5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
2XV2A 3OM3B 3NJFA 4AX3A 1JVLA 4K9JA 2PCFA 3NP3A 3JT2A 3HEIB 4KNSA 1AG0A 4A67A 2GHZA 2HZHA 1JZEA 1L9PA 1E5ZA 2FQDA 4G7SB 3TASA 3MX0B 2FJSA 4A2DA 1JXGA 3ABLB 2FT7A 1PY0A 3H4FA 3T6ZA 2BW5A 3V9EA 4DPCX 4X4KA 3UACA 3X2QB 4DP2X 1FWXA 3BQVA 2ZXWB 2PPDA 2WO2B 2ZOOA 3T6XA 5I5MA 1IBYA 1WAEA 2IDQA 4BDVA 2A3TA 1A4AA 2X88A 4HIPA 5PCYA 3WNJA 2CJ3A 2CAKA 4L0PB 1KYAA 2YEVB 1NIAA 1T5KA 1JZIA 1JOIA 2DWTA 4KOBA 1PNCA 3X1BA 1ILUA 2IDFA 2ZONA 3RYMA 3KW7A 5F7BA 1AR1B 1KGYE 1GSKA 1OOWA 2BP0B 1GS6X 5IY5B 4YVNA 5A7EA 2BZ7A 3FYIB 2I85A 1I53A 3NSYA 4A66A 3TU6A 2PPCA 3QJSB 3PXLA 3WKQA 2IWFA 3GYRA 4NERA 1KBVA 2YAEA 4EF3A 3OMNB 1NICA 3NJMA 1IBZA 3WKPA 4ENZA 4KO5A 3JTBA 1AANA 4GP5B 4FAAB 1QNIA 4GYBA 4W1TA 4E9SA 1GYCA 4QKTA 7PAZA 3FQYA 2YXVA 3PPSA 3QPKA 1DYZA 2DYSB 2IH8A 2YAOA 3AW5A 5B7EA 2AZUA 3ABKB 1KV7A 2PP7A 1BQ5A 3PCYA 3IN2A 2EIKB 4MFHA 4E9TA 2VW4A 4DPAX 2BP0A 2QDWA 1PLBA 4E9QA 1BXVA 1E65A 2P80A 2RACA 1PLCA 4JKNA 2AZAA 2YAMA 4NB7A 3KW8A 2J57A 2PCYA 2QT6A 2XU9A 1CYWA 2GI0A 3QJQB 4YSEA 2I7SA 5I26A 1IKOP 3WNIA 2J56A 4WKXA 1NPJA 2PPFA 1SNRA 5AFAA 1XB8A 1JXFA 1KDIA 5B3SB 1ID2A 3PLYA 1BQKA 3NSDA 1KBWA 1ET5A 3PAVA 3X1GA 2JXMA 9PCYA 2J5WA 3S3DB 1M56B 1ZPUA 5B1JC 3FYEB 2ZWNA 1L9QA 1E5YA 2QPDB 5I6NA 1EZLA 1MZYA 1ASQA 5LDUA 1AS8A 4G70B 2FQGA 3OQRA 1A65A 4QLWA 4G7RB 3FPXA 3FU7B 6PCYA 3NYKA 2OJ1A 1RZPA 2HLEB 1GS7A 5I6MA 2DYRB 1WA2X 2EIMB 2UX7A 5I6KA 3FSAA 4KNUA 4BWWA 2IDTA 1NZRA 3IE9A 4KO9A 1OV8A 2MRYA 3FT0A 3TA4D 6PAZA 1NDTA 1FA4A 1J5CA 2YAQA 4M3HA 2IAAC 2JFCA 1BQRA 1CC3A 5E9NA 3OMIB 1NIDA 3EH5B 3FSWA 2YXWA 1BEXA 3EF4A 3D12B 1N70A 3GDCA 3X1NA 4GP4B 2VSMB 2GBAA 1SFDA 4DP0X 2PPEA 1XB6A 3ABGA 7PCYA 1RKRA 3SBQA 3SBPA 1AAJA 2I7OA 3QQXA 1ASOA 2N0MA 1NINA 1ADWA 1NIEA 4A2HA 3FQ1A 3FSVA 3WIAA 3UABA 1IUZA 2VW6A 1A3ZA 3FU7A 3TBCA 4DP7X 3EHBB 3NJHA 1W6WA 2QPEB 3TBBA 1ZDQA 4A2GA 4HZ1A 1L9TA 3AG4B 3CG8A 3IN0A 2OCCB 4ZK8A 3S3CB 1A4BA 3ASNB 2YAHA 1AZCA 1SHWA 1CURA 1GS8A 5AKRA 5D4JA 8PAZA 5B1KA 1OE2A 1CYXA 4YSTA 1KCBA 3QJUB 1XMEB 4A2FA 5I28A 2VM4A 1WA0X 2BWDA 2UXGA 5B1JA 1ZIBA 4HALA 2UXFA 1TEFA 2E86A 2XV0A 3NJKA 1XB3A 2WSDA 4BXSV 3ASOB 4M4RB 2XXFA 2YQBA 3CVBA 2W8CA 3HB3B 2Y1AA 5B7MA 1AIZA 5AZUA 4AZUA 4JHUA 1M57B 1ASPA 1L9RA 4KO6A 1ET7A 2EINB 1AZUA 4N8UA 1J9QA 3T6WA 2BO0A 1M9WA 1L9OA 4YVUA 2TSBA 2FTAA 4BWUA 1BYOA 3PAZA 1PMYA 3OD3A 1TEGA 2XX1A 4F2EA 5I5JA 4A2EA 2X87A 3DIVA 2Y69B 1F56A 3S8GB 2YARA 1AZRA 1PNDA 4DPBX 2GC4C 4DP9X 2QDVA 3UAAA 2FNWA 1MZZA 2AFNA 2B08A 2VMJA 2R7EB 3ERXA 3T71A 2XLLA 3DTUB 3ZBMA 5B1BB 2W88A 3BVDB 1JZFA 1GY1A 3H56A 1MDAA 3WG7B 1ZIAA 1QHQA 2GC7C 2HX7A 3NSFA 3NJGA 4Q89A 3AZUA 3L45A 4E9VA 2FWLB 4GP8B 2HX9A 1VLXA 1WS8A 1NIBA 3V9CA 1PLAA 2UXTA 3QJRB 2BHFA 2FT8A 4G71B 1OCRB 1OF0A 4BWTA 1GW0A 1J9TA 3S3BB 1MG3C 3GXUB 1OE3A 1SJMA 1A8ZA 2IWKA 2GSMB 1GR7A 4BK5C 1OE1A 1AS7A 3SQRA 3CVDA 2XVBA 3SBRA 1X9RA 1PZAA 4HAKA 1B3IA 3FQ2A 2IDSA 1KDJA 1TU2A 2R7EA 3WI9A 5FC9A 2LLNA 1J9SA 4UANA 4DP8X 4KOCA 3UAEA 2H47C 4CSZA 4A68A 2EILB 1OCCB 1PZCA 1EHKB 2AANA 2NRDA 1KCWA 2HX8A 1JZGA 2XUWA 3AG1B 2GB2A 3FS9A 3H4HA 1PAZA 2JKWA 4E9YA 4AKQA 2VM3A 4AKOA 3T9WA 2HXAA 4PAZA 1DZ0A 1SDDB 1V10A 3NJJA 2DV6A 1OCOB 3IEAA 3CDZB 4NAJA 4RH4A 2DWSA 3NSCA 4AI7A 3X1EA 1HAUA 1L9SA 2J55A 4P5SA 2EIJB 2Q5BA 2MTAA 2BP8B 2BZCA 1R1CA 4GXFA 1ZV2A 5D4HA 5I6LA 2B3IA 3ZIYA 1NIFA 2CBPA 4YSQA 1BAWA 3C75A 1JZHA 4YSSA 5PAZA 2FT6A 2YAPA 2H5UA 3ABMB 2CUAA 3NT0A 2VW7A 2XX0A 3OMAB 3UGEA 2CCWA 3X1FA 2HRHA 1BXAA 2PP9A 3DKHA 3EH3B 4HCFA 1RCYA 2IWEA 2XWZA 1SDDA 2XYBA 4G7QB 3ZDWA 4P5RA 4WTQA 4G72B 5TK4A 4UAHA 1N68A 1URIA 4PCYA 3CDZA 4BXVA 3S8FB 2YAFA 2BWIA 3AG2B 2CALA 3EH4B 4Q8BA 4UF7C 1AG6A 1NWOA 1PCSA 4N4YB 4YSDA 4W9ZA 1CUOA 2BP8A 4DP5X 1W8EA 4YSOA 3NJLA 1WA1X 1JXDA 1AZBA 2VSKB 4YSAA 1PF3A 2XV3A 2FQEA 1V54B 1ET8A 1GY2A 4KNTA 1JVOA 4YL4A 2GIMA 1UATA 2HRGA 4F7KA 1SF3A 2DY2A 4AKPA 2XXGA 4HHGA 1BXUA 3FU8A 3QJVB 3AG3B 4E9WA 1ZDSA 2OV0A 1JZJA 3NJNA 2UX6A 1YLBB 4JHVA 3ZX1A 4GY4A 2Q9OA 1NTDA 3PAUA 4HCGA 4F2FA 1AZNA 3MBWB 5ANHA 1J5DA 1JERA 4YSRA 1E30A 2AVFA 1A4CA 1RZQA 3CVCA 3T6VA 4CSPA 5B7FA 1AQ8A 1QLEB 2FQFA 1V55B 2PLTA 2PP8A 5B1AB 4DP1X 3G5WA 1MG2C 1PZBA 3U25A 4YSPA 5I5IA 4YSCA 2TSAA 1W6LA 3UADA 3CZUB 3N2JA 1J9RA 1AS6A 2P80D 1IC0A 1TKWA 1AACA 5TK2A 1AOZA 1ILSA 1ETJA 1BYPA 3IBOA 1OCZB 1SF5A 3AY2A 3NP4A 1HAWA 5D4IA 1NWPA 4E9XA 2IDUA 5F7AA 1FFTB 2PPAA 3N55A 4HCIA 1SHXA 4KO7A 2H3XC 4TXVB 4DP4X 2UXVA 3QJTB 4BDVB 4YSUA 5I6OA 2VN3A 4HHWA 2BW4A 1NPNA 1X9UA 3FPYA 5EHFA 3FSZA 3NJIA 1HFUA 4DP6X 2WO3B 1E67A 4FA7B 5I6PA 2IH9A 4E9RA 1SFHA 1WS7A 3FU9A
chains in the Genus database with same CATH superfamily
