4LF5O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf5O00
5LMUO 1AB3A 3J81N 1XMQO 3F5TA 4DV7O 4JI8O 1IBMO 1FYJA 1HNXO 4DV3O 2E5LO 4OPHA 4JI5O 2F4VO 5BY1A 2UUCO 4AQYO 4GKKO 4DV2O 3T1YO 1N34O 4DV4O 1HR0O 1F7YA 5FLXN 1A32A 3SDLA 4LFCO 4DR7O 4A5UB 4NXMO 2UXBO 5BXZA 3OTOO 1IBKO 1HNWO 2ZKOA 1XNRO 2N74A 4OX9O 4JI0O 2UUAO 4DV0O 4JI6O 5LMNO 1N33O 4LF6O 2FKXA 4YHHO 1XMOO 1DK1A 2DJVA 1R6TA 1NS1A 1I94O 4LF5O 1HNZO 2HHHO 5IWAO 1N36O 4B3RO 4K0KO 1XNQO 2UU9O 4GKJO 4JI2O 4LF7O 1AILA 3J80N 4X62O 4YY3O 5A2QN 3JAMN 1X59A 4DV5O 1J5EO 3T1HO 4DR3O 5BR8O 2UXCO 4JI7O 5H5NA 4DV1O 2UXDO 1G1XB 5IT9N 1KUQA 4JV5O 4JI4O 4X65O 4LF8O 1D2DA 4LFAO 4JI1O 4B3MO 4OPAA 2VQEO 4LFBO 4LF4O 2JRIA 1IBLO 1R1BA 4JI3O 4DR2O 4DR4O 2AGAA 3O65A 4LF9O 2LW7A 4DUYO 4DUZO 4NXNO 2ZM6O 4B3TO 3M8AA 2VQFO 3R66A 4DR6O 1N32O 5LL6Y 2Z0AA 2UUBO 1FJGO 4DR5O 4JYAO 4X66O 2DOSA 4DR1O 1FKAO 4KHPO 1YZBA 1XEQA 4DV6O 3RT3C 4X64O 4B3SO 3J7AU
chains in the Genus database with same CATH superfamily
4NTWA 4FLVA 1FS0G 3KG2A 4BAYA 1UPGA 3APOA 1IBMB 1WA8B 1Y6XA 1HNXO 5CA0A 4HZ3A 1LUVA 3BHPA 4NB5A 4LF9B 3FB5C 2ZIMA 5IY5B 5E79Z 4DV2O 4AQYB 5IJ0A 4DK0A 1GH6A 4LFCB 2UXBO 2ZR3A 1U97A 2M6YA 2QEXV 5LXTB 1VQPV 5IE9A 1FFTB 3OR7C 2Y69B 2DQ3A 2F23A 2E74B 3L70H 1CEZA 5KA5A 3HKBB 5CBGA 3HKCA 2XASA 3ZHVA 3ZIAG 3G6BA 1MSWD 1XREA 1N33O 2QKSA 3K5OA 4XBFA 1SQBH 1SQVH 1AI7A 2ATKC 3BY6A 5IYCO 2EIMC 1SZXA 1QR9A 4H44B 4FLTA 3LDDA 4K0KO 1XNQO 1Y67A 1TVKB 5FNVA 4DRXB 1O9HA 4DV5O 1BL8A 3T1HB 2CH7B 4FFBB 3P30A 4JI4O 1RSOB 1NR1A 3E8GA 1MG1A 3OEHG 2EJ7A 4LH7A 2DYRB 3CEIA 2EILB 1BSMA 5LA6A 3SYAA 2GTAA 4JZ2A 2ZDIA 4WFFA 4LFBO 3TGUH 2Q5ZA 4JAAA 3DTUB 4JI3O 3LSSA 3ZMSA 4UV8A 4GUNA 4UVAA 3O65A 1JFFA 3CCSV 1PL4A 4R6ZA 3S3XA 3B2EE 4J80A 5JQGB 1IXBA 2ADQB 1I5YA 4DR5B 4LF8B 3JD2A 5LYJA 4O2BA 1ORQC 2ZR2A 3VQVA 1YTFD 1S77D 4XDLA 5JCOA 2WLMA 3AG2C 1GM8A 5JJEB 3IGAC 4K3AA 3L74H 5L3BA 1YJNV 3VOUA 4UCUA 4DK1A 4XDJA 4UVBA 1ZX3A 2RDCA 4OPHA 3AK2A 2JEXA 1PD3A 4ZOLB 3OUFA 4RUEA 1MABG 2K9PA 5KLVH 3TXSA 4EFBA 2X6AA 1SA0A 5KAIZ 2EZPA 4U3JA 1XI1A 2E3CA 1VIBA 3EHBB 2ITDC 4MTXA 2Q4PA 1VQ5V 3VQWA 1YEWA 4HYOA 1QVFU 2YXLA 3RYIB 2K1EA 1HNXB 2Y4UA 5BMVB 1UFIA 2FL4A 3U10A 1YJ9V 4O2AB 3B77A 1XMOB 4K8ZA 1NS1A 2BOCC 4YJ3A 4FLZA 1NQTA 1VF6C 1HNZO 1WN7A 4EB6B 2UU9O 2PF4E 2W0FC 3X2QB 1QVGU 1NH2B 1JQ0A 1J5EO 2UXXA 2UXCB 4DV1O 3ZJZA 1N33B 2AZ2A 4X65O 2EIJB 4O4LA 1M56B 5J2UA 4IIJB 1WNSA 1DTOA 5EYPA 1D5NA 4B3MB 4NTXA 1B06A 1E1QG 4X1KB 1P7BA 1MNGA 3A8TA 2WPDG 4MVOA 1SQGA 4TV9B 3CRAA 2ZINA 1XDCA 4LP8A 3ZRVA 3CRRA 3JATA 3D36A 3SPCA 4YJ2A 1K34A 1XEQA 3U0ZA 3G4SV 4TUYB 1BT8A 2KG7B 3ZBHA 3DXRB 4AILC 5EIBD 1OCOC 1NVPB 4JI3B 4G28B 1RM1B 5CB4A 2Q6AA 5FPOA 1ZLZA 3D3IA 1NT2B 2Y4TA 4LBEC 4E4EA 1KKDA 1Q5OA 5FLXN 4QPJA 4WBNA 4GX2A 4GCZA 3B8NA 4O4JB 3LNMB 1ENVA 2ZKOA 1ROPA 4TQFA 3GB7C 4MW8A 1UJWB 3ZCCA 3VBBA 3RFRA 4X8AA 2IJHA 4JASA 4DW1A 3K04A 3OGCC 2WSSG 2JJ2G 3OFNG 4YHHO 4UB8Z 1DK1A 4BR6A 3MHHC 3IAYA 1DGSA 3JAKA 3EFFK 3A0RA 2LFSA 3RYHB 1VQMV 1IVSA 5DM6V 1I7FA 4J9ZB 1R3IC 4MW3A 3R65A 2E76B 4RWUA 1K7DA 1JX9A 2YIBA 4UVCA 5KMGB 4W4KA 1AR5A 3G6EV 4QPKA 3OM3B 4UCSA 2F93B 4X1IB 5EIBC 1EN5A 3CYOA 1X4TA 4CC6A 4JI1O 2WLJA 3UT5B 1HNZB 1H2NA 2LW1A 2W6IG 5D5PA 2WLKA 3C3TA 4GX1A 1N4CA 2F1MA 2IU0A 1EM1A 1HP8A 5EBWC 3H1HH 5JJNB 2JGUA 3UCSC 2ZE7A 4RUFA 4X65B 4JYAO 5KUKA 4UCTA 4DV6O 3ETDA 4X64B 5LMUB 2Q0OC 2F95B 3CXCU 4DV7B 4MTGA 3OW2U 4JI8O 2CUGA 2BTOA 1FYJA 1OHHG 3ZRXA 2GSMB 3RYCB 4LWSA 4PA4A 2F4VB 3T1YO 4XDKA 5EZYB 4MVQA 4DV4O 3E35A 2GDSA 4LNUB 4I55B 1EZJA 4DR7O 2EBOA 4PJ0Z 1WB7A 4PDVA 4MSWC 4I50B 2W6JG 2AHYA 1NTMH 5J2TB 3K5NA 2X6BA 1GN2A 3SPHA 5LMNO 5IJ9B 3K03A 3SYQA 4X9QA 4D7TA 2CDYA 1GKFA 1L0NH 2WA4A 2FB5A 2E75B 3LNNA 2P7TC 1AR4A 4PA6A 1YTFB 1N36B 2CTPA 4FM0A 4FVMA 1NKDA 3H1IH 1AILA 2YSUB 1TUEB 1V55C 1CP9A 1X59A 5FL7G 4DR3O 1D5AA 3THOA 3ABMC 4JI7O 5BZBA 2QWNB 3W7XA 1H8EG 2AHZA 3E22A 3M99B 4JV5B 2IBZH 2XAJA 3UO3A 1OCZC 3OT7A 3C90A 4J7KA 4LFAB 2R72A 1V54C 2VQEB 5GTHZ 3ABLC 4I7ZB 1XHZA 4IYHA 2LGQA 1KP2A 2LGWA 1Y74A 3CMAV 4PDLA 1NBMG 2DWDC 1HWYA 4JTDB 1GO3F 4DR6O 3G80A 5H6RA 4X66O 2JGDB 1OCOB 1GAXA 2CE4A 3JARB 3ASNC 2ODMA 3ZHQA 3STLC 5JH7A 3L73H 3JSNA 4TOIA 3I56V 4FK5C 2ZNIA 1E1RG 1IBMO 2EILC 3D3QA 1BMFG 