KL1 A;  1WPB A;  3HKB B;  3K0D A;  4JAS A;  2RQ6 A;  3NR7 A;  3ABT A;  5JWP A;  1BE3 H;  3AK2 A;  4J42 A;  2GUZ B;  1IBL B;  4ZOL A;  1D5A A;  3S3W A;  2LO1 A;  1MA1 A;  1MSD A;  3P32 A;  3JAM N;  1DTO A;  3BEH A;  1R6N A;  2RJZ A;  2CTQ A;  3MD0 A;  4HNA B;  3Q4H A;  2LFR A;  5IWA O;  2EUL A;  4OGQ B;  1E1Q G;  1BQ0 A;  3FAV B;  2IBZ H;  1Q6I A;  3RFR A;  3SJQ C;  2HFE C;  3E22 A;  4J7Z A;  4DO2 A;  3HKB A;  4QPJ A;  4U3J B;  2X7R B;  5EIB D;  2UUB O;  4X20 B;  4LWS B;  5KHG A;  4QJF B;  1OCC B;  4X65 O;  2L35 A;  1BQZ A;  2JGU A;  3CCU V;  2KG7 B;  1JQ0 A;  4PHZ A;  2GUZ A;  3K9A A;  1VF5 B;  3CRA A;  5BMV B;  1WB8 A;  1RPO A;  2VWK A;  2HKO A;  3C3T A;  1HWY A;  1IXB A;  5KMG B;  1VIB A;  3E2E A;  4UCU A;  3MDS A;  2Y0P A;  4HNA A;  3ZX6 A;  1MNG A;  2DWD C;  4ICG A;  4MVZ A;  3T2M A;  2YSU B;  2JRI A;  2CE4 A;  4WFE A;  4YIP A;  2Q8V A;  5BZB A;  4DV6 O;  3FAV A;  4X9Q A;  2QWO B;  3BA8 A;  2CAZ C;  4RUE A;  4U3J A;  4X20 A;  1R3K C;  2QWQ B;  4LWS A;  3CHX A;  3ZRS A;  1K92 A;  2KG7 A;  1YHQ V;  3OFN G;  5LP6 B;  5BMV A;  2R9I A;  1IBL O;  5KMG A;  3CCR V;  5B3S B;  4UCT A;  1PNL A;  2PYL A;  4FFK A;  1M9N A;  4I9W A;  1AR1 B;  4QIW F;  4GCZ A;  4X64 O;  3ZS8 C;  1DLB A;  2CGO A;  4PV1 B;  2EIL B;  2QA4 V;  2F66 C;  2Q69 A;  1NS1 A;  5BY1 A;  4WFH A;  3R66 A;  4J7J A;  2P90 A;  2K1E A;  3E8G A;  5EBM C;  1L0L H;  2NLJ C;  1YDX A;  3DC5 A;  2OIE A;  3MHS C;  1KUQ A;  5LP6 A;  4I50 B;  3C90 A;  3D3Q A;  3RVZ A;  3B8N A;  5GW7 A;  1G4Y B;  2ITD C;  1ZSP A;  1J95 A;  2KB1 A;  2EBO A;  1EN6 A;  1BHA A;  1MG1 A;  5FNV B;  4MS2 A;  2ZKO A;  1FAF A;  3VQV A;  3CWB H;  4JI5 O;  4I5S A;  3TET A;  5IT9 N;  5A2Q N;  3FYE B;  2VS0 A;  4QE9 A;  3IC7 A;  4OXS A;  2ZDI C;  1JOY A;  2IU0 A;  4X66 B;  4JGS A;  4H37 A;  2QE7 G;  5JH7 B;  3ZJZ A;  4GUN A;  1AI7 A;  3CPW U;  2AZ0 A;  5H6Q A;  4XBF A;  2OT5 A;  3CRC A;  3THO A;  1VQO V;  4I50 A;  1N32 B;  3RN4 A;  5H5N A;  2Z0A A;  4MVR A;  4A5U B;  3K57 A;  2LW7 A;  4B3R O;  2EIN B;  1HNZ O;  1Z5W A;  2VRZ A;  3ETQ A;  3B2E E;  3W7S A;  1VF7 A;  1N8R W;  5E79 Z;  2AW9 