5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
4JHVA 1V54B 1SNRA 2VM3A 2XUWA 2ZONA 3QJRB 4UAHA 4E9VA 4N8UA 1HFUA 4HCIA 4Q8BA 1FA4A 2FJSA 4GYBA 4GY4A 5AZUA 3U25A 4A2GA 1E5YA 5I28A 2HXAA 1MG3C 1AOZA 1AZCA 1A8ZA 2CAKA 3HB3B 1J9TA 2H5UA 2FNWA 4HCFA 4EF3A 4DP5X 2EINB 1L9OA 1NDTA 2FQEA 1SF5A 5I6KA 4F7KA 1B3IA 2XV2A 1PLAA 1HAWA 3FSVA 4YSQA 1MZZA 2BP0A 2QDWA 3N55A 4KO7A 1BYPA 2X88A 2XXGA 3OM3B 2BWDA 1NINA 2OV0A 4KO9A 2BP0B 2ZXWB 3PXLA 3QQXA 2PCYA 3SBRA 2UXFA 4E9SA 2JFCA 4DP0X 1BQ5A 2VN3A 2VW6A 2IWEA 2XVBA 1AG0A 1EHKB 5I6OA 2DYRB 2IDQA 3NJKA 3S3CB 1PZBA 3H4FA 4YL4A 2QPEB 1OE3A 2I85A 2WO3B 3QJQB 1PMYA 2GHZA 2R7EB 5PCYA 2EIJB 4BDVA 3NJGA 3UGEA 1IBYA 1ET5A 5B1AB 4G7QB 1FFTB 3FT0A 1J9RA 3NT0A 2VM4A 2BP8A 1W8EA 1KDIA 1M57B 2FQGA 1NWOA 1T5KA 2IH8A 1GS6X 5PAZA 1AS7A 1JVLA 2P80A 3CG8A 3L45A 2BZ7A 4W1TA 3ABLB 3NSFA 4F2FA 3WI9A 5B7MA 2DV6A 5I6LA 4G70B 2YAOA 1IKOP 3KW7A 1GS8A 3WKPA 4YSPA 4FA7B 1DZ0A 2LLNA 1V10A 3JT2A 5LDUA 1NIAA 1IBZA 1L9PA 1TKWA 2VW7A 1FWXA 1V55B 1J9QA 2XV0A 4BXSV 3GDCA 3FPXA 3NJJA 1E5ZA 8PAZA 2X87A 2BW4A 1PY0A 1X9UA 1ILUA 1F56A 2XLLA 3QJTB 1TU2A 1L9SA 1TEGA 1ZPUA 2CJ3A 1JVOA 2VMJA 1MDAA 1AS8A 4HHGA 4ZK8A 1OOWA 1DYZA 2AZAA 1KBWA 3WNJA 3QJSB 3FU8A 4BWTA 4ENZA 2DYSB 3H4HA 1CURA 3X1FA 5A7EA 3RYMA 1AACA 3NP3A 3PAVA 3TBCA 4KOCA 3SBQA 2H47C 2FT8A 1KCBA 4DPCX 1M56B 2PPDA 1EZLA 1SDDA 5B3SB 1RCYA 2QPDB 3X2QB 3MBWB 2XU9A 1J5CA 3NJLA 4YVUA 4BWUA 4G71B 2CUAA 2JXMA 2XX1A 1IUZA 1SDDB 2N0MA 2XXFA 1JZIA 3SBPA 3AG4B 2A3TA 3PAZA 4A2DA 5B1JA 2AZUA 4HALA 4DP4X 4E9WA 2EILB 4P5SA 1NTDA 4A66A 1MG2C 5B1JC 4YSSA 3NJFA 3V9CA 3UAEA 1KCWA 1NIEA 2I7OA 3CVBA 1XB8A 2YAEA 2NRDA 2Y69B 1AZRA 1ZIBA 2HX7A 1JXGA 3PCYA 1AIZA 3FQ1A 4PAZA 1OE2A 1SJMA 2FQFA 1RKRA 3ABGA 4E9YA 3ASNB 4AZUA 2HLEB 4E9QA 3T6WA 2HX8A 1CYXA 1NPNA 4GP8B 3ZBMA 4DP6X 1WA0X 4A2EA 2J55A 2J56A 3FU7A 4K9JA 1I53A 4QLWA 4KOBA 3N2JA 4YSOA 2P80D 4HZ1A 1ASQA 3FU7B 1GSKA 2PP8A 1ADWA 4RH4A 4WTQA 3UADA 1OF0A 4KO6A 5IY5B 1L9TA 2FT7A 1HAUA 3WNIA 1BQKA 3DIVA 5AKRA 1J5DA 3EF4A 1AS6A 2PLTA 3FYIB 2PP9A 3NYKA 1BXUA 3FSWA 3X1NA 2EIKB 3ZIYA 4AI7A 1GR7A 1PF3A 4KO5A 4BDVB 4BK5C 4DP9X 5EHFA 1AG6A 4G7SB 4GP4B 1NIBA 1KGYE 1WS8A 2UXTA 2BP8B 1SHWA 1JZGA 5B7FA 5I5IA 5D4JA 2YEVB 1NWPA 3ABMB 1CC3A 7PCYA 4HAKA 2TSBA 2IH9A 3AG2B 2CCWA 2HX9A 3S3DB 3IN2A 5I6NA 1RZPA 3S8GB 1KYAA 3C75A 4L0PB 1NPJA 5B7EA 4YSCA 2GI0A 2CALA 1ZV2A 1ET8A 3T6VA 1OCZB 2Y1AA 4E9XA 1WS7A 1QNIA 4N4YB 3MX0B 2YAHA 1E67A 2W88A 4BWWA 3IN0A 1MZYA 1PNDA 1BEXA 1RZQA 1NZRA 4GP5B 1SHXA 3G5WA 3OD3A 2B08A 3BVDB 4KNTA 5FC9A 3T6XA 3OMAB 4DP1X 2HZHA 1BXVA 1NIFA 3NJMA 2IDFA 4W9ZA 2BW5A 1PLCA 2XWZA 4DPAX 1JZJA 3FPYA 1ZIAA 3WG7B 3BQVA 1A4CA 1JZHA 1PZAA 1W6WA 4F2EA 3NJNA 3X1BA 2MRYA 2I7SA 1KV7A 2IWFA 3FSAA 4JHUA 2GIMA 3NJHA 4M4RB 5I5MA 3CDZA 1TEFA 1NICA 2PPEA 3PLYA 3S8FB 2WO2B 3H56A 1NIDA 2BWIA 2XX0A 1JZFA 4DPBX 2XV3A 1E65A 3CDZB 4G7RB 4FAAB 4BXVA 2UX7A 1QHQA 3OMNB 2DY2A 4Q89A 3FSZA 3WKQA 4A68A 1PZCA 2ZWNA 2FT6A 3ERXA 3EH3B 2UX6A 3GYRA 1CYWA 2AVFA 1UATA 3T71A 3KW8A 1VLXA 4HIPA 3QJVB 4QKTA 3ZX1A 4TXVB 2PP7A 1PAZA 5D4IA 3NSCA 4A2FA 2UXVA 1ZDSA 1PLBA 1N70A 3IE9A 7PAZA 2PPAA 3AZUA 2YQBA 2E86A 2DWSA 3NSYA 1JERA 3T6ZA 3DTUB 3FU9A 3IBOA 2HRHA 1AR1B 4M3HA 2JKWA 2VW4A 2IDUA 1JXDA 2QDVA 4JKNA 2OJ1A 2AANA 3UACA 1WA2X 1KBVA 2FWLB 3CZUB 2UXGA 3ZDWA 2YARA 5F7BA 2BZCA 1PCSA 4YSUA 3HEIB 3CVCA 3QPKA 3QJUB 2BHFA 1QLEB 4CSPA 2XYBA 1W6LA 2YAPA 2CBPA 4GXFA 1WA1X 1BXAA 2J5WA 4A67A 2TSAA 3X1EA 3EHBB 2OCCB 3T9WA 4YSEA 4NB7A 1GY1A 5ANHA 3AY2A 4X4KA 4YSRA 5E9NA 2ZOOA 4P5RA 2W8CA 1CUOA 5B1BB 4MFHA 4A2HA 4YSAA 1N68A 2R7EA 4HHWA 5AFAA 5TK4A 3FS9A 1GW0A 1PNCA 3TU6A 1X9RA 1ILSA 9PCYA 5TK2A 5I6MA 3JTBA 2PCFA 1JOIA 3TA4D 2RACA 1SFDA 4CSZA 1YLBB 1A65A 2PPFA 4AKQA 3AW5A 3AG1B 1J9SA 1M9WA 2VSMB 5F7AA 3V9EA 4YVNA 1BAWA 5B1KA 1BQRA 3FQYA 1BYOA 3GXUB 2GBAA 3ABKB 2QT6A 1GS7A 2DWTA 2YXWA 2BO0A 2YAQA 1XB3A 4KNSA 1ET7A 5I6PA 4AX3A 1XB6A 2H3XC 5I26A 1JZEA 1AZUA 2FTAA 3DKHA 1OV8A 2B3IA 2VSKB 4E9TA 1AAJA 1AANA 2J57A 3S3BB 1ZDQA 1OCCB 3NP4A 1WAEA 3OQRA 3OMIB 1KDJA 2HRGA 2GC7C 2IDTA 3PPSA 4E9RA 1OCRB 2FQDA 3NJIA 1AQ8A 3FYEB 1R1CA 1L9RA 1GYCA 2MTAA 3PAUA 1L9QA 3TBBA 6PAZA 4HCGA 4NERA 1ETJA 4NAJA 4YSTA 2AFNA 2Q9OA 3TASA 3FQ2A 2YAMA 4PCYA 1E30A 2GB2A 4DP7X 4AKOA 1ASPA 5I5JA 4YSDA 1URIA 1SF3A 2YXVA 2PPCA 1IC0A 1OE1A 4KNUA 3IEAA 3D12B 4G72B 4UANA 3AG3B 3EH5B 2GSMB 1GY2A 3NSDA 4WKXA 3UAAA 1A4BA 3CVDA 3WIAA 1OCOB 1ASOA 3X1GA 5D4HA 2YAFA 4AKPA 1AZNA 2IDSA 2IAAC 4UF7C 1XMEB 3ASOB 2Q5BA 3SQRA 1AZBA 2WSDA 3EH4B 1A4AA 1SFHA 1A3ZA 4DP2X 1JXFA 6PCYA 2EIMB 1ID2A 4DP8X 3UABA 2IWKA 2GC4C
chains in the Genus database with same CATH superfamily