1VQOV 3CMEV 4ZI7A 2HLDG 3K79A 1MOFA 2E5LO 4AQYO 4CS4A 2XNDG 1KKCA 1T5EA 3ZN0A 1A32A 4UUJC 4LFCO 3FB7C 4NXMB 5BXZA 3OTOO 3C3SA 4OX9B 2QDOA 2EULA 4JI0B 4J41A 4IL6Z 1GM9A 1NH2D 3L71H 2IH3C 3SPIA 4F6RA 1XOUA 1GN4A 3HB3B 1M57C 2CTQA 1FAFA 3T1YB 4Z2WA 2B9ZA 3TXQA 3STZC 1K9MW 2DQ0A 3DC5A 5GTIZ 2FYUH 4DR7B 2ITCC 1P84F 2BE3A 1GRJA 1JA8A 4B3RB 3OEEG 4JAUA 3M7MX 1Q7YW 3AG4C 4LR3A 3N2KB 3IFXA 2H94A 1IDSA 3T1HO 4TV8B 3A2FA 4U3FH 3CRQA 1U96A 1Y66A 2Y48A 2QWRB 2RNBA 1THZA 3AG7A 1Y76A 1AI4A 5B1NA 2HKOA 2WA3A 2R9IA 3JAWA 2B1GA 4PELA 5KAFZ 4LF4B 2G38A 2JRIA 1IBLB 2V4DA 1NVPD 1JR9A 3F5WC 4F4LA 3CE2A 2NR5A 1Q6IA 3SJQC 1NTKH 1WA8A 4DR5O 1F4NA 3SPGA 4JYCA 3HKDB 3CC2V 4JZGA 4ABMA 1SERA 4LCUC 1V9PA 1ZWIC 1M56C 4MTOA 3K3WA 3ABKB 2YXYA 3PJSK 3P3PA 2HJFC 2YDEA 3CS5A 5CA3A 2IU3A 3ZMTA 1HR0O 4EEQA 2QTOA 2A79B 4MVRA 1HNWB 2BSKA 3N2GA 4R50A 5GONB 1H2KA 2LO1A 2PGGA 3CX5F 4WFHA 4R8CA 2E5LB 3WB0A 1XMOO 1Z5VA 1Z5WA 4JGSA 1V55B 1RM1C 4HNAB 1ZL8B 2KKWA 1ZTEA 5EC2C 3VQYA 2HHHB 3ABMB 3OTOB 4I4TA 4LH6A 4PA9A 4YY3B 1OCZB 4MVSA 4AI8A 2UXCO 4JTCB 1V54B 3MAQA 4FLYA 3ABLB 2GHYA 3QO5A 4OGQB 2X0LA 4BW9A 4B3MO 2H3OA 3FAVA 4OPAA 5ITZB 5B1OA 1R1BA 1Q6UA 4FIPC 2AGAA 3BFRA 3ASNB 2OTLV 4ZHQB 4DUZO 4UXNA 1N32B 2UUBB 4EKWA 3JCUZ 5FPRA 3D36C 1GM7A 1URFA 1GTOA 4MVUA 1JOYA 1SZTA 2P4KA 2R9AA 3VQXA 5CA0B 2HG5C 1P7GA 2PYJA 2X7RB 5KX5A 3FFQA 3H1JH 5IJ0B 4CC5A 5IYBO 4X1YA 1WP7A 2YIAA 3ML0A 2VWKA 2AW9A 3LSQA 2OT5A 4P9OA 2YI9A 1GN6A 1F7YA 1YJWV 4A5UB 4CS3A 3JALA 5E1AC 4J11A 3B8MA 1BQZA 2LP7A 3HKCB 1IBKB 2Q68A 2WLLA 1BHAA 4PA7A 1M57B 1QLEB 5LBQA 1YHQV 3CC4V 4J10A 4ZKIA 2PY5A 4YIOA 3SPJA 2IH1C 4JF3A 4K8XA 3I5DA 4JPRA 4O4IA 5B5EZ 3KCYA 4E2LA 1R73A 3AG4B 1I94B 1HR0B 2Q73A 2OCCB 4H37A 2CAZC 5FNVB 1S0VA 2Z5UA 4LF7B 3OMNB 2EJRA 1H2LA 4I5SA 5EBMC 5LA6B 2YICA 1H2MA 5KHIA 2QWQB 4IHJA 5F2VO 4J9YB 1I5XA 2NN4A 3EVKA 1SC5B 2JVDA 3H1KH 2XAHA 1JFFB 4B7KA 1R3JC 4TUYA 3BAAA 3MDSA 2KG7A 2EX3A 1EZVH 1QR8A 3QG5A 3BA9A 1PL0A 5LYJB 1KC8W 4NXNB 4O2BB 5DEDA 1Q90D 3E89A 4QE9A 3FB8C 2RMKB 4HBNA 4GX0A 1TUBA 4TSFG 4N23A 1B3QA 1L1FA 4P2ZA 4X64O 4B3SB 1XL6A 5LMUO 3K9SA 5LHGA 2YIDA 1AI5A 1CXZB 4I0XA 4DV7O 2DN9A 3IJ4A 4O4JA 4NKGB 1DF4A 2RN9A 3AK3A 2PI4A 1G8MA 2F4VO 2GBOA 5D5QA 4DUZB 1SA0B 1N34B 2XOKG 4U3JB 3B40A 2XTAA 3K06A 3P3NA 2N74A 4FLUA 3ICXA 3WU2Z 4QJFB 1W0JG 3W7UA 3RYFA 3ZEDA 4B08A 1ZUQA 1N8RW 2VS0A 1FXKA 4YJ3B 1PNKA 1K4DC 3JD4A 5JJJB 3JD1A 1BZKA 1S5JA 2XT9A 5TISZ 1KBHA 1S3JA 1N36O 1LUWA 2CGOA 4H0LB 2ZD9A 3WG7C 3HKEA 3RW0A 3BCCH 2IJJA 4RAIA 3CCVV 2CTRA 1YVWA 4O4LB 4YXWG 5J2UB 4X20A 2DMXA 3ASOB 5HFMA 4JV5O 5EYPB 2BCCH 3W7WA 3APQA 4I9QA 1IZ3A 5K1PA 3NXSA 2N05A 1COWG 4LFAO 2ILMA 1YCIA 2VQEO 3K59A 5KHGA 3QO8A 1KYOF 1XQ8A 2Y0PA 3JATB 2LW7A 4YJ2B 2ZXWB 4WFGA 1MZEA 2ZM6B 2AXTZ 5J9PC 3ZHRA 2DOSA 1M90W 1VQ6V 3OUSA 1US6A 5LOVA 5CB4B 5JWPA 4DW0A 3TJTA 3KKYA 1I08A 2A7WA 3E86A 2ZT9B 1I0HA 1SQFA 1FPOA 4WBNB 3E8BA 3G71V 5LGTA 4D6TH 4NXMO 4C7UA 4IYIA 1QBZA 1XHXA 5C8YA 2QR4A 2V1DA 4ICGA 4OX9O 4JI0O 1KD1W 1IX9A 1EN6A 1NR7A 2ZIOA 2YEVA 3T4DA 4L87A 4QNHB 2BTQA 3E8FA 3JAKB 2F66C 3JSLA 3AEIA 3G67A 4FMTA 4PDMA 3ABKC 4P9PA 4MS2A 2PI5A 4CH5A 3ABUA 2B1IA 4B3RO 3OTFA 1MA1A 3J80N 2QA4V 4WFBV 2ZCEA 3ZMUA 2WLIA 5BR8B 1EFRG 5KUMA 2GTSA 3ZRSA 3CCLV 2R70A 3CCRV 3CWBH 4B7EA 4LF4O 2XAFA 2QGNA 1IBLO 4KFMA 2MW2B 4ASUG 1EBOA 4PHZA 1Q82W 1G4YB 3FB6C 1VQ8V 4X89A 1Q86W 3ZRWA 5LL6Y 4DR1O 1W0KG 3UQ8A 2JDIG 1VQ9V 3CRMA 1Y4MA 3Q4HA 3J7AU 1KECA 1K73W 4CH3A 3HR0A 1K3EA 3FKSG 4FZ1A 3JASA 1XMQB 1TA8A 4JYBA 5LHIA 5JVDA 4AHCA 1FFXA 4K35A 2KB1A 3SGIA 2Q7GA 4MVZA 5CA1A 3OE7G 1HNWO 2ZE8A 4CZZA 2UUAB 3GWOA 1PPJH 4UCVA 4DV0B 2GUZA 3N2KA 2P4VA 3ETQA 1B04A 5HFLA 4PI0A 3AK1A 4NVPA 5L3FA 4PDRA 3WG7B 4JYYA 1W2BU 3T4ZA 3IC9A 3L9DA 2HHHO 3CCEV 1VQ4V 4GLXA 5LP6A 3DSQA 1VQKV 5B66Z 4X62B 4YY3O 3E22B 1R3KC 2Q69A 1F4MA 3SR2C 5IYZA 2ZE5A 1OCRB 1SKVA 3CCMV 3BABA 1AJQA 1QLEC 3CXHF 3RWRD 1R3LC 4BWAA 1NU1H 1VF5B 4WFAV 1Y74B 3K57A 4PD4F 1K8AW 2OCCC 1RPOA 2WLNA 1ZSPA 2JS5A 4DUYB 1N32O 3CJHA 2UUBO 3E83A 1OV9A 3MD0A 5JH7B 2Q7HA 4KHPB 3ZMVA 1YDXA 1HW7A 5A9GA 4O4HA 4UB6Z 4JTAB 1Q6HA 5L3EA 2HVKC 3BPZA 2JK5C 4ZI7B 2ZDIC 1PNLA 3CC7V 1H2SB 1W59A 2QM8A 5KA6A 2ADPA 4GX5A 4GKKB 4QGPA 2UUCB 3TK1A 2VWJA 2ZNJA 