A;  4O4H B;  4UFZ A;  5FNV A;  1EM1 A;  1XHZ A;  2QWR B;  3AK1 A;  1OZ0 A;  2YUA A;  4U3F H;  1BT8 A;  5B5E Z;  3CC7 V;  3CME V;  1BZK A;  1WPX A;  1VP7 A;  1PPJ H;  3TXQ A;  5JH7 A;  3FKS G;  5LHG A;  1NTM H;  1CP9 A;  3J7A U;  1F4N A;  4UB8 Z;  3WB1 A;  3LSQ A;  5CBG A;  1YVW A;  4LBE C;  5LBQ A;  1NQT A;  3OTF A;  2WLL B;  4JZ2 A;  1EN5 A;  3ZMT A;  3PJS K;  3H1J H;  1P7G A;  4O4H A;  4KXR A;  2QGN A;  2AGA A;  2X6B A;  4MTF A;  1XIL A;  2BSK B;  3F7V C;  4U7O A;  2P4K A;  3BCC H;  3CB2 A;  1Q3E A;  1YTF D;  1AI5 A;  1SC5 B;  1Q6U A;  3M7M X;  4X66 O;  1CEZ A;  1UFI A;  2R70 A;  4PJ0 Z;  4BR6 A;  1IBM B;  1GH6 A;  4G2K A;  1AVM A;  1B3Q A;  4X62 B;  4TT3 G;  3H01 A;  3SPI A;  1SET A;  1EZJ A;  2A3Q A;  1W0K G;  2HP8 A;  1LUV A;  2WLL A;  3F5T A;  2HLD G;  4R50 A;  1OJH A;  3IFX A;  2AZ2 A;  2BSK A;  1SER A;  4FLX A;  2WLI B;  1WLE A;  4Q20 A;  2YI9 A;  4KP4 A;  4H44 B;  4BW5 A;  3U10 A;  1QLN A;  2P22 C;  2HVK C;  4MTX A;  3U0Z A;  2VQF O;  4AQY B;  2DYS B;  1HNW B;  1GN4 A;  4TV9 B;  1N36 B;  3OEE G;  1MZE A;  4NTX A;  3JD3 A;  3ZED A;  2XAS A;  2Q68 A;  3HPL C;  4W4L A;  2ITC C;  1D2D A;  1R6K A;  2E76 B;  4D7S A;  1ZL8 B;  3LDD A;  2WSS G;  2QKS A;  4MTO A;  2WLI A;  1ENV A;  3DGE A;  4L8J A;  1GMG A;  3FB6 C;  1X59 A;  3WB0 A;  4DUY O;  5CN0 A;  1TAE A;  3QG5 A;  5KUM A;  1MSW D;  3K04 A;  2FTK A;  3SPG A;  4NXM B;  4UXN A;  1COW G;  3P3P A;  4J11 A;  3N2G B; 
#chains in the Genus database with same CATH homology
 1M56 B;  4GX2 A;  3FB7 C;  5B1B B;  3SYP A;  2BOC C;  2PI4 A;  3P30 A;  3X2Q C;  1H2G A;  4EKW A;  5LHH A;  2OTL V;  3LSS A;  4ZBM A;  3CD6 V;  1EFR G;  3T1C A;  4JTA B;  2P6J A;  4PA7 A;  3NXS A;  3ZN0 A;  1BL8 A;  2V1D A;  2EIK C;  1CPY A;  1EBO A;  2EIM B;  2H8P C;  4U7N A;  3VOU A;  1Q82 W;  2QM8 A;  1YJ9 V;  1GM9 A;  2JIZ G;  2QEX V;  1V54 C;  2CK3 G;  5HFL A;  1GM8 A;  4JYB A;  4JAU A;  1GK9 A;  3FB8 C;  1JPX A;  4TSF G;  4KUM A;  3ZRV A;  1OHH G;  3R65 A;  1NR1 A;  1AI4 A;  3SPH A;  3K79 A;  1FXV A;  1OCO C;  3OGC C;  1V55 C;  4P2Z A;  3CYO A;  4MTG A;  4N23 A;  5CMU A;  1P7B A;  