5H37H 2OW6A 4TULL 4JHVA 3AB0B 5TDNA 3RVXD 5MENA 2ZONA 1JF1A 4KJWD 4PV1C 1RZKL 3D30A 2XQYK 4HUXA 1NCBL 1E40A 1EZVH 1RJLA 3K2IA 4J3BA 4D3CH 2Y69C 4YDLC 3LKOA 5EUOB 1GSMA 2Z7WA 3VGAB 4O4YH 4LF4O 4N0CC 3EFFK 1KD1W 1A6VL 2PXYA 1R6KA 3REVB 4ETYA 4G82A 3UGXA 3ML9A 3CFJA 1HOCB 2ZYIA 1T0PB 1D5MA 1FG2B 1JWMB 2FZ3A 1UT9A 3DIFA 4HMCA 4KK6C 2MFNA 4QHPA 1WZLA 3VG9B 3ASNC 5IKCB 1B3IA 1A2YA 2KPNA 1Z1WA 2FO4B 1L1FA 4N21A 2ITCC 1MZZA 5B1CA 4UCUA 1J86A 4N23A 1RU9L 3APFA 4NN6B 2OL3H 3K4DA 3SDXE 3MTXA 5GZND 1X4XA 4B3SO 3H9HB 3WFEL 1KBPA 4U3SB 3D6GA 4LFAO 4B27A 3HG1D 1TDQA 3KLAA 2UU9B 5K93A 1UB5A 5SX5H 5AB2A 4X20B 5E8DL 4GKNA 4P5MB 3RIKA 3MRPB 5EBMB 4OIFA 3IXTB 1R3JC 5IY5C 1T80A 4BW5A 3H4FA 3OR6A 4HQQH 4PCKA 3RYIA 4I1RA 3SJVD 4TOYH 4D6TH 1ICTA 3HC4H 3KD4A 3QJQB 4DV5B 3GI8L 1M1XB 1EQWA 4PGDB 1VZHA 2WLKA 4KKRA 1HU8A 2ZSVA 2IBZH 5AOKA 5LVEA 1Z9MA 3B7SA 1MFBL 5LXTB 3V2AR 3MJ9H 3T3MB 1F3JA 2AW2A 3BD4A 5HYEA 1T03L 3QDGA 5DZ9A 5ID1A 3H7BB 4M1DL 1D9KD 1CDIA 1ETA1 4WU5B 1CS6A 1KNOB 5AW3B 2P5WE 4E0RA 2IH3B 2X0UA 2VDPL 2ZCLH 5F1IB 1UM4H 1QPXA 2VDKB 4R6ZA 4QRPD 1U96A 3RB7A 1Z6JT 3QPXH 5I6LA 3CZJA 2IOOA 2ATPA 1EAOA 3U4EA 5CIPH 4HOZA 3BVNA 4XO8A 3N2GB 2VABA 1A3RL 2HMID 2A7BA 3WN5C 3JCUZ 4KU1A 4FI6A 2MCAA 3KPNA 3BE1L 4JRXA 5LB1A 3CRAA 5FNVA 3B6SA 1U4EA 3WXWH 5KSAC 2RQEA 2Q7GA 3KZIZ 1VF5B 4LRNH 2K3HA 1DVYA 1A7BA 5DJ8B 3WLWD 1U6AH 4M3JA 4MD5A 4ZPVB 4HBCH 1MDAA 1AS8A 4HDIB 2GEQA 2YPLD 4GW5B 5I0VA 1W8NA 1J1OL 5IFAL 3U36B 4HU8A 3HE7B 5GGTH 5IBLD 5F3BB 1IJNA 4KTYA 2DMBA 4IM8A 3P4MB 4X4XA 4L37A 2GHWB 3R0NA 4JTDB 3PAVA 3BFRA 5FM4A 3BP4B 2NNCA 5FGBC 5IJ0B 3VH8A 1FRGL 4BFGA 4CADA 4DUZO 5LGTA 4JI2B 4EUPA 1J5CA 5IVXE 3E22A 3MDSA 5B21A 3REWA 3ZL4L 4M48L 1RAMA 1A0QL 4JFED 2WIIA 2BRQA 2BXYA 5E99L 1R3IH 1IEBA 5HJGA 3TCXA 4ZKIA 2NY5C 3G5VA 3CFKA 2R72A 5DR5L 4X65O 3KPPB 2EO7A 2X41A 1RIVH 3NJFA 3QFJE 1Y07A 3HCVA 2FEDD 4S11A 2I7OA 3DNKA 4PB9L 3T0EB 4X7FC 1HQ4B 3WJLC 3QXVA 4K5LA 5I30L 1VFBB 1EZVX 1RPQA 5T5NF 5GGSY 4MMZA 5ISZE 1VSCA 4XNUH 1ZIBA 3K4AA 4K7PL 3WEMA 4UOQA 3BLPX 5ELIA 1VFOA 5L88L 3CN3A 3MVSA 1KU9A 4XVJH 5GISL 1ESOA 1T1YA 1QR1A 3FQTB 3FFDA 4LLMA 4LB8A 4AZ8B 3EO0A 4E2LA 2HLEB 4TQ8A 1CEZA 4AZUA 5I6XB 3CVHH 3KZ8A 4C8XA 3CWGA 4LHUG 3BUYA 1G7PA 4DP6X 1E42A 3DV6B 2ICES 4JHZA 5D8JH 4XNYL 1Q9KB 3NCXA 3MAQA 3O0LA 5JW4N 3GXTA 3AS2A 2IO5A 4WFFD 4DVBB 2Q8BL 3TLRA 4FNQA 1DUZA 2DM7A 1VAHA 5BMFH 4XMZA 1CI5A 4YR6B 1FPTL 3OC8A 3FD9A 4MJIB 3V0EA 1K5WA 4EPSA 1T89A 3QWNA 2D7NA 3UADA 1Z9NA 3DI3B 2DAVA 3S5ZA 4XAWH 1DJYA 2FD6L 3SIKA 5E79Z 3ZDYB 4QJ5B 4IJ3B 2VAJA 4I77L 3ETDA 5IB4B 1NUNB 3JBG7 4NUJB 4AJVA 1OTTC 2XVLA 4PRHE 2OYMA 1MCIA 4X80L 3VQYA 2B4CH 2YSSB 3U1SL 3NN8B 4GI9A 3QUZB 2G60H 3EYUL 4TVPE 2GG1A 2WXHA 4HIEA 4P3DA 5EBMC 4CN1A 1PD1A 3O8XB 1IXMA 4M7LL 1CLCA 2ZKWA 1H8OA 5K1PA 1DCLA 3OVUB 2CH7A 5CJQH 4DKDC 2OBGA 2LU3A 4JI1B 2J1XA 4IGBA 5L6YL 3HPLB 4ADJA 4X64O 5JPMB 2CSPA 4HJGA 5DTFB 2K4AA 5D4JA 2LR4A 5C9KA 5D6CA 5IFHL 3PGFH 1JMZA 1RFYA 4DW0A 4Y2DD 4DVRL 2IH9A 2G3ZA 1I8IB 2FNBA 5DD1L 3S3DB 4IKJA 2X2HA 5KBDA 3DHPA 2E7BA 3ARGB 4EMZA 1FZJA 2GI0A 5IR1A 5C6TH 3DVGB 4RDQF 2VIRA 1N0XH 3MX0B 4X5WB 3VJ6B 4AT6B 1ZK9A 4N20A 2Y1VA 3K57A 4ZX5A 3RJDA 4RAUA 3SDAA 1CFSA 4AUJA 1Y18B 1DVUA 2OSLB 4KX9A 1JMKC 2QM8A 1HWYA 3EJCA 3L3GB 5J9PB 1Q4NX 1ZLUK 1UUSA 4YZFF 4P9PA 2BY3A 2X3BA 4BUHA 5IIEB 3OMAB 1EJ8A 1RY7B 3GK8L 4GXUM 4AQYO 1E6OL 3HN3A 4Y5YA 4LVOB 1PLCA 4M7ZC 2A83B 3LSQA 2DL9A 4J4PA 2XWZA 4F37F 4ZI7A 1M4KA 4TYUA 1CGWA 4B7EA 4YUEH 3IMRA 1M4UA 3OHXC 5T33H 3HAEA 4PWGA 1UVQA 1RUKL 4DGYH 1KEMH 1KJ2B 5EO9A 4OZIB 4TNFA 3BVVA 5TE4H 2Y3AA 3M7OA 4JPKH 4DKFH 4DK0A 1KV7A 4ELKB 1NGPH 4PJGB 4FTDA 3CPWU 4MD0B 1F4NA 4YO0A 4M4RB 4G5ZH 4HNAA 4DUWA 4UNVA 3UZVB 1X6NA 2VLJD 2XWEA 3D69A 2IIJA 5CJOH 3IGLA 1LILA 4X9GA 4G8FB 1YI2V 2ZWLT 1DO6A 4PJIF 1RPRA 2FGWL 4TSAH 2Q0OC 4KKAD 4HZLB 1FL6A 4JFXA 2Z0AA 4OZGF 4QRBA 4BA8A 1C5CH 2AEQH 3LHAA 4DV6B 3FMGL 3S2CA 1MI5D 2W9DL 3P9MA 1CICB 1JHLH 4CH5A 3EH3B 4GUPB 1S7VA 3NCJH 4OLVH 2QADD 3GYRA 1VB9A 4RISH 3T0XA 1PM9A 2GAZA 1A4JA 1UATA 1F8TL 3IFOA 1XCQB 4QPEA 2WPDG 1NCDH 1K5NA 4ZOAA 5IFJA 1AP2A 4I18C 5ALCH 1P7BA 1HX0A 3QUYA 3VI4F 3QEQE 3L3OB 1OGTB 3OLGA 4OCXH 4YHPB 2W94A 1HWGB 3MOQA 5DMGC 2V4DA 3P30H 3C08H 4X8GA 4WW2B 2YUZA 5DJYA 1AKJB 1NKOA 4BSVA 3NSYA 4N9GA 4IRZH 2VDNL 5CMUA 4GAYB 1XOUA 2I9LA 1YQ2A 1EJOL 3GBNL 4H1LG 3HMXL 4HISA 4P9HC 1G8MA 2DD8L 1IAII 2YMOA 4TVSa 3DI2B 3DX6B 2IDUA 4WCYL 3A4EA 2GW5A 5DSCB 2OJ1A 3LRSA 1X5XA 1THAA 1A9EB 4C7UA 4OX9O 2BCKA 2JMRA 2NY6B 5D5ME 4P3WA 4G2KA 5GZOD 4NGHL 1JD7A 4DK5A 1MFAL 1Y1UA 3KPSB 4BFRA 1KF9B 2EP6A 5CD3A 3GEWB 2OMVB 3SKNB 2NY2C 2X2JA 4PP2B 3STLB 3CVCA 5JIHA 1KC5H 2KYIA 1S9VA 1BZ7A 2WXRA 1UWFA 5A2LH 4OVVA 3IDGA 1OK0A 4P2OB 4AGNA 4KMLB 1UTDA 4M43L 3LXAA 2G4GA 4LLQA 1H38A 1G1XB 4LHUA 2FX9L 4XNXL 3U9PH 1PBYA 4P4KA 4IOFC 2NQDA 4QD2E 1TTGA 1EDQA 3VDCA 4PA3A 3IGAA 4OIBA 3MUJA 3D0AA 1QRNE 3QIWA 3A67L 1LWHA 3GJEB 4KY1H 5AVZB 5B1BB 2A73B 4PB0L 3S3PA 5AFAA 5J8OA 4KK5C 4LDEB 4TS6A 4G83A 5CA1A 3QXTA 3OMZA 2OMZA 3KYKH 3TU6A 1IQDB 3II1A 3V6FB 1WLHA 3H42H 2AJZB 2VXUH 2MQCA 3W7SA 1CFQB 3P3SA 4OZFB 3EFOB 3GWOA 3IJEA 3G6DH 1DN0A 5D1XE 3VCLB 4NO0A 4Z7WA 2Y5EA 1WT5C 4OQ1A 3S97C 5FX3A 2OZNA 3Q2LA 2NY1C 3BISA 5FFOA 4EEEA 2GBUA 3I3DA 1BAWA 1HE7A 4DQOL 3OKLA 2BSKB 4LVEA 5LYJB 2F6AA 3HC2A 2XZQL 5DHVA 3RX8A 3WOVA 3MLXH 2V7NA 2IXQB 5L9DH 4C55A 5ACZA 