4RO2A 4DR1B 3K5LA 1VQNV 1QCEA 1FXHA 2BOBC 4PV1B 1IBKO 3SJBC 3B09A 4BIUA 3EXAA 4QIWF 3N27A 4F6RB 3QF7A 1M93A 5JCOC 2DW4A 5LXTA 3B4SA 4Q6GA 2IJIA 1Z2GA 4DXWA 5KHHA 4LF6B 3SJAC 3HKBA 4FJCC 4QE7A 3ZMZA 4CS2A 1R6TA 4Q20A 1I94O 4GT1A 1AR1B 5B1BC 1TGOA 3CHXA 3I55V 5CBFA 2A3QA 2LFRA 4LF7O 3U11A 1Q8IA 1S5HC 1K97A 1WPBA 2P90A 4IGGA 3K58A 1VQ7V 1TVKA 1Y76B 5IT9N 4DRXA 3OAAG 1L0LH 3JAWB 4FZ0A 1XL4A 2CH7A 3DC6A 4FFBA 2WLHA 3FYIB 4BIOA 1RSOA 3WB1A 4KP4A 1K4CC 1R6KA 2YUAA 5L3GA 3CCJV 1Q43A 2HEPA 2OCHA 5DN6G 4NXNO 2JS3A 4B3TB 3ETEA 2VQFB 2QJ1A 1VF7A 2QKAA 5JQGA 4B3SO 3OMAB 1SF9A 2GV9A 3ASOC 1CPYA 2HJDA 2YI8A 1RPRA 2ZQMA 1WB8A 4H33A 5B1AB 2ZE6A 2MK3A 4DV3B 3P32A 1MZFA 1XBLA 2Q8VA 1N34O 4WCEV 1WLEA 2X6CA 3D8CA 2BSKB 4ZOLA 3KZIZ 3SJCC 1YSCA 3N2GB 3OR6C 2ZXWC 3CP1A 1OCCC 3W7TA 1XNRB 2YIBD 1JPXA 1AP6A 3HPLC 4BIZA 4JI6B 3CCQV 1JJOA 2H8PC 3QO7A 1FXKC 1JCHA 4FPPA 3UM7A 4I9WA 3RYIA 3NR7A 3SYCA 2Q67A 4FLWA 5BMVA 4LF5O 4I4TB 1R6NA 4IT5A 4O2AA 4TWKA 1WJZA 5IWAO 4DO2A 1SQQH 4LC1A 4W4LA 4JI2B 1S72V 3E2EA 4EB6A 1NI8A 2M7WA 4Z1VA 2UXDB 2EINB 3FAVB 1D2DA 1VEWA 1PKXA 2Y0IA 5EK0A 4WFEA 4IIJA 2RQ6A 1KB9F 5H6QA 2QWPB 3OD4A 1Q3EA 3JCZA 1NTZH 3ABTA 4DR2B 4DR4O 1FD9A 2NLJC 1BS3A 4X1KA 4L8JA 2PZSA 1QU7A 4OXSA 2ZM6O 3R66A 2RCVA 5KHKA 4TV9A 1S5LZ 1FJGB 1M1KW 1O9GA 5KX5B 5CN0A 3LDEA 4R7CA 3J81N 4X1YB 1GMGA 2PUSA 1SRYA 3RBZA 1YF2A 4BW5A 3DXRA 4JI5O 4DV2B 5DECA 3T1CA 3JALB 5KHJA 1N0NA 4DYLA 1SETA 2P67A 2WLLB 1TAEA 1QLNA 3GVMA 2UXBB 2R9RB 1AJNA 1K5QA 3ETGA 2DYSC 2N04A 3CCUV 3BVOA 1QHTA 2HR3A 2V7QG 4O4IB 2P06A 5B1BB 3AG1C 2YC0A 3O9OA 1AROP 2L6LA 2ETNA 1QNMA 2EIKC 3MHSC 4KXRA 4MVMA 4K0KB 2XHBA 1XNQB 4GKJO 4RQFA 2IW5A 4GZRB 3RYHA 5A2QN 4DV5B 1JJ2U 1K33A 4IHJB 5BR8O 2CK3G 2AZ0A 2JEUA 3CB2A 4JI4B 2F43G 4KL1A 4NR1A 1Q81W 5KMGA 2OIEA 4ZIBA 4X1IA 2ARHA 4LF5B 3JYCA 2QTSA 4LFBB 2XUMA 5IWAB 4MTFA 3ZHSA 1JVMA 5B3SC 3UT5A 1F51A 4J7JA 1MMMA 2P22C 3CPWU 1TUBB 1XILA 4I0XB 1OCRC 1AI6A 4FM1A 1XMQO 3OMIB 4PA3A 3L75H 1K92A 2EIMB 4DR4B 1FXVA 2JIZG 5BY1A 3JD3A 3BA8A 1OCCB 3RYCA 3UKMA 5LHHA 3A0HZ 3SDLA 3S3WA 2PYLA 2JJ1G 1HDJA 5EZYA 2A9HA 4YIPA 4LNUA 4I55A 3RYFB 2QKCA 4HAMA 1FXKB 2UUAO 3H9VA 1E79G 3LUTB 1AP5A 2CGNA 4DV0O 3L72H 3QTCA 4I50A 4Z1MG 2QWOB 2D2CB 5J2TA 3ZHTA 1YITV 1PNMA 4JI5B 1SQXH 2FMLA 2FKXA 2PTMA 1BHBA 1IXMA 2DJVA 1VF6A 4TT3G 1OJHA 5IJ9A 2D3OW 3CSXA 4D7SA 4FM2A 4GYCB 3HKEB 1F23A 1P49A 4H13B 4RQEA 3OGIB 1YXBA 2UU9B 2QM4A 4X20B 4X62O 2Z3YA 3IC7A 5LP6C 1PV0A 5LGNA 2IM9A 1J5EB 3QNEA 1M5IA 2Q9LA 5H5NA 1KQSU 3AG2B 4DV1B 1G1XB 1KUQA 4CH6A 1NZ6A 5K1XA 1BCCH 2DE0X 3RGBA 5H2FZ 4FLXA 4X88A 3SYOA 2WWWA 2DWEC 2HVJC 3K08A 2HFEC 4GKJB 2L35A 1YI2V 2W0XA 2XAGA 1S76D 4DUYO 5LOVB 4J42A 1SESA 1VP7A 2RJZA 4PI2A 4KHPO 5LGUA 1BGYH 3LDCA 2OIGA 2KQXA 3E8HA 2JGDA 2XAQA 3JARA 2VRZA 3CD6V 1RFYA 2O57A 3K5MA 3AG3C 1PM9A 3SYPA 4GKKO 2UUCO 4CH4A 2DYSB 1PP9H 1ZAUA 5C8YB 2A06H 3AG1B 3F7YC 2QM7A 2YS8A 3K9AA 1SQPH 5IY5C 2YEVB 4KUMA 5H9CA 3WB2A 2YXHA 1H8HG 2BTQB 1MSDA 2EIKB 4LWSB 2Y69C 4LF6O 2OTJV 3RN4A 3UO2A 4YHHB 5B1AC 5IYDO 5AG2A 4CBCA 4G2KA 4TQDA 1J95A 2WLIB 3K0GA 3PN1A 1BQ0A 4J7ZA 3FD9A 2OWOA 4EFEA 2WAMA 2C2AA 4N21A 4G27B 4TV8A 2Q7EA 3WFVA 1DF5A 1P4RA 5B3SB 4UV9A 1WAZA 4JI1B 1H38A 5IDJA 2QSAA 1M9NA 4NYKA 2DYRC 3ZRWB 1DLBA 1SS3A 2Q0AA 2NNUA 4LF9O 3DGEA 1NJIW 4B3TO 2VQFO 1JMKC 2Z0AA 3Q4HB 3JD0A 2OYQA 4JYAB 3TCUA 4U7OA 1YZBA 3JASB 4NTYA 3RT3C 4DV6B 2KSDA 3FYEB 2IJKA 2EINC 1AB3A 1K5SA 3F5TA 3HKDA 5JVDB 3RVZA 1FFXB 4JI8B 4UCRA 4DV3O 2P5OA 4UCOA 4JAVA 3QVNA 4U7NA 1WP8A 1WPXA 5CA1B 4DV4B 1M4UA 2LJ2A 3LSUA 4FFKA 5C93A 1VARA 2LQTA 3ZHUA 5CMUA 1XNRO 2EZOA 2GUZB 2B5UA 3GWKC 3T2MA 3RVYA 5L3DA 1B6QA 1KU9A 3ZS8C 1GK9A 4JI6O 5LMNB 3BRCA 5GONA 3TETA 2P6JA 3H01A 3CRCA 2QE7G 5LP6B 3H1LH 3BEHA 1RP3B 5IYZB 4HNAA 4F6EA 4JI2O 1ZL8A 2UXNA 1VQLV 3FX7A 1KP3A 5GW7A 3JAMN 4UFZA 1KMIZ 4DR3B 1OZ0A 1BE3H 4JI7B 2HP8A 2UXDO 1GN3A 1AVMA 1YIJV 3A0BZ 4LF8O 5L3CA 3X2QC 1AJPA 2FTKA 1G6UA 1H2GA 3F7VC 1XUQA 1EN4A 3ZN1A 1LR1A 2EIJC 4P30A 4DR2O 5ITZA 1LNQA 3CJHB 2CTWA 5EC1C 4ZBMA 4MT8A 1IURA 5CBHA 2A0LA 1QQCA 3M8AA 4DR6B 5EBLC 3ZX6A 1FJGO 3W7SA 4X66B 1L8DA 4O4HB 4ZHQA 1FKAO 1N0JA 1VMGA 3KCXA 3AG3B 4WF9V 3K0DA
chains in the Genus database with same CATH topology
