5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
4MFHA 2VSMB 4K9JA 2OV0A 1RZPA 1WS7A 3OMIB 3T6XA 2GSMB 3MX0B 3ZIYA 1QNIA 3IBOA 2QT6A 1J5DA 5PAZA 2BHFA 3AW5A 1ZV2A 2VMJA 1NWPA 3QJRB 1A4CA 2BZ7A 4JHVA 2B3IA 2LLNA 1M9WA 1ASPA 1M57B 5B7FA 1L9RA 2YARA 1OE1A 3JTBA 4UF7C 5LDUA 2DY2A 1L9PA 2J55A 4YSAA 4UANA 4KOCA 2XX1A 3T6WA 3IEAA 1A4BA 1NWOA 2J56A 4G72B 1AG6A 2BP8B 4DP1X 1XB8A 1XB3A 4GY4A 1BQKA 1F56A 3IN2A 1IC0A 1NZRA 4YVNA 4A2FA 2UXFA 2IWKA 1V54B 4KO5A 1GYCA 3OD3A 1J9SA 1BXUA 3WKPA 2DWTA 1PF3A 1AS6A 1PNDA 2WO2B 4NERA 4Q89A 4HHWA 2FNWA 3NJFA 4HALA 1R1CA 4E9WA 3FSZA 2PP9A 3SBPA 2GIMA 2VSKB 1JZGA 1AR1B 1IBYA 2PP7A 1NTDA 5F7AA 3X1GA 1MZYA 4CSPA 2HX8A 3X1NA 3WKQA 3NP3A 2Y1AA 3G5WA 4DP8X 4NAJA 4F2FA 4DPCX 3D12B 1JZEA 1NDTA 4JHUA 1JERA 3IE9A 4DP9X 4WKXA 4YSCA 2BO0A 5TK4A 5AKRA 1W8EA 3EHBB 1WA1X 2XV2A 8PAZA 4KO7A 4P5SA 2ZXWB 1E67A 1KV7A 1WA0X 1SFHA 1PLAA 4CSZA 3FPYA 1NIBA 3NJIA 4TXVB 1OF0A 3UADA 2PPEA 3ABKB 1KYAA 4DP7X 1M56B 4HCFA 2J5WA 1X9UA 3OMNB 4BDVB 1OV8A 2E86A 1PZCA 4BXVA 1ZDSA 3DKHA 1PZAA 7PCYA 1GSKA 2DV6A 1NICA 2PPAA 4X4KA 2BP8A 4G71B 5E9NA 4DP6X 2WO3B 1L9SA 1BXVA 4GXFA 5B7MA 2IAAC 3V9EA 4E9SA 2XWZA 3H56A 1OOWA 4BK5C 3N2JA 2BWDA 1NPNA 1WS8A 1FA4A 2PCYA 2FT8A 4HHGA 4KO9A 3FPXA 3FQ2A 3FYEB 2FT6A 2FTAA 3PXLA 5I5JA 2XX0A 4Q8BA 3HEIB 1J9QA 1KDIA 2UX6A 2I7SA 1SF5A 3AY2A 5I6KA 5B1AB 1CYXA 1KCWA 1JZHA 4A66A 7PAZA 1SNRA 2ZOOA 3TA4D 2TSAA 4G7QB 3S3DB 3NSFA 1ET5A 3U25A 4YSEA 2BW4A 2QPEB 4GP5B 4F7KA 1HAWA 4GYBA 1L9TA 3NJKA 5ANHA 1ID2A 2J57A 1E30A 2CJ3A 1A3ZA 1HFUA 1ADWA 5I6LA 1ETJA 1JZIA 1GS7A 3BVDB 4E9TA 2VW6A 3TBCA 1SHWA 3ABLB 4YSDA 3AG2B 3CDZB 3S8GB 1XB6A 6PAZA 4KNTA 2PLTA 3ZBMA 3ZDWA 1HAUA 5AZUA 1PLCA 4A2GA 1AZNA 4NB7A 4BXSV 2NRDA 3DTUB 4YSRA 2XYBA 3PAUA 1GS8A 1AZBA 4PCYA 1BQ5A 3QJTB 3ABGA 3PPSA 1BAWA 2EIMB 1PZBA 2YAFA 5I6PA 4F2EA 1ILUA 2XUWA 3GYRA 4BDVA 2YAQA 4P5RA 1L9OA 1AZCA 2AZUA 1TEGA 3ASOB 2PPDA 5PCYA 2BZCA 1AACA 4N4YB 1DZ0A 1MG3C 1UATA 3KW7A 1JVOA 3NJGA 2CCWA 2QDVA 4E9QA 3EH5B 1SDDB 1KBWA 4DP4X 1KCBA 2WSDA 1QLEB 1BYOA 1WA2X 2R7EA 4HZ1A 4ENZA 4RH4A 3S3CB 1SHXA 5B1KA 2VM4A 3WI9A 3QQXA 2HRGA 4HCGA 3FSAA 1EZLA 3L45A 4YSQA 2YAMA 2FQGA 4QKTA 4DP0X 3FS9A 2EIJB 4E9XA 1ZDQA 5FC9A 5I6MA 3WIAA 1OCCB 4KNUA 4DP5X 5I28A 2TSBA 2JKWA 2N0MA 1OCOB 1AS7A 3S8FB 1CYWA 1V10A 2IWEA 4AZUA 2CUAA 4E9VA 5D4HA 2H3XC 4YVUA 2QPDB 2DYSB 2IDFA 3NT0A 5B1BB 2VW4A 4UAHA 2Q5BA 2PPCA 1BYPA 5AFAA 1AQ8A 2UX7A 4G7RB 4BWUA 2DYRB 2W88A 1V55B 2UXGA 2JFCA 2YXVA 1BEXA 1ZIBA 4AKPA 1ASOA 2MTAA 2UXVA 1KDJA 2AANA 3FQYA 3QJVB 3FYIB 2MRYA 2VM3A 4AKQA 4YL4A 2GC7C 2ZONA 4AX3A 1AANA 1L9QA 1PAZA 3WNJA 1JXDA 2GBAA 1SDDA 4A68A 1X9RA 2IH9A 4YSUA 3AG3B 2XLLA 2CBPA 3H4FA 1FWXA 1ET8A 4A67A 3NP4A 2HX9A 2ZWNA 3NSCA 1SF3A 2IWFA 1URIA 1JOIA 1RKRA 2IDTA 1WAEA 2VN3A 3UABA 2GI0A 3EH3B 3RYMA 3MBWB 1KBVA 3X1BA 2XXFA 2CALA 1E5ZA 2FJSA 3AZUA 4M4RB 1TU2A 2OCCB 5EHFA 3WNIA 1AIZA 4YSOA 1CURA 3CG8A 1OE2A 2JXMA 2PP8A 1MZZA 1I53A 5B1JC 1PCSA 3CVCA 4FAAB 5B1JA 4KNSA 4W9ZA 5F7BA 2EINB 3NSDA 1FFTB 1RCYA 2XV0A 1PMYA 1AZUA 1BXAA 2GB2A 1IUZA 2XV3A 2EILB 2I7OA 1NINA 5B7EA 3SBQA 1ILSA 2FT7A 4FA7B 1W6LA 4YSSA 3PLYA 4L0PB 2GHZA 1A8ZA 1W6WA 3QJSB 2Y69B 3OQRA 3T9WA 2HLEB 4EF3A 3QPKA 2XXGA 1OE3A 3NJHA 3V9CA 1GR7A 2DWSA 2HRHA 3C75A 1JXFA 1AS8A 1GW0A 4PAZA 3NJJA 3BQVA 4DPBX 5A7EA 3JT2A 3DIVA 3WG7B 3QJQB 3TASA 1OCZB 1IBZA 1JVLA 2HXAA 1A65A 2P80A 4YSPA 2YAPA 1E65A 1NIDA 4BWTA 2AZAA 4KO6A 2BP0B 3FU8A 3UAEA 1AOZA 3UACA 2YQBA 3NSYA 2CAKA 1AZRA 3QJUB 4AI7A 5I6OA 5B3SB 3AG1B 3ZX1A 2YAHA 4HCIA 4ZK8A 4DP2X 1GY2A 4M3HA 4JKNA 3FU7B 1CUOA 4G70B 3X1FA 3CVBA 2XU9A 1ET7A 1KGYE 2Q9OA 2BWIA 3T6VA 1TEFA 4GP4B 1AG0A 1A4AA 2PCFA 4N8UA 3T6ZA 4A2DA 3NYKA 1JXGA 3X1EA 2I85A 1TKWA 1JZJA 2P80D 2X87A 3CDZA 2IH8A 3FSVA 1IKOP 2IDQA 2HX7A 3HB3B 5IY5B 1SJMA 3NJNA 1J9TA 3PAZA 2EIKB 3EH4B 3SBRA 1JZFA 3FT0A 1B3IA 4WTQA 2FQEA 3S3BB 4YSTA 1NIFA 4GP8B 5I5MA 4DPAX 2IDSA 1GS6X 1N68A 2HZHA 3CVDA 5I26A 1ASQA 1NIEA 2W8CA 4E9YA 2OJ1A 1YLBB 1J5CA 1PNCA 3EF4A 2YAEA 1N70A 3GDCA 4A2HA 3N55A 2IDUA 2B08A 2H47C 3OMAB 2GC4C 2QDWA 3ERXA 3T71A 2BP0A 4G7SB 3PCYA 3OM3B 2X88A 5D4IA 6PCYA 4W1TA 3FQ1A 3GXUB 3NJLA 1BQRA 3H4HA 2VW7A 1PY0A 4A2EA 2YXWA 1RZQA 1J9RA 1MG2C 1GY1A 1CC3A 1NPJA 3IN0A 5I5IA 3ASNB 4HIPA 2PPFA 5TK2A 3TBBA 2UXTA 1VLXA 3KW8A 1E5YA 2XVBA 1XMEB 3FU7A 3PAVA 1OCRB 2R7EB 1MDAA 3FU9A 2A3TA 3UGEA 4QLWA 1NIAA 2AVFA 1ZPUA 1DYZA 3TU6A 9PCYA 4KOBA 3NJMA 4AKOA 2AFNA 3ABMB 2BW5A 3CZUB 5I6NA 1T5KA 1PLBA 2H5UA 3FSWA 4HAKA 5D4JA 3SQRA 1ZIAA 2YEVB 3X2QB 1EHKB 1QHQA 2FWLB 4E9RA 2FQFA 3AG4B 1SFDA 2FQDA 4BWWA 2YAOA 2RACA 1AAJA 3UAAA
chains in the Genus database with same CATH superfamily