4AXWB 1JWSA 2D0HA 3CRRA 5BXFA 5FGCB 3IGAA 3C2AH 1E4HA 3SDDB 4AGMA 4HA1A 4KTYA 4WV1A 3HNSH 4KJYB 4FLWA 4U3SA 1MNUH 4DK1A 2R9IA 4RLDA 5EORL 1DVFC 3BW9A 1DJSA 5HYJE 2WZ0A 1YEFL 4I7ZC 2VYRE 4M8VA 4Y16D 4FABL 4U6HA 4OI7A 4PJIB 2A7WA 3QPXL 4CJ1A 2PW1B 3GD1C 5ACZA 1VADB 5C9JA 3W57A 3KLHC 5DXWA 2B7DT 4BDVA 4I9QA 3KL0A 3SGKA 5A40E 5HYJA 3NCEB 5LHIA 4NWUL 1JVMA 3UMTA 5D7EA 1X5MA 1CFSA 1JZIA 5F8QC 3ZGHA 4K73A 4PDRA 4K94C 2DIBA 5BRQA 4XWOD 2QM7A 2AGJL 4J4PA 4I0PC 1EPFA 1GAFH 3A4DA 4B95C 5GRVL 3ZTJH 3L5IA 4ZMQA 3IGKA 4XWGL 2BSRB 1AO7B 1IKFH 1TVKA 1FFNA 4ORZC 3W81A 1IGYB 3IFXA 3JD3A 4GSXA 4LL1A 2ADFL 5DDHA 4L3FA 3V0AC 3EOAB 3KPNB 3LVTA 1KIQA 3VGFA 4GMSH 4HXBH 4DNLA 5J57B 1J10A 4WEMB 2H8PC 1X7TA 4R4FL 3G3LA 3LRGA 1D5NA 5D1QC 5L9DL 4PJDF 1NKGA 1UOLA 3Q1EA 4C8XA 3A4FA 4FCAA 4OCWH 4UTCA 2YGVA 3VE0A 2OK0L 3GRWL 3D30A 3U30B 1FV1B 2Y5TA 1WD8A 1CJYA 1NEUA 5SX5K 2YXMA 3F58L 3JTBA 5A6MA 2CLZB 3RBGA 4WDIB 5BNXD 1B2WH 3EJYC 3ECQA 4AGLA 3VYNA 4E9SA 4UTBL 1RIVL 2XWXA 4JM0A 1GYCA 1QNZL 1BIIA 4H8HA 3BWZA 2YXVA 4BA8A 4M1GH 1FZMB 2VMDA 4XMLL 1X5FA 4IM8A 1TQBC 3FRPG 5JA8B 2ITDA 2Q87A 4FQ1L 3IXAA 2OYPA 1MIMH 3K06A 5ESAB 4RSYA 1YAZA 1SLWA 1ND0B 1PLBA 2L8AA 2QDWA 4JQVA 2ED8A 4R26L 3SKMB 3KWWB 1FPOA 1NCHA 4P4KC 3MFFB 2IPKB 4ZPVB 2ZKYA 4BE6A 4JKNA 2AEIT 2IQAB 2DLHA 4N87A 2BH0A 3QXVA 2D3VA 5ERWA 4HLZG 4HCRA 3SZKC 4UOW1 4LKCB 4XP9L 1J0YA 4H5SA 3A6OA 2FR4A 4A7UA 4EBQL 1NEPA 3UTTB 2F54D 4GPVA 1LEGB 2ZM6B 1JZDC 3ARBD 3QW9A 4G43A 1UXWB 2CLRA 2A83A 4IBWA 2WXFA 2VDPB 4B5ZA 1ET5A 5BS0D 3WTSA 3QA3A 3OE7G 1HHGA 1AIFB 6CGTA 1UWGH 1VEOA 1EUUA 2QTSA 3DGGA 1PIGA 5CXPA 5B1JC 3FYEB 3ZSTA 4B50A 5DJ8A 4S1SH 5EEUA 3F7YA 4M61B 5DR5H 4JFOA 2Q7GA 1SJEA 5DJYA 4L4VE 3AREA 2NZ9D 1K8AW 4QXVA 5FKAB 3NFSH 2ZOLA 3IFNL 4AC4A 3HMWL 2WD0A 3T6QC 3ARDD 2WGXA 3VH8A 3N85H 1H8EG 1OGAD 5BO0D 3ZE2B 3G5XB 3FSAA 1ZLDA 5B22A 3VFVA 4F33B 5I1CL 2YRLA 1OV8A 1SOSA 4IEFB 4R5XA 3PNRB 5EZIH 2P5WE 4L4VA 3ZVVA 1RK1B 2VT0A 1OJHA 1M1SA 4HGWA 4JZNB 4D9RE 3DO7A 5F0MB 4F7CB 4FXLA 4X5QA 1I3VA 1CC3A 4ZS7H 1X5XA 2DWDA 4P2OA 1URLA 1WFIA 3EH5B 1ZL8B 2YXWA 2DJSA 3G5YA 5M7QA 3H6JA 2DKSA 3Q1SL 2EACA 1EA9C 3IU4H 4XVJH 2P5WA 2V0AA 4JCMA 3S4SA 1IGFH 4F37F 4ZOEA 4XCCH 2OWOA 3VU2A 4GKJB 2CDEB 1JPSL 1W2KT 4LVOB 5FYJH 1B3JA 4RWYH 1RURH 2X4QA 1P2CA 4O4JA 2A77L 1YNTB 2R2BA 5E4OA 1KC5L 1V3MA 2A9CA 2YUZA 5LA6B 3C5ZD 1BVOA 5MENE 2YZ8A 1DVUA 4DP7X 1IBBA 4J1UB 1W6WA 2OQJB 3HI1A 2D2OA 4V1DB 3T2NH 1U92B 2BIMA 5T3ZH 5E00B 3R06B 4QRBA 5HI5D 1L9TA 4KJQC 4NSKA 5EBLA 2JCCF 3S36H 1MZEA 5J56B 1RJCA 5EU3B 1WFOA 3DXRB 3S3CB 3N0PB 3SCMA 4NM4L 1FP5A 5HFMA 1JPFB 4XPFL 3GMOB 2R9RB 3IVKB 3I02B 1J1PH 5D4JA 3U48A 1IAIH 3O9WD 5B1KA 4R50A 4OCXL 4HK0B 1CXEA 3MJWA 2E6JA 3RWJA 2B4CC 1F3JB 4Z5RB 1TEFA 3A47A 3MOAH 1DVXA 5IB1A 3KZ8A 2VC2H 3VFPA 3TEWA 2OBGA 1UTDA 2NR6D 3D39E 4Q9CA 5C86A 1HNZO 3GMQB 4I89A 4RRPM 3S88L 5EF0A 1ZHKB 4Z3FA 3PG2A 1XL4A 4FNTA 4IU2B 1WE5A 1YYLL 5FYJD 3K4ZA 4UQAA 4OB5L 1TAEA 3MBEA 3E6HB 3ZRXA 1YNTF 2AP2A 2RN9A 3JWOL 3LQZB 5C0AA 1AZUA 3OKEA 3FUMA 3LKSB 3EJTA 2QKIC 3D39A 3O0RL 4PLKD 1YG9A 5ES4B 1J5OL 3F5WB 1TVBA 4PA7A 4DP8X 4U1NB 5T3ZD 5I76B 3QZWA 1UFUA 4HV8B 3EJPA 2XX1A 3QDAA 5CM1A 2D31A 4M7LL 4L5FL 4F15C 1DJYA 4Y4KC 4AYFA 3CE2A 4DKEL 1ODUA 1FL3A 4AYID 4UVBA 5BQDA 1AE6L 3BHBA 3PABA 2V2XB 4PJBB 3UYOD 3MRFB 5FB8A 1H3VA 5HGGS 4WCYL 4J3XA 1HINL 1QX1A 3PGDA 5DZAA 2AQRA 1OP5K 2FJGB 2OP4L 1W8NA 4NN5B 3ZMTA 5C07E 32C2B 5C8YA 1T7VA 1C5CH 1M05B 3BVDB 3I3BA 3O6KL 4XOBA 5EBGA 4KZDH 3WG7B 1MCQA 3ZHNA 4JKLA 4KWUA 2XAFA 2N04A 1CDBA 2WYZA 5DD1L 2WTRA 5T1DH 5C07A 1HDMA 3M07A 4DH2A 3O3DB 4LSQH 3KR3L 1H8OA 2JS5A 1OF0A 2IG2L 4RBPH 1R4XA 3W0WD 2BVPA 1U8HA 3QCVL 4WJKB 3ZE0E 3A67H 4GG6B 3CLFH 5DWUH 3FUJA 2D73A 1E43A 4G42A 4ECNA 3HR5A 4ZFGH 5CBAA 2ATKA 2N7AA 1XGRA 1AHWA 2VN4A 4JFZL 1A6VH 1QLEH 2QEXV 3M1BA 4DR3O 1R3IH 4FN0A 4LDOB 1TTAA 3RWGB 3LSOB 4BH7A 1L7IH 3QUYC 1HOEA 4ZQTA 3VQXA 4R8WH 2R7EA 1AHKA 1WCBB 4E42A 3FC8A 3O3BB 5DM6V 5IQNA 2HLDG 1U91B 5AKSA 3DUUB 4PJGF 5I1HL 3QHFL 4JPSA 3BUIA 1RVFH 2UUDH 3GJFH 4M5SA 3WCYA 3S96B 3TIEA 5D7IB 3HKZA 1E28B 4AMWA 4FZEL 5JPNB 2JB5L 2JI2A 1WLEA 5T8IA 3VSTA 1LGVA 5CA0B 1XZ0A 2DICA 1PZCA 3BSHA 4JGUA 5DFAA 4LMQI 1SERA 4UWQB 5A3ID 2XUWA 4D0BA 43C9B 1WSST 1F4YL 1CFBA 4GI6A 2F5AL 2H0JA 4PJFF 1E9PA 3H4HA 4N0UE 3P11H 1KU9A 1ZTXE 5TGBB 3VD1A 3VGHA 1D9KA 3KGSA 4IGGA 1C12B 3ZMZA 1DVYA 4KUZL 3BESR 1IFHH 1N12A 5J12C 1T04B 1F6LL 1WWWX 3LKPB 3QXAB 4OIAA 5DJ2A 4L8SB 3ZKNC 4BSVB 2EZ0D 1FL6A 3VMPA 2C9VA 3A24A 4NAJA 1H8NA 2WANA 5DC4B 3F7VA 3WEXB 5HYSB 2VDML 3VFGH 4M5ZH 4N0UA 3U0TB 3EIFA 5KBKA 3OB0H 4YL9A 1UM5L 2F19H 3MV01 5HHMD 1CIDA 1H5BA 4X9GA 4ZMXA 4EOWH 3KWTA 3JTTA 4JKKA 3DROA 4ASUG 3BEVB 4APQB 3GMPA 3MRKB 4YDKL 3S5LG 2G38A 3ZL4H 2EDRA 3TBWB 3OC5A 2WXPA 5F7NC 1EV2E 5HI3D 3VMOA 5C0CB 4BA0A 2CM5A 4GRWE 1SYVA 2YO3A 4DW0A 4N0CC 1CQYA 4B3SB 1ONQB 4QHMB 1FYJA 4KVPA 5DK3A 3CEIA 2H5UA 3P4OA 4N0FB 3SDCB 2R0WH 4GEJA 3IJ8A 2Y7LA 4D0CB 3CUPB 3EDDA 2JVUA 3GK8L 1E8WA 1P49A 5CJQL 2NY2D 1PNLA 2WLIB 2Z4QA 3A5VA 2OMVA 2X2UA 4A55A 4Q58C 4XVTH 1IURA 4ICGA 3DRTA 3THOA 1MCFA 1Z0NA 2XQYG 4TKWA 3W39A 2CR6A 3DRQB 5DLMH 3DX8A 2XWZA 4JFFB 5CSZB 4FNLH 3RGBA 1IM3B 3CDZA 4X7EC 1T6VN 2J6EL 3D52A 2Z65C 4FVMA 1MABG 1TETL 4X9IA 4UNVA 5IVXB 1BZ9A 3QRGL 4LEEA 5AYUH 3QIBC 4WK0B 5KSUA 2E9BA 3TM6A 5L88H 3F7KA 5C71A 1JTTA 4K7PX 4OLVH 2XFXA 1PV0A 1Z5YD 