5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
1NIBA 2VW4A 1W8EA 2CALA 5I6NA 2EINB 2QPDB 2WO3B 4YVUA 1AS7A 4FA7B 2BP0B 2BW4A 5I26A 1AZUA 5B1BB 2UXGA 2VSKB 3T6VA 1AZRA 2CAKA 2IDFA 2HXAA 1PZBA 5EHFA 2MTAA 2IDUA 4QKTA 4F2EA 5TK4A 2I7SA 2BZCA 1CYXA 5PAZA 2Q9OA 1MZZA 3FU7B 1KCWA 7PCYA 1A65A 4AZUA 2FT8A 4HCFA 1R1CA 2LLNA 4A66A 2XXFA 2ZXWB 1E5ZA 5B1KA 2XV0A 4E9SA 3CVDA 1IBYA 2UXFA 3NJGA 1JZEA 5B7EA 1MDAA 2H3XC 3WIAA 1ZDQA 1B3IA 5D4HA 2P80A 4DP0X 6PCYA 2YAMA 2HZHA 4KO6A 2Y1AA 1PY0A 2DWSA 2DWTA 2XX1A 2ZWNA 4HCGA 4PAZA 5AKRA 1JZGA 1NICA 3OD3A 2XV3A 5D4JA 4DP9X 2VM4A 4W1TA 3PAZA 2AZUA 3PAUA 1JOIA 3JT2A 4YVNA 2VW6A 1HAWA 5B3SB 2VN3A 1J9RA 2EIJB 2UXVA 2DYRB 1WS7A 3CG8A 4GP8B 1AZNA 1AANA 2QDVA 5I6MA 4BWTA 2XLLA 3T9WA 4E9WA 3IEAA 3NJNA 3CDZA 1ZPUA 3NYKA 1IBZA 2IDTA 1SHXA 2FQFA 3NSDA 1EHKB 3MX0B 4HHWA 3AG1B 2GI0A 3DKHA 2GBAA 4X4KA 4HALA 2GB2A 1PLCA 2GIMA 1PLBA 1CC3A 3QJSB 4M4RB 2CCWA 3G5WA 2ZOOA 1I53A 1HAUA 2GC4C 3CVCA 1SDDA 4AKOA 1KCBA 4GYBA 4A2EA 3S3CB 3WNJA 4QLWA 3S8GB 1NIDA 1L9PA 3ZDWA 3ASNB 1ZV2A 1NDTA 3X1BA 1F56A 5I5IA 1CURA 1IUZA 4YSCA 1T5KA 1ASQA 1E65A 3NJHA 1AG6A 2IWFA 3WI9A 3FSAA 2WSDA 4G71B 2HX9A 1SF5A 2FWLB 2AZAA 3OQRA 1OCRB 2GSMB 5E9NA 1CYWA 1L9QA 2N0MA 8PAZA 1BQRA 4DPCX 2YAPA 3IN2A 4FAAB 5B1JC 3OMIB 4YSUA 3EHBB 2DY2A 4YSTA 4A67A 1J5CA 2YAEA 2XU9A 2GC7C 3X1GA 1IKOP 2GHZA 2J55A 2XXGA 4KNTA 2BZ7A 2XX0A 4JHUA 1QNIA 1BXAA 3NSYA 3NJLA 4BXSV 5AZUA 4A2DA 1W6WA 2FNWA 1RZPA 4WKXA 4E9XA 4YSQA 1PF3A 2HX8A 2A3TA 4BDVB 3ABLB 1OCOB 1DYZA 1L9RA 2E86A 1J9TA 2P80D 1V54B 3AG2B 1NINA 1PMYA 1JZJA 2PPEA 3FU7A 3ASOB 4E9RA 1NWOA 4HAKA 2TSAA 3ABMB 3ABKB 1WAEA 2B3IA 3FU8A 2PCYA 4KO7A 1FA4A 2QT6A 4DP1X 1JXFA 1BXUA 1GSKA 1BXVA 2J5WA 4KO9A 1NPNA 4AX3A 2PPAA 3QJVB 1SFHA 4JKNA 4A2GA 1JZIA 4KOCA 1E30A 4DPBX 3AW5A 2PPFA 1ET7A 1A3ZA 3NJIA 3FU9A 1KDIA 1N68A 4G70B 3OMNB 1SFDA 3SBPA 2RACA 4YSDA 1GS6X 1L9OA 4KO5A 4KNSA 3ZX1A 1PCSA 3NT0A 2TSBA 1A4CA 1PNCA 2XV2A 4BWWA 3V9CA 2PLTA 2YAHA 4A2HA 1PAZA 2UXTA 4W9ZA 1NWPA 1FFTB 3NSCA 1GR7A 2XYBA 1JXGA 4YSOA 3ZBMA 4CSZA 3WG7B 3UABA 4K9JA 3NJJA 3UAEA 2YAFA 3IN0A 5F7AA 1X9UA 3SQRA 4GP5B 2NRDA 3S8FB 3KW7A 5FC9A 1TU2A 3T6WA 4JHVA 3UADA 1NIEA 1BYOA 2X88A 4HCIA 4BK5C 2BO0A 3MBWB 3QJQB 3WKQA 3ZIYA 3DTUB 4M3HA 1BEXA 2I7OA 3SBRA 1TKWA 1WA2X 5B7FA 2B08A 1HFUA 4BXVA 3TBBA 3FSZA 3NJMA 4NERA 1M56B 2CUAA 2CBPA 4UANA 5I6OA 4ZK8A 1BQ5A 2BW5A 3OM3B 2OCCB 4AKPA 1GS7A 3FPXA 3BVDB 2BP8B 5PCYA 4GXFA 1TEGA 2FQGA 3UAAA 1AIZA 1OV8A 1XB3A 3QJRB 4F2FA 3X1NA 2HX7A 3NSFA 2IDSA 2DYSB 4P5RA 3FSVA 1A4AA 2X87A 4TXVB 4UF7C 3H4HA 3UGEA 3PCYA 1AZBA 4YSSA 4L0PB 1PNDA 3FSWA 3RYMA 3CVBA 5B7MA 1FWXA 1NZRA 1SHWA 3TASA 1V55B 3H56A 2UX7A 3AG3B 5I5JA 1JVOA 1JZHA 1AAJA 3NP3A 3U25A 4GP4B 4UAHA 3FS9A 4ENZA 2JKWA 1WA1X 1XB6A 2BWDA 2HRGA 5AFAA 3PLYA 1NPJA 1NTDA 3FT0A 2JXMA 4RH4A 2BP0A 1W6LA 3TBCA 1MG3C 5ANHA 1AG0A 2IH9A 1KBWA 3ERXA 4GY4A 2R7EA 7PAZA 1ILUA 2W88A 1N70A 2QPEB 1GY1A 1NIAA 1BAWA 3S3DB 4DP7X 3EH5B 1GYCA 1QHQA 1PZCA 3FPYA 1ID2A 1RZQA 2ZONA 1BYPA 3IE9A 4F7KA 1E5YA 1V10A 2UX6A 3FQ1A 5TK2A 3AG4B 1XB8A 4N4YB 4E9YA 4YSRA 1JVLA 2VMJA 1SJMA 1QLEB 4YSPA 1IC0A 3UACA 3FYIB 1ZDSA 2BHFA 2PP8A 4DP5X 4CSPA 4G72B 2PCFA 3L45A 1ADWA 5IY5B 4NAJA 1UATA 3WNIA 2XWZA 2OJ1A 2YXVA 9PCYA 2Y69B 1WS8A 3QJUB 1DZ0A 3BQVA 2YEVB 1ET5A 3KW8A 2FT6A 4BDVA 2MRYA 4EF3A 1MG2C 2PPCA 4G7QB 2HLEB 1J9QA 3WKPA 5B1JA 2IWEA 4YSEA 1KBVA 2IH8A 2PP9A 2FT7A 1ZIAA 1J9SA 4PCYA 4G7RB 4HIPA 3SBQA 4YL4A 4E9QA 1OE1A 3AZUA 1URIA 3D12B 1CUOA 1JZFA 3EH4B 1KYAA 1AQ8A 5I28A 1KV7A 1AR1B 1EZLA 1AOZA 5D4IA 4G7SB 2IAAC 3GDCA 1OE2A 3NP4A 2XVBA 3TA4D 4Q8BA 4DP2X 2EILB 1JXDA 2Q5BA 3OMAB 1X9RA 1OCCB 1GS8A 3NJKA 3T6ZA 4HHGA 4A2FA 2FJSA 4HZ1A 4A68A 3GYRA 2YARA 2YQBA 3FQYA 3TU6A 2YAOA 1M57B 1AS6A 5A7EA 1ETJA 3QJTB 2H5UA 4BWUA 4N8UA 1SNRA 3AY2A 1VLXA 2VW7A 3S3BB 4E9TA 2BP8A 2CJ3A 3ABGA 4DP8X 3FYEB 1GW0A 1OF0A 2JFCA 1E67A 3EF4A 3JTBA 4KNUA 2H47C 1TEFA 4DP4X 4DPAX 3QPKA 5I6KA 2AFNA 1XMEB 3PAVA 3N2JA 1AS8A 4NB7A 4AKQA 2AVFA 3H4FA 1L9TA 1OE3A 2BWIA 2VSMB 2OV0A 2FQDA 3NJFA 3CZUB 4WTQA 4E9VA 1M9WA 2AANA 2FQEA 1SF3A 2I85A 1PLAA 3GXUB 3EH3B 2EIMB 1ET8A 5I5MA 4MFHA 4DP6X 1SDDB 2HRHA 3PXLA 2EIKB 1A4BA 4KOBA 5LDUA 3N55A 1WA0X 1KDJA 1YLBB 3CDZB 3T71A 6PAZA 2PPDA 1L9SA 2YXWA 1RKRA 3FQ2A 4P5SA 5I6LA 1ZIBA 2R7EB 2FTAA 2IWKA 3PPSA 1ASOA 1OOWA 1AACA 5B1AB 2J56A 2PP7A 1MZYA 3HEIB 1JERA 2VM3A 3IBOA 3T6XA 1A8ZA 2YAQA 2IDQA 2J57A 1KGYE 1NIFA 4Q89A 5F7BA 1J5DA 3V9EA 3DIVA 3HB3B 2DV6A 1ASPA 2W8CA 3X1EA 1ILSA 1BQKA 1GY2A 2XUWA 3X2QB 4AI7A 3C75A 1OCZB 1AZCA 3X1FA 2QDWA 2WO2B 5I6PA 1RCYA 4YSAA 3QQXA 1PZAA
chains in the Genus database with same CATH superfamily