3B8MA 1ROWA 2VXVH 1U3HD 3DURB 1TENA 4IOSA 5IK3B 3UL4A 2Y4TA 4AQYO 5BR8O 3KPLA 1I8IB 4KK6D 3SSGA 3IDJA 5ANMB 2HT4D 4GLRH 5J06A 1W2KT 1KXVC 2PWFA 4X6DB 2GV9A 1QLRA 4ANXA 3ZIMA 2JELL 2B3IA 2NY5C 4YDMA 3W5NA 1PG7L 5MEQB 4TS6A 1BIIA 3CU7A 1AGBB 3QUZD 1DANU 2HFEB 1ZLSL 1KPRB 3P4OB 5IM7B 1L9PA 3IJEA 2XVLA 3HC0A 4LCCA 4QOKA 1AD9B 1K4CB 1SXBA 5IZ7A 2A0LC 1WP7A 4Z18A 5AB2A 4UINL 1O7VA 1OHHG 2BMKB 2WINB 3CBRA 4NQDA 4OD2B 4AT6B 3C6EA 1EHNA 1H8OA 4OQ1A 1TT6A 2JTYA 3GFUA 1CG9A 1U3HB 1CS6A 3RIKA 5ALBH 4DUXA 3BAYA 1GZPA 2VN6A 1GYCA 3QAZC 5MENA 3AXIA 3MNDA 1K3ZA 2YD7A 3FQRA 5DC2A 4R4BB 4GZRB 4QTIH 1RVFL 1PNDA 5CZVH 1ZTXH 3Q2WA 4HC1A 5DJ6B 3UAJC 4FZ8H 3ZE2B 5E6UB 3LPFA 4YAQB 2NSXA 1I1YB 1VEPA 3IE4A 4R5XA 1UZ8A 2VDPB 3QUZB 1JHLL 1SVZA 2IBGA 2X3BA 3T2OA 3C9NA 3QXUA 4Y5XA 4FHBD 4OX9O 2F66C 4WK4B 4L4VA 3ZDYF 3MLPA 2HG5C 3DV6B 3I3DA 4XC1H 5IMOB 3D4GA 4JFZH 1LK2B 4JANA 4ZFZA 5FA3B 5FYJL 5LXTA 2QVFB 1HHKA 1WEJL 2DMGA 4DR4B 2BVTA 4HFUH 4AITA 3CC2V 1EVUA 4PV9B 3WTXA 3FQTA 4TRPL 2BO0A 5LMUO 5D1ZI 1E2WA 4ZTOH 5I1KL 3NCYP 1TVDA 5I8EB 1U8CB 4CJ0A 4TV3A 4AC2A 3HRZC 3VI3A 1LO4H 1TQWA 4ZOEA 1URZA 1FV1B 3SDXE 1PPJH 4CZZA 4Z7UA 2VRAA 1E7UA 1AI6A 4U1MB 3RWHA 3L3GB 5I17A 3OLIA 3VFMA 3CX5F 1YCSA 2NLJA 2WXRA 4YEEA 2VN4A 1NC2A 3L5XH 3V0WL 5FO9A 2OMVB 4K8RL 1ZLEA 5J1TC 1G7IA 3KYMA 3QUKA 2Y7QB 3ZTNL 4X8JB 4O51B 1WCQA 1UWGH 4N9GA 2DL9A 3FAWA 5CUSH 4I3SL 4BZ1A 3IMBA 2VR5A 4TQHA 1FYTD 4AL8L 4DR6O 4FQLL 1X9UA 1A7QH 5A3ID 4TNGA 1G9MH 5JZ7D 1X5MA 3L75H 2DQUL 2IJJA 3JVFC 5C2BH 4QYOA 3HI5L 1KEGL 3WHE0 4F2ME 3ZMUA 1HDMB 2NY5H 1ZGLA 3KPRE 4PGBA 4C83A 2IGLA 1BIHA 4RESB 2EE9A 2P1YA 2X7RB 4UBDD 1V54C 5IHZB 3BYTA 3FQNB 4R83A 3KWWA 2GK2A 4K2UH 3MLTB 4DGIH 2BWDA 2ESVE 4IOFD 2IPTL 1V7ML 1NMCC 3NABH 1IAKB 5B21A 4KH9A 4BZ2A 4DK3A 1R6TA 4GQ9H 2WLIB 3DX4A 1SLXA 5KTEH 2KPNA 1H15B 4NNXA 4KROC 4DXWA 4PJFF 5BMFH 5B1AB 1YJ9V 3R06A 1N5AB 4MA3A 1JFQL 1FYTB 1P9MC 5DVMA 3OXSA 1JPSL 3MJWA 2TSAA 4QIWF 4LVOC 4EIZC 1H8SA 3W7XA 2WLLB 3O8XA 3QH3B 2OP4L 4DUZO 4OSUL 1AFVL 4KQ4L 3TBWB 5C0CD 1WJ3A 1ZHKB 3FFQA 1JXJA 5INDB 2YC1A 4DZBA 2ZAHA 1QQDA 1W0VB 3Q2NA 4U7OA 3EYQD 4L8SB 1IDSA 1PZ3A 4WGKA 1Z1WA 2RJMA 1SS3A 1UOKA 1IBGH 4N9OB 2Y1VA 5BUAA 1SQVH 3MREA 5HXMA 1S9KC 2OBGA 3NGBC 3RW0A 1T89A 1WT5C 5LXGL 1KCVH 4QY8A 1FNSL 3K2UH 3TCLB 3VD5A 3LD8B 2RA1A 4TKWA 3OL2A 1JDDA 2R9RB 2AZUA 1S7XA 3ZBHA 2IH3B 4YFLI 2MQ3A 3QULB 3STZB 2R51A 2FYVA 2FWUA 4KXZH 3VG9C 3CE2A 1NCUA 4C47A 4OZIE 4Y9CA 5CJOH 1U8IA 2VLRE 4EI6A 1MCSA 3QG7H 1U97A 2BJMH 3QE5A 2JB5L 4NQVB 3H2QA 4NFBA 3O4LA 1JFFB 3NZUA 2HA1A 1YPZF 1JVOA 3NJGA 2W92A 3ZKXC 4RWYH 5ID1B 3T3ME 3WXWL 4FNLH 1RZGB 2ZX6A 1M7UA 3FQUA 3QJXA 4WK2B 1F8TL 1VEMA 2R0ZH 3F7KA 4ENZA 1FP5A 4XE0A 5I66A 2HJFB 4QMEA 3ZXAC 3EO9L 5D7JA 1INQA 3F7YB 3CZJA 3CCEV 3G08A 1QKZL 3GRBA 5H4YA 5CA0B 2VM4A 3H54A 4EKWA 1BD2E 5J57B 5J9PB 1DVZA 2WK2A 5KVDL 1AGEA 5E8EA 4P30A 1UC6A 1EDYA 1CLZH 2PXYC 2J4WL 3D18A 4KRMB 4ZSOA 2ZOLA 2R2BA 1IGJA 5F7DB 3WJLC 3CJHA 2I69A 1OSZA 1IFHL 3ES6A 4GSDH 3M86A 5JW4N 4HEPA 4RISL 4NAMA 3APQA 5F1NB 1AZVA 1OCCB 5ESVA 3HMWL 3O6KL 3IJ8A 2EDMA 4IT5A 4OFVA 3SDAA 2HTKD 1FJ1B 2EZ0C 2TSBA 2EUXA 4O4HA 4OF8A 2FJFB 2K9FB 4PRPA 4S1DC 4R5TA 3U1SL 3SO3C 3VYNA 5FM5M 5HDOA 1J0HA 4P49A 1P84J 2G2NA 3DHUA 5CGYD 5EORL 2DYSB 4UIKH 4PJ8B 1SQQH 3HKEB 3ARFC 3OKDA 3P40A 1FL3B 2Q5BA 4PJ5E 4RRPG 5EO9B 2YGPA 1BFOB 2EO7A 2A74C 3GK8L 2Z31C 3KWTA 4G11A 4LSSH 5IMLB 5EEWA 4KKLD 1L9MA 3V52H 1KG0B 3KD4A 4XODA 5EC1A 4TV9B 5AAPA 5KAFZ 3GTNA 3AACA 4Z7VF 1FL6B 2DI7A 4S1SL 2IOIA 3CHQA 2MRYA 3FRPA 2JCCF 4G8GA 3NDYE 4TUYB 4PJ7E 5DK2A 4B41A 1J95A 4ZKIA 1BM3H 1CT8B 2GC7C 1D5AA 4O58L 3OJ2C 4TTGA 3NRFA 4GOSA 3BFQG 3A0HZ 1W0WB 3JZ7A 5EUOF 3VB8A 1JNNH 3RYCB 3MLYL 1MJ8L 4KK9D 4KMTH 1J48A 1XGUA 1X9RA 1WBZB 4AM0A 1UCTA 4Z9KB 5HYSA 2QKAA 2HVJC 4JI8B 1HZHL 1EAJA 2V7NA 3LNHA 4JEGB 4FLZA 2R2HB 2IWFA 5TE7L 4GQZA 3I9PA 2P49B 2CPCA 2O6DA 1DGSA 1S7SB 4WW2B 5DEZA 1EEZB 5LXVA 1CI5A 4FLYA 2WWMC 1MJUH 3FQWA 3GIZL 3TP4A 5B38B 2W07A 8FABB 3CHSA 4X5WB 5KYXA 3N41F 4XP1L 3CS5A 2MPVA 3MBWB 4JPKL 1WZ1H 4W70A 3X1BA 5FGBC 5HYFA 1E5UI 4NZTH 4YL9A 1ENVA 1I8UA 4Y5XB 1LWHA 2OCCB 1OSPH 1AIZA 2Y1ZA 4KVCH 1LP9F 2OMTA 5E4EB 2ENPA 5E08H 3MRPA 1MIMH 4FAAB 1MNUL 1HHKB 4KNSA 4N26A 5ESQA 1NGPL 2Y6TE 4BQBA 1QATA 5DJAB 3Q01A 2LW3A 2VDRH 2VRQA 4L48A 2IFFH 4JPSA 1J8RA 4GI9A 3DIFB 3SY6A 1MELA 1PW3A 5TE4H 2QPFA 3HHRB 2I7OA 5B1BC 3CAFA 3SBQA 5DR5H 3KS0J 3N06B 2JH2A 4GO8A 1FRGH 4Z7UB 4LSVH 3BDXA 5B1CA 1FL5B 2CGRH 4EEQA 4BK8A 4JDEA 3WEOA 2W1NA 3HHSA 3VFMB 3QGVA 4ELMF 3TF7C 4JFXB 4KBPA 3QPKA 1F4WH 4EZLA 1S0VA 5FO9B 2VGLM 4R3SB 1Y1DA 3BWZA 2EP6A 2BCKB 1WUNT 4JI4B 1FE8L 4TNVK 5F2FA 3T65B 1ZA6A 2OTWA 3K72B 1KLUA 3OTOB 4DHLA 1F00I 1IQWH 4FTDA 4X80L 1HSAB 1OCZB 2V2WA 3BLKA 3KPOA 2K78A 3PRZA 4FMVA 4JREC 3BJ91 3VQ2C 4TVPE 4JJ5B 1M42A 4PPTA 5SV4A 1NIDA 3RHWK 2RCSL 2AZAA 3UAEA 4D9QE 5IOPB 1ZSDB 3TA3C 1XNQB 2NY0D 4HISA 5HBBA 1IM3A 1MW3A 2WIMA 1WJZA 2OMZA 5D5QA 3CFCL 1HNWB 2P52A 3BN9D 3LEXB 3VTAA 1QAWA 5IBUG 4S0HA 1F97A 1M7DB 3SPVB 1XAUA 2A6IA 1AO7A 1HL5A 2B0SL 3FU7B 2LTQB 2DH3A 1DE4A 3PGDA 1OP5K 1ODAA 3ZE0B 2MK3A 2BWIA 4WWID 5GHWL 1KMGA 3RVXC 3B4NA 1NJ9A 4N2MA 1JRHL 4U3JB 3NA9L 4LHUA 2H2SD 1PYWB 1TNMA 2B20A 2F18A 2VABA 2CH8A 3LKPA 5JNYB 1YJDH 1U8HA 5EB9A 1HOEA 3VYOA 1MHHB 4ESKA 4LHQB 2SODB 2NY0B 5FECA 5L4MA 4LRNL 5HDQH 3CFDB 3HE7C 2UXCO 3UTPE 4KXRA 4N0CC 