5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
1OCRB 1OCOB 2HLEB 3ASNB 3NJNA 1BEXA 2FQDA 1NTDA 1M9WA 2ZWNA 2IDFA 2BO0A 2XV2A 2J56A 1JVOA 3FU9A 4GY4A 2YAHA 1OE3A 2Q5BA 4F7KA 1AIZA 2IAAC 1KCWA 4HIPA 3MX0B 5LDUA 1EZLA 3T9WA 1V54B 3S3DB 2W8CA 3NSYA 3QJUB 5TK4A 2YARA 1RKRA 1FA4A 4N8UA 4DP6X 1PLAA 2VSMB 3S8FB 2XXGA 3AG2B 5FC9A 3OMAB 3NJGA 3CG8A 3FS9A 2Q9OA 1J9RA 3ASOB 1AZRA 1GS6X 1NICA 2BP8B 2FJSA 3X1NA 2IWFA 3HEIB 2PPFA 2QPDB 2B08A 2XU9A 3WNIA 3S3BB 4A67A 1BYPA 4DP9X 1MDAA 1B3IA 1MG2C 1NDTA 2BP0B 3ABGA 1BAWA 2FT8A 2XWZA 1SFHA 1PNDA 5AZUA 3NJFA 2UXGA 4KNTA 2DWTA 4QLWA 2DV6A 2YXVA 1SDDA 1J9QA 1AZCA 1BXAA 2WSDA 4KO7A 4M3HA 2N0MA 1SDDB 2W88A 4E9VA 2HX7A 2PPCA 3PAVA 2IH8A 4GP8B 4QKTA 5AKRA 4E9XA 5I5IA 5I6NA 1ZDQA 1L9OA 2PPDA 2OJ1A 1JZJA 2HRGA 2XLLA 1OCZB 1NIEA 3CVDA 4P5SA 5A7EA 4E9QA 2UXTA 2PLTA 1F56A 3UACA 2J57A 4K9JA 3PPSA 3FSZA 2GSMB 1NIFA 2IDSA 3CVCA 3FQYA 3NP3A 4JHVA 2CUAA 2LLNA 3QQXA 3JTBA 4Q8BA 2FT7A 4FAAB 3N55A 3CDZA 2FQEA 1URIA 1XMEB 2BHFA 2CALA 2BZ7A 3MBWB 2GI0A 2QDVA 4E9WA 4YSUA 1SHXA 5PCYA 1E65A 1W6LA 1ADWA 4GP4B 1AACA 5B7MA 2DY2A 5B7FA 8PAZA 5B3SB 1L9RA 1WA1X 1PNCA 1PLCA 4HHGA 1DYZA 1SJMA 2P80A 1HAUA 4KOBA 1JXFA 1NINA 1A4BA 4DP4X 4A2GA 5I6OA 3FSVA 2CAKA 1ID2A 2EILB 3OMNB 2H5UA 2P80D 3UAEA 4BXVA 2IDQA 1PF3A 4E9TA 1ILSA 2BW5A 1A4AA 3IBOA 4EF3A 1MZYA 4A66A 2CCWA 2UXFA 4AI7A 4DPAX 2PP8A 3NJKA 4ZK8A 1WS8A 1V55B 1PLBA 1KDIA 4YL4A 3ZBMA 1BXVA 1BQKA 4G7QB 1OCCB 1A4CA 4FA7B 3NJLA 1MG3C 2Y1AA 4DPCX 1ZV2A 3WI9A 4WKXA 2DYSB 1CUOA 1JXGA 1SNRA 2BW4A 2XVBA 2GC4C 4JKNA 1RZPA 3QJTB 3DTUB 1MZZA 2HX8A 1ET8A 1GY2A 9PCYA 2UX6A 3NSFA 1AS8A 2I7SA 3FU8A 1HAWA 3QJSB 1AQ8A 1M56B 2UXVA 2VSKB 1YLBB 3TU6A 5D4HA 3FYEB 2TSAA 2EIJB 2J5WA 1ZIAA 2ZOOA 1J5CA 4CSZA 1ASPA 1IC0A 1NPNA 2R7EB 4X4KA 4BDVB 1AOZA 1AANA 1OOWA 1ZDSA 1OE1A 1XB8A 2HRHA 1AZBA 2XYBA 5I5JA 3ERXA 2BP8A 3EHBB 3FSAA 2AANA 1E30A 1CYWA 3OM3B 4KO6A 2YAEA 4BWWA 1RCYA 4HHWA 1KBVA 1SF3A 1W6WA 3PAUA 3NSCA 3X1EA 4HALA 4YSCA 3AY2A 4AKOA 3H4HA 2GBAA 4BXSV 4KNSA 4NAJA 2YAMA 2BP0A 4HZ1A 1IKOP 4UANA 3RYMA 1TU2A 3PAZA 2FNWA 2GIMA 1XB6A 2YAPA 3PLYA 6PAZA 3T6VA 4G72B 4DP8X 1KDJA 1L9TA 4YSRA 1N68A 5TK2A 1KYAA 2IWEA 1JXDA 3IN0A 4A2EA 3ABLB 4BWUA 2IDTA 1BQRA 2AZAA 2PP7A 1AAJA 2FQGA 1X9RA 2XV3A 2OV0A 1WS7A 4BWTA 3H56A 3CZUB 3FQ2A 4AKPA 3WKPA 2AVFA 2QPEB 5IY5B 1NIAA 2FWLB 2QDWA 2YAFA 4YSPA 5D4JA 2HZHA 4YVUA 4YSAA 2VM4A 1WAEA 1PAZA 1AS6A 3FQ1A 4TXVB 1XB3A 1ETJA 2IDUA 5I6KA 4AKQA 3EH5B 3TA4D 1NZRA 4G7SB 2ZONA 1UATA 2H3XC 2RACA 4AX3A 3NYKA 1CC3A 4KNUA 4E9SA 1N70A 1GS8A 4HCIA 2I85A 3X1FA 5B7EA 1GY1A 1GYCA 1SFDA 4DP7X 3H4FA 3FT0A 1AG0A 1PZBA 1ASOA 2I7OA 3FSWA 3UABA 4YSQA 2PP9A 3FU7B 4L0PB 1PCSA 3OMIB 5D4IA 2A3TA 3BQVA 2JKWA 4GYBA 4YSTA 1JZEA 2YQBA 1AZUA 4A2FA 3NJJA 3IEAA 3D12B 4W9ZA 3WNJA 3X2QB 4PCYA 1ASQA 1A65A 5EHFA 4BK5C 3QJVB 2VM3A 1WA0X 2EINB 2VW7A 1KV7A 5F7AA 4P5RA 1PZAA 5AFAA 1JZGA 1J5DA 2VW6A 2X87A 2PPEA 1NWPA 3CVBA 1SHWA 3X1BA 2IWKA 3OQRA 3G5WA 4DP1X 2EIKB 2X88A 3NJHA 3KW7A 2J55A 1IBZA 5F7BA 2OCCB 3FPXA 1AG6A 1BYOA 3ABMB 3OD3A 4W1TA 2AZUA 2ZXWB 1HFUA 4YVNA 3NJIA 1TEGA 5I6LA 3WIAA 3GYRA 3V9CA 1ILUA 1L9PA 4AZUA 3IE9A 1E67A 1GSKA 4N4YB 2Y69B 1IBYA 2QT6A 2NRDA 3TASA 1ZPUA 3L45A 3U25A 4BDVA 2R7EA 4E9YA 2PCYA 5ANHA 1KCBA 3EH3B 4NB7A 5I6MA 3AZUA 1PZCA 3AW5A 1KBWA 1JOIA 1WA2X 1A3ZA 2WO2B 1TKWA 3NJMA 1ET5A 3N2JA 1GR7A 2FQFA 4G71B 4GP5B 2BWIA 2HX9A 3SBRA 3AG3B 4ENZA 2GB2A 4MFHA 5PAZA 3SBQA 1RZQA 4CSPA 4DP2X 4UAHA 1KGYE 4UF7C 2E86A 3FYIB 3GDCA 3S3CB 4YSDA 1PY0A 1AS7A 1GW0A 2FTAA 2CBPA 3EF4A 4YSOA 3UGEA 4G7RB 1FWXA 3QJQB 3IN2A 1VLXA 3EH4B 3ZIYA 4GXFA 2UX7A 4JHUA 3DIVA 3SBPA 1T5KA 2MRYA 2GC7C 2XX1A 5I5MA 3KW8A 4A2DA 4A68A 6PCYA 1W8EA 2YAOA 2DYRB 2EIMB 3PCYA 2PPAA 4KOCA 3ABKB 2FT6A 3T6XA 5B1JC 4F2EA 1BXUA 3HB3B 1L9QA 1NIDA 1E5ZA 2XXFA 1DZ0A 1JZHA 4PAZA 2IH9A 3X1GA 2BZCA 3TBBA 4E9RA 7PCYA 3V9EA 3ZDWA 3T6WA 1AZNA 5B1AB 4DP0X 4NERA 4KO9A 5B1JA 4YSSA 1M57B 3AG4B 3NP4A 3FU7A 4G70B 2YXWA 3T6ZA 1L9SA 3WKQA 3C75A 5I28A 2VW4A 4RH4A 4A2HA 3FPYA 2VN3A 3UAAA 2HXAA 1AR1B 1SF5A 1JZIA 1ZIBA 4M4RB 3NSDA 5B1BB 3ZX1A 2WO3B 2XX0A 3NT0A 1JERA 1QNIA 4DPBX 2YEVB 3AG1B 1NPJA 3TBCA 2VMJA 4Q89A 1E5YA 1J9SA 5I26A 1OF0A 3WG7B 1IUZA 3T71A 1CYXA 1JZFA 1OE2A 2CJ3A 3BVDB 3CDZB 2DWSA 2XV0A 4HAKA 2B3IA 1QLEB 3QJRB 1PMYA 5E9NA 1GS7A 1R1CA 4HCFA 4HCGA 1BQ5A 2JFCA 1A8ZA 2TSBA 2JXMA 3S8GB 4KO5A 2AFNA 4DP5X 1NWOA 1V10A 1I53A 3UADA 4YSEA 1EHKB 3JT2A 4WTQA 3SQRA 1J9TA 3DKHA 5I6PA 7PAZA 1CURA 2YAQA 1OV8A 3PXLA 2PCFA 2H47C 1TEFA 1X9UA 2BWDA 5B1KA 3QPKA 1NIBA 1FFTB 2MTAA 1JVLA 2XUWA 4F2FA 1ET7A 3GXUB 1QHQA 2GHZA
chains in the Genus database with same CATH superfamily