1NM4A 4UQEA 3NCYP 3SPVB 2OQJB 2MPAH 2C7UB 4N2HA 4PJDE 3IMWA 1FSKB 4P5TB 4LLUB 3T0XA 5EU3A 4JCLA 3U2IA 1EJ6A 3KLAA 2D31A 5E9DD 3OKOB 3LNHA 3LZQA 1XF5A 4KJQD 2E6QA 1YNKL 2DKSA 2E46A 1AI1L 2W5PA 4BZ1H 4UM9A 1X5XA 2V9UA 2EDFA 1JZ8A 3TP4A 4NP4H 2XZAH 2Y72A 3EBHA 1KEML 4N86A 1KGCD 1LK2B 4X42A 5CO1A 5C0IB 1BDYA 3OF6D 3A0BZ 7PCYA 3GMPA 1SA0B 2FEJA 5F6IB 2IF7A 4U1NB 1UEMA 5JO5A 2ZXWB 4XC1H 4EJ1C 3L4TA 4E9SA 5JVDB 1PZ2A 3KXFA 2A9ML 3TH2T 2WP3T 2VDKB 1RPQA 4DVBA 2H3XC 5J1TC 1UT1A 1TAEA 3B2EE 2OR7A 3WNKA 5D4HA 1QR9A 5BV7B 1MVYA 2YIHA 1EMTL 1K4DC 2I69A 1RIHH 4TVUA 4LVHB 4XNUH 1R3JA 3W57A 3L7EA 4LWSB 2A9CA 2HKAA 5L3CA 4Y2DA 3AS2A 3FTGB 4NRYB 1FYTB 3LVEA 1HYRC 3LTVA 4HISA 1VF5B 2VJ8A 5E0FA 4OGYH 1I7ZA 1UM6H 3W81A 1N8OE 1MJ8H 3N3EA 3OWEA 1SJHA 4PJ7A 3KXFD 3M8OH 4WEUD 1V8HA 43CAA 3P3NA 3T9WA 2Y4SA 4QRRB 1K6QH 4JFDB 4JFFE 2VZOA 3O2VL 3CDZA 4ODTL 4QNPE 3VE0A 1SRYA 4LCUB 4G2AA 4XNUL 1Y6KR 2QSCH 3SJBC 2WKOF 2Y6SC 3S35X 3GMMB 1DVYA 4XNQB 5I2IB 1KECA 4P3CH 5H35A 2YGOA 3KJ6L 4JJ5A 1XV8A 1CI3M 3EOTL 2HH0L 5FUOL 1RZGB 4UVBA 1SDAB 4FFVD 1URFA 3KH4A 4TLSA 3BA9A 4PQXA 2OR8A 5EC2B 3WJMB 1GTOA 1CK0H 3V0AC 1M2VA 4TSAL 5LWYL 4JG0L 2V2TB 4GW5B 1CN4A 1YZZA 2RCSH 3CVCA 3KDMA 4NT6A 1TLKA 4AKOA 2XXMB 3DGCR 3GQFA 1VQ5V 4F7EB 1Q38A 3H53A 1UGNA 1QP1A 2X05A 3O2DL 2EEXA 2Q3ZA 2YEZB 1HE7A 2FYYB 2VDNL 4MS8D 1ZV2A 2LLGA 3QQ9D 3QWOB 2CH8A 5D5MA 1ZLWH 2UZXA 3TZVC 3ZEDA 2OTWB 5L7XL 2H3NB 4I9WE 4WHTA 1CURA 4CMHB 5LNDA 2VLRD 4PV8A 4JJ5B 2P8LA 3FMGH 3QJHA 3D9AL 4JL1A 4NJ9L 3SE8L 4HQQH 3RL1B 3BESR 2AZAA 1UD2A 2NY7H 2IAND 1S5IL 3WXWH 1IXMA 4UQCA 4DKDC 3Q9PA 2R4SH 4H8WH 4MJ2A 4FTDA 4P9HC 5IJ9A 1TSRA 5F7FA 2EDOA 4JB9L 4F7PB 4R2GC 4OQ1A 1JWUB 2JKSA 4JFEA 3MA7B 4JFPA 4CVXA 3GRWH 4WBNB 5F96L 2X7RB 1MQKH 4FDWA 2DY2A 5CSZB 2XG5B 4HXAL 1SJVA 4DETA 1X5GA 5C09B 1AKJB 4XBFA 2J55A 1MEXL 4JDEB 4P23D 5BRZB 5AZEL 1SOQA 2QL1A 5DQ9B 3ZOAA 2YSTA 3BWUC 2ZCHL 3NIFF 3SPVA 3BRDA 2YK1L 3VJ6B 4C8XA 4LH6A 1H5BC 3TO2B 1B3QA 4GX0A 5IUCA 2BVTA 2IBBA 1G6RA 1YPZB 2DIBA 1UD5A 3EO1B 3JWNG 2Q10A 4R5VA 2GTWB 4NIYE 2R1XB 5EZPA 3KXFE 2ZTBA 4F9PA 3QWNA 2WNWA 5B1BC 1F7YA 4W9CC 1DJSA 2PPEA 4Q2ZB 3S34H 1NWOA 4MVOA 2WWKO 1S7SA 1WFIA 3HS0C 3RKDD 5JA9A 4JFQB 3QAQA 4JFZL 4X80L 4DP1X 1HHGA 5SWQB 1JXFA 4JKPL 2CO4A 4XPTL 5JJJB 2Y4TA 2K8MA 4UOZA 3ECVA 2VXUL 1N10A 4HMDA 2OBGA 3GSOB 4CU7A 5C0ND 4ZO7A 3CX5J 2P42B 1F8TH 5CGYD 4S1SL 1XHXA 4EXKA 3QORB 1FNEB 4KTEL 1JA8A 2XY2A 5JQGB 2V5RA 4GG8A 1KYUA 3U0PA 4YO0A 1T22A 3WIFA 5D1QE 1ONQA 1HEJC 5GGVH 4LLYB 4R7NB 5HGBA 3SJVE 2KDGA 4IBSA 1TZIB 2ENPA 3RVXD 43C9A 4F2MB 3HS0B 2NX5E 5E9DB 5GSVA 1PD0A 3ASNC 2LLLA 2HFEB 1HKLH 3GJFH 1A22B 2YPLA 4QKXB 3P30A 3ILQC 5L4FA 1IBGL 2ZX7A 4A7GA 1P7GA 1NCGA 3UYPA 3Q05A 1U8KA 4Y19B 5DHXB 1PPIA 1WBZB 3UIZA 3E22A 4ANXA 1JJOA 3PXHA 3FONA 4TT3G 4OLZH 3QG7H 3MRGA 2OIGA 2PWFA 1T6BX 4MSWC 1GR7A 1YO4A 1ZVNA 1S7WB 1L6PA 3ZBMA 1O7DE 1RULH 1N34B 4BSWB 5F8RC 3K91A 3U4AA 1KCRL 4NP9A 2WXFA 3P9LA 3W3BA 4PDMA 5BXFA 3FUJA 4RWYL 1XF5B 3P3RA 3C08L 3KLKA 2OXGB 2GUZA 3MRRA 4XVJL 4WU7B 4Y5XA 4BK5C 3OKLB 4FNTA 3O4LA 4O2EA 1MFVA 1BEXA 1YC8A 5HHOE 1TSHA 1WA2X 1JMKC 1FVDB 4HZ3A 1W16A 3ARGB 4CVZB 3NBNA 1A0QL 4JRXB 1FZKA 2VDQH 3WFEL 2KMWA 4GIPD 3TNNA 4E0RA 1SUHA 4W4OC 1IGFL 5IQ7L 4X9BA 1ZLZA 1MCCA 4UI2A 1FVCA 4RBPK 5H9CA 5ICZB 5I5RA 2YC0A 4V11A 4OV6F 4Y5YA 3C5ZB 1CIDA 5LWYH 4WCYH 5KHHA 1IEBB 4G1EA 3IBEA 2IH1C 4YPGB 3WUWA 2VMCA 3UBXA 3L7FB 2YPLD 3KZIZ 3KCPB 4JGJA 3B2XA 5TDPA 2MTPA 1AJPA 2OL3L 4UB8Z 5A3IC 4G8FA 2X4QB 5F7WC 3MLWL 1U8QA 3CX5F 1NGWA 4MXWH 4OZHF 4PGBB 5F6HI 5DJ6B 3HKEB 2D7MA 5J6HB 4JI2B 5B7MA 5GSRB 4JDVA 3RZCC 4UYQA 1WZMA 2XSKA 4OPAA 1NCAH 3A6CL 4QHPA 5FUCC 3SD2A 2WWNA 3O3DB 4S1SH 4XCFH 3RWIB 4ZTPL 4HC1A 4UAHA 4ZXBA 4A1RA 4ZMOA 3EJYD 3IJ7A 4DUYB 3CLWA 4PA4A 1WT5C 3JVGA 1PTZA 1XB6A 1U2YA 4NZRH 4MHHG 1AVAA 4KK5C 5AOLA 1NPJA 2VUOA 3N04A 2IO5A 2YD2A 4JRXE 1RJZA 3FQXA 2W91A 4AGNA 4W9KC 3D6GA 4F33A 4GXUN 1XGUB 4GRWH 3GSWB 5A6LA 3HFMH 1ZHLB 3MR9A 3IMSA 1DTOA 5DHYB 3NSXA 5E6ZA 4XWOC 3T1HO 2L7UA 1NCAL 2DWDA 2P5WD 3OKDA 5EFIB 3RB7A 4UNVA 5LAXB 4Z95H 4Z7OB 2F8XC 3BAWA 1RJCA 2XA8H 4I13B 2X4RA 3WIHH 1LHZA 3CRRA 3QNZA 1UFUA 3FRUB 4A04A 3FUEA 4N85A 1AR1D 1ED3A 1FGVL 4K5OA 1MOEA 2B5IC 4P4RA 5EBMA 5T1JA 3BVNA 5CSBA 5CZRA 5AB2A 5FGCE 4YDKL 5LHIA 4ZSOA 4A2LA 4KKLC 4F7KA 2C1OB 3L1OH 4Q4IA 1UC6A 3BAIA 1OHQA 4KHXL 1D6VH 3X2QC 4U4IA 4R2GD 2NY5L 5D1ZI 5FW8A 5GIRB 5GRJL 2ZAGA 3BIKB 4EOWH 3NH7H 4GUOA 2WBJB 5C0BD 2BHFA 3Q1EA 2A6KA 4BZ1A 2XA3A 4B3SO 2WYTA 1OLLA 1SRDA 2UY7B 4NAJA 1MA1A 3DROB 3HAEH 1FAIH 5G4OA 3ZK0A 3PWJA 4HAFA 3RU8L 4UT6H 4FL4B 2QV2A 1S3JA 1WN7A 1QLNA 1QBML 2XQBL 3Q8CA 2BY0A 4YSEA 4NFBA 2NY4C 2QSVA 1X4XA 4HYOA 1R3IC 1YJ9V 3ESNA 2B16A 4BH8A 1F1AA 3IB4A 3GRWA 3L4VA 4UV4L 4IHJB 3BP5B 5CINL 1RERA 2NY6C 3FFOA 3QGVA 5HVFB 2WBXA 3V0JA 2NY5H 1CUOA 3PF2A 1FHGA 2FJGB 1P4LA 2OSXA 3LHAA 2GJPA 3CU7A 1ZLVK 4X89A 4ZQTA 4R6ZA 4QTFA 2E3VA 2P45B 3P4LA 1NR7A 3BRFA 4JG1H 1KELL 1TUBA 3MJWA 3OKOA 4Q8BA 4WGVB 1R5VA 3JWNE 1JS4A 1BFVL 4KDWA 3RWFA 3HLKA 4X9HA 2KPWA 4P9ML 4CSTA 2F1MA 5D2NE 2F53D 2QWNB 2HG5B 1B6UA 4X4XA 5AVQB 2HLDG 4MNGB 9CGTA 3GMPB 5T3XH 1BPLB 3ROLB 3GMNA 4NHUB 2WLLB 1S3RA 1QUPA 4B9PA 2CKBA 1PQZA 4LSTH 4Q6IC 3S3BB 4WWNA 1KB9F 4ISVA 1CZ8L 2FCBA 4R7NA 1OP4A 4KFZC 5HGGS 2CK3G 1NGXA 3WUWB 4WFFD 2ZUTA 2AV1B 3LS5L 1S7UB 1SXCA 1ZE3C 2AVFA 5TE7L 3H4FA 3BGMA 1D5IL 2J8OA 