2FX7L 1VACA 2G3XA 4YSOA 5J06A 1ZSDB 1Z0MA 2ICWB 4QT5A 4UNIA 3MLZH 3HE7D 3SO5A 3N27A 1JJ2U 1NANH 3HCVB 4Q6KA 5T3XH 2CGZA 2UXDO 4ZI7A 1DJXA 4BSJA 1Q0EA 3H42L 1NBCA 3FUEA 3KPSB 5EBMA 1BL8A 2ALAA 3O4OC 4G11A 3R18A 5F1IA 4A04A 4JPVL 4MVOA 4I2XE 1KZYA 4NPKA 5E99L 3BH4A 2JCWA 1U3HB 1P53A 4XBEL 1A3LL 4MVBC 3B8SA 4AIOA 2AEWA 1R3JB 3L48A 2LAGB 3OJDA 3I9GL 4FOMA 2V5RA 4JPKL 1IV8A 3LPOA 2EYSB 4LLMB 3RJOA 3TTYA 4TSCH 5FYKL 3TVMB 1TFPA 1GKOA 4I2XA 4WFGE 5AENA 1A4CA 1RZQA 1VPOL 3CC5B 3FCBA 4FJYA 3U4BL 3TP4A 2D4DA 4DN4L 4KI5D 1MXDA 3D4ZA 5KVDL 3CNKA 3QUXD 4RNRA 1THZA 3O2DA 2VN5A 4FQIL 2Q7EA 2OCJA 5E4EC 4B60A 4ELMB 4LSVL 2QTOA 4UT7L 4BKSC 4ONFL 1TKWA 1NCCH 3WKNA 5KYUB 2PTTB 1UVQB 1ETJA 3FZUD 1KPVA 3LNDA 1OM3H 4B3RB 1J8SA 2C1OA 3TO2A 3BUYB 2BCKB 2H0EA 5F7AA 5LQBH 4HJSA 3WSQH 4LASL 1OAQL 1WT5A 1SMOA 4AYMC 3X3FL 4L23A 4ZMLA 4JFWA 4HS6A 1G43A 4XPAL 4RGNB 5LHGA 5BV7C 1QBAA 2YIDA 5SWSD 5LVEA 2QKSA 4RUEA 4XCFL 4F7MA 1MCHA 1NCJA 1YNKH 1XHHA 2BSKB 5DCCA 2GIXA 1ZK9A 5EHFA 1HFUA 5JDSB 1KJVA 1TTFA 5J9PB 1ITBB 4XBGA 5H6QA 4QTHA 1ZGLB 4Q6YA 1RUML 3MFGB 3QF7A 4AYEC 4UI2A 4ANKA 5C0GA 1S7WB 4K5OA 5JOFB 3NP3A 3WHE1 5FNVB 3BH9A 4W6XB 5SV3A 3JASA 2PYFB 1P4BH 2D3LA 5DFVC 3ZZ1A 1JZEA 2EYTA 4XZUB 2JSFA 2ENYA 3H1KH 3P77A 3TYFB 4YJZL 4PG2C 4ELMF 4FYRA 4MCYA 5D2NB 4OW6A 3WB2A 1MJ7L 4JRXE 3OAYH 4KKCD 4XP1L 5EORH 3CCVV 3NK4A 4FQLL 5K9QI 4JY4A 4HP5A 1AHMA 1SY6H 1ROWA 3QUKB 5DZLA 3UACA 1RK0B 2M1KA 2XZZA 3ZTEA 4OV5B 1CLOL 4FABH 2WSPA 5E4AA 2X4TA 3QPXH 2ZT9B 1DE4A 5FGCE 1WFNA 2GTQA 3L7EB 5JQGB 1SQPH 3JD2A 3SYQA 5D7KD 4NWUH 2CH8A 2X9WA 4FLQA 3MJ8A 4J8RA 1KGWA 2LO1A 2EC9U 5BVJB 5LUMA 2OCHA 4AXWA 4CS4A 4D0DB 2OZ4L 5FGSA 1KLUB 1EM1A 2O5NA 2YGPA 2IPTH 3SDDA 3Q48A 4JDEB 5M94B 3THML 1OWRM 5IJKA 4GJTB 4YQXL 4JPRA 4KJYA 5L2KD 5EOQL 2ADFH 1CXIA 4KDTA 3GTTA 2PTUA 1S46A 5GGTH 5CP3H 4FEMA 3U1PA 1E4XI 5F72S 5G4NA 3KH3A 1DSYA 5EOCJ 1UM4L 3QQ9C 2ZXCA 5DT1L 1SF9A 2DYPB 2AZ2A 1ADQA 1JTPA 2WJ7A 3GSNA 5L9DH 4PJIA 1Y74B 2OK0H 3SDAC 1VADA 3GRWH 3KYNB 3U79A 4AHCA 5DJZB 5KMGB 4LP8A 3F58H 2AJZB 5FYLL 1S7UB 1N7MH 2PXYD 2P4KA 3GKWL 2EXYC 1TQCC 2BVTA 4R4NC 3AW5A 5FPIA 1QNZH 3B37A 3RVXD 2YD2A 4NO5B 5IGXL 4Q56A 3TBYB 3E2HB 2BOCB 4Q6IB 4P5KA 4UXNA 3ILQD 4XMLH 1KTCA 1T89A 1SHMA 4GUQA 4PJEB 4DUZB 1OT4A 1AO7A 2QGBA 3HUJB 4Y4HD 2WAQA 4FQ1H 3QI9B 4UNUA 1QR1B 1IX9A 4P23C 5CS7A 2WA4A 1P5UC 3KGRA 3PUUA 4JJHA 1IGYA 3N43B 4WWID 3LN5A 2NY3D 2W0FB 3LDEA 5F0PB 3EOAA 4YDIL 1MFDL 3KPNA 4O2BB 2NUTB 2PCYA 4N90E 1R5VB 5F7EH 3I6LD 5F93C 2O6EA 2BP3A 1ZAGA 2Y4TA 2J56A 5E1AC 1FV1A 4EBQH 2CRIA 2LTQC 2V3EA 3OAZK 1NFKA 2CLZA 3MV7E 4WDIA 4YK4B 1V5JA 2CDFA 3MXWL 1K6QL 5C0FB 1T83C 1ZPUA 2DN9A 1FZMA 5BQ7B 5AB2A 5I8OL 2IU0A 4OJFL 4XXDB 2CKNA 2WQVA 4QAWA 3LZLA 2MKLC 5CIPH 5JHDD 3MV7A 4DV2O 3EJUA 4YX2L 5TE7L 3IFNH 2DYRB 3HMWH 3UPAA 3OFNG 1ND0A 3BD4A 3SKMA 4DEWA 3UTTE 3JSLA 3GHEL 1Z3GL 3KWWA 4HJIA 3E86A 3WXVH 2IPKA 4ZPVA 2VWJA 5AVZB 2R69H 4CBCA 2IQAA 3ECVA 3F64A 2W9DL 4MTFA 4X66O 5DYFA 5I1CH 1JI2A 3WS6C 4QDGA 3APMA 3HMXL 4LKCA 4ZBMA 2GK2A 2ZKWA 2ZKXA 5A2AA 3QG6B 3UTTA 4K9EH 3NEEA 2LU4A 3X1NA 5JCOC 1LEGA 2XG4B 3A0RA 3A0HZ 2FVNA 1UXWA 3QZMA 3Q1SH 5GTIZ 1YECH 2ZIMA 3N41F 1NM4A 2IW5A 3VFWB 1AIFA 4UM9B 2FCBA 3SE9L 2C34A 2DI7A 2WXJA 3L4TA 3VFNB 1F58L 5T1MA 3VFOB 1D5BB 2IOOA 3UBHA 1JPSH 1P7KB 5FKAA 3GI8L 4P9HC 2VW6A 3DWTA 2A77H 3PYCA 4NRYB 4Z7QE 3LQAC 4PBVC 1KC5H 4L3EB 2OYLA 5F7WC 4MQ7B 4BQ6A 4BH8B 4EDWL 3K6IA 3CFKB 4A2GA 1B04A 2VLLB 4F33A 2XKUA 1QEWB 4GQPH 3K8MA 2E7LA 4IEFA 1XMWA 2N0KA 3HZ3A 3FQTB 1RK1A 3HBGA 4ZXBB 2VWEC 4UYPA 4HUWB 3K3QA 4F7CA 2VC2B 4UCRA 4BUHA 3HKDB 2PR9A 2DJUA 3WENA 2I9LA 4NM4H 4Z76B 1OE2A 2AEPL 4JJOA 4AY0A 4XPFH 1CO1A 3R8QA 3BGMB 4X6CE 1M6OB 1J05A 4FJ6A 1JOYA 4GRLD 2NY1B 4OCXH 4NT6B 4FADA 2J2ZB 2PCXA 4IRJB 3ASOB 4CC4A 5I1KH 3EBIA 3G9VA 1J7VR 3QFJD 1T5WB 4NO2B 1EJOH 2IAMD 3TH2T 4OGYH 5I24A 1YNTA 4DO4A 2XZQL 3S88H 2N7BA 3UOAB 4QGYA 5LA6A 2EINB 1YYLH 1M71B 1HC1A 4AVKA 4J1UA 5DJCB 1XR8B 2OQJA 4OB5H 4V1DA 1XV8A 3RE0A 1K5NB 4L9LB 5E00A 3IB4A 3D34A 1JDCA 3O0RH 5EU3A 2ZCKH 3KLKA 4U4IA 5IHHA 1PKQE 2ZCEA 3GMOA 3IVKA 2VDNH 3I02A 2YEZB 1DJIA 5DHVH 4M7LH 3QIUC 4EKXA 5ICYB 4L5FH 1DDTA 4HK0A 3A0OA 1NKRA 2NN4A 4QXTB 3VXPB 2FL4A 1F3JA 4DKEH 3O81A 4Z5RA 2VQEB 3CLWA 4LEBA 5HDRA 4FFWC 5JMOC 3T71A 5AVSB 5EC1B 4KP4A 3ZBMA 4QHUB 2XTJC 3GMQA 2PI5A 1HINH 1U8CB 2ZNXA 5T1JA 2F53B 4GNKB 2OP4H 4IU2A 4O5LH 2VLRB 4Q89A 5D8JH 3L74H 3O6KH 4IMKC 1UM6L 1MXGA 1PL4A 4CILA 2HVBA 2JKTM 4ZAKA 3ULUD 3VXRB 1M9NA 3LQZA 1UWYA 3II2A 3LKSA 2NXYB 5AAPA 3VDBA 1FL5B 4CSSA 4E2OA 1KB3A 3HZKB 4G5AA 4WSGA 4QGPA 5DD1H 3F5WA 4PJBE 3BA9A 3CSTA 4U1NA 2H32H 4MJIB 5E7BA 4HV8A 2Q8AL 3V0VB 5I76A 3IJHB 1E5CA 3FO1B 2IG2H 2VDLB 1DVFD 3G6JB 3MJ7B 3C5JB 3QCVH 4JB9L 2OMXB 3TEYA 2GSMB 3LN9A 2CR0A 3K4DA 3SQRA 4NUQA 3CB2A 4HBNA 3QFGA 1UURA 4FYQA 5FKPB 3FT2A 2KZBA 4NQSB 1VQ9V 1PD1A 1IBMB 2V2XA 4PJBA 4TQIA 1V7MH 4HJJL 4WUUD 1CYGA 4YJ3B 5IROD 5CA1B 4LRNH 3KLHD 3ZU8A 1K7DA 1KIUB 3P9LB 1BZDA 1FDLH 2FJGA 2GBTA 32C2A 3ZEDA 2UXBB 2Y36H 