1I85A 4X89A 3ASNB 3H1HH 2FQDA 4ZW8A 3ZMUA 3SHSA 1M9WA 2IJ0C 1NGZA 4OTXH 5IREA 5E6IB 3ML8A 1CK0L 2VDRH 2VJ0A 3B7SA 4M4PA 5ESAA 1JVOA 1UC6A 1IFHH 3FQTA 1U36A 5IJ0A 2YAHA 5EOCJ 5FA3B 1TO5A 3MRKB 1QCEA 4LSVH 1SERA 3PUCA 2IH1C 1UJWB 5DZLA 1XF2A 3HG5A 5C8JA 3S3DB 2QR4A 3OZ9H 5I1KH 4PD4J 3BH9A 3M1OA 1P5UB 1XIWB 2B1OA 1FZOB 5DN6G 3CH8A 2HTLC 3CN2A 3HN5A 5KEZA 3F05A 3EXLA 4HIHB 4UT6H 3OXSB 1PM9A 1NAKL 1IGFL 4L3CB 3VFVA 1BS3A 1B90A 2UXDB 1H2KA 3QW9A 3VFPB 4NKOB 4DKFH 4Z3EA 2P44B 3HUJA 3G5YB 3HE7C 4L8BA 2ZKXA 3BDYH 3JARB 5DRXA 5B1NA 2ADJB 3D2TA 4JV5B 3S3BB 4PB9L 4PRPA 4WSJA 3A6BH 4ZMYA 4U3HA 4M9PA 2ENQA 1BYPA 2F5AL 4B7IA 3FN3A 2A6IA 1U3YA 2IAMB 3SE4C 4Z7AA 5EOQH 3NK3A 4U1KB 4J8QA 1Q43A 1SXSA 1T66C 1ULVA 5IB3A 5IEHA 5JOPE 4YNYB 1KCSL 5TF1L 1U8OA 3VYNA 1T5XB 3MNWB 1S5IL 2VZVA 3C3SA 4K71B 3NJFA 4Z7WB 4XB3A 1KEGL 1M7IB 3MRHA 1NTZH 3T6QC 1SQFA 4PWFA 5DS2A 1G7JB 2HFFB 4TUKL 4EIBA 1OALA 3C5SA 1GN2A 2ZKOA 1MCNA 4QT5A 3GJFK 4NT6A 1IEBB 2HX7A 4XOBA 5CF3A 4AJWA 1CXFA 2AXGB 1X5IA 4RDQG 2XTJD 3P3UA 3O9WB 3UO3A 3LNDA 4LZKA 3UXFA 2P43B 4TUYB 1T4KB 3U9PH 1RUML 4OZFA 3ELQA 2HVKC 4X6BA 4EI6A 2HJKB 3GMPB 5CNHA 5I74B 5IW3A 5IROC 5HP5A 3ULUF 1MCPH 4EBQH 2ED7A 1BLNB 3CDZA 1C08A 3CMOH 2WZAA 4U0QB 1PIFA 5J2UB 1OGTB 3T0BA 4X20A 5ANMA 5FOJA 2QVIA 4PSPA 1YJ9V 1QFUL 3CJHA 3QAZC 5J6HB 3GLAA 3KGUA 4WWKB 4JFXB 5D7JC 8PAZA 4LFHD 4G43B 1MWAA 2BSTA 2XIDA 3K79A 1DYZA 1MLBB 2ZOWA 1RFYA 2ZX6A 4IK6A 3SIKA 1SQPH 3U2SB 3OKMB 3T1HO 4X8JA 4IHJB 1ID2A 2F7QA 3UAEA 4BXVA 4G7VH 3RP1A 1SJVA 2A0LD 2D3NA 2G75A 4Q6IB 4GS7C 3VE0A 1OZUA 2BNRA 3QULA 2VQ1A 3RNQA 3X13B 1P2CA 3SGKC 2ZCKH 1INEL 2UYLA 2FATH 4AEEA 3CFIC 5AWNL 2EKSA 3TO2A 3US0A 2BM3A 2EULA 4KDTA 1D5IL 4OGZA 4JI4B 4PJ0Z 4YHPB 4OLWL 2Z35B 5E1AB 3S2CA 3NPSC 5I1GL 5F72S 3EIFA 3FOLA 2R8SH 2O5NA 1KWGA 1QNZH 2V6HA 4NZJA 1TQWA 1RZPA 2CA3A 3L4UA 2QPFA 2VL4A 1MHHA 2Q4PA 2GBVA 3BP5B 3VYOA 2R0LH 5DS8A 2YSSA 4OAWA 2FLRT 5L3FA 1N9PA 4ORZC 1HAWA 4FQ2L 5JPMA 4ICGA 4RQEA 1ZHKA 5DA4A 2NR6D 3BZFA 4PTTB 4NX0A 2EIJB 2XAJA 4WFGA 4DR3O 3E2EA 5D6DC 3QXAB 5HYSG 3O4LB 3O45B 1SQGA 3CS5A 4PA4A 2UUCB 1E9OB 1ZA3B 2KL6A 3A24A 3G6JE 3MZGB 4WU7B 4C58B 1E4XH 3SJVA 2L8AA 5CEYA 2KYIA 4MSWA 4KKBD 5LMUO 4TVSa 4NC0B 1UGNA 1P7HL 3IMRA 2BH0A 4P23D 3VXQA 3MSPA 3FSAA 3P11L 4B9IA 1NDGB 1XCWA 3U36B 4FI7A 3EHBD 4IKLA 1WSST 1RJLA 3GMMB 2HKOA 4LOUD 2ZKHL 3MCKB 2ZM6O 4BKTC 2FWOA 2RFXB 2WBJD 5DQDH 1GIGL 3GSVA 4IKNA 3LNMB 4PRNA 2OPCA 4NAJA 3W38A 2BP0A 1IKOP 3FO1A 1O5PA 3STLB 2QWNB 3U0WL 2P5EE 3OG4B 4MW3A 2XTJC 4B3RB 2Y07H 1IBDA 3WEBA 6PAZA 3NQKA 2P3YA 3TF7C 4MMZC 3F12B 5D7IB 5ITFA 1L9TA 4TUJA 1S7WB 1KYAA 4A2EA 3EO9H 4TTGA 2X05A 4G8AC 2IH1B 4PYHA 4LSQL 3UBXA 1A0QH 3QNZA 2ZP0T 3IFOB 4R97C 4ZODA 5AUMB 4OCWL 4ZYKB 4F7MB 5JIPA 1KJ3H 1HT6A 4H7VA 1RMFH 1WS7A 3PQYA 3OF6D 4P2RE 4YO0A 5F9DC 3H42L 1PL3A 5ITZB 2PCPA 4IRSA 4WW2A 4PJ5B 2CDGB 3M45A 1WFTA 2IQAB 3PY9A 5K9JH 4Z7IA 2FD6H 2Z31B 4C4UA 3KNBA 1T4WA 1URLA 3EADA 1ZS8B 1W59A 1LQSR 4J8RB 2EDJA 1LGVA 4EOWH 2KS0A 5HVWA 1FGVL 1YEFL 3NUKA 1R6TA 3HZMB 3KCXA 4AX3A 3MLSL 5KS9B 1TNMA 3IJSB 3U1QA 4N87A 2EE9A 4HCIA 2C7UA 5DMIL 3N42F 3QO5A 2VS0A 3IJ4A 1AKJB 1GYCA 1SFDA 2BVEA 2R1XA 5D1QA 5DJYB 5E70A 4NQVB 1TG8A 2A0LC 1VQPV 2OJZL 1Q1PA 2BLFA 2YUXA 3MV8D 2ITCB 2LAGB 4K5MA 3HZVB 4ORGB 1KXVC 1YEDA 2DDQL 3M07A 1QFHA 2WNXA 3UTTE 3V7AG 3VQYA 3IRPX 4UCVA 2JKWA 2VSCA 4FQCH 4AL8C 1MJ7L 1YDPA 1ZWIA 3PIQA 1MW0A 1RIVL 2YA0A 5J11B 3FT3A 4GMTL 1A65A 4LPXA 4GQZA 3HI5L 4ZFZA 2XG4A 2KB1A 1MNUH 2Y7NA 4D8PA 5JHLL 1BCCH 2OW7A 3CHRA 4PREB 4RA3A 1G7MA 4U1LA 3RWRD 4U3SB 1ZGLA 1VKXA 4IHOA 2VW6A 4U6YA 2A73B 2BZDA 2HYMA 3HG1A 3QDGA 4LEEA 1HWYA 5C08E 5D72L 4AJVA 3TIDB 1BF2A 4R26H 5ACLA 3VI4A 5IKCA 1O9VA 3ZHSA 3B3IA 2JIZG 3JD4A 2ZUQC 5G4MA 4IEFA 2B0SL 4JO2H 4YFLI 1U2HA 5AG8A 2FVNA 2NX5B 1RZIA 3HLKA 1QMUA 4MS8C 1AJQA 5TD4A 4O4IB 2JLLA 4P23C 1L9PA 1E8ZA 3CVIH 4C55A 2WQSA 4ELDA 1PNMA 3EHBC 3K08A 1YN6A 4P3DB 4LOUC 4PHXA 1S3KH 3L5JA 5JW5A 1VF5B 3GMLB 2WBJC 1A6WH 3GSUB 3DMMB 5CCHE 3BZ4A 2APVA 1XR8B 3D4CA 4BK8A 4ETYA 3RT3C 1CFVL 1UQSB 4J39A 3CBRA 2GSIA 4A7UA 3DBXB 1CO1A 1RPQA 5I6MA 4QTIH 2ZUSA 4DCQB 3K72A 3DSFL 3U6RB 4FPPA 2HJLA 3HRZA 4QRRD 3BGAA 3PHOB 4Y4HB 3GXTA 1QU7A 3GKZA 1AD9A 2B14A 4PJXA 5JXAL 2TRHA 4O4JB 4OCSL 4K3HA 1JDAA 5SWSD 2LO1A 4G6FB 4LCUB 4QXVA 1IX2A 4JZGA 3H54A 3I2CL 4XP6H 1D6EA 1P5VB 4DP2X 3P73A 3K5OA 4G3YH 4XGZA 4JM4L 1WZAA 1D9KB 2Q68A 3L72H 4WWPA 4G7YL 3ZRWB 2F54B 4GKLA 1JFFA 2CBPA 4XN2A 2EDHA 5SWZD 1EZJA 5B8CC 4OFYA 3FCGA 5E9DD 3BC9A 3M8AA 2BNQA 5AVQB 3BVOA 3D39A 5J06A 1HHJA 3D9AL 3QG6B 2QKSA 2CIKA 3HKBB 2H0EA 2W91A 4XMKL 3ZTNH 3ECQA 4JFDA 2UUBO 1EAJA 2XHNA 3FAVA 3T1HB 3UTQA 2KDYA 4N0UE 4TQ8A 3WDHA 1F4WL 4B0MM 1NT2B 1IC4L 5JW4N 5LOVB 1PL0A 2NTFB 1A7PH 4TL5A 4JRYD 3N2KA 4EE2A 4OF7A 4Y5YA 5AYTA 1SRYA 5IUSA 4Q2ZB 3FUKA 4NYKA 1JZHA 2BOBB 2LW3A 2P46B 4KUMA 1DEEA 4DGYL 5KSBB 1Z1WA 1P4IH 5FYKD 4TQEL 4LGSB 5HHNA 4EDXA 3ARDB 4UDUA 3OMZA 4ZX3A 4PP2B 5EF3A 1CDBA 3E2HB 3HR5A 4UV7H 2JELL 1JWUA 1KGJA 3FUFA 4IJ3B 3JWNG 3VXNA 5KVEL 4HJEA 4HCRH 4MNQE 3V5KB 1RUKH 3A22A 1B2WL 4RH4A 2KDGA 4PB0H 4Q52A 4FFVD 4Y2DA 4QTFA 2WLMA 5DJZA 2LU3A 5LYJB 2WIIB 4LWSB 3CHOA 1QRNB 3G7TA 3SE3C 5DC2A 3IRCA 4AZ8B 4B5ZA 3FQUA 5DF0A 4OZIF 4HKBA 4N8CL 3I50L 2B77A 1JK9B 4J1UA 4PJ9C 5DJ6A 4GINA 3DDGA 2CRYA 4WDIB 5JCOA 4DR3B 1GKEA 2DEWX 1PV0A 4YPGA 3KWVA 1XI1A 3KYKL 5TQ2H 3STZC 