4CJ1A 2BRRL 2FQDA 1KGWA 4HIEB 4YAQB 3IFXA 3U6XS 3WMSA 4JV5O 3CZUB 3APOA 4PLKD 4AG4L 1M9WA 1Z9NA 3ZDZB 3OKMA 3NRPA 3AQYA 4O00A 5JVDA 3GMRB 5EG6C 1W15A 2IJHA 1HXMA 2N56A 5J0BA 1H2KA 4YDLC 4X9QA 1M05B 5BCAA 1WA8B 2QPSA 4DP6X 4EB6A 1T5WA 4ZHQB 2IFFH 1I8LC 3ZRXA 3OR7A 4FL4C 3O3DA 5KS9B 5LDUA 4S1QH 1BP3B 2D0GA 3I85A 4LF8B 3ZHKA 2X2HA 3BEHA 2PPDA 4J4PC 2Z3YA 5DHEA 4BQ9A 3C09B 3L9RB 4NTWA 4G42B 5IF0A 1BFSA 1TCRA 4NO0B 3EXLA 1ASOA 1D2DA 1ZAUA 3LDDA 1AACA 1KBKA 1WITA 4G5AA 5IVZA 4ZW6A 4ABWA 1COWG 2XNAB 5IOPB 3RNKB 2GJ6B 3T6XA 4F93B 4KJPC 5HVWA 2YXYA 2HVJC 2R0ZH 3GKWH 4YDLB 4GH7B 2HP8A 3QDJB 5JTWA 3I3DA 2W8CA 4YXLL 4JFTA 3OKDB 3QO1A 3AG3C 1N8ZB 1KXQE 2QQNL 2V4LA 2XUWA 3PWLA 4LLAA 4Y5YB 4DZBA 2D2CB 5C0FA 1RURH 4F58L 5IHLB 3H42L 1QVFU 3I6GB 3TO4B 4F37F 3DRQB 2PTMA 2X0UA 4Q6IA 3WLBB 1W8EA 3RL2A 5MEQB 1JWSB 3K6FA 3P2TA 4GSRA 2W0FC 5KJ7E 2UZXB 3OC5A 5AW5B 1QASA 5DVPA 4EAEA 3SGKA 2AITA 3CFCL 4F8OA 1UYWH 2EBOA 1WWAX 1II4E 2X41A 4IM8A 4TPRH 2V6HA 1AZUA 5BVPL 4H1LA 4HLZG 4PJIF 4D9QD 4PD4J 3GSNA 4GEJA 4U3JB 1XL4A 3HPLA 4IKLA 1ACCA 3T3PF 2LQRA 4OCWL 1EZVH 1PX3A 2G3NA 3EZJB 4DEUA 4V2CB 3WEXA 4XN8A 1U9KA 1JZ4A 1MZZA 4ANKA 2AQ2A 3NK3A 3GHPA 5EORH 2LVEA 5D6CA 4TV8B 2W0PA 1UM4H 3M7FB 4CVWA 3DOIA 4IKIA 3K5NA 5B66Z 4K2UH 3KLHD 4KX8A 4YEFA 3S35L 1IBKO 2UXFA 4HCRA 5TDOA 4LOVA 3UZVA 2ZKHL 1LTXA 1RSOA 3GS0A 4BK5A 5L2JB 3STZC 4KMTL 5AAWA 2MSPA 3NJXA 1ZT4B 3L5IA 3WBDA 4PGJA 3IDYC 1F4YH 4M62H 3DYPA 3FCTB 4MA7L 5MHSE 3IGKA 3TFKD 1OALA 3FQRB 1Q0YH 2Q0AA 5IMOA 4HHAB 4WNSA 3KPNA 3OD3A 3QPQC 4PJ8C 2DQHH 1UASA 2FBRA 1I1AC 4P2QB 2MCPL 3WTWA 3GINA 2LW7A 4QHMB 4I18B 3RTQC 3VXOB 1F2QA 2QGNA 2CLZB 2JIXD 3CC1A 1N8RW 3FO1B 4PLOB 2XVGA 5B3SB 2KC0A 3N42B 1F6AA 1IGIH 1W0WA 2Z8SA 1WHOA 5GS1A 1QRNB 1PS3A 4UVCA 4M7JH 3GSOA 2QV4A 1MFBL 4O2AB 3LKOA 5KVDL 5H37H 2EDWA 3B8SA 3CJJA 5CZXD 3LY6A 1LK3L 4F3FB 1TQVA 1AB3A 1CFSA 5ABDE 1RIHL 3JARB 2IH3B 3IAGC 5JHDB 2CKBB 1ORQA 2JCCA 2ODMA 1WTLA 3UBGA 5IEKA 1M56C 3CN0A 3MCLL 3NSDA 5IVXF 4EDWH 4RQQA 1J88A 5F0JB 1XCXA 1EPFA 4YUEH 5FGCB 5FUZH 3F85A 1VADA 3II3A 2VLKB 4X6EB 5CU5A 3ILPB 2GEQA 3P77A 3WKMH 2BNRA 2WXGA 4OJCA 4UMGA 1T7VA 4EI6A 4OM0L 4YQXL 3JD1A 3UTSA 3ZE1B 4WI8A 1L3NA 3UKMA 1C12B 2WNKA 4R0LA 4MDIB 2GC4C 5ADOH 4U3CA 1SDDA 1BF2A 4X64B 1MFBH 4M00A 3QDMD 1TF4A 2A3QA 3V6BR 3UZEA 3V4UH 3GMRA 1NUGA 3MFFA 4JQXA 2XKNB 3S3CB 3FBQA 2H8PC 3H9HB 4RZCA 3UC2A 3R18A 2JRIA 1M05A 3L74H 4PIBA 4YXHL 2VO8A 3VRJA 2HUEA 5HYJD 4P46A 1IC1A 2CK0L 3LS4L 1K97A 4OW6A 1NDTA 4DUWA 2FWSA 4DWHA 2HN7B 2EXWD 2OMNA 1M71B 1KF9B 2CDFA 4NXMB 1AQDB 2FX8L 3CFEA 3LN5A 4FXKA 1CD1A 5C08A 1F4MA 5DGRA 2CTQA 1M4UA 4K0KB 2WSDA 3V0FA 2XRAH 3LD8B 1SF5A 2FWLB 2HEPA 4BWAA 2UXDB 1MFCL 3DGGB 5F93C 1LK2A 1WBZA 1E4XL 3Q5YA 4JE4B 3QXTA 4OZIF 1X59A 4DQAA 4Z7OE 4FQ2L 4IBTA 4HWUA 2YXHA 4FAAB 4APQC 1XF4B 3OX8A 2NLJC 3UEZA 4YSUA 4DR1B 2VLJB 3PWPE 4PJEE 2HVJA 3SDLA 2ZKOA 1UACL 3IJSB 4DVBB 3L3KA 3QFJE 2JIZG 2ESVA 4UZSA 5IBTL 3V6FA 3NCBB 4FNUA 3SEPA 4B08A 2HJKA 4Y1AB 2K45A 4DN4L 3RYHB 4B3RB 1R24A 3LEXA 5DD0L 4R7VA 3VD5A 4D7PA 4BIUA 4WFEA 1C9SA 2XAFA 1ADQH 1EDHA 2IW5A 4JFXA 1KXTA 1MFCH 4A63A 2HWZH 3FB5B 4ZNEA 1KMGA 1M5IA 3WIHA 3IXTA 4XNZC 1HH6B 4WCEV 1IAOB 5E6UB 4FFBB 5KBKA 2LE9A 1T1ZB 3WSQH 4J39A 1HNZO 3DUSA 5C07A 3RWHB 3VI4E 1BXUA 1FGNH 1NMBH 1A6AA 3BEVB 1V3MA 5I1HL 2VQUA 3SGDH 1EBPA 2DMHA 4KMQA 1KLUA 3VSVA 3I84A 3RUGB 3QPXL 1FJGB 1P7QA 2VDOB 3BIBX 1V55C 3P9MA 1H6EA 2CIIA 4DN4H 4GW1B 4IRSB 1S78D 1GRJA 4AJ0A 5ECGA 3BZ4B 4YHHB 3VNZA 1I8KB 3GMMA 1NFIA 3S3PA 3O6FC 3EG9B 1AC6A 1JNJA 4ANUA 3QC6X 4OM0H 1I7UA 1NCHA 5B1NA 2FHBA 3QIBD 3HAEA 4L5FL 5D7IE 4IBYA 4IGBA 4NNYA 2J6WA 1GS6X 5DHYA 3L3GA 1BJ1H 2BSED 1QVOB 3N1GC 1JTTA 1ORSB 3FU0A 4UM8B 2VLJE 1RH8A 3KPSD 4PJEB 5E9DE 4P4RB 2AK4A 1HNXB 4AYEC 5KBMA 4LSQL 1NPUA 1X7SA 2OMYA 2FO4A 3DC0A 4HFUH 2CHWA 3SJVB 3JATA 1RZIB 3DTDA 4DUZB 4O02B 5T1MA 2X9YA 3O6ML 2YDEA 5H4YA 3GM0A 4FNLH 4AWJC 4DV1O 4NDMB 3D9AH 1XCTA 5F89A 3SO3B 4F58H 4S10A 3T6QC 3VFNA 1TA8A 3ETEA 4NN6C 2AXWA 4I50B 1SLVA 1TU2A 2EE3A 5MENA 1Q9LA 1XEUA 5T1KB 2BO0A 2LFEA 3QJQB 2IGTA 4M3HA 2L7QA 1URLA 2BCMA 3ML9A 1LP9F 2FLBT 2YJQA 3CH1B 3HE6B 1AOHA 4GKKO 3OR6A 4O5LL 4UILL 3DX9A 5DEFB 4MA8H 4NERA 4UTBA 3MNVB 5KSUA 1M56B 3MRNA 2CR6A 4M4RA 3QBTB 1BQ0A 3HZMB 4XI5D 2F68X 4LF5O 4KI5F 3N42F 1Q86W 2AQTA 5CCHE 4F7CA 1FS0G 1UADC 2ITDB 2A73B 2B59B 2W38A 4QXUL 5AVVB 3JASA 1YCSA 3RVTD 5AB1A 3W9DA 4JI6B 2G0LA 4OQTH 3JV6B 3UPRA 5K39B 4DV0O 1JFFB 3PE9A 4WWKC 3O3EB 2A6KB 4LT7A 5F89B 3ZKMD 5BJTB 5KYUB 1FH2A 3EYFB 3MV8D 3HZYB 1Q1JL 2EDBA 2DF3A 1OAXH 4N90E 4WV1A 2EP6A 4XPBL 4J3OG 5L3DA 3HI6L 4H0LC 5CCJA 5D7LE 4XO3A 3QXAB 25C8H 4ZMTA 1G84A 3SE6A 1R5WA 2FLRT 4JFFA 4YHZL 4HIQA 3UTPD 2VISA 5AW4B 3QPXH 5D7JD 1AAJA 1QUNA 2YGPA 5EEWA 2W59A 2A6IB 3TVMA 4KTEH 4JFZH 4Y89A 2WXRA 2G9KA 2X7LB 1BJ8A 2A4EA 1P4LB 4WFEE 4XPFH 1ENVA 2L7EA 5L8LB 2HRGA 2ZKWA 1O9WA 4CMHC 5EUOF 3PYCA 5HHVH 2NSMA 5DRWA 2JK5A 3I6LE 5IHUL 5E4AA 2AHIA 1ACYH 3S96B 1W6LA 1JYNA 4OCNC 4LDLB 2OX5B 3DX1A 4Y1AA 4FLWA 4D7SA 