5IY5B

Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex structure of cytochrome c-cytochrome c oxidase reveals a novel protein-protein interaction mode
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 64
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iy5B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5iy5B02
1AZUA 4DP0X 2BW4A 5B7FA 5I5JA 5IY5B 1PZAA 1SDDA 5AZUA 5B3SB 1N68A 1BXUA 1AS8A 2I85A 3X1BA 1OCRB 2B3IA 4YL4A 1EZLA 1X9RA 1BYOA 1AZNA 2YAHA 1YLBB 4G7QB 2P80D 3N2JA 2MRYA 4Q8BA 2VW6A 2NRDA 3ABKB 2BHFA 6PCYA 4M4RB 3T6XA 1CC3A 4BWTA 1I53A 2UX7A 3NJHA 1W8EA 1NICA 4DPBX 4GYBA 3JTBA 2PP9A 4F2FA 3PAVA 5I28A 1PY0A 3IE9A 1KDIA 2CAKA 2VM3A 1DZ0A 4TXVB 1NIAA 1J9TA 1NPNA 3NJLA 4QLWA 2XX0A 2IDQA 4A2GA 1N70A 3ZDWA 1BXVA 2YXWA 3DTUB 2BWDA 4KO6A 1JZEA 1ET8A 3FSAA 1WAEA 1PCSA 2IDTA 4E9QA 1OCCB 2HRGA 2XV2A 1KDJA 4KNUA 4JHVA 3EH3B 5LDUA 4ZK8A 1A3ZA 2YAOA 2FQGA 1L9OA 1GY2A 1B3IA 2VMJA 4X4KA 2IH9A 1CYXA 3ASNB 5B7MA 2N0MA 2WSDA 3WNJA 1XB8A 4BDVB 1ZDQA 1ET7A 2HZHA 1WA0X 2QDVA 3NJFA 1OE1A 4AKPA 4E9VA 2J5WA 1XB6A 2DYSB 4W1TA 2FT6A 1V55B 1J5CA 3OMNB 1ASQA 3NT0A 2H47C 3CDZA 3QJUB 4YSOA 1BXAA 2OCCB 3H4FA 3AG3B 2BP8A 4A2FA 1JXDA 5D4JA 1KBVA 3FSVA 2VW4A 3ZBMA 2FTAA 2EINB 3AG1B 1HFUA 1FA4A 3X2QB 2PP8A 5I26A 4NERA 4P5RA 5PCYA 4KOBA 4A2HA 2AVFA 3X1NA 3FU8A 2FQDA 3N55A 3X1GA 3BVDB 4A2EA 1T5KA 4UAHA 1OCOB 2EILB 2GI0A 2JFCA 3ABLB 1JZHA 5B7EA 1A4CA 2CCWA 2HRHA 1PAZA 2YAEA 1JZIA 2DWSA 2PCYA 2AZUA 3S8GB 4Q89A 2BP8B 4G7SB 1ASPA 4KO9A 1GS8A 4PAZA 4YVUA 1NIDA 3FU7B 4HHGA 1ZPUA 4GP5B 4KO7A 3QJQB 3NP3A 6PAZA 3X1EA 2X87A 3ABGA 4YSCA 4HCGA 2EIMB 4E9XA 2PPAA 5FC9A 3S8FB 2RACA 4AX3A 2JXMA 3FYEB 1IKOP 1MZZA 4N8UA 2HX7A 4G71B 4ENZA 1PZBA 1IC0A 2VM4A 4P5SA 1WS8A 2IDFA 5AFAA 4YVNA 4BK5C 1AS6A 3NJMA 3C75A 1SF5A 1SHXA 2DWTA 1A65A 2QT6A 2VSKB 1OF0A 1W6LA 2GIMA 2CALA 3AY2A 1AS7A 3PPSA 4DP7X 2FWLB 3QJRB 2GC7C 2XV3A 3S3CB 1NZRA 1KYAA 3EF4A 5EHFA 4E9WA 1RKRA 3WNIA 1GYCA 3PCYA 1ETJA 5I5MA 5D4HA 2WO3B 3MBWB 2ZWNA 4YSRA 7PCYA 5E9NA 3EH5B 2CUAA 1V10A 2QPEB 5B1AB 1AZCA 3TA4D 4EF3A 1L9SA 1XMEB 3T6VA 2AZAA 1EHKB 2AANA 1SDDB 2XVBA 3FT0A 1KCWA 1BQKA 1GY1A 3QJSB 3ZX1A 3FQYA 4BDVA 3G5WA 4MFHA 2YAPA 7PAZA 1J5DA 1SF3A 1J9SA 3PAUA 1NINA 2HX8A 3SBRA 2AFNA 1JXGA 2Q5BA 3FPXA 1ZIBA 2J55A 3NJIA 5I6PA 1KBWA 2XYBA 3PXLA 1ZDSA 4BWUA 3T9WA 2W88A 2PPFA 1GW0A 3SQRA 2DV6A 2GSMB 4KNSA 3CVCA 1PNCA 2GB2A 3L45A 1ASOA 4RH4A 3HEIB 2IH8A 3ERXA 3UACA 1PLAA 3TBBA 2QDWA 3V9CA 1NDTA 1AAJA 2PPDA 2P80A 1FFTB 5B1JC 4DP2X 1GS6X 3FQ1A 2IWEA 1TU2A 3TU6A 4YSUA 2HXAA 4WKXA 1HAWA 3WKQA 4BXSV 1NWPA 2B08A 2BWIA 1JERA 1AACA 1SJMA 4YSTA 5A7EA 2EIJB 1L9PA 1GR7A 4DP5X 4UANA 3UABA 1J9RA 3IBOA 3AW5A 3PLYA 1VLXA 3TBCA 4KOCA 2GHZA 1QHQA 1TEGA 5I6NA 1AIZA 3BQVA 4DPCX 2E86A 3CZUB 4E9TA 4YSAA 1AANA 1JOIA 1IUZA 1NWOA 3GDCA 3ASOB 5TK2A 2X88A 1KGYE 3NP4A 3NSCA 1BYPA 3IN2A 2FT8A 4CSPA 3DKHA 3FSZA 4E9SA 1J9QA 3GYRA 1QLEB 1OV8A 3FYIB 1SHWA 2XXGA 4DP1X 2XX1A 4YSSA 3WKPA 3T71A 2R7EB 4AI7A 1NIBA 4F2EA 3OMIB 1NPJA 2PPEA 2PCFA 3T6WA 3UAAA 1E5ZA 1PLCA 5I6OA 1JZJA 3ZIYA 1IBYA 1E5YA 3S3BB 1OE2A 5AKRA 1TKWA 3OMAB 1ZIAA 2R7EA 4BXVA 4G72B 1AG0A 3NJJA 3TASA 4A68A 2XLLA 1PZCA 2I7OA 5F7BA 1JZGA 2CJ3A 4KO5A 4M3HA 2H3XC 3SBQA 4AKQA 1SNRA 4L0PB 1ADWA 4HCFA 1PLBA 3DIVA 8PAZA 1BAWA 3WG7B 4G70B 1MDAA 3IEAA 1ILSA 3OM3B 3OQRA 4HHWA 2OJ1A 1FWXA 3FU9A 3NSYA 2UXGA 4NAJA 4A2DA 1JVLA 3QPKA 3AG2B 1M56B 4F7KA 4KNTA 2J57A 1OOWA 2YAQA 3NYKA 4YSQA 5B1KA 1ET5A 3FS9A 3CVDA 3QJVB 1E30A 4NB7A 4GP4B 2H5UA 2HX9A 1AG6A 3T6ZA 1KV7A 3FU7A 1RZPA 2BO0A 4HAKA 2EIKB 1AOZA 1R1CA 4GP8B 1AZRA 4HZ1A 3V9EA 1A4AA 4QKTA 4DP9X 2J56A 2YARA 4GXFA 2BZCA 2IDSA 3NJNA 5ANHA 1A8ZA 2PP7A 3IN0A 1RZQA 3WIAA 3CG8A 3KW7A 2CBPA 1RCYA 4E9YA 4DP8X 2ZONA 2GC4C 2XU9A 4HCIA 1CURA 4PCYA 4DPAX 1URIA 2BP0A 1M9WA 2PLTA 4N4YB 1E65A 1TEFA 2FQFA 2YAMA 3EH4B 1PF3A 4WTQA 3S3DB 1AQ8A 1NTDA 1JZFA 2PPCA 1L9QA 2ZXWB 2FQEA 2FNWA 5I6LA 1HAUA 3QJTB 5I6KA 2Q9OA 2YXVA 4YSPA 4A66A 2I7SA 1UATA 4JHUA 1IBZA 2GBAA 3HB3B 2DY2A 4UF7C 3UAEA 3AG4B 4YSEA 1JXFA 3QQXA 3UADA 2MTAA 2UX6A 2UXTA 1SFDA 1WA1X 4W9ZA 1BQRA 3X1FA 2DYRB 3JT2A 1A4BA 2XV0A 1E67A 1CUOA 2IAAC 2IDUA 1F56A 3MX0B 3FPYA 2BZ7A 2YAFA 2HLEB 1BEXA 3EHBB 3H4HA 3ABMB 1MG2C 1MG3C 2XWZA 2QPDB 4DP4X 1OCZB 4BWWA 2YQBA 4HALA 4JKNA 3FQ2A 1CYWA 2IWKA 1PNDA 1SFHA 5F7AA 3RYMA 1PMYA 4GY4A 2VN3A 1ZV2A 3AZUA 1WA2X 5D4IA 2FJSA 2TSAA 1ILUA 1NIFA 1W6WA 1ID2A 1DYZA 1OE3A 3PAZA 1QNIA 1BQ5A 3UGEA 4DP6X 2XUWA 5TK4A 9PCYA 4K9JA 3SBPA 1KCBA 1AZBA 2XXFA 1MZYA 3NJGA 3WI9A 2LLNA 4AKOA 2TSBA 1GS7A 2OV0A 4G7RB 5PAZA 1M57B 2IWFA 3OD3A 2YEVB 2ZOOA 2Y1AA 2WO2B 2JKWA 3D12B 4CSZA 1JVOA 3CVBA 3U25A 5I6MA 3NSDA 4FA7B 1L9RA 2Y69B 3NJKA 2W8CA 4FAAB 2VW7A 4HIPA 3CDZB 4E9RA 1AR1B 2BW5A 2UXFA 3GXUB 4YSDA 5I5IA 3KW8A 5B1JA 1V54B 4A67A 3NSFA 1L9TA 2VSMB 1GSKA 2BP0B 2A3TA 1XB3A 1WS7A 2UXVA 5B1BB 1X9UA 2FT7A 1NIEA 3FSWA 3H56A 4AZUA
chains in the Genus database with same CATH superfamily