2D4FA 2MPAH 3KLAA 4UOZA 5DK2B 2DQHL 3I9GH 4H44C 5KVFE 3D25A 4ZPTA 1GN3A 3T0EA 2JKRM 2CHXA 4RGOH 4RVBA 1I75A 2ICEA 3QDAA 5CA0B 1E4KC 5DEDA 3RI5F 4DGIH 5LMUB 1K5QA 1I7UB 1MOEA 1AZZC 2ZIDA 3MRQB 4ODXB 5EORH 3QBTB 4TV3A 1HIML 2EEFA 1I3GL 2XUMA 1TQCC 4NQEA 1P53A 4FXKA 4KO5A 2PYED 2A38A 2RN9A 4GT0A 4GG6A 1YY8B 2C9UA 2BOCB 1D5AA 4UCTA 2FH8A 3MRFA 3ROLB 4WTQA 1DBML 3J2PA 4UILL 1M71A 3L9RB 2FCBA 1CURA 2F61A 2J20A 3BESR 2NNUA 1NUNB 1UJ3A 3A0HZ 4J9YB 1WCQA 2F5BL 5CILL 5LGTA 2Y1VA 5E00A 4XBGA 4ERSH 4WNJA 5EOTA 2QSCL 4U3JA 5H35B 2DB8A 3UC2A 35C8L 4LNRA 5FYJH 3TNNB 2R9AA 5LDSA 3DXAB 4EUPA 1WRFA 3ETEA 3AT9A 3S7GA 2AGAA 3BAWA 3RWIB 5KMGA 3EO1B 3X3FH 2I9LA 2IDFA 4H26A 5IB1A 3CAFA 1TSHA 3HFML 5I1JH 4A63A 3NCYS 1RLBA 4XZUA 2AVGA 2BC4A 3JWNH 4IRJD 5LBVA 1LQBC 4DFHA 3QFJA 3O2WL 1N3NB 2IGFH 2ILLA 4RQQB 4RMQA 1S72V 2E76B 5DJXB 4WUUD 1VPOH 5IY5C 1EBPA 1JSYA 4KROB 4R2GB 1G5AA 4P46B 3OGCA 4P07A 2DBLL 4K3EL 2JSFA 3O4OC 1C5CL 1WWAX 3B6SA 3QDMA 4MA8H 4MMXA 2M6YA 4OLYH 4GYCB 1OK8A 2DMKA 1BMGA 2ODIA 1EZUA 3V8OA 2YIBD 4XPBL 2EDLA 4AGOA 4Z7OE 5KG9A 1XNRB 5FFOA 1DJGA 5CEXA 2Q3AA 2B2XL 4LP8A 1VFMA 4KZ0A 5DZVA 2JJVA 3S37L 2ZE5A 4M7LH 4XPAL 5HXMA 2ZR3A 1QYGL 4EFBA 1JAEA 1KCVH 2DQJL 5EU4A 3T3PB 2IXQA 3DX6A 3BCDA 4PRIA 1OGAD 3A0OA 2R1YB 4F6RB 3NA4A 3R66A 4W9KC 1JQ0A 1ZKAA 3BYYA 2WKOA 1FNGB 3P0VH 4FFVC 4YDIL 3VBBA 2Y36L 4TLTA 1V3KA 2CLRB 3ABGA 3F58H 3IGUA 1KGCE 1IM3B 1QSFB 4LLVB 1BXXA 1BAWA 4LSUH 1EO5A 1MREL 2NY2B 4PTUA 4B9CA 4FQPA 3I6LE 4FD0A 1ZCRA 2R1WB 2DMHA 2UXGA 4OLUL 5BMVA 2AMUA 2DD8H 3L1OL 1JV2A 4JDVB 5KVDE 3CD4A 2IJKA 1R5WA 1J48A 1IGMH 4TNFA 5K9OB 4HH9A 1J9QA 4IRZL 4JFEE 3WGUB 3QUXA 5A2KH 4G42B 3IRZA 4YGAB 1NCJA 4MAYC 5I6NA 4TSAH 3CDFA 2XLLA 3LEYL 1OCZB 3ZE0E 3KXFA 4D0CA 2QM7A 4XDKA 1XVSA 2E8YA 2FJGA 2QQLH 4J2QA 4OZHE 2GFBB 5B8CB 5MEQB 4YY3O 1RSFA 1U8KA 1J5HA 5CEZD 4HWBL 3ALPA 1S7TB 3KEDA 4RRPG 2PW2B 3ZL4L 4GLXA 2VLME 2P5WB 3BSZL 4C56D 3Q4HB 3IGAA 2Q8VA 5D5MA 3F7VA 4P59L 2AJVL 4FFZL 1URIA 4KRLB 2FH6A 4UAOC 2IOMA 4E5XB 2QMKA 2YOCA 1A7QH 3GBLA 5FO8A 1FC2D 1SHXA 3GQFA 1W6LA 3DHPA 2OJEB 4JO1H 4J3XA 2F7OA 2LTQC 5EU6E 3T2QA 4GEIA 3PWUA 1A9EB 1WF5A 1GM7A 4M02A 2A83A 1XT5A 1WD9A 4NC2B 4RGMC 1NCWH 3LRGA 3TBYA 4L4VB 1OCRC 3UCRA 4Z3JA 4HIJA 1DQLH 2XN9E 5KUMA 1KYOJ 4HJTA 3S96A 3T4DA 2P24A 2DQTH 3MJ9H 2OXGA 1V27A 2I32A 2OR9L 4PLOB 4OGYL 2FIKA 4N6RB 3WNPA 4ACPA 1SZTA 2B1GA 4IRJC 2CCWA 3DGEA 1TTAA 1CD9B 4X7EC 1JGVL 3NJKA 4Z7QB 2CO6B 4N2LA 3MTXA 3LDBB 5AALA 1HINL 1BQKA 3ETSA 5D96C 3ZDZE 5E1GA 4PJ9B 2EJ7A 1UOLA 1YTFB 4R3SA 1SJXA 2Q3XA 2XTSA 3WI9A 1MPAH 4X5WB 3M1BB 4ZUVB 3E8UL 2ORBL 3B9AA 5E6IA 5BCAA 1N2RB 5J7CC 4QOKB 4N2NA 4H44B 2ZCHH 5C0CE 2ZAIA 1KLFA 1N6QH 3MRKA 5HHVL 1NGYA 9PCYA 3CYOA 3SPVB 5F0JB 3FTSA 4RX4A 4PJCF 3PJLA 3ASOC 1IIKA 1AQ8A 5AW8B 2WQRA 5D4HA 5HD8C 2ARJB 1KFAH 1P5UA 5E2UH 1FZOA 3KPOB 1E4XI 3NN8B 3U0TB 1JHLL 1P9MC 3C9NA 2DQ3A 1AE6L 3QQ9D 1ASPA 2X0WA 4A7SA 1V3MA 4JI2O 1IBHA 1RM1C 5J13B 2QHRL 1R5VB 3UX9B 1HZHL 1TUEB 4F7CA 2QSTA 2GT9A 4Y4KC 1GZQB 4BQ9A 5DUML 5I73C 5JYMA 4NKOA 1D7BA 2YICA 1CLZH 4PN6A 5CSBA 4AC2A 1CI5A 2X7RB 3JARA 2ZJSL 4FCAA 1JS4A 3QK0A 2ADJA 4Y7OC 1F4YH 2JKLA 3ML0A 3FB6A 1PIGA 3GD1C 1IBGH 3ECVA 4HHWA 4O58L 4ZFQA 4UOW1 3X1EA 4LLDB 2VERA 1VGKB 2XZAL 1EHAA 4YSCA 4JFWA 5EIQA 4ONGH 1KJ2H 2IAMA 4UOQA 1KYDA 2LLGA 4U1KA 3IXTB 3JV4A 2Z7WA 4QXUL 2OTPA 2JLPA 2Y7SA 5CIPB 1XB6A 4ODTH 3H9YA 3IBEA 2Q86B 1FYTE 2PCXA 4KTYA 1T5XA 2DLFL 1MOFA 3MKGA 3P4OB 4XI5D 5EFIB 4U7MA 5FKPB 3T6VA 4GBXD 5KYWA 1LEIA 2D31A 5IE9A 5LBSL 3QARA 2MOQA 2YI8A 1G7JA 4EDWH 3AUWB 2WQXA 3VQ2C 1YPZE 1S9WA 2F7IA 4LVNC 3ZL2A 3F5WB 2BVPB 4XX1G 5FF6B 4FABL 4BIKA 2QLYA 3FU0A 4RMUA 4BWTA 1IEBA 5ADOL 4KXBA 4BAYA 3V4VB 1ETZB 2YD2A 4QLRA 1TQBB 5IY5B 1QA9B 4JYYA 1M2VB 2AXGA 1XH3A 3CBKB 2J1WA 2AABH 2VXVH 2IPTL 3V6OA 3BQUA 1TCMA 3UPAA 4TUYA 2UZXB 3BWZA 5CP7A 3BABA 4V1DE 2W07B 1DF4A 2IJHA 2FGWL 2HJKA 1J1PL 5TE4H 4I88A 3SE9H 1F6FB 3VCLA 2N01B 2ZUUA 4E9SA 1BLNA 3PGCA 1ZTEA 1BD2D 3GLEA 4Y5VC 3E0GA 5J2UA 2MMXA 4CH3A 2EILC 1Z9OA 3NIGF 2EEDA 4CS2A 1QQDB 2VDML 2IU3A 5T33H 5J6HA 3P3TA 1EA9C 3FL7A 4I2XE 4B3SO 1NS1A 4FP8H 1N8ZA 2PR9A 4G2KA 2VRAA 3O8XD 4G43A 4WTZG 3PF2A 2FDBP 5K1JA 3TFBA 2BRQA 1MLBA 5EF0A 1CVSC 3U2SA 1LWJA 3OKMA 2XQ0A 4IHJA 4BFNA 4W9ZA 3IMWA 4NPYB 3IDUA 2CHZA 4PLNC 2VIRA 3TO4C 1WA0X 4GRWF 4MJIE 4HAFA 4KV5F 5IMKA 1U3HD 2YPVH 4MAYB 4C47A 5F9WC 3X13A 1A4KB 4Y1AE 5FHAH 4NC1C 5FGRA 2X87A 4J6RL 3GSOB 2DJ4A 1YEWA 1NWPA 3T2OA 1PQZB 3PDDA 4P2CG 1OJHA 4AV0A 3SPCA 5ESVB 2ZDIA 3QQ9C 3SGJC 2Z35A 5E1AA 3EOBB 5E23A 4G8EA 4TSCL 5D93C 3QNYB 5JHBA 2ZNJA 1JOYA 4K9EL 4M9OA 4OJCA 4N21A 3TPUA 4UM9B 3BP5A 3EJRA 3M6DA 2FZ3B 5E2TL 4LCCB 5MEND 5C9JA 4JUTA 4EZMA 4OUUA 4AZUA 1AYRA 4HJGB 2ZWSA 3JD2A 4Z0BH 4DTGH 4DR2O 4PTTA 4RMBA 3QXAA 4Z95H 3L4YA 2WCGA 2X1QA 4IBLT 3O4LA 3QRBA 3O45A 2XICA 4TQPA 5KJRH 1ZA3A 1E9OA 3CRCA 2KPNA 5GRZA 4WU7A 1JTOA 4GFXA 4CC4A 2E3VA 1PKQA 3HKZA 1QEWB 2JCCB 5I76A 2V2WB 4N0YH 1CXEA 1TMQA 5ICZB 4XI5C 4NQCD 3HMWH 3NCWA 4FLXA 5LB1A 4RWYH 4GBXC 