1KEML 5E4AA 1DJYA 2XXCB 4GKSB 1CF8L 4YSTA 4ZW6A 4AENA 5KVEL 1AI4A 3KLQA 4CH3A 4CW1A 1GKFA 1OZ0A 4RZCB 1P6FA 4ZFOB 3CFBB 5GSRA 2DWEC 2UU9B 3BCFA 1YLBB 5HHNA 3ALWA 3RL1B 4Y2OA 3GDCA 3NMEA 1CFBA 3L6FB 2YRBA 2HWZH 4WI7A 1FG2A 2E8YA 1QTSA 4OM1L 4X6EB 2GC4C 2GYSA 5IQ7L 1DP0A 2PTTB 4ODXB 2XG4B 1JOYA 3D9AH 1S8DA 2GAZB 2W38A 1BYNA 2X88A 3KS0H 4Z7OE 3QO5A 1TO5A 3GXUB 4QNPF 4XC3L 4J2QA 4YNYB 3H4HA 1SLWA 3QXDA 3CCJV 5HHVH 1OM3L 2B1HL 1UQSB 3SKOA 3NFSH 5I5IA 2BSTA 4P4KD 3HN8A 2L7EA 4GX0A 4HIPA 1G9EA 1RUKL 4U6XB 1F51A 5A2LH 3QZWB 2L3BA 1NBZA 1XMEB 1WV7T 4MYWB 3MLRH 3S3WA 1MDAA 1W0KG 1QVGU 4ZUWB 1S5IH 2FNBA 3PQYA 2Z0BA 3UC0L 3UJTH 4RAUA 1AXTL 4OZHA 3H2PA 2RBLA 2B5IB 3CC5A 3HR6A 4IGBC 1AGEB 4I5BB 4JCWA 3T0AA 2AGJH 4ETYA 3SGKA 1HCYA 2KLRA 1QBAA 4L8JA 2RCVA 3B5GA 5DMKA 2Y36L 1DJSA 2WIIA 2ADGB 1NA8A 1O9WA 1X44A 4I85A 4MD0B 3LKQB 2GSMB 5IR1B 3LY6A 4P4KB 4O4HB 1CLYH 4PRPB 2IH1B 5EWIL 3F8UB 1KXVA 3ASWA 1BWMA 4JHVA 3ROLB 5FNVA 4A7GA 3BSZL 3T0EE 5K9OB 4M6OL 1DSYA 5I1JL 2VLLB 4UF7C 3S34H 3K57A 3B34A 3TEXA 4NO3B 2Q2LA 3F01A 4LDEB 4PJEB 3ZE1F 3X17A 4F8OA 4OLUH 1F86A 4N1CA 4P5MA 1CGUA 5KHJA 3MN8A 2BTQB 4N20A 2XX1A 4UXNA 4XZ4A 4GS7B 4ZMLA 3NFNA 2A0LA 4L8DA 3GM8A 3OAZH 2ZP0T 2EJRA 1OCWH 3VAEA 1MCIA 1XHHA 1NSNL 2VIRB 3QUXC 4MRBA 1BAFL 4OCYH 4HK3N 4N68A 5ILTH 1U21A 1IGFH 2VUYA 4PP1C 4QHNA 1KYOF 2G60H 4QHMA 2X3AA 1YTFD 5CB4A 3TESA 4WKZB 4PMFA 3QYCA 2DWTA 4NP4H 4ODSL 2A77H 1TVKB 3MO1B 4MQ7A 2WPDG 4NYLA 2VO8A 2DMHA 4Q89A 3UAJA 1D6EB 2X2UA 4FYTA 1KULA 5EULV 1JZGA 2GABA 4U6HB 5F7AA 3WY4A 5HGAA 1MZYA 1SJVA 4J8RA 3VUAA 2HG5A 3MV8A 4UTBL 1T22A 4X9BA 4XVTL 5E2TL 3CMGA 3U4KA 4FABL 2Z9TA 4YJ2A 1JZEA 1OGPA 5TH2A 1KY6A 1O0VA 2C1PB 2P24B 4GIAA 1F4YH 1FIGH 4HAFA 4OGQB 3UJJL 4ODVH 4P06A 3BPOC 2DQDL 2FGZA 4OI7A 1YTFB 4HSCX 4MXVF 1QSFE 1NKDA 3E6FB 3HRZA 2OS7A 4NR1A 1VA9A 1KYOK 4MNQD 5GGTA 5IVZA 2OMTB 2R15A 4JLRB 4X7CC 1Q3EA 1SFHA 3MRPB 3D6GA 4NN6C 2P5WE 5CEZL 1CL7L 1CFSB 2W9LA 4TLTA 2ZD9A 1WWWX 1S5JA 1JN6B 2HJLB 4HDIA 5JJJB 2Z3FA 4HUMB 4XRCA 4EDXB 4JQIH 2FZ3B 3BAEL 1GHFH 5HHXH 4I9XA 3HS0B 1TYRA 3BUYA 2J5WA 2FEDC 1KOAA 3GSOB 4WEBH 1A4KB 4C8XA 3KVDD 1T04A 5CN2A 2CR6A 1I9EA 3S8WA 1CXIA 1SM3H 1GSKA 2VISA 4K7PH 2GFBB 3Q3GA 4JFHE 2X28A 1RHHB 3W0WA 5BPPA 3KXFE 4DP6X 2UY6A 2JVDA 3GWOA 3V9EA 1KLUB 4DR5O 4G6MH 1KYFA 3L4VA 4TQ8A 1V7NL 1SA0B 2IAMD 4CBCA 3WOVA 1J8KA 4QRRE 3H9SE 1TMQA 5K33A 1KFGA 2H1LM 1GZQA 5CD5D 3MR9A 5A40E 3AY2A 5I9QC 1S77D 2OXGA 2CPUA 4F3FA 3MV01 1P9MA 1HQ4A 1AR1C 5L3DA 4YHNA 3VSQA 2Y23A 1CD9B 4RAVA 3OR7C 4WFEE 4UQ9A 5EU6E 3DX1A 2CGYA 2G4GA 4RFEA 3TIDB 3S0PA 3C6LC 2VLMD 2H7WA 3HS8A 1O7SA 1SOKA 5KBMA 3BVOA 4X6CA 5A2FA 3ARGB 2X6BA 4PLKC 1H0DA 3OGOE 4HCRL 2ZR3A 2CXGA 5I1GH 1PPIA 3RVTD 3G6JE 4GNKB 2DBJA 5JXEC 3GVMA 2F23A 4LBEB 3EIFA 2IAMB 3QDMA 3QWNA 2B7DT 2LGNA 3M1BA 4PJCB 4JFEE 1XB6A 4X89A 4QDGA 5D7HA 1B04A 2GDSA 4BQ9A 4JG1L 3IDYC 5AKVA 4IIJB 4MVUA 1Z5LA 3L2MA 1KF9B 3U4AA 4PCYA 1KELH 2PW2A 4B9ZA 1WT5A 4PGEB 2PN5A 2AJSL 5F1OB 3O41A 4E2OA 1VKXA 2ATKC 2ZYIA 5EF0A 4B0MB 4B6ZA 3UQ8A 3QPXH 1B0GB 1XGRB 2ZCLH 2E6PA 3LXCA 4MASA 3BVWA 2GSIA 5DHMC 1F3JA 1EDHA 1L0PA 5CCKL 2MKWA 3JWNG 4WWNA 3OTTA 4KP4A 1XHZA 4XNZB 2ICWJ 5I19L 2AAVA 1LO3L 3LN4A 4YFDB 2ZPKH 2OCFD 1XF5B 3HPLB 1JYNA 3Q4HB 3LH2H 3SD2A 3VI4A 2BWQA 4LCYB 4KQ3L 3CZNA 1CP9A 3RVYA 5A16B 1HHJB 4OF7A 3VXPA 4V1DA 5HI4C 1QLEL 4IHOB 2ZXCA 5DEFA 2PUSA 2F15A 4YBHA 5L3GA 4CGTA 4O2CB 3OGIB 3CD4A 2O5ZH 4S1QH 3IGAC 1MWOA 1VP7A 1KTBA 4PJBB 3H1JH 4IS6B 1OAYH 3WI9A 3OKKA 4QPEA 2LABA 1E2VA 4XCEB 4L3CB 4D7SA 1G8MA 5DDHB 3BKJH 1WWBX 2PXYA 5ITFB 5DD3H 2O6FA 2B1AL 1XF4B 2RHEA 4NO2A 3VFSA 3P4MA 3WJLA 4I0XB 1RULH 5I75C 1WUZA 1XCQB 3TCXA 3ZHUA 3IRCA 3VG0L 3J81N 4P57A 4M62H 2EH8H 1YDPA 3U7WL 5H9CA 2A9NH 5F1IA 4M8QB 4ATWA 2ENYA 4IW4C 4C4UA 2A06H 1LQBC 4A2MA 2AJUL 4YVUA 3AQDA 1D7DA 1Z5HA 3L9EA 4GSRA 4N87A 1FIEA 3SD5A 4UAHA 1SN5A 1GMIA 1YYMH 3ARFA 3O9WD 3MRQA 4HIJB 2ZCHH 4BELD 4Y4FC 2HT2D 3FUHA 3LRSA 5JQGB 4G7RB 4G1EA 3BZFA 4LF8B 4I5SA 4NQUA 4PJ6A 2EQDA 4X4XA 5D7LA 2A74A 3VRIA 2Z31A 3REVB 4F7MA 5HYJE 2EXYD 2HKHH 5GRXG 1UKSA 5IVXA 3O6FD 3QVNA 3QWRA 2DWDC 4GQRA 3G9VA 4GUQA 1RK0B 4U1HB 3QJVB 2HTLD 5DJDB 4HXAL 4AYFA 3FL7A 1MKFA 1MHPH 1BGXL 4JHZA 2DLTA 2EICA 2WB1A 3PFQA 1BM7A 3TFKC 1JXDA 1AQKH 2ADIA 2GQHA 5EZIL 5DJ8B 2D9QB 5L88H 2VXQL 2IH9A 3WNKA 4JI5O 2I9LA 3UEZA 1EHXA 2F4VB 1VPOL 2AITA 2AJ3A 3HAEG 2XNDG 2HVJA 3O9WB 2P8LA 1XF2A 1FI8C 1W0JG 1FFNA 2VDKH 2A73A 5AZ2H 3LZRA 4LVNC 4PTUB 4RSVA 5SX4I 4DV1O 4F57L 4LCIH 4HJUA 1E3ZA 4TULL 5C0BA 2FGWH 4AJVA 2OMWA 4RBPH 3O6FB 1IBBA 4I4TA 4KRNA 3TBTB 5DJYB 4MB4A 5C0RL 2PZSA 4B9FA 4PS7A 5FIEA 3JV5A 1K7DA 1NCCL 3QIBB 3PWJB 4TVPH 4YHIB 1IURA 5HGAB 4CN4A 2F8XC 4M48H 1FHGA 4WGWB 4F58L 4LIQE 1N6QL 2PP8A 4RUEA 3DYOA 3ILPA 2IALA 4MJ6A 3TJHC 3TONA 5IHBA 2E5LO 4O4YH 2BIMA 1A6TA 1FFTB 1G7HA 3RVVD 1R24A 3FOMB 4ZD3H 3E2HB 4HF5H 4ZUUA 2EE3A 3FUIA 2FMLA 4I7ZB 5F9OL 3M7MX 1ORQC 1NM4A 2GTZB 1Q90A 2XV3A 4N8VB 4BCZA 1LK3H 3D2TA 4ZXBD 5I1HH 4PP2B 3BRDA 4WAFA 4X1KA 5F6HI 2FT7A 