4NO2B 5J6HB 3BX7C 5AAMC 4Y9CA 5DN6G 1XGTB 1CLYH 1LO2H 2GPZA 1XR8B 2E4FA 3V4VL 3C8KB 3LTVA 5CSZA 4ZS7L 3V6FA 12E8H 3T0DA 2OJZH 4J2XA 3AG1C 1AZVA 3GMMB 2H26B 3BWUF 1T0NA 4JFHE 4UT9L 4WI4A 3FO2A 5H35A 1WLHA 1MJ8H 3MNVB 1HI6A 3HHMA 1FUNA 1OWWA 3B77A 4GSRA 4QHUB 4EKJA 4X7SL 2F23A 1I82A 5IR1A 1JIBA 1X7SA 1CR9L 1WAAE 1IAIH 5FGBA 3ZSSA 3LCYA 3O2DA 4NQCD 4XPFL 5ABDE 4F6RB 1W8EA 2XWBB 1NICA 3MRBA 4NFBA 5T1KA 1HQRA 5T3ZH 3VACA 4RO2A 2DQIH 3X14B 2JJ1G 4E41B 3M86A 5I28A 1WBXB 3CXHK 5IHHA 3OR7B 1T7XA 4OZ4B 3TS8A 1KYOJ 3RWDA 3S4SG 5KYNA 4LPUA 1FCCA 1J11A 1ZHKA 2HB0A 1JPTL 3O4LD 1CGXA 5FGSA 4D3CH 5JQ6H 1I1YB 2QM8A 5KVFE 3LKPB 3ZMSA 6CGTA 4S1SH 3F7YB 2XXCB 1BFSA 2VWJA 2VRQA 5DWUH 3VI3E 3ULUL 4LVHB 2F1AA 4EDWL 3M99B 3P73B 3QVNA 2FWUA 4JV5B 5JPMA 2ZSVB 3TF7C 1KDJA 2ZIDA 1D2DA 4N6RB 5J0BA 4JYYA 3Q6FB 3DV6B 1G7HB 1K6QH 1G6VK 3HS0A 3LPFA 5LDUA 3IFLH 1S77D 4GT1A 1FFOA 3HKBA 4AJWA 4NQSA 3L8QA 1JWUB 1S9YA 2WCGA 5JHBA 4NQDB 2NY2D 1HKLH 5H9CA 3MJ9H 3KXFB 3BP6A 4HGKC 1COBA 3CTTA 5D71L 2HA1A 4M8QB 4TQHA 5K9JL 5LGHH 3D48R 1A1MB 2IAMD 2QGNA 4FLTA 1KTCA 1QWNA 5JOPD 1NFDA 1PZ3A 1F4YH 2VZOA 3P0YL 5C0DB 1IIIA 1QA9A 3IRZA 4IIQC 4HLZG 4MAYC 3L4UA 1U8LB 3ULVF 1L0XA 2V17H 5HGAA 2HTKD 1IM3B 4P5TD 1FFXB 1FVCB 3I55V 1KLGA 4K5OA 3ZBMA 2FX8H 4Z7VA 2O6EA 2L3BA 4OZGF 1JGVH 3IS1X 3BRGC 1NCBL 2BRRL 4NM8H 4WFHE 3V4UL 5DHVA 2ZINA 2EXYC 4AIOA 1AJPA 3A6OA 5ITZB 2A74B 2X4UB 3D2UA 1BPVA 3WJMA 2BS9A 4I88A 2BOBC 4TSCL 3ZYOA 4BQCA 3BVDB 2DBJA 2VDRL 3ARTA 4XMXA 1W16A 1XDCA 5IJVA 2YKLH 1GZQB 2ZX9A 1CZ8L 2OAAA 2Q7AA 2AQQA 2LFGA 4DTGH 2PCYA 4PV8B 4LHUB 2AZUA 1BZDA 4R6UA 2QSTA 4Q89A 5J56B 3RPIA 4NTXA 1S8DA 1NIDA 4ONOA 3MJ9L 1RXLA 4ODHH 4H20L 3ROLA 1K8DB 4JO8A 2ZZUT 1TUBB 2CK3G 3NIGF 2ZXBA 1BVNT 4LL4A 4CSSA 2E7CA 4UB8Z 1IC5H 4HCGA 4XNYH 4E9XA 3IMWA 1X5ZA 1IKOP 2QQLL 1PKQE 3I6LE 3HPLB 1NL0L 1ZLUH 3VNZA 2ATAA 2AK4D 4I7ZC 4G7VH 4KJYA 5LMUB 3P73A 1N34B 5MP6L 1E4WH 4RRPG 4D94A 1BAGA 2ITDA 1W6LA 3RNKB 2ODIA 1QSEA 4S1SL 4HULB 5IB4B 3GPEA 1BQ0A 3L3DB 2JEXA 5E2WH 5JHMA 3NUKA 4HJGA 2HMID 4CS3A 4RETB 5BNXD 1A6WH 1FPTL 1KPUA 3B4NA 4N5EC 5D1XD 1OTUD 5F1IA 3U9UA 2YJLA 4Y0GA 3WTXA 1JRHI 2HKHH 2WZ6A 3TZVD 4X9HA 1SF9A 1LWJA 4OF8A 4F7MB 2B1AL 4UTCA 4YSRA 2HFGL 3U7AA 2Y69C 3FUJA 3SY0A 4OLXH 1OGAE 3H1JH 3LS5H 1G9MC 5F1SA 4KFMA 3VGFA 2ISDA 3KLHC 3THOA 3UEZA 4KTYA 1IJ9A 4X7SH 2YPLA 3EFDL 3TO2B 2FEEL 3BD4A 4QHPA 3X3GL 4JI3O 4MNGA 1VACB 3RX7A 3QJSB 1S4IA 3C5SB 3RX8A 3MSPA 2NXYD 1CF8H 1MHHA 1OZUA 3GK8L 2ZE8A 4ICWA 5LG1A 3VXSB 4KJWD 1CLOH 4ABMA 1HR0O 1WGVA 4HD9A 5HGGS 4B9IA 5I1CL 1M7IB 1WISA 3WIHH 3D8MA 3ZW3A 3VWKA 4DR2O 4N0UE 5LCVH 5IGXL 3KM1A 2WGNB 2J6EL 4GAGH 5GGRB 3GB7A 4MNHB 5D1ZI 4XXCC 2OZ4A 1SXZA 4JI7O 2DV6A 3GTNA 3HZMA 1XF2A 4P9HH 3MUHL 3C8KA 1HXMB 2KG7B 1R3KC 4ZMQA 5KSVB 1S7TA 5AUMB 3KLKA 2JXMB 1I1AB 3KG2A 3CC5A 3MRHB 1G7IA 3RA7H 1JOYA 1QLEL 4GRLB 1ZTXE 2XPYA 5D7LA 4N2AA 4JPQA 4GIOA 3HN3A 4N90D 3CJJA 5FF6B 5FFLA 5IZ7A 1JFFB 1YN7B 2MPAH 4KKBD 3VGEA 2ZR2A 3ZRXA 2ESVE 5DS8B 5LBQA 1AXTL 3AWFA 4MMXB 1F86A 1SJMA 2EYRB 1G9HA 5A7EA 5IM7A 5HI3D 4AL8C 2G2RB 3WS3A 3VH8B 4N24A 3UABA 4GW5A 1S5IL 3ES6A 1J1XH 3TBCA 2Y5TB 3UBXG 5C7XL 3DX4A 2K0RA 5FOBA 3IGKA 3UIZA 1FO0B 4FG6C 4PELA 3BZDA 5EZLA 4LQ1A 2WHVA 3OX8A 2BSRB 3FUEA 1BVKA 3GDCA 3TV3H 1GOHA 1OQOA 3VXUA 2YMTA 3F5WC 3GJEA 4P2CG 1F6FB 2WLIA 1IAKB 3IN2A 1M4UA 3PWPE 4IMKA 4RRPA 1A8JH 2GYSA 4IKKA 3ZHDA 2B59B 3GI9H 3VD9A 2AK4A 4E9SA 1J9QA 1MNUL 4BSVB 5IFHH 4OQTH 1FNEA 1DVYA 5TPWH 2ZWSA 3PWPA 3SDCD 3SOTA 5LXGL 3FU0A 1MFCL 5JHLA 2WBWB 2WIIB 3HKBB 5JQGA 1O75A 2HT3C 4TN9A 1BGYH 5KSBE 3V6ZB 3TJTA 4XNBA 3GHEL 3REVA 2NZ9D 2WQSA 2F66C 1L1FA 4X6EB 3MV8E 1YEFH 5H2BA 2UUDH 3RVYA 3MLUH 4NZRL 4IL6Z 1YHPA 1XXDC 1QFHA 3QUZD 4LPTA 3G6DH 4YHOH 3HKZA 5HPOA 4QDGA 5FUZH 3E22A 2N1TE 3ZR5A 3P0GB 3GSUB 1AZZC 1K72A 3FTGB 5D1ZB 5LWYH 4XDKA 1A7PL 3MUGB 4L8DB 1A7RL 4BYHA 3B8NA 2EUXA 1JX9A 3LQZB 3V55A 5DQ9B 4G7YH 2R2EA 1CE1L 2Z91B 1XF4B 3O0LA 1QZ1A 4B7LA 3ZL1A 4LPCA 1KCRL 4FXTA 4I0KA 1JPXA 2AXWA 2NOYA 4G70B 4XXCA 3V52H 5JZ7D 3ULUF 5LHDA 2KHAA 1T7WA 2EVHA 3VWKC 1SUJA 3CDGB 4BSJA 1G0DA 4LF9O 4GEJA 3HKDB 1PD0A 2VDOH 5T1LB 3RVXC 1UUNA 5KYYA 3NYKA 5IIEA 3O3EA 5EU5A 1ET5A 3L81A 1KZQA 2P8MA 5I19L 1OLZA 2VLKE 3WKML 1OTTD 3WDIA 4BQ6A 3ZR6A 4NN7B 4AJVA 4GMTL 1D7CA 1MFBL 4RDQG 1YYLL 2WYTA 3RI5F 4JFDA 4G9FD 5C09A 4FQXD 2XN9D 4CADB 1H3TA 2FBOJ 1FFPB 3K1DA 4O02B 3BPLC 3WB2A 1IAII 1T21B 1A1OB 1JJOA 4H0LC 5BRZD 1WFMA 3D08A 4N0FA 4P48A 1N64H 2DQJL 2V2WB 4TL4A 4HWZB 4X6BB 4HZLA 3TVMB 1EZJA 5F89B 3UZQB 1N2RB 3QC6X 1Z6JT 1Q90D 5HHVH 4C8XA 2XZQL 3MDSA 4X1YB 1RCYA 3VXSD 4FL4B 3CSTA 2QR0B 3F7VB 4JFWA 3KWTA 3CE1A 2ITDC 1TQUA 4FLRA 4P4KD 5JXAL 3IMBA 2BVOB 2LABA 3D39A 3O45A 1BZ7B 4L5FH 4I2XB 5IQLA 2YUZA 1NM9A 2XG5B 1ZK5A 2CGYA 3QS3A 4KVNL 4XVUC 4XX1G 1AQ8A 4CNIA 4WF7A 1RM1B 1I3RA 3B2UC 2LFRA 3GGWB 2R8SL 1L9QA 2VZTA 2YD3A 1BS3A 1GN6A 1TJIH 4NP9A 4LCWE 4RSVA 4TTGA 3EO1B 5GS0C 2WO4A 1UD3A 1DE4A 4POZC 3QA3B 3OGCB 3UADA 1VGEL 3IFPB 2QSVA 4IDJH 1HQ4B 1SFDA 4NENA 5GGVY 2YC1A 2O26U 4XCNA 3QDMA 3F05A 4RBPK 1D9KA 1E5UI 3D07A 4B50A 2KZ1B 3FQTB 4JJ5A 3TN0A 4YHZL 3U7YL 1TNNA 3G4SV 2YAFA 1NDMA 1KB3A 