4LVEA 3K7UA 1E6OL 1G9ML 4NBXB 5GSVB 4AVHA 4J7JA 5H4ZA 3FB7A 2HMID 3F7YC 2E7HA 3WAKA 4LBAA 1MI5B 5AALA 4HOZA 1QFOA 1FYTA 4WWOA 4JAVA 1ZTMA 2KBGA 3HE7A 4K3JL 2YS4A 3Q2WA 3VFSB 4KJWD 3TVMB 3N5AA 1GXEA 3HNSL 4LKXB 1V7MH 3L3IA 4ZBJA 3VWJC 3RZCD 4QCIB 4GXUM 1CFMA 1GOFA 2BJMH 4JM4L 3L3HA 2ZIOA 5CJQL 5EN3A 1TFPA 4H0GA 4OB5L 3FQ1A 3MACH 2H45A 5CIPH 3TEZA 1ERNA 1G7PA 5FB8B 3LPWA 5AOIA 4NN5B 4WKZA 4M1CC 2DOSA 4YSPA 1MHEA 1MQ8A 2DICA 1IC0A 2YOCA 4X8JA 5IV2B 1Z9OA 1E28A 2XBDA 1S9VA 4BINA 4MMZB 5JNYA 1R75A 3EO9H 4CH5A 4WW1B 2OJ1A 1T5XB 4HSQA 4AGQA 5I17A 2P4KA 3QG6A 2XCMC 4ZMAT 1VQ7V 3G6DL 3OAZK 2F7RA 5C0CA 1LEIA 4DV2B 3VDCA 2VQFB 4NGHH 5FW6A 1MH5A 1FJ1A 4J3OF 2RCVA 2WWMC 3KGSA 1I8AA 3VFOB 3I75A 4RVBA 5ITFB 3LV3A 1MCQA 4KRMB 4ZRGA 4HCRH 4LSDA 3MXWH 4URTB 4G7RB 3NRQA 5C0JA 5I1IH 4JFSA 3C5JA 4U7SA 1EBOA 2JLPA 1CFVL 3P3UA 5I1DA 1BBJB 4QHKI 3ZMNA 4LVHC 1O6TA 1YTFB 4NXNO 2HHHB 3DX7A 3SO5A 5FGBA 1AR1B 3WLWC 4ZQKB 5KVDE 4Z0BH 4NXMO 3AK1A 1UENA 3HI6H 3NESA 4Y5VC 1NCTA 1ZHKB 4FLUA 1PLGH 3QUZB 4X7TA 3R0NA 3SE4A 3HI5L 1YDPA 3ARDB 5C93A 4LCCC 3VFNB 5GW7A 1N5AA 3LDEA 2C9XA 4PU2A 1R47A 4JAMB 5IVXA 3LEVL 1MLCA 1FN4B 2Z7WA 3BVWA 3BEVA 3QHTC 1G4YB 2B4CH 5DEZA 1BZOA 3FT2A 1PL3A 3L4ZA 5D6CB 1UA7A 2Y2YA 1MJ7H 3FQYA 3TN0B 5A7EA 2YEZA 5EBLA 1WB8A 3CRMA 5SWZE 3WFZA 2FEEL 1QOKA 1CT8A 3VXSA 3ZQ9A 4AITA 3MRKB 5CA0A 2CE4A 3MLZH 4YBHA 2BTOA 5BRZA 5C0NC 1Z2KA 2YBRB 5KAQG 3BXNA 3CAFA 4H1LB 3EDFA 1LDSA 4OSUH 2F95B 3I6SA 4YGVB 4APQA 1EDQA 3L3JB 1GW6A 3BUPA 4IBZA 2TAAA 2OV0A 3CYOA 4AL8L 2EH7L 3JWNC 3NJFA 4MNQA 2MPVA 4A39A 2RQ6A 3S3WA 2ZKYA 2NOYA 4GAGH 2X4PB 1RIVH 2Z0AA 3FO1A 2FQEA 1MFAL 2R51A 4PREB 1LP9B 3QK0A 1Y76A 2VITA 3D33A 3RURA 3WFVA 1ET8A 5KA6A 1TO5A 4I5SA 5FGBC 2NY3C 2DW4A 5HHMD 3LKOB 4J27A 1T6WA 5HHOA 5JOPD 1IM9D 5IB3B 4LZKA 4N2AA 4R8WH 4Y16C 3RVWD 3VFTA 1SEQL 4RNRA 4KHXH 4HU8A 5A2JH 4KVCL 4HUXB 4J9ZB 5KX5B 2MEJB 3E8BA 2W07B 2P5EB 3MUGA 4O2FB 3ISRA 1I31A 3QXWA 5K9QG 4PB0L 1QBAA 5CEYB 4AK1A 2GG1A 4PWIA 5CBAA 1KJVA 4YWGL 2CLVB 2ERJB 4PJGE 3NIGB 1S7SB 3B9EA 3VGDA 4D3CL 5J2UA 2XN9E 1MLBA 4U3SA 5KSAC 1LEGA 1YUHA 4UV4H 5I0XA 1W9XA 2IAMA 2MPAL 2YKLL 5DT1L 4AZ8B 3X2QB 2UXDO 4XOEA 1HSAA 2EJRA 3LRHA 5L6YL 2ZP8A 3IRCA 2QDWA 1R6NA 5IWLC 3VW3H 1H3GA 1U8NA 4TUJB 1WV7T 4YHIA 1U30A 2J73A 4ALAL 4ELKB 1WJ3A 1OP9A 5LXVA 4XPHH 3HZYA 2YSSA 3ELAT 1K9TA 3Q01A 4OQTA 2EO9A 4BCXA 5LGNA 3ZN0A 4DR1O 1WTGT 3CZLA 2ATKC 5C0AB 4ACTA 3GVMA 3K08A 3PRZA 1R3JB 2ZWYA 3CV5A 3BKCH 5EU5A 5F3FA 2UXGA 3EJZC 3W7XA 5I26A 1I8MB 5I24A 4LWSA 2HXAA 2QKIA 3ARTA 3G04B 4HK0A 3OKLA 3TT3L 3DSFH 1JZ7A 2W81C 3UYRL 3ZCCA 4X5XB 1UWYA 4KXBA 5ID1A 2JQMA 2YPKB 4WW1A 1RJLB 3VRLF 1YJDH 5E5MA 1LEGB 1YUHB 5JHAA 4RSYA 1N5YL 4KI5E 1C7TA 2JLLA 5I71C 2BE3A 3OAZH 2GJJA 3G3LA 4QHNA 5KJRH 5KANI 1WE5A 1RZKH 3FQWB 1D5BA 4GMTL 4H26B 4PRIA 4PRHE 1EHLL 4M9PA 1YUKB 1RP3B 3EYQC 3VXUA 4DEWA 1M6UA 3GSXB 4DKAA 5FFOA 3MXWL 3QA3B 1NZ6A 2AV1A 3AQDA 1IV8A 4XNQA 5I2IA 1I7RA 4PLNC 5JDSB 4L8BA 3UT5B 3U30C 5LOVB 1TCMA 3ZHDA 3RVVD 5K69A 1PG7W 3SOBL 3D51A 3VXSE 3DVIA 5EZIL 4ILDA 3MOAL 3VRIB 4MMXB 1DBMH 1M2VB 4UV9A 3OKMB 5K59F 5HDBF 4JMXA 4ZFOL 3KMDA 4NS0A 2DKUA 1JPFB 1KB5L 3SDXA 4EIBA 5I23A 5KJRL 1CS6A 1MLCB 4GP8B 5LQBH 1PU0A 5IB2A 4WO4B 4PELA 1E50A 2VH5L 3RAJH 1GMEA 2VDPL 3OXRB 3G7TA 1Q6IA 4O58H 2QADD 3SYAA 4OCXL 4XBEL 4KXDA 1NGPH 5LXTB 1B04A 5FIEA 2OK0L 1I4FB 2FJFB 3D0VA 5TPWH 3VXNB 3US0A 3G6JA 5JPMA 1KEGH 1D7CA 4XXWA 2YC1B 4GKSA 3QA3A 1U33A 5ESAB 1UCBL 2X0WA 3EJSA 3BGFB 2ATPB 4ANVA 1A4KA 4YHHO 4J4PA 2E59A 4J41A 2H0PA 2GBAA 4HX1B 4POZC 1EWHA 1I85C 1GM9A 2NYYD 3QJSB 4UTBH 4Y4KD 3VRIA 4EUPA 5IIEA 4FA8A 3TBWB 2KQNA 2ED9A 3M7MX 4J3OH 4K8RD 2IG2L 1FP5A 5LGHL 3I55V 5CZVH 1CQYA 3N91A 4TNFA 3WB0A 3K6OA 2ETNA 4XMLL 4A2EA 3OJMB 5KOVC 5GZNA 1NSNL 5KBPA 4QLWA 1NIDA 4FXGA 1C5CL 2DE0X 1QR4A 4MDRA 2HA1A 4PVMA 1OB0A 2MCAA 3FT3B 5DC0A 2PTTA 3FKSG 2DQEH 3EOBA 4J4PD 1ASQA 2OXHB 2UZYA 4WZ9A 3WFHA 4W4LA 2NUPB 4JI6O 2ZYIA 4XXDA 3WNLA 4WWPA 2OMZA 5F3BB 4IOSD 4X9YA 1FN4A 3QRBA 5HDQL 4G6KH 2GSMB 1NBVH 3S5LB 4F8NA 2WQXA 3NCFB 1I1FA 2NQCA 3WFDL 5ELIA 1Z5LB 4UMSA 1B2WH 2QM8A 1UH3A 2AGJL 3VYNA 3QI9D 5CCGE 3KHQA 4M5SA 4DCQB 1VKXA 1K8AW 1RZKL 5G4MA 4GMTH 5FO8A 1DVTA 4I48B 4BKSC 4IOFD 1E4XI 5J2UB 5CF3A 3NQIA 4AVKA 3KJ6H 4K7FB 4YSTA 1G9EA 1A4JB 3TF4A 1BQSA 4HUWA 2VJXA 3GUFA 1T7XA 4TUJA 1BZDA 1ZT1A 2Z0BA 3EYFA 4X8GA 3NSYA 1I5XA 3RJDA 1RZPA 5E23A 1JV2B 4TSCH 4QYOB 3QIUD 5KG9A 4OZ4B 5KEZA 3BZFA 2ZSVB 5T5FH 3SYOA 3ZHTA 3VXUD 2G9HB 1JZJA 1HQRA 3MKGA 1F8TL 4PRHA 3N2GA 1ROWA 1UZ6F 4G6AD 5IQLA 4DGIH 4A7SA 4GG6A 1TQCC 3VFWB 1XNQO 3RVZA 1VFAB 3MRLB 3L1GA 5EOCL 4GG6F 1FAFA 1GGIL 1I75A 4RNRB 5BZDA 1Q90D 1KCVH 1P5UB 1WHPA 5DHVH 4EIUA 2XBTA 3MRHA 3MRFA 1ZLEA 1OSEA 4DPBX 3ZIMA 3S96A 5BXFB 2WYZA 2PN5A 3CDFA 4NFCA 1D9KB 3MPCA 1JI1A 1N68A 1JE6A 1KCKA 3RG1C 4QRQA 1M1KW 1T0OA 3FULA 1I9RH 2L6LA 4XODA 3KPPB 3NOIA 4KO5A 4ODVH 3HG1B 1JF1B 2IV9A 3OGCC 1GGCH 3UTSB 5CZVL 1M93A 3I5DA 3JD2A 5B1AC 1MFUA 3FRPB 2XN2A 3FUHA 4Y1SA 1PNCA 1P84J 3IPFA 4UM9B 