3FMGH 3V0EA 4XAKD 4OZFG 1F2QA 2XKNB 2HUEA 3P9MB 2ZNIA 5DLMH 1IC7L 4NDMA 1A8ZA 5GGRA 3LDBB 3BFWA 2XT1B 5I8OL 2R69H 3H0TB 1OE3A 4OLYL 8CGTA 1UA3A 4U31A 2WNKA 3JVGC 2PKDA 1N64L 3KCXA 3U0ZA 5D70H 1CMOA 1EBAA 1R3JB 25C8L 3DK0A 1KB9F 3QDJE 4R97C 2G2RB 4KVNL 4UQ2B 4PREA 4J10A 2UUDK 3JARA 3OUFA 3J27A 1A65A 4YUEH 2VMCA 3EYVB 1BG9A 4KUMA 3T0EC 2Q8AL 2GJZA 4LDLB 2VISB 3R4DA 2HVKC 1MWAH 1T1XB 3TA3A 4LFBB 2ZM6O 2R0LH 3ZS8C 3B8NA 2XA8L 5FFOA 3ZHLA 5CEYB 1E42A 5EC2B 3V6FB 3N1MC 1MI5A 2GSGB 2NY4C 1R3LC 4JZ2A 2NYYD 3ISWA 4Y2NA 4LARH 3HZYA 1BQLL 1UVQA 2IG2H 1QSVA 4UCTA 4MJJA 2WQXA 3ETQA 4LF6O 1QFPA 2AXGB 3AT9A 3WFHB 1IKFL 2R2CA 3DX7A 4G43A 2X4RA 1JVKA 1LO0H 1IGIL 5CU9A 5IB5B 5I15H 4UILL 4L4JA 3BT0A 4L3EE 4FLUA 1JGUL 2P80D 3IDNA 1M6OB 4LVOB 4MXWH 4MNHA 4C54A 1B4LA 3I9AA 4Z7IA 5DRWA 1LD9B 2BSSB 5L2KE 3ZHKA 4LPWA 3MRFB 2FCBA 4C59B 1T21A 5FKAA 4CJ1A 1IE4A 4B3MB 2WHVA 4XMPL 5F97E 2CDFB 2J72A 3II3A 5IHUH 5KVMC 2QM4A 2X2JA 4R50A 3KPTA 3S3PA 1PDKA 1YAIA 2J8UB 2ZDIC 3KJ4C 4PJ9D 4XVJH 1K5NA 1QD0A 2WN2A 3CVHB 1T4WA 5C0GA 3V4PB 1XBDA 5B1OA 4M7LT 2OCHA 4JVPA 4L5FL 3GXDA 2PYFA 3EF4A 2BNRA 3JWDL 4YDIH 5MEPB 2WPGA 2VITA 3SDXA 4AXWA 1W8OA 2VQTA 3LQAC 4J8QA 1SY6H 1EFXD 4IIQB 2QQNL 2QV2A 4U49A 1M9SA 43C9B 4AZ8A 2D2CB 3FX7A 2CQVA 5BZZA 1L0QA 4X6DF 1KJMB 1MEXL 4DK0A 4E2LA 3KLKA 1S7VA 1UD4A 3VG9B 2PWDA 5IQ9B 4XVSL 5T5FA 5T3ZD 2EC8A 5LVEA 2Q6WA 4WBNB 1K5WA 1XTMA 2FECL 3G5ZB 4UQBA 4E5XB 1KGCE 2XN9B 4PJ9B 1X4XA 2IV8A 1KUQA 3N0AA 2Z65C 3B56A 4WI4A 2CHNA 1GAFH 4MX7A 5F9WC 1CTMA 4NZUL 5EZOH 3K8KA 2UXTA 4BRVA 2X4QB 5I1IL 2XTJE 1DDTA 1ZHBB 5IROC 4I1PA 1Z3GH 1FZMB 1VQOV 1PNMA 3DSFL 4DVRH 1QR8A 3OKLA 4J7ZA 1EFXB 1NCWH 1NMAH 1QBLL 3C8HA 4KKQA 1NBVH 3ABMB 4YHPB 2PY5A 5FV2A 1SC5B 2R4SH 3ATEA 5D6CA 3UDWC 5I6NA 4LLQB 1YSCA 5JCOC 3PIQB 1NBQA 4OFYD 3VXSE 2ARJQ 1HHHB 1ZIAA 4IGBA 3EOAA 4P5TD 2D3OW 4NPYA 2FYUH 2CMRH 4ZQKB 3D4CA 2YAOA 4LOUC 3LRKA 4ODWB 2GTWA 3FFCE 4RFOH 1AAJA 2I9TB 3WNMA 2V7QG 4YDLC 5DK3A 4JQIA 2EIKC 4TQFA 4EI0A 5LMUB 4XMXA 2BFVL 4DKEL 1YDPB 1MCRA 1SBSH 2H0PA 1J5DA 1P7KA 2MNWA 5ISZA 5C07E 3THML 3CQPA 4D9LH 4IU2B 3ZGHA 1UWEH 2CCVA 4X99A 1ONQA 4LPUA 1JGVH 3B8YA 2E76C 4LLUB 3OG6B 3ZMVA 1Q72L 1M57B 2Y5TA 2ZCKH 5E94B 4IKKA 2UWEE 3TJEH 3UH8A 1FC2D 1YN7B 3GS7A 3TIEA 4DGYL 1ETA1 3QQ3A 3V6ZB 3QNZA 3WE1A 5AW4B 2ZYRA 5AYTA 3S5ZA 2DQ0A 3BPNC 5D7LB 1MCKA 4MCYB 5J2TA 1IBKB 3WIIH 4CVWA 4S1RH 4DR6B 1T0PB 2MQCA 1Q9WB 3DXRA 1IC4H 1HT6A 1TZOA 3HIZA 2GUOA 5CLZA 3QUXA 3RYHA 3OKOA 4KNQA 1DQDH 2D0GA 4GAFB 4UCFA 4ZT1A 2EH7H 1KV3A 1WFJA 5C0AE 3ARRA 1HI6A 3L9RA 1T80A 3GI8H 1IBDA 1FDLL 3AQXA 4I2XE 4OZIA 1NGXB 1U8QB 3RDJA 5FOBB 3VMOA 1AYRA 2ADJB 5FYLL 2VDPL 2FB5A 4HALA 1L6ZA 2A4ZA 1UJ3C 3EXLA 1E90A 4I9WE 1O75A 4JM2C 5JR1H 1YQ2A 4QUOA 1A7NL 2E8ZA 1NBCA 1WICA 4LL9A 3VX1A 3ZZLA 4RQEA 4KFZC 3CRRA 3P3UA 2QE7G 1WO2A 5GRYA 4EVNB 3X1NA 4DNLA 3MJ9H 4DIXA 1C16A 4JDVB 4AV5A 3V5HA 5KAQF 1HU8A 2Y1AA 3B9KB 1CFVL 2VWEE 4IL6Z 3OF6D 3K06A 3CV5A 1F1AA 3IE9A 5EDXA 4YSCA 1TFHA 3E6HA 4Y5VB 4FLQA 3VWJC 4DUZB 3CLFH 3GZOA 4JGSA 3U1QA 4XPTH 3CN4A 3D1MC 3RNQB 1AP2A 1BD2A 1JG9A 2CKBA 3QORC 4P5SA 2ADFL 1R5IB 4NZRH 3I5DA 2F58L 4ZI7B 3QO0A 2YICA 3R7RA 4Y1SA 4AUJA 4ZX3A 5J7CC 1RIVH 6TAAA 3EXJA 4DYLA 3KR3H 2BIOA 4MA1C 1NH6A 5ADOL 4WUUA 5LBSL 5LAXB 2EKSB 5GGQH 3P30H 1AGDB 3PV6B 4I18C 3VBBA 3B6SA 4NIYE 4Q7DA 3ETEA 2W0PA 3MRDB 3SJVD 1NCOA 5DC9B 2NY6B 3H9HB 5BZWB 5LGHL 3C60C 5D1QD 2ZOTA 5ICXB 2VZUA 3IJHA 4U1GC 5SWZE 5EIIA 4LFHD 5KS9E 2HLFC 5F8RC 3B4SA 3OB0H 4PJ5A 5EU4A 4NFCA 1WZMA 3L4YA 4YHYC 4GKKO 4HWBL 1PNLA 2XWZA 1OIOA 3DIDA 4LC1A 2WJ7A 1GGBL 4R96B 2QHRH 2WXFA 1MFCL 3PNWA 3ULVD 3L3DA 3JARB 3UEQA 3P3NA 1OALA 1QP1A 3QK0A 3RZCC 3D5OF 4OJDH 3ZTCC 1VQNV 1SBBA 5JHAA 3BRCA 1J8SA 4NP9A 3WDHA 4Q8BA 4ZMNA 1JE6A 2UX6A 4PJ7A 4BW5A 5I6KA 3MKKA 3K91A 3APOA 2AHIA 2WGNB 3SJVB 2VLKD 2YUXA 3CN2A 3X14B 3OR7A 2QLVB 2JF1A 1KLFB 2BW4A 1NAMB 3SYPA 2DF3A 2QQLH 5KOVC 1MNNA 3C6LA 5GIRB 3CZGA 3O3EA 3LKRA 3L3OB 4JM4L 3FRUA 4FXKB 3RWGA 3RKDC 2Q20A 4DN4L 2I07A 2J5LB 3V5KA 5FF6A 1AI5A 3DYMA 3RX8A 2CDEB 1B2WH 1FORL 5JUEL 2VW6A 1SHWA 4TUJB 3SQOL 4ILDA 3SN6N 4N86A 5JXEA 2Y25A 4L8BA 1SXAA 1EZVX 3I75A 4Y5YB 3M46A 5DRWB 4ANWA 4XPAL 1LO5A 1XDCA 5F72S 4J3OF 4ELDA 1HAUA 4NQCB 4DW2H 1ORSB 2I32A 3P4NB 4UAOB 1M1KW 3QJOA 2XJKA 1T21B 4DV0O 2OYLA 2FL5B 5HJGA 3HE7B 2GBOA 2ADQB 4RGMC 5GONA 4H0HB 1XH1A 2VLKB 1HXYA 1FNLA 4BUHA 1M56C 4O2EB 1OGAE 4G7YL 2ATKA 2Y2WA 2Z4QA 3A6CL 1KIPB 3GYRA 3MLSL 4CADA 1BZ9B 3EBGA 4TQDA 4P5RA 2VQ1B 4NSKB 1T2JA 1W72B 3TNMA 4C4BA 2B2XH 2WYZA 2DWEB 3KNBB 4J42A 1FH5L 4X0KA 5F7KC 5EZYA 2WLHA 1G9NL 5CXPA 3WIFB 5C09D 2VITB 1U41A 4NXKA 1ZGLP 4N4YB 3SPCA 1MCQA 4DF9A 2O61B 3T4YB 4FP8H 1MSDA 3CLEH 4FFWD 2QEXV 4HS3A 4K9EL 3EYFB 3Q6FA 4M7KH 2PETA 1EEUA 4QWWC 1L0NH 2ICWA 3FB8C 1CYGA 2H0JA 1H2GA 1K8IB 3FU6A 1QLFA 4HZ1A 1T1YB 4ZFGL 4PJXB 1FFPB 2F8VA 3CMOH 3IFPB 3QO8A 4U1SA 4X7EC 4MLSA 4OLXL 4P99A 4KHXH 4HPYL 3IGAA 5D72H 4Y2DD 5B1KA 2ZF8A 5IMKA 3S3CB 1S7RB 3RTLA 3DXAD 3TVMC 3UO8B 1U2CA 3ABTA 4JCLA 2RTTA 5IB1A 