2P26A 5GS1C 3Q2VA 1BEXA 2J7LA 5BO0D 2BC4B 4K4KA 1G4RA 4W68A 5BV7C 5DJ8A 3UTZB 4KHPO 2R69H 1M6UA 4HKZB 1CS6A 1WP8A 1HH6B 1NGPH 4NP4H 2PWHA 1WA8B 4Z1MG 3FUKA 3MLTA 1Y67A 3AWEA 3BVXA 1I7FA 1XO8A 4HNAA 4KHPB 2F54E 1I8IB 2XHBA 3RYMA 4BELD 4ALAC 5I1DB 3PWLA 4IIQA 1DQLH 1N0XL 2CKBH 3FT3A 2E27L 1OAZH 2HT4C 5I1HL 2WYHA 3D6GA 3FQRB 1R24B 3TC9A 2TSAA 2ADGB 3FTVA 4WRLA 4XBGB 2CGRL 5DU7A 4XPTL 4GAAA 2ILMA 4DP6X 4PRAB 1QZNA 1QATA 3E8UL 2FRGP 4FRWA 4MMXA 4YXKL 1Z9SB 2X89D 5B4MC 1HI6B 3AK1A 3IWUA 4O4HA 3D4CA 3FU3A 2LLNA 4KP4A 1CGVA 3IM1A 4LCIH 4CH3A 4MB1A 1B2WL 1UPGA 3KWWB 2ITDB 2IWFA 4KAQL 1EAJA 1GJUA 3SB3A 1ZLDA 2ZOOA 1AJ7L 1M71B 4HUKB 3MRCA 3O3AA 3HS0C 4JL2A 1F7YA 5DO8A 3M6DA 3I9GH 5CGYC 5JPMC 3IAQA 1A6TB 3ESNA 4P2RB 3H1KH 5DD1H 2DWDC 1W72H 3DGEA 2P5WB 2ZQMA 2FKXA 5A2AA 1FO0H 2W8CA 5I30H 4NTWA 1YNTB 3MVSA 4NKMB 2K45A 3WELA 3WTYA 3P2BA 7FABL 4X1IA 2XAJA 3IBEA 3S9DB 4GRWB 4L1DA 4RQQA 2YEQA 4Z7OE 4NQDD 2Y7MA 4HBQA 4KV5E 3DC0A 1A3RH 2XN9B 1R4XA 4WVRA 5T1JA 1V54B 3UTSE 3PWVA 5FYJU 1GAFL 3K5MA 1GSKA 1MY5A 1WZ1L 4H13B 1NCCL 3PY9A 1DCEA 2FUTA 3OHXC 1E4JA 4QXTB 1VKXB 2UXVA 3CCHB 4MNQE 4IW4C 2FBRA 1HWWA 3BSHA 2EDNA 5F88B 4HWBH 5BR8B 4K3JH 4P2QD 5CD3A 4BINA 5FGBC 1TCRB 4LF9B 2A6IB 1MCIA 3D0LB 3MKGA 2Y7OA 1FQ9C 3LD8C 4MCZB 1S5LZ 4NZ8A 5DJ0A 5AVSB 4CDGC 4NWTH 2EEXA 4P5TB 4POYA 2B3IA 1EXUA 2CLRB 3G6AB 3NK3A 1EZLA 5IJ9B 2R0KL 5CZKA 1VZHA 3P4OB 3U46B 4YDKH 1PLGL 4JAMA 4APXB 5GONB 1C1EH 2P80D 2Z93B 3ARED 2NLJC 1HE8A 3S37X 5HJDA 4LQFH 1MH5B 4FXKB 3BUQA 3DARA 5I1DA 4JHBA 4FVMA 3VXMB 4DKEL 1AR1D 4GQRA 1HIML 1RZ8B 4PH8A 1SM3L 4Y5VB 3NFSL 4G9FE 1R24A 4JFFE 3TV8A 2ZAGA 3A67L 3S88H 2YLHA 2FDBP 3CD4A 2R9RB 3OTFA 3A0OA 4FYQA 1ERNA 1A4KA 1B0RA 1DZ0A 2V2XB 5SX4H 2O61A 1R3HA 1SYVB 5CIPA 2XX0A 4A2LA 2IDQA 2IPUK 1XZWA 5BR8O 1YJDH 2AMUA 3PXHA 5GGSY 1MNNA 1OARL 1PY9A 1Z66A 1WP7A 2Y1YA 2QA4V 3L08A 2LTQC 1FBIL 4TUKL 5EO1B 5FHAH 4YHHB 1EBPA 5AOMA 4OFKA 3TXQA 1YMMA 3CUPA 1AHMA 2VN5A 1M1KW 3PJSB 2GK0A 1A9EB 1G6RL 3EH3B 4F7CA 4DR3B 1W2BU 3UJJH 4TULL 5HI4D 2GTWA 4ZK8A 1V5JA 1EH9A 1Q8IA 4DGUA 3D3IA 2NXZD 3BAWA 2XFGB 1X5AA 1NMAH 4O02H 4OM0H 4Y4KA 4YE0A 1B3IA 4UCFA 3ZMUA 1WT5C 4WKZB 2CR0A 4H2CA 3IDXH 5DD3L 2ICWA 2A83B 4R90H 4WFHD 4LSVH 3ZDZF 2QHLA 5GS0L 4ZMZA 4ABUA 1WB7A 2HKFH 3R7QA 3G5ZB 4FQQB 4LCCB 3U9WA 4GS7B 2NSMA 1FL5A 1G0XA 2FSEA 5MHSE 4ZFOA 4QRFA 1CD8A 3RT3C 2KB1A 5ITZA 3MLSH 2Q10A 3X2QC 4G2KA 1E9QB 4AENA 3MBEA 3DHMA 4MNQA 2ATKA 1JTOA 4P59H 2QMKA 3I84A 1KBPA 4MXWH 2NY0B 1EK3A 4HPOH 4LP5A 2FGZA 4N9GA 4XAKE 1P6AB 3WEOA 4B3EA 2D31B 2Y36L 2FBJL 4ONGH 5CEZH 3SJAC 1Q72L 1VB9A 3K8KA 4RAUB 4QO1B 2AK4E 1U3HC 1JHLH 3NJXA 4WENB 1SS3A 2EILB 5EFIB 3B83A 3D25B 3P30H 4JI1B 2GITA 4DHLA 4GH7B 2DWSA 4LCUB 4CZZA 1CDBA 5JW4N 1IV8A 1NDGA 1VACA 1KYDA 4KO9A 4UM8B 3LH2L 1IL1B 1ZPUA 5ILTL 5BW7C 3VOUA 5C08A 1PSKH 1IBHA 3CZGA 4C4KO 3CE2A 3FHEA 3FH5A 4OR1A 3T3MB 3APOA 2CA3A 2E8YA 2IW5A 4CVWA 3PRZA 5C0RH 4EXPX 3QXVA 5EN2B 4BJLA 3IPEA 4BAYA 4JFQA 3V0WL 3U4BL 2IDFA 5IQ9B 1PJWA 5KG9B 4YBQC 4J7KA 4FLVA 4QRUB 5I1IH 5M95B 2E74C 1KV3A 2WXIA 2OMXB 4YLCA 2HJFC 1I94B 3DUUA 5EBMB 1NCIA 2IH1A 3FD9A 3OKOA 4JLRA 3ZN1A 2NR6C 1FXKA 1NQBA 3TVMC 3DGGA 2V9TA 1ORQB 4JFOB 3II3A 3ZHNA 3U1SL 1IGJB 4IRSB 3TWYA 4NQVA 5I1LB 3HKEB 1QR1A 1EN6A 3FTXA 2IPTL 3MBWB 1NUDA 2UYLB 3JVGA 1RUMH 5DMGC 3RGVC 3A4DA 2DOCA 3UTPE 1YITV 3NZHH 2QPEB 1F4NA 2HJDA 2MHAA 5EEXA 4PTTB 2RJMA 5E5LA 1EFXB 4X20A 3QJHA 4LNRA 3IC7A 5CBHA 4M29A 3PXJA 4PV1B 1MJ7L 1TO4A 3PUUA 3ESVF 2ENJA 4HMEA 4JFDE 5C07A 5INCB 4A39A 3EJRA 1YVWA 5D2LF 2HFEA 1X5XA 4OIFA 4W9FC 1NLDL 2EO1A 4F7EA 2BM3A 5EBLA 1IC4L 4E2LA 1CTOA 5CO1A 5ELIA 2CSPA 4AQEA 1BLIA 3JV5A 3OR7C 1U96A 3MLZL 2KKWA 5KAQF 1NINA 2FJHB 1QABA 2VDML 3CSXA 1C16B 1IGCL 1N4XH 3G9VA 4TYUA 2WWNA 5AL8A 4PREB 1MEXH 5C9JA 2EDKA 3QDGB 4OSUL 5IUCA 1TJGL 4W9HC 2R51A 3BAJA 3QZWA 3IXTA 5IHUL 5K9KA 1U92A 4PTUB 3EYOA 4GXVH 4XP5L 1DLHB 4Z76B 2H41A 2MTPA 4YDJB 3N44B 2A73B 4TKWA 2IH8A 1DVFD 1QAWA 5I0DA 2YPLD 2XTSA 3GKWL 5KTEL 4Y8DC 5TE4H 1AAJA 1DUZB 2E4TA 2BSEA 4JPVH 1EEUA 2PW1A 3L3IB 2IH3A 5D7JA 2D4DA 5T3XD 4BKTC 2EIJB 3ECBA 1T6BX 1L9PA 5FDWB 3LDCA 3LQZA 4ADJA 5ISZE 2Z0AA 3GI8L 3GSQB 4NXMB 1SBBA 5CMAB 4TNVF 3QUXD 3EJYC 1EEZB 1UA6H 5A3ID 4RAIA 3TNNB 2A6KB 2PO6C 5TH2B 4H44B 1KXHA 2E86A 4V1DE 2EH7L 2IG2L 3D52A 3TBYB 4JGJA 1B0RB 2V2XA 1H6UA 5DJZA 5JNYB 5B1OA 1MFUA 2K78A 3LPPA 1PGRB 2F58H 3SKJL 3IDGA 3ZKNC 2B0SH 3FQUB 3UAFA 1KT2B 2CJUL 2YIAA 4WHTB 3QE5A 1BOYA 3MXVL 4JGUA 4CN6A 3CMGA 3H53A 3CBJB 5CJXC 2DD8L 2W0LA 3ATBA 4X0NA 4ZW5A 4YSSA 3NBNA 2HJLB 3NCMA 1KTKE 3U2IA 4IGBC 1SLUA 5D7IB 4P49A 5E00A 3VXNB 4JGSA 3AGVA 3KH3A 4OIBA 3ZGHA 3CPLA 2AEIT 2DQ0A 4HS6B 1L7IH 2EDQA 3JSSA 3DV4A 5EPMA 3MRFA 3UAAA 3W0WE 1CGUA 3H6AA 4KROC 4LLQB 5DQ9A 2OTWA 5IW3A 4IBTA 4K9EC 1DO6A 1MUJA 1BHGA 1I8LC 5JHDD 4G72B 3BA9A 2IU0A 4EKWA 1BD2B 2AABL 1LM8V 3UZQA 3QO8A 2V3FA 4BZ2A 3LV3B 4CC4A 1A7BA 2CAZC 2CJ3A 4HF5L 4XP4L 1LO0H 2R83A 1JF1A 1PBYA 4MDJB 4WBNB 2GI7A 2WZ0A 4NN6B 2ZF8A 1E8XA 4J4PA 2AQRA 5ITFB 1JNJA 1CEZA 5BMFL 3QFJB 3PS6A 1MDAA 3GLAA 5JOFB 