4ZDHB 4XMLH 3U36A 3RWHB 4UTBH 4D7SA 3NRPA 3KJ6H 4Z8FL 5GW7A 3MRPB 1JPSH 2F95B 2GPZA 4G71B 2RFXA 4X42A 4YY3B 1XF1A 2FSDA 4JKKA 2J5LB 3T77B 1UEMA 2X9ZA 3OC8A 5PAZA 1G7IA 3EYOA 3STLA 4CSPA 4BSWB 2DM3A 1YY9C 1FJGB 5CLXA 1KYOF 4PJFA 2AEQL 3ARQA 1T1ZA 4MS6A 4XOEA 1R75A 5D7IA 2RDCA 2A99A 5INDB 2VDMB 1EQWA 2IH1A 4FNTA 5TDOB 2V4DA 5I9QC 3QJQB 2K1EA 3IFOA 4A7QA 2R51A 5J3HD 4NO2A 2ZINA 2XCMC 5HHPB 2CJUH 3QNFA 4IDJH 1MCFA 1UWYA 2X53A 4R84A 1CDJA 4X5XB 2JJTA 5KW9L 3SDXA 4Y19D 4PJ5A 4XC1L 1ID5I 1OAKH 4HC1L 1JFQH 2IQAA 1DJIA 2Z31A 1J12A 3MA7B 5B1JC 4OPHA 2P22C 4Z7UE 3O8XC 1KG0B 3HB3B 1ZS8A 4J8RA 2Y1YA 3BPNB 2VH5H 4P2ZA 2XXFA 2YLHA 5ETUA 3RU8L 3VU1A 3HZMA 3HE7A 3OWEA 4MQXD 4DK6A 1FFNB 4NAMA 3V0HA 3JTSB 4RUFA 3W7TA 3MN8A 4OTXL 3TBBA 3T4ZA 3RY6C 4ZW5A 5DJYA 2GABA 4HXBH 3K0YA 2VDLL 5I30L 1RP8A 4HIIB 2MCAA 3IAGC 3RZCB 1I9JH 1G6RA 4LSVL 2CXGA 3RA7L 3C8KA 3NEOA 1U3HC 3SE4A 1F2QA 3HIZA 1Q81W 4G70B 3OZ9L 2F53B 3WKQA 5F0PB 2ZICA 3RJQB 1EHLL 2F0CA 1RVFH 5M94B 1UM4H 1EFRG 4XN9A 3BVVA 4UT6L 2IVFC 3GXDA 5BZXA 1KIRA 3BEHA 4MQSB 3ETTA 2QQNH 3CFKA 3QEQE 4JFFA 3HNVH 2GSGA 3F7YC 3L3GB 4OD2A 4ZSOB 3UJJH 2D2CC 2H8PB 1K4CC 3UYOD 1TGOA 4G8GD 4O2FA 4D7TA 4U3SA 2DW4A 3QCTH 5BRQA 3HC0A 3SD2A 1CDUA 3FQXA 4PI0A 4H0LB 1W72L 1BHAA 1KTJA 3GHBL 4PBXA 4XTRD 5GRUL 1GGCL 2HWZH 3GLZA 1PZ2A 1X4XA 2HVKA 1GOFA 5E2WH 1UPGA 1VQMV 2AEIT 2YWYA 1Q72L 4JDTL 3PP3K 5EWIH 4ZIBA 4AQEB 4EXKA 1IXBA 2HRPH 4NJAH 3D09A 2YN5A 5L88H 1BE3H 1VRSA 2Z7UA 4FE9A 3KL0A 1IE5A 3KD4A 1OD7A 2YAQA 3K0DA 2UZIL 1CGSH 3KPRE 4QUOA 5D7JA 2ADFL 4E2OA 5BV7B 2ZX7A 1VADB 3LN5A 2N05A 2H47C 2IGLA 5H4YA 1AFVH 2ZP9A 5E5MB 1UQSA 1NIBA 2H0FA 4LEXH 4NOBA 2BTOA 4OM0H 3DBXA 1HOEA 5CS7A 4IGGA 1P1ZA 2W80C 4U6VH 4KJQD 1WD8A 2ZG1A 1DBKH 3TO4B 2XFXB 3KWUA 3VI3B 3U6RA 5BY1A 3GMQA 3PHOA 5F9WB 4Y4HA 2OT5A 1T1YB 1LK3H 5F96L 3SGKA 2F18A 4HQQL 4V11A 4EBQL 4EZKA 1NKGA 4B9YA 3VXUE 3N1PC 2V9UA 4K7PH 3R7QA 3FUDA 3MRDA 4J42A 4WWNA 3UP6A 1VGEL 3WTXA 5D7SH 4JY6B 2JEUA 2WAHA 5IBUB 2W60B 3QPXH 4Y89A 1P6FA 5C0AD 2VN7A 3L3OC 2VQFO 3K6IA 2VDLB 5DFTA 1VZGA 3ZRWA 3CE2A 1DLHB 2F54A 2J88H 4BH7A 3QDJE 1O9WA 3EG9B 4MQXC 4PDLA 3Q2CA 3SGIA 2R69H 3TCLB 5DUPH 1SN0A 4HIEB 1GCYA 4GSQA 4DGVL 5LXTB 1I8LA 1MCEA 3QP3A 5D6DA 5EN2B 4HOWA 4NZDA 4KUCD 3VQMA 3CQQA 2D0FA 1WFIA 2PF6A 4OUOA 1KSRA 4AMKL 3A5VA 2ZCKL 2PW1B 1URFA 3QG7H 1DQVA 2FATL 2KSDA 2NTFA 3EJPA 4NTWA 4QRFA 1U6AH 3BUDA 3WJMB 1WA8B 3SGEH 2YC1B 4Q2ZA 1ENVA 2BOBA 2QE7G 1HEZB 3R06B 1BZDA 3B8YA 3VM5A 3ULUH 3PV7A 5LVEA 3RDTD 1W72B 4LIQH 1PNDA 4URTB 5AZUA 1QVOB 3QJXA 5DVLA 4DH2A 1LO3H 4PJXF 5IK3B 4NNYB 2H0PA 2YO3A 4Z9KB 4QLWA 2VYRE 3HR0A 2BJMH 1WBZB 2WSDA 4FZ0A 1LEKB 5A2IH 4KRNA 1CCZA 1OO2A 3RIAK 2JTDA 3DTDA 3BD4A 2VAJA 5J56B 3AS2A 4XTRC 5JW3H 1FS0G 3RAJH 2P28B 5LYJA 4MMZA 2WIIA 4LWSA 4FLZA 1MW3A 4JPKH 4AJ0A 3HA0A 4AZ8A 1NIEA 4YZFF 3HBGA 3IDGB 4EKJA 1BX2B 2R9HC 4Q58C 3BRGC 1HYSD 1E4XL 1F56A 5JMOC 1NDMB 4DR2B 5I1IL 3T8XB 2Y6TE 2AJXL 2GSMB 3CZGA 4WI7A 5CU5A 3FB8C 4YK4B 1H2GA 1XGQB 5AD0A 3JTBA 4FLSA 4EKWA 5DK2A 1WN7A 3ABMC 2FSEB 3LKOA 4P06A 1EERB 4E41D 4PWEA 2WUCH 4PWHA 2BZ7A 5CA0A 3DUSB 4I55A 2QDVA 4HD9A 5ACZB 2X1OA 3SJCC 2IF7A 1KZYA 3MRQA 3GVMA 4QPJA 2IW5A 1NMAL 2C1OB 2X6AA 3GS4A 2PO6D 3VXRD 2WYHA 3WE6B 1T89C 2X3AA 4UQBA 5F1IA 1YY8A 3BWSA 4KJQC 4MD5B 4IMKC 3ULVL 3ROLA 4D8OA 1WG3A 2YOAA 4OIAA 3GNML 2X0VA 3L9RA 1HS6A 1KXVA 4HJ0D 1OY3B 4U3CA 4J2XA 4PYGA 1AYOA 3JASB 3LAFA 1PF3A 3RI5K 3W9DA 4CADB 4WGWB 1EV2E 5EYPB 2UXFA 3GHEH 2XPZA 5EUOB 2CNYA 4AQAB 2AQ3A 3SSGA 4AIEA 5H35A 5DMYA 5MEOB 4MCNA 3PREA 2Z7YA 5GS1C 5E0QA 1JE6A 3UO2A 3DXAA 1V54C 4U1GC 3IFPB 2Y1AA 4EOWL 4J11A 3CXDH 5TFSH 5KSVB 1FFOB 3RWIA 2D2CB 3EO1A 2DKSA 1XXFC 4ENED 1OM3L 4HWEL 5F1OB 4XXCC 1JPGB 3CQPA 4X9GA 4F8PA 3GMOB 1FNAA 2JGDB 3LS4H 4BFKA 2ZNIA 2XIIA 4MRCA 2UXVA 5FYJD 3QWRA 3P4NB 2D0HA 1N3NA 1AZVA 4RQQA 5EBWC 5EMYA 4YX2L 5T3XE 3V0IA 4DNLA 2IFGA 3L81A 1KIQB 3U30B 3KDPB 5CP3H 2YRPA 4I48B 2BSKB 2G2RA 2OTUB 3NCCB 1RJZB 4P23A 3T1WA 4GG6F 5FNVA 3LVEA 1MABG 3MBEB 4TOYL 5T1LB 1A8JH 4JL1A 2CJTA 1HWWA 1AZBA 1RUPH 3RDTC 2MNJB 3LV3B 2EE2A 2ADGA 4KX8A 4DWHA 2WBJA 1NJ9B 3ENEA 2IADB 4CVXB 1BPLB 1OHZA 1TJMA 2CO4A 2LU7A 1KBVA 3GIVA 2QEXV 4ZMQA 4BFIA 4WO4B 2GBAA 1JG9A 2MOGA 3HKCB 1HDMA 3HS9A 3QZNA 4GAYA 4PWJA 4WI5A 4XZ4A 2CLRA 4BZ2H 1GKFA 3HG4A 1HSBB 1IM3A 3CCLV 5DQ9A 1FVEB 4HFWB 2HKFH 4JO2L 2GIMA 3T0AA 1HYSC 1WFMA 4UQAA 5AL0A 2OMWB 5EC1C 1KBGH 3T1YB 2FGZA 3U83A 1KDJA 32C2B 4Y8AA 2CTWA 4JDVA 1AGEB 4QPKA 4FQXD 3CVIL 3OF6A 2VQTA 1OAZH 1SEBB 3BAEH 4ZAKD 1EEQA 1HE8A 3WJLC 4O9HH 4PJHB 1SBSL 1S3KL 5E03A 3H56A 1SKVA 3FUNA 4XT1C 4G42A 3T2NL 3HHMA 1JJOA 1BZKA 5KBLA 2V7NB 4WFBV 1AIFA 4OF5A 1BLIA 5L9DL 1AS6A 1IVLA 4AUUA 1J8SA 3PP3H 4K5PA 4OB5H 4GRMB 2GTWB 2PO6C 4QYAA 5B8CA 4QTIL 2YKLH 5MEQA 2J1KA 3EH5B 3HZYB 4KH2A 3L3JB 5AVTB 1JHTB 1S7TA 1E6JL 4G7SB 1IB5A 2J8UB 5AAMC 2ATPB 2P5WA 1O7DE 2C9SA 3C09B 3NYKA 1CC3A 2AQTA 2PTMA 1K5NB 1RIHH 2ZP8A 3KPSD 3MV8A 2C9RA 3QQNA 4P5TC 5F1NB 4HJ0C 1GY1A 2R9RB 2XKNB 1PG7X 4BQBA 3BD5A 4PJAF 2WVVB 