5LMUO 1AB3A 3J81N 1XMQO 3F5TA 4DV7O 4JI8O 1IBMO 1FYJA 1HNXO 4DV3O 2E5LO 4OPHA 4JI5O 2F4VO 5BY1A 2UUCO 4AQYO 4GKKO 4DV2O 3T1YO 1N34O 4DV4O 1HR0O 1F7YA 5FLXN 1A32A 3SDLA 4LFCO 4DR7O 4A5UB 4NXMO 2UXBO 5BXZA 3OTOO 1IBKO 1HNWO 2ZKOA 1XNRO 2N74A 4OX9O 4JI0O 2UUAO 4DV0O 4JI6O 5LMNO 1N33O 4LF6O 2FKXA 4YHHO 1XMOO 1DK1A 2DJVA 1R6TA 1NS1A 1I94O 4LF5O 1HNZO 2HHHO 5IWAO 1N36O 4B3RO 4K0KO 1XNQO 2UU9O 4GKJO 4JI2O 4LF7O 1AILA 3J80N 4X62O 4YY3O 5A2QN 3JAMN 1X59A 4DV5O 1J5EO 3T1HO 4DR3O 5BR8O 2UXCO 4JI7O 5H5NA 4DV1O 2UXDO 1G1XB 5IT9N 1KUQA 4JV5O 4JI4O 4X65O 4LF8O 1D2DA 4LFAO 4JI1O 4B3MO 4OPAA 2VQEO 4LFBO 4LF4O 2JRIA 1IBLO 1R1BA 4JI3O 4DR2O 4DR4O 2AGAA 3O65A 4LF9O 2LW7A 4DUYO 4DUZO 4NXNO 2ZM6O 4B3TO 3M8AA 2VQFO 3R66A 4DR6O 1N32O 5LL6Y 2Z0AA 2UUBO 1FJGO 4DR5O 4JYAO 4X66O 2DOSA 4DR1O 1FKAO 4KHPO 1YZBA 1XEQA 4DV6O 3RT3C 4X64O 4B3SO 3J7AU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU O;  1AB3 A;  3J81 N;  1XMQ O;  3F5T A;  4DV7 O;  4JI8 O;  1IBM O;  1FYJ A;  1HNX O;  4DV3 O;  2E5L O;  4OPH A;  4JI5 O;  2F4V O;  5BY1 A;  2UUC O;  4AQY O;  4GKK O;  4DV2 O;  3T1Y O;  1N34 O;  4DV4 O;  1HR0 O;  1F7Y A;  5FLX N;  1A32 A;  3SDL A;  4LFC O;  4DR7 O;  4A5U B;  4NXM O;  2UXB O;  5BXZ A;  3OTO O;  1IBK O;  1HNW O;  2ZKO A;  1XNR O;  2N74 A;  4OX9 O;  4JI0 O;  2UUA O;  4DV0 O;  4JI6 O;  5LMN O;  1N33 O;  4LF6 O;  2FKX A;  4YHH O;  1XMO O;  1DK1 A;  2DJV A;  1R6T A;  1NS1 A;  1I94 O;  4LF5 O;  1HNZ O;  2HHH O;  5IWA O;  1N36 O;  4B3R O;  4K0K O;  1XNQ O;  2UU9 O;  4GKJ O;  4JI2 O;  4LF7 O;  1AIL A;  3J80 N;  4X62 O;  4YY3 O;  5A2Q N;  3JAM N;  1X59 A;  4DV5 O;  1J5E O;  3T1H O;  4DR3 O;  5BR8 O;  2UXC O;  4JI7 O;  5H5N A;  4DV1 O;  2UXD O;  1G1X B;  5IT9 N;  1KUQ A;  4JV5 O;  4JI4 O;  4X65 O;  4LF8 O;  1D2D A;  4LFA O;  4JI1 O;  4B3M O;  4OPA A;  2VQE O;  4LFB O;  4LF4 O;  2JRI A;  1IBL O;  1R1B A;  4JI3 O;  4DR2 O;  4DR4 O;  2AGA A;  3O65 A;  4LF9 O;  2LW7 A;  4DUY O;  4DUZ O;  4NXN O;  2ZM6 O;  4B3T O;  3M8A A;  2VQF O;  3R66 A;  4DR6 O;  1N32 O;  5LL6 Y;  2Z0A A;  2UUB O;  1FJG O;  4DR5 O;  4JYA O;  4X66 O;  2DOS A;  4DR1 O;  1FKA O;  4KHP O;  1YZB A;  1XEQ A;  4DV6 O;  3RT3 C;  4X64 O;  4B3S O;  3J7A U; 
#chains in the Genus database with same CATH topology
 4NTW A;  4FLV A;  1FS0 G;  3KG2 A;  4BAY A;  1UPG A;  3APO A;  1IBM B;  1WA8 B;  1Y6X A;  1HNX O;  5CA0 A;  4HZ3 A;  1LUV A;  3BHP A;  4NB5 A;  4LF9 B;  3FB5 C;  2ZIM A;  5IY5 B;  5E79 Z;  4DV2 O;  4AQY B;  5IJ0 A;  4DK0 A;  1GH6 A;  4LFC B;  2UXB O;  2ZR3 A;  1U97 A;  2M6Y A;  2QEX V;  5LXT B;  1VQP V;  5IE9 A;  1FFT B;  3OR7 C;  2Y69 B;  2DQ3 A;  2F23 A;  2E74 B;  3L70 H;  1CEZ A;  5KA5 A;  3HKB B;  5CBG A;  3HKC A;  2XAS A;  3ZHV A;  3ZIA G;  3G6B A;  1MSW D;  1XRE A;  1N33 O;  2QKS A;  3K5O A;  4XBF A;  1SQB H;  1SQV H;  1AI7 A;  2ATK C;  3BY6 A;  5IYC O;  2EIM C;  1SZX A;  1QR9 A;  4H44 B;  4FLT A;  3LDD A;  4K0K O;  1XNQ O;  1Y67 A;  1TVK B;  5FNV A;  4DRX B;  1O9H A;  4DV5 O;  1BL8 A;  3T1H B;  2CH7 B;  4FFB B;  3P30 A;  4JI4 O;  1RSO B;  1NR1 A;  3E8G A;  1MG1 A;  3OEH G;  2EJ7 A;  4LH7 A;  2DYR B;  3CEI A;  2EIL B;  1BSM A;  5LA6 A;  3SYA A;  2GTA A;  4JZ2 A;  2ZDI A;  4WFF A;  4LFB O;  3TGU H;  2Q5Z A;  4JAA A;  3DTU B;  4JI3 O;  3LSS A;  3ZMS A;  4UV8 A;  4GUN A;  4UVA A;  3O65 A;  1JFF A;  3CCS V;  1PL4 A;  4R6Z A;  3S3X A;  3B2E E;  4J80 A;  5JQG B;  1IXB A;  2ADQ B;  1I5Y A;  4DR5 B;  4LF8 B;  3JD2 A;  5LYJ A;  4O2B A;  1ORQ C;  2ZR2 A;  3VQV A;  1YTF D;  1S77 D;  4XDL A;  5JCO A;  2WLM A;  3AG2 C;  1GM8 A;  5JJE B;  3IGA C;  4K3A A;  3L74 H;  5L3B A;  1YJN V;  3VOU A;  4UCU A;  4DK1 A;  4XDJ A;  4UVB A;  1ZX3 A;  2RDC A;  4OPH A;  3AK2 A;  2JEX A;  1PD3 A;  4ZOL B;  3OUF A;  4RUE A;  1MAB G;  2K9P A;  5KLV H;  3TXS A;  4EFB A;  2X6A A;  1SA0 A;  5KAI Z;  2EZP A;  4U3J A;  1XI1 A;  2E3C A;  1VIB A;  3EHB B;  2ITD C;  4MTX A;  2Q4P A;  1VQ5 V;  3VQW A;  1YEW A;  4HYO A;  1QVF U;  2YXL A;  3RYI B;  2K1E A;  1HNX B;  2Y4U A;  5BMV B;  1UFI A;  2FL4 A;  3U10 A;  1YJ9 V;  4O2A B;  3B77 A;  1XMO B;  4K8Z A;  1NS1 A;  2BOC C;  4YJ3 A;  4FLZ A;  1NQT A;  1VF6 C;  1HNZ O;  1WN7 A;  4EB6 B;  2UU9 O;  2PF4 E;  