4XC1L 4O2AB 3LEVL 3QO0B 4FMVA 1TIUA 3CSTA 4J7RA 4QOKE 5DMJB 1EXHA 1XSOA 4EBQL 2JJSA 1FH5H 1E1QG 5KYYA 1HH6B 4P2RA 2J8UB 1Z5YD 1JGIA 4MVBD 3K1DA 4XMKH 2P5EB 3RU8L 1TYEB 1AAJA 2BVEA 3GJFA 4KKLC 2OXHB 4IBTA 1WHPA 3S3BB 1V55C 3VXTB 1A02N 2YGVA 5AKSA 4JCLA 1CFBA 1HHJA 3FB6C 1TGOA 1YTFD 3JARA 1NGZB 2GC7C 4UNUA 3VD2A 3LRKA 1NUGA 5DMIL 3MHSC 4IQHA 4J28A 1S7XA 5IJ9A 1TYJA 2JTYA 4GEJA 1BOGA 3QSKB 5IVZB 1WZMA 4HH8A 3EYFA 4XP6H 1RVFL 3ZHUA 5FOBA 2DKMA 4NQCA 3QF7A 1T21B 2Z0UA 1QSFB 4Z7UA 4Z7NF 2HRPL 1SLWA 3AAZB 3BP5A 2DEWX 1X5HA 3L7FB 2XJKA 1QWHA 2PPCA 4PJCA 4C59B 2AK1L 1KC8W 1TQCB 5K59E 3PIQA 1Q72H 3OKEA 4XP4L 5DHYA 1T0MA 3OGCA 4Z3TA 3ZRWB 3CFMA 1E2WA 2B8OT 5CN2A 4F8PA 3GBMH 1SBSH 5FYKU 3T3PE 2I26N 3OXSA 3UYPA 2YK1L 4ZDHA 5JXEC 1B06A 5D5PA 1OAYH 1AP5A 2VLKE 2YKKA 1UA3A 4F9PC 3EYVB 5JR1L 3QEGL 3GSNL 5IGXH 3EH4B 3ESVF 5C08A 1D2OA 3BH4A 3EJZC 5LA6B 3NQKA 2IWKA 2CGOA 1ZWIA 3O11A 3HKDB 5I0WA 3B9KA 1E8WA 3H2WA 1V54B 3ABUA 2DM3A 5EZIL 5GHWH 3DLQR 4R0LA 1E7UA 2HJDA 4QPJA 4AEFA 2OIGA 4OY9A 5DI8A 5SV3A 2HT3C 4HCIA 1Q38A 4JO4H 2HWZL 4Y5XC 3X3GL 2WWMD 2FBJH 3U25A 1BMZA 2ADFL 4WHYH 3DMMB 2CUHA 4LSQH 5I28A 4Y1AD 4LAQH 1FZKB 1CG9B 4PGEB 3L3OC 2C9AA 4LO9A 3IS1X 3ZW3A 5I1LA 1OP9A 2WAQA 3P3NA 3DX0A 1XD0A 1X5KA 5EV7A 4OI9A 4DV1O 3ILQC 2X4OA 3MNVA 2QTVA 2ZTBA 3K2KA 2UYLA 3GSVA 1R3LB 2D3NA 5AG9A 2H32A 3SDCD 3ULUF 5DO2C 3FBKA 4NP4H 1OZ0A 1ZS8B 1WPBA 2X10A 1TVHB 3O0RH 4H1LA 2YMXL 4BR6A 2X05A 4Y2LA 1IIKA 3TT3L 3UBGA 1RD6A 2OA9A 5H2BA 3QIBA 5J12B 2FL5A 2QR0A 3SDDB 3UZQA 2F53E 4FFTA 2JIXA 4JO3H 4KZEL 2DYRB 3UBHA 4RWUA 4LLVA 2R27A 4FQ2L 5DYOB 3PHOA 1M2OA 4M5ZH 3E8HA 1PMYA 4G5AA 4FMFA 5C2UB 2AC0A 1A3LL 4XMPL 1P7QB 1CGYA 1TZHB 3LKPA 4PJFF 1Z9SB 4JYAO 2MWCA 3AWEA 1BBDL 2K7PA 1T20A 4HWBH 2R39A 3H54A 1V7MH 1UJ3A 3K1KC 5C92A 2PCPB 4YHMH 3ZN6A 3INOA 3D5OF 1EO7A 4N2EA 1BMGA 2VM4A 2UZYA 4HIJB 4WEEA 5FS5A 4K8RD 2Y6TE 3D06A 2EJ1A 3C6EA 5D7EA 2PR4L 5IB1B 2EBOA 1ADQL 1FNGB 1RUPH 1KLUB 2IAMB 3L7EA 4ZX3A 2DS4A 4NXSA 2ITDB 1HDMB 2EDQA 4MQ7B 1SUJA 1TVDA 1DJXA 4HIHB 3QFDA 3UBFA 4I13B 2E27L 1LNUA 4JRYB 5EFIA 4U6TA 3WN5A 1DZ0A 2GJ6D 1JPSL 3RGVA 4G42A 5L4MA 1J9QA 2CG9X 3O45A 2IU3A 2F95B 4FKKA 2XNAA 4X5XA 4DR5O 1MPAH 5ALBH 2QHRH 5KSAA 1DL7H 2NX5B 2AXGA 2O26U 3BVWA 2FLBT 4E9LA 1L9SA 4TV8A 4Z1VA 3TGXA 3NACH 4Y4HC 1RZJC 4WFED 5IYBO 3ECBA 2PTMA 1J1PL 4QRTA 2P5WD 4ANXA 3IU4L 1JS4A 4NC0B 2APXA 5C0IB 3O6FD 4ODSH 3UTZB 3ISWA 1P53A 4UTCA 3Q0HA 4JG1H 5KOMC 1ZA6A 5HYSB 3IS0X 4CJ0A 2X1WL 5L3EA 3EJRA 1ZUQA 3FB7C 3D36A 1IEAA 4JPWH 5GRVL 4Z8FL 4LPWA 3KCXA 3ET9F 4QHMB 5FGBA 3VXPA 2KZKA 2KLRA 5DJ2A 2CGRL 4DPCX 1LO2H 1F3DH 1NGWB 3L3DB 4PW9A 1W72B 4HPYL 6FABH 4QO1A 2RGSA 3GUTA 3QXWA 3HUJF 1GMEA 3HZMB 1QABA 5K9QG 1YEHL 1LDPH 5TE6H 3RAJH 4QT5A 4PJ5D 1G7IA 3T8VA 3AG4B 1PKQB 3LH8A 4PW4A 5FV2A 4J11A 3FRPB 3MNWA 3U6RB 2JXMB 3QB7C 3GSXB 3BW9B 3MRGA 1MWAL 3V4UH 2C7UA 2LHAA 5DRNB 5KYWB 3U46A 2KDYA 4DGWC 4K55A 2WXIA 1DQKA 3KLHC 1WAZA 3C87A 1KFAL 3NCYP 4OGZA 1UXSA 3S34L 3A2FA 4BFKA 3AJ7A 2YKLL 4I0XB 1AZRA 2NW2A 3M1OA 5IEKA 3SPGA 1O9HA 4FI7A 4U1JB 3LEYL 4P4RB 2VDKH 2G3XA 2CKBA 3BP7B 4MSWB 1RHHA 3BSGA 3JAKB 3BT2L 2Y7OA 5DEDA 4H4NA 1OSEA 2X2UA 2WJ5A 3BEVA 3HRZB 4BD4A 2HRLA 1DVFA 1T2XA 5SWZD 1SQBH 2WSPA 3Q6GL 4Z7OF 3DMMC 3FB5C 1HEJC 1BL8A 5KVFL 4L3CA 4DNLA 5E51A 4CC1A 3WKMH 1QHOA 3FCTB 1GC1H 4CMMA 3QFJD 3TO4C 4DTGH 2Y7LA 3VFWB 1K4DB 3IXAA 1AYRA 1O6SB 3A6OA 2Z4QB 5BZWA 3SE6A 2AAVA 4D7TA 2P80D 3MLZL 4JR9H 4KK9C 1WJ3A 5ESAA 1KIQA 3BDXA 2YWZA 4YHIA 1KUMA 4RH4A 3T2PA 5DXWA 5AWNL 4TNWF 3K71A 1SERA 4Q6YA 4KXRA 1JXKA 2DMHA 1J9CT 3FUIA 3W9EA 2MH4A 4L4VA 3PJSK 5LMUO 1KCKA 3GZPA 4JG0H 3SYPA 2ZOLB 5I5RA 3A0HZ 3MOAL 1GN3A 4Z0BL 4CNIA 2D3JA 1IIIA 4JBSA 5CN3A 3RWJA 3ARBB 4PY7B 3X1NA 1A7RH 3NMEA 4P5TA 2DKSA 3JSSA 4YAQB 2HKOA 1R3KA 4ZW7A 4CU6A 4XPAL 4NWTL 1GR7A 3P4NA 1BGXH 3U7WH 2OTWA 3K81A 4HWEH 3LMJL 2Z3YA 3DX7A 2VO8A 3FAVA 1GN4A 1NBVL 1YNTF 3OKKA 2IBZY 1JI2A 2DIBA 4M8UA 5FO7A 5LBGA 2MPAH 2VDML 3OUSA 4MAYC 1AC6A 4I87A 4IYHA 3G5XA 3CFUA 2NYYC 4HC1L 1WFJA 3CFBA 4IS6B 4MXWH 2CCWA 4X5RA 2HX9A 2NYZA 4A7SA 1MCCA 4ALAH 2NSQA 1OAQL 3VU1A 4RQEA 1LDSA 1FSKB 1KCLA 4M02A 5AVTB 3L3HB 2R29A 3LEXB 3R4RA 4OD1L 4I7ZB 1HL5A 4E9XA 3V10A 2GTWA 3RUGA 2XQYA 4PRHD 2NR5A 3OR7C 3ZHRA 4WFBV 1XFPA 2IAMC 1M7IA 1NGYB 1E67A 4PPTA 4I3RH 1YNKH 2IWGA 3BPOC 3KLSA 2A6DB 1YMMA 3LN4A 4TVPD 1KPRB 4F37K 3OD4A 3G6JF 3EFFA 2FIKA 5D7IF 1AC0A 2F19H 2X38A 3P73B 5HHVL 4L4TB 4R96B 3RL2B 5L8JB 4P23C 5HGHA 2XTJB 4NS0A 4IBYA 1T4KB 3MLUH 4N87A 1OCCC 1YDPB 2JQAA 4OGAC 3B8NA 2J4WH 4DV3B 2XFXB 4P57B 3EFDL 4PWIA 4UV4L 3R7RA 5L3GA 1FZOA 3CRQA 4EDWH 1IGML 2YPKA 3D2TA 3O4OC 2WZPA 3JVGC 1JNNL 2H26A 3GLEA 4DH2A 4NXNO 5GRZA 1QEWB 3IAPA 5DUPH 1XO8A 5B1OA 3LDBC 4F2EA 3BGMA 1PYWB 1CLOH 2H3NB 4F1ZA 1KKDA 1GAFL 2FSDA 3DVIA 1WBXB 3T1FA 1MOEA 4GBXD 4PA4A 3CDZA 4AVKA 3MLWL 3CCRV 2J88H 1QLRB 4GI6A 3VXOA 4G9FE 3BGFB 2WO2B 3K6DA 4OZHB 5E9DE 2IH1A 3D18A 1WQVT 3KPRA 5BV7B 3O2WL 4S1RH 2J2ZB 5I9QC 2WQRA 3U0WL 4CS3A 4NT6B 1CD0A 2HFEC 1SMAA 4WO4B 