1VQ5 V;  4CZZ A;  4J9Z B;  3OUS A;  1I5Y A;  3ABM C;  5CBH A;  3EFF K;  3ZRX A;  2AHY A;  3CP1 A;  3OW2 U;  2GHY A;  4E2L A;  5KA6 A;  1MAB G;  4JYC A;  1M56 C;  4F4L A;  3OMI B;  2ZD9 A;  1RPR A;  4PA9 A;  3GWO A;  3SPJ A;  1QR8 A;  1NKD A;  3ASN B;  3ASO C;  1OCR B;  1K97 A;  2Q6A A;  1ARO P;  2HG5 C;  2LP7 A;  2WLJ A;  5DM6 V;  2PI5 A;  3OUF A;  4UVB A;  1KP2 A;  2F43 G;  2XAF A;  4MVS A;  1VQL V;  1KC8 W;  5H6R A;  1K5S A;  2B1I A;  5LHI A;  5E1A C;  1AJQ A;  1SRY A;  4BIZ A;  1PNK A;  2Y69 C;  3EHB B;  2AHZ A;  3F7Y C;  4TWK A;  3SYA A;  4MT8 A;  4WFB V;  2JK5 C;  3LDC A;  4RO2 A;  3T4D A;  5IYB O;  4FJC C;  2X6C A;  4FMT A;  3W7W A;  3CC2 V;  5LGN A;  3OR7 C;  4JTC B;  4GT1 A;  5KUK A;  4CBC A;  1PKX A;  4JAS A;  3K0D A;  1K73 W;  1VQK V;  5J9P C;  1PNM A;  3ABT A;  1W2B U;  1F23 A;  4PDM A;  4X89 A;  3ZMV A;  2M7W A;  3W7U A;  3X2Q B;  5B3S C;  1Q7Y W;  1Y66 A;  2QM7 A;  3D3I A;  4J9Y B;  4UVC A;  2EIL C;  3P32 A;  5B1N A;  2EIK B;  1DTO A;  3E35 A;  3BEH A;  1R6N A;  3F5W C;  1V54 B;  1S5H C;  3MD0 A;  2LFR A;  1Q81 W;  3LUT B;  3AG2 B;  3T4Z A;  1E1Q G;  1E1R G;  2MK3 A;  5C93 A;  3WG7 C;  3QO7 A;  1OCO B;  1V55 B;  3STZ C;  3SJQ C;  2HFE C;  3IGA C;  4DO2 A;  1QVG U;  3ABM B;  4MW3 A;  1YIT V;  4QPJ A;  2X7R B;  1K3E A;  4QJF B;  1OCC B;  1M1K W;  3JD4 A;  3CCU V;  2WWW A;  5L3B A;  2JEX A;  1MOF A;  3BY6 A;  1JQ0 A;  4GX0 A;  2W0F C;  3K9A A;  1ROP A;  3LNM B;  2EZO A;  2H94 A;  5EK0 A;  1RPO A;  2HKO A;  4KFM A;  1HWY A;  3E83 A;  4RQE A;  1YIJ V;  3E2E A;  1SZT A;  5HFM A;  1G8M A;  3ASO B;  1KKD A;  1GM7 A;  3K3W A;  1RM1 B;  1TUE B;  3ABL C;  3LDE A;  2DWD C;  1NH2 D;  2V7Q G;  4MVZ A;  3T2M A;  2YSU B;  3G71 V;  4PDL A;  3JD1 A;  3AG2 C;  4WFE A;  4WFA V;  2Y69 B;  1ZWI C;  5BZB A;  2HJF C;  3CCM V;  1XL4 A;  4RUE A;  4FPP A;  1R3K C;  2GSM B;  3K03 A;  3CXC U;  1H8E G;  2A79 B;  3ZRS A;  3ETD A;  1K92 A;  3ZMZ A;  1VQ6 V;  1YHQ V;  1OCC C;  2WLK A;  3OFN G;  2EIN C;  3OM3 B;  1VQ7 V;  2JJ2 G;  2R9I A;  3CCV V;  1AJN A;  1PD3 A;  4MVM A;  2WPD G;  1K5Q A;  2EJR A;  4QPK A;  2P67 A;  4FIP