1JFHA 1G7LB 3UAJC 3KPQB 1CVRA 3RB5A 1JD9A 4MJ6B 1KULA 4JPWL 3NA4A 5CINH 3CSYB 2AQPA 2AXFB 3OKMA 1D5BB 3WFDH 4ELMA 2VS0A 1QVGU 2AJXH 5I1EL 4P2OC 2L35A 3QO1A 3STLB 4AC2A 4B5EA 3F7LA 1SRDA 1LEKB 4WNQA 4BZYA 1MPAL 4PJHB 1FE8L 1JHLL 2W0KA 3RTQD 1XX9C 3WLWD 1X3DA 1KB5A 2VZ1A 2E6QA 3EVKA 3HB3D 1RZPA 2V3DA 4JW3A 4P3WA 4R97C 1CL7L 3DIFA 4JFXB 1VJSA 4URTB 3DV6A 1YNTF 1UZ6E 1SERA 1KBBA 4DEPC 4ICGA 2BE3A 4LNVA 4B0MB 1SMDA 5CJ8A 3ZHSA 5LVEA 1HXKA 4V1DD 3GJFA 3RL2B 4QCIB 1BQHB 3APMA 3ZCCA 4OBSA 4FCAA 2XU9A 1OPOA 2YRZA 3KS0H 4K5NA 4PBDA 2NY6C 4Z7IA 2DH3A 2B5IB 1S8DB 4PRHD 4X7DC 1HHJB 4H8HA 4YQXL 2FE0A 3I6KA 1ROCA 1DE4B 2UWEB 2YA2A 3CPLB 3AGWA 2W94A 5KLVH 1KXVA 3JZ7A 4XODA 3HG5A 4JFDD 2J6EA 1IQWH 2PPCA 2VLJA 4XWOD 1XTMA 2QKSA 1GO3F 5DXWA 2GJZB 2OMVA 3MLXH 3V6FB 1F4XL 3BSZA 3SPJA 1CQYA 2Z7UA 4CKVX 3GZPA 5I66B 3OUSA 2PN5A 3HB3B 2DY2A 4KTDL 2EILC 2XACC 4HOXA 4TULH 5HHXL 5EA0L 5H35B 4PRID 4NN5C 2W9EH 5TQ2H 3LSOA 4WBNA 3X1FA 2G5BA 4PJAB 2VQ1A 4NQEB 4OUOA 5CA1B 1MAKA 1N8ZA 4NO5A 4X6DE 3WN5C 2I26N 3ARFC 2CRYA 2YS8A 4ZMAT 3BQUC 5JW5A 3AG2C 1CUOA 3UX9B 2Y6SC 1Y74B 2Q76B 3M7MX 3DSNB 5F2VO 3AQDA 1FNFA 1JGEA 2FL5A 4KHXH 4CUCA 1BDYA 3JARB 2V9RA 3H4HA 1TCMA 1SEQL 4MQXD 4X80L 1BJMA 4BE6A 3V6OC 4NR1A 1WBXA 4N2OA 3FOMA 3A67H 1UCTA 4OJEH 4NXMO 1E1QG 25C8H 4TT3G 2OCJA 2VR6A 3CZFB 3K0YA 3EYQD 1QNZL 4W9KC 4NYLA 1I1YA 1KC8W 1IBDA 2JNZA 4JM4H 4M3JA 2C4FU 4XC1L 3V7AE 4DKEH 2FH8A 4ZXBA 2KQMA 2ZCLL 1VFBA 4FXKC 4H8VA 1VFAB 1NMBH 4BIUA 3LDDA 1E4KC 1T20B 2ZAIA 1JG9A 3D0LA 4HD5A 3BO8A 4MXQC 2FJFA 4DO4A 5A7BA 1E28B 3FFDB 1JZ8A 5C07E 1W6WA 2HT2D 4IKJA 4QIWF 1OE3A 3PAZA 4G8GD 4XTRD 2PYFA 2Q73A 3KYNA 1A9BB 2R1YA 5CZRA 5KBMA 4NXNB 4WEEA 2XXFA 2OIEA 1XGRB 3QPXH 4YX2L 4YE4H 2Q5ZA 4FJCC 1M7UA 2F8VA 3E8VA 1THCA 2ODHA 2VN7A 3HNVH 5EBMA 2Q68A 2YEVB 1CFBA 1INEH 2BPBA 2QDOA 1WFJA 1NCCH 4R50A 4WJKB 3AREA 3DYPA 4XNQB 5E2UH 2F4VO 1JGLH 5GSVA 2EQDA 3WIFA 5TGBB 2C3GA 3KPRD 5MENE 1EERB 3B5GA 5BMVB 3QNZA 3ELQA 5HJ3A 3U0TA 4PJIE 1TQBB 3VXRD 4NX0A 1ZANL 3CK0L 4TUUA 3CCQV 1XVSA 3KW8A 5B1JA 3ARGA 2W6JG 1J7VR 1M53A 4Z7WA 4B9KC 5DEDA 2OQJA 2ZJSH 5CJOH 3O4OB 1EGJA 5D7IA 1IT9L 1F58L 1WS7A 4GG6B 4I1NB 4WSGA 5IYDO 4RA0C 2XY2A 5D96B 3X11A 2W59A 2EDEA 1HINL 4HUMB 4L3CB 3TXSA 2ZP8A 3SHSA 4OQTA 1T03H 2DLGA 3C2AH 3FB5C 2JTYA 4WW2C 4XCCH 5DA0B 4GAYA 1UFUA 1PZAA 3UDWA 5JHLH 2IBZX 4PS3A 3LZOA 1NBZA 4H88L 1Q9LA 5AL0A 4BSWB 3HUJF 3K80A 3K2MC 4J23A 4O9HL 3KDPB 4U6HA 1GOGA 2B1IA 1Z3RA 3OJVC 4KC3B 3HRZA 5K1PA 1XF3B 3O41B 1OB1B 4Z1PA 1OM3H 2E27H 3QUXC 1JFFA 1YN7A 1THZA 4MA1C 2XG4B 1F4WL 32C2A 1J5EO 1R3HB 4N2KA 4NC1C 5H8DA 1HEZB 3CCVV 2NY3C 3ABLC 2XN2A 3BP4A 2R9HC 5D2NB 3HZKB 3BO8B 1DDHA 1SA0B 4Z7WF 3NIFF 5EORH 3IETA 1NGPL 1U36A 4OZGE 5IQOA 1J1PL 1G7MA 3TFKD 5CIPH 2VLKA 1E5BA 4RX4A 4CC1A 1EBOA 1L6PA 2AI0H 2BSRA 4I3SL 3U2SB 5KUKA 1NGWA 3BLPX 3MJ7B 3OAZH 3BJLA 1H5BB 5H5NA 4TVUA 1P0SE 5D96C 4FHKA 1AXSA 1TJXA 4AUUA 2R2EB 3LJ3A 3ULVH 3TJHD 4H8WH 4OZ4A 1SHMA 5IBUB 3FSAA 3FB5B 2IDTA 2FEEI 5FECA 2CGNA 4FN0A 2BY2A 3BP7B 3HG1D 1LWRA 1HEJC 4DR1O 4HUWA 2NNRA 5KHKA 1HVXA 5JOEA 2UU9B 2GVYA 1KLFA 3QUZC 4KY1L 2Y0SA 1GY2A 4UCTA 2I9LB 4H8PA 1I8MA 2WLJA 3ASNB 2BIHA 1OF2A 4X6EA 4XMPH 4EZLA 1K2DB 2DYPA 1WO2A 1YMHB 1JV5A 1FG9C 3HMWL 3VQMA 1RZJL 4R7CA 5F1OB 1NANI 3PL6C 1IDSA 1BF2A 2LW1A 4A38A 2NY3B 1DBJH 2WVTA 3EO9L 2ZUWA 3M7OA 2VE6B 2JF1A 3ZKQD 4QF1A 1ZS2A 1EZSA 4UQCA 4W6XB 1ZV5A 3RY4A 4DV1O 1JGUH 1RZGB 4U7MA 2N7SA 1T4KB 2XZQH 4RAUA 3L4WA 3U6RA 4A2FA 2X2HA 4LLMB 3LZRA 1FL6A 1XF4A 5E6ZA 2XNAB 2EINB 1FGVH 1LK3H 1PIFA 3FFOA 4DKTA 2OXGB 3AT8A 3UTQA 1MVUB 3ZS8C 1JJ2U 5JIPA 1CDCA 4Y19A 3WHXB 4YJ2A 1QYGH 3BKYH 5DD6A 2XKSA 2YLKA 4FMKA 5I71B 3QI9C 5B1BC 2XA8H 4B08A 1NCJA 4JN1H 4C83A 2Z8RA 4JKPH 1CXEA 1N8ZB 3ETBJ 1VSCA 4GMTH 3WU1A 1A6PA 1OAXH 3DVFA 3QCTL 3RIFF 2D7TL 3V4PB 5E8EA 1A4CA 2G2RA 2GTSA 3BP4B 3KXFD 1P7GA 5J12B 5F97E 2B20A 5DHYB 3WJJC 4ADGA 4N28A 4ELMB 2EEDA 3GINA 4AV0A 5J8OA 1HYRC 3NIDF 2P4KA 5F3BB 4OGAC 3NCEB 3OAYK 3MLWH 3WHE0 3S8FB 2QV4A 4L1BA 4ZMWA 3E6HA 4N8UA 4AYDC 2JKRM 3KGRA 3OTOO 3C5ZB 4G8AC 1KCRH 2TAAA 3H54A 5BVJB 5JPNA 5E6UB 3HBGA 3DJTA 5E6IC 2UU9O 3SDXF 3KCPB 4TOIA 4PJGB 3QEUA 4DR5O 1EFXD 4H8WL 4X7TB 1S7SA 3RUGB 3FF8A 2G60H 5JR1H 4K71B 5IWLC 4LF5O 5FUZL 4I0CC 4KJPC 4N0CC 3FQNA 1AS7A 1OANA 1GMEA 4JO4L 1WBZB 4KWUA 2F54B 3WEXA 4ZUSA 3TONA 4B41A 3T4YB 5LDSA 3MLUL 4NZRH 3LNEA 2PTUA 3SE4C 1RKRA 1QW9A 1XBRA 4I87A 3SGKC 3PCYA 4X65O 2IH3B 2WXGA 5EORL 1T0OA 3MV01 5L2KA 3OJMB 5KSAD 3P2DA 4XHQA 3A0RA 4UCVA 3VU2A 1KIRB 1MFCH 1H2SB 1Z7JA 3ARVA 4ZDHB 3EGXB 5C0AE 2D3LA 3HRPA 3EBIA 1OM3L 1ZT1A 3ARDB 3OJ2C 4LU5L 3QWOB 1I9RH 2HR3A 3GI9L 4PD4K 3KG5A 3ETQA 3CFKA 3FQYA 5I8KL 4FFBB 2R29A 1KCKA 3X3FL 4LLDA 3VFGH 2NDFA 2H32H 4JR9H 3UCSC 3LOWA 4P99A 3QQ9C 2EC9T 4PRPA 4QJ3B 1BYNA 3GBLA 4C58B 5T1DH 1RSOB 3ZYIA 1ND0B 1RULL 2J55A 3QUML 4EXKA 4NQEA 3SSGA 1P1ZA 4FCHA 4RISH 1SN0A 1I1FB 3QIUD 2P24A 1MHHB 4CVZB 2Q3XA 2PPFA 2VDKB 2W0FB 2WMPA 1FYTB 2XVKA 3MRHA 4L9DA 4M7LL 3S35X 3KCYA 2W38A 4Y1AD 3GMRA 1FZOA 1KJ2L 4EBQL 1ASOA 3PHOB 4LH6A 