3DRTA 1T3FB 3S4SA 3IWUA 1C5BH 2BH0A 3HMXH 1YZBA 4NHUA 4GS7C 4AT6A 1VQ8V 3US1A 2BCCH 2X5PA 4TUYA 4YQXH 5DA0B 2LFRA 2WQSA 3L1OL 4FLQA 4JKWA 1A6TA 3QJZA 4JI8B 3EYSL 3CWBH 3D09A 4K35A 2BOLA 3BMWA 1NGXB 2CRIA 4P99A 2AK4E 5C1MB 2IU3A 2FGWL 1UKQA 2YD3A 3NTCL 5FC9A 2PO6B 4LVNB 3EJUA 4JHVA 3V4VL 2MOGA 1BYOA 4XAWH 4MDJB 4MX7B 4OGZA 3V6ZB 1ZSDB 3OKYA 1IZ3A 2QSAA 3CPLA 4OGQC 1SYSB 2G75A 5FYLH 1I7TB 3BYYA 2BS9A 2MIZA 3NABL 3HKEA 4BUQA 2Q6WB 5JR1L 2PF4E 2CBMA 5BQDA 5J3HC 2EDMA 3RX9A 2C9VA 1N59A 2QQLH 3OPZH 4HDIA 4P23A 5D1ZD 3SKOA 2BOBA 4UXNA 4I1RA 4UANA 1CR9L 4H8UA 2VDQB 4LOUD 2FL5B 4EEEA 4QRPA 1G7QA 4GB9A 2AJXL 4Z77B 4I55B 2A83B 4LDEB 5E8OB 3D87B 1OW0C 2JJ2G 4L23A 2C9PA 1RLBA 4P2RB 4ZAKA 4D8OA 4ENED 4XDLA 4HIXL 3CS5A 5DD0H 3SY0A 3TL5A 3VXUB 3T3PE 4JF3A 1AJ7H 4QPKA 4P5RA 3NZ8B 1R24B 1JWSA 1E9OB 1IAIH 1TZOA 3RUGF 5DDHA 4EDXB 3V0IA 3B9AA 4ICGA 1KEMH 4AOFA 3K59A 1Y66A 2NNCA 2EE6A 3KPOA 4NM8L 1MRFH 3OVUB 4L0PB 3H7BA 4KJPD 2IANA 3P0YH 4MNHA 4FP8H 2DQEL 2YGNA 1QNZH 1K34A 3NK4A 3ATDA 2BM3A 4MXQC 4UOJA 3VDBA 3NFPB 2NX5A 3D85D 1T5EA 2UUBB 4UCRA 1OCRC 4JFYB 3U36B 3A4EA 5D55A 2WCGA 3BZ5A 5AL0A 2D03H 5E1IA 2PYJA 2JKWA 1EMTH 2ZKMX 4M8VA 2ITFA 4NNPL 1ZRUA 1MCDA 3KG2A 4LGPB 5CBHA 3DETC 3FT0A 3UTSE 1QO3B 3VI3F 4QTIL 1BM7A 2IPUK 1VQMV 3H3BC 5GIRA 3WFEH 2AC0A 1AP2B 3SYPA 1J5IA 4NKIH 3BAAA 3QB7C 4GY4A 1CD9B 3MCKB 1U8JA 1SM3H 2R2CA 5DCCA 5MERB 2DJSA 2DYPD 5DVMA 4KTGA 2NZIA 3EDJA 1W0VB 4TL5A 1IAIM 2QPEB 3RX7A 4O4JA 3CWGA 4BZ2A 1ZCRA 1E4KA 2ZSWA 3EJCA 4OFDA 5FDWA 3ET9F 4DV3O 4HETA 3J80N 5CD3A 3CVHA 1IQDA 5IFJB 2NX5B 3N1FC 2VITB 4JFYA 3GNML 5GONA 4MCYB 1TXKA 3HKBB 3DV6B 3MNZA 4MA1C 4BELD 4RFEB 1HKFA 1GMGA 3EBIA 4FQLL 4YHNB 3D3VD 4OF0A 1M53A 4YY3B 1O5DT 1V10A 1DQJB 4QDGA 1GN2A 4HVBA 1T89C 5K9OB 1FIGL 4IRJB 1AI1H 5HGDB 1M90W 3CZFB 4LMQI 2C3HA 2H32A 2VR8A 2OMWA 1EHAA 1TFHA 4FZEH 4HHAA 4UT6L 3R1GH 4JHZA 1XIWA 4DW0A 3QUXC 2ADGB 2PCFA 4PJXB 2VNCA 5C97A 4RGNE 4XCYB 3FUNA 4ZOEA 3PWPA 3QIUB 2D3JA 3F7VA 4ZPTB 1YEIH 4QGTA 3BLPX 1N67A 4FRWA 3EGDA 3UO1H 2J7LA 1XGZA 2A6JB 1L9MA 1CGXA 1TYRA 3Q44A 5B1JA 2IWEA 3JWOL 3K8MA 2LAAA 4HFWB 1K85A 2OYKA 1NVPD 3MNZB 2FEDC 3UTOA 3MJ8A 2ICEB 4G1MB 2DWDC 2FTKA 4HKXB 4IHOB 4YL4A 2G30A 2QMJA 3JZ7A 4NN5C 5JHDA 2Y5TB 3UPRB 4O4YH 3LQZA 4OZGB 3R8BB 5C0RH 1AQ8A 1VZGA 4RQQB 3TO4C 2YUWA 4JY6A 3F04A 1CDIA 2VLKA 4QYOA 4WWKD 3ZKMC 1KCLA 25C8L 3FAVB 3IGFA 4M48H 4EO5A 2P3YA 4H13C 1OAXL 3MHSC 1MLBB 3HW7A 4LCWD 4U3SB 1I5YA 5SWSE 1FCCA 2HJLA 3BDYL 3BAJA 3JVFC 2VXTL 3QJFB 4MJIE 1DBJH 3FUIA 5F9JB 2R72A 3RGVC 3UCQA 5GS2D 5BQ7B 4ZMPA 2K4WA 3LN9A 4OUOA 3UYPB 3MAQA 4WIQA 1AHWA 2H5UA 4U7MA 4A37A 4Q9CA 5HTSA 1OAJA 2ZUQC 1T1WB 1BECA 1IBLB 4DP8X 1OVZA 1NTZH 2A0LD 4YFDB 4DPRA 3CZGA 3TV3H 3ARDC 1IVLA 2Z34A 1AROP 2BNQA 4DPAX 1ZA3B 1JDCA 4TVPH 3QWRD 1Y4MA 3WU2Z 2XNAA 5LA6B 1ES0B 1Z9SB 5FYJU 1CLYL 5JIMA 3ZKQD 2OJZL 4OD2B 3H1IH 2C5DC 1DCEA 1KNOB 4ZODA 5KVGL 2CO7B 3TJTA 2PXYB 4EKWA 1QI5A 1QTSA 2J4WL 3MNDA 5E2UH 2JKRM 3B83A 5TFSH 1X5LA 3HB3C 3SDYL 2VDNH 3GXUB 3P9WB 5IB1B 4OB5H 3EH3B 4P05A 3DX2A 2VL4A 4LBEC 3O3UN 5MENE 1FIGH 3KDMB 5EIIG 2HRHA 4ICXA 4NQEB 4K8RH 4ZFOA 3HNSH 5T1LA 2DI7A 2ICEC 4JQVA 1PKQB 3LZFH 4B9IA 1RZFH 2EKJA 4Q6IB 2LJ2A 3ZHRA 2VN7A 1CICB 3FQ2A 4JANA 1FG9C 2B1IA 3UG4A 4Z8FL 4P06A 4OFYA 1RU9L 5ESAA 2EUVA 3IU4L 4QAMB 4B50A 1A7PH 5E4IA 2R39A 1X4ZA 4XNMB 3ILQD 3C9NA 3D3VE 5FHAL 2IPTH 3ATAA 2YA1A 3CXHK 3ZKND 1IC4L 1AI5A 4E42A 5E8PB 4HUKB 1MFAH 3ARQA 2YUXA 5I16B 1EHNA 1ZTXH 4FK5C 2J25A 3CE1A 5EIBD 2BPBA 3STLC 4AL8H 4M6MH 4RLDA 4IIQA 4LRNH 3PABA 2A83A 4AUUA 4LVOC 4N9GB 5D1XB 3C6EA 2YXFA 4E5XA 1OCZB 4KZ0A 3D07A 4ZAKB 5CD3B 4J1UB 4GI6A 5I6PA 2PZSA 4M1DL 1RPOA 1F2XK 4PY7A 4QRRD 4QHLA 2KB1A 2AEOA 1JX9A 1BZ7B 1DUYB 1OCWL 2QA4V 4LKCA 2WHVA 1FRGH 3KPOB 2JSFA 1XMOO 5E8NA 5IEHB 5EULV 4DK5A 2EIZB 4X2UA 1USZA 2HKOA 4GQZA 1AYRA 2NSXA 5KYWB 3H7LA 4L3FA 1DL7L 1DBJL 4R4ND 4CU8A 5LHDA 4DEPB 2IDUA 3GMLA 1HNXO 1T1XB 2H1LM 4K2UL 5EEVA 4KX7A 2W60A 3P4OA 3W0WE 5I0ZA 1CYXA 1KPVA 4IQHA 1EN5A 1A2YB 4WEEA 2NT0A 3L4WA 3RWGA 4NHCL 4S2SA 1JQ0A 3RN4A 5JIHA 2ITCC 1EDYA 3BPOB 4S0SD 1M1XB 2X2YA 1FBIH 1E5ZA 1WCBB 2AW9A 4MJHA 2W6IG 3LH2H 3WDHA 2Z91B 3C6LA 3BWUF 5L3GA 3CXHJ 1NC4B 4ZSOB 2VLRE 5SWSA 1A7OH 1K9MW 1P6WA 3GSVB 1FYTD 1OP3H 4AC2A 4EVNB 4NPYB 4KO6A 5FGRA 4HV8B 1ZWIA 3CFJA 3FN0L 2OL3A 4XVSL 3K5SA 5FO7A 4HJ0C 4OLEA 5EPMB 2WBJA 5BOJA 4ZZFA 4RAVA 1UKSA 2FB4H 5D4JA 1Q72L 2VXQH 4M6AA 3MNVA 3N06B 3RNQA 5CGBA 4O4HB 1BHGA 4N8VA 5EF0A 4L9LC 3QWQB 5CGMA 2NY1D 3EJYC 4TTGA 5L0QC 2BSBA 3SGKC 2VN3A 3F58H 4PMFA 3ETGA 4B5EA 3QEHA 4HUWB 2ARJA 3ETBF 3MFFB 4BWTA 3QZOA 2ENSA 3ALPA 4AIXA 2YIDA 3NJNA 3O3EA 3RWCB 4L9DA 4WTZA 3DX0A 4LXFA 5CEXA 1KTRL 4PB0H 3IJEA 4X6CE 5JZ7C 2JCCF 2GUOB 4KY2A 3OEEG 3ATFA 1VB9A 3BZFB 3DOSB 3QCVH 3ESUF 4H8VA 4LFBB 4MTFA 1I3VA 4I0PD 4WY7H 1G1OA 2G9HA 1OZ0A 2VUYA 1YEEL 2GAZA 3U0TA 1YN7B 4NJ9H 2ENYA 1F02I 2YIBA 4ZMWA 1VEOA 2NY6B 3F7YA 5LA6A 4FPPA 1ES0A 5TGBA 2PO6C 1X4TA 1RUQH 3ATBA 4LVNC 1CDGA 4YDKH 1KUQA 1HAUA 2EXYC 2VH5H 4X7FC 5DFWH 