2W0F C;  3X2Q B;  1QVG U;  1NH2 B;  1JQ0 A;  1J5E O;  2UXX A;  2UXC B;  4DV1 O;  3ZJZ A;  1N33 B;  2AZ2 A;  4X65 O;  2EIJ B;  4O4L A;  1M56 B;  5J2U A;  4IIJ B;  1WNS A;  1DTO A;  5EYP A;  1D5N A;  4B3M B;  4NTX A;  1B06 A;  1E1Q G;  4X1K B;  1P7B A;  1MNG A;  3A8T A;  2WPD G;  4MVO A;  1SQG A;  4TV9 B;  3CRA A;  2ZIN A;  1XDC A;  4LP8 A;  3ZRV A;  3CRR A;  3JAT A;  3D36 A;  3SPC A;  4YJ2 A;  1K34 A;  1XEQ A;  3U0Z A;  3G4S V;  4TUY B;  1BT8 A;  2KG7 B;  3ZBH A;  3DXR B;  4AIL C;  5EIB D;  1OCO C;  1NVP B;  4JI3 B;  4G28 B;  1RM1 B;  5CB4 A;  2Q6A A;  5FPO A;  1ZLZ A;  3D3I A;  1NT2 B;  2Y4T A;  4LBE C;  4E4E A;  1KKD A;  1Q5O A;  5FLX N;  4QPJ A;  4WBN A;  4GX2 A;  4GCZ A;  3B8N A;  4O4J B;  3LNM B;  1ENV A;  2ZKO A;  1ROP A;  4TQF A;  3GB7 C;  4MW8 A;  1UJW B;  3ZCC A;  3VBB A;  3RFR A;  4X8A A;  2IJH A;  4JAS A;  4DW1 A;  3K04 A;  3OGC C;  2WSS G;  2JJ2 G;  3OFN G;  4YHH O;  4UB8 Z;  1DK1 A;  4BR6 A;  3MHH C;  3IAY A;  1DGS A;  3JAK A;  3EFF K;  3A0R A;  2LFS A;  3RYH B;  1VQM V;  1IVS A;  5DM6 V;  1I7F A;  4J9Z B;  1R3I C;  4MW3 A;  3R65 A;  2E76 B;  4RWU A;  1K7D A;  1JX9 A;  2YIB A;  4UVC A;  5KMG B;  4W4K A;  1AR5 A;  3G6E V;  4QPK A;  3OM3 B;  4UCS A;  2F93 B;  4X1I B;  5EIB C;  1EN5 A;  3CYO A;  1X4T A;  4CC6 A;  4JI1 O;  2WLJ A;  3UT5 B;  1HNZ B;  1H2N A;  2LW1 A;  2W6I G;  5D5P A;  2WLK A;  3C3T A;  4GX1 A;  1N4C A;  2F1M A;  2IU0 A;  1EM1 A;  1HP8 A;  5EBW C;  3H1H H;  5JJN B;  2JGU A;  3UCS C;  2ZE7 A;  4RUF A;  4X65 B;  4JYA O;  5KUK A;  4UCT A;  4DV6 O;  3ETD A;  4X64 B;  5LMU B;  2Q0O C;  2F95 B;  3CXC U;  4DV7 B;  4MTG A;  3OW2 U;  4JI8 O;  2CUG A;  2BTO A;  1FYJ A;  1OHH G;  3ZRX A;  2GSM B;  3RYC B;  4LWS A;  4PA4 A;  2F4V B;  3T1Y O;  4XDK A;  5EZY B;  4MVQ A;  4DV4 O;  3E35 A;  2GDS A;  4LNU B;  4I55 B;  1EZJ A;  4DR7 O;  2EBO A;  4PJ0 Z;  1WB7 A;  4PDV A;  4MSW C;  4I50 B;  2W6J G;  2AHY A;  1NTM H;  5J2T B;  3K5N A;  2X6B A;  1GN2 A;  3SPH A;  5LMN O;  5IJ9 B;  3K03 A;  3SYQ A;  4X9Q A;  4D7T A;  2CDY A;  1GKF A;  1L0N H;  2WA4 A;  2FB5 A;  2E75 B;  3LNN A;  2P7T C;  1AR4 A;  4PA6 A;  1YTF B;  1N36 B;  2CTP A;  4FM0 A;  4FVM A;  1NKD A;  3H1I H;  1AIL A;  2YSU B;  1TUE B;  1V55 C;  1CP9 A;  1X59 A;  5FL7 G;  4DR3 O;  1D5A A;  3THO A;  3ABM C;  4JI7 O;  5BZB A;  2QWN B;  3W7X A;  1H8E G;  2AHZ A;  3E22 A;  3M99 B;  4JV5 B;  2IBZ H;  2XAJ A;  3UO3 A;  1OCZ C;  3OT7 A;  3C90 A;  4J7K A;  4LFA B;  2R72 A;  1V54 C;  2VQE B;  5GTH Z;  3ABL C;  4I7Z B;  1XHZ A;  4IYH A;  2LGQ A;  1KP2 A;  2LGW A;  1Y74 A;  3CMA V;  4PDL A;  1NBM G;  2DWD C;  1HWY A;  4JTD B;  1GO3 F;  4DR6 O;  3G80 A;  5H6R A;  4X66 O;  2JGD B;  1OCO B;  1GAX A;  2CE4 A;  3JAR B;  3ASN C;  2ODM A;  3ZHQ A;  3STL C;  5JH7 A;  3L73 H;  3JSN A;  4TOI A;  3I56 V;  4FK5 C;  2ZNI A;  1E1R G;  1IBM O;  2EIL C;  3D3Q A;  1BMF G;  1VQO V;  3CME V;  4ZI7 A;  2HLD G;  3K79 A;  1MOF A;  2E5L O;  4AQY O;  4CS4 A;  2XND G;  1KKC A;  1T5E A;  3ZN0 A;  1A32 A;  4UUJ C;  4LFC O;  3FB7 C;  4NXM B;  5BXZ A;  3OTO O;  3C3S A;  4OX9 B;  2QDO A;  2EUL A;  4JI0 B;  4J41 A;  4IL6 Z;  1GM9 A;  1NH2 D;  3L71 H;  2IH3 C;  3SPI A;  4F6R A;  1XOU A;  1GN4 A;  3HB3 B;  1M57 C;  2CTQ A;  1FAF A;  3T1Y B;  4Z2W A;  2B9Z A;  3TXQ A;  3STZ C;  1K9M W;  2DQ0 A;  3DC5 A;  5GTI Z;  2FYU H;  4DR7 B;  2ITC C;  1P84 F;  2BE3 A;  1GRJ A;  1JA8 A;  4B3R B;  3OEE G;  4JAU A;  3M7M X;  1Q7Y W;  3AG4 C;  4LR3 A;  3N2K B;  3IFX A;  2H94 A;  1IDS A;  3T1H O;  4TV8 B;  3A2F A;  4U3F H;  3CRQ A;  1U96 A;  1Y66 A;  2Y48 A;  2QWR B;  2RNB A;  1THZ A;  3AG7 A;  1Y76 A;  1AI4 A;  5B1N A;  2HKO A;  2WA3 A;  2R9I A;  3JAW A;  2B1G A;  4PEL A;  5KAF Z;  4LF4 B;  2G38 A;  2JRI A;  1IBL B;  2V4D A;  1NVP D;  1JR9 A;  3F5W C;  4F4L A;  3CE2 A;  2NR5 A;  1Q6I A;  3SJQ C;  1NTK H;  1WA8 A;  4DR5 O;  1F4N A;  3SPG A;  4JYC A;  3HKD B;  3CC2 V;  4JZG A;  4ABM A;  1SER A;  4LCU C;  1V9P A;  1ZWI C;  1M56 C;  4MTO A;  3K3W A;  3ABK B;  2YXY A;  3PJS K;  3P3P A;  2HJF C;  2YDE A;  3CS5 A;  5CA3 A;  2IU3 A;  3ZMT A;  1HR0 O;  4EEQ A;  2QTO A;  2A79 B;  4MVR A;  1HNW B;  2BSK A;  3N2G A;  4R50 A;  5GON B;  1H2K A;  2LO1 