5CIPA 3GSNB 4HUUA 5J12C 5MP6H 5JOFA 1U91B 4XCYB 4YSQA 3G5YA 5HYEA 3DSNA 5IJ0B 3ZMEA 5C09B 4DP0X 3WV0A 5LCVH 2ZE7A 4FDWA 3H9YA 1S5LZ 3PN1A 2VDNH 3QEHB 1VGKA 4MMZC 1AQMA 1MCDA 4Q4IA 4YBQC 4KJYB 1NDGA 2KDYA 3AG2C 3MYJB 4WO4D 2DJ4A 3QNYA 1M4KA 1KJ2H 3BGFC 3EOAB 5KSBA 3U2SA 1AS7A 2VZ1A 3ZTJH 2EDOA 3RWEB 1V3KA 3N1FC 3WEMA 3WLWC 1VERA 1CQYA 4XDKA 2QPDB 1XH3A 4PGDB 4XTRC 3K0WA 1P4IL 2PNDA 2W0LA 1RZFH 2YPLD 4Y4FA 4ECNA 2CJSA 3JTSB 2NXYC 4H1LB 3S2AA 1I7UB 1KGIA 4BRJA 2QZQA 4UV4H 5D1ZB 2C3XA 2FVNA 2X1PA 2Z91A 1BFVH 2UXVA 2DWDA 4FJCC 3HC3H 3IDMB 3LAFA 2OWOA 1KDJA 1MWAA 4LIQH 4XNQA 4AK2A 5BV7B 3FYIB 2CHZA 4Y2LA 3VI3F 2VM3A 3FCGA 4AVHA 1ZD6A 1OGSA 2YFOA 3C08H 2GEQA 4NHCH 3OKMB 3DTXA 4Z7UF 1OAQL 3V5DB 4OZ4A 4GX1A 3K2MC 4APQC 1YNLL 5DUBB 1WAAE 5C0NC 3ULUC 3DXRB 3T4AC 2GUOB 4D0CA 4YSUA 1A6WH 3AG3B 2WC7A 4B9CA 1QO3B 5E9AA 1G1YA 5JJEB 5EO0A 1UB5A 1GW6A 4KKCC 4LVHC 2YPLB 4AYGA 1SYVB 4JO2L 4TWKA 4UQ3A 4G9FD 4PGCA 4ANUA 4M5YL 1GJIA 2X41A 5GRZA 4IMLB 1FS0G 1JZ2A 1CXZB 5BXFA 2UXBO 1SHMA 4NPKA 1MXGA 3OAWA 5CBAA 3OGCC 1E5ZA 1FZOA 3S9DB 3RG1C 1M7IA 1K8DA 4CS4A 4UMGA 5GS2H 1RZ7L 3D3IA 5HVGB 3ZHFA 4ORGA 3LEVH 3OKNB 4JY4B 4MDJB 5E9DD 2PYEE 3L5WB 5DFWH 1C16B 4MW8A 1MZZA 1MAKA 4RGNC 2RQEA 1CD8A 1PCSA 4J1UB 4TQEH 4EN3D 4DKEH 4KKBD 1VESA 4OCXH 3KPSE 3SKNA 1DBKH 3AK3A 2VXSH 5SWSD 5FAAA 3V7AE 3SE9H 3BPOB 1PZUB 5LJYH 4L8CB 4MD4B 2ARWA 3V0DA 2EILB 1ORQA 3GMPA 3PL6D 3CH1B 3IETA 3UXFA 4G9FB 5L0QC 5HHOD 1ILSA 1E4XL 2UXCB 1SY6A 1Q9LB 2O26U 2Z6FA 3RJOA 4ZRGA 5DTFA 1DUZB 2V5RA 4OCWH 1WF5A 1Z9SA 3LZOA 4RX4A 3IFLH 1M2VA 4YIQA 5H2BA 3ZDYE 1QQCA 2JMRA 4M03A 3E8HA 3OT7A 3CRQA 2NNRA 1YN6A 2CR0A 3BKCH 3U7AA 4LFAO 3UTZB 3BZEA 4LZKA 4M6NL 1KXTA 4N5ED 4ZG1A 3JVGA 4NXMO 2YSTA 3VQWA 4J2XA 4OGYL 1B0RB 1QSEE 3IT8D 4KQ0A 5E9DB 2VO5A 3L3JB 1N9PA 3BLBA 3GSRB 4XCNB 1YEFL 3VFWA 5E23A 2OXHB 2ZKHH 4KO6A 3IJHB 1AOZA 2Q10A 3T0EA 1YO4A 5HVHB 3MRHB 4OCNC 1CBVH 2WXMA 4PRAA 1KCSL 1K6QH 2YQBA 5SWSB 1HL9A 1K97A 3UBXA 3V4VH 2HVKA 4JN2A 5BNXD 4K3DL 3DJ9A 1Q0YH 3NIGB 4P3DA 4G6AC 1R3LA 5MEOB 1QU7A 3H6JA 4M3HA 5EYPA 4CC4C 1PD6A 3TN0D 3AADB 5IFHL 1CUOA 1Z9MA 3JALB 1EBOA 1KGYE 4LK4A 2Q9OA 2VE6A 4YPGB 2UZXB 4G1MA 3EJSA 2QGEA 5J11B 3MTRA 5JORA 3D52A 5I9QB 3DVNA 4YN3A 3V55A 2XN0A 4M4RA 5DUPH 4FI6A 3X1EA 5HYJD 1KBGH 3VH8B 4GKZA 4F15C 1N2RA 1S9XA 2YK1H 1CLCA 1NFKA 3JCUZ 1A3QA 4FMTA 1MHCB 3BVTA 1UXSB 1Z0NA 3PWUB 5CZKA 3TYGH 3OC5A 3FO2B 4FTVA 2DKSA 4NLHA 3EFDL 4YWGH 1FVCB 3QWOA 5BZDB 4ZX5A 3S36X 4LSQH 2Z93B 2CLVB 1DR9A 4JM0A 3G3LA 2OJZH 1MPAH 1SZXA 4OTXL 5HHMD 2HHHO 3I75B 1NH2D 1CJYA 2W9EH 2HZHA 4FFYL 4I3GA 2ZDIA 1RK1B 3TN0B 1N7ML 4ZFOL 3EYUH 2AEPH 4FFZH 3IWVA 5DHYA 5HI5D 3LQMA 4N8CH 3L9BA 3OAYH 3PNRB 5T1LA 3V6OE 5JQ6H 1QSFA 1FLRL 4GG6B 2YD2A 4GRWB 1HH6B 4X8CA 4X6FB 5MHSE 4G8EA 1HXYB 1LEKB 2AQTA 4LSPL 4J3UA 3BO8B 4UT6A 5IBLD 4UNUA 2P5WA 4RSYA 3GKWL 3IJYB 4AQ1B 4JR9H 4FQIH 2V2TB 1M71B 4APXB 2X4OA 3UROR 1ROPA 4PD4J 2BP0A 4B7IA 5KVDE 1M4UA 5ACZA 5JHDD 2J12B 3FQ1A 5HHMB 3QEQD 2OMYB 2PYLA 1SJXA 3OSVA 1NH2B 4AQAA 1WAZA 1PY0A 4TUUA 1JYVA 4N90E 4O9HL 1AQDA 4R7DA 5BMVB 5F0JB 3MJ9A 2H45A 5ESAA 1J8HA 4NI3A 3P02A 2BNQE 4HUWA 2ZE8A 3MUY1 3CDGA 4H0LC 5IROA 1MCWM 3K7UA 3UGEA 4K7PX 5TDPA 5LOVA 1MFAL 2QFPA 5IEHB 3WFDH 2E47A 4PJIB 4IRZH 5DVOA 5J13B 1OLLA 3ICXA 3QUYD 3UO3A 2C9AA 4QF1A 3ROOA 3MBXL 3UDWA 1A6AB 4QRRA 2JI3A 5JCOA 2QVMA 4TSCH 4LEOA 5CZXC 3X2QB 3WN5B 1C12B 1YQVH 3MNWA 4OJEH 4ZTPL 4HV8B 3EJUA 3UO1L 5K9JL 4JFPB 1X7TA 5DVKA 1AI7A 1YNKL 2A6KB 4TQEL 4X8GA 5EPMA 3QEQB 4NKIH 3UAAA 3UTSA 2HMID 3JWOC 1HXKA 5L7XL 3CE1A 5EU6A 3HFML 3FF8A 4AIOA 2EDLA 3P30A 1TTFA 3A6BH 1QRNE 1CU4H 3QPXL 4OUUB 3IBOA 1A47A 2F54A 3T1FA 2BVPA 4WWKC 1BLNA 3WS3B 2W60A 1A4CA 3WMSA 1C7SA 4ADGA 5AEAA 3G6JA 1BZKA 2O5XH 4WVRA 3JAKA 2VJ8A 1QBMH 2YIBD 1BXXA 3FT4A 3HZKA 4P2OC 4MVBD 4PY7B 1YAZA 1OF2A 2EVGA 3LKOB 1EN4A 4XOAA 1DVSA 4YZFE 4PY8I 4A7SA 1XQ8A 2G75A 3KPPA 4OJAA 3X3FL 4FLSA 3NDZE 2P3YA 1MFEL 1KB3A 1XR8B 2B1IA 1DBJH 4H5SB 5DI8A 5E2VH 4MA8H 5IFAH 2DWDB 2EC9T 1RZIB 1KGXA 4K5PA 5AKTA 5A2IH 3DRTB 2OMNA 1F4AA 4JRYE 4WY7L 5LG6A 3S98A 1BQ0A 3LIZH 4UQIM 3WEXB 1BCCH 2WW8A 2Q0OC 5FKPA 2K4AA 3QRGH 1G1OA 1XGYL 3K0DA 3LZFH 3PGCA 1XEUA 4FF9A 5JVDA 4G28B 2EIZA 4RRPA 2DS4A 3WIHA 2VM9A 5F96H 4WFHE 5D2NC 2VN5A 2GCYA 5TF1L 3CSTA 1UJ3A 3LH8A 5IBTH 3WO3B 2HLAA 2WLYA 4JM2A 1D5IL 3CZKA 5IJ9A 4LDOB 1FPTH 3O3BA 3B1UA 2CO1A 5K59E 1ERNA 2FEEL 4Z7VE 3JZYA 3MV7B 2VDLL 2NX5A 3HE6B 3EJZC 3GBEA 4JZNB 1OAUL 2JCCE 3INOA 1MQKL 3DRQB 3UCQA 4TUKH 1MQ8A 3EYOB 1EZVY 1RUAH 1GC1H 5T8IA 2QZ5A 4L29B 5EUOE 3UYRH 5GISH 3VWJA 3F5TA 1U93B 1M7IB 3GSWB 1Y07A 3ZPDA 5IV2B 5FHBL 5CMAA 3ECBB 4QO1A 2N3JA 4B3SB 3EDEA 3DGGA 3TS8A 2YC0A 3FTVA 4Y7OC 5E8DL 3ESOA 3QTCA 3BEWA 2XY2A 4Z7NF 3ZQWA 1KXHA 3OG4B 4MD5A 4JFOA 4NCC2 3ZIAG 4YPJA 3HPJB 3FB5C 4HLZG 4JFDE 5LMNO 1OF0A 4N8PA 5KANI 1DFBH 5KSVA 3M7FB 3N5AA 3WE6B 2C7FA 3JWOH 4EPSA 3LIUA 5BRZE 4L05A 3VXMD 2HKFH 1TITA 3QWQB 4LLYB 4GXVH 3DPDA 1KCKA 4I18A 5JOPD 1P6WA 3RGVD 3F7VC 3U0WH 4PJCF 4U1LB 2A6DA 2H8PC 