C;  3CCR V;  4LP8 A;  1I5X A;  5B3S B;  1PNL A;  2IJK A;  3AG4 C;  5IDJ A;  1M9N A;  4I9W A;  2BOB C;  1AR1 B;  4QIW F;  4GCZ A;  3OE7 G;  5LGU A;  4RAI A;  3OMN B;  1GO3 F;  1DLB A;  3A0R A;  2EIL B;  2QA4 V;  1W0J G;  1THZ A;  3STL C;  1FXH A;  2IW5 A;  1RM1 C;  2X6A A;  2Q69 A;  2XAQ A;  5DN6 G;  2HVJ C;  4WFH A;  2ZR3 A;  4BAY A;  3AG3 C;  3QO8 A;  1VQM V;  1OCZ C;  5B1A C;  2DWE C;  3QNE A;  2IU3 A;  2P90 A;  2K1E A;  3E8G A;  5EBM C;  2R9R B;  2NLJ C;  3WG7 B;  4WCE V;  3MHS C;  2Q67 A;  2JDI G;  2XAH A;  3AG1 C;  2W6I G;  4WF9 V;  2JJ1 G;  3JD0 A;  3RVZ A;  5L3D A;  3FYI B;  1FXK C;  2D3O W;  1S0V A;  3B8N A;  5GW7 A;  4XDL A;  4UV8 A;  1M57 C;  3K0G A;  4P9P A;  1G4Y B;  2Z3Y A;  1K8A W;  2ITD C;  3DTU B;  1J95 A;  4H33 A;  2XOK G;  4G28 B;  2KB1 A;  1YI2 V;  5L3E A;  4R7C A;  4MW8 A;  2EBO A;  2Z5U A;  5EC2 C;  1BHA A;  1MG1 A;  4MS2 A;  1B6Q A;  1FS0 G;  1K4D C;  4G27 B;  3ZMU A;  1NH2 B;  2OTJ V;  2X0L A;  4HZ3 A;  4PA4 A;  4I5S A;  3TET A;  4JF3 A;  2DW4 A;  2UXX A;  4JTD B;  1Y4M A;  3W7T A;  3ABL B;  3FYE B;  4WFF A;  1BHB A;  4L87 A;  3QO5 A;  4QE9 A;  3IC7 A;  4OXS A;  4R6Z A;  3ABU A;  2ZDI C;  2DQ0 A;  4N21 A;  1JOY A;  2IU0 A;  4MSW C;  4LC1 A;  4JGS A;  4H37 A;  2QE7 G;  5IY5 B;  3ZJZ A;  1NVP D;  1ORQ C;  4QNH B;  3CCS V;  1AI7 A;  2ZR2 A;  3CPW U;  1R3I C;  3E89 A;  1VQ9 V;  2OCC C;  5H6Q A;  2XND G;  2OT5 A;  2B1G A;  4XBF A;  3ZRW B;  4X88 A;  1VQO V;  3SYO A;  3K06 A;  1F51 A;  1VQP V;  2A9H A;  3CCE V;  1P4R A;  1YJN V;  3B77 A;  2XAJ A;  4MVR A;  1K4C C;  3E8F A;  2YEV B;  1PL0 A;  2EIN B;  3GB7 C;  2IH3 C;  3W7S A;  1N8R W;  4HAM A;  4GX5 A;  2DQ3 A;  3OMA B;  2ZQM A;  4FK5 C;  1NJI W;  4LCU C;  1M90 W;  3AG4 B;  1KQS U;  5CA3 A;  4UV9 A;  1SES A;  1OZ0 A;  2ZXW C;  2C2A A;  4P30 A;  4RUF A;  4P9O A;  4R8C A;  3I55 V;  3W7X A;  3KG2 A;  1QLE C;  5CBF A;  3JD2 A;  3I56 V;  3CME V;  3CC7 V;  1QCE A;  1WPX A;  3AG3 B;  1VQN V;  1S76 D;  2DYS C;  1OCZ B;  2P7T C;  4PA6 A;  3FKS G;  5B1A B;  3ZCC A;  1AJP A;  1GTO A;  5LHG A;  1CP9 A;  2EIJ C;  1F4N A;  4MVU A;  3B8M A;  5IY5 C;  