1M05A 3KCPA 1N0NA 4ZTEA 2B5UA 4OZHF 3UAEA 3BP6B 3ECUA 4A68A 4YXLL 3FUKA 2IH3B 4I0PD 4MLIA 3BSZA 3IS1X 1GJUA 4N2MA 4IBQA 2JB5H 1TLKA 2HX8A 2C2AA 1PDKB 4WWKC 2O6DA 3AAZB 2GB2A 3R8BB 1JS4A 3O3DA 3PNWB 3O9OA 3WGUB 1KUMA 4N1EA 1F4YH 1IKNA 1AKJD 1E5AA 2F5AH 1YMMB 4OTXL 3DJSA 3CHOA 3NZHL 4MMXC 3T9WA 4YHPB 4GG6A 1PL0A 4XN8A 3E8VA 4O2FB 3BAXA 1U9KA 4EXPX 4ZW5A 4JYCA 5KSAC 5D7IE 4GX1A 3G6JF 3GUTB 4NJ9H 1IQWH 4Z1MG 1S0VA 1SXBA 5HDBB 3LSOA 3RWGA 3V0FA 5CO1A 3IMSA 4AM0B 2JTDA 1WCBA 1MN4A 2N01B 4GXFA 4UT9L 3EJYD 1U91A 3DUUA 1Y18B 3S97C 3ZIYA 1EEQA 4U31A 4TM9A 5IV2A 3CSFA 2L04A 2ZNIA 3S96A 1WO2A 1BZ8A 1K4DB 5TISZ 4GH7B 5D7IA 5JPNA 2E27H 4YJ2A 5E1QA 5JIKA 1MW2A 3HN5A 2UUCB 2CUAA 5CA0A 3WU2Z 3DOHA 1M4UA 4LHUA 4MX7B 1R5IB 3U7AA 5CINL 3V7AE 3AWEA 4O4YL 4U2YA 2QPFA 1PPIA 4M8QA 1NPUA 4Z0XB 1QATA 3OR6B 4JDTH 4P4KD 2XXCB 4G8GD 3GK8H 1E2VA 3RLSA 4ANUA 4MXWL 1NKOA 1T04A 2IWEA 3MDSA 3UTZA 1SN5A 3LKPA 3QXAA 4L8SA 1K85A 3MUY1 1URIA 2ZNJA 4LOUC 5MEOB 1UB5B 4AE0A 3WEXA 5HYSA 4UB8Z 5FFGA 4U1HB 3V95A 3U0TA 4LFHD 2J6EH 3A3YB 1WH0A 2HKFL 1TETH 5JLZB 3MRDB 3Q5YA 3QRGH 1GK9A 3L5WB 2BXYA 3NABL 3NJLA 3NOIA 4XODA 3MRKA 1HL5A 3IMVA 1OCRC 2FX7H 3TBWA 4BKTC 2YD8A 5I8KH 3DC5A 2K9UA 1ONQA 1HIML 2FECI 4QHMA 4RMBA 4N0FA 3MNWB 1O5PA 4DV6O 1G7HB 4DV7O 4P0DA 4W6YB 4XI5D 5D2LB 5GRVK 4D0CA 2AJVL 3CUPA 3H42H 2XXGA 5E2VH 2YIBA 2ICEC 5IVXE 1S4IA 3TC9A 5EBWB 5F3BB 5E99H 3VACA 4FEIA 1VKXB 3ZHUA 1YCSA 2BY3A 5CLTA 3ULVE 4XBEH 4JHVA 3DRQA 4N2NA 1A3LH 1JV2B 2WY3B 3A6BL 4HBQA 5CSZA 1NCOA 4KI5F 3I9GH 2LW1A 4GXVL 1KBBA 3N04A 1I1AB 3V6BR 4JPKH 1LEIB 4R0LB 2UV3A 4O00A 1N4CA 5IVXA 5FYKH 4RQQB 4JM2D 3AITA 1HL4A 2FQFA 2DH2A 3RILA 1VPOH 1A2YB 5EC2C 3T8XB 3KPSE 1OCCC 5G55A 2PP8A 1MAML 3QAZC 3U4BH 2VLJB 4GW4A 1ZSDA 4DN4H 2ICWA 2VDRH 4DW2L 4UZUA 5TQ0H 4JF3A 5KVDH 3HCVA 3WUWB 4FQIH 2B9BA 4KKQA 2Q3ZA 1QNMA 4UT7H 1B4RA 4ONFH 5E23A 1OCZB 2RQEA 3KPSA 4L9DA 4D8PB 5ABZA 1A7NL 4QXGH 4AW7A 2YUVA 1UC6A 3GXPA 2BSEA 4KO7A 4A2LA 5D2LF 1U3HA 3N50A 5K9JH 2EIJC 2YPVL 2E9WA 4DR5O 1OAQH 1R3JA 4GFTB 4KKNA 2Z0BA 3X3FH 1DVTA 1O7DE 2VN3A 4YHIB 4Q4EA 4XPAH 2RQ8A 2VR8A 2QZQA 4OGAC 4BSWB 4LLMA 2EYSA 3LKRB 4G2AA 5EUOB 3TVMA 3L1EA 3CC5A 2IH9A 4ZYKB 1BAGA 4NM8L 3MRQA 5AW5B 2XDHA 2CD0A 3C6LC 3SY6A 2BXZA 1HNFA 4JVPA 1U41A 4BUGA 5FYKD 4ZFFB 4A7GA 4H2AA 5CZKA 3IWVA 4FNQA 1JMZA 4CH3A 5J0BA 3F65A 1J8RA 1HCYA 3VI4B 1IC7H 2CO4A 5F89B 2HEPA 5KYUA 2FBJL 2PTTA 1UVQA 2E0PA 4ZMOA 1G9MC 1OVZA 4M8RA 1P7QA 1EEUA 2W07A 3BUYA 3FHAA 3MLXL 3UJTH 4AVIA 3BWAB 4X4KA 2EVHA 4N2OA 1MJ7H 4PM1A 4MXQC 2OXGB 2WXGA 1G1CA 4XP1H 4FQLH 2XNAB 3OBAA 3SO3C 5JQIB 2ERJC 1DFBH 1HS6A 1OP4A 3VI3B 1CLOH 2CAKA 5C3IA 2E5EA 4JI6B 2E6PA 2BSKA 4EJ1C 1SJXA 5E2JA 1Z66A 1MFVA 2HAZA 1KECA 2X28A 3MLSL 4J11A 3FT9A 4LOEA 4ORGA 1MCIA 4Y4KD 3UMNA 2H45A 3KCYA 4K35A 4Y0GA 3UL4A 1VQ4V 2ZP8A 5D2NE 1ZGLA 5HPMA 3FAWA 4QKXB 1CIUA 2DQHH 1H3PL 3DVIA 3EDKA 2DOCA 3FYIB 1S7WA 5JOFA 2R9HC 2BNQB 5FNVA 3BZ4B 4JG5A 4WI8A 4YBHA 2KERA 3V4LA 4XZUA 3TYFA 4TVPL 3QJSB 3THMH 3I56V 4YQXH 1F0LA 1BVLB 3MACH 5D2NA 5BJTB 1I7TB 1JGDB 1KBVA 3ZTJG 1IAOB 1N33O 3QUKA 5HDLA 3H9SD 1RK0A 3QIWC 4XMZA 4OV5A 1Q1PA 3DHPA 1UM4H 4PJCB 3ZRCC 1N8ZB 1U36A 3KXFB 2WP3O 4B9KC 2WCSA 1QNIA 3DSFL 1I5XA 4BZ1H 4EAEA 1ZK5A 1RZKC 4AQ8C 3L7EA 2ZKHL 5JQGA 3NK3A 5FYLH 3T08A 1FSKC 3GKWH 3UTSD 2FH6A 1KNOB 3CIQA 5IGXH 1ZA3B 2DI8A 2VW4A 5L4JA 4DR6B 3OZLA 1E5UI 2W95A 3QUYD 1MCJA 4LF8B 1X3DA 4JUTA 4PU2A 4D0DA 5LGUA 3PDOB 4NQVB 4FGMA 3WB0A 3SD5A 2ITEA 4JDEA 5KSVB 3CVIH 1AGCB 2AZAA 4UAOC 4WRLA 3K2IA 1XNQB 1CDUA 4G1MA 4WI7A 4YDIH 2RJZA 4P2ZA 4U1KB 1KGIA 1XSKA 3MNMA 4PLNC 1KT2B 4QR7A 4R7DB 4YLBA 1CS6A 1NCDL 2DYPA 2DM2A 3ARRA 1JI1A 1QSED 1Q9KB 3H8NA 5T5FA 2H2PC 1Y74A 2XICA 3PLYA 1ID2A 1SKVA 3O2WH 5CIPB 4PJEE 2YPLB 1SBBA 1G6RH 3KYNA 4FFVC 1D5AA 3HUJE 5DJZA 1VF5C 3GI9H 4WAFA 2AJZA 3DDGA 3WTXA 1S7UA 1TPXB 3ZKND 2QPDB 1K6QH 1VQMV 2KPWA 5T1KB 3BP5B 4NO5A 4LVNC 5F9OL 2C8NA 3TBYA 5EEWA 4OQTA 1BYNA 2BOCA 2Z5UA 4G70B 4Q6IA 1ZY9A 5FYLD 5ACMA 5I8OH 4AQYB 4RX4A 1FFXB 4PJEA 3HUJA 3TNNB 3OZKA 3QI9A 2XWTB 5IFAL 1QR1A 3L3KB 4DRXB 2ZP9A 3LHPH 3OKLB 5TE7H 4J5VA 3FH5A 2W0FA 4M62H 2DTML 4Y19B 3EYUL 2EKJA 2J8OA 4O2BA 4R97B 2NUTA 5IYCO 1K3IA 1R5VA 3QFJB 4OFDA 1SXZA 4X42A 2IAAC 4JVUA 2W9DH 4N0CD 4NIYE 4KFMA 2WXRA 3VWJB 3MLYL 2C4FU 1VHPA 3E8BA 2IJKA 4X80L 4M00A 1YYMH 2VR3A 2J8UB 1L3WA 2DQ6A 3WNNA 3VG0H 8CGTA 3H9ZA 3DIFB 3P2TA 2LVEA 1GTFA 5JA9A 2EE2A 4JGSA 3LNNA 1OLLA 2BDNL 4KKBC 5BQ7A 5ISZE 3V52H 3SE9H 3NN8B 1BOGB 4HC1L 4A2HA 1BBJA 5FF6B 4EZJA 2ZWZA 2EECA 1ZGLP 3E9UA 3FX7A 1N18A 3QWRD 2FWOB 1M5IA 4JG9A 4IU3B 3GI8H 3RPBA 4W4KA 5EO1B 5LGYA 5HYQB 2E7MA 5CZVL 4FKHA 4F9LC 5B1CA 1GMGA 3QEHB 2K4WA 4N2BA 1C08B 4UOQA 4EDWH 3WFVA 2BERA 1QSFB 1OV9A 3EYOB 3QO5A 4XVSL 4UV4L 5GZOC 3ETDA 1A4BA 1JK9B 1N59B 3ASNB 3B83A 3BRFA 2DWYA 1EMTL 4L4TB 3S34L 1CU4H 1S5LZ 4HWZB 1JPXA 5FW6A 3VA2C 3QG6A 3VW3H 1M1KW 3LS4L 2DWXA 4K3JL 2XG4A 5F21B 3SOBL 2AEPH 4RMWA 3TO4A 3EADA 2APTA 3BUDA 4R4BB 5MHSE 4EN2A 1FO0L 1WAAE 3CE1A 4L3EE 4MVBD 4LFAB 1DUZB 