2H0JA 4HLJA 4AGLA 3A24A 3MBEA 4X6CF 3TV3L 3GS0A 3CJHB 1XGPB 4LOVA 2YBGA 3UTOA 2BRRH 2WLMA 2OMYA 2YSTA 4Y19A 3V95A 3ZS8C 4EXPX 5DD3H 3HZ3A 4DKEL 4OZ4A 4JYYA 2JKJA 5DUBB 2J25A 1I5XA 3GB7B 4WJ5A 1Y0LA 5GONA 4L8DA 5J11B 4MVSA 2NDGA 3SDYL 1E0OB 2QFPA 3P9LA 1N26A 4JM4L 5IB2A 5CBGA 5G4NA 5B3JF 2UXCO 4XH2B 4J3OD 3HMXA 4TUKL 5FYJH 5BVJB 4YBQD 4W68A 5HYFA 3TYGL 2GFBA 1J05B 1G7MA 2X1OA 3C90A 1QZNA 3Q44A 3G6AA 3MXWH 1SY6H 4J1UA 1IBMB 3OSKA 2P8PA 4UUJB 5DQJA 5AVRB 4AYSA 5L2KA 4Q9RL 2XWCA 4AW4A 2F4VO 2UXGA 1JV2A 2XN9A 4YOKA 2BIIA 4N2IA 1XF5A 3K8MA 1IAOB 2EDXA 2ICCA 2ZX7A 3B43A 2EE9A 3IMWA 3ZTCC 4KJPD 1LLAA 1UB6A 4X8JB 3VGGA 2J5WA 2DQTH 1MCNA 1LD9B 3BCCH 3QUHA 2DJ4A 2Y36H 1I0HA 1NOLA 3H85A 4FCAA 4Y2OB 1IM3A 2WXMA 1TUPA 5C0RH 1QTPA 2RCSL 1PZ5B 4H26B 5D7JA 3UO1L 2DKUA 1ZGLP 1BBJA 3CZLA 3H2PA 2R4SL 3ES6B 1KJ2H 3L2LA 4WUUD 5K5YA 4WJKB 4X4KA 1R6NA 5E9NA 4M61A 5CLXA 2OIEA 3BUIA 2W8CA 3GO1H 3BN3B 3Q8FA 2CCLA 3UG5A 3BA9A 2EDWA 5GGSA 2HPTA 3MREA 1FVCA 4JO1H 1ILSA 2NY4C 3V5KB 2YEZA 1XSIA 3DURA 5C0DA 4OKDA 4PRPA 5INCB 5MI0C 1WT5A 4LF5O 2X6UA 5AG2A 4ANVA 5HHOA 1AGCA 3JWDC 4Q74A 1KCSH 4XN2A 4RMQA 3RNQB 1RHFA 2GK2A 4D3CL 1HNZB 3OZKA 5F7AA 3NIGF 4O4YL 2F5BL 4YVNA 1OAZH 2ORBL 3MRMA 3D3VE 5EEWA 4PSRA 4LQFH 1TQSA 5EIQA 1I3UA 3GXUB 2X5PA 1N5AA 4NQSA 4ILDA 2Q8AL 5E6IC 3L3IA 1X7TA 1PG7H 1QRND 4XNZB 4CMHC 4RCAA 1COBA 3F84A 3HG1B 5BW7A 3GXIA 3E2HB 2XHBA 4WI0A 4FGMA 5A16A 3EDDA 1QATA 4F8OA 3G7TA 3BCDA 2OL3L 3RBGA 1IAIL 2OTJV 2F9BT 2ZDIC 3PDOA 4RGNC 1CFNB 1Z3GL 3ZTEA 2I9TB 5DJAB 2VMDA 1TQBC 4C56B 2YD6A 1QZ1A 3OQRA 3SJVB 1NCHA 4JGUA 4F5CA 5D1XD 2HRGA 4MNHA 2DIEA 3SO3B 3BYYA 1LEIA 3D2UA 2X7LB 3LZNA 4TTDD 1T66D 4KP4A 3M6DA 2FR4B 1A6AA 2P48B 1OTSD 1XGUA 3UPRB 2CAZC 3B8SA 3HN5A 3RWEB 4YMPA 2APWA 4HQQL 1RJZA 4NERA 4TOYL 4ZW5A 5HDQL 2OX5B 5CZRA 3HC4L 2MCG1 1T7VA 3GWJA 2HVJB 4QOKD 4NO5A 3V6OE 1QEXA 1NH2D 1RK1A 1JCVA 1BIHA 1D9KB 1CPYA 4NN7B 5M94B 3EJYD 4FZ0A 2BIHA 2WGXA 1MCQA 1QW9A 2Q0ZX 3J80N 4QRPB 2QL1A 3IC7A 2K8MA 2BVOA 2UY6A 3CDGB 3HFMH 3MJ9L 1SQFA 2GSMB 1LL1A 4HWUA 5I82A 2Q4PA 3K6NA 5JXEA 1PU0A 1M56C 5B38G 4QRQB 2EDEA 1OCOB 1JNJA 3KG2A 1ES0B 2YAFA 3AQZA 3HTLX 4X9FA 3BAEH 2ZCLL 2FYVA 5ICXB 3A4FA 1MAKA 4NWUL 3VXSB 1UM4L 5HI5D 1A6WH 3QAQA 4Z7VE 5ESQA 4MW8A 3QPXL 4X7TB 2O57A 1HSAB 3GBDA 4OZFH 2UU9O 4GW1B 4PGZA 1IGCH 3NFSH 4ODBD 3WHXA 5LHHA 2CM6A 5ITFB 3MGAA 1ZSHA 3A0RA 4GG8A 4Q8BA 1NBYA 5B4MD 3WDHA 1MJJB 1K3ZA 2EXWD 2YPLB 1MG3C 2AXJA 2WOBA 4DV5O 1BQSA 4GKSA 4DV0B 4YHOH 4D0BA 1AOZA 3OXRB 3WXWL 5KAFZ 4HH9B 1YQVL 2DQHH 5IJKC 2JS5A 3AS0A 3T1WA 4YJ3B 2C1PB 2BS8A 1U6AL 1J1XH 2VLKD 4HKXB 4IU2A 4LSUH 5G4OA 1LQSR 5JOEA 4U1SB 4UINH 1Z5VA 5GGTL 3S35H 2R2BB 3PV6B 5JZ7C 2VLRE 4OJEH 3B2EE 1W0WA 2G75B 2FLRT 4RAVB 4JFEB 4OIIH 1Z66A 2PTTA 5ANMB 5LNGA 1MOFA 1B4JL 2J8OA 2VLLB 3MRKA 2ODIA 3SBRA 1SZXA 1E3FA 2UXFA 3N50A 4HIIB 5KG9A 2BCCH 1G9MC 1D2DA 2Z6FA 1XF3B 1EGJL 4M29A 2AQQA 2E59A 4ZUWA 5A3ID 1Q8IA 4HAMA 3LS5H 4YDVB 1R3IL 5FXCH 3VRJA 4X8AA 4PJXF 4HKBA 4LCUB 3TURA 4MCNA 4POUB 3F7VC 4RIRA 2PYFA 5GRJH 1HI6A 3DGGA 3MRBB 1JI1A 2ZX8A 5FB8B 3QUGA 1RIVL 1IBYA 2CCVA 3MZTA 5B1AB 2OI9B 3SD2A 3WU2Z 5I66A 1N32O 1JYNA 3KGRA 2N7SA 2CMRH 2H2SC 4TUYA 1JSYA 1JUFA 2IVFC 1B0RA 3BVUA 3IDMA 2WQUA 4M9PA 4XNUL 2AI0H 3LVEA 1PFCA 3Q1EA 4HG4J 3ORJA 3G67A 1THZA 1I31A 2E4TA 4JKKA 4U6YB 2IH8A 3KBFA 1DQQB 4OBSA 3GSRA 4HUNB 4XVJL 4WZ9A 1N0LA 2F53D 3JWNC 4RVBA 3ML0A 1U42A 4PRNA 4L3AA 5KS9B 1IKOP 1EPFA 3CVHL 4PTTB 5DEZA 5LWYH 4JM2D 3I75B 2ADJA 1I7UB 1TO4A 1H8LA 1SOKA 1YY8B 2OZ4H 1NM9A 3EGDB 3HMWL 4GT7A 4M6OH 5D8JL 3ILEA 3GIVA 3PHQB 5LMNB 3OTOB 1PGRB 3GDCA 3QIUA 3CS5A 3LN5A 4M93B 2Y6SC 4OAWB 5BMFL 8PAZA 2A3QA 1IM9A 5EN3A 1SQMA 2RHEA 1PY0A 3RWCA 1O6TA 1EDHA 2BC4A 3VSVA 1Q0YH 4IU3A 3Q8AA 3K2MC 3MKGA 3TBTB 1H5BB 5E4EC 1WFIA 4H44B 3PGCA 4N3TA 4IBZA 5E8EB 3CCQV 5L4IA 1T7YA 1QHPA 3PHSA 3AREA 2R2HA 1LP9E 5CBHA 4JN2A 1PIFA 3ZMUA 3FB7A 4ACTA 1XAKA 1BREA 4I2XB 2HJFC 2B4CL 4JRLA 2ZOKB 3WG7C 4XPFL 2G60L 2VZVA 1O7DC 4Y2DB 2MQ0A 1AQHA 1LE9B 2NT1A 2AQNA 3B3IA 1XREA 1KCBA 4F7PB 4HJUA 5CJQL 3STZC 3HPJB 3MV7A 1Q0XH 1P84K 3IFPA 2BNQE 2MOVA 1WFMA 4HV8A 4X9YA 4AV5A 2JCCB 4MA3A 1J5IA 3PNWB 5IHBA 1OW0C 4GX1A 2KI6A 3AUWB 3OPUA 1BA9A 1TOXA 2MSPA 3AY4A 1DLHB 3WD5H 4WSGA 3SQBA 3U2SB 4U2ZA 2IDCA 3OLEA 5JORA 1ZEAH 4JHAH 2IANE 4LSPH 3JD0A 5C6TL 5I1CL 3NIFF 2PYEA 4G80B 3WNNA 4MS8C 3JTTB 2BSTA 1N0XL 5DHEA 4PJBE 1BEYH 4PDMA 1BF2A 1OL0A 3IMSA 1A7QH 4GRWF 1OGAE 4LEOA 4OF8A 3WFBH 3D4GA 5SWSE 4O2FA 5TGBA 1S7TB 2D2CC 4XXCC 3CN1A 4LARH 2LLGA 4PAZA 4IDJH 1FIGH 5C09A 1M2VB 3BAKA 2AEPH 4M1GH 2YLHA 1PZDA 4MTFA 1ZV5A 4B3RB 3E9TA 4F9LC 1OF2A 3BH8A 3PWPA 4L05A 4EZKA 3RWFA 3T6WA 4YUEL 1Y6XA 1ZLZA 3J07A 1A1OA 2A9CA 3GI9H 3KHOA 4JO2H 5T33L 4JI1O 3JV5A 3ZBMA 2VLJB 3M45A 4TNWK 5HDBB 3TO4A 2F54E 1KEML 4P2YA 5IBLC 5EU7E 4DGYL 2PO6D 3R0MA 5KVGE 3QVNA 2ENQA 4GMTL 2XV6B 3QC5X 3FO0H 1U41A 4N2DA 5TE4L 4JPKL 4RQFA 3RYCA 5CINH 2DWYA 5KVMC 4I55A 1NGPL 1ORQB 1YN6B 1EERB 1MI5B 2ZWSA 4JFPB 5H37G 4AQ1B 4G5ZL 4HIXL 2PP8A 1JWSB 3RWGB 