2LFS A;  3ZRW A;  3LSQ A;  4WFG A;  3E8B A;  1IXM A;  5CBG A;  3OAA G;  4LBE C;  3RBZ A;  1R3L C;  3AG1 B;  3MHH C;  2YEV A;  2DYR C;  5KA5 A;  1NQT A;  5LBQ A;  2WLL B;  3ZMT A;  3PJS K;  1FXK B;  1S72 V;  3K08 A;  1NR7 A;  3HB3 B;  3VBB A;  1M57 B;  1KEC A;  3ABK C;  4GX1 A;  1L1F A;  1UJW B;  2IJH A;  4ZKI A;  2WLM A;  3OEH G;  4PA3 A;  3CCL V;  3D36 A;  2X6B A;  4MTF A;  3RVY A;  3ZN1 A;  3F7V C;  3ETG A;  2B5U A;  2HR3 A;  4U7O A;  3WFV A;  3G4S V;  3AEI A;  1JX9 A;  1YTF D;  4QE7 A;  4XDJ A;  1AI5 A;  2Y48 A;  1H8H G;  5LGT A;  1NVP B;  1CEZ A;  5EC1 C;  5B1B C;  3M99 B;  2JEU A;  2W6J G;  2NNU A;  4Z1M G;  3CC4 V;  3ETE A;  4G2K A;  4TT3 G;  3ML0 A;  3H01 A;  3SPI A;  1SET A;  1Q86 W;  1EZJ A;  2OCC B;  1QR9 A;  1W0K G;  3OR6 C;  2WLL A;  1DF5 A;  1FXK A;  2EIM C;  4JPR A;  4MVQ A;  5IYC O;  3RW0 A;  3CMA V;  2HLD G;  4R50 A;  5H9C A;  1BMF G;  5B1O A;  1K33 A;  5EBW C;  3IFX A;  2WAM A;  1YJW V;  1SER A;  2WLI B;  1WLE A;  4Q20 A;  1JJ2 U;  1XL6 A;  4KP4 A;  4PEL A;  4UVA A;  5EBL C;  4BW5 A;  5L3F A;  2ZXW B;  1QLN A;  2HVK C;  1QLE B;  2IH1 C;  3JCZ A;  5FL7 G;  4DXW A;  2A0L A;  1K9M W;  3JYC A;  1QVF U;  4MTX A;  1YSC A;  1VQ4 V;  4RQF A;  3SPC A;  1S3J A;  1KD1 W;  1H38 A;  2ZDI A;  2DYS B;  4MVO A;  3ZIA G;  4HYO A;  1F4M A;  1K34 A;  3OEE G;  2WLN A;  3SYQ A;  1QBZ A;  3JD3 A;  3UKM A;  2EIJ B;  4BIU A;  1E79 G;  2QTO A;  2XAS A;  2Q68 A;  3UM7 A;  1DF4 A;  3HPL C;  1S77 D;  3ASN C;  1OCR C;  3E8H A;  3TCU A;  4UUJ C;  2ITC C;  5L3G A;  1R6K A;  1NBM G;  2DYR B;  3LDD A;  2WLH A;  1FFT B;  2WSS G;  2QKS A;  4YXW G;  4PDR A;  4MTO A;  2EZP A;  1KP3 A;  2IJI A;  3ABK B;  3E86 A;  2WLI A;  1ENV A;  3DGE A;  1R73 A;  1GMG A;  3FB6 C;  3FB5 C;  2XAG A;  3CCJ V;  3CCQ V;  1AI6 A;  2ATK C;  1JCH A;  1LNQ A;  3ZMS A;  5IYD O;  3SYC A;  1YTF B;  2UXN A;  1JVM A;  4XDK A;  5CN0 A;  5KUM A;  5L3C A;  3K04 A;  2IJJ A;  1GKF A;  3G6E V;  2FTK A;  1MSW D;  4X8A A;  3SPG A;  1VQ8 V;  1K7D A;  4JAV A;  1R3J C;  4UXN A;  1COW G;  3TK1 A;  4PDV A;  4ASU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...