A;  2PGG A;  3CX5 F;  4WFH A;  4R8C A;  2E5L B;  3WB0 A;  1XMO O;  1Z5V A;  1Z5W A;  4JGS A;  1V55 B;  1RM1 C;  4HNA B;  1ZL8 B;  2KKW A;  1ZTE A;  5EC2 C;  3VQY A;  2HHH B;  3ABM B;  3OTO B;  4I4T A;  4LH6 A;  4PA9 A;  4YY3 B;  1OCZ B;  4MVS A;  4AI8 A;  2UXC O;  4JTC B;  1V54 B;  3MAQ A;  4FLY A;  3ABL B;  2GHY A;  3QO5 A;  4OGQ B;  2X0L A;  4BW9 A;  4B3M O;  2H3O A;  3FAV A;  4OPA A;  5ITZ B;  5B1O A;  1R1B A;  1Q6U A;  4FIP C;  2AGA A;  3BFR A;  3ASN B;  2OTL V;  4ZHQ B;  4DUZ O;  4UXN A;  1N32 B;  2UUB B;  4EKW A;  3JCU Z;  5FPR A;  3D36 C;  1GM7 A;  1URF A;  1GTO A;  4MVU A;  1JOY A;  1SZT A;  2P4K A;  2R9A A;  3VQX A;  5CA0 B;  2HG5 C;  1P7G A;  2PYJ A;  2X7R B;  5KX5 A;  3FFQ A;  3H1J H;  5IJ0 B;  4CC5 A;  5IYB O;  4X1Y A;  1WP7 A;  2YIA A;  3ML0 A;  2VWK A;  2AW9 A;  3LSQ A;  2OT5 A;  4P9O A;  2YI9 A;  1GN6 A;  1F7Y A;  1YJW V;  4A5U B;  4CS3 A;  3JAL A;  5E1A C;  4J11 A;  3B8M A;  1BQZ A;  2LP7 A;  3HKC B;  1IBK B;  2Q68 A;  2WLL A;  1BHA A;  4PA7 A;  1M57 B;  1QLE B;  5LBQ A;  1YHQ V;  3CC4 V;  4J10 A;  4ZKI A;  2PY5 A;  4YIO A;  3SPJ A;  2IH1 C;  4JF3 A;  4K8X A;  3I5D A;  4JPR A;  4O4I A;  5B5E Z;  3KCY A;  4E2L A;  1R73 A;  3AG4 B;  1I94 B;  1HR0 B;  2Q73 A;  2OCC B;  4H37 A;  2CAZ C;  5FNV B;  1S0V A;  2Z5U A;  4LF7 B;  3OMN B;  2EJR A;  1H2L A;  4I5S A;  5EBM C;  5LA6 B;  2YIC A;  1H2M A;  5KHI A;  2QWQ B;  4IHJ A;  5F2V O;  4J9Y B;  1I5X A;  2NN4 A;  3EVK A;  1SC5 B;  2JVD A;  3H1K H;  2XAH A;  1JFF B;  4B7K A;  1R3J C;  4TUY A;  3BAA A;  3MDS A;  2KG7 A;  2EX3 A;  1EZV H;  1QR8 A;  3QG5 A;  3BA9 A;  1PL0 A;  5LYJ B;  1KC8 W;  4NXN B;  4O2B B;  5DED A;  1Q90 D;  3E89 A;  4QE9 A;  3FB8 C;  2RMK B;  4HBN A;  4GX0 A;  1TUB A;  4TSF G;  4N23 A;  1B3Q A;  1L1F A;  4P2Z A;  4X64 O;  4B3S B;  1XL6 A;  5LMU O;  3K9S A;  5LHG A;  2YID A;  1AI5 A;  1CXZ B;  4I0X A;  4DV7 O;  2DN9 A;  3IJ4 A;  4O4J A;  4NKG B;  1DF4 A;  2RN9 A;  3AK3 A;  2PI4 A;  1G8M A;  2F4V O;  2GBO A;  5D5Q A;  4DUZ B;  1SA0 B;  1N34 B;  2XOK G;  4U3J B;  3B40 A;  2XTA A;  3K06 A;  3P3N A;  2N74 A;  4FLU A;  3ICX A;  3WU2 Z;  4QJF B;  1W0J G;  3W7U A;  3RYF A;  3ZED A;  4B08 A;  1ZUQ A;  1N8R W;  2VS0 A;  1FXK A;  4YJ3 B;  1PNK A;  1K4D C;  3JD4 A;  5JJJ B;  3JD1 A;  1BZK A;  1S5J A;  2XT9 A;  5TIS Z;  1KBH A;  1S3J A;  1N36 O;  1LUW A;  2CGO A;  4H0L B;  2ZD9 A;  3WG7 C;  3HKE A;  3RW0 A;  3BCC H;  2IJJ A;  4RAI A;  3CCV V;  2CTR A;  1YVW A;  4O4L B;  4YXW G;  5J2U B;  4X20 A;  2DMX A;  3ASO B;  5HFM A;  4JV5 O;  5EYP B;  2BCC H;  3W7W A;  3APQ A;  4I9Q A;  1IZ3 A;  5K1P A;  3NXS A;  2N05 A;  1COW G;  4LFA O;  2ILM A;  1YCI A;  2VQE O;  3K59 A;  5KHG A;  3QO8 A;  1KYO F;  1XQ8 A;  2Y0P A;  3JAT B;  2LW7 A;  4YJ2 B;  2ZXW B;  4WFG A;  1MZE A;  2ZM6 B;  2AXT Z;  5J9P C;  3ZHR A;  2DOS A;  1M90 W;  1VQ6 V;  3OUS A;  1US6 A;  5LOV A;  5CB4 B;  5JWP A;  4DW0 A;  3TJT A;  3KKY A;  1I08 A;  2A7W A;  3E86 A;  2ZT9 B;  1I0H A;  1SQF A;  1FPO A;  4WBN B;  3E8B A;  3G71 V;  5LGT A;  4D6T H;  4NXM O;  4C7U A;  4IYI A;  1QBZ A;  1XHX A;  5C8Y A;  2QR4 A;  2V1D A;  4ICG A;  4OX9 O;  4JI0 O;  1KD1 W;  1IX9 A;  1EN6 A;  1NR7 A;  2ZIO A;  2YEV A;  3T4D A;  4L87 A;  4QNH B;  2BTQ A;  3E8F A;  3JAK B;  2F66 C;  3JSL A;  3AEI A;  3G67 A;  4FMT A;  4PDM A;  3ABK C;  4P9P A;  4MS2 A;  2PI5 A;  4CH5 A;  3ABU A;  2B1I A;  4B3R O;  3OTF A;  1MA1 A;  3J80 N;  2QA4 V;  4WFB V;  2ZCE A;  3ZMU A;  2WLI A;  5BR8 B;  1EFR G;  5KUM A;  2GTS A;  3ZRS A;  3CCL V;  2R70 A;  3CCR V;  3CWB H;  4B7E A;  4LF4 O;  2XAF A;  2QGN A;  1IBL O;  4KFM A;  2MW2 B;  4ASU G;  1EBO A;  4PHZ A;  1Q82 W;  1G4Y B;  3FB6 C;  1VQ8 V;  4X89 A;  1Q86 W;  3ZRW A;  5LL6 Y;  4DR1 O;  1W0K G;  3UQ8 A;  2JDI G;  1VQ9 V;  3CRM A;  1Y4M A;  3Q4H A;  3J7A U;  1KEC A;  1K73 W;  4CH3 A;  3HR0 A;  1K3E A;  3FKS G;  4FZ1 A;  3JAS A;  1XMQ B;  1TA8 A;  4JYB A;  5LHI A;  5JVD A;  4AHC A;  1FFX A;  4K35 A;  2KB1 A;  3SGI A;  2Q7G A;  4MVZ A;  5CA1 A;  3OE7 G;  1HNW O;  2ZE8 A;  4CZZ A;  2UUA B;  3GWO A;  1PPJ H;  4UCV A;  4DV0 B;  2GUZ A;  3N2K A;  2P4V A;  3ETQ A;  1B04 A;  5HFL A;  4PI0 A;  3AK1 A;  4NVP A;  5L3F A;  4PDR A;  3WG7 