2VN5A 3I9IA 4N2CA 5B8CA 5C9JB 5CJOL 5C07D 2QADB 3WUWB 4AE0A 4YHYC 1B3QA 4ZW6A 3EHBC 3K6SA 4DR7B 3FTWA 3HR0A 5E00A 1NVPD 5CGYC 1HAUA 3BP6A 1EEYB 3RILA 4JQVA 2AEQL 1AZZC 1CT8A 3ZDZE 4ES9A 2X6VA 3FYIB 4X4YA 3FSWA 1JHLL 1S7QB 2YRLA 3JXAA 3NJXA 4FQPA 1BHAA 5LGJB 3NCJL 1S0VA 5CEYB 5E1QA 2B7DT 4RISL 2UVFA 2ZXEB 3JYCA 3GNMH 4N2NA 3VTAA 4R5XA 4IT5A 4FDWA 3CMOH 4BH8B 4U31A 3VI3E 1GCFA 4CW1B 1NCDL 1W72H 1ZLWH 3HBZA 2CTPA 1T0NB 2FJFA 1UCBH 3DIDA 5ALCL 4MAYA 1HDJA 4AGPA 4WW1B 2QTEA 4ONFH 4W9GC 4OCXL 4D7BA 2CUMA 5B7FA 5BR8B 4DZBB 4EZJA 5BQDA 4I9WA 4WFAV 3P30L 2FJGA 3C08L 4ZOLA 1VHPA 5BUPA 4XDJA 4Z18A 3ABZA 4IRJD 3NA9H 4LKCB 3O65A 5GS1A 3QEHB 1DQDH 3K4ZA 3MCKB 1V3LA 3P2BA 3GXPA 4HJJL 3ZHQA 4JUSA 3BGAA 5B7EA 3L1OH 4JQXC 4UCTA 2W95A 2ZIOA 4P46D 1I1AC 3FT3B 4XVUD 5E2TL 3ABKC 2HLFC 5FK9B 43CAB 5I0DA 4L1LA 5BRPA 4KHTH 3CU7A 1IBKB 1YUKB 3BZ4A 4IBWA 3BUBA 1EHLH 1BCIA 3DRTB 1TSRA 2K0RA 1EMTH 2D31A 1P9MA 1TR7A 4P23A 1KC5L 4Y4FD 3VWKD 4APQA 1IBDA 5E94A 1BCCH 4DV6O 1NDGB 4R7LA 4YJZL 4ZZKA 4CRPA 4HA1A 4W9ZA 2QLYA 3MRRB 4RFEA 2P46B 4JE4B 3WIHA 3U9PL 3KR3L 3JVGA 4MS2A 1SJHA 4Z3JA 2X0LA 2Q7NA 1PIGA 3IPEA 5KMGB 5CP3A 2FHBA 1KWKA 3CCUV 1TVBA 1MABG 3DO7A 5KBNC 4UV9A 4KY1L 2XG5A 3BEWA 4H44C 1W6WA 2F66C 4Y9FA 2WBJC 4CVZB 3KYKL 3GPSA 3H42L 3RKDC 5HYIA 1AGDB 1NQBA 2VXUL 5DFVD 4Z77A 5JA8B 1BQLH 3NJHA 5EUKA 4CSSA 3EVKA 3EH1A 2EDOA 3G6DL 3GRGA 2BWQA 5BRZE 1E8XA 2VO5A 1U8LB 3EYQD 3PFUA 4Q9BA 2F1BA 4XCFH 1GYVA 1Q82W 1CI3M 3HKCB 3LCYA 5A6MA 3QORD 3MLXL 4KUMA 3MO1B 1QI3A 2N3JA 4X5LA 1BQHB 5EF0A 3Q4HB 1ZTMA 1C16A 2N56A 2W0KA 3H7LA 2NR6A 1OZTG 4U6XA 2EH8H 4ZMTA 4GIAA 1AQKL 3KL0A 1FH5L 4MNQA 1G1OA 4WWNA 4R5VA 1YTFB 2ICEC 3V5HB 3QJVB 2VSDA 5B39G 5HFLA 4U7MA 2C2AA 2KSDA 4XMKL 2B0SL 5D4IA 1QUPA 3HZKB 2EEXA 4NKMA 5C0JA 1NKRA 4LVHB 4OFKA 4U33A 5DRXB 2K7QA 5J6HB 3G9AB 1MH5B 3O4LA 4HD9A 2WP3T 1SF9A 4G9FD 4NKQB 1MMMA 2CGZA 3QHZL 4B5EA 1WHOA 5MEPB 4G43B 2FH8A 2EAEA 3GBLA 4JKNA 3ZSTA 2ICWA 1DTUA 4UFZA 1IKFH 2AANA 1XNQB 2HVKB 5D2NC 5DVPA 4XP6L 3ZTJH 3V4VB 4BZ1H 3BLBA 2OP4H 3KYMB 5EOCJ 2BZCA 4JDVA 3QI9D 2H8PB 5AYTA 2EULA 1AXTH 3ROOA 3GGWB 3RI5F 1WF5A 1QLEB 2BSSB 2WIMA 1WA1X 4A67A 1Q72L 3DDFA 1UXWB 3IDXH 4PV8A 4U7KA 4PJ9A 3BO8A 1OV9A 2XAFA 2VDQB 1AI4A 3GBML 1SBSL 3NIDB 4Z7QE 4BK5A 1U8IA 4KRLB 2QDOA 5HHQB 5ICYA 1S77D 1OAYL 3EJUA 4JZJB 3LB6D 3UGUA 4AQ1C 2F0CA 5IGXL 1H3XA 3N44B 1EANA 3HBQA 1YN7B 4Q9CA 5ICUA 5H37A 3T0AA 1TLKA 3QDJA 3U30B 3L4CA 4Q6IC 5C08E 3VXME 4YHKH 4F6RB 5E6RB 5IYDO 3TIDA 2QKIC 4Y1AB 2F68X 5GHWL 1G0XA 3UAJC 5BV7H 4ETQA 5IVNA 3D39A 2FJHA 3FN9A 1QBMH 4JANB 5F8QC 3DSFH 4ZMXA 1ROCA 4JO4L 2XN0A 5D55A 5IE9A 2FBJL 1HNXO 5AB1A 4YIPA 4NQED 3D34A 5B1NA 2OXGB 4LSQL 2EXSA 5FW8A 2F61A 4LAQL 3SDCB 2EZOA 3O41B 4GX5A 2VNCA 4IIQC 4CU7A 3S5LB 3ZBHA 1T83A 4LLWA 3UYRH 2X4RA 4X0KB 2MCMA 4FG4A 1FO0B 2BO0A 2O6DA 2ZAIA 1FIEA 3MFFB 3MRCB 4TKWA 4ZQKA 4DPAX 4W9DC 3CZEA 3KG5A 5EC2B 4HZ3A 3RY6C 5CO1A 3PJNA 1KPUB 2NXYC 3CJJA 1XB6A 2CR0A 4HGWB 5FF6A 1AZUA 1JZ7A 3B9DA 2OL3A 5EWIH 3HI5H 4NP4L 3K6OA 4XMUA 4HS6A 1NAMB 4ADIA 3D85A 1AR4A 3O0RL 5MP6H 3WDJA 3POHA 2KKQA 5C8YB 3N42B 2F1AA 5FDWB 1OP5K 3X12B 4LMQI 2YXYA 1UQSA 3O3AA 1CGUA 3QP3A 2CKNA 4R9HA 4AYID 5GPRA 7CGTA 4P9OA 4X2UA 3GS4A 3VFTA 4WF9V 3E83A 3TJHC 1C5DB 5KBLA 4JO3L 3D3VD 1K2DA 1XT5A 2CLVA 1G9MH 4JCWA 3M99B 2K9PA 2CPCA 3OX8B 4TNVF 1YMHB 1HSBA 1R5IA 1WTGT 2WOYA 4HEMA 5DS8B 5JIPA 2AFNA 2IADA 2Q9OA 3LKSA 4M5ZL 3DXAD 2YAMA 3SDXB 3NDZE 4GRLA 4WK4B 4K71B 2HR3A 2HTKD 1IFHL 4HWBL 4YSDA 1K92A 4XP9H 2JB5H 1V7ML 5TH2A 3IEAA 4YHML 5IMOB 1XUQA 1F4XH 3D12B 4UNIA 2JLPA 3DTDA 4X9BA 3ZYZA 3MUZ1 3PJSA 4JZOA 1SJXA 1Z32X 2V5TA 3G08A 4KV5F 5CMAB 4NC1C 2LFGA 1I1RA 5C0BA 4ABUA 1S5LZ 1MCEA 2DMKA 4DUYB 3NCWA 5LAXA 1RUPL 4B3VA 4KHXH 2GJ6B 3RDJA 2YRZA 1AZNA 2Q6AA 3O9WC 3NEEA 4DKAA 4FCHA 1S7WA 3R18A 4AGOA 5JW4R 1BQUA 3LRLA 3LZPA 4NZDA 4ZUTA 4ELMA 4W9KC 2NY0D 3D0VA 4JGJA 4HX1A 1BVOA 4MB4A 2P8MA 2VITB 2JB6B 2FHCA 5I1AB 4G8EB 2YS4A 3FT4B 3QUXD 3O6LH 1URLA 2P5WB 4OF3A 2Y22A 3ECQA 1MPAL 4N8CH 1F4YH 2QHRL 5ALBL 3O6FB 1OQOA 3H9VA 1S7RB 4FJ6A 5CHNA 5H94A 3ULAB 4XNMB 2ADPA 3ZZLA 1AZCA 1J18A 5IHLB 2UY7A 1I1CA 2MQ3A 4DP5X 3RA7L 4GKZA 2QQQA 1Q9OB 2X70A 2ZIDA 1R5WB 3SY0A 5B39A 2EUVA 3APCA 3V8CA 1QO3B 4ODSL 3VGHA 4JG1L 2XETA 1C8PA 1N10A 4LF6O 5GGTA 5MEOA 3ECVA 2WLLA 4YSQA 4U3HA 4B9PA 1QRKA 4LBEC 1CWVA 1AILA 4QUOA 3SCMC 3OM3B 3T2NH 1PZSA 5A6IA 1FGNL 2AGAA 4PJ5B 2HVKC 4S1SH 4XDLA 3M88A 3F00A 4PMEA 3U1PA 2FAUA 4X66B 1W16A 1LO2L 1T22B 3MRNB 5K1JA 4F15B 3T2MA 1TCRA 6FABL 3QZWB 4JY4A 1I8MB 1NLDH 4NLAA 4JY5H 3PWNB 1F97A 1LDPL 5TE6L 3RAJL 4GIOA 1HKFA 1ACYH 1F6LL 3F7VA 1OT4A 1ZVHA 3OWRA 2V5SA 1TJMA 3UROR 3P1VA 2CUIA 2ZX9A 1U8KB 4PS4L 3S4SA 4IYIA 3V4UL 3C12A 3NK3A 4OB5H 1N2RB 3GSOA 4QY8B 3HS0B 4J8RA 2G5UA 3IDNB 5SWZB 1MWOA 4LFBO 2BOCC 2AJ3A 2DLFH 3C9NB 1L6PA 3RDTC 4UU9B 4EN2A 4MCYB 4LNRA 2VDKL 5C0CE 4GPVA 3RVWC 4ZNEA 4YH6A 1WIUA 5PAZA 5J2TB 2A9NH 2AZ0A 4P2ZA 1D5BA 3I6KA 1B4LA 3QFJB 3ABLB 1KYOF 1V5JA 5B7MA 2V4LA 1H6UA 5E2VH 2Q76B 5GS0D 