1SXAA 2MPAL 4OVVA 1KIQB 3R65A 2VQTA 3MCYA 3EH1A 2KQNA 1T6WA 4WWKD 4PRHB 3ZT5A 3BAXA 1AXIB 4G5ZL 2NY0D 1RK0B 4EMZA 4L29A 4LKXB 4V11A 4JV5O 3TWCL 3IF1A 3LYRA 4JM2D 2MOQA 4LAQL 4WWOA 3ROOA 1S9KC 1DUYB 4QIRA 2PXYB 3HE6D 4EO5A 5CD5C 2JVUA 5HVHB 4DAGL 4KTEH 4P9HL 4DKDC 4DSYA 4MDJA 2VUKA 2ADIA 2C7UA 1QWUA 3B9EA 2EVIA 3NCWA 4UANA 5CZXD 4JZJC 1KT2A 2WINA 3ZZSA 3VAEA 1KNOA 4URKA 3ETDA 1J8SA 2QR0A 5BRPA 2WLNA 1SOSA 3CLEH 1MJUL 4FZ8H 4GI8A 4J28A 3GZQA 4KKLD 5AW3B 3WJLA 4JGNA 1TQVA 3KJ4B 3HKCB 4AZ8A 1F4HA 4DR2B 3G6AA 4BD4A 2VLMD 2Z7ZA 3VXME 2DLFL 1I3RB 4KKAD 4N2NA 2JS5A 4OGYH 1MJJA 4P2QE 2NXYB 4Q2ZB 2D7NA 5FK9B 3BAYA 3UG3A 4LCWB 3GYRA 1ZLZA 4UV8A 1QLRA 4KUZH 3VXMA 2PF6A 3M1BB 3CIAA 1H8SA 2ZCLH 3R4DA 2ZAHA 1YJ9V 1UJTA 4FJ6A 5F7WC 3T71A 4BKLB 1S9WB 4JM4L 1CICB 1T4WA 4QRRE 4XC1H 4AI7A 3RVUD 4OZHE 1RMFH 1JDDA 4NO3B 5GS3A 3G71V 3O6ML 4NUGH 4DR7B 3MV8A 2BVPB 4PP2B 2D2CC 3ZE0E 4I9XA 1JCHA 5DD5L 3ZTDC 2BY1A 3ABZA 1Y66A 5DHDA 5TF1H 5FCUL 1N3NA 4QOKE 3MNMA 4MA7H 4I4TB 4Y1AE 5HYSG 1ND0A 1DANU 2J12B 5DHMC 3NIFB 3WDHA 3L9DA 1C08B 2OA9A 1X59A 3G67A 1PJ9A 4D7SA 1FYTA 3A5VA 4HQQH 1DSFL 4HFUL 4YJ3B 4MVOA 3O4OC 4LL9A 2VDPL 4MWFA 3VVVA 3IJHB 1I7UB 1PU0A 5KYYB 3OKLA 5ID0B 5GGQH 3H7BB 3K5OA 4KKBC 1P84F 4Q9QH 4PG2C 3L9EA 5E03A 1F4XH 4XNYL 1CI5A 1GGCH 1TQBC 4L8SA 1CIUA 2EDFA 4LSRL 3FU9A 3QC5X 43C9A 1SESA 4JB9H 4JFZL 4HSAC 4KJQC 2EE3A 2ZUQC 3T2NL 5DEGA 2IALB 2CRZA 1OOWA 4XWGL 3QZLA 3VXOB 4ODVH 3TPUB 4ZAKB 2DQCH 1E8ZA 4PRPE 4F8NA 1CGSL 2XWJB 4AMXA 5CGMA 4Z7WE 3DX0A 2DMHA 3FH7A 3WFEL 2YKLL 4NKDA 3IB4A 3AITA 3D05A 4QRQB 2JJSC 1GH6A 5IR1B 3T8XA 4OTXH 1HDJA 1N2RA 3F83A 3MA7B 1NEPA 4GP8B 5GGUA 4EOWL 1UWEL 4F7CB 2VUYA 4N25A 4NM8L 2A6DA 4WTWA 3QTCA 3NIGB 2FX8L 4IYHA 1QFWL 3BUIA 3KDMB 1FI8C 3B8MA 2QE7G 2AJUL 3P0VL 5BVJA 1RZQA 5ETUA 4MS2A 2DJSA 3RWFB 3T2MA 1GYAA 1NC2A 5KYWB 4RQQB 2H94A 4FS0A 3L3GB 1NUGA 2ZX8A 4AE1A 3RYCA 4U3SA 4X7TA 3RUGA 4LL1A 4EVNB 4PDRA 1XSJA 1VF5C 4X8JB 4PJBA 2XAGA 1FE8H 1MPAH 3SGDI 3IYLW 2VC2B 5LP6C 2AK1L 4AQ1B 5LGHL 2WXRA 5F7DA 1P5UC 4NUJB 4S10A 4PJCF 4HC1L 2AJXL 1WC7A 1E28A 4LFHD 1PF3A 3N85L 3IDMB 5E6RB 1VCAA 3CFMA 3P11L 3ZDYB 1DQQB 5IESH 2QSCL 4WO4C 2BSCA 2FQEA 1F11A 4TVPD 4B7IA 3QJTB 3HZ3A 2VQFB 1PTZA 4ZQKB 1P7QD 5IP4A 4FQXB 3VE0A 5EYPA 2HLAA 3VRJB 5CB4B 2XHNA 1W9XA 3I75A 3CQQA 5KYUB 3RFZA 2ZE6A 1SDYA 3K59A 3OWEA 2ARJB 5E1AB 1REIA 4XOBA 5CA0A 2GFBA 4M6ML 1W0KG 1OSYA 2YXMA 4QO1A 3WAKA 1EAQA 1E67A 1KTJA 3F3HA 3GBNH 4MVRA 1RH8A 1F56A 4D7TA 5L3DA 2D4FA 3OQ3B 3ORJA 4DV3O 4GRWH 5DD6B 4U1LB 3VGGA 1QBML 3NCJH 1AGBA 1AQDA 5T3XL 1QVFU 5G4NA 2XWZA 5C08B 2C1OA 2ZYHA 2DQIL 1S5HB 4KK6D 3T2QA 3BHBB 3PGDA 4XPFH 4G6KL 5HD8C 1PFOA 5ICZA 1KACB 2GUZA 1PNDA 4AILC 2YFNA 3WL9A 4HKBA 1XIWA 5C0FA 4J12A 4LGRB 3C90A 1AHWA 2EDMA 2I60H 3F12A 5D1QC 2E3VA 2NR5A 4XCYA 2JIXD 5D4IA 2FB5A 4XHJC 1MWOA 4X66B 1JCVA 1G1YA 1ILUA 2VXUL 4LVOB 4V33A 5FLXN 4HU2A 3KWWA 3SKJH 4GLRH 2F58L 4KI5F 2XUWA 4D0BA 3MC0A 3GS4A 3FCBA 2COVD 2ERJC 3H42H 3RYHA 4F33B 4ZS7H 4JI7B 3RGVD 1JMZA 3QCUL 4HETA 1OPGL 1T04B 1ZMYA 3B1TA 1D3CA 5FYLH 5IMLB 3G3LA 3DJ9A 1GL4B 2IQ9L 2WP3T 3HLKA 4BFOA 1XUQA 4E41E 3C5ZC 2AEQL 2M83A 4PJ8A 3QIWA 4H33A 4N1HB 1QLEC 2OQJB 3PNWB 2ESVD 1ZGLP 3SJVE 3PFUA 3QJHB 4A5UB 1NCNA 2DEWX 2Q7GA 2OL3A 1J8RA 4D8PB 4JZ2A 1F51A 5TE4L 4PGDA 4GUOA 1M5IA 1XIWD 3KVDD 1YDXA 3FOLA 4O2EB 3AUVA 2V1DA 2UXFA 3GXUB 4TOYL 4YSDA 1MW3A 3O2VH 1VGKA 4ODUB 4P2RA 4LSTH 3TCLB 4UV7L 4Y2DB 3KAAA 3R06A 4RCAA 1YAZA 3EYSL 1PZ5A 2N4IA 2Y7QB 2W9DH 5KVEH 4HUXB 2JLPA 4X1IB 3L4YA 3NEXA 1IGFH 1NIEA 3PDGA 1LDPH 4OSUH 1O9VA 1BIIA 4A63A 2CUGA 2F5BH 3CRRA 1KFAL 2IBBA 3O41A 4JPKH 4HOMA 2HTLC 4NZTH 2WVVB 1BXUA 4R4ND 3QXTA 4WFGE 1EZVX 1AKJA 2DWYA 3NIDB 3C3TA 1KN4H 1X4YA 2YPKA 3PWJB 4BGDA 3W38A 4K3GA 2DZEA 1I1FA 1WEJH 4HLJA 2BNUA 4U6XB 3ARXA 1P4UA 1NTKH 4WFBV 1FS0G 5FWQA 3W0WB 4G7QB 4BZ1A 2OR9H 2RQ6A 3E1ZA 3UC0L 3WMPA 1IVTA 2VR7A 1JHTA 3L3IA 4KXDA 2P8PB 5IT2H 2Z8WC 5F7MC 3D0VA 1F3DH 3OKLB 2VDKL 3WTUA 3NZHL 4U4BA 4FFVD 2O72A 3KL3A 4LLQA 3HG1E 2XWCA 5TE6L 2IPTH 4MT8A 2ED6A 1KXQA 2WNXA 3CGTA 4NAMA 4F2FA 4S1QH 4FFZL 3U1SH 1NSNL 2OXHA 2WKLA 4FXGA 1N12A 1KDIA 5JDSA 5CN1A 2H3NB 3DOHA 1CMOA 2XT9A 2VL5A 4DZ8B 3BPOC 4QLWA 1VQMV 1JZ6A 4C59B 4UB6Z 1Z5LA 4LSUL 2F08A 5BXFB 2CPCA 3RTLA 1HNYA 4D9QD 2N0KA 2NZ9C 1NFDF 1WAEA 3LQMA 4H1LB 4PBVC 2YPVH 4UQ2A 2AP2A 4CVXA 2A79B 3T4AC 5MEPA 3V0WH 3G5VB 3QORD 5ADOL 5EEWA 4QJ4B 1R5VB 2DL2A 2PUQT 4UBDC 3SPGA 5EIBD 1CF1A 1CFNA 2FQGA 4JG0H 4WUKH 1O9GA 1PKQB 1C8QA 3BVVA 4PQXA 5CBAA 5HDWA 3OB8A 1XBDA 1QLRB 4F8OA 3GQFA 3MLRL 3GIVA 5DDHA 2HZHA 3LEYH 4FNSA 5EEUA 1UKQA 2SODB 4HFWB 1AP2B 3VUAA 1Y0LB 4QTHA 15C8L 1CP9A 2GJPA 1E3FA 1U3ZA 2RR3A 3LN5A 3VFTA 2J4WH 4LDLB 1OAKL 3NOIA 4N9OB 2H1LM 1BXAA 3SCMD 1P49A 2NMSA 3AG3B 3TEYA 1YY9D 3BEWB 1FIGL 1JXDA 5D4JA 4AGPA 5JHAA 1FZJA 3FSVA 4U1NB 4OPHA 3O6FC 4MVZA 1S46A 4HPOL 4MXWL 3RWDB 3CFJA 5LAXA 2WBJC 1OGAB 1RUQL 1XGQB 4P8QA 4NERA 2ZUUA 3FRPA 3LH8A 4A2HA 4JG1H 4KOBA 1UH2A 2VIRA 2YWYA 1E4HA 3MLSL 2A4EA 1OAYH 4GOSA 2OYLA 2L7UA 3BSZH 1JAEA 4Z78A 2A9NH 2JFCA 