B;  4JYY A;  1W2B U;  3T4Z A;  3IC9 A;  3L9D A;  2HHH O;  3CCE V;  1VQ4 V;  4GLX A;  5LP6 A;  3DSQ A;  1VQK V;  5B66 Z;  4X62 B;  4YY3 O;  3E22 B;  1R3K C;  2Q69 A;  1F4M A;  3SR2 C;  5IYZ A;  2ZE5 A;  1OCR B;  1SKV A;  3CCM V;  3BAB A;  1AJQ A;  1QLE C;  3CXH F;  3RWR D;  1R3L C;  4BWA A;  1NU1 H;  1VF5 B;  4WFA V;  1Y74 B;  3K57 A;  4PD4 F;  1K8A W;  2OCC C;  1RPO A;  2WLN A;  1ZSP A;  2JS5 A;  4DUY B;  1N32 O;  3CJH A;  2UUB O;  3E83 A;  1OV9 A;  3MD0 A;  5JH7 B;  2Q7H A;  4KHP B;  3ZMV A;  1YDX A;  1HW7 A;  5A9G A;  4O4H A;  4UB6 Z;  4JTA B;  1Q6H A;  5L3E A;  2HVK C;  3BPZ A;  2JK5 C;  4ZI7 B;  2ZDI C;  1PNL A;  3CC7 V;  1H2S B;  1W59 A;  2QM8 A;  5KA6 A;  2ADP A;  4GX5 A;  4GKK B;  4QGP A;  2UUC B;  3TK1 A;  2VWJ A;  2ZNJ A;  4RO2 A;  4DR1 B;  3K5L A;  1VQN V;  1QCE A;  1FXH A;  2BOB C;  4PV1 B;  1IBK O;  3SJB C;  3B09 A;  4BIU A;  3EXA A;  4QIW F;  3N27 A;  4F6R B;  3QF7 A;  1M93 A;  5JCO C;  2DW4 A;  5LXT A;  3B4S A;  4Q6G A;  2IJI A;  1Z2G A;  4DXW A;  5KHH A;  4LF6 B;  3SJA C;  3HKB A;  4FJC C;  4QE7 A;  3ZMZ A;  4CS2 A;  1R6T A;  4Q20 A;  1I94 O;  4GT1 A;  1AR1 B;  5B1B C;  1TGO A;  3CHX A;  3I55 V;  5CBF A;  2A3Q A;  2LFR A;  4LF7 O;  3U11 A;  1Q8I A;  1S5H C;  1K97 A;  1WPB A;  2P90 A;  4IGG A;  3K58 A;  1VQ7 V;  1TVK A;  1Y76 B;  5IT9 N;  4DRX A;  3OAA G;  1L0L H;  3JAW B;  4FZ0 A;  1XL4 A;  2CH7 A;  3DC6 A;  4FFB A;  2WLH A;  3FYI B;  4BIO A;  1RSO A;  3WB1 A;  4KP4 A;  1K4C C;  1R6K A;  2YUA A;  5L3G A;  3CCJ V;  1Q43 A;  2HEP A;  2OCH A;  5DN6 G;  4NXN O;  2JS3 A;  4B3T B;  3ETE A;  2VQF B;  2QJ1 A;  1VF7 A;  2QKA A;  5JQG A;  4B3S O;  3OMA B;  1SF9 A;  2GV9 A;  3ASO C;  1CPY A;  2HJD A;  2YI8 A;  1RPR A;  2ZQM A;  1WB8 A;  4H33 A;  5B1A B;  2ZE6 A;  2MK3 A;  4DV3 B;  3P32 A;  1MZF A;  1XBL A;  2Q8V A;  1N34 O;  4WCE V;  1WLE A;  2X6C A;  3D8C A;  2BSK B;  4ZOL A;  3KZI Z;  3SJC C;  1YSC A;  3N2G B;  3OR6 C;  2ZXW C;  3CP1 A;  1OCC C;  3W7T A;  1XNR B;  2YIB D;  1JPX A;  1AP6 A;  3HPL C;  4BIZ A;  4JI6 B;  3CCQ V;  1JJO A;  2H8P C;  3QO7 A;  1FXK C;  1JCH A;  4FPP A;  3UM7 A;  4I9W A;  3RYI A;  3NR7 A;  3SYC A;  2Q67 A;  4FLW A;  5BMV A;  4LF5 O;  4I4T B;  1R6N A;  4IT5 A;  4O2A A;  4TWK A;  1WJZ A;  5IWA O;  4DO2 A;  1SQQ H;  4LC1 A;  4W4L A;  4JI2 B;  1S72 V;  3E2E A;  4EB6 A;  1NI8 A;  2M7W A;  4Z1V A;  2UXD B;  2EIN B;  3FAV B;  1D2D A;  1VEW A;  1PKX A;  2Y0I A;  5EK0 A;  4WFE A;  4IIJ A;  2RQ6 A;  1KB9 F;  5H6Q A;  2QWP B;  3OD4 A;  1Q3E A;  3JCZ A;  1NTZ H;  3ABT A;  4DR2 B;  4DR4 O;  1FD9 A;  2NLJ C;  1BS3 A;  4X1K A;  4L8J A;  2PZS A;  1QU7 A;  4OXS A;  2ZM6 O;  3R66 A;  2RCV A;  5KHK A;  4TV9 A;  1S5L Z;  1FJG B;  1M1K W;  1O9G A;  5KX5 B;  5CN0 A;  3LDE A;  4R7C A;  3J81 N;  4X1Y B;  1GMG A;  2PUS A;  1SRY A;  3RBZ A;  1YF2 A;  4BW5 A;  3DXR A;  4JI5 O;  4DV2 B;  5DEC A;  3T1C A;  3JAL B;  5KHJ A;  1N0N A;  4DYL A;  1SET A;  2P67 A;  2WLL B;  1TAE A;  1QLN A;  3GVM A;  2UXB B;  2R9R B;  1AJN A;  1K5Q A;  3ETG A;  2DYS C;  2N04 A;  3CCU V;  3BVO A;  1QHT A;  2HR3 A;  2V7Q G;  4O4I B;  2P06 A;  5B1B B;  3AG1 C;  2YC0 A;  3O9O A;  1ARO P;  2L6L A;  2ETN A;  1QNM A;  2EIK C;  3MHS C;  4KXR A;  4MVM A;  4K0K B;  2XHB A;  1XNQ B;  4GKJ O;  4RQF A;  2IW5 A;  4GZR B;  3RYH A;  5A2Q N;  4DV5 B;  1JJ2 U;  1K33 A;  4IHJ B;  5BR8 O;  2CK3 G;  2AZ0 A;  2JEU A;  3CB2 A;  4JI4 B;  2F43 G;  4KL1 A;  4NR1 A;  1Q81 W;  5KMG A;  2OIE A;  4ZIB A;  4X1I A;  2ARH A;  4LF5 B;  3JYC A;  2QTS A;  4LFB B;  2XUM A;  5IWA B;  4MTF A;  3ZHS A;  1JVM A;  5B3S C;  3UT5 A;  1F51 A;  4J7J A;  1MMM A;  2P22 C;  3CPW U;  1TUB B;  1XIL A;  4I0X B;  1OCR C;  1AI6 A;  4FM1 A;  1XMQ O;  3OMI B;  4PA3 A;  3L75 H;  1K92 A;  2EIM B;  4DR4 B;  1FXV A;  2JIZ G;  5BY1 A;  3JD3 A;  3BA8 A;  1OCC B;  3RYC A;  3UKM A;  5LHH A;  3A0H Z;  3SDL A;  3S3W A;  2PYL A;  2JJ1 G;  1HDJ A;  5EZY A;  2A9H A;  4YIP A;  4LNU A;  4I55 A;  3RYF B;  2QKC A;  4HAM A;  1FXK B;  2UUA O;  3H9V A;  1E79 G;  3LUT B;  1AP5 A;  2CGN A;  4DV0 O;  3L72 H;  3QTC A;  4I50 A;  4Z1M G;  2QWO B;  2D2C B;  5J2T A;  3ZHT A;  1YIT V;  1PNM A;  4JI5 B;  1SQX H;  2FML A;  2FKX A;  2PTM A;  