3HC3H 2I7OA 4M7ZB 1Z0NA 3ARXA 4GB9A 1YEEL 2OJEA 3L75H 2WKOF 4G3YL 4RESB 5T1KB 4HUXA 1A9EA 2X4QB 2F58H 3CCVV 1RZ8A 1Q3EA 3OJDA 4XNMB 3UIZA 4EQ2A 1NMCB 1L8DA 2NNFA 4A2FA 4F2MB 1QW9A 4L4VA 4HWUA 2V3EA 2W9EH 4ENEC 2V5SA 1QSED 2XWRA 5E2VH 4QNPE 5I0YA 5GGSY 6CGTA 4N6RA 1KP3A 2D7OA 4BQCA 4P5RA 4ELMF 4TOIA 1NAML 4MA1C 4NGHL 4NFCA 2H3NB 5EV7A 3SE3A 4MB1A 3WIHH 3WDJA 2Q87A 3ZTNL 1D3CA 2QADB 1SHWA 4WJ5B 2CDEA 2YA2A 4GSUA 5J57B 1UWGL 1MJJB 4PJ9A 2IWKA 2OCJA 3U4EB 3F5TA 2ODMA 1BOYA 1ZTXH 4IGBD 2J55A 3Q3GB 3M1BA 4U1NB 4ZUVA 3STZA 1P4IL 3IJHB 2JXMB 3WV0A 4WI4A 3ABMB 3ZKND 3FB7C 1L7TH 3FCUB 2XBDA 3JWNC 4H1LB 1HFUA 1MCWW 1JZ7A 1MW2A 1SOQA 2XNAB 4WFHD 5C0JB 2F08A 1S7XB 3SPVA 3ZE2E 4UV7L 3IJYB 2M8XA 5HGAB 4HKXB 2CH7B 5GS0H 1J1OH 3FNKA 3IE9A 1UVQB 4RNRB 1UM6H 4K35A 4CZZA 3VYPA 4AG4L 4N24A 4H0IA 5TDPB 4DRXA 3IAQA 4U31A 2PCFB 3R0MA 4JO8A 1M7XA 5BVPH 3N41F 4Y5XC 4IRZA 1R5VA 4QRRA 2Q7NA 5GS2H 4JW3A 1WAAE 5HDQL 2IJIA 1GZQA 4J3SA 5JHMA 1YSOA 1NEZG 3AU1B 5HHOE 2R0WH 4YXHL 3RIFF 1QLEL 3GTVA 5SV3A 2OL3L 1JOIA 1NGWA 5CSGA 2GQHA 1A3ZA 1T7WA 2YFOA 4FQXC 3EAKA 3I9GL 3QUML 3VFMA 1GR7A 4LLDA 1E9QA 5GS1B 3MOQA 4ENZA 1HQRB 4FFYH 1C5DB 5IOPA 1BA9A 1I8KA 2BDNH 2FX7H 4RRPM 4G6MH 4NQSB 1USQA 4UU9B 5EORL 1RK1A 1SGKA 1UENA 2VERN 4FNLL 3FU3A 1PZDA 4FFZA 5FUCE 5IGXL 3P4OA 5FKPA 5SWZA 5EFIA 3GJFB 4Q0XH 5E9DA 1GW0A 3QJHA 1L0XA 4ZXBD 1XCTB 4NQQA 3F5WA 3HJ0A 3JSSA 4UCUA 2UX7A 4AQYO 4JHUA 3O0RH 2PWEA 1GGIH 2WXLA 1CDHA 1JZDC 1QA9A 2BSSB 1M2VA 4JRYA 3ZT6A 4ERSL 4N3UA 5A7BA 4NCDA 2HT2D 2MCG1 4TUOA 3FUJA 2N3JA 2WSKA 3MJGX 4RGNE 5FYJL 4EI5B 1TPXB 2RAMA 1BXUA 2W07A 5BZWB 3T1FB 3TZVB 1SUJA 3QIWD 3JD0A 3W7WA 3VXME 2XG5B 1NAMB 4KI5F 3TYFB 4BR6A 4ODSL 3B40A 2DMGA 2AXHA 1S5HB 3II3A 1FXKB 4R4ND 3N04A 3IPEA 1NCCH 4WCYL 2A77H 2AK4B 3DX1A 1NC4B 2AJSL 4NERA 4OGXL 4L3EE 4X65O 4EZJA 3GSNH 5GJTH 1QQDA 2YA1A 5CLYA 1K6QL 4X4XA 3WFCH 2EINC 1GMIA 3MBXL 4LF5B 2Y7LA 1SY6H 5JW4R 2P8MB 3IU3B 1VPOL 1X5FA 1CLOL 3ZTJG 4Z2WA 1F41A 2VLRE 5BVJA 3MV01 4Z7WF 4IGBC 4JRFA 3TCUA 1ZIBA 3PNWA 1OAUH 4NPYA 2NR5A 2G9HA 5DDHA 1CTNA 1MRFH 3GBNH 4LHUB 3ZKNC 2VQEB 1IFRA 2UWEB 7FABH 4JRXE 5ENWB 4DPBX 1JNLL 5F1SA 4MAYA 3TBCA 4WI2A 1QWNA 2V8LA 1A4KA 3ARZA 5D9SB 4AQOA 3S5YA 4RISL 4PCKA 3AWEA 4JFOB 1IARB 4DQOH 1PQZA 1MZEA 3AADB 3H3PH 43C9A 2C4FT 4LASH 4PGZA 3TH3T 2PYEA 3TYGL 1QLEB 3P0VL 4MJJA 2OL3B 4LF3B 3ZHKA 1B4RA 4WHCA 4HLEA 2DWEC 2OYMA 3QNYA 4GNKB 5GGSA 2M7WA 1P1VA 1DVYA 3QUMB 4OX9B 3D85D 5CD3B 4WFEA 2XJLA 4P5TB 1UB5A 1NGPH 2Y4UA 2WZPD 4CMHC 1AI6A 2DD8L 1Z66A 4PVNA 2UUDK 4DVRL 4F5CA 3C6SB 4MX7B 3UG4A 2ZG3A 4HJGA 4HOXA 2RQ6A 2FYYA 1WWCA 5FWRA 1CVRA 2WQVA 1U4FA 4H25B 1SXNA 3HHSA 4JKPH 2ESVE 3E1ZA 3A3YB 4JN2A 4LVHB 1TLKA 4FRWA 4PI2A 1QEWA 1QHQA 2QQLL 3COOA 2V2WA 1OSZB 1MXDA 3E22B 3N1FC 5ICZA 1J87A 3OAWA 2BHUA 3BUBA 1N0NA 2IH3B 5ISZB 1XXDC 4IRJA 4U1SA 3RWHA 1F97A 1FAFA 3DVNB 3MRPA 1CQYA 1U0QA 3FKUS 3QVAA 1CE1L 3BIKB 2CO3A 5C09B 4MS2A 3LJ3A 3F7RA 5J9PC 4JTAB 5EZYB 1A7QL 4WUUA 4HIPA 3T77A 5IW6B 3N40F 1E3ZA 2KHAA 3MOAL 1RPUA 4JO1L 4BSWA 1TT6A 2VKWA 5D1XD 3P3YA 1JZ2A 1P4LB 2HT2C 3ZTJH 3AWFA 3B9VA 5C0EA 1GMEA 2YMTA 4GG8B 1YJWV 3OJVC 2DL2A 2E7BA 3QIWC 3V0EA 4X6CE 4DP6X 5TDOA 4XCEB 3T2MA 1DQLL 3Q13A 4JHAH 2QVMA 4CN6A 1FL5A 4DUWA 3WKML 1NANH 1O9ZA 1TMCB 2H26A 1AZRA 5HHPA 2DWYA 1NICA 4PVBA 1P9MA 2EBOA 4X5XA 5FPIA 3MRLB 2P4AB 3MV7B 3UDWC 5J6GB 3RFZC 4JUSA 1YJDL 2WXMA 3WNIA 2W9DH 1FNHA 2GYSA 1DSYA 2HPOA 3CN0A 3QZWG 4L5FH 1BCIA 4WEBL 3BAKA 4Y4KA 1WBYB 3PGFH 4IBSA 4IMLB 4LCWB 2NOYA 5EEUA 4M93C 1VHPA 3SO3B 4MXVF 1FFNA 1TU2B 3OR6C 3JTSA 5AVXB 2FT8A 1A25A 2ZCHL 4Y1AD 1NBYA 1U91B 5H2FZ 2FL5B 4HIIA 2Q6WB 1DFXA 4HV8A 1A7OL 2VLKB 3BH8B 5LXVA 1KCUL 2ROXA 1R3KB 2YXVA 3RTQD 3G6DL 4MBRA 5IBTH 3U9UB 3CPLA 4X1KB 2LLLA 2A79B 2CAZC 5E2UL 3AS0A 1VMGA 1UWEL 5T8IA 1ZL8B 1FFXB 3FKSG 2XT9A 3OVUB 2XN1A 3RY4A 3VXSE 2OJ1A 1JZJA 1IRAY 5E99L 3BKCH 4HS8L 2DAVA 5D7IF 2PLTA 3RWJB 5IB2A 4OSUH 5I0ZA 1YEGH 3SKJH 4NO0D 4X9FA 3H9SD 2Z0BA 4ZSOA 1CLZL 1I3UA 3AXHA 2F9BT 4M61A 3W39B 2H8PA 4ODWA 2YXYA 1J8HD 5B5EZ 2BHZA 2MOVA 2VDOL 3N85H 5EBGA 3RLSA 4A2MA 5IQ7H 2V5TA 2C5DC 3H9HA 5M7QA 2O26U 3OKDB 1C12B 2CALA 4CDGC 4ONGL 1HTYA 3GEFA 4D9QE 1SJHA 4NUMA 5D7KE 4UMSA 4AIZA 3C6EA 5MP6H 1AACA 1S3JA 1MCOH 5CZVL 2Z0UA 4H8HA 5KS9F 2LE9A 3HUJE 2QWPB 2NY6B 4KDVA 4Y5VA 4CH6A 4AVHA 2J6WA 2NNAA 4N2BA 3IMVA 2FLBT 3EFDL 4YC2B 1W9XA 4YFEA 2CKNA 4JI0B 3NIGE 2FO8A 4FKHA 4PRPE 4BELD 5JDSB 3HG0A 3NFSH 4L4JA 1FVCA 4HVBA 4E9TA 4FQQA 4F15B 5E6UB 2DQFB 3VVVA 3R1GH 1KB5H 2VXVL 5E5MA 4XAWH 5KZCD 1RURH 3QFGA 4M7JH 4XPGL 3V52H 2O30A 3NIDE 5IOKA 2X9XA 5D1XC 3QIBD 1OCCB 4XP1L 4AQYB 3TO4A 3NJLA 2XFXA 4FNQA 1QKZH 1ZV2A 4WKXA 4MB3A 5IJBC 4G27B 5DR5L 1TTUA 1T1YA 2XVBA 3K71A 4H20H 1K4DC 4FS0A 4HC1A 5LQBH 2LGWA 1MZZA 1NL0H 5AKTA 1LE9B 4X0KA 3M1CA 1W0WA 1FLRH 2JB6B 1BQLH 1DUYA 2EE3A 5C0BD 1XMOO 4P3CL 3APMA 4YLQT 3SGJA 1B6QA 2NY3B 3A8TA 3FUMA 2CCVA 1RU9L 4FP8L 5FO7B 3ARVA 4I0PB 4P5MB 4JAAA 4KX9A 4BCZA 4FTVB 2CBOA 1EK3A 1ZIAA 1GAFH 5J1SC 4FQLL 5C6PB 4CSZA 