1H38A 1A66A 4PRPD 5BS0B 2HCZX 3O65A 3OKNB 3FZUD 2VR3A 4DK3A 5DSCA 4LKXA 3N9GL 4XO5A 1BVKB 1RZJH 4NCC2 3C5ZA 2QHRL 2DQ0A 2YMOA 4OUUB 4HK3N 1EN6A 1ZVSB 1WWWX 3SGIA 2XACC 1F86A 1A6WH 1TDQA 3K4ZA 3OKKA 1B4RA 2DB8A 1KJMB 1MOFA 2KKWA 1T5KA 2D8KA 3ALXA 4WFBV 1KCRH 2CDEA 1U3ZA 4FN0A 2X6MA 3K9SA 2Y7OA 1VFBB 1Q9KA 3ECQA 3PWUA 2DWEC 1P7BA 5SWZA 4K9EH 3EFOA 4YDZA 3ZPDA 3LH8A 4X62B 3GS7A 3WMPA 4HPOH 3IU4H 5BRZE 5I1AA 3QEUA 3F7QA 3SDAC 4FG6C 4OCMC 3BDYH 4N1CA 2F8VA 4PJCF 4HULB 3OMIB 2FSEB 2F5AH 3J27A 3VFVB 4IT5A 3WUWG 3FQWA 1NKGA 3HKFA 3TN0D 3IXAA 5JJNB 1TVHA 2FZ3B 4WUUD 4QGPA 4AQ1A 3RVTC 3CCLV 1BD2B 1KELH 4I5BA 4D8PB 1DVUA 1ETB1 3RGHA 2X9XA 4FFYA 4GW4A 2XN9B 1Q1JH 4KJQC 4IK6A 3FQXB 2V7NA 3K6IA 4EBQH 4EN2A 3GI8H 3HZVA 4ABQA 2MNWA 3CRQA 2JTYA 4MZRA 1PF3A 1NBVL 2XWEA 2XC8A 3RDTB 5I1HH 2ZOLA 3WUZA 5L9DH 3OR6C 3RVVC 5EEYA 5CMAB 4TNEA 4RQFA 3CVHH 1E5AA 3ZN6A 4F5CE 1KULA 1J0YA 3IMUA 4FXKC 4O58L 4XBEH 2Q5ZA 2PTUA 1N34O 2V5SA 5EDXA 3WTTA 1U8MB 1ZSPA 3OXRA 2FO4B 4OF8A 4EOWL 5LQBL 5KN5B 3RX8A 5DZ9A 1VQOV 4WNQA 1FQ9C 2ZCKH 5CZXC 3HG0A 5AAMC 5JMOC 1FPOA 1EEZB 1RULL 4PP2A 2WUCL 5A6IA 5DI8B 3AW5A 2PPFA 3LEYH 3ULSA 4E2LA 1G5GA 1NKRA 4KQ3L 1WDAA 1RZFL 5T5FL 3EO0B 1JBJA 4ZJ9A 3SE3C 3GLDA 4QR7A 1L5GB 1UZGA 4JI2O 2Q7HA 4U7NA 1A7OL 2C34A 2P48B 4YSDA 5FUZL 3ECBB 3VACA 1KJ2L 4QNPF 2CMRH 2Q68A 1V54C 4U3JA 1AGBA 1IARB 3HPLB 4XVOA 3V6OC 4MYPA 5C8JA 4OZIB 1MCWM 5L3FA 2ZYHA 2R2EA 5F7DB 3AITA 2NPLX 4WU5A 3CCHA 2X38A 3UTZA 4DGUA 1NWPA 3UOAB 3DV6A 5LYJA 2XAJA 5F1SA 3ZTEA 5FLXN 1FZOB 3QIWB 3TJPA 2F53B 3U7WH 3BRCA 4LBEB 5GRYA 3EYOA 3ME0B 4NTYA 3VGEA 5K39A 1I94B 2GPZA 5EBMC 3A4FA 3FOMA 1PCXA 4L5FE 1HHHB 3UJJH 3WSQL 5LGJA 5HDQH 3CVIL 4EFBA 4BK8A 1SLWA 1VERA 3NMEA 3OKEB 3FUKA 4O2FA 1QR1B 4IYKA 1G6RH 1NLBL 3BPNC 3FB7C 1F6LL 1TKWA 1HIMH 1XXDC 2DQJL 2PCPA 4H25A 3KPRB 4PGDB 4ATTA 4JKMA 1FO0L 1JPGA 4KC3B 1BD2D 4UFZA 4UV8A 4K55A 4PW3A 2AZ0A 1P6FA 2PABA 3LIUA 3SPCA 3NAAH 3INOA 1NBZA 4LLVA 4NEHB 2AAAA 4FULA 2A6IA 3CP1A 2YUVA 3WEBA 4AKPA 1EZVY 4MKMA 2O5XL 4AZ8A 2JF1A 3U48A 4DR4B 3HPLC 4X0KB 1AIZA 1OV8A 3QJRB 2DJMA 2IMMA 5B1CA 2R83A 2UV3A 4M6NL 4P2OA 1A6VH 3FU5A 2DQFB 2CSPA 2EO7A 2H26B 2ZYRA 3HI5H 4GSDH 3AROA 5INCA 1IE4A 3ULVF 4OCWH 1NCJA 3N85L 4GEIA 4YSSA 3B5HA 3BH4A 3K57A 1OSZB 1KJMA 4PJIA 2IPKB 4QJ4B 3O2WL 3GXNA 1RJLA 4K9EC 3G6JE 2VLLB 2ADQB 2HT2D 2DJUA 3D2UA 1KIUB 3D4ZA 4LPXA 3P0VH 4L29A 1R19A 3F58L 1CFNA 1SERA 4M6OL 1F4YL 4ASUG 3HR5A 4PGCA 5DQ9A 1SY6H 3K4DA 4HUUB 5C0AA 1YSOA 5DHVB 5ISZA 4MTOA 4PW4A 3I9GL 5EU5B 3T0EA 4CN4A 4AGMA 5JIQA 5BR8O 3SDCD 5CN1A 5I19H 5M95B 1V27A 3BJ91 3CUPA 1FL3A 1SESA 5IYCO 4PLKC 4UCOA 4RMBA 5G5DA 5C08B 1EVTC 1JF1A 2JELL 3O2WH 5GZND 2JJSA 4MAYB 2RMKB 3ABUA 3WKYA 2J44A 5FCSH 1GMIA 4OZGE 5KZCB 1THCA 4FG2A 1RK0B 4O4IB 2CKNA 1X4YA 2P67A 4OJAA 5E2VL 2BOCB 1H2SB 1CLCA 1XX9C 1KMIZ 5ITFA 1SJHB 4PJ7B 4B7LA 5IBLD 4LLWA 2MQGA 3GSUB 7FABH 1PZ3A 3GLEA 3N1PC 4NKIL 3CFKA 1JVLA 3FH7A 1I3GL 1OXYA 3B9KC 4OLXH 3VXNA 5CR1A 1AXSB 4KK9C 3RYFA 1P84K 4MX7A 3V6ZA 5D7LB 2H6PB 4CSPA 5JOPE 1PNLA 4BIZA 3KAAA 3VU1A 5D96B 1GYWA 3CBRA 2OMUB 1Z3GL 4R83A 3DHPA 3P1VA 3P3PA 2AJXH 4X4ZA 1LDPH 1WZAA 2BOBB 1AD9A 3GWKC 3GKWL 1EXGA 2YRPA 1TPXB 1IKFH 4N8CL 1J9SA 3JTTA 3RWHA 4ELMA 2NY3B 1WICA 1QLEC 4XE0A 4KV5E 5L7XH 3QEQB 1ZGLP 1MELA 1N9PA 4RSVA 1D3CA 4OR1A 3OHMB 1KYAA 4EZLA 4NKGB 1S6NA 5J11B 1BG1A 5KAIZ 1YNTF 1CZ8H 5J57B 1OIOA 2YLKA 2XVBA 4LVOB 2B5IB 3QCUH 3NFNA 3QR2A 1ZY9A 5LUMA 4QY8B 3T4DA 2CIKB 4L48A 3FQRA 3STLB 4X8CA 4JASA 3TCUA 2V2XA 5F8QC 3UL4A 1YNLL 1LNUA 1W8NA 4RGNC 1U8LA 4U2YA 4UTCA 2VLRB 2A4CA 1QFHA 2BDNL 1DJGA 4MSWA 4Y8DC 3AM8C 2JTDA 1YPZF 1BAGA 3KPRA 7TAAA 2ZZUT 4QOKD 1MW2A 4PY7B 2YARA 3T1FB 1ZL8B 1FDLH 2NY1C 4K23H 1M3IA 1M2OA 3L5WA 2ARHA 4MB5A 4TVPE 3WFCL 5J89A 5EIBC 4KWUA 2BSSB 2RDCA 4N23A 4X66O 4J8QA 5GGUA 4MD0B 3FJTA 3G6DH 4GT7A 1CFSB 2BMKA 1TJIL 3DDFA 4B7IA 2OMTA 5DJ8A 2EVIA 3Q2NA 1Q81W 1TEFA 4FJYA 4S1RL 4G9FB 5JW4M 1TJGH 3APNA 1IBMO 4APXB 2BWIA 4JDVB 5EIVA 1F1DA 2PXYC 4LFBO 2FECI 4E9VA 1N0XL 4ZFGL 1WEJH 5FO8B 3SDCA 4IOIA 5CU9A 1OTSC 3SN6N 4YXLH 2EIMB 4ZW5A 5INDB 1NCOA 2PYED 5C0CE 2UXBO 2N59A 2ZX5A 3ZDZF 5L4IA 1BMGA 1XR8B 5MEOA 2FX7H 3RVXC 5DMGD 1BOYA 2YXWA 2B5UA 1U93A 4X7EC 1JZ6A 1XQ4A 3VFMB 4A6YA 2MW2B 1G6VK 1UXWA 2F7IA 2YQGA 3GBLA 3CSYA 5DVKA 4DHLA 5KVEE 2OWOA 3ESMA 1CQKA 4P5TC 2EIKC 2H1PH 3OB0H 4APXA 2ZM6O 2KZBA 3GK8L 1YC7A 4LQ1A 4Z3FA 3BKML 3EH1A 3PJSA 1LWJA 2UY6A 4JI3O 3TT1H 1CB4A 1R3IH 2DTSA 1FORL 1PKQE 4QXWA 3QJXA 4K8RC 5HHMB 3ZRFC 2VQ1A 1QRKA 5IESH 1OO2A 1PY9A 3VWKB 1ZHBB 5DS8B 4U1HB 4N87A 3K79A 1D7FA 1P5UC 2DM4A 2IFGA 2XHBA 1KN2H 4Q14A 5C3LD 1DF4A 3BABA 1C1EL 2DM3A 3GRBA 4MAYC 1ZK9A 2WIIA 2WVUA 4PHXA 4MS2A 1HYSC 1DANT 2WGNB 2W9DH 3P3TA 3QXDA 4RGMB 5FHAH 1BG9A 2L35A 4WENB 4L8BB 1BE3H 2IGFL 2PF6A 2X70B 3HUJB 4FNQA 3TA3C 1G9MC 1U36A 1J12A 5F88B 2H6PA 1F3JB 1WWBX 2COQA 1XSJA 2Q9OA 3V0DA 2H3OA 1GZQB 3KCWA 1AVMA 2DQIL 1F90L 2LU3A 4AZUA 5B22A 3ENEA 1BVNP 5D93B 3VH8G 4G7VL 1DSFH 5B1KA 1IT9L 4OKVB 4ABVA 5IHHA 4M7LT 