3U1SH 3OLIA 3D36A 1I75A 3D2TA 4TLTA 3VFWA 5DHDA 2FO4B 4G6FB 1AIZA 3VFNA 3GXIA 4Q9RL 4G8IB 5TE6H 1HVXA 2X4SA 3GGWB 1D5BA 2FEDC 2BS8A 3K4AA 1P7KA 2NXZC 2R0ZL 4X5PA 4KGLA 3ZDZB 2HH0H 5JOPE 4PA9A 4NRYA 2APBA 1LQBC 4L3EA 4R3SB 2P26A 4MQ7A 1J9QA 5K39B 4BH8A 1P4RA 3VJ6B 3UM7A 1FH2A 1QEWA 3Q2NA 2IV8A 4TUOB 4F2MB 2F7PA 5LGHL 5JW4Q 5B66Z 1CLYL 4B0MM 5FOBB 4AIZA 4ZXBA 4UU9B 5C7ZA 1I94O 4U1IB 4HUWA 4QYAA 5JQ6H 2ICWJ 4FIPC 3GO1H 3HKDA 3PL6B 4Z1VA 5EU7E 3U0WL 4WI4A 4ZOBA 4Z18A 4PELA 1M6OA 3QR1A 1ZPLA 5JORA 3FU0A 3STBA 4KMQA 4WTWA 4YHYB 4NT6A 1NBZB 1TU2B 4ZNEA 5JW5B 2AEQL 1KCVL 2J2ZA 4HEPG 4IRJA 4M7KH 1CGVA 1HSAB 1T4WA 2O5ZL 3C60C 3WFZA 3VD2A 5B1NA 1G4RA 4KK5C 1T5WA 4NO2A 3RTQB 4W9CC 2HHHO 2JF1A 3GIVB 2H1XA 4S0HA 2VZVA 1WZ1L 2B77A 2F7OA 1DANU 4QWWD 1S9XB 2XVLA 3TIDB 5A2QN 3EJQA 3L45A 1M71A 2AK1L 5DJCA 4LAJH 5I8EB 5GS0C 2IADB 3K1KC 1UM6H 4TQHA 4XOCA 4HKBB 1UACL 1K5NA 4BJLA 3MZGB 2ZUXA 4J3OC 1MREL 1VCAA 5IWLC 1YYCA 4XB7A 3B4NA 1OT2A 3QXDB 3QVNA 1UD4A 4P9ML 4U7OA 4S1DC 2PCFB 1P0SE 3CIAA 2NZIA 4EB6B 4WI0B 5BV7H 2JEUA 1XMOO 2XJKA 4X6DB 5EEYA 1XCTB 2XVBA 4QXTA 1TGOA 5GZND 4JB9H 3VXPA 12E8L 1EVTC 1Q9OA 2DL9A 2RTTA 2VLRE 1SOKA 2QR0B 2K7PA 2X42A 3UCSC 2BIQA 1MHEB 3FQ2A 1G7LB 4QOKE 2AKRB 3HAEB 3RBZA 3U9WA 2Y06L 4JFYA 5C7XL 4FYTA 5I0DA 2YWZA 3ZKMC 4KRPB 2DIAA 5EC1A 1HOCB 2YOAA 4QHUA 1U8CA 5FGBC 2VZ3A 3C8KB 4N2DA 5CZXC 2F53A 4DGWC 2UXDB 1ZD6A 2VLRA 1E4XH 3B2DC 3GPEA 2F5BL 4NN6C 4UOW0 4N20A 2AANA 3VXRA 4LSRH 2NRDA 4YXLH 4BZ2H 3BH8B 1SM3H 1T6BX 3MV8D 3G9AB 2D4FA 4JMXA 4DR4O 3HZKA 2J6WA 3RAJL 3T0VA 4GT7A 3C8DA 4WFEE 4U6XB 1JWMB 3V0VA 4G7YH 4MJIA 4YBLB 4B7IA 4G6KL 3IMWA 1QZ1A 2VDMB 2GTAA 1DZ0A 3IJHA 5KANI 1KFGA 1MFEL 3NJJA 4OTXH 3MJ7A 3C5JA 2AMGA 1PZ5B 3QO1B 3M8AA 2OMXA 3W9DA 5F6IB 1OLZA 1QABA 3BQUA 3U2SA 3F7QA 3AFLA 3T3MF 4CGTA 5DJXB 4DV4B 3KPMB 1CL7I 3QQ9D 3KGUA 4HUXB 2IANB 4NQSA 3VB8A 2ENJA 4YJ3A 4ZO9A 5CA1A 1Y1DA 4M02A 4Q7DA 3GZPA 2K9PA 1KIUA 2OS7A 3P9LA 4ABVA 4UV7L 1A7QH 3LJ3A 4UT9H 2PO6B 4N24A 2EXYD 3P9WB 4X0NA 3BP6A 1AD0B 2IH3A 4K3GA 5L8LB 2QGEA 4Z7UB 4AW4A 1AYRA 1R1BA 3SE8L 5I1GH 1JZ8A 3QEQB 4N23A 4KMTH 3BRDA 1PDKA 2NW2B 3KPRB 3AAZA 4P23D 3PNWA 4BIOA 5IB2B 4QHNA 1KB9F 4F4LA 1EFQA 1S76D 5CINH 1BE3H 4FM2A 5ITZB 4LLAA 5HDBE 2K9FB 3DKHA 5ICUA 2KT6A 4LNVA 3SDCA 4EVNB 4YHPA 5EDXA 1PZ3A 4P59H 3W2DL 4MB5A 4GSQA 4MXWH 4O2FA 3TA3C 5C0BD 3JALB 2WLLB 4WFFE 5AYTA 1G1XB 3GUTA 3O3EA 2CHXA 4OQ1A 1WBZB 4Q9QH 3FB5C 1UFGA 4BM7A 1UZ6F 1WITA 2HKFH 3L6FB 4GS7C 3BAEL 3O8XB 2GDSA 1JGEB 4JHAL 3L9DA 3BGFC 1OZUA 3ES6B 4WFFA 1K4DA 3B43A 3NABH 2J4WL 5AOMA 4P9HH 3HTLX 1TMCB 3L9BA 3NRFA 3DBXB 2GIMA 3EJSA 2QM4A 2HRGA 4Z7VF 3QUZC 1HIMH 4MX7A 1QUPA 1R5IA 4UT6A 4B9CA 3FN9A 4YDVB 2QVMA 4Z0XA 3OR6A 3CX2A 4OUUB 5IQ9A 4R7VA 4W68A 1JNLH 4M3JA 4JM2F 3WFBL 1TYEB 3D3VD 1FH5L 3JATB 4KITB 1XD1A 4A5UB 1JUFA 4D3CL 4HCGA 4NNYB 2F7RA 1AZNA 4K23L 1Z5LB 3KCXA 5MEOA 1B4LA 4CC0A 3C9NB 2R29L 3A6BH 3BFWA 4HWNA 4LPYA 4U1HA 3Q4HB 3JAWB 4FLVA 4MMYA 3ILPB 3VQLA 1OTUC 4MS2A 5TD4A 1G9NL 4KH2A 3MRDA 5JJEB 4QRFA 5TF1L 5JLZA 1TSRA 4F6RB 3L5WA 1IBKB 3KM1A 4BHUI 3LH9A 3JD4A 4L3CB 1JNJA 3B9KB 4JEGB 5F7DB 5DVNA 4OLWH 1XGPB 3N2JA 3N40P 5FM5M 2R9AA 2QPUA 4MBRA 3TCXA 4BQ9A 1ROPA 4XX1E 4ZW6A 5E4IA 3MNWA 1G7HA 2A74B 3AY2A 1UKSA 2VXSL 3PPEA 3AT0A 1HQRB 2ZSVA 4XMUA 3FULA 3C5XA 3T0EB 3EDFA 4EFBA 3RPKA 2YPVH 1JV2A 2E8YA 1M7UA 4FLRA 1TQTA 4LF9B 1I1AA 3BWUC 1LEIA 4R0LA 4O51B 1M9SA 3GC3A 3FB7B 5HJDA 3BI9X 5IHBA 1D5IL 1WBXB 1WS7A 5DO2C 3TN0C 1P4IL 2V5TA 1A2YA 1J87A 3T8XA 4NM8H 1IIKA 4JRYB 1G5GA 5D7JC 1RIUH 3FOLA 1YIJV 2IBZX 3UBXI 2YRZA 4HSAC 1CN4A 3PJLA 3ARFC 3WUWA 5KOMC 4XMVA 1BDYA 5EOTB 1QLRA 2DWEC 3I5DA 5LNEA 5DECA 3NCCB 1DLFL 1IBHA 5H37A 4ODHL 4JQXA 4LVEA 1FAIL 2NSXA 2FJFB 2FBJH 4D8PA 4Z3GA 2VLKD 1YDXA 1R3KB 1UD2A 3GWOA 2AF2A 3BQVA 4KJWC 1JWUB 4KKPA 4QNPF 3MLXH 2PPDA 3K59A 3UG5A 2Q3XA 4MB1A 4LLUB 1AI5A 2IDQA 5BRZE 3R7QA 4MTXA 4EE2A 3L3DB 3TOPA 4HQQL 2GSIB 4YHIA 1EZVX 4BSWA 4PWHA 4LF3B 3LKRA 4WHCA 5IOKA 5EUOA 1J0IA 1VQLV 3VGDA 4IHJB 1W16A 3QIUD 3VI4E 5E8PB 1H6FA 4ZYKA 5DMJB 2IEPA 3MLSH 3FUDA 2C9RA 4OGXH 3GM0A 4ZFFA 2PWFA 2AK4B 1CDJA 4FFWD 4PCTA 1MCSA 1H3PH 3FUFA 2XTJD 2EDQA 2GQHA 3VI4A 1X5ZA 5F89A 3V8OA 3VI3E 3RB5A 4GT1A 4MQSB 4TVPH 2VERN 2CO2A 4YXHL 5JIQA 4DW1A 2UZXA 2OXGA 4L18A 3HKFA 5J7CC 5GS1C 1V55C 4PW3A 3FCUB 3HJEA 5GJTL 5IBUG 3P3YA 1GA2A 4CNIB 2OM5A 3VI3A 1JYNA 5HXMA 4PRAB 5T33H 3HVDA 3VWKB 1WYJA 5IHZB 4JRFA 4RZCB 1R17A 4EEQA 1DBAH 5B3SC 3DARA 5G2NA 4HMEA 4H20H 2N7SA 2PP7A 4B3MB 2ZKHH 4NKOB 2EIKB 4MFHA 5GSRA 2ZWYA 3MLWH 1XAKA 4U0RB 4AVHA 5SWZB 4OBSA 2H1PH 2PZSA 3DURB 5F0JB 4EIZC 4Y2OB 1ZA6B 1A1MB 2P42B 1PLCA 3BZ4A 4X98B 3AK3A 4PJCE 3N5AA 3WJMA 5KZCD 1DBKL 2Z7YA 3KXFE 1QRKA 3MRGB 2FB5A 2APXA 1XCQA 4N2HA 5DHMC 3CJHB 1BVLA 1CL7L 1PL3A 2J20A 3BAYA 4N2AA 4OCSL 5BJTA 1OOAA 5ICXB 2B5IC 2I32A 1JGDA 2X1QA 3WIHL 4PJ9D 1KFAL 1IAOA 3CH1B 4TVPD 5EU6D 5JIDA 4UTBA 4PI2A 2AW2A 4HK3J 3ZHKA 4WWKD 3FFCD 4PJCA 4BBWA 1NCDH 2VDKL 1N8ZA 2X44D 3KXFA 3Q6GL 1ZLSL 2F1BA 3DUHA 5L4IA 