4X65B 1DLHA 2E5LO 4KMTH 4K0KB 2GTZB 5KTEH 1AANA 1Q4NX 3QUZB 3V9FA 3EH1A 1BQHG 3EG9A 3ZMTA 2JIXB 3RVTD 4JGNA 2BXZA 2J4WH 4ODHH 1XMQB 3TCLA 2NXYD 5IHWA 4HIEA 5ANME 3VMPA 2WOYA 3CD6V 4AMWA 5LXTA 2EZPA 3FFCB 3MGTB 5EN2A 2YPVL 3HAEB 3MLUH 4HG4J 4RFNB 1R3IH 3MHSC 4UT6A 1K3ZA 4O5LL 1HHIB 1UUSA 2LQTA 1G0XA 2PW1A 5CJOL 3RTQC 1XCQB 2AJ3A 4P30A 4AKOA 3IS0X 3P9LB 2AJYL 4KTDH 1V7NL 3WJMA 2YC1A 2YEQA 4GSDH 5CGYD 5C07B 1NA8A 4OF0A 1HEZA 3FTVA 2VDOB 4FN0A 4KTGA 3OC5A 1Z9MA 1XUQA 2DWDC 4KHPO 2EDTA 2H1PH 1PZ5B 3B2MA 2WLKA 4LNUB 1W72A 4K8RH 2BNRE 1QVOA 4F24A 5DK0B 4NQDB 4IJTA 4U2ZA 3VFOB 1QBZA 1JXDA 1L6XA 3B37A 2KUTA 3ABLB 3L54A 5AW2B 1WBZA 1Z5LA 2I25N 4Z1VA 1TZGL 4Z0BL 1LEKA 1GTFA 2YSUB 1IAIH 1CICD 3V4PL 4G82A 4Z95L 1LP9B 1NIAA 4U0RB 3MV9B 1DP0A 1SUHA 1Y1DA 3HS0C 4MLSA 2F8VA 3INOA 3ULUD 1BX2A 2HJDA 1ROWA 1KLGA 3N2GA 4OKVB 2EVJA 4MD4B 1M7UA 3WMSA 4KQ4H 2YUAA 3T8XA 2I60H 4N0YL 3K6SB 1NZRA 4GRWH 4XAKE 4RWYL 5HHME 4Z76B 2VMCA 1XGQA 3MNZB 5DEGB 1JCVA 2A9CA 2FSEA 3S5LB 4JG1H 5EZIH 2I85A 3UZEC 4ZUTB 2VDPH 3MXWH 1UYWH 4UIKH 5E6YA 3VG0H 5JORA 4OZ4B 3VWJD 2YUVA 3DUSA 4ZOBA 4QEGA 5ACZA 2E0PA 3CC2V 5EU3A 3SPIA 3E7JA 5KWYC 3SJVE 1YA5A 3WJJC 1UA3A 2C1OA 4OZFH 3C3TA 5G5DB 3VFGL 1EEYB 3O3BB 4D9LH 5KSBF 3O6LH 2J8HA 3WE6A 4BSJA 2P7TC 1UWXH 1SYSB 4R7NB 4YSTA 1EH9A 2G5BB 1CPUA 5DJ0A 1MFMA 1V7ML 2OCHA 4AM0B 2KQMA 4N28A 4K8XA 3MLVH 5AB1A 4XCNA 2WAQA 1HQ4A 3R4DA 3JASA 1JYVA 1S7RB 5FIEA 3WMPA 5L4JA 4IDJL 3SJAC 5EYPA 1I94O 6FABL 1JYXA 1KMGA 2P26A 5M95B 3VGDA 1MWAH 1S9XA 5MEOA 1I1AD 4IS6B 1MCSA 4JFPA 5DWUL 3K06A 3IFPA 1IGJA 2VH5L 4N2OA 4WWOA 5KSVA 3SQBA 1GRJA 4LFAO 1EUUA 1FFOA 2P6JA 2C9PA 2WXQA 1HH6B 3L48A 1K4CA 3O6FB 5MENA 2M26A 3FPXA 4D0DB 2E7HA 1Y74A 2O93L 2O5YL 3RVTC 4LSTL 4W1TA 1JPGA 2NXYC 3OTTA 5DLML 3BVXA 3PL6D 3NJIA 3MLXH 7TAAA 2JGDA 1Y6XA 2GITB 2ZE7A 3AT8A 1JCHA 5E8PB 3MRIB 3NCYP 3Q1SL 3FUEA 1FDLL 3ULSB 2BCKB 4KRMB 3OAZK 4JPSA 3RX9A 1NOLA 1WFOA 3OAAG 2Z1KA 3APQA 4NKDB 4N8VB 1G94A 1AGDB 2GI7A 2BSKA 4I48A 3FHQA 5HYJD 3BVWA 4N9GA 3ECUA 3WFBH 4XE0A 1RJZA 3BN9D 4APXB 2DJVA 2ZQMA 5DVOA 3G6BA 3MBEA 3IFNH 2NQDA 2QQNL 2FK9A 5D1QE 3L73H 3FQNB 3OB0H 3V4PB 1BZEA 2C26A 2FX9H 3UJJL 2QGDA 3IKKA 3N43B 3D2UD 3C5JA 5JHDD 1P49A 4RFEA 2IADA 3DVGB 2CK3G 2HKHL 4CVXA 1ZMYA 2V5YA 3T0WA 5F1KC 1R3LB 1WQVT 2HX9A 2HWZL 3L3DB 3SY6A 1TKWB 1CICC 1N0XH 4L4TB 1XR9A 2FBRA 5DC4B 4JYCA 4AQ1B 3MLZH 1FFPB 2QTVA 3K6OA 1CD8A 4X6DE 1LTXA 4P8QA 3KMDA 3CE1A 3ULUC 1FVEA 4HFWA 2VZUA 3DDFA 2FECI 4I3RL 4G1EB 5BO1L 4WBNA 1RERA 4TVPE 3FYIB 4BIUA 1Z9SB 2OMWA 4JM2B 2HRPL 4NJAL 3CX2A 5HPOA 2P8LB 32C2A 5L88L 4PS7A 3EO0B 2HAZA 1SEBA 1AO7B 2AJZA 4CMMB 5F6IB 1QNMA 2CBQA 2KLRA 3NCXA 1EJ8A 3KWWB 1CGSL 1RFDL 3SBPA 1B4LA 3LNFA 4QXTB 3VI4E 3L3OA 4NN6B 3VWJC 1Y07A 3D5OF 2V7NA 2ZOKB 1AFVL 4KXZI 2EIMB 3O3AA 4NOFA 4DVBA 5C8YB 3DHJA 2E27H 4OFQA 4U7SA 4YDMA 2YD1A 4GRMA 3HPLC 3ARGD 4F2EA 4F3FA 3L3JA 1NIDA 3EOAB 3UTSD 2J8UA 2PF4E 1BPVA 1DZ0A 4QIWF 1QPPA 4KRPD 2GKIA 4HKJB 5CSZB 3MLYL 4PAZA 1LK3L 1YEJH 4HX1B 3X1GA 4E9RA 5IIEB 1OWRM 5I18L 1OTTD 2MJWA 1W0YT 2QJ1A 2QSAA 4EAEA 4JAUA 5HPMB 2CO2A 3T3PF 2QFPA 5HYQB 1VENA 1Y7VA 2WVVA 2CH8A 5IMMB 5JQ6H 5IHUL 1N7MH 4RFOH 3SY0A 4Z7NE 2DJUA 3QPXL 4EN3D 1I8AA 2X4QA 1I1AC 3W0WD 3C75A 1QZ1A 5I28A 4GXVL 5TH2B 4XNMA 3F64A 3OJ2C 4JREC 2J88L 3LPOA 1OCWH 4F2MA 4FFBB 4ZBMA 3OAYK 2OMTB 4NRYB 3RTLA 1N34O 4G8GA 1BFSA 2R69L 4TNEA 5DUPL 3IMBA 5HI3C 4OKDA 4BSVA 1PD3A 1W16A 4W6YB 4A7GA 5CKGA 3SQOL 3ZL1A 3E6HB 1Q1JL 3PL6C 1ZLVH 4A2LA 1KNOB 3KYNB 2E5LB 4AV4A 4OV6F 2GUYA 1CR9H 1W8OA 4D3CL 4AH2B 1OF0A 1R5IB 2VRKA 4XBFA 4HF5L 4BK4A 2CJ3A 4YZFE 2EDDA 1U92B 5T1DL 3UL4A 5BS0D 4YLBA 5ESQB 4EEQA 2Y69C 3FB8A 4AQ8C 5I0WA 3KL5A 1BQ5A 1UCTA 3BP7B 3IJHA 2JXMA 2Z1PA 2FWSA 1D2OA 3S8GB 2BNQE 1SVCP 2XTAA 4XNXL 1ITCA 4XRCB 4PIBA 2OMVB 1I1CA 4H1LA 4QCIB 2RCSL 1FSKC 2YR3A 5DD6B 5AZEH 3VO0A 1S7XA 4OGAD 5D70H 5C0JA 3IJYA 3QCVL 5IUCA 4JFDE 3I3EA 5LXGL 2DH3A 5DT1L 1L6PA 5HGAA 3MROA 4HKXA 2CH7A 1UVQA 3T4YA 2ZUTA 3NA9H 2QJDA 5L0QB 1JGIA 3KGTA 5JW3L 1T89A 3RAJL 1JHKH 2P7TB 2PCFA 1ML0A 3EUDA 2X12A 1K5WA 4IMKA 1QZNA 5EF1A 5E5UB 3EBGA 4NRZB 1ZSDB 2A6DA 3AU1A 3BFOA 2G3ZA 1FBIL 1H5BC 1BEXA 3LQAL 5L3DA 1NTDA 5GS0D 4F37K 1T7VA 2EAEA 2COQA 4B7EA 1E8XA 1ZV9A 2FB4L 2XV2A 1KJMA 4ABQA 1BQUA 2WUCL 4DO2A 1TJHL 3FU9A 4GY4A 4O4YL 4Z7QF 5GS1A 2F8XC 4Q9QL 4C4KO 1HQRA 1CL7I 2ZKWA 5DLLA 5LBGA 3QDHA 4NQSA 2NW2A 2WN2A 4KKAD 3ECBB 4UU9A 5FYKU 5GS2D 4I4TA 1TVHB 2HG5B 4JKWA 1PDKA 1GYUA 2W8CA 1D2DA 4GKNA 2R29L 4S1DD 2C34A 4H33A 3MJ7B 4XXCA 3ARGC 4XVSH 1BHGA 4A6YB 3GJFA 5TK4A 5KHGA 5EIIG 5KSUA 2R4RH 2Y5QA 1A5FL 4KVCL 5IWLA 1JUFB 3B2UC 4KRPC 3OMAB 1E2ZA 2NUTB 4U1MB 4LHQB 1XCTA 1YC8A 3B83A 5MEPB 1EMTH 1LO5B 2OMXB 1OTTC 5DO2D 3IF1A 1GS6X 4PG9B 3QCUL 2BSSA 4YR6A 2OQJB 3S35X 4Z7VB 2I24N 3QWNA 4LF8B 3Q0HA 5FHBL 5J5EA 1JJ2U 4NQEE 3BIBX 1FPOA 3KDMA 4WGVB 5L3BA 4EI5A 4GG6E 4XOAA 4EN3C 1ZJBA 3TP4A 2DYPD 3NABL 3T1FA 5BZWA 1C7TA 3TZVA 5EO0B 4XCCL 1MG2C 5ILTL 1MEXL 3PN1A 5F93C 4F7PA 1KIUA 4J12A 2H41A 1YMME 2VCOA 