1AE6L 1GM9A 2Z0UA 3C60A 3N50A 2YSUB 4MAUL 4Z78B 2FJHA 1LP9E 5BS0D 2M7WA 5JPNB 2WO3B 1MG1A 1UD8A 5I1LB 1A8JH 3L74H 5HYJA 3MLVH 1H2MA 1AJ7L 4KZEL 3Q6GH 1HK6A 3MZTA 1BDYA 2FT8A 2GY7B 4KKRA 1QPXA 2A1WH 2AEQL 2KH2B 4LQ1A 3CSYA 3FQ2A 3U36A 3V6BR 3RZCA 1K72A 5E6SB 1FGNH 4D9RE 3UZQA 3HS9A 1J9QA 4HS6B 2E9IA 4DV3B 1ZJAA 4H25A 3VXMB 5F70A 5BRQA 5AVRB 3BH9B 5LCVA 4ELME 1MCLA 2X9XA 3I6LD 2BTOA 4WFFE 5L3EA 5KN5A 3RGVB 2ZSVA 2JB6B 2OMUA 2VDMB 3SOBL 4DN3H 2EAEA 3JCZA 1DLFL 1S7WB 5E2WH 2EVHA 5BS0B 2QPEB 1JQ0A 1BHAA 1XBRA 2BSBA 1I9RL 4BKLB 5KVEE 2XASA 4GAYA 3FSOA 3ZW3A 4Z1PA 2DM4A 3NJKA 1HEHC 3VX0A 2EUWA 3CU1A 3SCMC 4GBXD 2IQAB 2WXJA 4D7TA 3TBCA 4Z8FL 3U6RA 4DRXA 4GKZB 2R29H 1IJNA 1BE3H 5H5NA 2DQIH 2EX3A 2CO3A 1K2DA 1UZ6F 6PAZA 1G6RB 4AMWA 1KP3A 3C5JA 2AJVH 4JYAO 5ITZA 3IDXL 4AJWA 3LXBA 1IBMO 4N2AA 4DV2O 4C56A 2EIMB 2GEEA 4OZHF 3VVVA 5JO5A 4JV5O 2TRYA 3N91A 3L3HB 3HAEH 4AL8C 3EGDB 3KJ4B 3F6IA 4ABMA 3B7RL 4U0RC 1QEWB 4XPGL 5DUML 1L9OA 1N59B 3RFZC 5KMGA 3WS6C 2JELH 1PG7H 3BCCH 4GBXB 1P5UC 2QEJA 1NGWA 3BWAB 5DRZA 1KTRL 5C7XL 3IS0X 2Q7NA 3TF4A 1R6VA 1SJEA 2Y6SC 4B7KA 1BZEA 4UINH 3WBDA 2WXIA 1S7QA 3LRGA 4UOJA 4MTFA 4A7GF 3GDBA 4W4NA 2VSDA 3FB8A 1MJJB 3QDJA 1BJ1H 5GGRY 4EXPX 5LGJB 4RMRA 4G8IB 5EIBD 2ZWKA 2A79B 4TOYL 4D8PB 2EDNA 3U9PL 1T1ZB 3GD1C 1KLGA 3QQXA 5AVWB 2X7LB 3TVMA 3T2NL 3NFPB 1RVFH 3FSAA 3KCPA 4NENB 3L45A 1MRFL 4XCFH 1MUJB 4NXSA 2HKAA 2FQGA 2NPLX 4YLBA 3T3PB 4TF4A 3CDGB 2JGDB 1JHLH 3FS9A 2MCPL 2EIJB 4F6RB 2YPKA 3MA7A 3FTUA 1B6UA 1GTFA 3WLBA 5KJ4A 3ABLC 5IJKC 4MMZA 5D96B 1UJWB 3EH2A 3PJSA 5DU7A 4QNPE 2AJXL 1GMEA 2P5EE 4UB8Z 9CGTA 2C2AA 2WSSG 4CC1A 4E9VA 4HJGA 4JAMA 4L9LB 4TRPH 1FZKB 3UTSB 4LNRB 4L3EA 5I1KH 1JF6A 4XI5D 4YDLB 1AP6A 1AIFB 1BBJA 3HKDB 4C58B 5DVNA 2NNCA 4EFBA 1FZJA 2FLBT 3DTDA 3JTTB 1TVBA 4XN4A 1LDPL 2V5MA 4WHTB 3QUMA 3V0WH 4OFQA 5IEKA 1H3TA 2BLFA 4K55A 4K8RH 2UZYB 3MV9A 4V11A 2WLNA 2OMXB 1WZAA 2ZP8A 4MQXD 2JKJA 4H2AA 3OFNG 4I3SH 3VCLB 4BQCA 4YL4A 4AL8H 4FQLH 4U3CA 5GS0D 1I94O 2EYTB 4PJHA 3EJQA 2ZONA 2CK3G 4APQA 2DQUH 5IB2B 1HX0A 3HI5H 3SZ6A 1KEGH 1X4ZA 1MLBB 4QHPA 3VFPA 3HUJE 3T4AA 4A68A 1XV8A 3GWJA 1SXZA 4FXGB 2YJLA 1ET8A 4EUPH 3Q2CA 3CC4V 4FQJL 4UM8A 2NN4A 2QGNA 5JA8B 3A6OA 3NSCA 1EEYB 2MJWA 1PKQE 1JOIA 2DEYX 3DX6B 1NEZA 2IPTH 1V7MH 5KHIA 2GI0A 1J0YA 4WQOA 3ZUCA 5JVDB 1KBBA 4F7EB 3ZE1E 5DHVA 1JPFB 1N67A 3NIFB 1P4UA 2CALA 3S88L 1F41A 2W80C 5F9DC 5CEZE 3T2LA 3OGCA 1VFAB 4I1RA 3U7YL 1ZA3A 1JFQH 1PBYA 4NTYA 1CURA 1JPSH 1Y6NR 4ZZKA 1NQTA 4FCAA 4PB9L 4KPHL 4QT5A 3ECUA 1WN7A 3AUVA 4OSUH 5SWQA 4FFZA 1AFVH 1I8KB 1BXAA 1R75A 1HNXB 2Q3ZA 1DF4A 1TJMA 4RWHA 5GGTL 1A4JB 3LNEA 3K9SA 1WIUA 3QORB 4XB8A 5TGBA 4I0KA 5KVGL 2DZEA 1PY9A 2NQDA 4HUNB 3ARTA 1HS6A 5I74B 5B66Z 4JO1L 4X6CF 1YF2A 2CK0L 3FFCA 3R8QA 3QEGL 4RFNB 5F3HA 4QEGA 5G4MA 2ZUQC 4DR1O 4WZ9A 1AHMA 3E83A 3QQ9D 1QR1A 1XNRO 2HRHA 2LO1A 1JK8B 5LXGH 3TEWA 1FNSH 2ENJA 4HWNA 4QRPE 1BX2B 3T8XA 2P42B 4YSPA 4ADIA 4MXVE 3D51A 2NTFA 4YH6A 3AMLA 5CR1A 4XBPA 2UWEA 1IBHA 3UT5A 3HHMA 2XTLA 3EFFB 3AG7A 4Q6IB 3QXVA 5IREA 4PG9A 3ZCCA 2JB5H 3HKBA 3RAJL 4MVQA 5ID0A 4IRZA 1TQCB 1FCCA 2XWDA 3BD5A 4K7PY 4BH7A 4ASUG 4P3WA 4IBYA 1F4NA 1S9WA 4D2NA 3WXWH 2I24N 1BVZA 3A24A 1EVTC 1I1FB 2XU9A 3BN3B 4ODHL 4KTEL 3CHPA 1F8TH 4O2AB 2F43G 1TEFA 3PWPE 4PRID 1F23A 4XAWL 3EO9H 3D30A 1HSBB 1QKZH 2ZP9A 4JDZA 5DJ0B 3VI4F 1XR9B 4N22A 1BQSA 1R9FA 4OKVA 4PRBA 3EBHA 3L1EA 3RTQC 2KT6A 4JO4H 5G5DB 5KVDH 1K8AW 1OT1A 2CA4A 2APSA 2QWNB 1N4CA 2AGAA 2F1MA 3MBED 1R5WB 2XZCL 2HX7A 2J4WH 3BGMA 4PM1A 2CDGA 5GGUA 1ITBB 2XFXA 4JI1O 5JDSA 1H3XA 1IFHH 1X5ZA 1IKNC 1N3NA 1HCZA 2F7OA 2X70B 3GJFB 4RISH 5C9KA 3KYAA 1R46A 4LEXL 4ZMTA 3EDFA 1AO7D 4QLRA 2ETWA 3HMWH 3FKSG 4J11A 2ZG3A 3O6KH 3ARDC 3CVHL 2ZOUA 2P28B 5E6IC 2CLRB 2C9SA 3O11B 5I26A 3U1SH 5IBUB 4YO0A 1X5IA 2J2ZB 4AYMC 4CDGC 4LU5L 1ZL8B 4DO4A 4PRIB 5DD6B 3S37H 1CI3M 2AV1B 1UUSA 2NY1B 5FW6A 2JS5A 1MCFA 5EORH 4JFQA 5FYKU 4KI5C 5EU7E 1S3JA 3D08A 4Y9GA 4ZAKD 3FT2A 4WU7A 5L3CA 3GK8H 1JK9A 1WB8A 4S0TD 2E9JA 1DF5A 3LNDA 5D93B 3WY1A 1T3FB 3MBEB 2N05A 4IRSC 3ERXA 1R3KA 3RT3C 3BP7B 1SVBA 1JPEA 6PCYA 2JQAA 2CBMA 3BXNA 4HEME 3CP1A 2WSKA 2ZUUA 4NO5B 1GVIA 5DZOA 2GBVA 2WVVB 2F53A 4XBMA 3TBSA 4PA9A 2XWTB 2YXWA 5SWZA 2E46A 1NPJA 2JWYA 4W9CC 3MLYH 3TO4D 1MJ8H 1S7UA 5IVXF 1P84F 5TK2A 2CGNA 1NCIA 1T66C 1HZHH 1WITA 1YEJL 4PB0L 4DEWA 5HDQL 1G0DA 1THCA 1X9QA 1T0OA 5JIQA 4IHJB 1D7CA 5DHXB 5TE7H 4JRXE 1KLGB 3BFOA 4FXLA 4QRAA 4CKQA 4YE4L 4WCYL 2F7IA 1EERB 2L4OA 4ERSL 2A4CA 3GIZH 5IWAB 1Q43A 4XP1H 2FWLB 5T3ZL 1H2LA 3AG4B 4LOFA 4JPKH 3KCWA 2DLFL 4CKVX 2V4DA 3GB7B 4KC3B 5D55A 2IOMA 5CILL 3WLBB 5JPMB 1WS7A 2A2QT 1WBYA 3DDFA 2UVFA 1WHPA 4GT1A 4KJQC 3ZIYA 3PJSB 5C0DB 1X5JA 3BD4A 1MNUH 4WWKA 3QJRB 2CK2A 2BZ7A 4KRPD 1NGPH 2J1YA 3QR1A 2QR0B 4LESA 4GAGL 1WCBB 1XZWA 4WFGA 1E7VA 2VAAA 3OZKA 3AJ7A 4M93B 4MNGB 3ZR6A 4TLKA 4P2OA 5CJBA 1GGIL 2YR3A 3TBYA 3UKMA 3FTGB 4XVUC 4KX7A 3IDGA 1NWOA 5HHQB 4XXDA 2IC2A 5JW5A 2A6JA 3PS6A 4BHUA 3QI9D 4YVNA 3MV9B 3OR6C 1WNSA 4NKMA 4TT3G 