1MHPL 1CVRA 3CDCA 2NY5L 3BVNB 3U6XS 3LOWA 3CC4V 1BM7A 1PJWA 3HB3D 4OD3L 5I6NA 4LVHB 4NQCD 4H37A 2EDLA 3I9PA 1E5BA 3KYOA 8FABB 1A25A 4N0YH 5F9OH 1KNOA 1GC1C 1ZA3A 2VKWA 1W0VB 1MFNA 3K74B 2FX9L 4B9IA 1V7NL 1NCGA 3J07A 3KHQA 4XB3A 3VX1A 5LB1A 1ZOXA 2Y72A 3T04D 5IFAH 4OZFH 1AGCA 1Z2KA 4XHJC 5T1LB 5KSVA 3QO0B 1JZ7A 5BMFH 3AUVA 1MI5D 4DV0B 2YPLE 2DTMH 3K2KA 1ZRUA 3MJ9L 4N1CA 3EYUH 4WBNB 2F93B 2Q0ZX 4U1KA 4JDZB 3ESOA 3VFRB 1NBMG 3OMIB 1AGBB 1TZ8A 1KBPA 1KT2A 3JCUZ 1MAJA 4R7DA 5CMUA 1Q38A 4U3JB 4BFJA 4PJXF 4EN3B 1Q9KA 2QADB 3RKDC 1KSRA 2PYLA 3WMPA 4UOJA 3WYRA 3MLYH 5JO5B 5D7LE 2KMWA 3RZCA 4U0QB 2YPLA 3MGTB 2P5ED 2AXHA 3IDGB 3LRSB 4GKOA 3VFTB 1VQPV 4KHPB 4NCDA 3ZDYF 4ELKB 2R15A 1ASOA 4X83A 3S35L 3WS3A 3L3IB 4LOUD 5T1KA 2F9BT 3BP5A 2UY7B 2BDNH 4YLQT 1QTYT 1CDHA 5D7LA 5F9WB 2M8XA 1A21A 3CGTA 4HC1H 1FFXA 4I3RL 4BFEA 4DK3A 3S5LA 1E6JH 1RY7B 1NTZH 2XWTA 3BMWA 1NFDE 3GF8A 5TDPB 1CD9B 3IF1B 4DRXA 3L3KA 3OKLA 3V6FB 1A02N 1OIOA 2IGFL 4N2CA 3V4PH 1J5IA 4JTAB 3V6OE 4H8QA 1PM9A 2ETNA 3J7AU 5HY9B 1CFTA 3VXSE 2J8UE 4YEFA 1YY9C 3SDXF 3GB7B 2LGNA 2YLKA 3M45A 2B1AL 4UV4H 5BMVB 4FF9A 1CFQB 2DYSC 1SN2A 1LO0L 2KI6A 2GUZB 3F7YC 3IRPX 1N4XH 2ZX5A 4ZFQA 3S34H 3VWJA 5I28A 3AREC 2JK5B 3ABKC 5D1XB 3V6OA 2PW2B 1FFRA 4WO0A 2I26N 4N21A 3NTCL 1L4IA 2J8UA 2NY4C 4HS3B 3VXSA 5MEQB 5JPMB 4J3UA 3MX0A 4M6ML 3SOBH 2YQBA 2DBLL 1MOEA 3DIFA 1CP9A 4Y5XB 4GEIA 1FO0H 1P1ZB 3WHE0 3E1F1 3INUH 5B3NA 4DFIA 1MCPL 1J1OL 5FF6A 3FB6B 2QFRA 4Q9RH 5I19L 3SJAC 1MG1A 3IDIB 4UILL 3AU1B 4UQ2B 2FWOA 4L4TE 1F13A 2DWDC 1JCHA 2PCPA 2R0ZH 4IU3A 4NN7B 4HJEA 2ADPA 1GN4A 1RZ7L 5EO1A 4APXB 1M9WA 2V8MA 3QEHA 1C08A 5CEZE 3P30L 1QSFA 4IHBA 2Q6WB 3EYOA 2EYRB 2F68X 3ZL2A 1JK9A 1N59A 5LGHH 4L4TA 3E80A 4DESA 1CLYH 1G9MH 5EF1A 2HFGL 4HWZA 3GPSA 3L2LA 4BIZA 2R4RL 1F2XK 4P2AA 1J86A 4YHZL 3U0WH 1D5XA 3ZDZE 1JNNH 3FQNB 1SMDA 1JF6A 4P5TA 4R4BA 3EXLA 2WGNB 1E7UA 1DUZA 2XN9D 4ILDA 3IPEA 4FQQB 3K5RA 2FO4A 4ETQA 5EBLC 2AEQH 5K5YA 3H1ZA 4N5UA 4RAVB 1TF4A 2M2DA 2O5ZH 3GGWA 3RVZA 2C3XA 3ZHSA 1E7VA 4I1PA 3HLAB 5ECJE 2MTPA 3RUGF 1E1QG 3ZKQD 4IOSA 1JRHL 4HWUA 1V3LA 1COBA 3UH8A 1WZ1H 4FK5C 4R3SA 3C6LD 2FWLB 3LNEA 3F6LA 4P57B 2Y25A 1MSPA 5FAAA 3VJ6A 1PLAA 3WNMA 2AK1H 4I1NB 1TZAA 4LO9A 4TUOA 1VF6C 4NTXA 3WELA 5FOBA 3CFCL 4RMVA 4UU9A 5D93B 1HHHB 4HGKC 1K5QA 1MCWW 2X4NB 3PL6A 4GSRA 5CP7B 2GJZB 3B5TA 3KKYA 1RZIB 5JIHA 4DJMA 1IU1A 4MXQD 3VRJB 1IBDA 2JMRA 4AOFA 1NBZA 1TU2A 5JW5A 2EQDA 4BGDA 5HYIA 3K5MA 1RZKH 4DVRL 2HKAA 4XBMA 3EDJA 3RTQA 5C7XH 4JLRB 3ASWA 4LIQE 1PX4A 3L54A 1EGJL 5EIQA 4LBAA 5AW2B 3GIVA 1WPCA 4IIQC 3NCFB 2B2XL 4ZZKA 5AZEL 1S9XA 4DR7B 1IQDB 3FONB 4QRPD 3PHQB 4R9HA 2XIIA 3KL5A 5I8EA 5LCVL 2IADA 2F5BH 4KKZA 1PS3A 3STLB 2ZG3A 2B9AA 4HKBA 4ZSOB 3MV9B 1X5LA 4B27A 3BISA 2VL4A 3Q01A 1DBML 1R19A 3FFDA 3WEMA 3TTSA 4Z7AA 1WB7A 2Z1KA 4ZX6A 2BOBC 1XSOA 4JHZA 4EI0A 4EB6A 1J18A 3QRLA 4WI0A 4ALAC 2CCVA 3BAJA 2Z6FA 4X6DA 1XCTA 2CJTA 2OT5A 2EDYA 1JMXA 1MRFH 3QIWD 1L0YA 1MHEA 4KVCH 1G7LA 1AJPA 4RFNB 3QZBA 3HAEA 1BVNT 3KVPA 1ZV2A 3BY6A 4UQCA 2EEFA 2NPLX 4LCCC 1EBOA 3SYAA 4HMCA 4IKLA 1MCBA 2B59B 3C8KA 3Q9PA 2FT6A 4BQ8A 4LFHG 3RYCB 4X5LA 4DV5B 2ATKC 3KPTA 1AHWC 2PYJA 1N19A 3UQ8A 4LWSB 2RCSH 3BH8A 1S2EA 4YWGL 1ITCA 1OAJA 2HTLC 1TJIL 4H8WL 1KCLA 4DVBB 3RJQB 3II1A 1SZTA 4U6XA 3KBHE 4BKLB 1QBML 1JWMA 1BXAA 2VMCA 4K4KA 3ETBJ 2EZOA 3OPUA 1AFVL 2LVCA 4YDMA 4MXVF 3U2JA 5C3LD 2VL5B 4AK2A 5HHQB 5C93A 4P5RA 4LFBB 1MRDL 1PZ5A 3QO1A 4PRHB 3PY9A 3VXNB 1GGIL 1JPGB 1NA8A 3W2DH 2O61B 2HFFB 5DJXA 5F9JB 3KPMA 1KCUH 4HUXA 4U1GB 4L87A 4C56E 3A2FA 5BR8B 2H2PD 3TXAA 1HR0B 1ROCA 2NUPB 4F8QA 4YNYB 1OZTG 6TAAA 3QEQE 5AOZA 3BE1L 1S77D 4JPWL 3TPUB 3WHXB 2UXXA 2PO6A 1N5AB 4FI7A 4B9YA 4XO9A 2X9ZA 5JNYB 1LO3L 4K7FB 2C1PA 3OGCB 1AD0A 3SYOA 3SPGA 4DAGL 1ED3B 3LEXB 2J4WH 1TCMA 1BP3B 2Y22A 4Z7UA 4K0KB 5HHPB 5ADPH 1K5WA 3WJJC 3P0GB 3QEQA 3SOTA 4KXBA 3MRIB 3KPRA 1MCEA 2ADGB 3CN4A 3FD9A 3G6AB 4XN2A 5IB2A 2R2HA 1F2QA 5ITZA 4EVNA 4O9HL 4MJ5B 3E8GA 1I1FB 1GM9A 1OAUL 2WN3A 4J27A 4MASA 4MVSA 3QJZA 1UWFA 3UBFA 2IBBA 3WFBH 5ADOL 2MCPL 1FH5H 2IJIA 4YSRA 4P30A 3ZMSA 4PJ8B 2A5UA 4D8OA 2XCMC 1HZLA 2AVFA 1WJ3A 2WLLA 4K23H 1OSZB 4B9FA 3C87A 2DQFB 3QGVA 2R29H 5GRZA 5HJ3B 1I0HA 1WBZA 4GAJL 1A66A 4Z7OF 3IYLW 3N9GH 1EO5A 4YC2B 4WF7A 3ELAT 2WWWA 2JQMA 3L6FA 4ADIA 1G9NH 2TSAA 2Q4PA 3O8XA 4YFDB 3OEHG 1KLGB 1IZJA 1JGEA 1AI1L 1U8OA 2HWZL 3CVHB 3MPCA 3PRZA 3ARGB 4LRIA 5C08B 5I71C 4KKBD 1F1GA 3UZQB 3ARPA 5IJVB 3TYGL 3DBXA 5EN2B 1ECZA 3T1HB 4GRMB 1SXAA 1GKFA 2VUKA 3T1YB 4ZUWB 4DO6A 4LGSB 4E9XA 1EN5A 4YDVA 2Y6SC 3ZHFA 2VXSH 3MLUH 4PRBB 3SJVB 1OANA 1XBLA 4ODTH 4OUUA 2HVKB 2WPGA 1QQDB 1M2OA 5CN3A 3JATA 4OGQB 2NCMA 4NHCH 4XO4A 4NUJB 5GS1A 4PBDA 3K57A 4TQFA 1OHZA 4DP6X 2GY7B 3C9NA 5H5NA 1QFWM 1ZGLM 1EHLL 3JAWA 4HIJB 3ILPA 2VR4A 2VO5A 1D2PA 2YQGA 3OTOO 1AYOA 4KUCD 1T0NB 4F6RA 3RWDA 4UUJB 5ESQB 3UGXA 3K2UL 1P4IH 3ULAB 4RISL 4E5XG 5IZ7A 4L3CA 3KEHA 3B9KA 2NY6D 5F7DA 1F86A 1XGPA 3CXHF 4PWIA 2CH7A 1FNEB 3AK1A 4XC3L 3T0EE 2WJ5A 4LSUL 2CHWA 2FEDD 