4CVWA 4FA7B 3DK2A 1KELH 1S5HA 5LDUA 1OCZC 1J0JA 2B1GA 4H8WC 5HPOA 1UD3A 3WKML 1XILA 2ATKA 2WCGA 1GC1L 2HUHA 5J13C 3Q6FB 4HKJB 4DTGL 4ZNCD 4OLWH 1I94O 2WC7A 4UQAA 3BQUC 1QYGH 5IB5B 3D1MC 4IMLB 4JR9L 3BZEA 1RJCA 4AK2A 4HUCA 1ZTXE 1WAAF 5DJDA 4K3DL 1ZHLB 1E27B 2UWEB 1CJYA 2JI3A 3M17B 4PYHA 3OJDB 1ZPUA 5DURD 4JG0L 4KAQH 1M90W 5JLZB 1EAPB 1SEBB 3DJZA 3OZLA 4QRRE 4UV7H 3GSQA 3GMQA 1OOWA 4UIMA 1A7RL 2K8QA 2ZUQC 2DYSB 1ZLSH 2LW7A 1QA9A 1DEEA 4U3JA 4NXMB 1BGXL 2Y3NA 2YRPA 3ARFD 5IV2A 4NQVA 3STZA 5EU6A 1I5YA 1UXMA 3U7WL 5IG7B 2RMKB 4HWEL 3L16A 2YO3A 5EDSA 3TBSA 1H3GA 1SN5A 4XWGH 4TMPA 4EEQA 1OT1A 1YPZE 3VRLE 2QKAA 3MBWB 4YBLC 3VO0A 4DO5A 3VSTA 1F11A 1S7SA 4PRHB 4LCCC 4BWUA 4QHKI 4MXWL 3JALA 4Z7WE 2QELA 4ALAL 1J5OL 3L6FA 3G80A 5KYUA 4F8TA 1K7DA 3BCFA 4PJ7F 4ZAKC 3QPQC 3QO8A 1KEGH 3OUFA 3LS4H 3MR9A 3L5WA 4XN1A 4UQDA 4DW1A 4GG6F 1TMCB 4F80A 4I3RL 1YNKL 4DAGH 2J3SA 1RFDH 3FQUA 5EC1C 4P2RE 2P6JA 4R3SA 2VAAB 3E6FB 3OGIB 2OTLV 1F41A 1IL1A 4LVNC 2EEBA 3AXHA 5HHME 4D8PA 4DT2A 1FE8H 5HVWA 3KVPA 3MLUL 2BNQD 3KGTA 1AY1H 2YD5A 1GGCH 4L23A 3F7YA 1TNMA 3CFEA 3RWIB 1UC6A 2J4WL 1INDH 1I3VA 3THMH 4P3CH 4KQ4L 2Z31C 4EDWL 1ZS2A 2HX8A 3PY9A 3RVTC 4GBXB 2LFEA 2LU5A 2LU4A 2ZM6B 2P1YA 3AGVA 3FONB 2IAND 5DUPL 3TFKD 2WQ8A 4R8CA 2IM9A 3C5XA 3ZHNA 4AGMA 2HPOA 3NEOA 1MFEH 1CLOL 4EDXA 1NM4A 2EH7H 4DO4A 1HXYB 1L0QA 1OGAD 4AEIH 4PJCE 2J88L 4B97A 3ARWA 3WIFA 5ITZB 4ZMVA 4X7DC 1G87A 3WL9A 4S1RL 2FT7A 1T1XA 1DBAH 5D1QE 3UTPD 5L4JA 3RRQA 2GTQA 4Z5RB 4WHYG 3BWZA 3BHBA 5BOPA 4R7DB 3ARYA 3FU0A 4QNPE 5EH1A 2BRRL 2AHIA 4R4ND 4KO5A 5DD3L 4BJLA 1MVFA 4N1EA 3F5WA 5EHFA 1VQ7V 1MUJA 4POYA 4GP4B 1WS8A 1KGYE 2NOYA 1EXUA 5AOLA 1MSWD 2BP8B 4DV3O 2J7LA 2AEOA 1XIWD 3P30A 3FU3A 3L95A 1JFHA 2KZBA 3TYFB 4IRZA 3FQRB 2RFXA 4QMEA 3WLBB 3AG2B 1S76D 4WDIA 3Q2VA 1NFIA 5ECGA 4WWKD 5FYJL 3C75A 3NFNA 5C0NC 1EUTA 2H0PA 3NH7H 1M42A 1NFDA 1KLFB 4LSVH 3MXWL 4O00A 4N4YB 5J6SA 5B5EZ 2LE9A 3HI1B 4H20L 1TZIB 3AITA 2VN6A 4Y5VB 2MW2B 3PWJB 3DOIA 4L3EA 3EZ8A 4WNJA 1DJSA 4WUUB 4LIQE 2DQTL 4QGYA 5MEND 3BUQA 3BXNB 1YVWA 4S2SB 1X5GA 1N3NB 4LLUB 4XNBA 3WEXB 1UM6H 2BW5A 4AYFA 4DGVH 5D5MB 3VXQA 5C0RL 3HR5B 2ID5A 5T1KD 4J80A 2G5BA 1JZJA 2Z91B 2KB1A 4MA1B 4U0QB 4XE5B 4X6DE 4FHBD 4TQIA 4Y4KB 3S96A 4C54A 3GO1L 2WBJA 2QR4A 5JIIA 4M6MH 4N86A 3JSNA 4D9RE 4JO1L 4CKQA 3DOSA 2BHYA 4PD4F 3GEFA 5CJ8A 4YBHA 4L8BB 1KTLB 5C7XH 2RB8A 5D4QA 1ETB1 1ECZA 1GHFH 2AK4A 2WGNB 3ZEDA 2FEJA 2P49B 2EEFA 5D2LA 1KCSL 1QRNB 2XQBH 3JD3A 2A06H 2ARJB 1NJIW 2VXTL 5D93B 4H5SA 4LQFL 5CBFA 4YK4B 1XWVA 1R6TA 3SYCA 2UX6A 4W6WB 4MCMA 1X4YA 4XNQA 3PAYA 5AG8A 1T2JA 2WXQA 4WSJA 1YJDH 5FYKH 4Z76A 1AIFA 3AC0A 3KL3A 1CZ8H 1XHHA 3KW8A 2LTQC 3CFTA 3ROLA 3S6CA 1QVFU 2IPTH 5D1XB 3NSCA 1X7QB 3B8MA 3O9OA 3APDA 4GQ9H 3B34A 2DYPA 2F18A 3QEUA 4Q6GA 3M8OL 1JWUB 1EX0A 2CO3A 5EOCL 2UXDB 3ZO9A 4MCZB 4HUVA 1KQSU 4GSXA 4QOKB 4KKPA 3K5OA 1NH2B 4M3HA 4PG2C 4JKLA 3RI5K 1SQVH 4FLYA 3B2DC 4X50A 3UG3A 3EDJA 5HGBA 3GLZA 1IX2A 1IC1A 1FJ1B 3U10A 1DFXA 5DK0A 5EK0A 5F7BA 1DQJA 1HILB 2NUTA 1G94A 3QPKA 4WV1C 1XL4A 3VD9A 2R9HD 1G7JA 4U1HB 2HEPA 3H1KH 3R65A 2CH8A 3HFML 4DOHE 5IHWA 4FMTA 1G0YR 2EXTA 4KRPC 3WFZA 2D2OA 1UOWA 3VFVA 5LGUA 2JKLA 4BSWA 1CR9H 4O2CB 1RV6X 3HUJA 4JYBA 1QI4A 3KNBB 3KEDA 1ZHNB 4NUQA 5IYZA 2FSEB 1JPFB 4O51B 3DTXB 2D03H 2IJ0C 2QKIA 3SODB 1IC4L 3PABB 4AG4H 1UZGA 1ZT7B 4LOUD 4BGDA 2J1YA 1IGCL 3T65B 5KYXA 4YPGA 2DQFA 3W11D 1I8LC 4B95C 1A22B 4UDUB 1BX2B 5E6UB 5F6HI 5EYPB 4OKVB 2LW3A 2VLKB 1J9SA 1G7HB 3NGBB 4JMNA 1Q9LB 4ZUUA 4L29B 3UCSC 1ONQB 4WTWA 1JNHA 4FYQA 5B1KA 2N05A 1BQRA 4YHOL 4BINA 1RZ8A 3LXUX 4ODHH 7TAAA 1BYOA 1M6OA 4MVUA 2GBAA 2DQHL 3P3UA 5EZJB 4N0UA 3CMAV 4AL8C 1J1XL 3HHMA 2WKOF 1D5ZB 3SGJC 4LSUL 1N6UA 1PEZA 3MBXH 1KUQA 1H8SA 2L0DA 4UCOA 1WWBX 2BOLA 2FTAA 4UINL 3HZVB 2X4SA 2AHZA 5L3DA 3UO2A 2H6PB 3AT8A 3FQNB 3S35L 3H1HH 5C08D 3AK1A 2GUZA 3TZVA 2D7MA 2QMKA 4PJ8D 4OIIL 1ZOXA 4TV9A 3FUKA 3ESUF 1CFMA 4AEEA 2EYRB 2G3MA 3UX9B 2APSA 3QQ9C 1FZMA 1JV5B 3N40F 4FQXD 1S9XA 1GRJA 3V4VH 3LS5L 1ACCA 2WVVA 1INEH 4QF1A 5ABAA 4D0CA 2DQGH 4MB5A 3S98A 4NAJA 2AXWA 2ADGB 3PG2A 4YSTA 4PJDB 3TASA 1A6PA 3TBYA 4PJAF 1E9PB 3FB8A 1QLEH 5KJ4A 4HWBA 3RTQC 3OKMB 2QLVB 3UKMA 3M46A 4M8QA 1S8DA 3D4CA 3U4KA 2YGNA 2VDQH 2JJ2G 1E4XI 2CMRL 4Y4KC 5CWSA 6CGTA 4NTWA 3B2VH 2F53B 1GY2A 1KB3A 4C4UA 2M26A 1D5IH 1I85C 3CVDA 3MRHB 1EZJA 3VXUB 4Z3HA 1YNTA 2OSXA 2Z92A 3WIAA 3X1GA 4HCRH 3NRFA 3O9WA 4JM2B 5SX4H 3KLDA 4AKPA 3EJSA 5DD6B 3O6MH 1A64A 2ZSWA 1FC1A 4JM0A 5LBSH 1JPTL 1XNRO 3GC3A 2V7HA 2LV4A 2Q0AA 1FYJA 4Y2NA 4LWSB 5LWYL 1AHWB 4R7CA 3ZKMD 1XGRB 4DR1O 5BCAA 1SNRA 2OZ4L 4HSCX 4M6OL 2CDEA 2ZYHA 5EUOA 3WTTA 1GL4B 4X42A 3FULA 4FLRA 3RVVD 1XMOO 3BD5A 3REVA 5JH7B 4GYBA 1LEKA 3DUSB 2V8LA 5ETUB 1NC4A 5I2IB 3G6JA 5D7IA 1J5EB 1FG2A 2YBRB 2DBJA 1C08A 3K08A 1Q0YL 3FUJA 4DV7O 3IF1B 3U7YH 5IKCA 3PJLA 1FO0H 1HNFA 4QI3A 1SYVB 3O3UN 4N26A 1UA7A 3EJJX 4RSVA 4DN3H 4FADA 2FO4A 3VQMA 2YIAA 1YZBA 3SYAA 1OTSC 1J0ZA 2P90A 1U9KA 2J6EA 5TF0A 1PLAA 3OKOA 3ZYOA 4WUKH 1ODUA 