3TYFA 3H1KH 3X12B 3GKWH 5I1DB 3G80A 4CRPA 1S5HA 4GAFB 1XHHA 2AK4A 2RB8A 2OZNA 1NC4A 5EZOH 4RAUB 2EEBA 2QHLA 4FNPA 2FL4A 2IALB 5B1BC 5D2NE 5F3HB 1AZCA 3MR9A 4RETB 3AG1C 1S5JA 5KA5A 3ARYA 5GGRB 2P8MA 5IVOA 2ENPA 1FNFA 4JI3O 5EC1A 5JW4M 2VXQL 3IU4L 1M53A 3VG9B 2R2CA 2VLJD 2X2IA 2OIEA 1ERNA 3WJLA 2WNKA 5K1XA 4L2YA 3WELA 2UWEA 3B2VH 3FQRB 2MQCA 1FXVA 4PJBA 5ENWA 2ZCZA 1HXMB 3QFJE 1BM3H 2A74B 4OGAC 3MREB 2EXYD 3ISYA 4Q6YA 4OJEH 4BYHA 4XBEL 1A3LH 2BHFA 4K3GA 4GCZA 4U6HB 3MBWB 2PO6A 2OTWB 3GM8A 1TVDA 4OI7A 3O2DH 3QDME 3VXRA 5IMOB 2FX8H 2OL3A 3LEVH 4LF3A 5JQIB 3VH8B 5E1QA 1EXUB 3I74A 2K6WA 1UHVA 2HKFL 4HFUH 1Q0XL 4NN7C 4H8QA 1HW7A 4NBYB 5B7FA 5LHGA 4P5TA 5ERWB 5A16B 1NKRA 4F20A 3D18A 1AROP 4H2CA 4MBOA 2N7SA 5BO0D 5C2BL 4KOBA 2E4TA 2P48B 4DP4X 2SEBB 1HCFX 1OAZL 3UAJD 3C6SA 3C5XA 3KR3H 1MAKA 5GS0C 4MX7A 2EEXA 5ALCH 3QEUB 3MO1B 2P80D 1BVKB 3NEXA 3MDJA 4H25A 3X14B 4UQ9A 3TX4A 1K3EA 3AEIA 1FNEB 3RGVB 4KKAC 1UH2A 4KVPA 4FZ1A 1WS8A 3BO8B 3U6XS 5CWSB 4OB5L 4YL4A 1BXVA 2JI2A 2HFGL 2X44D 1SOXA 4G5ZH 5E8NB 3UPRB 2L3BA 1TFHA 4S1DC 4Y16B 3OHMB 4NENB 4P2QE 1VAHA 1R6NA 2CPUA 1M1XB 2DYSB 4JEGB 4GW4B 4AYDC 3JWDL 2D7PA 3VRLE 3DVNA 1JVKA 2R39A 2I69A 4JKNA 2XAHA 1IJ9A 1WICA 1ZVSB 3P02A 4IIQC 2WXOA 3BIKA 1LK2A 5FW8A 5DO2C 1BG9A 3HC3L 1RXLA 1HYRC 3HKDB 3QJSB 2WK2A 4GAJL 3QQDB 1QRKA 4AK1A 3WXVH 1P4LA 2F58L 4E68A 4R5VA 5LGHH 3GJEA 1H3XA 4QRTA 4R4BB 4BFEA 4KHXH 1TETH 2F15A 1IBLO 3HJEA 1X5AA 2X4TB 1KXQE 4L9LC 4MD0B 2EJ1A 5D5ME 3HG3A 4N8PA 5CB4B 4XCEA 2WANA 3TVMB 3RJOA 3VTTA 2YD9A 5E2VL 1XF4B 3ZGIA 5F89B 1CB4A 1Z9LA 5BRZB 1MAML 1BF8A 2X1XR 1JMZA 3MRLA 3VGEA 3IXAB 3MV7A 2H3KA 2IANB 4BWWA 4N2HA 3BXNB 1AXSB 5J6GA 1JBJA 1DGSA 1CN4A 1FAKT 4M5ZH 3MLWH 3ARBB 4Y5XA 3RKDD 5CMAB 1BIHA 4YFLF 2FJFA 4HALA 3QIUC 2DI8A 3OAUH 1WBYA 1J0HA 1LVEA 4IMLA 4LCWA 4FTDA 3F65A 1KUMA 2FMLA 2OI9B 3SJQC 2JCCF 3IYLW 3TT3H 3ZT7A 2NY5H 1GC1H 1BVLB 1TU2A 4Z3GA 4HEMA 1KPRB 2CGRL 3OAYH 4FQXA 2XPGA 4ZMOA 5HHXH 3EDKA 3LZOA 1L7TL 2HJFC 3ARFB 1U91A 2FL5A 4JM0A 1HKFA 1U3NA 1IAII 3QB7C 5AAWC 2VLKA 3ETQA 1RUAL 1YCSA 3BH8A 4JO5A 1R3KA 4WAFA 1NGQH 2ID5A 3RFRA 2EXYC 1BQRA 4X1KA 1TZAA 3AT0A 1AAJA 5KLVH 3MCLL 2GJRA 3VFSB 2QL1A 4QRPE 1QR4A 1U3ZA 3CZUB 4UB6Z 2NNRA 2G4EA 4ODVH 1FFXA 3I5DA 1SMDA 3RVVD 5CFHA 4GRLB 4YVUA 3VMNA 4YSAA 5BVPL 4IOIB 4TXVB 5BR8B 4QAWA 3FULA 4J41A 4YDKH 1TEYA 2R0WL 3IK2A 2VSDA 2ZONA 5B3SC 3PWPE 1UATA 5FYLE 3W39A 3VW3H 2FHBA 4LFBO 4PJ7A 3WB2A 4PRHB 4XNQB 2YXHA 1JNNH 2NY4B 3UAJC 4KP4A 1KQSU 1N70A 3Q5TA 5D7LD 3OKDA 4ZTPL 3IDYC 4ILDA 2OYKA 3WNMA 4DAGH 1AG0A 4FFYL 2BDNL 2FX7L 2VE6B 2A1WH 5MERB 2NZIA 4BW5A 2IQ9L 4R5XA 2Z8SA 3IAYA 4DERA 4EO5A 4TKWA 4MNGE 3OMIB 2GJ6B 2CTQA 1XAKA 4DUZO 3MUGB 5LL6Y 5H4ZA 3OHXC 3JYCA 1QSEA 2H9GA 1DF5A 1JZEA 3MLTA 1QTYT 3UTPD 2FECL 2EDWA 2EH8H 2XVLA 4BZ1L 1PS3A 2CK2A 2IPKB 3FT1A 4ZX6A 3P69A 1XGPB 2ZXGA 3O0RL 5EBLB 5F8RC 1MXGA 5T5FH 3SDAD 1MVYA 2Z34A 5C6WH 3N44B 2ED6A 1JIBA 1UA6H 4ZMLA 4NP4H 1V8HA 4MA3A 2W0FC 3VXOA 2WN3A 2XI9A 2R2BB 3CCHA 1HK6A 4UUJB 4CW1B 2A9MH 3WL9A 3CVBA 4NTXA 4DKDC 4PBVC 3MJ9A 4JDEB 5ACMA 5I1IH 4O2EB 4MDRA 4WFHA 3OX8A 4OQ1A 1JPXA 3TGXA 5FM4A 3CMGA 1HHHB 2C9QA 4XCFL 1BDYA 1WCBB 3VGAB 1LE9A 2A77L 1U93B 3BA8A 4AEFA 3GSNL 3WIAA 5KSAD 1TJIH 3NFPA 3V6OE 4NXSA 2HTKC 1G9NC 2DWEA 4I0PA 1I31A 1ORQC 4NN7B 2Z3YA 1EEUA 5FLUA 3RKDC 2OK0H 1H3GA 2VRQA 2NRDA 2O5ZH 3VGFA 4GX2A 2GTZA 3O6MH 1JN6B 3P3SA 1U8LB 1UACL 3QUZA 4N2FA 4PJEE 2JIXA 3Q2VA 1MCBA 3GLDA 3Q7JA 3D05A 4KI1A 5IQ9A 3S97C 3GBNL 2PETA 2OIGA 4ODUA 2PY5A 2XVKA 7FABL 4MXWL 3MGTA 2YC0A 4FLTA 1TUBB 1F4AA 5C3TA 3QH3B 3B2DC 2OMYB 3WENA 1YNLL 1PU0A 4LF4O 2KBGA 4NZ8A 1HHIA 3CFEB 5J1AB 2DQ0A 4ZW7A 1J1XH 4RRPA 4M62H 3ORJA 1R6KA 4MJ6B 4NKIH 5F8QC 4ZNCD 2XC8A 1ZVHA 4ZNEA 4JQVC 3QZMA 2WOBA 5BMFH 3OZKA 4R4FL 3RWDA 3SOBL 2LFEA 3WNKA 1FV1B 3RVVC 1CGXA 3ZRCC 1GPOH 3VWKC 2J25A 3LDDA 3VI3F 1PZ5A 1Y6MR 1IGTA 3WD5L 4LNUA 5JDJA 3MRCA 3NDYE 3V10A 4PY7A 1XILA 4YHLH 5ALBH 5DUBB 3VFOA 3NACH 4JE0A 3T3ME 4LEOB 1IBMO 4FL4B 5F6HI 3MMEA 3DIDA 4AC4A 2ZXEB 4GAAA 3CV5A 1AGCB 4M5TA 1CMOA 3LNNA 3FAXA 5G55A 3ZIYA 1MH5B 1Q7YW 4MVUA 3DVIA 1UFUA 2O6FA 1FIGH 1LP9A 3CFJB 1G1OA 2GK2A 3MV9A 4NHCH 4RA0C 4A1RA 3NBNA 2YAOA 2AF2A 4KZDH 2BY1A 3QIWA 4L9LB 2R2EA 2EYTA 1QUNA 5HJ3B 3JVGC 3OEHG 1MI5B 4K8RD 4OKVA 2XDHA 3UEQA 4MD4A 2HLAB 3KLQA 3P77B 4YE4H 1EFQA 4PRPD 2J1ZA 1OAQH 4FADA 1PZSA 4Z76A 1IAIM 3MNZA 4YXLL 5IDJA 1KTLB 4OLZL 3UDWA 3L3KA 4N20A 1S0VA 1AJ7H 2W1NA 3LUTB 4R96A 2HT3D 2F4VB 4L29A 1FIEA 2GW5A 4ZUTA 3WFDH 3D0AA 3CX5J 3QIUB 4OZ4A 5GGTL 3X2QC 3D3IA 1DL7L 3WHE0 1DBJH 2YUZA 1PKQE 2MPVA 1KGWA 1G9NL 3OR6A 4FFWD 3IS1X 5G5DA 1CL7L 1EEYA 3O3BA 2Q0ZX 1QO3B 1B3QA 1KT2B 1SYSA 2HJFB 5L2KE 1XZ0A 4R7NA 3GSNB 3VFNB 1KC5H 3J7AU 2G5BA 2JJ2G 2Q0OC 1NC2B 3AM8C 4J7RA 4XO8A 5DJDB 2WLHA 3RY5A 1UD6A 3EVKA 1ZOXA 3Q1EA 4A7VA 4N0CD 1QNIA 2BXYA 3GUFA 2XN0A 4FX5A 4OM1L 5EUKB 3I3DA 1CK0H 5KSAC 1C1EL 2YQGA 4JR9L 1YSCA 2W9DL 4IS6A 4GUPB 4PJFE 1RK0B 3HE6D 3TS8A 5MI0B 5EO9B 2J2ZB 2XV0A 3PGFL 4G6KL 4XMPH 3JALA 3QI9D 1WJ3A 