1TZOA 4PP1C 4F57L 2NXZD 1VERA 4JZJC 1GPOH 4NLAA 4X6EB 5GS0H 5IMKB 3L08A 5F2VO 1DLFH 1HQRA 4F9PA 3BPNB 3CCHB 5F2FA 2Q68A 5C09D 5IW6B 5B39G 1UJ3C 2E75B 4J3OH 3T0EA 4HPOH 4N26A 4JRYE 4LL9A 2BSBA 1ZANH 3FMGL 1Z9SB 4HQQH 2X0UA 4M5YH 5I2IA 5I0ZA 5FOJA 4O51A 2V1DA 2WIMA 3FB7A 4GMTL 1MLCA 4HMDA 1FUNA 3SGDI 3WIIL 2C3HA 1WBXA 1T3FB 1AR1B 3FB8A 1CD0A 4I0CC 4P2RB 4BRJA 4JRYA 1X9QA 3VG9C 1WF5A 5DJ6B 1G0XA 3MN8A 3K5OA 1K9MW 3O6ML 3LB6C 3GHPA 5CSGA 3UO3A 4MA7L 5HVHC 5EOTA 3LKNA 3IDMA 4PGEB 4PYGA 5HGHB 2P49B 2YFOA 3P3NA 2KH2B 1MQKL 1BX2A 2FJFA 3GFUA 4HX1B 3JYCA 4PREB 4CVWA 1LWJA 5GS0D 1R3KA 4KTEH 3EBGA 1HTYA 3NZUA 1JWUA 5KS9B 1AD9B 5EEXA 2F2HA 1W0JG 4N6RB 3RI5K 4LLUA 1NKDA 1ACCA 3L3DA 4J3OD 1NAMB 2HFEA 3QDGB 4NUMA 5D72L 2CDGB 4HIHB 3O2VL 1DQMH 5EOCL 5CGBA 3CSYB 5H6RA 4LF3A 3SODB 5I75B 4G80B 2UUBB 1MFMA 3DC6A 4IHJA 2OZ4A 1KC8W 1PTZA 4NBZB 5E8PA 4ZQKB 1FAFA 4L1SA 4PGZA 1KPUB 1PFOA 5DGQA 3UJJL 2CK3G 4N2GA 1OY3B 5D5ME 5DRXB 4XN5A 4I3GA 2AK4A 3O3AB 3VTTA 3DX4A 4G8FB 4O2EB 2WUBH 4HHAB 5AQ0A 1DJWA 2CBTA 2RACA 3ZKMD 1D2OA 4CUCA 3O6FC 1IGIL 4MNQB 4TS6A 2P5EB 5F9AC 3IKCA 4JW3A 2QT6A 4E41D 4MJ6B 1XXDC 4CKVX 5D5MA 3Q7JA 1DBKH 4W93A 2I7SA 3ARQA 4ZTPL 1CL7H 2X0WA 4IHOB 4PSPA 2W5PA 4OCSH 2FLMA 1NPJA 2Y48A 4NTYA 2HA1A 3GQFA 1TCRB 4OSUL 1KFAH 4J42A 5BXZA 4HWEL 1VAHA 3SQOL 1TA8A 2QELA 4QHKJ 4RWHA 5KBDA 1ZJAA 1RLWA 5SWZE 4CNIA 3F7LA 1GYAA 2VDKH 3NCJL 4PLJD 4PRAA 3S3DB 3Q6GH 3SDDC 3VWKA 1ZLSH 5IHZA 5KYNA 3FKSG 1MHPH 4AYDC 4G27B 1BHAA 2NY5H 2XASA 3N6YA 4HAFA 4KROB 4ZX4A 4X1YB 3H7BB 4NKOA 5F96L 4OD3H 2HKOA 2Y3AA 3WD5L 2UWEF 2HP8A 4WK4B 3QQNA 1JPTL 1O7VA 2OJ1A 3BZFB 4ICXA 2Y2TA 5SWZA 2D9QB 2QQLH 3DURA 4PD4F 4JL2A 4Y2OA 4X64B 3BCDA 1ZA6A 3B3IB 4JFEB 2FX9H 3IE9A 1A1MA 1V7NH 4X98A 2AVGA 1NM9A 2CUGA 4DKFL 2HN7B 1GOFA 3MRGA 4EUPA 1F18A 2QSTA 3V5HB 1ZTXL 3P4MA 5J89A 2NNFA 2ZIOA 4R7LA 4Y1AD 5ICXA 1B0RB 2Z0AA 3MJ9H 3EZ8A 3CH1A 2OCCC 4NP4H 2JIXB 3BDYL 3LS5L 4IDJL 3DXAD 3CS5A 3HLKA 1KPRB 3P2DA 2MPVA 4AQ1C 1DEDA 1ZVNA 1I1YB 4NFBA 2QSAA 2FK9A 3BVNA 1K33A 3GM8A 2I7OA 3L73H 4LZKA 4N5EC 1IVLA 2AXJA 3T0DA 1RUQH 4OCRL 5AW4B 3AXLB 2EC9T 5HHOD 3S35H 3TA3D 5BPPA 4Z1PA 2WVVA 4FD0A 8FABA 1ODAA 4IGBC 5J11B 1W0VA 1XNRO 3TT1L 1URFA 5LYJB 4P46A 1WIUA 4I3RH 4Y4FB 5ALCH 2E9IA 3IGUA 3HMXA 3AG4B 4JYAB 2C9AA 4M48H 2G0LA 2AHIA 4X5RA 1VFAA 1IT9H 1W15A 3QO0A 2IGFH 3C8HA 4KK6C 3V4VB 1SJVA 4WBNA 3UT5B 3UTPE 3I6GA 4JDZA 4GBXB 3VFRA 4DK0A 4YO0A 3E83A 2DIJA 2B1AH 2R27A 2ZE5A 4U3JA 1N32O 1Q0XL 1T66C 2VM4A 2P67A 2GJRA 3MOQA 4EDXB 1CLZL 1Q5OA 4XE5B 5FA4B 4EN3A 2UXFA 1QYGL 2J1KA 3K91A 4JBSA 4MRCA 3RGVB 5JO5A 4O2AB 2E76B 1XIWB 4K8RL 3VBBA 2EEAA 3MGTA 1GL4B 3LRSA 4B3TO 4X8AA 3TCTA 4P9PA 3NTCH 3VFTA 3OWRA 3RRQA 5B7MA 4TNFA 2XI9A 4ELKA 3LKOB 1UWXK 1ORQC 2X09A 4M6MH 2DBLH 4MYPA 2YXLA 1S9YB 3L3IA 4ZUVB 4WI3A 2UY7A 4HUCA 2ARJQ 3T4ZA 1ASPA 2CA3A 1YMHB 1INDL 1N10A 2Q5ZA 1LILA 1MCPH 1J1OH 3PWPD 5I19H 2DS4A 2AQ3A 1OTUD 5TDPA 1E4KC 1JZ3A 3IF1A 4MQXC 1TT6A 4AGNA 5EN3A 4AV4A 2APWA 4MSWB 5HY9A 3D4YA 4OLEA 2OX5B 3GB7A 3IMUA 3QDHA 1UH4A 4IRSD 3S37X 1MWAL 5IBLC 3R0NA 1K8IB 1CFQA 2Y07L 3NRPA 4IJ3B 2Y69B 3CPWU 2MCMA 4UQBA 4NQXA 3PP3K 1NC4B 2HFGH 2JK5A 1IGML 3I3EA 4DPBX 1KYUA 2UUAO 2PW2A 3O2DL 1BFVL 2R4RH 1UKTA 3L9RB 4HS3A 4NHUB 5JPMA 3EGDB 3X12B 4Y5XA 5EIVA 1O7SA 2Q10A 1P1ZA 1SQMA 1G84A 1WWCA 4UDUB 3W5MA 1I8UA 2XWBB 1SN0A 3H9YA 5F9DC 4CU6A 3IDIA 3UAJA 3AU1A 4UQ2A 4PJ5B 4OPAA 5DO2D 3TN0D 4GP8B 5E08L 3G6BA 1JRHH 3MGAA 5D7JD 4APXA 1CXLA 2YD1A 1G7QB 4G71B 2BSTB 5HGDA 4LKXA 5DQDL 2YD3A 1BFOB 3AXHA 2Q6WA 1B88A 2EYRA 6FABH 3ARFD 4IYIA 3HS0A 1J9TA 3N2KB 3S3BB 4YZWA 1K8DB 1FXVA 4DOHB 3FTSA 3FUHA 2K0RA 3GXUB 2YD5A 5KHJA 1A3RL 1VGEH 3CFCH 4LVOC 5E94B 5TDNB 1Y6XA 4UBDD 3CCEV 4OIBA 4LOFA 3D8MA 3JWNE 5K9QG 4AUJA 3SPIA 4WEBL 1QFOA 2UYLA 4F7EB 4YIOA 2HG0A 1X9RA 2XN2A 1IZ3A 2GT9B 4K3DL 1L0QA 4JUSA 1YJNV 4KJWD 3FQNA 5DF0A 1XOUA 3CV5A 2BSCA 3V0EA 4FXGB 2QR4A 4FE9A 4FQQA 1J5EO 1MJUL 3KYMB 1P84F 4RAVA 5HTSA 1N0LB 1SLXA 1W9XA 4DVRH 4LF7O 3HLAA 4WU5B 3U36A 2EILB 2BP5M 2ZDIC 4MNGB 1F4AA 1QOKA 2B2XH 2Z7UA 4FLUA 4ODBD 4WW2B 4PVLA 4P57A 3RIAK 1EZSA 5BO1L 3V0IA 1B6QA 3ISYA 4OD1H 3HC4L 2AGAA 1A6AA 4IKJA 1S9WA 2H6UA 1GSMA 3LNFA 3QARA 3RYIB 1HHHA 5IFHL 4EI6A 4EIUA 1DBMH 1E42A 4I9WE 3D9AL 2X4NA 2R2EA 4R7XA 3DJZA 4LXFA 2OA9A 4PS8A 5CP7A 3VVVA 4W81A 3V0HA 4QLRA 1A6WL 1RZIA 1HAUA 3DK0A 4HT1L 3RWEB 4FQCL 5E6IC 1TSHA 3AQXA 2X6VA 4M93B 2WOBA 4DKTA 5DRZB 1XH1A 5JVDB 1DEEB 4M6OL 4AZ8B 1U0QA 4I9WA 1RD6A 3DSNB 3E8UL 4Z0BL 2R39A 4ZSOE 3KS0J 3G5ZB 4JLRA 3F5WC 4P2OB 1TTCA 2VQFB 1U8IB 2PYED 1N64H 4OZGB 3TONA 3UXFA 1ADQL 1KLFB 1RSFA 25C8H 3GSNL 1BG1A 1I8IB 1IQDA 2WXIA 2X40A 3FONA 3PHQA 4MZIA 5IHUL 5DSCB 1JZ5A 4PSRA 2X7RB 1QPPA 2AV7B 3STLA 2OCFD 5AB1A 4ZSOA 3CZSA 3MV9A 3QE5A 4K5NA 2YS8A 4JYBA 5KHHA 4LHJB 4GUPB 4YWGH 3X1FA 4O58L 1TJIH 2J12B 4H8WH 2VZTA 3QNFA 1MCRA 5DMIH 1QBMH 2R1XB 3TH3T 2GAZB 5HYJD 4UAHA 1AFVH 5LXVA 2BVQB 3SE6A 1BVKA 3H53A 1EIBA 5LNGA 2VS0A 3WG7C 1MRDH 2KS0A 1WAPA 4I5BB 1AG6A 3KLQA 4NC2B 4J4PD 5KA6A 