4R26H 1NAMH 4J27A 3VTTA 5A2CA 3SCMA 3UCRA 3MKKA 5DJ6A 5LP6B 3C3TA 2XXGA 3VD5A 2CXGA 3E8UH 2W91A 5CD5C 5HXMA 3R66A 4X20A 1CLYH 4I0PD 4P5MA 4CH3A 1U33A 3B77A 2W59A 3N0AA 5CEZE 1GOFA 5LBQA 2DQ0A 2E7HA 5I6OA 1PL3A 5BZBA 1SYSB 2O6EA 4K8RH 4Y0GA 1M1XA 4PGDA 1XEQA 1OB1B 4MA8L 3U9UB 1Q3EA 5LMNO 5FGSA 1R19A 1I75A 4XXDB 4A6YB 1ZEAL 1KBHA 4NHUB 3NZ8B 4LE8A 3OAYK 2CK2A 2A9MH 3TJEH 3KS0J 4YDJA 4N5ED 5JHDE 4IGGA 3H7BA 3CRCA 1BEYL 2BVQB 3NCBB 4LBAA 4ANKA 1QMUA 1A7QL 1KYOK 4I50B 3WFBL 2IH3A 2DWEC 5F1IA 4CUCA 4QE7A 3RZCC 4XCNA 5KAQG 1CTNA 5BQ7B 4UM9D 4LARL 4IDJL 4DGIH 1AS7A 2AEPL 3ABMC 4M1GL 5I19H 2PO6B 2PI5A 1HS6A 1HK6A 3DBXB 3N2GA 4TLUA 2JKRM 4JFYB 3B1UA 5H35B 4PA6A 4JV5B 3GI9L 4MJ5B 3WKPA 4JO2L 1VGEH 3AU1B 1NIAA 3AQDA 1N18A 5DC4B 4F2MA 2ESVA 5C07B 2KUTA 3NPSB 4GAFB 3BQUA 3SY6A 1T0OA 4HKZA 3FO0L 3NJJA 4PRIE 2XN9E 3N1PC 2VDOB 5CINL 5AOJA 5GS3A 3UTSE 2BW4A 5JOFB 3WY4A 1H3WM 3W37A 4NFCA 1S3RA 3QUYD 4GW5A 4N0FB 1K72A 5C0CD 2EZ0C 2R69A 3N06B 3HE7A 3D8CA 5IJCC 5F3BA 2VMJA 3QQ3A 5I74B 1BYNA 1AR5A 3ATDA 3P4MA 3RT3C 4MJIE 4H13B 2NXZC 2Z35B 5D5QA 1AI5A 3ZT7A 3FU8A 1E5UI 4ZXBD 5IJ0A 3ZDYE 4V1DB 3HZYB 3FUNA 3QDAA 4IOSA 4NO2B 1ZVSB 3GNML 4IRJB 1E4WH 5FCUH 3CMOL 1WNSA 3GMMB 4K0OA 1W72L 4B3RO 2FT8A 3PU7A 1UCBL 4U1KB 5LO7A 2D7TH 2Y0PA 4DV2B 1R24B 2XPGB 4ONFL 3OKDB 3X2QB 3EBIA 2WTOA 1DJGA 4P46B 4POZC 3DO4A 4J41A 2CA3A 3HJ0A 4K94H 5HHOE 2XXFA 3NA9L 3QTCA 2WSSG 1DQDL 1M7DA 3D9AH 4LSRH 3VWKB 4Y4FB 4XWOD 3L1OL 2OYLA 3T0EA 3GMLA 3SO5A 1VFBA 1UFGA 3B9AA 1B0IA 5EC1A 1H6FA 4KHTL 2FBRA 2AHYA 1RIUH 1XR8A 5HD8D 2ZXQA 3CMEV 2IPUK 4N2KA 1EHLL 2L7JA 2XRAH 1EMTL 4FFZH 3EBGA 5KAIZ 4BUGA 2GTZB 3S37H 4PV9B 4JJ5B 1EBAA 3PCYA 4BFJA 1AIZA 4AZ8A 1W80A 1J7VR 1V9PA 2C3VB 2Y9RT 4HK0B 3ZHFA 3FKSG 4FABL 5KSBE 2VISB 3QAZB 3HR6A 3V0WL 3JV4A 3O3DB 3TN0C 5HVHB 3CK0H 4ZX4A 5H6QA 4YFLF 3LDEA 4NO0D 4R97B 5K9KA 4ZFZB 4QYAA 3VA2C 4DVBA 1BDYA 3FFCA 3J7HA 1OLLA 4B9YA 3MV8A 2Z1PA 5L0QC 1A7NH 1JJOA 3CYOA 3NRPA 2R9AA 4Q2ZB 5I8EB 4JDZB 2XXCB 1P4LA 4KH9A 1M6UA 5CCGE 2AJSL 1PLGL 3ULVD 4UT9H 4EB6B 1BQLL 1RZIB 4P2RD 3QORB 1JGDB 4OZFG 3FU7B 3GMOA 1PSKH 1Q8MA 1BWMA 3C5ZC 4NUJA 1KGJA 5F1KC 2ZR2A 4YE4H 1A1MB 2OCCC 1OF0A 1WC7A 3CXHF 4GRMA 5DRZB 2P7TB 5TQ0H 4KK8D 2YSSA 1WG3A 2Y7MA 1IBKO 2H9GA 4BFIB 4HUUB 3KXFA 5HI3D 5JW5B 2GITB 2DW5A 4XOCA 2IJIA 2DJMA 2KZ1B 4Y9CA 3GSWB 4I48A 1FN4B 2EIKB 2F23A 2WA4A 3TXAA 4IKKA 1XV8A 2W0FB 2EH8L 4XPGH 4DEWA 4L2LA 4LCWE 3HPLA 4H0HB 3QJHB 4B5ZA 5DTFA 2OMWA 4G9FB 4D7PA 5AOMA 3MRQB 4I4WB 1RMFL 2J43A 1I8IA 4M5TA 3ARUA 4GAJH 2YEVB 3FK3A 3ARGA 2JKNA 4YXKH 4TVPH 4HAKA 3AM8C 4N2OA 3DARA 4Z9KB 3CAFA 1KXVC 2ZZUT 4O4JB 4X5WA 3VJ6A 2H4EA 3QI9B 2B9AA 5TISZ 5D1QD 4ZO6A 5A6LA 1IKFL 1ET8A 4DK1A 1SY6A 3GTVA 3T6VA 3KPLA 3PWLB 3G9VA 2OSLA 4NR1A 3OWEA 2X12A 4BZ1L 1AROP 1PAMA 4AMXA 5F3FA 4FXGC 4XO3A 1H15B 4AQOA 3L3GA 1XH0A 2DWDC 3UERA 2FYUH 3KLLA 2B1IA 4MMXC 5IIEA 2A4CA 1AXTL 2Y7SA 4WBNA 3F7KA 4JFFE 4LNUB 2F58H 2GYSA 1NTKH 3GUFA 1LYQA 1WZ1H 2Q86B 3IDXL 1OANA 3CE2A 1LHZA 1TU2B 4TWKA 3LNHA 3NJMA 3RPIB 1SOSA 3K5SA 5DEFA 5EU3B 1FFOA 2JK5C 1ROWA 1AYOA 2CHZA 2E3VA 2ZCHH 3ZKQD 1LO0H 2X3AA 4PD4K 1KIPA 1MHEB 1SXNA 4N0CD 1KJ2A 4NYLB 1EEUA 2NUPB 1F4WL 3BZDA 2IPKB 5AAMC 4PJGA 1L7IH 1A4CA 4KK6D 2AQSA 3QG5A 1UASA 3FJTA 3MLTA 4NCC1 4NQEB 5SX4I 4F57H 2I7SA 4YHKL 5I74C 5D1ZC 4X1IA 1KWGA 2E8ZA 1NFAA 1DLBA 2OPCA 5BV7L 2BIMA 1GVIA 1ORSB 2QJ1A 3HLAA 2ZOWA 3ESMA 4HZLA 4D8OA 3PLYA 1QBML 3C5JA 3DSFL 1PEWA 2BWIA 2QWNB 1J8HA 4NFBA 5JO5B 1Q1JH 4GX0A 2WJ7A 4XBMA 1HHGB 3ESPA 3KYOA 2J20A 1S7UA 2V2TB 1DJWA 4GO6B 4GUPA 3QUMA 4PEEA 2ZR3A 5I18H 5JYMA 3DUHA 3L9RA 3C60C 2X4PA 4TVUA 3IMUA 3QIBD 3UYRL 5IVXF 1VIBA 3ASOC 4WGWB 4J3OH 4EI6A 2IQAA 1D6EA 1PQZA 5INDB 5IW1A 4XPTH 3OKNB 5LHIA 4YHPA 5SV4A 4FEMA 3F8UB 4GUQA 1COWG 1MFCL 1MCPH 4PWJA 1HOEA 1ND0B 3GSNB 1ZDSA 5EWIL 3HI5L 2VDRB 1F42A 2WNWA 2YGOA 5HYQB 1HINL 3G6BA 1TTFA 5MP6L 3D3VB 1RSOB 2HTLC 2XOTA 4N85A 2M83A 2OR7A 3DX6A 3A4AA 5CR8A 5DSCA 2J8UE 5J2UB 3H3BC 3DXAB 4LAJH 1FL3B 3UJTH 3E2EA 1X5YA 3KDPB 2P5EE 2Q2EB 4TSCH 3ATBA 1G7LB 1A5FH 2PETA 4WKZB 4RWYH 2XHNA 2RMNA 1ZLUH 1A66A 2IJJA 5E4OA 2AV7A 1BZ9A 4A37A 1G9ML 1QFPA 5DD0H 4CKVX 2Z93A 3GMNA 4ZPTA 5T1MB 3LNFA 4CBPA 5F6IB 2A74B 3CZUB 4WV1A 1AD9B 5AVXB 1G1YA 2EE0A 4P2OA 2BSEA 1E2ZA 4NENB 1M93A 3N1FC 3PQYA 4J23A 4XP9L 2JB5L 5DFVC 2WQSA 1W6LA 2WXFA 2XBDA 1BQ0A 1F4XL 1B2YA 5JCOC 5I1KH 4TLKA 1QSFE 1BS3A 1CDHA 3MLVH 4QGPA 3GJEA 4ZFOA 2NY0B 4KHXL 4I9QA 3WS6C 2A73A 4NQQA 2BSBA 5KSAD 4YSRA 3DETC 1IQDA 1OY3B 3QNFA 4MFHA 3QUXB 3KPMB 4GKLA 1IV8A 1CFQA 5KX5B 3VXRE 1HZHH 4DN4L 3EFOA 4YNYB 5KS9E 1I8LA 2RACA 1CXIA 3L8QA 2DQCH 4XRCB 1LUVA 4F33B 3L4XA 3SJAC 3AG1B 3CRRA 2NSMA 4HMEA 3OV6A 2BSKA 2X44D 3O6LL 2W0FC 4OJDH 4YE0A 2ZD9A 2IXQA 4JFHE 1IKNC 4N8CL 1F4YL 3C09B 3KVDD 4M03A 4O2AA 4PGBB 4Z7VB 3IJSB 3C8DA 3EYSH 1HH6A 4QTHB 2LABA 4K8ZA 1WWWX 3B4NA 1MKFA 3FQWB 2ZE6A 2YAQA 1DHKA 4MA7L 3VG0H 3L9DA 2GPZA 3BY6A 5MERB 2ERJC 1KGCE 1CMOA 3HVDA 4NM8H 4F8QA 1WBYB 2CO2A 5JWPA 1ZAUA 3BA8A 2YD2A 4DUYO 4Q6KA 2B1AH 