1SLXA 2WAHA 5BV7H 4WF9V 3DOHA 3VUAA 5ISZB 1I7FA 3TXSA 2VS0A 4O2CB 2WLZA 3WIAA 2AQ1A 3AY4C 1SY6A 1B3IA 5BZWB 1R1BA 2Q86B 2F23A 3T4YA 3DX8B 3GC3A 4B3TO 3KPRE 5EO9B 4JREB 5FO9B 5EIIB 4TQFA 3KYNA 3GBEA 4GKJO 5AYTA 5AKRA 3I74A 4X6DB 3T8XA 1JZGA 2MKWA 4BFGA 4OF5A 4XCFL 4Z9KB 3D50A 2CO7A 5LP6C 4K3HA 3EFFB 4YN3A 2K78A 2VW6A 5F0MB 2W92A 3MRGB 4JUTA 5GS0H 3OPUA 1NEZB 2YMXL 1FD9A 3K58A 4H44B 4TL4A 3QUMH 3EGSB 3PJSK 2DDQH 4PEEA 5E56A 4LLWB 5KSBB 3G4SV 1QSEB 4NQSA 2QWRB 5ADOL 3FU3A 1BL8A 5I6MA 4GXVL 2XN9A 1UQSB 1E27B 4XVJH 2R56H 3F62A 4K8RL 3RY5A 3HOGA 4LIQE 4OZIE 3BSGA 3DSQA 2KLRA 2FQFA 4J5VA 1SEQH 2BZDA 2BIIA 1E3XA 4CILA 4WSJA 3A5VA 5E2TL 4XP9H 5J6GB 5CCKL 2FK9A 5HDBB 4MNHB 4HS8H 3AT0A 1Z9MA 5JHBA 1AXIB 2ZX8A 3AB0C 1BZ9A 3ZKNC 3LRSA 1R3LB 2B0SH 1H3UA 2HFFB 2JNZA 4FZ1A 2RGSA 3F84A 4K7PL 4NWTH 2HPTA 4AV0A 4D7BA 5HYJB 4HKZB 3IC9A 4L9LA 3KPMA 3W0WD 3ARBC 4NUMA 3B1UA 4QF1A 4PBVC 5GZNC 5ITZA 4MA3A 3HNTL 3AU1B 3M07A 4XWOD 4XMVA 1HZHH 3O4LD 1CT8B 3VW3L 4MQ7B 3MOAH 3QEGH 4ODUA 5K9JH 4JGNA 3RWDB 5AAPA 1MJUH 5E5UB 5E8NB 3CZFA 2E9BA 1J1PH 5B8CB 2APSA 2OMXB 3UPAA 3VFUB 4HOMA 3CCQV 2IWGA 5J6GA 3GBNL 4YMPA 3VBBA 3HE7C 3KYKL 1UVQB 4BFBD 1LNUB 5EBWC 3ETTA 1WBYB 4N8PA 2UUCB 3UO3A 4NHCH 1TJMA 3Q8EA 1A1OB 5KBNC 2Z65C 2Q0ZX 3K0WA 1MFEL 3BT0A 4U1GC 4ZPTA 1I8LA 1AIFA 1VF7A 5JW3H 1CYWA 2VISB 3FH5A 1VCAA 3CLEL 4NSKA 4DPCX 3IFLL 1YJDL 3IGUA 4HKJA 2X4PA 1GKFA 5B1JC 5J13B 5AYQA 1ZLVH 3CJHB 5T3XD 2GW5A 3ISWA 2LOEA 1D5ZA 3MJ8B 2F54B 3JSSA 5CBEB 3HFML 4OV5B 1GOGA 4OJFH 4J3BA 3ULVD 3QDJE 4I85A 4NXKA 5DFVD 1HWWA 4WHTB 4JO3L 4Z7WE 5F0PB 3VFUA 4E9XA 3SYCA 3MV9E 4A2DA 5BUAA 4YSQA 2XT9A 2X3AA 2CGZA 5AAWC 3EFDH 5I0DA 3TNMA 5IT2L 4FD0A 2WJ5A 2WD0A 1IKNC 4UNIA 3KHOA 3FB5C 2E86A 3PWPD 4K07A 1FF5A 4O4HA 3HCVA 1PY4A 4GAYA 3UTPE 2WBWB 3QW9A 2YQ2A 3ABKB 1H3PL 2IGFH 4PJFB 3ZE1F 4G8IA 3ZT7A 5JOFB 2Y6SD 1NGYB 4PRAA 4TSFG 4B9FA 5B38A 4ZFGH 2Y6TE 1I8IA 3KLDA 1AI6A 4F15B 2QADC 5A2LH 4XWGH 2BS8A 1VF6A 3ZBHA 1BCIA 1TQUA 3CDCA 3Q48A 2YWZA 1IM3A 3LHPH 5CCKH 4NO2A 1X7QA 2UY7A 3ARVA 4I2XA 1J5OL 3UC0L 1GKOA 2ZXWC 3RWJA 2B1AL 4F92B 1TZHA 5C6WH 4K71C 3RFZC 1S9VB 2YA2A 4YJ2B 4B3RO 2BS71 4OGAD 3HG3A 2ZE7A 5CILH 1RZ8B 1ETZB 4JFHD 5E94B 2HKHL 5SV3A 4HJ0D 5ABAA 4LF6O 4B9GA 4BWWA 3F7KA 2IFFL 4JE0A 1OPGH 4Z7UB 3B37A 4X1YA 1MAML 2QHLA 2UXTA 4GMSH 2E9JA 4LEXL 4MMXC 3WELA 5C0DA 3OZ9H 4UIKH 2X6AA 1I8IB 2JKLA 3I75B 4NZTL 4HUUA 5AZ2H 1NEZA 3RVWC 3MJ9H 2XYBA 3D4YA 5D1XD 1OD7A 1A3RH 2AJSH 4LLDA 1ZTXE 2PGGA 5EC2C 4ZHQA 1AQMA 3IN0A 4GRMA 3PGDB 3W0WA 5A2BA 2PW1A 1WZKA 1MWAB 1S3KL 3HUJA 3QFJD 5GXBB 3G71V 2CPCA 1R3HB 4JEGB 1ADQA 3V5DB 2JB6B 4NO0A 4JI5B 2HFGL 2WKLA 5D70L 3UO1L 3DVNA 1HFUA 4JPIB 4OKDA 5DUPH 4R97C 4PBXA 4JJOA 3AU0A 3EO9L 1IM3D 1WYJA 3DBSA 2IBZY 1K8IB 5EUKB 3QORD 3IDIB 1EHXA 2Y0SA 3MJ9L 4GS7B 1EEYB 1JWMB 2ZINA 1B4JH 4HIJA 5PCYA 1WAZA 3VRJB 3P4MA 1EJ8A 4IW4C 4X1IB 1KJ3L 5DVLA 5F9WB 3TEYA 3L4YA 4GLRH 4Z1MG 2VDKL 5KHJA 3NSFA 3TN0C 1G7MA 2ATKB 3BDBA 2DYSB 4N2MA 4JFDA 5AW1B 1P5VA 4DV6B 1RUPH 2C3WA 4L3CA 1UB5B 1JL8A 2J88L 3ARPA 1M7IA 2DAVA 1AZBA 3PCYA 4HMEA 4YDIH 5CP7A 1WC7B 2XETA 1J10A 3NEEA 2FX9H 3T65A 3IDNA 4JY5L 4H37A 2VWJA 2WA3A 1G9MH 4PWKA 4HX1A 1U3YA 3NAAL 2QMKA 4HP5A 3RIAK 5KYXB 2ORBH 4E41A 4MJ5B 5TH2B 1WPBA 2OS7A 2N7SA 3GSQB 3II1A 4LMQE 4DGWC 4JO1L 3AG1C 1AIFB 3H9ZA 4NWUL 1KJ3H 5FHBH 1CFTB 1G4MA 1YNKH 4KK8D 3S3JA 3OD4A 3K6SB 1DVFB 4XP6H 3B4SA 5IFAL 2J2ZA 3MQIA 3AC0A 4ETQB 2R0ZL 1T6VN 3I02B 4LHQB 5DURB 1H6TA 3RNKA 3SOBH 2HRLA 3N1MC 4C4KO 3STLA 1BCCH 2MCPH 4ZFFB 1JFQL 3GS4A 2YICA 4DK0A 4WSGA 5LMUB 1KP3A 3CFUA 3ECBA 4PV8B 5EPMA 4EN3A 4M43L 2Y9RT 3JTSA 3KYMB 3L8QA 5IMOB 3QVAA 3CGTA 1EIBA 3QG7L 4DR3O 3KPMB 4G8GE 4M56A 4K15A 1PZCA 5HYFA 4GAYB 3KLLA 4PI2A 3H1ZA 2EZ0C 1RIVL 2K8QA 2WQWA 1CG9B 4I9QA 3G80A 2ADIB 2AJ3A 3HJ0A 1PJ9A 4PJ8D 3ESVF 4WUKL 3T0AA 5EU6E 1NFKA 4N4YB 4XRCB 1ZE3H 4QRPE 2Z7ZA 1SJMA 5JHLA 3P32A 1MJ8L 3MRJA 2RIKA 5BNXD 1CL7I 3HAEB 5DJYA 3C2AH 1KCSL 4X8AA 2W0FA 3EJQA 3RJQB 1F0LA 3UDWA 4M43H 1H8EG 1P7HL 4PR5A 2AJZA 3HS8A 1WS8A 5I6XC 1G6RL 1NLBH 2OTUB 1PX4A 3KYMA 2W0LA 1EZSA 1BD2E 4NSKB 3GJFA 3ZGHA 3S5LG 2UY6B 3P30H 5HHPA 2XBZA 2QQLL 3OPZL 4FQHA 5LG6A 3O6KH 2UVEA 4MTXA 4M1DH 2Y1ZA 5SWQA 2VZSA 3MRMB 7FABL 4Y4KA 4MA7H 5LBSA 3KL3A 1J8HD 4FQXD 4JREC 5LVEA 1MAMH 4GMSL 1MJJB 4LEXH 5AB0A 5L6YH 1VQ9V 1NEPA 3SJCC 4MTMA 2JS5A 3VD3A 3ZYJA 4MXWL 5AZ2L 1AOZA 1DQLH 4D9RD 3V8CA 3FAXA 4WK0B 5DRXB 1A3RL 2AJSL 3B2DC 4L4TD 2LW3A 3IDUA 4GRLB 5BMVA 4F9PC 1RUAH 4LC1A 3CHPA 5TF0A 1NI8A 3H1JH 1UXLA 3SQOL 4KL1A 4I0XA 2MOVA 3LPOA 1G1XB 1GZQA 2H4EA 4WK4B 4KUMA 5EO1B 2HFGH 2F53E 3ZDXE 3HKCA 1ZLWK 5HDLA 3ZR6A 3V2AR 1Q3EA 3Q6FB 4NQEA 4EDWL 1S5IH 1EO5A 3F05A 4NXSA 3WXWL 1EEYA 5LXTA 1YEIL 4YHOH 5BJTA 2OM5A 1YSCA 3D85B 1GW0A 3PJLA 4IMLB 5D7KD 1OF0A 5E2JA 4V2BA 3VQYA 3EF4A 4E41E 3SGDI 1KCUL 4FFTA 4NXNB 2AI0L 4J7RA 3FUDA 4RDBA 2QSQA 2FB4L 1ID5I 3H01A 1UA6L 3MNWA 3ZMUA 5E4EC 3FB6C 3DSNB 1J8HA 4X6CB 1QNMA 2CA4A 3VXPB 1WC7A 1OKEA 1U21A 3WFCH 3HPJA 5EUOB 3QI9B 5C07B 4F8QA 