1BHB A;  1IXM A;  2DJV A;  1VF6 A;  4TT3 G;  1OJH A;  5IJ9 A;  2D3O W;  3CSX A;  4D7S A;  4FM2 A;  4GYC B;  3HKE B;  1F23 A;  1P49 A;  4H13 B;  4RQE A;  3OGI B;  1YXB A;  2UU9 B;  2QM4 A;  4X20 B;  4X62 O;  2Z3Y A;  3IC7 A;  5LP6 C;  1PV0 A;  5LGN A;  2IM9 A;  1J5E B;  3QNE A;  1M5I A;  2Q9L A;  5H5N A;  1KQS U;  3AG2 B;  4DV1 B;  1G1X B;  1KUQ A;  4CH6 A;  1NZ6 A;  5K1X A;  1BCC H;  2DE0 X;  3RGB A;  5H2F Z;  4FLX A;  4X88 A;  3SYO A;  2WWW A;  2DWE C;  2HVJ C;  3K08 A;  2HFE C;  4GKJ B;  2L35 A;  1YI2 V;  2W0X A;  2XAG A;  1S76 D;  4DUY O;  5LOV B;  4J42 A;  1SES A;  1VP7 A;  2RJZ A;  4PI2 A;  4KHP O;  5LGU A;  1BGY H;  3LDC A;  2OIG A;  2KQX A;  3E8H A;  2JGD A;  2XAQ A;  3JAR A;  2VRZ A;  3CD6 V;  1RFY A;  2O57 A;  3K5M A;  3AG3 C;  1PM9 A;  3SYP A;  4GKK O;  2UUC O;  4CH4 A;  2DYS B;  1PP9 H;  1ZAU A;  5C8Y B;  2A06 H;  3AG1 B;  3F7Y C;  2QM7 A;  2YS8 A;  3K9A A;  1SQP H;  5IY5 C;  2YEV B;  4KUM A;  5H9C A;  3WB2 A;  2YXH A;  1H8H G;  2BTQ B;  1MSD A;  2EIK B;  4LWS B;  2Y69 C;  4LF6 O;  2OTJ V;  3RN4 A;  3UO2 A;  4YHH B;  5B1A C;  5IYD O;  5AG2 A;  4CBC A;  4G2K A;  4TQD A;  1J95 A;  2WLI B;  3K0G A;  3PN1 A;  1BQ0 A;  4J7Z A;  3FD9 A;  2OWO A;  4EFE A;  2WAM A;  2C2A A;  4N21 A;  4G27 B;  4TV8 A;  2Q7E A;  3WFV A;  1DF5 A;  1P4R A;  5B3S B;  4UV9 A;  1WAZ A;  4JI1 B;  1H38 A;  5IDJ A;  2QSA A;  1M9N A;  4NYK A;  2DYR C;  3ZRW B;  1DLB A;  1SS3 A;  2Q0A A;  2NNU A;  4LF9 O;  3DGE A;  1NJI W;  4B3T O;  2VQF O;  1JMK C;  2Z0A A;  3Q4H B;  3JD0 A;  2OYQ A;  4JYA B;  3TCU A;  4U7O A;  1YZB A;  3JAS B;  4NTY A;  3RT3 C;  4DV6 B;  2KSD A;  3FYE B;  2IJK A;  2EIN C;  1AB3 A;  1K5S A;  3F5T A;  3HKD A;  5JVD B;  3RVZ A;  1FFX B;  4JI8 B;  4UCR A;  4DV3 O;  2P5O A;  4UCO A;  4JAV A;  3QVN A;  4U7N A;  1WP8 A;  1WPX A;  5CA1 B;  4DV4 B;  1M4U A;  2LJ2 A;  3LSU A;  4FFK A;  5C93 A;  1VAR A;  2LQT A;  3ZHU A;  5CMU A;  1XNR O;  2EZO A;  2GUZ B;  2B5U A;  3GWK C;  3T2M A;  3RVY A;  5L3D A;  1B6Q A;  1KU9 A;  3ZS8 C;  1GK9 A;  4JI6 O;  5LMN B;  3BRC A;  5GON A;  3TET A;  2P6J A;  3H01 A;  3CRC A;  2QE7 G;  5LP6 B;  3H1L H;  3BEH A;  1RP3 B;  5IYZ B;  4HNA A;  4F6E A;  4JI2 O;  1ZL8 A;  2UXN A;  1VQL V;  3FX7 A;  1KP3 A;  5GW7 A;  3JAM N;  4UFZ A;  1KMI Z;  4DR3 B;  1OZ0 A;  1BE3 H;  4JI7 B;  2HP8 A;  2UXD O;  1GN3 A;  1AVM A;  1YIJ V;  3A0B Z;  4LF8 O;  5L3C A;  3X2Q C;  1AJP A;  2FTK A;  1G6U A;  1H2G A;  3F7V C;  1XUQ A;  1EN4 A;  3ZN1 A;  1LR1 A;  2EIJ C;  4P30 A;  4DR2 O;  5ITZ A;  1LNQ A;  3CJH B;  2CTW A;  5EC1 C;  4ZBM A;  4MT8 A;  1IUR A;  5CBH A;  2A0L A;  1QQC A;  3M8A A;  4DR6 B;  5EBL C;  3ZX6 A;  1FJG O;  3W7S A;  4X66 B;  1L8D A;  4O4H B;  4ZHQ A;  1FKA O;  1N0J A;  1VMG A;  3KCX A;  3AG3 B;  4WF9 V;  3K0D A; 
#chains in the Genus database with same CATH homology
 5LMU O;  1AB3 A;  3J81 N;  1XMQ O;  3F5T A;  4DV7 O;  4JI8 O;  1IBM O;  1FYJ A;  1HNX O;  4DV3 O;  2E5L O;  4OPH A;  4JI5 O;  2F4V O;  5BY1 A;  2UUC O;  4AQY O;  4GKK O;  4DV2 O;  3T1Y O;  1N34 O;  4DV4 O;  1HR0 O;  1F7Y A;  5FLX N;  1A32 A;  3SDL A;  4LFC O;  4DR7 O;  4A5U B;  4NXM O;  2UXB O;  5BXZ A;  3OTO O;  1IBK O;  1HNW O;  2ZKO A;  1XNR O;  2N74 A;  4OX9 O;  4JI0 O;  2UUA O;  4DV0 O;  4JI6 O;  5LMN O;  1N33 O;  4LF6 O;  2FKX A;  4YHH O;  1XMO O;  1DK1 A;  2DJV A;  1R6T A;  1NS1 A;  1I94 O;  4LF5 O;  1HNZ O;  2HHH O;  5IWA O;  1N36 O;  4B3R O;  4K0K O;  1XNQ O;  2UU9 O;  4GKJ O;  4JI2 O;  4LF7 O;  1AIL A;  3J80 N;  4X62 O;  4YY3 O;  5A2Q N;  3JAM N;  1X59 A;  4DV5 O;  1J5E O;  3T1H O;  4DR3 O;  5BR8 O;  2UXC O;  4JI7 O;  5H5N A;  4DV1 O;  2UXD O;  1G1X B;  5IT9 N;  1KUQ A;  4JV5 O;  4JI4 O;  4X65 O;  4LF8 O;  1D2D A;  4LFA O;  4JI1 O;  4B3M O;  4OPA A;  2VQE O;  4LFB O;  4LF4 O;  2JRI A;  1IBL O;  1R1B A;  4JI3 O;  4DR2 O;  4DR4 O;  2AGA A;  3O65 A;  4LF9 O;  2LW7 A;  4DUY O;  4DUZ O;  4NXN O;  2ZM6 O;  4B3T O;  3M8A A;  2VQF O;  3R66 A;  4DR6 O;  1N32 O;  5LL6 Y;  2Z0A A;  2UUB O;  1FJG O;  4DR5 O;  4JYA O;  4X66 O;  2DOS A;  4DR1 O;  1FKA O;  4KHP O;  1YZB A;  1XEQ A;  4DV6 O;  3RT3 C;  4X64 O;  4B3S O;  3J7A U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...