1UURA 4L37B 3MA9L 5FO9B 2G9HB 4FZEH 4NPYB 5FHBL 1LEKA 5E51A 1RIVL 4WEBH 2HKFL 5DC9B 3HFFA 3QJFB 3PQYB 3GUFA 4FQCH 4JY5L 5K93A 1AH1A 3P9LB 5GS0H 1XD0A 3P3RA 3QDME 5C8JA 1O6SB 4M7JH 5HHNA 2WKOF 1G4MA 6PAZA 1GGTA 3CWGA 3WLBB 4YSCA 2XBZA 3MJGX 4ZMOA 2VC2L 4BK8A 3KHOA 4G71B 4QRTB 4IRZL 2VQ1B 4OCXL 3Q6FA 4XPGL 2GHYA 1G7HA 5DJ6A 3L74H 3WN5B 1G6RH 5AB0A 2JCCA 3VQWA 2IAMB 4H1LA 1G1CA 2CKNA 3UO8B 3PUCA 1A65A 1Y6KR 2VMCA 2WAHA 1AC6A 1U8LA 3NN8A 4I18C 2CHDA 2XBTA 3HI6L 1D6EA 3W9DB 5ES4B 5EG6C 5C09B 1K8DA 3EJYD 3TZVB 4UFZA 4CADA 1PFCA 3MREB 4BFFA 3WNOA 1JF5A 3W11D 4FX5A 3S88L 3IF1B 5DJAA 3ZXAC 3M07A 1SM3H 4K73A 5C07B 4M7LT 4NHUB 5JDJA 5AG8A 3DRQA 1TTGA 4ZRGA 5F7DB 5L0QC 4ZOLB 2YSUB 2H2SD 1NCDL 4I89A 5GSRA 1XMEB 5DK3A 1EHKB 4ONFL 4PLOB 4M6NH 1DVFC 4LK4A 5DLMH 1D7DA 3T1WA 3HKFA 3ZX1A 3DX9B 4ONHB 2YD2A 2H32A 2NY0C 5CXPA 2ZUXA 4JZOB 1TEYA 1XWVA 2G5RA 2H2PD 4NWTL 4Q6IC 1A6UH 5BUGA 2GSIB 3O6LL 1SN2A 2IJ0C 4XNXH 4ZT1A 3WS6C 3OXRA 4ZNCD 1QTPA 4F37F 5IVXB 2JKSA 4X98A 2PYEE 1T83C 3FPXA 4AEHH 5DRZA 3AG7A 1P4LA 5HYQA 5HD8D 3RDJA 5E1AA 2XYBA 2LHAA 3WIHA 2P06A 3DC5A 3OLDA 1PG7L 5LGJB 1RV6X 4YDVB 2EE2A 3CN3A 2V37A 1V7NL 4QWWC 1BZ9B 2Z92B 3OGCC 3VDCA 1Q0YL 1C5CL 3VFNB 2DKSA 3O11A 5C7ZA 1EGJH 4FFWC 5GRJH 4JRXB 1GPOL 1EO5A 5B39B 2Y48A 2OSLA 1ZLUK 3TBBA 3K5SA 1NDTA 1DEEA 4AK2A 2X4NB 3MACL 4JVPA 5I30L 3ISRA 2B8OT 4PVMA 4FABH 1XBLA 4Y2LA 4Q14A 1BX2A 2GAZB 4F7MA 1YZBA 3GSVB 4PJDE 3CCJV 1BOGA 1KUMA 1OAJA 3N9GH 3KBHE 2IQAA 1HZHH 3C9NA 3GXMA 1AJ7H 3V0AC 1E79G 2XTJE 4XN4A 3L3DA 1FDLH 5HJGA 3RAJH 3TL5A 2DLIA 5I6NA 4FA8A 4F33A 4GNKB 5BO1L 4UCRA 1XNQO 1BE3H 3KCXA 4KQ0A 2XCMC 1UB5B 4XPTH 3QUZB 1YNKL 1MHPL 3ZIAG 3FCTA 4GLRI 5EUOB 2GHWB 4FIPC 3L1FA 4MKMA 1SJHB 1NOAA 1OAZL 2FECI 2VDNH 4BH8B 4QMEA 3NEEA 1MREH 5GSRB 4NKDB 4X99A 2OMYB 1MUJB 5LBGA 1GM7A 3JTTB 4Y9FA 3I9PA 2BINA 3SBWA 3W2DL 4PJDF 4JVWA 4P23A 5F96H 1S7TB 1DK1A 1CXZB 2PPEA 4XCEB 3EGSA 1L3WA 1TZOA 5KSUB 5TE7L 1JZJA 5AAWA 2DQEH 1IFRA 1OL0A 4XNZC 3TM6A 3SJBC 1S3KH 2E7DA 4JKMA 3JWOH 4M62L 2ZUTA 3B9KC 3M8OL 5CWSB 5D1QE 3IAPA 5C0ND 3TASA 1YEGH 2YICA 3IKCB 3G04B 4XMKH 2WAQA 1EFRG 3BZ5A 3RTQC 2NYYC 1S9XA 4L0PB 3N06B 3UYOD 4YDVA 2PF4E 4NQCB 2A6JB 4H13C 2ESVB 5L4FA 2EIJC 3APDA 1OT1A 4QXTA 1D5MA 1RU9H 1W15A 3FO0H 3BYYA 3KKYA 4PWFA 2CIIA 1K4DC 4UDUB 4HJEA 4WI8A 1NEZB 2ZTBA 4APQA 1TCRA 2J20A 4NAJA 5EBWB 2UXGA 3E38A 3IETB 2Y6SD 4KNTA 4TPRL 3WIIH 3D85B 1E6JH 2L7JA 4XN8A 2E7LA 3E8FA 5HVWA 2HVKA 3QARA 4S2SB 3T4AB 4GX0A 5D6DA 4LF7B 4XCFH 4JI5O 1ED3A 4JN2B 4KY2A 4NPYA 3PWPB 5FO9A 5KVDL 3SDCB 5JXAH 4QRSB 3QORC 1LJMA 1R3KB 2AHIA 1PNKA 1DVSA 5IMOA 5C3TA 3FFQA 3O2WL 4NRYA 4LF7O 4N2FA 3BDBA 4X4MA 4F9PA 1R1CA 5BJTA 2YD9A 5I8OH 1LE5A 4GKZA 3NESA 1PZSA 1IM9B 3ESOA 1AI1L 1QUNB 2HLFD 1D7BA 3BRDA 4IHJA 2J44A 1JN6B 2DLTA 3DIFB 1RJLA 3IN0A 4A6YH 2X40A 6FABL 2EJRA 2X4TB 2CHWA 4HEPA 2H9GB 4TLUA 3KHQA 4JO1L 5LNEA 1MFBH 1F11B 3IGFA 4GSXA 3ULUC 3F7RA 1NVPD 3RPBA 3BQUD 5AB2A 2Z0UA 2Y0IA 3BDYH 1AVAA 1WAPA 1BZEA 4HSCX 3H1HH 4FI7A 1OLLA 2R0WH 2XN1A 4XGZB 3M17B 1NI8A 2VYRE 5HHMB 2R4SL 3GIVB 2HP8A 5DDHB 1ZL8B 4I9WD 2ZXWB 1Z3GL 3IKKA 4N2EA 1XZ0A 2EABA 1HAUA 4PJGE 1EDHA 3S4SB 3B2EE 1JZ4A 4RUFA 1GKOA 4XR8C 3HIZA 2I7SA 4MZRA 2FECL 4UOJA 2AVGA 3EDKA 3N2GB 3ATEA 4XZ4A 1A4JA 5EWIL 2EICA 3CRCA 3BAIA 5SWZA 3PDOB 3PP4H 3F6LA 4P2RE 5D7LE 3RJQB 3QWNA 5HVHC 4G7YL 1AGBB 3FRPG 3GMNA 3VXMD 2DIJA 4R26H 1ZSPA 1A7PH 3MCKB 3Q13A 2NNXA 4JO2L 3RWHA 3CFBB 3ML8A 4ZW7A 5DZ9A 5J1AB 4DEUA 3T0XA 2J8UF 4YLBA 1J8HD 2Q69A 4DW1A 2FSEB 4M1CC 5ICZB 2P67A 3AT9A 1AB3A 4OZGB 3L4TA 4M5YL 3BN9D 3QUYC 4NTYA 1BSIA 5ACMA 1K4CC 4PGCA 2EUWA 2VDQL 1ROWA 2JKIS 3TGUH 1VFAA 4BWAA 1F8TL 1UT1A 2BWQA 4DV4B 2HVKB 1H2NA 1JPSL 3WFHB 4WQOA 3U1QA 3K03A 5F7AA 1YC8A 2GBUA 2AV1B 1PMYA 1M3JA 4OQTL 5IFHL 5AOZA 1NBVH 2JGUA 1WWBX 2ADJB 2ZWKA 3AJ7A 3JYBA 3U2JA 4C54A 1IGML 4OKVA 1QRKA 3L4VA 2NQCA 4X5QA 5F89A 2V2TA 3UGEA 4M93C 1QTYT 2YPKB 4XN2A 3AC0A 3D39E 3FO9A 5A1AA 5DUML 4JDVA 4WCYH 2K9FB 5AVWB 5C2BH 3FB8C 3K6FA 3FQRA 2H9GA 1DLBA 3LDBB 1H2KA 4DRXB 2M26A 1KC5L 3L17A 1I8IA 5HDOA 3L72H 4PJ5D 3P3SA 2WO2B 3OKKB 4GS7C 3VI4F 4FA7B 1K33A 5DMJB 5H94B 3PN1A 4Y2DA 4PJFA 4B9GA 4RMVA 1RK0A 4PRPD 3GDBA 1GZHA 1ZL8A 1T89A 3OMZA 2ZX6A 4MSWB 4I4WA 4D7PA 2PO6D 3ILPB 1I5XA 4ODSH 3VI3A 1OIOA 3IDIB 3L7FB 3VSUA 5I1JH 1BEYH 2VO5A 2ZDIA 3BWUC 2BP0B 1HNWB 1XCTA 2XQBH 4RFNB 3FULA 4C83B 4M7ZB 4BKSC 4YHYB 3HKCA 2BW4A 2EKSA 3QP3A 5A16B 3KEDA 1TZAA 3CDCA 3PWNA 3W0WA 3ZO0A 4MAUH 1TVKB 2YD0A 2CO7A 1CT8B 1VADA 3OG4B 2YA0A 3RZCA 2EVJA 1LK2A 3MR9B 3O3BB 3KR3H 3GK8H 4PRAA 3WY3A 4LCWD 3O6KH 1U8QB 2Y5EA 1MRFH 5E4EC 4I3RL 3FO1B 4DZBA 5LJYH 5IMKA 5E99H 2A6IA 3EFDH 4LSQL 4ZNEE 1SA0A 3N1FC 4L29B 5JUEL 1E43A 3AG4C 3CCHA 1FL3A 4ENEC 4HWEH 3LS5L 4BWTA 4R3SA 4K9EL 4U6VH 2YA1A 2B1AH 2X7LA 3NIFE 2PP9A 1L9NA 3NFNB 1R3JB 2HKHL 2IV8A 2VGLM 4PV9B 2IJIA 3VFSB 3OGOE 1F41A 1GC1H 4FQ2H 2DLHA 2CDFB 3VWJA 2VXSL 4NXKA 1A6WL 1NPNA 1U42A 1XQ4A 4FQ1H 4ZOCA 4OX9O 3ZDWA 1KCVH 3BP7A 5BQ7B 2OK0L 5CMUA 5GONA 2Z93A 4DJMA 4ANUA 1Q90A 5KANG 1MAJA 1WTGT 4Z7OB 