3DXRB 3LIZL 2HR3A 1Y1DA 1LLAA 5ICZA 1CXEA 1ULVA 2K6ZA 4IJTA 4N21A 5FO9A 3L54A 3ZDXF 3FX7A 1W0JG 4PP2B 1RKRA 2VXTH 1XH0A 1Z5HA 5DEGA 1KIPB 3PNWB 3O6LH 4GW1A 1ZWIC 4HWZA 2AEWA 2FTAA 2M26A 3ZYIA 3RJOA 3ZT5A 3AMKA 5TPWL 5D72H 3IBOA 3ARGA 1A8ZA 5GHWL 4K94L 2I24N 2N74A 3HI1B 1U8CB 4BSVA 3FCSB 1VGKB 4N2KA 4K71B 3RFZB 3I6KB 3V9EA 1U91B 1KPVB 3SDXF 1JFQH 4NKOA 4GAJH 5D70H 3L3GB 5ENWB 1WNSA 4AVJA 5FECB 5L3BA 1FVCB 1OCWH 2EYTA 4N20A 2R9HD 3P4MB 3RE0A 2EEDA 1UOVA 4TQHA 4WI0A 3APQA 4ZS7L 4EN3C 2HAZA 3QDGD 2OI9B 2QADB 3Q8AA 2NLJA 2YN5A 5FF6B 4FMFA 4HJ1A 2Y48A 5CN0A 1YMMD 2DQDL 2VW4A 4LOFA 1T21A 4PJIE 1CBJA 5DRZA 2AXGB 1VQNV 4Q58C 3KS0J 2H41A 3VXMA 1CD0A 3AS0A 4EQ2A 4JRXD 4MVBC 4PWEA 1AS7A 1L5GA 2H3NA 3O8XC 3ASOC 3D25B 4ZT1A 4D9LH 2C1PB 2IGLA 4LF4B 3CXDL 3NJVA 5LGJB 4ZUTA 1DGSA 4WUKH 2CAKA 2CE6A 5MENB 3TGXA 2LGNA 2ADFH 1E90A 3V10A 5KSBF 1IC5L 1W0VA 1ZXKA 4CSSA 3VB9A 1JF5A 1NCBH 1XXFC 2X2IA 2FT8A 4NUPA 5EOTA 1CE6A 1DJHA 1QLFA 1R1CA 3T4AA 4PTUB 3O81A 3G5ZB 3UZQA 3L16A 1S4IA 4HYTB 5LXGL 2VKXA 1KLFB 4JVUA 3CVDA 1IBYA 3NJGA 4ODUB 2XG5A 5FK9A 4GINA 2LQTA 1GC1H 4CN1A 1TNNA 4HJIA 3FB6B 1B0IA 1P5UA 3FO2B 1I08A 4H0IA 4OCXH 2NY4D 3CFCH 4AYFB 3QFGA 5EN2A 2UUDH 3FBKA 4F91B 4UQIM 1JPXA 2K9PA 3CMOH 2X6CA 2XXCB 4C56E 2F5BH 1L0LH 4S1RH 1AE6H 1CTMA 4UQAA 1GCYA 1O7VA 2XUMA 1OAZH 1JOIA 1YMMA 3JT2A 4BW9A 1UCTA 2AK4B 2V5MA 3D1MC 1IXBA 4IOIB 4XVUC 1S7QA 1CDCA 4IDJH 2EIJB 4FNLL 4LF3A 1MCOH 2W9EH 1EX0A 4WHCA 3MJ9A 1DE4A 1YEGH 3DX6A 5I0VA 4FE9A 1YHPA 1XH1A 4LEBA 1FFXA 3RWEA 5A1AA 3EOTH 2Y7MA 3A6CH 3EJPA 5FUOH 2XFGB 4LF9O 2P5WB 4M62L 4P59L 3WEMA 5A2IH 5IG7A 2ITCA 3FCTA 2G3XA 4J28A 1X5HA 3SPGA 4PUBH 1GN4A 3BT2H 2WAMA 3F00A 4F15C 1TQSA 2OX5A 4HBCH 4MBOA 1E8XA 1FLRH 4HWEL 2YMXH 2WLJA 4M4RB 1KTJA 1YMMB 2A77L 2FHCA 5AYUH 2CGOA 1A9EB 2QTOA 3L3OC 3OTOB 3O6FD 4DVRH 5JIDA 4L29B 4QPJA 4Y19A 1CI5A 2YI9A 4XNZB 4XMZA 2EIEA 3BFQG 1KCBA 1FO0B 2ZOTA 3HHMA 4IBLT 2QVIA 4JO8A 3TPKA 4EIGB 1RD6A 1AHWB 4J23A 5I6XB 5I1KL 1JYVA 3DXRA 4TPRL 4M61B 5DUML 5D5MF 4FQCL 4DAGH 1KYDA 4CH3A 1ZEAL 1TTFA 1M9SA 4QMEA 3QXAA 1HYSD 4Z7VF 2Z31A 5C3IA 3QULA 2HFEC 3RVUD 1KJVB 2NTFA 4MB3A 1G7HB 3QDGE 2DEYX 4P23C 4NC1E 4ZOAA 3BFOA 2WKGA 2AZ2A 5DWPA 1E9PB 1F90H 4XNYL 3QC5X 2XQYG 2AHYA 3L7EB 5C0DB 4Y7OC 1ZGLB 1CWVA 4NLHA 4PJDB 1L9QA 2NW3A 4Z5RB 3CHXA 4PS8A 1LO3H 3GXPA 4BH7A 3HKCB 4AEEA 4IU2A 2F08A 4JM2B 5CJ5A 4JPKL 1AQHA 2WLLA 3ZS8C 3CCSV 4PJ0Z 2GSGA 4NN6B 3ABMC 3W7UA 2DN7A 1I1CA 3D8MA 1AGDA 2XU9A 1OSPH 2BHZA 2GC7C 1U8PB 1EGJA 2Z64C 1YA5A 4LFAO 4N2IA 3VXQB 1CK0L 2R9HC 2X1QA 2XX0A 1M71A 4FXKB 5JORA 1XGTB 2GTZA 4MXVF 4Z7NB 3IJ4A 1G7LA 2IJ0C 3M7OA 1W6WA 3OWRA 4RMWA 5HY9A 2Z35A 4K8ZA 4G42A 5IF0B 1RV6X 3CFTA 4MS8C 3O41A 2BVQA 1IX9A 4NAMA 4J2QA 4PJ9C 2XIBA 1I8UA 1NOAA 2DDQL 2XFXB 5J12C 3ABMB 1WAEA 4M7JL 1XQ8A 1KU9A 5KS9F 3HG2A 1GJUA 1ZGLM 5GS0L 2XOTA 4C7UA 2EJ7A 3O3AA 4LDOB 4NJAH 3GXIA 4UCSA 1T04B 3HRZA 1QSEA 5IW1A 4PCKA 3MOBH 4PTTB 1LWHA 4WKZB 1SFHA 3S2CA 4WGKA 3CEIA 3R1GL 5I8KH 4PJ5D 1MXGA 4FADA 2XICA 1JXKA 4OSUL 3H3PL 4U6TA 4YXKH 5HJ3A 3VWKC 3TF7C 4TVPL 3RIAF 1KWGA 1YMME 4ZS6C 4BFNA 3WD5L 3CZSA 2BMKB 1F4XH 2FYYA 4DUXA 1GC1C 1Z32X 1OGPA 2I07A 2FECL 1E79G 4L3EA 3ZZQA 4DN3L 1EZVX 1R5IB 3SBPA 3DIDA 4CS3A 5K1XA 2AEIT 2B0SL 4WWKB 3DJRA 2WLIA 4XCCL 4LSTL 2DWEB 5TH2A 3GEFA 1KC5H 4KNSA 3RTLA 3LRSB 5LMUO 1VCBC 2DJVA 1CVRA 3SJQC 5DQDH 5AB9A 4N0UE 5KVEH 1T04A 3HRZB 4DF9A 1T89A 3V5HB 4S2SB 1QEWB 2YN3A 2WLYA 4PJ8B 4TV8A 2BRRH 2JXMB 2NY0B 4BHUA 1BT8A 1XNQB 1T21B 3V4PA 3ULVL 4KKZA 1WP7A 3EZ8A 4N2LA 4XTRD 3U1SL 1CTOA 1IBMB 5F7AA 4QJ5B 3BCFA 3S34L 3VG9C 3V79C 2D7PA 1Y07A 2EXTA 2VLME 1HDMA 2LGQA 1LILA 2I07B 2VDQL 3T6WA 3UADA 5K9JL 4UTAA 1E4XH 4NZUL 3ZIYA 5IW3A 1GYVA 4Z23A 1UT2A 3QH3B 3MFGB 4ZTOL 1BGYH 4OZFG 4JI0B 4B6ZA 3TBWA 1SJXA 4IYIA 1QVOA 4LLQA 5KVEL 1B4TA 3K5RA 4UWQB 3TIEB 2JGDA 3Q06A 3BT2L 1TGOA 3MV7D 1UOLA 2A99A 2ADIA 2AJ3B 2Y1YA 4GSUA 1JNHA 5IBTH 2HJFB 3DGEA 4ODHH 3VWKA 15C8H 4JZOB 5DS8A 5GGSB 3GRWL 5AYUL 1C08B 4AILC 5IP4A 3FQNB 3LZNA 1CBVH 3VYPA 2W0FB 4ZNCD 5IT2H 2BVOA 1ZHNA 2PWHA 3MHHC 4UQ3B 5DXWA 3JARA 1MF2H 2NUPA 4IBVA 3BO8A 3H4HA 4M5YH 1WVZA 3NQKA 4OLZL 2GI7A 3NA9H 4WEBL 1CXZB 4IRSC 4LPYA 4ONOA 4P07A 4UILH 2D2CC 4G28B 1Y74B 2XN9D 1V55B 4FABL 4YLBA 2AV7B 4JI1O 5B1OA 2AJUH 1O6SA 5IGXL 1F6AB 3QFJB 4J3XA 4IIQC 2B1OA 1MHPH 1SY6L 2JKXA 3MDJA 4A7UA 4BFIA 3NP3A 1ZGLA 2H94A 4JN1L 1IAMA 1FCGA 4RZKA 2HJFA 1MJJA 1WF5A 2ITDA 4KITB 1IEAB 2ZT9B 1EAPA 4Z76A 3ULUC 3RTQD 3MCG1 2R15A 2BWDA 2IH3C 2G5BA 3WV0A 4D9RE 3CZNA 4XMKL 4PYHA 1UG9A 1X5MA 3GT6A 3INUH 1NTDA 3MODH 2LHAA 4HWNA 5CZKA 4F7TB 2EUWA 2VWKA 4H8QA 2NCMA 4CS4A 1T03H 3BH9A 2VZTA 1QABA 5EIQA 1OSPL 3W2DH 2IIJA 1BQHG 4POYA 1CL7L 1QSEE 5ANME 2ZG2A 1FXVA 3SGEH 2XV6B 3ARFD 3NCJL 2E8ZA 3DGGA 4GIAA 2J1ZA 1FSKC 4PP1D 3ULUE 2EDYA 4GSDL 3QEUB 2F6AA 3SDXB 3OZ9L 4YXWG 2ZONA 2WXJA 3LOWA 2BSTB 4FJZA 2WLHA 3KBFA 1PNKA 3PDDA 3REVB 1QW8A 3I9PA 4Z2WA 1QPXA 2UX6A 5TK2A 2C3GA 5IW1B 5T8IA 5D1XC 4DQOH 1AO7E 3IJSA 2CDFB 2AXHA 3LN5B 1MSDA 4O4YL 4GUPB