4ZHQA 1FE8H 1JNHB 1UOWA 4B08A 3K58A 2R2EA 3F6LA 4LCWD 4OLZH 3F12B 2R1YB 3QCTL 4WHCA 3D4YA 4KJWC 2CJUL 4X80H 4C4KO 3NXSA 4XMWA 2BSCA 2RCSH 5HDBB 1AKJA 4JY6B 3NJFA 1PAMA 4E68A 2KBGA 4E9WA 5D2NA 1YZZA 2VQFO 4H4NA 3B2XA 3QIWD 5ICZA 3CFCH 3TPUB 3P32A 1DN0B 4M00A 1E8YA 3FO0L 1VDGA 5J1AA 3IKKA 1KC8W 4XPBL 3ZDXF 5IMMA 4G6FD 4KUZL 1U96A 2R29A 3SGJC 3MRJA 3D2UA 2K8QA 2K9PA 1U8MB 2B0SH 2CD0A 3QI9B 2YEVA 3CWBH 5GHWH 4M1CD 2MCG1 3UCRA 3PP4H 5FDWA 4HGMA 1JRHH 4LCWB 4AJ0A 5TPWL 3NA9H 1M1XB 3EHBB 3DX9B 2QDOA 3IJSA 3NPSC 3Q5OA 4XP9H 1NFIA 2ZXWB 3DUUB 1KV7A 1ITCA 3GSUB 3Q05A 3CBKB 3HAEA 2Y7OA 3GZPA 4DV7B 4EIUA 3FPYA 1OP5H 3IB4A 3KLAA 2EZOA 3QDGB 3B37A 4PJDB 1YY8A 3FB5A 4LRNH 4U3SB 4GW1A 3QIWB 2A83B 3IYLW 2A38A 4M6ML 4I89A 4QCIA 4YOKA 3RWJB 4F9LC 4HAGA 3VRJA 3SYQA 1KEMH 1CF8H 2AK1L 3VACA 2WANA 4G6FB 5TGBB 2Y7NA 3V10A 3VDCA 1FNEB 1MRDL 5KVEH 1KXQA 2C1OB 2EE6A 2H26A 1U58A 1K5QA 3F7VA 4Z3IA 1QLNA 1FGVL 1A5FL 3K1KC 2ZOKA 2H8PA 1DQJA 5DSCA 5B3NA 3RBGA 3ZEDA 1X5KA 1RP8A 2YIHA 2BP8A 5E9NA 4O5LL 1DL7L 1Q94B 2CBQA 5LHIA 2ZNWA 3BQUD 1RJCA 5AVTB 4A7QA 1MOFA 1KENH 2EDYA 4O4IB 1XIWD 1XSOA 2BSKA 4OM1H 4KO9A 4DGVL 3FPXA 5MERB 5A2KH 5J56B 2GJJA 3D85B 4X5XB 5IQ7H 3AGVA 5D5MB 4PS3A 4Y1AE 4CN1A 5JHLL 1N6UA 2HJKA 2QPSA 4YDKL 3SY0B 3SDXF 1NBYB 2Y06L 5DYOB 5FCUL 3HKBB 3C5ZD 4X1YA 2F7PA 1Q82W 1DCEA 4XNUL 1WAAA 1XGQA 1TCRB 3G80A 1OM3H 1QUPA 2B1HH 3LZPA 5DFAA 1Y18A 3B2VL 1NAML 4HPOL 3RPKA 1RUKH 3EUDA 1U3YA 4U0QB 3VFUA 3JAMN 1QUNA 2IJIA 3ZOAA 3BQUB 4MB5A 2YMXL 3ZRFC 2AK4A 2BHUA 3SCMA 2NOYA 2ETNA 3BVDB 1XIWB 3LPGA 4L5FE 3UC0H 1HW7A 3TZVC 1AXTH 4OLWH 3KDMA 5DECA 4HKBB 4PB0H 2BIPA 3S8GB 1KYOJ 2NW2B 3QXWA 1F11B 1G43A 5CJXC 5CSBA 3UTTD 1IGYA 2O93L 2XXMB 2YBRB 2Y7MA 2FB4H 2NZ1A 1H8EG 1PLCA 3OKEB 1I7TA 1AZNA 5BXZA 4M5ZL 3LQZA 4JFFB 3FU3A 2Y36H 1RHFA 2RGSA 3B3IA 3C5ZB 1GS8A 4N21A 4TNFA 4YSRA 3ABKC 1EAPB 3ARBB 4HK0B 2EYRA 4ZMPA 1GKEA 5GRWA 3PPSA 1ZAGA 1AI1L 1YMMD 1NGYA 3LV3B 4X50A 2HUHA 4PJGB 3CFJB 3KPSA 2X4NA 4BFGA 1OSEA 3FQXB 5EWIH 3RFZA 4MS8C 2WKGA 4YO0B 3TM6A 2BXYA 3O2WH 5LGNA 2OQJB 3DUSA 1XHXA 4YJ3B 4WTXA 2YO3A 3WS6A 3BSZH 4Q9QL 4M6OH 4EE2A 1P5UA 3PE9A 2AABL 2QVIA 3RN4A 3QJZA 3WMPA 2GT9B 4I13B 1S5HB 2P7TC 3QDMD 2QDVA 3UTTB 2RQ8A 2ATPA 1ETB1 3OC8A 2IIJA 5C08E 1E9QB 1OL0A 4R7NB 1NSNH 2ARJA 3S36L 3TT3L 1BAFH 4F33B 4U1KB 4N1EA 3OJDA 4NKDA 1QVOB 1MSPA 1RFYA 1KIQA 1YMMB 4HKZA 5EBGA 4Z77A 4ODSH 1M2OA 5K39A 2C9QA 2NXZC 3ZHRA 2DICA 3K5OA 1YEDB 2DD8L 4FFVC 5FEBA 2D03L 4R7VA 3AT8A 5ANME 5J6GA 1RPQA 1C5DA 4H0LB 2D31B 3WNPA 3E3QE 3M17A 4DCQA 4X6DE 4LPYA 1WBXB 5HYIA 2UXBB 4ZMZA 1ZDQA 4OU3A 4QHLB 5I6MA 4BH8B 3WIAA 5INCA 5IJKA 2VXTL 3F6JA 3KH3A 4XN5A 1QFHA 4JYBA 4GW5A 1HQRB 3E8VA 5E2TH 4XVTH 4FABH 2WTRB 4QIRA 5FUOL 4W6XB 4HQQL 1SERA 1LEIA 1FNGA 2H3XC 2DQDH 4YHLL 2FK9A 3AB0C 3I6GB 5K1XA 1UM5L 4LB8A 2AQ2A 1T5XA 1L3WA 4LSUL 1QCEA 3FKUS 3QZWG 5C8JA 5IUSA 1S78C 5CEZH 1CL7H 2H6PA 1BEXA 1HILA 1TQBB 5EZJA 4NUGL 4LF4O 1UEYA 4OY9A 5DJXA 1E4JA 1KYUA 4JCMA 1JZ8A 5E70A 2AQPA 3BAEH 1Z5VA 1FUNA 3SE4C 2XI9A 2VUOA 4PBXA 4Y19E 5FYLE 1D5BB 3ABUA 1F6AB 1KT2A 4P23C 2G5BA 2DKUA 1A21A 4OFPA 1NCBL 1IGTB 2JNZA 2EZ0D 2OULB 3IDGB 4J23A 3C09B 1FJGB 5EU7C 1QLEC 1LUVA 3BUQA 1UEMA 3AXHA 5DZVA 1W0YT 1G7QA 1EX0A 5T1KB 3AAZA 1ZLZA 4ZW7A 3FOLA 1KTDA 5FA4A 2Z31D 2JIXA 3VGAB 1IAOA 1V7NH 5D7KD 3RWCB 4UOW0 3EADA 3FCSB 4A6YA 2R4RL 4RMBA 1T0NB 2W81C 4H40A 2PUQT 5F44A 1R34A 1XL4A 4B7EA 5DJ2B 3TXSA 4OH2A 5TDNA 5DRNB 3AZUA 3I2CH 1I5XA 3LEYL 1HXMB 4PCKA 1CXFA 3MSPA 1TTUA 2OIEA 5J1AB 3UG4A 2VL5A 4FLVA 1ZLDA 1L7TL 2HN7A 4BFFA 1O9GA 3KWVA 4JPIB 1I53A 4QXTB 1KJVA 1FXHA 3B3BA 5DO2C 3K1DA 4ZUTA 4KUCF 2AVGA 5I8CA 1AZUA 3A0RA 2E7DA 3UPRA 3MRIB 5K1PA 4Z7WA 4F8QA 1NINA 2BHYA 1EUTA 1T4KB 3TNNA 3VFOB 3HG1E 3SPIA 5GS1B 1HEZA 4NQXA 4FA7B 5DJCA 2N7AA 3EF7A 1SOQA 1BZ7A 3PLYA 4L0PB 1H5BC 4UUJB 4ZO7A 1VADA 2WBJC 5ABAA 3WDJA 3RL2B 2ERJC 4XNAA 3KMDA 4JG1H 1DSWA 2WQ8A 2C3VB 2XXGA 2E5EA 3S48A 5IW1A 4KHPB 3HR0A 3MQIA 3G4SV 1VQ4V 1UKQA 4URKA 4HA1A 4F8PA 1V27A 4B7LA 2QM8A 2AJSH 2XAFA 1JVLA 1VHPA 3LRLA 4QHKJ 3ETBF 4OCRL 2Y4SA 2YAPA 1RPOA 3WSQL 2H8PB 1A7RL 3EGSB 2XQYK 1NTZH 3R19A 2X0UA 4U4BA 1CFQA 1OP4A 3N1PC 3VSTA 3VXUE 1OVZA 3T0WA 4GG6F 2CAKA 4QAWA 5E8NB 3ZX1A 1KB5B 1LO3H 3PWVB 4MCNA 1RK7A 4HCIA 5J6SA 3EFOA 4Z7QB 4DP2X 4MXQD 4OIBA 4KQ3H 1GY2A 2E7CA 1RLWA 1QBZA 2IGFL 4FQXC 1FFXA 1QLEH 3RU8H 3X13A 3IMSA 3T6VA 1NTMH 4OZFB 3QDHA 1LE9B 2PCFA 2WVUA 3OKYA 4N8UA 2EXWC 5DN6G 1EZSA 2Y4UA 5I1CL 1V3JA 1JNLL 1Y4MA 1FVDB 5B1NA 1KZQA 4FMKA 4MHHG 3RTQA 4I55B 2IH8A 4AM0Q 2MOVA 3BP6A 1NI8A 3VFUB 4TV8B 1U95B 3QFJA 3Q0HA 2FDBP 3TA3D 3MOQA 5IY5B 2B1AH 4XGZA 1RLBA 3H55A 1IKNA 1F18A 4LAJH 4Z7VA 4NQEE 2XAGA 4Y88A 4BZYA 3VG0H 3FT0A 4N2CA 5IW6B 5ADPL 5FLVA 2L35A 3U7WH 4LFCB 5T33L 3ARDA 2J6EL 2XOTA 5E6IA 1U8OA 1X7QA 2YKKA 3FK3A 3RPBA 1K4DC 2CO7A 3B2EE 3WJJC 1DVQA 4WNQB 3RVXD 1VFBA 3S5LG 2AJUH 4MCMA 2R0WH 4G3YL 4KMQA 3IXTA 2EO9A 2ZINA 1MY7A 1INEL 3E22B 1NR1A 4OCSL 2P67A 1HHIB 1RJZB 4Z1MG 4NHUB 5JW3L 2VERA 4OD3L 5B4MD 5AW3B 2XAHA 