1VKXA 5MP6H 1A6AA 2OCHA 2VMDA 2K1EA 1OCCB 1IURA 5FUOH 1LNUA 1IAOA 4X4YB 5IYZA 2X12A 1RJCA 2HVBA 4HK3N 4WJ5B 4X2UA 3ZHLA 4TSFG 2QQLH 4BK5A 1G4YB 3HNSL 1K8IA 4RGMB 3RG1C 1CICA 2J71A 3QEGL 1B0GA 1XDTT 2KI6A 2AJYL 1ORSB 5A2CA 5DGRA 5AZ2L 5DJCA 1JV2B 3NA9L 3L9BA 3TFKC 3L7EB 1FGNH 1OE1A 1WGOA 4GKSA 4E9VA 3D3VA 1HHGB 1KKDA 2OMYA 3MV8D 4M8RA 4DTGL 3GLDA 4MQTB 1TUPA 3LB6D 3K58A 5IB1A 3VTMA 4PA7A 4ELKB 3VQLA 4RZCA 4ZSOB 2O57A 2OXGA 1FIEA 5CJBA 3D9AH 3GS0A 4LVNB 4W9IC 2XASA 1OB0A 3FBKA 5LCVA 4I13B 2QGCA 1XGZA 4X8GA 1KB5L 3VFWB 5KZCD 4ES8A 1WD8A 2BIOA 4UQ3A 1OGAD 4J11A 3NJVA 4KGJA 4UU9B 2NY6D 4Z95H 2BRRH 1NCBH 3V4UH 2YRBA 1SJEA 3K57A 4OCRH 1FJ1A 2QHRL 5BPPA 3D1MC 5DZPA 3O8XD 4LE8A 2ICEA 2Z3FA 4PRHE 1SOXA 3JZYA 2V17L 1A0QH 3ZHVA 2TRHA 2LGWA 3D33A 2ITCC 1KYOF 1NR1A 3CVIL 1F4YL 1X6LA 3F7KA 4M7ZC 1YY8B 3ML0A 4LOVA 1AP6A 4E41D 4HKXB 4XNUH 3KYMA 4AGOA 4UDUA 3ABUA 1VF6A 3ARUA 2CCWA 3LNGA 4N90E 2W9LA 4Q74A 5T1KB 5HDLA 3QIUB 4I77L 4XP9L 2IANA 1MA1A 4W9LC 1EM1A 4FC3E 4ZQKA 3KPSB 5FYLE 5EZYB 1NANH 1HKLL 1IEAB 2YO3A 3NPSC 4H0IA 3DBSA 4UIMB 4WKZA 5EU6B 3TA3A 2WXKA 2FX9H 1ZVHA 1UJ3B 3D2UD 1TPXC 4YL9A 5GHWH 3B5TA 3QHTC 3FYEB 1OT2A 3WFHA 5E8NB 4XVTH 3SQOL 1G5AA 3KDMA 4IIJA 3IFOA 3D85D 3T09A 3WV0A 4LEXL 1CDUA 2V6HA 1BZ9A 3AAZA 3FL7A 1SF5A 2ZXEB 4PVNA 4GKZB 5EOTA 3UYPB 2QZQA 1OF0A 2GIMA 3K8MA 4U3CA 2EBOA 1DVTA 5LO7A 1WP6A 4OZHB 2R9AA 1SOKA 3F6IA 1XL4A 3PPSA 1JNNL 5IF0B 1PDKB 5C9KA 4G6AC 4GSQA 4OFYA 1KIRA 4L3EB 3RIFK 2Y5QA 5IBTL 3FXIC 1NC4D 1YMME 1AI7A 2FYUH 5IT9N 2ZPKH 1YI2V 4X9YA 5LB1A 1AILA 4U1MA 4XBPB 2P52A 3C09C 3DX9A 4ONHA 3WFZA 7PCYA 2FZ3A 1SQQH 3FTYA 3VBBA 4ZFOB 5B4MD 1JDCA 4ZUSB 1AZCA 3WEXB 1J05B 4JANA 4JI3B 3UKMA 4WV1B 2X70B 4KZCA 5EFIA 4UVAA 2IOMA 2WBJD 4PJFF 1BQKA 5KSAA 4XO8A 4MWFB 4QR7A 1K4CB 4UT9H 2AV7B 2GIXA 1JNLH 4BDVA 3G5WA 5JXEA 1HDMB 4ZUVA 7PAZA 5FB8B 2MCPL 2VDMB 4HAFA 4NIKB 4RVBA 4MBRA 4U6TA 4DVBB 4XAWL 4J3OC 4K8RH 5I6PA 5MERB 2WN2A 2X4UA 1N8RW 2RAMA 3QIWD 4L05A 3GWJA 5EBLB 2QTVA 2QQNH 4PRPB 4ZUWA 4M6OL 2YPVA 4K3DH 2CTQA 4UM8A 1KEMH 5LBSL 4YHIB 4ETYA 1I8KB 2CO7B 4OZIE 3ZZLA 2WXLA 2NY4C 4PSRA 2GB2A 4F57H 3HBZA 5AENA 5L2JB 5DD0L 2EDTA 3B7YA 3ROOB 3CVHA 4GSUA 1XIWB 5E7BA 5J3HC 3ZTJH 1M9SA 3I85A 5C8YA 2NY5C 4YHPB 3S2CA 3UBXI 5EZYA 1UJ3C 3NZ8A 4Y4FB 4AWJC 2ZOTA 4PYHA 4R0LA 4G1EA 3MOAH 3QB7C 1S9YB 1PZ5B 4Z7UA 3AU0A 3I50L 3HKEA 4WKXA 1L0PA 1QR1B 1NWPA 3DJSA 4G3YL 2JJTA 4WHCA 1LYQA 3EYVA 5KVFL 1Q4NX 4YBHA 1F4MA 5B5EZ 4DR1B 3U7WL 5C0GA 1KEML 5LBSH 4K3DL 1DQML 1J9RA 4K7PL 5KYXA 2HG5C 4U0RB 4XP1L 2ZF9A 2FWSA 4KQ4L 4WGKA 4WWPA 2L8AA 4F8PA 4JDEA 4RGOL 4Z18A 3N0AA 5TQ0H 1ZLVH 2KZWA 4YSAA 1IUZA 4JDVB 3ZHRA 1EDYA 4M1GH 1BFTA 4JCWA 5I8CB 3GZKA 3QO7A 5ADPL 1I31A 2RQ8A 5KHHA 3E3QE 2GCYB 5EZOL 1AGCA 3ESPA 2MOVA 3GMPB 3NP4A 4WWKA 4BK4A 2ZYIA 4NLAA 4Z23A 5JQIB 3HG1B 3D85A 1E8YA 1KMIZ 5CBGA 4NN7C 2NNAB 2VXVL 4J2QA 1E9OB 1B4JH 1CDYA 3MCG1 4PLKC 2A9AA 4Y19E 3N2KA 1SMAA 2PMZA 1NBQA 3ZGIA 3NRQA 4N2LA 2VWKA 2BOCC 2QVIA 5HYEA 4FFYH 5LXVA 1A02N 4YOKA 2ZPKL 4X4ME 1N6UA 2ZXQA 4DK5A 5GZOA 1E5YA 1RPUA 5E5MB 1NGZB 1G7QA 4OB5L 2ALWA 1JR9A 3FQUA 3QIUC 2A9HA 2OSYA 4CU7A 3BDXA 3BIKA 1W0VB 2HVJA 2IBGA 1M7IA 3E83A 1RVFH 1JZGA 3DBXB 3SO3B 3SBQA 3SJVD 3DO4A 3B7RL 1EHXA 5GTIZ 3OF6D 2W5PA 5D2NC 4LEXH 4MNHA 4WUUB 5CMAA 3VSTA 4EAEA 4UM9A 3PYCA 3ZE0F 3GNML 4G6MH 4DK6A 4R2GC 2F1BA 5JA9A 4XVTL 3SQOH 4P04A 1ILSA 3TBYA 3APQA 4HU8A 4D9QE 4PGBB 4A7QA 3UEQA 1I1AA 3E86A 3FTWA 5E23A 3Q2CA 5FEBA 4DFHA 1B2YA 3WAJA 5D5QA 3QO5A 4RWYH 1RFDH 2WSSG 3NDYE 5FDWA 4OLZH 1IQDB 3PWUB 1K5NB 3Q4HA 1SC5B 1UT9A 2O5NA 5B1KA 3FS9A 3FAVB 2BVQA 4OM1H 4Y4FD 43C9B 3MRBB 4G8GB 1TTRA 4LSSH 3ZQ9A 5I16B 3MAWA 1M7DB 3EYQC 4L4VA 4BBWA 3VYNA 4JFFB 2E7BA 4FQLL 5DUJA 1A4AA 3ZK0A 1QNMA 1F3RB 3KBFA 1NTMH 3INUH 1USQA 1R3IC 1KCSL 4PJBB 5D1QD 5DFAA 2IADB 4KDWA 5GIRA 3RY6A 2YD5A 1RP8A 1S5JA 3PQYE 2YD6A 4YPGA 1MFDL 1URLA 1OCCC 1X9LA 1VPOL 2JH2A 2CBPA 4LEBA 2CR3A 3BQUB 3SDDB 3PP3K 2C34A 2P5EE 2X6MA 2ZONA 1YXBA 4DP8X 4J3BA 4RMUA 2AKRA 1XZ0B 3SCMC 2NDGA 4PJHA 3U0ZA 1OD7A 4N4YB 3DVNA 3ATAA 2LGQA 1MAMH 1RHFA 4YPJA 2BVTA 1EWHA 2JKNA 3NPZB 3BPZA 2KH2B 3DX7B 2F7PA 5IJCC 1U8OB 5I75C 2H8PC 4B7EA 1G9ML 5T1KD 3MJ8B 3G9AB 3MJWA 3CSYA 5I6LA 1KTBA 5F3FA 5I0WA 2DQGH 2WLKA 1IBMB 1WFIA 4PA3A 3FK3A 4Y5XA 4JRYD 3NIDE 3QEGH 4KJPD 4N0CD 4DR5B 2BXYA 5TDPB 4ZYKA 2RHEA 3GJFB 3HG2A 4MX7B 2QKIA 5GRWA 1DF5A 1PKOA 4AH2A 1XGQA 5ITFA 1K2DA 1DJZA 2QMJA 4KHTH 4ZTEA 3FJTA 4XP6L 1BQRA 3TBWA 1T1WB 1U8PA 3HCVB 3MHZA 2ZYRA 1RUPL 1QUPA 4J6RH 5HY9A 3LIZL 1EJOH 4DQOL 3FPYA 2IIJA 4J4PD 1ZHNB 3JAKB 1J0YA 5D72H 5F7LB 1JBJA 2A5UA 3TBVB 5L6YH 1IXMA 2VXSH 4Z3IA 4CC5A 1EZVY 3D2TA 2GKIA 3CIQA 1U8JB 4KVCL 4WNQB 1MG3C 2EO7A 2ZNXA 4M7KH 4XVOA 2ADJA 2PWEA 2CDYA 2QLVB 3SGJA 5CSBA 4DN3L 4YIQB 2PWFA 3ARBB 1DVUA 1A14H 2NCEA 4OI9A 4RFNC 5EUKB 5ABAA 5F7EH 4YHIA 3PJNA 3M1CA 2FL5B 1JGEB 5D5MB 2IWKA 3C09B 3JSLA 1DQDH 1U8KB 3COOA 2G2NA 4Y7OC 5D2LA 4HX1A 4MVBD 1AKJD 2H7WA 1S76D 3LXBA 4DK3A 2UZXA 3BP5B 4BR6A 5LMNB 5EU5B 2GABA 3N6YA 5C71A 2M6YA 1BQZA 3V6ZA 3V5DB 1MRFL 1ID2A 