4I18B 4JI8B 4YSDA 5D70H 1CLCA 5BS0E 2CUMA 3IGFA 4XRCB 4LPVA 3JTSB 2AABL 4OV6F 5KVFE 1I85A 1OK8A 1IKNC 2B59A 3BE1H 4A39A 4JPWH 1PZUB 4DWHA 4HCRH 1AMXA 1XGTB 3RYCA 3ALPA 4GX5A 1LO3H 1C7TA 4Z3IA 1OGAE 4OZGF 4W9KC 4LWSA 4DAGH 1EAJA 4OVUA 4YN3A 4NO0B 2QGNA 2WBJC 4LQ1A 4EMZA 2L4OA 3BKCH 4DVBA 1RFDH 4OZIE 3NJNA 1YEEH 1LP9F 3WIFA 3FTVA 4XHJD 2PTVA 2K1MA 4DTGL 1WGVA 3ORJA 2VL5A 1AQDB 4O9HH 3LXAA 5HHQA 4NP9A 3AY4A 1HXKA 1OAUH 4PRHA 3VXNA 5E5MB 5ADOH 1T2QL 3EYFB 1JPGA 2R59A 3PWVA 2O61A 5F9JA 3I9AA 2Y0SA 1DHKA 2BZDA 1NGYA 2JI3A 4OZIA 3K5LA 4AGPA 2BJML 4FQXC 3RKDD 3C09C 2NUPA 5DUML 4YNYA 2ARHA 5C09B 4GAJH 4YSCA 1ZLUK 2PF6A 1MW3A 2FSEA 1GMEA 1RPQA 1B4JL 2D8KA 3WHXA 1N5AA 5JNYA 3W3BA 5AD0B 4K7FA 5IFJB 1ILSA 1E8ZA 1SEBB 1T7XA 2HWZH 2CTPA 1AI1H 3OGCA 4Y89A 2HLAB 5DMGC 3UDWA 2IWGA 4L8SC 3LEXA 5D4IA 5K1VA 3T4AC 3IC9A 3TYGH 4KKAC 3T1WA 1BHGA 1FFTB 4S1RL 2VDPL 4JI4O 3E9TA 3MRIA 5TE4L 4HJ0C 4HF5L 2ADGA 4TXVB 4HOWA 4FS0A 2IQ9L 3F04A 4PJAB 1IM9B 3EKCA 3UIYA 2B16A 1GGUA 3C5ZA 2IGTA 1R33A 4MJ5A 2XTAA 1SJHB 2P4AB 4KQ3H 1I1FA 1YY9D 3WLBB 4APQC 3C12A 4KUCF 3SKJL 1HESA 3ABZA 4FG4A 4Y2DB 1KIRA 2GJ6B 4MAYB 5C08E 1OSZA 1EN6A 1F3DJ 2CIKB 4NQED 4E9RA 5B3JF 3O6LL 3ARED 5HJ3A 3DGCR 4MVUA 3IJEA 2XV2A 1EHLH 3RIAF 3OM3B 2NY4D 4WY7H 1X5YA 4QD2E 4MD4A 3J80N 2IF7A 3EG9B 5IB3B 3JT2A 3D3IA 1PLGL 2W81C 2EDTA 4HDIB 4NDMB 2ICWI 3CCJV 3K2UH 1KLGA 3CVHA 4RISH 1HXMA 4G6JH 2GHZA 4OFYA 1NVPB 3ARGA 1VF7A 3JV6A 5C08A 4EZKA 1KJ2A 1TITA 1L5GB 4L4VD 3UCRA 3UZQA 1N5YL 2EVFA 5IJVA 1NUDA 4YBQC 5EN2A 3RDTC 3UO8B 4GRMA 4I48A 2VXQL 2NR6A 2G4GA 2GPZA 4PR5A 2D7TL 4GKZB 4ZUWA 3T6ZA 4F57H 3V5KB 3HZYA 5IUSA 3BKJH 5JW4M 2HRPL 3V2AR 5T3ZE 4B6ZA 4PRBA 3T1CA 4LCIH 5J1SC 5I0XA 2HVKA 4MVMA 2NZ1A 2P5WD 1QQDA 1BIHA 3X14B 1VIWA 4L0PB 3IAGC 5DUBB 2BMKB 1U96A 3MYZA 3SKNB 2MPAH 3FMGH 3VXMD 2AJSH 2CSPA 4HIJA 1JFHA 3WMQA 3WIIH 4RFEB 3C08L 5IY5B 1T0NA 4UUJA 5ESQA 2YR3A 4IOFC 1MVUB 2CGRL 4I7ZB 4X62O 1F1DA 2ILLA 1FNEA 2NYYC 2EBOA 4X7CC 5KYYB 1VFBB 5GS3A 3S3JA 3O6MH 4JI2B 3SCMD 4MA7H 4OF8A 2MMXA 2WBKA 4J3OF 4X6EA 4OLZL 4W9GC 5IMKA 4TV9B 1GGBL 4U3CA 3CCHA 5K1NA 3N1MC 3QPQD 1OQXA 1KMGA 4DUYO 1J0JA 5IW6A 1NICA 3W0WE 1V3JA 4W1TA 1NEZB 2KQXA 1IC4L 1T22A 4IS6B 4R5VA 2AAAA 1GIGH 1Z9SA 3B4SA 5ETUB 1DYZA 2YAOA 5EOCH 5IBTL 4TVUA 5BUAA 3T0WA 4XMKL 4JO4H 1I7RB 1QFWI 3MBXL 2Q8BL 4H1LB 2CIIB 3MBED 5HPOA 4P2RA 4KJPC 1CMOA 1JJOA 2K1EA 3UJJH 4F5CA 3E6FA 2E3CA 5C0AD 2OL3L 2ZUUA 5ID0B 2CK0L 4C7UA 1OAZH 2P80A 3D39D 1SMAA 5DJ6A 5J1AB 5JIPA 5KS9E 2YAMA 4RGNC 3HJ0A 5EZJB 2VZOA 3BLBA 4YR6B 1S7QB 2P8LA 4OFVA 3CX5K 4RRPG 4PGCA 4L3AA 5HGHA 4OLUL 2EABA 3HFFA 2ADYA 2VDKB 4XO5A 4GIAA 4HX1A 4OZHE 1YNLH 3GMLA 4PREA 4QRRE 5J9PC 4J7RA 3CZFB 1WGOA 2KB1A 5KS9A 1AD9A 1TQBB 1RPOA 3H9HB 4S1QL 1SETA 3M7OA 1NAMA 4YH6A 2CDGA 4HIHA 2W1NA 1M56B 3CSYA 3CSXA 2ZWNA 3HRZB 4NQUA 5ENWA 3BSZL 3GIZL 1KXVA 4G80A 2E6QA 4QRRA 3NCJH 1MZYA 2ITCC 1FD9A 5HHME 1XDTT 2ZYIA 4XXWA 4UCOA 4ZQKA 3K6NA 3OQRA 5D2NC 1KPUA 6PCYA 4QUOA 2F23A 5FL7G 5DRXA 3FT3B 3WAJA 5F96H 4PHZA 2Z91B 3CSPA 1NQTA 3AUWB 3CFIC 3GKZA 3LMJL 3O3AA 4G8FA 3WD5H 2YQ2A 4O2EA 5GSVA 3Q8FA 2P28B 1PG7H 4KXZI 3T2OA 3OJVC 1QVFU 3NFNB 2WZPA 5LP6B 4HU2A 4BIKA 4YDLB 1A9BB 3QP3A 2FWUA 4IK6A 4H2CA 1J5CA 1DK1A 4MJ6A 1HEHC 5DC0A 2DMGA 2OR9L 3HKCB 1FXKB 2WKLA 3D0LB 4XAWH 1WBYB 4TLKA 4Z7NB 4IHOA 2LQRA 4GG8B 1ZTXH 1NJIW 1CFMA 3D12B 3VRLF 4U1LB 3WL9B 1T2XA 1TCRA 1LK2B 1FE8H 2HTLD 1LLAA 3BAIA 2IPUG 3BDYH 4IDJH 3VNZA 4M1CC 2OYMA 2OTWB 3ABGA 3MRJB 3SBQA 4OZFG 3ARBC 1B6UA 1MIEL 1FGVL 5AAMC 1OHHG 1H6UA 2ZE0A 4N8VG 3T3PB 4YHML 4FFZL 4JFEE 1BGYH 3K9AA 4FM1A 1FRGH 3H7BA 3JYBA 1EZUA 3GLEA 5KEZA 1L1FA 1IXMA 3NIFB 2PY5A 1FNSH 3IXTB 4OCRH 4XMXA 1RJZB 1XZWA 3BZFA 1G9EA 1RZ8B 1T7WA 4KK8C 2QVTA 1DDHA 4N9GB 2Q1EA 4A63A 4JFEA 2EIZA 2ZCHL 4GQRA 3HPLA 4AV5A 2JKJA 1EVUA 3ARDC 3D33A 4I4WB 1D9KD 2HN7A 3FAXA 5KX5B 3ATEA 1RXLA 1HKLL 3Q6FB 4DT2A 1E6OL 4XT1C 3B40A 1B0RA 1SA0B 3ZMUA 1G7MB 5FUCC 4WTXA 3MNZB 2JIXA 3E2HC 2UXGA 1Q0XH 2HVJB 5JR1L 1AJQA 2WWOA 4HZAA 4H0IA 3QI9C 2G3MA 1JHLH 1QYGH 1I1YA 4M4RB 5I1IL 2HT2C 3EJCA 3VFUB 4V11A 4Y88A 2EO7A 2ADJB 3T3PF 3AXLA 4AZUA 1ENVA 2HG5C 2R4SH 2YKLH 1L9RA 3F85A 2Y23A 3MKKA 4TSBL 3RHWF 3MXVL 2OKMA 3GLZA 2Y7OA 3NSJA 4H13C 4WO4B 4AEEA 5ID1B 1INDH 5LYJA 4OD2B 4Y4FA 2L3BA 2N05A 2P7TB 1XT5A 1C16B 3EYVB 4K55A 4U6TA 1ES0B 2J3SA 5EEVA 4YK4C 1TNNA 3TJTA 3UZEA 3UBXB 3V4VA 3MRRA 3UT5A 2B3RA 3QUXA 4HJ1A 4GBXA 1LNUB 3LDCA 5E2TL 4G9FB 3ULVL 2P52A 3PHSA 3TL5A 3UYRL 4EDXA 3QRBA 1F4HA 5FCUL 1U95B 2Y07H 2XAHA 1F4WL 5FA4A 3RGVA 5SWSE 3R66A 2Y6SD 5CSBA 3O9WC 4O2AA 3BWUF 1XIWA 4BEIA 3O2DH 2YZ1A 2QHRL 5GGSY 3DK2A 1KTLB 4MGXA 5JUEL 4GAGL 4D94A 2I5YH 5I1KL 2YHGA 2QKIB 1S9YA 3IRCA 2VABB 4LEXH 4ZUVA 4PIRF 5I23A 1ZIAA 2WZ6A 3HG1D 1TJMA 1YMHA 4TSAL 4Z78B 1YTFB 1CTNA 4GW1B 2F4VB 3JZ7A 3L7FB 1YEJH 2PN5A 1VLXA 1WS8A 3OMZA 3WN5C 5DUPL 2DDQL 5E08H 2HB0A 3UAFA 1VIBA 4B3VA 5DVMA 2G5RA 2ZUSA 3CFEB 3TBVB 3VAEA 1MCCA 4MSWA 3OTFA 4UCTA 1W91A 2BVEA 3SBWC 1E3FA 1SEQH 4PLKC 5DQDH 4PI0A 4P05A