4O4IA 3QI9C 2KMWA 3T2NL 2H45A 4OGQB 4S1SL 5CJBA 1F51A 1WAEA 1H3PH 3EYOA 1NCBH 5IVZA 1HNGA 3ZMRA 2P5OA 4LHJB 3NJIA 1NLDL 4JY5L 1XTLA 4TUJB 2GBOA 1T21A 2WMPB 4PJEE 1ACYL 3LB6C 2MHAA 4J3TA 4JI5O 4L4JA 3FRPG 3L7FA 1ETJA 3HBPA 1QLNA 3RTQA 3QA3B 4NQDA 1FG9C 4E42A 1DSWA 3ARDA 2OS7A 5C8JB 2H3OA 4JI3O 2X42A 3BIKA 5JIDA 4OB5L 3KPOB 3BPNC 3GIVB 5L2JA 4PJHB 1RU9H 2UUDH 1QSEA 4XHJC 5DRWB 4ZS7H 1MVYA 4K5MA 1A4BA 2Z7UA 1UWGH 2YJQA 1LXMA 1KXHA 2COQA 5D4HA 3E7JA 5IK3B 1KXTA 5IUSA 4KMTH 4FTVA 5IQ9B 2A9NL 1EN5A 2Q6WA 3Q48A 3VB8A 1BJMA 3H9SE 1OOAA 6PCYA 2F43G 4WNQA 5E2VL 5BJTB 1F58L 1OTTD 4DK6A 3F6LA 3OBAA 1XDCA 2G38A 2LP7A 1KELL 4MJJA 3QJRB 2XUWA 4AVJA 1HHIA 4PGCA 3GI8H 1AKPA 5MEQB 3GZKA 3GHEL 5LCVH 4H8PA 3G6EV 4D9QE 5DURB 1UEMA 1M71A 4G8GA 1CG9A 4GY4A 4JFZH 5GGUB 4F8LA 4PGEA 1QYGL 1PV0A 4JRYE 1E5YA 1HJCA 5IMLB 2G2RA 4QHLB 4F4LA 4BYHA 1CGSH 3L54A 3CRMA 1SLXA 5FHAH 3S0PA 1J9TA 1YSOA 4M1DH 4CS2A 3D48R 5GRUL 1D7CA 4NZUH 3ARFB 4QCIB 3QO1A 4RGMB 1QUNB 1SF5A 5CA0A 2VDPH 4KAQL 5EU5B 5AB0A 4UV7L 1KCUH 5DECA 3NFPA 1TVHA 4L8JA 4YY3O 4W9JC 1I4FB 4NZRH 2GI7A 1ZLSL 3V5DB 1XMQB 2DEYX 4XMWA 2QGNA 3WTYA 2NLJB 1A3RH 3CZFB 1TJXA 1SOXA 3T77B 1JYVA 1NMBH 1AQDA 4XWGL 3BE1H 4EFBA 2IGTA 1LP9B 2IWEA 1KTRL 5KN5B 1P7QA 1XF2B 1TZHA 3NG5A 3JQOB 1SDAB 1OE3A 4G7YH 4NFDA 4WI7A 1E4XL 5DCCA 2EVHA 4L9DA 4Q56A 1KEGL 4MD4B 2HJKA 4HIJA 1UUNA 2J1WA 2VE6B 2DQ3A 4Z7UF 1HT6A 3ZE2F 2YC1A 2YPVL 2BNQB 4GUNA 3EGSB 5IB1A 3ZIMA 4DAGL 1WUNT 5DM6V 1FNGA 1KLUA 1RFDL 4JI0B 3WNMA 5EO1B 3ZTJG 2V5RA 1X3DA 5LLIC 4QJFB 2ITDA 1HDMA 3FOLB 1DE4A 4W81A 2HFFA 1K85A 1VF6C 3OT7A 3H3PH 5FA3A 1ZLDA 3UJJH 4HUWB 5CEZD 5IJDC 5J1TC 2IANB 1AY1L 3N43B 1GGCL 2HN7B 3FAXA 5F89B 5L3BA 2JJTA 3AG1C 1INDL 3THML 2ROXA 4AUUA 4M48H 4F2FA 1A0QH 3D51A 4P3CL 3HHRB 1P7GA 1A6TB 3IMTA 4DWHA 2XY1A 3I56V 2LLNA 3JT2A 1TZGH 1L9PA 3QR0A 3H6JA 1PVHA 3JWOH 3V7MA 1W9XA 2FYYB 2NX5A 2WWKT 3UH8A 5EB9A 1NCAH 5F9JB 2BOBC 2ZWZA 5JHDD 3W5NA 2EH7L 4X6FA 4NRYB 1T5WA 3D25B 4AEIL 1ILUA 4EIBA 1VGKB 2Y7NA 2XFGB 5AW1B 2VGLM 3BRDA 5DMGD 2VZUA 1GPOL 3K6FA 4QJ3B 1GTNA 1HC1A 4OIAA 4W9FC 1DBAL 4OGQC 3V6ZB 3LQZA 3C6LC 4QHMA 2AZAA 2YICA 1XIWB 4NN5C 1BF5A 2AJXL 3QJSB 1NDMA 4RZKA 4D7SA 3MRFB 1CURA 2QZ5A 3L3DA 4W6XB 3VFGH 5GS2D 2CO7A 3HZMA 1IAKA 4WWKB 3N41B 2NY2D 1V3JA 25C8H 2H3KA 4PRID 3LKQA 4K9EC 2XN9D 5BXZA 1PKQA 5FLUA 2OK0H 1I8KA 3UTSD 4JI4O 3FRPA 3MUGB 2JJ1G 3D39E 2JXMA 3ZDZB 2ZM6O 4QGTA 4A6YH 5C6PB 5J06A 2X3CA 4GKKB 4LCIH 1WZKA 4K23H 1E5CA 2KG7B 4A2DA 5FOJA 3NH7L 4XTRC 3T3PF 3OB0K 4IOFD 4XVSH 4P5SA 1IM3D 3VI3B 5GS0C 4TQHA 4YPJA 4MJID 5MENB 2ZKYA 1JF1B 4JLRB 5TDPA 1P4UA 4HUXB 4KK5D 3BP7A 1E3ZA 3VSQA 4MSWA 5ADPH 5T1KB 3JAKA 3EOBA 1HXMA 4RGNE 2HJLA 4XI5C 3US9A 4NBZB 4BQ9A 1HIMH 4HAGA 4K7FA 4KKZA 3FUFA 3BUTA 2MKLC 2PW1B 4TSBL 4JPIB 4JDTH 1JZ8A 1A6ZA 4PRPD 5E03A 5M95B 3CFJB 4DGVL 1UM6L 1IGTA 2YUXA 1D5MB 2NY1D 1XBRA 2FZ3B 5HHOD 5DD1H 1IBLO 3BWUF 3ZMTA 4CN4A 1WITA 5JQGA 4ADGA 2B59A 3FUEA 1I7FA 4O4HB 1O6SA 2VDOH 3CXHK 3GF8A 4M6ML 4ZUVA 1QFOA 1XBLA 4DIXA 1DQTA 4QLWA 3ARVA 1BIIA 1TMQA 1MHHA 3F6JA 3I3BA 2QEJA 1MRFL 1G7QB 1GHFL 1UB5B 3FO1B 1OTUC 4JN1H 1OSZA 4KKLD 2I32A 1KENH 3VX0A 4PY7A 2XQBL 4YJ2A 5F9AC 5HSFA 4W4LA 1MFUA 5C0BE 4A55A 3QDHA 3EF4A 3OR6B 1UADC 1JX9A 3FFOA 1GZPB 3MD0A 3QK0A 5I1GH 4AI7A 3D2UD 1YJDL 5FYKL 1QX1A 1CZ8L 2AEWA 3BPLC 1NIBA 4RFNC 5BS0A 2FO8A 4GQ9L 4GZRB 1F3JB 2B77A 2BLFA 3FHQA 5IW6B 1Z0MA 2CNZA 3MGTB 3QDGB 5DZPA 4PHZA 4RMBA 2QE7G 2QVKA 4ZSOA 2AXTZ 1OAJA 3LEXA 2CIIB 4E0RB 1U4FA 5AW0B 3V6BR 1PD6A 4OFVA 2F74A 2FGWH 3GXMA 4XO4A 4LASH 3V7AE 5HYJA 1EVTC 5JXED 3RHWK 1JZ5A 2E76B 2ATPB 1K4CC 2Y1AA 3U4EB 4FXGA 1KPRA 1QNIA 3FHAA 4N90D 4RNRA 3S9DB 3P73A 3B56A 1KG0A 2R70A 3HKFA 4L4TA 3EJZD 4MMXA 4N6RB 2KBGA 1T4KA 4LCWD 4W9HC 5DC2A 4F20A 1YDPA 4WHDA 3KPNB 2RBLA 3ZSSA 2QSCH 2EC9T 1PD3A 4U3XA 2XFXA 3H1ZA 5FNVB 3B6SB 2PYJA 2JK5A 2HT3D 4DZ8B 2IDFA 2P45B 4J2XA 5K9JH 1CR9L 3H55A 1N33B 3MAWA 1EJOH 5AAMA 1PYWA 3GSUB 3UPAA 2H3NA 2OMBA 3IDYC 4PJIE 2W1NA 1KOAA 1F1GA 1JZHA 2D03L 3QRGH 4OUUA 3QZNA 4OZGE 1JA8A 5D1ZA 2MRYA 3ILQD 4AG4L 3VFMA 2D3VA 4ZMNA 3Q2CA 2DQEH 3MOBH 2WW8A 2VXSH 2J2ZA 3X13B 4BK4A 3HI6H 5DO2D 3VH8B 4CADB 3JV0A 4Z7QB 1TEFA 3SPIA 4WENB 2LFRA 5LAPA 4JFFD 4GSQA 1FV1A 5ADOH 2QGBA 2BIOA 3C60A 3IETB 2CPUA 4R2GC 3VI4E 1GKEA 2UX7A 3PP4H 3C3SA 2DY2A 1A7OH 3HA0A 4ODHL 4O5LL 4Q89A 1TPXC 5C08B 3BWSA 4IHOB 1VEWA 5DUBA 3K59A 3G5VB 3CFKB 4FL4B 4PJ8B 4EIGB 2AVFA 3HCVB 3A67H 4UZSA 2XDHA 1OVZA 1T5XA 4BGLA 3B7UX 4KDTC 2W60B 1YUHB 1USQA 4TLSA 3WV0A 2IQ9H 2YA0A 4U49A 4Y89A 2L4OA 5EEXA 4MMZB 4FQXB 5F9WB 2Z8RA 2VJXA 5DF0A 5JMOC 1SLUA 2WD0A 2I25N 4JAAA 1A21A 3IBOA 4C4BA 1GO3F 1T1YB 1QR1B 4NNXB 1QNMA 3FFDB 4LLMB 2EDFA 4UUJA 3B4SA 4XAKD 5DUMH 3UOAB 3EO0B 3HOGA 2Q73A 1MJ7H 1INEL 1N8OE 1K8AW 5AVVB 4C56E 1AFVH 1G7PB 2DQGL 2PXYC 1YYCA 3RUGF 1IAOA 1INQB 1LTXA 4X6EB 2J44A 4S0HA 3WYRA 3ZDWA 5CGBA 3LQAC 1QLEL 1PCSA 1LD9A 4YSUA 4KTEH 1O7DE 1DUZB 4IRSC 5JCOA 4QAWA 1BVLB 2VDQL 1PZ5A 4H26A 4LCYA 5EU6E 3S5YA 3B2VL 2V8MA 3INUH 4E2OA