1ZWIC 3TO4A 3FB7C 1OW0C 3FX7A 1LO4L 3LN4B 5FFOA 3ZMZA 1FF5A 3HPLA 1U6AH 2X4SB 3SBPA 3PV6B 4O02A 4Z8FH 3ASNC 1BP3B 2NY6B 4PBXA 3B9VA 2CO2A 3TIEB 4IHBA 4HLZH 2Q8BH 2Y5TA 3AU1B 3BFQG 1M57B 5JOPE 4Z5RA 5EZIH 1HL9A 2FYYA 3QDMD 4AQZA 3MODH 4D8PA 2FLRT 4RFEA 4F20A 5K9QI 3U25A 3FHQA 1NAML 4NNXB 4Y8AA 5IW6B 4LRNH 3NPSB 1YO4A 2CK0L 2BOLA 4H26B 5B8CC 3F7VA 3HUJA 1G1OA 1L7TL 1AR1B 2YD8A 3J8F7 2WN3A 2OMUA 3JCUZ 3QK0A 4LFAO 3K2UL 5GS2D 2WTPA 5KJRL 4O2BB 3AREB 1L9TA 1QLFB 3ARFB 3NH7L 3LZPA 1AVMA 1BQHG 4JMXA 3UO1L 5JQGB 5D7LD 4Y16A 5AKTA 4PJ7A 4PWIA 4JRYB 4TNEA 3ML9A 1LNUB 3MRPA 4QRRD 3WFBL 5B3JF 2VWEC 3J7HA 3B3IA 4XNQA 4C56E 4JFDB 5DUPL 4JI5B 2LQRA 4LIQL 5EO9A 4JM2C 4JQXA 4Q0XL 2EX3A 3KGUA 5DUMH 1PV0A 1KXTA 2I85A 5E08H 5C70A 3KYNB 4XVSH 2NZIA 4GG6A 1A1OA 1A66A 4ILDA 3HE6A 4YL4A 3DX8A 2QTOA 4L48A 1X9RA 1MCJA 3V0FA 1AZNA 2J5LC 1WA8A 4M03A 1DN2A 3ZL4L 4OCSH 2B16A 1B0WA 4PLNC 5JYMA 5DK2A 4ELKA 1KTLB 2Q0ZX 2B1HH 4WWID 2VQFO 4OZIF 2KPWA 4OD3H 4NNPL 1YPZE 4OCLC 1BHBA 4U6HB 5ERWB 5A2FA 1DFBL 2BVOA 3NG5A 3G6JB 4PRBB 1VQNV 2Z7WA 1R46A 2YPLE 3OPZL 3PAVA 4JS7A 1DQVA 1PY0A 1NBZB 4KMTH 1FJ1B 3D39D 1Y1UA 1D5XB 2O5ZH 5A6MA 1MMMA 3G04A 3IGAA 2AJVL 2BCKB 4JZGA 1JJUA 1R3LA 3L3OA 2OPCA 2BWDA 4AQ1C 3OKDB 3SDLA 4R26L 4FXGB 3MUJA 1VEMA 3OAYH 4WW2F 4RGNE 4JHAL 3X11B 1NUFA 1S7QB 4N8CL 3CC2V 4OLWH 3WLWC 2O5XH 2Y07L 3L48A 5EU7E 4RQFA 3ZDZE 4KFZC 4X99B 5JW4Q 1A7QL 1HSBB 4LFAB 3HZYA 1IKFH 1L9OA 4Z1VA 4IU2A 4RZCB 4ZSOA 3V4VA 1TJMA 1D5IH 4OV5A 2XZCH 3TA3B 4XCEA 2P5PA 4FP8L 3D0AA 2QVKA 1MVYA 3JASA 1XF5B 4Y1AA 2P5WA 2R0WL 4W1TA 2FT6A 3DVNB 3BAEL 4WI3A 4Z7OF 1U8MA 1EHLL 4OLUH 4JO3L 1E3XA 4U7SA 4TQDA 3UC2A 1P9MA 2G3XA 2XKNB 4PJ5B 3TYGH 3ZE1E 4FA6A 3QDHA 2EIMC 1IGTA 2A77H 5L7XH 1PD1A 2C3VA 2DLEA 2VIRB 3NACH 4LPYA 4UTBH 3UGXA 2A6JA 4HYOA 2ZM6B 4HUUA 3DC6A 1KPRB 1CD1B 5MEQA 3LVTA 4OLYL 5EZJB 1AI1H 3HR0A 3VXRE 1AQKH 1EXUB 2VNCA 4J3OG 5F71A 4A55A 3MXWL 1MI5D 4LVEA 4E68A 5KBDA 1FSKB 1H5BA 1LDSA 1CFVH 3UP6A 4U1GB 1OALA 3BUDA 3EHBC 3X1NA 4ES9A 4LBEA 1HK6A 3C12A 5HPMB 5C0CA 2E9BA 2Y7SA 4CBZA 2VO8A 2F8XC 1BOGB 3MBED 4XCFL 4WHYG 3GMQA 3ARRA 2DYSC 4DV6B 2VQ4A 3A3YB 1ZHLB 2WTOA 3QFJE 3ULSA 3U6RB 4Q20A 3QQDB 3MHSC 1GS8A 1EQWA 5K1XA 3FU7B 4HHGA 4FP8H 4YVUA 3HE7A 3O9WA 4TPRH 1Q9WA 1R33A 2BY0A 5DI8A 3VSVA 4Z78B 3L13A 2X1WL 3X1EA 2XZCL 2APWA 3QZBA 5D70H 2EDWA 4EN3D 5C0AA 4NPKA 2NTFB 2UUCB 3A0HZ 1YNTA 1A7QH 4MSWC 1QO3B 3ULUD 4I3GA 2LV4A 4LNUA 3HOGA 4HGMA 3THML 5DURD 2O5XL 1BHAA 4R7NA 3BXNB 5IYCO 1YQ2A 1JA8A 4HG4J 5GISL 5IWAB 4JHAH 3JV6A 4PJHF 5DMIH 1ZTXL 2Z8VC 3RVVC 1V55C 2ZQKA 3L95A 3QH3A 4GMSH 2J6WA 1U8NB 2Y6TE 1JPEA 3QJRB 1MG1A 4I55B 2OTUB 4E0RB 2EZ0C 2VQUA 5FYKU 3DGCR 1Q86W 2ZT9C 3GRGA 3KCPA 5AW7B 1QFUH 2N01B 2F5AL 4G43A 3F8UB 3VCLA 1ORQC 4H4NA 3Q44A 5DQDH 3E89A 4L4TE 4M8VA 5IJ9A 3U4AA 4G83A 2WXQA 3TA4D 1MREL 3FU6A 3KPRB 2W92A 1MCLA 2VSCA 2NY4D 4N8VG 1SDDB 3C5JA 4Z7VE 4K7PY 3JATA 1CG9A 4FQJL 4ZBMA 1KECA 1BECA 2WTRB 3BP6B 1XGYH 3C60A 4UTAA 2W80C 4UOW0 5TJWK 1JHKH 2QBWA 5MEQB 4JL1A 3EOYG 3RVUC 4LC1A 2R29H 5BO1H 2ZE0A 1Y18A 3PAUA 4LIQE 4QGPA 3MLVL 2Q2LA 4OFYD 4AE0A 3SD5A 5C0DA 1ZIBA 3I56V 2CR6A 2EDRA 5SWSA 1VQLV 3VGAB 5ECGA 5L88L 2X9XA 4IKIA 3MRMA 3WFBH 2XWEA 1IVSA 3QUKA 4J8RA 3NQKA 4TQIA 3UCRA 2Z31A 3QEQA 5F0LB 1EXGA 3V9FA 3SQRA 2VXQL 4D0DB 5GRUL 2FHCA 4QRAA 2AEPH 3SDCA 2Q7EA 4LCUA 5IFJB 4O00A 2B15A 4AGLA 3LKQA 5IJ0B 1KGCD 3K2UH 2AV1A 3EFFK 2W81C 1HZLA 2JB6A 4YNYB 4Z0BL 1FORL 2OTPA 2CPUA 3E6HB 4MD0B 3MACH 1L7TH 3TT3L 5KYXB 3V9CA 1G7QB 2KBGA 4GBXD 4J80A 1FSKC 1I85A 2Z64C 1SVBA 3ARWA 3LKNB 3FQ1A 2UV3A 3QZOA 3NTCL 2ETWA 3CCUV 1HAWA 3NFPA 4ZMTA 3I3BA 1EGJL 1JERA 3B2XA 3H6JA 4K0KO 1NA8A 4Y5VC 2KLTA 4PI2A 4KI5D 5GGSB 1CLZL 2X6UA 4LP8A 1L3NA 5IB2A 5EZIL 1YN6A 5CLTA 5E6YA 2ODMA 1TVKA 3BIAX 3IU3A 1N6QL 3HVNA 1U8NA 1OCWH 4BUGA 4JLRB 2YUXA 3CU1A 4I0PB 4QLRA 4Z8FL 3TZVC 1JOIA 2K4AA 4U49A 2H26A 1BVLB 4P9MH 4DUXA 2AJSL 3RWCB 5T33H 4DUZB 3FH8A 2NSQA 3UPAA 3IDNB 2Q7HA 4HAMA 3PWUA 3QRLA 2G30A 2KL6A 4CSPA 3IDYC 3C5XA 3N40F 4HIHA 4P9OA 4DP1X 5IG7A 4F6RA 1PW3A 3LEXA 4PTTA 1ODAA 3EJSA 2ZXGA 3Q48A 1YZZA 3ARBD 3S2AA 1X5JA 3MNWB 4HXAH 2X4OA 3HUJB 5DK0A 2H0EA 3K6NA 1A14L 2UYLA 4YK4B 4F58H 7CGTA 4KZDH 3R4RA 4O4JB 4M7KL 1E5ZA 5IEHA 2QJ1A 3OAUL 4R4FL 5HYJA 5KVGE 2HHHO 5KUMA 1EFXA 4PJIB 5FGRA 5ACZB 5GRVK 5IV2A 4DV0B 3LIZH 2YUWA 1GW6A 5TTRA 5JPMB 3QR0A 2NNFA 3QRGL 4ZTPH 5EULV 4R6ZA 4DR6B 5IMKB 3BLBA 3MJ9A 1T3FB 4NQUA 4HUCA 5J3HD 4YDIH 1DCLA 3O8XA 3R06B 3VXSA 3WG7B 8PAZA 1TZHA 1M1XA 3L1OH 1KYOK 2ATKB 4YS4A 2E5LO 4PREA 4PGJA 2DWXA 3ZHKA 3B7TA 4OF5A 2PI4A 5IFAL 2DKMA 1T5WB 4FQIL 1MRCL 1QRND 1OEZW 5FR3A 1TSRA 1ED3B 1JVMA 2FJGB 2GTQA 5SWZD 2AQNA 3TJPA 3CN2A 4M7JL 5FLVA 4IKLA 3RYFA 5K1VA 3E3QC 5C0JB 5F1NA 5C0CB 5A40E 2F53E 5I75B 4FFKA 3D50A 2ICCA 2LW3A 4MX7A 3Q9QA 4WEBL 1G7JB 4DUYO 3O0RL 3D25A 5EBWA 2BJML 1YEKL 2A9NL 4R2GB 4Y19D 4P2QB 2VLRD 3EYFA 3D09A 2F6AA 1UZ8B 2XQYA 3NCBB 4UVCA 3BH4A 1HP8A 1IL1A 2VERN 4QGYA 3QQ3A 1AD9A 2VDLL 4TLKA 4RQEA 3VXPA 4JDZA 4OLEA 1RJLB 4CDHA 4CMMA 4WW1B 3X13A 2QSQA 4N6RA