2VJ8A 2YPVA 4X98B 1OP5K 3TNMB 4JFYA 2YPLE 1R1CA 4R7DB 5GS3A 3O6FA 2X4UB 4D7BA 2TSBA 1FFQA 3MOBL 4EVNA 4KGLA 3NDZE 3V2AR 2XAFA 4CVZB 2DEXX 5ICYB 1NAKH 2WLYA 3VNZA 4GUCA 2ZXDA 3SDXE 2LVEA 1O7SA 5E8PA 4EIZC 1I85C 5BZDB 1OL0A 4L1BA 2NYYC 2BCKA 3P2BA 2VO8A 4Y8DC 3L4ZA 3DV4A 5K5YA 1VQ4V 1A21A 4NKDA 4F91B 2BVYA 3FF8A 2Q69A 4N8VA 4XWGH 1AGDA 4LOVA 2YRBA 5H5NA 1EVUA 4PB9H 4KKNA 2NW3A 2AW2A 4APXA 4YJZL 2I07B 2ZUYA 2F5AH 2XUWA 2VABA 3S9DB 3V4PA 1IZKA 3AS3A 4FULA 4HZ3A 1JD9A 1N12A 3IDXL 5JOEA 1I9IL 2CRMA 1R3IC 2BIHA 4GQRA 4MWFA 2DM2A 4ZJ9A 4OJFH 3LSOB 2WTPA 3BEWB 43CAB 2B7DT 1KCSH 5IQ7L 12E8H 1I7ZA 2W0FB 1AGFA 2BSDA 3DVGA 3NZ8B 1M1KW 3VD3A 1G9EA 3DTXA 1MIEL 4I9WD 2J56A 3ETGA 1KEGH 1R3LA 2RR3A 3GXPA 2EUWA 1BHBA 5K1NA 4PV1B 5D1XA 5EUOF 2JRIA 4L4TA 2XNDG 3CP1A 3QYCA 3TESA 3E9TA 4AQ1A 1ZVNA 3OXRA 2JB5H 1W0KG 3ELAT 4JFHE 1SQQH 4JFFE 2BTQB 2CG9X 3QO0A 4G1EA 1CPYA 1WUNT 2WLNA 4K8RC 3ABKC 1EGJH 3AY4A 4JM2A 4UB8Z 1N33O 2KZWA 4I13B 4JI5O 1P7KB 2P8LA 4WFGD 1FA4A 3WY3A 4E0RB 3BE1H 1YG9A 3C12A 3L2NA 2PYLA 4WTZA 2HFEC 4G9FE 1R3HA 2KMWA 1BFOA 4UYQA 3SYAA 3GB7B 2B39A 1U8CA 3KWWA 1ORQB 2HT3C 4FFTA 4O2BB 2ZOKA 3R1GL 2DTML 4JANA 4N2CA 4XAWL 1TITA 1XQ4A 3ZRSA 3KCWA 5HGDB 1C7SA 5DFWH 1QFUH 4FFWC 1JMXA 1FVDB 3ASWA 3TBTB 3WFZA 5HGBA 2Q7GA 4DP9X 3D33A 2WZ6A 3ETBJ 4NQUA 4HS6B 3H2QA 5IVXA 4AT6A 4K5OA 3MUZ1 2NY0D 1XSOA 4B60A 5LQBL 3ZSTA 3ATFA 3O11B 5LCVL 4ZQTA 3TURA 3WS3B 5TE6L 4UVCA 2CDFB 1FC1A 2VLLB 3C5ZB 1BQLL 1YNKL 5GGUB 5HYQA 1L3NA 4N0CC 4X4YB 3K5LA 1NBCA 3BKYH 2EX3A 3IE4A 2A6KB 3K1KC 3ZQ9A 4AXWB 5F3BB 1VACA 5I8KH 3VWKB 3V0VA 5TH2A 1EXHA 1GAFL 3OR7B 2PPCA 3HE6C 1U95A 1L9OA 2XWJB 3PQYD 3H9SA 4KBPA 5A1AA 3QI9C 4JYAO 5AWNH 4PY8J 2H94A 1JR9A 2ZSWA 1D5IH 4RAVB 2Y1ZA 4NRYA 4IRSD 4ODHL 1J8HA 4J3VA 4OLWH 5LAXB 4X7FC 5I1GH 3D36A 1LNUB 5T1MB 3MLUL 4PJHF 3VD1A 3E6HA 3CVCA 1R3IL 1S9YB 1AB3A 3KYNA 4YHZH 2RCVA 3X3GL 4NR1A 2FT7A 4AH2A 4XCYA 2CKBB 1XO8A 3ULVF 1U92A 3G6JB 2ATKC 1KV3A 1N4CA 4KTDL 4DFIA 4S1QL 4WU5B 4JI8B 2CXKA 1H3PL 3KLSA 5H2BA 5IW1A 2JMRA 5FCSH 4NAQA 1MA1A 4CGUB 5B7MA 2J8UF 3BP7A 1KTDA 9CGTA 3RPIA 3UZEA 3NPZB 2CPCA 4PJDE 3MRMB 1UJTA 4QCIA 5C6TH 3BKJL 4KDTC 1OCOC 3QXVA 4HJJH 3L4VA 5L2JA 3RKPA 3WJJA 1MMMA 3W7XA 1IAIL 2YQ2A 3CU1A 3GMNB 3P11H 3W5NA 2WZ0A 4F6EA 1G4MA 2P5EB 3AREB 1L7IL 4IDLA 4TV8A 2P7TA 4OR1A 4Q7DA 5IF0B 2WUBL 2ZKHH 4W9EC 4BQ6A 5I16B 1IBMB 4DPAX 3ZVVA 5EEZA 3J7HA 3DSQA 1Z7JA 1V55B 5DQJA 1PLBA 1OOAA 3C6LB 4UWQB 4NRZA 4XNZB 1ZSDA 1T0NB 2I60L 5JPMC 3HG1D 4H5SB 3QDGD 4AHCA 3S35L 3U0WH 2FO1A 3CX5F 4GO9A 1QLNA 5C0BA 5HJDA 4A7GF 4P2RB 2XTJE 4AITA 2K8MA 2Q2EB 4RZKA 4TNWF 2LGNA 3VG0L 1OP3K 1XHZA 1LL1A 3QYMA 4MYWB 3BAIA 4MSWC 3I55V 4QXGH 2OBGA 1M56B 1VZIA 3HTLX 3O2VL 1JGUL 2O72A 2HG5A 3ZMNA 3KGRA 2BPBA 3ILPB 5FCUH 4D9LL 7CGTA 2WLIB 1HR0O 2MIZA 3APDA 3WN5C 2J5WA 5I1LB 4NUJB 2YLKA 2ETNA 1KBKA 5JPNB 1F11B 4ZBJA 1JUFA 1CE6B 2WWMD 2NUTA 1AC6A 3FQWA 5FGSA 2NY0C 3TA3B 1LO5A 1YEFH 4G80B 4I3SL 2CUMA 5H8DA 3MLSH 3SN6N 4X8XA 4B96A 3RUGA 1G9ML 2WTOA 3UTTB 3DOSA 3ZHNA 4Z7VA 5DMIH 1CYWA 4DETA 2F74B 2WMPB 3QVNA 1YAIA 2EDMA 1DTUA 1AD0B 2R69A 2OJZH 3L9DA 5J0BA 1J0KA 5T5NF 4GKSA 5EO0A 3H0TA 2DDQH 4BUGA 3K4AA 4HZ1A 1MCIA 3MA9H 3PDOA 2AS5M 2DQ6A 2QELA 3T0VA 5I1DA 1PSKH 1FZJB 4HMCA 3LKNA 3LMJL 1HH9B 4XVTL 3FMGL 2DQMA 4G72B 4TN9A 3MLXL 1RIVH 3UJIL 2A2QT 4IBTA 1LNQA 5C08B 2IALA 5IFHL 5F3HA 4BWUA 2IDTA 1O6VA 2AZAA 1ORSB 4WK0B 5JHLH 4DR1O 2VXTH 3TEXA 4DO5A 4TLKA 1E1RG 3DIFA 4OFYD 2FWLB 4JVPA 5DHXB 3B9EA 3MHZA 3EJTA 4WHYG 3WFBL 3D39D 1I8UA 2H32B 3DJ9A 1XB3A 1IVSA 3WLWC 4BGDA 1BZOA 1D5RA 2B1HL 2EDEA 5F70A 3UO8B 1OB1B 2ZQKA 1AH1A 1HXMA 2B0SH 4DV4O 1DQDL 2DMBA 2JVDA 3MREA 4LDEB 4HJIA 1A1OB 1YN7B 3CPWU 5IT9N 1X4YA 5IJKC 1MNGA 2AXTZ 1E50A 2IO5A 1TQTA 4U6HA 3MBWA 1N0XL 3A23A 3FT0A 2K4WA 5KVFL 2EVFA 2WC7A 5IMOA 4RWUA 4NN5C 1CXKA 5DEJA 5EU7C 3I6KB 3ZRXA 5KVEE 5FECB 3UABA 3T09A 1EXUA 3RYCA 1TFPA 3CZFA 3V55A 1PCSA 5EZLA 5DJAB 1WB7A 5ERWA 5A16A 3MAQA 4ZO9A 5I8CB 3JD1A 4I9QA 2NXZD 4LRNL 2XQYK 1HILB 1BJ1J 2R59A 2HKAA 1WBXA 3I3BA 4Z77A 5FYJU 2SEBA 5EH1A 4OZGE 4ZTOL 5FPOA 1FUNA 5K93A 4OV5A 1MFCL 3QEUA 3MO1A 1GZHC 5HVGB 3DSFH 4P4RB 2JV6A 2R29A 1I1AA 4N2AA 5HBBA 4X66B 1E1QG 2G60H 4NKMA 1N33B 4N25A 5F7AA 1WV7T 3H7LA 3RE0A 5JW4Q 2OZ4H 1HNXB 4OCSH 2EC9U 3RGVA 5SX4I 2CLZB 5L4IA 4H2AA 2RA1A 1I1YB 3EYSL 4QRQB 2V17H 3I2CH 5E8NA 3UPRA 3T0ED 3VD4A 4Y16A 4NENA 1QVGU 2VC2B 2EIKB 2TRYA 3B9DA 1EO8H 4JM4H 1NCGA 1M1XA 3CSTA 4GH7B 2UWEF 4GW4A 4JG9A 4PR5A 5E4EC 2WWMC 1ANUA 5C0FB 3QWOB 4G7YH 1YRKA 3IDNB 1ZVSA 3VGBA 2X2UA 1Q9KB 1G7LA 4YVNA 2ETWA 1KZQA 5D5PA 4N0UB 3FFDB 3V9CA 5JQ6L 3HKDA 3E35A 1N7ML 4R8CA 4WNSA 3EYFA 4HSAC 4EIGB 4UCSA 1GSKA 2ODHA 3GTNA 3D9AH 2R2HA 4WHYH 3MVSA 5EK0A 1QBML 1TYRA 3FBKA 2X70B 4PA7A 3L45A 3ZEDA 2X4TA 4MD0A 4DO4A 1EFXB 3MV8E 2FR4B 4FLWA 5CB4A 3LRMA 3T65A 3MODH 4LCVA 4Q74A 4AUJA 4NB7A 4KKLC 5KAQG 2WWWA 4DGYH 1XF4A 4E5XG 4Y4FD 3L9YA 5F89A 5BRZA 1G7HA 4MNQB 5IB5B 3F04A 3IXAA 3MV11 3TXQA 5A40E 2IANA 4HGWB 3K80A 2ZWYA 3J8F7 1HP8A 3HI1B