5KSBF 4JFDA 4IRSA 2J1ZA 1L7IH 3TWCL 4FZ1A 5BRZA 3G04A 4W9KC 3O4OC 2RMNA 3G5VA 4XNYL 5E5RB 4HXAH 1G7JB 4P07A 3AMKA 1MFDL 3P3PA 2YUVA 3L7FA 1COWG 4ISVB 1BGXH 1H19A 1BS3A 2NNAA 3KEHA 2XVGA 2P8MA 2XKSA 4WI0B 4XN8A 1NC4D 1MG2C 3QBTB 4H8WC 1L0LH 4JHAL 4M1GL 5EZIH 3I56V 4CNIB 3FD9A 1V8HA 3QR2A 5JDJA 1G7LB 1P5VA 3FW6A 1DEEB 3FU9A 1VPOH 5DVLA 1A3RL 1NIAA 3QG6A 3MNZA 2YN3A 1ZPUA 3BD3A 3CK0L 4PTTA 3T0XA 3VE0B 2QR4A 4CVZA 1ZLVH 4N2KA 2FHCA 4K0KO 3H9VA 4F57H 3L5IA 2H5UA 3A4FA 5F7EL 4TULH 4DR4O 1HHGA 1OGTB 2HAZA 3CIQA 2YGOA 1CB4A 3GM0A 4NZDA 1SEBB 1TPXC 4XX1G 2ZT9B 1BVLA 3BAKA 5C0RH 3VQYA 4Q0XL 2ZUXA 4Y16D 5E03A 2Z4TA 3BLPX 4Q14A 1NCCH 1XX9C 2VSMB 1PQZA 4GH7B 4K9JA 2MCMA 4FADA 4YR6B 3Q2VA 1N32B 2JK5C 5EA0L 3T6XA 3VDAA 1NC4B 2YMTA 2XPGA 2AXWA 3KPRD 1WLHA 3MX0B 4IKJA 4QRQB 1MCWW 4F58H 4PV8A 2BHFA 3A4DA 1MRCL 1LEIB 1JV5A 1U2HA 2DWYA 3ESMA 4F7PA 4NQDE 2YARA 5F9OH 4OV5B 3IMVA 2ESVD 4ABVA 3ZSTA 3T77B 2YFNA 3SDCC 5FK9B 5EO1B 3H42L 2BDNL 3N2KB 1VACA 2KC0A 2JQMA 4MJIA 3SYCA 4CDHA 3SGEH 1IC7H 2ZWYA 5MENE 5I8OH 4UB0L 4DP1X 1G4MA 1XB3A 2MTPA 4PGZA 2D7MA 4UCSA 1F56A 4Y16B 3GPEA 3ZO9A 1N64H 3OR6A 5AW8B 4AYSA 2YS4A 4ZTEA 1NLDH 4F2MB 25C8H 3IVKB 3OD3A 3KPRB 5CGTA 3FT3A 3TEUA 4JKWA 4KVNH 2WLJA 4DQOL 1PF3A 1U8LB 3LS5L 3EYSH 2LOEA 1U33A 4L4VE 4K3AA 5EU5B 2Q8AH 1HWYA 5E56A 3AY4C 2BM3A 2KL6A 4PLJC 2IPKA 2EIBA 5BOPA 1TA8A 2E4FA 2ESVB 3R0NA 2GIMA 4DH2A 2XA8H 4X4ME 3APDA 3LKNB 1IBYA 2UUDH 3W2DL 4RLDA 4TOIA 1BQLH 3X11A 3VI3E 4E0RA 4DP8X 1ZY9A 4NAJA 1Q6UA 4W4OC 3SGJA 5IJCC 4ODUA 1WFOA 4Z7UE 2X4SB 5IG7B 3LOWA 4EB6B 4LF7B 5D1XC 1ID5I 3KYOA 5E8PB 3SKJL 3TH3T 2VKXA 4XO8A 1IGIH 1KQSU 4PLOB 2XV2A 4UILH 4LP8A 3QHZL 4XMKL 1JGUH 1FVEB 3QIUD 1Q81W 2VLRD 1A14L 5HSFA 3E3QC 1MFBL 4FYRA 3P9LA 1OAZH 3IFOA 4AVJA 2D73A 3MCKA 3BSZA 2F1EA 3I50H 1PG7W 4TLSA 3JSSA 1BMGA 2HFEC 4JYAB 2ROXA 4F9LA 1UXWB 4HWEH 3L70H 2IQ9L 4QR7A 1HEZB 2E86A 1K4CC 5C0IA 1T7ZA 1VADB 2X4TA 1QOKA 2PO6B 4FNQA 5CA3A 4U6YB 2BSRB 2V9QA 4L5FH 1I9JL 1NICA 2NZIA 2FLRT 3T2QA 2ZUQB 5J3HD 3JWDH 4JG9A 5IW1B 3S96B 3P0YL 3VXTA 1U3HC 4XO5A 2IBZX 1BD2D 3RWDA 4G9DB 3ZMNA 3CZEA 4KK6C 1DUYA 2PGGA 2HT4C 2QGBA 3QIUB 2VLRB 2MNJB 1MEXH 2CA3A 3LZQA 1E1QG 3NCWA 4PR5B 1NCAL 3OQ3B 1ZLWK 3ESPA 2F5AL 3MGOB 4XVSH 3DGDA 3B2PA 3QUZC 3NIDB 3CHOA 5AOLA 1XGPA 3KGTA 4BSVB 3BPZA 3VWKB 4DEPB 2K4WA 1SNRA 4G7QB 4AQ8C 3MROB 4YJZL 1KWKA 1RJLB 3HUJA 4NZUH 3AGWA 4UTBA 5I1IH 4PJ5D 2B5UA 4PSPA 5TFSL 4L0ZA 3LZLA 3NTCL 3O3UN 3DSFH 4F7TB 5AD0A 3LN5B 2P44B 2FHBA 4OJYA 1QBLH 3FHEA 2C9XA 3TZVA 3CDYA 3QO1B 4HS8L 1OXYA 1ZWIB 1QFWM 3P73B 1J9CT 5CJXA 2YLKA 3ZKND 2DMXA 1Y6MR 2N04A 5K9QG 2A9BA 2F5BL 2X53A 2XHNA 3N43B 4V33A 3K6SA 2NRDA 1N0LA 2XYBA 4RWUA 3M07A 3W81A 4B5EA 3H9ZA 7CGTA 1SQFA 1XSIA 3S35X 1GGUA 2BFVH 2QADD 2B15A 4KXCA 4GRLB 2ZWSA 4BIZA 3J07A 1LNUB 1RJYA 4XN1A 1G1CA 3O4LE 3THMH 5LWYL 5JHMA 3LNMB 3GMLB 1JPST 1Q72H 4NT6A 3BIKB 2MHAB 1ZVSA 1SMOA 4NJAL 3ZR5A 3HR5A 4UT6L 1S7TA 1GOFA 5TISZ 3LQAL 1UATA 4DGYH 1LEGB 1DLBA 1TSRA 1F42A 15C8L 2P7TA 2WKOA 3POCA 2GHWB 2W65B 4KGLA 3L8QA 3T1HB 4JI8O 3C8KB 4X98B 3GMOB 3G6JF 1KP2A 1DLHB 3ZYOA 5LP6B 4RIRB 1JWMA 2H32A 2YQ2A 4LF3A 4NRYA 1KTKE 4DVBA 3C6SB 5A1AA 5B1AC 5D7SH 2QADB 2YHGA 4QRPA 4ZSOE 5IE9A 3TGXA 3G5XB 3CPWU 1OAJA 5E1AB 4XMTA 5A3IC 1G7PA 3K8MA 5JZ7C 4QHUB 1A02N 1E50A 1F4XL 1FDLH 2VWJA 2Q2EB 1BV8A 1XGTB 2GTAA 3KLSA 4WJ5B 4K15A 4H8QA 3ZL2A 5FYLH 4NRXA 2VDPH 4YDJB 1IAII 1U8PA 3X3GL 3CD6V 4PRPE 1QA9A 2WP3O 3BCDA 4RAHA 2BVOA 2AW9A 1A7NH 4HCRA 4PTTB 2D3NA 1VCAA 3MUGB 5KZCD 4L37A 3B2MA 4IOFC 1HHGB 4O02H 2EJ1A 1CFVH 1WFNA 1ZXKA 3N1QC 5CP3A 4FLXA 3PWPA 2OR8A 2XWEA 4IOIB 2DM2A 4E5XG 2Y07L 1ZAUA 4K94H 3H8NA 4XBFA 1CTNA 3B40A 1WIPA 2IDFA 4LLVB 4UM9D 4TVPD 5DRXA 4MHHI 2IEPA 2HFFB 1PL0A 3P0GB 3LD8C 4JN1L 1ZXQA 5HPMA 4B60A 4UV8A 2DYRB 2ADFH 4G8GE 2F58H 2OI9B 1Z5WA 4NO0A 1YYCA 2F0CA 5GGSA 1IO4C 2PCXA 3STZC 2IH3C 4NBYB 2EDEA 3JAWA 4JI4O 5AL0A 1G9NC 3HA0A 4ZOLB 5F7MC 3OTOO 4LSTL 5ADOH 5LBSH 3IM1A 3SE4A 5DMJB 4GAJL 1P7BA 3AQZA 5KZCB 2F74A 1A9VA 1LNQA 4P23A 2J7LA 1WC7B 3ECWA 5JMOC 4AOFA 3CZFA 5LGHH 2GBAA 5JXAL 1EA9C 1BEYL 4UVBA 4HW6A 2CBPA 1HNWO 4UM9B 1VZGA 3OR6B 1IVSA 4HWBH 1SQMA 2ZWNA 4UQDA 4G8FA 3FT3B 3F7YC 5HGDA 1GGBH 1XEDA 4LLDA 1MFCH 4XH2A 1G6UA 2BNUB 3QQ4A 1DZBA 4TUOA 2IXQB 5C6WH 2GUYA 3RB7A 4RNRB 3U82B 1MREL 4YDVB 3WIHL 2XWBA 3UTPD 4HEMA 3ZRCC 3BEVB 4IDLA 2KKWA 2VTFA 4IQHA 5J6HA 4RA3A 1QW8A 1MZEA 2X40A 3GIVA 2NNFA 4FNRA 2WUCL 3K4ZA 5DZJA 4NUMA 4EQ3A 2W6JG 2Q8BL 2OZNA 3QFGA 1OCCC 1JL8A 5DVPA 4E0RB 3FO1B 3RYFA 1EJFA 5JIHA 5EOCL 1Q1JL 3WDIA 4F7CB 2ZX8A 4JM4H 3D36C 2IANB 5EZLB 1GJUA 4JRXA 2DYSC 4ELKA 1FORH 5JUEH 1WAPA 2R1WA 3OV6A 4PJ8C 3NPSB 3R4RA 2DIEA 2DTML 3SQOH 1QZNA 3US1A 4GJTB 2UU9O 4XPAH 1T7XA 5E5MB 2PWEA 3BDYL 3VXOB 3VD2A 3QJSB 1H5BA 3ETDA 1OB0A 2WBJA 4G5ZL 4Q4EA 3KPQA 4EF3A 1R3IL 5JQHC 5CEXB 1QWHA 3CB2A 4EFEA 3J80N 5D8JH 5E00B 3IXAB 4AUYA 1NGQH 5ITBL 1JRHI 3BQVA 5LYJA 3EFFK 4DPBX 5I1AB 3L4ZA 3WG7B 2IADB 2ZUVA 2VL4A 3VD1A 1QTYT 4ACTA 1GMGA 2I26N 2J3SA 2Z7YA 4G7YH